4PY5A

Thermovibrio ammonificans rnase h3 in complex with 19-mer rna/dna
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
267
Chain Sequence
b'SMKLSSSEKEKLLKKLKALGAKEEKPPEHAQYRLRLNDAILTVYKSGSVVYGGKGREKLKELVAETVLSDTELPRIGCNEAGKGEFVGPLVVACIVADEKCLKRLIELGVKDSKKLSNEKVEELASEITETCHGKVKLLIPEKYNRAYSKFKNINRLLEAVYREIVSDLCEKFSPKVVVVDKFSNRAEEVLKDVVKGARLEVRPKAEDDLAVAAASIVAKAVRLKTMKELEKRFKVKLPEGNTGLAELLKKTPKELHEKLFKLHFSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Crystal structure of RNase H3-substrate complex reveals parallel evolution of RNA/DNA hybrid recognition.
pubmed doi rcsb
source organism Thermovibrio ammonificans
molecule tags Hydrolase/dna/rna
total genus 93
structure length 267
sequence length 267
ec nomenclature ec 3.1.26.-:
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4py5A01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4py5A02
2IV9A 4DQQA 3EY1A 3TAPA 2X6NA 3B6OA 4UQGA 4OGEA 1QNEA 1TKXA 3HL8A 3HP6A 3AVGA 2HHQA 1HMVA 2YKMA 4ELUA 1RBVA 1RBTA 2XY7A 2WOMA 1UOCA 3BGRA 3OYNA 1JFIC 4KTZA 2G8HA 4CCHA 4C8OA 4L8RB 3BDPA 4CF8A 3DLRA 3SUQA 1A5WA 3L2WA 1RT2A 1KYDA 4RW6A 1ZBIA 1D5AA 1LWEA 3LDSA 3SUNA 3RMAA 1RT1A 4RODB 1A5XA 1TGHA 1KVBA 4KHNA 1U49A 4CJEA 4B9LA 4ELTA 4KHQA 1C6VA 3ISNC 3ZT1A 4B08A 3V9ZA 2IAJA 1QSSA 1VTOA 2YNFA 3ITHA 3K57A 1U45A 4FJ8A 4AHSA 5IYBP 4J2EA 4IFYA 1B9FA 3AO5A 1PCZA 1W9HA 3K5OA 4GW6A 4E19A 3WNGA 1RTIA 1VRUA 3TAGA 4NCAA 1VSEA 2A1RA 3AO4A 1EETA 4C8MA 4CK2A 1QSYA 2VJ0A 2DTUA 1WSEA 3L2QA 2OZSA 3LP1A 3S3MA 2HVIA 3NFAA 3TAMA 3IS9A 1GOBA 2DFFA 3OYCA 1NJYA 3L2RA 3KKSA 4DSJA 4FK2A 3AVFA 3CM6A 4BE1A 1KRPA 4DFJA 2XY6A 4G1QA 4E7KA 4O0JA 1QN5A 1UAXA 3O4NA 4KHUA 3OYHA 1VSFA 4DS4A 1KVCA 4KV8A 3OJUA 1WSIA 4DG1A 4ID1A 3DLGA 4AILC 1QN8A 3V1QA 1NKBA 4CERA 4OLAA 1L3TA 1LAVA 3LPTA 1XHXA 4DTJA 4F4KA 1R0AA 3HXMA 1K6YA 4EP4A 4DSFA 4CEEA 4CK3A 3VA0A 2Y1JA 4QCLA 2B5JA 4CF0A 3DLBA 4FM2A 4O55A 4CESA 3SQ2A 1DLOA 4JRQA 3DM2A 5J2NA 1UA1A 1X9MA 3RR8A 1LWFA 1ZYQA 4H4MA 1C1AA 3VQ4A 3KK3A 2D0CA 2JLEA 4WE1A 3SPYA 2DFHA 1C1BA 5D3GA 3M8SA 3NGZA 4FLUA 1QN7A 3VQPA 1HQEA 4HTUA 1VSKA 3VQ9A 1S1XA 4BDZA 1TK5A 3HS8A 1RILA 1RT4A 1WSFA 5HBMA 4M45A 3DOLA 1HRHA 3QO9A 2RN2A 3OYEA 4E0DA 4FJLA 3VQ6A 4I9QA 4F3TA 4ZTJA 1T8EA 4CGHA 3AVMA 1D9FA 3OC3C 1LAWA 4BWMA 2G8VA 3KD1E 2FC0A 4CGJA 4LY7A 3CFRA 2QKBA 5CYQA 2B4JA 3QIOA 4KI6A 4FJIA 3V9UA 1SKSA 4DTOA 4ID5A 1MU2A 1S1TA 1NVPA 1C1CA 4O5BA 3B6PA 4CFCA 1B9DA 3KLIA 4RW9A 1JLCA 2I5JA 4N56A 3G10A 4DMNA 3OS1A 3IG1A 2KZMA 1RTDA 1IKXA 4CFBA 2Z1IA 3IAYA 1BHLA 2JGUA 1IKVA 2IC3A 3TI0A 1C0TA 3AO2A 3CG7A 3MEEA 4H8KA 3QNOA 1O1WA 4DFPA 4IKFA 3P5JA 3MXIA 4Z4GA 3VQBA 4CJUA 3RRHA 4M41A 3V4IA 2KQ2A 1XC9A 1NKEA 2Z1JA 4ZHRA 3S3NA 1BISA 1JLEA 4E1MA 1YT3A 3DI6A 3U3YA 1Z25A 1NJZA 1SL2A 3ZSYA 5HRPA 1F21A 5KGXA 1TGOA 4W5OA 1QS4A 3CFPA 2HNYA 5HROA 3THVA 2G8FA 1ZBFA 3AVBA 4DTPA 4DQIA 1IKWA 4M3XA 5FROA 4Z4EA 2O4GA 3CYMA 2YNGA 3ZSQA 4J2DA 3MEGA 4BWJA 1SV5A 3HS9A 4KFBA 2A1SA 3VQ8A 4QAGA 4FLWA 1VSDA 2RKIA 1YTBA 5EU7A 1TL3A 5KGWA 1VSMA 4CJQA 3KLGA 2X74A 1QSLA 2HW3A 3ZT4A 5FDLA 3HK2A 1WLJA 4HHTA 3SCXA 3AVLA 5C24A 5HRRA 4CJKA 3NGIA 1J53A 2HHVA 3LAKA 3SQ4A 4NCBA 3E01A 3F9KA 1VOLB 1FKOA 3NF7A 3CFOA 3VQEA 1HYVA 1TL1A 3HO1A 1N5YA 2VWKA 4OGCA 1BGXT 4E1NA 4Y1DA 3K58A 3CQ8A 3SYZA 3L8BA 4E89A 4KRFA 1TVRA 3OYAA 3M8RA 4ZTFA 4I2QA 2F96A 1TBPA 3EIKA 1WNSA 3AVNA 4GVMA 3MAQA 3SUOA 4RG8A 3VQDA 1XHZA 2KFZA 1KVAA 3ZSVA 4CJPA 2NUBA 3HT3A 3SI6A 1JLQA 4LSNA 1NH2A 3NAEA 2YNHA 1RNHA 4DQRA 3DMJA 3G0ZA 1Q8IA 1RDBA 3TWHA 4E3SA 3RMCA 5K14A 1W0HA 4CHNA 3NHGA 1KY7A 1RDDA 3D45A 4IFVA 4CEQA 2OPPA 3SZ2A 2B6AA 3QLHA 4IBNA 5CY4A 1VTLE 2LSNA 4YFUA 4K8XA 4FLTA 2GV9A 3O3HA 1N6QA 1T03A 3WNHA 4EZ6A 3ZSZA 1D8YA 1KSPA 4BE0A 4DLGA 4DU4A 2AJQA 1QQCA 1B92A 2YV0X 4B9UA 3LALA 3DLKA 3DLHA 4DWIA 4N47A 4B9VA 3SQ0A 4N5SA 4O4GA 1WN7A 2FBYA 4AHRA 2DFEA 2XO7A 2XY8A 4FJ7A 4MQ3A 3L3UA 1CLQA 1WAFA 2MJ7A 1JLFA 5JS2A 4KPYA 4JLHA 1SKWA 4CGDA 2P5GA 3V1RA 4M3ZA 3SUPA 1QN6A 5J2PA 4DSIA 4EP5A 3C6UA 5FRNA 4J2AA 4M3YA 4E7LA 1HJRA 4F2SA 4KHWA 4CGIA 4KO0A 4FM0A 1NK4A 3AVJA 3ZSWA 4CJSA 1EXQA 4TSXA 1WSHA 3PO4A 2OPSA 3EZ5A 1CXQA 1VSIA 3ASMA 1WSJA 4F3OA 4W5QA 3MECA 3NGYA 1FKPA 4YNQA 4DF8A 1G15A 4F2RA 1VRTA 3P83D 4IDKA 3TANA 4PUOA 4Q0BA 2DY4A 5HLFA 1T7PA 2PY5A 4CEAA 3DRRA 2KZZA 3O4QA 1RBRA 1TK0A 2G8UA 1HYSA 2KFNA 3HPGA 4KB0A 4MFBA 2IGIA 2KTQA 4DFMA 3LZIA 4FLZA 4FVMA 1JKHA 4I7FA 2E6MA 3V9SA 2VG7A 2HMIA 4OVLA 4CK1A 2FBTA 3WNEA 4PY5A 1S1WA 3V9WA 3V81A 3KD5E 2KW4A 3O3GA 4DTNA 3AO3A 4FW2A 3SPZA 4RW7A 1FXXA 4CGGA 1ASWA 2VG5A 4ROEB 4CJ5A 3HPHA 4B8AB 5C42A 4WZSD 3F73A 3PX0A 3HJFA 1I3AA 1KYFA 4B9MA 4B9TA 3VN5A 4DU1A 2F8SA 1Z26A 4M3TA 1XI1A 3MEDA 3RMBA 3SNNA 1S6PA 3K5NA 1JLBA 4E7JA 4DU3A 1KY6A 3TABA 3C95A 4CFAA 4BE2A 4Z4CA 4FJXA 3DYAA 1RTJA 3T3FA 4BDPA 3OYDA 4FLYA 2D5RA 4CIEA 3HM9A 4DSLA 2HB5A 2GUIA 4AH9A 1REVA 2X6SA 4FJMA 5HP1A 1TKZA 3DRSA 3ZCMA 4AHTA 4GMJB 2G8WA 1ITGA 3QEIA 4EZ9A 3V6DA 4FJGA 3ZT3A 1L5UA 3AVHA 4HUFA 1YTUA 2ATQA 4CJFA 1NK8A 1GOAA 4CEFA 2HHWA 3I8DA 4CEBA 4C8KA 4J2BA 4CEZA 1C9BB 4CHPA 4CF2A 3PX4A 2YKNA 3NH2A 1TAUA 1JLAA 3T19A 4JS5A 3AA2A 3SQ1A 3AVIA 5KI6A 1HPZA 1ZBUA 2OZMA 4LSLA 3NF6A 1RBSA 2E4LA 4B3OA 4FZYA 1S9GA 4HUGA 1J5OA 4KHYA 1W80A 1E42A 4FJKA 1BIUA 3H08A 4OKEA 3K59A 2Y1IA 3LP0A 3SV3A 1DTQA 4FJ5A 4FJ9A 1JL1A 5IYDP 1TKTA 4ICLA 3KLFA 3RMDA 1NK6A 3UIQA 3LZJA 1CZBA 1YTAA 3H1ZA 5KRTA 3NH0A 1PZDA 4AHCA 5E41A 3JSMA 4ROCB 2FBXA 1JL2A 1IO2A 1VSHA 3WNFA 1C0UA 1T05A 4FYDA 3DRPA 4O44A 4FCYA 3KTQA 2ZQBA 3O3FA 1J9AA 1GOCA 5KTQA 2HHSA 4M3UA 2OA8A 3V1OA 2Z1HA 2RF2A 2IV8A 3NF9A 1IH7A 3NBPA 3K5LA 3AVCA 2QXFA 3I0SA 1C0MA 1RCHA 2ZD1A 4NCGA 4KREA 2OYQA 5C25A 1S1UA 3PO5A 1ZBLA 1BI4A 1QNAA 3T1AA 3PUFA 4B0AA 4AHVA 1ASVA 4Q5VA 1NOYA 3C94A 2BGGA 4OKKA 4CIGA 3K5MA 3IRXA 1MP9A 4KKOA 2HHTA 4OJRA 1Y97A 3AA5X 3QINA 1L3UA 3AA4A 3HSTB 4R5PA 4C8LA 1CXUA 3OYMA 4M3WA 3QERA 3RR7A 4DTXA 5HRNA 1LW2A 1RM1A 1KFDA 3VQ7A 1YTFA 4CE9A 2W42A 4OLBA 2IOCA 3OYJA 3TARA 1L3SA 3SV4A 2ITGA 5KRSA 4XIUA 1RT7A 5T7BA 3LP2A 1JLGA 1BI4B 1Q9YA 4B9NA 2G30A 3S3OA 3AV9A 4CJVA 2XHBA 3KLHA 4N76A 2P51A 4CJ4A 4CEOA 1NJXA 3OS2A 1NK7A 4M3RA 3OYGA 5DMRA 1ZBHA 3AVAA 2O4IA 4FM1A 3QESA 3QEWA 3D0PA 5SWMA 3L2UA 1U04A 3AA3A 3CM5A 3LWLA 1S1VA 3M8QA 4FW1A 1KTQA 4FK0A 1QNCA 4DS5A 2D0AA 3OYLA 1S6QA 3NF8A 3NDKA 4Z4HA 1BCMA 4DLEA 1SL1A 3KK1A 1L3VA 1HNVA 4KTQA 3KK2A 4M42A 5CYMA 1KYUA 1QTPA 4I2PA 4CHOA 4FLVA 5J2QA 3TR8A 3LAMA 3P1GA 4DTSA 3QNNA 1BL3A 4Z4FA 2Z1GA 4N41A 1NOZA 1LW0A 4DTRA 4CHYA 1HNIA 3QEXA 3OJSA 2D0BA 4BDYA 4DF4A 4DSEA 4KB1A 1TBAB 1HYZA 1RBUA 1RT6A 3LWMA 4K8ZA 1B9KA 1FK9A 1JXBA 1BQNA 2FBVA 1NK0A 5JS1A 2G8KA 2VWJA 1S9EA 3L2VA 3DOKA 4IG0A 1D9DA 4DTUA 1RDCA 3ZT2A 2OPQA 1RT3A 3KLEA 2EX3A 2XRIA 4JRPA 1X9SA 4CFDA 1IG9A 2YHAA 1QTSA 4DQPA 2YHBA 4DSKA 3ZSRA 4CECA 3RRGA 2GBZA 4CJWA 1EP4A 4CHQA 2BE2A 3VQCA 1QN4A 1EX4A 2YNIA 4HUEA 1R4XA 3QIPA 5DK5A 1SUQA 3A2FA 4FXDA 3NE6A 1RT5A 2VG6A 4IG3A 4FJHA 4Y1CA 1A5VA 3VQQA 1AISA 1QN3A 1QHTA 4OPJA 1LV5A 5IYCP 3TAEA 4F8RA 3NH1A 3QEPA 1D3UA 4FK4A 1NGMA 3ZSOA 1NKCA 2HVHA 2G8IA 4QOZB 1U47A 4OPKA 4W5RA 3MXMA 2HHUA 4ELVA 5I42A 1JXEA 4AHUA 1S5JA 2EHGA 3ALYA 3L3VA 4OKJA 1IKYA 1RTHA 2IS3A 3OY9A 3KIOA 1NJWA 3ZSXA 4FZZA 3I0RA 1BQMA 1CZ9A 3U3GA 1TV6A 4CJRA 4Z4IA 2PZSA 3HYFA 1LWCA 3HPOA 4KHSA 1HQUA 4HVJA 1J54A 1RDAA 4RW4A 3VQAA 3PY8A 4PWDA 4W5TA 1VOKA 1BCOA 2QK9A 4JS4A 3EYZA 1UWBA 1NK5A 2HHXA 2Q3SA 1TAQA 3RTVA 3M8PA 4RW8A 3HVRA 1KLNA 3NCIA 1SKRA 3DLEA 1VSJA 4CIFA 4FLXA 3U6FA 2RPIA 4H4OA 2QKKA 3SJJA 4KI4A 4LH5A 3OYBA 4CJ3A 3HVTA 1KFSA 3C6TA 2BDPA 3AVKA 5HRSA 3ZT0A 1BIZA 1UA0A 2HNZA 3S9HA 5FRMA 4W5NA 2X78A 4B8CA 1U4BA 4HCCA 1U48A 5J1EA 2PYJA 4E7HA 4B9SA 1QN9A 1XWLA 4FZXC 4DQSA 3KKRA 3OVNA 4CJLA 3VA3A 1WAJA 3LPUA 4PA1A 3QEVA 3OS0A 1TKDA 1EKEA 4CF1A 3TAFA 2OPRA 2PYLA 3HP9A 3PV8A 4O0IA 2HNDA 1Q9XA 2R7YA 3OCIA 3PX6A 1SL0A 3K2PA 3FFIA 1QNBA 3VQ5A 2BANA 4KAZA 1KCFA 3KJVA 4CHZA 2P1JA 2ETJA 3JYTA 1X9WA 4FJJA 3MXJA 1DTTA 4NYFA 2Z8UA 2XY5A 3RWUA 4HCBA 3V9XA 4LD0A 4FJNA 1ASUA 5CZ1A 5I3UA 3AO1A 3ULDA 3OYFA 3OYKA 3OYIA 4I9LA 1VK0A 3LANA 1I39A 4NYNA 1X1PA 1YVUA 1QE1A 4E7IA 1TK8A 2P5OA 2F8TA 4KTWA 2ZE2A 1KLMA 3LP3A 3QETA 1VSLA 4CJTA 4CF9A 2E6LA 4DTMA 4BACA 4DFKA 1WSGA 4CGFA 1NK9A 4PQUA 1QTMA 1CDWA 5CZ2A 5SZTA 2WONA 4C8NA 2IDOA 3TAQA 4LH4A 4Z0UA 4CEDA 5J2MA
chains in the Genus database with same CATH superfamily
