4PY5A

Thermovibrio ammonificans rnase h3 in complex with 19-mer rna/dna
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
267
Chain Sequence
SMKLSSSEKEKLLKKLKALGAKEEKPPEHAQYRLRLNDAILTVYKSGSVVYGGKGREKLKELVAETVLSDTELPRIGCNEAGKGEFVGPLVVACIVADEKCLKRLIELGVKDSKKLSNEKVEELASEITETCHGKVKLLIPEKYNRAYSKFKNINRLLEAVYREIVSDLCEKFSPKVVVVDKFSNRAEEVLKDVVKGARLEVRPKAEDDLAVAAASIVAKAVRLKTMKELEKRFKVKLPEGNTGLAELLKKTPKELHEKLFKLHFSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of RNase H3-substrate complex reveals parallel evolution of RNA/DNA hybrid recognition.
pubmed doi rcsb
source organism Thermovibrio ammonificans
molecule tags Hydrolase/dna/rna
molecule keywords Ribonuclease
total genus 93
structure length 267
sequence length 267
ec nomenclature ec 3.1.26.-:
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4py5A01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4py5A02
2Z8UA 1KVAA 3VA3A 2G8HA 4FK2A 4B9LA 1TK5A 4DFKA 1JLAA 4CE9A 4DU3A 1NK7A 4CJUA 2D0AA 3VQ7A 4CIEA 1LWEA 2HHSA 3BGRA 3L3VA 1RT1A 3KIOA 1FKOA 3LZJA 1YTFA 1SL0A 4M45A 3C94A 4B9UA 4KB0A 3LP0A 2F8TA 4W5OA 1ZBFA 5IYDP 1DTQA 2B5JA 3CFOA 1BIUA 3NF6A 3O4NA 4AHRA 4OKKA 3AO3A 5HRSA 4N5SA 3K5NA 1VSEA 4DQSA 3AO4A 1S1TA 2OPQA 4ZHRA 1XC9A 2HHTA 4CIGA 4O0IA 4DTJA 3WNGA 4IG0A 4AHUA 1KYDA 3K2PA 3LZIA 4FZYA 1KYFA 1NK4A 4N56A 1KFDA 1VSLA 4DSJA 3RMBA 3CM6A 3DYAA 4CK3A 4CGJA 4FJ8A 2KTQA 3ZSRA 4I9LA 3TAQA 3ISNC 2NUBA 1C0UA 3I8DA 4DTNA 1NK6A 2BDPA 1BCOA 4FK0A 1EKEA 2LSNA 3OCIA 1WSHA 3CFPA 2XRIA 1IKVA 1BQMA 2OPPA 3V9ZA 3VQAA 3WNFA 2YNHA 4DTRA 3PV8A 1XHZA 4CF1A 2D0BA 1QN4A 2QKBA 4LSLA 1JLCA 1B9KA 4ICLA 1ZBIA 2XO7A 4JS5A 4MFBA 3AA2A 4WE1A 3ZSZA 1C1AA 3NGIA 2B4JA 4B3OA 1HNIA 4B9VA 2XY5A 4EZ6A 2HMIA 1RT5A 1C0TA 1NJXA 3V1RA 2ZQBA 4CJTA 1IO2A 2P1JA 1FK9A 4M3RA 3ZT0A 4EP4A 3RWUA 1VRUA 3AA3A 4KFBA 5CZ1A 4CJEA 2XY7A 4F8RA 3L2UA 4DSKA 3C95A 5HRRA 1D9DA 2VWKA 2OA8A 5J1EA 1MP9A 1GOAA 3LWLA 4Z4HA 4M41A 3C6TA 4CJSA 4CJKA 3TAFA 4CIFA 3S3MA 1JL2A 4KI4A 2PY5A 3EIKA 4KHNA 3QIPA 3OYAA 3EY1A 1IKXA 4I9QA 4XIUA 1SL2A 4Z4FA 3VQQA 4AHSA 2YHAA 4CGFA 3OYHA 4FJKA 1NGMA 3L8BA 4B9SA 4FJ5A 2VG5A 3AO5A 3PY8A 4DU1A 4L8RB 4IG3A 3TI0A 1Q9YA 3SI6A 3OYIA 2I5JA 4CJLA 2HHQA 3MECA 4M3UA 1NK0A 4CHYA 2FBYA 4KREA 2O4GA 3OJUA 3MXJA 4B08A 4CF8A 3PX4A 1HQEA 5DMRA 1DTTA 1WSEA 5I42A 3ZT3A 4GW6A 3KLFA 3TAMA 3K5OA 5KGXA 3SUOA 1TL3A 2HNDA 3NF8A 4EP5A 4FJMA 3ULDA 4CF9A 3DRRA 4QCLA 3AA5X 3DLRA 4HTUA 3AVJA 4HHTA 4OLAA 3TANA 4E19A 1N6QA 1T7PA 3V9SA 1L3UA 2FBVA 3M8RA 2G8WA 1S6QA 3RRHA 4RW9A 2G8IA 1BHLA 1EXQA 1FKPA 1HNVA 2OPRA 2IOCA 3HS8A 3AO2A 3LALA 3VQDA 3OJSA 1ZYQA 1K6YA 4BDPA 2IV8A 1S1XA 4DTXA 1TAUA 1QN3A 5HRPA 1VSDA 3LPTA 4HVJA 3WNEA 3QEWA 4B9TA 3V81A 1L3VA 1D5AA 3G10A 3OYDA 2HVHA 1I39A 4O4GA 3H1ZA 1QN5A 4OKJA 2EX3A 1YT3A 4CHPA 1TBAB 1W0HA 1VSJA 3AVNA 3VQBA 1BI4B 3NHGA 3T3FA 4FJJA 4N76A 3MXMA 4CJPA 4E7LA 3KLHA 1NH2A 4Z4CA 4BE0A 1RT2A 3NFAA 2YNFA 4F3OA 2YKMA 4OPJA 3HJFA 4B9MA 1KFSA 3P1GA 1WN7A 4HUGA 3OY9A 1U49A 1J5OA 4E7JA 3L2RA 1UA0A 4CERA 4BWJA 1IKYA 1D9FA 1C6VA 4DG1A 4DQRA 4W5NA 1CZBA 2DFEA 2X78A 4DQIA 4KTWA 1LAWA 2HB5A 1HMVA 4DTOA 1PCZA 4ZTFA 4FW2A 3K5MA 1GOCA 5EU7A 2HNZA 4R5PA 3LP1A 4DWIA 4M3XA 3O3GA 5T7BA 1TK8A 5HROA 2E6LA 1QS4A 1QTPA 1A5XA 2W42A 4C8OA 1RT6A 2PZSA 1TVRA 4AHTA 3RRGA 3KJVA 1CZ9A 4F3TA 3PX6A 1LW2A 1JLGA 4Q0BA 1E42A 3TAGA 3QEIA 4FCYA 1J54A 1RBVA 1TKDA 2HHXA 3AVFA 1BISA 3VQ4A 1Q8IA 2KFNA 1VOKA 4PY5A 3DI6A 4B8CA 1VOLB 2XY8A 3HP6A 4TSXA 3OC3C 2ETJA 2F96A 4ROCB 2MJ7A 3DM2A 3HP9A 4GMJB 4Y1DA 4DTMA 1NOYA 4LD0A 4KKOA 3ASMA 1BCMA 4RW8A 3QETA 4DSLA 3IG1A 1QQCA 3B6PA 4HUEA 2JGUA 2HHWA 1I3AA 5CYQA 4RW4A 3RMCA 4HUFA 1Q9XA 4C8LA 3KD1E 3MEEA 4EZ9A 4BWMA 1QSYA 3OYJA 3S9HA 1J53A 5HRNA 3DMJA 1ZBUA 3P83D 3HM9A 2YNIA 3SQ2A 4C8KA 3AVCA 4LH4A 3H08A 3T19A 4ZTJA 1R0AA 5HP1A 2GV9A 3CM5A 4CEBA 1UAXA 1SUQA 3ZSOA 1RDAA 3LP2A 4CGIA 1U47A 1L3SA 4BE1A 1KYUA 4Q5VA 4DTUA 3SUQA 1PZDA 3BDPA 5D3GA 4KB1A 4O55A 4CEQA 1RTJA 4OKEA 4CFDA 3QNNA 3KLIA 4FK4A 4CFAA 2RKIA 1UWBA 3KK2A 4GVMA 4PA1A 3T1AA 3NDKA 3SUNA 1R4XA 1UA1A 1HRHA 1RDCA 3C6UA 1NKEA 1L5UA 4J2DA 5FROA 3ZT2A 4M3TA 1GOBA 4E0DA 2A1SA 3K59A 4UQGA 1VTOA 3K5LA 2XY6A 3TABA 4FYDA 4J2BA 4DTPA 1LV5A 4QOZB 3OYNA 3G0ZA 1SV5A 4DF4A 1FXXA 1RT4A 3CYMA 2KW4A 1S9EA 3HPHA 3OS1A 2P51A 4DSFA 3VA0A 3SJJA 3NH2A 3DLBA 2B6AA 1WSJA 3CQ8A 4QAGA 4JRPA 1REVA 4CEFA 5J2PA 3PUFA 5SZTA 2YV0X 3HVTA 4E1MA 3O4QA 1YTUA 1X9WA 1IKWA 3AVMA 2FBXA 4RG8A 4FJ9A 3AA4A 2O4IA 3HPOA 3U3YA 2RPIA 4FLVA 1O1WA 3AVKA 3F9KA 3ZT4A 3SPZA 1QNBA 2KZZA 3E01A 4FLUA 1KLMA 4HCCA 4LY7A 4M3ZA 1ZBHA 3ZSQA 3L2VA 4KV8A 1U4BA 4FJGA 4E7IA 4M3YA 1RBTA 4KTQA 3TWHA 1BI4A 4AHVA 1WLJA 3O3HA 5FDLA 3OYGA 3KTQA 2GUIA 3TR8A 1NK9A 2E4LA 3DLKA 4KTZA 1J9AA 4OGCA 4AH9A 1SKWA 3THVA 3F73A 2VG7A 3S3OA 4DSIA 3UIQA 4IKFA 4KHWA 4FZZA 1D8YA 1ITGA 2IS3A 5KRSA 5DK5A 3DLHA 4YNQA 2Y1IA 1TK0A 1RNHA 4CJFA 1QTMA 2G8FA 3VN5A 2P5GA 4PWDA 4Z0UA 2HW3A 3HK2A 2DFFA 3DOKA 4I7FA 1SL1A 3L3UA 1G15A 4FM2A 1X9SA 3FFIA 4FJ7A 1QN6A 5C24A 4DFPA 3ZSYA 2Z1IA 3M8SA 2X74A 3SCXA 3I0RA 4Y1CA 3P5JA 1BIZA 3O3FA 4BDYA 2Q3SA 1RBUA 2BE2A 4CGHA 3OYMA 3EYZA 4DLGA 4ELTA 4DF8A 1C1CA 1TBPA 2GBZA 3QEVA 1BGXT 1QNCA 3NGZA 1MU2A 3OYKA 1ASUA 3AVGA 3NAEA 3KD5E 3SV4A 1VSMA 2IV9A 2D0CA 4MQ3A 4C8MA 1DLOA 3JSMA 1B9FA 5HBMA 1JXEA 4KO0A 5C42A 2VG6A 1WNSA 4E1NA 3KK3A 4E7KA 1WAFA 2ATQA 1YVUA 3AVAA 3ITHA 5KTQA 1HJRA 1RILA 4CJWA 4Z4GA 4CJ4A 4DU4A 4FZXC 4J2AA 3ZSWA 3AVIA 3A2FA 2E6MA 4IDKA 4AHCA 4FLTA 4H8KA 1W9HA 4O44A 1NJYA 3QESA 1RDDA 4CJQA 1KTQA 3KK1A 3SNNA 5KGWA 1QN8A 3IRXA 3KLEA 5J2QA 4CJ3A 1QTSA 3QINA 2HVIA 2HHUA 2QK9A 2X6SA 4OJRA 3L2WA 3ZCMA 4KRFA 4KI6A 1XI1A 1QN9A 1TKZA 1S1UA 3PX0A 3V9XA 3HYFA 3QNOA 1TV6A 3QEXA 2YKNA 4C8NA 4H4OA 4O5BA 4E7HA 1TKXA 4ID1A 1QSLA 4CF2A 4CK2A 4H4MA 4OGEA 4Z4IA 1S5JA 3IAYA 5HLFA 4FJNA 5K14A 2BANA 4W5RA 1N5YA 2G8VA 2OZSA 3KKSA 5J2NA 4ELVA 3HT3A 1W80A 1JKHA 2D5RA 3NF7A 2VJ0A 4FXDA 3U3GA 3HL8A 2A1RA 4Z4EA 3LDSA 2DY4A 1LWCA 4ROEB 3D0PA 1NOZA 3V6DA 3SZ2A 4JS4A 3K57A 3VQ9A 4W5QA 1KSPA 3QERA 1EETA 4ELUA 1HYVA 1LAVA 1NKCA 3V1QA 2KZMA 4K8XA 1NVPA 4B9NA 1WSIA 2IC3A 3VQEA 4J2EA 4G1QA 1JLBA 1XWLA 3L2QA 1B92A 3ALYA 5J2MA 1VTLE 1JXBA 1TGOA 1Z26A 3ZT1A 3B6OA 4CGDA 5IYBP 1RBSA 4KPYA 1T05A 2IAJA 2DTUA 1U48A 4W5TA 3V1OA 2XHBA 1RBRA 2OPSA 4CJRA 1VSFA 3NF9A 4CEDA 4CEOA 3NGYA 5KRTA 1IG9A 1S1VA 3MEDA 1CXUA 1QN7A 4IBNA 1TGHA 3OYEA 4DTSA 2R7YA 5IYCP 2Z1HA 3DRPA 1RT7A 3KKRA 4FVMA 1VSHA 3QO9A 3NCIA 3QLHA 1X9MA 4FJHA 3DRSA 3NE6A 4N41A 3LPUA 3HVRA 2PYJA 1S1WA 3TAEA 4FM0A 3IS9A 3NH0A 1C0MA 4DFMA 2FC0A 3ZSXA 2EHGA 2WOMA 3TAPA 1JLEA 4IFYA 4FLXA 3PO5A 3M8QA 1KRPA 4KHYA 1EX4A 3OS0A 3SV3A 4CF0A 5CY4A 3LP3A 3MEGA 4CEAA 4CK1A 1YTBA 1A5WA 1RCHA 3QEPA 3U6FA 1NKBA 3CG7A 1U45A 4FLWA 1S6PA 1T03A 2X6NA 4O0JA 3RR8A 4E89A 1QE1A 1RDBA 5CYMA 1NJWA 4CEEA 1JLQA 3OYLA 4RODB 4LH5A 5FRMA 1RT3A 4NCAA 2AJQA 1KVCA 3NBPA 4CHQA 1NK8A 1L3TA 4YFUA 4CESA 3RR7A 1RTDA 3PO4A 4F4KA 4CGGA 1ZBLA 3WNHA 1NJZA 3ZSVA 1JLFA 2IGIA 1LW0A 4M42A 3AV9A 1KY6A 4FJIA 3RTVA 1KCFA 4JLHA 1QNEA 4DLEA 4I2QA 1C1BA 3SPYA 4K8ZA 3I0SA 1QHTA 2VWJA 2G8KA 2Z1JA 4DS4A 4KHSA 1CLQA 4IFVA 4CJ5A 3KLGA 3SUPA 2HHVA 1JFIC 1CXQA 3MXIA 3DLEA 3AVBA 4CFBA 5KI6A 3CFRA 3AVHA 4B8AB 5C25A 3K58A 2QXFA 2ITGA 4KAZA 3S3NA 2YNGA 4M3WA 3V9WA 4CECA 3V4IA 3VQ8A 1U04A 3AVLA 4RW6A 4KHUA 1Y97A 3JYTA 4CHZA 4CEZA 1EP4A 1HPZA 4ID5A 1ASWA 4NYNA 4CFCA 3LANA 2P5OA 1XHXA 3LAKA 2RF2A 3M8PA 3RMAA 3TARA 3D45A 4AILC 1QNAA 1WAJA 1AISA 2KQ2A 3MAQA 4DQQA 4KHQA 3VQ5A 1HYZA 1WSFA 3VQCA 1HQUA 1KY7A 3HS9A 1T8EA 4DFJA 1A5VA 3DOLA 2PYLA 1CDWA 4B0AA 1WSGA 4DQPA 5CZ2A 4JRQA 1ASVA 1VK0A 2G8UA 1KVBA 2Y1JA 2OYQA 4OLBA 1IH7A 2ZD1A 4BACA 1S9GA 3NH1A 1HYSA 1NK5A 3OYFA 1TKTA 4FLZA 2FBTA 3VQPA 4DSEA 4NCGA 4FM1A 3SYZA 3HO1A 1YTAA 4PQUA 3LAMA 3SQ4A 3SQ0A 3HPGA 4BE2A 3DLGA 1JL1A 4CHOA 4N47A 1RM1A 3OYBA 5FRNA 4FW1A 5JS1A 2ZE2A 1BL3A 2KFZA 1VSIA 2F8SA 1B9DA 2QKKA 4HCBA 1BQNA 2JLEA 3OVNA 2G30A 4DS5A 4OVLA 3OS2A 1VSKA 5JS2A 1LWFA 2HNYA 1TL1A 3OYCA 3RMDA 4F2RA 3VQ6A 2OZMA 2YHBA 4NCBA 3QIOA 4BDZA 1TAQA 4CJVA 4I2PA 1X1PA 1Z25A 4NYFA 3LWMA 1C9BB 3HXMA 1RTHA 1RTIA 1QSSA 2DFHA 2RN2A 4CCHA 4F2SA 4FLYA 4E3SA 4PUOA 1UOCA 2IDOA 2WONA 3V9UA 2Z1GA 4OPKA 5I3UA 4FJXA 1D3UA 4CHNA 3AO1A 3EZ5A 3HSTB 3SQ1A 1SKSA 4LSNA 4DMNA 2BGGA 5E41A 1SKRA 1KLNA 5SWMA 1F21A 4WZSD 4RW7A 1VRTA 4FJLA
chains in the Genus database with same CATH superfamily
