1QN7A

Crystal structure of the t(-27) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
186
structure length
186
Chain Sequence
DLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
molecule tags Tata box-binding protein (tbp)
source organism Arabidopsis thaliana
total genus 48
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn7A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn7A02
1QNBA 3H1ZA 1W80A 1C9BB 1R4XA 1PZDA 1JFIC 1QNEA 1VOKA 1TBPA 1QN5A 1QNAA 2IV8A 3ASMA 1QNCA 1KY7A 4WZSD 1VOLB 5IYDP 1QTSA 2MJ7A 4ROCB 1NVPA 3HS9A 2IV9A 1NH2A 2D0BA 1VTLE 4RODB 1PCZA 5IYCP 2G30A 1QN3A 1QN4A 1KY6A 1YTFA 3OCIA 3VN5A 1E42A 1KYUA 3OC3C 1RM1A 2VJ0A 1QN9A 1D3UA 1CDWA 1QN7A 1B9KA 1TBAB 4ROEB 1TGHA 1QN6A 1YTBA 2Z8UA 1QTPA 1MP9A 2D0AA 1KYFA 1NGMA 1KYDA 3EIKA 2D0CA 1VTOA 1AISA 4PY5A 4B0AA 1QN8A 5IYBP 3HS8A
chains in the Genus database with same CATH superfamily
1C47A 1M5Q1 3H1ZA 3C04A 3OLPA 1P5DX 4C7PA 1N3CA 1JFIC 1QN5A 5KL0A 2IV8A 1QNAA 5IYDP 1KY7A 4EAJA 2H5AX 1LXTA 1QTSA 3OSTA 4ROCB 3T4NA 2IV9A 3RSMA 2NOLA 2D0BA 1VTLE 1KFIA 1PCZA 2FGTA 1XSZA 3I0XA 2NOIA 1E42A 1KYUA 3OC3C 3BKQX 2QLVA 1RM1A 1LWWA 1D3UA 3CW7A 3SNSA 1QN7A 1TBAB 4ROEB 1TGHA 1TUOA 1UT7A 2HL8A 4CFFA 3PMGA 3I0WA 2FKFA 2D0AA 5HSHA 3CVSA 2HZMA 3OSEA 1KYFA 4I8OA 3IH7A 1PVSA 2ZFDB 4EAKA 3PDKA 4PY5A 1P5GX 1DIZA 2FKMX 1QNBA 2JHJA 1W80A 2NVMA 2YA3A 3D4VA 1VOKA 1N3AA 1TBPA 3ULXA 5EPCA 1VKLA 1VOLB 1QNCA 4EAGA 4EAIA 4WZSD 2DKDA 4EJZA 2NOEA 2DKCA 2YH5A 2MJ7A 3HS9A 3OH6A 3KTUA 3CWSA 2NOBA 4EALA 3D7QA 2H4LX 2DKAA 1C4GA 2G30A 2PWWA 2QRCA 2Z0FA 3ENCA 2QRDA 4HJHA 1PCJX 5JMVD 2HL9A 3UW2A 1QN4A 3VN5A 4WXAA 2VJ0A 1QN9A 1CDWA 2HKPA 3ENOC 2QR1A 3CWTA 2MZ8A 3DPTA 4TPSA 5AN4A 5IYCP 3CVTA 5BMPA 2OOYA 3EIKA 1LWYA 2JPIA 2EHBD 1K35A 4B0AA 1M3QA 1C9BB 1UL7A 1HU0A 2O3OA 1QNEA 2V8QA 2JOIA 1FN7A 1KO9A 1KFQA 2JHNA 4QG5A 1K2YX 1EUVA 4RODB 5JN5A 2OOXA 1QN3A 3F10A 3OCIA 1JDYA 3RPJA 4D7QA 2QREA 2Y8LA 3F0ZA 3OH9A 2V9JA 1B9KA 3TDHA 1QN6A 2NWVA 2Z8UA 4DULA 4EJYA 1MP9A 3CWUA 4MRQA 2NOZA 1NGMA 1KYDA 1V5SA 2R5XA 1UT4A 1YQRA 2D0CA 3HS8A 1R4XA 1YQLA 1PZDA 1QN8A 2LAEA 5BMNA 1J3MA 4D7RA 1YQKA 2HZSA 1PCMX 3ASMA 3OGDA 4WX8A 1NVPA 2I5WA 2Y8QA 2XHIA 1NH2A 1Q9UA 2NLVA 1EBMA 2V92A 1KY6A 1YTFA 3DPUA 4IL8A 4BJUA 1T6AA 1WQAA 1YQMA 1YTBA 2NOFA 3NA5A 1QTPA 3N89A 4Q11A 3EAYA 3KRMA 1WJWA 3I3WA 1MPGA 1M3HA 2NOHA 3OSMA 5F9CA 2F7LA 1N39A 2FUVA 3TE5A 1VTOA 1AISA 3CWAA 1LWVA 5IYBP
chains in the Genus database with same CATH topology