2IV9A 1QNEA 1XUPO 3HP6A 3G4SN 2YKMA 4ELUA 4D7RA 1PCJX 1RBTA 5EPCA 2BUPA 4B1YB 1QQOA 1ZC6A 3R9PA 4CZMA 5AQIA 3ZETB 3SUNA 1RT1A 4PKHA 1VQ5N 4KHNA 1C6VA 3ISNC 4B08A 1U45A 3J7ZO 5IYBP 3T7ZA 3RSMA 3O9SA 3TAGA 3CWSA 5AQLA 5F1XA 3CCSN 1VRUA 1VSEA 3CD6N 3AO4A 4CK2A 3MN7A 4YORA 2EHBD 3O1WA 3CWTA 3LP1A 3S3MA 4GKKK 2HZSA 3TAMA 3SAGA 3IS9A 3OYCA 4C7PA 4AQYK 3J81O 3L2RA 4DSJA 4FK2A 4BE1A 3CM6A 3AGRA 1P8ZA 1KRPA 4G1QA 3OYHA 4KV8A 4BG8A 3OJUA 1WSIA 4XH5A 3UE5A 3V1QA 1T6CA 2NOZA 3QICA 2P9NB 4F4KA 5AR0A 1TUOA 3PLAA 4EP4A 4DSFA 2YHWA 1FN7A 3BZCA 4O8KA 3ULEB 3SQ2A 3DM2A 1X9MA 1YJ9N 4CZFA 4ILJA 3KK3A 3BUZB 4WE1A 4FLUA 1QN7A 3VQPA 4HTUA 1J3MA 1S1XA 1TK5A 2O8FA 1RILA 2I7NA 5HBMA 3DOLA 2NZTA 4M45A 3MX5A 4ZTJA 2HKPA 1IBLK 1LAWA 4BC5A 3CC2N 4JI4K 4WFAL 2QKBA 2Y8QA 2B4JA 1SKSA 4ID5A 3VOVA 1SZ2A 2Z0FA 4CFCA 1DKGD 4RW9A 1NNEA 4N56A 3G10A 3OS1A 2Z1IA 1BHLA 3TI0A 1C0TA 3MEEA 2PFUA 3VQBA 3RRHA 3CCMN 2OTLN 1BG3A 4ZHRA 1YT3A 3DI6A 2E88A 3KTUA 4EJZA 1YI2N 1F21A 5KGXA 1XQSC 4Z4EA 1VQMN 1YUWA 5AJ3K 3MEGA 2QWRA 1QSLA 2HW3A 2NOHA 1WLJA 2HHVA 3SCXA 5HRRA 3I56N 2YX6A 3NF7A 1FKOA 4BRHA 2VWKA 4E1NA 3MX2A 3L8BA 1K2YX 1QQMA 3MAQA 3EIKA 3O80A 3PDKA 4YOTA 3VQDA 1XHZA 4YY3K 4WQ5C 2V8QA 3M5RA 2CGKA 2QXLA 1N36K 1V4TA 3RPJA 1JLQA 2V92A 3CC7N 2VWBA 1RNHA 3FFKB 1Q8IA 5KPRA 3TWHA 4E3SA 4XH1A 4IJAA 5K14A 1RDDA 4CEQA 2E8AA 2OPPA 3AGKA 4YFUA 3UKRA 4FLTA 3WXMB 1T03A 4DR5K 4FWMA 3ZSZA 1GLLO 1D8YA 3OH6A 2AJQA 4IL8A 4DWIA 1E4GT 4O4GA 2XO7A 1UL7A 1JLFA 1WUAA 4CZKA 4CGDA 5GIOA 4M3ZA 5CE3A 1HX1A 4LFCK 2WC9A 1HJRA 3G25A 4KO0A 1NK4A 1Q81O 3ZSWA 5FLXO 5JLFA 5KL0A 1MA9B 4CFFA 4PUOA 4Q0BA 4IDKA 5I9EB 2KZZA 3KWGA 4HTLA 2DKDA 4DFMA 1WJWA 1JKHA 4IOAL 2E2OA 4KH6A 4PY5A 3N4QA 3V9WA 3CIPA 2KW4A 4EFHA 5TKWA 4R79A 3AO3A 2D1KA 4B1ZA 1UT4A 3SPZA 3L4QA 1ASWA 2VG5A 4ROEB 3PX0A 3HPHA 5C42A 5F0XA 4WZSD 5AQOA 3P4IA 4B9TA 2JPIA 4EAKA 3THWA 5CR4A 4M3TA 1XI1A 3SNNA 4IJNA 5AQQA 3TABA 4BE2A 4Z4CA 2JOIA 4QS8A 1YQKA 4JI8K 4X64K 4BRPA 3THXB 4JKAA 2GUIA 2FSNA 2X6SA 4B3RK 3LDQA 3DRSA 3ZCMA 2G8WA 3V6DA 3ZT3A 1L5UA 3CMAN 1YTUA 5JLHA 4CJFA 1J5EK 1PCMX 3I8DA 4C8KA 5AQPA 4CHPA 4DUZK 4BRFA 5BPNA 2OZMA 3BZKA 1U2VA 4B3OA 1J5OA 3FE1A 1W80A 1E42A 3H3OB 1BIUA 4BRMA 3SV3A 1DTQA 3RMDA 3UIQA 4ICLA 4EIAA 3KLFA 3LZJA 1CZBA 1VQ7N 1YTAA 3CMEN 1SS6A 3U9DA 1MPGA 3C65A 5M1NA 3W0LA 5GAHP 4CBXA 1T6DA 3CWUA 1KXPA 3WNFA 4FYDA 2P9SA 2WBNA 2HHSA 2DKCA 3CW7A 1IH7A 4DR2K 4NCGA 5C25A 1YHQN 3CPEA 1BUPA 4AHVA 3TSPA 3HRGA 4Q5VA 3IRXA 3VEVA 2HHTA 3QINA 3AA4A 2QTDA 1OVYA 3NVMA 4XH4A 4DTXA 3RR7A 3VQ7A 2W42A 2IOCA 3CETA 1L3SA 3SV4A 1OH7A 5KRSA 3EZWA 3CCUN 4CBWA 5T7BA 1JLGA 1Q9YA 3BF1A 2G30A 2HHHK 3AARA 3HSCA 4GV6A 1K8KA 4CJVA 2P9LB 4N76A 2P51A 3U4LA 4CJ4A 3ID8A 5EVZA 4C1NK 1ZBHA 3AVAA 2O4IA 4FM1A 1U04A 3AA3A 5LY3A 1KTQA 1WB9A 1KAZA 4DS5A 4Z4HA 1TUUA 3KK1A 2QWLA 4BGBA 5J2QA 4CHOA 4FLVA 3TR8A 3K0SA 4DTSA 4N41A 1QHAA 3OJSA 1RBUA 4O8UA 3VEOA 4WFNL 2FBVA 1NK0A 4BQZA 2P9UA 5JMVD 4JEPA 1RDCA 5EOYA 2F7TA 2EX3A 1IG9A 4DQPA 1QTSA 5GAEP 1OH6A 4CECA 1GLBG 2BE2A 3VQCA 5KPZA 1QN4A 4WXAA 4IOCL 4HUEA 2UXDK 4JD2A 1R4XA 5DK5A 4A2BA 1Z6RA 1RT5A 2WFBA 3EKSA 4Y1CA 3GOIA 1BU6O 1LV5A 2HZMA 2FSJA 1VQPN 2V52B 1D3UA 2HL9A 1HLUA 4QOZB 4ELVA 3UB5A 4FWNA 2J4RA 1S5JA 2EHGA 4OKJA 2HSTA 4RWTA 3CJBA 4Z94A 3DPTA 2O8EB 1GLJO 4Z4IA 3VEXA 3HPOA 1RDAA 3ENOA 4IO8A 4JS4A 1C47A 3NCIA 4FWKA 3WEEA 4CIFA 3SJJA 4CJ3A 3HVTA 3C6TA 4IOXA 3S9HA 4LF8K 4W5NA 2X78A 3IFRA 4BR0A 4E7HA 1XWLA 4BVOA 2GWJA 4YOWA 1NGFA 4FWQA 4PA1A 1NGEA 4CF1A 1JCGA 5AQWA 3HP9A 3OCIA 1YVNA 3NA5A 1G99A 3FFIA 3VQ5A 1JCEA 3C04A 5AQJA 4AM6A 3KJVA 4RTFD 2ETJA 1DTTA 4I6MA 3L0QA 4HCBA 3J7AP 5I3UA 3AO1A 1WQAA 1NGHA 4IDHA 3OYIA 4BR5A 1YVUA 4BVPA 3H1QA 2F8TA 4KTWA 2ZE2A 3LP3A 4CF9A 2Y8LA 2WTUA 2RHKA 3ZETA 2NRRA 1QQNA 3I0WA 2QREA 5J2MA 1L3UA 2X6NA 3B6OA 5AQKA 1N32K 3HL8A 4NLBA 3AVGA 1HMVA 4CD1A 1JCFA 1UOCA 1JFIC 4KTZA 4CCHA 2E1ZA 4CF8A 1NGJA 3DLRA 3SUQA 1A5WA 3L2WA 1RT2A 1KYDA 1HR0K 2GWKA 1D5AA 1LWEA 4BC2A 3LDSA 2GX9A 3RMAA 3I55N 4RODB 1A5XA 2A41A 4BRNA 4CJEA 4KHQA 3EEQA 2NVMA 4FJ8A 3ITHA 3K57A 3OLPA 1T6AA 1B9FA 4PL8A 1PCZA 3K5OA 3WNGA 1QSYA 4DCHA 2YH5A 1WSEA 3BF3A 2HVIA 2P9NA 3NFAA 5BPMA 2DFFA 3D7QA 3S41A 3KKSA 3ULEA 4H0YB 4DFJA 2ZGYA 2XY6A 3FZLA 1GLDG 1UAXA 3H46O 3O4NA 1KC8O 4DS4A 3THYB 1C0GA 1QN8A 3MN5A 1NKBA 5BRDA 2W6LA 1R0AA 3EL2A 2B5JA 3DLBA 4YOYA 4FM2A 2Q1NA 3CCQN 4JRQA 5J2NA 1UA1A 1HKBA 1GLAG 3VQ4A 2JLEA 4BR7A 4DR7K 3NGZA 5GAGP 2QEXN 5AN4A 4GV3A 3NVKA 1WSFA 3OYEA 4E0DA 2RN2A 4JKEA 4YDUC 3AVMA 4BWMA 3CFRA 4CW7B 3TSUA 4DTOA 4A62A 5CHIA 1S1TA 3O5BA 4O5BA 4FO0A 4KHPK 5M1PA 3GBTA 4DMNA 3F5TA 3IG1A 3R6MA 3EN9A 2VGMA 5AQFA 3CXCM 3QNOA 5E26A 1O1WA 1W97L 3MXIA 2KQ2A 1XC9A 1JLEA 4E1MA 3D2FB 1SL2A 4YOVA 1E4FT 3ZSYA 3SMSA 3SJHA 1QS4A 1LCUA 4CVNE 4W5OA 3TTCA 4DQIA 4DTPA 2OTJN 5FROA 3CYMA 4J2DA 1NGDA 4KFBA 4QAGA 2RKIA 5KPTA 3DLHA 1TL3A 3HK2A 4HHTA 2HBLA 3AVLA 4CJKA 1J53A 3SQ4A 3E01A 3QBXA 3VQEA 4Y1DA 3DXMB 4JN4A 2NOFA 1TVRA 4BR2A 3OYAA 5B8HA 4I2QA 4GVMA 1J6ZA 4K25A 2D0PA 5BREA 3SUOA 2H4LX 5BRHA 4RG8A 4XEIA 2KFZA 2H3GX 1KVAA 1SQKA 1JJ2M 3O9QA 2DPNA 2YNHA 1ATSA 4JI3K 3DMJA 3PSIA 2YHYA 1W0HA 4BG9A 1KQSM 3D45A 4IBNA 5CY4A 4K8XA 2LSNA 3U8XA 2O8DB 2GV9A 4EZ6A 3CPWM 1KSPA 4B1UB 4H03B 3OSMA 3DLLL 1DIZA 1B92A 3DLKA 4B9VA 4JI7K 1QZ5A 2YA3A 2FGTA 1VKLA 1NG9A 3NMUA 2XY8A 3L3UA 4JLHA 1SKWA 2P5GA 3SUPA 4DSIA 4WF9L 4J2AA 2NRVA 4CGIA 4FM0A 3IUCA 3AVJA 1YQMA 3M8RA 3PO4A 4FPAA 3E1YA 3EZ5A 4C23A 1WSJA 4DV7K 3MECA 1FKPA 1G15A 2DY4A 2QWPA 3F9MA 1VQNN 1T7PA 2PY5A 2IVPA 3DRRA 2Q97A 1RBRA 4LF4K 2KFNA 4KB0A 1N33K 3G71N 3FR0A 2HMIA 4YOXA 3WNEA 1S1WA 3V81A 1C4GA 1X3MA 3O3GA 3THXA 4PL7A 3QFUA 4RW7A 3W3DA 3F73A 3ZX0A 4FVUA 3OSEA 1I3AA 3VN5A 1JDYA 3ENCA 4JHDB 4DU3A 1HNWK 3C95A 4BROA 1RTJA 4FLYA 4DSLA 2HB5A 4JKBA 4EAIA 1TKZA 3K9JA 5BR9A 5M1FA 4HWIA 4H0XB 3AVHA 3CHWA 1OKJA 4H5WA 1GOAA 5M1KA 4JI1K 1CZAN 2O3OA 2D4WA 4CEZA 1IBKK 4CF2A 2YKNA 3NH2A 1TAUA 3T19A 4JS5A 3AA2A 3SQ1A 3AVIA 5KI6A 1HPZA 1ZBUA 4LSLA 2HBMA 4FZYA 2PBDA 3O8MA 4HUGA 2NRWA 3KK7A 4FWSA 2ITMA 1K9MO 2ZJRL 1TKTA 1NU0A 4DV5K 5A2QO 5E41A 3JSMA 4ROCB 2FBXA 4GVEA 1JL2A 2VCPA 3C6HA 4H0VB 1IO2A 1C0UA 3DRPA 2NWVA 5AQHA 4DKWA 3O3FA 4Q11A 2OA8A 2Z1HA 1MDUB 1M90O 2RF2A 2IV8A 2V7ZA 2A40A 1Q7YO 4DR4K 2IVOA 2QXFA 2F4VK 3QBWA 3I0SA 2EWSA 2NRTA 2ZD1A 3VF2A 3PO5A 4BREA 4BRDA 1QNAA 3T1AA 4QCLA 1NOYA 1ASVA 3C94A 3K5MA 2P9LA 3OGDA 4LF6K 4OJRA 2GEMA 3HSTB 1LOTB 3CC4N 3OYMA 4IEEA 5EX5A 5HRNA 5EXWA 2ITGA 3LP2A 4JI2K 3MWTA 4CEOA 3OS2A 4HJHA 4M3RA 1BA0A 5DMRA 3OYGA 3QEWA 5SWMA 3M8QA 4FW1A 2F7LA 4FK0A 5LMUK 1S6QA 3NF8A 3NDKA 5EY4A 1TYQA 3I0XA 5GIPA 5CYMA 3JXUA 1QTPA 3P1GA 3HBTA 2Z1GA 3SK3A 4BY9C 2HMPA 1HNIA 3QEXA 2YHXA 1VHXA 1JXBA 3DPUA 4KH4A 2F9WA 2G8KA 1E3MA 3LL3A 2QW9A 4JKDA 4YOUA 1LWWA 4WQ4A 3ZT2A 4DV0K 2OPQA 1RT3A 4X62K 4CFDA 2YHAA 4B1VA 4QS9A 5AQZA 2AA4A 4BRLA 1S72N 4F9OA 5GINA 4B1WB 2NRHA 2NOIA 2GBZA 3SBTA 4CHQA 3CCRN 1EX4A 2YNIA 2CGLA 4DV3K 2O8EA 3NE6A 1W2BM 4FJHA 3CVSA 5HL7L 3CJ1A 1AISA 1QHTA 5IYCP 3TAEA 3D7EO 1OH8A 3BY5A 3QEPA 2A3ZA 4JAXA 3DWLA 2G8IA 4LFAK 3A5LC 3TDHA 4OPKA 3MXMA 4AHUA 3LDOA 4UY8O 1LXTA 1CZ9A 3HYFA 2OANA 1LWCA 4KHSA 1HQUA 4HVJA 3VQAA 4PWDA 1VOKA 1BCOA 1KAYA 2QK9A 3EYZA 3RTVA 3M8PA 1SKRA 3PIOL 2QKKA 4FLXA 4H4OA 4DUYK 4EALA 3ZT0A 1BIZA 5FRMA 5DM7L 4B8CA 3VGKA 3ATVA 5AQNA 2PYJA 2RE2A 4B9SA 1SAZA 2FUVA 5FPNA 1NLVA 4CJLA 4CZJA 2P9IB 1WAJA 1TKDA 3OS0A 1EKEA 3TAFA 4DB3A 4O0IA 1SL0A 4ZTFA 2LAEA 3K2PA 3F2KA 5LL6Z 4EHUA 3T1HK 2P1JA 3JYTA 1VQ4N 1M3QA 3RWUA 4LD0A 4MRQA 4A59A 3ULDA 4JK9A 4I9LA 3ULXA 1EO1A 4ISFA 3KHYA 1H1VA 4WYBA 1KLMA 1YIJN 4GKJK 4DTMA 4PQUA 4AF1A 5FPMA 5SZTA 2WONA 2IDOA 3Q7CA 2ZGZA 3EY1A 3TAPA 4UQGA 4BRKA 2HBJA 1RDUA 1TKXA 2HHQA 1XNQK 1NMNA 1RBVA 2XY7A 4A5AA 3BGRA 3SBGA 4L8RB 2MZ8A 2V9JA 4QS7A 3E9PA 2HBKA 1ZBIA 3VEYA 2FKMX 1TGHA 1KVBA 4B9LA 4ELTA 4NXMK 3ZT1A 1QSSA 4MDBA 2YNFA 2QLVA 2W41A 4AHSA 4IFYA 1BA1A 1KAXA 1W9HA 4GW6A 4OPAA 1RTIA 2A1RA 4C8MA 3O9UA 3THYA 2DTUA 3P38A 1EUVA 3L2QA 1HJOA 2YCHA 4M63C 5C0YA 1TYQB 3WXKA 5BN9A 4GY2B 2O8BB 3LM9A 4E7KA 4O0JA 1QN5A 2YJEA 4LF5K 5FPEA 1VSFA 1N3CA 4WCEL 4DG1A 4ID1A 1VAZA 3F0ZA 1L3TA 3LPTA 4DTJA 4Y0WA 1DEJA 4D7QA 4CEEA 4GNIA 4CK3A 2Y1JA 4J8FA 1N8RO 2QM1A 1NJIO 4CESA 5E84A 1LWFA 1ZYQA 4H4MA 2D0CA 2NNWA 2DFHA 1C1BA 5D3GA 1EBMA 1VSKA 2NRZA 3ENHA 1XC3A 3VQ9A 5C2DA 4BDZA 1NM1A 3RSEB 2NLXA 3OHRA 1HRHA 3QO9A 4EHTA 4F3TA 4FJLA 3CJAA 4I9QA 2Q0RA 3C0BA 3OC3C 2G8VA 5AZJB 3KD1E 3FZMA 3GG4A 2FC0A 3T1YK 2DKAA 4CGJA 2KKZA 3QIOA 4FJIA 1MU2A 3CCLN 3ENOC 2P9KB 1IG8A 2E5LK 1C1CA 2UXCK 3D2FA 3B6PA 1B9DA 3KLIA 1Q82O 3HM8A 4ILGB 2KZMA 4GV9A 4CFBA 2JGUA 2IC3A 4IKFA 3CG7A 3MCPA 1D4XA 2E1YA 1P5GX 3P5JA 4Z4GA 1Q18A 4CJUA 4M41A 1ATRA 2Q31A 1NKEA 1BISA 4B3TK 4CZIA 2FSKA 1TGOA 3WXIA 2HNYA 3FLCO 3DXMA 4DV6K 2G8FA 2GUPA 3MN9A 2YNGA 1SV5A 4FLWA 3SPYA 1VSDA 5EU7A 1YTBA 5BN8A 5KGWA 4CJQA 4V19S 3J8AA 2VQEK 2JWLA 4MO4A 4CD3A 3HO1A 3CFOA 1NMDA 4OGCA 3CQ8A 1BGXT 3K58A 3SYZA 3ENBA 4E89A 2W40A 1WNSA 3OSTA 4M7YA 3VF6A 3ZSVA 2O8DA 3SI6A 4B1XB 4NB4A 2QRCA 3G0ZA 3FZFA 3RMCA 4JK8A 4CHNA 1KY7A 4IFVA 5JICA 2B6AA 3O3HA 2OCEA 1N6QA 3UW2A 4DU4A 1KO9A 4A2AA 2R5XA 3LALA 3SQ0A 4N5SA 2QI2A 4ISEA 1CLQA 2DFEA 4FJ7A 4MQ3A 4LF9K 3QDKA 1WAFA 3WXJA 2MJ7A 3CJ9A 3FGUA 3IH7A 5AZIB 3V1RA 3VMFB 1RGIA 2UUBK 1QN6A 5J2PA 3IDHA 5FRNA 4EJYA 4E7LA 4F2SA 4KHWA 1KD1O 5KQDA 3IMXA 4DV2K 1EXQA 2JWKA 2OPSA 1ESVA 1CXQA 5AQGA 3ASMA 5DM6L 3NGYA 4DV1K 4CJ7A 1VRTA 3P83D 3TANA 5HLFA 4CEAA 1WBBA 3O4QA 3PMGA 1HYSA 4LC9B 5AQUA 3FZKA 4MFBA 4IXCA 3LZIA 4JHDA 4FVMA 2ASPA 2VG7A 3LDLA 4OVLA 4CK1A 1VQ8N 1KFQA 4JKHA 4RCHA 4DTNA 2CGJA 4FW2A 4CGGA 1FXXA 4B8AB 3HJFA 1BWFO 1KYFA 4DU1A 3B8AX 4WX8A 1Z26A 3MEDA 3RMBA 3D2EB 4E7JA 1KY6A 2ZJQL 3K9KA 3DYAA 5GADP 4BC3A 3T3FA 1W7AA 4BDPA 3KZBA 3L4IA 4CIEA 2IVNA 4AH9A 4FJMA 3SNSA 2Q2RA 4AHTA 4GMJB 1ITGA 3CF5L 1BO5O 4FJGA 2H5AX 3D4VA 2E20A 4K43A 5MLCQ 4X65K 3R8EA 2KHOA 3O9TA 4CI6A 1JLAA 5HSHA 3GL1A 1N3AA 2E4LA 3OA9A 3CQXA 2YI1A 4OKEA 3K59A 2Y1IA 4FJ9A 3LP0A 4MDAA 5IYDP 1NK6A 3AAPA 1YQLA 3NH0A 4AHCA 5BPLA 3CVTA 1ZXOA 3KTQA 2ZQBA 5ADXH 1J9AA 1GOCA 3V1OA 2QWMA 3NF9A 1HKGA 3PIPL 3AVCA 1ILYA 1C0MA 1RCHA 2Q0UA 4KREA 2FXUA 4DR3K 1HKCA 2BGGA 2A6AA 2P9PB 5JMVA 4PKIA 3C7NB 2YJFA 1DT9A 4OKKA 5AQRA 4BR9A 1MP9A 1Y97A 4C8LA 4R5PA 1CXUA 2UUCK 3QERA 4JKGB 1RM1A 1KFDA 5C2FA 4OLBA 3OH9A 3TARA 3OYJA 3I8BA 1YAGA 4XIUA 4K41A 1RT7A 4MLHA 1M1KO 4H0PA 1BI4B 1PVSA 3S3OA 1XNRK 3MK6A 1QVGM 3HOTA 3I33A 4G9ZA 3QESA 5JVGL 4BGAA 3LWLA 3CM5A 1NBWA 4K0KK 3E66A 1QNCA 5ADXA 3TTDA 3MN6A 1BCMA 4KTQA 1HNVA 3KK2A 4M42A 3UKUB 5BMNA 3QNNA 3LAMA 5ELZA 1NOZA 1LW0A 3VTIA 3VERA 4U67L 4BDYA 4L3QA 4DSEA 3ZEUB 1RT6A 3LWMA 3QB0A 4K8ZA 4IO9L 5JS1A 2VWJA 2ASOA 4BRGA 3L2VA 1N34K 3FZHA 2I7PA 4IG0A 1D9DA 4DTUA 1VQLN 4H5RA 4JRPA 1X9SA 2XRIA 3SAFA 1X9JA 3ZX3A 2A42A 3EE8A 2O8CB 4DSKA 3ZSRA 3RRGA 1EP4A 5HOOA 3WQTA 1HNZK 4OO1J 1SUQA 2ZWHA 3A2FA 4FXDA 2VG6A 3M3ZA 3VQQA 4OPJA 4C1NI 3NH1A 1NGMA 3G6EN 2HVHA 3N4PA 3WQUA 4ILHA 4W5RA 2HHUA 3OW2M 5C12A 5I42A 1JXEA 3HI0A 2IS3A 4FZZA 3ZSXA 1BQMA 4B9QA 3U3GA 4CJRA 2VYPA 3BKQX 1J54A 4RW4A 3PY8A 3AY9A 4W5TA 5IWAK 1NK5A 2HHXA 4NXNK 1TAQA 2P9IA 2ASMA 3DLEA 1LWVA 2RPIA 4KI4A 4YHHK 