4IOCL 1KVAA 1WUAA 2G8HA 2D0AA 2FKFA 4IO8A 1E4GT 2CGKA 3JS6A 3BGRA 1T3VA 1N3CA 4MO4A 4FWMA 3C94A 2V52B 4W5OA 3TTDA 5IYDP 1YVNA 4JI8K 4XH5A 2FSKA 3ENHA 3AO3A 3K5NA 3FZLA 1S1TA 2OPQA 4EJZA 3VEYA 4FVUA 4BC4A 4O0IA 3LZIA 1D4XA 3PSIA 1NK4A 4N56A 1VSLA 4IWVA 4DSJA 4CBWA 3TAQA 3ISNC 5FPEA 5AQMA 3CFPA 3VQAA 2HL8A 2PWWA 2QA4N 3RSMA 1ZBIA 5JVHL 3AA2A 2ZM6K 1HNIA 2YHXA 4EZ6A 4O8UA 2HMIA 3ENBA 1IO2A 3SLCA 3ZT0A 4EP4A 3RWUA 5CR4A 2OA8A 5J1EA 1MP9A 1C47A 1GOAA 3TAFA 4CJSA 4CIFA 2VWBA 4I9QA 4XIUA 4GNIA 2NOZA 2HF4A 2JPIA 4FJ5A 2VG5A 3AO5A 1MWKA 3E9PA 4DU1A 1Q9YA 3OYIA 4JI5K 2VQEK 5AZIA 2H3GX 4KREA 4A2BA 1DEJA 1HQEA 5DMRA 1DTTA 3FZHA 3VF6A 2FSJA 2HNDA 3NF8A 4FSVA 4QS8A 4CF9A 3DRRA 5CE3A 1N34K 2GWKA 3J8AA 3MK6A 2NNWA 3OSMA 4E19A 5HOOA 1N6QA 2FBVA 1YI2N 2G8WA 1S6QA 1T44A 2FF3B 4NB4A 1VQNN 4B1ZA 1BHLA 3LALA 3OJSA 4EHTA 3WXKA 2IV8A 1S1XA 2HBKA 3R6MA 5HRPA 5HL7L 5AQUA 4BGAA 3QEWA 3UKRA 1L3VA 3OYDA 2HVHA 2HBMA 4NXNK 3H1ZA 4CHPA 1YT3A 1TBAB 1BI4B 4A5AA 4FJJA 3THYA 3MXMA 4E7LA 4V19S 3TTCA 4LF9K 3NFAA 2YKMA 4A62A 3P1GA 1S22A 1WN7A 4O8KA 4E7JA 1HNWK 3L2RA 3ENCA 3LL3A 4CERA 1Z05A 1M3HA 5KPRA 1YIJN 3VEOA 1C6VA 4DQIA 3ZLJA 3K5MA 1GOCA 1P8ZA 2Q97A 3VOVA 5T7BA 3EE9A 4BQLA 2HL9A 3CF5L 3CQXA 3ZETA 3T69A 3Q7CA 2W42A 4C8OA 2P9LB 2Y8QA 2HMPA 3J81O 1NGCA 5BR8K 2W41A 4JK9A 1JLGA 3H45C 3QB0A 3THXB 4GV9A 1VOKA 3O5BA 1VOLB 1RTDA 2MJ7A 4CZKA 4DTMA 3E9LA 3ASMA 3QETA 4DSLA 1QZ5A 1VAZA 4PKIA 3PIOL 4NO7A 3OYJA 2UUAK 1ZBUA 3HM9A 2YNIA 4DHYA 4AQYK 4C8KA 4LH4A 4DR6K 1R0AA 2WBNA 3A8YA 2GV9A 4DQ8A 1U47A 4H0PA 4LF6K 4K43A 4JK8A 1KYUA 3SUQA 3D2EB 2Q31A 3CIPA 3ZYYX 4JI6K 3O4WA 5I9EB 4CFDA 1XSZA 3QNNA 2P9PA 1HRHA 1RDCA 1BA1A 1L5UA 1HUXA 5GIPA 4QS7A 3ZT2A 4CZIA 2A1SA 3K59A 4UQGA 5KL0A 5E26A 3K5LA 3TABA 1C4GA 2OOYA 1LV5A 2P9LA 1SV5A 4WFNL 1FXXA 4TPSA 1Q86O 1WOQA 2KW4A 1U48A 3OS1A 4DSFA 3VA0A 3CQ8A 4JKEA 4BRPA 5J2PA 3PUFA 2QXLA 3J7YP 1YTUA 1XNQK 4FWSA 1IKWA 3CJ7A 3UKUA 3E66A 4H5WA 4EFHA 5BPNA 3U3YA 2D1KA 3EKSA 1EUVA 4LF7K 1U2VB 4X65K 4FLUA 3O08A 2YJEA 4KV8A 1KO9A 3CWAA 4E7IA 3I3WA 1RBTA 3L4QA 1BI4A 1VQ9N 2UU9K 4WQ4A 5FDLA 3KTQA 2GUIA 1NK9A 4KTZA 3R8EA 1K2YX 3MX5A 4DKWA 4FZZA 5AQYA 4U7BA 1TK0A 5BMNA 2QWQA 4Z0UA 1SL1A 2P9IA 3HZ6A 1KFIA 5C24A 1RDWX 2J4RA 1ATNA 4BRDA 3O3FA 4EJYA 1GLFO 4BDYA 1RBUA 3DLLL 2BE2A 4ELTA 4EAHD 2GBZA 4BJUA 2YA3A 4BRIA 3SV4A 2IV9A 4ISFA 2OANA 4MQ3A 3VERA 1B9FA 4BR2A 2VG6A 3CERA 1WNSA 4BRQA 1K8KB 4E1NA 4E7KA 2ATQA 3AVAA 3ITHA 4CJWA 1IJJA 4H0YB 4J2AA 3A2FA 4FPAA 1W9HA 1NJYA 4JD2A 3KLEA 3C04A 4XH4A 3PLAA 4J8FA 3VEXA 3VGKA 4QS9A 3L2WA 4WQ4C 4KI6A 1S1UA 3CJ9A 3V9XA 3HYFA 3QNOA 4CBXA 3QICA 3THWB 3MN9A 4H4MA 4OGEA 4DV7K 2UYTA 4Z4IA 1S5JA 3IAYA 5HLFA 1KD1O 4FJNA 2O8CB 2NVMA 3GG4A 4YOWA 3HT3A 1W80A 2Q36A 2A42A 1NOZA 3SZ2A 2CH6A 1JDYA 3VQ9A 4W5QA 1W2BM 1LAVA 5GAEP 1NVPA 3VQEA 4G1QA 1B92A 3ALYA 1JXBA 3ZT1A 4E1JA 4CGDA 1RBSA 3V1OA 4B9QA 2QWNA 1VSFA 3NF9A 4CEOA 2IVPA 1S1VA 2R7YA 1K35A 5AQXA 2Z1HA 5M1KA 1NWKA 2NLVA 3LDPA 3DRSA 1BUPA 3NE6A 4DV0K 3TAEA 3HRGA 1NJIO 1UT4A 4MLHA 1QQOA 3QFUA 2EHGA 2ITMA 1JLEA 2QEXN 4IFYA 3M8QA 4KHYA 1EX4A 4RWTA 4G9ZA 3D2FB 3MEGA 1Q7YO 4CK1A 4K0KK 2IVOA 4Y0WA 4E89A 1RDBA 2DTUA 4CEEA 4X62K 4BREA 1RT3A 5M1FA 1L3TA 1HNZK 3RR7A 3PO4A 3ZSVA 1JLFA 4JKBA 3AV9A 1IBMK 3RTVA 5AZJB 2OOXA 3UB5A 2VWJA 2H5AX 4MDBA 4KHSA 3KLGA 2BH1A 3SUPA 1CXQA 1JFIC 3A5OC 4CFBA 3AVBA 3AARA 4B8AB 5AFUH 2ITGA 3C65A 4M3WA 1J3MA 4CECA 1U04A 1MPGA 4RW6A 1Y97A 4IOAL 1MA9B 2ASMA 3JYTA 4CEZA 4CZFA 3PDKA 2FUVA 1ASWA 2JWKA 3J7ZO 4BRLA 1JCFA 2RF2A 3DXMA 1WBDA 2NOEA 1QNAA 1WAJA 1AISA 3DJCA 3OLPA 3MAQA 1N32K 4KHQA 3VQCA 1WSFA 3HS9A 1YF5L 3QBXA 3DOLA 4DQPA 4BR7A 2Y1JA 1S9GA 1HYSA 1DKGD 3OYFA 4JI4K 4FLZA 3UKUB 4FWNA 4FM1A 3LAMA 3HPGA 4BE2A 1VQKN 1JL1A 1RM1A 3TSPA 3EKUA 4MRQA 1B9DA 2QKKA 3CCLN 3W3DA 2G30A 4BRNA 1SZ2A 4OVLA 1VSKA 4JEPA 2JHJA 2KLAA 2P9NA 5JS2A 3VQ6A 3QIOA 4CI6A 4BDZA 2UXDK 5LJWA 1X1PA 3LWMA 3CJ1A 3U9ZA 1QSSA 4DV6K 5BR9A 4F2SA 4PUOA 4IJNA 4YOTA 2WONA 4FJXA 3EZ5A 3WXJA 1SKRA 1GLJO 2QI2A 5SWMA 5F0XA 2Z8UA 3VA3A 3OSTA 3TSUA 4CIEA 3NVKA 1KQSM 3LZJA 2VCPA 2GUPA 1OH7A 3H6EA 4AHRA 1ZBLA 4N5SA 1HJOA 2HBLA 4DQSA 3AO4A 2HHTA 4CZEA 4A57A 4IG0A 4AHUA 4Q11A 1KYFA 3P38A 4JKGB 3RMBA 3CM6A 2KTQA 4CGJA 3ZSRA 2LSNA 4WFAL 5GINA 4JKHA 1IKVA 2OPPA 3V9ZA 2YNHA 2D0BA 4LSLA 4ICLA 4JS5A 2CH5A 3H46O 4MFBA 3ZSZA 1C1AA 1KXPA 2B4JA 4DR2K 3H1VX 1S3XA 1RT5A 1SQKA 5AQZA 1NJXA 3V1RA 2P1JA 3C6AA 4M3RA 1YJNN 1VRUA 3AA3A 4CJEA 3KRMA 3SBGA 3C95A 3VGLA 1XMOK 1WB9A 3LWLA 2E2OA 3WUHA 3C6TA 3EIKA 3THYB 4KHNA 3LDOA 3OYAA 2IVNA 5ELZA 1SL2A 3KTUA 4C1NI 2YHAA 4FJKA 1WBBA 3PY8A 4IG3A 3IKMA 3WT0A 1FN7A 2I5JA 2FGTA 4CHYA 3MXJA 4BG8A 1WSEA 3SUOA 2Y8LA 5AQQA 1TL3A 4EP5A 1HKBA 3AA5X 4HTUA 1BOTO 4UY8O 3AVJA 1BU6O 3CMEN 2E2PA 4YORA 1BA0A 3M8RA 4DB3A 1GLBG 1EXQA 3VQDA 2IOCA 3AO2A 5LJVA 3CCVN 1TAUA 1N36K 4HVJA 5AQWA 4GV6A 4BRAA 3G10A 1QN5A 4OKJA 4LF5K 5BMPA 3T3FA 3AVNA 3LM2A 4N76A 3I0XA 5JLFA 4BY9C 2NOHA 2V92A 1RT2A 4IL8A 2YNFA 3WEEB 5MLCQ 4OPJA 4HUGA 3OY9A 1U49A 1TUYA 1D9FA 4BR0A 1WQAA 3DPUA 4DG1A 4DQRA 1CZBA 1KAYA 4KTWA 2P9UA 2NRVA 2Z0FA 4FW2A 3IMXA 4BQZA 3HOTA 3R1XA 5AQOA 4R5PA 2FSNA 4IXCA 3O3GA 4DV1K 5HROA 1A5XA 3KJVA 2WUSA 1LW2A 4Q0BA 3T4NA 4AM6A 3TAGA 4FCYA 1TUOA 4PY5A 3U4LA 2XY8A 3O9SA 4TSXA 1NOYA 3DM2A 2ZJRL 1NU0A 3FE1A 4KKOA 3IG1A 3WEEA 1XNRK 2HHWA 2JGUA 5CYQA 4RW4A 3KD1E 1VQ8N 1QSYA 5GAGP 3AVCA 3T19A 1N8RO 1SUQA 3ZSOA 1RDAA 3LP2A 4CGIA 3CC7N 2NRRA 3TSQA 4Q5VA 4DULA 3BDPA 4KH6A 4O55A 3Q7BA 3N4QA 3F0ZA 3VEVA 3I0WA 1R4XA 1NKEA 3C6UA 3C6HA 5AJ3K 1GOBA 4E0DA 2HHHK 3CCJN 4GKJK 5AQSA 4BRFA 3TTFA 3MX2A 4QG5A 1Q82O 3DLBA 1WSJA 4JRPA 4C1NK 3O4QA 2F9TA 1O13A 4B1UB 2O4IA 3HPOA 2D4WA 3F9KA 3ZT4A 4HCCA 4M3YA 4FJGA 3LDNA 3M5RA 4CZGA 4WX8A 3M6GA 3TR8A 2E4LA 4AH9A 1SKWA 1J9AA 4OGCA 2O8CA 1GLDG 2VG7A 3SK3A 4EIAA 3EO3A 4ISEA 2P5GA 1SS6A 2YCHA 2HW3A 4BRGA 2I5WA 1VQPN 2DPNA 4I7FA 3L3UA 4EAIA 4BRKA 3SAHA 4IFEA 1QN6A 3ZSYA 2Z1IA 3M8SA 2X74A 3SCXA 3KVGA 2F7TA 2GX9A 5AQTA 4IOXA 2Q3SA 4K41A 3OYMA 4CGHA 4IJAA 2EHBD 5FPDA 1TBPA 4LFBK 5KPZA 1BGXT 1QNCA 3NGZA 3DXKA 5AQLA 3NAEA 3MWPA 3AVGA 3BY5A 4C23A 3JSMA 4C8MA 3MCAB 4KO0A 5C42A 1NGGA 3KK3A 1WAFA 1YVUA 4ILHA 5KTQA 2QRDA 4AF1A 3MN7A 4CJ4A 1UL7A 3FZFA 3ZSWA 4CZJA 1HR0K 4H8KA 4O44A 3QESA 5KGWA 3UE5A 1T6CA 4DV2K 1XI1A 1TV6A 2YKNA 5KQ8A 5BREA 4O5BA 3WQTA 3IUCA 4ID1A 3SAFA 4CF2A 2H4LX 4W5RA 1OH8A 2G8VA 4ELVA 3NF7A 1JKHA 4DR7K 4YY3K 3HL8A 1LWCA 4ROEB 3ZX3A 3D0PA 1U2VA 1CZAN 4JS4A 5C2DA 1KSPA 1LWWA 1EETA 4BRMA 4JKGA 3V1QA 1WSIA 3GOIA 1XWLA 3VTIA 5J2MA 1Z26A 4O5FA 3L0QA 4KPYA 1RGIA 2BUPA 1T05A 3BP8A 5AQRA 1NGFA 4CEDA 3G71N 3C0BA 3J80O 4IBNA 3GE1A 4JI0K 4DTSA 5IYCP 3UKRB 4FJHA 4DCHA 3HVRA 1S1WA 4FWOA 4DFMA 2WOMA 4FLXA 4X64K 1ZXOA 4YOYA 3CJCA 3I55N 3SV3A 4CF0A 3D7EO 1YQLA 2HZSA 3CVTA 1YTBA 3QEPA 1NKBA 3VENA 3CG7A 1U45A 1KAZA 1T03A 3THWA 3OSEA 2X6NA 3RR8A 1QE1A 5FRMA 2AJQA 3OYLA 4LH5A 2P9NB 4RTFD 5C2FA 1KVCA 5C15A 4JHDA 3L4IA 4H0TB 4CGGA 4CZLA 3WNHA 2IGIA 5AZIB 1V4SA 4JKAA 1MDUB 2I7NA 2MZ8A 4C7PA 3O9QA 3CCSN 2E1YA 2G8KA 5CHIA 4DS4A 1QZ6A 5AQPA 4EAGA 3CFRA 5C25A 4B3TK 1LWYA 1VQ7N 2YNGA 3JAMO 5GADP 3V9WA 3D6RA 1I94K 1LOTB 4CHZA 1HPZA 5GAHP 3BKQX 4NYNA 3LANA 3P31A 3LAKA 3RMAA 4AILC 1YQRA 3O9RA 2KQ2A 4M7XA 1ZC6A 1A5VA 4FO0A 1CDWA 4JRQA 3O8MA 1KVBA 4OLBA 1HKGA 3NH1A 1TKTA 3VQPA 4DSEA 4NCGA 1NLVA 3HO1A 3N89A 1YTAA 2FKMX 4CHOA 4PKGA 4FW1A 2Q2RA 2NRTA 3RVCA 4HCBA 3EN9A 1BQNA 3OS2A 3AAQA 1JCEA 1LWFA 5TKWA 3CC4N 4YOUA 2YHBA 4NCBA 4I6MB 4JV5K 1Q81O 2QWPA 1Z25A 5JMVA 4NYFA 3H1QA 1YQMA 1RTHA 2DFHA 2IDOA 3V9UA 3O1BA 5I3UA 1D3UA 5BRFA 3AY9A 4CHNA 5BN9A 2E2NA 1OH6A 5E41A 2KKZA 3NVMA 1F21A 3N4PA 2ZJPL 4M42A 4FJLA 4KH5A 4FWKA 1TK5A 4M7YA 4DFKA 1T6AA 4CE9A 4DU3A 2P9PB 1RT1A 1E4FT 2HSTA 3KIOA 4M45A 2O8EB 2F8TA 3LP0A 2A6AA 1DTQA 3NF6A 1BIUA 3O4NA 5HRSA 4OKKA 4ZHRA 1YQKA 2NZTA 3KK7A 1KYDA 4A5BA 1KFDA 1T6DA 3DYAA 3DXMB 5EOYA 1NK6A 2RE2A 1C0UA 3I8DA 4FK0A 1BCOA 1EKEA 1NGDA 3OCIA 3WXMB 1X3MA 2WFBA 3WNFA 4DTRA 3PV8A 1XHZA 4HTLA 1QN4A 2QKBA 3BF3A 4FOIA 1JLCA 1B9KA 2XO7A 1HU0A 4WQ5C 2E20A 1H1VA 3NGIA 4B9VA 3O1WA 5FLXO 1C0TA 1YAGA 2ZQBA 4CJTA 3CHWA 1FK9A 5JN5A 3A5LC 3CWUA 2XY7A 5CZ1A 3VF4A 4DSKA 5HRRA 5KPTA 4Z4HA 4M41A 1P5GX 1JL2A 5E84A 4NLCA 2PY5A 1YUWA 3QIPA 4M63C 1IKXA 1HLUA 3FGUA 4NXMK 3VQQA 4AHSA 4CGFA 3OYHA 1NGMA 2V51B 3L8BA 1R59O 3K9JA 4L8RB 3TI0A 3ULXA 3MECA 4M3UA 1NK0A 4B1XB 4CF8A 3PX4A 5I42A 3ZT3A 3KLFA 5KGXA 2QREA 4FJMA 4OX9K 3ULDA 3DLRA 1DIZA 4ISGA 4BR9A 4JK7A 3VMFB 4YDUA 3TANA 1TYQB 5AQFA 1DT9A 1VHXA 1L3UA 2GELA 5EVZA 1NMNA 2NOLA 1V5SA 3RRHA 3FR0A 4RW9A 1WJWA 3MMVA 1FKPA 4ILGB 2A5XA 2OPRA 1ZYQA 1K6YA 4BDPA 3AAPA 4DTXA 1QN3A 4LC9B 3V81A 1D5AA 3VESA 5DM6L 3VQBA 1V4TA 1EWRA 3KLHA 3ID6A 4BE0A 3CCUN 4F3OA 3HJFA 4B1YB 3OGDA 3OBYA 1Y64A 2HZMA 1UA0A 2V9JA 4BWJA 2FF6A 1DGKN 4NLBA 2OTLN 2HB5A 3GDQA 1HMVA 4DTOA 1PCZA 4ZTFA 3B8AX 2HBJA 3R9PA 4M3XA 2CGLA 1GLCG 3G6EN 4GV3A 5BRDA 1QTPA 1RT6A 3E9OA 2PZSA 4AHTA 2VQFK 4YDUC 3RRGA 4JNEA 4JN4A 5EPCA 3P39A 1IBKK 1E42A 1OVQA 5F2RA 4MLEA 1J54A 1RBVA 1TKDA 4B3SK 3VQ4A 4HJHA 3O9UA 1Q8IA 5AQVA 4CZMA 3DI6A 1PCMX 1BO5O 4B9MA 2ETJA 4Y1DA 4EAKA 4LD0A 3QFPA 1QQCA 4HUEA 2XHIA 1W97L 3C7NB 3GBTA 4HUFA 1NGEA 4C8LA 4GY2B 3BZCA 4BWMA 3J7AP 4ILJA 3S9HA 3SQ2A 3P83D 1BG3A 4PL7A 3HOSA 3H08A 4ZTJA 1YXQA 1L3SA 4BE1A 4DTUA 1PZDA 2QW9A 3QBWA 1QQMA 1RTJA 3FFKB 1NGBA 4OKEA 2RKIA 1UWBA 3T1AA 3PIPL 3SUNA 5H1SQ 3CMAN 3T1HK 2VYPA 1QHAA 5JMVD 1M1KO 3RPJA 2A3ZA 2XY6A 1M5Q1 3NA5A 3SMPA 4J2BA 4FYDA 4QOZB 3OYNA 1HNXK 4DF4A 1RT4A 3CYMA 1S9EA 2P51A 2AP1A 3NH2A 1EO1A 2HOEA 2D0PA 2YV0X 2F7LA 3HVTA 4BC5A 3ULEB 3W0LA 5AQNA 4RG8A 4FJ9A 3AA4A 4YOVA 2GEMA 1J6ZA 1XMQK 2RPIA 3P4IA 2D0OA 1O1WA 3AVKA 3SPZA 3VF2A 1KLMA 4IEEA 4LY7A 4OO1J 4OPAA 3ZSQA 3L2VA 3CETA 1BWFO 2FLOA 3O3HA 2W6LA 3DLKA 4DSIA 3S3OA 5F1XA 1C0GA 2E2QA 3DLHA 4YNQA 3NMUA 1RNHA 5JICA 3VN5A 4PWDA 2DFFA 4WCEL 3DOKA 1G15A 1X9SA 3FFIA 3QDKA 2NRZA 2ZFDB 4Y1CA 3P5JA 4A2AA 4BROA 1BIZA 4DR1K 1Q18A 2VGNA 1K8AO 2PBDA 3R3LA 2Q0UA 3OYKA 1ASUA 3AGKA 1YJ9N 3KD5E 1VSMA 2NOIA 2D0CA 1NGAA 1ESVA 2W6KA 1JXEA 3I56N 2HF3A 3M1FA 3LM9A 1HJRA 4FWPA 2YHYA 5M1NA 1YJWN 3DXKB 5GIOA 4Z4GA 4FZXC 4DU4A 5HSHA 4FLTA 4JKCA 1KTQA 5M1OA 1QN8A 3IRXA 3QINA 4B1WB 1VQMN 1ATSA 2X6SA 3ZETB 2QK9A 1LCUA 3QMLA 3ZCMA 3CVSA 4WF9L 4KRFA 4AM7A 1QQNA 4LF4K 4MO5A 4E7HA 3CWTA 1QSLA 2NOFA 4CK2A 1ILYA 1SAZA 4BVOA 4D7QA 2QTDA 3ZX0A 2OZSA 1C0FA 3KKSA 5J2NA 2VJ0A 4FXDA 4Z4EA 3TE5A 3LDSA 3HTVA 5AQKA 2EWSA 4DV3K 2JHNA 2ZGZA 2KZMA 4KBOA 1HYVA 1NKCA 1NGJA 4K8XA 5AQHA 2IC3A 4J2EA 5BN8A 1IBLK 1JLBA 3L2QA 4R79A 1TGOA 1VQ6N 2UUCK 2O8FA 4W5TA 4JI3K 3OH9A 2XHBA 1RBRA 2OPSA 3CC2N 4CJRA 1KFQA 4DUYK 1ZBSA 4PKHA 1X9JA 1VQLN 3DRPA 4GVEA 1RT7A 2A41A 3HBTA 3KKRA 3QO9A 1X9MA 1UT7A 4H0OA 2PYJA 3D7QA 3NH0A 1C0MA 2FC0A 4CJ7A 3ZSXA 1EQYA 3CW7A 2PFUA 4CEAA 1RCHA 3ENOC 3U6FA 4FWQA 3OHRA 4FLWA 4JI2K 1S6PA 4I6MA 2V7ZA 4B9LA 5CYMA 4WXAA 3CCMN 2NLXA 1NNEA 3NBPA 4JI7K 1NK8A 2NRHA 4WQ5A 4B1VA 4YFUA 4CESA 2ZGYA 5C0YA 4F4KA 1NJZA 1YHQN 5IT9O 1BDGA 1LW0A 2ZWHA 1KY6A 1NBWA 4JLHA 1QNEA 1NM1A 3VTHA 5F9CA 4DLEA 5EX5A 4JI1K 4FWRA 3SPYA 4K8ZA 2QLVA 3I0SA 5JLHA 1OKJA 4IFVA 4CJ5A 2HHVA 3MXIA 3DLEA 3HM8A 