4PY5A

Thermovibrio ammonificans rnase h3 in complex with 19-mer rna/dna
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
267
Chain Sequence
SMKLSSSEKEKLLKKLKALGAKEEKPPEHAQYRLRLNDAILTVYKSGSVVYGGKGREKLKELVAETVLSDTELPRIGCNEAGKGEFVGPLVVACIVADEKCLKRLIELGVKDSKKLSNEKVEELASEITETCHGKVKLLIPEKYNRAYSKFKNINRLLEAVYREIVSDLCEKFSPKVVVVDKFSNRAEEVLKDVVKGARLEVRPKAEDDLAVAAASIVAKAVRLKTMKELEKRFKVKLPEGNTGLAELLKKTPKELHEKLFKLHFSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of RNase H3-substrate complex reveals parallel evolution of RNA/DNA hybrid recognition.
pubmed doi rcsb
source organism Thermovibrio ammonificans
molecule tags Hydrolase/dna/rna
molecule keywords Ribonuclease
total genus 93
structure length 267
sequence length 267
ec nomenclature ec 3.1.26.-:
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4py5A01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4py5A02
1A5VA 5IYDP 2GUIA 4RW4A 2OA8A 1S9EA 1KY7A 3IG1A 2XHBA 4FLTA 2Y1JA 1CXUA 2HHSA 3S3NA 3HPGA 1C1CA 1RBUA 3ZT3A 3O3HA 2O4GA 4KHNA 4FXDA 3NF7A 4CEAA 3K5MA 2Z1IA 4CF1A 1A5WA 1LV5A 1CXQA 5CZ2A 1SV5A 3NH1A 3OS2A 1TKDA 3ZSOA 1NK0A 4O4GA 1EKEA 3LAKA 1S1UA 4FLWA 4ZTFA 4W5NA 5KGXA 1RTIA 4HUFA 2KFZA 3C95A 4UQGA 4JS4A 1S5JA 1NVPA 1XC9A 3K57A 4Z4EA 4E1NA 4FLVA 1RDBA 4J2BA 1ITGA 4AHCA 1VSHA 5DK5A 3RRGA 3CYMA 1QN4A 1T7PA 3OYMA 4H4OA 2OZSA 1UAXA 4HCBA 5C25A 3HM9A 2Y1IA 1KLNA 3OYJA 2G8WA 1JLAA 1WLJA 2Z1GA 2YKNA 1VSFA 4FJXA 2QK9A 3HJFA 3LWMA 4L8RB 1S1VA 3AO5A 3DLEA 1HQEA 3DLRA 4CK3A 1RILA 4H4MA 3OS1A 4FW2A 4CJUA 1YTBA 3VQ7A 4DS4A 4ZTJA 1QSYA 1TKTA 2PY5A 3K5OA 1WSGA 4M3TA 3QINA 3V9XA 1C0MA 3VQQA 3TAPA 1R4XA 4B8AB 4CJFA 4F3TA 3L3VA 4HUGA 4FZYA 4LH5A 1E42A 3TARA 2RF2A 4Z4CA 4CECA 4C8OA 4C8KA 3I0RA 4CJRA 4KI6A 4PWDA 1NK6A 3VQEA 4DSJA 4KHSA 3SI6A 1X1PA 4QCLA 4ID1A 1NJZA 3KLIA 4DFKA 3MEDA 4CIGA 4FVMA 1NOZA 1L3VA 2ZQBA 2O4IA 1JLBA 2ZD1A 2BE2A 3TAEA 2P5OA 1I3AA 1VOLB 1BIZA 1BQMA 4CERA 4N5SA 3M8PA 3V1QA 4FM1A 2NUBA 3RR7A 1RDCA 1S1WA 4C8NA 1IKXA 4AH9A 3OJSA 4FK4A 1VRUA 4WZSD 3AA5X 1CDWA 1KVCA 4KFBA 4BWJA 4CJLA 3L2RA 4HUEA 2HHTA 4CEEA 3TAFA 2XY7A 1QSLA 3LP1A 4W5TA 3O4NA 4E7IA 1NK4A 4DQRA 4B9SA 1SKRA 2I5JA 4G1QA 5HRRA 4DF4A 2DFFA 4DTUA 1KFSA 1SL1A 3KK2A 1WSIA 4DF8A 1KYUA 1D8YA 4FJJA 4OLBA 1O1WA 4CJPA 4AHVA 2DFHA 3K59A 1ZBFA 3U3YA 1QSSA 1DTQA 3OYLA 2AJQA 3AO3A 4CHQA 4CEZA 1QHTA 2XY5A 3QIOA 4EP5A 3P83D 3KLHA 5CYMA 2IV9A 2YNIA 2FBYA 4CJ5A 1BQNA 4KRFA 4KB0A 1L3SA 4Z4IA 4CJSA 2E6LA 5FRMA 1WSEA 3LP2A 3SQ4A 1QTMA 4FLXA 4CGGA 1NH2A 2OPPA 1TBPA 1XHXA 3O3FA 3KLGA 2XRIA 1HMVA 2HNYA 4GMJB 3HPOA 4LD0A 4LY7A 3VQ5A 3T3FA 4DLEA 4E1MA 1RNHA 2X6NA 4IFYA 2YHBA 3L2VA 2B4JA 5HP1A 2PYJA 2BGGA 5D3GA 1BISA 1HYZA 2F8TA 4M3RA 1Q9XA 1Q8IA 3K58A 2HHVA 2WOMA 2D5RA 1LW2A 3ZSXA 1C1AA 4CJ3A 4I2PA 3S3OA 4DQPA 2F96A 4O0IA 4IG0A 4BDZA 3S3MA 3OYAA 4FJ8A 1QN6A 4M3UA 1F21A 1GOBA 2G8IA 4N41A 3EZ5A 4FZZA 1EX4A 1LAWA 1IG9A 4NYNA 1KTQA 4CFCA 4IBNA 3AVLA 5HROA 3CFOA 1B9FA 4HVJA 4DTPA 4O0JA 3KK1A 3SQ0A 4QOZB 1ZBHA 1VTLE 3LPUA 3U3GA 3TABA 2HW3A 3LPTA 2W42A 4DSLA 4DMNA 2PYLA 4GW6A 1B9KA 1NGMA 4ICLA 3L2QA 5JS2A 5HRPA 4DU3A 4DTMA 4DFJA 3QERA 1D9DA 3SUOA 3E01A 4B08A 3SCXA 3OYBA 1SL2A 4OGCA 3IS9A 3AA3A 4W5QA 3AVJA 3HS9A 1IKVA 1HNVA 3NBPA 4JLHA 4CF9A 4FJ9A 3KKRA 1KYFA 4O44A 1KCFA 1SUQA 4HHTA 3DRSA 1BI4B 2IC3A 4CJKA 5HRSA 4EZ9A 1L3TA 1QS4A 4Z4GA 2YKMA 3QESA 3KD1E 5SZTA 5C42A 4YNQA 3OYHA 3TAQA 1QNEA 2OPQA 4M3WA 4CEBA 5KTQA 4B9UA 3OYCA 3K5LA 4IKFA 3A2FA 3DOKA 3L8BA 1U49A 4CJQA 3TWHA 1C1BA 1HPZA 3DMJA 4DQQA 4DWIA 3H1ZA 4CFDA 1QN5A 4K8ZA 4FW1A 3SNNA 3IRXA 1SL0A 3BGRA 4B9LA 1RDAA 4FK2A 4EP4A 1Z25A 3OY9A 4KHUA 2HVHA 4CHPA 4C8MA 3L2WA 1FKPA 2IGIA 1EETA 3DRPA 2MJ7A 3LZJA 4CE9A 1CZBA 5KGWA 3M8RA 4KV8A 3SV3A 4E3SA 4BDYA 1IKYA 1VSEA 3ITHA 5IYBP 3V1OA 4OVLA 2FC0A 1AISA 1RTJA 2P51A 4OJRA 3L3UA 4H8KA 2JLEA 4KTWA 2YNFA 1L3UA 1MU2A 3ZSWA 4B8CA 3OS0A 3RRHA 3FFIA 3M8SA 3U6FA 3V6DA 4Z4FA 3LWLA 1ZYQA 3OYDA 4CHZA 3NGZA 3WNGA 4FJ5A 1QNAA 1JLCA 4AHSA 4JS5A 4FJ7A 3RR8A 4J2AA 3HVRA 3AVNA 5HBMA 1ASWA 2Q3SA 4DTJA 1WAFA 4XIUA 4HCCA 4OLAA 1C6VA 1REVA 3K5NA 3ASMA 5IYCP 3M8QA 5J2PA 2RKIA 2QKKA 1JL2A 3TANA 1R0AA 4RG8A 1ASUA 4RW6A 2KW4A 3HP6A 1RM1A 3VQ4A 4DTRA 3TR8A 1B92A 4RW8A 4ELTA 3QETA 2HHWA 1JFIC 1JLQA 4LSNA 4CEFA 4CHNA 3MECA 4YFUA 1RT7A 5EU7A 2R7YA 1I39A 2VJ0A 4DTNA 2EHGA 2YHAA 4B0AA 4CJTA 3CFRA 4B9VA 3KK3A 3S9HA 4I9LA 3SQ2A 1LW0A 4KO0A 1HRHA 1HJRA 3EIKA 4AHUA 4Q0BA 2BANA 3VQCA 3KLEA 4KPYA 3RTVA 3OYNA 4PY5A 2ZE2A 3QEVA 1LAVA 2G8HA 3ZSVA 3PO4A 3RMAA 3DYAA 4DSEA 4CESA 4IDKA 4Q5VA 2ATQA 5FROA 1VRTA 5I3UA 1NKCA 1HYSA 1WSHA 4BDPA 3NAEA 2IDOA 3HVTA 4DSFA 4CIFA 4QAGA 4ELUA 1CZ9A 1N5YA 1RBVA 3KKSA 1UA0A 4JRQA 3PUFA 2FBVA 4NYFA 4BE0A 3SQ1A 4E7KA 3TAMA 2B6AA 3VQAA 2FBTA 1FXXA 2HB5A 5C24A 2WONA 4W5RA 3QLHA 2VG5A 3DLGA 3VQ9A 3LDSA 3LP0A 4JRPA 4CJVA 4R5PA 3NHGA 5J2QA 1VSDA 1VSLA 3NH2A 5HLFA 2FBXA 2OPRA 3PO5A 4N47A 3VQ6A 4PUOA 3AV9A 4KHYA 2RN2A 5CYQA 1TK0A 3HP9A 4Z0UA 3H08A 1YVUA 1KSPA 1XWLA 3CG7A 2EX3A 1U45A 3OC3C 3DRRA 5FRNA 3KD5E 4DQSA 4B9NA 4CJWA 3NE6A 3QEXA 2DTUA 1C9BB 1KVBA 1FK9A 1QN8A 4CFBA 3PY8A 2D0CA 2VWKA 3TI0A 4E19A 1JLEA 4BE1A 1KFDA 3VQDA 4RODB 5HRNA 1TGHA 4E0DA 3NF9A 1W80A 5KRTA 3V81A 3D0PA 3TAGA 2ITGA 4WE1A 4BE2A 1NKEA 4FJHA 3PX0A 1Z26A 2PZSA 2Z1JA 2YNGA 1NJXA 4FLZA 1QN3A 3NF8A 1G15A 4CFAA 1B9DA 3KJVA 1RBTA 1IO2A 1S6QA 3CM5A 4FJMA 4FJKA 3D45A 4FLUA 1UA1A 1T05A 2E4LA 4DS5A 1L5UA 1DTTA 1BI4A 4I2QA 3WNHA 3G10A 3AVCA 4CEOA 4ELVA 4KREA 2QKBA 2HNDA 4NCBA 1WN7A 1Q9YA 4DU4A 3CQ8A 1HNIA 4E7JA 1JXEA 1S6PA 3AA2A 3MXMA 4FZXC 2DFEA 1D3UA 1QQCA 5T7BA 3I8DA 4O55A 1RDDA 1TL3A 4FLYA 5KI6A 4M42A 2GV9A 2XY8A 4DFMA 4E7HA 5J2NA 3QEWA 3PX6A 3DLBA 3JSMA 4M3XA 4CHOA 4DTSA 3AA4A 3VN5A 1VTOA 1X9SA 1CLQA 1VSKA 2IV8A 4DLGA 1QTSA 1RBRA 3V9WA 4ROEB 1RT2A 1TBAB 3B6OA 3EY1A 3B6PA 3AVFA 3WNEA 3SPZA 1ASVA 3HPHA 1BIUA 3SJJA 1U04A 1J5OA 1NOYA 1C0UA 2HNZA 3AVBA 3T1AA 4W5OA 2KZZA 1BHLA 4CHYA 1YT3A 2HVIA 1NKBA 1RBSA 1LWCA 4M3YA 4CF0A 4CIEA 1KVAA 2QXFA 3QO9A 4E7LA 1X9MA 4F8RA 5J2MA 4C8LA 4N76A 3SUNA 2IS3A 3NCIA 1KLMA 1ZBUA 2VG6A 1RT1A 4B9MA 4CCHA 2F8SA 1EP4A 1TK8A 5KRSA 1UWBA 4FM0A 3SYZA 3OCIA 4MQ3A 2OZMA 3RMBA 1T03A 1RTDA 2JGUA 4CJEA 3HS8A 3NGYA 4CEDA 3AO1A 3OYKA 3SUPA 1SKWA 2HMIA 4CK2A 2VG7A 3SV4A 3V4IA 3KTQA 4F3OA 1S1XA 1J9AA 3AVGA 3DM2A 4AHTA 3LZIA 2IAJA 3DLHA 4KB1A 4IG3A 2D0AA 3AO4A 3WNFA 3ZT0A 4KHQA 4DQIA 4FYDA 3SZ2A 1W0HA 1YTUA 3DI6A 3ZT4A 4FJLA 4FJGA 3ISNC 1BGXT 3I0SA 4M45A 1RT4A 4KKOA 1JLGA 3AVKA 4RW7A 3ALYA 4E89A 2A1RA 2OYQA 3P1GA 4M3ZA 3NGIA 2RPIA 4OKJA 4OPKA 1TAQA 1T8EA 1S1TA 2KTQA 5FDLA 4ROCB 1GOCA 1PCZA 4ID5A 1TK5A 2X6SA 4B3OA 3MXIA 3RMDA 3NF6A 3KIOA 4DFPA 4AILC 3OJUA 1K6YA 4CK1A 3CFPA 3UIQA 2P1JA 1TL1A 4ZHRA 2Z8UA 3AVHA 4FM2A 1U47A 1SKSA 2KQ2A 1UOCA 2G30A 1BCOA 1GOAA 4EZ6A 3O4QA 3BDPA 3OYFA 3K2PA 4KHWA 2D0BA 1JL1A 3V9SA 1ZBIA 3ZT2A 2IOCA 4FJIA 3HYFA 3VQ8A 3HXMA 3QEPA 3ZSRA 1KRPA 2HHUA 4OGEA 4DTOA 5I42A 3HL8A 2A1SA 4DTXA 3EYZA 1LWFA 3AVMA 4AHRA 1VSJA 3HT3A 4M41A 2B5JA 3RWUA 3MEGA 2X74A 5CZ1A 4CGFA 5JS1A 1KYDA 3LANA 1ZBLA 5K14A 3OVNA 5CY4A 4CJ4A 4DSKA 3PX4A 4CGJA 1S9GA 4DU1A 1N6QA 3VQBA 1NK7A 4LSLA 3KLFA 3NH0A 4PQUA 3QNOA 1LWEA 3MAQA 3OYGA 4B9TA 3QIPA 1QN7A 3V1RA 4F4KA 4NCAA 1BCMA 4F2SA 1KY6A 4LH4A 1TKXA 1NJYA 2G8VA 1A5XA 3C6TA 1NK9A 4CF8A 1TV6A 4IFVA 1WSFA 4K8XA 3AVAA 3QEIA 4OKEA 1XHZA 1NK8A 2HHXA 4OKKA 4O5BA 3C94A 1QNCA 3VQPA 2KZMA 4NCGA 1VK0A 2HHQA 3LALA 3L2UA 3HO1A 1QE1A 3OYEA 3HK2A 4KAZA 3ZSYA 4HTUA 2OPSA 2ETJA 3G0ZA 4PA1A 2BDPA 4CEQA 3P5JA 3DLKA 1EXQA 2XY6A 3RMCA 2G8KA 3ZCMA 1C0TA 1WAJA 2P5GA 1TVRA 2XO7A 4CGDA 3V9UA 2G8FA 3MXJA 3ULDA 3PV8A 1JKHA 3SUQA 3AVIA 1U48A 4KI4A 1Y97A 1RCHA 2LSNA 3ZSQA 3F73A 1JLFA 4Z4HA 3QNNA 2DY4A 1NJWA 2Z1HA 4CF2A 1JXBA 1IH7A 4FK0A 4Y1CA 5SWMA 3ZSZA 1XI1A 3IAYA 1MP9A 3O3GA 5E41A 4N56A 2G8UA 1QN9A 4OPJA 1PZDA 1FKOA 3OYIA 2KFNA 1RT3A 3NFAA 1VSMA 3LAMA 4GVMA 4F2RA 3AO2A 1IKWA 1J53A 2E6MA 2YV0X 1X9WA 3DOLA 5DMRA 4J2EA 4I7FA 3VA3A 3V9ZA 1BL3A 1QNBA 1RT5A 4MFBA 2GBZA 3HSTB 4KTZA 4FCYA 3F9KA 1YTAA 1U4BA 5J1EA 1HQUA 4RW9A 1TGOA 2YNHA 1VSIA 1WSJA 4CGHA 3ZT1A 2X78A 1QTPA 4BACA 3VA0A 1NK5A 1YTFA 4CGIA 3THVA 4I9QA 4J2DA 3CM6A 3C6UA 1TAUA 4BWMA 2VWJA 1D9FA 1J54A 4Y1DA 4DSIA 1DLOA 3MEEA 3T19A 1D5AA 1W9HA 1HYVA 1RTHA 4DG1A 1WNSA 4KTQA 4TSXA 1VOKA 3SPYA 4FJNA 3NDKA 1TKZA 3LP3A 1RT6A 3JYTA
chains in the Genus database with same CATH superfamily