4LH5A 3OYBA 1KFSA 5TKYA 2BDPA 3AVKA 5HRSA 2HF4A 2FF3B 1U4BA 1NGAA 1U48A 1BDGA 1QN9A 5LJWA 4H5NA 3KKRA 1P90A 3SAHA 2FLOA 2PYLA 3PV8A 1Q9XA 1Q9UA 1YXQA 3DXKB 4EAJA 3VENA 4CHZA 5C15A 1X9WA 4NYFA 2OOXA 1WOQA 2Z8UA 2UYTA 2XY5A 1ASUA 1NGCA 2F9TA 2CH6A 4FWRA 2JHJA 1VK0A 3LANA 4NYNA 3VGLA 1X1PA 1Z05A 4E7IA 2P5OA 5M1OA 3QETA 1VSLA 4WQ5A 4DFKA 4BR4A 3CI5A 1QTMA 1CDWA 4C8NA 3TTFA 1K35A 4H0OA 4LH4A 3JAMO 4CEDA 4M7XA 5AFUH 3KD5E 4DQQA 2QA4N 2PWWA 4OGEA 3QFPA 3DAWA 2JHNA 4DR1K 4B3SK 2WOMA 3O4WA 2G8HA 3OYNA 4C8OA 3BDPA 3CCVN 1Y64A 1VQON 2ZM6K 3LM2A 3WXLA 4H0TB 4RW6A 1QVFM 1S22A 4IFEA 1U49A 3V9ZA 2IAJA 1VTOA 4O5FA 3R3LA 2O8BA 4IWVA 4J2EA 3AO5A 4E19A 4NCAA 3F10A 1EETA 2VJ0A 3CCEN 1MWKA 1N39A 2QWNA 2OZSA 2HOEA 1GOBA 1NJYA 3A5NC 3AVFA 2GTDA 4KHUA 4JI5K 1KVCA 4WQ4C 3H45C 3DLGA 5AQVA 5AFUA 4AILC 4MLEA 4CERA 4OLAA 1LAVA 5F2RA 1U6ZA 1XHXA 3RSEA 3HXMA 1K6YA 3VA0A 4KBOA 4CF0A 2NOEA 3H6EA 4O55A 5AZJA 1IBMK 1DLOA 3RR8A 1C1AA 4DQ8A 2VQFK 4A61A 1OVQA 1R59O 2P9KA 3M8SA 1HQEA 5BMPA 1V5SA 2W6KA 3CJCA 3HS8A 1RT4A 2BTFA 2UXBK 2QWQA 1FJGK 3VQ6A 1YJWN 1T8EA 4CGHA 1D9FA 4A5BA 4A57A 3EKUA 4H5VA 4LY7A 5CYQA 2WUSA 4H5TA 2V51B 4KI6A 4BRCA 3V9UA 3Q7BA 5LMNK 3E9LA 1NVPA 2E2NA 4JYAK 2O8FB 1JLCA 3O6WA 2I5JA 2NOLA 4CZEA 1RTDA 1IKXA 3IAYA 1IKVA 3AO2A 4H8KA 4DFPA 1KFIA 4LFBK 3V4IA 2Z1JA 3S3NA 4I8OA 3U3YA 1Z25A 1NJZA 4CZGA 4FL9A 4BJUA 5HRPA 5LJVA 5HROA 3CFPA 3THVA 5H1SQ 1ZBFA 3AVBA 3ZLJA 1IKWA 4M3XA 2O4GA 3ZSQA 1GLEG 4BWJA 3HS9A 3VQ8A 2A1SA 1EWQA 3LDPA 4FPBA 5F9CA 1XMQK 4LF7K 1VSMA 2A5XA 3KLGA 2X74A 4TPSA 1IV0A 3ZT4A 3T4NA 5FDLA 2I5WA 2UUAK 3A5OC 5C24A 3NGIA 3LAKA 4NCBA 3F9KA 1VOLB 1HYVA 1TL1A 3HZ6A 4FSVA 1N5YA 4KRFA 3KWIA 2F96A 1TBPA 3AVNA 1EWRA 1UT7A 2E2PA 2OOYA 4CJPA 2KLAA 2NUBA 3LDNA 3HT3A 3EE9A 3VF4A 1QZ6A 4LSNA 1NH2A 3NAEA 2XHIA 4CBUA 4DQRA 1RDBA 3R1XA 3MMVA 3NHGA 3SZ2A 3A8YA 1S3XA 3ZYYX 3QLHA 1VTLE 4EAHD 5AZIA 2QWOA 3J80O 4FWPA 3ZX2A 1V4SA 1XMOK 3N89A 3AAQA 3WNHA 4B3MK 5M1QA 4BE0A 4DLGA 3TU5A 2Q36A 4IZ9A 1QQCA 2YV0X 4B9UA 5AQTA 4KH5A 2FF6A 4N47A 1IJJA 4JI6K 1WN7A 2FBYA 4AHRA 5JS2A 4KPYA 3UKRB 4JKFA 3TPQA 4EP5A 3C6UA 3KRMA 4M3YA 5FPDA 5KQ8A 3WT0A 3L6QA 2AP1A 2HL8A 4CJSA 4BRQA 4TSXA 1WSHA 3OBWA 4DV4K 1FW6A 2UU9K 1VSIA 4F3OA 2BH1A 4W5QA 4DF8A 4YNQA 4F2RA 5AQYA 1NGIA 2HF3A 1TK0A 3CERA 1C0FA 2G8UA 3HPGA 1NGGA 3HTVA 2KTQA 2IGIA 1HU0A 3VEWA 4FLZA 3D2EA 4I7FA 3VGMA 2E6MA 3V9SA 1GLCG 2FBTA 3P39A 4EAGA 2ZF5O 3O9RA 4BRIA 4NLCA 4FWLA 4CJ5A 4B9MA 3I3WA 2F8SA 3RVCA 1S6PA 3K5NA 1JLBA 4FJXA 4CFAA 4FWOA 3OYDA 2D5RA 2QR1A 3HM9A 1REVA 3CCJN 3KVGA 5HP1A 3PSFA 3QEIA 4EZ9A 2E2QA 1YF5L 4HUFA 2ATQA 3THWB 1NK8A 1BOTO 4CEFA 4CZLA 2HHWA 1GLFO 4CEBA 4J2BA 1YITN 1C9BB 3PX4A 3M6GA 3A5MC 3MDQA 4JNEA 3GDQA 3H3NO 3VESA 3NF6A 1RBSA 1S9GA 1ZBSA 1T44A 4KHYA 4OPHA 4FJKA 2ZJPL 1MWMA 3H08A 4FJ5A 4PKGA 1JL1A 3H1ZA 5KRTA 1PZDA 4JI0K 4AM7A 1HUXA 4DHYA 5AQMA 1VSHA 4U7BA 2P9PA 5C10A 1T05A 3C7NA 1ATNA 4O44A 4FCYA 1U2VB 5KTQA 4E1JA 1K8AO 4M3UA 4JV5K 4OX9K 3GE1A 3ID6A 1K73O 4JKGA 3NBPA 4JK7A 3K5LA 4NO7A 1X3NA 1LWYA 2OYQA 2PAVA 3SLCA 1S1UA 1ZBLA 1BI4A 1EQYA 2D0OA 3PUFA 4B0AA 3D6RA 2P9SB 4CIGA 5AQXA 1HPMA 4KKOA 3AA5X 3TSQA 4M3WA 3MCAB 3MWPA 1LW2A 4CE9A 1YTFA 1HNXK 5IT9O 3DJCA 2V7YA 4B9NA 1P5DX 4DR6K 3VPZA 3AV9A 2XHBA 3KLHA 3UKUA 2GELA 2QRDA 1NJXA 1NK7A 2NOBA 3E9OA 3O1BA 3ZEUA 3D0PA 1NWKA 3L2UA 1S1VA 4FOIA 3VTHA 5JVHL 2D0AA 2FKFA 3OYLA 1L3VA 1SL1A 4DLEA 3OBYA 1XSZA 1K8KB 3WUHA 1KYUA 1VQ9N 4I2PA 4Z4FA 1BL3A 4BC4A 1I94K 4BRAA 3CJ7A 3M1FA 4DTRA 4CHYA 1OH5A 2D0BA 4MO5A 4DF4A 4KB1A 2NRXA 1TBAB 1HYZA 2O8CA 1B9KA 1FK9A 3T69A 1BQNA 3O08A 2VGNA 1S9EA 3IKMA 3DOKA 4FOEA 5AQSA 3A0IX 1YQRA 3KLEA 3HOSA 4BQLA 2YHBA 1VQ6N 4X66K 4CJWA 3EAYA 3C6AA 3QIPA 2IIRA 1O13A 2P9UB 4IG3A 1A5VA 2ZFDB 2NLVA 1QN3A 1RDWX 3VETA 4F8RA 4FK4A 3ZSOA 1NKCA 3QMLA 4WFBL 1U47A 4YDUA 3J7YP 4JKCA 3ALYA 3L3VA 3U9ZA 1IKYA 1RTHA 3OY9A 1NJWA 3KIOA 4JD2B 3I0RA 1T3VA 1TV6A 5BRFA 4ISGA 2PZSA 3H1VX 1UWBA 2Q3SA 1M3HA 4RW8A 4K42A 3HVRA 1KLNA 3SMPA 1RFQA 1VSJA 4PHTX 3U6FA 5JN5A 1VQKN 1TUYA 4IEIA 3VEZA 4CZHA 3P31A 1UA0A 2HNZA 3DXKA 3JS6A 1DGKN 4HCCA 5J1EA 1NGBA 3OTOK 4FZXC 4DQSA 3OVNA 5BR8K 3VA3A 1YJNN 3LPUA 3QEVA 3WEEB 2OPRA 2HNDA 2R7YA 3PX6A 1QNBA 2BANA 4KAZA 1KCFA 3BEXA 3EO3A 4FJJA 3MXJA 3V9XA 4FJNA 5CZ1A 3TE5A 3OYFA 1Q86O 3OYKA 1I39A 3ATUA 1QE1A 1TK8A 2CH5A 4CJTA 3CQYA 2E6LA 4BACA 1WSGA 4CGFA 1NK9A 3BP8A 3CWAA 4I6MB 5CZ2A 4DULA 1WBDA 1M5Q1 3TAQA 4Z0UA 4QG5A
chains in the Genus database with same CATH topology
2IV9A 4DQQA 3EY1A 3TAPA 2X6NA 3B6OA 4UQGA 4OGEA 1QNEA 1TKXA 3HL8A 3HP6A 3AVGA 2HHQA 1HMVA 2YKMA 4ELUA 1RBVA 1RBTA 2XY7A 2WOMA 1UOCA 3BGRA 3OYNA 1JFIC 4KTZA 2G8HA 4CCHA 4C8OA 4L8RB 3BDPA 4CF8A 2MZ8A 3DLRA 3SUQA 1A5WA 3L2WA 1RT2A 1KYDA 4RW6A 1ZBIA 1D5AA 1LWEA 3LDSA 3SUNA 3RMAA 1RT1A 4RODB 1A5XA 1TGHA 1KVBA 4KHNA 1U49A 4CJEA 4B9LA 4ELTA 4KHQA 1C6VA 3ISNC 3ZT1A 4B08A 3V9ZA 2IAJA 1QSSA 1VTOA 2YNFA 3ITHA 3K57A 1U45A 4FJ8A 4AHSA 5IYBP 4J2EA 4IFYA 1B9FA 3AO5A 1PCZA 1W9HA 3K5OA 4GW6A 4E19A 3WNGA 1RTIA 1VRUA 3TAGA 4NCAA 1VSEA 3F10A 2A1RA 3AO4A 1EETA 4C8MA 4CK2A 1QSYA 2VJ0A 2DTUA 2YH5A 1WSEA 3L2QA 1N39A 2OZSA 3LP1A 3S3MA 2HVIA 3NFAA 2HZSA 3TAMA 3IS9A 1GOBA 2DFFA 3OYCA 1NJYA 3L2RA 3KKSA 4DSJA 4FK2A 3AVFA 3CM6A 4BE1A 1KRPA 4DFJA 2XY6A 4G1QA 4E7KA 4O0JA 1QN5A 1UAXA 3O4NA 4KHUA 3OYHA 1VSFA 4DS4A 1N3CA 1KVCA 4KV8A 3OJUA 1WSIA 4DG1A 4ID1A 3DLGA 4AILC 1QN8A 3V1QA 2NOZA 1NKBA 4CERA 4OLAA 3F0ZA 1LAVA 1L3TA 3LPTA 1XHXA 4DTJA 4F4KA 1R0AA 3HXMA 1K6YA 4EP4A 4DSFA 4CEEA 4CK3A 3VA0A 2Y1JA 1FN7A 4QCLA 2B5JA 4CF0A 3DLBA 2NOEA 4FM2A 4O55A 4CESA 3SQ2A 1DLOA 4JRQA 3DM2A 5J2NA 1UA1A 1X9MA 3RR8A 1LWFA 1ZYQA 4H4MA 1C1AA 3VQ4A 3KK3A 2D0CA 2JLEA 4WE1A 3SPYA 2DFHA 1C1BA 5D3GA 3M8SA 1EBMA 3NGZA 1QN7A 3VQPA 1HQEA 4HTUA 1VSKA 4FLUA 5AN4A 3VQ9A 1S1XA 4BDZA 1TK5A 3HS8A 1RILA 1RT4A 1WSFA 5HBMA 4M45A 3DOLA 1HRHA 3QO9A 2RN2A 3OYEA 4E0DA 4FJLA 3VQ6A 4I9QA 4F3TA 4ZTJA 1T8EA 4CGHA 3AVMA 1D9FA 3OC3C 1LAWA 4BWMA 2G8VA 3KD1E 2FC0A 4CGJA 4LY7A 3CFRA 2QKBA 5CYQA 2B4JA 3QIOA 4KI6A 4FJIA 3V9UA 1SKSA 4DTOA 4ID5A 1MU2A 1S1TA 1NVPA 1C1CA 4O5BA 3B6PA 4CFCA 1B9DA 3KLIA 4RW9A 1JLCA 2I5JA 4N56A 2NOLA 3G10A 4DMNA 3OS1A 3IG1A 2KZMA 1RTDA 1IKXA 4CFBA 2Z1IA 3IAYA 1BHLA 2JGUA 1IKVA 2IC3A 3TI0A 1C0TA 3AO2A 3CG7A 3MEEA 4H8KA 3QNOA 1O1WA 4DFPA 4IKFA 3P5JA 3MXIA 4Z4GA 3VQBA 4CJUA 3RRHA 4M41A 3V4IA 2KQ2A 1XC9A 1NKEA 2Z1JA 4ZHRA 3S3NA 1BISA 4I8OA 1JLEA 1YT3A 3DI6A 4E1MA 3KTUA 3U3YA 4EJZA 1Z25A 1NJZA 1SL2A 3ZSYA 5HRPA 1F21A 5KGXA 1TGOA 4W5OA 1QS4A 3CFPA 2HNYA 5HROA 3THVA 2G8FA 1ZBFA 3AVBA 4DTPA 4DQIA 1IKWA 4M3XA 5FROA 4Z4EA 2O4GA 3CYMA 2YNGA 3ZSQA 4J2DA 3MEGA 4BWJA 1SV5A 3HS9A 4KFBA 2A1SA 3VQ8A 4QAGA 4FLWA 1VSDA 2RKIA 1YTBA 5EU7A 1TL3A 5KGWA 1VSMA 4CJQA 3KLGA 2X74A 4TPSA 1QSLA 2NOHA 5FDLA 3ZT4A 2I5WA 1WLJA 3HK2A 4HHTA 3SCXA 3AVLA 5C24A 5HRRA 4CJKA 3NGIA 1J53A 2HHVA 3LAKA 3SQ4A 4NCBA 3E01A 3F9KA 1VOLB 1FKOA 3NF7A 3CFOA 3VQEA 1HYVA 1TL1A 3HO1A 1N5YA 2VWKA 4OGCA 1BGXT 4E1NA 4Y1DA 3K58A 3CQ8A 3SYZA 3L8BA 4E89A 4KRFA 2NOFA 1TVRA 3OYAA 3M8RA 4ZTFA 4I2QA 2F96A 1TBPA 3EIKA 1WNSA 3AVNA 4GVMA 3MAQA 1UT7A 3SUOA 4RG8A 3VQDA 3OSTA 1XHZA 2KFZA 1KVAA 3ZSVA 4CJPA 2NUBA 3HT3A 3SI6A 3RPJA 1JLQA 4LSNA 1NH2A 3NAEA 2XHIA 2YNHA 1RNHA 4DQRA 3DMJA 3G0ZA 1Q8IA 1RDBA 3TWHA 4E3SA 3RMCA 5K14A 1W0HA 4CHNA 3NHGA 1KY7A 1RDDA 3D45A 4IFVA 4CEQA 2OPPA 3SZ2A 2B6AA 3QLHA 4IBNA 5CY4A 1VTLE 2LSNA 4YFUA 4K8XA 4FLTA 2GV9A 3O3HA 1N6QA 1T03A 3N89A 3WNHA 4EZ6A 3ZSZA 1D8YA 1KSPA 4BE0A 4DLGA 3OSMA 4DU4A 2AJQA 2HW3A 1QQCA 1KO9A 1B92A 2YV0X 4B9UA 3LALA 3DLKA 3DLHA 4DWIA 4N47A 4B9VA 3SQ0A 4N5SA 4O4GA 2FGTA 1WN7A 2FBYA 2DFEA 4AHRA 2XY8A 2XO7A 4MQ3A 3L3UA 4FJ7A 1CLQA 1WAFA 2MJ7A 1JLFA 5JS2A 4KPYA 4JLHA 1SKWA 4CGDA 2P5GA 3IH7A 3V1RA 4M3ZA 3SUPA 1QN6A 5J2PA 4DSIA 4EP5A 3C6UA 5FRNA 4J2AA 3KRMA 4M3YA 4EJYA 4E7LA 1HJRA 4F2SA 4KHWA 4CGIA 4KO0A 4FM0A 1NK4A 3AVJA 1YQMA 3ZSWA 4CJSA 1EXQA 4TSXA 1WSHA 3PO4A 2OPSA 3EZ5A 1CXQA 1VSIA 3ASMA 1WSJA 4F3OA 4W5QA 3MECA 3NGYA 1FKPA 4YNQA 4DF8A 1G15A 4F2RA 1VRTA 3P83D 4IDKA 3TANA 4PUOA 4Q0BA 2DY4A 5HLFA 1T7PA 2PY5A 4CEAA 3DRRA 2KZZA 3O4QA 1RBRA 1TK0A 2G8UA 1HYSA 2KFNA 3HPGA 4KB0A 4MFBA 2IGIA 2KTQA 1HU0A 4DFMA 3LZIA 4FLZA 4FVMA 1JKHA 4I7FA 2E6MA 3V9SA 2VG7A 2HMIA 4OVLA 4CK1A 2FBTA 3WNEA 4PY5A 1S1WA 3V9WA 3V81A 3KD5E 2KW4A 3O3GA 4DTNA 3AO3A 4FW2A 1UT4A 3SPZA 4RW7A 1FXXA 4CGGA 1ASWA 2VG5A 4ROEB 4CJ5A 3HPHA 4B8AB 5C42A 4WZSD 3F73A 3PX0A 3HJFA 1I3AA 1KYFA 4B9MA 4B9TA 3VN5A 4DU1A 2F8SA 1Z26A 4M3TA 1XI1A 3MEDA 3RMBA 3SNNA 1S6PA 3K5NA 1JLBA 4E7JA 4DU3A 1KY6A 3TABA 3C95A 4CFAA 4BE2A 4Z4CA 4FJXA 3DYAA 1RTJA 2JOIA 3T3FA 1YQKA 4BDPA 3OYDA 4FLYA 2D5RA 4CIEA 3HM9A 4DSLA 2HB5A 2GUIA 4AH9A 1REVA 2X6SA 3SNSA 4FJMA 5HP1A 1TKZA 3DRSA 3ZCMA 4AHTA 4GMJB 2G8WA 1ITGA 3QEIA 4EZ9A 3V6DA 4FJGA 3ZT3A 1L5UA 3AVHA 4HUFA 1YTUA 2ATQA 4CJFA 1NK8A 1GOAA 4CEFA 2HHWA 3I8DA 4CEBA 4C8KA 2O3OA 4J2BA 4CEZA 1C9BB 4CHPA 4CF2A 3PX4A 2YKNA 3NH2A 1TAUA 1JLAA 3T19A 4JS5A 3AA2A 3SQ1A 3AVIA 5KI6A 1HPZA 1ZBUA 2OZMA 4LSLA 3NF6A 1N3AA 1RBSA 2E4LA 4B3OA 4FZYA 1S9GA 4HUGA 1J5OA 4KHYA 1W80A 1E42A 4FJKA 1BIUA 3H08A 4OKEA 3K59A 2Y1IA 3LP0A 3SV3A 1DTQA 4FJ5A 4FJ9A 1JL1A 5IYDP 1TKTA 4ICLA 3KLFA 3RMDA 1NK6A 3UIQA 3LZJA 1CZBA 1YQLA 3H1ZA 1YTAA 5KRTA 1PZDA 4AHCA 3NH0A 5E41A 3JSMA 4ROCB 2FBXA 1JL2A 1IO2A 1VSHA 3WNFA 1C0UA 1T05A 4FYDA 3DRPA 4O44A 4FCYA 3KTQA 2ZQBA 3O3FA 1J9AA 1GOCA 5KTQA 2HHSA 4M3UA 4Q11A 2OA8A 3V1OA 2Z1HA 2RF2A 2IV8A 3NF9A 1IH7A 3NBPA 3K5LA 3AVCA 2QXFA 3I0SA 1C0MA 1RCHA 2ZD1A 1LWYA 4NCGA 2OYQA 5C25A 4KREA 1S1UA 3PO5A 1ZBLA 1BI4A 1QNAA 3T1AA 3PUFA 4B0AA 4AHVA 1ASVA 4Q5VA 1NOYA 3C94A 2BGGA 4OKKA 4CIGA 3K5MA 3IRXA 1MP9A 4KKOA 2HHTA 4OJRA 1Y97A 3AA5X 3QINA 1L3UA 3AA4A 3HSTB 4R5PA 4C8LA 1CXUA 3OYMA 4M3WA 3QERA 3RR7A 4DTXA 5HRNA 1LW2A 1RM1A 