4PY5A

Thermovibrio ammonificans rnase h3 in complex with 19-mer rna/dna
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
267
Chain Sequence
SMKLSSSEKEKLLKKLKALGAKEEKPPEHAQYRLRLNDAILTVYKSGSVVYGGKGREKLKELVAETVLSDTELPRIGCNEAGKGEFVGPLVVACIVADEKCLKRLIELGVKDSKKLSNEKVEELASEITETCHGKVKLLIPEKYNRAYSKFKNINRLLEAVYREIVSDLCEKFSPKVVVVDKFSNRAEEVLKDVVKGARLEVRPKAEDDLAVAAASIVAKAVRLKTMKELEKRFKVKLPEGNTGLAELLKKTPKELHEKLFKLHFSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Crystal structure of RNase H3-substrate complex reveals parallel evolution of RNA/DNA hybrid recognition.
pubmed doi rcsb
source organism Thermovibrio ammonificans
molecule tags Hydrolase/dna/rna
total genus 93
structure length 267
sequence length 267
ec nomenclature ec 3.1.26.-:
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4py5A01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4py5A02
1KLMA 4CERA 3HPHA 1TKXA 1NKEA 1T05A 1S1TA 4KV8A 2OZMA 2HHVA 3QINA 3L3UA 4CF2A 1A5WA 1KFSA 1IKYA 4DTMA 2BANA 1KTQA 1WAJA 3PUFA 5HRPA 4HTUA 3AO1A 3QIOA 3K5MA 1YTFA 4DU1A 4KPYA 2ZE2A 1QQCA 4CEQA 3IRXA 3L2QA 3QIPA 4G1QA 4CJPA 2AJQA 4Z4CA 3OYCA 4DS4A 3HXMA 4EP4A 1TBAB 3AVLA 4CHNA 3SI6A 1KLNA 1T8EA 1TGHA 3DRSA 4WZSD 1VSEA 4OGEA 4E7KA 1T7PA 3SQ4A 4FJLA 3VQ9A 4B08A 2YHBA 1KY7A 3AVIA 3AVAA 2G8HA 3NGIA 3RRGA 1S6PA 2EHGA 2IV9A 2X6NA 3V9XA 1WN7A 2ZQBA 3HPGA 3OS2A 4IG3A 4Y1DA 4DTJA 1RT6A 4B9LA 1TK0A 4M3ZA 3M8SA 2F8TA 2HNDA 2P5OA 1NJYA 2QKBA 5KRSA 1WLJA 2I5JA 3NCIA 4FLTA 3PX4A 5FRMA 1C0MA 2Z1GA 4DFPA 1BIUA 1NJWA 4FYDA 3MAQA 2G30A 4AILC 1G15A 5JS2A 4F3OA 3H1ZA 3SV3A 2D5RA 4C8OA 3I0SA 1KVAA 3P5JA 4JLHA 3HS8A 4DSJA 1S6QA 3KLGA 1VSLA 3EY1A 4F2SA 2BE2A 1WSHA 2LSNA 4CCHA 4KHWA 1ITGA 4W5RA 4FJHA 4WE1A 1NVPA 4I9LA 1VOKA 3OJSA 3DLHA 1I3AA 4CJ5A 3A2FA 2OPRA 4KTZA 3CQ8A 3V6DA 1QN5A 4KKOA 4E1MA 1RT5A 4CGIA 3O3HA 3QEVA 1X9SA 3QLHA 4BE0A 4CHQA 1KYUA 4ROEB 1VSHA 1QSLA 1VSMA 2G8WA 4C8KA 4KTWA 4Z4EA 3SJJA 5CY4A 2YV0X 1KCFA 3V81A 4KHYA 1W0HA 1NK7A 4CEZA 4CF1A 1Q9XA 1DTQA 5KGXA 2D0CA 1CZBA 4E3SA 1X1PA 2G8IA 1SUQA 3V4IA 3M8RA 1S1UA 1QN4A 3QO9A 4H4OA 2XY6A 4CJ3A 1DLOA 4CK3A 2OZSA 1W80A 1EKEA 3V1QA 3AVNA 3ULDA 4DSKA 3HS9A 4FLZA 1KFDA 3KK2A 3OYFA 3K5LA 2KFNA 3G0ZA 1CLQA 2QK9A 1IH7A 4CGJA 2HVHA 3KKSA 4M3TA 1T03A 2HNZA 3DRPA 1LWFA 1C9BB 3K5OA 5DMRA 2DFEA 1ZBFA 2FBXA 3HP6A 1UA0A 4KHUA 1NK5A 4DFJA 3LZJA 1S5JA 4KAZA 4CJVA 2G8FA 2W42A 3DI6A 4OGCA 4FJIA 3HK2A 3SPZA 5HRNA 4CEBA 4DTXA 1REVA 5I42A 3OYEA 1VTLE 1B9DA 1O1WA 3VQDA 2X74A 3CYMA 4I7FA 4CJUA 4I2QA 3OYGA 1U45A 3BDPA 4KB1A 1B92A 2YHAA 3ITHA 1JXBA 3HVTA 4N47A 4CGHA 4E1NA 4N56A 1LV5A 3HT3A 1SV5A 4CJTA 3OY9A 3EYZA 4W5OA 1ASWA 5HBMA 1N6QA 4L8RB 3DOKA 1NOYA 1BGXT 2G8VA 1VTOA 1YT3A 5SZTA 3AVBA 4HCBA 2HMIA 3LP1A 3MXJA 1QHTA 2HHSA 1RT1A 3ZT1A 4ICLA 1HYZA 4E7IA 4J2BA 1U47A 3EIKA 2P51A 1C1CA 2YNFA 3O3FA 2RN2A 3MECA 4CJLA 3CG7A 3O4NA 4PA1A 2XY8A 3V9UA 3L3VA 4KI4A 3QNNA 2IAJA 4CJWA 4FK0A 2F96A 3HVRA 4ID5A 1NGMA 2ZD1A 3TAGA 3AVCA 4FLYA 3OYNA 1JL1A 1HQUA 4LH5A 1Q8IA 3AA5X 4GMJB 1L3SA 3ZSXA 3MEDA 3F9KA 2KQ2A 4M45A 3RMAA 2D0BA 2B5JA 2RKIA 4LSNA 1RDDA 4E89A 4CEFA 4DTPA 4CGDA 3TAPA 4RW7A 4DMNA 1GOBA 1RDCA 3AA2A 4ELTA 4OKKA 4KHQA 1TL3A 3THVA 3MEEA 3ZSVA 3KLHA 2XY5A 5CYQA 4HUGA 3KD1E 4M3XA 1EXQA 1MP9A 1J54A 1GOAA 2WOMA 2VG7A 2X6SA 3NH2A 3L2VA 1QTPA 1E42A 1VSDA 2Z1IA 3OS1A 4E7JA 5HLFA 4KB0A 2P1JA 1RTJA 4BWJA 4CESA 4HUFA 4NCGA 3TAQA 1A5VA 4AHUA 4W5QA 1KYDA 1RT7A 1TVRA 3M8QA 1YTUA 1LAWA 1QSSA 1Z26A 1WSGA 4IFVA 3HPOA 3LWLA 2HVIA 3NFAA 4IG0A 4FM0A 4B9NA 4ROCB 4E19A 3SUQA 1KSPA 4O0JA 4RW4A 4CFAA 3DLGA 3HJFA 2FBYA 4DSLA 1RNHA 4CF0A 1R4XA 3K2PA 5HRRA 2BDPA 2FBVA 5J1EA 1JXEA 1VSFA 5CZ1A 4BE2A 2Z1HA 5KGWA 4DTRA 3SQ0A 4C8LA 1CXQA 5DK5A 1VRTA 4CIEA 4RODB 4OJRA 4CGGA 4KHSA 2OA8A 3KLIA 2KTQA 4Z4GA 1D8YA 2HB5A 3T1AA 4FXDA 1AISA 5K14A 4C8MA 4CHYA 4YNQA 4O5BA 2RF2A 1HNVA 4FCYA 1RT2A 2KZZA 1NKBA 4FJ5A 3AVGA 4FK4A 1S9GA 3VQQA 3RTVA 5HROA 2IV8A 3RR8A 3OYJA 4KI6A 3OYDA 4B3OA 4MQ3A 1XI1A 1VSJA 5CZ2A 4BACA 2A1SA 1Y97A 5D3GA 2ETJA 2IGIA 4CJRA 1D3UA 3QETA 2QXFA 2O4IA 5C42A 1KVCA 1XHZA 1WSEA 4FM2A 1L3UA 1J5OA 2HHUA 4K8ZA 4DF8A 1BIZA 1PCZA 3KKRA 3VQBA 4KRFA 4N41A 3O3GA 3SYZA 4PUOA 3DRRA 1QNAA 4O0IA 3NF8A 4DU3A 1LWCA 4OPJA 3M8PA 1TL1A 1WSFA 4CE9A 2D0AA 1JLFA 2G8UA 2E6MA 5J2NA 4W5TA 1ZBUA 3AVFA 5T7BA 4DWIA 5CYMA 4XIUA 1YVUA 3NE6A 1BQNA 4BDPA 1QN6A 1XHXA 4NCBA 3HYFA 3HO1A 2KFZA 4CEOA 1EP4A 4FJGA 1K6YA 4ZHRA 3SQ2A 1UOCA 3AA4A 1KY6A 1F21A 3S3MA 4NYNA 1DTTA 1SL0A 4KTQA 4NYFA 4H8KA 1TK8A 1QTMA 2GV9A 4EZ9A 3VA3A 1N5YA 1IKVA 3VQ6A 1VSIA 1TV6A 1YTBA 1VK0A 4FM1A 3SNNA 2A1RA 3LP2A 4DQPA 3LAKA 3L2UA 2VG5A 3MEGA 4DTNA 3PX0A 1SKRA 1C1BA 4CFCA 4IBNA 3VQ5A 5J2QA 2YNHA 4RW9A 1SKSA 1NK0A 2F8SA 1CDWA 1QN8A 4DFKA 4O55A 3LP0A 2Y1JA 4E0DA 3AO2A 1QSYA 4M3WA 1TKZA 4ELUA 3CFPA 4E7HA 1S9EA 1HNIA 1XC9A 1RBUA 4QCLA 5C25A 4K8XA 4I9QA 4HCCA 3TAEA 4NCAA 4HHTA 2FC0A 3CM5A 3VQPA 3V1OA 4DFMA 1SKWA 3DLBA 1ZBHA 3AVMA 3VQAA 4CJSA 3F73A 4Z4FA 3AVHA 3VQ4A 3HL8A 3C6TA 1KYFA 4HVJA 1Z25A 1ASVA 4DLGA 3SPYA 4FW1A 2ATQA 3U3GA 3RMBA 3OYMA 5I3UA 1NK6A 4FVMA 2FBTA 2EX3A 1LW0A 3DYAA 4LY7A 4BWMA 2XHBA 3L2WA 4DQSA 2PZSA 1HMVA 5IYCP 4PQUA 3SQ1A 2VG6A 3WNFA 4CIFA 3K5NA 4CFDA 4FJ8A 4M3YA 4AHVA 4CGFA 4OLBA 4EZ6A 4CF8A 4FLUA 1JKHA 4CEDA 3OYLA 2PY5A 4BDZA 2YNGA 4OKEA 4OPKA 4B9TA 1NJXA 4F3TA 4Y1CA 1LW2A 2Q3SA 2PYLA 3SCXA 1QNBA 3V9ZA 1BL3A 2GBZA 1BQMA 1EETA 2HNYA 5KI6A 3S9HA 3ZSOA 3LP3A 1TGOA 2P5GA 3ISNC 4FZYA 1VOLB 1JLEA 4CHOA 2G8KA 3T3FA 3PX6A 3VQ7A 1KVBA 3IS9A 3NHGA 3V9WA 1QE1A 4FJMA 3CFRA 1GOCA 1W9HA 1L3TA 3P83D 1C6VA 2OPQA 3KK1A 4RG8A 1NJZA 4OLAA 1IO2A 4M3RA 4QOZB 4W5NA 2XO7A 1BCMA 3OYIA 3NDKA 4AHSA 4I2PA 4DSEA 4CK2A 4KHNA 1LAVA 4PY5A 4IKFA 1J9AA 1B9FA 4DQRA 1BI4B 3LAMA 1QN7A 1NOZA 1VRUA 1RM1A 3RRHA 4FJJA 1B9KA 1C1AA 4ELVA 3H08A 2HW3A 5JS1A 4B0AA 1C0UA 4FW2A 3KK3A 1S1XA 3WNHA 3ZT4A 3LDSA 1EX4A 3NAEA 1RT4A 4DTSA 4CF9A 1CZ9A 2R7YA 1TAUA 4UQGA 4PWDA 1UWBA 3NF9A 3P1GA 5HP1A 4CFBA 4C8NA 3ZT3A 4CEEA 3VQ8A 4Q5VA 3T19A 5FDLA 4JRQA 3IG1A 2MJ7A 1KRPA 3FFIA 3DLRA 4F2RA 1BCOA 1RCHA 4GW6A 4CJEA 1Q9YA 2IOCA 3QEXA 3AA3A 1U49A 1D9FA 3AVKA 4KFBA 2PYJA 1FKPA 3IAYA 2VWJA 3AO4A 2HHQA 4LD0A 3DMJA 2WONA 1L3VA 3OYKA 2KZMA 3OJUA 1X9WA 4DSIA 4M41A 4KO0A 1IKXA 3ZSZA 4BE1A 4DU4A 2JLEA 3OCIA 1PZDA 4OVLA 2E6LA 3OS0A 1X9MA 1S1WA 4Q0BA 4TSXA 1QNEA 3EZ5A 3PO4A 4AHRA 5HRSA 3ALYA 2DFHA 5KRTA 2B6AA 4IDKA 4OKJA 4N76A 2OPSA 4RW8A 3DLEA 3AO3A 5FROA 3S3NA 3I0RA 1JLGA 4CECA 4CK1A 2HHTA 1UA1A 3LANA 4Z0UA 4CJKA 3LZIA 3C6UA 3KJVA 3QEWA 1JLQA 3LPTA 2DTUA 1JLAA 1FKOA 4N5SA 3V9SA 3ZSYA 1RBVA 3V1RA 4QAGA 1S1VA 3TI0A 3TANA 1WSIA 3ZSRA 2HHWA 1U04A 1CXUA 1XWLA 2B4JA 3JSMA 4DS5A 3K57A 1D9DA 4ZTFA 4B9MA 2NUBA 4CHZA 2VWKA 3RWUA 1TAQA 1J53A 4B9UA 4FZZA 1D5AA 1JLBA 1RBSA 3L2RA 5EU7A 3OYHA 4ZTJA 3LWMA 4FLVA 1HYVA 3VN5A 3ZCMA 1YTAA 4Z4HA 3OC3C 3AVJA 3TABA 4J2AA 3TR8A 3SUPA 2DY4A 4BDYA 4CJQA 4CEAA 1WSJA 1HRHA 1JL2A 1JLCA 3JYTA 3ASMA 2VJ0A 1TKDA 4YFUA 4FLWA 4DTOA 4DSFA 4ID1A 3NGZA 2RPIA 1SL1A 3TAMA 4B9VA 1WNSA 2O4GA 4E7LA 4DF4A 3U3YA 1HJRA 1I39A 3WNEA 3LPUA 3NF7A 1TBPA 1QTSA 4LSLA 1RILA 4B8CA 4EP5A 3C95A 3OYBA 3ZT0A 5E41A 3RR7A 3SUOA 2HHXA 1LWEA 4MFBA 4F8RA 1L5UA 4KREA 3NH0A 3QEIA 4IFYA 3ZT2A 2ITGA 2YKNA 4AH9A 5IYDP 4JRPA 2Z8UA 3E01A 3QEPA 1NK9A 4LH4A 3PO5A 1FXXA 4GVMA 3D45A 3BGRA 1RDBA 3I8DA 4J2EA 4FK2A 2GUIA 3AO5A 2IS3A 1UAXA 3O4QA 3VQEA 1ZYQA 1BI4A 3HSTB 5KTQA 3CFOA 1FK9A 2X78A 3K59A 4FJKA 3CM6A 1ASUA 1HYSA 3DOLA 1QN3A 4HUEA 3TARA 4FZXC 4FJ9A 3NH1A 4O44A 3MXIA 3DM2A 3OVNA 3NF6A 2JGUA 4AHTA 4DG1A 5FRNA 3B6PA 3NGYA 1HPZA 1HQEA 1U48A 1BHLA 1NH2A 3KIOA 4DQIA 3KD5E 3KLEA 1NK4A 3D0PA 3MXMA 4CJFA 1C0TA 3VA0A 2IDOA 5J2PA 2KW4A 4F4KA 3B6OA 2DFFA 2Y1IA 3TAFA 3SUNA 3RMDA 4JS5A 3C94A 3QERA 3NBPA 1IG9A 1RT3A 4B9SA 4DQQA 3HP9A 1WAFA 4FJNA 1QS4A 1RTIA 4M3UA 5IYBP 4RW6A 3VQCA 2QKKA 5J2MA 5C24A 2Z1JA 3ZSQA 3U6FA 1ZBIA 3KLFA 4CIGA 4FLXA 3ZSWA 1ZBLA 4Z4IA 1IKWA 1RDAA 4B8AB 3K58A 1U4BA 3DLKA 3QNOA 4DLEA 1TK5A 1RTDA 3LALA 5SWMA 4M42A 1NKCA 2OYQA 4FJ7A 4FJXA 3RMCA 2E4LA 1MU2A 3AV9A 4CHPA 1QNCA 1VSKA 2XRIA 3PV8A 3PY8A 3OYAA 1QN9A 3SZ2A 3S3OA 1RBRA 3L8BA 3QESA 4J2DA 2XY7A 1TKTA 3G10A 1RBTA 2BGGA 3SV4A 4JS4A 2YNIA 1BISA 1NK8A 3UIQA 1A5XA 3WNGA 1RTHA 3TWHA 3KTQA 4AHCA 4DTUA 2YKMA 1R0AA 1SL2A 4R5PA 2OPPA 4CJ4A 3HM9A 1JFIC 4O4GA 4H4MA 2IC3A
chains in the Genus database with same CATH superfamily