4IEIA 4FLTA 2HHSA 1YITN 3S3NA 4EAHD 4KHNA 3NF7A 2Z1IA 4H5VA 1CXQA 4FWPA 4O5FA 5KPTA 5KGXA 1RTIA 2NOHA 2VQFK 2DKDA 3OYMA 3SAHA 3MWPA 3OHRA 3BF3A 3CI5A 1VQNN 2Z1GA 1QQMA 3WT0A 3HJFA 2P9IA 1DGKN 4ISEA 2QWQA 5BRHA 1S1VA 3VEYA 4QS9A 4CK3A 4H4MA 3OS1A 1GLJO 3C6HA 1HKBA 3QINA 4WQ4C 2NOFA 4B8AB 4CJFA 4OO1J 1E42A 1OKJA 2RF2A 4CECA 4PWDA 4CJRA 4DV3K 3MN9A 4QCLA 1GLDG 4FVMA 4RWTA 4LFCK 2UXBK 1YI2N 3OSEA 1M3HA 5GIOA 3E66A 3QDKA 3AA5X 1KVCA 4CJLA 4HUEA 3TAFA 3BP8A 4E7IA 4B9SA 1NK4A 1SKRA 5AQFA 4IOXA 1KFSA 2E1YA 1T3VA 1WSIA 4CJPA 1GLAG 4CZJA 4JKBA 4WFAL 3KVGA 1DTQA 2AJQA 3K0SA 2HF3A 4EAGA 4CEZA 2XY5A 4EP5A 4EZ9A 3P83D 2IV9A 2FBYA 1BQNA 3OBWA 3EEQA 5C2DA 4CJSA 5BRDA 2YI1A 1Q9UA 2BTFA 1WSEA 3LP2A 3SQ4A 3VMFB 4CGGA 2XRIA 4F9OA 1M3QA 1WJWA 2PBDA 2D1KA 3LDNA 4JKGA 2B4JA 2PYJA 5D3GA 1HYZA 2F8TA 1Q8IA 2D0OA 2O8CA 1ATRA 2D5RA 1LW2A 4CJ3A 1C1AA 4I2PA 3AY9A 1V4TA 2F96A 4IG0A 4M3UA 3VGKA 3EZ5A 3SLCA 1HUXA 1KTQA 4CFCA 3EO3A 3DPTA 4A61A 4DTPA 1ZBHA 2ZF5O 3LPUA 2HW3A 5AQIA 2PYLA 3RPJA 2IVNA 5HRPA 4DB3A 1Z6RA 4OGCA 1HNXK 4W5QA 3M6GA 1IKVA 1JCGA 2Q97A 4DR5K 4JLHA 2ZWHA 1S72N 2E2PA 3DWLA 4U7BA 4EAKA 1SUQA 5HRSA 1SAZA 4Z4GA 2YKMA 5SZTA 5C42A 4YNQA 3AAPA 3J7AP 2P9LB 5BRFA 2KFNA 1VQ7N 3DMJA 4V19S 4YORA 3H1ZA 3O9SA 4H5TA 4CFDA 1C4GA 1SL0A 3IRXA 3H6EA 1M90O 1Z25A 3CPEA 4OX9K 3JXUA 5AQWA 3L2WA 3THYB 4GKKK 4CE9A 4JEPA 1VSEA 3ITHA 5IYBP 1H1VA 3ID8A 2P51A 3L3UA 4IFEA 3OW2M 4B1UB 4B1ZA 3FFIA 1NGBA 3J7YP 1VQ4N 5LMUK 2RHKA 3WNGA 4FJ5A 4CZKA 4JKEA 4AHSA 4BR5A 3RR8A 3HVRA 3AVNA 5AQQA 1WAFA 3CW7A 3ATVA 1REVA 2P9UA 2QKKA 2RKIA 1JL2A 4RCHA 3EE9A 1B92A 4RW8A 5EY4A 2CGKA 4A62A 3DXKB 4YFUA 1RT7A 1I39A 2VJ0A 4DTNA 1MA9B 1TYQA 4NB4A 4B9VA 1KO9A 3S9HA 3SQ2A 4ILHA 1QQNA 2EHBD 4AHUA 1TUOA 2BANA 3RTVA 2F7TA 3O9RA 5IWAK 4B1XB 2I7NA 4DULA 3CPWM 3EAYA 4CESA 4IDKA 1K9MO 4Q5VA 3T4NA 4IO9L 4ILGB 1CZ9A 4K42A 1UA0A 4JRQA 2FBVA 4BE0A 4R79A 3AGKA 2ZM6K 2VG5A 4YHHK 4JRPA 2Q31A 2QWOA 1J5EK 1CLQA 1VSLA 3AV9A 5CYQA 1KSPA 2HF4A 1HJOA 3CG7A 1U45A 4DV4K 4BROA 4CZIA 1PCJX 3QEXA 2DTUA 4O8UA 4IZ9A 4IWVA 1KVBA 4CFBA 3J81O 4G9ZA 3CVTA 3TI0A 3CJ9A 3HTVA 3H1QA 4RODB 3WXMB 3BUZB 1V4SA 1BA1A 5KRTA 4WE1A 4FJHA 1Z26A 2R5XA 2YHXA 5AQMA 4DV2K 4F4KA 3NF8A 4CFAA 1RBTA 4FJKA 2F9WA 4IJAA 1T05A 1VQMN 2HZMA 4DV1K 4JI4K 3U8XA 4ELVA 2XHIA 5F0XA 2HNDA 2FKFA 1WN7A 3A0IX 3OBYA 4JKAA 1HNIA 4E7JA 1K35A 2OOYA 4GVEA 4O55A 4FLYA 3P4IA 5KI6A 5AQJA 2GV9A 4JI1K 4DFMA 4CHOA 3WXIA 3EE8A 2O8EA 2NOBA 1QTSA 1WBBA 1E3MA 3IFRA 1RT2A 1TBAB 3AVFA 3SPZA 3HPHA 1J5OA 4K25A 3FR0A 1KVAA 3QO9A 4BR2A 3SUNA 2F8SA 1KLMA 2P9LA 3MDQA 3TTCA 1Q82O 1OH5A 2VGMA 2OTJN 4MQ3A 4BRDA 2JGUA 1U2VA 3NGYA 2E2QA 4CEDA 2KTQA 4CK2A 3MCPA 3V4IA 1S1XA 4AHTA 2FKMX 3DM2A 4KHQA 2O8BB 1IV0A 1M5Q1 3AGRA 3CCEN 1QHAA 3VF2A 3UW2A 3W3DA 3ZT4A 5TKWA 3TSQA 1NGEA 2RPIA 2P9SA 1GOCA 1PCZA 2X6SA 4JK9A 1JCFA 3VF6A 3RMDA 4DFPA 1K6YA 4CK1A 4OPHA 3ULEA 2Z8UA 2KQ2A 3ZEUA 2G30A 3BDPA 3K2PA 2D0BA 3R9PA 3A5NC 2E8AA 1QQOA 4D7QA 1YHQN 3OTOK 2P9NA 4OGEA 3EYZA 2VQEK 1LWFA 3AVMA 1YQMA 1YQLA 4BR0A 2B5JA 5E84A 5H1SQ 5JS1A 3OH9A 3LANA 4YDUC 1W97L 4JI0K 4CGJA 3ID6A 5EOYA 4DU1A 4LSLA 4PQUA 3QNOA 3MAQA 2UU9K 4B9TA 1MPGA 3CCRN 1NK9A 2D0PA 4K8XA 3JS6A 4IFVA 2Q1NA 2HHXA 1P5DX 3C0BA 3C94A 3VQPA 1GLLO 2V9JA 4JD2B 1VK0A 4H0VB 1QE1A 4M7XA 1HLUA 1N34K 1KQSM 4KAZA 2OPSA 4PA1A 3G0ZA 3P5JA 3GOIA 2BUPA 4CVNE 1LWWA 5BR9A 3NVMA 1GLEG 3ULDA 3PV8A 4KI4A 1RCHA 2V8QA 2QLVA 1NJWA 5AZIA 4CF2A 2E5LK 2E1ZA 1C47A 2NRRA 3ZETB 5E41A 4WF9L 5C2FA 3HSCA 1N32K 2OCEA 2VWBA 2ZJRL 1RT3A 3AO2A 1X9WA 3DOLA 3V9ZA 4MFBA 4BRNA 3F9KA 1XMQK 3AARA 3EKSA 2X78A 4YOTA 4BACA 1NK5A 2NRVA 3LDQA 4BC4A 3S41A 1IBLK 4KBOA 3VEZA 4DG1A 3HRGA 1VOKA 3SPYA 4FJNA 3CQXA 1SQKA 4MO4A 3NDKA 4CZGA 1ZYQA 1RT6A 3JYTA 3SJJA 2GUIA 3IG1A 3ZT3A 2P9PB 3KHYA 2RE2A 3CVSA 3C7NB 4CF1A 1NMNA 1LV5A 5AQHA 4DR2K 3NH1A 1NK0A 1KXPA 1EQYA 3CCQN 3LAKA 2NRHA 1RDWX 4HUFA 3C95A 1XC9A 4FWMA 3O8MA 4Z4EA 4FLVA 1RDBA 3L4QA 1ITGA 5F2RA 1VSHA 5EVZA 3RRGA 2Z0FA 4HCBA 2G8WA 1NGHA 2YKNA 1VSFA 4FJXA 3UB5A 3VEXA 3RSEB 3AO5A 3VGLA 1HQEA 3TTDA 2MZ8A 1HX1A 5BR8K 2ZJPL 4ZTJA 4K41A 1EUVA 3K5OA 1R4XA 1X3NA 3TARA 4Z4CA 4C8OA 3I0RA 2GWKA 3OGDA 5AQNA 2QWMA 4KHSA 3H46O 4A2BA 1X1PA 4ID1A 1EBMA 3KLIA 4DFKA 3MEDA 3J8AA 1NM1A 5BREA 1NOZA 2ZQBA 2O4IA 3UKRB 3I55N 3TAEA 3QBWA 1I3AA 1VOLB 1BIZA 1BQMA 4N5SA 1RDCA 1GLCG 1QVGM 1IKXA 4FK4A 1CDWA 4KFBA 3L2RA 4CEEA 1QSLA 3O4NA 1DKGD 1LXTA 3TPQA 4DQRA 3EZWA 2W6KA 4FJJA 1O1WA 4BG9A 3NMUA 3D2EA 2NLXA 2FUVA 2HMPA 1QSSA 3F10A 2P9KA 2E88A 2VYPA 4M7YA 3UE5A 3DXMB 3QIOA 3KLHA 3IH7A 5CYMA 4YOXA 5AZIB 5C15A 4Z4IA 2PFUA 1HPMA 1QZ5A 4JN4A 1QTMA 2OPPA 1XHXA 4CD3A 3T7ZA 4LY7A 3VQ5A 3T3FA 2NLVA 4E1JA 2V52B 2YJEA 1RNHA 4IFYA 2YHBA 2ZGZA 4M3RA 1Q9XA 1XSZA 5AQKA 4DQPA 4O0IA 3S3MA 1NGAA 1GOBA 1KAXA 3ZETA 4EJZA 1LAWA 1XC3A 4IBNA 5EXWA 3RSMA 3SQ0A 3KK1A 3FZLA 4QOZB 1WUAA 3DJCA 3TABA 4DMNA 4GW6A 1B9KA 4ICLA 1D9DA 2H5AX 3L2QA 4DTMA 4B08A 4IOAL 3AA3A 1HNVA 3NBPA 1JCEA 1L3TA 2YCHA 2QI2A 3QESA 3H3NO 4XH5A 3OYHA 1Q81O 2OPQA 3OYCA 3K5LA 4D7RA 3A2FA 3DOKA 1U49A 5ADXA 4DQQA 3TWHA 1C1BA 5F1XA 3GG4A 1QN5A 1Y64A 3SNNA 2I5WA 4AM6A 4CHPA 3H1VX 4C8MA 5BN9A 3M5RA 1EETA 3DRPA 2MJ7A 3LZJA 1M1KO 1YVNA 1N8RO 3ENCA 1CZBA 4E3SA 3R6MA 4B1WB 3M8RA 3G25A 1RTJA 4H8KA 2JLEA 2YNFA 3WEEB 4X64K 4B8CA 3RRHA 5JLFA 4Z4FA 1S3XA 5MLCQ 3IKMA 4JS5A 2Q3SA 4QS7A 4DTJA 5DM6L 2ITMA 1C0FA 4IEEA 1C6VA 4NLBA 3ZX0A 3K5NA 3M8QA 4BC5A 1U6ZA 3TANA 4RG8A 1ASUA 1RM1A 3VQ4A 2H4LX 4ELTA 1JFIC 3K9KA 2ZJQL 1HR0K 4CHNA 4PKGA 1NWKA 4PKIA 4CJTA 3VTHA 2E20A 3BY5A 4Y0WA 3KK3A 4I9LA 3L4IA 3CJCA 3VEVA 1HRHA 3RVCA 4BR9A 3KLEA 1ESVA 4BJUA 4LF7K 4BRMA 4PY5A 4BRKA 3UKRA 3QEVA 1LAVA 2JWKA 3M1FA 3DYAA 4DSEA 5I3UA 1VRTA 1NKCA 3I8BA 1IJJA 4K0KK 3HVTA 4YDUA 3KKSA 4EJYA 1SS6A 4NYFA 5I9EB 3TAMA 4E7KA 2EWSA 4FOEA 2GUPA 5AQXA 1J3MA 2HB5A 2NRTA 3ZX2A 1R59O 1K8AO 4CBXA 1O13A 3LDSA 3LP0A 5J2QA 3KZBA 2FBXA 2OPRA 3N4QA 4GY2B 4XH4A 3PO5A 5AQYA 3KK7A 3THWB 4IL8A 4C7PA 4Z0UA 1XWLA 3I0WA 2EX3A 5DM7L 3KD5E 4CJWA 3NE6A 3D6RA 3CQYA 1N3AA 5JN5A 1C9BB 3MN6A 3PY8A 1QN8A 2O8DB 1JLEA 4BE1A 1KFDA 4E0DA 3FFKB 1W80A 3Q7BA 3V81A 2P9SB 3TSUA 4BRAA 1NKEA 1J6ZA 2PZSA 2QW9A 4CZLA 1XUPO 4WQ4A 1QN3A 5LY3A 1NJXA 3E9PA 2E2OA 4NXNK 4CJ7A 4FLUA 1L5UA 1DTTA 1BI4A 3VEWA 3G10A 3AVCA 2F9TA 4CEOA 5HL7L 4EHTA 4KREA 2GWJA 4NCBA 2YJFA 1Q9YA 1JXEA 2W41A 2DFEA 1DEJA 1NGFA 1QQCA 1RDDA 4M42A 1T6CA 2P9UB 4M3XA 3I56N 3PX6A 4CZEA 3JSMA 3AA4A 1X9SA 1VSKA 4DLGA 1RBRA 3V9WA 4ROEB 3B6OA 3QBXA 3EY1A 3B6PA 5AQZA 2UUBK 1BIUA 1NOYA 4YOVA 3CCUN 2HNZA 3CCSN 3T1AA 2KZZA 3O6WA 1BHLA 4CHYA 5EPCA 1YT3A 2HVIA 1NKBA 1LWCA 1Q18A 1EO1A 4JI3K 2AP1A 3MMVA 2HBKA 4E7LA 4J8FA 2IS3A 1ZBUA 1RT1A 3D2FA 4H0XB 1TK8A 5AQPA 1T03A 1RTDA 2FF6A 3OYKA 2HMIA 2VG7A 3T1YK 3DLHA 5LJVA 3AVGA 3LZIA 2IAJA 3CC2N 4IG3A 3SZ2A 4FJLA 3OSTA 3ISNC 2YHYA 4KKOA 4EZ6A 3ALYA 2FXUA 3P1GA 4WFBL 4OKJA 4OPKA 1TAQA 1S1TA 3R8EA 4ROCB 2LAEA 4ID5A 1TK5A 4JV5K 2DPNA 3CFPA 5GAEP 1U47A 3ENOA 1BG3A 3HM8A 1X3MA 4IXCA 4LF4K 4KHWA 1JL1A 3V9SA 2IOCA 1LWVA 5AR0A 3ZSRA 2FSNA 3ZLJA 5HOOA 3CJBA 3MEGA 4WQ5C 4DR7K 2V7YA 4CGFA 1KYDA 5AQOA 5FPMA 4DSKA 4CJ4A 3PX4A 3O9TA 4BRHA 2WC9A 3DLLL 5IT9O 3NVKA 2DKAA 4YOUA 3FZKA 1KY6A 4FPAA 3O9UA 1A5XA 4BR7A 1NGJA 3AVAA 3QEIA 4FWKA 4OKEA 2QWPA 5GINA 4JKHA 1NK8A 3DXMA 4ISFA 1ZC6A 1RFQA 4MDAA 3HK2A 4HTUA 2XY6A 5FPDA 4DV6K 2G8KA 4FOIA 3ZCMA 3VETA 2NNWA 5HSHA 2P5GA 1TVRA 4Q11A 2XO7A 3MXJA 3CF5L 5BPMA 1JKHA 3AVIA 1U48A 4H03B 5AFUH 2UXDK 3F73A 3O4WA 3WXJA 1NMDA 4Y1CA 3ZSZA 3IAYA 1MP9A 1IBMK 2KHOA 3PSIA 2OANA 4N56A 2G8UA 1FKOA 5B8HA 3LAMA 4CW7B 1J53A 3E9OA 5DMRA 4GKJK 1QNBA 2GBZA 4FCYA 2PWWA 1BU6O 4RW9A 2YNHA 4CGIA 3U9DA 4I9QA 2A3ZA 4XEIA 1TAUA 3IMXA 1NLVA 4BWMA 1J54A 3MEEA 3T19A 4DUYK 4KTQA 4LF8K 5FPEA 1TKZA 4RW4A 1S9EA 4ISGA 1C1CA 1RBUA 3O3HA 2O4GA 4EFHA 4FWRA 1KD1O 3ULXA 3CMEN 5CHIA 1A5WA 2V92A 3GBTA 3DXKA 1YQKA 1EKEA 4FLWA 4ZTFA 4JKCA 5KQDA 2KFZA 4H0OA 1S5JA 3K57A 4E1NA 4AHCA 5DK5A 2HOEA 3CYMA 1T7PA 4H4OA 3F2KA 2OZSA 1KLNA 4LF6K 3LM9A 3OYJA 5M1OA 1WLJA 2QK9A 2HHHK 1ZBSA 3CWUA 3THXA 4L8RB 5FPNA 5AZJB 4I6MB 3DLRA 3VQ7A 4M3TA 1TKTA 3E9LA 4JK8A 2ZGYA 2HKPA 3V9XA 1C0MA 3VQQA 3TAPA 2NVMA 4F3TA 3K9JA 3L3VA 5BPLA 4LH5A 2BH1A 4C8KA 4KI6A 1NK6A 3VQEA 4GV3A 4A5BA 4DSJA 3C7NA 4BVPA 1SZ2A 4CIGA 1BWFO 2P5OA 4OPAA 3M8PA 2NUBA 3THYA 4C8NA 3VOVA 2V7ZA 5BMPA 4WZSD 1VRUA 4BWJA 3OJSA 4BY9C 3LP1A 2QM1A 3BEXA 5JVHL 2NRWA 5HRRA 4G1QA 4DF4A 2DFFA 4DTUA 1SL1A 3TE5A 4DF8A 3VF4A 1N3CA 5JMVD 2QWNA 3K59A 1ZBFA 3U3YA 3C6AA 4QG5A 3OYLA 4DCHA 3CC7N 4CJ5A 2QTDA 2YHWA 4KB0A 1L3SA 5AQVA 2NWVA 2E6LA 5FRMA 4Z94A 1NH2A 1TBPA 1XQSC 3KLGA 2OTLN 2HBLA 2HNYA 3HPOA 4DLEA 2ASPA 5M1KA 5AFUA 2X6NA 5HP1A 3L2VA 4HWIA 5AQUA 4C1NI 3K58A 2HHVA 3MCAB 2WOMA 3ZSXA 1NGCA 4FJ8A 1QN6A 1F21A 4FZZA 4NYNA 2O3OA 2JHJA 3AVLA 3CFOA 1B9FA 3LDLA 4O0JA 3E1YA 1S22A 3ZX3A 1VTLE 3LPTA 1L3VA 1NGMA 3SMSA 4N41A 4DU3A 5EX5A 3SUOA 3E01A 3ENHA 1YJNN 3IS9A 4XH1A 3AVJA 3HS9A 2FLOA 4NO7A 4CF9A 1VQPN 1KCFA 4HHTA 3DRSA 1BI4B 4CJKA 4JD2A 1QZ6A 4JI2K 4A2AA 1QS4A 3LM2A 4M3WA 3QFUA 4MRQA 4CEBA 5KTQA 4B9UA 2D4WA 4FWOA 4IKFA 4DWIA 4CJQA 1HPZA 3CMAN 3MN5A 1W2BM 5ELZA 4FW1A 4K8ZA 4B9LA 4FK2A 1UL7A 2CH6A 2IGIA 3SV3A 1IKYA 3EL2A 1OH8A 3T1HK 4OJRA 3MN7A 4LF5K 4KTWA 1ZXOA 1L3UA 3M8SA 3U6FA 3PDKA 4CHZA 2HSTA 1QNAA 1JLCA 3TSPA 4BRCA 4WXAA 3FGUA 3O08A 4BRQA 4J2AA 5HBMA 3P38A 4MDBA 4JNEA 4OLAA 1K8KA 2WBNA 3ASMA 5IYCP 5J2PA 3THXB 2A41A 1R0AA 4DTRA 4IOCL 3SK3A 3QETA 2HHWA 4DQ8A 4LSNA 4CEFA 3MECA 1NNEA 5EU7A 5M1QA 2R7YA 2EHGA 4HTLA 3I33A 3CFRA 1LW0A 4KO0A 3QICA 5M1NA 1ILYA 1HJRA 3EIKA 4EALA 2Q0RA 3VQCA 4KPYA 4NLCA 4H5NA 2G8HA 4DR4K 3RMAA 1HYSA 2JOIA 2ATQA 5FROA 2JHNA 3NAEA 2IDOA 1KC8O 4ELUA 3VPZA 3PUFA 3O9QA 4BRGA 3VQAA 2FBTA 1FXXA 3CJ1A 4W5RA 4L3QA 1HKGA 3QLHA 3DLGA 3UKUB 1QVFM 4CJVA 4KHYA 4N47A 3L0QA 5A2QO 4PUOA 2RN2A 3DAWA 4BC2A 2FGTA 1TK0A 3H08A 2O8BA 3DRRA 5FRNA 4B9NA 3O1BA 3KTUA 3CJ7A 3VQDA 2HBMA 4MLEA 3L6QA 4BC3A 3TAGA 2ITGA 5AQTA 2W40A 4JKFA 1VQ9N 3PX0A 4H0TB 4FVUA 4WYBA 3SJHA 4BGBA 1S6QA 3CM5A 2A5XA 2O8DA 3N89A 1UA1A 2E4LA 4DS5A 5M1FA 4I2QA 4DKWA 3F9MA 3VERA 3KWIA 2FSJA 3CQ8A 2A6AA 1S6PA 3MXMA 4FZXC 1D3UA 4BQZA 5T7BA 3AAQA 3I8DA 3C65A 1X9JA 2HBJA 3PMGA 3QEWA 5C10A 4GNIA 1KFQA 5KL0A 3VN5A 1VTOA 4DV0K 3SBTA 4B1VA 2VGNA 3WNEA 1ASVA 3BF1A 1P8ZA 1EWRA 1U04A 2J4RA 3HOTA 2Q36A 3O5BA 1TYQB 1RBSA 4CF0A 2P9IB 2O8EB 4F8RA 2HL8A 4LF9K 5J2MA 4C8LA 3CJAA 4I8OA 3NCIA 2VG6A 4NXMK 3FZHA 5BN8A 4B9MA 4CCHA 2F4VK 3P31A 5F9CA 5KRSA 1UWBA 4FM0A 3SYZA 3RMBA 2ZFDB 1HU0A 4JKDA 4BREA 4F3OA 2YX6A 3OSMA 2D0AA 3AO4A 3ZT0A 4FYDA 1W0HA 1YTUA 3A5OC 4FJGA 3ULEB 3WXLA 1BGXT 3I0SA 4M45A 3N4PA 2OYQA 1JLGA 3CWTA 4YOYA 4E89A 1D4XA 4M3ZA 1KFIA 3NGIA 5AQGA 2JWLA 2UUCK 4DR6K 1DIZA 2NOZA 1YXQA 1WB9A 4B3OA 3MXIA 3KIOA 4AILC 2P1JA 4ZHRA 1VQKN 3CETA 4CD1A 2QRDA 3OYFA 4KH5A 1KRPA 4YY3K 2HHUA 2Y8LA 1YUWA 4DTOA 3HL8A 3P39A 4BRFA 4AHRA 1VSJA 4M41A 3RWUA 2X74A 1NG9A 5AZJA 2GEMA 3SAFA 1ZBLA 5K14A 1KAZA 1RGIA 3G71N 2WUSA 3NH0A 2QR1A 4FPBA 4TPSA 4YOWA 4NCAA 4B3TK 1GLBG 4B3SK 4F2SA 3A5MC 1TKXA 4JYAK 1VQON 2G8VA 5KPZA 3C6TA 2HZSA 1TV6A 1WSFA 2I7PA 1QNCA 3WEEA 2QREA 3CIPA 3WUHA 4NCGA 5C0YA 2HHQA 3CCVN 1JJ2M 