1KFDA 3VQ7A 1YTFA 4CE9A 2W42A 4OLBA 2IOCA 3OYJA 3TARA 1L3SA 3SV4A 2ITGA 5KRSA 4XIUA 1RT7A 5T7BA 3LP2A 1JLGA 1BI4B 1Q9YA 4B9NA 2G30A 3S3OA 3AV9A 4CJVA 2XHBA 3KLHA 4N76A 2P51A 4CJ4A 4CEOA 1NJXA 3OS2A 1NK7A 4M3RA 3OYGA 5DMRA 2NOBA 1ZBHA 3AVAA 2O4IA 4FM1A 3QESA 3QEWA 3D0PA 5SWMA 3L2UA 1U04A 3AA3A 3CM5A 3LWLA 1S1VA 3M8QA 4FW1A 1KTQA 4FK0A 1QNCA 4DS5A 2D0AA 3OYLA 1S6QA 3NF8A 3NDKA 4Z4HA 1BCMA 4DLEA 1SL1A 3KK1A 1L3VA 1HNVA 4KTQA 3KK2A 4M42A 3I0XA 5CYMA 1KYUA 1QTPA 4I2PA 4CHOA 4FLVA 5J2QA 3TR8A 3LAMA 3P1GA 4DTSA 3QNNA 1BL3A 4Z4FA 2Z1GA 4N41A 1NOZA 1LW0A 4DTRA 4CHYA 1HNIA 3QEXA 3OJSA 2D0BA 4BDYA 4DF4A 4DSEA 4KB1A 1TBAB 1HYZA 1RBUA 1RT6A 3LWMA 4K8ZA 1B9KA 1FK9A 1JXBA 3DPUA 1BQNA 2FBVA 1NK0A 5JS1A 2G8KA 2VWJA 1S9EA 3L2VA 3DOKA 4IG0A 1LWWA 1D9DA 4DTUA 1YQRA 1RDCA 2OPQA 1RT3A 3ZT2A 2EX3A 2XRIA 3KLEA 4JRPA 1X9SA 4CFDA 1IG9A 2YHAA 1QTSA 4DQPA 2YHBA 4DSKA 3ZSRA 4CECA 3RRGA 2NOIA 2GBZA 4CJWA 1EP4A 4CHQA 2BE2A 3VQCA 1QN4A 1EX4A 2YNIA 4HUEA 1R4XA 3QIPA 5DK5A 1SUQA 3A2FA 4FXDA 3NE6A 1RT5A 2VG6A 4IG3A 4FJHA 4Y1CA 1A5VA 3VQQA 1AISA 1QN3A 1QHTA 4OPJA 1LV5A 5IYCP 2HZMA 3TAEA 4F8RA 3NH1A 3QEPA 1D3UA 4FK4A 1NGMA 3ZSOA 1NKCA 2HVHA 2G8IA 4QOZB 1U47A 4OPKA 4W5RA 3MXMA 2HHUA 4ELVA 5I42A 1JXEA 4AHUA 1S5JA 2EHGA 3ALYA 3L3VA 4OKJA 1IKYA 1RTHA 2IS3A 3OY9A 3KIOA 1NJWA 3ZSXA 4FZZA 3I0RA 1BQMA 1CZ9A 3U3GA 3DPTA 1TV6A 4CJRA 4Z4IA 2PZSA 3HYFA 1LWCA 3HPOA 4KHSA 1HQUA 4HVJA 1J54A 1RDAA 4RW4A 3VQAA 3PY8A 4PWDA 4W5TA 1VOKA 1BCOA 2QK9A 4JS4A 3EYZA 1UWBA 1NK5A 2HHXA 2Q3SA 1TAQA 3RTVA 1M3HA 3M8PA 4RW8A 3HVRA 3NCIA 1KLNA 1SKRA 3DLEA 1LWVA 1VSJA 4CIFA 4FLXA 2RPIA 4H4OA 3U6FA 3SJJA 2QKKA 4KI4A 4LH5A 3OYBA 4CJ3A 3HVTA 1KFSA 3C6TA 2BDPA 3AVKA 5HRSA 3ZT0A 1BIZA 1UA0A 2HNZA 3S9HA 5FRMA 4W5NA 2X78A 4B8CA 1U4BA 4HCCA 1U48A 5J1EA 2PYJA 4E7HA 4B9SA 1QN9A 1XWLA 4FZXC 4DQSA 3KKRA 3OVNA 4CJLA 3VA3A 1WAJA 3LPUA 4PA1A 3QEVA 3OS0A 1TKDA 1EKEA 4CF1A 3TAFA 2OPRA 2PYLA 3HP9A 3PV8A 4O0IA 2HNDA 1Q9XA 2R7YA 3OCIA 3PX6A 2LAEA 3K2PA 1SL0A 3FFIA 1QNBA 3VQ5A 2BANA 4KAZA 1KCFA 3KJVA 4CHZA 2P1JA 2ETJA 3JYTA 1M3QA 1X9WA 3MXJA 1DTTA 4NYFA 4FJJA 2Z8UA 2XY5A 3RWUA 4HCBA 3V9XA 4LD0A 4FJNA 1ASUA 5CZ1A 5I3UA 3AO1A 3ULDA 3OYFA 3OYKA 3OYIA 4I9LA 3ULXA 1VK0A 3LANA 1I39A 4NYNA 1X1PA 1YVUA 1QE1A 4E7IA 1TK8A 2P5OA 2F8TA 4KTWA 2ZE2A 1KLMA 3LP3A 3QETA 1VSLA 4CJTA 4CF9A 2E6LA 4DTMA 4BACA 4DFKA 1WSGA 4CGFA 1NK9A 4PQUA 1QTMA 1CDWA 5CZ2A 5SZTA 2WONA 4DULA 2IDOA 4C8NA 3TAQA 4LH4A 3I0WA 4Z0UA 4CEDA 5J2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IV9 A;  4DQQ A;  3EY1 A;  3TAP A;  2X6N A;  3B6O A;  4UQG A;  4OGE A;  1QNE A;  1TKX A;  3HL8 A;  3HP6 A;  3AVG A;  2HHQ A;  1HMV A;  2YKM A;  4ELU A;  1RBV A;  1RBT A;  2XY7 A;  2WOM A;  1UOC A;  3BGR A;  3OYN A;  1JFI C;  4KTZ A;  2G8H A;  4CCH A;  4C8O A;  4L8R B;  3BDP A;  4CF8 A;  3DLR A;  3SUQ A;  1A5W A;  3L2W A;  1RT2 A;  1KYD A;  4RW6 A;  1ZBI A;  1D5A A;  1LWE A;  3LDS A;  3SUN A;  3RMA A;  1RT1 A;  4ROD B;  1A5X A;  1TGH A;  1KVB A;  4KHN A;  1U49 A;  4CJE A;  4B9L A;  4ELT A;  4KHQ A;  1C6V A;  3ISN C;  3ZT1 A;  4B08 A;  3V9Z A;  2IAJ A;  1QSS A;  1VTO A;  2YNF A;  3ITH A;  3K57 A;  1U45 A;  4FJ8 A;  4AHS A;  5IYB P;  4J2E A;  4IFY A;  1B9F A;  3AO5 A;  1PCZ A;  1W9H A;  3K5O A;  4GW6 A;  4E19 A;  3WNG A;  1RTI A;  1VRU A;  3TAG A;  4NCA A;  1VSE A;  2A1R A;  3AO4 A;  1EET A;  4C8M A;  4CK2 A;  1QSY A;  2VJ0 A;  2DTU A;  1WSE A;  3L2Q A;  2OZS A;  3LP1 A;  3S3M A;  2HVI A;  3NFA A;  3TAM A;  3IS9 A;  1GOB A;  2DFF A;  3OYC A;  1NJY A;  3L2R A;  3KKS A;  4DSJ A;  4FK2 A;  3AVF A;  3CM6 A;  4BE1 A;  1KRP A;  4DFJ A;  2XY6 A;  4G1Q A;  4E7K A;  4O0J A;  1QN5 A;  1UAX A;  3O4N A;  4KHU A;  3OYH A;  1VSF A;  4DS4 A;  1KVC A;  4KV8 A;  3OJU A;  1WSI A;  4DG1 A;  4ID1 A;  3DLG A;  4AIL C;  1QN8 A;  3V1Q A;  1NKB A;  4CER A;  4OLA A;  1L3T A;  1LAV A;  3LPT A;  1XHX A;  4DTJ A;  4F4K A;  1R0A A;  3HXM A;  1K6Y A;  4EP4 A;  4DSF A;  4CEE A;  4CK3 A;  3VA0 A;  2Y1J A;  4QCL A;  2B5J A;  4CF0 A;  3DLB A;  4FM2 A;  4O55 A;  4CES A;  3SQ2 A;  1DLO A;  4JRQ A;  3DM2 A;  5J2N A;  1UA1 A;  1X9M A;  3RR8 A;  1LWF A;  1ZYQ A;  4H4M A;  1C1A A;  3VQ4 A;  3KK3 A;  2D0C A;  2JLE A;  4WE1 A;  3SPY A;  2DFH A;  1C1B A;  5D3G A;  3M8S A;  3NGZ A;  4FLU A;  1QN7 A;  3VQP A;  1HQE A;  4HTU A;  1VSK A;  3VQ9 A;  1S1X A;  4BDZ A;  1TK5 A;  3HS8 A;  1RIL A;  1RT4 A;  1WSF A;  5HBM A;  4M45 A;  3DOL A;  1HRH A;  3QO9 A;  2RN2 A;  3OYE A;  4E0D A;  4FJL A;  3VQ6 A;  4I9Q A;  4F3T A;  4ZTJ A;  1T8E A;  4CGH A;  3AVM A;  1D9F A;  3OC3 C;  1LAW A;  4BWM A;  2G8V A;  3KD1 E;  2FC0 A;  4CGJ A;  4LY7 A;  3CFR A;  2QKB A;  5CYQ A;  2B4J A;  3QIO A;  4KI6 A;  4FJI A;  3V9U A;  1SKS A;  4DTO A;  4ID5 A;  1MU2 A;  1S1T A;  1NVP A;  1C1C A;  4O5B A;  3B6P A;  4CFC A;  1B9D A;  3KLI A;  4RW9 A;  1JLC A;  2I5J A;  4N56 A;  3G10 A;  4DMN A;  3OS1 A;  3IG1 A;  2KZM A;  1RTD A;  1IKX A;  4CFB A;  2Z1I A;  3IAY A;  1BHL A;  2JGU A;  1IKV A;  2IC3 A;  3TI0 A;  1C0T A;  3AO2 A;  3CG7 A;  3MEE A;  4H8K A;  3QNO A;  1O1W A;  4DFP A;  4IKF A;  3P5J A;  3MXI A;  4Z4G A;  3VQB A;  4CJU A;  3RRH A;  4M41 A;  3V4I A;  2KQ2 A;  1XC9 A;  1NKE A;  2Z1J A;  4ZHR A;  3S3N A;  1BIS A;  1JLE A;  4E1M A;  1YT3 A;  3DI6 A;  3U3Y A;  1Z25 A;  1NJZ A;  1SL2 A;  3ZSY A;  5HRP A;  1F21 A;  5KGX A;  1TGO A;  4W5O A;  1QS4 A;  3CFP A;  2HNY A;  5HRO A;  3THV A;  2G8F A;  1ZBF A;  3AVB A;  4DTP A;  4DQI A;  1IKW A;  4M3X A;  5FRO A;  4Z4E A;  2O4G A;  3CYM A;  2YNG A;  3ZSQ A;  4J2D A;  3MEG A;  4BWJ A;  1SV5 A;  3HS9 A;  4KFB A;  2A1S A;  3VQ8 A;  4QAG A;  4FLW A;  1VSD A;  2RKI A;  1YTB A;  5EU7 A;  1TL3 A;  5KGW A;  1VSM A;  4CJQ A;  3KLG A;  2X74 A;  1QSL A;  2HW3 A;  3ZT4 A;  5FDL A;  3HK2 A;  1WLJ A;  4HHT A;  3SCX A;  3AVL A;  5C24 A;  5HRR A;  4CJK A;  3NGI A;  1J53 A;  2HHV A;  3LAK A;  3SQ4 A;  4NCB A;  3E01 A;  3F9K A;  1VOL B;  1FKO A;  3NF7 A;  3CFO A;  3VQE A;  1HYV A;  1TL1 A;  3HO1 A;  1N5Y A;  2VWK A;  4OGC A;  1BGX T;  4E1N A;  4Y1D A;  3K58 A;  3CQ8 A;  3SYZ A;  3L8B A;  4E89 A;  4KRF A;  1TVR A;  3OYA A;  3M8R A;  4ZTF A;  4I2Q A;  2F96 A;  1TBP A;  3EIK A;  1WNS A;  3AVN A;  4GVM A;  3MAQ A;  3SUO A;  4RG8 A;  3VQD A;  1XHZ A;  2KFZ A;  1KVA A;  3ZSV A;  4CJP A;  2NUB A;  3HT3 A;  3SI6 A;  1JLQ A;  4LSN A;  1NH2 A;  3NAE A;  2YNH A;  1RNH A;  4DQR A;  3DMJ A;  3G0Z A;  1Q8I A;  1RDB A;  3TWH A;  4E3S A;  3RMC A;  5K14 A;  1W0H A;  4CHN A;  3NHG A;  1KY7 A;  1RDD A;  3D45 A;  4IFV A;  4CEQ A;  2OPP A;  3SZ2 A;  2B6A A;  3QLH A;  4IBN A;  5CY4 A;  1VTL E;  2LSN A;  4YFU A;  4K8X A;  4FLT A;  2GV9 A;  3O3H A;  1N6Q A;  1T03 A;  3WNH A;  4EZ6 A;  3ZSZ A;  1D8Y A;  1KSP A;  4BE0 A;  4DLG A;  4DU4 A;  2AJQ A;  1QQC A;  1B92 A;  2YV0 X;  4B9U A;  3LAL A;  3DLK A;  3DLH A;  4DWI A;  4N47 A;  4B9V A;  3SQ0 A;  4N5S A;  4O4G A;  1WN7 A;  2FBY A;  4AHR A;  2DFE A;  2XO7 A;  2XY8 A;  4FJ7 A;  4MQ3 A;  3L3U A;  1CLQ A;  1WAF A;  2MJ7 A;  1JLF A;  5JS2 A;  4KPY A;  4JLH A;  1SKW A;  4CGD A;  2P5G A;  3V1R A;  4M3Z A;  3SUP A;  1QN6 A;  5J2P A;  4DSI A;  4EP5 A;  3C6U A;  5FRN A;  4J2A A;  4M3Y A;  4E7L A;  1HJR A;  4F2S A;  4KHW A;  4CGI A;  4KO0 A;  4FM0 A;  1NK4 A;  3AVJ A;  3ZSW A;  4CJS A;  1EXQ A;  4TSX A;  1WSH A;  3PO4 A;  2OPS A;  3EZ5 A;  1CXQ A;  1VSI A;  3ASM A;  1WSJ A;  4F3O A;  4W5Q A;  3MEC A;  3NGY A;  1FKP A;  4YNQ A;  4DF8 A;  1G15 A;  4F2R A;  1VRT A;  3P83 D;  4IDK A;  3TAN A;  4PUO A;  4Q0B A;  2DY4 A;  5HLF A;  1T7P A;  2PY5 A;  4CEA A;  3DRR A;  2KZZ A;  3O4Q A;  1RBR A;  1TK0 A;  2G8U A;  1HYS A;  2KFN A;  3HPG A;  4KB0 A;  4MFB A;  2IGI A;  2KTQ A;  4DFM A;  3LZI A;  4FLZ A;  4FVM A;  1JKH A;  4I7F A;  2E6M A;  3V9S A;  2VG7 A;  2HMI A;  4OVL A;  4CK1 A;  2FBT A;  3WNE A;  4PY5 A;  1S1W A;  3V9W A;  3V81 A;  3KD5 E;  2KW4 A;  3O3G A;  4DTN A;  3AO3 A;  4FW2 A;  3SPZ A;  4RW7 A;  1FXX A;  4CGG A;  1ASW A;  2VG5 A;  4ROE B;  4CJ5 A;  3HPH A;  4B8A B;  5C42 A;  4WZS D;  3F73 A;  3PX0 A;  3HJF A;  1I3A A;  1KYF A;  4B9M A;  4B9T A;  3VN5 A;  4DU1 A;  2F8S A;  1Z26 A;  4M3T A;  1XI1 A;  3MED A;  3RMB A;  3SNN A;  1S6P A;  3K5N A;  1JLB A;  4E7J A;  4DU3 A;  1KY6 A;  3TAB A;  3C95 A;  4CFA A;  4BE2 A;  4Z4C A;  4FJX A;  3DYA A;  1RTJ A;  3T3F A;  4BDP A;  3OYD A;  4FLY A;  2D5R A;  4CIE A;  3HM9 A;  4DSL A;  2HB5 A;  2GUI A;  4AH9 A;  1REV A;  2X6S A;  4FJM A;  5HP1 A;  1TKZ A;  3DRS A;  3ZCM A;  4AHT A;  4GMJ B;  2G8W A;  1ITG A;  3QEI A;  4EZ9 A;  3V6D A;  4FJG A;  3ZT3 A;  1L5U A;  3AVH A;  4HUF A;  1YTU A;  2ATQ A;  4CJF A;  1NK8 A;  1GOA A;  4CEF A;  2HHW A;  3I8D A;  4CEB A;  4C8K A;  4J2B A;  4CEZ A;  1C9B B;  4CHP A;  4CF2 A;  3PX4 A;  2YKN A;  3NH2 A;  1TAU A;  1JLA A;  3T19 A;  4JS5 A;  3AA2 A;  3SQ1 A;  3AVI A;  5KI6 A;  1HPZ A;  1ZBU A;  2OZM A;  4LSL A;  3NF6 A;  1RBS A;  2E4L A;  4B3O A;  4FZY A;  1S9G A;  4HUG A;  1J5O A;  4KHY A;  1W80 A;  1E42 A;  4FJK A;  1BIU A;  3H08 A;  4OKE A;  3K59 A;  2Y1I A;  3LP0 A;  3SV3 A;  1DTQ A;  4FJ5 A;  4FJ9 A;  1JL1 A;  5IYD P;  1TKT A;  4ICL A;  3KLF A;  3RMD A;  1NK6 A;  3UIQ A;  3LZJ A;  1CZB A;  1YTA A;  3H1Z A;  5KRT A;  3NH0 A;  1PZD A;  4AHC A;  5E41 A;  3JSM A;  4ROC B;  2FBX A;  1JL2 A;  1IO2 A;  1VSH A;  3WNF A;  1C0U A;  1T05 A;  4FYD A;  3DRP A;  4O44 A;  4FCY A;  3KTQ A;  2ZQB A;  3O3F A;  1J9A A;  1GOC A;  5KTQ A;  2HHS A;  4M3U A;  2OA8 A;  3V1O A;  2Z1H A;  2RF2 A;  2IV8 A;  3NF9 A;  1IH7 A;  3NBP A;  3K5L A;  3AVC A;  2QXF A;  3I0S A;  1C0M A;  1RCH A;  2ZD1 A;  4NCG A;  4KRE A;  2OYQ A;  5C25 A;  1S1U A;  3PO5 A;  1ZBL A;  1BI4 A;  1QNA A;  3T1A A;  3PUF A;  4B0A A;  4AHV A;  