3DPTA 4KV8A 4CZEA 2NLVA 4DV5K 3EZWA 4FWLA 1IKYA 3CJ9A 3F10A 5HRPA 3K5MA 1GLDG 2ZE2A 4CEQA 4DV3K 3TE5A 1FN7A 2VQFK 4ISEA 3WT0A 1J6ZA 4EP4A 1SS6A 3HTVA 1T8EA 1T7PA 4WZSD 1VSEA 4E7KA 3SQ4A 3VQ9A 1EO1A 4B08A 2YHBA 1LWYA 2UYTA 2X6NA 3C65A 3CMAN 3DJCA 4DTJA 4HJHA 2HHHK 4M3ZA 3MN5A 2EHBD 1YJNN 4BRMA 2I5JA 2Z1GA 4CBUA 1NMNA 2J4RA 2G30A 3CCRN 4F3OA 3U9ZA 4BRGA 5LMNK 3KTUA 1NVPA 4KBOA 2GX9A 1HNXK 4I9LA 3DLHA 1UT7A 2OPRA 4FO0A 1QN5A 3O3HA 1JCEA 3IFRA 1TUUA 1HU0A 3F9MA 2QI2A 2G8WA 4C8KA 4BRCA 2D0CA 1CZBA 1HNWK 2G8IA 3J7AP 3FFKB 2O8DA 3O9QA 1YITN 3BF3A 3O8MA 2P9PA 4CJ3A 3GOIA 4CK3A 4U7BA 4ISGA 2UU9K 2KFNA 1T6CA 5JVGL 2JHNA 2Q1NA 1IBMK 3KKSA 3DRPA 2DPNA 5DMRA 3OBYA 2WC9A 3E9PA 3QFPA 3J7ZO 1M1KO 1GLJO 5HRNA 5BPLA 3PSFA 1U4BA 1VTLE 2HBKA 2NRTA 3VQDA 4KB0A 4KB1A 1B92A 2P9SB 3ITHA 1JXBA 4CGHA 2UXDK 2VYPA 4H0YB 1ASWA 4W5OA 5BR8K 5SZTA 4RCHA 3AVBA 4FPBA 3MXJA 1RT1A 2I7PA 3CQXA 1M3QA 4EAJA 2RN2A 4YDUC 3SK3A 3WXJA 3DXKA 2XY8A 3WXLA 4NXNK 4CJWA 4FK0A 1HJOA 4MDBA 1Q8IA 4GMJB 1L3SA 3UW2A 2PBDA 4E89A 4IEIA 4BREA 4BRDA 4DTPA 4DMNA 1GOBA 4ELTA 2FSNA 4B3MK 4BC4A 2D0PA 2XY5A 4HUGA 5B8HA 4M3XA 3DWLA 1MP9A 2F9TA 4O8UA 2Z1IA 3J81O 3TAQA 1A5VA 4CVNE 4KHPK 1RT7A 3M8QA 4IFVA 3MMVA 2HBMA 1JJ2M 4O0JA 1BG3A 1N33K 5AQKA 1K9MO 1VQ7N 4BE2A 2NVMA 1RFQA 5CZ1A 4C8LA 5KGWA 1EWQA 3ENOA 4IZ9A 3O80A 5AZJB 5E84A 3C7NA 3VEVA 2KTQA 4Z4GA 1D8YA 4M63C 4H0OA 3T1AA 1WJWA 5K14A 1VAZA 4YNQA 1RT2A 2KZZA 1NKBA 2H4LX 2IV8A 1D4XA 3CF5L 4LF7K 1YQLA 4FWQA 5CZ2A 4BACA 2IGIA 2QXFA 2O4IA 3OSMA 1KVCA 1DGKN 1EBMA 1WSEA 2F7TA 3THWA 1XHZA 1L3UA 4DF8A 4CBWA 1PCZA 1Y64A 1NMDA 4D7QA 2QRCA 2NWVA 4OPHA 3ULXA 1J3MA 3CCLN 4DWIA 5CYMA 3NE6A 1QN6A 1K6YA 1KY6A 2JWLA 3DXMB 1S72N 1RGIA 3G4SN 3A0IX 1TV6A 2YHXA 5C10A 3LP2A 3CETA 3LAKA 3L2UA 4DTNA 1LCUA 4BJUA 3VQ5A 2YNHA 1CDWA 4EHTA 2DKAA 3CMEN 1P5DX 3LP0A 4E0DA 2QWQA 1QSYA 1LXTA 4MRQA 5FLXO 2V7YA 4EAHD 1HNIA 4QCLA 1QQOA 4BY9C 4NCAA 4JK7A 2FC0A 3CM5A 3VQPA 4IXCA 1SKWA 3DLBA 2NRXA 3AVMA 4XH1A 3HL8A 3C6TA 1KYFA 5LL6Z 4G9ZA 3RMBA 3KRMA 3U3GA 2FBTA 2EX3A 3DYAA 4DQSA 5JICA 3HBTA 2PZSA 4I8OA 3K5NA 4FJ8A 4JI8K 3OYLA 3VERA 1JCFA 4OKEA 2Q97A 4MLEA 4IDHA 4F3TA 2PYLA 2NLXA 3CERA 2GBZA 3D6RA 4CZGA 2CGKA 3TTDA 1JLEA 2G8KA 3T3FA 3CFRA 2E2NA 2QWMA 1L3TA 4FL9A 5EXWA 2OPQA 1W97L 2W6LA 4LFAK 4JD2B 3PIPL 4OLAA 1IO2A 4M3RA 4W5NA 3WEEB 2XO7A 4H5TA 1C0FA 3RRHA 4FJJA 3CD6N 2O3OA 4FW2A 3KK3A 2I7NA 3H1VX 3GDQA 2R7YA 1J5EK 4PWDA 1UWBA 3NF9A 3P1GA 4JRQA 3VQ8A 1OVYA 4LFBK 1XUPO 1KRPA 2Y8LA 4AQYK 1QQNA 1RCHA 2IOCA 3QEXA 3IAYA 5AQFA 1RDUA 3AO4A 5M1PA 2ZGZA 4FWKA 1NGBA 2WONA 3OYKA 2JOIA 3TDHA 4DSIA 3E9LA 4WQ4C 4EJYA 1RDWX 3O1WA 3FLCO 2E6LA 3OLPA 4IFEA 1G99A 1X9MA 1WUAA 1QNEA 3EZ5A 1XNRK 2O8CA 4DV1K 4IDKA 3E1YA 3VEYA 4B3SK 3S3NA 4CD1A 3W3DA 4CECA 5AQWA 3LANA 3LZIA 2NOLA 2E2QA 3V9SA 3V1RA 4QAGA 3TANA 4YOTA 2B4JA 2NUBA 4CHZA 3D2EA 3T1HK 1RBSA 4BR7A 4ILJA 3OSEA 5EU7A 4ZTJA 4MDAA 4B9QA 1VQ9N 4Z4HA 3TABA 5HOOA 3D2FA 2NOFA 4X66K 5BR9A 3P39A 2ZJRL 1YQKA 3CJ1A 4FLWA 4DTOA 2ASPA 3ZEUA 3TAMA 1NJIO 1WNSA 1HJRA 1I39A 5AQYA 4JKDA 2AP1A 1QTSA 3OYBA 4GY2B 4F8RA 1L5UA 4AH9A 3IDHA 2QM1A 4LF6K 3E01A 3J7YP 1FXXA 1KXPA 3BGRA 4FK2A 5AJ3K 4IWVA 2D0OA 4CZIA 5KTQA 3CFOA 4FJKA 3FZFA 3K59A 2PAVA 5FPMA 2ASMA 3DOLA 1QN3A 1GLEG 3NH1A 4DR3K 1BDGA 3CW7A 4DG1A 3B6PA 4OX9K 3CCUN 1IBLK 3KIOA 4IO9L 3MDQA 3CJ7A 1W2BM 2KW4A 2ZJPL 1OH8A 1IG9A 3SUNA 4KI4A 1RT3A 2O8DB 2KKZA 3KZBA 1H1VA 5J2MA 3ZSQA 4BRKA 2VWBA 3LDPA 1RDAA 3VGLA 4B8AB 1TUYA 3ZX2A 4DLEA 1RTDA 5A2QO 2OYQA 4FJXA 3RMCA 1MU2A 1QNCA 1HUXA 3OYAA 3AY9A 4DQ8A 3ZLJA 2BGGA 3G10A 1NK8A 1A5XA 1WQAA 4JKCA 1U2VA 3WNGA 3I56N 3TWHA 3HM9A 1KLMA 4CERA 3T1YK 1WBBA 1IBKK 2HHVA 5F9CA 3L3UA 2UUBK 1YF5L 2W41A 1KTQA 1N36K 1MPGA 2NOZA 3VEOA 4KPYA 3BEXA 5AQHA 3HRGA 3QIPA 5M1FA 4CJPA 3RPJA 4Z4CA 3DXKB 4CHNA 1X9JA 3AVLA 1QVFM 3SI6A 1E4GT 3MN9A 4OGEA 4FJLA 1DKGD 1IG8A 5CR4A 2QW9A 3AVIA 5IWAK 4IEEA 1S6PA 3F2KA 4DR4K 3Q7CA 2ZQBA 3NVKA 1P5GX 4LF5K 3ZX3A 3PLAA 4JV5K 3M8SA 1YJWN 2YX6A 2HNDA 1YQRA 1WLJA 3NCIA 3PX4A 4B1ZA 2YHYA 1C0MA 2HZMA 4QS8A 4MO4A 5JS2A 3SV3A 4C8OA 4EIAA 3P5JA 1OVQA 4B3TK 1VSLA 3H3OB 4JI4K 2LSNA 4JHDB 3TSQA 1ITGA 3P4IA 3VENA 5GIOA 1T6AA 4BRNA 1I3AA 3FZLA 4KTZA 3CQ8A 3H1QA 4KKOA 3QEVA 5H1SQ 1RT5A 3QLHA 1HKGA 4LFCK 4Z4EA 4QG5A 3OBWA 4KTWA 1KCFA 4KHYA 4EFHA 4CF1A 1DTQA 3C7NB 4IL8A 3ZX0A 3L0QA 2QR1A 3VTIA 5KQ8A 1S1UA 5GINA 2OZSA 3V1QA 1I94K 3AVNA 3TSPA 4H5RA 4FLZA 1OH5A 1KFDA 3KK2A 3OYFA 3K5LA 3FZKA 1IH7A 4M3TA 4H0TB 3H46O 3J80O 1LWFA 3K5OA 3P31A 3THWB 1NK5A 4WF9L 4DFJA 1S5JA 4GVEA 3SPZA 5EVZA 4C1NK 3P38A 1U45A 3OYGA 2QEXN 3OGDA 4N47A 3HVTA 4ILHA 1LV5A 3VPZA 3GE1A 2G8VA 1VTOA 1YT3A 3QFUA 4ICLA 1HYZA 1VQ8N 4OO1J 3CJCA 2E8AA 1C1CA 3O3FA 4QS9A 3UKRA 2HSTA 3O4NA 4PA1A 3QB0A 2F96A 3VGMA 3N4QA 2YJFA 3K9KA 3MK6A 1PVSA 3AA5X 3ZSXA 3MEDA 3R8EA 2RKIA 2B5JA 4LSNA 1LWWA 4I6MA 4KHQA 2E1YA 3THVA 3MEEA 3ULEA 3G71N 4DQIA 1J54A 2WOMA 4BRQA 3L2VA 1QTPA 5HLFA 4E7JA 4V19S 2OTLN 4CESA 3TU5A 1TVRA 4CZMA 1QSSA 3PDKA 1T44A 3LWLA 2V9JA 3NFAA 4IG0A 4B9NA 3A5MC 4ROCB 4E19A 3SLCA 4CFAA 4RW4A 3HJFA 1NGIA 2E2OA 4MLHA 4YOVA 3K2PA 1JXEA 3SQ0A 4JKGA 2Z1HA 1CXQA 3T4NA 1VRTA 4CIEA 4GKKK 4CGGA 3RSEA 2P9LA 1K35A 4FJ5A 2JHJA 4CZFA 3BF1A 3VQQA 1NWKA 1NGCA 3RR8A 4BC2A 1VSJA 2Q0UA 5D3GA 2ETJA 2A3ZA 3G25A 1J5OA 2HHUA 3VQBA 4KRFA 3O3GA 2OANA 3D7EO 4PUOA 3DRRA 3SAGA 3SAHA 3OSTA 4O0IA 3ZYYX 2BH1A 1LWCA 4WX8A 3M8PA 1Q9UA 4W5TA 2CGLA 3LDOA 5T7BA 4NCBA 1YVUA 2KFZA 3HZ6A 3UE5A 4FJGA 1MA9B 3OTOK 4BVPA 1XC3A 3H45C 1TK8A 1QTMA 3L4QA 3VQ6A 3H6EA 4DQPA 2QWLA 3SNNA 4BRFA 3BZCA 2VG5A 2Q0RA 1SKRA 3O9UA 5AQUA 5J2QA 5EPCA 3GL1A 2F8SA 3ENOC 1XMQK 1SZ2A 4DFKA 4LF9K 3QMLA 3AO2A 2O8CB 4M3WA 1E3MA 4ELUA 3CFPA 4E7HA 3CCEN 1R59O 1S22A 2P9NA 5HSHA 4HWIA 3MN6A 5C25A 4K8XA 3VQAA 4CJSA 3MWPA 4Z4FA 2HZSA 2GELA 2YCHA 4YORA 4HVJA 1Z25A 4FW1A 2ATQA 3OYMA 3VEZA 1NK6A 4X64K 2XHBA 1HMVA 3NA5A 3EAYA 5IYCP 4PQUA 3LM2A 4DR1K 3I55N 3WNFA 3EO3A 4CFDA 4DV2K 4M3YA 4AHVA 4CGFA 4CF8A 4DUZK 2O8EA 1LW2A 2Q3SA 3ENBA 1QNBA 3V9ZA 4JKHA 5HL7L 1BL3A 5KI6A 2HNYA 1EETA 1K8KA 3ZSOA 3EKUA 2P5GA 3ISNC 4IOXA 3ZEUB 4MO5A 3PX6A 5ADXA 3VQ7A 1QE1A 1GOCA 1C6VA 3KK1A 4RG8A 1NJZA 2V8QA 1MDUB 3NDKA 4NO7A 4BRIA 4I2PA 1LAVA 4PY5A 4H5WA 4IKFA 1J9AA 4D7RA 3SAFA 5DM6L 3T7ZA 4ELVA 3H08A 4C23A 5JS1A 3WUHA 1S1XA 3LDLA 4K41A 3WNHA 5AZIB 4DTSA 1RT4A 2V52B 1CZ9A 3VF6A 4CZHA 4UQGA 2WUSA 4CFBA 4C8NA 4Q5VA 1PCJX 4GV9A 3IG1A 4XH4A 3FFIA 3O4WA 4GW6A 1Q9YA 1IV0A 1D9FA 3AA3A 2PYJA 3AVKA 2VWJA 2P9UB 1L3VA 2V51B 1DIZA 1VQ5N 4KO0A 1IKXA 3DPUA 4JI1K 2QRDA 2FLOA 3ALYA 3R9PA 3DLEA 5FROA 3I0RA 1JLGA 4Z0UA 2FUVA 1U2VB 3C6UA 3QEWA 1JLQA 1JLAA 3L6QA 3SBGA 3ZSYA 1KD1O 3K9JA 1S1VA 3TI0A 2VCPA 2R5XA 1D9DA 2VWKA 1TAQA 1J53A 4DV0K 1VQPN 1JLBA 3L2RA 1TUOA 3OYHA 3NVMA 3VN5A 4J2AA 3C04A 3AVJA 4YOXA 2DY4A 4CJQA 1HRHA 5ADXH 4DR2K 3ASMA 1TKDA 1BO5O 5C12A 4ID1A 3CCMN 5AQZA 2OOXA 5AQOA 2ZF5O 2Q2RA 3MX5A 4E7LA 3NF7A 1TBPA 2ZJQL 4EP5A 3C95A 3RR7A 3SUOA 1LWEA 5BPMA 4DULA 2A6AA 3CI5A 5IYDP 4AM6A 2Z8UA 4LH4A 5BRDA 3I8DA 5LY3A 2NRWA 3NMUA 3VQEA 1Q81O 1M3HA 3HSTB 2P9KA 3CM6A 1ASUA 4NB4A 4X62K 3TARA 4FZXC 3DM2A 2W6KA 4F9OA 3NF6A 3I8BA 3R1XA 2Z0FA 2OCEA 3O08A 3CHWA 4BRPA 4TPSA 3SNSA 4WCEL 4DV4K 3KLEA 2VQEK 3KD5E 3LDNA 5CE3A 5DM7L 1C0TA 5J2PA 2DFFA 4JN4A 4YHHK 3RMDA 4DQQA 3HP9A 4Y0WA 3ZETB 3VQCA 1N3AA 5C24A 2Z1JA 2F4VK 4NXMK 4FLXA 4Z4IA 1IKWA 3DLKA 1TYQA 1TK5A 3LALA 1HKCA 3AV9A 4BG9A 3A5LC 5C0YA 3ID8A 3R3LA 5EY4A 3RVCA 3SZ2A 3S3OA 1RBRA 4B3RK 4JI6K 4JS4A 3UIQA 1QQMA 5M1QA 2PFUA 1QHAA 5BN8A 4DTUA 2YKMA 1SL2A 3FZHA 1S3XA 4O4GA 4H4MA 5AQGA 4J8FA 3HPHA 4BR9A 4Q11A 1SQKA 3QINA 4CF2A 3MX2A 2ZGYA 4DTMA 2BANA 1WAJA 3PUFA 2P9IA 1YTFA 2QWRA 1SAZA 3BP8A 4G1QA 1NBWA 4RTFD 3UKRB 3M5RA 4CZLA 4KH4A 3R6MA 1KLNA 5AQPA 2AA4A 3DRSA 3EE9A 1KY7A 5BRHA 3AVAA 2G8HA 4A57A 3NGIA 3RRGA 3THYB 2QWPA 3V9XA 1WN7A 3OS2A 4FWPA 4Y1DA 4B9LA 1TK0A 3E9OA 1NJYA 2P5OA 1HX1A 5GADP 3GG4A 1VQKN 3ULEB 1NJWA 3MAQA 4DKWA 4AILC 1G15A 4DSJA 3I0SA 3VEXA 4DV6K 1S6QA 3KLGA 4F2SA 3EY1A 2BE2A 4KHWA 4FJHA 1O13A 4IOCL 5GAHP 1VOKA 3OJSA 1Z05A 4CJ5A 3PIOL 4JI0K 4JI5K 3SJHA 4BRAA 1X9SA 3C6AA 1N8RO 2D1KA 4BRHA 2NOIA 4ROEB 4JEPA 1VSHA 2P9SA 1QSLA 2H3GX 1VSMA 3IUCA 5CY4A 2YV0X 3V81A 4A2BA 4CEZA 3KWGA 3RSEB 4E3SA 1X1PA 3V4IA 2P9LB 3M8RA 3CPWM 3DAWA 1W80A 1EKEA 3ULDA 4DSKA 3HS9A 2V92A 3CC2N 1CLQA 2QK9A 5M1OA 1UL7A 2HNZA 1C9BB 1GLLO 3U8XA 5AQIA 2DFEA 1ZBFA 2FBXA 3HP6A 4KHUA 5BPNA 4FSVA 2BUPA 4KAZA 4CJVA 1E4FT 4OGCA 4FJIA 3HK2A 5AQJA 4DTXA 1REVA 2OZMA 2X74A 3CYMA 4EAGA 4I2QA 5CHIA 4E1NA 4N56A 3D4VA 4CJTA 3EYZA 5HBMA 4L8RB 3DOKA 1BGXT 2HMIA 3LP1A 1QHTA 3ZT1A 5KL0A 2QLVA 4E7IA 4J2BA 1U47A 2YNFA 2P9PB 3MECA 4PKIA 2NRVA 4WQ4A 3J8AA 4JI2K 2UXBK 3QNNA 4H5VA 4ID5A 4U67L 1NGMA 3AVCA 4EAIA 4LH5A 3JAMO 2KQ2A 3RMAA 4EJZA 2P9NB 1RDDA 4CEFA 5FPEA 4B1YB 1RDCA 3AA2A 4OKKA 3FZMA 1TL3A 1WOQA 3KD1E 1EXQA 3NH2A 4ZTFA 2X6SA 2VG7A 3BY5A 1VSDA 3OS1A 2P1JA 1RTJA 4BWJA 4HUFA 4NCGA 4AHUA 4W5QA 1KYDA 1YTUA 3WQUA 4AM7A 1Z26A 3I0XA 1WSGA 3HM8A 2ZWHA 3HPOA 5GIPA 4FM0A 4PKGA 2FGTA 1EWRA 1RNHA 2O8EB 2WTUA 1R4XA 3A5OC 3PSIA 5HRRA 2BDPA 2FBVA 5J1EA 4JAXA 1VSFA 1K8KB 4DTRA 3HOTA 4OJRA 2OA8A 2HB5A 2A42A 1X3MA 3I3WA 4R79A 2MZ8A 4YY3K 5AQNA 1S9GA 3RTVA 5HROA 3JS6A 4B3OA 3O1BA 4IJAA 4MQ3A 2A1SA 1Y97A 3MN7A 1D3UA 3QETA 1NG9A 5C42A 1BUPA 3CC7N 4FM2A 3CCQN 2IVPA 5TKWA 2NOEA 2FF3B 3CCSN 3SYZA 1BA0A 1ZBHA 3VGKA 4OPJA 1TL1A 1WSFA 4JKEA 2G8UA 1JLFA 1HNZK 4EALA 1CZAN 2E6MA 1NGDA 4BG8A 5J2NA 3AVFA 4GKJK 4XIUA 5EOYA 3HO1A 1BQNA 4BDPA 1XHXA 2NOHA 3HYFA 3QICA 4CEOA 3SMPA 3W0LA 4ZHRA 3SQ2A 1UOCA 5AQSA 1F21A 2IVNA 1HLUA 4NYNA 1DTTA 4KTQA 3VA3A 1IKVA 3CIPA 4JI3K 3RSMA 1VK0A 5BMNA 3MEGA 3PX0A 1C1BA 4CFCA 4IBNA 4DR5K 1NK0A 2HL8A 4RW9A 1SKSA 4DR6K 5F2RA 4GV3A 1QN8A 1OKJA 1WB9A 2IIRA 2Y1JA 1VQNN 4DR7K 2KHOA 1TKZA 2QA4N 2NNWA 1S9EA 3ID6A 3CJAA 4HCCA 3TAEA 5F0XA 4HHTA 3V1OA 4DFMA 1Q18A 1ATSA 3VQ4A 4DLGA 3M6GA 1Q7YO 1LW0A 3LM9A 4EAKA 2YA3A 3SQ1A 2VG6A 4EZ6A 4FLUA 3VMFB 2QWNA 5AQRA 4CEDA 2PY5A 2YNGA 4OPKA 4B9TA 3M1FA 2W40A 5E26A 3JXUA 3SCXA 1BWFO 3S41A 4FWOA 3LP3A 4H5NA 1TGOA 3MCPA 5BMPA 1VOLB 3O9TA 3KVGA 3IS9A 1W9HA 5JMVD 3OH6A 1M5Q1 1MWMA 4CJ7A 3OYIA 4BGBA 3AGRA 4CK2A 4KHNA 1NGGA 1B9FA 4DQRA 1JDYA 3WXKA 1B9KA 4B0AA 1C0UA 5BREA 3NAEA 1EX4A 5EX5A 2A5XA 5BRFA 4CF9A 2E20A 2FSKA 1TAUA 3TSUA 1NNEA 2LAEA 3WXMB 4CEEA 4DHYA 5FDLA 3HI0A 4F2RA 4CJEA 4FOIA 4M7YA 1EUVA 1U49A 4KFBA 5JVHL 2UXCK 2NRRA 4XH5A 4LD0A 1YVNA 3DMJA 2FF6A 4YOUA 3OJUA 1X9WA 4BE1A 4WQ5A 4DU4A 4CZJA 3D7QA 4OVLA 1OH6A 1TYQB 2RE2A 3OS0A 4Q0BA 4BR5A 3ATVA 3PO4A 4AHRA 5HRSA 2E88A 5KRTA 4N76A 2B6AA 4OKJA 2OPSA 1ATNA 3EEQA 4WXAA 2EWSA 4ISFA 4CK1A 3THXA 1UA1A 2HHTA 1C47A 1KAYA 3CPEA 3VEWA 4CJKA 1UT4A 3KJVA 2DTUA 1FKOA 1P90A 4H03B 2Q36A 1V4SA 3ZSRA 2HHWA 3F0ZA 1CXUA 1XWLA 4DS5A 1Q86O 4JK9A 4B9UA 1U6ZA 4FZZA 1D5AA 2WBNA 3C0BA 5IT9O 3OHRA 3A8YA 2P9IB 3LWMA 4FLVA 1HYVA 3HOSA 2FXUA 3OC3C 4JKAA 3SUPA 4CEAA 1JL2A 3FE1A 3JYTA 1DEJA 1P8ZA 1C4GA 4DSFA 4JNEA 2RPIA 1SL1A 5AR0A 2O4GA 4DF4A 3WNEA 1YIJN 3LPUA 3TTFA 3CC4N 4B8CA 3GBTA 3ZT0A 4Z94A 4MFBA 4KREA 3C6HA 4IOAL 3NH0A 2ITGA 4DUYK 4A61A 3PO5A 1XMOK 2NRZA 2NOBA 1RDBA 3AO5A 2A41A 3B8AX 2IS3A 1UAXA 3O4QA 