2Y8LA

Structure of the regulatory fragment of mammalian ampk in complex with two adp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
158
structure length
104
Chain Sequence
SMAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKNSCTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structure of Mammalian Ampk and its Regulation by Adp
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 25
structure length 104
sequence length 158
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2y8lA01
4CFFA 2QREA 4EALA 2V9JA 3T4NA 2Y8QA 2QR1A 2OOYA 2QRDA 4EAKA 4EAJA 3OSEA 1V5SA 3TDHA 3TE5A 4EAIA 2OOXA 1UL7A 2V92A 4EAGA 2Y8LA 2EHBD 2ZFDB 2QLVA 2YA3A 2V8QA 2QRCA
chains in the Genus database with same CATH superfamily
1QTSA 1VOKA 4MRQA 1QN3A 1QTPA 2DKAA 1J3MA 1YQMA 2YH5A 2O3OA 1EBMA 1K35A 1QN6A 5JMVD 2NOEA 2OOYA 1YTFA 3CW7A 3I0WA 1PCJX 2FKMX 1JDYA 1NVPA 3OCIA 3F10A 1KY7A 4DULA 1TGHA 1JFIC 4TPSA 1WJWA 2F7LA 1D3UA 1CDWA 1LWWA 1MPGA 3BKQX 1YQKA 4WXAA 4ROCB 1QNCA 2NOHA 1T6AA 5BMPA 1KYUA 3IH7A 4C7PA 2Z8UA 1QNBA 3KRMA 3D4VA 1VOLB 2H4LX 2QREA 3D7QA 3H1ZA 1PVSA 1YQRA 1M3QA 3I0XA 4EJYA 1EUVA 1B9KA 2D0CA 2V9JA 3T4NA 1P5DX 2FUVA 2HL9A 3OGDA 3OSMA 2Y8QA 5EPCA 3RSMA 2D0BA 2QRDA 2R5XA 2MJ7A 1P5GX 2Z0FA 3VN5A 1UT7A 4EAJA 3NA5A 1TBAB 1N39A 1LWVA 1MP9A 4I8OA 3CVSA 1QN9A 5AN4A 3RPJA 4ROEB 3ULXA 2I5WA 1YQLA 2HZSA 1XSZA 3TDHA 1YTBA 2PWWA 2JPIA 3N89A 1FN7A 5KL0A 1DIZA 3KTUA 1TBPA 2DKCA 5IYCP 2OOXA 3DPTA 2HZMA 3PDKA 5IYBP 1Q9UA 1PCZA 2YA3A 1N3AA 3CWSA 1TUOA 1PZDA 4BJUA 2IV8A 4CFFA 5HSHA 1WQAA 4EALA 1M5Q1 1QN7A 5BMNA 2H5AX 3I3WA 1R4XA 4Q11A 1K2YX 2XHIA 3EAYA 3OLPA 3DPUA 1W80A 2G30A 3ENOC 3OC3C 2LAEA 1C47A 3OSEA 2NOZA 1V5SA 2HL8A 4WZSD 2NOFA 4WX8A 1KYFA 1QN4A 1E42A 2NVMA 2DKDA 4B0AA 1VKLA 3TE5A 3C04A 1QNEA 3ENCA 4RODB 4EAGA 1NH2A 2ZFDB 2MZ8A 2NOBA 3UW2A 2QLVA 1HU0A 3SNSA 3ASMA 4IL8A 3CWUA 1KO9A 1LXTA 3PMGA 2NOLA 3OH6A 1VTOA 1KFIA 1AISA 1QN5A 1C4GA 1M3HA 4EJZA 2FKFA 2HKPA 2JHJA 2JHNA 3EIKA 4QG5A 1QNAA 3OSTA 2VJ0A 3F0ZA 2FGTA 2QR1A 3HS8A 2NOIA 4D7RA 4EAKA 2IV9A 5IYDP 1KY6A 5F9CA 1QN8A 4PY5A 2JOIA 2NLVA 5JN5A 3CWAA 3HS9A 3CVTA 1N3CA 2D0AA 4D7QA 4HJHA 4EAIA 1LWYA 1KYDA 1UL7A 2V92A 3OH9A 1KFQA 2Y8LA 2EHBD 3CWTA 1VTLE 2NWVA 1UT4A 1RM1A 1NGMA 1PCMX 2V8QA 1C9BB 2QRCA
chains in the Genus database with same CATH topology
4CFFA 2QREA 4EALA 2V9JA 3T4NA 2Y8QA 2QR1A 2OOYA 2QRDA 4EAKA 4EAJA 3OSEA 1V5SA 3TDHA 3TE5A 4EAIA 2OOXA 1UL7A 2V92A 4EAGA 2Y8LA 2EHBD 2ZFDB 2QLVA 2YA3A 2V8QA 2QRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFF A;  2QRE A;  4EAL A;  2V9J A;  3T4N A;  2Y8Q A;  2QR1 A;  2OOY A;  2QRD A;  4EAK A;  4EAJ A;  3OSE A;  1V5S A;  3TDH A;  3TE5 A;  4EAI A;  2OOX A;  1UL7 A;  2V92 A;  4EAG A;  2Y8L A;  2EHB D;  2ZFD B;  2QLV A;  2YA3 A;  2V8Q A;  2QRC A; 