1ASV A;  4Q5V A;  1NOY A;  3C94 A;  2BGG A;  4OKK A;  4CIG A;  3K5M A;  3IRX A;  1MP9 A;  4KKO A;  2HHT A;  4OJR A;  1Y97 A;  3AA5 X;  3QIN A;  1L3U A;  3AA4 A;  3HST B;  4R5P A;  4C8L A;  1CXU A;  3OYM A;  4M3W A;  3QER A;  3RR7 A;  4DTX A;  5HRN A;  1LW2 A;  1RM1 A;  1KFD A;  3VQ7 A;  1YTF A;  4CE9 A;  2W42 A;  4OLB A;  2IOC A;  3OYJ A;  3TAR A;  1L3S A;  3SV4 A;  2ITG A;  5KRS A;  4XIU A;  1RT7 A;  5T7B A;  3LP2 A;  1JLG A;  1BI4 B;  1Q9Y A;  4B9N A;  2G30 A;  3S3O A;  3AV9 A;  4CJV A;  2XHB A;  3KLH A;  4N76 A;  2P51 A;  4CJ4 A;  4CEO A;  1NJX A;  3OS2 A;  1NK7 A;  4M3R A;  3OYG A;  5DMR A;  1ZBH A;  3AVA A;  2O4I A;  4FM1 A;  3QES A;  3QEW A;  3D0P A;  5SWM A;  3L2U A;  1U04 A;  3AA3 A;  3CM5 A;  3LWL A;  1S1V A;  3M8Q A;  4FW1 A;  1KTQ A;  4FK0 A;  1QNC A;  4DS5 A;  2D0A A;  3OYL A;  1S6Q A;  3NF8 A;  3NDK A;  4Z4H A;  1BCM A;  4DLE A;  1SL1 A;  3KK1 A;  1L3V A;  1HNV A;  4KTQ A;  3KK2 A;  4M42 A;  5CYM A;  1KYU A;  1QTP A;  4I2P A;  4CHO A;  4FLV A;  5J2Q A;  3TR8 A;  3LAM A;  3P1G A;  4DTS A;  3QNN A;  1BL3 A;  4Z4F A;  2Z1G A;  4N41 A;  1NOZ A;  1LW0 A;  4DTR A;  4CHY A;  1HNI A;  3QEX A;  3OJS A;  2D0B A;  4BDY A;  4DF4 A;  4DSE A;  4KB1 A;  1TBA B;  1HYZ A;  1RBU A;  1RT6 A;  3LWM A;  4K8Z A;  1B9K A;  1FK9 A;  1JXB A;  1BQN A;  2FBV A;  1NK0 A;  5JS1 A;  2G8K A;  2VWJ A;  1S9E A;  3L2V A;  3DOK A;  4IG0 A;  1D9D A;  4DTU A;  1RDC A;  3ZT2 A;  2OPQ A;  1RT3 A;  3KLE A;  2EX3 A;  2XRI A;  4JRP A;  1X9S A;  4CFD A;  1IG9 A;  2YHA A;  1QTS A;  4DQP A;  2YHB A;  4DSK A;  3ZSR A;  4CEC A;  3RRG A;  2GBZ A;  4CJW A;  1EP4 A;  4CHQ A;  2BE2 A;  3VQC A;  1QN4 A;  1EX4 A;  2YNI A;  4HUE A;  1R4X A;  3QIP A;  5DK5 A;  1SUQ A;  3A2F A;  4FXD A;  3NE6 A;  1RT5 A;  2VG6 A;  4IG3 A;  4FJH A;  4Y1C A;  1A5V A;  3VQQ A;  1AIS A;  1QN3 A;  1QHT A;  4OPJ A;  1LV5 A;  5IYC P;  3TAE A;  4F8R A;  3NH1 A;  3QEP A;  1D3U A;  4FK4 A;  1NGM A;  3ZSO A;  1NKC A;  2HVH A;  2G8I A;  4QOZ B;  1U47 A;  4OPK A;  4W5R A;  3MXM A;  2HHU A;  4ELV A;  5I42 A;  1JXE A;  4AHU A;  1S5J A;  2EHG A;  3ALY A;  3L3V A;  4OKJ A;  1IKY A;  1RTH A;  2IS3 A;  3OY9 A;  3KIO A;  1NJW A;  3ZSX A;  4FZZ A;  3I0R A;  1BQM A;  1CZ9 A;  3U3G A;  1TV6 A;  4CJR A;  4Z4I A;  2PZS A;  3HYF A;  1LWC A;  3HPO A;  4KHS A;  1HQU A;  4HVJ A;  1J54 A;  1RDA A;  4RW4 A;  3VQA A;  3PY8 A;  4PWD A;  4W5T A;  1VOK A;  1BCO A;  2QK9 A;  4JS4 A;  3EYZ A;  1UWB A;  1NK5 A;  2HHX A;  2Q3S A;  1TAQ A;  3RTV A;  3M8P A;  4RW8 A;  3HVR A;  1KLN A;  3NCI A;  1SKR A;  3DLE A;  1VSJ A;  4CIF A;  4FLX A;  3U6F A;  2RPI A;  4H4O A;  2QKK A;  3SJJ A;  4KI4 A;  4LH5 A;  3OYB A;  4CJ3 A;  3HVT A;  1KFS A;  3C6T A;  2BDP A;  3AVK A;  5HRS A;  3ZT0 A;  1BIZ A;  1UA0 A;  2HNZ A;  3S9H A;  5FRM A;  4W5N A;  2X78 A;  4B8C A;  1U4B A;  4HCC A;  1U48 A;  5J1E A;  2PYJ A;  4E7H A;  4B9S A;  1QN9 A;  1XWL A;  4FZX C;  4DQS A;  3KKR A;  3OVN A;  4CJL A;  3VA3 A;  1WAJ A;  3LPU A;  4PA1 A;  3QEV A;  3OS0 A;  1TKD A;  1EKE A;  4CF1 A;  3TAF A;  2OPR A;  2PYL A;  3HP9 A;  3PV8 A;  4O0I A;  2HND A;  1Q9X A;  2R7Y A;  3OCI A;  3PX6 A;  1SL0 A;  3K2P A;  3FFI A;  1QNB A;  3VQ5 A;  2BAN A;  4KAZ A;  1KCF A;  3KJV A;  4CHZ A;  2P1J A;  2ETJ A;  3JYT A;  1X9W A;  4FJJ A;  3MXJ A;  1DTT A;  4NYF A;  2Z8U A;  2XY5 A;  3RWU A;  4HCB A;  3V9X A;  4LD0 A;  4FJN A;  1ASU A;  5CZ1 A;  5I3U A;  3AO1 A;  3ULD A;  3OYF A;  3OYK A;  3OYI A;  4I9L A;  1VK0 A;  3LAN A;  1I39 A;  4NYN A;  1X1P A;  1YVU A;  1QE1 A;  4E7I A;  1TK8 A;  2P5O A;  2F8T A;  4KTW A;  2ZE2 A;  1KLM A;  3LP3 A;  3QET A;  1VSL A;  4CJT A;  4CF9 A;  2E6L A;  4DTM A;  4BAC A;  4DFK A;  1WSG A;  4CGF A;  1NK9 A;  4PQU A;  1QTM A;  1CDW A;  5CZ2 A;  5SZT A;  2WON A;  4C8N A;  2IDO A;  3TAQ A;  4LH4 A;  4Z0U A;  4CED A;  5J2M A; 
#chains in the Genus database with same CATH topology
 2IV9 A;  1QNE A;  1XUP O;  3HP6 A;  3G4S N;  2YKM A;  4ELU A;  4D7R A;  1PCJ X;  1RBT A;  5EPC A;  2BUP A;  4B1Y B;  1QQO A;  1ZC6 A;  3R9P A;  4CZM A;  5AQI A;  3ZET B;  3SUN A;  1RT1 A;  4PKH A;  1VQ5 N;  4KHN A;  1C6V A;  3ISN C;  4B08 A;  1U45 A;  3J7Z O;  5IYB P;  3T7Z A;  3RSM A;  3O9S A;  3TAG A;  3CWS A;  5AQL A;  5F1X A;  3CCS N;  1VRU A;  1VSE A;  3CD6 N;  3AO4 A;  4CK2 A;  3MN7 A;  4YOR A;  2EHB D;  3O1W A;  3CWT A;  3LP1 A;  3S3M A;  4GKK K;  2HZS A;  3TAM A;  3SAG A;  3IS9 A;  3OYC A;  4C7P A;  4AQY K;  3J81 O;  3L2R A;  4DSJ A;  4FK2 A;  4BE1 A;  3CM6 A;  3AGR A;  1P8Z A;  1KRP A;  4G1Q A;  3OYH A;  4KV8 A;  4BG8 A;  3OJU A;  1WSI A;  4XH5 A;  3UE5 A;  3V1Q A;  1T6C A;  2NOZ A;  3QIC A;  2P9N B;  4F4K A;  5AR0 A;  1TUO A;  3PLA A;  4EP4 A;  4DSF A;  2YHW A;  1FN7 A;  3BZC A;  4O8K A;  3ULE B;  3SQ2 A;  3DM2 A;  1X9M A;  1YJ9 N;  4CZF A;  4ILJ A;  3KK3 A;  3BUZ B;  4WE1 A;  4FLU A;  1QN7 A;  3VQP A;  4HTU A;  1J3M A;  1S1X A;  1TK5 A;  2O8F A;  1RIL A;  2I7N A;  5HBM A;  3DOL A;  2NZT A;  4M45 A;  3MX5 A;  4ZTJ A;  2HKP A;  1IBL K;  1LAW A;  4BC5 A;  3CC2 N;  4JI4 K;  4WFA L;  2QKB A;  2Y8Q A;  2B4J A;  1SKS A;  4ID5 A;  3VOV A;  1SZ2 A;  2Z0F A;  4CFC A;  1DKG D;  4RW9 A;  1NNE A;  4N56 A;  3G10 A;  3OS1 A;  2Z1I A;  1BHL A;  3TI0 A;  1C0T A;  3MEE A;  2PFU A;  3VQB A;  3RRH A;  3CCM N;  2OTL N;  1BG3 A;  4ZHR A;  1YT3 A;  3DI6 A;  2E88 A;  3KTU A;  4EJZ A;  1YI2 N;  1F21 A;  5KGX A;  1XQS C;  4Z4E A;  1VQM N;  1YUW A;  5AJ3 K;  3MEG A;  2QWR A;  1QSL A;  2HW3 A;  2NOH A;  1WLJ A;  2HHV A;  3SCX A;  5HRR A;  3I56 N;  2YX6 A;  3NF7 A;  1FKO A;  4BRH A;  2VWK A;  4E1N A;  3MX2 A;  3L8B A;  1K2Y X;  1QQM A;  3MAQ A;  3EIK A;  3O80 A;  3PDK A;  4YOT A;  3VQD A;  1XHZ A;  4YY3 K;  4WQ5 C;  2V8Q A;  3M5R A;  2CGK A;  2QXL A;  1N36 K;  1V4T A;  3RPJ A;  1JLQ A;  2V92 A;  3CC7 N;  2VWB A;  1RNH A;  3FFK B;  1Q8I A;  5KPR A;  3TWH A;  4E3S A;  4XH1 A;  4IJA A;  5K14 A;  1RDD A;  4CEQ A;  2E8A A;  2OPP A;  3AGK A;  4YFU A;  3UKR A;  4FLT A;  3WXM B;  1T03 A;  4DR5 K;  4FWM A;  3ZSZ A;  1GLL O;  1D8Y A;  3OH6 A;  2AJQ A;  4IL8 A;  4DWI A;  1E4G T;  4O4G A;  2XO7 A;  1UL7 A;  1JLF A;  1WUA A;  4CZK A;  4CGD A;  5GIO A;  4M3Z A;  5CE3 A;  1HX1 A;  4LFC K;  2WC9 A;  1HJR A;  3G25 A;  4KO0 A;  1NK4 A;  1Q81 O;  3ZSW A;  5FLX O;  5JLF A;  5KL0 A;  1MA9 B;  4CFF A;  4PUO A;  4Q0B A;  4IDK A;  5I9E B;  2KZZ A;  3KWG A;  4HTL A;  2DKD A;  4DFM A;  1WJW A;  1JKH A;  4IOA L;  2E2O A;  4KH6 A;  4PY5 A;  3N4Q A;  3V9W A;  3CIP A;  2KW4 A;  4EFH A;  5TKW A;  4R79 A;  3AO3 A;  2D1K A;  4B1Z A;  1UT4 A;  3SPZ A;  3L4Q A;  1ASW A;  2VG5 A;  4ROE B;  3PX0 A;  3HPH A;  5C42 A;  5F0X A;  4WZS D;  5AQO A;  3P4I A;  4B9T A;  2JPI A;  4EAK A;  3THW A;  5CR4 A;  4M3T A;  1XI1 A;  3SNN A;  4IJN A;  5AQQ A;  3TAB A;  4BE2 A;  4Z4C A;  2JOI A;  4QS8 A;  1YQK A;  4JI8 K;  4X64 K;  4BRP A;  3THX B;  4JKA A;  2GUI A;  2FSN A;  2X6S A;  4B3R K;  3LDQ A;  3DRS A;  3ZCM A;  2G8W A;  3V6D A;  3ZT3 A;  1L5U A;  3CMA N;  1YTU A;  5JLH A;  4CJF A;  1J5E K;  1PCM X;  3I8D A;  4C8K A;  5AQP A;  4CHP A;  4DUZ K;  4BRF A;  5BPN A;  2OZM A;  3BZK A;  1U2V A;  4B3O A;  1J5O A;  3FE1 A;  1W80 A;  1E42 A;  3H3O B;  1BIU A;  4BRM A;  3SV3 A;  1DTQ A;  3RMD A;  3UIQ A;  4ICL A;  4EIA A;  3KLF A;  3LZJ A;  1CZB A;  1VQ7 N;  1YTA A;  3CME N;  1SS6 A;  3U9D A;  1MPG A;  3C65 A;  5M1N A;  3W0L A;  5GAH P;  4CBX A;  1T6D A;  3CWU A;  1KXP A;  3WNF A;  4FYD A;  2P9S A;  2WBN A;  2HHS A;  2DKC A;  3CW7 A;  1IH7 A;  4DR2 K;  4NCG A;  5C25 A;  1YHQ N;  3CPE A;  1BUP A;  4AHV A;  3TSP A;  3HRG A;  4Q5V A;  3IRX A;  3VEV A;  2HHT A;  3QIN A;  3AA4 A;  2QTD A;  1OVY A;  3NVM A;  4XH4 A;  4DTX A;  3RR7 A;  3VQ7 A;  2W42 A;  2IOC A;  3CET A;  1L3S A;  3SV4 A;  1OH7 A;  5KRS A;  3EZW A;  3CCU N;  4CBW A;  5T7B A;  1JLG A;  1Q9Y A;  3BF1 A;  2G30 A;  2HHH K;  3AAR A;  3HSC A;  4GV6 A;  1K8K A;  4CJV A;  2P9L B;  4N76 A;  2P51 A;  3U4L A;  4CJ4 A;  3ID8 A;  5EVZ A;  4C1N K;  1ZBH A;  3AVA A;  2O4I A;  4FM1 A;  1U04 A;  3AA3 A;  5LY3 A;  1KTQ A;  1WB9 A;  1KAZ A;  4DS5 A;  4Z4H A;  1TUU A;  3KK1 A;  2QWL A;  4BGB A;  5J2Q A;  4CHO A;  4FLV A;  3TR8 A;  3K0S A;  4DTS A;  4N41 A;  1QHA A;  3OJS A;  1RBU A;  4O8U A;  3VEO A;  4WFN L;  2FBV A;  1NK0 A;  4BQZ A;  2P9U A;  5JMV D;  4JEP A;  1RDC A;  5EOY A;  2F7T A;  2EX3 A;  1IG9 A;  4DQP A;  1QTS A;  5GAE P;  1OH6 A;  4CEC A;  1GLB G;  2BE2 A;  3VQC A;  5KPZ A;  1QN4 A;  4WXA A;  4IOC L;  4HUE A;  2UXD K;  4JD2 A;  1R4X A;  5DK5 A;  4A2B A;  1Z6R A;  1RT5 A;  2WFB A;  3EKS A;  4Y1C A;  3GOI A;  1BU6 O;  1LV5 A;  2HZM A;  2FSJ A;  1VQP N;  2V52 B;  1D3U A;  2HL9 A;  1HLU A;  4QOZ B;  4ELV A;  3UB5 A;  4FWN A;  2J4R A;  1S5J A;  2EHG A;  4OKJ A;  2HST A;  4RWT A;  3CJB A;  4Z94 A;  3DPT A;  2O8E B;  1GLJ O;  4Z4I A;  3VEX A;  3HPO A;  1RDA A;  3ENO A;  4IO8 A;  4JS4 A;  1C47 A;  3NCI A;  4FWK A;  3WEE A;  4CIF A;  3SJJ A;  4CJ3 A;  3HVT A;  3C6T A;  4IOX A;  3S9H A;  4LF8 K;  4W5N A;  2X78 A;  3IFR A;  4BR0 A;  4E7H A;  1XWL A;  4BVO A;  2GWJ A;  4YOW A;  1NGF A;  4FWQ A;  4PA1 A;  1NGE A;  4CF1 A;  1JCG A;  5AQW A;  3HP9 A;  3OCI A;  1YVN A;  3NA5 A;  1G99 A;  3FFI A;  3VQ5 A;  1JCE A;  3C04 A;  5AQJ A;  4AM6 A;  3KJV A;  4RTF D;  2ETJ A;  1DTT A;  4I6M A;  3L0Q A;  4HCB A;  3J7A P;  5I3U A;  3AO1 A;  1WQA A;  1NGH A;  4IDH A;  3OYI A;  4BR5 A;  1YVU A;  4BVP A;  3H1Q A;  2F8T A;  4KTW A;  2ZE2 A;  3LP3 A;  4CF9 A;  2Y8L A;  2WTU A;  2RHK A;  3ZET A;  2NRR A;  1QQN A;  3I0W A;  2QRE A;  5J2M A;  1L3U A;  2X6N A;  3B6O A;  5AQK A;  1N32 K;  3HL8 A;  4NLB A;  3AVG A;  1HMV A;  4CD1 A;  1JCF A;  1UOC A;  1JFI C;  4KTZ A;  4CCH A;  2E1Z A;  