3QBXA 1ZYQA 3UKUA 1BI4A 1FK9A 3D2EB 3Q7BA 3N4PA 4HTLA 1HYSA 4HUEA 4FJ9A 1ZC6A 4O44A 3MXIA 3OVNA 4PHTX 2O8BA 1YQMA 4LC9B 2JGUA 3D2FB 4C1NI 5FRNA 3NGYA 1HPZA 2CH6A 4PL8A 3AAQA 1KAXA 1NK4A 3VF4A 3MXMA 4CJFA 4F4KA 2IDOA 1XQSC 3B6OA 4JS5A 3C94A 3NBPA 1GLBG 5TKYA 1RTIA 4M3UA 5IYBP 4RW6A 3U6FA 2E5LK 1FJGK 3ZSWA 4BQZA 1ZBLA 2GUPA 3QNOA 5LJVA 5AQMA 5AQLA 4M42A 1NKCA 4FJ7A 2E4LA 4CD3A 2F9WA 3PV8A 3PY8A 1QN9A 4RWTA 4LF8K 3N89A 3L8BA 3QESA 4J2DA 2XY7A 1ZXOA 1TKTA 1RBTA 2CGJA 3SV4A 1BISA 5M1NA 1RTHA 4AHCA 1ESVA 4GV6A 2OPPA 3WQTA 4CJ4A 4O8KA 4DB3A 2QWOA 2IC3A 1VSKA 1VQON 1NKEA 1TKXA 1T05A 1S1TA 1A5WA 1KFSA 4JHDA 4X65K 4HTUA 3AO1A 1VQ4N 3QIOA 4DU1A 1QQCA 3IRXA 3L2QA 2AJQA 3OYCA 4DS4A 3HXMA 1TBAB 3I33A 2O8FA 1TGHA 4A5BA 3CVSA 1XSZA 1K8AO 2PWWA 1PCMX 2EHGA 4K0KK 2IV9A 5JLFA 3HPGA 1N39A 4IG3A 1V4TA 4FWMA 3CCJN 2HOEA 1RT6A 1VQLN 5GAGP 2F8TA 1NGFA 3IMXA 2QKBA 5KRSA 4FLTA 5FRMA 4DFPA 2QTDA 1BIUA 1KQSM 4FWNA 4FYDA 2DKCA 3H1ZA 2D5RA 1KVAA 4JLHA 3HS8A 3ENHA 1VHXA 4L3QA 1GLFO 1WSHA 4M7XA 4CCHA 4W5RA 4WE1A 2HF3A 5LJWA 1YI2N 3A2FA 4BR2A 5AQXA 3K0SA 3V6DA 4E1MA 4CGIA 4YDUA 1YJ9N 4BE0A 4CHQA 1KYUA 1W7AA 3SJJA 3AARA 1W0HA 1NK7A 4A5AA 1Q9XA 1ILYA 5KGXA 1WBDA 1IJJA 4DV7K 3O6WA 1SUQA 5AQTA 3QO9A 1QN4A 4H4OA 1NLVA 2XY6A 1DLOA 5MLCQ 3QDKA 1C0GA 1K73O 4K42A 2UUCK 2ZFDB 1M90O 4FPAA 2E1ZA 1QVGM 3G0ZA 1KAZA 2HVHA 4CGJA 1T03A 1BA1A 3OW2M 3TTCA 5C15A 3BZKA 3L4IA 3LZJA 5AN4A 2G8FA 2W42A 3DI6A 4CEBA 5I42A 4BC3A 3OYEA 1B9DA 1O1WA 4JKFA 3BDPA 4I7FA 4CJUA 4YOWA 2YHAA 1Q82O 3HT3A 1T3VA 1SV5A 3OY9A 1N6QA 2OTJN 2QREA 3IKMA 1NOYA 2HF4A 2JWKA 4HCBA 1GLAG 2HHSA 1K2YX 4NLBA 2FKFA 5FPNA 2H5AX 4B1WB 1BU6O 3EIKA 2P51A 3VETA 3U9DA 3FGUA 3WXIA 3CVTA 4WFNL 4CJLA 3CG7A 4WYBA 5KPRA 3V9UA 3L3VA 2IAJA 1N3CA 3HVRA 2ZD1A 4FOEA 3TAGA 3U4LA 3CCVN 4OPAA 4FLYA 3OYNA 1JL1A 1HQUA 3F9KA 4M45A 2D0BA 3O9RA 2HBJA 4YOYA 4CGDA 3TAPA 4RW7A 2FKMX 4B1VA 3ZSVA 4JK8A 3KLHA 5CYQA 1GOAA 4IO8A 1UA0A 1N34K 1E42A 4B1XB 1Z6RA 1LAWA 2ITMA 2HVIA 4CW7B 3SUQA 1KSPA 3DLGA 2FBYA 3VOVA 4KH5A 4DSLA 4CF0A 2GEMA 3VTHA 5DK5A 1NGAA 3FR0A 4RODB 4AF1A 4KHSA 3KLIA 5JMVA 5KPTA 2BTFA 2RHKA 4FXDA 1AISA 1T6DA 2HBLA 4C8MA 4CHYA 4O5BA 5F1XA 2RF2A 1HNVA 1NGHA 4FCYA 4I6MB 1HPMA 3AVGA 4FK4A 4KI6A 5KQDA 3OYJA 2KLAA 3OYDA 1XI1A 3KK7A 4H0PA 4LF4K 4CJRA 3T69A 3O9SA 4K8ZA 1BIZA 3KKRA 1KFQA 2CH5A 4N41A 4FWRA 3UB5A 1QNAA 1HR0K 3NF8A 4DU3A 4H0XB 4CE9A 2D0AA 2YI1A 3IH7A 1ZBUA 4JKGB 4A59A 1EP4A 4C7PA 2Y8QA 5AFUA 3AA4A 1KO9A 3S3MA 1YAGA 1SL0A 4FWSA 4NYFA 4H8KA 1KC8O 4EZ9A 2GV9A 5ELZA 1N5YA 1VSIA 1NM1A 1YUWA 1YTBA 4FM1A 2A1RA 4BR0A 1OH7A 4O55A 3EL2A 3KWIA 4O5FA 5AQVA 4B1UB 2GWJA 1XC9A 1RBUA 2HMPA 5M1KA 3LDQA 4I9QA 3THXB 3F73A 4ILGB 3AVHA 1ZBSA 3H3NO 3SPYA 1ASVA 5I3UA 4FVMA 3EN9A 4LY7A 4BWMA 3L2WA 1V5SA 3EKSA 4BROA 1QZ5A 4KH6A 4CIFA 4OLBA 2VGNA 2HKPA 5AZIA 1JKHA 4BDZA 3E66A 1BOTO 5AQQA 1YHQN 1NJXA 4Y1CA 4GNIA 4UY8O 1BQMA 3S9HA 1MWKA 2GTDA 3O5BA 4BC5A 1NU0A 5AZJA 4FZYA 3CXCM 1KFIA 5KPZA 4XEIA 4CHOA 3ATUA 2P9UA 1KVBA 3NHGA 3V9WA 4FJMA 2GWKA 3P83D 4BQLA 4CZKA 3AGKA 4QOZB 1BCMA 4CBXA 3A5NC 1GLCG 4AHSA 3AAPA 4DSEA 4E1JA 3M3ZA 4WFAL 3SMSA 3QBWA 2WFBA 3UKUB 1BI4B 3LAMA 1QN7A 1NOZA 1VRUA 1RM1A 3VESA 1C1AA 2HW3A 3ZT4A 3CWAA 3LDSA 1DT9A 3CQYA 2O8BB 2QXLA 4NLCA 4DCHA 3HSCA 5HP1A 3ZT3A 5AFUH 3T19A 3BKQX 2MJ7A 1YXQA 3DLRA 4BVOA 1BCOA 1QZ6A 1NGJA 4PKHA 1FKPA 2HHQA 5JLHA 2XHIA 3DXMA 2KZMA 4M41A 2NRHA 3ZSZA 4CFFA 2JLEA 3OCIA 1PZDA 2OOYA 3BUZB 2E2PA 1S1WA 3VF2A 4TSXA 1ATRA 5I9EB 2YH5A 2DFHA 4RW8A 1FW6A 3AO3A 4QS7A 2F7LA 2V7ZA 3OH9A 3LPTA 3TPQA 4IJNA 4N5SA 4WFBL 1RBVA 1NGEA 3CWTA 1WSIA 1U04A 3JSMA 4B9MA 3K57A 1VKLA 5C2DA 3RWUA 5GAEP 3MWTA 3PMGA 4EHUA 4A2AA 3SBTA 3ZCMA 1YTAA 3TR8A 2ASOA 4BDYA 2I5WA 1WSJA 1JLCA 2D4WA 4JI7K 2VJ0A 2O8FB 4CI6A 4YFUA 4JYAK 2YHWA 2FSJA 3NGZA 5JN5A 1VQ6N 4B9VA 4H0VB 1LWVA 1JCGA 2DKDA 3I0WA 3F5TA 4BRLA 3U3YA 3ZETA 4LSLA 1RILA 4WQ5C 5E41A 2HHXA 4K25A 4JD2A 3QEIA 4IFYA 3ZT2A 2YKNA 3WEEA 4JRPA 2HL9A 4A62A 3QEPA 1NK9A 1EQYA 4GVMA 3D45A 4J2EA 2GUIA 3CWSA 2X78A 2ZM6K 4K43A 5C2FA 3KHYA 4AHTA 4BGAA 1HQEA 3EE8A 3DLLL 1U48A 1BHLA 1NH2A 5FPDA 4JKBA 3D0PA 3VA0A 3LL3A 1X3NA 1XNQK 2Y1IA 2JPIA 3TAFA 5BN9A 3QERA 3CJBA 4B9SA 2Q31A 1WAFA 4FJNA 1QS4A 2YJEA 1VQMN 2QKKA 1N32K 3CWUA 2NZTA 1ZBIA 3KLFA 4CIGA 2UUAK 3K58A 4BR4A 5SWMA 1LOTB 2VGMA 5LMUK 4CHPA 2P9KB 2XRIA 3OA9A 3THYA 4PL7A 2YNIA 2A40A 3ENCA 1HKBA 3MCAB 3KTQA 1R0AA 2IVOA 4FVUA 4R5PA 1JFIC 3G6EN
chains in the Genus database with same CATH topology
3DPTA 1KLMA 4CERA 3HPHA 1TKXA 1NKEA 1T05A 4Q11A 1S1TA 4KV8A 2OZMA 2HHVA 3QINA 3L3UA 4CF2A 1A5WA 1KFSA 1IKYA 4DTMA 2BANA 1KTQA 1WAJA 3PUFA 5HRPA 3F10A 3AO1A 4HTUA 3QIOA 3K5MA 1YTFA 4DU1A 2NOZA 4KPYA 2ZE2A 1QQCA 4CEQA 3IRXA 1FN7A 3L2QA 3QIPA 4G1QA 4CJPA 2AJQA 3RPJA 4Z4CA 3OYCA 4DS4A 3HXMA 4EP4A 1TBAB 3AVLA 4CHNA 3SI6A 1KLNA 1T8EA 1TGHA 3DRSA 4WZSD 1VSEA 4OGEA 4E7KA 1T7PA 3SQ4A 4FJLA 3VQ9A 4B08A 2YHBA 1KY7A 1LWYA 3AVIA 3AVAA 2G8HA 3NGIA 3RRGA 1S6PA 2EHGA 2IV9A 2X6NA 3V9XA 1WN7A 2ZQBA 3HPGA 1N39A 4NCBA 3OS2A 4IG3A 4Y1DA 4DTJA 1RT6A 4B9LA 1TK0A 4M3ZA 3M8SA 2F8TA 2HNDA 2P5OA 1NJYA 1YQRA 2QKBA 5KRSA 1WLJA 2I5JA 3NCIA 4FLTA 3PX4A 5FRMA 1C0MA 2Z1GA 4DFPA 1BIUA 1NJWA 2HZMA 4FYDA 3MAQA 2G30A 4AILC 1G15A 5JS2A 4F3OA 3H1ZA 3SV3A 2D5RA 4C8OA 3I0SA 1KVAA 3P5JA 4JLHA 3HS8A 4DSJA 1S6QA 3KLGA 1VSLA 3EY1A 4F2SA 2BE2A 1WSHA 2LSNA 4CCHA 3KTUA 1ITGA 4W5RA 4FJHA 4KHWA 4WE1A 1NVPA 4I9LA 1VOKA 3OJSA 3DLHA 1I3AA 4CJ5A 3A2FA 1UT7A 2OPRA 4KTZA 3CQ8A 3V6DA 1QN5A 4KKOA 4E1MA 1RT5A 4CGIA 3O3HA 3QEVA 1X9SA 3QLHA 2NOIA 4CHQA 1KYUA 4ROEB 4BE0A 1VSHA 1HU0A 1QSLA 1VSMA 2G8WA 4C8KA 4KTWA 4Z4EA 3SJJA 5CY4A 2YV0X 1KCFA 3V81A 4KHYA 1W0HA 1NK7A 4CEZA 4CF1A 1Q9XA 1DTQA 5KGXA 2D0CA 1CZBA 4E3SA 1X1PA 2G8IA 1SUQA 3V4IA 3M8RA 1S1UA 1QN4A 3QO9A 4H4OA 2XY6A 4CJ3A 1DLOA 4CK3A 2OZSA 1W80A 1EKEA 3V1QA 3AVNA 3ULDA 4DSKA 3HS9A 4FLZA 1KFDA 3KK2A 3OYFA 3K5LA 2KFNA 3G0ZA 1CLQA 2QK9A 1IH7A 4CGJA 2HVHA 3KKSA 4M3TA 1T03A 2HNZA 3DRPA 1LWFA 1C9BB 3K5OA 5DMRA 2DFEA 1ZBFA 2FBXA 3HP6A 1UA0A 4KHUA 1NK5A 4DFJA 3LZJA 5AN4A 1S5JA 4KAZA 4CJVA 2G8FA 2W42A 3DI6A 4OGCA 4FJIA 3HK2A 3SPZA 5HRNA 4CEBA 4DTXA 1REVA 5I42A 3OYEA 1VTLE 1B9DA 1O1WA 3VQDA 2X74A 3CYMA 4I7FA 4CJUA 4I2QA 3OYGA 1U45A 3BDPA 4KB1A 1B92A 2YHAA 3ITHA 1JXBA 3HVTA 4N47A 4CGHA 4E1NA 4N56A 1LV5A 3HT3A 1SV5A 4CJTA 3OY9A 3EYZA 4W5OA 1ASWA 5HBMA 1N6QA 4L8RB 3DOKA 1NOYA 1BGXT 2G8VA 1VTOA 1YT3A 5SZTA 3AVBA 4HCBA 2HMIA 3LP1A 3MXJA 1QHTA 2HHSA 1RT1A 3ZT1A 4ICLA 1HYZA 4E7IA 1M3QA 1U47A 4J2BA 3EIKA 2P51A 1C1CA 2YNFA 3O3FA 2RN2A 3MECA 4CJLA 3CG7A 3O4NA 4PA1A 2XY8A 3V9UA 3L3VA 4KI4A 3QNNA 2IAJA 4CJWA 4FK0A 1N3CA 2F96A 4ID5A 3HVRA 1NGMA 2ZD1A 3TAGA 3AVCA 4FLYA 3OYNA 1JL1A 1HQUA 4LH5A 1Q8IA 3AA5X 4GMJB 1L3SA 3ZSXA 3MEDA 3F9KA 2KQ2A 4M45A 3RMAA 4EJZA 2D0BA 2B5JA 2RKIA 4LSNA 1RDDA 4E89A 4CEFA 4DTPA 1LWWA 4CGDA 3TAPA 4RW7A 4DMNA 1GOBA 1RDCA 3AA2A 4ELTA 4OKKA 4KHQA 1TL3A 3THVA 3MEEA 3ZSVA 3KLHA 2XY5A 5CYQA 4HUGA 3KD1E 4M3XA 1EXQA 1MP9A 1J54A 1GOAA 2WOMA 2VG7A 2X6SA 3NH2A 3L2VA 1QTPA 1E42A 1VSDA 2Z1IA 3OS1A 4E7JA 5HLFA 4KB0A 2P1JA 1RTJA 4BWJA 4CESA 4HUFA 4NCGA 3TAQA 1A5VA 4AHUA 4W5QA 1KYDA 1RT7A 1TVRA 3M8QA 1YTUA 1LAWA 1QSSA 1Z26A 3I0XA 1WSGA 4IFVA 3HPOA 3LWLA 2HVIA 3NFAA 4IG0A 4FM0A 4B9NA 4ROCB 4E19A 3SUQA 1KSPA 4O0JA 4RW4A 2FGTA 3DLGA 4CFAA 3HJFA 2FBYA 4DSLA 1RNHA 4CF0A 1R4XA 3K2PA 5HRRA 2BDPA 2FBVA 5J1EA 1JXEA 1VSFA 5CZ1A 4BE2A 2Z1HA 5KGWA 4DTRA 3SQ0A 4C8LA 1CXQA 5DK5A 1VRTA 4CIEA 4RODB 4OJRA 4CGGA 4KHSA 2OA8A 3KLIA 2KTQA 4Z4GA 1D8YA 2HB5A 3T1AA 4FXDA 1AISA 5K14A 4C8MA 4CHYA 4YNQA 4O5BA 2RF2A 1HNVA 4FCYA 2MZ8A 1RT2A 2KZZA 1NKBA 4FJ5A 3AVGA 4FK4A 1S9GA 3VQQA 3RTVA 5HROA 2IV8A 3RR8A 3OYJA 4KI6A 3OYDA 4B3OA 4MQ3A 1YQLA 1XI1A 1VSJA 5CZ2A 4BACA 2A1SA 1Y97A 5D3GA 2ETJA 2IGIA 4CJRA 1D3UA 3QETA 2QXFA 2O4IA 3OSMA 5C42A 1KVCA 1EBMA 1WSEA 1XHZA 4FM2A 1L3UA 1J5OA 2HHUA 4K8ZA 4DF8A 1BIZA 1PCZA 3KKRA 3VQBA 2NOEA 4N41A 3O3GA 4KRFA 3SYZA 4PUOA 3DRRA 1QNAA 3OSTA 4O0IA 3ULXA 3NF8A 1LWCA 4OPJA 3M8PA 1TL1A 1WSFA 4CE9A 2D0AA 1JLFA 4DU3A 2G8UA 3IH7A 2E6MA 5J2NA 4W5TA 1ZBUA 3AVFA 5T7BA 4DWIA 5CYMA 4XIUA 1YVUA 3NE6A 1BQNA 4BDPA 1QN6A 2NOHA 1XHXA 3HYFA 3HO1A 2KFZA 4CEOA 1EP4A 4FJGA 1K6YA 4ZHRA 3SQ2A 1UOCA 3AA4A 1KY6A 1F21A 1KO9A 4NYNA 3S3MA 1DTTA 1SL0A 4KTQA 4NYFA 4H8KA 1TK8A 1QTMA 2GV9A 4EZ9A 3VA3A 1N5YA 1IKVA 3VQ6A 1VSIA 1TV6A 1YTBA 1VK0A 4FM1A 3SNNA 2A1RA 3LP2A 4DQPA 3LAKA 3L2UA 2VG5A 3MEGA 4DTNA 3PX0A 1SKRA 1C1BA 4CFCA 4IBNA 3VQ5A 5J2QA 2YNHA 4RW9A 1SKSA 1NK0A 2F8SA 1CDWA 1QN8A 4DFKA 4O55A 3LP0A 2Y1JA 4E0DA 3AO2A 1QSYA 4M3WA 1TKZA 4ELUA 3CFPA 4E7HA 1S9EA 1HNIA 1XC9A 1RBUA 4QCLA 5C25A 4K8XA 4I9QA 4HCCA 3TAEA 4NCAA 4HHTA 2FC0A 3CM5A 3VQPA 3V1OA 4DFMA 1SKWA 3DLBA 1ZBHA 3AVMA 3VQAA 4CJSA 3F73A 4Z4FA 2HZSA 3AVHA 3VQ4A 3HL8A 3C6TA 1KYFA 4HVJA 1Z25A 1ASVA 4DLGA 3SPYA 4FW1A 3KRMA 2ATQA 3U3GA 3OYMA 3RMBA 5I3UA 4FVMA 2FBTA 1NK6A 2EX3A 1LW0A 3DYAA 4LY7A 4BWMA 2XHBA 3L2WA 4DQSA 2PZSA 1HMVA 5IYCP 4PQUA 3SQ1A 2VG6A 3WNFA 4I8OA 4CIFA 3K5NA 4CFDA 4FJ8A 4M3YA 4AHVA 4CGFA 4OLBA 4EZ6A 4CF8A 4FLUA 1JKHA 4CEDA 3OYLA 2PY5A 4BDZA 2YNGA 4OKEA 4OPKA 4B9TA 1NJXA 4F3TA 4Y1CA 1LW2A 2Q3SA 2PYLA 3SCXA 1QNBA 3V9ZA 5HP1A 1BL3A 2GBZA 1BQMA 1EETA 2HNYA 5KI6A 3S9HA 3ZSOA 3LP3A 1TGOA 2P5GA 3ISNC 4FZYA 1VOLB 1JLEA 4CHOA 2G8KA 3T3FA 3PX6A 3VQ7A 1KVBA 3IS9A 3NHGA 3V9WA 1QE1A 4FJMA 3CFRA 1GOCA 1W9HA 1L3TA 3P83D 1C6VA 2OPQA 3KK1A 4RG8A 1NJZA 4OLAA 1IO2A 4M3RA 4QOZB 4W5NA 2XO7A 1BCMA 3OYIA 3NDKA 4AHSA 4I2PA 4DSEA 4CK2A 4KHNA 1LAVA 4PY5A 4IKFA 1J9AA 1B9FA 4DQRA 1BI4B 3LAMA 1QN7A 1NOZA 1VRUA 1RM1A 3RRHA 4FJJA 1B9KA 1C1AA 4ELVA 3H08A 2HW3A 5JS1A 4B0AA 2O3OA 1C0UA 4FW2A 3KK3A 1S1XA 3WNHA 3ZT4A 3LDSA 1EX4A 3NAEA 1RT4A 4DTSA 4CF9A 1CZ9A 2R7YA 1TAUA 4UQGA 4PWDA 2LAEA 1UWBA 3NF9A 3P1GA 4CFBA 