2Y8LA

Structure of the regulatory fragment of mammalian ampk in complex with two adp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
158
structure length
104
Chain Sequence
SMAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKNSCTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structure of Mammalian Ampk and its Regulation by Adp
pubmed doi rcsb
source organism Rattus norvegicus
total genus 25
structure length 104
sequence length 158
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2y8lA01
3OSEA 2EHBD 2OOXA 2V8QA 2QLVA 3TE5A 3T4NA 4EAKA 2QRDA 4EAGA 2ZFDB 4EAJA 2QREA 4EAIA 2OOYA 4CFFA 2Y8LA 2YA3A 2V92A 2QR1A 1UL7A 4EALA 2QRCA 2V9JA 3TDHA 1V5SA 2Y8QA
chains in the Genus database with same CATH superfamily
1J3MA 2IV8A 1R4XA 3OSEA 4ROEB 3I0WA 3SNSA 1KY7A 1QN9A 2D0CA 2FUVA 3OLPA 3T4NA 5HSHA 4EAKA 4EAGA 2NOFA 5JMVD 4D7RA 4HJHA 1JDYA 1MPGA 1N3AA 2NWVA 4BJUA 1TUOA 4B0AA 1VTOA 2Y8LA 3EAYA 2HZMA 1P5GX 2JPIA 3OCIA 2XHIA 2YA3A 4EJYA 2MJ7A 5IYDP 2NOZA 2VJ0A 3CWUA 1EUVA 2H5AX 1C47A 1T6AA 2NOBA 3PDKA 2LAEA 2PWWA 1PCZA 2NOIA 1RM1A 1YTFA 3H1ZA 3KRMA 2FKMX 1CDWA 2HKPA 3D4VA 1HU0A 4PY5A 2H4LX 2O3OA 3IH7A 3CWAA 2OOXA 1YQLA 2QLVA 2JOIA 1TBAB 1XSZA 3OH6A 2NOEA 1NVPA 3EIKA 4C7PA 1YQKA 1VTLE 1MP9A 3D7QA 2JHJA 2QREA 2DKCA 4EAIA 1YTBA 1N3CA 3F0ZA 1QNEA 1LWYA 1Q9UA 2DKDA 2F7LA 1C9BB 5BMNA 4TPSA 3UW2A 3C04A 2FKFA 3DPTA 3HS8A 4Q11A 2DKAA 1KYDA 5BMPA 5F9CA 1EBMA 1P5DX 2QR1A 3CVSA 3OSMA 1KYUA 1PCMX 4EALA 1KY6A 1VOKA 2V9JA 1QN8A 2NOLA 3ASMA 1M3QA 1UT7A 1NGMA 1WJWA 5KL0A 5IYCP 2HL8A 3CW7A 2FGTA 1K35A 1PZDA 4ROCB 3PMGA 3RSMA 1VOLB 3ENCA 4IL8A 1M3HA 3CVTA 1UT4A 5EPCA 2YH5A 1W80A 2R5XA 3KTUA 1K2YX 1KYFA 2ZFDB 1QNBA 4WZSD 1QNCA 3I3WA 2OOYA 4CFFA 3BKQX 2JHNA 4D7QA 3CWTA 3RPJA 2NOHA 1VKLA 4DULA 1YQRA 1NH2A 2G30A 2IV9A 2V92A 1KFQA 1FN7A 5JN5A 1QN6A 1E42A 1KO9A 5IYBP 1QN4A 3ENOC 1UL7A 1JFIC 1AISA 3CWSA 3VN5A 2QRCA 1C4GA 3NA5A 1QN5A 2MZ8A 4MRQA 3OGDA 1YQMA 1PCJX 2Z0FA 1TGHA 1M5Q1 3F10A 3OC3C 2NVMA 1QN7A 2V8QA 3TE5A 1KFIA 5AN4A 2QRDA 1DIZA 2NLVA 1QTPA 4QG5A 1PVSA 3DPUA 4EAJA 1QNAA 1N39A 3OSTA 3OH9A 3HS9A 2HZSA 2HL9A 4WXAA 1LWWA 1QN3A 1TBPA 1LXTA 4RODB 3I0XA 2Y8QA 1WQAA 3ULXA 1D3UA 4I8OA 2D0AA 4WX8A 1B9KA 1QTSA 2D0BA 1LWVA 2I5WA 3N89A 4EJZA 3TDHA 2Z8UA 1V5SA 2EHBD
chains in the Genus database with same CATH topology
3OSEA 2EHBD 2OOXA 2V8QA 2QLVA 3TE5A 3T4NA 4EAKA 2QRDA 4EAGA 2ZFDB 4EAJA 2QREA 4EAIA 2OOYA 4CFFA 2Y8LA 2YA3A 2V92A 2QR1A 1UL7A 4EALA 2QRCA 2V9JA 3TDHA 1V5SA 2Y8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSE A;  2EHB D;  2OOX A;  2V8Q A;  2QLV A;  3TE5 A;  3T4N A;  4EAK A;  2QRD A;  4EAG A;  2ZFD B;  4EAJ A;  2QRE A;  4EAI A;  2OOY A;  4CFF A;  2Y8L A;  2YA3 A;  2V92 A;  2QR1 A;  1UL7 A;  4EAL A;  2QRC A;  2V9J A;  3TDH A;  1V5S A;  2Y8Q A; 
