1C9BB

Crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
180
structure length
180
Chain Sequence
GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of preinitiation complex assembly on human pol II promoters.
pubmed doi rcsb
molecule keywords ADMLP TATA-BOX DNA CONTAINING IIB RECOGNITION ELEMENT
molecule tags Transcription/dna
source organism Homo sapiens
total genus 38
structure length 180
sequence length 180
chains with identical sequence F, J, N, R
ec nomenclature
pdb deposition date 1999-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1c9bB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1c9bB02
1QN8A 2D0CA 1R4XA 4ROEB 1KYUA 1YTFA 1NH2A 1C9BB 3HS9A 1AISA 1QNCA 5IYDP 1QN9A 2D0BA 1YTBA 2D0AA 1QNBA 1JFIC 1QNEA 3ASMA 2IV8A 1B9KA 1QN5A 2Z8UA 2VJ0A 1QN3A 1PCZA 3OCIA 1KY6A 2G30A 4B0AA 1W80A 5IYCP 1NGMA 1QNAA 2IV9A 3EIKA 3VN5A 1D3UA 4RODB 5IYBP 1QN7A 1MP9A 1TGHA 1VTLE 4ROCB 1QTSA 1KY7A 1NVPA 1TBAB 2MJ7A 1QN6A 1VOLB 3HS8A 3OC3C 4PY5A 1VOKA 1VTOA 1PZDA 1QN4A 1E42A 1CDWA 1KYDA 1QTPA 1KYFA 1TBPA 1RM1A 4WZSD 3H1ZA
chains in the Genus database with same CATH superfamily
2HKPA 3OLPA 3DPTA 1M3HA 3F0ZA 2FKMX 2PWWA 3OSEA 3I3WA 2DKCA 4EAGA 1YTBA 3ASMA 3CVSA 4C7PA 2NOBA 2Z8UA 1YQLA 2EHBD 3EAYA 5IYCP 2H5AX 5KL0A 4IL8A 2IV9A 1QNAA 3OH9A 1PCMX 1D3UA 2FKFA 3OSMA 2JHJA 4RODB 5BMNA 1N3CA 1EBMA 2NOHA 4QG5A 2LAEA 3OGDA 1NVPA 1LXTA 1T6AA 4WXAA 1TUOA 1FN7A 1VOLB 3KTUA 1K35A 1KYDA 1QTPA 2NWVA 2OOXA 2YA3A 2QREA 2NLVA 1MPGA 2V92A 4WZSD 4D7QA 2D0CA 1R4XA 5F9CA 3DPUA 1KYUA 1C9BB 2FGTA 2HL9A 3T4NA 4MRQA 2NVMA 2QLVA 4TPSA 1YQMA 3TE5A 3ENOC 4Q11A 2Y8LA 2D0AA 4I8OA 1B9KA 5JMVD 2NOFA 1QN5A 3F10A 5EPCA 2VJ0A 1PCZA 2XHIA 2YH5A 5BMPA 1LWYA 1QN7A 1MP9A 1VTLE 1TBAB 1LWWA 3OC3C 1VOKA 1K2YX 3D7QA 1N39A 2MZ8A 3RPJA 4EAKA 2NOZA 1KYFA 1UL7A 3I0XA 2R5XA 2OOYA 2I5WA 1VKLA 3CW7A 1KO9A 4ROEB 4CFFA 4EAIA 3CWAA 2DKAA 1C4GA 3TDHA 1NH2A 1YTFA 2HZSA 1P5DX 3RSMA 1EUVA 5HSHA 1AISA 1QNCA 5IYDP 1WQAA 1PCJX 4DULA 3N89A 1QNBA 1JFIC 3PDKA 2IV8A 3C04A 2QRCA 2JPIA 4D7RA 2NOLA 2FUVA 3IH7A 1KY6A 2G30A 3OSTA 1J3MA 1YQRA 3EIKA 4HJHA 3VN5A 3I0WA 3CVTA 1QTSA 1QN6A 1UT4A 2NOIA 4PY5A 1P5GX 3UW2A 1Q9UA 1PZDA 2DKDA 4EALA 2F7LA 2QR1A 3OH6A 2H4LX 3H1ZA 1QN8A 2V9JA 3PMGA 3HS9A 2JHNA 4EJZA 1KFQA 1UT7A 5JN5A 1V5SA 1N3AA 3D4VA 2D0BA 1QN9A 2V8QA 1PVSA 2ZFDB 3CWUA 1KFIA 1QNEA 1C47A 3NA5A 1XSZA 1QN3A 3OCIA 2Z0FA 4B0AA 4EAJA 2NOEA 4BJUA 1W80A 1NGMA 1M5Q1 4EJYA 2O3OA 2HZMA 5IYBP 1LWVA 1DIZA 1TGHA 2HL8A 1JDYA 4ROCB 2JOIA 1KY7A 4WX8A 2MJ7A 1YQKA 1HU0A 3CWSA 3HS8A 5AN4A 1VTOA 3ULXA 3SNSA 1QN4A 1E42A 1WJWA 3KRMA 2Y8QA 1CDWA 3CWTA 3BKQX 1M3QA 1TBPA 1RM1A 2QRDA 3ENCA