4C8NA 3ZT3A 4CEEA 3VQ8A 4Q5VA 3T19A 5FDLA 4JRQA 3IG1A 2MJ7A 1KRPA 3FFIA 3DLRA 4F2RA 1BCOA 1RCHA 4GW6A 4CJEA 1Q9YA 2IOCA 3QEXA 3AA3A 1U49A 1D9FA 3AVKA 4KFBA 2PYJA 1FKPA 3IAYA 2VWJA 3AO4A 2HHQA 2XHIA 4LD0A 3DMJA 2WONA 1L3VA 3OYKA 2KZMA 2JOIA 3OJUA 1X9WA 4DSIA 4M41A 4KO0A 4EJYA 1IKXA 3ZSZA 4BE1A 4DU4A 2JLEA 2IC3A 3OCIA 1PZDA 4OVLA 2E6LA 3OS0A 3DPUA 1X9MA 1S1WA 4Q0BA 4TSXA 1QNEA 3EZ5A 2YH5A 3PO4A 4AHRA 5HRSA 3ALYA 2DFHA 5KRTA 2B6AA 4IDKA 4OKJA 4N76A 2OPSA 4RW8A 3DLEA 3AO3A 5FROA 3S3NA 3I0RA 1JLGA 4CECA 4CK1A 2HHTA 1UA1A 3LANA 4Z0UA 4CJKA 3LZIA 2NOLA 3C6UA 1UT4A 3KJVA 3QEWA 1JLQA 3LPTA 2DTUA 1JLAA 1FKOA 4N5SA 3V9SA 3ZSYA 1RBVA 3V1RA 4QAGA 1S1VA 3TI0A 3TANA 1WSIA 3ZSRA 2HHWA 1U04A 3F0ZA 1CXUA 1XWLA 2B4JA 3JSMA 4DS5A 3K57A 1D9DA 4ZTFA 4B9MA 2NUBA 4CHZA 2VWKA 3RWUA 1TAQA 1J53A 4B9UA 4FZZA 1D5AA 1JLBA 1RBSA 3L2RA 5EU7A 3OYHA 4ZTJA 3LWMA 4FLVA 1HYVA 3VN5A 3ZCMA 1YTAA 4Z4HA 3OC3C 3AVJA 3TABA 4J2AA 3TR8A 3SUPA 2NOFA 2DY4A 4BDYA 4CJQA 4CEAA 2I5WA 1WSJA 1HRHA 1JL2A 1JLCA 3JYTA 3ASMA 2VJ0A 1TKDA 1YQKA 4YFUA 4FLWA 4DTOA 4DSFA 4ID1A 3NGZA 2RPIA 1SL1A 3TAMA 4B9VA 1WNSA 2O4GA 4E7LA 1LWVA 4DF4A 1HJRA 3I0WA 1I39A 3WNEA 3LPUA 3NF7A 3U3YA 1TBPA 1QTSA 4LSLA 1RILA 4B8CA 4EP5A 3C95A 3OYBA 3ZT0A 5E41A 3RR7A 3SUOA 2HHXA 1LWEA 4MFBA 4F8RA 1L5UA 4KREA 3NH0A 4DULA 4IFYA 3ZT2A 3QEIA 2ITGA 2YKNA 4AH9A 5IYDP 4JRPA 2Z8UA 3E01A 3QEPA 1NK9A 4LH4A 3PO5A 1FXXA 2NOBA 4GVMA 3D45A 3BGRA 1RDBA 3I8DA 4J2EA 4FK2A 2GUIA 3AO5A 2IS3A 1UAXA 3O4QA 3VQEA 1ZYQA 1BI4A 1M3HA 3HSTB 5KTQA 3CFOA 1FK9A 2X78A 3K59A 4FJKA 3CM6A 1ASUA 1HYSA 3DOLA 1QN3A 4HUEA 3TARA 4FZXC 4FJ9A 3NH1A 4O44A 3MXIA 3DM2A 3OVNA 3NF6A 1YQMA 2JGUA 4AHTA 4DG1A 5FRNA 3B6PA 3NGYA 1HPZA 4TPSA 1HQEA 1U48A 3SNSA 1BHLA 1NH2A 3KIOA 4DQIA 3KD5E 3KLEA 1NK4A 3D0PA 3MXMA 4CJFA 1C0TA 3VA0A 2IDOA 5J2PA 2KW4A 4F4KA 3B6OA 2DFFA 2Y1IA 3TAFA 3SUNA 3RMDA 4JS5A 3C94A 3QERA 3NBPA 1IG9A 1RT3A 4B9SA 4DQQA 3HP9A 1WAFA 4FJNA 1QS4A 1RTIA 4M3UA 5IYBP 4RW6A 3VQCA 1N3AA 5J2MA 5C24A 2QKKA 2Z1JA 3ZSQA 3U6FA 1ZBIA 3KLFA 4CIGA 4FLXA 3ZSWA 1ZBLA 4Z4IA 1IKWA 1RDAA 4B8AB 3K58A 1U4BA 3DLKA 3QNOA 4DLEA 1TK5A 1RTDA 3LALA 5SWMA 4M42A 1NKCA 2OYQA 4FJ7A 4FJXA 3RMCA 2E4LA 1MU2A 3AV9A 4CHPA 1QNCA 2XRIA 3PV8A 3PY8A 3OYAA 1QN9A 3SZ2A 3S3OA 3N89A 1RBRA 3L8BA 3QESA 2XY7A 4J2DA 1TKTA 3G10A 1RBTA 2BGGA 3SV4A 4JS4A 2YNIA 1BISA 1NK8A 3UIQA 1A5XA 3WNGA 1RTHA 3TWHA 3KTQA 4AHCA 4DTUA 2YKMA 1R0AA 1SL2A 4R5PA 2OPPA 4CJ4A 3HM9A 1JFIC 4O4GA 4H4MA 1VSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KLM A;  4CER A;  3HPH A;  1TKX A;  1NKE A;  1T05 A;  1S1T A;  4KV8 A;  2OZM A;  2HHV A;  3QIN A;  3L3U A;  4CF2 A;  1A5W A;  1KFS A;  1IKY A;  4DTM A;  2BAN A;  1KTQ A;  1WAJ A;  3PUF A;  5HRP A;  4HTU A;  3AO1 A;  3QIO A;  3K5M A;  1YTF A;  4DU1 A;  4KPY A;  2ZE2 A;  1QQC A;  4CEQ A;  3IRX A;  3L2Q A;  3QIP A;  4G1Q A;  4CJP A;  2AJQ A;  4Z4C A;  3OYC A;  4DS4 A;  3HXM A;  4EP4 A;  1TBA B;  3AVL A;  4CHN A;  3SI6 A;  1KLN A;  1T8E A;  1TGH A;  3DRS A;  4WZS D;  1VSE A;  4OGE A;  4E7K A;  1T7P A;  3SQ4 A;  4FJL A;  3VQ9 A;  4B08 A;  2YHB A;  1KY7 A;  3AVI A;  3AVA A;  2G8H A;  3NGI A;  3RRG A;  1S6P A;  2EHG A;  2IV9 A;  2X6N A;  3V9X A;  1WN7 A;  2ZQB A;  3HPG A;  3OS2 A;  4IG3 A;  4Y1D A;  4DTJ A;  1RT6 A;  4B9L A;  1TK0 A;  4M3Z A;  3M8S A;  2F8T A;  2HND A;  2P5O A;  1NJY A;  2QKB A;  5KRS A;  1WLJ A;  2I5J A;  3NCI A;  4FLT A;  3PX4 A;  5FRM A;  1C0M A;  2Z1G A;  4DFP A;  1BIU A;  1NJW A;  4FYD A;  3MAQ A;  2G30 A;  4AIL C;  1G15 A;  5JS2 A;  4F3O A;  3H1Z A;  3SV3 A;  2D5R A;  4C8O A;  3I0S A;  1KVA A;  3P5J A;  4JLH A;  3HS8 A;  4DSJ A;  1S6Q A;  3KLG A;  1VSL A;  3EY1 A;  4F2S A;  2BE2 A;  1WSH A;  2LSN A;  4CCH A;  4KHW A;  1ITG A;  4W5R A;  4FJH A;  4WE1 A;  1NVP A;  4I9L A;  1VOK A;  3OJS A;  3DLH A;  1I3A A;  4CJ5 A;  3A2F A;  2OPR A;  4KTZ A;  3CQ8 A;  3V6D A;  1QN5 A;  4KKO A;  4E1M A;  1RT5 A;  4CGI A;  3O3H A;  3QEV A;  1X9S A;  3QLH A;  4BE0 A;  4CHQ A;  1KYU A;  4ROE B;  1VSH A;  1QSL A;  1VSM A;  2G8W A;  4C8K A;  4KTW A;  4Z4E A;  3SJJ A;  5CY4 A;  2YV0 X;  1KCF A;  3V81 A;  4KHY A;  1W0H A;  1NK7 A;  4CEZ A;  4CF1 A;  1Q9X A;  1DTQ A;  5KGX A;  2D0C A;  1CZB A;  4E3S A;  1X1P A;  2G8I A;  1SUQ A;  3V4I A;  3M8R A;  1S1U A;  1QN4 A;  3QO9 A;  4H4O A;  2XY6 A;  4CJ3 A;  1DLO A;  4CK3 A;  2OZS A;  1W80 A;  1EKE A;  3V1Q A;  3AVN A;  3ULD A;  4DSK A;  3HS9 A;  4FLZ A;  1KFD A;  3KK2 A;  3OYF A;  3K5L A;  2KFN A;  3G0Z A;  1CLQ A;  2QK9 A;  1IH7 A;  4CGJ A;  2HVH A;  3KKS A;  4M3T A;  1T03 A;  2HNZ A;  3DRP A;  1LWF A;  1C9B B;  3K5O A;  5DMR A;  2DFE A;  1ZBF A;  2FBX A;  3HP6 A;  1UA0 A;  4KHU A;  1NK5 A;  4DFJ A;  3LZJ A;  1S5J A;  4KAZ A;  4CJV A;  2G8F A;  2W42 A;  3DI6 A;  4OGC A;  4FJI A;  3HK2 A;  3SPZ A;  5HRN A;  4CEB A;  4DTX A;  1REV A;  5I42 A;  3OYE A;  1VTL E;  1B9D A;  1O1W A;  3VQD A;  2X74 A;  3CYM A;  4I7F A;  4CJU A;  4I2Q A;  3OYG A;  1U45 A;  3BDP A;  4KB1 A;  1B92 A;  2YHA A;  3ITH A;  1JXB A;  3HVT A;  4N47 A;  4CGH A;  4E1N A;  4N56 A;  1LV5 A;  3HT3 A;  1SV5 A;  4CJT A;  3OY9 A;  3EYZ A;  4W5O A;  1ASW A;  5HBM A;  1N6Q A;  4L8R B;  3DOK A;  1NOY A;  1BGX T;  2G8V A;  1VTO A;  1YT3 A;  5SZT A;  3AVB A;  4HCB A;  2HMI A;  3LP1 A;  3MXJ A;  1QHT A;  2HHS A;  1RT1 A;  3ZT1 A;  4ICL A;  1HYZ A;  4E7I A;  4J2B A;  1U47 A;  3EIK A;  2P51 A;  1C1C A;  2YNF A;  3O3F A;  2RN2 A;  3MEC A;  4CJL A;  3CG7 A;  3O4N A;  4PA1 A;  2XY8 A;  3V9U A;  3L3V A;  4KI4 A;  3QNN A;  2IAJ A;  4CJW A;  4FK0 A;  2F96 A;  3HVR A;  4ID5 A;  1NGM A;  2ZD1 A;  3TAG A;  3AVC A;  4FLY A;  3OYN A;  1JL1 A;  1HQU A;  4LH5 A;  1Q8I A;  3AA5 X;  4GMJ B;  1L3S A;  3ZSX A;  3MED A;  3F9K A;  2KQ2 A;  4M45 A;  3RMA A;  2D0B A;  2B5J A;  2RKI A;  4LSN A;  1RDD A;  4E89 A;  4CEF A;  4DTP A;  4CGD A;  3TAP A;  4RW7 A;  4DMN A;  1GOB A;  1RDC A;  3AA2 A;  4ELT A;  4OKK A;  4KHQ A;  1TL3 A;  3THV A;  3MEE A;  3ZSV A;  3KLH A;  2XY5 A;  5CYQ A;  4HUG A;  3KD1 E;  4M3X A;  1EXQ A;  1MP9 A;  1J54 A;  1GOA A;  2WOM A;  2VG7 A;  2X6S A;  3NH2 A;  3L2V A;  1QTP A;  1E42 A;  1VSD A;  2Z1I A;  3OS1 A;  4E7J A;  5HLF A;  4KB0 A;  2P1J A;  1RTJ A;  4BWJ A;  4CES A;  4HUF A;  4NCG A;  3TAQ A;  1A5V A;  4AHU A;  4W5Q A;  1KYD A;  1RT7 A;  1TVR A;  3M8Q A;  1YTU A;  1LAW A;  1QSS A;  1Z26 A;  1WSG A;  4IFV A;  3HPO A;  3LWL A;  2HVI A;  3NFA A;  4IG0 A;  4FM0 A;  4B9N A;  4ROC B;  4E19 A;  3SUQ A;  1KSP A;  4O0J A;  4RW4 A;  4CFA A;  3DLG A;  3HJF A;  2FBY A;  4DSL A;  1RNH A;  4CF0 A;  1R4X A;  3K2P A;  5HRR A;  2BDP A;  2FBV A;  5J1E A;  1JXE A;  1VSF A;  5CZ1 A;  4BE2 A;  2Z1H A;  5KGW A;  4DTR A;  3SQ0 A;  4C8L A;  1CXQ A;  5DK5 A;  1VRT A;  4CIE A;  4ROD B;  4OJR A;  4CGG A;  4KHS A;  2OA8 A;  3KLI A;  2KTQ A;  4Z4G A;  1D8Y A;  2HB5 A;  3T1A A;  4FXD A;  1AIS A;  5K14 A;  4C8M A;  4CHY A;  4YNQ A;  4O5B A;  2RF2 A;  1HNV A;  4FCY A;  1RT2 A;  2KZZ A;  1NKB A;  4FJ5 A;  3AVG A;  4FK4 A;  1S9G A;  3VQQ A;  3RTV A;  5HRO A;  2IV8 A;  3RR8 A;  3OYJ A;  4KI6 A;  3OYD A;  4B3O A;  4MQ3 A;  1XI1 A;  1VSJ A;  5CZ2 A;  4BAC A;  2A1S A;  1Y97 A;  5D3G A;  2ETJ A;  2IGI A;  4CJR A;  1D3U A;  3QET A;  2QXF A;  2O4I A;  5C42 A;  1KVC A;  1XHZ A;  1WSE A;  4FM2 A;  1L3U A;  1J5O A;  2HHU A;  4K8Z A;  4DF8 A;  1BIZ A;  1PCZ A;  3KKR A;  3VQB A;  4KRF A;  4N41 A;  3O3G A;  3SYZ A;  4PUO A;  3DRR A;  1QNA A;  4O0I A;  3NF8 A;  4DU3 A;  1LWC A;  4OPJ A;  3M8P A;  1TL1 A;  1WSF A;  4CE9 A;  2D0A A;  1JLF A;  2G8U A;  2E6M A;  5J2N A;  4W5T A;  1ZBU A;  3AVF A;  5T7B A;  4DWI A;  5CYM A;  4XIU A;  1YVU A;  3NE6 A;  1BQN A;  4BDP A;  1QN6 A;  1XHX A;  4NCB A;  3HYF A;  3HO1 A;  2KFZ A;  4CEO A;  1EP4 A;  4FJG A;  1K6Y A;  4ZHR A;  3SQ2 A;  1UOC A;  3AA4 A;  1KY6 A;  1F21 A;  3S3M A;  4NYN A;  1DTT A;  1SL0 A;  4KTQ A;  4NYF A;  4H8K A;  1TK8 A;  1QTM A;  2GV9 A;  4EZ9 A;  3VA3 A;  1N5Y A;  1IKV A;  3VQ6 A;  1VSI A;  1TV6 A;  1YTB A;  1VK0 A;  4FM1 A;  3SNN A;  2A1R A;  3LP2 A;  4DQP A;  3LAK A;  3L2U A;  2VG5 A;  3MEG A;  4DTN A;  3PX0 A;  1SKR A;  1C1B A;  4CFC A;  4IBN A;  3VQ5 A;  5J2Q A;  2YNH A;  4RW9 A;  1SKS A;  1NK0 A;  2F8S A;  1CDW A;  1QN8 A;  4DFK A;  4O55 A;  3LP0 A;  2Y1J A;  4E0D A;  3AO2 A;  1QSY A;  4M3W A;  1TKZ A;  4ELU A;  3CFP A;  4E7H A;  1S9E A;  1HNI A;  1XC9 A;  1RBU A;  4QCL A;  5C25 A;  4K8X A;  4I9Q A;  4HCC A;  3TAE A;  4NCA A;  4HHT A;  2FC0 A;  3CM5 A;  3VQP A;  3V1O A;  4DFM A;  1SKW A;  3DLB A;  1ZBH A;  3AVM A;  3VQA A;  4CJS A;  3F73 A;  4Z4F A;  3AVH A;  3VQ4 A;  3HL8 A;  3C6T A;  1KYF A;  4HVJ A;  1Z25 A;  1ASV A;  4DLG A;  3SPY A;  4FW1 A;  2ATQ A;  3U3G A;  3RMB A;  3OYM A;  5I3U A;  1NK6 A;  4FVM A;  2FBT A;  2EX3 A;  1LW0 A;  3DYA A;  4LY7 A;  4BWM A;  2XHB A;  3L2W A;  4DQS A;  2PZS A;  1HMV A;  5IYC P;  4PQU A;  3SQ1 A;  2VG6 A;  3WNF A;  4CIF A;  3K5N A;  4CFD A;  4FJ8 A;  4M3Y A;  4AHV A;  4CGF A;  4OLB A;  4EZ6 A;  4CF8 A;  4FLU A;  1JKH A;  4CED A;  3OYL A;  2PY5 A;  4BDZ A;  2YNG A;  4OKE A;  4OPK A;  4B9T A;  1NJX A;  4F3T A;  4Y1C A;  1LW2 A;  2Q3S A;  2PYL A;  3SCX A;  1QNB A;  3V9Z A;  1BL3 A;  2GBZ A;  1BQM A;  1EET A;  2HNY A;  5KI6 A;  3S9H A;  3ZSO A;  3LP3 A;  1TGO A;  2P5G A;  3ISN C;  4FZY A;  1VOL B;  1JLE A;  4CHO A;  2G8K A;  3T3F A;  3PX6 A;  3VQ7 A;  1KVB A;  3IS9 A;  3NHG A;  3V9W A;  1QE1 A;  4FJM A;  3CFR A;  1GOC A;  1W9H A;  1L3T A;  3P83 D;  1C6V A;  2OPQ A;  3KK1 A;  4RG8 A;  1NJZ A;  4OLA A;  1IO2 A;  4M3R A;  4QOZ B;  4W5N A;  2XO7 A;  1BCM A;  3OYI A;  3NDK A;  4AHS A;  4I2P A;  4DSE A;  4CK2 A;  4KHN A;  1LAV A;  4PY5 A;  4IKF A;  1J9A A;  1B9F A;  4DQR A;  1BI4 B;  