4PY5A

Thermovibrio ammonificans rnase h3 in complex with 19-mer rna/dna
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
267
Chain Sequence
SMKLSSSEKEKLLKKLKALGAKEEKPPEHAQYRLRLNDAILTVYKSGSVVYGGKGREKLKELVAETVLSDTELPRIGCNEAGKGEFVGPLVVACIVADEKCLKRLIELGVKDSKKLSNEKVEELASEITETCHGKVKLLIPEKYNRAYSKFKNINRLLEAVYREIVSDLCEKFSPKVVVVDKFSNRAEEVLKDVVKGARLEVRPKAEDDLAVAAASIVAKAVRLKTMKELEKRFKVKLPEGNTGLAELLKKTPKELHEKLFKLHFSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna/rna
molecule keywords Ribonuclease
publication title Crystal structure of RNase H3-substrate complex reveals parallel evolution of RNA/DNA hybrid recognition.
pubmed doi rcsb
source organism Thermovibrio ammonificans
total genus 93
structure length 267
sequence length 267
ec nomenclature ec 3.1.26.-:
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4py5A01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4py5A02
4W5TA 3V4IA 2VG5A 4XIUA 4JS5A 3NH0A 4I9QA 4K8XA 4G1QA 4CF0A 2O4IA 4CERA 4M3RA 4I2PA 4CGJA 1NVPA 3G0ZA 3L2VA 1QTMA 4FJXA 1JL2A 1QN5A 3NFAA 4LH5A 4FJ9A 1HJRA 4IG3A 3TAMA 4FVMA 2A1RA 3DLGA 4C8LA 4CK3A 3DM2A 4DU1A 3LZJA 1A5VA 1NJZA 1B9DA 2PYLA 4PY5A 2X74A 5FROA 1ITGA 4AHVA 4UQGA 1T03A 3SQ2A 4H4MA 4BDPA 3AA2A 1BCMA 4CJRA 4FLYA 2X78A 4C8KA 1CLQA 3QEWA 2F96A 4CHOA 3V9SA 1S9GA 3QNNA 3D45A 1RTDA 3K59A 3RMCA 1NKBA 3K5MA 2BE2A 4DSFA 3OS2A 4FW2A 3ISNC 4OPJA 3HP6A 3MAQA 1S6QA 1KYDA 3ZT4A 3AVNA 1QNAA 1ASUA 3HVTA 2F8TA 3EYZA 1UA0A 2HHQA 5J1EA 3V81A 1L3UA 2DY4A 3H08A 4CK1A 1VSHA 2G8UA 1NJWA 3VQEA 1RTIA 2HW3A 4GW6A 3MEEA 3NF9A 1RDBA 1LAWA 3QETA 3HPHA 3CYMA 3U3GA 4QOZB 2G8WA 4FLUA 4KO0A 4Z4IA 4OKEA 1EKEA 3A2FA 3OYEA 1L3TA 2P1JA 1TK8A 1TBPA 4B0AA 1KCFA 1NOYA 2HMIA 1BL3A 1RTHA 3ZSOA 4IBNA 4DFKA 1LWEA 3V6DA 1J5OA 3HT3A 1VOKA 4OGEA 4FM1A 1U4BA 3RRHA 3VQAA 3P83D 1Q9YA 1JLEA 3NF7A 4CFCA 1QSYA 1CZBA 3SJJA 1X9WA 2HVIA 4OKJA 1KY7A 4FZZA 4NYNA 3OYAA 4B3OA 2D0CA 4E7IA 2YHAA 2EHGA 2GBZA 4HCBA 1C0MA 4HVJA 3VA0A 4DSIA 4J2BA 1XHXA 4I9LA 3KD5E 4OLAA 1RT2A 4F2RA 3BDPA 1JLCA 3QNOA 3OJSA 3ZSYA 4C8MA 1RT3A 3AVCA 3ZT1A 4DF4A 3RMAA 3OYHA 3LAMA 3HVRA 4FJLA 4E7LA 4B9NA 4BWJA 3K5NA 3TR8A 4CJ5A 1Q9XA 2HHTA 3QEXA 4DQSA 4DFJA 4CEQA 4O4GA 4CGIA 1QSLA 1A5WA 4M3YA 4M41A 3OYCA 2P5OA 4W5QA 3KIOA 4YNQA 2W42A 1U04A 4FXDA 5HRRA 1RNHA 1Y97A 1UAXA 2OPSA 1IKVA 4BWMA 4DTRA 3ZCMA 1SL0A 2QK9A 4KHSA 3LWMA 3OS1A 3OS0A 4E7HA 5J2NA 4E7JA 3NBPA 4FZXC 3G10A 3HO1A 3L8BA 1E42A 3RTVA 4FLVA 2Z1IA 4AHCA 4FCYA 4DFPA 5JS2A 2QKBA 1VTLE 3MXMA 1C9BB 1KVAA 3VQ6A 1L5UA 1WSIA 3WNGA 1CXUA 3OYBA 1GOAA 3SZ2A 5C24A 4CJFA 2X6NA 3V9XA 4AHUA 5SZTA 2DFHA 1B92A 1YTUA 4DS5A 3MEGA 1BQNA 4PA1A 1EXQA 4Y1CA 3OYKA 3VA3A 3SUOA 4O44A 4CGGA 3EY1A 3V1QA 4OPKA 4Z4HA 3DRSA 5E41A 4FK0A 1YTAA 1HPZA 3AO1A 4N56A 3DLBA 2XRIA 4H4OA 4E3SA 3AVFA 3LANA 3KLHA 1WSJA 1S1XA 2FBXA 4BE1A 2DTUA 4O5BA 1VSJA 1BGXT 4DF8A 4E1MA 3V9UA 3M8QA 5IYBP 1NK6A 4AHRA 5HROA 4HCCA 3PUFA 4FJMA 4CHYA 3D0PA 4C8OA 1YVUA 1SL1A 3DOLA 2D0BA 1TKDA 4KI4A 5C42A 4CEAA 1D3UA 4CJWA 4DWIA 1JL1A 5SWMA 3NE6A 3TWHA 1N5YA 1KY6A 1IG9A 3AVKA 4E89A 3QESA 1NOZA 2YHBA 2VWKA 3NH2A 4BDYA 3TARA 1NH2A 1Q8IA 3AA3A 1QTPA 1S5JA 4RODB 1WSEA 3LALA 1VOLB 2ZD1A 1LW2A 1KRPA 4FJ7A 1CDWA 2JGUA 3P1GA 4NYFA 3SQ1A 4FJIA 2HNZA 2IDOA 3DI6A 2YV0X 3FFIA 4AHTA 1QN3A 4ZHRA 4HUEA 4QCLA 1RDDA 2HHUA 4CJ4A 3QEPA 4KTZA 2KFZA 3AVLA 1UA1A 3WNEA 1RBUA 4FJHA 4BDZA 5I3UA 1A5XA 4B8CA 2P51A 3VQ4A 1TL3A 2G8IA 3HJFA 1W9HA 3K58A 4I7FA 1I3AA 3CG7A 3K5LA 3QERA 4FM2A 2ATQA 4E19A 4Q5VA 4OVLA 1UWBA 4DQRA 3IRXA 3HP9A 3RWUA 1NK4A 5HBMA 5D3GA 2HHXA 4DLEA 1QNBA 1S1UA 2Z1HA 2XO7A 3SUPA 1NK9A 4ELVA 3CM5A 4M3WA 3ZSXA 3F73A 4CF8A 1S1WA 1K6YA 3SI6A 4FLXA 5DK5A 4CJSA 1L3VA 4B9TA 4Q0BA 4DU4A 2IS3A 3LP1A 4OJRA 3MECA 5CYQA 4CGHA 1ZBHA 3P5JA 3AO2A 2NUBA 3MEDA 2MJ7A 1N6QA 1TK5A 2G8VA 3HS9A 2KZMA 3HL8A 1PCZA 3TI0A 4KHWA 2XY7A 1NKCA 2B6AA 4NCAA 2B4JA 4CHPA 2KQ2A 4EP5A 5JS1A 4DQPA 4RW7A 3JYTA 3RR8A 3AO4A 1U45A 1VSDA 1DLOA 1C0UA 1JXEA 2Y1IA 1TK0A 4B9UA 2O4GA 3OYGA 4BE2A 3O4NA 1UOCA 4DSEA 4CGFA 4DTPA 5I42A 4NCBA 4CJKA 3OYIA 4B9SA 3PO5A 5DMRA 3KLEA 1TL1A 4ROEB 3I8DA 3MXIA 4KB0A 1ZYQA 3V1OA 4MFBA 5FRNA 2IOCA 3EZ5A 1YT3A 1RDCA 1KTQA 3ZSVA 2HB5A 1QNCA 3VQCA 3HYFA 3C94A 1HNVA 3AVGA 3QO9A 1U48A 3KK2A 4Z4CA 3HM9A 3F9KA 2XHBA 1NKEA 3DRPA 1TKTA 2OPQA 3CFOA 2HHVA 2VG6A 4LH4A 2XY5A 5KRSA 1IKXA 2Z8UA 1T05A 1C1AA 3RR7A 3LDSA 2X6SA 4L8RB 1IKYA 1WSHA 1XHZA 4KB1A 3AVAA 4RW9A 3E01A 3QINA 3ZT0A 4DTNA 1HQEA 1B9KA 1QTSA 1NJYA 1JKHA 3NGIA 3CQ8A 3PV8A 4DSKA 3LP2A 1HYVA 1LAVA 4ICLA 4LSNA 2RN2A 1VSEA 3SPZA 3AO3A 3VQ8A 3K57A 2Z1GA 1KVCA 3AVMA 3PX0A 4B9MA 4JRQA 1QN8A 1YTFA 1BI4A 4KFBA 3SCXA 1RT7A 1QE1A 1C0TA 4CJVA 2OA8A 4PUOA 1RDAA 4J2AA 1WAFA 4CEBA 1ASVA 4DQIA 3ZSRA 1S1VA 3VQQA 4KKOA 4QAGA 1RILA 3L3UA 1SKWA 2RF2A 3RMDA 2G8KA 1ASWA 1TAUA 3KLGA 2KFNA 3HS8A 1RCHA 2ZE2A 1FKOA 3NGZA 1VTOA 3NGYA 4FJ5A 3ALYA 2KZZA 3AA4A 1D5AA 3V9WA 5HP1A 4W5OA 2HNYA 1HRHA 1D9FA 3OYMA 5KRTA 1S1TA 3KK1A 1HYZA 4KREA 2RPIA 2YNFA 3TABA 4O55A 4DTJA 2ITGA 3VN5A 4FLTA 1TVRA 3T1AA 1O1WA 3VQPA 3L2WA 3L3VA 1XI1A 1CXQA 3DLKA 4IG0A 4CEFA 2WONA 3VQDA 3ZSQA 1KFDA 3WNHA 3OJUA 3RRGA 3KD1E 1VRTA 3I0RA 3VQBA 1LV5A 5KTQA 1J9AA 3SV3A 5EU7A 1QHTA 4CIEA 1FK9A 1JLAA 4CF9A 4YFUA 4DQQA 4Z4EA 1IH7A 2AJQA 1X9SA 4ZTFA 1TGOA 4FK4A 1C6VA 3LWLA 3L2QA 5K14A 4CJLA 3L2UA 3DOKA 3OYLA 3K2PA 3EIKA 4DTSA 4KPYA 4FJNA 2DFFA 3SUQA 4FJ8A 1S6PA 3U3YA 4Y1DA 4CESA 1EX4A 1D8YA 2PY5A 1KVBA 2OPPA 1WLJA 5HLFA 4LSLA 3DMJA 1W0HA 1ZBLA 3HPGA 3ZT3A 4CGDA 4I2QA 1L3SA 4CEDA 1QN4A 1VSIA 4KHNA 4CF1A 4DG1A 1BHLA 3THVA 2VWJA 5IYDP 1T8EA 2F8SA 2QXFA 3O3FA 1JLQA 5J2QA 4CFDA 1RT1A 1VRUA 3OYNA 3S3OA 4CJ3A 4CF2A 3L2RA 1EETA 4AH9A 4B9LA 1IKWA 3ULDA 1SUQA 1Z25A 2XY8A 4DMNA 2IV8A 3ZT2A 4CEOA 3SQ4A 3IAYA 3DRRA 2OZMA 4FYDA 3KLIA 1NK7A 3HK2A 4CIGA 5HRNA 1LWCA 5CY4A 3TAFA 1FKPA 3TAGA 1KFSA 4MQ3A 1KLMA 4CHZA 3SNNA 1NK5A 2IV9A 3IG1A 5C25A 1WNSA 3CM6A 3LP3A 4DSLA 1RT6A 3AVHA 3VQ5A 4ZTJA 4ELUA 1ZBIA 1GOBA 2ZQBA 3HPOA 3NCIA 4J2EA 1TKXA 3SQ0A 5FDLA 2HHSA 1IO2A 3CFRA 4FK2A 4CHNA 4B9VA 4KHYA 4CEEA 2D0AA 4KAZA 1B9FA 1KYFA 3AVJA 4M3XA 4F8RA 2HVHA 3H1ZA 4KTWA 2YKMA 1VSMA 2DFEA 3V1RA 3O3HA 4RW8A 2OYQA 1REVA 4CK2A 4M45A 5FRMA 1J54A 2OPRA 3O4QA 4JS4A 4NCGA 3S3NA 3AA5X 4KHQA 4Z4GA 3DLEA 1RT5A 1RT4A 4CECA 1SV5A 5CZ2A 4OKKA 1QNEA 2YNHA 4CJPA 3LZIA 2P5GA 3IS9A 4M3TA 3B6OA 3C95A 3NF6A 4M3ZA 1ZBFA 1GOCA 1I39A 4PWDA 2GV9A 4JRPA 4DTXA 2HHWA 1AISA 4RW4A 3QLHA 3MXJA 3OY9A 4LY7A 3HSTB 4W5RA 3TAPA 2G8HA 2D5RA 2VG7A 3S3MA 4CEZA 2YNGA 4N47A 4BE0A 1TGHA 2FBVA 3KKRA 4RW6A 5HRSA 1NK8A 2BANA 4FJJA 4Z4FA 2G8FA 1ZBUA 3ASMA 3AVBA 3I0SA 1CZ9A 4FW1A 4JLHA 1WSGA 3ZSWA 4CJUA 2JLEA 2XY6A 1C1BA 4IKFA 3K5OA 2Z1JA 3KTQA 1BIZA 4EZ9A 2QKKA 4FLZA 3V9ZA 2I5JA 2OZSA 4W5NA 4OGCA 4HTUA 1S9EA 2WOMA 1J53A 3OYDA 1BISA 4HUGA 4F3TA 4FLWA 1FXXA 4N5SA 4FJGA 1BCOA 4KHUA 1EP4A 5HRPA 1SL2A 1HQUA 3OCIA 4CJQA 2EX3A 1BIUA 1JXBA 3AO5A 5KI6A 4N76A 1QS4A 4IFVA 1TV6A 1QQCA 3B6PA 3KK3A 1QSSA 1SKRA 5IYCP 4OLBA 5KGWA 1RBSA 1HMVA 1MP9A 1BI4B 3KKSA 3S9HA 1JLGA 3OYFA 1JLBA 4EP4A 3SUNA 3LPUA 4E1NA 3NAEA 5T7BA 3NH1A 4BACA 3DLHA 2GUIA 3TAEA 4H8KA 1X9MA 4ID5A 3HXMA 3PY8A 2B5JA 4F3OA 4KI6A 1Z26A 2IAJA 2E4LA 4O0JA 1XC9A 2E6LA 1JLFA 2Y1JA 2FBTA 2KW4A 3M8RA 1VSKA 4F4KA 4RG8A 4KTQA 1W80A 4DU3A 1RM1A 1TKZA 1F21A 3M8PA 4FJKA 2ETJA 1U47A 1PZDA 4M3UA 2YKNA 2E6MA 1KYUA 1DTTA 1RBVA 3VQ9A 1WSFA 4B8AB 3OYJA 1RBRA 4E7KA 1X1PA 4E0DA 4FZYA 3UIQA 2BGGA 3T19A 4CFAA 1WAJA 5CZ1A 4DTUA 4WE1A 5J2PA 1TAQA 4DSJA 2Q3SA 4CJTA 4DTOA 4KRFA 3DLRA 1R0AA 1U49A 1NK0A 3QIOA 1DTQA 3QIPA 2FBYA 4B08A 5CYMA 3M8SA 4CJEA 3SV4A 2PYJA 4F2SA 1QN6A 4GVMA 4ROCB 3U6FA 4CFBA 1R4XA 2RKIA 3LPTA 4ID1A 4C8NA 1HNIA 3O3GA 3JSMA 3SPYA 1D9DA 4AHSA 1T7PA 4DS4A 4DTMA 3SYZA 3TAQA 4PQUA 1BQMA 4Z0UA 2R7YA 3RMBA 5KGXA 3BGRA 4ELTA 1HYSA 4WZSD 2HNDA 3VQ7A 4CIFA 1KLNA 3NHGA 3C6UA 3KJVA 2YNIA 3PX4A 2PZSA 3NF8A 4CE9A 1QN7A 4HUFA 3AV9A 3WNFA 1SKSA 4M42A 1NJXA 3OVNA 3C6TA 2KTQA 3OC3C 1XWLA 4FM0A 4DLGA 2VJ0A 4TSXA 3KLFA 1RBTA 1LWFA 4AILC 4J2DA 2FC0A 4O0IA 3PX6A 2IGIA 1LW0A 1MU2A 4IFYA 1QN9A 4HHTA 2BDPA 1TBAB 3CFPA 1WN7A 3LAKA 4CHQA 5J2MA 4DFMA 4GMJB 3TANA 4IDKA 1VSLA 3ITHA 3T3FA 1KSPA 2A1SA 1NGMA 1G15A 3QEIA 3DYAA 3PO4A 4N41A 1VSFA 3AVIA 1JFIC 4KV8A 3QEVA 4CCHA 4EZ6A 4K8ZA 2IC3A 4R5PA 1RTJA 3ZSZA 1C1CA 2G30A 1VK0A 2LSNA 4LD0A 3LP0A 1YTBA 3NDKA
chains in the Genus database with same CATH superfamily