4CF8 A;  1NGJ A;  3DLR A;  3SUQ A;  1A5W A;  3L2W A;  1RT2 A;  1KYD A;  1HR0 K;  2GWK A;  1D5A A;  1LWE A;  4BC2 A;  3LDS A;  2GX9 A;  3RMA A;  3I55 N;  4ROD B;  1A5X A;  2A41 A;  4BRN A;  4CJE A;  4KHQ A;  3EEQ A;  2NVM A;  4FJ8 A;  3ITH A;  3K57 A;  3OLP A;  1T6A A;  1B9F A;  4PL8 A;  1PCZ A;  3K5O A;  3WNG A;  1QSY A;  4DCH A;  2YH5 A;  1WSE A;  3BF3 A;  2HVI A;  2P9N A;  3NFA A;  5BPM A;  2DFF A;  3D7Q A;  3S41 A;  3KKS A;  3ULE A;  4H0Y B;  4DFJ A;  2ZGY A;  2XY6 A;  3FZL A;  1GLD G;  1UAX A;  3H46 O;  3O4N A;  1KC8 O;  4DS4 A;  3THY B;  1C0G A;  1QN8 A;  3MN5 A;  1NKB A;  5BRD A;  2W6L A;  1R0A A;  3EL2 A;  2B5J A;  3DLB A;  4YOY A;  4FM2 A;  2Q1N A;  3CCQ N;  4JRQ A;  5J2N A;  1UA1 A;  1HKB A;  1GLA G;  3VQ4 A;  2JLE A;  4BR7 A;  4DR7 K;  3NGZ A;  5GAG P;  2QEX N;  5AN4 A;  4GV3 A;  3NVK A;  1WSF A;  3OYE A;  4E0D A;  2RN2 A;  4JKE A;  4YDU C;  3AVM A;  4BWM A;  3CFR A;  4CW7 B;  3TSU A;  4DTO A;  4A62 A;  5CHI A;  1S1T A;  3O5B A;  4O5B A;  4FO0 A;  4KHP K;  5M1P A;  3GBT A;  4DMN A;  3F5T A;  3IG1 A;  3R6M A;  3EN9 A;  2VGM A;  5AQF A;  3CXC M;  3QNO A;  5E26 A;  1O1W A;  1W97 L;  3MXI A;  2KQ2 A;  1XC9 A;  1JLE A;  4E1M A;  3D2F B;  1SL2 A;  4YOV A;  1E4F T;  3ZSY A;  3SMS A;  3SJH A;  1QS4 A;  1LCU A;  4CVN E;  4W5O A;  3TTC A;  4DQI A;  4DTP A;  2OTJ N;  5FRO A;  3CYM A;  4J2D A;  1NGD A;  4KFB A;  4QAG A;  2RKI A;  5KPT A;  3DLH A;  1TL3 A;  3HK2 A;  4HHT A;  2HBL A;  3AVL A;  4CJK A;  1J53 A;  3SQ4 A;  3E01 A;  3QBX A;  3VQE A;  4Y1D A;  3DXM B;  4JN4 A;  2NOF A;  1TVR A;  4BR2 A;  3OYA A;  5B8H A;  4I2Q A;  4GVM A;  1J6Z A;  4K25 A;  2D0P A;  5BRE A;  3SUO A;  2H4L X;  5BRH A;  4RG8 A;  4XEI A;  2KFZ A;  2H3G X;  1KVA A;  1SQK A;  1JJ2 M;  3O9Q A;  2DPN A;  2YNH A;  1ATS A;  4JI3 K;  3DMJ A;  3PSI A;  2YHY A;  1W0H A;  4BG9 A;  1KQS M;  3D45 A;  4IBN A;  5CY4 A;  4K8X A;  2LSN A;  3U8X A;  2O8D B;  2GV9 A;  4EZ6 A;  3CPW M;  1KSP A;  4B1U B;  4H03 B;  3OSM A;  3DLL L;  1DIZ A;  1B92 A;  3DLK A;  4B9V A;  4JI7 K;  1QZ5 A;  2YA3 A;  2FGT A;  1VKL A;  1NG9 A;  3NMU A;  2XY8 A;  3L3U A;  4JLH A;  1SKW A;  2P5G A;  3SUP A;  4DSI A;  4WF9 L;  4J2A A;  2NRV A;  4CGI A;  4FM0 A;  3IUC A;  3AVJ A;  1YQM A;  3M8R A;  3PO4 A;  4FPA A;  3E1Y A;  3EZ5 A;  4C23 A;  1WSJ A;  4DV7 K;  3MEC A;  1FKP A;  1G15 A;  2DY4 A;  2QWP A;  3F9M A;  1VQN N;  1T7P A;  2PY5 A;  2IVP A;  3DRR A;  2Q97 A;  1RBR A;  4LF4 K;  2KFN A;  4KB0 A;  1N33 K;  3G71 N;  3FR0 A;  2HMI A;  4YOX A;  3WNE A;  1S1W A;  3V81 A;  1C4G A;  1X3M A;  3O3G A;  3THX A;  4PL7 A;  3QFU A;  4RW7 A;  3W3D A;  3F73 A;  3ZX0 A;  4FVU A;  3OSE A;  1I3A A;  3VN5 A;  1JDY A;  3ENC A;  4JHD B;  4DU3 A;  1HNW K;  3C95 A;  4BRO A;  1RTJ A;  4FLY A;  4DSL A;  2HB5 A;  4JKB A;  4EAI A;  1TKZ A;  3K9J A;  5BR9 A;  5M1F A;  4HWI A;  4H0X B;  3AVH A;  3CHW A;  1OKJ A;  4H5W A;  1GOA A;  5M1K A;  4JI1 K;  1CZA N;  2O3O A;  2D4W A;  4CEZ A;  1IBK K;  4CF2 A;  2YKN A;  3NH2 A;  1TAU A;  3T19 A;  4JS5 A;  3AA2 A;  3SQ1 A;  3AVI A;  5KI6 A;  1HPZ A;  1ZBU A;  4LSL A;  2HBM A;  4FZY A;  2PBD A;  3O8M A;  4HUG A;  2NRW A;  3KK7 A;  4FWS A;  2ITM A;  1K9M O;  2ZJR L;  1TKT A;  1NU0 A;  4DV5 K;  5A2Q O;  5E41 A;  3JSM A;  4ROC B;  2FBX A;  4GVE A;  1JL2 A;  2VCP A;  3C6H A;  4H0V B;  1IO2 A;  1C0U A;  3DRP A;  2NWV A;  5AQH A;  4DKW A;  3O3F A;  4Q11 A;  2OA8 A;  2Z1H A;  1MDU B;  1M90 O;  2RF2 A;  2IV8 A;  2V7Z A;  2A40 A;  1Q7Y O;  4DR4 K;  2IVO A;  2QXF A;  2F4V K;  3QBW A;  3I0S A;  2EWS A;  2NRT A;  2ZD1 A;  3VF2 A;  3PO5 A;  4BRE A;  4BRD A;  1QNA A;  3T1A A;  4QCL A;  1NOY A;  1ASV A;  3C94 A;  3K5M A;  2P9L A;  3OGD A;  4LF6 K;  4OJR A;  2GEM A;  3HST B;  1LOT B;  3CC4 N;  3OYM A;  4IEE A;  5EX5 A;  5HRN A;  5EXW A;  2ITG A;  3LP2 A;  4JI2 K;  3MWT A;  4CEO A;  3OS2 A;  4HJH A;  4M3R A;  1BA0 A;  5DMR A;  3OYG A;  3QEW A;  5SWM A;  3M8Q A;  4FW1 A;  2F7L A;  4FK0 A;  5LMU K;  1S6Q A;  3NF8 A;  3NDK A;  5EY4 A;  1TYQ A;  3I0X A;  5GIP A;  5CYM A;  3JXU A;  1QTP A;  3P1G A;  3HBT A;  2Z1G A;  3SK3 A;  4BY9 C;  2HMP A;  1HNI A;  3QEX A;  2YHX A;  1VHX A;  1JXB A;  3DPU A;  4KH4 A;  2F9W A;  2G8K A;  1E3M A;  3LL3 A;  2QW9 A;  4JKD A;  4YOU A;  1LWW A;  4WQ4 A;  3ZT2 A;  4DV0 K;  2OPQ A;  1RT3 A;  4X62 K;  4CFD A;  2YHA A;  4B1V A;  4QS9 A;  5AQZ A;  2AA4 A;  4BRL A;  1S72 N;  4F9O A;  5GIN A;  4B1W B;  2NRH A;  2NOI A;  2GBZ A;  3SBT A;  4CHQ A;  3CCR N;  1EX4 A;  2YNI A;  2CGL A;  4DV3 K;  2O8E A;  3NE6 A;  1W2B M;  4FJH A;  3CVS A;  5HL7 L;  3CJ1 A;  1AIS A;  1QHT A;  5IYC P;  3TAE A;  3D7E O;  1OH8 A;  3BY5 A;  3QEP A;  2A3Z A;  4JAX A;  3DWL A;  2G8I A;  4LFA K;  3A5L C;  3TDH A;  4OPK A;  3MXM A;  4AHU A;  3LDO A;  4UY8 O;  1LXT A;  1CZ9 A;  3HYF A;  2OAN A;  1LWC A;  4KHS A;  1HQU A;  4HVJ A;  3VQA A;  4PWD A;  1VOK A;  1BCO A;  1KAY A;  2QK9 A;  3EYZ A;  3RTV A;  3M8P A;  1SKR A;  3PIO L;  2QKK A;  4FLX A;  4H4O A;  4DUY K;  4EAL A;  3ZT0 A;  1BIZ A;  5FRM A;  5DM7 L;  4B8C A;  3VGK A;  3ATV A;  5AQN A;  2PYJ A;  2RE2 A;  4B9S A;  1SAZ A;  2FUV A;  5FPN A;  1NLV A;  4CJL A;  4CZJ A;  2P9I B;  1WAJ A;  1TKD A;  3OS0 A;  1EKE A;  3TAF A;  4DB3 A;  4O0I A;  1SL0 A;  4ZTF A;  2LAE A;  3K2P A;  3F2K A;  5LL6 Z;  4EHU A;  3T1H K;  2P1J A;  3JYT A;  1VQ4 N;  1M3Q A;  3RWU A;  4LD0 A;  4MRQ A;  4A59 A;  3ULD A;  4JK9 A;  4I9L A;  3ULX A;  1EO1 A;  4ISF A;  3KHY A;  1H1V A;  4WYB A;  1KLM A;  1YIJ N;  4GKJ K;  4DTM A;  4PQU A;  4AF1 A;  5FPM A;  5SZT A;  2WON A;  2IDO A;  3Q7C A;  2ZGZ A;  3EY1 A;  3TAP A;  4UQG A;  4BRK A;  2HBJ A;  1RDU A;  1TKX A;  2HHQ A;  1XNQ K;  1NMN A;  1RBV A;  2XY7 A;  4A5A A;  3BGR A;  3SBG A;  4L8R B;  2MZ8 A;  2V9J A;  4QS7 A;  3E9P A;  2HBK A;  1ZBI A;  3VEY A;  2FKM X;  1TGH A;  1KVB A;  4B9L A;  4ELT A;  4NXM K;  3ZT1 A;  1QSS A;  4MDB A;  2YNF A;  2QLV A;  2W41 A;  4AHS A;  4IFY A;  1BA1 A;  1KAX A;  1W9H A;  4GW6 A;  4OPA A;  1RTI A;  2A1R A;  4C8M A;  3O9U A;  3THY A;  2DTU A;  3P38 A;  1EUV A;  3L2Q A;  1HJO A;  2YCH A;  4M63 C;  5C0Y A;  1TYQ B;  3WXK A;  5BN9 A;  4GY2 B;  2O8B B;  3LM9 A;  4E7K A;  4O0J A;  1QN5 A;  2YJE A;  4LF5 K;  5FPE A;  1VSF A;  1N3C A;  4WCE L;  4DG1 A;  4ID1 A;  1VAZ A;  3F0Z A;  1L3T A;  3LPT A;  4DTJ A;  4Y0W A;  1DEJ A;  4D7Q A;  4CEE A;  4GNI A;  4CK3 A;  2Y1J A;  4J8F A;  1N8R O;  2QM1 A;  1NJI O;  4CES A;  5E84 A;  1LWF A;  1ZYQ A;  4H4M A;  2D0C A;  2NNW A;  2DFH A;  1C1B A;  5D3G A;  1EBM A;  1VSK A;  2NRZ A;  3ENH A;  1XC3 A;  3VQ9 A;  5C2D A;  4BDZ A;  1NM1 A;  3RSE B;  2NLX A;  3OHR A;  1HRH A;  3QO9 A;  4EHT A;  4F3T A;  4FJL A;  3CJA A;  4I9Q A;  2Q0R A;  3C0B A;  3OC3 C;  2G8V A;  5AZJ B;  3KD1 E;  3FZM A;  3GG4 A;  2FC0 A;  3T1Y K;  2DKA A;  4CGJ A;  2KKZ A;  3QIO A;  4FJI A;  1MU2 A;  3CCL N;  3ENO C;  2P9K B;  1IG8 A;  2E5L K;  1C1C A;  2UXC K;  3D2F A;  3B6P A;  1B9D A;  3KLI A;  1Q82 O;  3HM8 A;  4ILG B;  2KZM A;  4GV9 A;  4CFB A;  2JGU A;  2IC3 A;  4IKF A;  3CG7 A;  3MCP A;  1D4X A;  2E1Y A;  1P5G X;  3P5J A;  4Z4G A;  1Q18 A;  4CJU A;  4M41 A;  1ATR A;  2Q31 A;  1NKE A;  1BIS A;  4B3T K;  4CZI A;  2FSK A;  1TGO A;  3WXI A;  2HNY A;  3FLC O;  3DXM A;  4DV6 K;  2G8F A;  2GUP A;  3MN9 A;  2YNG A;  1SV5 A;  4FLW A;  3SPY A;  1VSD A;  5EU7 A;  1YTB A;  5BN8 A;  5KGW A;  4CJQ A;  4V19 S;  3J8A A;  2VQE K;  2JWL A;  4MO4 A;  4CD3 A;  3HO1 A;  3CFO A;  1NMD A;  4OGC A;  3CQ8 A;  1BGX T;  3K58 A;  3SYZ A;  3ENB A;  4E89 A;  2W40 A;  1WNS A;  3OST A;  4M7Y A;  3VF6 A;  3ZSV A;  2O8D A;  3SI6 A;  4B1X B;  4NB4 A;  2QRC A;  3G0Z A;  3FZF A;  3RMC A;  4JK8 A;  4CHN A;  1KY7 A;  4IFV A;  5JIC A;  2B6A A;  3O3H A;  2OCE A;  1N6Q A;  3UW2 A;  4DU4 A;  1KO9 A;  4A2A A;  2R5X A;  3LAL A;  3SQ0 A;  4N5S A;  2QI2 A;  4ISE A;  1CLQ A;  2DFE A;  4FJ7 A;  4MQ3 A;  4LF9 K;  3QDK A;  1WAF A;  3WXJ A;  2MJ7 A;  3CJ9 A;  3FGU A;  3IH7 A;  5AZI B;  3V1R A;  3VMF B;  1RGI A;  2UUB K;  1QN6 A;  5J2P A;  3IDH A;  5FRN A;  4EJY A;  4E7L A;  4F2S A;  4KHW A;  1KD1 O;  5KQD A;  3IMX A;  4DV2 K;  1EXQ A;  2JWK A;  2OPS A;  1ESV A;  1CXQ A;  5AQG A;  3ASM A;  5DM6 L;  3NGY A;  4DV1 K;  4CJ7 A;  1VRT A;  3P83 D;  3TAN A;  5HLF A;  4CEA A;  1WBB A;  3O4Q A;  3PMG A;  1HYS A;  4LC9 B;  5AQU A;  3FZK A;  4MFB A;  4IXC A;  3LZI A;  4JHD A;  4FVM A;  2ASP A;  2VG7 A;  3LDL A;  4OVL A;  4CK1 A;  1VQ8 N;  1KFQ A;  4JKH A;  4RCH A;  4DTN A;  2CGJ A;  4FW2 A;  4CGG A;  1FXX A;  4B8A B;  3HJF A;  1BWF O;  1KYF A;  4DU1 A;  3B8A X;  4WX8 A;  1Z26 A;  3MED A;  3RMB A;  3D2E B;  4E7J A;  1KY6 A;  2ZJQ L;  3K9K A;  3DYA A;  5GAD P;  4BC3 A;  3T3F A;  1W7A A;  4BDP A;  3KZB A;  3L4I A;  4CIE A;  2IVN A;  4AH9 A;  4FJM A;  3SNS A;  2Q2R A;  4AHT A;  4GMJ B;  1ITG A;  3CF5 L;  1BO5 O;  4FJG A;  2H5A X;  3D4V A;  2E20 A;  4K43 A;  5MLC Q;  4X65 K;  3R8E A;  2KHO A;  3O9T A;  4CI6 A;  1JLA A;  5HSH A;  3GL1 A;  1N3A A;  2E4L A;  3OA9 A;  3CQX A;  2YI1 A;  4OKE A;  3K59 A;  2Y1I A;  4FJ9 A;  3LP0 A;  4MDA A;  5IYD P;  1NK6 A;  3AAP A;  1YQL A;  3NH0 A;  4AHC A;  5BPL A;  3CVT A;  1ZXO A;  3KTQ A;  2ZQB A;  5ADX H;  1J9A A;  1GOC A;  3V1O A;  2QWM A;  3NF9 A;  1HKG A;  3PIP L;  3AVC A;  1ILY A;  1C0M A;  1RCH A;  2Q0U A;  4KRE A;  2FXU A;  4DR3 K;  1HKC A;  2BGG A;  2A6A A;  2P9P B;  5JMV A;  4PKI A;  3C7N B;  2YJF A;  1DT9 A;  4OKK A;  5AQR A;  4BR9 A;  1MP9 A;  1Y97 A;  4C8L A;  4R5P A;  1CXU A;  2UUC K;  3QER A;  4JKG B;  1RM1 A;  1KFD A;  5C2F A;  4OLB A;  3OH9 A;  3TAR A;  3OYJ A;  3I8B A;  1YAG A;  4XIU A;  4K41 A;  1RT7 A;  4MLH A;  1M1K O;  4H0P A;  1BI4 B;  1PVS A;  3S3O A;  1XNR K;  3MK6 A;  