chains in the Genus database with same CATH topology
3DPTA 1M3HA 1YTBA 3ASMA 2NOBA 2Z8UA 1YQLA 5IYCP 1TBPA 1QNAA 2IV9A 1D3UA 4RODB 3OSMA 1N3CA 1EBMA 2NOHA 2LAEA 1NVPA 1FN7A 1VOLB 3KTUA 1KYDA 1QTPA 4WZSD 2D0CA 1R4XA 3DPUA 1KYUA 1C9BB 2FGTA 4TPSA 1YQMA 4Q11A 2D0AA 4I8OA 1B9KA 2NOFA 1QN5A 3F10A 2VJ0A 1PCZA 2XHIA 2YH5A 1LWYA 1QN7A 1MP9A 1VTLE 1TBAB 1LWWA 3OC3C 1VOKA 1N39A 2MZ8A 3RPJA 2NOZA 1KYFA 3I0XA 2I5WA 1KO9A 4ROEB 1YTFA 1NH2A 2HZSA 1AISA 1QNCA 5IYDP 4DULA 3N89A 1QNBA 1JFIC 2IV8A 2NOLA 3IH7A 1KY6A 2G30A 3OSTA 1YQRA 3EIKA 3I0WA 3VN5A 1QTSA 1QN6A 1UT4A 2NOIA 4PY5A 1PZDA 3H1ZA 1QN8A 3HS9A 4EJZA 1UT7A 1N3AA 1QN9A 2D0BA 1QNEA 1QN3A 3OCIA 2NOEA 4B0AA 1W80A 1NGMA 4EJYA 2O3OA 2HZMA 5IYBP 1LWVA 1TGHA 4ROCB 1YQKA 2JOIA 1KY7A 2MJ7A 1HU0A 3HS8A 5AN4A 1VTOA 3ULXA 3SNSA 1QN4A 1E42A 3KRMA 1CDWA 1M3QA 3F0ZA 1RM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QN8 A;  2D0C A;  1R4X A;  4ROE B;  1KYU A;  1YTF A;  1NH2 A;  1C9B B;  3HS9 A;  1AIS A;  1QNC A;  5IYD P;  1QN9 A;  2D0B A;  1YTB A;  2D0A A;  1QNB A;  1JFI C;  1QNE A;  3ASM A;  2IV8 A;  1B9K A;  1QN5 A;  2Z8U A;  2VJ0 A;  1QN3 A;  1PCZ A;  3OCI A;  1KY6 A;  2G30 A;  4B0A A;  1W80 A;  5IYC P;  1NGM A;  1QNA A;  2IV9 A;  3EIK A;  3VN5 A;  1D3U A;  4ROD B;  5IYB P;  1QN7 A;  1MP9 A;  1TGH A;  1VTL E;  4ROC B;  1QTS A;  1KY7 A;  1NVP A;  1TBA B;  2MJ7 A;  1QN6 A;  1VOL B;  3HS8 A;  3OC3 C;  4PY5 A;  1VOK A;  1VTO A;  1PZD A;  1QN4 A;  1E42 A;  1CDW A;  1KYD A;  1QTP A;  1KYF A;  1TBP A;  1RM1 A;  4WZS D;  3H1Z A; 
#chains in the Genus database with same CATH topology
 2HKP A;  3OLP A;  3DPT A;  1M3H A;  3F0Z A;  2FKM X;  2PWW A;  3OSE A;  3I3W A;  2DKC A;  4EAG A;  1YTB A;  3ASM A;  3CVS A;  4C7P A;  2NOB A;  2Z8U A;  1YQL A;  2EHB D;  3EAY A;  5IYC P;  2H5A X;  5KL0 A;  4IL8 A;  2IV9 A;  1QNA A;  3OH9 A;  1PCM X;  1D3U A;  2FKF A;  3OSM A;  2JHJ A;  4ROD B;  5BMN A;  1N3C A;  1EBM A;  2NOH A;  4QG5 A;  2LAE A;  3OGD A;  1NVP A;  1LXT A;  1T6A A;  4WXA A;  1TUO A;  1FN7 A;  1VOL B;  3KTU A;  1K35 A;  1KYD A;  1QTP A;  2NWV A;  2OOX A;  2YA3 A;  2QRE A;  2NLV A;  1MPG A;  2V92 A;  4WZS D;  4D7Q A;  2D0C A;  1R4X A;  5F9C A;  3DPU A;  1KYU A;  1C9B B;  2FGT A;  2HL9 A;  3T4N A;  4MRQ A;  2NVM A;  2QLV A;  4TPS A;  1YQM A;  3TE5 A;  3ENO C;  4Q11 A;  2Y8L A;  2D0A A;  4I8O A;  1B9K A;  5JMV D;  2NOF A;  1QN5 A;  3F10 A;  5EPC A;  2VJ0 A;  1PCZ A;  2XHI A;  2YH5 A;  5BMP A;  1LWY A;  1QN7 A;  1MP9 A;  1VTL E;  1TBA B;  1LWW A;  3OC3 C;  1VOK A;  1K2Y X;  3D7Q A;  1N39 