3NVKA 2WTUA 2VG5A 5AQSA 4DV1K 1NJIO 4K8XA 2JHJA 4JI0K 3T7ZA 1NVPA 4BC5A 1QTMA 3CCLN 1QN5A 3CHWA 1T6DA 5LMNK 5C2DA 4WFAL 4C8LA 1NJZA 4DV6K 2PWWA 1B9DA 2VWBA 4AHVA 1ITGA 3KWGA 4H4MA 3SQ2A 1BCMA 4FWNA 4FLYA 3HM8A 4DV3K 3MN9A 1RTDA 3I56N 1NKBA 4DSFA 4H5NA 3PDKA 3ISNC 4FW2A 3WUHA 2BUPA 1S6QA 1KYDA 3GE1A 3A5NC 4EIAA 3VEOA 3HVTA 2F8TA 3EYZA 1UA0A 2HHQA 1J5EK 2JHNA 2G8UA 1NG9A 3EZWA 4GW6A 2YHXA 4A59A 1VQON 3QETA 5M1NA 1XMQK 4Z4IA 1ZC6A 3IH7A 2P1JA 2HMIA 4JKHA 4IBNA 1LWEA 4FM1A 1U4BA 3P83D 1Q9YA 2ZM6K 1QSYA 3D2EB 3SJJA 1X9WA 2QWRA 2P9IA 4B3OA 4HCBA 3R9PA 3SAGA 1ESVA 3ZX2A 4FWOA 4G9ZA 2XHIA 3ZSYA 1RT3A 3LAMA 4BWJA 2PAVA 1Q9XA 2Y8QA 3QEXA 3H1QA 4DQSA 4O4GA 3HBTA 4FOEA 4M41A 3BZKA 1Q7YO 1WJWA 3DXKA 4W5QA 5IT9O 1RNHA 3E9LA 4H5RA 3MCPA 1SL0A 4KHSA 3LWMA 4BR2A 4E7HA 5J2NA 4E7JA 3NBPA 4JK9A 4OX9K 3FZLA 3L8BA 4FLVA 3LM9A 1K8AO 2QKBA 1C9BB 1WSIA 3WNGA 4BG8A 3OYBA 5AQVA 3VGKA 4CJFA 2EHBD 5SZTA 1B92A 4ISFA 4Y1CA 3OYKA 2UU9K 3AARA 1HKCA 3N4QA 4X64K 1S72N 2E20A 1VQ4N 3D7QA 1HPZA 3AO1A 4N56A 2CH6A 4EHUA 4JD2B 2FBXA 1LOTB 4DF8A 1BGXT 4FJMA 5HROA 3T1HK 4D7RA 4CHYA 1NGCA 1TKDA 1JL1A 5SWMA 1IBKK 3TWHA 3ZEUA 1N33K 1NOZA 2VWKA 1NH2A 3AA3A 1S5JA 1WSEA 4H0PA 1LW2A 4DB3A 1CDWA 2JGUA 4NYFA 2Q36A 3TSQA 2Q0RA 4HUEA 4IJNA 1RDDA 1V4TA 5AQWA 4CJ4A 3QEPA 2KFZA 3AVLA 2E1ZA 2OTLN 4FJHA 1A5XA 3HJFA 1TL3A 1W9HA 3K58A 2QWPA 1I3AA 4I7FA 4LFCK 4FM2A 4BY9C 3UW2A 4EAHD 3RWUA 2QRCA 4B3TK 2HHXA 3T4NA 1QNBA 1S1UA 4ELVA 3LL3A 2AA4A 3L6QA 4M3WA 3ZSXA 3THWB 1K6YA 2NRXA 5AQXA 2RHKA 3RVCA 1HPMA 2GWJA 4B9TA 1KAYA 2CGKA 4DU4A 2IS3A 3LP1A 4GKJK 4WQ4C 4KH5A 1N6QA 2G8VA 1HLUA 1GLJO 4NCAA 1RDUA 4CHPA 4HTLA 3JYTA 2O8DB 4A5AA 1JXEA 1TUYA 1MDUB 3OYGA 3MN7A 1IBLK 2WUSA 3FZKA 4DTPA 5I42A 4JAXA 4A62A 3LM2A 4B9SA 1TL1A 1J3MA 1GLFO 1ZYQA 3D2FB 2A40A 5EY4A 3VF2A 3O9RA 1KTQA 5AZIA 3ZSVA 1M5Q1 2HB5A 2NOIA 1HNVA 4H0OA 3DRPA 2HHVA 4LH4A 1NGHA 1C1AA 3FZFA 4L8RB 4KB1A 3AVAA 4RW9A 5JLFA 1NJYA 3ULEA 1JKHA 4JKAA 4ICLA 2YHWA 3UE5A 3KZBA 1VSEA 3K57A 3H3OB 2Z1GA 3PX0A 1IJJA 1N3CA 2W40A 2HZSA 5AFUA 2P9PB 3H6EA 4MRQA 4PUOA 4J2AA 4CEBA 1WBDA 1S1VA 3VQQA 4KKOA 1RILA 4B1UB 3DWLA 3EEQA 3KLGA 1UT7A 1RCHA 2ZE2A 3UKRB 1FN7A 2NOHA 3NGZA 2A5XA 1VQ7N 4WQ5C 3CCSN 5HP1A 5F9CA 3CJ7A 3OA9A 4H0YB 4EAIA 3TSPA 3KK1A 2RPIA 1ZBSA 2FGTA 3VQPA 1K73O 1JDYA 3LDPA 1X3NA 3KD1E 1J9AA 5EU7A 4CIEA 4CF9A 1JLAA 4R79A 4DQQA 1IH7A 1X9SA 4ZTFA 4GNIA 4AM7A 1C6VA 3LWLA 4GY2B 4CJLA 1YJWN 2NWVA 4FJ8A 3U3YA 1D8YA 1YQMA 3G4SN 4JN4A 1W0HA 3HPGA 2P9NA 1BHLA 3THVA 2QXFA 2FXUA 1QQOA 2YHYA 3O3FA 3E1YA 3OYNA 3M3ZA 4JEPA 4CF2A 3NA5A 3CD6N 4AH9A 4B3SK 3ULDA 3OH6A 2XY8A 3OLPA 3ZT2A 4CEOA 1Q81O 3IAYA 1BO5O 4FYDA 1NK7A 4FWSA 3TAFA 2V8QA 5C25A 2V51B 1JJ2M 3LP3A 1EWQA 3O80A 4ELUA 1RT6A 3AVHA 2O3OA 2ZQBA 2FLOA 1UT4A 1YJNN 4CHNA 4MDBA 4B9QA 4M3XA 1KYFA 1Q82O 3QBXA 3H1ZA 4F8RA 4KTWA 2HVHA 3V1RA 2DFEA 3CWAA 3O3HA 1HNXK 4FWRA 4EHTA 2KLAA 3HOTA 2OPRA 3S3NA 2WFBA 3VF4A 2GUPA 3C95A 1XUPO 1GOCA 1I39A 4JKFA 2NRRA 4H0TB 4JRPA 1TYQB 4DTXA 3E66A 4NLBA 3EO3A 3QLHA 4DR1K 1W97L 2W41A 3HSTB 3TAPA 1KXPA 2VG7A 4PKIA 1K35A 3KKRA 5HRSA 4FJJA 2NNWA 4EAKA 4Z4FA 5LJVA 3AVBA 3ZSWA 4IKFA 3K5OA 3VTIA 2A41A 2V7YA 4H5TA 1VQ6N 2O8CA 1NGEA 2I5JA 3GL1A 3GBTA 4OGCA 1S9EA 2WOMA 1BWFO 4N5SA 2P9SB 3JXUA 1HNWK 1EP4A 1SL2A 3I55N 1GLLO 3T1YK 3M1FA 1JXBA 5KI6A 3P4IA 4IFVA 5CR4A 4QS9A 3CPWM 1TV6A 3B6PA 3KK3A 2HOEA 1SKRA 5IYCP 5BN8A 5KGWA 1RBSA 4OLBA 1HMVA 2FSNA 3KKSA 3S9HA 4EP4A 3ID6A 3SUNA 4E1NA 2DPNA 3DLHA 3TAEA 5FPDA 1N3AA 1Z26A 2E4LA 2E6LA 3HI0A 4UY8O 2FBTA 4DU3A 3G71N 1YF5L 2QEXN 2WBNA 2E6MA 3VQ9A 4WYBA 2D0PA 4E7KA 2BGGA 2UYTA 4WE1A 1TAQA 4DTOA 5M1QA 3VESA 1NK0A 1Z6RA 2HSTA 4EAJA 1QN6A 4ROCB 3SPYA 2RKIA 4ID1A 3TSUA 1HNIA 3VENA 1XSZA 4DTMA 3SYZA 5I9EB 4PQUA 1T44A 5KGXA 2I5WA 4CIFA 2HNDA 3PX4A 3WNFA 1SKSA 4M42A 1M3QA 5BRDA 3OVNA 2NOEA 1SZ2A 5AQHA 4I6MA 3DXMA 3U9ZA 4HHTA 2BDPA 1TBAB 1ATSA 5AZJB 3O9TA 1GLCG 3A0IX 3LAKA 3TTFA 4CFFA 4E1JA 3WT0A 2Z0FA 3DYAA 5KQDA 3PO4A 1JFIC 2ITMA 2IC3A 4GVEA 3ZSZA 2F9TA 3KTUA 3LP0A 3H45C 1YTBA 4W5TA 3NDKA 1XMOK 1S22A 5AR0A 3NH0A 3H3NO 4G1QA 3CCRN 4CF0A 1U6ZA 3MCAB 4CERA 2H3GX 3CI5A 4IG3A 3TAMA 1MA9B 3DLGA 2NZTA 1A5VA 2FSKA 3QB0A 4WFBL 2X74A 4UQGA 1T03A 3CC2N 4BDPA 2X78A 3TU5A 3F2KA 2BH1A 3ID8A 3QNNA 3V9SA 2O8BB 2O8EB 3D45A 3UKUA 3MAQA 3ENHA 1QNAA 4A5BA 1JCGA 3V81A 2DKCA 1VSHA 1RTIA 4JI3K 3CJBA 1NGBA 3MEEA 1E4FT 4CZJA 1LAWA 3HPHA 4JKEA 4IEEA 1QHAA 4YOUA 1L3TA 4B0AA 1CZAN 1BL3A 3ZSOA 3HT3A 4OGEA 3VQAA 3SK3A 3N4PA 3JS6A 1OH6A 2HVIA 4OKJA 3QFPA 2D0CA 2YHAA 3IKMA 4J2BA 2ZJQL 2QA4N 3KD5E 4OLAA 1RT2A 5BN9A 3BDPA 2ZGZA 3QNOA 1P8ZA 4DF4A 3AVCA 3RMAA 3HVRA 4LF7K 4QG5A 3TR8A 2HHTA 5FLXO 1DKGD 4DFJA 1OVYA 4B1VA 1QSLA 1A5WA 4M3YA 1HU0A 3U9DA 2HBLA 2P5OA 1G99A 5AQTA 5HRRA 1XQSC 2A6AA 1IKVA 4FPBA 3G6EN 5C15A 4CW7B 5F1XA 1BOTO 2FF3B 3OS1A 3T69A 3G10A 1E42A 4CZLA 2FF6A 3TDHA 3VQ6A 1L5UA 3OTOK 4EJZA 1GOAA 4ILGB 3SZ2A 1IV0A 2E2QA 5C24A 4AHUA 2O8FB 3WQUA 3MEGA 3SUOA 5AJ3K 4CGGA 3EY1A 4GKKK 4JI6K 4OPKA 3DRSA 2JPIA 1TUOA 2YI1A 4CZEA 2OTJN 4E3SA 4H4OA 3KLHA 4BE1A 1VSJA 2HKPA 2P9LB 1NK6A 4HCCA 4BJUA 2QR1A 2D0BA 4KI4A 4CJWA 2I7NA 4YOXA 1KY6A 4CBWA 3LALA 4FJ7A 1VOLB 3P1GA 3FFIA 5EXWA 5LY3A 3IFRA 4YDUA 4KTZA 3WNEA 2W6LA 5AQOA 3PSIA 3VGMA 4BDZA 2P51A 5AQZA 1KFIA 4WFNL 3QERA 3L0QA 4K42A 4DHYA 5HBMA 5D3GA 2XO7A 2E1YA 1LWYA 1YUWA 2ZFDB 4FLXA 3THYA 5DK5A 1L3VA 4JHDA 4OJRA 2F9WA 4BR0A 3AO2A 1TK5A 2QRDA 3HL8A 1PCZA 3QDKA 2B4JA 2KQ2A 4EP5A 1XNRK 2A3ZA 2NRZA 3AO4A 1VSDA 1DLOA 1YJ9N 5JVGL 1TK0A 4B9UA 3I33A 3DLLL 3C7NA 4CGFA 3OYIA 4NB4A 4ROEB 3C6AA 4O8UA 3I8DA 4YOYA 3V1OA 1K8KA 4K41A 2Q0UA 4ISGA 1YT3A 1Q9UA 5AQPA 2P9IB 2QWLA 4JI4K 3VQCA 1VHXA 3QO9A 1U48A 4LFAK 4BC3A 3CFOA 4MO5A 5ELZA 2Q2RA 2Z8UA 5C10A 4DR7K 3E01A 4BR9A 4DTNA 2JOIA 4IDHA 2KKZA 1NLVA 3AO3A 4YOTA 3VQ8A 3CCUN 3OW2M 3DXKB 4FSVA 3D6RA 2WC9A 2LAEA 1BI4A 4KFBA 3SCXA 1RT7A 1QE1A 2YA3A 1C0TA 1HR0K 1GLBG 4DQIA 4QAGA 5IWAK 1YQLA 3RMDA 1TAUA 2Y8LA 3HS8A 1VTOA 3AA4A 5JVHL 3ZLJA 1KD1O 2HNYA 1HRHA 1KC8O 5KRTA 5LL6Z 1S1TA 1HYZA 4DV5K 2H5AX 4KREA 4BC2A 2HBKA 3VN5A 3CJ1A 3CC7N 3FLCO 1O1WA 1XI1A 4H03B 3CCVN 3DLKA 3ZSQA 3OJUA 3WNHA 3ENOA 3HZ6A 5BRFA 1VRTA 2NRTA 2CH5A 3WEEA 1LV5A 5KTQA 1EBMA 4IWVA 3SV3A 2OCEA 5BPMA 1TGOA 2UUBK 1ATNA 3ATVA 1C47A 3OSTA 5E84A 3L2UA 4DTSA 1GLDG 3EIKA 3K2PA 3L4QA 2DFFA 1S6PA 1WLJA 3ZEUB 4WX8A 1QVFM 4BRFA 1N36K 5EPCA 1IG8A 5AQNA 3ZT3A 5ADXA 1ZBLA 1BDGA 1QN4A 1VSIA 4CF1A 4MLEA 2F8SA 5IYDP 2NLVA 4CFDA 1RT1A 3S3OA 4NO7A 4CJ3A 2NOZA 2QWQA 3AGRA 4DR4K 2ZWHA 4B9LA 4BRMA 1IKWA 4DMNA 3SQ4A 4IOCL 1ZXOA 3EN9A 3HOSA 1LWCA 5CY4A 4DSLA 3QMLA 3VQ5A 1GOBA 4D7QA 3HPOA 3SQ0A 1NNEA 5FDLA 4I8OA 4FK2A 3CFRA 4CEEA 5KPZA 4KAZA 3AVJA 3L4IA 3CMAN 2YKMA 2EWSA 1VSMA 5FRMA 1REVA 4CK2A 3SAHA 4NCGA 4Z4GA 4CECA 1RT4A 5CZ2A 4BC4A 4M3TA 3IS9A 3B6OA 5GAEP 3MN6A 4JI5K 1AISA 3CWSA 2NRVA 3OY9A 2G8HA 2HHHK 3OH9A 4AM6A 3CCEN 3VEWA 3S3MA 3BKQX 2FBVA 5AZIB 3P31A 2QI2A 2G8FA 4BRLA 1CZ9A 4JLHA 1WSGA 2JLEA 1C1BA 3KTQA 1BIZA 1NMNA 1R59O 1W2BM 3LDQA 4W5NA 4HTUA 4DR5K 1BISA 4CBXA 3ULEB 5M1OA 4FWQA 3OCIA 3A5MC 4XH1A 4LC9B 4CZHA 4N76A 3QFUA 2YH5A 3EE8A 3K0SA 3AAPA 2H4LX 1Y64A 3MN5A 5T7BA 3NH1A 3OBWA 4BACA 1X9MA 3F10A 3HXMA 1Q18A 4F3OA 1VSKA 4JKGA 1RM1A 1RFQA 1TKZA 3CC4N 2RE2A 1T3VA 3D4VA 1DTTA 5KQ8A 4B8AB 4CZFA 3OYJA 3PLAA 1X1PA 3T19A 4CFAA 5CZ1A 4OPAA 1TUUA 2Q3SA 4CJTA 4BRNA 1VQMN 1U49A 3QIOA 1DTQA 4EFHA 1DT9A 4B08A 3M8SA 4CJEA 3SV4A 1P5DX 2ZJRL 4GVMA 2QK9A 3LPTA 1HKBA 3JSMA 1VAZA 2UXDK 3ZX3A 1T7PA 4DS4A 4B1WB 2QWMA 3RMBA 5C0YA 4WF9L 4WZSD 3VQ7A 4BRHA 1KLNA 1J6ZA 3O6WA 3AV9A 2HL8A 3NVMA 3KVGA 3P38A 3C6TA 2KTQA 2V9JA 1XWLA 4TSXA 1LWFA 4J2DA 3PX6A 2IGIA 3VF6A 3O8MA 2P9NB 1QN9A 3R6MA 4JKBA 4BRGA 1WN7A 4GMJB 4PL7A 4IDKA 3ITHA 4BRKA 3CQXA 2VQFK 1JCFA 3E9OA 1NGMA 3QEIA 4N41A 3AVIA 3KHYA 3QEVA 4CCHA 4K8ZA 4ISEA 4R5PA 3O9UA 3CMEN 1C1CA 1VK0A 1RGIA 3V4IA 3DAWA 3O9QA 4Z94A 3KRMA 4GV3A 4XIUA 3CETA 2O4IA 1OVQA 4HWIA 4I2PA 3LDNA 3L2VA 1JL2A 5LMUK 1D4XA 1HJRA 4FVMA 4OPHA 1BA0A 4CK3A 4RWTA 5CHIA 3WXMB 3LZJA 5LJWA 2PYLA 5FROA 2W6KA 1OKJA 1CLQA 4C8KA 3BEXA 4JK8A 3K59A 3RMCA 2BE2A 4OPJA 2V52B 2FKMX 3AVNA 1ASUA 5EVZA 1N39A 2DY4A 4CK1A 3J7YP 1NJWA 3DPTA 3NF9A 5AQJA 3CJAA 3U3GA 4FLUA 2NRWA 3OYEA 1NOYA 2NOLA 1TK8A 4M63C 1TBPA 3V6DA 1J5OA 1VOKA 2E5LK 3RRHA 2O8CB 1SS6A 1W7AA 1YIJN 2F7LA 1JLEA 4CFCA 1CZBA 4IO8A 1HKGA 4IOAL 1KY7A 1NGGA 4FOIA 3OYAA 4FZZA 4E7IA 1FJGK 2F7TA 2GBZA 4HVJA 3O1BA 4DSIA 4I9LA 2P9UA 1JLCA 2GWKA 1HJOA 3ZT1A 4C8MA 4DUZK 3SJHA 3OYHA 4GV6A 4E7LA 1NGFA 4CJ5A 3H1VX 4CEQA 1FW6A 4CGIA 3K9JA 2NOFA 1YAGA 3KIOA 4YNQA 2W42A 4FXDA 1UAXA 3C04A 3ZCMA 4JI2K 1NWKA 5KPTA 1WQAA 3ZETA 4O5FA 3SAFA 3HO1A 2IVNA 3RSEA 4DFPA 3I8BA 3ENBA 5JS2A 3PIPL 3J8AA 5BR8K 2Q31A 2X6NA 3D7EO 1DEJA 4DS5A 4PA1A 3WXKA 1EXQA 3PIOL 5B8HA 3VA3A 3OBYA 1HUXA 4Q11A 4BRQA 1C0FA 2IIRA 3MX5A 3AVFA 3VOVA 2J4RA 1S1XA 3DXMB 4I6MB 4O5BA 4BG9A 4YORA 5JICA 3C6HA 4E1MA 4LF4K 3M8QA 2UXBK 5IYBP 3THXA 5AQFA 3D0PA 4C8OA 1YVUA 1SL1A 3DOLA 3IMXA 4DR3K 5C42A 4CEAA 1D3UA 3HSCA 1N5YA 3P39A 3NE6A 4CZGA 4CZKA 1IG9A 3AVKA 3F0ZA 3NH2A 2VGNA 1QTPA 3G25A 3SNSA 4XH5A 2ZD1A 3SQ1A 4FJIA 4KBOA 2HNZA 2IDOA 3DI6A 2YV0X 4AHTA 1LCUA 4ILJA 1VQPN 1V4SA 4QCLA 2HHUA 3ENCA 4PKHA 1UA1A 5I3UA 3VQ4A 2G8IA 5BR9A 3CVSA 3K5LA 3CG7A 2ATQA 4DQRA 4OVLA 3IRXA 4DLEA 1M90O 3SUPA 3F73A 3DJCA 4CF8A 3SI6A 4F9OA 5ADXH 2GX9A 5CYQA 3UKUB 3MECA 4CGHA 3LDLA 4H5WA 3MEDA 2MJ7A 2KZMA 2OOYA 3HS9A 4KH4A 1WBBA 3TI0A 4BREA 1NKCA 2B6AA 4WCEL 4DQPA 1U45A 5AQUA 2Y1IA 1C0UA 2O4GA 4BE2A 3O4NA 3GDQA 4X65K 1UOCA 4M7YA 5AQYA 4DSEA 4CJKA 5GAHP 3ULXA 1GLAG 3KLEA 3MXIA 4KB0A 1EWRA 5FRNA 2IOCA 1N8RO 2VCPA 1RDCA 1QNCA 2GELA 4CBUA 1M1KO 2ASOA 4Z4CA 2XHBA 1ATRA 2MZ8A 2OPQA 5C2FA 2XY5A 1SQKA 1IKXA 3A8YA 3RR7A 3LDSA 2X6SA 1IKYA 1XHZA 1X3MA 3Q7BA 3O5BA 1HQEA 4K25A 5F2RA 1QTSA 1DIZA 3CQ8A 4DSKA 2NLXA 4YDUC 4LSNA 3SPZA 2DKDA 3JAMO 3AVMA 1KVCA 4K0KK 4B9MA 4JRQA 3MX2A 1NGDA 1QN8A 2PFUA 4FVUA 3EKUA 1C4GA 4CJVA 3F9MA 2OA8A 5AN4A 1RDAA 1ASVA 3ZSRA 3MK6A 1RDWX 2QREA 3L3UA 2G8KA 2RF2A 4DCHA 2KFNA 1FKOA 2IVOA 3ALYA 4LF8K 2KZZA 1D5AA 4W5OA 4DUYK 1D9FA 1GLEG 3OYMA 3CERA 3TABA 4DTJA 4YHHK 3SMSA 3L2WA 1O13A 3CWTA 4IG0A 4CEFA 2YJEA 1XNQK 1QHTA 1NM1A 4YFUA 4Z4EA 5BMNA 2AJQA 3EL2A 2P9KA 4FK4A 2ASMA 3L2QA 3WQTA 3OYLA 5AQQA 5TKWA 3SUQA 4Y1DA 4CESA 2PY5A 2KHOA 1KVBA 2OPPA 2V7ZA 5HLFA 1U2VA 4LSLA 3J7AP 3O08A 4CEDA 4CZIA 4J8FA 4KHNA 4DG1A 4A61A 2VWJA 3UB5A 1T8EA 4C1NK 4BGAA 1VRUA 4DV0K 5E26A 3L2RA 3RSMA 3FZMA 1VQLN 5CE3A 2ASPA 2PBDA 1Z25A 4CZMA 4KH6A 5HRNA 1KFSA 1FKPA 4MQ3A 1NK5A 2IV9A 3IG1A 1N32K 1WNSA 1ZBIA 3W0LA 3TTDA 3THYB 1TKXA 5HOOA 4JHDB 2FUVA 4B9VA 4KHYA 1IBMK 5M1FA 4FO0A 4DV7K 2QXLA 2QTDA 2ZF5O 4RW8A 4BRDA 4M45A 4MLHA 4JS4A 3O4QA 3M5RA 3AA5X 3DLEA 2HF4A 2GEMA 1SV5A 2VQEK 3NF6A 4M3ZA 3C7NB 3ENOC 2Q97A 3O1WA 1Z05A 4PWDA 3CIPA 4RW4A 3MXJA 1SAZA 4LY7A 4W5RA 1PCMX 1LWWA 1K8KB 1P5GX 5MLCQ 1KAXA 4BR7A 4CEZA 1T6AA 1QQMA 1TGHA 4PL8A 4H0XB 1NK8A 3ASMA 3I0SA 4FW1A 4CJUA 3VPZA 4H5VA 2Z1JA 2V92A 2QKKA 3ZYYX 5GIOA 1P90A 5TKYA 3V9ZA 4F3TA 3D2EA 3SLCA 4YY3K 3OYDA 1FXXA 3AAQA 4FJGA 5EX5A 1BCOA 4KHUA 1V5SA 3QBWA 2EX3A 3VMFB 1BIUA 3LDOA 1QQCA 3J7ZO 3N89A 