1NH2A

Crystal structure of a yeast tfiia/tbp/dna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
molecule keywords 5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C
molecule tags Transcription/dna
source organism Saccharomyces cerevisiae
total genus 43
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1nh2A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1nh2A02
1JFIC 1NVPA 1QNCA 1PCZA 1NH2A 1VOLB 2G30A 1W80A 1AISA 1QN4A 1TGHA 4PY5A 2D0CA 5IYBP 3HS8A 4WZSD 1YTFA 4B0AA 3OCIA 1PZDA 2IV9A 1QNAA 1QN8A 1YTBA 3H1ZA 3ASMA 1VTOA 2D0BA 1MP9A 1B9KA 1VTLE 5IYDP 3EIKA 1QTPA 3OC3C 4RODB 1QNBA 1R4XA 1CDWA 1KYDA 1QTSA 3HS9A 1QN9A 2Z8UA 1KYUA 1NGMA 1KY6A 1C9BB 2IV8A 1D3UA 1E42A 1QN7A 1VOKA 1RM1A 1QN3A 1QN6A 4ROCB 2D0AA 5IYCP 2VJ0A 1TBPA 4ROEB 1QNEA 2MJ7A 1KY7A 3VN5A 1KYFA 1QN5A 1TBAB
chains in the Genus database with same CATH superfamily
2F7LA 1LWYA 2NOBA 2V9JA 1P5GX 5HSHA 1YQKA 1VOLB 2G30A 1AISA 1TGHA 1QN4A 3HS8A 3ULXA 4DULA 3IH7A 5BMPA 3F0ZA 3OGDA 1MP9A 3OC3C 3CWTA 2OOXA 1R4XA 1CDWA 4I8OA 1QTSA 2HKPA 2H4LX 2ZFDB 3KRMA 3OSMA 1KFIA 5JMVD 3C04A 4TPSA 3UW2A 1C9BB 1D3UA 1QN7A 1E42A 1QN3A 2Z0FA 4Q11A 1PVSA 1QN6A 1M5Q1 1YQRA 3OH9A 1QNEA 3T4NA 3SNSA 1KY7A 3RSMA 4EAIA 1KYFA 1QN5A 1P5DX 5KL0A 1JFIC 1W80A 4HJHA 3DPUA 2FKFA 1K35A 2XHIA 4IL8A 3BKQX 1V5SA 3TE5A 5EPCA 1YTBA 2NOEA 4D7RA 4EALA 1M3HA 3ASMA 2QREA 1B9KA 3F10A 3RPJA 1LWVA 3EIKA 1N39A 4RODB 4EJZA 3CW7A 3OH6A 3HS9A 3I3WA 1QN9A 3ENOC 2V92A 3OSEA 1PCJX 2IV8A 1UT4A 1WQAA 2DKDA 2DKCA 2QLVA 1J3MA 2QRDA 2Y8LA 4WXAA 4WX8A 4ROCB 1TUOA 3CWAA 3NA5A 1FN7A 1TBPA 3OSTA 3DPTA 2FGTA 3KTUA 1KO9A 4EAJA 1QNCA 2V8QA 1NH2A 2JHJA 2QRCA 2D0CA 5IYBP 4WZSD 1YTFA 1HU0A 1Q9UA 2IV9A 2Y8QA 1MPGA 4D7QA 2DKAA 1EBMA 2H5AX 2HZSA 3H1ZA 2D0BA 1VTOA 1YQMA 1N3AA 4CFFA 1DIZA 5IYDP 2NOFA 1QTPA 3PDKA 2YH5A 1XSZA 1YQLA 3CVSA 4EAKA 1QNBA 1N3CA 2NOHA 2JPIA 1K2YX 3CVTA 2NOIA 1C4GA 1KYUA 3EAYA 1NGMA 3CWSA 1RM1A 2HL9A 2O3OA 2D0AA 5IYCP 2VJ0A 4MRQA 4ROEB 2MJ7A 3N89A 1UT7A 3VN5A 2FUVA 1VKLA 4EAGA 2HZMA 3D4VA 1TBAB 3ENCA 3TDHA 3I0WA 1NVPA 1KFQA 3D7QA 1PCZA 2I5WA 1C47A 4PY5A 2LAEA 2R5XA 2NOLA 2NVMA 4B0AA 5JN5A 3OCIA 1LWWA 1PZDA 1QN8A 1QNAA 2PWWA 2OOYA 2NLVA 4C7PA 1EUVA 2QR1A 2NOZA 1PCMX 1WJWA 1VTLE 1UL7A 3OLPA 3PMGA 5AN4A 3I0XA 1KYDA 2JHNA 4QG5A 2NWVA 2Z8UA 5F9CA 1KY6A 2JOIA 4BJUA 2YA3A 5BMNA 1T6AA 1VOKA 2MZ8A 3CWUA 1LXTA 4EJYA 2FKMX 2EHBD 1JDYA 1M3QA 2HL8A
chains in the Genus database with same CATH topology