1N3CA 3H1ZA 1JFIC 1QN5A 1QNAA 2IV8A 5IYDP 1KY7A 1QTSA 3OSTA 4ROCB 2IV9A 2NOLA 2D0BA 1VTLE 1PCZA 2FGTA 3I0XA 2NOIA 1E42A 1KYUA 3OC3C 1RM1A 1LWWA 1D3UA 3SNSA 1QN7A 1TBAB 4ROEB 1TGHA 1UT7A 3I0WA 2D0AA 2HZMA 1KYFA 4I8OA 3IH7A 4PY5A 1QNBA 1W80A 1VOKA 1N3AA 1TBPA 3ULXA 1VOLB 1QNCA 4WZSD 4EJZA 2NOEA 2YH5A 2MJ7A 3HS9A 3KTUA 2NOBA 5IYCP 2G30A 1QN4A 3VN5A 2VJ0A 1QN9A 1CDWA 2MZ8A 3DPTA 4TPSA 5AN4A 3EIKA 1LWYA 4B0AA 1M3QA 1C9BB 1HU0A 2O3OA 1QNEA 2JOIA 1FN7A 1KO9A 4RODB 1QN3A 3F10A 3OCIA 3RPJA 3F0ZA 1B9KA 1QN6A 2Z8UA 4EJYA 4DULA 1MP9A 2NOZA 1NGMA 1KYDA 1UT4A 1YQRA 2D0CA 3HS8A 1R4XA 1YQLA 1PZDA 1QN8A 2LAEA 1YQKA 2HZSA 3ASMA 1NVPA 2I5WA 2XHIA 1NH2A 1EBMA 1KY6A 1YTFA 3DPUA 1YQMA 1YTBA 2NOFA 1QTPA 3N89A 4Q11A 3KRMA 2NOHA 1M3HA 3OSMA 1N39A 1VTOA 1AISA 1LWVA 5IYBP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNB A;  3H1Z A;  1W80 A;  1C9B B;  1R4X A;  1PZD A;  1JFI C;  1QNE A;  1VOK A;  1TBP A;  1QN5 A;  1QNA A;  2IV8 A;  3ASM A;  1QNC A;  1KY7 A;  4WZS D;  1VOL B;  5IYD P;  1QTS A;  2MJ7 A;  4ROC B;  1NVP A;  3HS9 A;  2IV9 A;  1NH2 A;  2D0B A;  1VTL E;  4ROD B;  1PCZ A;  5IYC P;  2G30 A;  1QN3 A;  1QN4 A;  1KY6 A;  1YTF A;  3OCI A;  3VN5 A;  1E42 A;  1KYU A;  3OC3 C;  1RM1 A;  2VJ0 A;  1QN9 A;  1D3U A;  1CDW A;  1QN7 A;  1B9K A;  1TBA B;  4ROE B;  1TGH A;  1QN6 A;  1YTB A;  2Z8U A;  1QTP A;  1MP9 A;  2D0A A;  1KYF A;  1NGM A;  1KYD A;  3EIK A;  2D0C A;  1VTO A;  1AIS A;  4PY5 A;  4B0A A;  1QN8 A;  5IYB P;  3HS8 A; 
#chains in the Genus database with same CATH topology
 1C47 A;  1M5Q 1;  3H1Z A;  3C04 A;  3OLP A;  1P5D X;  4C7P A;  1N3C A;  1JFI C;  1QN5 A;  5KL0 A;  2IV8 A;  1QNA A;  5IYD P;  1KY7 A;  4EAJ A;  2H5A X;  1LXT A;  1QTS A;  3OST A;  4ROC B;  3T4N A;  2IV9 A;  3RSM A;  2NOL A;  2D0B A;  1VTL E;  1KFI A;  1PCZ A;  2FGT A;  1XSZ A;  3I0X A;  2NOI A;  1E42 A;  1KYU A;  3OC3 C;  3BKQ X;  2QLV A;  1RM1 A;  1LWW A;  1D3U A;  3CW7 A;  3SNS A;  1QN7 A;  1TBA B;  4ROE B;  1TGH A;  1TUO A;  1UT7 A;  2HL8 A;  4CFF A;  3PMG A;  3I0W A;  2FKF A;  2D0A A;  5HSH A;  3CVS A;  2HZM A;  3OSE A;  1KYF A;  4I8O A;  3IH7 A;  1PVS A;  2ZFD B;  4EAK A;  3PDK A;  4PY5 A;  1P5G X;  1DIZ A;  2FKM X;  1QNB A;  2JHJ A;  1W80 A;  2NVM A;  2YA3 A;  3D4V A;  1VOK A;  1N3A A;  1TBP A;  3ULX A;  5EPC A;  1VKL A;  1VOL B;  1QNC A;  4EAG A;  4EAI A;  4WZS D;  2DKD A;  4EJZ A;  2NOE A;  2DKC A;  2YH5 A;  2MJ7 A;  3HS9 A;  3OH6 A;  3KTU A;  3CWS A;  2NOB A;  4EAL A;  3D7Q A;  2H4L X;  2DKA A;  1C4G A;  2G30 A;  2PWW A;  2QRC A;  2Z0F A;  3ENC A;  2QRD A;  4HJH A;  