1BI4B 1JLGA 1JLBA 4Y0WA 1DGKN 3I0WA 4K43A 3LPUA 3NAEA 2GUIA 4H8KA 4NXNK 4ILHA 4KI6A 1Q86O 1VKLA 2IAJA 5JMVD 1JLFA 1OH5A 2Y1JA 5AQMA 2KW4A 4RG8A 4DR6K 1W80A 3VEZA 4FJKA 3MMVA 1U47A 4LF5K 1HX1A 2YKNA 1KYUA 4FZYA 4E0DA 3UIQA 3CPEA 2GTDA 3R8EA 4DSJA 5J2PA 1QZ5A 3C65A 4KRFA 1PVSA 2PYJA 4FWKA 4F2SA 1PCJX 4MDAA 4CFBA 1R4XA 4C8NA 3WEEB 3CCJN 1D9DA 3CCQN 4YOWA 4IXCA 4AHSA 4XH4A 3NMUA 5AQGA 1BQMA 2R7YA 4CD1A 4CVNE 3OGDA 3H46O 1KFQA 2AP1A 3J81O 2NVMA 2A42A 3C6UA 3KJVA 3NF8A 4CE9A 4HUFA 4CJ7A 1C0GA 3A5LC 2DKAA 2D0OA 4JD2A 4FM0A 4AILC 4DLGA 2VJ0A 3KLFA 3VEVA 2FC0A 4O0IA 5JN5A 4LF6K 4IFYA 2ZJPL 1VQKN 4CHQA 4JNEA 4DFMA 2QWOA 2QWNA 1G15A 3FFKB 4JI1K 1NGAA 1VSFA 4KV8A 4GV9A 1OH7A 3VERA 2G30A 2LSNA 4LD0A 4JS5A 4I9QA 2YJFA 3AGKA 4M3RA 4CGJA 3R3LA 3G0ZA 4FJXA 3NFAA 1NU0A 3SBTA 4LH5A 4FJ9A 3K9KA 4EJYA 1WUAA 1E3MA 2A1RA 2YCHA 3DM2A 4DU1A 3SBGA 1YI2N 2JWKA 4L3QA 4PY5A 5AQLA 5KPRA 3AA2A 4CJRA 3THWA 3VGLA 3QEWA 2F96A 1T6CA 4CHOA 1HNZK 1S9GA 3F5TA 3K5MA 3OS2A 3HP6A 2VGMA 3ZT4A 4JI7K 1WB9A 4C23A 1VQNN 5J1EA 1L3UA 3H08A 3VQEA 1KO9A 2HW3A 2O8DA 1RDBA 3CYMA 4QOZB 2G8WA 5BRHA 4KO0A 3VEYA 4OKEA 1EKEA 3A2FA 1K9MO 2E88A 1KCFA 5FPNA 3ATUA 1RTHA 4DFKA 3EE9A 5DM7L 5GAGP 4FWMA 3NF7A 3U4LA 3D2FA 1VQ9N 4JI8K 4NYNA 5JLHA 2EHGA 1C0MA 3VA0A 4IZ9A 1M3HA 1XHXA 3MWTA 1EUVA 5EOYA 4F2RA 4TPSA 4B3RK 3PMGA 2ZGYA 3OJSA 2E8AA 1UL7A 4FJLA 4B9NA 3K5NA 2IVPA 5AQIA 3R1XA 1NBWA 4LF9K 4C1NI 3OYCA 1KAZA 4X66K 4JKGB 1U04A 2UUAK 3ZX0A 1Y97A 2OPSA 5AQKA 2P9PA 4BWMA 4DTRA 3E9PA 5GADP 3CW7A 2CGLA 3OS0A 4FZXC 5GIPA 3RTVA 2Z1IA 4AHCA 4FCYA 4U7BA 1VTLE 5GINA 3MXMA 1KVAA 1CXUA 3UKRA 4WQ4A 4BVOA 3I3WA 3V9XA 2DFHA 1BQNA 4O44A 3V1QA 3CJ9A 4Z4HA 5E41A 4FK0A 1YTAA 3DLBA 2XRIA 3MWPA 4IEIA 3LANA 2JWLA 1WSJA 2DTUA 3V9UA 4AHRA 5HSHA 3C0BA 3PUFA 2VYPA 4JKDA 3MDQA 1BUPA 4DWIA 4BRAA 1LXTA 3CCMN 4E89A 3QESA 2YHBA 4BDYA 3TARA 1Q8IA 5KL0A 4RODB 1KRPA 4XEIA 5HL7L 4BVPA 1LWVA 4ZHRA 3OHRA 4A2BA 1QN3A 5BPNA 1BA1A 1RBUA 4B3MK 4RTFD 4B8CA 1MWMA 4IOXA 4X62K 4FL9A 3DPUA 2BTFA 4E19A 4Q5VA 1UWBA 3HP9A 3WXJA 4B1YB 1NK4A 4EALA 2Z1HA 1NK9A 3KK7A 3CM5A 4DV4K 4FWPA 4IJAA 1S1WA 4CJSA 3TE5A 3CF5L 4Q0BA 3U8XA 2D1KA 1ZBHA 3CJCA 3P5JA 2NUBA 4WQ5A 4M7XA 3CQYA 4KHWA 2XY7A 3CVTA 5JS1A 4RW7A 3RR8A 4BGBA 3BY5A 4NCBA 1TYQA 2HL9A 3PO5A 5DMRA 3GOIA 4MO4A 5A2QO 4MFBA 4QS8A 3EZ5A 3HYFA 3C94A 4DV2K 3OSMA 3AVGA 3KK2A 3HM9A 3F9KA 1NKEA 2P9UB 1TKTA 5AQRA 2VG6A 5KRSA 1T05A 1WSHA 3W3DA 4YOVA 3QINA 3FE1A 3ZT0A 3I0XA 2E2OA 2P9SA 4AQYK 1B9KA 3NGIA 3GG4A 3PV8A 1EQYA 3LP2A 1HYVA 1LAVA 4CD3A 2RN2A 4BQZA 4BROA 4RCHA 5BREA 3BF1A 3BF3A 1VQ8N 2OOXA 1YQKA 5JMVA 3FZHA 1YTFA 4LFBK 4V19S 1H1VA 3ZETB 1WAFA 1S3XA 3BP8A 3WXIA 1OH8A 3RSEB 1JCEA 1SKWA 1ASWA 3BZCA 3IDHA 1NGJA 3AY9A 3OSEA 3NGYA 4FJ5A 4JK7A 1BU6O 2HMPA 3V9WA 4A57A 3TPQA 2QW9A 2QM1A 4AF1A 1YHQN 2YNFA 4O55A 2ITGA 4FLTA 1VQ5N 1TVRA 3T1AA 3RPJA 3L3VA 1CXQA 1YTUA 1YQRA 2E2PA 2WONA 3VQDA 2UUCK 1KFDA 3RRGA 3I0RA 4NLCA 4H0VB 4PKGA 3VQBA 1NGIA 1FK9A 3IUCA 3HRGA 2QLVA 3THXB 5K14A 4KPYA 4FJNA 3DOKA 5M1PA 3CWUA 3VEXA 2F4VK 1EX4A 3DMJA 4CGDA 1KQSM 4I2QA 1L3SA 3EAYA 2Q1NA 5AZJA 1JLQA 5J2QA 2R5XA 3Q7CA 1EETA 4WXAA 1YVNA 3PSFA 1SUQA 2IV8A 3QICA 3DRRA 5F0XA 2OZMA 1EO1A 1E4GT 3KLIA 3HK2A 4CIGA 3TAGA 4BQLA 1KLMA 4CHZA 3SNNA 3CXCM 3CM6A 2FSJA 4ZTJA 2NOBA 3NCIA 4J2EA 2HHSA 1IO2A 4NXMK 2FKFA 3WXLA 2D0AA 1B9FA 3A5OC 4CI6A 2OYQA 1J54A 4KHQA 1RT5A 3LZIA 4OKKA 1QNEA 2YNHA 4CJPA 2P5GA 2O8EA 2O8BA 5BPLA 1ZBFA 2GV9A 2HHWA 2NRHA 3BUZB 4QS7A 2D5RA 4C7PA 4DR2K 2YNGA 3FGUA 4N47A 4DKWA 4RW6A 4BE0A 2BANA 4EAGA 1ZBUA 3KWIA 2D4WA 3J80O 2XY6A 1YXQA 5M1KA 1K2YX 2CGJA 5H1SQ 3SMPA 4EZ9A 1QZ6A 4O8KA 4FLZA 1XC3A 1N34K 2I7PA 2OZSA 1J53A 4HUGA 3EKSA 4FLWA 2HBMA 4DQ8A 1MWKA 5HRPA 1X9JA 1HQUA 4CJQA 4B1XB 3TTCA 4JKCA 3AO5A 1QS4A 4IO9L 4BRPA 1QSSA 4BR4A 1MP9A 5BMPA 3OYFA 1MPGA 4BR5A 4ID5A 2OANA 5FPEA 2B5JA 3PY8A 4JV5K 4JYAK 1XC9A 4O0JA 3M8RA 1ILYA 4F4KA 4KTQA 5FPMA 3O9SA 1F21A 3HTVA 3M8PA 2ETJA 4M3UA 1PZDA 3S41A 1QVGM 1RBVA 1WSFA 1RBRA 4HJHA 2HF3A 4BRCA 1WAJA 1NMDA 4DTUA 1BG3A 3DLRA 4DULA 3VETA 1R0AA 3QIPA 2YX6A 2FBYA 5CYMA 2UXCK 3VTHA 3U6FA 1WOQA 3O3GA 3O4WA 4BRIA 2O8FA 3TAQA 1HYSA 3B8AX 4Z0UA 4U67L 4ELTA 3BGRA 2P9KB 2HBJA 3NHGA 2YNIA 2PZSA 2E2NA 1QN7A 3FR0A 4PHTX 4IL8A 3M6GA 1NJXA 1QQNA 5AFUH 1U2VB 3OC3C 1RBTA 1LW0A 1MU2A 2P9LA 4FPAA 3CFPA 5C12A 5J2MA 2HZMA 3TANA 1VSLA 4IFEA 3T3FA 1KSPA 5DM6L 2A1SA 4FWLA 4OO1J 4KHPK 4EZ6A 1I94K 1RTJA 1YITN 4B1ZA 4A2AA
chains in the Genus database with same CATH topology
4W5TA 3V4IA 2VG5A 3KRMA 4XIUA 4JS5A 3NH0A 4I9QA 4K8XA 4G1QA 4CF0A 2O4IA 4CERA 4M3RA 4I2PA 4CGJA 1NVPA 3G0ZA 3L2VA 1QTMA 4FJXA 1JL2A 1QN5A 3NFAA 4LH5A 4FJ9A 1HJRA 4IG3A 4EJYA 4FVMA 3TAMA 2A1RA 3DLGA 4C8LA 4CK3A 3DM2A 4DU1A 3LZJA 1A5VA 1NJZA 1B9DA 2PYLA 4PY5A 2X74A 5FROA 1ITGA 4AHVA 4UQGA 1T03A 3SQ2A 4H4MA 4BDPA 3AA2A 1BCMA 4CJRA 4FLYA 2X78A 4C8KA 1CLQA 3QEWA 2F96A 4CHOA 3V9SA 1S9GA 3QNNA 3D45A 1RTDA 3K59A 3RMCA 1NKBA 3K5MA 2BE2A 4DSFA 3OS2A 4FW2A 3ISNC 4OPJA 3HP6A 3MAQA 1S6QA 1KYDA 3ZT4A 3AVNA 1QNAA 1ASUA 3HVTA 2F8TA 3EYZA 1UA0A 2HHQA 5J1EA 1N39A 3V81A 1L3UA 3H08A 4CK1A 2DY4A 1VSHA 2G8UA 1NJWA 3VQEA 1RTIA 1KO9A 2HW3A 4GW6A 3DPTA 3MEEA 3NF9A 1RDBA 1LAWA 3QETA 3HPHA 3CYMA 3U3GA 4QOZB 2G8WA 4FLUA 4KO0A 4Z4IA 3IH7A 4OKEA 1EKEA 3A2FA 3OYEA 2NOLA 2P1JA 1TK8A 1TBPA 4B0AA 1KCFA 1L3TA 1NOYA 2HMIA 1BL3A 1RTHA 3ZSOA 4IBNA 4DFKA 1LWEA 3V6DA 1J5OA 3HT3A 1VOKA 4OGEA 4FM1A 1U4BA 3RRHA 3VQAA 3P83D 1Q9YA 1JLEA 3NF7A 4CFCA 1QSYA 1CZBA 3SJJA 1X9WA 2HVIA 4OKJA 1KY7A 4FZZA 4NYNA 3OYAA 4B3OA 2D0CA 4E7IA 2YHAA 2EHGA 2GBZA 4HCBA 1C0MA 4HVJA 3VA0A 4DSIA 4J2BA 1M3HA 1XHXA 4I9LA 3KD5E 4OLAA 1RT2A 4F2RA 4TPSA 3BDPA 1JLCA 3QNOA 3OJSA 2XHIA 3ZSYA 4C8MA 1RT3A 3AVCA 3ZT1A 4DF4A 3RMAA 3OYHA 3LAMA 3HVRA 4FJLA 4E7LA 4B9NA 4BWJA 3K5NA 3TR8A 4CJ5A 1Q9XA 2HHTA 3QEXA 4DQSA 4DFJA 4CEQA 4O4GA 4CGIA 1QSLA 1A5WA 4M3YA 1HU0A 4M41A 2NOFA 3OYCA 2P5OA 4W5QA 3KIOA 4YNQA 2W42A 1U04A 4FXDA 5HRRA 1RNHA 1Y97A 1UAXA 2OPSA 1IKVA 4BWMA 4DTRA 3ZCMA 1SL0A 2QK9A 4KHSA 3LWMA 3OS1A 3OS0A 4E7HA 5J2NA 4E7JA 3NBPA 4FZXC 3G10A 3HO1A 3L8BA 1E42A 3RTVA 4FLVA 2Z1IA 4AHCA 4FCYA 4DFPA 5JS2A 2QKBA 1VTLE 3MXMA 1C9BB 1KVAA 3VQ6A 1L5UA 1WSIA 3WNGA 1CXUA 4EJZA 1GOAA 3OYBA 3SZ2A 5C24A 4CJFA 2X6NA 3V9XA 4AHUA 5SZTA 2DFHA 1B92A 1YTUA 4DS5A 3MEGA 1BQNA 4PA1A 1EXQA 4Y1CA 3OYKA 3VA3A 3SUOA 4O44A 4CGGA 3EY1A 3V1QA 4OPKA 4Z4HA 3DRSA 4Q11A 5E41A 4FK0A 1YTAA 1HPZA 3AO1A 4N56A 3DLBA 2XRIA 4H4OA 4E3SA 3AVFA 3LANA 3KLHA 1WSJA 1S1XA 2FBXA 4BE1A 2DTUA 4O5BA 1VSJA 1BGXT 4DF8A 4E1MA 3V9UA 3M8QA 5IYBP 1NK6A 4AHRA 5HROA 4HCCA 3PUFA 4FJMA 4CHYA 3D0PA 4C8OA 1YVUA 1SL1A 3DOLA 2D0BA 1TKDA 4KI4A 5C42A 4CEAA 1D3UA 4CJWA 4DWIA 1JL1A 5SWMA 3NE6A 3TWHA 1N5YA 1KY6A 1IG9A 3AVKA 4E89A 3F0ZA 1NOZA 2YHBA 2VWKA 3NH2A 4BDYA 3QESA 3TARA 1NH2A 1Q8IA 3AA3A 1QTPA 1S5JA 4RODB 3SNSA 1WSEA 1VOLB 2ZD1A 1LW2A 3LALA 1KRPA 1CDWA 2JGUA 3P1GA 4NYFA 3SQ1A 4FJIA 1LWVA 2HNZA 2IDOA 3DI6A 2YV0X 3FFIA 4AHTA 1QN3A 4ZHRA 4HUEA 4QCLA 1RDDA 2HHUA 4CJ4A 3QEPA 4KTZA 2KFZA 3AVLA 1UA1A 3WNEA 1RBUA 4FJHA 4BDZA 5I3UA 1A5XA 4B8CA 2P51A 3VQ4A 1TL3A 4FJ7A 2G8IA 1W9HA 3HJFA 3K58A 4I7FA 1I3AA 3CG7A 3K5LA 3QERA 3DPUA 4FM2A 2ATQA 4E19A 4Q5VA 4OVLA 1UWBA 4DQRA 3IRXA 3HP9A 3RWUA 1NK4A 5HBMA 5D3GA 2HHXA 4DLEA 1QNBA 1S1UA 2Z1HA 2XO7A 3SUPA 1NK9A 4ELVA 3CM5A 4M3WA 3ZSXA 3F73A 1LWYA 4CF8A 1S1WA 1K6YA 3SI6A 4FLXA 5DK5A 4CJSA 1L3VA 4B9TA 4Q0BA 4DU4A 2IS3A 3LP1A 4OJRA 3MECA 5CYQA 4CGHA 1ZBHA 3P5JA 3AO2A 2NUBA 3MEDA 2MJ7A 1N6QA 1TK5A 2G8VA 3HS9A 2KZMA 3HL8A 1PCZA 3TI0A 4KHWA 2XY7A 1NKCA 2B6AA 4NCAA 2B4JA 4CHPA 2KQ2A 4EP5A 5JS1A 4DQPA 4RW7A 3JYTA 3RR8A 3AO4A 1U45A 1VSDA 1DLOA 1C0UA 1JXEA 2Y1IA 1TK0A 4B9UA 2O4GA 3OYGA 4BE2A 3O4NA 1UOCA 4DSEA 4CGFA 4DTPA 5I42A 4NCBA 4CJKA 3OYIA 3ULXA 4B9SA 3PO5A 5DMRA 3KLEA 1TL1A 4ROEB 3I8DA 3MXIA 4KB0A 1ZYQA 3V1OA 4MFBA 5FRNA 2IOCA 3EZ5A 1YT3A 1RDCA 1KTQA 3ZSVA 2HB5A 1QNCA 3VQCA 3HYFA 3C94A 3OSMA 2NOIA 1HNVA 3AVGA 3QO9A 1U48A 3KK2A 4Z4CA 3HM9A 3F9KA 2XHBA 1NKEA 3DRPA 1TKTA 2MZ8A 2OPQA 3CFOA 2HHVA 2VG6A 4LH4A 2XY5A 5KRSA 1IKXA 2Z8UA 1T05A 1C1AA 3RR7A 3LDSA 2X6SA 4L8RB 1IKYA 1WSHA 1XHZA 4KB1A 3AVAA 4RW9A 3E01A 3QINA 3ZT0A 3I0XA 4DTNA 1HQEA 2JOIA 1B9KA 1QTSA 1NJYA 1JKHA 3NGIA 3CQ8A 3PV8A 4DSKA 3LP2A 1HYVA 1LAVA 4ICLA 4LSNA 2RN2A 1VSEA 3SPZA 3AO3A 3VQ8A 3K57A 2Z1GA 1KVCA 3AVMA 3PX0A 4B9MA 4JRQA 1YQKA 1N3CA 2HZSA 1QN8A 1YTFA 2LAEA 1BI4A 4KFBA 3SCXA 1RT7A 1QE1A 1C0TA 4CJVA 2OA8A 4PUOA 5AN4A 1RDAA 1WAFA 4CEBA 4J2AA 1ASVA 4DQIA 3ZSRA 1S1VA 3VQQA 4KKOA 4QAGA 1RILA 1YQLA 3L3UA 1SKWA 2RF2A 3RMDA 2G8KA 1ASWA 1TAUA 3KLGA 1UT7A 2KFNA 3HS8A 1RCHA 2ZE2A 1FKOA 1FN7A 2NOHA 1VTOA 3NGZA 3NGYA 4FJ5A 3ALYA 2KZZA 3AA4A 1D5AA 3V9WA 5HP1A 4W5OA 2HNYA 1HRHA 1D9FA 3OYMA 5KRTA 1S1TA 3KK1A 1HYZA 4KREA 2RPIA 2YNFA 3TABA 4O55A 4DTJA 2ITGA 3VN5A 4FLTA 2FGTA 1TVRA 3T1AA 1O1WA 3VQPA 3L2WA 3RPJA 3L3VA 1CXQA 3DLKA 1YQRA 4IG0A 2WONA 3VQDA 3ZSQA 1KFDA 3WNHA 4CEFA 3OJUA 3RRGA 3KD1E 1VRTA 3I0RA 3VQBA 1LV5A 5KTQA 1J9AA 1EBMA 3SV3A 5EU7A 1QHTA 4CIEA 1FK9A 1JLAA 4CF9A 4YFUA 4DQQA 4Z4EA 1IH7A 2AJQA 1X9SA 4ZTFA 1TGOA 4FK4A 1C6VA 3LWLA 3OSTA 5K14A 4CJLA 3L2QA 3DOKA 3OYLA 3K2PA 3EIKA 3L2UA 4DTSA 4KPYA 4FJNA 2DFFA 3SUQA 4FJ8A 1S6PA 3U3YA 4Y1DA 4CESA 1EX4A 1YQMA 1D8YA 1KVBA 2OPPA 1WLJA 2PY5A 5HLFA 4LSLA 3DMJA 1W0HA 1ZBLA 3HPGA 3ZT3A 4CGDA 4I2QA 1L3SA 4CEDA 1QN4A 1VSIA 4KHNA 4CF1A 4DG1A 1BHLA 3THVA 2VWJA 5IYDP 1T8EA 2F8SA 2QXFA 3O3FA 1JLQA 5J2QA 4CFDA 1RT1A 1VRUA 3OYNA 3S3OA 4CJ3A 2NOZA 4CF2A 3L2RA 1EETA 4AH9A 4B9LA 1IKWA 3ULDA 1SUQA 1Z25A 2XY8A 4DMNA 2IV8A 3ZT2A 4CEOA 3SQ4A 3IAYA 3DRRA 2OZMA 4FYDA 3KLIA 1NK7A 3HK2A 4CIGA 5HRNA 1LWCA 5CY4A 3TAFA 1FKPA 3TAGA 1KFSA 4MQ3A 1KLMA 4CHZA 3SNNA 1NK5A 2IV9A 3IG1A 5C25A 1WNSA 3CM6A 3LP3A 4DSLA 1RT6A 3AVHA 3VQ5A 4ZTJA 