4IO8A 5FLXO 3ZSYA 2ETJA 2BDPA 4CEQA 4B3RK 3RMCA 4FWQA 4JHDB 3SAGA 1WAJA 3M3ZA 3V9UA 2G8FA 3SUQA 3O1WA 4LFBK 1Y97A 2LSNA 1EWQA 1JLFA 1CZAN 4Z4HA 3PLAA 3QNNA 3HBTA 3GL1A 4FWSA 5JMVA 3O3GA 1G99A 2KKZA 1PZDA 3OYIA 3G4SN 4X62K 3NFAA 1VSMA 4GVMA 4PHTX 3CCLN 1LWYA 2YV0X 1NJIO 4J2EA 4I7FA 4CZMA 4EAJA 3VA3A 2O8FA 1BL3A 1RT5A 3QFPA 1YTAA 4DR1K 5J1EA 5M1PA 1VKLA 4FO0A 1WSJA 4UY8O 3ZT1A 4CBUA 3KWGA 2P9KB 3VGMA 3VA0A 1YTFA 4JHDA 3BZCA 4GV9A 1D9FA 4Y1DA 4DSIA 1V5SA 1D5AA 1W9HA 2NRXA 3HZ6A 2FF3B 1WNSA 1T6AA 2AA4A 4LC9B 1A5VA 5IYDP 2OA8A 1KY7A 4PL7A 2XHBA 2Y1JA 1CXUA 3HPGA 3U4LA 4FXDA 4B1YB 4CEAA 3K5MA 2YH5A 1IG8A 5CZ2A 1SV5A 4WCEL 3OS2A 3EKUA 3ZSOA 1TKDA 3WQTA 4O4GA 1S1UA 4CFFA 5ADXH 4JS4A 4UQGA 1NVPA 4B3MK 3LL3A 3H45C 4J2BA 2YA3A 2P9PA 1QN4A 5LMNK 1UAXA 5C25A 3HM9A 2Y1IA 1OH7A 1JLAA 2NZTA 3LWMA 2CGLA 2E2NA 5CE3A 3DLEA 1RILA 4FW2A 4CJUA 1YTBA 3IDHA 4DS4A 1QSYA 2PY5A 2W6LA 1WSGA 4FWNA 5TKYA 4HUGA 4FZYA 3TDHA 1OVQA 2UUAK 5C12A 3MWTA 3SI6A 4I6MA 1XNRK 1NJZA 3THWA 1JLBA 2ZD1A 2BE2A 4CERA 3A5LC 3HOSA 4FM1A 3V1QA 3RR7A 1S1WA 4AH9A 1HNWK 2HHTA 2XY7A 4W5TA 2I5JA 4C23A 1D8YA 3KK2A 4OLBA 1KYUA 1Q7YO 1BDGA 4AHVA 2DFHA 1K2YX 1VAZA 3PIPL 3AO3A 4CHQA 1QHTA 2DKCA 3OLPA 2YNIA 4JI8K 4JKGB 4IJNA 5GADP 3D4VA 2Q2RA 4FLXA 5JLHA 4M63C 3O3FA 3ZYYX 1HMVA 4GMJB 3R1XA 4LD0A 3J80O 2Y8QA 3O80A 4E1MA 2BGGA 1BISA 1VQLN 3S3OA 4BDZA 5GAGP 3OYAA 1VQ5N 2ASOA 2G8IA 3TU5A 1EX4A 1IG9A 2CGJA 4AF1A 5HROA 2IVOA 4WQ5A 4HVJA 3ATUA 1U2VB 3U3GA 4X66K 1ATNA 4AQYK 1VQ6N 2W42A 4DSLA 3QERA 3ZEUB 4DFJA 2QXLA 5JS2A 1C0GA 3SCXA 3OYBA 1SL2A 3TTFA 4K43A 1YJ9N 4FJ9A 5BMNA 3KKRA 1KYFA 3B8AX 4O44A 3U9ZA 3CCMN 2IC3A 1XMOK 1WBDA 3MX2A 3KD1E 3TAQA 1QNEA 3MX5A 3L8BA 3BZKA 1Z05A 4MO5A 3SBGA 2IVPA 4EAIA 4U67L 1YIJN 2NOLA 4C1NK 1Q86O 3CD6N 1PVSA 3BGRA 1RDAA 4EP4A 3OY9A 4KHUA 2HVHA 2V51B 2QEXN 1FKPA 1BO5O 5JVGL 3CERA 4A57A 3T69A 1NGGA 5KGWA 4KV8A 4BDYA 3DPUA 2UXCK 1YF5L 3F5TA 3V1OA 2GTDA 2IIRA 4OVLA 3JAMO 2FC0A 1AISA 4JI7K 2A40A 1MU2A 3D2EB 3ZSWA 3OS0A 3V6DA 5AN4A 3LWLA 4A5AA 3OYDA 3A8YA 1I94K 3NGZA 3C04A 4H0PA 4FJ7A 4BGAA 1ASWA 3EN9A 2FSKA 4XIUA 4HCCA 1NGDA 4FWLA 4ILJA 4RW6A 3CWSA 2KW4A 4H5WA 3HP6A 3F0ZA 3TR8A 1JLQA 5BPNA 3WXKA 2NRZA 4X65K 3OA9A 2YHAA 4B0AA 2NOIA 1FW6A 4CZFA 4DUZK 4Q0BA 4HJHA 1NBWA 3OYNA 1W7AA 2ZE2A 3PO4A 3ZSVA 4BVOA 4PL8A 1WSHA 4BDPA 4DSFA 3FZFA 4CIFA 4QAGA 1N5YA 1RBVA 3SQ1A 2GX9A 2B6AA 4CI6A 3ENBA 4CBWA 3NA5A 4O8KA 3I3WA 4MLHA 2WONA 5C24A 3GDQA 4JAXA 3D2FB 1P90A 1YAGA 3VQ9A 2NOEA 4R5PA 3NHGA 1VSDA 3NH2A 5HLFA 3VQ6A 3BKQX 3HP9A 4DV5K 1YVUA 2QWRA 3OC3C 4WFNL 4DQSA 4FL9A 3CWAA 1NGIA 3H3OB 1FK9A 2D0CA 2VWKA 2P9NB 3VTIA 1KAYA 4E19A 4JI5K 2QA4N 5HRNA 1TGHA 3NF9A 1MDUB 4KHPK 3D0PA 4BE2A 1E4FT 1N39A 1YQRA 2Z1JA 2YNGA 3FZMA 4FLZA 4W5NA 3KJVA 1G15A 1B9DA 1IO2A 2PAVA 4FJMA 3D45A 3G6EN 4KH4A 3WNHA 2H3GX 2QKBA 3VESA 4DU4A 2HL9A 3AA2A 2WTUA 1TL3A 4DR3K 5JICA 2XY8A 5J2NA 4E7HA 3DLBA 5CR4A 4DTSA 2IV8A 4QS8A 4B9QA 3CC4N 4H0YB 4DV7K 1WQAA 1C0UA 3AVBA 3LDPA 4W5OA 1NU0A 4PKHA 4M3YA 4CIEA 3RSEA 3SNSA 2QXFA 1X9MA 1T6DA 4A59A 4N76A 1EP4A 3OCIA 1BA0A 2OZMA 4CJEA 3HS8A 1SKWA 3SUPA 3AO1A 3LDOA 4KRFA 3SV4A 4KH6A 2GELA 3KTQA 1J9AA 2WFBA 3SMPA 4JK7A 4KB1A 3VENA 3WNFA 4DQIA 3GE1A 3MK6A 5KPRA 5LJWA 3DI6A 1TUYA 1RT4A 4RW7A 2QWLA 3AVKA 2A1RA 5AQLA 1HKCA 2CH5A 1T8EA 1FN7A 1MWMA 5FDLA 1VQ8N 1ATSA 5LL6Z 4BRIA 3CHWA 3UKUA 3NF6A 3OJUA 3UIQA 1TL1A 4LFAK 1SKSA 3AVHA 4FM2A 1UOCA 1BCOA 1GOAA 1JDYA 1T44A 3O4QA 3J7ZO 1ZBIA 3ZT2A 4BRPA 4FJIA 2Q0UA 3HYFA 4IDHA 5AQSA 3VQ8A 3HXMA 3QEPA 2O8CB 3OH6A 2OOXA 5I42A 2A1SA 4DTXA 3HT3A 4RTFD 5CZ1A 1OH6A 1K73O 1OVYA 3QMLA 3OVNA 5CY4A 1PCMX 1S9GA 1N6QA 1LCUA 3VQBA 3FLCO 1VHXA 1NK7A 3KLFA 3PIOL 1LWEA 1UT4A 3OYGA 1IBKK 3QIPA 1QN7A 3V1RA 3QB0A 1K8KB 1LOTB 1BCMA 4LH4A 2VCPA 4DHYA 1NJYA 4H5RA 4BR4A 2A42A 4CF8A 1E4GT 3FE1A 1XHZA 4OKKA 4O5BA 4BRLA 1HNZK 4AM7A 2KZMA 3LALA 3L2UA 3HO1A 3OYEA 4BQLA 2UYTA 5AJ3K 3DLKA 1EXQA 3D7EO 3R3LA 2JPIA 1C0TA 4FSVA 3W0LA 4WX8A 1YJWN 4CGDA 3CXCM 3ZSQA 3KRMA 3Q7CA 5GIPA 3D7QA 2DY4A 2Z1HA 1JXBA 1P5GX 1GLFO 1IH7A 4FK0A 5SWMA 1XI1A 1XNQK 1WOQA 5KQ8A 1QN9A 4OPJA 3I0XA 4JI6K 2F7LA 3ENOC 1BOTO 4F2RA 1IKWA 1TUUA 2E6MA 3HI0A 4BG8A 3CCJN 3PSFA 3WQUA 5GAHP 3IUCA 3HSTB 4KTZA 1FJGK 1U4BA 1RDUA 1HQUA 2KLAA 4EIAA 1TGOA 1VSIA 4CGHA 2QRCA 1QTPA 4CZHA 4EHUA 3THVA 4J2DA 3CM6A 3C6UA 2O8FB 4GV6A 1DT9A 1BUPA 2VWJA 5AQRA 1DLOA 3VEOA 1N36K 1HYVA 1MWKA 1RTHA 4TSXA 2ASMA 1N33K 5E26A 3LP3A 1UT7A
chains in the Genus database with same CATH topology
1A5VA 5IYDP 2GUIA 4RW4A 2OA8A 1S9EA 1KY7A 3IG1A 2XHBA 4FLTA 2Y1JA 1CXUA 2HHSA 3S3NA 3HPGA 1C1CA 1RBUA 3ZT3A 3O3HA 2O4GA 4KHQA 4KHNA 4FXDA 3NF7A 3ULXA 4CEAA 3K5MA 2Z1IA 4CF1A 1A5WA 1LV5A 1CXQA 2YH5A 5CZ2A 1YQKA 1SV5A 3NH1A 3OS2A 1TKDA 3ZSOA 1NK0A 4O4GA 1EKEA 3LAKA 1S1UA 4FLWA 4ZTFA 4W5NA 5KGXA 1RTIA 4HUFA 2KFZA 3C95A 4UQGA 4JS4A 1S5JA 1NVPA 1XC9A 3K57A 4Z4EA 4E1NA 4FLVA 2NOHA 1RDBA 4J2BA 1ITGA 4AHCA 1VSHA 5DK5A 3RRGA 3CYMA 1QN4A 1T7PA 4F3OA 3OYMA 4H4OA 2OZSA 1UAXA 4HCBA 5C25A 3HM9A 2Y1IA 1KLNA 3OYJA 2G8WA 1JLAA 1WLJA 2Z1GA 2YKNA 1VSFA 4FJXA 2QK9A 3HJFA 3LWMA 4L8RB 1S1VA 3AO5A 3DLEA 1HQEA 3DLRA 4CK3A 1RILA 2MZ8A 4H4MA 4FW2A 4CJUA 1YTBA 3VQ7A 3OS1A 4DS4A 4ZTJA 1TKTA 1QSYA 3K5OA 1WSGA 2PY5A 4M3TA 3QINA 3V9XA 2NOFA 1C0MA 3VQQA 3TAPA 1R4XA 4B8AB 4CJFA 4F3TA 3L3VA 4HUGA 4FZYA 4LH5A 1E42A 3TARA 2RF2A 4Z4CA 4CECA 4C8OA 4C8KA 3I0RA 4CJRA 4KI6A 4PWDA 1NK6A 3VQEA 4DSJA 4KHSA 3SI6A 1X1PA 4QCLA 4ID1A 1EBMA 1NJZA 3KLIA 4DFKA 3MEDA 4CIGA 4FVMA 1NOZA 1L3VA 2ZQBA 2O4IA 1JLBA 2ZD1A 2BE2A 3TAEA 2P5OA 1I3AA 1VOLB 1BIZA 1BQMA 4CERA 4N5SA 1M3HA 3M8PA 3V1QA 2NUBA 4FM1A 1RDCA 1S1WA 3RR7A 4C8NA 1IKXA 4AH9A 3OJSA 4FK4A 1VRUA 4WZSD 3AA5X 1CDWA 1KVCA 4KFBA 4BWJA 4CJLA 3L2RA 4HUEA 2HHTA 4CEEA 3TAFA 2XY7A 1QSLA 3LP1A 4W5TA 3O4NA 4E7IA 1NK4A 4DQRA 4B9SA 1SKRA 2I5JA 4G1QA 5HRRA 4DF4A 2DFFA 4DTUA 1KFSA 1SL1A 3KK2A 1WSIA 4DF8A 1KYUA 1D8YA 4FJJA 4OLBA 1O1WA 4CJPA 4AHVA 2DFHA 1N3CA 3K59A 1ZBFA 3U3YA 1QSSA 1DTQA 3F10A 3OYLA 2AJQA 3AO3A 4CHQA 4CEZA 1QHTA 2XY5A 3QIOA 4EP5A 3P83D 3IH7A 5CYMA 2IV9A 2YNIA 2FBYA 4CJ5A 1BQNA 4KRFA 4KB0A 1L3SA 4Z4IA 4CJSA 2E6LA 5FRMA 1WSEA 3LP2A 3SQ4A 1QTMA 4FLXA 4CGGA 1NH2A 2OPPA 1TBPA 1XHXA 3O3FA 3KLGA 2XRIA 1HMVA 1M3QA 2HNYA 4GMJB 4LD0A 3HPOA 4LY7A 3VQ5A 3T3FA 4DLEA 4E1MA 1RNHA 2X6NA 4IFYA 2YHBA 3L2VA 2B4JA 5HP1A 2PYJA 2BGGA 5D3GA 1BISA 1HYZA 2F8TA 4M3RA 1Q9XA 1Q8IA 1UT7A 3K58A 2HHVA 2WOMA 2D5RA 1LW2A 3ZSXA 1C1AA 4CJ3A 4I2PA 3S3OA 4DQPA 2F96A 4O0IA 4IG0A 4BDZA 3S3MA 3OYAA 4FJ8A 1QN6A 4M3UA 1F21A 1GOBA 2G8IA 4N41A 3EZ5A 4EJZA 4FZZA 1EX4A 1LAWA 1IG9A 4NYNA 1KTQA 2O3OA 4CFCA 4IBNA 3DPTA 3AVLA 5HROA 3CFOA 1B9FA 4HVJA 4DTPA 4O0JA 3KK1A 3SQ0A 4QOZB 1ZBHA 1VTLE 3LPUA 3U3GA 3TABA 2HW3A 3LPTA 2W42A 4DSLA 4DMNA 2PYLA 3RPJA 4GW6A 1B9KA 1NGMA 4ICLA 3L2QA 5JS2A 5HRPA 4DU3A 4DTMA 4DFJA 3QERA 1D9DA 3SUOA 3E01A 4B08A 3SCXA 3OYBA 1SL2A 4OGCA 3IS9A 3AA3A 4W5QA 3AVJA 3HS9A 1IKVA 1HNVA 3NBPA 4JLHA 4CF9A 4FJ9A 3KKRA 1KYFA 4O44A 1KCFA 1SUQA 4HHTA 3DRSA 1BI4B 2IC3A 4CJKA 5HRSA 4EZ9A 1L3TA 1QS4A 4Z4GA 2YKMA 3QESA 3KD1E 5SZTA 5C42A 4YNQA 3OYHA 3TAQA 1QNEA 2OPQA 4M3WA 4CEBA 5KTQA 4B9UA 3OYCA 3K5LA 4IKFA 3A2FA 3DOKA 3L8BA 1U49A 4CJQA 3TWHA 1C1BA 1HPZA 3DMJA 4DQQA 4DWIA 4KHYA 3H1ZA 4CFDA 1QN5A 4K8ZA 2NOLA 4FW1A 3IRXA 3SNNA 3BGRA 1SL0A 4B9LA 1RDAA 4FK2A 4EP4A 1Z25A 3OY9A 2I5WA 4KHUA 4CHPA 4C8MA 2HVHA 3L2WA 1FKPA 2IGIA 1EETA 3DRPA 2MJ7A 3LZJA 4CE9A 1CZBA 5KGWA 3M8RA 4KV8A 3SV3A 4E3SA 4BDYA 3DPUA 1IKYA 1VSEA 3ITHA 5IYBP 3V1OA 4OVLA 2FC0A 1AISA 1RTJA 2P51A 4OJRA 3L3UA 4H8KA 2JLEA 4KTWA 2YNFA 1L3UA 1MU2A 3ZSWA 4B8CA 3OS0A 3RRHA 3FFIA 3M8SA 5AN4A 3U6FA 3V6DA 4Z4FA 3LWLA 1ZYQA 3OYDA 4CHZA 3NGZA 3WNGA 4FJ5A 1QNAA 1JLCA 4AHSA 4JS5A 4FJ7A 3RR8A 4J2AA 3HVRA 3AVNA 5HBMA 1ASWA 2Q3SA 4DTJA 1WAFA 4XIUA 4HCCA 4OLAA 1C6VA 1REVA 3K5NA 3ASMA 5IYCP 3M8QA 5J2PA 2RKIA 2QKKA 1JL2A 3TANA 1R0AA 4RG8A 1ASUA 4RW6A 2KW4A 3HP6A 1RM1A 3VQ4A 3F0ZA 4DTRA 3TR8A 1B92A 4RW8A 4ELTA 3QETA 2HHWA 1JFIC 1JLQA 4LSNA 4CEFA 4CHNA 3MECA 4YFUA 1RT7A 5EU7A 2R7YA 1I39A 2VJ0A 4DTNA 2EHGA 2YHAA 4B0AA 4CJTA 3CFRA 4B9VA 3KK3A 1KO9A 3S9HA 2NOIA 4I9LA 3SQ2A 1LW0A 4KO0A 1HRHA 1HJRA 3EIKA 4AHUA 4Q0BA 2BANA 3VQCA 3KLEA 4KPYA 3RTVA 3OYNA 4PY5A 2ZE2A 3QEVA 1LAVA 2G8HA 4DULA 3ZSVA 3PO4A 3RMAA 3DYAA 4DSEA 4CESA 4IDKA 4Q5VA 2ATQA 2JOIA 1VRTA 5FROA 5I3UA 1NKCA 1WSHA 4BDPA 1HYSA 3NAEA 2IDOA 3HVTA 4DSFA 4CIFA 4QAGA 4ELUA 1CZ9A 1N5YA 1RBVA 4EJYA 3KKSA 1UA0A 4JRQA 3PUFA 2FBVA 4NYFA 4BE0A 3SQ1A 4E7KA 3TAMA 2B6AA 3VQAA 2FBTA 1FXXA 2HB5A 5C24A 2WONA 4W5RA 3QLHA 2VG5A 3DLGA 3VQ9A 3LDSA 3LP0A 4JRPA 2NOEA 4CJVA 4R5PA 3NHGA 1VSDA 1VSLA 3NH2A 5J2QA 2FBXA 2OPRA 5HLFA 4N47A 3VQ6A 3PO5A 3AV9A 4PUOA 2RN2A 5CYQA 2FGTA 1TK0A 3HP9A 4Z0UA 3H08A 1YVUA 1KSPA 1XWLA 3I0WA 3CG7A 2EX3A 1U45A 3OC3C 3DRRA 5FRNA 3KD5E 4DQSA 4B9NA 4CJWA 3NE6A 3QEXA 2DTUA 1N3AA 1C9BB 1KVBA 1FK9A 1QN8A 4CFBA 3PY8A 2D0CA 2VWKA 3KTUA 3TI0A 4E19A 1JLEA 4BE1A 1KFDA 3VQDA 4RODB 5HRNA 1TGHA 4E0DA 3NF9A 1W80A 5KRTA 3V81A 3D0PA 3TAGA 2ITGA 4WE1A 4BE2A 1NKEA 4FJHA 1N39A 3PX0A 1Z26A 2PZSA 1YQRA 2Z1JA 2YNGA 1NJXA 4FLZA 1QN3A 3NF8A 1G15A 4CFAA 1B9DA 3KJVA 1RBTA 1IO2A 1S6QA 3CM5A 4FJMA 4FJKA 3N89A 3D45A 4FLUA 1UA1A 1T05A 2E4LA 4DS5A 1L5UA 1DTTA 1BI4A 4I2QA 3WNHA 3G10A 2HZMA 3AVCA 4CEOA 4ELVA 2XHIA 4KREA 2QKBA 2HNDA 4NCBA 1WN7A 1Q9YA 4DU4A 3CQ8A 1HNIA 4E7JA 1JXEA 1S6PA 3AA2A 3MXMA 4FZXC 2DFEA 1D3UA 1QQCA 5T7BA 3I8DA 4O55A 1RDDA 1TL3A 4FLYA 5KI6A 4M42A 2GV9A 2XY8A 4DFMA 4E7HA 5J2NA 3QEWA 3PX6A 3DLBA 3JSMA 4M3XA 4CHOA 4DTSA 3AA4A 3VN5A 1VTOA 1X9SA 1CLQA 1VSKA 2IV8A 2NOBA 1QTSA 4DLGA 1RBRA 3V9WA 4ROEB 1RT2A 1TBAB 3B6OA 3EY1A 3B6PA 3AVFA 3WNEA 3SPZA 1ASVA 3HPHA 1BIUA 3SJJA 1U04A 1J5OA 1NOYA 1C0UA 2HNZA 3AVBA 3T1AA 4W5OA 2KZZA 1BHLA 4CHYA 1YT3A 2HVIA 1NKBA 