1PCJ X;  5JMV D;  2HL9 A;  3UW2 A;  1QN4 A;  3VN5 A;  4WXA A;  2VJ0 A;  1QN9 A;  1CDW A;  2HKP A;  3ENO C;  2QR1 A;  3CWT A;  2MZ8 A;  3DPT A;  4TPS A;  5AN4 A;  5IYC P;  3CVT A;  5BMP A;  2OOY A;  3EIK A;  1LWY A;  2JPI A;  2EHB D;  1K35 A;  4B0A A;  1M3Q A;  1C9B B;  1UL7 A;  1HU0 A;  2O3O A;  1QNE A;  2V8Q A;  2JOI A;  1FN7 A;  1KO9 A;  1KFQ A;  2JHN A;  4QG5 A;  1K2Y X;  1EUV A;  4ROD B;  5JN5 A;  2OOX A;  1QN3 A;  3F10 A;  3OCI A;  1JDY A;  3RPJ A;  4D7Q A;  2QRE A;  2Y8L A;  3F0Z A;  3OH9 A;  2V9J A;  1B9K A;  3TDH A;  1QN6 A;  2NWV A;  2Z8U A;  4DUL A;  4EJY A;  1MP9 A;  3CWU A;  4MRQ A;  2NOZ A;  1NGM A;  1KYD A;  1V5S A;  2R5X A;  1UT4 A;  1YQR A;  2D0C A;  3HS8 A;  1R4X A;  1YQL A;  1PZD A;  1QN8 A;  2LAE A;  5BMN A;  1J3M A;  4D7R A;  1YQK A;  2HZS A;  1PCM X;  3ASM A;  3OGD A;  4WX8 A;  1NVP A;  2I5W A;  2Y8Q A;  2XHI A;  1NH2 A;  1Q9U A;  2NLV A;  1EBM A;  2V92 A;  1KY6 A;  1YTF A;  3DPU A;  4IL8 A;  4BJU A;  1T6A A;  1WQA A;  1YQM A;  1YTB A;  2NOF A;  3NA5 A;  1QTP A;  3N89 A;  4Q11 A;  3EAY A;  3KRM A;  1WJW A;  3I3W A;  1MPG A;  1M3H A;  2NOH A;  3OSM A;  5F9C A;  2F7L A;  1N39 A;  2FUV A;  3TE5 A;  1VTO A;  1AIS A;  3CWA A;  1LWV A;  5IYB P; 
#chains in the Genus database with same CATH homology
 1N3C A;  3H1Z A;  1JFI C;  1QN5 A;  1QNA A;  2IV8 A;  5IYD P;  1KY7 A;  1QTS A;  3OST A;  4ROC B;  2IV9 A;  2NOL A;  2D0B A;  1VTL E;  1PCZ A;  2FGT A;  3I0X A;  2NOI A;  1E42 A;  1KYU A;  3OC3 C;  1RM1 A;  1LWW A;  1D3U A;  3SNS A;  1QN7 A;  1TBA B;  4ROE B;  1TGH A;  1UT7 A;  3I0W A;  2D0A A;  2HZM A;  1KYF A;  4I8O A;  3IH7 A;  4PY5 A;  1QNB A;  1W80 A;  1VOK A;  1N3A A;  1TBP A;  3ULX A;  1VOL B;  1QNC A;  4WZS D;  4EJZ A;  2NOE A;  2YH5 A;  2MJ7 A;  3HS9 A;  3KTU A;  2NOB A;  5IYC P;  2G30 A;  1QN4 A;  3VN5 A;  2VJ0 A;  1QN9 A;  1CDW A;  2MZ8 A;  3DPT A;  4TPS A;  5AN4 A;  3EIK A;  1LWY A;  4B0A A;  1M3Q A;  1C9B B;  1HU0 A;  2O3O A;  1QNE A;  2JOI A;  1FN7 A;  1KO9 A;  4ROD B;  1QN3 A;  3F10 A;  3OCI A;  3RPJ A;  3F0Z A;  1B9K A;  1QN6 A;  2Z8U A;  4EJY A;  4DUL A;  1MP9 A;  2NOZ A;  1NGM A;  1KYD A;  1UT4 A;  1YQR A;  2D0C A;  3HS8 A;  1R4X A;  1YQL A;  1PZD A;  1QN8 A;  2LAE A;  1YQK A;  2HZS A;  3ASM A;  1NVP A;  2I5W A;  2XHI A;  1NH2 A;  1EBM A;  1KY6 A;  1YTF A;  3DPU A;  1YQM A;  1YTB A;  2NOF A;  1QTP A;  3N89 A;  4Q11 A;  3KRM A;  2NOH A;  1M3H A;  3OSM A;  1N39 A;  1VTO A;  1AIS A;  1LWV A;  5IYB P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...