2O3OA 4ELUA 1ZBIA 2NOBA 1GOBA 2ZQBA 3HPOA 3NCIA 4J2EA 1TKXA 3SQ0A 5FDLA 2HHSA 4I8OA 1UT4A 1IO2A 3CFRA 4FK2A 4CHNA 4B9VA 4KHYA 4CEEA 2D0AA 4KAZA 1B9FA 1KYFA 3AVJA 4M3XA 4F8RA 2HVHA 3H1ZA 4KTWA 2YKMA 1VSMA 2DFEA 3V1RA 3O3HA 4RW8A 2OYQA 1REVA 4CK2A 4M45A 5FRMA 1J54A 2OPRA 3O4QA 4JS4A 4NCGA 3S3NA 3AA5X 4KHQA 4Z4GA 3DLEA 1RT5A 1RT4A 4CECA 1SV5A 5CZ2A 4OKKA 1QNEA 2YNHA 4CJPA 3LZIA 2P5GA 3IS9A 4M3TA 3B6OA 3C95A 3NF6A 4M3ZA 1ZBFA 1GOCA 1I39A 4PWDA 2GV9A 4JRPA 4DTXA 2HHWA 1AISA 4RW4A 3QLHA 3MXJA 3OY9A 4LY7A 3HSTB 4W5RA 3TAPA 2G8HA 1LWWA 2D5RA 2VG7A 3S3MA 4CEZA 2YNGA 4N47A 4BE0A 1TGHA 2FBVA 3KKRA 4RW6A 5HRSA 1NK8A 2BANA 4FJJA 4Z4FA 2G8FA 1ZBUA 3ASMA 3AVBA 3I0SA 1CZ9A 4FW1A 4JLHA 1WSGA 3ZSWA 4CJUA 2JLEA 2XY6A 1C1BA 4IKFA 3K5OA 2Z1JA 3KTQA 1BIZA 1XI1A 4EZ9A 2QKKA 4FLZA 3V9ZA 2I5JA 2OZSA 4W5NA 4OGCA 4HTUA 1S9EA 2WOMA 1J53A 3OYDA 1BISA 4HUGA 4F3TA 4FLWA 1FXXA 4N5SA 4FJGA 1BCOA 4KHUA 1EP4A 5HRPA 1SL2A 1HQUA 3OCIA 4CJQA 2EX3A 1BIUA 1JXBA 3AO5A 5KI6A 4N76A 1QS4A 4IFVA 1TV6A 1QQCA 2YH5A 3B6PA 3KK3A 1QSSA 1SKRA 5IYCP 4OLBA 5KGWA 1RBSA 3N89A 1HMVA 1MP9A 1BI4B 3KKSA 3S9HA 1JLGA 3OYFA 1JLBA 4EP4A 3I0WA 3SUNA 3LPUA 4E1NA 3NAEA 5T7BA 3NH1A 4BACA 3DLHA 2GUIA 3TAEA 3F10A 4H8KA 1X9MA 4ID5A 3HXMA 3PY8A 2B5JA 1N3AA 4F3OA 4KI6A 1Z26A 2IAJA 2E4LA 4O0JA 1XC9A 2E6LA 1JLFA 2Y1JA 2FBTA 2KW4A 3M8RA 1VSKA 4F4KA 4RG8A 4KTQA 1W80A 4DU3A 1RM1A 1TKZA 1F21A 3M8PA 4FJKA 2ETJA 1U47A 1PZDA 4M3UA 2YKNA 2E6MA 1KYUA 1DTTA 1RBVA 3VQ9A 1WSFA 4B8AB 3OYJA 1RBRA 4E7KA 1X1PA 4E0DA 4FZYA 3UIQA 2BGGA 3T19A 4CFAA 1WAJA 5CZ1A 4DTUA 4WE1A 5J2PA 1TAQA 4DSJA 2Q3SA 4CJTA 4DTOA 4KRFA 3DLRA 4DULA 1R0AA 1U49A 1NK0A 3QIOA 1DTQA 3QIPA 2FBYA 4B08A 5CYMA 3M8SA 4CJEA 3SV4A 2PYJA 4F2SA 1QN6A 4GVMA 4ROCB 3U6FA 4CFBA 1R4XA 2RKIA 3LPTA 4ID1A 4C8NA 1HNIA 3O3GA 3JSMA 3SPYA 1D9DA 4AHSA 1T7PA 4DS4A 4DTMA 3SYZA 3TAQA 4PQUA 1BQMA 4Z0UA 2R7YA 3RMBA 5KGXA 2I5WA 3BGRA 4ELTA 1HYSA 4WZSD 2HNDA 3VQ7A 4CIFA 1KLNA 3NHGA 3C6UA 3KJVA 2YNIA 3PX4A 2PZSA 3NF8A 4CE9A 1QN7A 4HUFA 3AV9A 3WNFA 1SKSA 4M42A 1M3QA 1NJXA 3OVNA 3C6TA 2NOEA 2KTQA 3OC3C 1XWLA 4FM0A 4DLGA 2VJ0A 4TSXA 2LSNA 1RBTA 1LWFA 3KLFA 4AILC 4J2DA 2FC0A 4O0IA 3PX6A 2IGIA 1LW0A 1MU2A 4IFYA 1QN9A 4HHTA 2BDPA 1TBAB 3CFPA 1WN7A 3LAKA 4CHQA 5J2MA 4DFMA 4GMJB 2HZMA 4IDKA 1VSLA 3ITHA 3T3FA 3TANA 1KSPA 2A1SA 1NGMA 1G15A 3QEIA 3DYAA 3PO4A 4N41A 1VSFA 3AVIA 1JFIC 4KV8A 3QEVA 4CCHA 4EZ6A 4K8ZA 2IC3A 4R5PA 1RTJA 3ZSZA 1C1CA 2G30A 3KTUA 1VK0A 4LD0A 3LP0A 1YTBA 3NDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5T A;  3V4I A;  2VG5 A;  4XIU A;  4JS5 A;  3NH0 A;  4I9Q A;  4K8X A;  4G1Q A;  4CF0 A;  2O4I A;  4CER A;  4M3R A;  4I2P A;  4CGJ A;  1NVP A;  3G0Z A;  3L2V A;  1QTM A;  4FJX A;  1JL2 A;  1QN5 A;  3NFA A;  4LH5 A;  4FJ9 A;  1HJR A;  4IG3 A;  3TAM A;  4FVM A;  2A1R A;  3DLG A;  4C8L A;  4CK3 A;  3DM2 A;  4DU1 A;  3LZJ A;  1A5V A;  1NJZ A;  1B9D A;  2PYL A;  4PY5 A;  2X74 A;  5FRO A;  1ITG A;  4AHV A;  4UQG A;  1T03 A;  3SQ2 A;  4H4M A;  4BDP A;  3AA2 A;  1BCM A;  4CJR A;  4FLY A;  2X78 A;  4C8K A;  1CLQ A;  3QEW A;  2F96 A;  4CHO A;  3V9S A;  1S9G A;  3QNN A;  3D45 A;  1RTD A;  3K59 A;  3RMC A;  1NKB A;  3K5M A;  2BE2 A;  4DSF A;  3OS2 A;  4FW2 A;  3ISN C;  4OPJ A;  3HP6 A;  3MAQ A;  1S6Q A;  1KYD A;  3ZT4 A;  3AVN A;  1QNA A;  1ASU A;  3HVT A;  2F8T A;  3EYZ A;  1UA0 A;  2HHQ A;  5J1E A;  3V81 A;  1L3U A;  2DY4 A;  3H08 A;  4CK1 A;  1VSH A;  2G8U A;  1NJW A;  3VQE A;  1RTI A;  2HW3 A;  4GW6 A;  3MEE A;  3NF9 A;  1RDB A;  1LAW A;  3QET A;  3HPH A;  3CYM A;  3U3G A;  4QOZ B;  2G8W A;  4FLU A;  4KO0 A;  4Z4I A;  4OKE A;  1EKE A;  3A2F A;  3OYE A;  1L3T A;  2P1J A;  1TK8 A;  1TBP A;  4B0A A;  1KCF A;  1NOY A;  2HMI A;  1BL3 A;  1RTH A;  3ZSO A;  4IBN A;  4DFK A;  1LWE A;  3V6D A;  1J5O A;  3HT3 A;  1VOK A;  4OGE A;  4FM1 A;  1U4B A;  3RRH A;  3VQA A;  3P83 D;  1Q9Y A;  1JLE A;  3NF7 A;  4CFC A;  1QSY A;  1CZB A;  3SJJ A;  1X9W A;  2HVI A;  4OKJ A;  1KY7 A;  4FZZ A;  4NYN A;  3OYA A;  4B3O A;  2D0C A;  4E7I A;  2YHA A;  2EHG A;  2GBZ A;  4HCB A;  1C0M A;  4HVJ A;  3VA0 A;  4DSI A;  4J2B A;  1XHX A;  4I9L A;  3KD5 E;  4OLA A;  1RT2 A;  4F2R A;  3BDP A;  1JLC A;  3QNO A;  3OJS A;  3ZSY A;  4C8M A;  1RT3 A;  3AVC A;  3ZT1 A;  4DF4 A;  3RMA A;  3OYH A;  3LAM A;  3HVR A;  4FJL A;  4E7L A;  4B9N A;  4BWJ A;  3K5N A;  3TR8 A;  4CJ5 A;  1Q9X A;  2HHT A;  3QEX A;  4DQS A;  4DFJ A;  4CEQ A;  4O4G A;  4CGI A;  1QSL A;  1A5W A;  4M3Y A;  4M41 A;  3OYC A;  2P5O A;  4W5Q A;  3KIO A;  4YNQ A;  2W42 A;  1U04 A;  4FXD A;  5HRR A;  1RNH A;  1Y97 A;  1UAX A;  2OPS A;  1IKV A;  4BWM A;  4DTR A;  3ZCM A;  1SL0 A;  2QK9 A;  4KHS A;  3LWM A;  3OS1 A;  3OS0 A;  4E7H A;  5J2N A;  4E7J A;  3NBP A;  4FZX C;  3G10 A;  3HO1 A;  3L8B A;  1E42 A;  3RTV A;  4FLV A;  2Z1I A;  4AHC A;  4FCY A;  4DFP A;  5JS2 A;  2QKB A;  1VTL E;  3MXM A;  1C9B B;  1KVA A;  3VQ6 A;  1L5U A;  1WSI A;  3WNG A;  1CXU A;  3OYB A;  1GOA A;  3SZ2 A;  5C24 A;  4CJF A;  2X6N A;  3V9X A;  4AHU A;  5SZT A;  2DFH A;  1B92 A;  1YTU A;  4DS5 A;  3MEG A;  1BQN A;  4PA1 A;  1EXQ A;  4Y1C A;  3OYK A;  3VA3 A;  3SUO A;  4O44 A;  4CGG A;  3EY1 A;  3V1Q A;  4OPK A;  4Z4H A;  3DRS A;  5E41 A;  4FK0 A;  1YTA A;  1HPZ A;  3AO1 A;  4N56 A;  3DLB A;  2XRI A;  4H4O A;  4E3S A;  3AVF A;  3LAN A;  3KLH A;  1WSJ A;  1S1X A;  2FBX A;  4BE1 A;  2DTU A;  4O5B A;  1VSJ A;  1BGX T;  4DF8 A;  4E1M A;  3V9U A;  3M8Q A;  5IYB P;  1NK6 A;  4AHR A;  5HRO A;  4HCC A;  3PUF A;  4FJM A;  4CHY A;  3D0P A;  4C8O A;  1YVU A;  1SL1 A;  3DOL A;  2D0B A;  1TKD A;  4KI4 A;  5C42 A;  4CEA A;  1D3U A;  4CJW A;  4DWI A;  1JL1 A;  5SWM A;  3NE6 A;  3TWH A;  1N5Y A;  1KY6 A;  1IG9 A;  3AVK A;  4E89 A;  3QES A;  1NOZ A;  2YHB A;  2VWK A;  3NH2 A;  4BDY A;  3TAR A;  1NH2 A;  1Q8I A;  3AA3 A;  1QTP A;  1S5J A;  4ROD B;  1WSE A;  3LAL A;  1VOL B;  2ZD1 A;  1LW2 A;  1KRP A;  4FJ7 A;  1CDW A;  2JGU A;  3P1G A;  4NYF A;  3SQ1 A;  4FJI A;  2HNZ A;  2IDO A;  3DI6 A;  2YV0 X;  3FFI A;  4AHT A;  1QN3 A;  4ZHR A;  4HUE A;  4QCL A;  1RDD A;  2HHU A;  4CJ4 A;  3QEP A;  4KTZ A;  2KFZ A;  3AVL A;  1UA1 A;  3WNE A;  1RBU A;  4FJH A;  4BDZ A;  5I3U A;  1A5X A;  4B8C A;  2P51 A;  3VQ4 A;  1TL3 A;  2G8I A;  3HJF A;  1W9H A;  3K58 A;  4I7F A;  1I3A A;  3CG7 A;  3K5L A;  3QER A;  4FM2 A;  2ATQ A;  4E19 A;  4Q5V A;  4OVL A;  1UWB A;  4DQR A;  3IRX A;  3HP9 A;  3RWU A;  1NK4 A;  5HBM A;  5D3G A;  2HHX A;  4DLE A;  1QNB A;  1S1U A;  2Z1H A;  2XO7 A;  3SUP A;  1NK9 A;  4ELV A;  3CM5 A;  4M3W A;  3ZSX A;  3F73 A;  4CF8 A;  1S1W A;  1K6Y A;  3SI6 A;  4FLX A;  5DK5 A;  4CJS A;  1L3V A;  4B9T A;  4Q0B A;  4DU4 A;  2IS3 A;  3LP1 A;  4OJR A;  3MEC A;  5CYQ A;  4CGH A;  1ZBH A;  3P5J A;  3AO2 A;  2NUB A;  3MED A;  2MJ7 A;  1N6Q A;  1TK5 A;  2G8V A;  3HS9 A;  2KZM A;  3HL8 A;  1PCZ A;  3TI0 A;  4KHW A;  2XY7 A;  1NKC A;  2B6A A;  4NCA A;  2B4J A;  4CHP A;  2KQ2 A;  4EP5 A;  5JS1 A;  4DQP A;  4RW7 A;  3JYT A;  3RR8 A;  3AO4 A;  1U45 A;  1VSD A;  1DLO A;  1C0U A;  1JXE A;  2Y1I A;  1TK0 A;  4B9U A;  2O4G A;  3OYG A;  4BE2 A;  3O4N A;  1UOC A;  4DSE A;  4CGF A;  4DTP A;  5I42 A;  4NCB A;  4CJK A;  3OYI A;  4B9S A;  3PO5 A;  5DMR A;  3KLE A;  1TL1 A;  4ROE B;  3I8D A;  3MXI A;  4KB0 A;  1ZYQ A;  3V1O A;  4MFB A;  5FRN A;  2IOC A;  3EZ5 A;  1YT3 A;  1RDC A;  1KTQ A;  3ZSV A;  2HB5 A;  1QNC A;  3VQC A;  3HYF A;  3C94 A;  1HNV A;  3AVG A;  3QO9 A;  1U48 A;  3KK2 A;  4Z4C A;  3HM9 A;  3F9K A;  2XHB A;  1NKE A;  3DRP A;  1TKT A;  2OPQ A;  3CFO A;  2HHV A;  2VG6 A;  4LH4 A;  2XY5 A;  5KRS A;  1IKX A;  2Z8U A;  1T05 A;  1C1A A;  3RR7 A;  3LDS A;  2X6S A;  4L8R B;  1IKY A;  1WSH A;  1XHZ A;  4KB1 A;  3AVA A;  4RW9 A;  3E01 A;  3QIN A;  3ZT0 A;  4DTN A;  1HQE A;  1B9K A;  1QTS A;  1NJY A;  1JKH A;  3NGI A;  3CQ8 A;  3PV8 A;  4DSK A;  3LP2 A;  1HYV A;  1LAV A;  4ICL A;  4LSN A;  2RN2 A;  1VSE A;  3SPZ A;  3AO3 A;  3VQ8 A;  3K57 A;  2Z1G A;  1KVC A;  3AVM A;  3PX0 A;  4B9M A;  4JRQ A;  1QN8 A;  1YTF A;  1BI4 A;  4KFB A;  3SCX A;  1RT7 A;  1QE1 A;  1C0T A;  4CJV A;  2OA8 A;  4PUO A;  1RDA A;  4J2A A;  1WAF A;  4CEB A;  1ASV A;  4DQI A;  3ZSR A;  1S1V A;  3VQQ A;  4KKO A;  4QAG A;  1RIL A;  3L3U A;  1SKW A;  2RF2 A;  3RMD A;  2G8K A;  1ASW A;  1TAU A;  3KLG A;  2KFN A;  3HS8 A;  1RCH A;  2ZE2 A;  1FKO A;  3NGZ A;  1VTO A;  3NGY A;  4FJ5 A;  3ALY A;  2KZZ A;  3AA4 A;  1D5A A;  3V9W A;  5HP1 A;  4W5O A;  2HNY A;  1HRH A;  1D9F A;  3OYM A;  5KRT A;  1S1T A;  3KK1 A;  1HYZ A;  4KRE A;  2RPI A;  2YNF A;  3TAB A;  4O55 A;  4DTJ A;  2ITG A;  3VN5 A;  4FLT A;  1TVR A;  3T1A A;  1O1W A;  3VQP A;  3L2W A;  3L3V A;  1XI1 A;  1CXQ A;  3DLK A;  4IG0 A;  4CEF A;  2WON A;  3VQD A;  3ZSQ A;  1KFD A;  3WNH A;  3OJU A;  3RRG A;  3KD1 E;  1VRT A;  3I0R A;  3VQB A;  1LV5 A;  5KTQ A;  1J9A A;  3SV3 A;  5EU7 A;  1QHT A;  4CIE A;  1FK9 A;  1JLA A;  4CF9 A;  4YFU A;  4DQQ A;  4Z4E A;  1IH7 A;  2AJQ A;  1X9S A;  4ZTF A;  1TGO A;  4FK4 A;  1C6V A;  3LWL A;  3L2Q A;  5K14 A;  4CJL A;  3L2U A;  3DOK A;  3OYL A;  3K2P A;  3EIK A;  4DTS A;  4KPY A;  4FJN A;  2DFF A;  3SUQ A;  4FJ8 A;  1S6P A;  3U3Y A;  4Y1D A;  4CES A;  1EX4 A;  1D8Y A;  2PY5 A;  1KVB A;  2OPP A;  1WLJ A;  5HLF A;  4LSL A;  3DMJ A;  1W0H A;  1ZBL A;  3HPG A;  3ZT3 A;  4CGD A;  4I2Q A;  1L3S A;  4CED A;  1QN4 A;  1VSI A;  4KHN A;  4CF1 A;  4DG1 A;  1BHL A;  3THV A;  2VWJ A;  5IYD P;  1T8E A;  2F8S A;  2QXF A;  3O3F A;  1JLQ A;  5J2Q A;  4CFD A;  1RT1 A;  1VRU A;  3OYN A;  3S3O A;  4CJ3 A;  4CF2 A;  3L2R A;  1EET A;  4AH9 A;  4B9L A;  1IKW A;  3ULD A;  1SUQ A;  1Z25 A;  2XY8 A;  4DMN A;  2IV8 A;  3ZT2 A;  4CEO A;  3SQ4 A;  