5KI6A 3AVHA 2QXFA 4KH4A 3ZX2A 1HPMA 1W7AA 1VQ5N 1K9MO 4KAZA 3MDQA 3S3NA 3U8XA 3V4IA 3VQ8A 3CJAA 3AVLA 4YOXA 3WXLA 1EP4A 3TDHA 3D45A 4F9OA 4XEIA 4DQQA 1HYZA 4JAXA 2A40A 5M1QA 2UXBK 3LDQA 3DWLA 2PYLA 3EL2A 4B0AA 1WSGA 1VKLA 3BUZB 2ZF5O 2Q0RA 1NK5A 3SYZA 4PQUA 1LWVA 3SQ4A 3VEWA 3DLGA 2P9KB 3I8BA 4FWLA 4N47A 4D7RA 3OA9A 3OYBA 2ZE2A 1BL3A 3CWSA 3RSEA 4DS5A 3FLCO 3ID8A 2AA4A 2HNYA 1TL1A 2PAVA 3SJHA 1JCGA 5BPMA 5C10A 3OYCA 3RMDA 2OZMA 2F4VK 1Q9UA 4BGBA 1RTIA 4FPBA 2RN2A 4FLYA 1OH5A 1UOCA 2NRWA 4BC3A 4CVNE 3O80A 2Z1GA 5A2QO 3AO1A 3HSTB 3SQ1A 1PVSA 1SKSA 4LSNA 4DMNA 4JKFA 4JKDA 1VRTA 1FJGK 3BF1A 1JLAA 1NK7A 3S41A 4CJUA 3VQ7A 1LWEA 3CXCM 4PHTX 3L3VA 2HHSA 1FKOA 3CJBA 1YTFA 5ADXA 1SL0A 4B9UA 4YHHK 4KB0A 2YI1A 1N3AA 3EZWA 3GL1A 1ZBFA 2B5JA 3CFOA 4FK2A 3L6QA 2DKAA 1N39A 1VSEA 4WYBA 1XC9A 4FL9A 4CIGA 4CZHA 4DTJA 3WNGA 4DR5K 3K2PA 4FZYA 4H5TA 1NGIA 4CK3A 4FJ8A 4KHPK 4WFBL 4I9LA 4DTNA 2NUBA 5KQDA 2BDPA 2UUBK 1WSHA 2XRIA 1BQMA 2Q1NA 4H5NA 3F5TA 4CF1A 4WE1A 4CW7B 2NRXA 4B3OA 2XY5A 3A5NC 3MWTA 4H0VB 3G25A 4KFBA 4F8RA 2WTUA 3L2UA 2V7YA 3I33A 1D9DA 2VWKA 4IO9L 2E5LK 3S3MA 4CJKA 3BEXA 4KI4A 2DKDA 4DV5K 2WC9A 3EY1A 1IV0A 3LDLA 2QRCA 4Z4FA 4B9SA 3F10A 3SI6A 4CJLA 1JJ2M 2HHQA 1E3MA 3D4VA 4B3RK 2FBYA 2O4GA 4Z94A 4B08A 3OJUA 1EBMA 1GLAG 2O8EA 4GW6A 3TAMA 3K5OA 1HKCA 4QCLA 3MCPA 1IG8A 3CPEA 5LL6Z 4HHTA 4OLAA 3KWGA 1GLLO 1T7PA 3V9SA 2QWOA 3RSEB 1HNVA 2G8IA 5AFUA 3HS8A 5ADXH 1VSDA 2O8BB 3OH6A 3LPTA 3WNEA 4B9TA 4LFAK 3H3NO 4LFCK 1I39A 4O4GA 2EX3A 1M90O 1W0HA 1VSJA 3HI0A 3NHGA 1Z6RA 4CJPA 1NH2A 4MDAA 3OTOK 4Z4CA 3CCQN 2OCEA 3ENOA 2E8AA 1KFSA 1J5OA 4EAJA 1IKYA 3CQYA 2O8DB 1U6ZA 4W5NA 2DFEA 2X78A 1LAWA 3EE8A 5EU7A 4BG9A 2HNZA 3LP1A 2E88A 4DWIA 1TK8A 2E6LA 1QS4A 3KWIA 1TVRA 1CZ9A 4F3TA 3PX6A 3E1YA 3QEIA 2HHXA 3AVFA 1BISA 3KHYA 2KFNA 4B8CA 3IH7A 3HP6A 3OC3C 2F96A 2R5XA 4ROCB 1GLEG 3HP9A 4GMJB 1BCMA 4RW8A 3B6PA 3OW2M 1I3AA 5LY3A 1Q9XA 2V8QA 3MEEA 4EZ9A 3SAGA 1J53A 5HRNA 3DMJA 2ZJQL 2CGJA 1M3QA 5HP1A 3CM5A 4CEBA 1UAXA 3VPZA 4XH1A 3A5MC 3D2FA 1K8KA 4H0XB 5D3GA 4KB1A 4CEQA 4PL8A 4B3MK 4JHDB 2UXCK 3KLIA 4FK4A 4CFAA 2GTDA 1QVFM 3KK2A 4GVMA 4PA1A 3NDKA 1NMDA 3K0SA 4DUZK 1UA1A 1QVGM 4J2DA 3ZEUB 5FROA 4M3TA 1VTOA 3DAWA 2F9WA 4A59A 4DTPA 3G0ZA 4CD3A 3BZKA 5AN4A 1NG9A 1XC3A 2P9IB 3HPHA 3SJJA 2B6AA 4QAGA 1HX1A 3EAYA 1REVA 4CEFA 2P9SA 5EXWA 5SZTA 1NGHA 4RCHA 4E1MA 3CCRN 4H5VA 3SMSA 1X9WA 3F9MA 3AVMA 3HSCA 2FBXA 4FLVA 3DPTA 2KZZA 1QNBA 3E01A 4M3ZA 1ZBHA 1U4BA 4KTQA 3TWHA 4AHVA 4A61A 1WLJA 3OYGA 3FZKA 3THVA 3F73A 4IKFA 3UIQA 4KHWA 4DR4K 2HKPA 1D8YA 1ITGA 2IS3A 5KRSA 5DK5A 2Y1IA 4CJFA 1QTMA 2G8FA 5BRHA 3HK2A 5BPLA 3OBWA 4FM2A 5IWAK 4FJ7A 4DFPA 3I0RA 3T1YK 4H5RA 2BTFA 4JYAK 3SNSA 4DLGA 3EYZA 3VGMA 3CI5A 4DF8A 1C1CA 4IDHA 3QEVA 5TKYA 1MU2A 3VETA 3WQUA 1DLOA 5HBMA 2JWLA 1XQSC 4I8OA 3D2EA 5EY4A 1RILA 5AQGA 1TUUA 3ATUA 3AVIA 2E6MA 4CBUA 4IDKA 4AHCA 2IIRA 3SNNA 1RDDA 4CJQA 3KK1A 5J2QA 4CJ3A 1QTSA 2HVIA 2HHUA 4BRCA 2E1ZA 4OJRA 2KHOA 2JOIA 3JXUA 1QN9A 1TKZA 3PX0A 1PCJX 3QEXA 3M3ZA 4EALA 4C8NA 4H4OA 4HWIA 3THXA 2P9UB 1TKXA 5FPNA 4CD1A 4BVPA 2O8DA 3PMGA 1OVYA 5K14A 2BANA 1N5YA 4CFFA 4K25A 2FXUA 1P5DX 2D5RA 5M1PA 3U3GA 2A1RA 1KC8O 2DY4A 3TPQA 3V6DA 3MN5A 4U67L 2QWRA 3K57A 4ELUA 3QERA 4DR3K 3AGRA 2QWLA 4B9NA 3ULEA 1XUPO 1RFQA 2VGMA 2O8BA 1VTLE 3B6OA 5IYBP 2IAJA 1MWMA 4GKKK 3O6WA 1RDUA 2O8FB 3SBTA 3NGYA 5KRTA 1IG9A 3MEDA 1FW6A 3CCEN 1CXUA 1K73O 1QN7A 1TGHA 1X3NA 2QM1A 3OYEA 2GWJA 1KAXA 2YJFA 4FVMA 1VSHA 2QWMA 3F2KA 3QLHA 3NCIA 3VEZA 2I7PA 3LPUA 4N41A 4FM0A 3IS9A 3U9DA 2QR1A 5C12A 1EWQA 4X66K 4OPHA 3TAPA 3PO5A 5AQIA 1VQ4N 1KRPA 3OS0A 4BRHA 5CY4A 1S72N 3LP3A 3EEQA 3PSFA 1A5WA 3ZEUA 2OTJN 5LMUK 4O0JA 1NJWA 1JLQA 4RODB 3CPWM 4NCAA 1ATRA 3C7NA 4CHQA 4LF8K 3WXIA 1LXTA 5AR0A 2P9KA 4FJIA 3UW2A 1KCFA 4I2QA 1C1BA 2YX6A 1J5EK 1QHTA 4IZ9A 2Z1JA 1CLQA 3O9TA 3K58A 3A0IX 4IEIA 2O3OA 4KHUA 4FOEA 4EHUA 2YHWA 4K42A 4ID5A 5B8HA 4CFCA 2P5OA 1XHXA 3M8PA 3TARA 1P90A 1VQON 2DKCA 3VQ5A 1HQUA 1KY7A 1T8EA 4DFJA 3G4SN 5CZ2A 1ASVA 1VK0A 2G8UA 2OYQA 1IH7A 2ZD1A 4H03B 1G99A 4BACA 4BC2A 2YH5A 5LMNK 2FBTA 3TU5A 5DM7L 3CD6N 3IDHA 5AZJA 3K9KA 4BR4A 3SQ0A 3MN6A 2P9SB 5FPMA 5JVGL 2ASPA 3IFRA 5JS1A 5FRNA 2W40A 2KFZA 1VSIA 2F8SA 2JLEA 3OVNA 3ATVA 4BR5A 4F2RA 1TYQA 3T7ZA 3H3OB 2ASOA 1N33K 1TAQA 3KZBA 4I2PA 4CJVA 3HXMA 1C9BB 2RHKA 3FZMA 4DV4K 1YITN 4CCHA 4E3SA 2NOBA 4OPKA 2NWVA 5AQJA 4JD2B 2BGGA 1KLNA 3RMCA 4L3QA 4WZSD 4RW7A 2LAEA
chains in the Genus database with same CATH topology
2Z8UA 1KVAA 3VA3A 2G8HA 4FK2A 4B9LA 1TK5A 4DFKA 3OSTA 1JLAA 4CE9A 4DU3A 1NK7A 4CJUA 2D0AA 3VQ7A 4CIEA 1LWEA 4ELUA 2HHSA 3BGRA 3L3VA 1RT1A 1N3CA 3KIOA 1FKOA 3LZJA 1YTFA 1SL0A 4M45A 3C94A 4B9UA 4KB0A 3LP0A 2F8TA 4W5OA 1N3AA 1ZBFA 5IYDP 1DTQA 2B5JA 3CFOA 1BIUA 3NF6A 3O4NA 4AHRA 4OKKA 3AO3A 5HRSA 4N5SA 1N39A 1VSEA 3K5NA 4DQSA 3AO4A 1S1TA 2OPQA 4EJZA 4ZHRA 1XC9A 2HHTA 4CIGA 4O0IA 4DTJA 1YQKA 3WNGA 4IG0A 4AHUA 1KYDA 4Q11A 3K2PA 3LZIA 4FZYA 1KYFA 1NK4A 4N56A 1KFDA 1VSLA 4DSJA 3RMBA 3CM6A 3DYAA 4CK3A 4CGJA 4FJ8A 2KTQA 3ZSRA 4I9LA 3TAQA 3ISNC 2NUBA 1C0UA 3I8DA 4DTNA 1NK6A 2BDPA 1BCOA 4FK0A 1EKEA 2LSNA 3OCIA 1WSHA 3CFPA 2XRIA 1IKVA 1BQMA 2OPPA 3V9ZA 3VQAA 3WNFA 2YNHA 4DTRA 3PV8A 1XHZA 4CF1A 2D0BA 1QN4A 2QKBA 4LSLA 1JLCA 1B9KA 4ICLA 1ZBIA 2XO7A 4JS5A 1HU0A 4MFBA 3AA2A 4WE1A 3ZSZA 1C1AA 3NGIA 2B4JA 4B3OA 1HNIA 4B9VA 2XY5A 4EZ6A 2HMIA 1RT5A 1C0TA 1NJXA 3V1RA 2ZQBA 4CJTA 1IO2A 2P1JA 1FK9A 4M3RA 3ZT0A 4EP4A 3RWUA 1VRUA 3AA3A 4KFBA 3KRMA 5CZ1A 4CJEA 2XY7A 3L2UA 4DSKA 4F8RA 3C95A 5HRRA 1D9DA 2VWKA 2OA8A 5J1EA 1MP9A 1GOAA 3LWLA 4Z4HA 4M41A 3C6TA 4CJSA 4CJKA 3TAFA 4CIFA 3S3MA 1JL2A 4KI4A 2PY5A 3EIKA 4KHNA 3QIPA 3OYAA 3EY1A 1IKXA 4I9QA 4XIUA 1SL2A 2NOZA 3KTUA 4Z4FA 3VQQA 4AHSA 2YHAA 4CGFA 3OYHA 4FJKA 1NGMA 3L8BA 4B9SA 4FJ5A 3F10A 2VG5A 3AO5A 3PY8A 4DU1A 4L8RB 4IG3A 3TI0A 1Q9YA 1FN7A 3OYIA 3SI6A 2I5JA 4CJLA 2HHQA 3ULXA 3MECA 2FGTA 1NK0A 4CHYA 4M3UA 2FBYA 4KREA 2O4GA 3OJUA 3MXJA 4B08A 1EBMA 4CF8A 3PX4A 1HQEA 5DMRA 1DTTA 1WSEA 5I42A 3ZT3A 4GW6A 3KLFA 3TAMA 3K5OA 5KGXA 3SUOA 1TL3A 2HNDA 3NF8A 4EP5A 4FJMA 3ULDA 4CF9A 3DRRA 4QCLA 3AA5X 3DLRA 4HTUA 3AVJA 4HHTA 4OLAA 3TANA 3OSMA 4E19A 1N6QA 1T7PA 3V9SA 1L3UA 2FBVA 3M8RA 2G8WA 1S6QA 2NOLA 3RRHA 4RW9A 2G8IA 1BHLA 1EXQA 1FKPA 1HNVA 2IOCA 2OPRA 3HS8A 3AO2A 3LALA 3VQDA 3OJSA 1ZYQA 1K6YA 4BDPA 2IV8A 1S1XA 4DTXA 1TAUA 1QN3A 5HRPA 1VSDA 3LPTA 4HVJA 3WNEA 3QEWA 4B9TA 3V81A 1L3VA 1D5AA 3G10A 3OYDA 2HVHA 1I39A 4O4GA 3H1ZA 1QN5A 4OKJA 2EX3A 1YT3A 4CHPA 1TBAB 1W0HA 1VSJA 3AVNA 3VQBA 1BI4B 3NHGA 3T3FA 4FJJA 4N76A 3I0XA 4CJPA 4E7LA 3KLHA 3MXMA 1NH2A 2NOHA 4Z4CA 4BE0A 1RT2A 3NFAA 2YNFA 4F3OA 2YKMA 4OPJA 3HJFA 4B9MA 1KFSA 3P1GA 1WN7A 4HUGA 3OY9A 1U49A 1J5OA 4E7JA 3L2RA 2HZMA 1UA0A 4CERA 4BWJA 1IKYA 1D9FA 1M3HA 3DPUA 1C6VA 4DG1A 4DQRA 4W5NA 1CZBA 2DFEA 2X78A 4DQIA 4KTWA 1LAWA 2HB5A 1HMVA 4DTOA 1PCZA 4ZTFA 4FW2A 3K5MA 1GOCA 5EU7A 2HNZA 4R5PA 3LP1A 4DWIA 4M3XA 3O3GA 5T7BA 1TK8A 5HROA 2E6LA 1QS4A 1QTPA 1A5XA 2W42A 4C8OA 1RT6A 2PZSA 1TVRA 4AHTA 3RRGA 3KJVA 1CZ9A 4F3TA 3PX6A 1LW2A 1JLGA 4Q0BA 1E42A 3TAGA 3QEIA 4FCYA 1J54A 1RBVA 1TKDA 2HHXA 3AVFA 1BISA 3VQ4A 1Q8IA 2KFNA 1VOKA 4PY5A 3DI6A 4B8CA 3IH7A 1VOLB 2XY8A 4TSXA 3OC3C 2ETJA 2F96A 4ROCB 2MJ7A 3DM2A 3HP9A 4GMJB 4Y1DA 4DTMA 1NOYA 4LD0A 4KKOA 3ASMA 1BCMA 4RW8A 3QETA 4DSLA 3IG1A 1QQCA 3B6PA 4HUEA 2JGUA 2HHWA 1I3AA 5CYQA 4RW4A 2XHIA 3RMCA 4HUFA 1Q9XA 4C8LA 3KD1E 3MEEA 4EZ9A 4BWMA 1QSYA 3OYJA 3S9HA 1J53A 5HRNA 3DMJA 1ZBUA 3P83D 3HM9A 2YNIA 3SQ2A 4C8KA 3AVCA 4LH4A 3H08A 3T19A 1M3QA 4ZTJA 1R0AA 5HP1A 2GV9A 3CM5A 4CEBA 1UAXA 1SUQA 3ZSOA 1RDAA 3LP2A 4CGIA 1U47A 1L3SA 4BE1A 1KYUA 4Q5VA 4DULA 4DTUA 1PZDA 3SUQA 3BDPA 5D3GA 4KB1A 4O55A 4CEQA 1RTJA 4OKEA 4CFDA 3QNNA 3KLIA 4FK4A 4CFAA 2RKIA 1UWBA 3KK2A 4GVMA 4PA1A 3F0ZA 3T1AA 3NDKA 3SUNA 3I0WA 1R4XA 1UA1A 1HRHA 1RDCA 3C6UA 1NKEA 1L5UA 4J2DA 5FROA 3ZT2A 4M3TA 1GOBA 4E0DA 2A1SA 3K59A 4UQGA 1VTOA 3RPJA 3K5LA 2XY6A 3TABA 4FYDA 4J2BA 4DTPA 1LV5A 4QOZB 3OYNA 3G0ZA 1SV5A 4DF4A 5AN4A 1FXXA 4TPSA 1RT4A 3CYMA 2KW4A 1S9EA 3HPHA 3OS1A 2P51A 4DSFA 3VA0A 3SJJA 3NH2A 3DLBA 2B6AA 1WSJA 3CQ8A 4QAGA 4JRPA 1REVA 4CEFA 5J2PA 3PUFA 5SZTA 2YV0X 3HVTA 4E1MA 3O4QA 1YTUA 1X9WA 1IKWA 3AVMA 2FBXA 4RG8A 4FJ9A 3AA4A 2O4IA 3HPOA 3U3YA 2RPIA 4FLVA 1O1WA 3AVKA 3DPTA 3F9KA 3ZT4A 3SPZA 1QNBA 2KZZA 3E01A 4FLUA 1KLMA 4HCCA 4LY7A 4M3ZA 1ZBHA 3ZSQA 3L2VA 4KV8A 1KO9A 1U4BA 4E7IA 4FJGA 4M3YA 1RBTA 4KTQA 3TWHA 1BI4A 4AHVA 1WLJA 3O3HA 5FDLA 3OYGA 3KTQA 2GUIA 3TR8A 1NK9A 2E4LA 3DLKA 4KTZA 1J9AA 4OGCA 4AH9A 1SKWA 3THVA 3F73A 2VG7A 3S3OA 4DSIA 3UIQA 4IKFA 4KHWA 4FZZA 1D8YA 1ITGA 2IS3A 5KRSA 5DK5A 3DLHA 4YNQA 2Y1IA 1TK0A 1RNHA 4CJFA 1QTMA 2G8FA 3VN5A 2P5GA 4PWDA 4Z0UA 2HW3A 3HK2A 2DFFA 2I5WA 3DOKA 4I7FA 1SL1A 3L3UA 1G15A 4FM2A 1X9SA 3FFIA 4FJ7A 1QN6A 5C24A 4DFPA 3ZSYA 2Z1IA 3M8SA 2X74A 3SCXA 3I0RA 4Y1CA 3P5JA 1BIZA 3O3FA 4EJYA 4BDYA 2Q3SA 1RBUA 3SNSA 2BE2A 4CGHA 3OYMA 3EYZA 4DLGA 4ELTA 4DF8A 1C1CA 1TBPA 2GBZA 3QEVA 1BGXT 1QNCA 3NGZA 1MU2A 3OYKA 1ASUA 3AVGA 3NAEA 3KD5E 3SV4A 1VSMA 2NOIA 2IV9A 2D0CA 4MQ3A 4C8MA 1DLOA 3JSMA 1B9FA 5HBMA 1JXEA 4KO0A 5C42A 2VG6A 4I8OA 1WNSA 4E1NA 3KK3A 4E7KA 1WAFA 2ATQA 1YVUA 3AVAA 3ITHA 5KTQA 1HJRA 1RILA 4CJWA 4Z4GA 4CJ4A 4DU4A 4FZXC 4J2AA 3ZSWA 3AVIA 3A2FA 2E6MA 4IDKA 4AHCA 4FLTA 4H8KA 1W9HA 4O44A 1NJYA 3QESA 1RDDA 4CJQA 1KTQA 3KK1A 3SNNA 5KGWA 1QN8A 3IRXA 3KLEA 5J2QA 4CJ3A 1QTSA 3QINA 2HVIA 2HHUA 2QK9A 2X6SA 4OJRA 3L2WA 3ZCMA 2JOIA 4KRFA 4KI6A 1XI1A 1QN9A 1TKZA 1S1UA 3PX0A 3V9XA 3HYFA 3QNOA 1TV6A 3QEXA 2YKNA 4C8NA 4H4OA 4O5BA 4E7HA 1TKXA 4ID1A 1QSLA 2NOFA 4CK2A 4H4MA 4OGEA 4CF2A 4Z4IA 1S5JA 3IAYA 5HLFA 4FJNA 5K14A 2BANA 4W5RA 1N5YA 2G8VA 2OZSA 3KKSA 5J2NA 4ELVA 3HT3A 1W80A 1JKHA 2D5RA 3NF7A 2VJ0A 4FXDA 3U3GA 3HL8A 2A1RA 