1RBSA 1LWCA 4M3YA 4CF0A 4CIEA 3SNSA 1KVAA 2QXFA 3QO9A 4E7LA 1X9MA 5J2MA 4C8LA 4F8RA 4N76A 4I8OA 2IS3A 3NCIA 1KLMA 1ZBUA 2VG6A 1RT1A 3SUNA 4B9MA 4CCHA 2F8SA 1EP4A 1TK8A 5KRSA 1UWBA 4FM0A 3SYZA 3OCIA 4MQ3A 2OZMA 3RMBA 1T03A 1RTDA 2JGUA 4CJEA 3HS8A 3NGYA 4CEDA 3AO1A 1HU0A 3OYKA 3SUPA 1SKWA 4CK2A 2VG7A 3SV4A 3V4IA 2HMIA 3KTQA 1S1XA 1J9AA 3AVGA 3DM2A 4AHTA 3LZIA 2IAJA 3DLHA 4KB1A 3OSMA 2D0AA 3AO4A 4IG3A 3WNFA 3ZT0A 4DQIA 4FYDA 3SZ2A 1W0HA 1YTUA 3DI6A 3ZT4A 3OSTA 4FJGA 4FJLA 3ISNC 1BGXT 3I0SA 4M45A 1RT4A 4KKOA 1JLGA 3AVKA 4RW7A 3ALYA 4E89A 2A1RA 2OYQA 3P1GA 4M3ZA 3NGIA 2RPIA 2NOZA 4OKJA 1TAQA 1FN7A 1S1TA 4OPKA 1T8EA 2KTQA 5FDLA 4ROCB 2LAEA 1GOCA 1PCZA 4ID5A 1TK5A 2X6SA 4B3OA 3MXIA 3RMDA 3NF6A 3KIOA 4DFPA 4AILC 3OJUA 1K6YA 4CK1A 3CFPA 3UIQA 2P1JA 1TL1A 4ZHRA 2Z8UA 3AVHA 4FM2A 1U47A 1SKSA 2KQ2A 1UOCA 2G30A 1BCOA 1GOAA 4EZ6A 3O4QA 3BDPA 3OYFA 3K2PA 4KHWA 2D0BA 1JL1A 3V9SA 1ZBIA 3ZT2A 2IOCA 4FJIA 1LWVA 3HYFA 3VQ8A 3HXMA 3QEPA 3ZSRA 1KRPA 2HHUA 4OGEA 4DTOA 5I42A 3HL8A 2A1SA 4DTXA 3EYZA 1LWFA 3AVMA 4AHRA 1VSJA 3HT3A 1YQMA 1YQLA 4M41A 2B5JA 3RWUA 3MEGA 2X74A 5CZ1A 4CGFA 5JS1A 1KYDA 3LANA 1ZBLA 5K14A 3OVNA 5CY4A 4CJ4A 4DSKA 3PX4A 4CGJA 1S9GA 4DU1A 1N6QA 3VQBA 1NK7A 4LSLA 3KLFA 3NH0A 4PQUA 3QNOA 4TPSA 1LWEA 1UT4A 3OYGA 3MAQA 3QIPA 1QN7A 3V1RA 4B9TA 4F4KA 4NCAA 1BCMA 4F2SA 1KY6A 4LH4A 1TKXA 1NJYA 2G8VA 1A5XA 3C6TA 1NK9A 4CF8A 2HZSA 1TV6A 4IFVA 1WSFA 4K8XA 3AVAA 3QEIA 4OKEA 1XHZA 1NK8A 2HHXA 4OKKA 3KLHA 4O5BA 3C94A 1QNCA 3VQPA 2KZMA 4NCGA 1VK0A 2HHQA 3LALA 3L2UA 3HO1A 1QE1A 3OYEA 3HK2A 4KAZA 3ZSYA 4HTUA 2OPSA 2ETJA 3G0ZA 4PA1A 2BDPA 4CEQA 3P5JA 3DLKA 1EXQA 2XY6A 3RMCA 2G8KA 3ZCMA 1C0TA 1LWWA 1WAJA 2P5GA 1TVRA 4Q11A 2XO7A 4CGDA 3V9UA 2G8FA 3MXJA 3ULDA 3PV8A 1JKHA 3SUQA 3AVIA 1U48A 4KI4A 1Y97A 1RCHA 2LSNA 3ZSQA 3KRMA 3F73A 1JLFA 4Z4HA 3QNNA 2DY4A 1NJWA 2Z1HA 4CF2A 1JXBA 1IH7A 4FK0A 4Y1CA 5SWMA 3ZSZA 1XI1A 3IAYA 1MP9A 3O3GA 5E41A 4N56A 2G8UA 1QN9A 4OPJA 3I0XA 1PZDA 1FKOA 3OYIA 2KFNA 1RT3A 3NFAA 1VSMA 3LAMA 4GVMA 4F2RA 3AO2A 1LWYA 1IKWA 1J53A 2E6MA 2YV0X 3DOLA 1X9WA 5DMRA 4J2EA 4I7FA 3VA3A 3V9ZA 1BL3A 1QNBA 1RT5A 4MFBA 2GBZA 3HSTB 4KTZA 4FCYA 3F9KA 1YTAA 1U4BA 5J1EA 1HQUA 4RW9A 1TGOA 2YNHA 1VSIA 1WSJA 4CGHA 3ZT1A 2X78A 1QTPA 4BACA 3VA0A 1NK5A 1YTFA 4CGIA 3THVA 4I9QA 4J2DA 3CM6A 3C6UA 1TAUA 4BWMA 2VWJA 1D9FA 1J54A 4Y1DA 4DSIA 1DLOA 3MEEA 3T19A 1D5AA 1W9HA 1HYVA 1RTHA 4DG1A 1WNSA 4KTQA 4TSXA 1VOKA 3SPYA 4FJNA 3NDKA 1TKZA 3LP3A 1RT6A 3JYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5V A;  5IYD P;  2GUI A;  4RW4 A;  2OA8 A;  1S9E A;  1KY7 A;  3IG1 A;  2XHB A;  4FLT A;  2Y1J A;  1CXU A;  2HHS A;  3S3N A;  3HPG A;  1C1C A;  1RBU A;  3ZT3 A;  3O3H A;  2O4G A;  4KHN A;  4FXD A;  3NF7 A;  4CEA A;  3K5M A;  2Z1I A;  4CF1 A;  1A5W A;  1LV5 A;  1CXQ A;  5CZ2 A;  1SV5 A;  3NH1 A;  3OS2 A;  1TKD A;  3ZSO A;  1NK0 A;  4O4G A;  1EKE A;  3LAK A;  1S1U A;  4FLW A;  4ZTF A;  4W5N A;  5KGX A;  1RTI A;  4HUF A;  2KFZ A;  3C95 A;  4UQG A;  4JS4 A;  1S5J A;  1NVP A;  1XC9 A;  3K57 A;  4Z4E A;  4E1N A;  4FLV A;  1RDB A;  4J2B A;  1ITG A;  4AHC A;  1VSH A;  5DK5 A;  3RRG A;  3CYM A;  1QN4 A;  1T7P A;  3OYM A;  4H4O A;  2OZS A;  1UAX A;  4HCB A;  5C25 A;  3HM9 A;  2Y1I A;  1KLN A;  3OYJ A;  2G8W A;  1JLA A;  1WLJ A;  2Z1G A;  2YKN A;  1VSF A;  4FJX A;  2QK9 A;  3HJF A;  3LWM A;  4L8R B;  1S1V A;  3AO5 A;  3DLE A;  1HQE A;  3DLR A;  4CK3 A;  1RIL A;  4H4M A;  3OS1 A;  4FW2 A;  4CJU A;  1YTB A;  3VQ7 A;  4DS4 A;  4ZTJ A;  1QSY A;  1TKT A;  2PY5 A;  3K5O A;  1WSG A;  4M3T A;  3QIN A;  3V9X A;  1C0M A;  3VQQ A;  3TAP A;  1R4X A;  4B8A B;  4CJF A;  4F3T A;  3L3V A;  4HUG A;  4FZY A;  4LH5 A;  1E42 A;  3TAR A;  2RF2 A;  4Z4C A;  4CEC A;  4C8O A;  4C8K A;  3I0R A;  4CJR A;  4KI6 A;  4PWD A;  1NK6 A;  3VQE A;  4DSJ A;  4KHS A;  3SI6 A;  1X1P A;  4QCL A;  4ID1 A;  1NJZ A;  3KLI A;  4DFK A;  3MED A;  4CIG A;  4FVM A;  1NOZ A;  1L3V A;  2ZQB A;  2O4I A;  1JLB A;  2ZD1 A;  2BE2 A;  3TAE A;  2P5O A;  1I3A A;  1VOL B;  1BIZ A;  1BQM A;  4CER A;  4N5S A;  3M8P A;  3V1Q A;  4FM1 A;  2NUB A;  3RR7 A;  1RDC A;  1S1W A;  4C8N A;  1IKX A;  4AH9 A;  3OJS A;  4FK4 A;  1VRU A;  4WZS D;  3AA5 X;  1CDW A;  1KVC A;  4KFB A;  4BWJ A;  4CJL A;  3L2R A;  4HUE A;  2HHT A;  4CEE A;  3TAF A;  2XY7 A;  1QSL A;  3LP1 A;  4W5T A;  3O4N A;  4E7I A;  1NK4 A;  4DQR A;  4B9S A;  1SKR A;  2I5J A;  4G1Q A;  5HRR A;  4DF4 A;  2DFF A;  4DTU A;  1KFS A;  1SL1 A;  3KK2 A;  1WSI A;  4DF8 A;  1KYU A;  1D8Y A;  4FJJ A;  4OLB A;  1O1W A;  4CJP A;  4AHV A;  2DFH A;  3K59 A;  1ZBF A;  3U3Y A;  1QSS A;  1DTQ A;  3OYL A;  2AJQ A;  3AO3 A;  4CHQ A;  4CEZ A;  1QHT A;  2XY5 A;  3QIO A;  4EP5 A;  3P83 D;  3KLH A;  5CYM A;  2IV9 A;  2YNI A;  2FBY A;  4CJ5 A;  1BQN A;  4KRF A;  4KB0 A;  1L3S A;  4Z4I A;  4CJS A;  2E6L A;  5FRM A;  1WSE A;  3LP2 A;  3SQ4 A;  1QTM A;  4FLX A;  4CGG A;  1NH2 A;  2OPP A;  1TBP A;  1XHX A;  3O3F A;  3KLG A;  2XRI A;  1HMV A;  2HNY A;  4GMJ B;  3HPO A;  4LD0 A;  4LY7 A;  3VQ5 A;  3T3F A;  4DLE A;  4E1M A;  1RNH A;  2X6N A;  4IFY A;  2YHB A;  3L2V A;  2B4J A;  5HP1 A;  2PYJ A;  2BGG A;  5D3G A;  1BIS A;  1HYZ A;  2F8T A;  4M3R A;  1Q9X A;  1Q8I A;  3K58 A;  2HHV A;  2WOM A;  2D5R A;  1LW2 A;  3ZSX A;  1C1A A;  4CJ3 A;  4I2P A;  3S3O A;  4DQP A;  2F96 A;  4O0I A;  4IG0 A;  4BDZ A;  3S3M A;  3OYA A;  4FJ8 A;  1QN6 A;  4M3U A;  1F21 A;  1GOB A;  2G8I A;  4N41 A;  3EZ5 A;  4FZZ A;  1EX4 A;  1LAW A;  1IG9 A;  4NYN A;  1KTQ A;  4CFC A;  4IBN A;  3AVL A;  5HRO A;  3CFO A;  1B9F A;  4HVJ A;  4DTP A;  4O0J A;  3KK1 A;  3SQ0 A;  4QOZ B;  1ZBH A;  1VTL E;  3LPU A;  3U3G A;  3TAB A;  2HW3 A;  3LPT A;  2W42 A;  4DSL A;  4DMN A;  2PYL A;  4GW6 A;  1B9K A;  1NGM A;  4ICL A;  3L2Q A;  5JS2 A;  5HRP A;  4DU3 A;  4DTM A;  4DFJ A;  3QER A;  1D9D A;  3SUO A;  3E01 A;  4B08 A;  3SCX A;  3OYB A;  1SL2 A;  4OGC A;  3IS9 A;  3AA3 A;  4W5Q A;  3AVJ A;  3HS9 A;  1IKV A;  1HNV A;  3NBP A;  4JLH A;  4CF9 A;  4FJ9 A;  3KKR A;  1KYF A;  4O44 A;  1KCF A;  1SUQ A;  4HHT A;  3DRS A;  1BI4 B;  2IC3 A;  4CJK A;  5HRS A;  4EZ9 A;  1L3T A;  1QS4 A;  4Z4G A;  2YKM A;  3QES A;  3KD1 E;  5SZT A;  5C42 A;  4YNQ A;  3OYH A;  3TAQ A;  1QNE A;  2OPQ A;  4M3W A;  4CEB A;  5KTQ A;  4B9U A;  3OYC A;  3K5L A;  4IKF A;  3A2F A;  3DOK A;  3L8B A;  1U49 A;  4CJQ A;  3TWH A;  1C1B A;  1HPZ A;  3DMJ A;  4DQQ A;  4DWI A;  3H1Z A;  4CFD A;  1QN5 A;  4K8Z A;  4FW1 A;  3SNN A;  3IRX A;  1SL0 A;  3BGR A;  4B9L A;  1RDA A;  4FK2 A;  4EP4 A;  1Z25 A;  3OY9 A;  4KHU A;  2HVH A;  4CHP A;  4C8M A;  3L2W A;  1FKP A;  2IGI A;  1EET A;  3DRP A;  2MJ7 A;  3LZJ A;  4CE9 A;  1CZB A;  5KGW A;  3M8R A;  4KV8 A;  3SV3 A;  4E3S A;  4BDY A;  1IKY A;  1VSE A;  3ITH A;  5IYB P;  3V1O A;  4OVL A;  2FC0 A;  1AIS A;  1RTJ A;  2P51 A;  4OJR A;  3L3U A;  4H8K A;  2JLE A;  4KTW A;  2YNF A;  1L3U A;  1MU2 A;  3ZSW A;  4B8C A;  3OS0 A;  3RRH A;  3FFI A;  3M8S A;  3U6F A;  3V6D A;  4Z4F A;  3LWL A;  1ZYQ A;  3OYD A;  4CHZ A;  3NGZ A;  3WNG A;  4FJ5 A;  1QNA A;  1JLC A;  4AHS A;  4JS5 A;  4FJ7 A;  3RR8 A;  4J2A A;  3HVR A;  3AVN A;  5HBM A;  1ASW A;  2Q3S A;  4DTJ A;  1WAF A;  4XIU A;  4HCC A;  4OLA A;  1C6V A;  1REV A;  3K5N A;  3ASM A;  5IYC P;  3M8Q A;  5J2P A;  2RKI A;  2QKK A;  1JL2 A;  3TAN A;  1R0A A;  4RG8 A;  1ASU A;  4RW6 A;  2KW4 A;  3HP6 A;  1RM1 A;  3VQ4 A;  4DTR A;  3TR8 A;  1B92 A;  4RW8 A;  4ELT A;  3QET A;  2HHW A;  1JFI C;  1JLQ A;  4LSN A;  4CEF A;  4CHN A;  3MEC A;  4YFU A;  1RT7 A;  5EU7 A;  2R7Y A;  1I39 A;  2VJ0 A;  4DTN A;  2EHG A;  2YHA A;  4B0A A;  4CJT A;  3CFR A;  4B9V A;  3KK3 A;  3S9H A;  4I9L A;  3SQ2 A;  1LW0 A;  4KO0 A;  1HRH A;  1HJR A;  3EIK A;  4AHU A;  4Q0B A;  2BAN A;  3VQC A;  3KLE A;  4KPY A;  3RTV A;  3OYN A;  4PY5 A;  2ZE2 A;  3QEV A;  1LAV A;  2G8H A;  3ZSV A;  3PO4 A;  3RMA A;  3DYA A;  4DSE A;  4CES A;  4IDK A;  4Q5V A;  2ATQ A;  5FRO A;  1VRT A;  5I3U A;  1NKC A;  1HYS A;  1WSH A;  4BDP A;  3NAE A;  2IDO A;  3HVT A;  4DSF A;  4CIF A;  4QAG A;  4ELU A;  1CZ9 A;  1N5Y A;  1RBV A;  3KKS A;  1UA0 A;  4JRQ A;  3PUF A;  2FBV A;  4NYF A;  4BE0 A;  3SQ1 A;  4E7K A;  3TAM A;  2B6A A;  3VQA A;  2FBT A;  1FXX A;  2HB5 A;  5C24 A;  2WON A;  4W5R A;  3QLH A;  2VG5 A;  3DLG A;  3VQ9 A;  3LDS A;  3LP0 A;  4JRP A;  4CJV A;  4R5P A;  3NHG A;  5J2Q A;  1VSD A;  1VSL A;  3NH2 A;  5HLF A;  2FBX A;  2OPR A;  3PO5 A;  4N47 A;  3VQ6 A;  4PUO A;  3AV9 A;  4KHY A;  2RN2 A;  5CYQ A;  1TK0 A;  3HP9 A;  4Z0U A;  3H08 A;  1YVU A;  1KSP A;  1XWL A;  3CG7 A;  2EX3 A;  1U45 A;  3OC3 C;  3DRR A;  5FRN A;  3KD5 E;  4DQS A;  4B9N A;  4CJW A;  3NE6 A;  3QEX A;  2DTU A;  1C9B B;  1KVB A;  1FK9 A;  1QN8 A;  4CFB A;  3PY8 A;  2D0C A;  2VWK A;  3TI0 A;  4E19 A;  1JLE A;  4BE1 A;  1KFD A;  3VQD A;  4ROD B;  5HRN A;  1TGH A;  4E0D A;  3NF9 A;  1W80 A;  5KRT A;  3V81 A;  3D0P A;  3TAG A;  2ITG A;  4WE1 A;  4BE2 A;  1NKE A;  4FJH A;  3PX0 A;  1Z26 A;  2PZS A;  2Z1J A;  2YNG A;  1NJX A;  4FLZ A;  1QN3 A;  3NF8 A;  1G15 A;  4CFA A;  1B9D A;  3KJV A;  1RBT A;  1IO2 A;  1S6Q A;  3CM5 A;  4FJM A;  4FJK A;  3D45 A;  4FLU A;  1UA1 A;  1T05 A;  2E4L A;  4DS5 A;  1L5U A;  1DTT A;  1BI4 A;  4I2Q A;  3WNH A;  3G10 A;  3AVC A;  4CEO A;  4ELV A;  4KRE A;  2QKB A;  2HND A;  4NCB A;  1WN7 A;  1Q9Y A;  4DU4 A;  3CQ8 A;  1HNI A;  4E7J A;  1JXE A;  1S6P A;  3AA2 A;  3MXM A;  4FZX C;  2DFE A;  1D3U A;  1QQC A;  5T7B A;  3I8D A;  4O55 A;  1RDD A;  1TL3 A;  4FLY A;  5KI6 A;  4M42 A;  2GV9 A;  2XY8 A;  4DFM A;  4E7H A;  5J2N A;  3QEW A;  3PX6 A;  3DLB A;  3JSM A;  4M3X A;  4CHO A;  4DTS A;  3AA4 A;  3VN5 A;  1VTO A;  1X9S A;  1CLQ A;  1VSK