3IAY A;  3DRR A;  2OZM A;  4FYD A;  3KLI A;  1NK7 A;  3HK2 A;  4CIG A;  5HRN A;  1LWC A;  5CY4 A;  3TAF A;  1FKP A;  3TAG A;  1KFS A;  4MQ3 A;  1KLM A;  4CHZ A;  3SNN A;  1NK5 A;  2IV9 A;  3IG1 A;  5C25 A;  1WNS A;  3CM6 A;  3LP3 A;  4DSL A;  1RT6 A;  3AVH A;  3VQ5 A;  4ZTJ A;  4ELU A;  1ZBI A;  1GOB A;  2ZQB A;  3HPO A;  3NCI A;  4J2E A;  1TKX A;  3SQ0 A;  5FDL A;  2HHS A;  1IO2 A;  3CFR A;  4FK2 A;  4CHN A;  4B9V A;  4KHY A;  4CEE A;  2D0A A;  4KAZ A;  1B9F A;  1KYF A;  3AVJ A;  4M3X A;  4F8R A;  2HVH A;  3H1Z A;  4KTW A;  2YKM A;  1VSM A;  2DFE A;  3V1R A;  3O3H A;  4RW8 A;  2OYQ A;  1REV A;  4CK2 A;  4M45 A;  5FRM A;  1J54 A;  2OPR A;  3O4Q A;  4JS4 A;  4NCG A;  3S3N A;  3AA5 X;  4KHQ A;  4Z4G A;  3DLE A;  1RT5 A;  1RT4 A;  4CEC A;  1SV5 A;  5CZ2 A;  4OKK A;  1QNE A;  2YNH A;  4CJP A;  3LZI A;  2P5G A;  3IS9 A;  4M3T A;  3B6O A;  3C95 A;  3NF6 A;  4M3Z A;  1ZBF A;  1GOC A;  1I39 A;  4PWD A;  2GV9 A;  4JRP A;  4DTX A;  2HHW A;  1AIS A;  4RW4 A;  3QLH A;  3MXJ A;  3OY9 A;  4LY7 A;  3HST B;  4W5R A;  3TAP A;  2G8H A;  2D5R A;  2VG7 A;  3S3M A;  4CEZ A;  2YNG A;  4N47 A;  4BE0 A;  1TGH A;  2FBV A;  3KKR A;  4RW6 A;  5HRS A;  1NK8 A;  2BAN A;  4FJJ A;  4Z4F A;  2G8F A;  1ZBU A;  3ASM A;  3AVB A;  3I0S A;  1CZ9 A;  4FW1 A;  4JLH A;  1WSG A;  3ZSW A;  4CJU A;  2JLE A;  2XY6 A;  1C1B A;  4IKF A;  3K5O A;  2Z1J A;  3KTQ A;  1BIZ A;  4EZ9 A;  2QKK A;  4FLZ A;  3V9Z A;  2I5J A;  2OZS A;  4W5N A;  4OGC A;  4HTU A;  1S9E A;  2WOM A;  1J53 A;  3OYD A;  1BIS A;  4HUG A;  4F3T A;  4FLW A;  1FXX A;  4N5S A;  4FJG A;  1BCO A;  4KHU A;  1EP4 A;  5HRP A;  1SL2 A;  1HQU A;  3OCI A;  4CJQ A;  2EX3 A;  1BIU A;  1JXB A;  3AO5 A;  5KI6 A;  4N76 A;  1QS4 A;  4IFV A;  1TV6 A;  1QQC A;  3B6P A;  3KK3 A;  1QSS A;  1SKR A;  5IYC P;  4OLB A;  5KGW A;  1RBS A;  1HMV A;  1MP9 A;  1BI4 B;  3KKS A;  3S9H A;  1JLG A;  3OYF A;  1JLB A;  4EP4 A;  3SUN A;  3LPU A;  4E1N A;  3NAE A;  5T7B A;  3NH1 A;  4BAC A;  3DLH A;  2GUI A;  3TAE A;  4H8K A;  1X9M A;  4ID5 A;  3HXM A;  3PY8 A;  2B5J A;  4F3O A;  4KI6 A;  1Z26 A;  2IAJ A;  2E4L A;  4O0J A;  1XC9 A;  2E6L A;  1JLF A;  2Y1J A;  2FBT A;  2KW4 A;  3M8R A;  1VSK A;  4F4K A;  4RG8 A;  4KTQ A;  1W80 A;  4DU3 A;  1RM1 A;  1TKZ A;  1F21 A;  3M8P A;  4FJK A;  2ETJ A;  1U47 A;  1PZD A;  4M3U A;  2YKN A;  2E6M A;  1KYU A;  1DTT A;  1RBV A;  3VQ9 A;  1WSF A;  4B8A B;  3OYJ A;  1RBR A;  4E7K A;  1X1P A;  4E0D A;  4FZY A;  3UIQ A;  2BGG A;  3T19 A;  4CFA A;  1WAJ A;  5CZ1 A;  4DTU A;  4WE1 A;  5J2P A;  1TAQ A;  4DSJ A;  2Q3S A;  4CJT A;  4DTO A;  4KRF A;  3DLR A;  1R0A A;  1U49 A;  1NK0 A;  3QIO A;  1DTQ A;  3QIP A;  2FBY A;  4B08 A;  5CYM A;  3M8S A;  4CJE A;  3SV4 A;  2PYJ A;  4F2S A;  1QN6 A;  4GVM A;  4ROC B;  3U6F A;  4CFB A;  1R4X A;  2RKI A;  3LPT A;  4ID1 A;  4C8N A;  1HNI A;  3O3G A;  3JSM A;  3SPY A;  1D9D A;  4AHS A;  1T7P A;  4DS4 A;  4DTM A;  3SYZ A;  3TAQ A;  4PQU A;  1BQM A;  4Z0U A;  2R7Y A;  3RMB A;  5KGX A;  3BGR A;  4ELT A;  1HYS A;  4WZS D;  2HND A;  3VQ7 A;  4CIF A;  1KLN A;  3NHG A;  3C6U A;  3KJV A;  2YNI A;  3PX4 A;  2PZS A;  3NF8 A;  4CE9 A;  1QN7 A;  4HUF A;  3AV9 A;  3WNF A;  1SKS A;  4M42 A;  1NJX A;  3OVN A;  3C6T A;  2KTQ A;  3OC3 C;  1XWL A;  4FM0 A;  4DLG A;  2VJ0 A;  4TSX A;  3KLF A;  1RBT A;  1LWF A;  4AIL C;  4J2D A;  2FC0 A;  4O0I A;  3PX6 A;  2IGI A;  1LW0 A;  1MU2 A;  4IFY A;  1QN9 A;  4HHT A;  2BDP A;  1TBA B;  3CFP A;  1WN7 A;  3LAK A;  4CHQ A;  5J2M A;  4DFM A;  4GMJ B;  3TAN A;  4IDK A;  1VSL A;  3ITH A;  3T3F A;  1KSP A;  2A1S A;  1NGM A;  1G15 A;  3QEI A;  3DYA A;  3PO4 A;  4N41 A;  1VSF A;  3AVI A;  1JFI C;  4KV8 A;  3QEV A;  4CCH A;  4EZ6 A;  4K8Z A;  2IC3 A;  4R5P A;  1RTJ A;  3ZSZ A;  1C1C A;  2G30 A;  1VK0 A;  2LSN A;  4LD0 A;  3LP0 A;  1YTB A;  3NDK A; 
#chains in the Genus database with same CATH topology
 3NVK A;  2WTU A;  2VG5 A;  5AQS A;  4DV1 K;  1NJI O;  4K8X A;  2JHJ A;  4JI0 K;  3T7Z A;  1NVP A;  4BC5 A;  1QTM A;  3CCL N;  1QN5 A;  3CHW A;  1T6D A;  5LMN K;  5C2D A;  4WFA L;  4C8L A;  1NJZ A;  4DV6 K;  2PWW A;  1B9D A;  2VWB A;  4AHV A;  1ITG A;  3KWG A;  4H4M A;  3SQ2 A;  1BCM A;  4FWN A;  4FLY A;  3HM8 A;  4DV3 K;  3MN9 A;  1RTD A;  3I56 N;  1NKB A;  4DSF A;  4H5N A;  3PDK A;  3ISN C;  4FW2 A;  3WUH A;  2BUP A;  1S6Q A;  1KYD A;  3GE1 A;  3A5N C;  4EIA A;  3VEO A;  3HVT A;  2F8T A;  3EYZ A;  1UA0 A;  2HHQ A;  1J5E K;  2JHN A;  2G8U A;  1NG9 A;  3EZW A;  4GW6 A;  2YHX A;  4A59 A;  1VQO N;  3QET A;  5M1N A;  1XMQ K;  4Z4I A;  1ZC6 A;  3IH7 A;  2P1J A;  2HMI A;  4JKH A;  4IBN A;  1LWE A;  4FM1 A;  1U4B A;  3P83 D;  1Q9Y A;  2ZM6 K;  1QSY A;  3D2E B;  3SJJ A;  1X9W A;  2QWR A;  2P9I A;  4B3O A;  4HCB A;  3R9P A;  3SAG A;  1ESV A;  3ZX2 A;  4FWO A;  4G9Z A;  2XHI A;  3ZSY A;  1RT3 A;  3LAM A;  4BWJ A;  2PAV A;  1Q9X A;  2Y8Q A;  3QEX A;  3H1Q A;  4DQS A;  4O4G A;  3HBT A;  4FOE A;  4M41 A;  3BZK A;  1Q7Y O;  1WJW A;  3DXK A;  4W5Q A;  5IT9 O;  1RNH A;  3E9L A;  4H5R A;  3MCP A;  1SL0 A;  4KHS A;  3LWM A;  4BR2 A;  4E7H A;  5J2N A;  4E7J A;  3NBP A;  4JK9 A;  4OX9 K;  3FZL A;  3L8B A;  4FLV A;  3LM9 A;  1K8A O;  2QKB A;  1C9B B;  1WSI A;  3WNG A;  4BG8 A;  3OYB A;  5AQV A;  3VGK A;  4CJF A;  2EHB D;  5SZT A;  1B92 A;  4ISF A;  4Y1C A;  3OYK A;  2UU9 K;  3AAR A;  1HKC A;  3N4Q A;  4X64 K;  1S72 N;  2E20 A;  1VQ4 N;  3D7Q A;  1HPZ A;  3AO1 A;  4N56 A;  2CH6 A;  4EHU A;  4JD2 B;  2FBX A;  1LOT B;  4DF8 A;  1BGX T;  4FJM A;  5HRO A;  3T1H K;  4D7R A;  4CHY A;  1NGC A;  1TKD A;  1JL1 A;  5SWM A;  1IBK K;  3TWH A;  3ZEU A;  1N33 K;  1NOZ A;  2VWK A;  1NH2 A;  3AA3 A;  1S5J A;  1WSE A;  4H0P A;  1LW2 A;  4DB3 A;  1CDW A;  2JGU A;  4NYF A;  2Q36 A;  3TSQ A;  2Q0R A;  4HUE A;  4IJN A;  1RDD A;  1V4T A;  5AQW A;  4CJ4 A;  3QEP A;  2KFZ A;  3AVL A;  2E1Z A;  2OTL N;  4FJH A;  1A5X A;  3HJF A;  1TL3 A;  1W9H A;  3K58 A;  2QWP A;  1I3A A;  4I7F A;  4LFC K;  4FM2 A;  4BY9 C;  3UW2 A;  4EAH D;  3RWU A;  2QRC A;  4B3T K;  2HHX A;  3T4N A;  1QNB A;  1S1U A;  4ELV A;  3LL3 A;  2AA4 A;  3L6Q A;  4M3W A;  3ZSX A;  3THW B;  1K6Y A;  2NRX A;  5AQX A;  2RHK A;  3RVC A;  1HPM A;  2GWJ A;  4B9T A;  1KAY A;  2CGK A;  4DU4 A;  2IS3 A;  3LP1 A;  4GKJ K;  4WQ4 C;  4KH5 A;  1N6Q A;  2G8V A;  1HLU A;  1GLJ O;  4NCA A;  1RDU A;  4CHP A;  4HTL A;  3JYT A;  2O8D B;  4A5A A;  1JXE A;  1TUY A;  1MDU B;  3OYG A;  3MN7 A;  1IBL K;  2WUS A;  3FZK A;  4DTP A;  5I42 A;  4JAX A;  4A62 A;  3LM2 A;  4B9S A;  1TL1 A;  1J3M A;  1GLF O;  1ZYQ A;  3D2F B;  2A40 A;  5EY4 A;  3VF2 A;  3O9R A;  1KTQ A;  5AZI A;  3ZSV A;  1M5Q 1;  2HB5 A;  2NOI A;  1HNV A;  4H0O A;  3DRP A;  2HHV A;  4LH4 A;  1NGH A;  1C1A A;  3FZF A;  4L8R B;  4KB1 A;  3AVA A;  4RW9 A;  5JLF A;  1NJY A;  3ULE A;  1JKH A;  4JKA A;  4ICL A;  2YHW A;  3UE5 A;  3KZB A;  1VSE A;  3K57 A;  3H3O B;  2Z1G A;  3PX0 A;  1IJJ A;  1N3C A;  2W40 A;  2HZS A;  5AFU A;  2P9P B;  3H6E A;  4MRQ A;  4PUO A;  4J2A A;  4CEB A;  1WBD A;  1S1V A;  3VQQ A;  4KKO A;  1RIL A;  4B1U B;  3DWL A;  3EEQ A;  3KLG A;  1UT7 A;  1RCH A;  2ZE2 A;  3UKR B;  1FN7 A;  2NOH A;  3NGZ A;  2A5X A;  1VQ7 N;  4WQ5 C;  3CCS N;  5HP1 A;  5F9C A;  3CJ7 A;  3OA9 A;  4H0Y B;  4EAI A;  3TSP A;  3KK1 A;  2RPI A;  1ZBS A;  2FGT A;  3VQP A;  1K73 O;  1JDY A;  3LDP A;  1X3N A;  3KD1 E;  1J9A A;  5EU7 A;  4CIE A;  4CF9 A;  1JLA A;  4R79 A;  4DQQ A;  1IH7 A;  1X9S A;  4ZTF A;  4GNI A;  4AM7 A;  1C6V A;  3LWL A;  4GY2 B;  4CJL A;  1YJW N;  2NWV A;  4FJ8 A;  3U3Y A;  1D8Y A;  1YQM A;  3G4S N;  4JN4 A;  1W0H A;  3HPG A;  2P9N A;  1BHL A;  3THV A;  2QXF A;  2FXU A;  1QQO A;  2YHY A;  3O3F A;  3E1Y A;  3OYN A;  3M3Z A;  4JEP A;  4CF2 A;  3NA5 A;  3CD6 N;  4AH9 A;  4B3S K;  3ULD A;  3OH6 A;  2XY8 A;  3OLP A;  3ZT2 A;  4CEO A;  1Q81 O;  3IAY A;  1BO5 O;  4FYD A;  1NK7 A;  4FWS A;  3TAF A;  2V8Q A;  5C25 A;  2V51 B;  1JJ2 M;  3LP3 A;  1EWQ A;  3O80 A;  4ELU A;  1RT6 A;  3AVH A;  2O3O A;  2ZQB A;  2FLO A;  1UT4 A;  1YJN N;  4CHN A;  4MDB A;  4B9Q A;  4M3X A;  1KYF A;  1Q82 O;  3QBX A;  3H1Z A;  4F8R A;  4KTW A;  2HVH A;  3V1R A;  2DFE A;  3CWA A;  3O3H A;  1HNX K;  4FWR A;  4EHT A;  2KLA A;  3HOT A;  2OPR A;  3S3N A;  2WFB A;  3VF4 A;  2GUP A;  3C95 A;  1XUP O;  1GOC A;  1I39 A;  4JKF A;  2NRR A;  4H0T B;  4JRP A;  1TYQ B;  4DTX A;  3E66 A;  4NLB A;  3EO3 A;  3QLH A;  4DR1 K;  1W97 L;  2W41 A;  3HST B;  3TAP A;  1KXP A;  2VG7 A;  4PKI A;  1K35 A;  3KKR A;  5HRS A;  4FJJ A;  2NNW A;  4EAK A;  4Z4F A;  5LJV A;  3AVB A;  3ZSW A;  4IKF A;  3K5O A;  3VTI A;  2A41 A;  2V7Y A;  4H5T A;  1VQ6 N;  2O8C A;  1NGE A;  2I5J A;  3GL1 A;  3GBT A;  4OGC A;  1S9E A;  2WOM A;  1BWF O;  4N5S A;  2P9S B;  3JXU A;  1HNW K;  1EP4 A;  1SL2 A;  3I55 N;  1GLL O;  3T1Y K;  3M1F A;  1JXB A;  5KI6 A;  3P4I A;  4IFV A;  5CR4 A;  4QS9 A;  3CPW M;  1TV6 A;  3B6P A;  3KK3 A;  2HOE A;  1SKR A;  5IYC P;  5BN8 A;  5KGW A;  1RBS A;  4OLB A;  1HMV A;  2FSN A;  3KKS A;  3S9H A;  4EP4 A;  3ID6 A;  3SUN A;  4E1N A;  2DPN A;  3DLH A;  3TAE A;  5FPD A;  1N3A A;  1Z26 A;  2E4L A;  2E6L A;  3HI0 A;  4UY8 O;  2FBT A;  4DU3 A;  3G71 N;  1YF5 L;  2QEX N;  2WBN A;  2E6M A;  3VQ9 A;  4WYB A;  2D0P A;  4E7K A;  2BGG A;  2UYT A;  4WE1 A;  1TAQ A;  4DTO A;  5M1Q A;  3VES A;  1NK0 A;  1Z6R A;  2HST A;  4EAJ A;  1QN6 A;  4ROC B;  3SPY A;  2RKI A;  4ID1 A;  3TSU A;  1HNI A;  3VEN A;  1XSZ A;  4DTM A;  3SYZ A;  5I9E B;  4PQU A;  1T44 A;  5KGX A;  2I5W A;  4CIF A;  2HND A;  3PX4 A;  3WNF A;  1SKS A;  4M42 A;  1M3Q A;  5BRD A;  3OVN A;  2NOE A;  1SZ2 A;  5AQH A;  4I6M A;  3DXM A;  3U9Z A;  4HHT A;  2BDP A;  1TBA B;  