#chains in the Genus database with same CATH topology
 1QTS A;  1VOK A;  4MRQ A;  1QN3 A;  1QTP A;  2DKA A;  1J3M A;  1YQM A;  2YH5 A;  2O3O A;  1EBM A;  1K35 A;  1QN6 A;  5JMV D;  2NOE A;  2OOY A;  1YTF A;  3CW7 A;  3I0W A;  1PCJ X;  2FKM X;  1JDY A;  1NVP A;  3OCI A;  3F10 A;  1KY7 A;  4DUL A;  1TGH A;  1JFI C;  4TPS A;  1WJW A;  2F7L A;  1D3U A;  1CDW A;  1LWW A;  1MPG A;  3BKQ X;  1YQK A;  4WXA A;  4ROC B;  1QNC A;  2NOH A;  1T6A A;  5BMP A;  1KYU A;  3IH7 A;  4C7P A;  2Z8U A;  1QNB A;  3KRM A;  3D4V A;  1VOL B;  2H4L X;  2QRE A;  3D7Q A;  3H1Z A;  1PVS A;  1YQR A;  1M3Q A;  3I0X A;  4EJY A;  1EUV A;  1B9K A;  2D0C A;  2V9J A;  3T4N A;  1P5D X;  2FUV A;  2HL9 A;  3OGD A;  3OSM A;  2Y8Q A;  5EPC A;  3RSM A;  2D0B A;  2QRD A;  2R5X A;  2MJ7 A;  1P5G X;  2Z0F A;  3VN5 A;  1UT7 A;  4EAJ A;  3NA5 A;  1TBA B;  1N39 A;  1LWV A;  1MP9 A;  4I8O A;  3CVS A;  1QN9 A;  5AN4 A;  3RPJ A;  4ROE B;  3ULX A;  2I5W A;  1YQL A;  2HZS A;  1XSZ A;  3TDH A;  1YTB A;  2PWW A;  2JPI A;  3N89 A;  1FN7 A;  5KL0 A;  1DIZ A;  3KTU A;  1TBP A;  2DKC A;  5IYC P;  2OOX A;  3DPT A;  2HZM A;  3PDK A;  5IYB P;  1Q9U A;  1PCZ A;  2YA3 A;  1N3A A;  3CWS A;  1TUO A;  1PZD A;  4BJU A;  2IV8 A;  4CFF A;  5HSH A;  1WQA A;  4EAL A;  1M5Q 1;  1QN7 A;  5BMN A;  2H5A X;  3I3W A;  1R4X A;  4Q11 A;  1K2Y X;  2XHI A;  3EAY A;  3OLP A;  3DPU A;  1W80 A;  2G30 A;  3ENO C;  3OC3 C;  2LAE A;  1C47 A;  3OSE A;  2NOZ A;  1V5S A;  2HL8 A;  4WZS D;  2NOF A;  4WX8 A;  1KYF A;  1QN4 A;  1E42 A;  2NVM A;  2DKD A;  4B0A A;  1VKL A;  3TE5 A;  3C04 A;  1QNE A;  3ENC A;  4ROD B;  4EAG A;  1NH2 A;  2ZFD B;  2MZ8 A;  2NOB A;  3UW2 A;  2QLV A;  1HU0 A;  3SNS A;  3ASM A;  4IL8 A;  3CWU A;  1KO9 A;  1LXT A;  3PMG A;  2NOL A;  3OH6 A;  1VTO A;  1KFI A;  1AIS A;  1QN5 A;  1C4G A;  1M3H A;  4EJZ A;  2FKF A;  2HKP A;  2JHJ A;  2JHN A;  3EIK A;  4QG5 A;  1QNA A;  3OST A;  2VJ0 A;  3F0Z A;  2FGT A;  2QR1 A;  3HS8 A;  2NOI A;  4D7R A;  4EAK A;  2IV9 A;  5IYD P;  1KY6 A;  5F9C A;  1QN8 A;  4PY5 A;  2JOI A;  2NLV A;  5JN5 A;  3CWA A;  3HS9 A;  3CVT A;  1N3C A;  2D0A A;  4D7Q A;  4HJH A;  4EAI A;  1LWY A;  1KYD A;  1UL7 A;  2V92 A;  3OH9 A;  1KFQ A;  2Y8L A;  2EHB D;  3CWT A;  1VTL E;  2NWV A;  1UT4 A;  1RM1 A;  1NGM A;  1PCM X;  2V8Q A;  1C9B B;  2QRC A; 
#chains in the Genus database with same CATH homology
 4CFF A;  2QRE A;  4EAL A;  2V9J A;  3T4N A;  2Y8Q A;  2QR1 A;  2OOY A;  2QRD A;  4EAK A;  4EAJ A;  3OSE A;  1V5S A;  3TDH A;  3TE5 A;  4EAI A;  2OOX A;  1UL7 A;  2V92 A;  4EAG A;  2Y8L A;  2EHB D;  2ZFD B;  2QLV A;  2YA3 A;  2V8Q A;  2QRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...