A;  2IV8 A;  4DLG A;  1QTS A;  1RBR A;  3V9W A;  4ROE B;  1RT2 A;  1TBA B;  3B6O A;  3EY1 A;  3B6P A;  3AVF A;  3WNE A;  3SPZ A;  1ASV A;  3HPH A;  1BIU A;  3SJJ A;  1U04 A;  1J5O A;  1NOY A;  1C0U A;  2HNZ A;  3AVB A;  3T1A A;  4W5O A;  2KZZ A;  1BHL A;  4CHY A;  1YT3 A;  2HVI A;  1NKB A;  1RBS A;  1LWC A;  4M3Y A;  4CF0 A;  4CIE A;  1KVA A;  2QXF A;  3QO9 A;  4E7L A;  1X9M A;  4F8R A;  5J2M A;  4C8L A;  4N76 A;  3SUN A;  2IS3 A;  3NCI A;  1KLM A;  1ZBU A;  2VG6 A;  1RT1 A;  4B9M A;  4CCH A;  2F8S A;  1EP4 A;  1TK8 A;  5KRS A;  1UWB A;  4FM0 A;  3SYZ A;  3OCI A;  4MQ3 A;  2OZM A;  3RMB A;  1T03 A;  1RTD A;  2JGU A;  4CJE A;  3HS8 A;  3NGY A;  4CED A;  3AO1 A;  3OYK A;  3SUP A;  1SKW A;  2HMI A;  4CK2 A;  2VG7 A;  3SV4 A;  3V4I A;  3KTQ A;  4F3O A;  1S1X A;  1J9A A;  3AVG A;  3DM2 A;  4AHT A;  3LZI A;  2IAJ A;  3DLH A;  4KB1 A;  4IG3 A;  2D0A A;  3AO4 A;  3WNF A;  3ZT0 A;  4KHQ A;  4DQI A;  4FYD A;  3SZ2 A;  1W0H A;  1YTU A;  3DI6 A;  3ZT4 A;  4FJL A;  4FJG A;  3ISN C;  1BGX T;  3I0S A;  4M45 A;  1RT4 A;  4KKO A;  1JLG A;  3AVK A;  4RW7 A;  3ALY A;  4E89 A;  2A1R A;  2OYQ A;  3P1G A;  4M3Z A;  3NGI A;  2RPI A;  4OKJ A;  4OPK A;  1TAQ A;  1T8E A;  1S1T A;  2KTQ A;  5FDL A;  4ROC B;  1GOC A;  1PCZ A;  4ID5 A;  1TK5 A;  2X6S A;  4B3O A;  3MXI A;  3RMD A;  3NF6 A;  3KIO A;  4DFP A;  4AIL C;  3OJU A;  1K6Y A;  4CK1 A;  3CFP A;  3UIQ A;  2P1J A;  1TL1 A;  4ZHR A;  2Z8U A;  3AVH A;  4FM2 A;  1U47 A;  1SKS A;  2KQ2 A;  1UOC A;  2G30 A;  1BCO A;  1GOA A;  4EZ6 A;  3O4Q A;  3BDP A;  3OYF A;  3K2P A;  4KHW A;  2D0B A;  1JL1 A;  3V9S A;  1ZBI A;  3ZT2 A;  2IOC A;  4FJI A;  3HYF A;  3VQ8 A;  3HXM A;  3QEP A;  3ZSR A;  1KRP A;  2HHU A;  4OGE A;  4DTO A;  5I42 A;  3HL8 A;  2A1S A;  4DTX A;  3EYZ A;  1LWF A;  3AVM A;  4AHR A;  1VSJ A;  3HT3 A;  4M41 A;  2B5J A;  3RWU A;  3MEG A;  2X74 A;  5CZ1 A;  4CGF A;  5JS1 A;  1KYD A;  3LAN A;  1ZBL A;  5K14 A;  3OVN A;  5CY4 A;  4CJ4 A;  4DSK A;  3PX4 A;  4CGJ A;  1S9G A;  4DU1 A;  1N6Q A;  3VQB A;  1NK7 A;  4LSL A;  3KLF A;  3NH0 A;  4PQU A;  3QNO A;  1LWE A;  3MAQ A;  3OYG A;  4B9T A;  3QIP A;  1QN7 A;  3V1R A;  4F4K A;  4NCA A;  1BCM A;  4F2S A;  1KY6 A;  4LH4 A;  1TKX A;  1NJY A;  2G8V A;  1A5X A;  3C6T A;  1NK9 A;  4CF8 A;  1TV6 A;  4IFV A;  1WSF A;  4K8X A;  3AVA A;  3QEI A;  4OKE A;  1XHZ A;  1NK8 A;  2HHX A;  4OKK A;  4O5B A;  3C94 A;  1QNC A;  3VQP A;  2KZM A;  4NCG A;  1VK0 A;  2HHQ A;  3LAL A;  3L2U A;  3HO1 A;  1QE1 A;  3OYE A;  3HK2 A;  4KAZ A;  3ZSY A;  4HTU A;  2OPS A;  2ETJ A;  3G0Z A;  4PA1 A;  2BDP A;  4CEQ A;  3P5J A;  3DLK A;  1EXQ A;  2XY6 A;  3RMC A;  2G8K A;  3ZCM A;  1C0T A;  1WAJ A;  2P5G A;  1TVR A;  2XO7 A;  4CGD A;  3V9U A;  2G8F A;  3MXJ A;  3ULD A;  3PV8 A;  1JKH A;  3SUQ A;  3AVI A;  1U48 A;  4KI4 A;  1Y97 A;  1RCH A;  2LSN A;  3ZSQ A;  3F73 A;  1JLF A;  4Z4H A;  3QNN A;  2DY4 A;  1NJW A;  2Z1H A;  4CF2 A;  1JXB A;  1IH7 A;  4FK0 A;  4Y1C A;  5SWM A;  3ZSZ A;  1XI1 A;  3IAY A;  1MP9 A;  3O3G A;  5E41 A;  4N56 A;  2G8U A;  1QN9 A;  4OPJ A;  1PZD A;  1FKO A;  3OYI A;  2KFN A;  1RT3 A;  3NFA A;  1VSM A;  3LAM A;  4GVM A;  4F2R A;  3AO2 A;  1IKW A;  1J53 A;  2E6M A;  2YV0 X;  1X9W A;  3DOL A;  5DMR A;  4J2E A;  4I7F A;  3VA3 A;  3V9Z A;  1BL3 A;  1QNB A;  1RT5 A;  4MFB A;  2GBZ A;  3HST B;  4KTZ A;  4FCY A;  3F9K A;  1YTA A;  1U4B A;  5J1E A;  1HQU A;  4RW9 A;  1TGO A;  2YNH A;  1VSI A;  1WSJ A;  4CGH A;  3ZT1 A;  2X78 A;  1QTP A;  4BAC A;  3VA0 A;  1NK5 A;  1YTF A;  4CGI A;  3THV A;  4I9Q A;  4J2D A;  3CM6 A;  3C6U A;  1TAU A;  4BWM A;  2VWJ A;  1D9F A;  1J54 A;  4Y1D A;  4DSI A;  1DLO A;  3MEE A;  3T19 A;  1D5A A;  1W9H A;  1HYV A;  1RTH A;  4DG1 A;  1WNS A;  4KTQ A;  4TSX A;  1VOK A;  3SPY A;  4FJN A;  3NDK A;  1TKZ A;  3LP3 A;  1RT6 A;  3JYT A; 
#chains in the Genus database with same CATH topology
 4IEI A;  4FLT A;  2HHS A;  1YIT N;  3S3N A;  4EAH D;  4KHN A;  3NF7 A;  2Z1I A;  4H5V A;  1CXQ A;  4FWP A;  4O5F A;  5KPT A;  5KGX A;  1RTI A;  2NOH A;  2VQF K;  2DKD A;  3OYM A;  3SAH A;  3MWP A;  3OHR A;  3BF3 A;  3CI5 A;  1VQN N;  2Z1G A;  1QQM A;  3WT0 A;  3HJF A;  2P9I A;  1DGK N;  4ISE A;  2QWQ A;  5BRH A;  1S1V A;  3VEY A;  4QS9 A;  4CK3 A;  4H4M A;  3OS1 A;  1GLJ O;  3C6H A;  1HKB A;  3QIN A;  4WQ4 C;  2NOF A;  4B8A B;  4CJF A;  4OO1 J;  1E42 A;  1OKJ A;  2RF2 A;  4CEC A;  4PWD A;  4CJR A;  4DV3 K;  3MN9 A;  4QCL A;  1GLD G;  4FVM A;  4RWT A;  4LFC K;  2UXB K;  1YI2 N;  3OSE A;  1M3H A;  5GIO A;  3E66 A;  3QDK A;  3AA5 X;  1KVC A;  4CJL A;  4HUE A;  3TAF A;  3BP8 A;  4E7I A;  4B9S A;  1NK4 A;  1SKR A;  5AQF A;  4IOX A;  1KFS A;  2E1Y A;  1T3V A;  1WSI A;  4CJP A;  1GLA G;  4CZJ A;  4JKB A;  4WFA L;  3KVG A;  1DTQ A;  2AJQ A;  3K0S A;  2HF3 A;  4EAG A;  4CEZ A;  2XY5 A;  4EP5 A;  4EZ9 A;  3P83 D;  2IV9 A;  2FBY A;  1BQN A;  3OBW A;  3EEQ A;  5C2D A;  4CJS A;  5BRD A;  2YI1 A;  1Q9U A;  2BTF A;  1WSE A;  3LP2 A;  3SQ4 A;  3VMF B;  4CGG A;  2XRI A;  4F9O A;  1M3Q A;  1WJW A;  2PBD A;  2D1K A;  3LDN A;  4JKG A;  2B4J A;  2PYJ A;  5D3G A;  1HYZ A;  2F8T A;  1Q8I A;  2D0O A;  2O8C A;  1ATR A;  2D5R A;  1LW2 A;  4CJ3 A;  1C1A A;  4I2P A;  3AY9 A;  1V4T A;  2F96 A;  4IG0 A;  4M3U A;  3VGK A;  3EZ5 A;  3SLC A;  1HUX A;  1KTQ A;  4CFC A;  3EO3 A;  3DPT A;  4A61 A;  4DTP A;  1ZBH A;  2ZF5 O;  3LPU A;  2HW3 A;  5AQI A;  2PYL A;  3RPJ A;  2IVN A;  5HRP A;  4DB3 A;  1Z6R A;  4OGC A;  1HNX K;  4W5Q A;  3M6G A;  1IKV A;  1JCG A;  2Q97 A;  4DR5 K;  4JLH A;  2ZWH A;  1S72 N;  2E2P A;  3DWL A;  4U7B A;  4EAK A;  1SUQ A;  5HRS A;  1SAZ A;  4Z4G A;  2YKM A;  5SZT A;  5C42 A;  4YNQ A;  3AAP A;  3J7A P;  2P9L B;  5BRF A;  2KFN A;  1VQ7 N;  3DMJ A;  4V19 S;  4YOR A;  3H1Z A;  3O9S A;  4H5T A;  4CFD A;  1C4G A;  1SL0 A;  3IRX A;  3H6E A;  1M90 O;  1Z25 A;  3CPE A;  4OX9 K;  3JXU A;  5AQW A;  3L2W A;  3THY B;  4GKK K;  4CE9 A;  4JEP A;  1VSE A;  3ITH A;  5IYB P;  1H1V A;  3ID8 A;  2P51 A;  3L3U A;  4IFE A;  3OW2 M;  4B1U B;  4B1Z A;  3FFI A;  1NGB A;  3J7Y P;  1VQ4 N;  5LMU K;  2RHK A;  3WNG A;  4FJ5 A;  4CZK A;  4JKE A;  4AHS A;  4BR5 A;  3RR8 A;  3HVR A;  3AVN A;  5AQQ A;  1WAF A;  3CW7 A;  3ATV A;  1REV A;  2P9U A;  2QKK A;  2RKI A;  1JL2 A;  4RCH A;  3EE9 A;  1B92 A;  4RW8 A;  5EY4 A;  2CGK A;  4A62 A;  3DXK B;  4YFU A;  1RT7 A;  1I39 A;  2VJ0 A;  4DTN A;  1MA9 B;  1TYQ A;  4NB4 A;  4B9V A;  1KO9 A;  3S9H A;  3SQ2 A;  4ILH A;  1QQN A;  2EHB D;  4AHU A;  1TUO A;  2BAN A;  3RTV A;  2F7T A;  3O9R A;  5IWA K;  4B1X B;  2I7N A;  4DUL A;  3CPW M;  3EAY A;  4CES A;  4IDK A;  1K9M O;  4Q5V A;  3T4N A;  4IO9 L;  4ILG B;  1CZ9 A;  4K42 A;  1UA0 A;  4JRQ A;  2FBV A;  4BE0 A;  4R79 A;  3AGK A;  2ZM6 K;  2VG5 A;  4YHH K;  4JRP A;  2Q31 A;  2QWO A;  1J5E K;  1CLQ A;  1VSL A;  3AV9 A;  5CYQ A;  1KSP A;  2HF4 A;  1HJO A;  3CG7 A;  1U45 A;  4DV4 K;  4BRO A;  4CZI A;  1PCJ X;  3QEX A;  2DTU A;  4O8U A;  4IZ9 A;  4IWV A;  1KVB A;  4CFB A;  3J81 O;  4G9Z A;  3CVT A;  3TI0 A;  3CJ9 A;  3HTV A;  3H1Q A;  4ROD B;  3WXM B;  3BUZ B;  1V4S A;  1BA1 A;  5KRT A;  4WE1 A;  4FJH A;  1Z26 A;  2R5X A;  2YHX A;  5AQM A;  4DV2 K;  4F4K A;  3NF8 A;  4CFA A;  1RBT A;  4FJK A;  2F9W A;  4IJA A;  1T05 A;  1VQM N;  2HZM A;  4DV1 K;  4JI4 K;  3U8X A;  4ELV A;  2XHI A;  5F0X A;  2HND A;  2FKF A;  1WN7 A;  3A0I X;  3OBY A;  4JKA A;  1HNI A;  4E7J A;  1K35 A;  2OOY A;  4GVE A;  4O55 A;  4FLY A;  3P4I A;  5KI6 A;  5AQJ A;  2GV9 A;  4JI1 K;  4DFM A;  4CHO A;  3WXI A;  3EE8 A;  2O8E A;  2NOB A;  1QTS A;  1WBB A;  1E3M A;  3IFR A;  1RT2 A;  1TBA B;  3AVF A;  3SPZ A;  3HPH A;  1J5O A;  4K25 A;  3FR0 A;  1KVA A;  3QO9 A;  4BR2 A;  3SUN A;  2F8S A;  1KLM A;  2P9L A;  3MDQ A;  3TTC A;  1Q82 O;  1OH5 A;  2VGM A;  2OTJ N;  4MQ3 A;  4BRD A;  2JGU A;  1U2V A;  3NGY A;  2E2Q A;  4CED A;  2KTQ A;  4CK2 A;  3MCP A;  3V4I A;  1S1X A;  4AHT A;  2FKM X;  3DM2 A;  4KHQ A;  2O8B B;  1IV0 A;  1M5Q 1;  3AGR A;  3CCE N;  1QHA A;  3VF2 A;  3UW2 A;  3W3D A;  3ZT4 A;  5TKW A;  3TSQ A;  1NGE A;  2RPI A;  2P9S A;  1GOC A;  1PCZ A;  2X6S A;  4JK9 A;  1JCF A;  3VF6 A;  3RMD A;  4DFP A;  1K6Y A;  4CK1 A;  4OPH A;  3ULE A;  2Z8U A;  2KQ2 A;  3ZEU A;  2G30 A;  3BDP A;  3K2P A;  2D0B A;  3R9P A;  3A5N C;  2E8A A;  1QQO A;  4D7Q A;  1YHQ N;  3OTO K;  2P9N A;  4OGE A;  3EYZ A;  2VQE K;  1LWF A;  3AVM A;  1YQM A;  1YQL A;  4BR0 A;  2B5J A;  5E84 A;  5H1S Q;  5JS1 A;  3OH9 A;  3LAN A;  4YDU C;  1W97 L;  4JI0 K;  4CGJ A;  3ID6 A;  5EOY A;  4DU1 A;  4LSL A;  4PQU A;  3QNO A;  3MAQ A;  2UU9 K;  4B9T A;  1MPG A;  3CCR N;  1NK9 A;  2D0P A;  4K8X A;  3JS6 A;  4IFV A;  2Q1N A;  2HHX A;  1P5D X;  3C0B A;  3C94 A;  3VQP A;  1GLL O;  2V9J A;  4JD2 B;  1VK0 A;  4H0V B;  1QE1 A;  4M7X A;  1HLU A;  1N34 K;  1KQS M;  4KAZ A;  2OPS A;  4PA1 A;  3G0Z A;  3P5J A;  3GOI A;  2BUP A;  4CVN E;  1LWW A;  5BR9 A;  3NVM A;  1GLE G;  3ULD A;  3PV8 A;  4KI4 A;  1RCH A;  2V8Q A;  2QLV A;  1NJW A;  5AZI A;  4CF2 A;  2E5L K;  2E1Z A;  1C47 A;  2NRR A;  3ZET B;  5E41 A;  4WF9 L;  5C2F A;  3HSC A;  1N32 K;  2OCE A;  2VWB A;  2ZJR L;  1RT3 A;  3AO2 A;  1X9W A;  3DOL A;  3V9Z A;  4MFB A;  4BRN A;  3F9K A;  1XMQ K;  3AAR A;  3EKS A;  2X78 A;  4YOT A;  4BAC A;  1NK5 A;  2NRV A;  3LDQ A;  4BC4 A;  3S41 A;  1IBL K;  4KBO A;  3VEZ A;  4DG1 A;  3HRG A;  1VOK A;  3SPY A;  4FJN A;  3CQX A;  1SQK A;  4MO4 A;  3NDK A;  4CZG A;  1ZYQ A;  1RT6 A;  3JYT A;  3SJJ A;  2GUI A;  3IG1 A;  3ZT3 A;  2P9P B;  3KHY A;  2RE2 A;  3CVS A;  3C7N B;  4CF1 A;  1NMN A;  1LV5 A;  5AQH A;  4DR2 K;  3NH1 A;  1NK0 A;  1KXP A;  1EQY A;  3CCQ N;  3LAK A;  2NRH A;  1RDW X;  4HUF