1ATS A;  5AZJ B;  3O9T A;  1GLC G;  3A0I X;  3LAK A;  3TTF A;  4CFF A;  4E1J A;  3WT0 A;  2Z0F A;  3DYA A;  5KQD A;  3PO4 A;  1JFI C;  2ITM A;  2IC3 A;  4GVE A;  3ZSZ A;  2F9T A;  3KTU A;  3LP0 A;  3H45 C;  1YTB A;  4W5T A;  3NDK A;  1XMO K;  1S22 A;  5AR0 A;  3NH0 A;  3H3N O;  4G1Q A;  3CCR N;  4CF0 A;  1U6Z A;  3MCA B;  4CER A;  2H3G X;  3CI5 A;  4IG3 A;  3TAM A;  1MA9 B;  3DLG A;  2NZT A;  1A5V A;  2FSK A;  3QB0 A;  4WFB L;  2X74 A;  4UQG A;  1T03 A;  3CC2 N;  4BDP A;  2X78 A;  3TU5 A;  3F2K A;  2BH1 A;  3ID8 A;  3QNN A;  3V9S A;  2O8B B;  2O8E B;  3D45 A;  3UKU A;  3MAQ A;  3ENH A;  1QNA A;  4A5B A;  1JCG A;  3V81 A;  2DKC A;  1VSH A;  1RTI A;  4JI3 K;  3CJB A;  1NGB A;  3MEE A;  1E4F T;  4CZJ A;  1LAW A;  3HPH A;  4JKE A;  4IEE A;  1QHA A;  4YOU A;  1L3T A;  4B0A A;  1CZA N;  1BL3 A;  3ZSO A;  3HT3 A;  4OGE A;  3VQA A;  3SK3 A;  3N4P A;  3JS6 A;  1OH6 A;  2HVI A;  4OKJ A;  3QFP A;  2D0C A;  2YHA A;  3IKM A;  4J2B A;  2ZJQ L;  2QA4 N;  3KD5 E;  4OLA A;  1RT2 A;  5BN9 A;  3BDP A;  2ZGZ A;  3QNO A;  1P8Z A;  4DF4 A;  3AVC A;  3RMA A;  3HVR A;  4LF7 K;  4QG5 A;  3TR8 A;  2HHT A;  5FLX O;  1DKG D;  4DFJ A;  1OVY A;  4B1V A;  1QSL A;  1A5W A;  4M3Y A;  1HU0 A;  3U9D A;  2HBL A;  2P5O A;  1G99 A;  5AQT A;  5HRR A;  1XQS C;  2A6A A;  1IKV A;  4FPB A;  3G6E N;  5C15 A;  4CW7 B;  5F1X A;  1BOT O;  2FF3 B;  3OS1 A;  3T69 A;  3G10 A;  1E42 A;  4CZL A;  2FF6 A;  3TDH A;  3VQ6 A;  1L5U A;  3OTO K;  4EJZ A;  1GOA A;  4ILG B;  3SZ2 A;  1IV0 A;  2E2Q A;  5C24 A;  4AHU A;  2O8F B;  3WQU A;  3MEG A;  3SUO A;  5AJ3 K;  4CGG A;  3EY1 A;  4GKK K;  4JI6 K;  4OPK A;  3DRS A;  2JPI A;  1TUO A;  2YI1 A;  4CZE A;  2OTJ N;  4E3S A;  4H4O A;  3KLH A;  4BE1 A;  1VSJ A;  2HKP A;  2P9L B;  1NK6 A;  4HCC A;  4BJU A;  2QR1 A;  2D0B A;  4KI4 A;  4CJW A;  2I7N A;  4YOX A;  1KY6 A;  4CBW A;  3LAL A;  4FJ7 A;  1VOL B;  3P1G A;  3FFI A;  5EXW A;  5LY3 A;  3IFR A;  4YDU A;  4KTZ A;  3WNE A;  2W6L A;  5AQO A;  3PSI A;  3VGM A;  4BDZ A;  2P51 A;  5AQZ A;  1KFI A;  4WFN L;  3QER A;  3L0Q A;  4K42 A;  4DHY A;  5HBM A;  5D3G A;  2XO7 A;  2E1Y A;  1LWY A;  1YUW A;  2ZFD B;  4FLX A;  3THY A;  5DK5 A;  1L3V A;  4JHD A;  4OJR A;  2F9W A;  4BR0 A;  3AO2 A;  1TK5 A;  2QRD A;  3HL8 A;  1PCZ A;  3QDK A;  2B4J A;  2KQ2 A;  4EP5 A;  1XNR K;  2A3Z A;  2NRZ A;  3AO4 A;  1VSD A;  1DLO A;  1YJ9 N;  5JVG L;  1TK0 A;  4B9U A;  3I33 A;  3DLL L;  3C7N A;  4CGF A;  3OYI A;  4NB4 A;  4ROE B;  3C6A A;  4O8U A;  3I8D A;  4YOY A;  3V1O A;  1K8K A;  4K41 A;  2Q0U A;  4ISG A;  1YT3 A;  1Q9U A;  5AQP A;  2P9I B;  2QWL A;  4JI4 K;  3VQC A;  1VHX A;  3QO9 A;  1U48 A;  4LFA K;  4BC3 A;  3CFO A;  4MO5 A;  5ELZ A;  2Q2R A;  2Z8U A;  5C10 A;  4DR7 K;  3E01 A;  4BR9 A;  4DTN A;  2JOI A;  4IDH A;  2KKZ A;  1NLV A;  3AO3 A;  4YOT A;  3VQ8 A;  3CCU N;  3OW2 M;  3DXK B;  4FSV A;  3D6R A;  2WC9 A;  2LAE A;  1BI4 A;  4KFB A;  3SCX A;  1RT7 A;  1QE1 A;  2YA3 A;  1C0T A;  1HR0 K;  1GLB G;  4DQI A;  4QAG A;  5IWA K;  1YQL A;  3RMD A;  1TAU A;  2Y8L A;  3HS8 A;  1VTO A;  3AA4 A;  5JVH L;  3ZLJ A;  1KD1 O;  2HNY A;  1HRH A;  1KC8 O;  5KRT A;  5LL6 Z;  1S1T A;  1HYZ A;  4DV5 K;  2H5A X;  4KRE A;  4BC2 A;  2HBK A;  3VN5 A;  3CJ1 A;  3CC7 N;  3FLC O;  1O1W A;  1XI1 A;  4H03 B;  3CCV N;  3DLK A;  3ZSQ A;  3OJU A;  3WNH A;  3ENO A;  3HZ6 A;  5BRF A;  1VRT A;  2NRT A;  2CH5 A;  3WEE A;  1LV5 A;  5KTQ A;  1EBM A;  4IWV A;  3SV3 A;  2OCE A;  5BPM A;  1TGO A;  2UUB K;  1ATN A;  3ATV A;  1C47 A;  3OST A;  5E84 A;  3L2U A;  4DTS A;  1GLD G;  3EIK A;  3K2P A;  3L4Q A;  2DFF A;  1S6P A;  1WLJ A;  3ZEU B;  4WX8 A;  1QVF M;  4BRF A;  1N36 K;  5EPC A;  1IG8 A;  5AQN A;  3ZT3 A;  5ADX A;  1ZBL A;  1BDG A;  1QN4 A;  1VSI A;  4CF1 A;  4MLE A;  2F8S A;  5IYD P;  2NLV A;  4CFD A;  1RT1 A;  3S3O A;  4NO7 A;  4CJ3 A;  2NOZ A;  2QWQ A;  3AGR A;  4DR4 K;  2ZWH A;  4B9L A;  4BRM A;  1IKW A;  4DMN A;  3SQ4 A;  4IOC L;  1ZXO A;  3EN9 A;  3HOS A;  1LWC A;  5CY4 A;  4DSL A;  3QML A;  3VQ5 A;  1GOB A;  4D7Q A;  3HPO A;  3SQ0 A;  1NNE A;  5FDL A;  4I8O A;  4FK2 A;  3CFR A;  4CEE A;  5KPZ A;  4KAZ A;  3AVJ A;  3L4I A;  3CMA N;  2YKM A;  2EWS A;  1VSM A;  5FRM A;  1REV A;  4CK2 A;  3SAH A;  4NCG A;  4Z4G A;  4CEC A;  1RT4 A;  5CZ2 A;  4BC4 A;  4M3T A;  3IS9 A;  3B6O A;  5GAE P;  3MN6 A;  4JI5 K;  1AIS A;  3CWS A;  2NRV A;  3OY9 A;  2G8H A;  2HHH K;  3OH9 A;  4AM6 A;  3CCE N;  3VEW A;  3S3M A;  3BKQ X;  2FBV A;  5AZI B;  3P31 A;  2QI2 A;  2G8F A;  4BRL A;  1CZ9 A;  4JLH A;  1WSG A;  2JLE A;  1C1B A;  3KTQ A;  1BIZ A;  1NMN A;  1R59 O;  1W2B M;  3LDQ A;  4W5N A;  4HTU A;  4DR5 K;  1BIS A;  4CBX A;  3ULE B;  5M1O A;  4FWQ A;  3OCI A;  3A5M C;  4XH1 A;  4LC9 B;  4CZH A;  4N76 A;  3QFU A;  2YH5 A;  3EE8 A;  3K0S A;  3AAP A;  2H4L X;  1Y64 A;  3MN5 A;  5T7B A;  3NH1 A;  3OBW A;  4BAC A;  1X9M A;  3F10 A;  3HXM A;  1Q18 A;  4F3O A;  1VSK A;  4JKG A;  1RM1 A;  1RFQ A;  1TKZ A;  3CC4 N;  2RE2 A;  1T3V A;  3D4V A;  1DTT A;  5KQ8 A;  4B8A B;  4CZF A;  3OYJ A;  3PLA A;  1X1P A;  3T19 A;  4CFA A;  5CZ1 A;  4OPA A;  1TUU A;  2Q3S A;  4CJT A;  4BRN A;  1VQM N;  1U49 A;  3QIO A;  1DTQ A;  4EFH A;  1DT9 A;  4B08 A;  3M8S A;  4CJE A;  3SV4 A;  1P5D X;  2ZJR L;  4GVM A;  2QK9 A;  3LPT A;  1HKB A;  3JSM A;  1VAZ A;  2UXD K;  3ZX3 A;  1T7P A;  4DS4 A;  4B1W B;  2QWM A;  3RMB A;  5C0Y A;  4WF9 L;  4WZS D;  3VQ7 A;  4BRH A;  1KLN A;  1J6Z A;  3O6W A;  3AV9 A;  2HL8 A;  3NVM A;  3KVG A;  3P38 A;  3C6T A;  2KTQ A;  2V9J A;  1XWL A;  4TSX A;  1LWF A;  4J2D A;  3PX6 A;  2IGI A;  3VF6 A;  3O8M A;  2P9N B;  1QN9 A;  3R6M A;  4JKB A;  4BRG A;  1WN7 A;  4GMJ B;  4PL7 A;  4IDK A;  3ITH A;  4BRK A;  3CQX A;  2VQF K;  1JCF A;  3E9O A;  1NGM A;  3QEI A;  4N41 A;  3AVI A;  3KHY A;  3QEV A;  4CCH A;  4K8Z A;  4ISE A;  4R5P A;  3O9U A;  3CME N;  1C1C A;  1VK0 A;  1RGI A;  3V4I A;  3DAW A;  3O9Q A;  4Z94 A;  3KRM A;  4GV3 A;  4XIU A;  3CET A;  2O4I A;  1OVQ A;  4HWI A;  4I2P A;  3LDN A;  3L2V A;  1JL2 A;  5LMU K;  1D4X A;  1HJR A;  4FVM A;  4OPH A;  1BA0 A;  4CK3 A;  4RWT A;  5CHI A;  3WXM B;  3LZJ A;  5LJW A;  2PYL A;  5FRO A;  2W6K A;  1OKJ A;  1CLQ A;  4C8K A;  3BEX A;  4JK8 A;  3K59 A;  3RMC A;  2BE2 A;  4OPJ A;  2V52 B;  2FKM X;  3AVN A;  1ASU A;  5EVZ A;  1N39 A;  2DY4 A;  4CK1 A;  3J7Y P;  1NJW A;  3DPT A;  3NF9 A;  5AQJ A;  3CJA A;  3U3G A;  4FLU A;  2NRW A;  3OYE A;  1NOY A;  2NOL A;  1TK8 A;  4M63 C;  1TBP A;  3V6D A;  1J5O A;  1VOK A;  2E5L K;  3RRH A;  2O8C B;  1SS6 A;  1W7A A;  1YIJ N;  2F7L A;  1JLE A;  4CFC A;  1CZB A;  4IO8 A;  1HKG A;  4IOA L;  1KY7 A;  1NGG A;  4FOI A;  3OYA A;  4FZZ A;  4E7I A;  1FJG K;  2F7T A;  2GBZ A;  4HVJ A;  3O1B A;  4DSI A;  4I9L A;  2P9U A;  1JLC A;  2GWK A;  1HJO A;  3ZT1 A;  4C8M A;  4DUZ K;  3SJH A;  3OYH A;  4GV6 A;  4E7L A;  1NGF A;  4CJ5 A;  3H1V X;  4CEQ A;  1FW6 A;  4CGI A;  3K9J A;  2NOF A;  1YAG A;  3KIO A;  4YNQ A;  2W42 A;  4FXD A;  1UAX A;  3C04 A;  3ZCM A;  4JI2 K;  1NWK A;  5KPT A;  1WQA A;  3ZET A;  4O5F A;  3SAF A;  3HO1 A;  2IVN A;  3RSE A;  4DFP A;  3I8B A;  3ENB A;  5JS2 A;  3PIP L;  3J8A A;  5BR8 K;  2Q31 A;  2X6N A;  3D7E O;  1DEJ A;  4DS5 A;  4PA1 A;  3WXK A;  1EXQ A;  3PIO L;  5B8H A;  3VA3 A;  3OBY A;  1HUX A;  4Q11 A;  4BRQ A;  1C0F A;  2IIR A;  3MX5 A;  3AVF A;  3VOV A;  2J4R A;  1S1X A;  3DXM B;  4I6M B;  4O5B A;  4BG9 A;  4YOR A;  5JIC A;  3C6H A;  4E1M A;  4LF4 K;  3M8Q A;  2UXB K;  5IYB P;  3THX A;  5AQF A;  3D0P A;  4C8O A;  1YVU A;  1SL1 A;  3DOL A;  3IMX A;  4DR3 K;  5C42 A;  4CEA A;  1D3U A;  3HSC A;  1N5Y A;  3P39 A;  3NE6 A;  4CZG A;  4CZK A;  1IG9 A;  3AVK A;  3F0Z A;  3NH2 A;  2VGN A;  1QTP A;  3G25 A;  3SNS A;  4XH5 A;  2ZD1 A;  3SQ1 A;  4FJI A;  4KBO A;  2HNZ A;  2IDO A;  3DI6 A;  2YV0 X;  4AHT A;  1LCU A;  4ILJ A;  1VQP N;  1V4S A;  4QCL A;  2HHU A;  3ENC A;  4PKH A;  1UA1 A;  5I3U A;  3VQ4 A;  2G8I A;  5BR9 A;  3CVS A;  3K5L A;  3CG7 A;  2ATQ A;  4DQR A;  4OVL A;  3IRX A;  4DLE A;  1M90 O;  3SUP A;  3F73 A;  3DJC A;  4CF8 A;  3SI6 A;  4F9O A;  5ADX H;  2GX9 A;  5CYQ A;  3UKU B;  3MEC A;  4CGH A;  3LDL A;  4H5W A;  3MED A;  2MJ7 A;  2KZM A;  2OOY A;  3HS9 A;  4KH4 A;  1WBB A;  3TI0 A;  4BRE A;  1NKC A;  2B6A A;  4WCE L;  4DQP A;  1U45 A;  5AQU A;  2Y1I A;  1C0U A;  2O4G A;  4BE2 A;  3O4N A;  3GDQ A;  4X65 K;  1UOC A;  4M7Y A;  5AQY A;  4DSE A;  4CJK A;  5GAH P;  3ULX A;  1GLA G;  3KLE A;  3MXI A;  4KB0 A;  1EWR A;  5FRN A;  2IOC A;  1N8R O;  2VCP A;  1RDC A;  1QNC A;  2GEL A;  4CBU A;  1M1K O;  2ASO A;  4Z4C A;  2XHB A;  1ATR A;  2MZ8 A;  2OPQ A;  5C2F A;  2XY5 A;  1SQK A;  1IKX A;  3A8Y A;  3RR7 A;  3LDS A;  2X6S A;  1IKY A;  1XHZ A;  1X3M A;  3Q7B A;  3O5B A;  1HQE A;  4K25 A;  5F2R A;  1QTS A;  1DIZ A;  3CQ8 A;  4DSK A;  2NLX A;  4YDU C;  4LSN A;  3SPZ A;  2DKD A;  3JAM O;  3AVM A;  1KVC A;  4K0K K;  4B9M A;  4JRQ A;  3MX2 A;  1NGD A;  1QN8 A;  2PFU A;  4FVU A;  3EKU A;  1C4G A;  4CJV A;  3F9M A;  2OA8 A;  5AN4 A;  1RDA A;  1ASV A;  3ZSR A;  3MK6 A;  1RDW X;  2QRE A;  3L3U A;  2G8K A;  2RF2 A;  4DCH A;  2KFN A;  1FKO A;  2IVO A;  3ALY A;  4LF8 K;  2KZZ A;  1D5A A;  4W5O A;  4DUY K;  1D9F A;  1GLE G;  3OYM A;  3CER A;  3TAB A;  4DTJ A;  4YHH K;  3SMS A;  3L2W A;  1O13 A;  3CWT A;  4IG0 A;  4CEF A;  2YJE A;  1XNQ K;  1QHT A;  1NM1 A;  4YFU A;  4Z4E A;  5BMN A;  2AJQ A;  3EL2 A;  2P9K A;  4FK4 A;  2ASM A;  3L2Q A;  3WQT A;  3OYL A;  5AQQ A;  5TKW A;  3SUQ A;  4Y1D A;  4CES A;  2PY5 A;  2KHO A;  1KVB A;  2OPP A;  2V7Z A;  5HLF A;  1U2V A;  4LSL A;  3J7A P;  3O08 A;  4CED A;  4CZI A;  4J8F A;  4KHN A;  4DG1 A;  4A61 A;  2VWJ A;  3UB5 A;  