1QVG M;  3HOT A;  3I33 A;  4G9Z A;  3QES A;  5JVG L;  4BGA A;  3LWL A;  3CM5 A;  1NBW A;  4K0K K;  3E66 A;  1QNC A;  5ADX A;  3TTD A;  3MN6 A;  1BCM A;  4KTQ A;  1HNV A;  3KK2 A;  4M42 A;  3UKU B;  5BMN A;  3QNN A;  3LAM A;  5ELZ A;  1NOZ A;  1LW0 A;  3VTI A;  3VER A;  4U67 L;  4BDY A;  4L3Q A;  4DSE A;  3ZEU B;  1RT6 A;  3LWM A;  3QB0 A;  4K8Z A;  4IO9 L;  5JS1 A;  2VWJ A;  2ASO A;  4BRG A;  3L2V A;  1N34 K;  3FZH A;  2I7P A;  4IG0 A;  1D9D A;  4DTU A;  1VQL N;  4H5R A;  4JRP A;  1X9S A;  2XRI A;  3SAF A;  1X9J A;  3ZX3 A;  2A42 A;  3EE8 A;  2O8C B;  4DSK A;  3ZSR A;  3RRG A;  1EP4 A;  5HOO A;  3WQT A;  1HNZ K;  4OO1 J;  1SUQ A;  2ZWH A;  3A2F A;  4FXD A;  2VG6 A;  3M3Z A;  3VQQ A;  4OPJ A;  4C1N I;  3NH1 A;  1NGM A;  3G6E N;  2HVH A;  3N4P A;  3WQU A;  4ILH A;  4W5R A;  2HHU A;  3OW2 M;  5C12 A;  5I42 A;  1JXE A;  3HI0 A;  2IS3 A;  4FZZ A;  3ZSX A;  1BQM A;  4B9Q A;  3U3G A;  4CJR A;  2VYP A;  3BKQ X;  1J54 A;  4RW4 A;  3PY8 A;  3AY9 A;  4W5T A;  5IWA K;  1NK5 A;  2HHX A;  4NXN K;  1TAQ A;  2P9I A;  2ASM A;  3DLE A;  1LWV A;  2RPI A;  4KI4 A;  4YHH K;  4LH5 A;  3OYB A;  1KFS A;  5TKY A;  2BDP A;  3AVK A;  5HRS A;  2HF4 A;  2FF3 B;  1U4B A;  1NGA A;  1U48 A;  1BDG A;  1QN9 A;  5LJW A;  4H5N A;  3KKR A;  1P90 A;  3SAH A;  2FLO A;  2PYL A;  3PV8 A;  1Q9X A;  1Q9U A;  1YXQ A;  3DXK B;  4EAJ A;  3VEN A;  4CHZ A;  5C15 A;  1X9W A;  4NYF A;  2OOX A;  1WOQ A;  2Z8U A;  2UYT A;  2XY5 A;  1ASU A;  1NGC A;  2F9T A;  2CH6 A;  4FWR A;  2JHJ A;  1VK0 A;  3LAN A;  4NYN A;  3VGL A;  1X1P A;  1Z05 A;  4E7I A;  2P5O A;  5M1O A;  3QET A;  1VSL A;  4WQ5 A;  4DFK A;  4BR4 A;  3CI5 A;  1QTM A;  1CDW A;  4C8N A;  3TTF A;  1K35 A;  4H0O A;  4LH4 A;  3JAM O;  4CED A;  4M7X A;  5AFU H;  3KD5 E;  4DQQ A;  2QA4 N;  2PWW A;  4OGE A;  3QFP A;  3DAW A;  2JHN A;  4DR1 K;  4B3S K;  2WOM A;  3O4W A;  2G8H A;  3OYN A;  4C8O A;  3BDP A;  3CCV N;  1Y64 A;  1VQO N;  2ZM6 K;  3LM2 A;  3WXL A;  4H0T B;  4RW6 A;  1QVF M;  1S22 A;  4IFE A;  1U49 A;  3V9Z A;  2IAJ A;  1VTO A;  4O5F A;  3R3L A;  2O8B A;  4IWV A;  4J2E A;  3AO5 A;  4E19 A;  4NCA A;  3F10 A;  1EET A;  2VJ0 A;  3CCE N;  1MWK A;  1N39 A;  2QWN A;  2OZS A;  2HOE A;  1GOB A;  1NJY A;  3A5N C;  3AVF A;  2GTD A;  4KHU A;  4JI5 K;  1KVC A;  4WQ4 C;  3H45 C;  3DLG A;  5AQV A;  5AFU A;  4AIL C;  4MLE A;  4CER A;  4OLA A;  1LAV A;  5F2R A;  1U6Z A;  1XHX A;  3RSE A;  3HXM A;  1K6Y A;  3VA0 A;  4KBO A;  4CF0 A;  2NOE A;  3H6E A;  4O55 A;  5AZJ A;  1IBM K;  1DLO A;  3RR8 A;  1C1A A;  4DQ8 A;  2VQF K;  4A61 A;  1OVQ A;  1R59 O;  2P9K A;  3M8S A;  1HQE A;  5BMP A;  1V5S A;  2W6K A;  3CJC A;  3HS8 A;  1RT4 A;  2BTF A;  2UXB K;  2QWQ A;  1FJG K;  3VQ6 A;  1YJW N;  1T8E A;  4CGH A;  1D9F A;  4A5B A;  4A57 A;  3EKU A;  4H5V A;  4LY7 A;  5CYQ A;  2WUS A;  4H5T A;  2V51 B;  4KI6 A;  4BRC A;  3V9U A;  3Q7B A;  5LMN K;  3E9L A;  1NVP A;  2E2N A;  4JYA K;  2O8F B;  1JLC A;  3O6W A;  2I5J A;  2NOL A;  4CZE A;  1RTD A;  1IKX A;  3IAY A;  1IKV A;  3AO2 A;  4H8K A;  4DFP A;  1KFI A;  4LFB K;  3V4I A;  2Z1J A;  3S3N A;  4I8O A;  3U3Y A;  1Z25 A;  1NJZ A;  4CZG A;  4FL9 A;  4BJU A;  5HRP A;  5LJV A;  5HRO A;  3CFP A;  3THV A;  5H1S Q;  1ZBF A;  3AVB A;  3ZLJ A;  1IKW A;  4M3X A;  2O4G A;  3ZSQ A;  1GLE G;  4BWJ A;  3HS9 A;  3VQ8 A;  2A1S A;  1EWQ A;  3LDP A;  4FPB A;  5F9C A;  1XMQ K;  4LF7 K;  1VSM A;  2A5X A;  3KLG A;  2X74 A;  4TPS A;  1IV0 A;  3ZT4 A;  3T4N A;  5FDL A;  2I5W A;  2UUA K;  3A5O C;  5C24 A;  3NGI A;  3LAK A;  4NCB A;  3F9K A;  1VOL B;  1HYV A;  1TL1 A;  3HZ6 A;  4FSV A;  1N5Y A;  4KRF A;  3KWI A;  2F96 A;  1TBP A;  3AVN A;  1EWR A;  1UT7 A;  2E2P A;  2OOY A;  4CJP A;  2KLA A;  2NUB A;  3LDN A;  3HT3 A;  3EE9 A;  3VF4 A;  1QZ6 A;  4LSN A;  1NH2 A;  3NAE A;  2XHI A;  4CBU A;  4DQR A;  1RDB A;  3R1X A;  3MMV A;  3NHG A;  3SZ2 A;  3A8Y A;  1S3X A;  3ZYY X;  3QLH A;  1VTL E;  4EAH D;  5AZI A;  2QWO A;  3J80 O;  4FWP A;  3ZX2 A;  1V4S A;  1XMO K;  3N89 A;  3AAQ A;  3WNH A;  4B3M K;  5M1Q A;  4BE0 A;  4DLG A;  3TU5 A;  2Q36 A;  4IZ9 A;  1QQC A;  2YV0 X;  4B9U A;  5AQT A;  4KH5 A;  2FF6 A;  4N47 A;  1IJJ A;  4JI6 K;  1WN7 A;  2FBY A;  4AHR A;  5JS2 A;  4KPY A;  3UKR B;  4JKF A;  3TPQ A;  4EP5 A;  3C6U A;  3KRM A;  4M3Y A;  5FPD A;  5KQ8 A;  3WT0 A;  3L6Q A;  2AP1 A;  2HL8 A;  4CJS A;  4BRQ A;  4TSX A;  1WSH A;  3OBW A;  4DV4 K;  1FW6 A;  2UU9 K;  1VSI A;  4F3O A;  2BH1 A;  4W5Q A;  4DF8 A;  4YNQ A;  4F2R A;  5AQY A;  1NGI A;  2HF3 A;  1TK0 A;  3CER A;  1C0F A;  2G8U A;  3HPG A;  1NGG A;  3HTV A;  2KTQ A;  2IGI A;  1HU0 A;  3VEW A;  4FLZ A;  3D2E A;  4I7F A;  3VGM A;  2E6M A;  3V9S A;  1GLC G;  2FBT A;  3P39 A;  4EAG A;  2ZF5 O;  3O9R A;  4BRI A;  4NLC A;  4FWL A;  4CJ5 A;  4B9M A;  3I3W A;  2F8S A;  3RVC A;  1S6P A;  3K5N A;  1JLB A;  4FJX A;  4CFA A;  4FWO A;  3OYD A;  2D5R A;  2QR1 A;  3HM9 A;  1REV A;  3CCJ N;  3KVG A;  5HP1 A;  3PSF A;  3QEI A;  4EZ9 A;  2E2Q A;  1YF5 L;  4HUF A;  2ATQ A;  3THW B;  1NK8 A;  1BOT O;  4CEF A;  4CZL A;  2HHW A;  1GLF O;  4CEB A;  4J2B A;  1YIT N;  1C9B B;  3PX4 A;  3M6G A;  3A5M C;  3MDQ A;  4JNE A;  3GDQ A;  3H3N O;  3VES A;  3NF6 A;  1RBS A;  1S9G A;  1ZBS A;  1T44 A;  4KHY A;  4OPH A;  4FJK A;  2ZJP L;  1MWM A;  3H08 A;  4FJ5 A;  4PKG A;  1JL1 A;  3H1Z A;  5KRT A;  1PZD A;  4JI0 K;  4AM7 A;  1HUX A;  4DHY A;  5AQM A;  1VSH A;  4U7B A;  2P9P A;  5C10 A;  1T05 A;  3C7N A;  1ATN A;  4O44 A;  4FCY A;  1U2V B;  5KTQ A;  4E1J A;  1K8A O;  4M3U A;  4JV5 K;  4OX9 K;  3GE1 A;  3ID6 A;  1K73 O;  4JKG A;  3NBP A;  4JK7 A;  3K5L A;  4NO7 A;  1X3N A;  1LWY A;  2OYQ A;  2PAV A;  3SLC A;  1S1U A;  1ZBL A;  1BI4 A;  1EQY A;  2D0O A;  3PUF A;  4B0A A;  3D6R A;  2P9S B;  4CIG A;  5AQX A;  1HPM A;  4KKO A;  3AA5 X;  3TSQ A;  4M3W A;  3MCA B;  3MWP A;  1LW2 A;  4CE9 A;  1YTF A;  1HNX K;  5IT9 O;  3DJC A;  2V7Y A;  4B9N A;  1P5D X;  4DR6 K;  3VPZ A;  3AV9 A;  2XHB A;  3KLH A;  3UKU A;  2GEL A;  2QRD A;  1NJX A;  1NK7 A;  2NOB A;  3E9O A;  3O1B A;  3ZEU A;  3D0P A;  1NWK A;  3L2U A;  1S1V A;  4FOI A;  3VTH A;  5JVH L;  2D0A A;  2FKF A;  3OYL A;  1L3V A;  1SL1 A;  4DLE A;  3OBY A;  1XSZ A;  1K8K B;  3WUH A;  1KYU A;  1VQ9 N;  4I2P A;  4Z4F A;  1BL3 A;  4BC4 A;  1I94 K;  4BRA A;  3CJ7 A;  3M1F A;  4DTR A;  4CHY A;  1OH5 A;  2D0B A;  4MO5 A;  4DF4 A;  4KB1 A;  2NRX A;  1TBA B;  1HYZ A;  2O8C A;  1B9K A;  1FK9 A;  3T69 A;  1BQN A;  3O08 A;  2VGN A;  1S9E A;  3IKM A;  3DOK A;  4FOE A;  5AQS A;  3A0I X;  1YQR A;  3KLE A;  3HOS A;  4BQL A;  2YHB A;  1VQ6 N;  4X66 K;  4CJW A;  3EAY A;  3C6A A;  3QIP A;  2IIR A;  1O13 A;  2P9U B;  4IG3 A;  1A5V A;  2ZFD B;  2NLV A;  1QN3 A;  1RDW X;  3VET A;  4F8R A;  4FK4 A;  3ZSO A;  1NKC A;  3QML A;  4WFB L;  1U47 A;  4YDU A;  3J7Y P;  4JKC A;  3ALY A;  3L3V A;  3U9Z A;  1IKY A;  1RTH A;  3OY9 A;  1NJW A;  3KIO A;  4JD2 B;  3I0R A;  1T3V A;  1TV6 A;  5BRF A;  4ISG A;  2PZS A;  3H1V X;  1UWB A;  2Q3S A;  1M3H A;  4RW8 A;  4K42 A;  3HVR A;  1KLN A;  3SMP A;  1RFQ A;  1VSJ A;  4PHT X;  3U6F A;  5JN5 A;  1VQK N;  1TUY A;  4IEI A;  3VEZ A;  4CZH A;  3P31 A;  1UA0 A;  2HNZ A;  3DXK A;  3JS6 A;  1DGK N;  4HCC A;  5J1E A;  1NGB A;  3OTO K;  4FZX C;  4DQS A;  3OVN A;  5BR8 K;  3VA3 A;  1YJN N;  3LPU A;  3QEV A;  3WEE B;  2OPR A;  2HND A;  2R7Y A;  3PX6 A;  1QNB A;  2BAN A;  4KAZ A;  1KCF A;  3BEX A;  3EO3 A;  4FJJ A;  3MXJ A;  3V9X A;  4FJN A;  5CZ1 A;  3TE5 A;  3OYF A;  1Q86 O;  3OYK A;  1I39 A;  3ATU A;  1QE1 A;  1TK8 A;  2CH5 A;  4CJT A;  3CQY A;  2E6L A;  4BAC A;  1WSG A;  4CGF A;  1NK9 A;  3BP8 A;  3CWA A;  4I6M B;  5CZ2 A;  4DUL A;  1WBD A;  1M5Q 1;  3TAQ A;  4Z0U A;  4QG5 A; 
#chains in the Genus database with same CATH homology
 2IV9 A;  4DQQ A;  3EY1 A;  3TAP A;  2X6N A;  3B6O A;  4UQG A;  4OGE A;  1QNE A;  1TKX A;  3HL8 A;  3HP6 A;  3AVG A;  2HHQ A;  1HMV A;  2YKM A;  4ELU A;  1RBV A;  1RBT A;  2XY7 A;  2WOM A;  1UOC A;  3BGR A;  3OYN A;  1JFI C;  4KTZ A;  2G8H A;  4CCH A;  4C8O A;  4L8R B;  3BDP A;  4CF8 A;  2MZ8 A;  3DLR A;  3SUQ A;  1A5W A;  3L2W A;  1RT2 A;  1KYD A;  4RW6 A;  1ZBI A;  1D5A A;  1LWE A;  3LDS A;  3SUN A;  3RMA A;  1RT1 A;  4ROD B;  1A5X A;  1TGH A;  1KVB A;  4KHN A;  1U49 A;  4CJE A;  4B9L A;  4ELT A;  4KHQ A;  1C6V A;  3ISN C;  3ZT1 A;  4B08 A;  3V9Z A;  2IAJ A;  1QSS A;  1VTO A;  2YNF A;  3ITH A;  3K57 A;  1U45 A;  4FJ8 A;  4AHS A;  5IYB P;  4J2E A;  4IFY A;  1B9F A;  3AO5 A;  1PCZ A;  1W9H A;  3K5O A;  4GW6 A;  4E19 A;  3WNG A;  1RTI A;  1VRU A;  3TAG A;  4NCA A;  1VSE A;  3F10 A;  2A1R A;  3AO4 A;  1EET A;  4C8M A;  4CK2 A;  1QSY A;  2VJ0 A;  2DTU A;  2YH5 A;  1WSE A;  3L2Q A;  1N39 A;  2OZS A;  3LP1 A;  3S3M A;  2HVI A;  3NFA A;  2HZS A;  3TAM A;  3IS9 A;  1GOB A;  2DFF A;  3OYC A;  1NJY A;  3L2R A;  3KKS A;  4DSJ A;  4FK2 A;  3AVF A;  3CM6 A;  4BE1 A;  1KRP A;  4DFJ A;  2XY6 A;  4G1Q A;  4E7K A;  4O0J A;  1QN5 A;  1UAX A;  3O4N A;  4KHU A;  3OYH A;  1VSF A;  4DS4 A;  1N3C A;  1KVC A;  4KV8 A;  3OJU A;  1WSI A;  4DG1 A;  4ID1 A;  3DLG A;  4AIL C;  1QN8 A;  3V1Q A;  2NOZ A;  1NKB A;  4CER A;  4OLA A;  3F0Z A;  1LAV A;  1L3T A;  3LPT A;  1XHX A;  4DTJ A;  4F4K A;  1R0A A;  3HXM A;  1K6Y A;  4EP4 A;  4DSF A;  4CEE A;  4CK3 A;  3VA0 A;  2Y1J A;  1FN7 A;  4QCL A;  2B5J A;  4CF0 A;  3DLB A;  2NOE A;  4FM2 A;  4O55 A;  4CES A;  3SQ2 A;  1DLO A;  4JRQ A;  3DM2 A;  5J2N A;  1UA1 A;  1X9M A;  3RR8 A;  1LWF A;  1ZYQ A;  4H4M A;  1C1A A;  3VQ4 A;  3KK3 A;  2D0C A;  2JLE A;  4WE1 A;  3SPY A;  2DFH A;  1C1B A;  5D3G A;  3M8S A;  1EBM A;  3NGZ A;  1QN7 A;  3VQP A;  1HQE A;  4HTU A;  1VSK A;  4FLU A;  5AN4 