A;  2MZ8 A;  3RPJ A;  4EAK A;  2NOZ A;  1KYF A;  1UL7 A;  3I0X A;  2R5X A;  2OOY A;  2I5W A;  1VKL A;  3CW7 A;  1KO9 A;  4ROE B;  4CFF A;  4EAI A;  3CWA A;  2DKA A;  1C4G A;  3TDH A;  1NH2 A;  1YTF A;  2HZS A;  1P5D X;  3RSM A;  1EUV A;  5HSH A;  1AIS A;  1QNC A;  5IYD P;  1WQA A;  1PCJ X;  4DUL A;  3N89 A;  1QNB A;  1JFI C;  3PDK A;  2IV8 A;  3C04 A;  2QRC A;  2JPI A;  4D7R A;  2NOL A;  2FUV A;  3IH7 A;  1KY6 A;  2G30 A;  3OST A;  1J3M A;  1YQR A;  3EIK A;  4HJH A;  3VN5 A;  3I0W A;  3CVT A;  1QTS A;  1QN6 A;  1UT4 A;  2NOI A;  4PY5 A;  1P5G X;  3UW2 A;  1Q9U A;  1PZD A;  2DKD A;  4EAL A;  2F7L A;  2QR1 A;  3OH6 A;  2H4L X;  3H1Z A;  1QN8 A;  2V9J A;  3PMG A;  3HS9 A;  2JHN A;  4EJZ A;  1KFQ A;  1UT7 A;  5JN5 A;  1V5S A;  1N3A A;  3D4V A;  2D0B A;  1QN9 A;  2V8Q A;  1PVS A;  2ZFD B;  3CWU A;  1KFI A;  1QNE A;  1C47 A;  3NA5 A;  1XSZ A;  1QN3 A;  3OCI A;  2Z0F A;  4B0A A;  4EAJ A;  2NOE A;  4BJU A;  1W80 A;  1NGM A;  1M5Q 1;  4EJY A;  2O3O A;  2HZM A;  5IYB P;  1LWV A;  1DIZ A;  1TGH A;  2HL8 A;  1JDY A;  4ROC B;  2JOI A;  1KY7 A;  4WX8 A;  2MJ7 A;  1YQK A;  1HU0 A;  3CWS A;  3HS8 A;  5AN4 A;  1VTO A;  3ULX A;  3SNS A;  1QN4 A;  1E42 A;  1WJW A;  3KRM A;  2Y8Q A;  1CDW A;  3CWT A;  3BKQ X;  1M3Q A;  1TBP A;  1RM1 A;  2QRD A;  3ENC A; 
#chains in the Genus database with same CATH homology
 3DPT A;  1M3H A;  1YTB A;  3ASM A;  2NOB A;  2Z8U A;  1YQL A;  5IYC P;  1TBP A;  1QNA A;  2IV9 A;  1D3U A;  4ROD B;  3OSM A;  1N3C A;  1EBM A;  2NOH A;  2LAE A;  1NVP A;  1FN7 A;  1VOL B;  3KTU A;  1KYD A;  1QTP A;  4WZS D;  2D0C A;  1R4X A;  3DPU A;  1KYU A;  1C9B B;  2FGT A;  4TPS A;  1YQM A;  4Q11 A;  2D0A A;  4I8O A;  1B9K A;  2NOF A;  1QN5 A;  3F10 A;  2VJ0 A;  1PCZ A;  2XHI A;  2YH5 A;  1LWY A;  1QN7 A;  1MP9 A;  1VTL E;  1TBA B;  1LWW A;  3OC3 C;  1VOK A;  1N39 A;  2MZ8 A;  3RPJ A;  2NOZ A;  1KYF A;  3I0X A;  2I5W A;  1KO9 A;  4ROE B;  1YTF A;  1NH2 A;  2HZS A;  1AIS A;  1QNC A;  5IYD P;  4DUL A;  3N89 A;  1QNB A;  1JFI C;  2IV8 A;  2NOL A;  3IH7 A;  1KY6 A;  2G30 A;  3OST A;  1YQR A;  3EIK A;  3I0W A;  3VN5 A;  1QTS A;  1QN6 A;  1UT4 A;  2NOI A;  4PY5 A;  1PZD A;  3H1Z A;  1QN8 A;  3HS9 A;  4EJZ A;  1UT7 A;  1N3A A;  1QN9 A;  2D0B A;  1QNE A;  1QN3 A;  3OCI A;  2NOE A;  4B0A A;  1W80 A;  1NGM A;  4EJY A;  2O3O A;  2HZM A;  5IYB P;  1LWV A;  1TGH A;  4ROC B;  1YQK A;  2JOI A;  1KY7 A;  2MJ7 A;  1HU0 A;  3HS8 A;  5AN4 A;  1VTO A;  3ULX A;  3SNS A;  1QN4 A;  1E42 A;  3KRM A;  1CDW A;  1M3Q A;  3F0Z A;  1RM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...