4Z4EA 3LDSA 2DY4A 1LWCA 4ROEB 3D0PA 1NOZA 3V6DA 3SZ2A 4JS4A 3K57A 3VQ9A 4W5QA 1KSPA 3QERA 1LWWA 1EETA 1HYVA 1LAVA 1NKCA 3V1QA 2KZMA 4K8XA 1NVPA 4B9NA 1WSIA 2IC3A 3VQEA 4J2EA 4G1QA 1JLBA 1XWLA 3L2QA 1B92A 3ALYA 5J2MA 1VTLE 1JXBA 1TGOA 1Z26A 3ZT1A 3B6OA 4CGDA 5IYBP 1RBSA 4KPYA 1T05A 2IAJA 2DTUA 1U48A 4W5TA 3V1OA 2XHBA 1RBRA 2OPSA 4CJRA 1VSFA 3NF9A 4CEDA 4CEOA 3NGYA 5KRTA 1IG9A 1S1VA 3MEDA 1CXUA 1QN7A 4IBNA 1TGHA 3OYEA 4DTSA 2R7YA 5IYCP 2Z1HA 3DRPA 1RT7A 3KKRA 4FVMA 1VSHA 3QO9A 3NCIA 3QLHA 1UT7A 1X9MA 4FJHA 3DRSA 3NE6A 4N41A 3LPUA 3HVRA 2PYJA 1S1WA 3TAEA 4FM0A 1UT4A 3IS9A 1C0MA 3NH0A 4DFMA 2FC0A 3ZSXA 2EHGA 2WOMA 3TAPA 1JLEA 4IFYA 4FLXA 3PO5A 3M8QA 1KRPA 4KHYA 1EX4A 3OS0A 3SV3A 4CF0A 1YQLA 5CY4A 3LP3A 2HZSA 3MEGA 4CEAA 4CK1A 1YTBA 1A5WA 1RCHA 3QEPA 3U6FA 1NKBA 3CG7A 1U45A 4FLWA 1S6PA 1T03A 2X6NA 4O0JA 3RR8A 4E89A 1QE1A 1RDBA 5CYMA 1NJWA 4CEEA 1JLQA 3OYLA 4RODB 4LH5A 5FRMA 1RT3A 4NCAA 2AJQA 1KVCA 3NBPA 4CHQA 1NK8A 1L3TA 4YFUA 4CESA 3RR7A 1RTDA 3PO4A 4F4KA 4CGGA 1ZBLA 3WNHA 1NJZA 3ZSVA 1JLFA 2IGIA 1LW0A 4M42A 3AV9A 1KY6A 4FJIA 3RTVA 1KCFA 2MZ8A 1QNEA 4JLHA 4DLEA 4I2QA 1C1BA 3SPYA 4K8ZA 3I0SA 1QHTA 2VWJA 2G8KA 2Z1JA 4DS4A 4KHSA 1CLQA 4IFVA 4CJ5A 3KLGA 3SUPA 2HHVA 1JFIC 1CXQA 3MXIA 3DLEA 3AVBA 4CFBA 5KI6A 3CFRA 3AVHA 4B8AB 5C25A 3K58A 2QXFA 2ITGA 1LWYA 4KAZA 3S3NA 2YNGA 4M3WA 2O3OA 3V9WA 4CECA 3V4IA 3VQ8A 1U04A 3AVLA 4RW6A 4KHUA 1Y97A 3JYTA 4CHZA 4CEZA 1EP4A 1HPZA 4ID5A 1ASWA 4NYNA 4CFCA 3LANA 2P5OA 1XHXA 3LAKA 2RF2A 3M8PA 3RMAA 3TARA 3D45A 1YQRA 2NOEA 4AILC 1QNAA 1WAJA 1AISA 2KQ2A 3MAQA 4DQQA 4KHQA 3VQ5A 1HYZA 1WSFA 3VQCA 1HQUA 1KY7A 3HS9A 1T8EA 4DFJA 1A5VA 3DOLA 2PYLA 1CDWA 4B0AA 1WSGA 4DQPA 5CZ2A 4JRQA 1ASVA 1VK0A 2G8UA 1KVBA 2Y1JA 2OYQA 4OLBA 1IH7A 2ZD1A 3HP6A 4BACA 1S9GA 3NH1A 1HYSA 1NK5A 3OYFA 1TKTA 4FLZA 2YH5A 2FBTA 3VQPA 4DSEA 4NCGA 4FM1A 3SYZA 3HO1A 3N89A 1YTAA 4PQUA 1LWVA 3LAMA 3SQ4A 3HPGA 3SQ0A 4BE2A 3DLGA 1JL1A 4CHOA 4N47A 1RM1A 3OYBA 5FRNA 4FW1A 5JS1A 2ZE2A 1BL3A 2KFZA 1VSIA 2F8SA 1B9DA 2QKKA 4HCBA 1BQNA 2JLEA 3OVNA 2G30A 4DS5A 4OVLA 3OS2A 1VSKA 5JS2A 1LWFA 2HNYA 1TL1A 3OYCA 3RMDA 4F2RA 3VQ6A 2OZMA 2YHBA 4NCBA 3QIOA 4BDZA 1TAQA 4CJVA 4I2PA 1X1PA 1Z25A 4NYFA 3LWMA 1C9BB 3HXMA 1YQMA 1RTHA 1RTIA 1QSSA 2DFHA 2RN2A 4CCHA 4F2SA 4FLYA 4E3SA 2NOBA 4PUOA 1UOCA 2IDOA 2WONA 3V9UA 2Z1GA 4OPKA 5I3UA 4FJXA 1D3UA 4CHNA 3AO1A 3EZ5A 3HSTB 3SQ1A 1SKSA 4LSNA 4DMNA 2BGGA 5E41A 1SKRA 1KLNA 5SWMA 1F21A 4WZSD 4RW7A 2LAEA 1VRTA 4FJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8U A;  1KVA A;  3VA3 A;  2G8H A;  4FK2 A;  4B9L A;  1TK5 A;  4DFK A;  1JLA A;  4CE9 A;  4DU3 A;  1NK7 A;  4CJU A;  2D0A A;  3VQ7 A;  4CIE A;  1LWE A;  2HHS A;  3BGR A;  3L3V A;  1RT1 A;  3KIO A;  1FKO A;  3LZJ A;  1YTF A;  1SL0 A;  4M45 A;  3C94 A;  4B9U A;  4KB0 A;  3LP0 A;  2F8T A;  4W5O A;  1ZBF A;  5IYD P;  1DTQ A;  2B5J A;  3CFO A;  1BIU A;  3NF6 A;  3O4N A;  4AHR A;  4OKK A;  3AO3 A;  5HRS A;  4N5S A;  3K5N A;  1VSE A;  4DQS A;  3AO4 A;  1S1T A;  2OPQ A;  4ZHR A;  1XC9 A;  2HHT A;  4CIG A;  4O0I A;  4DTJ A;  3WNG A;  4IG0 A;  4AHU A;  1KYD A;  3K2P A;  3LZI A;  4FZY A;  1KYF A;  1NK4 A;  4N56 A;  1KFD A;  1VSL A;  4DSJ A;  3RMB A;  3CM6 A;  3DYA A;  4CK3 A;  4CGJ A;  4FJ8 A;  2KTQ A;  3ZSR A;  4I9L A;  3TAQ A;  3ISN C;  2NUB A;  1C0U A;  3I8D A;  4DTN A;  1NK6 A;  2BDP A;  1BCO A;  4FK0 A;  1EKE A;  2LSN A;  3OCI A;  1WSH A;  3CFP A;  2XRI A;  1IKV A;  1BQM A;  2OPP A;  3V9Z A;  3VQA A;  3WNF A;  2YNH A;  4DTR A;  3PV8 A;  1XHZ A;  4CF1 A;  2D0B A;  1QN4 A;  2QKB A;  4LSL A;  1JLC A;  1B9K A;  4ICL A;  1ZBI A;  2XO7 A;  4JS5 A;  4MFB A;  3AA2 A;  4WE1 A;  3ZSZ A;  1C1A A;  3NGI A;  2B4J A;  4B3O A;  1HNI A;  4B9V A;  2XY5 A;  4EZ6 A;  2HMI A;  1RT5 A;  1C0T A;  1NJX A;  3V1R A;  2ZQB A;  4CJT A;  1IO2 A;  2P1J A;  1FK9 A;  4M3R A;  3ZT0 A;  4EP4 A;  3RWU A;  1VRU A;  3AA3 A;  4KFB A;  5CZ1 A;  4CJE A;  2XY7 A;  4F8R A;  3L2U A;  4DSK A;  3C95 A;  5HRR A;  1D9D A;  2VWK A;  2OA8 A;  5J1E A;  1MP9 A;  1GOA A;  3LWL A;  4Z4H A;  4M41 A;  3C6T A;  4CJS A;  4CJK A;  3TAF A;  4CIF A;  3S3M A;  1JL2 A;  4KI4 A;  2PY5 A;  3EIK A;  4KHN A;  3QIP A;  3OYA A;  3EY1 A;  1IKX A;  4I9Q A;  4XIU A;  1SL2 A;  4Z4F A;  3VQQ A;  4AHS A;  2YHA A;  4CGF A;  3OYH A;  4FJK A;  1NGM A;  3L8B A;  4B9S A;  4FJ5 A;  2VG5 A;  3AO5 A;  3PY8 A;  4DU1 A;  4L8R B;  4IG3 A;  3TI0 A;  1Q9Y A;  3SI6 A;  3OYI A;  2I5J A;  4CJL A;  2HHQ A;  3MEC A;  4M3U A;  1NK0 A;  4CHY A;  2FBY A;  4KRE A;  2O4G A;  3OJU A;  3MXJ A;  4B08 A;  4CF8 A;  3PX4 A;  1HQE A;  5DMR A;  1DTT A;  1WSE A;  5I42 A;  3ZT3 A;  4GW6 A;  3KLF A;  3TAM A;  3K5O A;  5KGX A;  3SUO A;  1TL3 A;  2HND A;  3NF8 A;  4EP5 A;  4FJM A;  3ULD A;  4CF9 A;  3DRR A;  4QCL A;  3AA5 X;  3DLR A;  4HTU A;  3AVJ A;  4HHT A;  4OLA A;  3TAN A;  4E19 A;  1N6Q A;  1T7P A;  3V9S A;  1L3U A;  2FBV A;  3M8R A;  2G8W A;  1S6Q A;  3RRH A;  4RW9 A;  2G8I A;  1BHL A;  1EXQ A;  1FKP A;  1HNV A;  2OPR A;  2IOC A;  3HS8 A;  3AO2 A;  3LAL A;  3VQD A;  3OJS A;  1ZYQ A;  1K6Y A;  4BDP A;  2IV8 A;  1S1X A;  4DTX A;  1TAU A;  1QN3 A;  5HRP A;  1VSD A;  3LPT A;  4HVJ A;  3WNE A;  3QEW A;  4B9T A;  3V81 A;  1L3V A;  1D5A A;  3G10 A;  3OYD A;  2HVH A;  1I39 A;  4O4G A;  3H1Z A;  1QN5 A;  4OKJ A;  2EX3 A;  1YT3 A;  4CHP A;  1TBA B;  1W0H A;  1VSJ A;  3AVN A;  3VQB A;  1BI4 B;  3NHG A;  3T3F A;  4FJJ A;  4N76 A;  3MXM A;  4CJP A;  4E7L A;  3KLH A;  1NH2 A;  4Z4C A;  4BE0 A;  1RT2 A;  3NFA A;  2YNF A;  4F3O A;  2YKM A;  4OPJ A;  3HJF A;  4B9M A;  1KFS A;  3P1G A;  1WN7 A;  4HUG A;  3OY9 A;  1U49 A;  1J5O A;  4E7J A;  3L2R A;  1UA0 A;  4CER A;  4BWJ A;  1IKY A;  1D9F A;  1C6V A;  4DG1 A;  4DQR A;  4W5N A;  1CZB A;  2DFE A;  2X78 A;  4DQI A;  4KTW A;  1LAW A;  2HB5 A;  1HMV A;  4DTO A;  1PCZ A;  4ZTF A;  4FW2 A;  3K5M A;  1GOC A;  5EU7 A;  2HNZ A;  4R5P A;  3LP1 A;  4DWI A;  4M3X A;  3O3G A;  5T7B A;  1TK8 A;  5HRO A;  2E6L A;  1QS4 A;  1QTP A;  1A5X A;  2W42 A;  4C8O A;  1RT6 A;  2PZS A;  1TVR A;  4AHT A;  3RRG A;  3KJV A;  1CZ9 A;  4F3T A;  3PX6 A;  1LW2 A;  1JLG A;  4Q0B A;  1E42 A;  3TAG A;  3QEI A;  4FCY A;  1J54 A;  1RBV A;  1TKD A;  2HHX A;  3AVF A;  1BIS A;  3VQ4 A;  1Q8I A;  2KFN A;  1VOK A;  4PY5 A;  3DI6 A;  4B8C A;  1VOL B;  2XY8 A;  3HP6 A;  4TSX A;  3OC3 C;  2ETJ A;  2F96 A;  4ROC B;  2MJ7 A;  3DM2 A;  3HP9 A;  4GMJ B;  4Y1D A;  4DTM A;  1NOY A;  4LD0 A;  4KKO A;  3ASM A;  1BCM A;  4RW8 A;  3QET A;  4DSL A;  3IG1 A;  1QQC A;  3B6P A;  4HUE A;  2JGU A;  2HHW A;  1I3A A;  5CYQ A;  4RW4 A;  3RMC A;  4HUF A;  1Q9X A;  4C8L A;  3KD1 E;  3MEE A;  4EZ9 A;  4BWM A;  1QSY A;  3OYJ A;  3S9H A;  1J53 A;  5HRN A;  3DMJ A;  1ZBU A;  3P83 D;  3HM9 A;  2YNI A;  3SQ2 A;  4C8K A;  3AVC A;  4LH4 A;  3H08 A;  3T19 A;  4ZTJ A;  1R0A A;  5HP1 A;  2GV9 A;  3CM5 A;  4CEB A;  1UAX A;  1SUQ A;  3ZSO A;  1RDA A;  3LP2 A;  4CGI A;  1U47 A;  1L3S A;  4BE1 A;  1KYU A;  4Q5V A;  4DTU A;  3SUQ A;  1PZD A;  3BDP A;  5D3G A;  4KB1 A;  4O55 A;  4CEQ A;  1RTJ A;  4OKE A;  4CFD A;  3QNN A;  3KLI A;  4FK4 A;  4CFA A;  2RKI A;  1UWB A;  3KK2 A;  4GVM A;  4PA1 A;  3T1A A;  3NDK A;  3SUN A;  1R4X A;  1UA1 A;  1HRH A;  1RDC A;  3C6U A;  1NKE A;  1L5U A;  4J2D A;  5FRO A;  3ZT2 A;  4M3T A;  1GOB A;  4E0D A;  2A1S A;  3K59 A;  4UQG A;  1VTO A;  3K5L A;  2XY6 A;  3TAB A;  4FYD A;  4J2B A;  4DTP A;  1LV5 A;  4QOZ B;  3OYN A;  3G0Z A;  1SV5 A;  4DF4 A;  1FXX A;  1RT4 A;  3CYM A;  2KW4 A;  1S9E A;  3HPH A;  3OS1 A;  2P51 A;  4DSF A;  3VA0 A;  3SJJ A;  3NH2 A;  3DLB A;  2B6A A;  1WSJ A;  3CQ8 A;  4QAG A;  4JRP A;  1REV A;  4CEF A;  5J2P A;  3PUF A;  5SZT A;  2YV0 X;  3HVT A;  4E1M A;  3O4Q A;  1YTU A;  1X9W A;  1IKW A;  3AVM A;  2FBX A;  4RG8 A;  4FJ9 A;  3AA4 A;  2O4I A;  3HPO A;  3U3Y A;  2RPI A;  4FLV A;  1O1W A;  3AVK A;  3F9K A;  3ZT4 A;  3SPZ A;  1QNB A;  2KZZ A;  3E01 A;  4FLU A;  1KLM A;  4HCC A;  4LY7 A;  4M3Z A;  1ZBH A;  3ZSQ A;  3L2V A;  4KV8 A;  1U4B A;  4FJG A;  4E7I A;  4M3Y A;  1RBT A;  4KTQ A;  3TWH A;  1BI4 A;  4AHV A;  1WLJ A;  3O3H A;  5FDL A;  3OYG A;  3KTQ A;  2GUI A;  3TR8 A;  1NK9 A;  2E4L A;  3DLK A;  4KTZ A;  1J9A A;  4OGC A;  4AH9 A;  1SKW A;  3THV A;  3F73 A;  2VG7 A;  3S3O A;  4DSI A;  3UIQ A;  4IKF A;  4KHW A;  4FZZ A;  1D8Y A;  1ITG A;  2IS3 A;  5KRS A;  5DK5 A;  3DLH A;  4YNQ A;  2Y1I A;  1TK0 A;  1RNH A;  4CJF A;  1QTM A;  2G8F A;  3VN5 A;  2P5G A;  4PWD A;  4Z0U A;  2HW3 A;  3HK2 A;  2DFF A;  3DOK A;  4I7F A;  1SL1 A;  3L3U A;  1G15 A;  4FM2 A;  1X9S A;  3FFI A;  4FJ7 A;  1QN6 A;  5C24 A;  4DFP A;  3ZSY A;  2Z1I A;  3M8S A;  2X74 A;  3SCX A;  3I0R A;  4Y1C A;  3P5J A;  1BIZ A;  3O3F A;  4BDY A;  2Q3S A;  1RBU A;  2BE2 A;  4CGH A;  3OYM A;  3EYZ A;  4DLG A;  4ELT A;  4DF8 A;  1C1C A;  1TBP A;  2GBZ A;  3QEV A;  1BGX T;  1QNC A;  3NGZ A;  1MU2 A;  3OYK A;  1ASU A;  3AVG A;  3NAE A;  3KD5 E;  3SV4 A;  1VSM A;  2IV9 A;  2D0C A;  4MQ3 A;  4C8M A;  1DLO A;  3JSM A;  1B9F A;  5HBM A;  1JXE A;  4KO0 A;  5C42 A;  2VG6 A;  1WNS A;  4E1N A;  3KK3 A;  4E7K A;  1WAF A;  2ATQ A;  1YVU A;  3AVA A;  3ITH A;  5KTQ A;  1HJR A;  1RIL A;  4CJW A;  4Z4G A;  4CJ4 A;  4DU4 A;  4FZX C;  4J2A A;  3ZSW A;  3AVI A;  3A2F A;  2E6M A;  4IDK A;  4AHC A;  4FLT A;  4H8K A;  1W9H A;  4O44 A;  1NJY A;  3QES A;  1RDD A;  4CJQ A;  1KTQ A;  3KK1 A;  3SNN A;  5KGW A;  1QN8 A;  3IRX A;  3KLE A;  5J2Q A;  4CJ3 A;  1QTS A;  3QIN A;  2HVI A;  2HHU A;  2QK9 A;  2X6S A;  4OJR A;  3L2W A;  3ZCM A;  4KRF A;  4KI6 A;  1XI1 A;  1QN9 A;  1TKZ A;  1S1U A;  3PX0 A;  3V9X A;  3HYF A;  3QNO A;  1TV6 A;  3QEX A;  2YKN A;  4C8N A;  4H4O A;  4O5B A;  4E7H A;  1TKX