1LWYA 2NOBA 1YQKA 1VOLB 2G30A 1AISA 1TGHA 1QN4A 3HS8A 3ULXA 4DULA 3IH7A 3F0ZA 1MP9A 3OC3C 1R4XA 1CDWA 4I8OA 1QTSA 3OSMA 3KRMA 4TPSA 1C9BB 1D3UA 1QN3A 1QN7A 1E42A 4Q11A 1QN6A 1YQRA 1QNEA 3SNSA 1KY7A 1KYFA 1QN5A 1JFIC 1W80A 3DPUA 2XHIA 2NOEA 1YTBA 1M3HA 3ASMA 1B9KA 3F10A 3RPJA 1LWVA 3EIKA 1N39A 4RODB 4EJZA 3HS9A 1QN9A 2IV8A 1UT4A 4ROCB 1FN7A 1TBPA 3OSTA 3DPTA 2FGTA 3KTUA 1KO9A 1QNCA 1NH2A 2D0CA 5IYBP 4WZSD 1YTFA 1HU0A 2IV9A 1EBMA 2HZSA 3H1ZA 1VTOA 2D0BA 1YQMA 1N3AA 5IYDP 2NOFA 1QTPA 2YH5A 1YQLA 1QNBA 1N3CA 2NOHA 2NOIA 1KYUA 1NGMA 1RM1A 2O3OA 2D0AA 5IYCP 2VJ0A 4ROEB 2MJ7A 3N89A 1UT7A 3VN5A 2HZMA 1TBAB 3I0WA 1NVPA 1PCZA 2I5WA 4PY5A 2LAEA 2NOLA 4B0AA 1LWWA 3OCIA 1PZDA 1QN8A 1QNAA 2NOZA 1VTLE 3I0XA 5AN4A 1KYDA 2Z8UA 1KY6A 2JOIA 1VOKA 2MZ8A 4EJYA 1M3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFI C;  1NVP A;  1QNC A;  1PCZ A;  1NH2 A;  1VOL B;  2G30 A;  1W80 A;  1AIS A;  1QN4 A;  1TGH A;  4PY5 A;  2D0C A;  5IYB P;  3HS8 A;  4WZS D;  1YTF A;  4B0A A;  3OCI A;  1PZD A;  2IV9 A;  1QNA A;  1QN8 A;  1YTB A;  3H1Z A;  3ASM A;  1VTO A;  2D0B A;  1MP9 A;  1B9K A;  1VTL E;  5IYD P;  3EIK A;  1QTP A;  3OC3 C;  4ROD B;  1QNB A;  1R4X A;  1CDW A;  1KYD A;  1QTS A;  3HS9 A;  1QN9 A;  2Z8U A;  1KYU A;  1NGM A;  1KY6 A;  1C9B B;  2IV8 A;  1D3U A;  1E42 A;  1QN7 A;  1VOK A;  1RM1 A;  1QN3 A;  1QN6 A;  4ROC B;  2D0A A;  5IYC P;  2VJ0 A;  1TBP A;  4ROE B;  1QNE A;  2MJ7 A;  1KY7 A;  3VN5 A;  1KYF A;  1QN5 A;  1TBA B; 
#chains in the Genus database with same CATH topology
 2F7L A;  1LWY A;  2NOB A;  2V9J A;  1P5G X;  5HSH A;  1YQK A;  1VOL B;  2G30 A;  1AIS A;  1TGH A;  1QN4 A;  3HS8 A;  3ULX A;  4DUL A;  3IH7 A;  5BMP A;  3F0Z A;  3OGD A;  1MP9 A;  3OC3 C;  3CWT A;  2OOX A;  1R4X A;  1CDW A;  4I8O A;  1QTS A;  2HKP A;  2H4L X;  2ZFD B;  3KRM A;  3OSM A;  1KFI A;  5JMV D;  3C04 A;  4TPS A;  3UW2 A;  1C9B B;  1D3U A;  1QN7 A;  1E42 A;  1QN3 A;  2Z0F A;  4Q11 A;  1PVS A;  1QN6 A;  1M5Q 1;  1YQR A;  3OH9 A;  1QNE A;  3T4N A;  3SNS A;  1KY7 A;  3RSM A;  4EAI A;  1KYF A;  1QN5 A;  1P5D X;  5KL0 A;  1JFI C;  1W80 A;  4HJH A;  3DPU A;  2FKF A;  1K35 A;  2XHI A;  4IL8 A;  3BKQ X;  1V5S A;  3TE5 A;  5EPC A;  1YTB A;  2NOE A;  4D7R A;  4EAL A;  1M3H A;  3ASM A;  2QRE A;  1B9K A;  3F10 A;  3RPJ A;  1LWV A;  3EIK A;  1N39 A;  4ROD B;  4EJZ A;  3CW7 A;  3OH6 A;  3HS9 A;  3I3W A;  1QN9 A;  3ENO C;  2V92 A;  3OSE A;  1PCJ X;  2IV8 A;  1UT4 A;  1WQA A;  2DKD A;  2DKC A;  2QLV A;  1J3M A;  2QRD A;  2Y8L A;  4WXA A;  4WX8 A;  4ROC B;  1TUO A;  3CWA A;  3NA5 A;  1FN7 