A;  3C95 A;  1XC9 A;  4FWM A;  3O8M A;  4Z4E A;  4FLV A;  1RDB A;  3L4Q A;  1ITG A;  5F2R A;  1VSH A;  5EVZ A;  3RRG A;  2Z0F A;  4HCB A;  2G8W A;  1NGH A;  2YKN A;  1VSF A;  4FJX A;  3UB5 A;  3VEX A;  3RSE B;  3AO5 A;  3VGL A;  1HQE A;  3TTD A;  2MZ8 A;  1HX1 A;  5BR8 K;  2ZJP L;  4ZTJ A;  4K41 A;  1EUV A;  3K5O A;  1R4X A;  1X3N A;  3TAR A;  4Z4C A;  4C8O A;  3I0R A;  2GWK A;  3OGD A;  5AQN A;  2QWM A;  4KHS A;  3H46 O;  4A2B A;  1X1P A;  4ID1 A;  1EBM A;  3KLI A;  4DFK A;  3MED A;  3J8A A;  1NM1 A;  5BRE A;  1NOZ A;  2ZQB A;  2O4I A;  3UKR B;  3I55 N;  3TAE A;  3QBW A;  1I3A A;  1VOL B;  1BIZ A;  1BQM A;  4N5S A;  1RDC A;  1GLC G;  1QVG M;  1IKX A;  4FK4 A;  1CDW A;  4KFB A;  3L2R A;  4CEE A;  1QSL A;  3O4N A;  1DKG D;  1LXT A;  3TPQ A;  4DQR A;  3EZW A;  2W6K A;  4FJJ A;  1O1W A;  4BG9 A;  3NMU A;  3D2E A;  2NLX A;  2FUV A;  2HMP A;  1QSS A;  3F10 A;  2P9K A;  2E88 A;  2VYP A;  4M7Y A;  3UE5 A;  3DXM B;  3QIO A;  3KLH A;  3IH7 A;  5CYM A;  4YOX A;  5AZI B;  5C15 A;  4Z4I A;  2PFU A;  1HPM A;  1QZ5 A;  4JN4 A;  1QTM A;  2OPP A;  1XHX A;  4CD3 A;  3T7Z A;  4LY7 A;  3VQ5 A;  3T3F A;  2NLV A;  4E1J A;  2V52 B;  2YJE A;  1RNH A;  4IFY A;  2YHB A;  2ZGZ A;  4M3R A;  1Q9X A;  1XSZ A;  5AQK A;  4DQP A;  4O0I A;  3S3M A;  1NGA A;  1GOB A;  1KAX A;  3ZET A;  4EJZ A;  1LAW A;  1XC3 A;  4IBN A;  5EXW A;  3RSM A;  3SQ0 A;  3KK1 A;  3FZL A;  4QOZ B;  1WUA A;  3DJC A;  3TAB A;  4DMN A;  4GW6 A;  1B9K A;  4ICL A;  1D9D A;  2H5A X;  3L2Q A;  4DTM A;  4B08 A;  4IOA L;  3AA3 A;  1HNV A;  3NBP A;  1JCE A;  1L3T A;  2YCH A;  2QI2 A;  3QES A;  3H3N O;  4XH5 A;  3OYH A;  1Q81 O;  2OPQ A;  3OYC A;  3K5L A;  4D7R A;  3A2F A;  3DOK A;  1U49 A;  5ADX A;  4DQQ A;  3TWH A;  1C1B A;  5F1X A;  3GG4 A;  1QN5 A;  1Y64 A;  3SNN A;  2I5W A;  4AM6 A;  4CHP A;  3H1V X;  4C8M A;  5BN9 A;  3M5R A;  1EET A;  3DRP A;  2MJ7 A;  3LZJ A;  1M1K O;  1YVN A;  1N8R O;  3ENC A;  1CZB A;  4E3S A;  3R6M A;  4B1W B;  3M8R A;  3G25 A;  1RTJ A;  4H8K A;  2JLE A;  2YNF A;  3WEE B;  4X64 K;  4B8C A;  3RRH A;  5JLF A;  4Z4F A;  1S3X A;  5MLC Q;  3IKM A;  4JS5 A;  2Q3S A;  4QS7 A;  4DTJ A;  5DM6 L;  2ITM A;  1C0F A;  4IEE A;  1C6V A;  4NLB A;  3ZX0 A;  3K5N A;  3M8Q A;  4BC5 A;  1U6Z A;  3TAN A;  4RG8 A;  1ASU A;  1RM1 A;  3VQ4 A;  2H4L X;  4ELT A;  1JFI C;  3K9K A;  2ZJQ L;  1HR0 K;  4CHN A;  4PKG A;  1NWK A;  4PKI A;  4CJT A;  3VTH A;  2E20 A;  3BY5 A;  4Y0W A;  3KK3 A;  4I9L A;  3L4I A;  3CJC A;  3VEV A;  1HRH A;  3RVC A;  4BR9 A;  3KLE A;  1ESV A;  4BJU A;  4LF7 K;  4BRM A;  4PY5 A;  4BRK A;  3UKR A;  3QEV A;  1LAV A;  2JWK A;  3M1F A;  3DYA A;  4DSE A;  5I3U A;  1VRT A;  1NKC A;  3I8B A;  1IJJ A;  4K0K K;  3HVT A;  4YDU A;  3KKS A;  4EJY A;  1SS6 A;  4NYF A;  5I9E B;  3TAM A;  4E7K A;  2EWS A;  4FOE A;  2GUP A;  5AQX A;  1J3M A;  2HB5 A;  2NRT A;  3ZX2 A;  1R59 O;  1K8A O;  4CBX A;  1O13 A;  3LDS A;  3LP0 A;  5J2Q A;  3KZB A;  2FBX A;  2OPR A;  3N4Q A;  4GY2 B;  4XH4 A;  3PO5 A;  5AQY A;  3KK7 A;  3THW B;  4IL8 A;  4C7P A;  4Z0U A;  1XWL A;  3I0W A;  2EX3 A;  5DM7 L;  3KD5 E;  4CJW A;  3NE6 A;  3D6R A;  3CQY A;  1N3A A;  5JN5 A;  1C9B B;  3MN6 A;  3PY8 A;  1QN8 A;  2O8D B;  1JLE A;  4BE1 A;  1KFD A;  4E0D A;  3FFK B;  1W80 A;  3Q7B A;  3V81 A;  2P9S B;  3TSU A;  4BRA A;  1NKE A;  1J6Z A;  2PZS A;  2QW9 A;  4CZL A;  1XUP O;  4WQ4 A;  1QN3 A;  5LY3 A;  1NJX A;  3E9P A;  2E2O A;  4NXN K;  4CJ7 A;  4FLU A;  1L5U A;  1DTT A;  1BI4 A;  3VEW A;  3G10 A;  3AVC A;  2F9T A;  4CEO A;  5HL7 L;  4EHT A;  4KRE A;  2GWJ A;  4NCB A;  2YJF A;  1Q9Y A;  1JXE A;  2W41 A;  2DFE A;  1DEJ A;  1NGF A;  1QQC A;  1RDD A;  4M42 A;  1T6C A;  2P9U B;  4M3X A;  3I56 N;  3PX6 A;  4CZE A;  3JSM A;  3AA4 A;  1X9S A;  1VSK A;  4DLG A;  1RBR A;  3V9W A;  4ROE B;  3B6O A;  3QBX A;  3EY1 A;  3B6P A;  5AQZ A;  2UUB K;  1BIU A;  1NOY A;  4YOV A;  3CCU N;  2HNZ A;  3CCS N;  3T1A A;  2KZZ A;  3O6W A;  1BHL A;  4CHY A;  5EPC A;  1YT3 A;  2HVI A;  1NKB A;  1LWC A;  1Q18 A;  1EO1 A;  4JI3 K;  2AP1 A;  3MMV A;  2HBK A;  4E7L A;  4J8F A;  2IS3 A;  1ZBU A;  1RT1 A;  3D2F A;  4H0X B;  1TK8 A;  5AQP A;  1T03 A;  1RTD A;  2FF6 A;  3OYK A;  2HMI A;  2VG7 A;  3T1Y K;  3DLH A;  5LJV A;  3AVG A;  3LZI A;  2IAJ A;  3CC2 N;  4IG3 A;  3SZ2 A;  4FJL A;  3OST A;  3ISN C;  2YHY A;  4KKO A;  4EZ6 A;  3ALY A;  2FXU A;  3P1G A;  4WFB L;  4OKJ A;  4OPK A;  1TAQ A;  1S1T A;  3R8E A;  4ROC B;  2LAE A;  4ID5 A;  1TK5 A;  4JV5 K;  2DPN A;  3CFP A;  5GAE P;  1U47 A;  3ENO A;  1BG3 A;  3HM8 A;  1X3M A;  4IXC A;  4LF4 K;  4KHW A;  1JL1 A;  3V9S A;  2IOC A;  1LWV A;  5AR0 A;  3ZSR A;  2FSN A;  3ZLJ A;  5HOO A;  3CJB A;  3MEG A;  4WQ5 C;  4DR7 K;  2V7Y A;  4CGF A;  1KYD A;  5AQO A;  5FPM A;  4DSK A;  4CJ4 A;  3PX4 A;  3O9T A;  4BRH A;  2WC9 A;  3DLL L;  5IT9 O;  3NVK A;  2DKA A;  4YOU A;  3FZK A;  1KY6 A;  4FPA A;  3O9U A;  1A5X A;  4BR7 A;  1NGJ A;  3AVA A;  3QEI A;  4FWK A;  4OKE A;  2QWP A;  5GIN A;  4JKH A;  1NK8 A;  3DXM A;  4ISF A;  1ZC6 A;  1RFQ A;  4MDA A;  3HK2 A;  4HTU A;  2XY6 A;  5FPD A;  4DV6 K;  2G8K A;  4FOI A;  3ZCM A;  3VET A;  2NNW A;  5HSH A;  2P5G A;  1TVR A;  4Q11 A;  2XO7 A;  3MXJ A;  3CF5 L;  5BPM A;  1JKH A;  3AVI A;  1U48 A;  4H03 B;  5AFU H;  2UXD K;  3F73 A;  3O4W A;  3WXJ A;  1NMD A;  4Y1C A;  3ZSZ A;  3IAY A;  1MP9 A;  1IBM K;  2KHO A;  3PSI A;  2OAN A;  4N56 A;  2G8U A;  1FKO A;  5B8H A;  3LAM A;  4CW7 B;  1J53 A;  3E9O A;  5DMR A;  4GKJ K;  1QNB A;  2GBZ A;  4FCY A;  2PWW A;  1BU6 O;  4RW9 A;  2YNH A;  4CGI A;  3U9D A;  4I9Q A;  2A3Z A;  4XEI A;  1TAU A;  3IMX A;  1NLV A;  4BWM A;  1J54 A;  3MEE A;  3T19 A;  4DUY K;  4KTQ A;  4LF8 K;  5FPE A;  1TKZ A;  4RW4 A;  1S9E A;  4ISG A;  1C1C A;  1RBU A;  3O3H A;  2O4G A;  4EFH A;  4FWR A;  1KD1 O;  3ULX A;  3CME N;  5CHI A;  1A5W A;  2V92 A;  3GBT A;  3DXK A;  1YQK A;  1EKE A;  4FLW A;  4ZTF A;  4JKC A;  5KQD A;  2KFZ A;  4H0O A;  1S5J A;  3K57 A;  4E1N A;  4AHC A;  5DK5 A;  2HOE A;  3CYM A;  1T7P A;  4H4O A;  3F2K A;  2OZS A;  1KLN A;  4LF6 K;  3LM9 A;  3OYJ A;  5M1O A;  1WLJ A;  2QK9 A;  2HHH K;  1ZBS A;  3CWU A;  3THX A;  4L8R B;  5FPN A;  5AZJ B;  4I6M B;  3DLR A;  3VQ7 A;  4M3T A;  1TKT A;  3E9L A;  4JK8 A;  2ZGY A;  2HKP A;  3V9X A;  1C0M A;  3VQQ A;  3TAP A;  2NVM A;  4F3T A;  3K9J A;  3L3V A;  5BPL A;  4LH5 A;  2BH1 A;  4C8K A;  4KI6 A;  1NK6 A;  3VQE A;  4GV3 A;  4A5B A;  4DSJ A;  3C7N A;  4BVP A;  1SZ2 A;  4CIG A;  1BWF O;  2P5O A;  4OPA A;  3M8P A;  2NUB A;  3THY A;  4C8N A;  3VOV A;  2V7Z A;  5BMP A;  4WZS D;  1VRU A;  4BWJ A;  3OJS A;  4BY9 C;  3LP1 A;  2QM1 A;  3BEX A;  5JVH L;  2NRW A;  5HRR A;  4G1Q A;  4DF4 A;  2DFF A;  4DTU A;  1SL1 A;  3TE5 A;  4DF8 A;  3VF4 A;  1N3C A;  5JMV D;  2QWN A;  3K59 A;  1ZBF A;  3U3Y A;  3C6A A;  4QG5 A;  3OYL A;  4DCH A;  3CC7 N;  4CJ5 A;  2QTD A;  2YHW A;  4KB0 A;  1L3S A;  5AQV A;  2NWV A;  2E6L A;  5FRM A;  4Z94 A;  1NH2 A;  1TBP A;  1XQS C;  3KLG A;  2OTL N;  2HBL A;  2HNY A;  3HPO A;  4DLE A;  2ASP A;  5M1K A;  5AFU A;  2X6N A;  5HP1 A;  3L2V A;  4HWI A;  5AQU A;  4C1N I;  3K58 A;  2HHV A;  3MCA B;  2WOM A;  3ZSX A;  1NGC A;  4FJ8 A;  1QN6 A;  1F21 A;  4FZZ A;  4NYN A;  2O3O A;  2JHJ A;  3AVL A;  3CFO A;  1B9F A;  3LDL A;  4O0J A;  3E1Y A;  1S22 A;  3ZX3 A;  1VTL E;  3LPT A;  1L3V A;  1NGM A;  3SMS A;  4N41 A;  4DU3 A;  5EX5 A;  3SUO A;  3E01 A;  3ENH A;  1YJN N;  3IS9 A;  4XH1 A;  3AVJ A;  3HS9 A;  2FLO A;  4NO7 A;  4CF9 A;  1VQP N;  1KCF A;  4HHT A;  3DRS A;  1BI4 B;  4CJK A;  4JD2 A;  1QZ6 A;  4JI2 K;  4A2A A;  1QS4 A;  3LM2 A;  4M3W A;  3QFU A;  4MRQ A;  4CEB A;  5KTQ A;  4B9U A;  2D4W A;  4FWO A;  4IKF A;  4DWI A;  4CJQ A;  1HPZ A;  3CMA N;  3MN5 A;  1W2B M;  5ELZ A;  4FW1 A;  4K8Z A;  4B9L A;  4FK2 A;  1UL7 A;  2CH6 A;  2IGI A;  3SV3 A;  1IKY A;  3EL2 A;  1OH8 A;  3T1H K;  4OJR A;  3MN7 A;  4LF5 K;  4KTW A;  1ZXO A;  1L3U A;  3M8S A;  3U6F A;  3PDK A;  4CHZ A;  2HST A;  1QNA A;  1JLC A;  3TSP A;  4BRC A;  4WXA A;  3FGU A;  3O08 A;  4BRQ A;  4J2A A;  5HBM A;  3P38 A;  4MDB A;  4JNE A;  4OLA A;  1K8K A;  2WBN A;  3ASM A;  5IYC P;  5J2P A;  3THX B;  2A41 A;  1R0A A;  4DTR A;  4IOC L;  3SK3 A;  3QET A;  2HHW A;  4DQ8 A;  4LSN A;  4CEF A;  3MEC A;  1NNE A;  5EU7 A;  5M1Q A;  2R7Y A;  2EHG A;  4HTL A;  3I33 A;  3CFR A;  1LW0 A;  4KO0 A;  3QIC A;  5M1N A;  1ILY A;  1HJR A;  3EIK A;  4EAL A;  2Q0R A;  3VQC A;  4KPY A;  4NLC A;  4H5N A;  2G8H A;  4DR4 K;  3RMA A;  1HYS A;  2JOI A;  2ATQ A;  5FRO A;  2JHN A;  3NAE A;  2IDO A;  1KC8 O;  4ELU A;  3VPZ A;  3PUF A;  3O9Q A;  4BRG A;  3VQA A;  2FBT A;  1FXX A;  3CJ1 A;  4W5R A;  4L3Q A;  1HKG A;  3QLH A;  3DLG A;  3UKU B;  1QVF M;  4CJV A;  4KHY A;  4N47 A;  3L0Q A;  5A2Q O;  4PUO A;  2RN2 A;  3DAW A;  4BC2 A;  2FGT A;  1TK0 A;  3H08 A;  2O8B A;  3DRR A;  5FRN A;  4B9N A;  3O1B A;  3KTU A;  3CJ7 A;  3VQD A;  2HBM A;  4MLE A;  3L6Q A;  4BC3 A;  3TAG A;  2ITG A;  5AQT A;  2W40 A;  4JKF A;  1VQ9 N;  3PX0 A;  4H0T B;  4FVU A;  4WYB A;  3SJH A;  4BGB A;  1S6Q A;  3CM5 A;  2A5X A;  2O8D A;  3N89 A;  1UA1 A;  2E4L A;  4DS5 A;  5M1F A;  4I2Q A;  4DKW A;  3F9M A;  3VER A;  3KWI A;  2FSJ A;  3CQ8 A;  2A6A A;  1S6P A;  3MXM A;  4FZX C;  1D3U A;  4BQZ A;  5T7B A;  3AAQ A;  3I8D A;  3C65 A;  1X9J A;  2HBJ A;  3PMG A;  3QEW A;  5C10 A;  4GNI A;  1KFQ A;  5KL0 A;  3VN5 A;  1VTO A;  4DV0 K;  3SBT A;  4B1V A;  2VGN A;  3WNE A;  1ASV A;  3BF1 A;  1P8Z A;  1EWR A;  1U04 A;  2J4R A;  3HOT A;  2Q36 A;  3O5B A;  1TYQ B;  1RBS A;  4CF0 A;  2P9I B;  2O8E B;  4F8R A;  2HL8 A;  4LF9 K;  5J2M A;  4C8L A;  3CJA A;  4I8O A;  3NCI A;  2VG6 A;  4NXM