3LAM A;  1QN7 A;  1NOZ A;  1VRU A;  1RM1 A;  3RRH A;  4FJJ A;  1B9K A;  1C1A A;  4ELV A;  3H08 A;  2HW3 A;  5JS1 A;  4B0A A;  1C0U A;  4FW2 A;  3KK3 A;  1S1X A;  3WNH A;  3ZT4 A;  3LDS A;  1EX4 A;  3NAE A;  1RT4 A;  4DTS A;  4CF9 A;  1CZ9 A;  2R7Y A;  1TAU A;  4UQG A;  4PWD A;  1UWB A;  3NF9 A;  3P1G A;  5HP1 A;  4CFB A;  4C8N A;  3ZT3 A;  4CEE A;  3VQ8 A;  4Q5V A;  3T19 A;  5FDL A;  4JRQ A;  3IG1 A;  2MJ7 A;  1KRP A;  3FFI A;  3DLR A;  4F2R A;  1BCO A;  1RCH A;  4GW6 A;  4CJE A;  1Q9Y A;  2IOC A;  3QEX A;  3AA3 A;  1U49 A;  1D9F A;  3AVK A;  4KFB A;  2PYJ A;  1FKP A;  3IAY A;  2VWJ A;  3AO4 A;  2HHQ A;  4LD0 A;  3DMJ A;  2WON A;  1L3V A;  3OYK A;  2KZM A;  3OJU A;  1X9W A;  4DSI A;  4M41 A;  4KO0 A;  1IKX A;  3ZSZ A;  4BE1 A;  4DU4 A;  2JLE A;  3OCI A;  1PZD A;  4OVL A;  2E6L A;  3OS0 A;  1X9M A;  1S1W A;  4Q0B A;  4TSX A;  1QNE A;  3EZ5 A;  3PO4 A;  4AHR A;  5HRS A;  3ALY A;  2DFH A;  5KRT A;  2B6A A;  4IDK A;  4OKJ A;  4N76 A;  2OPS A;  4RW8 A;  3DLE A;  3AO3 A;  5FRO A;  3S3N A;  3I0R A;  1JLG A;  4CEC A;  4CK1 A;  2HHT A;  1UA1 A;  3LAN A;  4Z0U A;  4CJK A;  3LZI A;  3C6U A;  3KJV A;  3QEW A;  1JLQ A;  3LPT A;  2DTU A;  1JLA A;  1FKO A;  4N5S A;  3V9S A;  3ZSY A;  1RBV A;  3V1R A;  4QAG A;  1S1V A;  3TI0 A;  3TAN A;  1WSI A;  3ZSR A;  2HHW A;  1U04 A;  1CXU A;  1XWL A;  2B4J A;  3JSM A;  4DS5 A;  3K57 A;  1D9D A;  4ZTF A;  4B9M A;  2NUB A;  4CHZ A;  2VWK A;  3RWU A;  1TAQ A;  1J53 A;  4B9U A;  4FZZ A;  1D5A A;  1JLB A;  1RBS A;  3L2R A;  5EU7 A;  3OYH A;  4ZTJ A;  3LWM A;  4FLV A;  1HYV A;  3VN5 A;  3ZCM A;  1YTA A;  4Z4H A;  3OC3 C;  3AVJ A;  3TAB A;  4J2A A;  3TR8 A;  3SUP A;  2DY4 A;  4BDY A;  4CJQ A;  4CEA A;  1WSJ A;  1HRH A;  1JL2 A;  1JLC A;  3JYT A;  3ASM A;  2VJ0 A;  1TKD A;  4YFU A;  4FLW A;  4DTO A;  4DSF A;  4ID1 A;  3NGZ A;  2RPI A;  1SL1 A;  3TAM A;  4B9V A;  1WNS A;  2O4G A;  4E7L A;  4DF4 A;  3U3Y A;  1HJR A;  1I39 A;  3WNE A;  3LPU A;  3NF7 A;  1TBP A;  1QTS A;  4LSL A;  1RIL A;  4B8C A;  4EP5 A;  3C95 A;  3OYB A;  3ZT0 A;  5E41 A;  3RR7 A;  3SUO A;  2HHX A;  1LWE A;  4MFB A;  4F8R A;  1L5U A;  4KRE A;  3NH0 A;  3QEI A;  4IFY A;  3ZT2 A;  2ITG A;  2YKN A;  4AH9 A;  5IYD P;  4JRP A;  2Z8U A;  3E01 A;  3QEP A;  1NK9 A;  4LH4 A;  3PO5 A;  1FXX A;  4GVM A;  3D45 A;  3BGR A;  1RDB A;  3I8D A;  4J2E A;  4FK2 A;  2GUI A;  3AO5 A;  2IS3 A;  1UAX A;  3O4Q A;  3VQE A;  1ZYQ A;  1BI4 A;  3HST B;  5KTQ A;  3CFO A;  1FK9 A;  2X78 A;  3K59 A;  4FJK A;  3CM6 A;  1ASU A;  1HYS A;  3DOL A;  1QN3 A;  4HUE A;  3TAR A;  4FZX C;  4FJ9 A;  3NH1 A;  4O44 A;  3MXI A;  3DM2 A;  3OVN A;  3NF6 A;  2JGU A;  4AHT A;  4DG1 A;  5FRN A;  3B6P A;  3NGY A;  1HPZ A;  1HQE A;  1U48 A;  1BHL A;  1NH2 A;  3KIO A;  4DQI A;  3KD5 E;  3KLE A;  1NK4 A;  3D0P A;  3MXM A;  4CJF A;  1C0T A;  3VA0 A;  2IDO A;  5J2P A;  2KW4 A;  4F4K A;  3B6O A;  2DFF A;  2Y1I A;  3TAF A;  3SUN A;  3RMD A;  4JS5 A;  3C94 A;  3QER A;  3NBP A;  1IG9 A;  1RT3 A;  4B9S A;  4DQQ A;  3HP9 A;  1WAF A;  4FJN A;  1QS4 A;  1RTI A;  4M3U A;  5IYB P;  4RW6 A;  3VQC A;  2QKK A;  5J2M A;  5C24 A;  2Z1J A;  3ZSQ A;  3U6F A;  1ZBI A;  3KLF A;  4CIG A;  4FLX A;  3ZSW A;  1ZBL A;  4Z4I A;  1IKW A;  1RDA A;  4B8A B;  3K58 A;  1U4B A;  3DLK A;  3QNO A;  4DLE A;  1TK5 A;  1RTD A;  3LAL A;  5SWM A;  4M42 A;  1NKC A;  2OYQ A;  4FJ7 A;  4FJX A;  3RMC A;  2E4L A;  1MU2 A;  3AV9 A;  4CHP A;  1QNC A;  1VSK A;  2XRI A;  3PV8 A;  3PY8 A;  3OYA A;  1QN9 A;  3SZ2 A;  3S3O A;  1RBR A;  3L8B A;  3QES A;  4J2D A;  2XY7 A;  1TKT A;  3G10 A;  1RBT A;  2BGG A;  3SV4 A;  4JS4 A;  2YNI A;  1BIS A;  1NK8 A;  3UIQ A;  1A5X A;  3WNG A;  1RTH A;  3TWH A;  3KTQ A;  4AHC A;  4DTU A;  2YKM A;  1R0A A;  1SL2 A;  4R5P A;  2OPP A;  4CJ4 A;  3HM9 A;  1JFI C;  4O4G A;  4H4M A;  2IC3 A; 
#chains in the Genus database with same CATH topology
 3DPT A;  4KV8 A;  4CZE A;  2NLV A;  4DV5 K;  3EZW A;  4FWL A;  1IKY A;  3CJ9 A;  3F10 A;  5HRP A;  3K5M A;  1GLD G;  2ZE2 A;  4CEQ A;  4DV3 K;  3TE5 A;  1FN7 A;  2VQF K;  4ISE A;  3WT0 A;  1J6Z A;  4EP4 A;  1SS6 A;  3HTV A;  1T8E A;  1T7P A;  4WZS D;  1VSE A;  4E7K A;  3SQ4 A;  3VQ9 A;  1EO1 A;  4B08 A;  2YHB A;  1LWY A;  2UYT A;  2X6N A;  3C65 A;  3CMA N;  3DJC A;  4DTJ A;  4HJH A;  2HHH K;  4M3Z A;  3MN5 A;  2EHB D;  1YJN N;  4BRM A;  2I5J A;  2Z1G A;  4CBU A;  1NMN A;  2J4R A;  2G30 A;  3CCR N;  4F3O A;  3U9Z A;  4BRG A;  5LMN K;  3KTU A;  1NVP A;  4KBO A;  2GX9 A;  1HNX K;  4I9L A;  3DLH A;  1UT7 A;  2OPR A;  4FO0 A;  1QN5 A;  3O3H A;  1JCE A;  3IFR A;  1TUU A;  1HU0 A;  3F9M A;  2QI2 A;  2G8W A;  4C8K A;  4BRC A;  2D0C A;  1CZB A;  1HNW K;  2G8I A;  3J7A P;  3FFK B;  2O8D A;  3O9Q A;  1YIT N;  3BF3 A;  3O8M A;  2P9P A;  4CJ3 A;  3GOI A;  4CK3 A;  4U7B A;  4ISG A;  2UU9 K;  2KFN A;  1T6C A;  5JVG L;  2JHN A;  2Q1N A;  1IBM K;  3KKS A;  3DRP A;  2DPN A;  5DMR A;  3OBY A;  2WC9 A;  3E9P A;  3QFP A;  3J7Z O;  1M1K O;  1GLJ O;  5HRN A;  5BPL A;  3PSF A;  1U4B A;  1VTL E;  2HBK A;  2NRT A;  3VQD A;  4KB0 A;  4KB1 A;  1B92 A;  2P9S B;  3ITH A;  1JXB A;  4CGH A;  2UXD K;  2VYP A;  4H0Y B;  1ASW A;  4W5O A;  5BR8 K;  5SZT A;  4RCH A;  3AVB A;  4FPB A;  3MXJ A;  1RT1 A;  2I7P A;  3CQX A;  1M3Q A;  4EAJ A;  2RN2 A;  4YDU C;  3SK3 A;  3WXJ A;  3DXK A;  2XY8 A;  3WXL A;  4NXN K;  4CJW A;  4FK0 A;  1HJO A;  4MDB A;  1Q8I A;  4GMJ B;  1L3S A;  3UW2 A;  2PBD A;  4E89 A;  4IEI A;  4BRE A;  4BRD A;  4DTP A;  4DMN A;  1GOB A;  4ELT A;  2FSN A;  4B3M K;  4BC4 A;  2D0P A;  2XY5 A;  4HUG A;  5B8H A;  4M3X A;  3DWL A;  1MP9 A;  2F9T A;  4O8U A;  2Z1I A;  3J81 O;  3TAQ A;  1A5V A;  4CVN E;  4KHP K;  1RT7 A;  3M8Q A;  4IFV A;  3MMV A;  2HBM A;  1JJ2 M;  4O0J A;  1BG3 A;  1N33 K;  5AQK A;  1K9M O;  1VQ7 N;  4BE2 A;  2NVM A;  1RFQ A;  5CZ1 A;  4C8L A;  5KGW A;  1EWQ A;  3ENO A;  4IZ9 A;  3O80 A;  5AZJ B;  5E84 A;  3C7N A;  3VEV A;  2KTQ A;  4Z4G A;  1D8Y A;  4M63 C;  4H0O A;  3T1A A;  1WJW A;  5K14 A;  1VAZ A;  4YNQ A;  1RT2 A;  2KZZ A;  1NKB A;  2H4L X;  2IV8 A;  1D4X A;  3CF5 L;  4LF7 K;  1YQL A;  4FWQ A;  5CZ2 A;  4BAC A;  2IGI A;  2QXF A;  2O4I A;  3OSM A;  1KVC A;  1DGK N;  1EBM A;  1WSE A;  2F7T A;  3THW A;  1XHZ A;  1L3U A;  4DF8 A;  4CBW A;  1PCZ A;  1Y64 A;  1NMD A;  4D7Q A;  2QRC A;  2NWV A;  4OPH A;  3ULX A;  1J3M A;  3CCL N;  4DWI A;  5CYM A;  3NE6 A;  1QN6 A;  1K6Y A;  1KY6 A;  2JWL A;  3DXM B;  1S72 N;  1RGI A;  3G4S N;  3A0I X;  1TV6 A;  2YHX A;  5C10 A;  3LP2 A;  3CET A;  3LAK A;  3L2U A;  4DTN A;  1LCU A;  4BJU A;  3VQ5 A;  2YNH A;  1CDW A;  4EHT A;  2DKA A;  3CME N;  1P5D X;  3LP0 A;  4E0D A;  2QWQ A;  1QSY A;  1LXT A;  4MRQ A;  5FLX O;  2V7Y A;  4EAH D;  1HNI A;  4QCL A;  1QQO A;  4BY9 C;  4NCA A;  4JK7 A;  2FC0 A;  3CM5 A;  3VQP A;  4IXC A;  1SKW A;  3DLB A;  2NRX A;  3AVM A;  4XH1 A;  3HL8 A;  3C6T A;  1KYF A;  5LL6 Z;  4G9Z A;  3RMB A;  3KRM A;  3U3G A;  2FBT A;  2EX3 A;  3DYA A;  4DQS A;  5JIC A;  3HBT A;  2PZS A;  4I8O A;  3K5N A;  4FJ8 A;  4JI8 K;  3OYL A;  3VER A;  1JCF A;  4OKE A;  2Q97 A;  4MLE A;  4IDH A;  4F3T A;  2PYL A;  2NLX A;  3CER A;  2GBZ A;  3D6R A;  4CZG A;  2CGK A;  3TTD A;  1JLE A;  2G8K A;  3T3F A;  3CFR A;  2E2N A;  2QWM A;  1L3T A;  4FL9 A;  5EXW A;  2OPQ A;  1W97 L;  2W6L A;  4LFA K;  4JD2 B;  3PIP L;  4OLA A;  1IO2 A;  4M3R A;  4W5N A;  3WEE B;  2XO7 A;  4H5T A;  1C0F A;  3RRH A;  4FJJ A;  3CD6 N;  2O3O A;  4FW2 A;  3KK3 A;  2I7N A;  3H1V X;  3GDQ A;  2R7Y A;  1J5E K;  4PWD A;  1UWB A;  3NF9 A;  3P1G A;  4JRQ A;  3VQ8 A;  1OVY A;  4LFB K;  1XUP O;  1KRP A;  2Y8L A;  4AQY K;  1QQN A;  1RCH A;  2IOC A;  3QEX A;  3IAY A;  5AQF A;  1RDU A;  3AO4 A;  5M1P A;  2ZGZ A;  4FWK A;  1NGB A;  2WON A;  3OYK A;  2JOI A;  3TDH A;  4DSI A;  3E9L A;  4WQ4 C;  4EJY A;  1RDW X;  3O1W A;  3FLC O;  2E6L A;  3OLP A;  4IFE A;  1G99 A;  1X9M A;  1WUA A;  1QNE A;  3EZ5 A;  1XNR K;  2O8C A;  4DV1 K;  4IDK A;  3E1Y A;  3VEY A;  4B3S K;  3S3N A;  4CD1 A;  3W3D A;  4CEC A;  5AQW A;  3LAN A;  3LZI A;  2NOL A;  2E2Q A;  3V9S A;  3V1R A;  4QAG A;  3TAN A;  4YOT A;  2B4J A;  2NUB A;  4CHZ A;  3D2E A;  3T1H K;  1RBS A;  4BR7 A;  4ILJ A;  3OSE A;  5EU7 A;  4ZTJ A;  4MDA A;  4B9Q A;  1VQ9 N;  4Z4H A;  3TAB A;  5HOO A;  3D2F A;  2NOF A;  4X66 K;  5BR9 A;  3P39 A;  2ZJR L;  1YQK A;  3CJ1 A;  4FLW A;  4DTO A;  2ASP A;  3ZEU A;  3TAM A;  1NJI O;  1WNS A;  1HJR A;  1I39 A;  5AQY A;  4JKD A;  2AP1 A;  1QTS A;  3OYB A;  4GY2 B;  4F8R A;  1L5U A;  4AH9 A;  3IDH A;  2QM1 A;  4LF6 K;  3E01 A;  3J7Y P;  1FXX A;  1KXP A;  3BGR A;  4FK2 A;  5AJ3 K;  4IWV A;  2D0O A;  4CZI A;  5KTQ A;  3CFO A;  4FJK A;  3FZF A;  3K59 A;  2PAV A;  5FPM A;  2ASM A;  3DOL A;  1QN3 A;  1GLE G;  3NH1 A;  4DR3 K;  1BDG A;  3CW7 A;  4DG1 A;  3B6P A;  4OX9 K;  3CCU N;  1IBL K;  3KIO A;  4IO9 L;  3MDQ A;  3CJ7 A;  1W2B M;  2KW4 A;  2ZJP L;  1OH8 A;  1IG9 A;  3SUN A;  4KI4 A;  1RT3 A;  2O8D B;  2KKZ A;  3KZB A;  1H1V A;  5J2M A;  3ZSQ A;  4BRK A;  2VWB A;  3LDP A;  1RDA A;  3VGL A;  4B8A B;  1TUY A;  3ZX2 A;  4DLE A;  1RTD A;  5A2Q O;  2OYQ A;  4FJX A;  3RMC A;  1MU2 A;  1QNC A;  1HUX A;  3OYA A;  3AY9 A;  4DQ8 A;  3ZLJ A;  2BGG A;  3G10 A;  1NK8 A;  1A5X A;  1WQA A;  4JKC A;  1U2V A;  3WNG A;  3I56 N;  3TWH A;  3HM9 A;  1KLM A;  4CER A;  3T1Y K;  1WBB A;  1IBK K;  2HHV A;  5F9C A;  3L3U A;  2UUB K;  1YF5 L;  2W41 A;  1KTQ A;  1N36 K;  1MPG A;  2NOZ A;  3VEO A;  4KPY A;  3BEX A;  5AQH A;  3HRG A;  3QIP A;  5M1F A;  4CJP A;  3RPJ A;  4Z4C A;  3DXK B;  4CHN A;  1X9J A;  3AVL A;  1QVF M;  3SI6 A;  1E4G T;  3MN9 A;  4OGE A;  4FJL A;  1DKG D;  1IG8 A;  5CR4 A;  2QW9 A;  3AVI A;  