#chains in the Genus database with same CATH topology
 1J3M A;  2IV8 A;  1R4X A;  3OSE A;  4ROE B;  3I0W A;  3SNS A;  1KY7 A;  1QN9 A;  2D0C A;  2FUV A;  3OLP A;  3T4N A;  5HSH A;  4EAK A;  4EAG A;  2NOF A;  5JMV D;  4D7R A;  4HJH A;  1JDY A;  1MPG A;  1N3A A;  2NWV A;  4BJU A;  1TUO A;  4B0A A;  1VTO A;  2Y8L A;  3EAY A;  2HZM A;  1P5G X;  2JPI A;  3OCI A;  2XHI A;  2YA3 A;  4EJY A;  2MJ7 A;  5IYD P;  2NOZ A;  2VJ0 A;  3CWU A;  1EUV A;  2H5A X;  1C47 A;  1T6A A;  2NOB A;  3PDK A;  2LAE A;  2PWW A;  1PCZ A;  2NOI A;  1RM1 A;  1YTF A;  3H1Z A;  3KRM A;  2FKM X;  1CDW A;  2HKP A;  3D4V A;  1HU0 A;  4PY5 A;  2H4L X;  2O3O A;  3IH7 A;  3CWA A;  2OOX A;  1YQL A;  2QLV A;  2JOI A;  1TBA B;  1XSZ A;  3OH6 A;  2NOE A;  1NVP A;  3EIK A;  4C7P A;  1YQK A;  1VTL E;  1MP9 A;  3D7Q A;  2JHJ A;  2QRE A;  2DKC A;  4EAI A;  1YTB A;  1N3C A;  3F0Z A;  1QNE A;  1LWY A;  1Q9U A;  2DKD A;  2F7L A;  1C9B B;  5BMN A;  4TPS A;  3UW2 A;  3C04 A;  2FKF A;  3DPT A;  3HS8 A;  4Q11 A;  2DKA A;  1KYD A;  5BMP A;  5F9C A;  1EBM A;  1P5D X;  2QR1 A;  3CVS A;  3OSM A;  1KYU A;  1PCM X;  4EAL A;  1KY6 A;  1VOK A;  2V9J A;  1QN8 A;  2NOL A;  3ASM A;  1M3Q A;  1UT7 A;  1NGM A;  1WJW A;  5KL0 A;  5IYC P;  2HL8 A;  3CW7 A;  2FGT A;  1K35 A;  1PZD A;  4ROC B;  3PMG A;  3RSM A;  1VOL B;  3ENC A;  4IL8 A;  1M3H A;  3CVT A;  1UT4 A;  5EPC A;  2YH5 A;  1W80 A;  2R5X A;  3KTU A;  1K2Y X;  1KYF A;  2ZFD B;  1QNB A;  4WZS D;  1QNC A;  3I3W A;  2OOY A;  4CFF A;  3BKQ X;  2JHN A;  4D7Q A;  3CWT A;  3RPJ A;  2NOH A;  1VKL A;  4DUL A;  1YQR A;  1NH2 A;  2G30 A;  2IV9 A;  2V92 A;  1KFQ A;  1FN7 A;  5JN5 A;  1QN6 A;  1E42 A;  1KO9 A;  5IYB P;  1QN4 A;  3ENO C;  1UL7 A;  1JFI C;  1AIS A;  3CWS A;  3VN5 A;  2QRC A;  1C4G A;  3NA5 A;  1QN5 A;  2MZ8 A;  4MRQ A;  3OGD A;  1YQM A;  1PCJ X;  2Z0F A;  1TGH A;  1M5Q 1;  3F10 A;  3OC3 C;  2NVM A;  1QN7 A;  2V8Q A;  3TE5 A;  1KFI A;  5AN4 A;  2QRD A;  1DIZ A;  2NLV A;  1QTP A;  4QG5 A;  1PVS A;  3DPU A;  4EAJ A;  1QNA A;  1N39 A;  3OST A;  3OH9 A;  3HS9 A;  2HZS A;  2HL9 A;  4WXA A;  1LWW A;  1QN3 A;  1TBP A;  1LXT A;  4ROD B;  3I0X A;  2Y8Q A;  1WQA A;  3ULX A;  1D3U A;  4I8O A;  2D0A A;  4WX8 A;  1B9K A;  1QTS A;  2D0B A;  1LWV A;  2I5W A;  3N89 A;  4EJZ A;  3TDH A;  2Z8U A;  1V5S A;  2EHB D; 
#chains in the Genus database with same CATH homology
 3OSE A;  2EHB D;  2OOX A;  2V8Q A;  2QLV A;  3TE5 A;  3T4N A;  4EAK A;  2QRD A;  4EAG A;  2ZFD B;  4EAJ A;  2QRE A;  4EAI A;  2OOY A;  4CFF A;  2Y8L A;  2YA3 A;  2V92 A;  2QR1 A;  1UL7 A;  4EAL A;  2QRC A;  2V9J A;  3TDH A;  1V5S A;  2Y8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...