K;  3FZH A;  5BN8 A;  4B9M A;  4CCH A;  2F4V K;  3P31 A;  5F9C A;  5KRS A;  1UWB A;  4FM0 A;  3SYZ A;  3RMB A;  2ZFD B;  1HU0 A;  4JKD A;  4BRE A;  4F3O A;  2YX6 A;  3OSM A;  2D0A A;  3AO4 A;  3ZT0 A;  4FYD A;  1W0H A;  1YTU A;  3A5O C;  4FJG A;  3ULE B;  3WXL A;  1BGX T;  3I0S A;  4M45 A;  3N4P A;  2OYQ A;  1JLG A;  3CWT A;  4YOY A;  4E89 A;  1D4X A;  4M3Z A;  1KFI A;  3NGI A;  5AQG A;  2JWL A;  2UUC K;  4DR6 K;  1DIZ A;  2NOZ A;  1YXQ A;  1WB9 A;  4B3O A;  3MXI A;  3KIO A;  4AIL C;  2P1J A;  4ZHR A;  1VQK N;  3CET A;  4CD1 A;  2QRD A;  3OYF A;  4KH5 A;  1KRP A;  4YY3 K;  2HHU A;  2Y8L A;  1YUW A;  4DTO A;  3HL8 A;  3P39 A;  4BRF A;  4AHR A;  1VSJ A;  4M41 A;  3RWU A;  2X74 A;  1NG9 A;  5AZJ A;  2GEM A;  3SAF A;  1ZBL A;  5K14 A;  1KAZ A;  1RGI A;  3G71 N;  2WUS A;  3NH0 A;  2QR1 A;  4FPB A;  4TPS A;  4YOW A;  4NCA A;  4B3T K;  1GLB G;  4B3S K;  4F2S A;  3A5M C;  1TKX A;  4JYA K;  1VQO N;  2G8V A;  5KPZ A;  3C6T A;  2HZS A;  1TV6 A;  1WSF A;  2I7P A;  1QNC A;  3WEE A;  2QRE A;  3CIP A;  3WUH A;  4NCG A;  5C0Y A;  2HHQ A;  3CCV N;  1JJ2 M;  4IO8 A;  5FLX O;  3ZSY A;  2ETJ A;  2BDP A;  4CEQ A;  4B3R K;  3RMC A;  4FWQ A;  4JHD B;  3SAG A;  1WAJ A;  3M3Z A;  3V9U A;  2G8F A;  3SUQ A;  3O1W A;  4LFB K;  1Y97 A;  2LSN A;  1EWQ A;  1JLF A;  1CZA N;  4Z4H A;  3PLA A;  3QNN A;  3HBT A;  3GL1 A;  4FWS A;  5JMV A;  3O3G A;  1G99 A;  2KKZ A;  1PZD A;  3OYI A;  3G4S N;  4X62 K;  3NFA A;  1VSM A;  4GVM A;  4PHT X;  3CCL N;  1LWY A;  2YV0 X;  1NJI O;  4J2E A;  4I7F A;  4CZM A;  4EAJ A;  3VA3 A;  2O8F A;  1BL3 A;  1RT5 A;  3QFP A;  1YTA A;  4DR1 K;  5J1E A;  5M1P A;  1VKL A;  4FO0 A;  1WSJ A;  4UY8 O;  3ZT1 A;  4CBU A;  3KWG A;  2P9K B;  3VGM A;  3VA0 A;  1YTF A;  4JHD A;  3BZC A;  4GV9 A;  1D9F A;  4Y1D A;  4DSI A;  1V5S A;  1D5A A;  1W9H A;  2NRX A;  3HZ6 A;  2FF3 B;  1WNS A;  1T6A A;  2AA4 A;  4LC9 B;  1A5V A;  5IYD P;  2OA8 A;  1KY7 A;  4PL7 A;  2XHB A;  2Y1J A;  1CXU A;  3HPG A;  3U4L A;  4FXD A;  4B1Y B;  4CEA A;  3K5M A;  2YH5 A;  1IG8 A;  5CZ2 A;  1SV5 A;  4WCE L;  3OS2 A;  3EKU A;  3ZSO A;  1TKD A;  3WQT A;  4O4G A;  1S1U A;  4CFF A;  5ADX H;  4JS4 A;  4UQG A;  1NVP A;  4B3M K;  3LL3 A;  3H45 C;  4J2B A;  2YA3 A;  2P9P A;  1QN4 A;  5LMN K;  1UAX A;  5C25 A;  3HM9 A;  2Y1I A;  1OH7 A;  1JLA A;  2NZT A;  3LWM A;  2CGL A;  2E2N A;  5CE3 A;  3DLE A;  1RIL A;  4FW2 A;  4CJU A;  1YTB A;  3IDH A;  4DS4 A;  1QSY A;  2PY5 A;  2W6L A;  1WSG A;  4FWN A;  5TKY A;  4HUG A;  4FZY A;  3TDH A;  1OVQ A;  2UUA K;  5C12 A;  3MWT A;  3SI6 A;  4I6M A;  1XNR K;  1NJZ A;  3THW A;  1JLB A;  2ZD1 A;  2BE2 A;  4CER A;  3A5L C;  3HOS A;  4FM1 A;  3V1Q A;  3RR7 A;  1S1W A;  4AH9 A;  1HNW K;  2HHT A;  2XY7 A;  4W5T A;  2I5J A;  4C23 A;  1D8Y A;  3KK2 A;  4OLB A;  1KYU A;  1Q7Y O;  1BDG A;  4AHV A;  2DFH A;  1K2Y X;  1VAZ A;  3PIP L;  3AO3 A;  4CHQ A;  1QHT A;  2DKC A;  3OLP A;  2YNI A;  4JI8 K;  4JKG B;  4IJN A;  5GAD P;  3D4V A;  2Q2R A;  4FLX A;  5JLH A;  4M63 C;  3O3F A;  3ZYY X;  1HMV A;  4GMJ B;  3R1X A;  4LD0 A;  3J80 O;  2Y8Q A;  3O80 A;  4E1M A;  2BGG A;  1BIS A;  1VQL N;  3S3O A;  4BDZ A;  5GAG P;  3OYA A;  1VQ5 N;  2ASO A;  2G8I A;  3TU5 A;  1EX4 A;  1IG9 A;  2CGJ A;  4AF1 A;  5HRO A;  2IVO A;  4WQ5 A;  4HVJ A;  3ATU A;  1U2V B;  3U3G A;  4X66 K;  1ATN A;  4AQY K;  1VQ6 N;  2W42 A;  4DSL A;  3QER A;  3ZEU B;  4DFJ A;  2QXL A;  5JS2 A;  1C0G A;  3SCX A;  3OYB A;  1SL2 A;  3TTF A;  4K43 A;  1YJ9 N;  4FJ9 A;  5BMN A;  3KKR A;  1KYF A;  3B8A X;  4O44 A;  3U9Z A;  3CCM N;  2IC3 A;  1XMO K;  1WBD A;  3MX2 A;  3KD1 E;  3TAQ A;  1QNE A;  3MX5 A;  3L8B A;  3BZK A;  1Z05 A;  4MO5 A;  3SBG A;  2IVP A;  4EAI A;  4U67 L;  1YIJ N;  2NOL A;  4C1N K;  1Q86 O;  3CD6 N;  1PVS A;  3BGR A;  1RDA A;  4EP4 A;  3OY9 A;  4KHU A;  2HVH A;  2V51 B;  2QEX N;  1FKP A;  1BO5 O;  5JVG L;  3CER A;  4A57 A;  3T69 A;  1NGG A;  5KGW A;  4KV8 A;  4BDY A;  3DPU A;  2UXC K;  1YF5 L;  3F5T A;  3V1O A;  2GTD A;  2IIR A;  4OVL A;  3JAM O;  2FC0 A;  1AIS A;  4JI7 K;  2A40 A;  1MU2 A;  3D2E B;  3ZSW A;  3OS0 A;  3V6D A;  5AN4 A;  3LWL A;  4A5A A;  3OYD A;  3A8Y A;  1I94 K;  3NGZ A;  3C04 A;  4H0P A;  4FJ7 A;  4BGA A;  1ASW A;  3EN9 A;  2FSK A;  4XIU A;  4HCC A;  1NGD A;  4FWL A;  4ILJ A;  4RW6 A;  3CWS A;  2KW4 A;  4H5W A;  3HP6 A;  3F0Z A;  3TR8 A;  1JLQ A;  5BPN A;  3WXK A;  2NRZ A;  4X65 K;  3OA9 A;  2YHA A;  4B0A A;  2NOI A;  1FW6 A;  4CZF A;  4DUZ K;  4Q0B A;  4HJH A;  1NBW A;  3OYN A;  1W7A A;  2ZE2 A;  3PO4 A;  3ZSV A;  4BVO A;  4PL8 A;  1WSH A;  4BDP A;  4DSF A;  3FZF A;  4CIF A;  4QAG A;  1N5Y A;  1RBV A;  3SQ1 A;  2GX9 A;  2B6A A;  4CI6 A;  3ENB A;  4CBW A;  3NA5 A;  4O8K A;  3I3W A;  4MLH A;  2WON A;  5C24 A;  3GDQ A;  4JAX A;  3D2F B;  1P90 A;  1YAG A;  3VQ9 A;  2NOE A;  4R5P A;  3NHG A;  1VSD A;  3NH2 A;  5HLF A;  3VQ6 A;  3BKQ X;  3HP9 A;  4DV5 K;  1YVU A;  2QWR A;  3OC3 C;  4WFN L;  4DQS A;  4FL9 A;  3CWA A;  1NGI A;  3H3O B;  1FK9 A;  2D0C A;  2VWK A;  2P9N B;  3VTI A;  1KAY A;  4E19 A;  4JI5 K;  2QA4 N;  5HRN A;  1TGH A;  3NF9 A;  1MDU B;  4KHP K;  3D0P A;  4BE2 A;  1E4F T;  1N39 A;  1YQR A;  2Z1J A;  2YNG A;  3FZM A;  4FLZ A;  4W5N A;  3KJV A;  1G15 A;  1B9D A;  1IO2 A;  2PAV A;  4FJM A;  3D45 A;  3G6E N;  4KH4 A;  3WNH A;  2H3G X;  2QKB A;  3VES A;  4DU4 A;  2HL9 A;  3AA2 A;  2WTU A;  1TL3 A;  4DR3 K;  5JIC A;  2XY8 A;  5J2N A;  4E7H A;  3DLB A;  5CR4 A;  4DTS A;  2IV8 A;  4QS8 A;  4B9Q A;  3CC4 N;  4H0Y B;  4DV7 K;  1WQA A;  1C0U A;  3AVB A;  3LDP A;  4W5O A;  1NU0 A;  4PKH A;  4M3Y A;  4CIE A;  3RSE A;  3SNS A;  2QXF A;  1X9M A;  1T6D A;  4A59 A;  4N76 A;  1EP4 A;  3OCI A;  1BA0 A;  2OZM A;  4CJE A;  3HS8 A;  1SKW A;  3SUP A;  3AO1 A;  3LDO A;  4KRF A;  3SV4 A;  4KH6 A;  2GEL A;  3KTQ A;  1J9A A;  2WFB A;  3SMP A;  4JK7 A;  4KB1 A;  3VEN A;  3WNF A;  4DQI A;  3GE1 A;  3MK6 A;  5KPR A;  5LJW A;  3DI6 A;  1TUY A;  1RT4 A;  4RW7 A;  2QWL A;  3AVK A;  2A1R A;  5AQL A;  1HKC A;  2CH5 A;  1T8E A;  1FN7 A;  1MWM A;  5FDL A;  1VQ8 N;  1ATS A;  5LL6 Z;  4BRI A;  3CHW A;  3UKU A;  3NF6 A;  3OJU A;  3UIQ A;  1TL1 A;  4LFA K;  1SKS A;  3AVH A;  4FM2 A;  1UOC A;  1BCO A;  1GOA A;  1JDY A;  1T44 A;  3O4Q A;  3J7Z O;  1ZBI A;  3ZT2 A;  4BRP A;  4FJI A;  2Q0U A;  3HYF A;  4IDH A;  5AQS A;  3VQ8 A;  3HXM A;  3QEP A;  2O8C B;  3OH6 A;  2OOX A;  5I42 A;  2A1S A;  4DTX A;  3HT3 A;  4RTF D;  5CZ1 A;  1OH6 A;  1K73 O;  1OVY A;  3QML A;  3OVN A;  5CY4 A;  1PCM X;  1S9G A;  1N6Q A;  1LCU A;  3VQB A;  3FLC O;  1VHX A;  1NK7 A;  3KLF A;  3PIO L;  1LWE A;  1UT4 A;  3OYG A;  1IBK K;  3QIP A;  1QN7 A;  3V1R A;  3QB0 A;  1K8K B;  1LOT B;  1BCM A;  4LH4 A;  2VCP A;  4DHY A;  1NJY A;  4H5R A;  4BR4 A;  2A42 A;  4CF8 A;  1E4G T;  3FE1 A;  1XHZ A;  4OKK A;  4O5B A;  4BRL A;  1HNZ K;  4AM7 A;  2KZM A;  3LAL A;  3L2U A;  3HO1 A;  3OYE A;  4BQL A;  2UYT A;  5AJ3 K;  3DLK A;  1EXQ A;  3D7E O;  3R3L A;  2JPI A;  1C0T A;  4FSV A;  3W0L A;  4WX8 A;  1YJW N;  4CGD A;  3CXC M;  3ZSQ A;  3KRM A;  3Q7C A;  5GIP A;  3D7Q A;  2DY4 A;  2Z1H A;  1JXB A;  1P5G X;  1GLF O;  1IH7 A;  4FK0 A;  5SWM A;  1XI1 A;  1XNQ K;  1WOQ A;  5KQ8 A;  1QN9 A;  4OPJ A;  3I0X A;  4JI6 K;  2F7L A;  3ENO C;  1BOT O;  4F2R A;  1IKW A;  1TUU A;  2E6M A;  3HI0 A;  4BG8 A;  3CCJ N;  3PSF A;  3WQU A;  5GAH P;  3IUC A;  3HST B;  4KTZ A;  1FJG K;  1U4B A;  1RDU A;  1HQU A;  2KLA A;  4EIA A;  1TGO A;  1VSI A;  4CGH A;  2QRC A;  1QTP A;  4CZH A;  4EHU A;  3THV A;  4J2D A;  3CM6 A;  3C6U A;  2O8F B;  4GV6 A;  1DT9 A;  1BUP A;  2VWJ A;  5AQR A;  1DLO A;  3VEO A;  1N36 K;  1HYV A;  1MWK A;  1RTH A;  4TSX A;  2ASM A;  1N33 K;  5E26 A;  3LP3 A;  1UT7 A; 
#chains in the Genus database with same CATH homology
 1A5V A;  5IYD P;  2GUI A;  4RW4 A;  2OA8 A;  1S9E A;  1KY7 A;  3IG1 A;  2XHB A;  4FLT A;  2Y1J A;  1CXU A;  2HHS A;  3S3N A;  3HPG A;  1C1C A;  1RBU A;  3ZT3 A;  3O3H A;  2O4G A;  4KHQ A;  4KHN A;  4FXD A;  3NF7 A;  3ULX A;  4CEA A;  3K5M A;  2Z1I A;  4CF1 A;  1A5W A;  1LV5 A;  1CXQ A;  2YH5 A;  5CZ2 A;  1YQK A;  1SV5 A;  3NH1 A;  3OS2 A;  1TKD A;  3ZSO A;  1NK0 A;  4O4G A;  1EKE A;  3LAK A;  1S1U A;  4FLW A;  4ZTF A;  4W5N A;  5KGX A;  1RTI A;  4HUF A;  2KFZ A;  3C95 A;  4UQG A;  4JS4 A;  1S5J A;  1NVP A;  1XC9 A;  3K57 A;  4Z4E A;  4E1N A;  4FLV A;  2NOH A;  1RDB A;  4J2B A;  1ITG A;  4AHC A;  1VSH A;  5DK5 A;  3RRG A;  3CYM A;  1QN4 A;  1T7P A;  4F3O A;  3OYM A;  4H4O A;  2OZS A;  1UAX A;  4HCB A;  5C25 A;  3HM9 A;  2Y1I A;  1KLN A;  3OYJ A;  2G8W A;  1JLA A;  1WLJ A;  2Z1G A;  2YKN A;  1VSF A;  4FJX A;  2QK9 A;  3HJF A;  3LWM A;  4L8R B;  1S1V A;  3AO5 A;  3DLE A;  1HQE A;  3DLR A;  4CK3 A;  1RIL A;  2MZ8 A;  4H4M A;  4FW2 A;  4CJU A;  1YTB A;  3VQ7 A;  3OS1 A;  4DS4 A;  4ZTJ A;  1TKT A;  1QSY A;  3K5O A;  1WSG A;  2PY5 A;  4M3T A;  3QIN A;  3V9X A;  2NOF A;  1C0M A;  3VQQ A;  3TAP A;  1R4X A;  4B8A B;  4CJF A;  4F3T A;  3L3V A;  4HUG A;  4FZY A;  4LH5 A;  1E42 A;  3TAR A;  2RF2 A;  4Z4C A;  4CEC A;  4C8O A;  4C8K A;  3I0R A;  4CJR A;  4KI6 A;  4PWD A;  1NK6 A;  3VQE A;  4DSJ A;  4KHS A;  3SI6 A;  1X1P A;  4QCL A;  4ID1 A;  1EBM A;  1NJZ A;  3KLI A;  4DFK A;  3MED A;  4CIG A;  4FVM A;  1NOZ A;  1L3V A;  2ZQB A;  2O4I A;  1JLB A;  2ZD1 A;  2BE2 A;  3TAE A;  2P5O A;  1I3A A;  1VOL B;  1BIZ A;  1BQM A;  4CER A;  4N5S A;  1M3H A;  3M8P A;  3V1Q A;  2NUB A;  4FM1 A;  1RDC A;  1S1W A;  3RR7 A;  4C8N A;  1IKX A;  4AH9 A;  3OJS A;  4FK4 A;  1VRU A;  4WZS D;  3AA5 X;  1CDW A;  1KVC A;  4KFB A;  4BWJ A;  4CJL A;  3L2R A;  4HUE A;  2HHT A;  4CEE A;  3TAF A;  2XY7 A;  1QSL A;  3LP1 A;  4W5T A;  3O4N