5IWA K;  4IEE A;  1S6P A;  3F2K A;  4DR4 K;  3Q7C A;  2ZQB A;  3NVK A;  1P5G X;  4LF5 K;  3ZX3 A;  3PLA A;  4JV5 K;  3M8S A;  1YJW N;  2YX6 A;  2HND A;  1YQR A;  1WLJ A;  3NCI A;  3PX4 A;  4B1Z A;  2YHY A;  1C0M A;  2HZM A;  4QS8 A;  4MO4 A;  5JS2 A;  3SV3 A;  4C8O A;  4EIA A;  3P5J A;  1OVQ A;  4B3T K;  1VSL A;  3H3O B;  4JI4 K;  2LSN A;  4JHD B;  3TSQ A;  1ITG A;  3P4I A;  3VEN A;  5GIO A;  1T6A A;  4BRN A;  1I3A A;  3FZL A;  4KTZ A;  3CQ8 A;  3H1Q A;  4KKO A;  3QEV A;  5H1S Q;  1RT5 A;  3QLH A;  1HKG A;  4LFC K;  4Z4E A;  4QG5 A;  3OBW A;  4KTW A;  1KCF A;  4KHY A;  4EFH A;  4CF1 A;  1DTQ A;  3C7N B;  4IL8 A;  3ZX0 A;  3L0Q A;  2QR1 A;  3VTI A;  5KQ8 A;  1S1U A;  5GIN A;  2OZS A;  3V1Q A;  1I94 K;  3AVN A;  3TSP A;  4H5R A;  4FLZ A;  1OH5 A;  1KFD A;  3KK2 A;  3OYF A;  3K5L A;  3FZK A;  1IH7 A;  4M3T A;  4H0T B;  3H46 O;  3J80 O;  1LWF A;  3K5O A;  3P31 A;  3THW B;  1NK5 A;  4WF9 L;  4DFJ A;  1S5J A;  4GVE A;  3SPZ A;  5EVZ A;  4C1N K;  3P38 A;  1U45 A;  3OYG A;  2QEX N;  3OGD A;  4N47 A;  3HVT A;  4ILH A;  1LV5 A;  3VPZ A;  3GE1 A;  2G8V A;  1VTO A;  1YT3 A;  3QFU A;  4ICL A;  1HYZ A;  1VQ8 N;  4OO1 J;  3CJC A;  2E8A A;  1C1C A;  3O3F A;  4QS9 A;  3UKR A;  2HST A;  3O4N A;  4PA1 A;  3QB0 A;  2F96 A;  3VGM A;  3N4Q A;  2YJF A;  3K9K A;  3MK6 A;  1PVS A;  3AA5 X;  3ZSX A;  3MED A;  3R8E A;  2RKI A;  2B5J A;  4LSN A;  1LWW A;  4I6M A;  4KHQ A;  2E1Y A;  3THV A;  3MEE A;  3ULE A;  3G71 N;  4DQI A;  1J54 A;  2WOM A;  4BRQ A;  3L2V A;  1QTP A;  5HLF A;  4E7J A;  4V19 S;  2OTL N;  4CES A;  3TU5 A;  1TVR A;  4CZM A;  1QSS A;  3PDK A;  1T44 A;  3LWL A;  2V9J A;  3NFA A;  4IG0 A;  4B9N A;  3A5M C;  4ROC B;  4E19 A;  3SLC A;  4CFA A;  4RW4 A;  3HJF A;  1NGI A;  2E2O A;  4MLH A;  4YOV A;  3K2P A;  1JXE A;  3SQ0 A;  4JKG A;  2Z1H A;  1CXQ A;  3T4N A;  1VRT A;  4CIE A;  4GKK K;  4CGG A;  3RSE A;  2P9L A;  1K35 A;  4FJ5 A;  2JHJ A;  4CZF A;  3BF1 A;  3VQQ A;  1NWK A;  1NGC A;  3RR8 A;  4BC2 A;  1VSJ A;  2Q0U A;  5D3G A;  2ETJ A;  2A3Z A;  3G25 A;  1J5O A;  2HHU A;  3VQB A;  4KRF A;  3O3G A;  2OAN A;  3D7E O;  4PUO A;  3DRR A;  3SAG A;  3SAH A;  3OST A;  4O0I A;  3ZYY X;  2BH1 A;  1LWC A;  4WX8 A;  3M8P A;  1Q9U A;  4W5T A;  2CGL A;  3LDO A;  5T7B A;  4NCB A;  1YVU A;  2KFZ A;  3HZ6 A;  3UE5 A;  4FJG A;  1MA9 B;  3OTO K;  4BVP A;  1XC3 A;  3H45 C;  1TK8 A;  1QTM A;  3L4Q A;  3VQ6 A;  3H6E A;  4DQP A;  2QWL A;  3SNN A;  4BRF A;  3BZC A;  2VG5 A;  2Q0R A;  1SKR A;  3O9U A;  5AQU A;  5J2Q A;  5EPC A;  3GL1 A;  2F8S A;  3ENO C;  1XMQ K;  1SZ2 A;  4DFK A;  4LF9 K;  3QML A;  3AO2 A;  2O8C B;  4M3W A;  1E3M A;  4ELU A;  3CFP A;  4E7H A;  3CCE N;  1R59 O;  1S22 A;  2P9N A;  5HSH A;  4HWI A;  3MN6 A;  5C25 A;  4K8X A;  3VQA A;  4CJS A;  3MWP A;  4Z4F A;  2HZS A;  2GEL A;  2YCH A;  4YOR A;  4HVJ A;  1Z25 A;  4FW1 A;  2ATQ A;  3OYM A;  3VEZ A;  1NK6 A;  4X64 K;  2XHB A;  1HMV A;  3NA5 A;  3EAY A;  5IYC P;  4PQU A;  3LM2 A;  4DR1 K;  3I55 N;  3WNF A;  3EO3 A;  4CFD A;  4DV2 K;  4M3Y A;  4AHV A;  4CGF A;  4CF8 A;  4DUZ K;  2O8E A;  1LW2 A;  2Q3S A;  3ENB A;  1QNB A;  3V9Z A;  4JKH A;  5HL7 L;  1BL3 A;  5KI6 A;  2HNY A;  1EET A;  1K8K A;  3ZSO A;  3EKU A;  2P5G A;  3ISN C;  4IOX A;  3ZEU B;  4MO5 A;  3PX6 A;  5ADX A;  3VQ7 A;  1QE1 A;  1GOC A;  1C6V A;  3KK1 A;  4RG8 A;  1NJZ A;  2V8Q A;  1MDU B;  3NDK A;  4NO7 A;  4BRI A;  4I2P A;  1LAV A;  4PY5 A;  4H5W A;  4IKF A;  1J9A A;  4D7R A;  3SAF A;  5DM6 L;  3T7Z A;  4ELV A;  3H08 A;  4C23 A;  5JS1 A;  3WUH A;  1S1X A;  3LDL A;  4K41 A;  3WNH A;  5AZI B;  4DTS A;  1RT4 A;  2V52 B;  1CZ9 A;  3VF6 A;  4CZH A;  4UQG A;  2WUS A;  4CFB A;  4C8N A;  4Q5V A;  1PCJ X;  4GV9 A;  3IG1 A;  4XH4 A;  3FFI A;  3O4W A;  4GW6 A;  1Q9Y A;  1IV0 A;  1D9F A;  3AA3 A;  2PYJ A;  3AVK A;  2VWJ A;  2P9U B;  1L3V A;  2V51 B;  1DIZ A;  1VQ5 N;  4KO0 A;  1IKX A;  3DPU A;  4JI1 K;  2QRD A;  2FLO A;  3ALY A;  3R9P A;  3DLE A;  5FRO A;  3I0R A;  1JLG A;  4Z0U A;  2FUV A;  1U2V B;  3C6U A;  3QEW A;  1JLQ A;  1JLA A;  3L6Q A;  3SBG A;  3ZSY A;  1KD1 O;  3K9J A;  1S1V A;  3TI0 A;  2VCP A;  2R5X A;  1D9D A;  2VWK A;  1TAQ A;  1J53 A;  4DV0 K;  1VQP N;  1JLB A;  3L2R A;  1TUO A;  3OYH A;  3NVM A;  3VN5 A;  4J2A A;  3C04 A;  3AVJ A;  4YOX A;  2DY4 A;  4CJQ A;  1HRH A;  5ADX H;  4DR2 K;  3ASM A;  1TKD A;  1BO5 O;  5C12 A;  4ID1 A;  3CCM N;  5AQZ A;  2OOX A;  5AQO A;  2ZF5 O;  2Q2R A;  3MX5 A;  4E7L A;  3NF7 A;  1TBP A;  2ZJQ L;  4EP5 A;  3C95 A;  3RR7 A;  3SUO A;  1LWE A;  5BPM A;  4DUL A;  2A6A A;  3CI5 A;  5IYD P;  4AM6 A;  2Z8U A;  4LH4 A;  5BRD A;  3I8D A;  5LY3 A;  2NRW A;  3NMU A;  3VQE A;  1Q81 O;  1M3H A;  3HST B;  2P9K A;  3CM6 A;  1ASU A;  4NB4 A;  4X62 K;  3TAR A;  4FZX C;  3DM2 A;  2W6K A;  4F9O A;  3NF6 A;  3I8B A;  3R1X A;  2Z0F A;  2OCE A;  3O08 A;  3CHW A;  4BRP A;  4TPS A;  3SNS A;  4WCE L;  4DV4 K;  3KLE A;  2VQE K;  3KD5 E;  3LDN A;  5CE3 A;  5DM7 L;  1C0T A;  5J2P A;  2DFF A;  4JN4 A;  4YHH K;  3RMD A;  4DQQ A;  3HP9 A;  4Y0W A;  3ZET B;  3VQC A;  1N3A A;  5C24 A;  2Z1J A;  2F4V K;  4NXM K;  4FLX A;  4Z4I A;  1IKW A;  3DLK A;  1TYQ A;  1TK5 A;  3LAL A;  1HKC A;  3AV9 A;  4BG9 A;  3A5L C;  5C0Y A;  3ID8 A;  3R3L A;  5EY4 A;  3RVC A;  3SZ2 A;  3S3O A;  1RBR A;  4B3R K;  4JI6 K;  4JS4 A;  3UIQ A;  1QQM A;  5M1Q A;  2PFU A;  1QHA A;  5BN8 A;  4DTU A;  2YKM A;  1SL2 A;  3FZH A;  1S3X A;  4O4G A;  4H4M A;  5AQG A;  4J8F A;  3HPH A;  4BR9 A;  4Q11 A;  1SQK A;  3QIN A;  4CF2 A;  3MX2 A;  2ZGY A;  4DTM A;  2BAN A;  1WAJ A;  3PUF A;  2P9I A;  1YTF A;  2QWR A;  1SAZ A;  3BP8 A;  4G1Q A;  1NBW A;  4RTF D;  3UKR B;  3M5R A;  4CZL A;  4KH4 A;  3R6M A;  1KLN A;  5AQP A;  2AA4 A;  3DRS A;  3EE9 A;  1KY7 A;  5BRH A;  3AVA A;  2G8H A;  4A57 A;  3NGI A;  3RRG A;  3THY B;  2QWP A;  3V9X A;  1WN7 A;  3OS2 A;  4FWP A;  4Y1D A;  4B9L A;  1TK0 A;  3E9O A;  1NJY A;  2P5O A;  1HX1 A;  5GAD P;  3GG4 A;  1VQK N;  3ULE B;  1NJW A;  3MAQ A;  4DKW A;  4AIL C;  1G15 A;  4DSJ A;  3I0S A;  3VEX A;  4DV6 K;  1S6Q A;  3KLG A;  4F2S A;  3EY1 A;  2BE2 A;  4KHW A;  4FJH A;  1O13 A;  4IOC L;  5GAH P;  1VOK A;  3OJS A;  1Z05 A;  4CJ5 A;  3PIO L;  4JI0 K;  4JI5 K;  3SJH A;  4BRA A;  1X9S A;  3C6A A;  1N8R O;  2D1K A;  4BRH A;  2NOI A;  4ROE B;  4JEP A;  1VSH A;  2P9S A;  1QSL A;  2H3G X;  1VSM A;  3IUC A;  5CY4 A;  2YV0 X;  3V81 A;  4A2B A;  4CEZ A;  3KWG A;  3RSE B;  4E3S A;  1X1P A;  3V4I A;  2P9L B;  3M8R A;  3CPW M;  3DAW A;  1W80 A;  1EKE A;  3ULD A;  4DSK A;  3HS9 A;  2V92 A;  3CC2 N;  1CLQ A;  2QK9 A;  5M1O A;  1UL7 A;  2HNZ A;  1C9B B;  1GLL O;  3U8X A;  5AQI A;  2DFE A;  1ZBF A;  2FBX A;  3HP6 A;  4KHU A;  5BPN A;  4FSV A;  2BUP A;  4KAZ A;  4CJV A;  1E4F T;  4OGC A;  4FJI A;  3HK2 A;  5AQJ A;  4DTX A;  1REV A;  2OZM A;  2X74 A;  3CYM A;  4EAG A;  4I2Q A;  5CHI A;  4E1N A;  4N56 A;  3D4V A;  4CJT A;  3EYZ A;  5HBM A;  4L8R B;  3DOK A;  1BGX T;  2HMI A;  3LP1 A;  1QHT A;  3ZT1 A;  5KL0 A;  2QLV A;  4E7I A;  4J2B A;  1U47 A;  2YNF A;  2P9P B;  3MEC A;  4PKI A;  2NRV A;  4WQ4 A;  3J8A A;  4JI2 K;  2UXB K;  3QNN A;  4H5V A;  4ID5 A;  4U67 L;  1NGM A;  3AVC A;  4EAI A;  4LH5 A;  3JAM O;  2KQ2 A;  3RMA A;  4EJZ A;  2P9N B;  1RDD A;  4CEF A;  5FPE A;  4B1Y B;  1RDC A;  3AA2 A;  4OKK A;  3FZM A;  1TL3 A;  1WOQ A;  3KD1 E;  1EXQ A;  3NH2 A;  4ZTF A;  2X6S A;  2VG7 A;  3BY5 A;  1VSD A;  3OS1 A;  2P1J A;  1RTJ A;  4BWJ A;  4HUF A;  4NCG A;  4AHU A;  4W5Q A;  1KYD A;  1YTU A;  3WQU A;  4AM7 A;  1Z26 A;  3I0X A;  1WSG A;  3HM8 A;  2ZWH A;  3HPO A;  5GIP A;  4FM0 A;  4PKG A;  2FGT A;  1EWR A;  1RNH A;  2O8E B;  2WTU A;  1R4X A;  3A5O C;  3PSI A;  5HRR A;  2BDP A;  2FBV A;  5J1E A;  4JAX A;  1VSF A;  1K8K B;  4DTR A;  3HOT A;  4OJR A;  2OA8 A;  2HB5 A;  2A42 A;  1X3M A;  3I3W A;  4R79 A;  2MZ8 A;  4YY3 K;  5AQN A;  1S9G A;  3RTV A;  5HRO A;  3JS6 A;  4B3O A;  3O1B A;  4IJA A;  4MQ3 A;  2A1S A;  1Y97 A;  3MN7 A;  1D3U A;  3QET A;  1NG9 A;  5C42 A;  1BUP A;  3CC7 N;  4FM2 A;  3CCQ N;  2IVP A;  5TKW A;  2NOE A;  2FF3 B;  3CCS N;  3SYZ A;  1BA0 A;  1ZBH A;  3VGK A;  4OPJ A;  1TL1 A;  1WSF A;  4JKE A;  2G8U A;  1JLF A;  1HNZ K;  4EAL A;  1CZA N;  2E6M A;  1NGD A;  4BG8 A;  5J2N A;  3AVF A;  4GKJ K;  4XIU A;  5EOY A;  3HO1 A;  1BQN A;  4BDP A;  1XHX A;  2NOH A;  3HYF A;  3QIC A;  4CEO A;  3SMP A;  3W0L A;  4ZHR A;  3SQ2 A;  1UOC A;  5AQS A;  1F21 A;  2IVN A;  1HLU A;  4NYN A;  1DTT A;  4KTQ A;  3VA3 A;  1IKV A;  3CIP A;  4JI3 K;  3RSM A;  1VK0 A;  5BMN A;  3MEG A;  3PX0 A;  1C1B A;  4CFC A;  4IBN A;  4DR5 K;  1NK0 A;  2HL8 A;  4RW9 A;  1SKS A;  4DR6 K;  5F2R A;  4GV3 A;  1QN8 A;  1OKJ A;  1WB9 A;  2IIR A;  2Y1J A;  1VQN N;  4DR7 K;  2KHO A;  1TKZ A;  2QA4 N;  2NNW A;  1S9E A;  3ID6 A;  3CJA A;  4HCC A;  3TAE A;  5F0X A;  4HHT A;  3V1O A;  4DFM A;  1Q18 A;  1ATS A;  3VQ4 A;  4DLG A;  3M6G A;  1Q7Y O;  1LW0 A;  3LM9 A;  4EAK A;  2YA3 A;  3SQ1 A;  2VG6 A;  4EZ6 A;  4FLU A;  3VMF B;  2QWN A;  5AQR A;  4CED A;  2PY5 A;  2YNG A;  4OPK A;  4B9T A;  3M1F A;  2W40 A;  5E26 A;  3JXU A;  3SCX A;  1BWF O;  3S41 A;  4FWO A;  3LP3 A;  4H5N A;  1TGO A;  3MCP A;  5BMP A;  1VOL B;  3O9T A;  3KVG A;  3IS9 A;  1W9H A;  5JMV D;  3OH6 A;  1M5Q 1;  1MWM A;  4CJ7 A;  3OYI A;  4BGB A;  3AGR A;  4CK2 A;  4KHN A;  1NGG A;  1B9F A;  4DQR A;  1JDY A;  3WXK A;  1B9K A;  4B0A A;  1C0U A;  5BRE A;  3NAE A;  1EX4 A;  5EX5 A;  2A5X A;  5BRF A;  4CF9 A;  2E20 A;  2FSK A;  1TAU A;  3TSU A;  1NNE A;  2LAE A;  3WXM B;  4CEE A;  4DHY A;  5FDL A;  3HI0 A;  4F2R A;  4CJE A;  4FOI A;  4M7Y A;  1EUV A;  1U49 A;  4KFB A;  5JVH L;  2UXC K;  2NRR A;  4XH5 A;  