A;  4ID1 A;  1QSL A;  4CF2 A;  4CK2 A;  4H4M A;  4OGE A;  4Z4I A;  1S5J A;  3IAY A;  5HLF A;  4FJN A;  5K14 A;  2BAN A;  4W5R A;  1N5Y A;  2G8V A;  2OZS A;  3KKS A;  5J2N A;  4ELV A;  3HT3 A;  1W80 A;  1JKH A;  2D5R A;  3NF7 A;  2VJ0 A;  4FXD A;  3U3G A;  3HL8 A;  2A1R A;  4Z4E A;  3LDS A;  2DY4 A;  1LWC A;  4ROE B;  3D0P A;  1NOZ A;  3V6D A;  3SZ2 A;  4JS4 A;  3K57 A;  3VQ9 A;  4W5Q A;  1KSP A;  3QER A;  1EET A;  4ELU A;  1HYV A;  1LAV A;  1NKC A;  3V1Q A;  2KZM A;  4K8X A;  1NVP A;  4B9N A;  1WSI A;  2IC3 A;  3VQE A;  4J2E A;  4G1Q A;  1JLB A;  1XWL A;  3L2Q A;  1B92 A;  3ALY A;  5J2M A;  1VTL E;  1JXB A;  1TGO A;  1Z26 A;  3ZT1 A;  3B6O A;  4CGD A;  5IYB P;  1RBS A;  4KPY A;  1T05 A;  2IAJ A;  2DTU A;  1U48 A;  4W5T A;  3V1O A;  2XHB A;  1RBR A;  2OPS A;  4CJR A;  1VSF A;  3NF9 A;  4CED A;  4CEO A;  3NGY A;  5KRT A;  1IG9 A;  1S1V A;  3MED A;  1CXU A;  1QN7 A;  4IBN A;  1TGH A;  3OYE A;  4DTS A;  2R7Y A;  5IYC P;  2Z1H A;  3DRP A;  1RT7 A;  3KKR A;  4FVM A;  1VSH A;  3QO9 A;  3NCI A;  3QLH A;  1X9M A;  4FJH A;  3DRS A;  3NE6 A;  4N41 A;  3LPU A;  3HVR A;  2PYJ A;  1S1W A;  3TAE A;  4FM0 A;  3IS9 A;  3NH0 A;  1C0M A;  4DFM A;  2FC0 A;  3ZSX A;  2EHG A;  2WOM A;  3TAP A;  1JLE A;  4IFY A;  4FLX A;  3PO5 A;  3M8Q A;  1KRP A;  4KHY A;  1EX4 A;  3OS0 A;  3SV3 A;  4CF0 A;  5CY4 A;  3LP3 A;  3MEG A;  4CEA A;  4CK1 A;  1YTB A;  1A5W A;  1RCH A;  3QEP A;  3U6F A;  1NKB A;  3CG7 A;  1U45 A;  4FLW A;  1S6P A;  1T03 A;  2X6N A;  4O0J A;  3RR8 A;  4E89 A;  1QE1 A;  1RDB A;  5CYM A;  1NJW A;  4CEE A;  1JLQ A;  3OYL A;  4ROD B;  4LH5 A;  5FRM A;  1RT3 A;  4NCA A;  2AJQ A;  1KVC A;  3NBP A;  4CHQ A;  1NK8 A;  1L3T A;  4YFU A;  4CES A;  3RR7 A;  1RTD A;  3PO4 A;  4F4K A;  4CGG A;  1ZBL A;  3WNH A;  1NJZ A;  3ZSV A;  1JLF A;  2IGI A;  1LW0 A;  4M42 A;  3AV9 A;  1KY6 A;  4FJI A;  3RTV A;  1KCF A;  4JLH A;  1QNE A;  4DLE A;  4I2Q A;  1C1B A;  3SPY A;  4K8Z A;  3I0S A;  1QHT A;  2VWJ A;  2G8K A;  2Z1J A;  4DS4 A;  4KHS A;  1CLQ A;  4IFV A;  4CJ5 A;  3KLG A;  3SUP A;  2HHV A;  1JFI C;  1CXQ A;  3MXI A;  3DLE A;  3AVB A;  4CFB A;  5KI6 A;  3CFR A;  3AVH A;  4B8A B;  5C25 A;  3K58 A;  2QXF A;  2ITG A;  4KAZ A;  3S3N A;  2YNG A;  4M3W A;  3V9W A;  4CEC A;  3V4I A;  3VQ8 A;  1U04 A;  3AVL A;  4RW6 A;  4KHU A;  1Y97 A;  3JYT A;  4CHZ A;  4CEZ A;  1EP4 A;  1HPZ A;  4ID5 A;  1ASW A;  4NYN A;  4CFC A;  3LAN A;  2P5O A;  1XHX A;  3LAK A;  2RF2 A;  3M8P A;  3RMA A;  3TAR A;  3D45 A;  4AIL C;  1QNA A;  1WAJ A;  1AIS A;  2KQ2 A;  3MAQ A;  4DQQ A;  4KHQ A;  3VQ5 A;  1HYZ A;  1WSF A;  3VQC A;  1HQU A;  1KY7 A;  3HS9 A;  1T8E A;  4DFJ A;  1A5V A;  3DOL A;  2PYL A;  1CDW A;  4B0A A;  1WSG A;  4DQP A;  5CZ2 A;  4JRQ A;  1ASV A;  1VK0 A;  2G8U A;  1KVB A;  2Y1J A;  2OYQ A;  4OLB A;  1IH7 A;  2ZD1 A;  4BAC A;  1S9G A;  3NH1 A;  1HYS A;  1NK5 A;  3OYF A;  1TKT A;  4FLZ A;  2FBT A;  3VQP A;  4DSE A;  4NCG A;  4FM1 A;  3SYZ A;  3HO1 A;  1YTA A;  4PQU A;  3LAM A;  3SQ4 A;  3SQ0 A;  3HPG A;  4BE2 A;  3DLG A;  1JL1 A;  4CHO A;  4N47 A;  1RM1 A;  3OYB A;  5FRN A;  4FW1 A;  5JS1 A;  2ZE2 A;  1BL3 A;  2KFZ A;  1VSI A;  2F8S A;  1B9D A;  2QKK A;  4HCB A;  1BQN A;  2JLE A;  3OVN A;  2G30 A;  4DS5 A;  4OVL A;  3OS2 A;  1VSK A;  5JS2 A;  1LWF A;  2HNY A;  1TL1 A;  3OYC A;  3RMD A;  4F2R A;  3VQ6 A;  2OZM A;  2YHB A;  4NCB A;  3QIO A;  4BDZ A;  1TAQ A;  4CJV A;  4I2P A;  1X1P A;  1Z25 A;  4NYF A;  3LWM A;  1C9B B;  3HXM A;  1RTH A;  1RTI A;  1QSS A;  2DFH A;  2RN2 A;  4CCH A;  4F2S A;  4FLY A;  4E3S A;  4PUO A;  1UOC A;  2IDO A;  2WON A;  3V9U A;  2Z1G A;  4OPK A;  5I3U A;  4FJX A;  1D3U A;  4CHN A;  3AO1 A;  3EZ5 A;  3HST B;  3SQ1 A;  1SKS A;  4LSN A;  4DMN A;  2BGG A;  5E41 A;  1SKR A;  1KLN A;  5SWM A;  1F21 A;  4WZS D;  4RW7 A;  1VRT A;  4FJL A; 
#chains in the Genus database with same CATH topology
 4IOC L;  1KVA A;  1WUA A;  2G8H A;  2D0A A;  2FKF A;  4IO8 A;  1E4G T;  2CGK A;  3JS6 A;  3BGR A;  1T3V A;  1N3C A;  4MO4 A;  4FWM A;  3C94 A;  2V52 B;  4W5O A;  3TTD A;  5IYD P;  1YVN A;  4JI8 K;  4XH5 A;  2FSK A;  3ENH A;  3AO3 A;  3K5N A;  3FZL A;  1S1T A;  2OPQ A;  4EJZ A;  3VEY A;  4FVU A;  4BC4 A;  4O0I A;  3LZI A;  1D4X A;  3PSI A;  1NK4 A;  4N56 A;  1VSL A;  4IWV A;  4DSJ A;  4CBW A;  3TAQ A;  3ISN C;  5FPE A;  5AQM A;  3CFP A;  3VQA A;  2HL8 A;  2PWW A;  2QA4 N;  3RSM A;  1ZBI A;  5JVH L;  3AA2 A;  2ZM6 K;  1HNI A;  2YHX A;  4EZ6 A;  4O8U A;  2HMI A;  3ENB A;  1IO2 A;  3SLC A;  3ZT0 A;  4EP4 A;  3RWU A;  5CR4 A;  2OA8 A;  5J1E A;  1MP9 A;  1C47 A;  1GOA A;  3TAF A;  4CJS A;  4CIF A;  2VWB A;  4I9Q A;  4XIU A;  4GNI A;  2NOZ A;  2HF4 A;  2JPI A;  4FJ5 A;  2VG5 A;  3AO5 A;  1MWK A;  3E9P A;  4DU1 A;  1Q9Y A;  3OYI A;  4JI5 K;  2VQE K;  5AZI A;  2H3G X;  4KRE A;  4A2B A;  1DEJ A;  1HQE A;  5DMR A;  1DTT A;  3FZH A;  3VF6 A;  2FSJ A;  2HND A;  3NF8 A;  4FSV A;  4QS8 A;  4CF9 A;  3DRR A;  5CE3 A;  1N34 K;  2GWK A;  3J8A A;  3MK6 A;  2NNW A;  3OSM A;  4E19 A;  5HOO A;  1N6Q A;  2FBV A;  1YI2 N;  2G8W A;  1S6Q A;  1T44 A;  2FF3 B;  4NB4 A;  1VQN N;  4B1Z A;  1BHL A;  3LAL A;  3OJS A;  4EHT A;  3WXK A;  2IV8 A;  1S1X A;  2HBK A;  3R6M A;  5HRP A;  5HL7 L;  5AQU A;  4BGA A;  3QEW A;  3UKR A;  1L3V A;  3OYD A;  2HVH A;  2HBM A;  4NXN K;  3H1Z A;  4CHP A;  1YT3 A;  1TBA B;  1BI4 B;  4A5A A;  4FJJ A;  3THY A;  3MXM A;  4E7L A;  4V19 S;  3TTC A;  4LF9 K;  3NFA A;  2YKM A;  4A62 A;  3P1G A;  1S22 A;  1WN7 A;  4O8K A;  4E7J A;  1HNW K;  3L2R A;  3ENC A;  3LL3 A;  4CER A;  1Z05 A;  1M3H A;  5KPR A;  1YIJ N;  3VEO A;  1C6V A;  4DQI A;  3ZLJ A;  3K5M A;  1GOC A;  1P8Z A;  2Q97 A;  3VOV A;  5T7B A;  3EE9 A;  4BQL A;  2HL9 A;  3CF5 L;  3CQX A;  3ZET A;  3T69 A;  3Q7C A;  2W42 A;  4C8O A;  2P9L B;  2Y8Q A;  2HMP A;  3J81 O;  1NGC A;  5BR8 K;  2W41 A;  4JK9 A;  1JLG A;  3H45 C;  3QB0 A;  3THX B;  4GV9 A;  1VOK A;  3O5B A;  1VOL B;  1RTD A;  2MJ7 A;  4CZK A;  4DTM A;  3E9L A;  3ASM A;  3QET A;  4DSL A;  1QZ5 A;  1VAZ A;  4PKI A;  3PIO L;  4NO7 A;  3OYJ A;  2UUA K;  1ZBU A;  3HM9 A;  2YNI A;  4DHY A;  4AQY K;  4C8K A;  4LH4 A;  4DR6 K;  1R0A A;  2WBN A;  3A8Y A;  2GV9 A;  4DQ8 A;  1U47 A;  4H0P A;  4LF6 K;  4K43 A;  4JK8 A;  1KYU A;  3SUQ A;  3D2E B;  2Q31 A;  3CIP A;  3ZYY X;  4JI6 K;  3O4W A;  5I9E B;  4CFD A;  1XSZ A;  3QNN A;  2P9P A;  1HRH A;  1RDC A;  1BA1 A;  1L5U A;  1HUX A;  5GIP A;  4QS7 A;  3ZT2 A;  4CZI A;  2A1S A;  3K59 A;  4UQG A;  5KL0 A;  5E26 A;  3K5L A;  3TAB A;  1C4G A;  2OOY A;  1LV5 A;  2P9L A;  1SV5 A;  4WFN L;  1FXX A;  4TPS A;  1Q86 O;  1WOQ A;  2KW4 A;  1U48 A;  3OS1 A;  4DSF A;  3VA0 A;  3CQ8 A;  4JKE A;  4BRP A;  5J2P A;  3PUF A;  2QXL A;  3J7Y P;  1YTU A;  1XNQ K;  4FWS A;  1IKW A;  3CJ7 A;  3UKU A;  3E66 A;  4H5W A;  4EFH A;  5BPN A;  3U3Y A;  2D1K A;  3EKS A;  1EUV A;  4LF7 K;  1U2V B;  4X65 K;  4FLU A;  3O08 A;  2YJE A;  4KV8 A;  1KO9 A;  3CWA A;  4E7I A;  3I3W A;  1RBT A;  3L4Q A;  1BI4 A;  1VQ9 N;  2UU9 K;  4WQ4 A;  5FDL A;  3KTQ A;  2GUI A;  1NK9 A;  4KTZ A;  3R8E A;  1K2Y X;  3MX5 A;  4DKW A;  4FZZ A;  5AQY A;  4U7B A;  1TK0 A;  5BMN A;  2QWQ A;  4Z0U A;  1SL1 A;  2P9I A;  3HZ6 A;  1KFI A;  5C24 A;  1RDW X;  2J4R A;  1ATN A;  4BRD A;  3O3F A;  4EJY A;  1GLF O;  4BDY A;  1RBU A;  3DLL L;  2BE2 A;  4ELT A;  4EAH D;  2GBZ A;  4BJU A;  2YA3 A;  4BRI A;  3SV4 A;  2IV9 A;  4ISF A;  2OAN A;  4MQ3 A;  3VER A;  1B9F A;  4BR2 A;  2VG6 A;  3CER A;  1WNS A;  4BRQ A;  1K8K B;  4E1N A;  4E7K A;  2ATQ A;  3AVA A;  3ITH A;  4CJW A;  1IJJ A;  4H0Y B;  4J2A A;  3A2F A;  4FPA A;  1W9H A;  1NJY A;  4JD2 A;  3KLE A;  3C04 A;  4XH4 A;  3PLA A;  4J8F A;  3VEX A;  3VGK A;  4QS9 A;  3L2W A;  4WQ4 C;  4KI6 A;  1S1U A;  3CJ9 A;  3V9X A;  3HYF A;  3QNO A;  4CBX A;  3QIC A;  3THW B;  3MN9 A;  4H4M A;  4OGE A;  4DV7 K;  2UYT A;  4Z4I A;  1S5J A;  3IAY A;  5HLF A;  1KD1 O;  4FJN A;  2O8C B;  2NVM A;  3GG4 A;  4YOW A;  3HT3 A;  1W80 A;  2Q36 A;  2A42 A;  1NOZ A;  3SZ2 A;  2CH6 A;  1JDY A;  3VQ9 A;  4W5Q A;  1W2B M;  1LAV A;  5GAE P;  1NVP A;  3VQE A;  4G1Q A;  1B92 A;  3ALY A;  1JXB A;  3ZT1 A;  4E1J A;  4CGD A;  1RBS A;  3V1O A;  4B9Q A;  2QWN A;  1VSF A;  3NF9 A;  4CEO A;  2IVP A;  1S1V A;  2R7Y A;  1K35 A;  5AQX A;  2Z1H A;  5M1K A;  1NWK A;  2NLV A;  3LDP A;  3DRS A;  1BUP A;  3NE6 A;  4DV0 K;  3TAE A;  3HRG A;  1NJI O;  1UT4 A;  4MLH A;  1QQO A;  3QFU A;  2EHG A;  2ITM A;  1JLE A;  2QEX N;  4IFY A;  3M8Q A;  4KHY A;  1EX4 A;  4RWT A;  4G9Z A;  3D2F B;  3MEG A;  1Q7Y O;  4CK1 A;  4K0K K;  2IVO A;  4Y0W A;  4E89 A;  1RDB A;  2DTU A;  4CEE A;  4X62 K;  4BRE A;  1RT3 A;  5M1F A;  1L3T A;  1HNZ K;  3RR7 A;  3PO4 A;  3ZSV A;  1JLF A;  4JKB A;  3AV9 A;  1IBM K;  3RTV A;  5AZJ B;  2OOX A;  3UB5 A;  2VWJ A;  2H5A X;  4MDB A;  4KHS A;  3KLG A;  2BH1 A;  3SUP A;  1CXQ A;  1JFI C;  3A5O C;  4CFB A;  3AVB A;  3AAR A;  4B8A B;  5AFU H;  2ITG A;  3C65 A;  4M3W A;  1J3M A;  4CEC A;  1U04 A;  1MPG A;  4RW6 A;  1Y97 A;  4IOA L;  1MA9 B;  2ASM A;  3JYT A;  4CEZ A;  4CZF A;  3PDK A;  2FUV A;  1ASW A;  2JWK A;  3J7Z O;  4BRL A;  1JCF A;  2RF2 A;  3DXM A;  1WBD A;  2NOE A;  1QNA A;  1WAJ A;  1AIS A;  3DJC A;  3OLP A;  3MAQ A;  1N32 K;  4KHQ A;  3VQC A;  1WSF A;  3HS9 A;  1YF5 L;  3QBX A;  3DOL A;  4DQP A;  4BR7 A;  2Y1J A;  1S9G A;  1HYS A;  1DKG D;  3OYF A;  4JI4 K;  4FLZ A;  3UKU B;  4FWN A;  4FM1 A;  3LAM A;  3HPG A;  4BE2 A;  1VQK N;  1JL1 A;  1RM1 A;  3TSP A;  3EKU A;  4MRQ A;  1B9D A;  2QKK A;  3CCL N;  3W3D A;  2G30 A;  4BRN A;  1SZ2 A;  4OVL A;  1VSK A;  4JEP A;  2JHJ A;  2KLA A;  2P9N A;  5JS2 A;  3VQ6 A;  3QIO A;  4CI6 A;  4BDZ A;  2UXD