1T8E A;  4C1N K;  4BGA A;  1VRU A;  4DV0 K;  5E26 A;  3L2R A;  3RSM A;  3FZM A;  1VQL N;  5CE3 A;  2ASP A;  2PBD A;  1Z25 A;  4CZM A;  4KH6 A;  5HRN A;  1KFS A;  1FKP A;  4MQ3 A;  1NK5 A;  2IV9 A;  3IG1 A;  1N32 K;  1WNS A;  1ZBI A;  3W0L A;  3TTD A;  3THY B;  1TKX A;  5HOO A;  4JHD B;  2FUV A;  4B9V A;  4KHY A;  1IBM K;  5M1F A;  4FO0 A;  4DV7 K;  2QXL A;  2QTD A;  2ZF5 O;  4RW8 A;  4BRD A;  4M45 A;  4MLH A;  4JS4 A;  3O4Q A;  3M5R A;  3AA5 X;  3DLE A;  2HF4 A;  2GEM A;  1SV5 A;  2VQE K;  3NF6 A;  4M3Z A;  3C7N B;  3ENO C;  2Q97 A;  3O1W A;  1Z05 A;  4PWD A;  3CIP A;  4RW4 A;  3MXJ A;  1SAZ A;  4LY7 A;  4W5R A;  1PCM X;  1LWW A;  1K8K B;  1P5G X;  5MLC Q;  1KAX A;  4BR7 A;  4CEZ A;  1T6A A;  1QQM A;  1TGH A;  4PL8 A;  4H0X B;  1NK8 A;  3ASM A;  3I0S A;  4FW1 A;  4CJU A;  3VPZ A;  4H5V A;  2Z1J A;  2V92 A;  2QKK A;  3ZYY X;  5GIO A;  1P90 A;  5TKY A;  3V9Z A;  4F3T A;  3D2E A;  3SLC A;  4YY3 K;  3OYD A;  1FXX A;  3AAQ A;  4FJG A;  5EX5 A;  1BCO A;  4KHU A;  1V5S A;  3QBW A;  2EX3 A;  3VMF B;  1BIU A;  3LDO A;  1QQC A;  3J7Z O;  3N89 A;  1BI4 B;  1JLG A;  1JLB A;  4Y0W A;  1DGK N;  3I0W A;  4K43 A;  3LPU A;  3NAE A;  2GUI A;  4H8K A;  4NXN K;  4ILH A;  4KI6 A;  1Q86 O;  1VKL A;  2IAJ A;  5JMV D;  1JLF A;  1OH5 A;  2Y1J A;  5AQM A;  2KW4 A;  4RG8 A;  4DR6 K;  1W80 A;  3VEZ A;  4FJK A;  3MMV A;  1U47 A;  4LF5 K;  1HX1 A;  2YKN A;  1KYU A;  4FZY A;  4E0D A;  3UIQ A;  3CPE A;  2GTD A;  3R8E A;  4DSJ A;  5J2P A;  1QZ5 A;  3C65 A;  4KRF A;  1PVS A;  2PYJ A;  4FWK A;  4F2S A;  1PCJ X;  4MDA A;  4CFB A;  1R4X A;  4C8N A;  3WEE B;  3CCJ N;  1D9D A;  3CCQ N;  4YOW A;  4IXC A;  4AHS A;  4XH4 A;  3NMU A;  5AQG A;  1BQM A;  2R7Y A;  4CD1 A;  4CVN E;  3OGD A;  3H46 O;  1KFQ A;  2AP1 A;  3J81 O;  2NVM A;  2A42 A;  3C6U A;  3KJV A;  3NF8 A;  4CE9 A;  4HUF A;  4CJ7 A;  1C0G A;  3A5L C;  2DKA A;  2D0O A;  4JD2 A;  4FM0 A;  4AIL C;  4DLG A;  2VJ0 A;  3KLF A;  3VEV A;  2FC0 A;  4O0I A;  5JN5 A;  4LF6 K;  4IFY A;  2ZJP L;  1VQK N;  4CHQ A;  4JNE A;  4DFM A;  2QWO A;  2QWN A;  1G15 A;  3FFK B;  4JI1 K;  1NGA A;  1VSF A;  4KV8 A;  4GV9 A;  1OH7 A;  3VER A;  2G30 A;  2LSN A;  4LD0 A;  4JS5 A;  4I9Q A;  2YJF A;  3AGK A;  4M3R A;  4CGJ A;  3R3L A;  3G0Z A;  4FJX A;  3NFA A;  1NU0 A;  3SBT A;  4LH5 A;  4FJ9 A;  3K9K A;  4EJY A;  1WUA A;  1E3M A;  2A1R A;  2YCH A;  3DM2 A;  4DU1 A;  3SBG A;  1YI2 N;  2JWK A;  4L3Q A;  4PY5 A;  5AQL A;  5KPR A;  3AA2 A;  4CJR A;  3THW A;  3VGL A;  3QEW A;  2F96 A;  1T6C A;  4CHO A;  1HNZ K;  1S9G A;  3F5T A;  3K5M A;  3OS2 A;  3HP6 A;  2VGM A;  3ZT4 A;  4JI7 K;  1WB9 A;  4C23 A;  1VQN N;  5J1E A;  1L3U A;  3H08 A;  3VQE A;  1KO9 A;  2HW3 A;  2O8D A;  1RDB A;  3CYM A;  4QOZ B;  2G8W A;  5BRH A;  4KO0 A;  3VEY A;  4OKE A;  1EKE A;  3A2F A;  1K9M O;  2E88 A;  1KCF A;  5FPN A;  3ATU A;  1RTH A;  4DFK A;  3EE9 A;  5DM7 L;  5GAG P;  4FWM A;  3NF7 A;  3U4L A;  3D2F A;  1VQ9 N;  4JI8 K;  4NYN A;  5JLH A;  2EHG A;  1C0M A;  3VA0 A;  4IZ9 A;  1M3H A;  1XHX A;  3MWT A;  1EUV A;  5EOY A;  4F2R A;  4TPS A;  4B3R K;  3PMG A;  2ZGY A;  3OJS A;  2E8A A;  1UL7 A;  4FJL A;  4B9N A;  3K5N A;  2IVP A;  5AQI A;  3R1X A;  1NBW A;  4LF9 K;  4C1N I;  3OYC A;  1KAZ A;  4X66 K;  4JKG B;  1U04 A;  2UUA K;  3ZX0 A;  1Y97 A;  2OPS A;  5AQK A;  2P9P A;  4BWM A;  4DTR A;  3E9P A;  5GAD P;  3CW7 A;  2CGL A;  3OS0 A;  4FZX C;  5GIP A;  3RTV A;  2Z1I A;  4AHC A;  4FCY A;  4U7B A;  1VTL E;  5GIN A;  3MXM A;  1KVA A;  1CXU A;  3UKR A;  4WQ4 A;  4BVO A;  3I3W A;  3V9X A;  2DFH A;  1BQN A;  4O44 A;  3V1Q A;  3CJ9 A;  4Z4H A;  5E41 A;  4FK0 A;  1YTA A;  3DLB A;  2XRI A;  3MWP A;  4IEI A;  3LAN A;  2JWL A;  1WSJ A;  2DTU A;  3V9U A;  4AHR A;  5HSH A;  3C0B A;  3PUF A;  2VYP A;  4JKD A;  3MDQ A;  1BUP A;  4DWI A;  4BRA A;  1LXT A;  3CCM N;  4E89 A;  3QES A;  2YHB A;  4BDY A;  3TAR A;  1Q8I A;  5KL0 A;  4ROD B;  1KRP A;  4XEI A;  5HL7 L;  4BVP A;  1LWV A;  4ZHR A;  3OHR A;  4A2B A;  1QN3 A;  5BPN A;  1BA1 A;  1RBU A;  4B3M K;  4RTF D;  4B8C A;  1MWM A;  4IOX A;  4X62 K;  4FL9 A;  3DPU A;  2BTF A;  4E19 A;  4Q5V A;  1UWB A;  3HP9 A;  3WXJ A;  4B1Y B;  1NK4 A;  4EAL A;  2Z1H A;  1NK9 A;  3KK7 A;  3CM5 A;  4DV4 K;  4FWP A;  4IJA A;  1S1W A;  4CJS A;  3TE5 A;  3CF5 L;  4Q0B A;  3U8X A;  2D1K A;  1ZBH A;  3CJC A;  3P5J A;  2NUB A;  4WQ5 A;  4M7X A;  3CQY A;  4KHW A;  2XY7 A;  3CVT A;  5JS1 A;  4RW7 A;  3RR8 A;  4BGB A;  3BY5 A;  4NCB A;  1TYQ A;  2HL9 A;  3PO5 A;  5DMR A;  3GOI A;  4MO4 A;  5A2Q O;  4MFB A;  4QS8 A;  3EZ5 A;  3HYF A;  3C94 A;  4DV2 K;  3OSM A;  3AVG A;  3KK2 A;  3HM9 A;  3F9K A;  1NKE A;  2P9U B;  1TKT A;  5AQR A;  2VG6 A;  5KRS A;  1T05 A;  1WSH A;  3W3D A;  4YOV A;  3QIN A;  3FE1 A;  3ZT0 A;  3I0X A;  2E2O A;  2P9S A;  4AQY K;  1B9K A;  3NGI A;  3GG4 A;  3PV8 A;  1EQY A;  3LP2 A;  1HYV A;  1LAV A;  4CD3 A;  2RN2 A;  4BQZ A;  4BRO A;  4RCH A;  5BRE A;  3BF1 A;  3BF3 A;  1VQ8 N;  2OOX A;  1YQK A;  5JMV A;  3FZH A;  1YTF A;  4LFB K;  4V19 S;  1H1V A;  3ZET B;  1WAF A;  1S3X A;  3BP8 A;  3WXI A;  1OH8 A;  3RSE B;  1JCE A;  1SKW A;  1ASW A;  3BZC A;  3IDH A;  1NGJ A;  3AY9 A;  3OSE A;  3NGY A;  4FJ5 A;  4JK7 A;  1BU6 O;  2HMP A;  3V9W A;  4A57 A;  3TPQ A;  2QW9 A;  2QM1 A;  4AF1 A;  1YHQ N;  2YNF A;  4O55 A;  2ITG A;  4FLT A;  1VQ5 N;  1TVR A;  3T1A A;  3RPJ A;  3L3V A;  1CXQ A;  1YTU A;  1YQR A;  2E2P A;  2WON A;  3VQD A;  2UUC K;  1KFD A;  3RRG A;  3I0R A;  4NLC A;  4H0V B;  4PKG A;  3VQB A;  1NGI A;  1FK9 A;  3IUC A;  3HRG A;  2QLV A;  3THX B;  5K14 A;  4KPY A;  4FJN A;  3DOK A;  5M1P A;  3CWU A;  3VEX A;  2F4V K;  1EX4 A;  3DMJ A;  4CGD A;  1KQS M;  4I2Q A;  1L3S A;  3EAY A;  2Q1N A;  5AZJ A;  1JLQ A;  5J2Q A;  2R5X A;  3Q7C A;  1EET A;  4WXA A;  1YVN A;  3PSF A;  1SUQ A;  2IV8 A;  3QIC A;  3DRR A;  5F0X A;  2OZM A;  1EO1 A;  1E4G T;  3KLI A;  3HK2 A;  4CIG A;  3TAG A;  4BQL A;  1KLM A;  4CHZ A;  3SNN A;  3CXC M;  3CM6 A;  2FSJ A;  4ZTJ A;  2NOB A;  3NCI A;  4J2E A;  2HHS A;  1IO2 A;  4NXM K;  2FKF A;  3WXL A;  2D0A A;  1B9F A;  3A5O C;  4CI6 A;  2OYQ A;  1J54 A;  4KHQ A;  1RT5 A;  3LZI A;  4OKK A;  1QNE A;  2YNH A;  4CJP A;  2P5G A;  2O8E A;  2O8B A;  5BPL A;  1ZBF A;  2GV9 A;  2HHW A;  2NRH A;  3BUZ B;  4QS7 A;  2D5R A;  4C7P A;  4DR2 K;  2YNG A;  3FGU A;  4N47 A;  4DKW A;  4RW6 A;  4BE0 A;  2BAN A;  4EAG A;  1ZBU A;  3KWI A;  2D4W A;  3J80 O;  2XY6 A;  1YXQ A;  5M1K A;  1K2Y X;  2CGJ A;  5H1S Q;  3SMP A;  4EZ9 A;  1QZ6 A;  4O8K A;  4FLZ A;  1XC3 A;  1N34 K;  2I7P A;  2OZS A;  1J53 A;  4HUG A;  3EKS A;  4FLW A;  2HBM A;  4DQ8 A;  1MWK A;  5HRP A;  1X9J A;  1HQU A;  4CJQ A;  4B1X B;  3TTC A;  4JKC A;  3AO5 A;  1QS4 A;  4IO9 L;  4BRP A;  1QSS A;  4BR4 A;  1MP9 A;  5BMP A;  3OYF A;  1MPG A;  4BR5 A;  4ID5 A;  2OAN A;  5FPE A;  2B5J A;  3PY8 A;  4JV5 K;  4JYA K;  1XC9 A;  4O0J A;  3M8R A;  1ILY A;  4F4K A;  4KTQ A;  5FPM A;  3O9S A;  1F21 A;  3HTV A;  3M8P A;  2ETJ A;  4M3U A;  1PZD A;  3S41 A;  1QVG M;  1RBV A;  1WSF A;  1RBR A;  4HJH A;  2HF3 A;  4BRC A;  1WAJ A;  1NMD A;  4DTU A;  1BG3 A;  3DLR A;  4DUL A;  3VET A;  1R0A A;  3QIP A;  2YX6 A;  2FBY A;  5CYM A;  2UXC K;  3VTH A;  3U6F A;  1WOQ A;  3O3G A;  3O4W A;  4BRI A;  2O8F A;  3TAQ A;  1HYS A;  3B8A X;  4Z0U A;  4U67 L;  4ELT A;  3BGR A;  2P9K B;  2HBJ A;  3NHG A;  2YNI A;  2PZS A;  2E2N A;  1QN7 A;  3FR0 A;  4PHT X;  4IL8 A;  3M6G A;  1NJX A;  1QQN A;  5AFU H;  1U2V B;  3OC3 C;  1RBT A;  1LW0 A;  1MU2 A;  2P9L A;  4FPA A;  3CFP A;  5C12 A;  5J2M A;  2HZM A;  3TAN A;  1VSL A;  4IFE A;  3T3F A;  1KSP A;  5DM6 L;  2A1S A;  4FWL A;  4OO1 J;  4KHP K;  4EZ6 A;  1I94 K;  1RTJ A;  1YIT N;  4B1Z A;  4A2A A; 
#chains in the Genus database with same CATH homology
 4W5T A;  3V4I A;  2VG5 A;  3KRM A;  4XIU A;  4JS5 A;  3NH0 A;  4I9Q A;  4K8X A;  4G1Q A;  4CF0 A;  2O4I A;  4CER A;  4M3R A;  4I2P A;  4CGJ A;  1NVP A;  3G0Z A;  3L2V A;  1QTM A;  4FJX A;  1JL2 A;  1QN5 A;  3NFA A;  4LH5 A;  4FJ9 A;  1HJR A;  4IG3 A;  4EJY A;  4FVM A;  3TAM A;  2A1R A;  3DLG A;  4C8L A;  4CK3 A;  3DM2 A;  4DU1 A;  3LZJ A;  1A5V A;  1NJZ A;  1B9D A;  2PYL A;  4PY5 A;  2X74 A;  5FRO A;  1ITG A;  4AHV A;  4UQG A;  1T03 A;  3SQ2 A;  4H4M A;  4BDP A;  3AA2 A;  1BCM A;  4CJR A;  4FLY A;  2X78 A;  4C8K A;  1CLQ A;  3QEW A;  2F96 A;  4CHO A;  3V9S A;  1S9G A;  3QNN A;  3D45 A;  1RTD A;  3K59 A;  3RMC A;  1NKB A;  3K5M A;  2BE2 A;  4DSF A;  3OS2 A;  4FW2 A;  3ISN C;  4OPJ A;  3HP6 A;  3MAQ A;  1S6Q A;  1KYD A;  3ZT4 A;  3AVN A;  1QNA A;  1ASU A;  3HVT A;  2F8T A;  3EYZ A;  1UA0 A;  2HHQ A;  5J1E A;  1N39 A;  3V81 A;  1L3U A;  3H08 A;  4CK1 A;  2DY4 A;  1VSH A;  2G8U A;  1NJW A;  3VQE A;  1RTI A;  1KO9 A;  2HW3 A;  4GW6 A;  3DPT A;  3MEE A;  3NF9 A;  1RDB A;  1LAW A;  3QET A;  3HPH A;  3CYM A;  3U3G A;  4QOZ B;  2G8W A;  4FLU A;  4KO0 A;  4Z4I A;  3IH7 A;  4OKE A;  1EKE A;  3A2F A;  3OYE A;  2NOL A;  2P1J A;  1TK8 A;  1TBP A;  4B0A A;  1KCF A;  1L3T A;  1NOY A;  2HMI A;  1BL3 A;  1RTH A;  3ZSO A;  4IBN A;  4DFK A;  1LWE A;  3V6D A;  1J5O A;  3HT3 A;  1VOK A;  4OGE A;  4FM1 A;  1U4B A;  3RRH A;  3VQA A;  3P83 D;  1Q9Y A;  1JLE A;  3NF7 A;  4CFC A;  1QSY A;  1CZB A;  3SJJ A;  1X9W A;  2HVI A;  4OKJ A;  1KY7 A;  4FZZ A;  4NYN A;  3OYA A;  4B3O A;  2D0C A;  4E7I A;  2YHA A;  2EHG A;  2GBZ A;  4HCB A;  1C0M A;  4HVJ A;  3VA0 A;  4DSI A;  4J2B A;  1M3H A;  1XHX A;  4I9L A;  3KD5 E;  4OLA A;  1RT2 A;  4F2R A;  4TPS A;  3BDP A;  1JLC A;  3QNO A;  3OJS A;  2XHI A;  3ZSY A;  4C8M A;  1RT3 A;  3AVC A;  3ZT1 A;  4DF4 A;  3RMA A;  3OYH A;  3LAM A;  3HVR A;  4FJL A;  4E7L A;  4B9N A;  4BWJ A;  3K5N