2Y8LA

Structure of the regulatory fragment of mammalian ampk in complex with two adp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
158
structure length
104
Chain Sequence
SMAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKNSCTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structure of Mammalian Ampk and its Regulation by Adp
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 25
structure length 104
sequence length 158
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2y8lA01
2QRCA 2EHBD 4EAIA 4EAJA 3TDHA 2ZFDB 2V8QA 1V5SA 4EAGA 2OOXA 3OSEA 4CFFA 3TE5A 2QLVA 2QR1A 2YA3A 2QRDA 2Y8LA 3T4NA 2QREA 4EAKA 2Y8QA 2V92A 2OOYA 1UL7A 2V9JA 4EALA
chains in the Genus database with same CATH superfamily
1W80A 2HKPA 1QN5A 1JFIC 1JDYA 1LWVA 4QG5A 2R5XA 4D7QA 1FN7A 2DKAA 4WXAA 5AN4A 3DPUA 2HL9A 3ENCA 3CVSA 1KY6A 1PCJX 3TDHA 1QTPA 1QN9A 2NOHA 2NOEA 2FGTA 1NGMA 3OC3C 2V8QA 2O3OA 3I3WA 1B9KA 3EAYA 4CFFA 1PCZA 1VKLA 2DKCA 1KYUA 3RPJA 1UT7A 3PDKA 2HZMA 2NOZA 2QLVA 1TBAB 2QR1A 1T6AA 2YA3A 3ASMA 2NOLA 1XSZA 2VJ0A 1MP9A 2Z0FA 1Q9UA 1QN4A 1KO9A 5JN5A 1RM1A 2OOYA 1KFIA 2D0AA 2D0CA 2QRCA 4EALA 2EHBD 3RSMA 2I5WA 2JHNA 3CWTA 1TBPA 2YH5A 4EAIA 1VOKA 1N3AA 1YTBA 2MZ8A 5HSHA 1K35A 1P5DX 1QNBA 1UT4A 2ZFDB 4IL8A 1LWYA 1YQKA 1EBMA 2XHIA 4B0AA 3F0ZA 2JPIA 3KTUA 1KYFA 2OOXA 3OSEA 3VN5A 1YQMA 5F9CA 1N3CA 4ROCB 3ENOC 1C47A 3OGDA 2QRDA 3ULXA 2Y8LA 2NWVA 4RODB 1NH2A 2NOFA 2MJ7A 3D4VA 5IYDP 3CWUA 2F7LA 2JOIA 2V92A 5IYBP 1UL7A 5IYCP 1QN7A 3CW7A 2NOIA 1QNAA 1LXTA 2JHJA 2DKDA 4EJYA 4DULA 1WQAA 3NA5A 3EIKA 3H1ZA 1AISA 5BMPA 5BMNA 5JMVD 3D7QA 1QNEA 3CWSA 4PY5A 1KYDA 1C9BB 3OH6A 4EJZA 2FKFA 1VTOA 1V5SA 1J3MA 1YQRA 1EUVA 3OH9A 1YTFA 4BJUA 1VTLE 3F10A 1K2YX 3OLPA 1M3HA 1QN6A 2NVMA 1P5GX 3BKQX 1D3UA 1LWWA 3TE5A 3OCIA 4WX8A 1N39A 1QN3A 1TGHA 2NOBA 3T4NA 3OSMA 2H5AX 1KY7A 2QREA 3IH7A 2Y8QA 2LAEA 2G30A 3C04A 2IV9A 3I0WA 1QNCA 3UW2A 3CWAA 3PMGA 2PWWA 5KL0A 1HU0A 2HL8A 4D7RA 1DIZA 3HS8A 1M3QA 1PCMX 2NLVA 3SNSA 1PVSA 1M5Q1 1NVPA 1R4XA 4HJHA 2FUVA 3OSTA 1TUOA 4I8OA 4EAJA 1E42A 4MRQA 4C7PA 1QTSA 1YQLA 1KFQA 2FKMX 4EAGA 2H4LX 1MPGA 3DPTA 3KRMA 3HS9A 2D0BA 1CDWA 3N89A 1C4GA 5EPCA 3CVTA 1PZDA 2Z8UA 1QN8A 4TPSA 4WZSD 3I0XA 4ROEB 1VOLB 4EAKA 4Q11A 2HZSA 2V9JA 2IV8A 1WJWA
chains in the Genus database with same CATH topology
2QRCA 2EHBD 4EAIA 4EAJA 3TDHA 2ZFDB 2V8QA 1V5SA 4EAGA 2OOXA 3OSEA 4CFFA 3TE5A 2QLVA 2QR1A 2YA3A 2QRDA 2Y8LA 3T4NA 2QREA 4EAKA 2Y8QA 2V92A 2OOYA 1UL7A 2V9JA 4EALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRC A;  2EHB D;  4EAI A;  4EAJ A;  3TDH A;  2ZFD B;  2V8Q A;  1V5S A;  4EAG A;  2OOX A;  3OSE A;  4CFF A;  3TE5 A;  2QLV A;  2QR1 A;  2YA3 A;  2QRD A;  2Y8L A;  3T4N A;  2QRE A;  4EAK A;  2Y8Q A;  2V92 A;  2OOY A;  1UL7 A;  2V9J A;  4EAL A; 