4LD0 A;  1YVN A;  3DMJ A;  2FF6 A;  4YOU A;  3OJU A;  1X9W A;  4BE1 A;  4WQ5 A;  4DU4 A;  4CZJ A;  3D7Q A;  4OVL A;  1OH6 A;  1TYQ B;  2RE2 A;  3OS0 A;  4Q0B A;  4BR5 A;  3ATV A;  3PO4 A;  4AHR A;  5HRS A;  2E88 A;  5KRT A;  4N76 A;  2B6A A;  4OKJ A;  2OPS A;  1ATN A;  3EEQ A;  4WXA A;  2EWS A;  4ISF A;  4CK1 A;  3THX A;  1UA1 A;  2HHT A;  1C47 A;  1KAY A;  3CPE A;  3VEW A;  4CJK A;  1UT4 A;  3KJV A;  2DTU A;  1FKO A;  1P90 A;  4H03 B;  2Q36 A;  1V4S A;  3ZSR A;  2HHW A;  3F0Z A;  1CXU A;  1XWL A;  4DS5 A;  1Q86 O;  4JK9 A;  4B9U A;  1U6Z A;  4FZZ A;  1D5A A;  2WBN A;  3C0B A;  5IT9 O;  3OHR A;  3A8Y A;  2P9I B;  3LWM A;  4FLV A;  1HYV A;  3HOS A;  2FXU A;  3OC3 C;  4JKA A;  3SUP A;  4CEA A;  1JL2 A;  3FE1 A;  3JYT A;  1DEJ A;  1P8Z A;  1C4G A;  4DSF A;  4JNE A;  2RPI A;  1SL1 A;  5AR0 A;  2O4G A;  4DF4 A;  3WNE A;  1YIJ N;  3LPU A;  3TTF A;  3CC4 N;  4B8C A;  3GBT A;  3ZT0 A;  4Z94 A;  4MFB A;  4KRE A;  3C6H A;  4IOA L;  3NH0 A;  2ITG A;  4DUY K;  4A61 A;  3PO5 A;  1XMO K;  2NRZ A;  2NOB A;  1RDB A;  3AO5 A;  2A41 A;  3B8A X;  2IS3 A;  1UAX A;  3O4Q A;  3QBX A;  1ZYQ A;  3UKU A;  1BI4 A;  1FK9 A;  3D2E B;  3Q7B A;  3N4P A;  4HTL A;  1HYS A;  4HUE A;  4FJ9 A;  1ZC6 A;  4O44 A;  3MXI A;  3OVN A;  4PHT X;  2O8B A;  1YQM A;  4LC9 B;  2JGU A;  3D2F B;  4C1N I;  5FRN A;  3NGY A;  1HPZ A;  2CH6 A;  4PL8 A;  3AAQ A;  1KAX A;  1NK4 A;  3VF4 A;  3MXM A;  4CJF A;  4F4K A;  2IDO A;  1XQS C;  3B6O A;  4JS5 A;  3C94 A;  3NBP A;  1GLB G;  5TKY A;  1RTI A;  4M3U A;  5IYB P;  4RW6 A;  3U6F A;  2E5L K;  1FJG K;  3ZSW A;  4BQZ A;  1ZBL A;  2GUP A;  3QNO A;  5LJV A;  5AQM A;  5AQL A;  4M42 A;  1NKC A;  4FJ7 A;  2E4L A;  4CD3 A;  2F9W A;  3PV8 A;  3PY8 A;  1QN9 A;  4RWT A;  4LF8 K;  3N89 A;  3L8B A;  3QES A;  4J2D A;  2XY7 A;  1ZXO A;  1TKT A;  1RBT A;  2CGJ A;  3SV4 A;  1BIS A;  5M1N A;  1RTH A;  4AHC A;  1ESV A;  4GV6 A;  2OPP A;  3WQT A;  4CJ4 A;  4O8K A;  4DB3 A;  2QWO A;  2IC3 A;  1VSK A;  1VQO N;  1NKE A;  1TKX A;  1T05 A;  1S1T A;  1A5W A;  1KFS A;  4JHD A;  4X65 K;  4HTU A;  3AO1 A;  1VQ4 N;  3QIO A;  4DU1 A;  1QQC A;  3IRX A;  3L2Q A;  2AJQ A;  3OYC A;  4DS4 A;  3HXM A;  1TBA B;  3I33 A;  2O8F A;  1TGH A;  4A5B A;  3CVS A;  1XSZ A;  1K8A O;  2PWW A;  1PCM X;  2EHG A;  4K0K K;  2IV9 A;  5JLF A;  3HPG A;  1N39 A;  4IG3 A;  1V4T A;  4FWM A;  3CCJ N;  2HOE A;  1RT6 A;  1VQL N;  5GAG P;  2F8T A;  1NGF A;  3IMX A;  2QKB A;  5KRS A;  4FLT A;  5FRM A;  4DFP A;  2QTD A;  1BIU A;  1KQS M;  4FWN A;  4FYD A;  2DKC A;  3H1Z A;  2D5R A;  1KVA A;  4JLH A;  3HS8 A;  3ENH A;  1VHX A;  4L3Q A;  1GLF O;  1WSH A;  4M7X A;  4CCH A;  4W5R A;  4WE1 A;  2HF3 A;  5LJW A;  1YI2 N;  3A2F A;  4BR2 A;  5AQX A;  3K0S A;  3V6D A;  4E1M A;  4CGI A;  4YDU A;  1YJ9 N;  4BE0 A;  4CHQ A;  1KYU A;  1W7A A;  3SJJ A;  3AAR A;  1W0H A;  1NK7 A;  4A5A A;  1Q9X A;  1ILY A;  5KGX A;  1WBD A;  1IJJ A;  4DV7 K;  3O6W A;  1SUQ A;  5AQT A;  3QO9 A;  1QN4 A;  4H4O A;  1NLV A;  2XY6 A;  1DLO A;  5MLC Q;  3QDK A;  1C0G A;  1K73 O;  4K42 A;  2UUC K;  2ZFD B;  1M90 O;  4FPA A;  2E1Z A;  1QVG M;  3G0Z A;  1KAZ A;  2HVH A;  4CGJ A;  1T03 A;  1BA1 A;  3OW2 M;  3TTC A;  5C15 A;  3BZK A;  3L4I A;  3LZJ A;  5AN4 A;  2G8F A;  2W42 A;  3DI6 A;  4CEB A;  5I42 A;  4BC3 A;  3OYE A;  1B9D A;  1O1W A;  4JKF A;  3BDP A;  4I7F A;  4CJU A;  4YOW A;  2YHA A;  1Q82 O;  3HT3 A;  1T3V A;  1SV5 A;  3OY9 A;  1N6Q A;  2OTJ N;  2QRE A;  3IKM A;  1NOY A;  2HF4 A;  2JWK A;  4HCB A;  1GLA G;  2HHS A;  1K2Y X;  4NLB A;  2FKF A;  5FPN A;  2H5A X;  4B1W B;  1BU6 O;  3EIK A;  2P51 A;  3VET A;  3U9D A;  3FGU A;  3WXI A;  3CVT A;  4WFN L;  4CJL A;  3CG7 A;  4WYB A;  5KPR A;  3V9U A;  3L3V A;  2IAJ A;  1N3C A;  3HVR A;  2ZD1 A;  4FOE A;  3TAG A;  3U4L A;  3CCV N;  4OPA A;  4FLY A;  3OYN A;  1JL1 A;  1HQU A;  3F9K A;  4M45 A;  2D0B A;  3O9R A;  2HBJ A;  4YOY A;  4CGD A;  3TAP A;  4RW7 A;  2FKM X;  4B1V A;  3ZSV A;  4JK8 A;  3KLH A;  5CYQ A;  1GOA A;  4IO8 A;  1UA0 A;  1N34 K;  1E42 A;  4B1X B;  1Z6R A;  1LAW A;  2ITM A;  2HVI A;  4CW7 B;  3SUQ A;  1KSP A;  3DLG A;  2FBY A;  3VOV A;  4KH5 A;  4DSL A;  4CF0 A;  2GEM A;  3VTH A;  5DK5 A;  1NGA A;  3FR0 A;  4ROD B;  4AF1 A;  4KHS A;  3KLI A;  5JMV A;  5KPT A;  2BTF A;  2RHK A;  4FXD A;  1AIS A;  1T6D A;  2HBL A;  4C8M A;  4CHY A;  4O5B A;  5F1X A;  2RF2 A;  1HNV A;  1NGH A;  4FCY A;  4I6M B;  1HPM A;  3AVG A;  4FK4 A;  4KI6 A;  5KQD A;  3OYJ A;  2KLA A;  3OYD A;  1XI1 A;  3KK7 A;  4H0P A;  4LF4 K;  4CJR A;  3T69 A;  3O9S A;  4K8Z A;  1BIZ A;  3KKR A;  1KFQ A;  2CH5 A;  4N41 A;  4FWR A;  3UB5 A;  1QNA A;  1HR0 K;  3NF8 A;  4DU3 A;  4H0X B;  4CE9 A;  2D0A A;  2YI1 A;  3IH7 A;  1ZBU A;  4JKG B;  4A59 A;  1EP4 A;  4C7P A;  2Y8Q A;  5AFU A;  3AA4 A;  1KO9 A;  3S3M A;  1YAG A;  1SL0 A;  4FWS A;  4NYF A;  4H8K A;  1KC8 O;  4EZ9 A;  2GV9 A;  5ELZ A;  1N5Y A;  1VSI A;  1NM1 A;  1YUW A;  1YTB A;  4FM1 A;  2A1R A;  4BR0 A;  1OH7 A;  4O55 A;  3EL2 A;  3KWI A;  4O5F A;  5AQV A;  4B1U B;  2GWJ A;  1XC9 A;  1RBU A;  2HMP A;  5M1K A;  3LDQ A;  4I9Q A;  3THX B;  3F73 A;  4ILG B;  3AVH A;  1ZBS A;  3H3N O;  3SPY A;  1ASV A;  5I3U A;  4FVM A;  3EN9 A;  4LY7 A;  4BWM A;  3L2W A;  1V5S A;  3EKS A;  4BRO A;  1QZ5 A;  4KH6 A;  4CIF A;  4OLB A;  2VGN A;  2HKP A;  5AZI A;  1JKH A;  4BDZ A;  3E66 A;  1BOT O;  5AQQ A;  1YHQ N;  1NJX A;  4Y1C A;  4GNI A;  4UY8 O;  1BQM A;  3S9H A;  1MWK A;  2GTD A;  3O5B A;  4BC5 A;  1NU0 A;  5AZJ A;  4FZY A;  3CXC M;  1KFI A;  5KPZ A;  4XEI A;  4CHO A;  3ATU A;  2P9U A;  1KVB A;  3NHG A;  3V9W A;  4FJM A;  2GWK A;  3P83 D;  4BQL A;  4CZK A;  3AGK A;  4QOZ B;  1BCM A;  4CBX A;  3A5N C;  1GLC G;  4AHS A;  3AAP A;  4DSE A;  4E1J A;  3M3Z A;  4WFA L;  3SMS A;  3QBW A;  2WFB A;  3UKU B;  1BI4 B;  3LAM A;  1QN7 A;  1NOZ A;  1VRU A;  1RM1 A;  3VES A;  1C1A A;  2HW3 A;  3ZT4 A;  3CWA A;  3LDS A;  1DT9 A;  3CQY A;  2O8B B;  2QXL A;  4NLC A;  4DCH A;  3HSC A;  5HP1 A;  3ZT3 A;  5AFU H;  3T19 A;  3BKQ X;  2MJ7 A;  1YXQ A;  3DLR A;  4BVO A;  1BCO A;  1QZ6 A;  1NGJ A;  4PKH A;  1FKP A;  2HHQ A;  5JLH A;  2XHI A;  3DXM A;  2KZM A;  4M41 A;  2NRH A;  3ZSZ A;  4CFF A;  2JLE A;  3OCI A;  1PZD A;  2OOY A;  3BUZ B;  2E2P A;  1S1W A;  3VF2 A;  4TSX A;  1ATR A;  5I9E B;  2YH5 A;  2DFH A;  4RW8 A;  1FW6 A;  3AO3 A;  4QS7 A;  2F7L A;  2V7Z A;  3OH9 A;  3LPT A;  3TPQ A;  4IJN A;  4N5S A;  4WFB L;  1RBV A;  1NGE A;  3CWT A;  1WSI A;  1U04 A;  3JSM A;  4B9M A;  3K57 A;  1VKL A;  5C2D A;  3RWU A;  5GAE P;  3MWT A;  3PMG A;  4EHU A;  4A2A A;  3SBT A;  3ZCM A;  1YTA A;  3TR8 A;  2ASO A;  4BDY A;  2I5W A;  1WSJ A;  1JLC A;  2D4W A;  4JI7 K;  2VJ0 A;  2O8F B;  4CI6 A;  4YFU A;  4JYA K;  2YHW A;  2FSJ A;  3NGZ A;  5JN5 A;  1VQ6 N;  4B9V A;  4H0V B;  1LWV A;  1JCG A;  2DKD A;  3I0W A;  3F5T A;  4BRL A;  3U3Y A;  3ZET A;  4LSL A;  1RIL A;  4WQ5 C;  5E41 A;  2HHX A;  4K25 A;  4JD2 A;  3QEI A;  4IFY A;  3ZT2 A;  2YKN A;  3WEE A;  4JRP A;  2HL9 A;  4A62 A;  3QEP A;  1NK9 A;  1EQY A;  4GVM A;  3D45 A;  4J2E A;  2GUI A;  3CWS A;  2X78 A;  2ZM6 K;  4K43 A;  5C2F A;  3KHY A;  4AHT A;  4BGA A;  1HQE A;  3EE8 A;  3DLL L;  1U48 A;  1BHL A;  1NH2 A;  5FPD A;  4JKB A;  3D0P A;  3VA0 A;  3LL3 A;  1X3N A;  1XNQ K;  2Y1I A;  2JPI A;  3TAF A;  5BN9 A;  3QER A;  3CJB A;  4B9S A;  2Q31 A;  1WAF A;  4FJN A;  1QS4 A;  2YJE A;  1VQM N;  2QKK A;  1N32 K;  3CWU A;  2NZT A;  1ZBI A;  3KLF A;  4CIG A;  2UUA K;  3K58 A;  4BR4 A;  5SWM A;  1LOT B;  2VGM A;  5LMU K;  4CHP A;  2P9K B;  2XRI A;  3OA9 A;  3THY A;  4PL7 A;  2YNI A;  2A40 A;  3ENC A;  1HKB A;  3MCA B;  3KTQ A;  1R0A A;  2IVO A;  4FVU A;  4R5P A;  1JFI C;  3G6E N; 
#chains in the Genus database with same CATH homology
 3DPT A;  1KLM A;  4CER A;  3HPH A;  1TKX A;  1NKE A;  1T05 A;  4Q11 A;  1S1T A;  4KV8 A;  2OZM A;  2HHV A;  3QIN A;  3L3U A;  4CF2 A;  1A5W A;  1KFS A;  1IKY A;  4DTM A;  2BAN A;  1KTQ A;  1WAJ A;  3PUF A;  5HRP A;  3F10 A;  3AO1 A;  4HTU A;  3QIO A;  3K5M A;  1YTF A;  4DU1 A;  2NOZ A;  4KPY A;  2ZE2 A;  1QQC A;  4CEQ A;  3IRX A;  1FN7 A;  3L2Q A;  3QIP A;  4G1Q A;  4CJP A;  2AJQ A;  3RPJ A;  4Z4C A;  3OYC A;  4DS4 A;  3HXM A;  4EP4 A;  1TBA B;  3AVL A;  4CHN A;  3SI6 A;  1KLN A;  1T8E A;  1TGH A;  3DRS A;  4WZS D;  1VSE A;  4OGE A;  4E7K A;  1T7P A;  3SQ4 A;  4FJL A;  3VQ9 A;  4B08 A;  2YHB A;  1KY7 A;  1LWY A;  3AVI A;  3AVA A;  2G8H A;  3NGI A;  3RRG A;  1S6P A;  2EHG A;  2IV9 A;  2X6N A;  3V9X A;  1WN7 A;  2ZQB A;  3HPG A;  1N39 A;  4NCB A;  3OS2 A;  4IG3 A;  4Y1D A;  4DTJ A;  1RT6 A;  4B9L A;  1TK0 A;  4M3Z A;  3M8S A;  2F8T A;  2HND A;  2P5O A;  1NJY A;  1YQR A;  2QKB A;  5KRS A;  1WLJ A;  2I5J A;  3NCI A;  4FLT A;  3PX4 A;  5FRM A;  1C0M A;  2Z1G A;  4DFP A;  1BIU A;  1NJW A;  2HZM A;  4FYD A;  3MAQ A;  2G30 A;  4AIL C;  1G15 A;  5JS2 A;  4F3O A;  3H1Z A;  3SV3 A;  2D5R A;  4C8O A;  3I0S A;  1KVA A;  3P5J A;  4JLH A;  3HS8 A;  4DSJ A;  1S6Q A;  3KLG A;  1VSL A;  3EY1 A;  4F2S A;  2BE2 A;  1WSH A;  2LSN A;  4CCH A;  3KTU A;  1ITG A;  4W5R A;  4FJH A;  4KHW A;  4WE1 A;  1NVP A;  4I9L A;  1VOK A;  3OJS A;  3DLH A;  1I3A A;  4CJ5 A;  3A2F A;  1UT7 A;  2OPR A;  4KTZ A;  3CQ8 A;  3V6D A;  1QN5 A;  4KKO A;  4E1M A;  1RT5 A;  4CGI A;  3O3H A;  3QEV A;  1X9S A;  3QLH A;  2NOI A;  4CHQ A;  1KYU A;  4ROE B;  4BE0 A;  1VSH A;  1HU0 A;  1QSL A;  1VSM A;  2G8W A;  4C8K A;  4KTW A;  4Z4E A;  3SJJ A;  5CY4 A;  2YV0 X;  1KCF A;  3V81 A;  4KHY A;  1W0H A;  1NK7 A;  4CEZ A;  4CF1 A;  1Q9X A;  1DTQ A;  5KGX A;  2D0C A;  1CZB A;  4E3S A;  1X1P A;  2G8I A;  1SUQ A;  3V4I A;  3M8R A;  1S1U A;  1QN4 A;  3QO9 