K;  5LJW A;  1X1P A;  3LWM A;  3CJ1 A;  3U9Z A;  1QSS A;  4DV6 K;  5BR9 A;  4F2S A;  4PUO A;  4IJN A;  4YOT A;  2WON A;  4FJX A;  3EZ5 A;  3WXJ A;  1SKR A;  1GLJ O;  2QI2 A;  5SWM A;  5F0X A;  2Z8U A;  3VA3 A;  3OST A;  3TSU A;  4CIE A;  3NVK A;  1KQS M;  3LZJ A;  2VCP A;  2GUP A;  1OH7 A;  3H6E A;  4AHR A;  1ZBL A;  4N5S A;  1HJO A;  2HBL A;  4DQS A;  3AO4 A;  2HHT A;  4CZE A;  4A57 A;  4IG0 A;  4AHU A;  4Q11 A;  1KYF A;  3P38 A;  4JKG B;  3RMB A;  3CM6 A;  2KTQ A;  4CGJ A;  3ZSR A;  2LSN A;  4WFA L;  5GIN A;  4JKH A;  1IKV A;  2OPP A;  3V9Z A;  2YNH A;  2D0B A;  4LSL A;  4ICL A;  4JS5 A;  2CH5 A;  3H46 O;  4MFB A;  3ZSZ A;  1C1A A;  1KXP A;  2B4J A;  4DR2 K;  3H1V X;  1S3X A;  1RT5 A;  1SQK A;  5AQZ A;  1NJX A;  3V1R A;  2P1J A;  3C6A A;  4M3R A;  1YJN N;  1VRU A;  3AA3 A;  4CJE A;  3KRM A;  3SBG A;  3C95 A;  3VGL A;  1XMO K;  1WB9 A;  3LWL A;  2E2O A;  3WUH A;  3C6T A;  3EIK A;  3THY B;  4KHN A;  3LDO A;  3OYA A;  2IVN A;  5ELZ A;  1SL2 A;  3KTU A;  4C1N I;  2YHA A;  4FJK A;  1WBB A;  3PY8 A;  4IG3 A;  3IKM A;  3WT0 A;  1FN7 A;  2I5J A;  2FGT A;  4CHY A;  3MXJ A;  4BG8 A;  1WSE A;  3SUO A;  2Y8L A;  5AQQ A;  1TL3 A;  4EP5 A;  1HKB A;  3AA5 X;  4HTU A;  1BOT O;  4UY8 O;  3AVJ A;  1BU6 O;  3CME N;  2E2P A;  4YOR A;  1BA0 A;  3M8R A;  4DB3 A;  1GLB G;  1EXQ A;  3VQD A;  2IOC A;  3AO2 A;  5LJV A;  3CCV N;  1TAU A;  1N36 K;  4HVJ A;  5AQW A;  4GV6 A;  4BRA A;  3G10 A;  1QN5 A;  4OKJ A;  4LF5 K;  5BMP A;  3T3F A;  3AVN A;  3LM2 A;  4N76 A;  3I0X A;  5JLF A;  4BY9 C;  2NOH A;  2V92 A;  1RT2 A;  4IL8 A;  2YNF A;  3WEE B;  5MLC Q;  4OPJ A;  4HUG A;  3OY9 A;  1U49 A;  1TUY A;  1D9F A;  4BR0 A;  1WQA A;  3DPU A;  4DG1 A;  4DQR A;  1CZB A;  1KAY A;  4KTW A;  2P9U A;  2NRV A;  2Z0F A;  4FW2 A;  3IMX A;  4BQZ A;  3HOT A;  3R1X A;  5AQO A;  4R5P A;  2FSN A;  4IXC A;  3O3G A;  4DV1 K;  5HRO A;  1A5X A;  3KJV A;  2WUS A;  1LW2 A;  4Q0B A;  3T4N A;  4AM6 A;  3TAG A;  4FCY A;  1TUO A;  4PY5 A;  3U4L A;  2XY8 A;  3O9S A;  4TSX A;  1NOY A;  3DM2 A;  2ZJR L;  1NU0 A;  3FE1 A;  4KKO A;  3IG1 A;  3WEE A;  1XNR K;  2HHW A;  2JGU A;  5CYQ A;  4RW4 A;  3KD1 E;  1VQ8 N;  1QSY A;  5GAG P;  3AVC A;  3T19 A;  1N8R O;  1SUQ A;  3ZSO A;  1RDA A;  3LP2 A;  4CGI A;  3CC7 N;  2NRR A;  3TSQ A;  4Q5V A;  4DUL A;  3BDP A;  4KH6 A;  4O55 A;  3Q7B A;  3N4Q A;  3F0Z A;  3VEV A;  3I0W A;  1R4X A;  1NKE A;  3C6U A;  3C6H A;  5AJ3 K;  1GOB A;  4E0D A;  2HHH K;  3CCJ N;  4GKJ K;  5AQS A;  4BRF A;  3TTF A;  3MX2 A;  4QG5 A;  1Q82 O;  3DLB A;  1WSJ A;  4JRP A;  4C1N K;  3O4Q A;  2F9T A;  1O13 A;  4B1U B;  2O4I A;  3HPO A;  2D4W A;  3F9K A;  3ZT4 A;  4HCC A;  4M3Y A;  4FJG A;  3LDN A;  3M5R A;  4CZG A;  4WX8 A;  3M6G A;  3TR8 A;  2E4L A;  4AH9 A;  1SKW A;  1J9A A;  4OGC A;  2O8C A;  1GLD G;  2VG7 A;  3SK3 A;  4EIA A;  3EO3 A;  4ISE A;  2P5G A;  1SS6 A;  2YCH A;  2HW3 A;  4BRG A;  2I5W A;  1VQP N;  2DPN A;  4I7F A;  3L3U A;  4EAI A;  4BRK A;  3SAH A;  4IFE A;  1QN6 A;  3ZSY A;  2Z1I A;  3M8S A;  2X74 A;  3SCX A;  3KVG A;  2F7T A;  2GX9 A;  5AQT A;  4IOX A;  2Q3S A;  4K41 A;  3OYM A;  4CGH A;  4IJA A;  2EHB D;  5FPD A;  1TBP A;  4LFB K;  5KPZ A;  1BGX T;  1QNC A;  3NGZ A;  3DXK A;  5AQL A;  3NAE A;  3MWP A;  3AVG A;  3BY5 A;  4C23 A;  3JSM A;  4C8M A;  3MCA B;  4KO0 A;  5C42 A;  1NGG A;  3KK3 A;  1WAF A;  1YVU A;  4ILH A;  5KTQ A;  2QRD A;  4AF1 A;  3MN7 A;  4CJ4 A;  1UL7 A;  3FZF A;  3ZSW A;  4CZJ A;  1HR0 K;  4H8K A;  4O44 A;  3QES A;  5KGW A;  3UE5 A;  1T6C A;  4DV2 K;  1XI1 A;  1TV6 A;  2YKN A;  5KQ8 A;  5BRE A;  4O5B A;  3WQT A;  3IUC A;  4ID1 A;  3SAF A;  4CF2 A;  2H4L X;  4W5R A;  1OH8 A;  2G8V A;  4ELV A;  3NF7 A;  1JKH A;  4DR7 K;  4YY3 K;  3HL8 A;  1LWC A;  4ROE B;  3ZX3 A;  3D0P A;  1U2V A;  1CZA N;  4JS4 A;  5C2D A;  1KSP A;  1LWW A;  1EET A;  4BRM A;  4JKG A;  3V1Q A;  1WSI A;  3GOI A;  1XWL A;  3VTI A;  5J2M A;  1Z26 A;  4O5F A;  3L0Q A;  4KPY A;  1RGI A;  2BUP A;  1T05 A;  3BP8 A;  5AQR A;  1NGF A;  4CED A;  3G71 N;  3C0B A;  3J80 O;  4IBN A;  3GE1 A;  4JI0 K;  4DTS A;  5IYC P;  3UKR B;  4FJH A;  4DCH A;  3HVR A;  1S1W A;  4FWO A;  4DFM A;  2WOM A;  4FLX A;  4X64 K;  1ZXO A;  4YOY A;  3CJC A;  3I55 N;  3SV3 A;  4CF0 A;  3D7E O;  1YQL A;  2HZS A;  3CVT A;  1YTB A;  3QEP A;  1NKB A;  3VEN A;  3CG7 A;  1U45 A;  1KAZ A;  1T03 A;  3THW A;  3OSE A;  2X6N A;  3RR8 A;  1QE1 A;  5FRM A;  2AJQ A;  3OYL A;  4LH5 A;  2P9N B;  4RTF D;  5C2F A;  1KVC A;  5C15 A;  4JHD A;  3L4I A;  4H0T B;  4CGG A;  4CZL A;  3WNH A;  2IGI A;  5AZI B;  1V4S A;  4JKA A;  1MDU B;  2I7N A;  2MZ8 A;  4C7P A;  3O9Q A;  3CCS N;  2E1Y A;  2G8K A;  5CHI A;  4DS4 A;  1QZ6 A;  5AQP A;  4EAG A;  3CFR A;  5C25 A;  4B3T K;  1LWY A;  1VQ7 N;  2YNG A;  3JAM O;  5GAD P;  3V9W A;  3D6R A;  1I94 K;  1LOT B;  4CHZ A;  1HPZ A;  5GAH P;  3BKQ X;  4NYN A;  3LAN A;  3P31 A;  3LAK A;  3RMA A;  4AIL C;  1YQR A;  3O9R A;  2KQ2 A;  4M7X A;  1ZC6 A;  1A5V A;  4FO0 A;  1CDW A;  4JRQ A;  3O8M A;  1KVB A;  4OLB A;  1HKG A;  3NH1 A;  1TKT A;  3VQP A;  4DSE A;  4NCG A;  1NLV A;  3HO1 A;  3N89 A;  1YTA A;  2FKM X;  4CHO A;  4PKG A;  4FW1 A;  2Q2R A;  2NRT A;  3RVC A;  4HCB A;  3EN9 A;  1BQN A;  3OS2 A;  3AAQ A;  1JCE A;  1LWF A;  5TKW A;  3CC4 N;  4YOU A;  2YHB A;  4NCB A;  4I6M B;  4JV5 K;  1Q81 O;  2QWP A;  1Z25 A;  5JMV A;  4NYF A;  3H1Q A;  1YQM A;  1RTH A;  2DFH A;  2IDO A;  3V9U A;  3O1B A;  5I3U A;  1D3U A;  5BRF A;  3AY9 A;  4CHN A;  5BN9 A;  2E2N A;  1OH6 A;  5E41 A;  2KKZ A;  3NVM A;  1F21 A;  3N4P A;  2ZJP L;  4M42 A;  4FJL A;  4KH5 A;  4FWK A;  1TK5 A;  4M7Y A;  4DFK A;  1T6A A;  4CE9 A;  4DU3 A;  2P9P B;  1RT1 A;  1E4F T;  2HST A;  3KIO A;  4M45 A;  2O8E B;  2F8T A;  3LP0 A;  2A6A A;  1DTQ A;  3NF6 A;  1BIU A;  3O4N A;  5HRS A;  4OKK A;  4ZHR A;  1YQK A;  2NZT A;  3KK7 A;  1KYD A;  4A5B A;  1KFD A;  1T6D A;  3DYA A;  3DXM B;  5EOY A;  1NK6 A;  2RE2 A;  1C0U A;  3I8D A;  4FK0 A;  1BCO A;  1EKE A;  1NGD A;  3OCI A;  3WXM B;  1X3M A;  2WFB A;  3WNF A;  4DTR A;  3PV8 A;  1XHZ A;  4HTL A;  1QN4 A;  2QKB A;  3BF3 A;  4FOI A;  1JLC A;  1B9K A;  2XO7 A;  1HU0 A;  4WQ5 C;  2E20 A;  1H1V A;  3NGI A;  4B9V A;  3O1W A;  5FLX O;  1C0T A;  1YAG A;  2ZQB A;  4CJT A;  3CHW A;  1FK9 A;  5JN5 A;  3A5L C;  3CWU A;  2XY7 A;  5CZ1 A;  3VF4 A;  4DSK A;  5HRR A;  5KPT A;  4Z4H A;  4M41 A;  1P5G X;  1JL2 A;  5E84 A;  4NLC A;  2PY5 A;  1YUW A;  3QIP A;  4M63 C;  1IKX A;  1HLU A;  3FGU A;  4NXM K;  3VQQ A;  4AHS A;  4CGF A;  3OYH A;  1NGM A;  2V51 B;  3L8B A;  1R59 O;  3K9J A;  4L8R B;  3TI0 A;  3ULX A;  3MEC A;  4M3U A;  1NK0 A;  4B1X B;  4CF8 A;  3PX4 A;  5I42 A;  3ZT3 A;  3KLF A;  5KGX A;  2QRE A;  4FJM A;  4OX9 K;  3ULD A;  3DLR A;  1DIZ A;  4ISG A;  4BR9 A;  4JK7 A;  3VMF B;  4YDU A;  3TAN A;  1TYQ B;  5AQF A;  1DT9 A;  1VHX A;  1L3U A;  2GEL A;  5EVZ A;  1NMN A;  2NOL A;  1V5S A;  3RRH A;  3FR0 A;  4RW9 A;  1WJW A;  3MMV A;  1FKP A;  4ILG B;  2A5X A;  2OPR A;  1ZYQ A;  1K6Y A;  4BDP A;  3AAP A;  4DTX A;  1QN3 A;  4LC9 B;  3V81 A;  1D5A A;  3VES A;  5DM6 L;  3VQB A;  1V4T A;  1EWR A;  3KLH A;  3ID6 A;  4BE0 A;  3CCU N;  4F3O A;  3HJF A;  4B1Y B;  3OGD A;  3OBY A;  1Y64 A;  2HZM A;  1UA0 A;  2V9J A;  4BWJ A;  2FF6 A;  1DGK N;  4NLB A;  2OTL N;  2HB5 A;  3GDQ A;  1HMV A;  4DTO A;  1PCZ A;  4ZTF A;  3B8A X;  2HBJ A;  3R9P A;  4M3X A;  2CGL A;  1GLC G;  3G6E N;  4GV3 A;  5BRD A;  1QTP A;  1RT6 A;  3E9O A;  2PZS A;  4AHT A;  2VQF K;  4YDU C;  3RRG A;  4JNE A;  4JN4 A;  5EPC A;  3P39 A;  1IBK K;  1E42 A;  1OVQ A;  5F2R A;  4MLE A;  1J54 A;  1RBV A;  1TKD A;  4B3S K;  3VQ4 A;  4HJH A;  3O9U A;  1Q8I A;  5AQV A;  4CZM A;  3DI6 A;  1PCM X;  1BO5 O;  4B9M A;  2ETJ A;  4Y1D A;  4EAK A;  4LD0 A;  3QFP A;  1QQC A;  4HUE A;  2XHI A;  1W97 L;  3C7N B;  3GBT A;  4HUF A;  1NGE A;  4C8L A;  4GY2 B;  3BZC A;  4BWM A;  3J7A P;  4ILJ A;  3S9H A;  3SQ2 A;  3P83 D;  1BG3 A;  4PL7 A;  3HOS A;  3H08 A;  4ZTJ A;  1YXQ A;  1L3S A;  4BE1 A;  4DTU A;  1PZD A;  2QW9 A;  3QBW A;  1QQM A;  1RTJ A;  3FFK B;  1NGB A;  4OKE A;  2RKI A;  1UWB A;  3T1A A;  3PIP L;  3SUN A;  5H1S Q;  3CMA N;  3T1H K;  2VYP A;  1QHA A;  5JMV D;  1M1K O;  3RPJ A;  2A3Z A;  2XY6 A;  1M5Q 1;  3NA5 A;  3SMP A;  4J2B A;  4FYD A;  4QOZ B;  3OYN A;  1HNX K;  4DF4 A;  1RT4 A;  3CYM A;  1S9E A;  2P51 A;  2AP1 A;  3NH2 A;  1EO1 A;  2HOE A;  2D0P A;  2YV0 X;  2F7L A;  3HVT A;  4BC5 A;  3ULE B;  3W0L A;  5AQN A;  4RG8 A;  4FJ9 A;  3AA4 A;  4YOV A;  2GEM A;  1J6Z A;  1XMQ K;  2RPI A;  3P4I A;  2D0O A;  1O1W A;  3AVK A;  3SPZ A;  3VF2 A;  1KLM A;  4IEE A;  4LY7 A;  4OO1 J;  4OPA A;  3ZSQ A;  3L2V A;  3CET A;  1BWF O;  2FLO A;  3O3H A;  2W6L A;  3DLK A;  4DSI A;  3S3O A;  5F1X A;  1C0G A;  2E2Q A;  3DLH A;  4YNQ A;  3NMU A;  1RNH A;  5JIC A;  3VN5 A;  4PWD A;  2DFF A;  4WCE L;  3DOK A;  1G15 A;  1X9S A;  3FFI A;  3QDK A;  2NRZ A;  2ZFD B;  4Y1C A;  3P5J A;  4A2A A;  4BRO A;  1BIZ A;  4DR1 K;  1Q18 A;  2VGN A;  1K8A O;  2PBD A;  3R3L A;  2Q0U A;  3OYK A;  1ASU A;  3AGK A;  1YJ9 N;  3KD5 E;  1VSM A;  2NOI A;  2D0C A;  1NGA A;  1ESV A;  2W6K A;  1JXE A;  3I56 N;  2HF3 A;  3M1F A;  3LM9 A;  1HJR A;  4FWP A;  2YHY A;  5M1N A;  1YJW N;  3DXK B;  5GIO A;  4Z4G A;  4FZX C;  4DU4 A;  5HSH A;  4FLT A;  4JKC A;  1KTQ A;  5M1O A;  1QN8 A;  3IRX A;  3QIN A;  4B1W B;  1VQM N;  1ATS A;  2X6S A;  3ZET B;  2QK9 A;  1LCU A;  3QML A;  3ZCM A;  3CVS A;  4WF9 L;  4KRF A;  4AM7 A;  1QQN A;  4LF4 K;  4MO5 A;  4E7H A;  3CWT A;  1QSL A;  2NOF A;  4CK2 A;  1ILY A;  1SAZ A;  4BVO A;  4D7Q A;  2QTD A;  3ZX0 A;  2OZS A;  1C0F A;  3KKS A;  5J2N A;  2VJ0 A;  4FXD A;  4Z4E