A;  1TBP A;  3OST A;  3DPT A;  2FGT A;  3KTU A;  1KO9 A;  4EAJ A;  1QNC A;  2V8Q A;  1NH2 A;  2JHJ A;  2QRC A;  2D0C A;  5IYB P;  4WZS D;  1YTF A;  1HU0 A;  1Q9U A;  2IV9 A;  2Y8Q A;  1MPG A;  4D7Q A;  2DKA A;  1EBM A;  2H5A X;  2HZS A;  3H1Z A;  2D0B A;  1VTO A;  1YQM A;  1N3A A;  4CFF A;  1DIZ A;  5IYD P;  2NOF A;  1QTP A;  3PDK A;  2YH5 A;  1XSZ A;  1YQL A;  3CVS A;  4EAK A;  1QNB A;  1N3C A;  2NOH A;  2JPI A;  1K2Y X;  3CVT A;  2NOI A;  1C4G A;  1KYU A;  3EAY A;  1NGM A;  3CWS A;  1RM1 A;  2HL9 A;  2O3O A;  2D0A A;  5IYC P;  2VJ0 A;  4MRQ A;  4ROE B;  2MJ7 A;  3N89 A;  1UT7 A;  3VN5 A;  2FUV A;  1VKL A;  4EAG A;  2HZM A;  3D4V A;  1TBA B;  3ENC A;  3TDH A;  3I0W A;  1NVP A;  1KFQ A;  3D7Q A;  1PCZ A;  2I5W A;  1C47 A;  4PY5 A;  2LAE A;  2R5X A;  2NOL A;  2NVM A;  4B0A A;  5JN5 A;  3OCI A;  1LWW A;  1PZD A;  1QN8 A;  1QNA A;  2PWW A;  2OOY A;  2NLV A;  4C7P A;  1EUV A;  2QR1 A;  2NOZ A;  1PCM X;  1WJW A;  1VTL E;  1UL7 A;  3OLP A;  3PMG A;  5AN4 A;  3I0X A;  1KYD A;  2JHN A;  4QG5 A;  2NWV A;  2Z8U A;  5F9C A;  1KY6 A;  2JOI A;  4BJU A;  2YA3 A;  5BMN A;  1T6A A;  1VOK A;  2MZ8 A;  3CWU A;  1LXT A;  4EJY A;  2FKM X;  2EHB D;  1JDY A;  1M3Q A;  2HL8 A; 
#chains in the Genus database with same CATH homology
 1LWY A;  2NOB A;  1YQK A;  1VOL B;  2G30 A;  1AIS A;  1TGH A;  1QN4 A;  3HS8 A;  3ULX A;  4DUL A;  3IH7 A;  3F0Z A;  1MP9 A;  3OC3 C;  1R4X A;  1CDW A;  4I8O A;  1QTS A;  3OSM A;  3KRM A;  4TPS A;  1C9B B;  1D3U A;  1QN3 A;  1QN7 A;  1E42 A;  4Q11 A;  1QN6 A;  1YQR A;  1QNE A;  3SNS A;  1KY7 A;  1KYF A;  1QN5 A;  1JFI C;  1W80 A;  3DPU A;  2XHI A;  2NOE A;  1YTB A;  1M3H A;  3ASM A;  1B9K A;  3F10 A;  3RPJ A;  1LWV A;  3EIK A;  1N39 A;  4ROD B;  4EJZ A;  3HS9 A;  1QN9 A;  2IV8 A;  1UT4 A;  4ROC B;  1FN7 A;  1TBP A;  3OST A;  3DPT A;  2FGT A;  3KTU A;  1KO9 A;  1QNC A;  1NH2 A;  2D0C A;  5IYB P;  4WZS D;  1YTF A;  1HU0 A;  2IV9 A;  1EBM A;  2HZS A;  3H1Z A;  1VTO A;  2D0B A;  1YQM A;  1N3A A;  5IYD P;  2NOF A;  1QTP A;  2YH5 A;  1YQL A;  1QNB A;  1N3C A;  2NOH A;  2NOI A;  1KYU A;  1NGM A;  1RM1 A;  2O3O A;  2D0A A;  5IYC P;  2VJ0 A;  4ROE B;  2MJ7 A;  3N89 A;  1UT7 A;  3VN5 A;  2HZM A;  1TBA B;  3I0W A;  1NVP A;  1PCZ A;  2I5W A;  4PY5 A;  2LAE A;  2NOL A;  4B0A A;  1LWW A;  3OCI A;  1PZD A;  1QN8 A;  1QNA A;  2NOZ A;  1VTL E;  3I0X A;  5AN4 A;  1KYD A;  2Z8U A;  1KY6 A;  2JOI A;  1VOK A;  2MZ8 A;  4EJY A;  1M3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...