A;  4H4O A;  2XY6 A;  4CJ3 A;  1DLO A;  4CK3 A;  2OZS A;  1W80 A;  1EKE A;  3V1Q A;  3AVN A;  3ULD A;  4DSK A;  3HS9 A;  4FLZ A;  1KFD A;  3KK2 A;  3OYF A;  3K5L A;  2KFN A;  3G0Z A;  1CLQ A;  2QK9 A;  1IH7 A;  4CGJ A;  2HVH A;  3KKS A;  4M3T A;  1T03 A;  2HNZ A;  3DRP A;  1LWF A;  1C9B B;  3K5O A;  5DMR A;  2DFE A;  1ZBF A;  2FBX A;  3HP6 A;  1UA0 A;  4KHU A;  1NK5 A;  4DFJ A;  3LZJ A;  5AN4 A;  1S5J A;  4KAZ A;  4CJV A;  2G8F A;  2W42 A;  3DI6 A;  4OGC A;  4FJI A;  3HK2 A;  3SPZ A;  5HRN A;  4CEB A;  4DTX A;  1REV A;  5I42 A;  3OYE A;  1VTL E;  1B9D A;  1O1W A;  3VQD A;  2X74 A;  3CYM A;  4I7F A;  4CJU A;  4I2Q A;  3OYG A;  1U45 A;  3BDP A;  4KB1 A;  1B92 A;  2YHA A;  3ITH A;  1JXB A;  3HVT A;  4N47 A;  4CGH A;  4E1N A;  4N56 A;  1LV5 A;  3HT3 A;  1SV5 A;  4CJT A;  3OY9 A;  3EYZ A;  4W5O A;  1ASW A;  5HBM A;  1N6Q A;  4L8R B;  3DOK A;  1NOY A;  1BGX T;  2G8V A;  1VTO A;  1YT3 A;  5SZT A;  3AVB A;  4HCB A;  2HMI A;  3LP1 A;  3MXJ A;  1QHT A;  2HHS A;  1RT1 A;  3ZT1 A;  4ICL A;  1HYZ A;  4E7I A;  1M3Q A;  1U47 A;  4J2B A;  3EIK A;  2P51 A;  1C1C A;  2YNF A;  3O3F A;  2RN2 A;  3MEC A;  4CJL A;  3CG7 A;  3O4N A;  4PA1 A;  2XY8 A;  3V9U A;  3L3V A;  4KI4 A;  3QNN A;  2IAJ A;  4CJW A;  4FK0 A;  1N3C A;  2F96 A;  4ID5 A;  3HVR A;  1NGM A;  2ZD1 A;  3TAG A;  3AVC A;  4FLY A;  3OYN A;  1JL1 A;  1HQU A;  4LH5 A;  1Q8I A;  3AA5 X;  4GMJ B;  1L3S A;  3ZSX A;  3MED A;  3F9K A;  2KQ2 A;  4M45 A;  3RMA A;  4EJZ A;  2D0B A;  2B5J A;  2RKI A;  4LSN A;  1RDD A;  4E89 A;  4CEF A;  4DTP A;  1LWW A;  4CGD A;  3TAP A;  4RW7 A;  4DMN A;  1GOB A;  1RDC A;  3AA2 A;  4ELT A;  4OKK A;  4KHQ A;  1TL3 A;  3THV A;  3MEE A;  3ZSV A;  3KLH A;  2XY5 A;  5CYQ A;  4HUG A;  3KD1 E;  4M3X A;  1EXQ A;  1MP9 A;  1J54 A;  1GOA A;  2WOM A;  2VG7 A;  2X6S A;  3NH2 A;  3L2V A;  1QTP A;  1E42 A;  1VSD A;  2Z1I A;  3OS1 A;  4E7J A;  5HLF A;  4KB0 A;  2P1J A;  1RTJ A;  4BWJ A;  4CES A;  4HUF A;  4NCG A;  3TAQ A;  1A5V A;  4AHU A;  4W5Q A;  1KYD A;  1RT7 A;  1TVR A;  3M8Q A;  1YTU A;  1LAW A;  1QSS A;  1Z26 A;  3I0X A;  1WSG A;  4IFV A;  3HPO A;  3LWL A;  2HVI A;  3NFA A;  4IG0 A;  4FM0 A;  4B9N A;  4ROC B;  4E19 A;  3SUQ A;  1KSP A;  4O0J A;  4RW4 A;  2FGT A;  3DLG A;  4CFA A;  3HJF A;  2FBY A;  4DSL A;  1RNH A;  4CF0 A;  1R4X A;  3K2P A;  5HRR A;  2BDP A;  2FBV A;  5J1E A;  1JXE A;  1VSF A;  5CZ1 A;  4BE2 A;  2Z1H A;  5KGW A;  4DTR A;  3SQ0 A;  4C8L A;  1CXQ A;  5DK5 A;  1VRT A;  4CIE A;  4ROD B;  4OJR A;  4CGG A;  4KHS A;  2OA8 A;  3KLI A;  2KTQ A;  4Z4G A;  1D8Y A;  2HB5 A;  3T1A A;  4FXD A;  1AIS A;  5K14 A;  4C8M A;  4CHY A;  4YNQ A;  4O5B A;  2RF2 A;  1HNV A;  4FCY A;  2MZ8 A;  1RT2 A;  2KZZ A;  1NKB A;  4FJ5 A;  3AVG A;  4FK4 A;  1S9G A;  3VQQ A;  3RTV A;  5HRO A;  2IV8 A;  3RR8 A;  3OYJ A;  4KI6 A;  3OYD A;  4B3O A;  4MQ3 A;  1YQL A;  1XI1 A;  1VSJ A;  5CZ2 A;  4BAC A;  2A1S A;  1Y97 A;  5D3G A;  2ETJ A;  2IGI A;  4CJR A;  1D3U A;  3QET A;  2QXF A;  2O4I A;  3OSM A;  5C42 A;  1KVC A;  1EBM A;  1WSE A;  1XHZ A;  4FM2 A;  1L3U A;  1J5O A;  2HHU A;  4K8Z A;  4DF8 A;  1BIZ A;  1PCZ A;  3KKR A;  3VQB A;  2NOE A;  4N41 A;  3O3G A;  4KRF A;  3SYZ A;  4PUO A;  3DRR A;  1QNA A;  3OST A;  4O0I A;  3ULX A;  3NF8 A;  1LWC A;  4OPJ A;  3M8P A;  1TL1 A;  1WSF A;  4CE9 A;  2D0A A;  1JLF A;  4DU3 A;  2G8U A;  3IH7 A;  2E6M A;  5J2N A;  4W5T A;  1ZBU A;  3AVF A;  5T7B A;  4DWI A;  5CYM A;  4XIU A;  1YVU A;  3NE6 A;  1BQN A;  4BDP A;  1QN6 A;  2NOH A;  1XHX A;  3HYF A;  3HO1 A;  2KFZ A;  4CEO A;  1EP4 A;  4FJG A;  1K6Y A;  4ZHR A;  3SQ2 A;  1UOC A;  3AA4 A;  1KY6 A;  1F21 A;  1KO9 A;  4NYN A;  3S3M A;  1DTT A;  1SL0 A;  4KTQ A;  4NYF A;  4H8K A;  1TK8 A;  1QTM A;  2GV9 A;  4EZ9 A;  3VA3 A;  1N5Y A;  1IKV A;  3VQ6 A;  1VSI A;  1TV6 A;  1YTB A;  1VK0 A;  4FM1 A;  3SNN A;  2A1R A;  3LP2 A;  4DQP A;  3LAK A;  3L2U A;  2VG5 A;  3MEG A;  4DTN A;  3PX0 A;  1SKR A;  1C1B A;  4CFC A;  4IBN A;  3VQ5 A;  5J2Q A;  2YNH A;  4RW9 A;  1SKS A;  1NK0 A;  2F8S A;  1CDW A;  1QN8 A;  4DFK A;  4O55 A;  3LP0 A;  2Y1J A;  4E0D A;  3AO2 A;  1QSY A;  4M3W A;  1TKZ A;  4ELU A;  3CFP A;  4E7H A;  1S9E A;  1HNI A;  1XC9 A;  1RBU A;  4QCL A;  5C25 A;  4K8X A;  4I9Q A;  4HCC A;  3TAE A;  4NCA A;  4HHT A;  2FC0 A;  3CM5 A;  3VQP A;  3V1O A;  4DFM A;  1SKW A;  3DLB A;  1ZBH A;  3AVM A;  3VQA A;  4CJS A;  3F73 A;  4Z4F A;  2HZS A;  3AVH A;  3VQ4 A;  3HL8 A;  3C6T A;  1KYF A;  4HVJ A;  1Z25 A;  1ASV A;  4DLG A;  3SPY A;  4FW1 A;  3KRM A;  2ATQ A;  3U3G A;  3OYM A;  3RMB A;  5I3U A;  4FVM A;  2FBT A;  1NK6 A;  2EX3 A;  1LW0 A;  3DYA A;  4LY7 A;  4BWM A;  2XHB A;  3L2W A;  4DQS A;  2PZS A;  1HMV A;  5IYC P;  4PQU A;  3SQ1 A;  2VG6 A;  3WNF A;  4I8O A;  4CIF A;  3K5N A;  4CFD A;  4FJ8 A;  4M3Y A;  4AHV A;  4CGF A;  4OLB A;  4EZ6 A;  4CF8 A;  4FLU A;  1JKH A;  4CED A;  3OYL A;  2PY5 A;  4BDZ A;  2YNG A;  4OKE A;  4OPK A;  4B9T A;  1NJX A;  4F3T A;  4Y1C A;  1LW2 A;  2Q3S A;  2PYL A;  3SCX A;  1QNB A;  3V9Z A;  5HP1 A;  1BL3 A;  2GBZ A;  1BQM A;  1EET A;  2HNY A;  5KI6 A;  3S9H A;  3ZSO A;  3LP3 A;  1TGO A;  2P5G A;  3ISN C;  4FZY A;  1VOL B;  1JLE A;  4CHO A;  2G8K A;  3T3F A;  3PX6 A;  3VQ7 A;  1KVB A;  3IS9 A;  3NHG A;  3V9W A;  1QE1 A;  4FJM A;  3CFR A;  1GOC A;  1W9H A;  1L3T A;  3P83 D;  1C6V A;  2OPQ A;  3KK1 A;  4RG8 A;  1NJZ A;  4OLA A;  1IO2 A;  4M3R A;  4QOZ B;  4W5N A;  2XO7 A;  1BCM A;  3OYI A;  3NDK A;  4AHS A;  4I2P A;  4DSE A;  4CK2 A;  4KHN A;  1LAV A;  4PY5 A;  4IKF A;  1J9A A;  1B9F A;  4DQR A;  1BI4 B;  3LAM A;  1QN7 A;  1NOZ A;  1VRU A;  1RM1 A;  3RRH A;  4FJJ A;  1B9K A;  1C1A A;  4ELV A;  3H08 A;  2HW3 A;  5JS1 A;  4B0A A;  2O3O A;  1C0U A;  4FW2 A;  3KK3 A;  1S1X A;  3WNH A;  3ZT4 A;  3LDS A;  1EX4 A;  3NAE A;  1RT4 A;  4DTS A;  4CF9 A;  1CZ9 A;  2R7Y A;  1TAU A;  4UQG A;  4PWD A;  2LAE A;  1UWB A;  3NF9 A;  3P1G A;  4CFB A;  4C8N A;  3ZT3 A;  4CEE A;  3VQ8 A;  4Q5V A;  3T19 A;  5FDL A;  4JRQ A;  3IG1 A;  2MJ7 A;  1KRP A;  3FFI A;  3DLR A;  4F2R A;  1BCO A;  1RCH A;  4GW6 A;  4CJE A;  1Q9Y A;  2IOC A;  3QEX A;  3AA3 A;  1U49 A;  1D9F A;  3AVK A;  4KFB A;  2PYJ A;  1FKP A;  3IAY A;  2VWJ A;  3AO4 A;  2HHQ A;  2XHI A;  4LD0 A;  3DMJ A;  2WON A;  1L3V A;  3OYK A;  2KZM A;  2JOI A;  3OJU A;  1X9W A;  4DSI A;  4M41 A;  4KO0 A;  4EJY A;  1IKX A;  3ZSZ A;  4BE1 A;  4DU4 A;  2JLE A;  2IC3 A;  3OCI A;  1PZD A;  4OVL A;  2E6L A;  3OS0 A;  3DPU A;  1X9M A;  1S1W A;  4Q0B A;  4TSX A;  1QNE A;  3EZ5 A;  2YH5 A;  3PO4 A;  4AHR A;  5HRS A;  3ALY A;  2DFH A;  5KRT A;  2B6A A;  4IDK A;  4OKJ A;  4N76 A;  2OPS A;  4RW8 A;  3DLE A;  3AO3 A;  5FRO A;  3S3N A;  3I0R A;  1JLG A;  4CEC A;  4CK1 A;  2HHT A;  1UA1 A;  3LAN A;  4Z0U A;  4CJK A;  3LZI A;  2NOL A;  3C6U A;  1UT4 A;  3KJV A;  3QEW A;  1JLQ A;  3LPT A;  2DTU A;  1JLA A;  1FKO A;  4N5S A;  3V9S A;  3ZSY A;  1RBV A;  3V1R A;  4QAG A;  1S1V A;  3TI0 A;  3TAN A;  1WSI A;  3ZSR A;  2HHW A;  1U04 A;  3F0Z A;  1CXU A;  1XWL A;  2B4J A;  3JSM A;  4DS5 A;  3K57 A;  1D9D A;  4ZTF A;  4B9M A;  2NUB A;  4CHZ A;  2VWK A;  3RWU A;  1TAQ A;  1J53 A;  4B9U A;  4FZZ A;  1D5A A;  1JLB A;  1RBS A;  3L2R A;  5EU7 A;  3OYH A;  4ZTJ A;  3LWM A;  4FLV A;  1HYV A;  3VN5 A;  3ZCM A;  1YTA A;  4Z4H A;  3OC3 C;  3AVJ A;  3TAB A;  4J2A A;  3TR8 A;  3SUP A;  2NOF A;  2DY4 A;  4BDY A;  4CJQ A;  4CEA A;  2I5W A;  1WSJ A;  1HRH A;  1JL2 A;  1JLC A;  3JYT A;  3ASM A;  2VJ0 A;  1TKD A;  1YQK A;  4YFU A;  4FLW A;  4DTO A;  4DSF A;  4ID1 A;  3NGZ A;  2RPI A;  1SL1 A;  3TAM A;  4B9V A;  1WNS A;  2O4G A;  4E7L A;  1LWV A;  4DF4 A;  1HJR A;  3I0W A;  1I39 A;  3WNE A;  3LPU A;  3NF7 A;  3U3Y A;  1TBP A;  1QTS A;  4LSL A;  1RIL A;  4B8C A;  4EP5 A;  3C95 A;  3OYB A;  3ZT0 A;  5E41 A;  3RR7 A;  3SUO A;  2HHX A;  1LWE A;  4MFB A;  4F8R A;  1L5U A;  4KRE A;  3NH0 A;  4DUL A;  4IFY A;  3ZT2 A;  3QEI A;  2ITG A;  2YKN A;  4AH9 A;  5IYD P;  4JRP A;  2Z8U A;  3E01 A;  3QEP A;  1NK9 A;  4LH4 A;  3PO5 A;  1FXX A;  2NOB A;  4GVM A;  3D45 A;  3BGR A;  1RDB A;  3I8D A;  4J2E A;  4FK2 A;  2GUI A;  3AO5 A;  2IS3 A;  1UAX A;  3O4Q A;  3VQE A;  1ZYQ A;  1BI4 A;  1M3H A;  3HST B;  5KTQ A;  3CFO A;  1FK9 A;  2X78 A;  3K59 A;  4FJK A;  3CM6 A;  1ASU A;  1HYS A;  3DOL A;  1QN3 A;  4HUE A;  3TAR A;  4FZX C;  4FJ9 A;  3NH1 A;  4O44 A;  3MXI A;  3DM2 A;  3OVN A;  3NF6 A;  1YQM A;  2JGU A;  4AHT A;  4DG1 A;  5FRN A;  3B6P A;  3NGY A;  1HPZ A;  4TPS A;  1HQE A;  1U48 A;  3SNS A;  1BHL A;  1NH2 A;  3KIO A;  4DQI A;  3KD5 E;  3KLE A;  1NK4 A;  3D0P A;  3MXM A;  4CJF A;  1C0T A;  3VA0 A;  2IDO A;  5J2P A;  2KW4 A;  4F4K A;  3B6O A;  2DFF A;  2Y1I A;  3TAF A;  3SUN A;  3RMD A;  4JS5 A;  3C94 A;  3QER A;  3NBP A;  1IG9 A;  1RT3 A;  4B9S A;  4DQQ A;  3HP9 A;  1WAF A;  4FJN A;  1QS4 A;  1RTI A;  4M3U A;  5IYB P;  4RW6 A;  3VQC A;  1N3A A;  5J2M A;  5C24 A;  2QKK A;  2Z1J A;  3ZSQ A;  3U6F A;  1ZBI A;  3KLF A;  4CIG A;  4FLX A;  3ZSW A;  1ZBL A;  4Z4I A;  1IKW A;  1RDA A;  4B8A B;  3K58 A;  1U4B A;  3DLK A;  3QNO A;  4DLE A;  1TK5 A;  1RTD A;  3LAL A;  5SWM A;  4M42 A;  1NKC A;  2OYQ A;  4FJ7 A;  4FJX A;  3RMC A;  2E4L A;  1MU2 A;  3AV9 A;  4CHP A;  1QNC A;  2XRI A;  3PV8 A;  3PY8 A;  3OYA A;  1QN9 A;  3SZ2 A;  3S3O A;  3N89 A;  1RBR A;  3L8B A;  3QES A;  2XY7 A;  4J2D A;  1TKT A;  3G10 A;  1RBT A;  2BGG A;  3SV4 A;  4JS4 A;  2YNI A;  1BIS A;  1NK8 A;  3UIQ A;  1A5X A;  3WNG A;  1RTH A;  3TWH A;  3KTQ A;  4AHC A;  4DTU A;  2YKM A;  1R0A A;  1SL2 A;  4R5P A;  2OPP A;  4CJ4 A;  3HM9 A;  1JFI C;  4O4G A;  4H4M A;  1VSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...