A;  3TE5 A;  3LDS A;  3HTV A;  5AQK A;  2EWS A;  4DV3 K;  2JHN A;  2ZGZ A;  2KZM A;  4KBO A;  1HYV A;  1NKC A;  1NGJ A;  4K8X A;  5AQH A;  2IC3 A;  4J2E A;  5BN8 A;  1IBL K;  1JLB A;  3L2Q A;  4R79 A;  1TGO A;  1VQ6 N;  2UUC K;  2O8F A;  4W5T A;  4JI3 K;  3OH9 A;  2XHB A;  1RBR A;  2OPS A;  3CC2 N;  4CJR A;  1KFQ A;  4DUY K;  1ZBS A;  4PKH A;  1X9J A;  1VQL N;  3DRP A;  4GVE A;  1RT7 A;  2A41 A;  3HBT A;  3KKR A;  3QO9 A;  1X9M A;  1UT7 A;  4H0O A;  2PYJ A;  3D7Q A;  3NH0 A;  1C0M A;  2FC0 A;  4CJ7 A;  3ZSX A;  1EQY A;  3CW7 A;  2PFU A;  4CEA A;  1RCH A;  3ENO C;  3U6F A;  4FWQ A;  3OHR A;  4FLW A;  4JI2 K;  1S6P A;  4I6M A;  2V7Z A;  4B9L A;  5CYM A;  4WXA A;  3CCM N;  2NLX A;  1NNE A;  3NBP A;  4JI7 K;  1NK8 A;  2NRH A;  4WQ5 A;  4B1V A;  4YFU A;  4CES A;  2ZGY A;  5C0Y A;  4F4K A;  1NJZ A;  1YHQ N;  5IT9 O;  1BDG A;  1LW0 A;  2ZWH A;  1KY6 A;  1NBW A;  4JLH A;  1QNE A;  1NM1 A;  3VTH A;  5F9C A;  4DLE A;  5EX5 A;  4JI1 K;  4FWR A;  3SPY A;  4K8Z A;  2QLV A;  3I0S A;  5JLH A;  1OKJ A;  4IFV A;  4CJ5 A;  2HHV A;  3MXI A;  3DLE A;  3HM8 A;  5KI6 A;  3AVH A;  2QXF A;  4KH4 A;  3ZX2 A;  1HPM A;  1W7A A;  1VQ5 N;  1K9M O;  4KAZ A;  3MDQ A;  3S3N A;  3U8X A;  3V4I A;  3VQ8 A;  3CJA A;  3AVL A;  4YOX A;  3WXL A;  1EP4 A;  3TDH A;  3D45 A;  4F9O A;  4XEI A;  4DQQ A;  1HYZ A;  4JAX A;  2A40 A;  5M1Q A;  2UXB K;  3LDQ A;  3DWL A;  2PYL A;  3EL2 A;  4B0A A;  1WSG A;  1VKL A;  3BUZ B;  2ZF5 O;  2Q0R A;  1NK5 A;  3SYZ A;  4PQU A;  1LWV A;  3SQ4 A;  3VEW A;  3DLG A;  2P9K B;  3I8B A;  4FWL A;  4N47 A;  4D7R A;  3OA9 A;  3OYB A;  2ZE2 A;  1BL3 A;  3CWS A;  3RSE A;  4DS5 A;  3FLC O;  3ID8 A;  2AA4 A;  2HNY A;  1TL1 A;  2PAV A;  3SJH A;  1JCG A;  5BPM A;  5C10 A;  3OYC A;  3RMD A;  2OZM A;  2F4V K;  1Q9U A;  4BGB A;  1RTI A;  4FPB A;  2RN2 A;  4FLY A;  1OH5 A;  1UOC A;  2NRW A;  4BC3 A;  4CVN E;  3O80 A;  2Z1G A;  5A2Q O;  3AO1 A;  3HST B;  3SQ1 A;  1PVS A;  1SKS A;  4LSN A;  4DMN A;  4JKF A;  4JKD A;  1VRT A;  1FJG K;  3BF1 A;  1JLA A;  1NK7 A;  3S41 A;  4CJU A;  3VQ7 A;  1LWE A;  3CXC M;  4PHT X;  3L3V A;  2HHS A;  1FKO A;  3CJB A;  1YTF A;  5ADX A;  1SL0 A;  4B9U A;  4YHH K;  4KB0 A;  2YI1 A;  1N3A A;  3EZW A;  3GL1 A;  1ZBF A;  2B5J A;  3CFO A;  4FK2 A;  3L6Q A;  2DKA A;  1N39 A;  1VSE A;  4WYB A;  1XC9 A;  4FL9 A;  4CIG A;  4CZH A;  4DTJ A;  3WNG A;  4DR5 K;  3K2P A;  4FZY A;  4H5T A;  1NGI A;  4CK3 A;  4FJ8 A;  4KHP K;  4WFB L;  4I9L A;  4DTN A;  2NUB A;  5KQD A;  2BDP A;  2UUB K;  1WSH A;  2XRI A;  1BQM A;  2Q1N A;  4H5N A;  3F5T A;  4CF1 A;  4WE1 A;  4CW7 B;  2NRX A;  4B3O A;  2XY5 A;  3A5N C;  3MWT A;  4H0V B;  3G25 A;  4KFB A;  4F8R A;  2WTU A;  3L2U A;  2V7Y A;  3I33 A;  1D9D A;  2VWK A;  4IO9 L;  2E5L K;  3S3M A;  4CJK A;  3BEX A;  4KI4 A;  2DKD A;  4DV5 K;  2WC9 A;  3EY1 A;  1IV0 A;  3LDL A;  2QRC A;  4Z4F A;  4B9S A;  3F10 A;  3SI6 A;  4CJL A;  1JJ2 M;  2HHQ A;  1E3M A;  3D4V A;  4B3R K;  2FBY A;  2O4G A;  4Z94 A;  4B08 A;  3OJU A;  1EBM A;  1GLA G;  2O8E A;  4GW6 A;  3TAM A;  3K5O A;  1HKC A;  4QCL A;  3MCP A;  1IG8 A;  3CPE A;  5LL6 Z;  4HHT A;  4OLA A;  3KWG A;  1GLL O;  1T7P A;  3V9S A;  2QWO A;  3RSE B;  1HNV A;  2G8I A;  5AFU A;  3HS8 A;  5ADX H;  1VSD A;  2O8B B;  3OH6 A;  3LPT A;  3WNE A;  4B9T A;  4LFA K;  3H3N O;  4LFC K;  1I39 A;  4O4G A;  2EX3 A;  1M90 O;  1W0H A;  1VSJ A;  3HI0 A;  3NHG A;  1Z6R A;  4CJP A;  1NH2 A;  4MDA A;  3OTO K;  4Z4C A;  3CCQ N;  2OCE A;  3ENO A;  2E8A A;  1KFS A;  1J5O A;  4EAJ A;  1IKY A;  3CQY A;  2O8D B;  1U6Z A;  4W5N A;  2DFE A;  2X78 A;  1LAW A;  3EE8 A;  5EU7 A;  4BG9 A;  2HNZ A;  3LP1 A;  2E88 A;  4DWI A;  1TK8 A;  2E6L A;  1QS4 A;  3KWI A;  1TVR A;  1CZ9 A;  4F3T A;  3PX6 A;  3E1Y A;  3QEI A;  2HHX A;  3AVF A;  1BIS A;  3KHY A;  2KFN A;  4B8C A;  3IH7 A;  3HP6 A;  3OC3 C;  2F96 A;  2R5X A;  4ROC B;  1GLE G;  3HP9 A;  4GMJ B;  1BCM A;  4RW8 A;  3B6P A;  3OW2 M;  1I3A A;  5LY3 A;  1Q9X A;  2V8Q A;  3MEE A;  4EZ9 A;  3SAG A;  1J53 A;  5HRN A;  3DMJ A;  2ZJQ L;  2CGJ A;  1M3Q A;  5HP1 A;  3CM5 A;  4CEB A;  1UAX A;  3VPZ A;  4XH1 A;  3A5M C;  3D2F A;  1K8K A;  4H0X B;  5D3G A;  4KB1 A;  4CEQ A;  4PL8 A;  4B3M K;  4JHD B;  2UXC K;  3KLI A;  4FK4 A;  4CFA A;  2GTD A;  1QVF M;  3KK2 A;  4GVM A;  4PA1 A;  3NDK A;  1NMD A;  3K0S A;  4DUZ K;  1UA1 A;  1QVG M;  4J2D A;  3ZEU B;  5FRO A;  4M3T A;  1VTO A;  3DAW A;  2F9W A;  4A59 A;  4DTP A;  3G0Z A;  4CD3 A;  3BZK A;  5AN4 A;  1NG9 A;  1XC3 A;  2P9I B;  3HPH A;  3SJJ A;  2B6A A;  4QAG A;  1HX1 A;  3EAY A;  1REV A;  4CEF A;  2P9S A;  5EXW A;  5SZT A;  1NGH A;  4RCH A;  4E1M A;  3CCR N;  4H5V A;  3SMS A;  1X9W A;  3F9M A;  3AVM A;  3HSC A;  2FBX A;  4FLV A;  3DPT A;  2KZZ A;  1QNB A;  3E01 A;  4M3Z A;  1ZBH A;  1U4B A;  4KTQ A;  3TWH A;  4AHV A;  4A61 A;  1WLJ A;  3OYG A;  3FZK A;  3THV A;  3F73 A;  4IKF A;  3UIQ A;  4KHW A;  4DR4 K;  2HKP A;  1D8Y A;  1ITG A;  2IS3 A;  5KRS A;  5DK5 A;  2Y1I A;  4CJF A;  1QTM A;  2G8F A;  5BRH A;  3HK2 A;  5BPL A;  3OBW A;  4FM2 A;  5IWA K;  4FJ7 A;  4DFP A;  3I0R A;  3T1Y K;  4H5R A;  2BTF A;  4JYA K;  3SNS A;  4DLG A;  3EYZ A;  3VGM A;  3CI5 A;  4DF8 A;  1C1C A;  4IDH A;  3QEV A;  5TKY A;  1MU2 A;  3VET A;  3WQU A;  1DLO A;  5HBM A;  2JWL A;  1XQS C;  4I8O A;  3D2E A;  5EY4 A;  1RIL A;  5AQG A;  1TUU A;  3ATU A;  3AVI A;  2E6M A;  4CBU A;  4IDK A;  4AHC A;  2IIR A;  3SNN A;  1RDD A;  4CJQ A;  3KK1 A;  5J2Q A;  4CJ3 A;  1QTS A;  2HVI A;  2HHU A;  4BRC A;  2E1Z A;  4OJR A;  2KHO A;  2JOI A;  3JXU A;  1QN9 A;  1TKZ A;  3PX0 A;  1PCJ X;  3QEX A;  3M3Z A;  4EAL A;  4C8N A;  4H4O A;  4HWI A;  3THX A;  2P9U B;  1TKX A;  5FPN A;  4CD1 A;  4BVP A;  2O8D A;  3PMG A;  1OVY A;  5K14 A;  2BAN A;  1N5Y A;  4CFF A;  4K25 A;  2FXU A;  1P5D X;  2D5R A;  5M1P A;  3U3G A;  2A1R A;  1KC8 O;  2DY4 A;  3TPQ A;  3V6D A;  3MN5 A;  4U67 L;  2QWR A;  3K57 A;  4ELU A;  3QER A;  4DR3 K;  3AGR A;  2QWL A;  4B9N A;  3ULE A;  1XUP O;  1RFQ A;  2VGM A;  2O8B A;  1VTL E;  3B6O A;  5IYB P;  2IAJ A;  1MWM A;  4GKK K;  3O6W A;  1RDU A;  2O8F B;  3SBT A;  3NGY A;  5KRT A;  1IG9 A;  3MED A;  1FW6 A;  3CCE N;  1CXU A;  1K73 O;  1QN7 A;  1TGH A;  1X3N A;  2QM1 A;  3OYE A;  2GWJ A;  1KAX A;  2YJF A;  4FVM A;  1VSH A;  2QWM A;  3F2K A;  3QLH A;  3NCI A;  3VEZ A;  2I7P A;  3LPU A;  4N41 A;  4FM0 A;  3IS9 A;  3U9D A;  2QR1 A;  5C12 A;  1EWQ A;  4X66 K;  4OPH A;  3TAP A;  3PO5 A;  5AQI A;  1VQ4 N;  1KRP A;  3OS0 A;  4BRH A;  5CY4 A;  1S72 N;  3LP3 A;  3EEQ A;  3PSF A;  1A5W A;  3ZEU A;  2OTJ N;  5LMU K;  4O0J A;  1NJW A;  1JLQ A;  4ROD B;  3CPW M;  4NCA A;  1ATR A;  3C7N A;  4CHQ A;  4LF8 K;  3WXI A;  1LXT A;  5AR0 A;  2P9K A;  4FJI A;  3UW2 A;  1KCF A;  4I2Q A;  1C1B A;  2YX6 A;  1J5E K;  1QHT A;  4IZ9 A;  2Z1J A;  1CLQ A;  3O9T A;  3K58 A;  3A0I X;  4IEI A;  2O3O A;  4KHU A;  4FOE A;  4EHU A;  2YHW A;  4K42 A;  4ID5 A;  5B8H A;  4CFC A;  2P5O A;  1XHX A;  3M8P A;  3TAR A;  1P90 A;  1VQO N;  2DKC A;  3VQ5 A;  1HQU A;  1KY7 A;  1T8E A;  4DFJ A;  3G4S N;  5CZ2 A;  1ASV A;  1VK0 A;  2G8U A;  2OYQ A;  1IH7 A;  2ZD1 A;  4H03 B;  1G99 A;  4BAC A;  4BC2 A;  2YH5 A;  5LMN K;  2FBT A;  3TU5 A;  5DM7 L;  3CD6 N;  3IDH A;  5AZJ A;  3K9K A;  4BR4 A;  3SQ0 A;  3MN6 A;  2P9S B;  5FPM A;  5JVG L;  2ASP A;  3IFR A;  5JS1 A;  5FRN A;  2W40 A;  2KFZ A;  1VSI A;  2F8S A;  2JLE A;  3OVN A;  3ATV A;  4BR5 A;  4F2R A;  1TYQ A;  3T7Z A;  3H3O B;  2ASO A;  1N33 K;  1TAQ A;  3KZB A;  4I2P A;  4CJV A;  3HXM A;  1C9B B;  2RHK A;  3FZM A;  4DV4 K;  1YIT N;  4CCH A;  4E3S A;  2NOB A;  4OPK A;  2NWV A;  5AQJ A;  4JD2 B;  2BGG A;  1KLN A;  3RMC A;  4L3Q A;  4WZS D;  4RW7 A;  2LAE A; 
#chains in the Genus database with same CATH homology
 2Z8U A;  1KVA A;  3VA3 A;  2G8H A;  4FK2 A;  4B9L A;  1TK5 A;  4DFK A;  3OST A;  1JLA A;  4CE9 A;  4DU3 A;  1NK7 A;  4CJU A;  2D0A A;  3VQ7 A;  4CIE A;  1LWE A;  4ELU A;  2HHS A;  3BGR A;  3L3V A;  1RT1 A;  1N3C A;  3KIO A;  1FKO A;  3LZJ A;  1YTF A;  1SL0 A;  4M45 A;  3C94 A;  4B9U A;  4KB0 A;  3LP0 A;  2F8T A;  4W5O A;  1N3A A;  1ZBF A;  5IYD P;  1DTQ A;  2B5J A;  3CFO A;  1BIU A;  3NF6 A;  3O4N A;  4AHR A;  4OKK A;  3AO3 A;  5HRS A;  4N5S A;  1N39 A;  1VSE A;  3K5N A;  4DQS A;  3AO4 A;  1S1T A;  2OPQ A;  4EJZ A;  4ZHR A;  1XC9 A;  2HHT A;  4CIG A;  4O0I A;  4DTJ A;  1YQK A;  3WNG A;  4IG0 A;  4AHU A;  1KYD A;  4Q11 A;  3K2P A;  3LZI A;  4FZY A;  1KYF A;  1NK4 A;  4N56 A;  1KFD A;  1VSL A;  4DSJ A;  3RMB A;  3CM6 A;  3DYA A;  4CK3 A;  4CGJ A;  4FJ8 A;  2KTQ A;  3ZSR A;  4I9L A;  3TAQ A;  3ISN C;  2NUB A;  1C0U A;  3I8D A;  4DTN A;  1NK6 A;  2BDP A;  1BCO A;  4FK0 A;  1EKE A;  2LSN A;  3OCI A;  1WSH A;  3CFP A;  2XRI A;  1IKV A;  1BQM A;  2OPP A;  3V9Z A;  3VQA A;  3WNF A;  2YNH A;  4DTR A;  3PV8 A;  1XHZ A;  4CF1 A;  2D0B A;  1QN4 A;  2QKB A;  4LSL A;  1JLC A;  1B9K A;  4ICL A;  1ZBI A;  2XO7 A;  4JS5 A;  1HU0 A;  4MFB A;  3AA2 A;  4WE1 A;  3ZSZ A;  1C1A A;  3NGI A;  2B4J A;  4B3O A;  1HNI A;  4B9V A;  2XY5 A;  4EZ6 A;  2HMI A;  1RT5 A;  1C0T A;  1NJX A;  3V1R A;  2ZQB A;  4CJT A;  1IO2 A;  2P1J A;  1FK9 A;  4M3R A;  3ZT0 A;  4EP4 A;  3RWU A;  1VRU A;  3AA3 A;  4KFB A;  3KRM A;  5CZ1 A;  4CJE A;  2XY7 A;  3L2U A;  4DSK A;  4F8R A;  3C95 A;  5HRR A;  1D9D A;  2VWK A;  2OA8 A;  5J1E A;  1MP9 A;  1GOA A;  3LWL A;  4Z4H A;  4M41 A;  3C6T A;  4CJS A;  4CJK A;  3TAF A;  4CIF A;  3S3M A;  1JL2 A;  4KI4 A;  2PY5 A;  3EIK A;  4KHN A;  3QIP A;  3OYA A;  3EY1 A;  1IKX A;  4I9Q A;  4XIU A;  1SL2 A;  2NOZ A;  3KTU A;  4Z4F A;  3VQQ A;  4AHS A;  2YHA A;  4CGF A;  3OYH A;  4FJK A;  1NGM A;  3L8B A;  4B9S