#chains in the Genus database with same CATH topology
 1W80 A;  2HKP A;  1QN5 A;  1JFI C;  1JDY A;  1LWV A;  4QG5 A;  2R5X A;  4D7Q A;  1FN7 A;  2DKA A;  4WXA A;  5AN4 A;  3DPU A;  2HL9 A;  3ENC A;  3CVS A;  1KY6 A;  1PCJ X;  3TDH A;  1QTP A;  1QN9 A;  2NOH A;  2NOE A;  2FGT A;  1NGM A;  3OC3 C;  2V8Q A;  2O3O A;  3I3W A;  1B9K A;  3EAY A;  4CFF A;  1PCZ A;  1VKL A;  2DKC A;  1KYU A;  3RPJ A;  1UT7 A;  3PDK A;  2HZM A;  2NOZ A;  2QLV A;  1TBA B;  2QR1 A;  1T6A A;  2YA3 A;  3ASM A;  2NOL A;  1XSZ A;  2VJ0 A;  1MP9 A;  2Z0F A;  1Q9U A;  1QN4 A;  1KO9 A;  5JN5 A;  1RM1 A;  2OOY A;  1KFI A;  2D0A A;  2D0C A;  2QRC A;  4EAL A;  2EHB D;  3RSM A;  2I5W A;  2JHN A;  3CWT A;  1TBP A;  2YH5 A;  4EAI A;  1VOK A;  1N3A A;  1YTB A;  2MZ8 A;  5HSH A;  1K35 A;  1P5D X;  1QNB A;  1UT4 A;  2ZFD B;  4IL8 A;  1LWY A;  1YQK A;  1EBM A;  2XHI A;  4B0A A;  3F0Z A;  2JPI A;  3KTU A;  1KYF A;  2OOX A;  3OSE A;  3VN5 A;  1YQM A;  5F9C A;  1N3C A;  4ROC B;  3ENO C;  1C47 A;  3OGD A;  2QRD A;  3ULX A;  2Y8L A;  2NWV A;  4ROD B;  1NH2 A;  2NOF A;  2MJ7 A;  3D4V A;  5IYD P;  3CWU A;  2F7L A;  2JOI A;  2V92 A;  5IYB P;  1UL7 A;  5IYC P;  1QN7 A;  3CW7 A;  2NOI A;  1QNA A;  1LXT A;  2JHJ A;  2DKD A;  4EJY A;  4DUL A;  1WQA A;  3NA5 A;  3EIK A;  3H1Z A;  1AIS A;  5BMP A;  5BMN A;  5JMV D;  3D7Q A;  1QNE A;  3CWS A;  4PY5 A;  1KYD A;  1C9B B;  3OH6 A;  4EJZ A;  2FKF A;  1VTO A;  1V5S A;  1J3M A;  1YQR A;  1EUV A;  3OH9 A;  1YTF A;  4BJU A;  1VTL E;  3F10 A;  1K2Y X;  3OLP A;  1M3H A;  1QN6 A;  2NVM A;  1P5G X;  3BKQ X;  1D3U A;  1LWW A;  3TE5 A;  3OCI A;  4WX8 A;  1N39 A;  1QN3 A;  1TGH A;  2NOB A;  3T4N A;  3OSM A;  2H5A X;  1KY7 A;  2QRE A;  3IH7 A;  2Y8Q A;  2LAE A;  2G30 A;  3C04 A;  2IV9 A;  3I0W A;  1QNC A;  3UW2 A;  3CWA A;  3PMG A;  2PWW A;  5KL0 A;  1HU0 A;  2HL8 A;  4D7R A;  1DIZ A;  3HS8 A;  1M3Q A;  1PCM X;  2NLV A;  3SNS A;  1PVS A;  1M5Q 1;  1NVP A;  1R4X A;  4HJH A;  2FUV A;  3OST A;  1TUO A;  4I8O A;  4EAJ A;  1E42 A;  4MRQ A;  4C7P A;  1QTS A;  1YQL A;  1KFQ A;  2FKM X;  4EAG A;  2H4L X;  1MPG A;  3DPT A;  3KRM A;  3HS9 A;  2D0B A;  1CDW A;  3N89 A;  1C4G A;  5EPC A;  3CVT A;  1PZD A;  2Z8U A;  1QN8 A;  4TPS A;  4WZS D;  3I0X A;  4ROE B;  1VOL B;  4EAK A;  4Q11 A;  2HZS A;  2V9J A;  2IV8 A;  1WJW A; 
#chains in the Genus database with same CATH homology
 2QRC A;  2EHB D;  4EAI A;  4EAJ A;  3TDH A;  2ZFD B;  2V8Q A;  1V5S A;  4EAG A;  2OOX A;  3OSE A;  4CFF A;  3TE5 A;  2QLV A;  2QR1 A;  2YA3 A;  2QRD A;  2Y8L A;  3T4N A;  2QRE A;  4EAK A;  2Y8Q A;  2V92 A;  2OOY A;  1UL7 A;  2V9J A;  4EAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...