A;  3VQ9 A;  1S1X A;  4BDZ A;  1TK5 A;  3HS8 A;  1RIL A;  1RT4 A;  1WSF A;  5HBM A;  4M45 A;  3DOL A;  1HRH A;  3QO9 A;  2RN2 A;  3OYE A;  4E0D A;  4FJL A;  3VQ6 A;  4I9Q A;  4F3T A;  4ZTJ A;  1T8E A;  4CGH A;  3AVM A;  1D9F A;  3OC3 C;  1LAW A;  4BWM A;  2G8V A;  3KD1 E;  2FC0 A;  4CGJ A;  4LY7 A;  3CFR A;  2QKB A;  5CYQ A;  2B4J A;  3QIO A;  4KI6 A;  4FJI A;  3V9U A;  1SKS A;  4DTO A;  4ID5 A;  1MU2 A;  1S1T A;  1NVP A;  1C1C A;  4O5B A;  3B6P A;  4CFC A;  1B9D A;  3KLI A;  4RW9 A;  1JLC A;  2I5J A;  4N56 A;  2NOL A;  3G10 A;  4DMN A;  3OS1 A;  3IG1 A;  2KZM A;  1RTD A;  1IKX A;  4CFB A;  2Z1I A;  3IAY A;  1BHL A;  2JGU A;  1IKV A;  2IC3 A;  3TI0 A;  1C0T A;  3AO2 A;  3CG7 A;  3MEE A;  4H8K A;  3QNO A;  1O1W A;  4DFP A;  4IKF A;  3P5J A;  3MXI A;  4Z4G A;  3VQB A;  4CJU A;  3RRH A;  4M41 A;  3V4I A;  2KQ2 A;  1XC9 A;  1NKE A;  2Z1J A;  4ZHR A;  3S3N A;  1BIS A;  4I8O A;  1JLE A;  1YT3 A;  3DI6 A;  4E1M A;  3KTU A;  3U3Y A;  4EJZ A;  1Z25 A;  1NJZ A;  1SL2 A;  3ZSY A;  5HRP A;  1F21 A;  5KGX A;  1TGO A;  4W5O A;  1QS4 A;  3CFP A;  2HNY A;  5HRO A;  3THV A;  2G8F A;  1ZBF A;  3AVB A;  4DTP A;  4DQI A;  1IKW A;  4M3X A;  5FRO A;  4Z4E A;  2O4G A;  3CYM A;  2YNG A;  3ZSQ A;  4J2D A;  3MEG A;  4BWJ A;  1SV5 A;  3HS9 A;  4KFB A;  2A1S A;  3VQ8 A;  4QAG A;  4FLW A;  1VSD A;  2RKI A;  1YTB A;  5EU7 A;  1TL3 A;  5KGW A;  1VSM A;  4CJQ A;  3KLG A;  2X74 A;  4TPS A;  1QSL A;  2NOH A;  5FDL A;  3ZT4 A;  2I5W A;  1WLJ A;  3HK2 A;  4HHT A;  3SCX A;  3AVL A;  5C24 A;  5HRR A;  4CJK A;  3NGI A;  1J53 A;  2HHV A;  3LAK A;  3SQ4 A;  4NCB A;  3E01 A;  3F9K A;  1VOL B;  1FKO A;  3NF7 A;  3CFO A;  3VQE A;  1HYV A;  1TL1 A;  3HO1 A;  1N5Y A;  2VWK A;  4OGC A;  1BGX T;  4E1N A;  4Y1D A;  3K58 A;  3CQ8 A;  3SYZ A;  3L8B A;  4E89 A;  4KRF A;  2NOF A;  1TVR A;  3OYA A;  3M8R A;  4ZTF A;  4I2Q A;  2F96 A;  1TBP A;  3EIK A;  1WNS A;  3AVN A;  4GVM A;  3MAQ A;  1UT7 A;  3SUO A;  4RG8 A;  3VQD A;  3OST A;  1XHZ A;  2KFZ A;  1KVA A;  3ZSV A;  4CJP A;  2NUB A;  3HT3 A;  3SI6 A;  3RPJ A;  1JLQ A;  4LSN A;  1NH2 A;  3NAE A;  2XHI A;  2YNH A;  1RNH A;  4DQR A;  3DMJ A;  3G0Z A;  1Q8I A;  1RDB A;  3TWH A;  4E3S A;  3RMC A;  5K14 A;  1W0H A;  4CHN A;  3NHG A;  1KY7 A;  1RDD A;  3D45 A;  4IFV A;  4CEQ A;  2OPP A;  3SZ2 A;  2B6A A;  3QLH A;  4IBN A;  5CY4 A;  1VTL E;  2LSN A;  4YFU A;  4K8X A;  4FLT A;  2GV9 A;  3O3H A;  1N6Q A;  1T03 A;  3N89 A;  3WNH A;  4EZ6 A;  3ZSZ A;  1D8Y A;  1KSP A;  4BE0 A;  4DLG A;  3OSM A;  4DU4 A;  2AJQ A;  2HW3 A;  1QQC A;  1KO9 A;  1B92 A;  2YV0 X;  4B9U A;  3LAL A;  3DLK A;  3DLH A;  4DWI A;  4N47 A;  4B9V A;  3SQ0 A;  4N5S A;  4O4G A;  2FGT A;  1WN7 A;  2FBY A;  2DFE A;  4AHR A;  2XY8 A;  2XO7 A;  4MQ3 A;  3L3U A;  4FJ7 A;  1CLQ A;  1WAF A;  2MJ7 A;  1JLF A;  5JS2 A;  4KPY A;  4JLH A;  1SKW A;  4CGD A;  2P5G A;  3IH7 A;  3V1R A;  4M3Z A;  3SUP A;  1QN6 A;  5J2P A;  4DSI A;  4EP5 A;  3C6U A;  5FRN A;  4J2A A;  3KRM A;  4M3Y A;  4EJY A;  4E7L A;  1HJR A;  4F2S A;  4KHW A;  4CGI A;  4KO0 A;  4FM0 A;  1NK4 A;  3AVJ A;  1YQM A;  3ZSW A;  4CJS A;  1EXQ A;  4TSX A;  1WSH A;  3PO4 A;  2OPS A;  3EZ5 A;  1CXQ A;  1VSI A;  3ASM A;  1WSJ A;  4F3O A;  4W5Q A;  3MEC A;  3NGY A;  1FKP A;  4YNQ A;  4DF8 A;  1G15 A;  4F2R A;  1VRT A;  3P83 D;  4IDK A;  3TAN A;  4PUO A;  4Q0B A;  2DY4 A;  5HLF A;  1T7P A;  2PY5 A;  4CEA A;  3DRR A;  2KZZ A;  3O4Q A;  1RBR A;  1TK0 A;  2G8U A;  1HYS A;  2KFN A;  3HPG A;  4KB0 A;  4MFB A;  2IGI A;  2KTQ A;  1HU0 A;  4DFM A;  3LZI A;  4FLZ A;  4FVM A;  1JKH A;  4I7F A;  2E6M A;  3V9S A;  2VG7 A;  2HMI A;  4OVL A;  4CK1 A;  2FBT A;  3WNE A;  4PY5 A;  1S1W A;  3V9W A;  3V81 A;  3KD5 E;  2KW4 A;  3O3G A;  4DTN A;  3AO3 A;  4FW2 A;  1UT4 A;  3SPZ A;  4RW7 A;  1FXX A;  4CGG A;  1ASW A;  2VG5 A;  4ROE B;  4CJ5 A;  3HPH A;  4B8A B;  5C42 A;  4WZS D;  3F73 A;  3PX0 A;  3HJF A;  1I3A A;  1KYF A;  4B9M A;  4B9T A;  3VN5 A;  4DU1 A;  2F8S A;  1Z26 A;  4M3T A;  1XI1 A;  3MED A;  3RMB A;  3SNN A;  1S6P A;  3K5N A;  1JLB A;  4E7J A;  4DU3 A;  1KY6 A;  3TAB A;  3C95 A;  4CFA A;  4BE2 A;  4Z4C A;  4FJX A;  3DYA A;  1RTJ A;  2JOI A;  3T3F A;  1YQK A;  4BDP A;  3OYD A;  4FLY A;  2D5R A;  4CIE A;  3HM9 A;  4DSL A;  2HB5 A;  2GUI A;  4AH9 A;  1REV A;  2X6S A;  3SNS A;  4FJM A;  5HP1 A;  1TKZ A;  3DRS A;  3ZCM A;  4AHT A;  4GMJ B;  2G8W A;  1ITG A;  3QEI A;  4EZ9 A;  3V6D A;  4FJG A;  3ZT3 A;  1L5U A;  3AVH A;  4HUF A;  1YTU A;  2ATQ A;  4CJF A;  1NK8 A;  1GOA A;  4CEF A;  2HHW A;  3I8D A;  4CEB A;  4C8K A;  2O3O A;  4J2B A;  4CEZ A;  1C9B B;  4CHP A;  4CF2 A;  3PX4 A;  2YKN A;  3NH2 A;  1TAU A;  1JLA A;  3T19 A;  4JS5 A;  3AA2 A;  3SQ1 A;  3AVI A;  5KI6 A;  1HPZ A;  1ZBU A;  2OZM A;  4LSL A;  3NF6 A;  1N3A A;  1RBS A;  2E4L A;  4B3O A;  4FZY A;  1S9G A;  4HUG A;  1J5O A;  4KHY A;  1W80 A;  1E42 A;  4FJK A;  1BIU A;  3H08 A;  4OKE A;  3K59 A;  2Y1I A;  3LP0 A;  3SV3 A;  1DTQ A;  4FJ5 A;  4FJ9 A;  1JL1 A;  5IYD P;  1TKT A;  4ICL A;  3KLF A;  3RMD A;  1NK6 A;  3UIQ A;  3LZJ A;  1CZB A;  1YQL A;  3H1Z A;  1YTA A;  5KRT A;  1PZD A;  4AHC A;  3NH0 A;  5E41 A;  3JSM A;  4ROC B;  2FBX A;  1JL2 A;  1IO2 A;  1VSH A;  3WNF A;  1C0U A;  1T05 A;  4FYD A;  3DRP A;  4O44 A;  4FCY A;  3KTQ A;  2ZQB A;  3O3F A;  1J9A A;  1GOC A;  5KTQ A;  2HHS A;  4M3U A;  4Q11 A;  2OA8 A;  3V1O A;  2Z1H A;  2RF2 A;  2IV8 A;  3NF9 A;  1IH7 A;  3NBP A;  3K5L A;  3AVC A;  2QXF A;  3I0S A;  1C0M A;  1RCH A;  2ZD1 A;  1LWY A;  4NCG A;  2OYQ A;  5C25 A;  4KRE A;  1S1U A;  3PO5 A;  1ZBL A;  1BI4 A;  1QNA A;  3T1A A;  3PUF A;  4B0A A;  4AHV A;  1ASV A;  4Q5V A;  1NOY A;  3C94 A;  2BGG A;  4OKK A;  4CIG A;  3K5M A;  3IRX A;  1MP9 A;  4KKO A;  2HHT A;  4OJR A;  1Y97 A;  3AA5 X;  3QIN A;  1L3U A;  3AA4 A;  3HST B;  4R5P A;  4C8L A;  1CXU A;  3OYM A;  4M3W A;  3QER A;  3RR7 A;  4DTX A;  5HRN A;  1LW2 A;  1RM1 A;  1KFD A;  3VQ7 A;  1YTF A;  4CE9 A;  2W42 A;  4OLB A;  2IOC A;  3OYJ A;  3TAR A;  1L3S A;  3SV4 A;  2ITG A;  5KRS A;  4XIU A;  1RT7 A;  5T7B A;  3LP2 A;  1JLG A;  1BI4 B;  1Q9Y A;  4B9N A;  2G30 A;  3S3O A;  3AV9 A;  4CJV A;  2XHB A;  3KLH A;  4N76 A;  2P51 A;  4CJ4 A;  4CEO A;  1NJX A;  3OS2 A;  1NK7 A;  4M3R A;  3OYG A;  5DMR A;  2NOB A;  1ZBH A;  3AVA A;  2O4I A;  4FM1 A;  3QES A;  3QEW A;  3D0P A;  5SWM A;  3L2U A;  1U04 A;  3AA3 A;  3CM5 A;  3LWL A;  1S1V A;  3M8Q A;  4FW1 A;  1KTQ A;  4FK0 A;  1QNC A;  4DS5 A;  2D0A A;  3OYL A;  1S6Q A;  3NF8 A;  3NDK A;  4Z4H A;  1BCM A;  4DLE A;  1SL1 A;  3KK1 A;  1L3V A;  1HNV A;  4KTQ A;  3KK2 A;  4M42 A;  3I0X A;  5CYM A;  1KYU A;  1QTP A;  4I2P A;  4CHO A;  4FLV A;  5J2Q A;  3TR8 A;  3LAM A;  3P1G A;  4DTS A;  3QNN A;  1BL3 A;  4Z4F A;  2Z1G A;  4N41 A;  1NOZ A;  1LW0 A;  4DTR A;  4CHY A;  1HNI A;  3QEX A;  3OJS A;  2D0B A;  4BDY A;  4DF4 A;  4DSE A;  4KB1 A;  1TBA B;  1HYZ A;  1RBU A;  1RT6 A;  3LWM A;  4K8Z A;  1B9K A;  1FK9 A;  1JXB A;  3DPU A;  1BQN A;  2FBV A;  1NK0 A;  5JS1 A;  2G8K A;  2VWJ A;  1S9E A;  3L2V A;  3DOK A;  4IG0 A;  1LWW A;  1D9D A;  4DTU A;  1YQR A;  1RDC A;  2OPQ A;  1RT3 A;  3ZT2 A;  2EX3 A;  2XRI A;  3KLE A;  4JRP A;  1X9S A;  4CFD A;  1IG9 A;  2YHA A;  1QTS A;  4DQP A;  2YHB A;  4DSK A;  3ZSR A;  4CEC A;  3RRG A;  2NOI A;  2GBZ A;  4CJW A;  1EP4 A;  4CHQ A;  2BE2 A;  3VQC A;  1QN4 A;  1EX4 A;  2YNI A;  4HUE A;  1R4X A;  3QIP A;  5DK5 A;  1SUQ A;  3A2F A;  4FXD A;  3NE6 A;  1RT5 A;  2VG6 A;  4IG3 A;  4FJH A;  4Y1C A;  1A5V A;  3VQQ A;  1AIS A;  1QN3 A;  1QHT A;  4OPJ A;  1LV5 A;  5IYC P;  2HZM A;  3TAE A;  4F8R A;  3NH1 A;  3QEP A;  1D3U A;  4FK4 A;  1NGM A;  3ZSO A;  1NKC A;  2HVH A;  2G8I A;  4QOZ B;  1U47 A;  4OPK A;  4W5R A;  3MXM A;  2HHU A;  4ELV A;  5I42 A;  1JXE A;  4AHU A;  1S5J A;  2EHG A;  3ALY A;  3L3V A;  4OKJ A;  1IKY A;  1RTH A;  2IS3 A;  3OY9 A;  3KIO A;  1NJW A;  3ZSX A;  4FZZ A;  3I0R A;  1BQM A;  1CZ9 A;  3U3G A;  3DPT A;  1TV6 A;  4CJR A;  4Z4I A;  2PZS A;  3HYF A;  1LWC A;  3HPO A;  4KHS A;  1HQU A;  4HVJ A;  1J54 A;  1RDA A;  4RW4 A;  3VQA A;  3PY8 A;  4PWD A;  4W5T A;  1VOK A;  1BCO A;  2QK9 A;  4JS4 A;  3EYZ A;  1UWB A;  1NK5 A;  2HHX A;  2Q3S A;  1TAQ A;  3RTV A;  1M3H A;  3M8P A;  4RW8 A;  3HVR A;  3NCI A;  1KLN A;  1SKR A;  3DLE A;  1LWV A;  1VSJ A;  4CIF A;  4FLX A;  2RPI A;  4H4O A;  3U6F A;  3SJJ A;  2QKK A;  4KI4 A;  4LH5 A;  3OYB A;  4CJ3 A;  3HVT A;  1KFS A;  3C6T A;  2BDP A;  3AVK A;  5HRS A;  3ZT0 A;  1BIZ A;  1UA0 A;  2HNZ A;  3S9H A;  5FRM A;  4W5N A;  2X78 A;  4B8C A;  1U4B A;  4HCC A;  1U48 A;  5J1E A;  2PYJ A;  4E7H A;  4B9S A;  1QN9 A;  1XWL A;  4FZX C;  4DQS A;  3KKR A;  3OVN A;  4CJL A;  3VA3 A;  1WAJ A;  3LPU A;  4PA1 A;  3QEV A;  3OS0 A;  1TKD A;  1EKE A;  4CF1 A;  3TAF A;  2OPR A;  2PYL A;  3HP9 A;  3PV8 A;  4O0I A;  2HND A;  1Q9X A;  2R7Y A;  3OCI A;  3PX6 A;  2LAE A;  3K2P A;  1SL0 A;  3FFI A;  1QNB A;  3VQ5 A;  2BAN A;  4KAZ A;  1KCF A;  3KJV A;  4CHZ A;  2P1J A;  2ETJ A;  3JYT A;  1M3Q A;  1X9W A;  3MXJ A;  1DTT A;  4NYF A;  4FJJ A;  2Z8U A;  2XY5 A;  3RWU A;  4HCB A;  3V9X A;  4LD0 A;  4FJN A;  1ASU A;  5CZ1 A;  5I3U A;  3AO1 A;  3ULD A;  3OYF A;  3OYK A;  3OYI A;  4I9L A;  3ULX A;  1VK0 A;  3LAN A;  1I39 A;  4NYN A;  1X1P A;  1YVU A;  1QE1 A;  4E7I A;  1TK8 A;  2P5O A;  2F8T A;  4KTW A;  2ZE2 A;  1KLM A;  3LP3 A;  3QET A;  1VSL A;  4CJT A;  4CF9 A;  2E6L A;  4DTM A;  4BAC A;  4DFK A;  1WSG A;  4CGF A;  1NK9 A;  4PQU A;  1QTM A;  1CDW A;  5CZ2 A;  5SZT A;  2WON A;  4DUL A;  2IDO A;  4C8N A;  3TAQ A;  4LH4 A;  3I0W A;  4Z0U A;  4CED A;  5J2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...