A;  4FJ5 A;  3F10 A;  2VG5 A;  3AO5 A;  3PY8 A;  4DU1 A;  4L8R B;  4IG3 A;  3TI0 A;  1Q9Y A;  1FN7 A;  3OYI A;  3SI6 A;  2I5J A;  4CJL A;  2HHQ A;  3ULX A;  3MEC A;  2FGT A;  1NK0 A;  4CHY A;  4M3U A;  2FBY A;  4KRE A;  2O4G A;  3OJU A;  3MXJ A;  4B08 A;  1EBM A;  4CF8 A;  3PX4 A;  1HQE A;  5DMR A;  1DTT A;  1WSE A;  5I42 A;  3ZT3 A;  4GW6 A;  3KLF A;  3TAM A;  3K5O A;  5KGX A;  3SUO A;  1TL3 A;  2HND A;  3NF8 A;  4EP5 A;  4FJM A;  3ULD A;  4CF9 A;  3DRR A;  4QCL A;  3AA5 X;  3DLR A;  4HTU A;  3AVJ A;  4HHT A;  4OLA A;  3TAN A;  3OSM A;  4E19 A;  1N6Q A;  1T7P A;  3V9S A;  1L3U A;  2FBV A;  3M8R A;  2G8W A;  1S6Q A;  2NOL A;  3RRH A;  4RW9 A;  2G8I A;  1BHL A;  1EXQ A;  1FKP A;  1HNV A;  2IOC A;  2OPR A;  3HS8 A;  3AO2 A;  3LAL A;  3VQD A;  3OJS A;  1ZYQ A;  1K6Y A;  4BDP A;  2IV8 A;  1S1X A;  4DTX A;  1TAU A;  1QN3 A;  5HRP A;  1VSD A;  3LPT A;  4HVJ A;  3WNE A;  3QEW A;  4B9T A;  3V81 A;  1L3V A;  1D5A A;  3G10 A;  3OYD A;  2HVH A;  1I39 A;  4O4G A;  3H1Z A;  1QN5 A;  4OKJ A;  2EX3 A;  1YT3 A;  4CHP A;  1TBA B;  1W0H A;  1VSJ A;  3AVN A;  3VQB A;  1BI4 B;  3NHG A;  3T3F A;  4FJJ A;  4N76 A;  3I0X A;  4CJP A;  4E7L A;  3KLH A;  3MXM A;  1NH2 A;  2NOH A;  4Z4C A;  4BE0 A;  1RT2 A;  3NFA A;  2YNF A;  4F3O A;  2YKM A;  4OPJ A;  3HJF A;  4B9M A;  1KFS A;  3P1G A;  1WN7 A;  4HUG A;  3OY9 A;  1U49 A;  1J5O A;  4E7J A;  3L2R A;  2HZM A;  1UA0 A;  4CER A;  4BWJ A;  1IKY A;  1D9F A;  1M3H A;  3DPU A;  1C6V A;  4DG1 A;  4DQR A;  4W5N A;  1CZB A;  2DFE A;  2X78 A;  4DQI A;  4KTW A;  1LAW A;  2HB5 A;  1HMV A;  4DTO A;  1PCZ A;  4ZTF A;  4FW2 A;  3K5M A;  1GOC A;  5EU7 A;  2HNZ A;  4R5P A;  3LP1 A;  4DWI A;  4M3X A;  3O3G A;  5T7B A;  1TK8 A;  5HRO A;  2E6L A;  1QS4 A;  1QTP A;  1A5X A;  2W42 A;  4C8O A;  1RT6 A;  2PZS A;  1TVR A;  4AHT A;  3RRG A;  3KJV A;  1CZ9 A;  4F3T A;  3PX6 A;  1LW2 A;  1JLG A;  4Q0B A;  1E42 A;  3TAG A;  3QEI A;  4FCY A;  1J54 A;  1RBV A;  1TKD A;  2HHX A;  3AVF A;  1BIS A;  3VQ4 A;  1Q8I A;  2KFN A;  1VOK A;  4PY5 A;  3DI6 A;  4B8C A;  3IH7 A;  1VOL B;  2XY8 A;  4TSX A;  3OC3 C;  2ETJ A;  2F96 A;  4ROC B;  2MJ7 A;  3DM2 A;  3HP9 A;  4GMJ B;  4Y1D A;  4DTM A;  1NOY A;  4LD0 A;  4KKO A;  3ASM A;  1BCM A;  4RW8 A;  3QET A;  4DSL A;  3IG1 A;  1QQC A;  3B6P A;  4HUE A;  2JGU A;  2HHW A;  1I3A A;  5CYQ A;  4RW4 A;  2XHI A;  3RMC A;  4HUF A;  1Q9X A;  4C8L A;  3KD1 E;  3MEE A;  4EZ9 A;  4BWM A;  1QSY A;  3OYJ A;  3S9H A;  1J53 A;  5HRN A;  3DMJ A;  1ZBU A;  3P83 D;  3HM9 A;  2YNI A;  3SQ2 A;  4C8K A;  3AVC A;  4LH4 A;  3H08 A;  3T19 A;  1M3Q A;  4ZTJ A;  1R0A A;  5HP1 A;  2GV9 A;  3CM5 A;  4CEB A;  1UAX A;  1SUQ A;  3ZSO A;  1RDA A;  3LP2 A;  4CGI A;  1U47 A;  1L3S A;  4BE1 A;  1KYU A;  4Q5V A;  4DUL A;  4DTU A;  1PZD A;  3SUQ A;  3BDP A;  5D3G A;  4KB1 A;  4O55 A;  4CEQ A;  1RTJ A;  4OKE A;  4CFD A;  3QNN A;  3KLI A;  4FK4 A;  4CFA A;  2RKI A;  1UWB A;  3KK2 A;  4GVM A;  4PA1 A;  3F0Z A;  3T1A A;  3NDK A;  3SUN A;  3I0W A;  1R4X A;  1UA1 A;  1HRH A;  1RDC A;  3C6U A;  1NKE A;  1L5U A;  4J2D A;  5FRO A;  3ZT2 A;  4M3T A;  1GOB A;  4E0D A;  2A1S A;  3K59 A;  4UQG A;  1VTO A;  3RPJ A;  3K5L A;  2XY6 A;  3TAB A;  4FYD A;  4J2B A;  4DTP A;  1LV5 A;  4QOZ B;  3OYN A;  3G0Z A;  1SV5 A;  4DF4 A;  5AN4 A;  1FXX A;  4TPS A;  1RT4 A;  3CYM A;  2KW4 A;  1S9E A;  3HPH A;  3OS1 A;  2P51 A;  4DSF A;  3VA0 A;  3SJJ A;  3NH2 A;  3DLB A;  2B6A A;  1WSJ A;  3CQ8 A;  4QAG A;  4JRP A;  1REV A;  4CEF A;  5J2P A;  3PUF A;  5SZT A;  2YV0 X;  3HVT A;  4E1M A;  3O4Q A;  1YTU A;  1X9W A;  1IKW A;  3AVM A;  2FBX A;  4RG8 A;  4FJ9 A;  3AA4 A;  2O4I A;  3HPO A;  3U3Y A;  2RPI A;  4FLV A;  1O1W A;  3AVK A;  3DPT A;  3F9K A;  3ZT4 A;  3SPZ A;  1QNB A;  2KZZ A;  3E01 A;  4FLU A;  1KLM A;  4HCC A;  4LY7 A;  4M3Z A;  1ZBH A;  3ZSQ A;  3L2V A;  4KV8 A;  1KO9 A;  1U4B A;  4E7I A;  4FJG A;  4M3Y A;  1RBT A;  4KTQ A;  3TWH A;  1BI4 A;  4AHV A;  1WLJ A;  3O3H A;  5FDL A;  3OYG A;  3KTQ A;  2GUI A;  3TR8 A;  1NK9 A;  2E4L A;  3DLK A;  4KTZ A;  1J9A A;  4OGC A;  4AH9 A;  1SKW A;  3THV A;  3F73 A;  2VG7 A;  3S3O A;  4DSI A;  3UIQ A;  4IKF A;  4KHW A;  4FZZ A;  1D8Y A;  1ITG A;  2IS3 A;  5KRS A;  5DK5 A;  3DLH A;  4YNQ A;  2Y1I A;  1TK0 A;  1RNH A;  4CJF A;  1QTM A;  2G8F A;  3VN5 A;  2P5G A;  4PWD A;  4Z0U A;  2HW3 A;  3HK2 A;  2DFF A;  2I5W A;  3DOK A;  4I7F A;  1SL1 A;  3L3U A;  1G15 A;  4FM2 A;  1X9S A;  3FFI A;  4FJ7 A;  1QN6 A;  5C24 A;  4DFP A;  3ZSY A;  2Z1I A;  3M8S A;  2X74 A;  3SCX A;  3I0R A;  4Y1C A;  3P5J A;  1BIZ A;  3O3F A;  4EJY A;  4BDY A;  2Q3S A;  1RBU A;  3SNS A;  2BE2 A;  4CGH A;  3OYM A;  3EYZ A;  4DLG A;  4ELT A;  4DF8 A;  1C1C A;  1TBP A;  2GBZ A;  3QEV A;  1BGX T;  1QNC A;  3NGZ A;  1MU2 A;  3OYK A;  1ASU A;  3AVG A;  3NAE A;  3KD5 E;  3SV4 A;  1VSM A;  2NOI A;  2IV9 A;  2D0C A;  4MQ3 A;  4C8M A;  1DLO A;  3JSM A;  1B9F A;  5HBM A;  1JXE A;  4KO0 A;  5C42 A;  2VG6 A;  4I8O A;  1WNS A;  4E1N A;  3KK3 A;  4E7K A;  1WAF A;  2ATQ A;  1YVU A;  3AVA A;  3ITH A;  5KTQ A;  1HJR A;  1RIL A;  4CJW A;  4Z4G A;  4CJ4 A;  4DU4 A;  4FZX C;  4J2A A;  3ZSW A;  3AVI A;  3A2F A;  2E6M A;  4IDK A;  4AHC A;  4FLT A;  4H8K A;  1W9H A;  4O44 A;  1NJY A;  3QES A;  1RDD A;  4CJQ A;  1KTQ A;  3KK1 A;  3SNN A;  5KGW A;  1QN8 A;  3IRX A;  3KLE A;  5J2Q A;  4CJ3 A;  1QTS A;  3QIN A;  2HVI A;  2HHU A;  2QK9 A;  2X6S A;  4OJR A;  3L2W A;  3ZCM A;  2JOI A;  4KRF A;  4KI6 A;  1XI1 A;  1QN9 A;  1TKZ A;  1S1U A;  3PX0 A;  3V9X A;  3HYF A;  3QNO A;  1TV6 A;  3QEX A;  2YKN A;  4C8N A;  4H4O A;  4O5B A;  4E7H A;  1TKX A;  4ID1 A;  1QSL A;  2NOF A;  4CK2 A;  4H4M A;  4OGE A;  4CF2 A;  4Z4I A;  1S5J A;  3IAY A;  5HLF A;  4FJN A;  5K14 A;  2BAN A;  4W5R A;  1N5Y A;  2G8V A;  2OZS A;  3KKS A;  5J2N A;  4ELV A;  3HT3 A;  1W80 A;  1JKH A;  2D5R A;  3NF7 A;  2VJ0 A;  4FXD A;  3U3G A;  3HL8 A;  2A1R A;  4Z4E A;  3LDS A;  2DY4 A;  1LWC A;  4ROE B;  3D0P A;  1NOZ A;  3V6D A;  3SZ2 A;  4JS4 A;  3K57 A;  3VQ9 A;  4W5Q A;  1KSP A;  3QER A;  1LWW A;  1EET A;  1HYV A;  1LAV A;  1NKC A;  3V1Q A;  2KZM A;  4K8X A;  1NVP A;  4B9N A;  1WSI A;  2IC3 A;  3VQE A;  4J2E A;  4G1Q A;  1JLB A;  1XWL A;  3L2Q A;  1B92 A;  3ALY A;  5J2M A;  1VTL E;  1JXB A;  1TGO A;  1Z26 A;  3ZT1 A;  3B6O A;  4CGD A;  5IYB P;  1RBS A;  4KPY A;  1T05 A;  2IAJ A;  2DTU A;  1U48 A;  4W5T A;  3V1O A;  2XHB A;  1RBR A;  2OPS A;  4CJR A;  1VSF A;  3NF9 A;  4CED A;  4CEO A;  3NGY A;  5KRT A;  1IG9 A;  1S1V A;  3MED A;  1CXU A;  1QN7 A;  4IBN A;  1TGH A;  3OYE A;  4DTS A;  2R7Y A;  5IYC P;  2Z1H A;  3DRP A;  1RT7 A;  3KKR A;  4FVM A;  1VSH A;  3QO9 A;  3NCI A;  3QLH A;  1UT7 A;  1X9M A;  4FJH A;  3DRS A;  3NE6 A;  4N41 A;  3LPU A;  3HVR A;  2PYJ A;  1S1W A;  3TAE A;  4FM0 A;  1UT4 A;  3IS9 A;  1C0M A;  3NH0 A;  4DFM A;  2FC0 A;  3ZSX A;  2EHG A;  2WOM A;  3TAP A;  1JLE A;  4IFY A;  4FLX A;  3PO5 A;  3M8Q A;  1KRP A;  4KHY A;  1EX4 A;  3OS0 A;  3SV3 A;  4CF0 A;  1YQL A;  5CY4 A;  3LP3 A;  2HZS A;  3MEG A;  4CEA A;  4CK1 A;  1YTB A;  1A5W A;  1RCH A;  3QEP A;  3U6F A;  1NKB A;  3CG7 A;  1U45 A;  4FLW A;  1S6P A;  1T03 A;  2X6N A;  4O0J A;  3RR8 A;  4E89 A;  1QE1 A;  1RDB A;  5CYM A;  1NJW A;  4CEE A;  1JLQ A;  3OYL A;  4ROD B;  4LH5 A;  5FRM A;  1RT3 A;  4NCA A;  2AJQ A;  1KVC A;  3NBP A;  4CHQ A;  1NK8 A;  1L3T A;  4YFU A;  4CES A;  3RR7 A;  1RTD A;  3PO4 A;  4F4K A;  4CGG A;  1ZBL A;  3WNH A;  1NJZ A;  3ZSV A;  1JLF A;  2IGI A;  1LW0 A;  4M42 A;  3AV9 A;  1KY6 A;  4FJI A;  3RTV A;  1KCF A;  2MZ8 A;  1QNE A;  4JLH A;  4DLE A;  4I2Q A;  1C1B A;  3SPY A;  4K8Z A;  3I0S A;  1QHT A;  2VWJ A;  2G8K A;  2Z1J A;  4DS4 A;  4KHS A;  1CLQ A;  4IFV A;  4CJ5 A;  3KLG A;  3SUP A;  2HHV A;  1JFI C;  1CXQ A;  3MXI A;  3DLE A;  3AVB A;  4CFB A;  5KI6 A;  3CFR A;  3AVH A;  4B8A B;  5C25 A;  3K58 A;  2QXF A;  2ITG A;  1LWY A;  4KAZ A;  3S3N A;  2YNG A;  4M3W A;  2O3O A;  3V9W A;  4CEC A;  3V4I A;  3VQ8 A;  1U04 A;  3AVL A;  4RW6 A;  4KHU A;  1Y97 A;  3JYT A;  4CHZ A;  4CEZ A;  1EP4 A;  1HPZ A;  4ID5 A;  1ASW A;  4NYN A;  4CFC A;  3LAN A;  2P5O A;  1XHX A;  3LAK A;  2RF2 A;  3M8P A;  3RMA A;  3TAR A;  3D45 A;  1YQR A;  2NOE A;  4AIL C;  1QNA A;  1WAJ A;  1AIS A;  2KQ2 A;  3MAQ A;  4DQQ A;  4KHQ A;  3VQ5 A;  1HYZ A;  1WSF A;  3VQC A;  1HQU A;  1KY7 A;  3HS9 A;  1T8E A;  4DFJ A;  1A5V A;  3DOL A;  2PYL A;  1CDW A;  4B0A A;  1WSG A;  4DQP A;  5CZ2 A;  4JRQ A;  1ASV A;  1VK0 A;  2G8U A;  1KVB A;  2Y1J A;  2OYQ A;  4OLB A;  1IH7 A;  2ZD1 A;  3HP6 A;  4BAC A;  1S9G A;  3NH1 A;  1HYS A;  1NK5 A;  3OYF A;  1TKT A;  4FLZ A;  2YH5 A;  2FBT A;  3VQP A;  4DSE A;  4NCG A;  4FM1 A;  3SYZ A;  3HO1 A;  3N89 A;  1YTA A;  4PQU A;  1LWV A;  3LAM A;  3SQ4 A;  3HPG A;  3SQ0 A;  4BE2 A;  3DLG A;  1JL1 A;  4CHO A;  4N47 A;  1RM1 A;  3OYB A;  5FRN A;  4FW1 A;  5JS1 A;  2ZE2 A;  1BL3 A;  2KFZ A;  1VSI A;  2F8S A;  1B9D A;  2QKK A;  4HCB A;  1BQN A;  2JLE A;  3OVN A;  2G30 A;  4DS5 A;  4OVL A;  3OS2 A;  1VSK A;  5JS2 A;  1LWF A;  2HNY A;  1TL1 A;  3OYC A;  3RMD A;  4F2R A;  3VQ6 A;  2OZM A;  2YHB A;  4NCB A;  3QIO A;  4BDZ A;  1TAQ A;  4CJV A;  4I2P A;  1X1P A;  1Z25 A;  4NYF A;  3LWM A;  1C9B B;  3HXM A;  1YQM A;  1RTH A;  1RTI A;  1QSS A;  2DFH A;  2RN2 A;  4CCH A;  4F2S A;  4FLY A;  4E3S A;  2NOB A;  4PUO A;  1UOC A;  2IDO A;  2WON A;  3V9U A;  2Z1G A;  4OPK A;  5I3U A;  4FJX A;  1D3U A;  4CHN A;  3AO1 A;  3EZ5 A;  3HST B;  3SQ1 A;  1SKS A;  4LSN A;  4DMN A;  2BGG A;  5E41 A;  1SKR A;  1KLN A;  5SWM A;  1F21 A;  4WZS D;  4RW7 A;  2LAE A;  1VRT A;  4FJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...