A;  4E7I A;  1NK4 A;  4DQR A;  4B9S A;  1SKR A;  2I5J A;  4G1Q A;  5HRR A;  4DF4 A;  2DFF A;  4DTU A;  1KFS A;  1SL1 A;  3KK2 A;  1WSI A;  4DF8 A;  1KYU A;  1D8Y A;  4FJJ A;  4OLB A;  1O1W A;  4CJP A;  4AHV A;  2DFH A;  1N3C A;  3K59 A;  1ZBF A;  3U3Y A;  1QSS A;  1DTQ A;  3F10 A;  3OYL A;  2AJQ A;  3AO3 A;  4CHQ A;  4CEZ A;  1QHT A;  2XY5 A;  3QIO A;  4EP5 A;  3P83 D;  3IH7 A;  5CYM A;  2IV9 A;  2YNI A;  2FBY A;  4CJ5 A;  1BQN A;  4KRF A;  4KB0 A;  1L3S A;  4Z4I A;  4CJS A;  2E6L A;  5FRM A;  1WSE A;  3LP2 A;  3SQ4 A;  1QTM A;  4FLX A;  4CGG A;  1NH2 A;  2OPP A;  1TBP A;  1XHX A;  3O3F A;  3KLG A;  2XRI A;  1HMV A;  1M3Q A;  2HNY A;  4GMJ B;  4LD0 A;  3HPO A;  4LY7 A;  3VQ5 A;  3T3F A;  4DLE A;  4E1M A;  1RNH A;  2X6N A;  4IFY A;  2YHB A;  3L2V A;  2B4J A;  5HP1 A;  2PYJ A;  2BGG A;  5D3G A;  1BIS A;  1HYZ A;  2F8T A;  4M3R A;  1Q9X A;  1Q8I A;  1UT7 A;  3K58 A;  2HHV A;  2WOM A;  2D5R A;  1LW2 A;  3ZSX A;  1C1A A;  4CJ3 A;  4I2P A;  3S3O A;  4DQP A;  2F96 A;  4O0I A;  4IG0 A;  4BDZ A;  3S3M A;  3OYA A;  4FJ8 A;  1QN6 A;  4M3U A;  1F21 A;  1GOB A;  2G8I A;  4N41 A;  3EZ5 A;  4EJZ A;  4FZZ A;  1EX4 A;  1LAW A;  1IG9 A;  4NYN A;  1KTQ A;  2O3O A;  4CFC A;  4IBN A;  3DPT A;  3AVL A;  5HRO A;  3CFO A;  1B9F A;  4HVJ A;  4DTP A;  4O0J A;  3KK1 A;  3SQ0 A;  4QOZ B;  1ZBH A;  1VTL E;  3LPU A;  3U3G A;  3TAB A;  2HW3 A;  3LPT A;  2W42 A;  4DSL A;  4DMN A;  2PYL A;  3RPJ A;  4GW6 A;  1B9K A;  1NGM A;  4ICL A;  3L2Q A;  5JS2 A;  5HRP A;  4DU3 A;  4DTM A;  4DFJ A;  3QER A;  1D9D A;  3SUO A;  3E01 A;  4B08 A;  3SCX A;  3OYB A;  1SL2 A;  4OGC A;  3IS9 A;  3AA3 A;  4W5Q A;  3AVJ A;  3HS9 A;  1IKV A;  1HNV A;  3NBP A;  4JLH A;  4CF9 A;  4FJ9 A;  3KKR A;  1KYF A;  4O44 A;  1KCF A;  1SUQ A;  4HHT A;  3DRS A;  1BI4 B;  2IC3 A;  4CJK A;  5HRS A;  4EZ9 A;  1L3T A;  1QS4 A;  4Z4G A;  2YKM A;  3QES A;  3KD1 E;  5SZT A;  5C42 A;  4YNQ A;  3OYH A;  3TAQ A;  1QNE A;  2OPQ A;  4M3W A;  4CEB A;  5KTQ A;  4B9U A;  3OYC A;  3K5L A;  4IKF A;  3A2F A;  3DOK A;  3L8B A;  1U49 A;  4CJQ A;  3TWH A;  1C1B A;  1HPZ A;  3DMJ A;  4DQQ A;  4DWI A;  4KHY A;  3H1Z A;  4CFD A;  1QN5 A;  4K8Z A;  2NOL A;  4FW1 A;  3IRX A;  3SNN A;  3BGR A;  1SL0 A;  4B9L A;  1RDA A;  4FK2 A;  4EP4 A;  1Z25 A;  3OY9 A;  2I5W A;  4KHU A;  4CHP A;  4C8M A;  2HVH A;  3L2W A;  1FKP A;  2IGI A;  1EET A;  3DRP A;  2MJ7 A;  3LZJ A;  4CE9 A;  1CZB A;  5KGW A;  3M8R A;  4KV8 A;  3SV3 A;  4E3S A;  4BDY A;  3DPU A;  1IKY A;  1VSE A;  3ITH A;  5IYB P;  3V1O A;  4OVL A;  2FC0 A;  1AIS A;  1RTJ A;  2P51 A;  4OJR A;  3L3U A;  4H8K A;  2JLE A;  4KTW A;  2YNF A;  1L3U A;  1MU2 A;  3ZSW A;  4B8C A;  3OS0 A;  3RRH A;  3FFI A;  3M8S A;  5AN4 A;  3U6F A;  3V6D A;  4Z4F A;  3LWL A;  1ZYQ A;  3OYD A;  4CHZ A;  3NGZ A;  3WNG A;  4FJ5 A;  1QNA A;  1JLC A;  4AHS A;  4JS5 A;  4FJ7 A;  3RR8 A;  4J2A A;  3HVR A;  3AVN A;  5HBM A;  1ASW A;  2Q3S A;  4DTJ A;  1WAF A;  4XIU A;  4HCC A;  4OLA A;  1C6V A;  1REV A;  3K5N A;  3ASM A;  5IYC P;  3M8Q A;  5J2P A;  2RKI A;  2QKK A;  1JL2 A;  3TAN A;  1R0A A;  4RG8 A;  1ASU A;  4RW6 A;  2KW4 A;  3HP6 A;  1RM1 A;  3VQ4 A;  3F0Z A;  4DTR A;  3TR8 A;  1B92 A;  4RW8 A;  4ELT A;  3QET A;  2HHW A;  1JFI C;  1JLQ A;  4LSN A;  4CEF A;  4CHN A;  3MEC A;  4YFU A;  1RT7 A;  5EU7 A;  2R7Y A;  1I39 A;  2VJ0 A;  4DTN A;  2EHG A;  2YHA A;  4B0A A;  4CJT A;  3CFR A;  4B9V A;  3KK3 A;  1KO9 A;  3S9H A;  2NOI A;  4I9L A;  3SQ2 A;  1LW0 A;  4KO0 A;  1HRH A;  1HJR A;  3EIK A;  4AHU A;  4Q0B A;  2BAN A;  3VQC A;  3KLE A;  4KPY A;  3RTV A;  3OYN A;  4PY5 A;  2ZE2 A;  3QEV A;  1LAV A;  2G8H A;  4DUL A;  3ZSV A;  3PO4 A;  3RMA A;  3DYA A;  4DSE A;  4CES A;  4IDK A;  4Q5V A;  2ATQ A;  2JOI A;  1VRT A;  5FRO A;  5I3U A;  1NKC A;  1WSH A;  4BDP A;  1HYS A;  3NAE A;  2IDO A;  3HVT A;  4DSF A;  4CIF A;  4QAG A;  4ELU A;  1CZ9 A;  1N5Y A;  1RBV A;  4EJY A;  3KKS A;  1UA0 A;  4JRQ A;  3PUF A;  2FBV A;  4NYF A;  4BE0 A;  3SQ1 A;  4E7K A;  3TAM A;  2B6A A;  3VQA A;  2FBT A;  1FXX A;  2HB5 A;  5C24 A;  2WON A;  4W5R A;  3QLH A;  2VG5 A;  3DLG A;  3VQ9 A;  3LDS A;  3LP0 A;  4JRP A;  2NOE A;  4CJV A;  4R5P A;  3NHG A;  1VSD A;  1VSL A;  3NH2 A;  5J2Q A;  2FBX A;  2OPR A;  5HLF A;  4N47 A;  3VQ6 A;  3PO5 A;  3AV9 A;  4PUO A;  2RN2 A;  5CYQ A;  2FGT A;  1TK0 A;  3HP9 A;  4Z0U A;  3H08 A;  1YVU A;  1KSP A;  1XWL A;  3I0W A;  3CG7 A;  2EX3 A;  1U45 A;  3OC3 C;  3DRR A;  5FRN A;  3KD5 E;  4DQS A;  4B9N A;  4CJW A;  3NE6 A;  3QEX A;  2DTU A;  1N3A A;  1C9B B;  1KVB A;  1FK9 A;  1QN8 A;  4CFB A;  3PY8 A;  2D0C A;  2VWK A;  3KTU A;  3TI0 A;  4E19 A;  1JLE A;  4BE1 A;  1KFD A;  3VQD A;  4ROD B;  5HRN A;  1TGH A;  4E0D A;  3NF9 A;  1W80 A;  5KRT A;  3V81 A;  3D0P A;  3TAG A;  2ITG A;  4WE1 A;  4BE2 A;  1NKE A;  4FJH A;  1N39 A;  3PX0 A;  1Z26 A;  2PZS A;  1YQR A;  2Z1J A;  2YNG A;  1NJX A;  4FLZ A;  1QN3 A;  3NF8 A;  1G15 A;  4CFA A;  1B9D A;  3KJV A;  1RBT A;  1IO2 A;  1S6Q A;  3CM5 A;  4FJM A;  4FJK A;  3N89 A;  3D45 A;  4FLU A;  1UA1 A;  1T05 A;  2E4L A;  4DS5 A;  1L5U A;  1DTT A;  1BI4 A;  4I2Q A;  3WNH A;  3G10 A;  2HZM A;  3AVC A;  4CEO A;  4ELV A;  2XHI A;  4KRE A;  2QKB A;  2HND A;  4NCB A;  1WN7 A;  1Q9Y A;  4DU4 A;  3CQ8 A;  1HNI A;  4E7J A;  1JXE A;  1S6P A;  3AA2 A;  3MXM A;  4FZX C;  2DFE A;  1D3U A;  1QQC A;  5T7B A;  3I8D A;  4O55 A;  1RDD A;  1TL3 A;  4FLY A;  5KI6 A;  4M42 A;  2GV9 A;  2XY8 A;  4DFM A;  4E7H A;  5J2N A;  3QEW A;  3PX6 A;  3DLB A;  3JSM A;  4M3X A;  4CHO A;  4DTS A;  3AA4 A;  3VN5 A;  1VTO A;  1X9S A;  1CLQ A;  1VSK A;  2IV8 A;  2NOB A;  1QTS A;  4DLG A;  1RBR A;  3V9W A;  4ROE B;  1RT2 A;  1TBA B;  3B6O A;  3EY1 A;  3B6P A;  3AVF A;  3WNE A;  3SPZ A;  1ASV A;  3HPH A;  1BIU A;  3SJJ A;  1U04 A;  1J5O A;  1NOY A;  1C0U A;  2HNZ A;  3AVB A;  3T1A A;  4W5O A;  2KZZ A;  1BHL A;  4CHY A;  1YT3 A;  2HVI A;  1NKB A;  1RBS A;  1LWC A;  4M3Y A;  4CF0 A;  4CIE A;  3SNS A;  1KVA A;  2QXF A;  3QO9 A;  4E7L A;  1X9M A;  5J2M A;  4C8L A;  4F8R A;  4N76 A;  4I8O A;  2IS3 A;  3NCI A;  1KLM A;  1ZBU A;  2VG6 A;  1RT1 A;  3SUN A;  4B9M A;  4CCH A;  2F8S A;  1EP4 A;  1TK8 A;  5KRS A;  1UWB A;  4FM0 A;  3SYZ A;  3OCI A;  4MQ3 A;  2OZM A;  3RMB A;  1T03 A;  1RTD A;  2JGU A;  4CJE A;  3HS8 A;  3NGY A;  4CED A;  3AO1 A;  1HU0 A;  3OYK A;  3SUP A;  1SKW A;  4CK2 A;  2VG7 A;  3SV4 A;  3V4I A;  2HMI A;  3KTQ A;  1S1X A;  1J9A A;  3AVG A;  3DM2 A;  4AHT A;  3LZI A;  2IAJ A;  3DLH A;  4KB1 A;  3OSM A;  2D0A A;  3AO4 A;  4IG3 A;  3WNF A;  3ZT0 A;  4DQI A;  4FYD A;  3SZ2 A;  1W0H A;  1YTU A;  3DI6 A;  3ZT4 A;  3OST A;  4FJG A;  4FJL A;  3ISN C;  1BGX T;  3I0S A;  4M45 A;  1RT4 A;  4KKO A;  1JLG A;  3AVK A;  4RW7 A;  3ALY A;  4E89 A;  2A1R A;  2OYQ A;  3P1G A;  4M3Z A;  3NGI A;  2RPI A;  2NOZ A;  4OKJ A;  1TAQ A;  1FN7 A;  1S1T A;  4OPK A;  1T8E A;  2KTQ A;  5FDL A;  4ROC B;  2LAE A;  1GOC A;  1PCZ A;  4ID5 A;  1TK5 A;  2X6S A;  4B3O A;  3MXI A;  3RMD A;  3NF6 A;  3KIO A;  4DFP A;  4AIL C;  3OJU A;  1K6Y A;  4CK1 A;  3CFP A;  3UIQ A;  2P1J A;  1TL1 A;  4ZHR A;  2Z8U A;  3AVH A;  4FM2 A;  1U47 A;  1SKS A;  2KQ2 A;  1UOC A;  2G30 A;  1BCO A;  1GOA A;  4EZ6 A;  3O4Q A;  3BDP A;  3OYF A;  3K2P A;  4KHW A;  2D0B A;  1JL1 A;  3V9S A;  1ZBI A;  3ZT2 A;  2IOC A;  4FJI A;  1LWV A;  3HYF A;  3VQ8 A;  3HXM A;  3QEP A;  3ZSR A;  1KRP A;  2HHU A;  4OGE A;  4DTO A;  5I42 A;  3HL8 A;  2A1S A;  4DTX A;  3EYZ A;  1LWF A;  3AVM A;  4AHR A;  1VSJ A;  3HT3 A;  1YQM A;  1YQL A;  4M41 A;  2B5J A;  3RWU A;  3MEG A;  2X74 A;  5CZ1 A;  4CGF A;  5JS1 A;  1KYD A;  3LAN A;  1ZBL A;  5K14 A;  3OVN A;  5CY4 A;  4CJ4 A;  4DSK A;  3PX4 A;  4CGJ A;  1S9G A;  4DU1 A;  1N6Q A;  3VQB A;  1NK7 A;  4LSL A;  3KLF A;  3NH0 A;  4PQU A;  3QNO A;  4TPS A;  1LWE A;  1UT4 A;  3OYG A;  3MAQ A;  3QIP A;  1QN7 A;  3V1R A;  4B9T A;  4F4K A;  4NCA A;  1BCM A;  4F2S A;  1KY6 A;  4LH4 A;  1TKX A;  1NJY A;  2G8V A;  1A5X A;  3C6T A;  1NK9 A;  4CF8 A;  2HZS A;  1TV6 A;  4IFV A;  1WSF A;  4K8X A;  3AVA A;  3QEI A;  4OKE A;  1XHZ A;  1NK8 A;  2HHX A;  4OKK A;  3KLH A;  4O5B A;  3C94 A;  1QNC A;  3VQP A;  2KZM A;  4NCG A;  1VK0 A;  2HHQ A;  3LAL A;  3L2U A;  3HO1 A;  1QE1 A;  3OYE A;  3HK2 A;  4KAZ A;  3ZSY A;  4HTU A;  2OPS A;  2ETJ A;  3G0Z A;  4PA1 A;  2BDP A;  4CEQ A;  3P5J A;  3DLK A;  1EXQ A;  2XY6 A;  3RMC A;  2G8K A;  3ZCM A;  1C0T A;  1LWW A;  1WAJ A;  2P5G A;  1TVR A;  4Q11 A;  2XO7 A;  4CGD A;  3V9U A;  2G8F A;  3MXJ A;  3ULD A;  3PV8 A;  1JKH A;  3SUQ A;  3AVI A;  1U48 A;  4KI4 A;  1Y97 A;  1RCH A;  2LSN A;  3ZSQ A;  3KRM A;  3F73 A;  1JLF A;  4Z4H A;  3QNN A;  2DY4 A;  1NJW A;  2Z1H A;  4CF2 A;  1JXB A;  1IH7 A;  4FK0 A;  4Y1C A;  5SWM A;  3ZSZ A;  1XI1 A;  3IAY A;  1MP9 A;  3O3G A;  5E41 A;  4N56 A;  2G8U A;  1QN9 A;  4OPJ A;  3I0X A;  1PZD A;  1FKO A;  3OYI A;  2KFN A;  1RT3 A;  3NFA A;  1VSM A;  3LAM A;  4GVM A;  4F2R A;  3AO2 A;  1LWY A;  1IKW A;  1J53 A;  2E6M A;  2YV0 X;  3DOL A;  1X9W A;  5DMR A;  4J2E A;  4I7F A;  3VA3 A;  3V9Z A;  1BL3 A;  1QNB A;  1RT5 A;  4MFB A;  2GBZ A;  3HST B;  4KTZ A;  4FCY A;  3F9K A;  1YTA A;  1U4B A;  5J1E A;  1HQU A;  4RW9 A;  1TGO A;  2YNH A;  1VSI A;  1WSJ A;  4CGH A;  3ZT1 A;  2X78 A;  1QTP A;  4BAC A;  3VA0 A;  1NK5 A;  1YTF A;  4CGI A;  3THV A;  4I9Q A;  4J2D A;  3CM6 A;  3C6U A;  1TAU A;  4BWM A;  2VWJ A;  1D9F A;  1J54 A;  4Y1D A;  4DSI A;  1DLO A;  3MEE A;  3T19 A;  1D5A A;  1W9H A;  1HYV A;  1RTH A;  4DG1 A;  1WNS A;  4KTQ A;  4TSX A;  1VOK A;  3SPY A;  4FJN A;  3NDK A;  1TKZ A;  3LP3 A;  1RT6 A;  3JYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...