A;  3TR8 A;  4CJ5 A;  1Q9X A;  2HHT A;  3QEX A;  4DQS A;  4DFJ A;  4CEQ A;  4O4G A;  4CGI A;  1QSL A;  1A5W A;  4M3Y A;  1HU0 A;  4M41 A;  2NOF A;  3OYC A;  2P5O A;  4W5Q A;  3KIO A;  4YNQ A;  2W42 A;  1U04 A;  4FXD A;  5HRR A;  1RNH A;  1Y97 A;  1UAX A;  2OPS A;  1IKV A;  4BWM A;  4DTR A;  3ZCM A;  1SL0 A;  2QK9 A;  4KHS A;  3LWM A;  3OS1 A;  3OS0 A;  4E7H A;  5J2N A;  4E7J A;  3NBP A;  4FZX C;  3G10 A;  3HO1 A;  3L8B A;  1E42 A;  3RTV A;  4FLV A;  2Z1I A;  4AHC A;  4FCY A;  4DFP A;  5JS2 A;  2QKB A;  1VTL E;  3MXM A;  1C9B B;  1KVA A;  3VQ6 A;  1L5U A;  1WSI A;  3WNG A;  1CXU A;  4EJZ A;  1GOA A;  3OYB A;  3SZ2 A;  5C24 A;  4CJF A;  2X6N A;  3V9X A;  4AHU A;  5SZT A;  2DFH A;  1B92 A;  1YTU A;  4DS5 A;  3MEG A;  1BQN A;  4PA1 A;  1EXQ A;  4Y1C A;  3OYK A;  3VA3 A;  3SUO A;  4O44 A;  4CGG A;  3EY1 A;  3V1Q A;  4OPK A;  4Z4H A;  3DRS A;  4Q11 A;  5E41 A;  4FK0 A;  1YTA A;  1HPZ A;  3AO1 A;  4N56 A;  3DLB A;  2XRI A;  4H4O A;  4E3S A;  3AVF A;  3LAN A;  3KLH A;  1WSJ A;  1S1X A;  2FBX A;  4BE1 A;  2DTU A;  4O5B A;  1VSJ A;  1BGX T;  4DF8 A;  4E1M A;  3V9U A;  3M8Q A;  5IYB P;  1NK6 A;  4AHR A;  5HRO A;  4HCC A;  3PUF A;  4FJM A;  4CHY A;  3D0P A;  4C8O A;  1YVU A;  1SL1 A;  3DOL A;  2D0B A;  1TKD A;  4KI4 A;  5C42 A;  4CEA A;  1D3U A;  4CJW A;  4DWI A;  1JL1 A;  5SWM A;  3NE6 A;  3TWH A;  1N5Y A;  1KY6 A;  1IG9 A;  3AVK A;  4E89 A;  3F0Z A;  1NOZ A;  2YHB A;  2VWK A;  3NH2 A;  4BDY A;  3QES A;  3TAR A;  1NH2 A;  1Q8I A;  3AA3 A;  1QTP A;  1S5J A;  4ROD B;  3SNS A;  1WSE A;  1VOL B;  2ZD1 A;  1LW2 A;  3LAL A;  1KRP A;  1CDW A;  2JGU A;  3P1G A;  4NYF A;  3SQ1 A;  4FJI A;  1LWV A;  2HNZ A;  2IDO A;  3DI6 A;  2YV0 X;  3FFI A;  4AHT A;  1QN3 A;  4ZHR A;  4HUE A;  4QCL A;  1RDD A;  2HHU A;  4CJ4 A;  3QEP A;  4KTZ A;  2KFZ A;  3AVL A;  1UA1 A;  3WNE A;  1RBU A;  4FJH A;  4BDZ A;  5I3U A;  1A5X A;  4B8C A;  2P51 A;  3VQ4 A;  1TL3 A;  4FJ7 A;  2G8I A;  1W9H A;  3HJF A;  3K58 A;  4I7F A;  1I3A A;  3CG7 A;  3K5L A;  3QER A;  3DPU A;  4FM2 A;  2ATQ A;  4E19 A;  4Q5V A;  4OVL A;  1UWB A;  4DQR A;  3IRX A;  3HP9 A;  3RWU A;  1NK4 A;  5HBM A;  5D3G A;  2HHX A;  4DLE A;  1QNB A;  1S1U A;  2Z1H A;  2XO7 A;  3SUP A;  1NK9 A;  4ELV A;  3CM5 A;  4M3W A;  3ZSX A;  3F73 A;  1LWY A;  4CF8 A;  1S1W A;  1K6Y A;  3SI6 A;  4FLX A;  5DK5 A;  4CJS A;  1L3V A;  4B9T A;  4Q0B A;  4DU4 A;  2IS3 A;  3LP1 A;  4OJR A;  3MEC A;  5CYQ A;  4CGH A;  1ZBH A;  3P5J A;  3AO2 A;  2NUB A;  3MED A;  2MJ7 A;  1N6Q A;  1TK5 A;  2G8V A;  3HS9 A;  2KZM A;  3HL8 A;  1PCZ A;  3TI0 A;  4KHW A;  2XY7 A;  1NKC A;  2B6A A;  4NCA A;  2B4J A;  4CHP A;  2KQ2 A;  4EP5 A;  5JS1 A;  4DQP A;  4RW7 A;  3JYT A;  3RR8 A;  3AO4 A;  1U45 A;  1VSD A;  1DLO A;  1C0U A;  1JXE A;  2Y1I A;  1TK0 A;  4B9U A;  2O4G A;  3OYG A;  4BE2 A;  3O4N A;  1UOC A;  4DSE A;  4CGF A;  4DTP A;  5I42 A;  4NCB A;  4CJK A;  3OYI A;  3ULX A;  4B9S A;  3PO5 A;  5DMR A;  3KLE A;  1TL1 A;  4ROE B;  3I8D A;  3MXI A;  4KB0 A;  1ZYQ A;  3V1O A;  4MFB A;  5FRN A;  2IOC A;  3EZ5 A;  1YT3 A;  1RDC A;  1KTQ A;  3ZSV A;  2HB5 A;  1QNC A;  3VQC A;  3HYF A;  3C94 A;  3OSM A;  2NOI A;  1HNV A;  3AVG A;  3QO9 A;  1U48 A;  3KK2 A;  4Z4C A;  3HM9 A;  3F9K A;  2XHB A;  1NKE A;  3DRP A;  1TKT A;  2MZ8 A;  2OPQ A;  3CFO A;  2HHV A;  2VG6 A;  4LH4 A;  2XY5 A;  5KRS A;  1IKX A;  2Z8U A;  1T05 A;  1C1A A;  3RR7 A;  3LDS A;  2X6S A;  4L8R B;  1IKY A;  1WSH A;  1XHZ A;  4KB1 A;  3AVA A;  4RW9 A;  3E01 A;  3QIN A;  3ZT0 A;  3I0X A;  4DTN A;  1HQE A;  2JOI A;  1B9K A;  1QTS A;  1NJY A;  1JKH A;  3NGI A;  3CQ8 A;  3PV8 A;  4DSK A;  3LP2 A;  1HYV A;  1LAV A;  4ICL A;  4LSN A;  2RN2 A;  1VSE A;  3SPZ A;  3AO3 A;  3VQ8 A;  3K57 A;  2Z1G A;  1KVC A;  3AVM A;  3PX0 A;  4B9M A;  4JRQ A;  1YQK A;  1N3C A;  2HZS A;  1QN8 A;  1YTF A;  2LAE A;  1BI4 A;  4KFB A;  3SCX A;  1RT7 A;  1QE1 A;  1C0T A;  4CJV A;  2OA8 A;  4PUO A;  5AN4 A;  1RDA A;  1WAF A;  4CEB A;  4J2A A;  1ASV A;  4DQI A;  3ZSR A;  1S1V A;  3VQQ A;  4KKO A;  4QAG A;  1RIL A;  1YQL A;  3L3U A;  1SKW A;  2RF2 A;  3RMD A;  2G8K A;  1ASW A;  1TAU A;  3KLG A;  1UT7 A;  2KFN A;  3HS8 A;  1RCH A;  2ZE2 A;  1FKO A;  1FN7 A;  2NOH A;  1VTO A;  3NGZ A;  3NGY A;  4FJ5 A;  3ALY A;  2KZZ A;  3AA4 A;  1D5A A;  3V9W A;  5HP1 A;  4W5O A;  2HNY A;  1HRH A;  1D9F A;  3OYM A;  5KRT A;  1S1T A;  3KK1 A;  1HYZ A;  4KRE A;  2RPI A;  2YNF A;  3TAB A;  4O55 A;  4DTJ A;  2ITG A;  3VN5 A;  4FLT A;  2FGT A;  1TVR A;  3T1A A;  1O1W A;  3VQP A;  3L2W A;  3RPJ A;  3L3V A;  1CXQ A;  3DLK A;  1YQR A;  4IG0 A;  2WON A;  3VQD A;  3ZSQ A;  1KFD A;  3WNH A;  4CEF A;  3OJU A;  3RRG A;  3KD1 E;  1VRT A;  3I0R A;  3VQB A;  1LV5 A;  5KTQ A;  1J9A A;  1EBM A;  3SV3 A;  5EU7 A;  1QHT A;  4CIE A;  1FK9 A;  1JLA A;  4CF9 A;  4YFU A;  4DQQ A;  4Z4E A;  1IH7 A;  2AJQ A;  1X9S A;  4ZTF A;  1TGO A;  4FK4 A;  1C6V A;  3LWL A;  3OST A;  5K14 A;  4CJL A;  3L2Q A;  3DOK A;  3OYL A;  3K2P A;  3EIK A;  3L2U A;  4DTS A;  4KPY A;  4FJN A;  2DFF A;  3SUQ A;  4FJ8 A;  1S6P A;  3U3Y A;  4Y1D A;  4CES A;  1EX4 A;  1YQM A;  1D8Y A;  1KVB A;  2OPP A;  1WLJ A;  2PY5 A;  5HLF A;  4LSL A;  3DMJ A;  1W0H A;  1ZBL A;  3HPG A;  3ZT3 A;  4CGD A;  4I2Q A;  1L3S A;  4CED A;  1QN4 A;  1VSI A;  4KHN A;  4CF1 A;  4DG1 A;  1BHL A;  3THV A;  2VWJ A;  5IYD P;  1T8E A;  2F8S A;  2QXF A;  3O3F A;  1JLQ A;  5J2Q A;  4CFD A;  1RT1 A;  1VRU A;  3OYN A;  3S3O A;  4CJ3 A;  2NOZ A;  4CF2 A;  3L2R A;  1EET A;  4AH9 A;  4B9L A;  1IKW A;  3ULD A;  1SUQ A;  1Z25 A;  2XY8 A;  4DMN A;  2IV8 A;  3ZT2 A;  4CEO A;  3SQ4 A;  3IAY A;  3DRR A;  2OZM A;  4FYD A;  3KLI A;  1NK7 A;  3HK2 A;  4CIG A;  5HRN A;  1LWC A;  5CY4 A;  3TAF A;  1FKP A;  3TAG A;  1KFS A;  4MQ3 A;  1KLM A;  4CHZ A;  3SNN A;  1NK5 A;  2IV9 A;  3IG1 A;  5C25 A;  1WNS A;  3CM6 A;  3LP3 A;  4DSL A;  1RT6 A;  3AVH A;  3VQ5 A;  4ZTJ A;  2O3O A;  4ELU A;  1ZBI A;  2NOB A;  1GOB A;  2ZQB A;  3HPO A;  3NCI A;  4J2E A;  1TKX A;  3SQ0 A;  5FDL A;  2HHS A;  4I8O A;  1UT4 A;  1IO2 A;  3CFR A;  4FK2 A;  4CHN A;  4B9V A;  4KHY A;  4CEE A;  2D0A A;  4KAZ A;  1B9F A;  1KYF A;  3AVJ A;  4M3X A;  4F8R A;  2HVH A;  3H1Z A;  4KTW A;  2YKM A;  1VSM A;  2DFE A;  3V1R A;  3O3H A;  4RW8 A;  2OYQ A;  1REV A;  4CK2 A;  4M45 A;  5FRM A;  1J54 A;  2OPR A;  3O4Q A;  4JS4 A;  4NCG A;  3S3N A;  3AA5 X;  4KHQ A;  4Z4G A;  3DLE A;  1RT5 A;  1RT4 A;  4CEC A;  1SV5 A;  5CZ2 A;  4OKK A;  1QNE A;  2YNH A;  4CJP A;  3LZI A;  2P5G A;  3IS9 A;  4M3T A;  3B6O A;  3C95 A;  3NF6 A;  4M3Z A;  1ZBF A;  1GOC A;  1I39 A;  4PWD A;  2GV9 A;  4JRP A;  4DTX A;  2HHW A;  1AIS A;  4RW4 A;  3QLH A;  3MXJ A;  3OY9 A;  4LY7 A;  3HST B;  4W5R A;  3TAP A;  2G8H A;  1LWW A;  2D5R A;  2VG7 A;  3S3M A;  4CEZ A;  2YNG A;  4N47 A;  4BE0 A;  1TGH A;  2FBV A;  3KKR A;  4RW6 A;  5HRS A;  1NK8 A;  2BAN A;  4FJJ A;  4Z4F A;  2G8F A;  1ZBU A;  3ASM A;  3AVB A;  3I0S A;  1CZ9 A;  4FW1 A;  4JLH A;  1WSG A;  3ZSW A;  4CJU A;  2JLE A;  2XY6 A;  1C1B A;  4IKF A;  3K5O A;  2Z1J A;  3KTQ A;  1BIZ A;  1XI1 A;  4EZ9 A;  2QKK A;  4FLZ A;  3V9Z A;  2I5J A;  2OZS A;  4W5N A;  4OGC A;  4HTU A;  1S9E A;  2WOM A;  1J53 A;  3OYD A;  1BIS A;  4HUG A;  4F3T A;  4FLW A;  1FXX A;  4N5S A;  4FJG A;  1BCO A;  4KHU A;  1EP4 A;  5HRP A;  1SL2 A;  1HQU A;  3OCI A;  4CJQ A;  2EX3 A;  1BIU A;  1JXB A;  3AO5 A;  5KI6 A;  4N76 A;  1QS4 A;  4IFV A;  1TV6 A;  1QQC A;  2YH5 A;  3B6P A;  3KK3 A;  1QSS A;  1SKR A;  5IYC P;  4OLB A;  5KGW A;  1RBS A;  3N89 A;  1HMV A;  1MP9 A;  1BI4 B;  3KKS A;  3S9H A;  1JLG A;  3OYF A;  1JLB A;  4EP4 A;  3I0W A;  3SUN A;  3LPU A;  4E1N A;  3NAE A;  5T7B A;  3NH1 A;  4BAC A;  3DLH A;  2GUI A;  3TAE A;  3F10 A;  4H8K A;  1X9M A;  4ID5 A;  3HXM A;  3PY8 A;  2B5J A;  1N3A A;  4F3O A;  4KI6 A;  1Z26 A;  2IAJ A;  2E4L A;  4O0J A;  1XC9 A;  2E6L A;  1JLF A;  2Y1J A;  2FBT A;  2KW4 A;  3M8R A;  1VSK A;  4F4K A;  4RG8 A;  4KTQ A;  1W80 A;  4DU3 A;  1RM1 A;  1TKZ A;  1F21 A;  3M8P A;  4FJK A;  2ETJ A;  1U47 A;  1PZD A;  4M3U A;  2YKN A;  2E6M A;  1KYU A;  1DTT A;  1RBV A;  3VQ9 A;  1WSF A;  4B8A B;  3OYJ A;  1RBR A;  4E7K A;  1X1P A;  4E0D A;  4FZY A;  3UIQ A;  2BGG A;  3T19 A;  4CFA A;  1WAJ A;  5CZ1 A;  4DTU A;  4WE1 A;  5J2P A;  1TAQ A;  4DSJ A;  2Q3S A;  4CJT A;  4DTO A;  4KRF A;  3DLR A;  4DUL A;  1R0A A;  1U49 A;  1NK0 A;  3QIO A;  1DTQ A;  3QIP A;  2FBY A;  4B08 A;  5CYM A;  3M8S A;  4CJE A;  3SV4 A;  2PYJ A;  4F2S A;  1QN6 A;  4GVM A;  4ROC B;  3U6F A;  4CFB A;  1R4X A;  2RKI A;  3LPT A;  4ID1 A;  4C8N A;  1HNI A;  3O3G A;  3JSM A;  3SPY A;  1D9D A;  4AHS A;  1T7P A;  4DS4 A;  4DTM A;  3SYZ A;  3TAQ A;  4PQU A;  1BQM A;  4Z0U A;  2R7Y A;  3RMB A;  5KGX A;  2I5W A;  3BGR A;  4ELT A;  1HYS A;  4WZS D;  2HND A;  3VQ7 A;  4CIF A;  1KLN A;  3NHG A;  3C6U A;  3KJV A;  2YNI A;  3PX4 A;  2PZS A;  3NF8 A;  4CE9 A;  1QN7 A;  4HUF A;  3AV9 A;  3WNF A;  1SKS A;  4M42 A;  1M3Q A;  1NJX A;  3OVN A;  3C6T A;  2NOE A;  2KTQ A;  3OC3 C;  1XWL A;  4FM0 A;  4DLG A;  2VJ0 A;  4TSX A;  2LSN A;  1RBT A;  1LWF A;  3KLF A;  4AIL C;  4J2D A;  2FC0 A;  4O0I A;  3PX6 A;  2IGI A;  1LW0 A;  1MU2 A;  4IFY A;  1QN9 A;  4HHT A;  2BDP A;  1TBA B;  3CFP A;  1WN7 A;  3LAK A;  4CHQ A;  5J2M A;  4DFM A;  4GMJ B;  2HZM A;  4IDK A;  1VSL A;  3ITH A;  3T3F A;  3TAN A;  1KSP A;  2A1S A;  1NGM A;  1G15 A;  3QEI A;  3DYA A;  3PO4 A;  4N41 A;  1VSF A;  3AVI A;  1JFI C;  4KV8 A;  3QEV A;  4CCH A;  4EZ6 A;  4K8Z A;  2IC3 A;  4R5P A;  1RTJ A;  3ZSZ A;  1C1C A;  2G30 A;  3KTU A;  1VK0 A;  4LD0 A;  3LP0 A;  1YTB A;  3NDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...