1VOLB

Tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
187
structure length
187
Chain Sequence
VDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a TFIIB-TBP-TATA-element ternary complex.
pubmed doi rcsb
molecule keywords DNA (5'-D(*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*GP*CP*TP*G)-3
molecule tags Transcription/dna
source organism Homo sapiens
total genus 41
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 1996-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1volB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1volB02
3ASMA 2D0AA 4B0AA 2D0CA 1QTSA 3H1ZA 1MP9A 1QTPA 1QN4A 1KY7A 1B9KA 3OCIA 3HS9A 2MJ7A 1JFIC 1RM1A 1D3UA 1PZDA 1KY6A 1QN6A 1W80A 4ROEB 1NH2A 1TBPA 2D0BA 1VTOA 1KYUA 1R4XA 1TGHA 5IYDP 1NVPA 1VTLE 4PY5A 1CDWA 2VJ0A 2IV8A 4ROCB 1QN3A 1VOLB 1QNBA 1KYFA 1YTBA 1QN5A 2IV9A 3EIKA 1QN7A 1QNCA 1VOKA 4RODB 1TBAB 1E42A 3OC3C 1AISA 4WZSD 1QN9A 1PCZA 1C9BB 1NGMA 5IYBP 1YTFA 2Z8UA 5IYCP 3HS8A 3VN5A 1QNEA 1QN8A 1KYDA 2G30A 1QNAA
chains in the Genus database with same CATH superfamily
2D0AA 4B0AA 4EAJA 3CWAA 2H4LX 1MP9A 1KY7A 2DKAA 2R5XA 4TPSA 3HS9A 1JFIC 1RM1A 1QN6A 1PZDA 1KY6A 3C04A 4WX8A 1LXTA 4DULA 1TGHA 1C47A 2NOLA 2NWVA 1CDWA 2VJ0A 2IV8A 3OSTA 3OH9A 1M3HA 1YQRA 3CWTA 4ROCB 4CFFA 1QN3A 4BJUA 3PDKA 1QNBA 2PWWA 2HZSA 1KO9A 4D7QA 1YTBA 3OLPA 4C7PA 1QN7A 2Z0FA 4WZSD 1QN9A 1YTFA 2V8QA 2NOFA 5IYCP 4WXAA 3VN5A 1QNEA 3D7QA 5BMPA 2JOIA 1JDYA 3ENCA 1FN7A 1LWYA 3TE5A 3ASMA 3N89A 2HKPA 3I3WA 2D0CA 1QTSA 3OH6A 2NOZA 1TUOA 3I0WA 1NH2A 1TBPA 3OSEA 3TDHA 5IYDP 3EAYA 3T4NA 1Q9UA 3DPTA 1HU0A 1VOLB 2NOEA 1N39A 5KL0A 2IV9A 1YQLA 1WJWA 3OC3C 2YH5A 1C9BB 3SNSA 1NGMA 2F7LA 2HL8A 2DKCA 3NA5A 3DPUA 1YQMA 1KYDA 3BKQX 2G30A 2EHBD 2YA3A 3ULXA 4EAIA 1P5GX 1QNAA 3KRMA 3OSMA 4EJZA 3H1ZA 1K2YX 1QN4A 1EUVA 1UT7A 5AN4A 1M3QA 4Q11A 3CW7A 3OGDA 1VKLA 3ENOC 2MZ8A 2QRDA 4ROEB 1VTOA 1P5DX 1NVPA 4PY5A 2HZMA 1PCJX 2FUVA 3F10A 3F0ZA 2QLVA 3I0XA 4HJHA 2DKDA 2O3OA 2OOXA 4EJYA 2NVMA 2V9JA 1UL7A 1KFIA 1K35A 2FKFA 1QN5A 1M5Q1 3EIKA 3PMGA 1QNCA 1UT4A 4RODB 1E42A 5JMVD 1PCZA 3CWUA 1J3MA 1QN8A 3HS8A 2V92A 5JN5A 1MPGA 2OOYA 2ZFDB 3KTUA 3UW2A 1DIZA 3RSMA 5BMNA 1QTPA 2QR1A 1N3AA 5F9CA 1B9KA 4EAKA 3OCIA 5EPCA 1LWWA 2I5WA 2Y8LA 2MJ7A 1D3UA 2NOIA 1PCMX 3IH7A 4I8OA 4EAGA 1W80A 2QRCA 2D0BA 2NOBA 1KYUA 1R4XA 3D4VA 2NOHA 1VTLE 2HL9A 5HSHA 2Y8QA 1C4GA 1XSZA 3CVTA 2NLVA 4D7RA 1V5SA 1KYFA 4IL8A 4MRQA 3CVSA 2H5AX 3RPJA 3CWSA 1VOKA 4EALA 1TBAB 1AISA 1KFQA 1WQAA 2QREA 1YQKA 2JPIA 2XHIA 1N3CA 2FGTA 5IYBP 2LAEA 1EBMA 4QG5A 1T6AA 2JHJA 2Z8UA 1LWVA 1PVSA 2JHNA 2FKMX
chains in the Genus database with same CATH topology
2D0AA 4B0AA 1MP9A 1KY7A 4TPSA 3HS9A 1JFIC 1RM1A 1QN6A 1PZDA 1KY6A 4DULA 1TGHA 2NOLA 1CDWA 2VJ0A 2IV8A 3OSTA 1M3HA 1YQRA 4ROCB 1QN3A 1QNBA 2HZSA 1KO9A 1YTBA 1QN7A 4WZSD 1QN9A 1YTFA 2NOFA 5IYCP 1QNEA 3VN5A 2JOIA 1FN7A 1LWYA 3ASMA 3N89A 2D0CA 1QTSA 2NOZA 3I0WA 1NH2A 1TBPA 5IYDP 3DPTA 1HU0A 1VOLB 2NOEA 1N39A 2IV9A 1YQLA 3OC3C 2YH5A 1C9BB 3SNSA 1NGMA 3DPUA 1YQMA 1KYDA 2G30A 1QNAA 3ULXA 3KRMA 3OSMA 3H1ZA 1QN4A 1UT7A 5AN4A 1M3QA 4Q11A 2MZ8A 4ROEB 1VTOA 1NVPA 4PY5A 2HZMA 3F10A 3F0ZA 3I0XA 2O3OA 4EJYA 1QN5A 3EIKA 1QNCA 1UT4A 4RODB 1E42A 1PCZA 1QN8A 3HS8A 3KTUA 1N3AA 1QTPA 2I5WA 4EJZA 1B9KA 1LWWA 3OCIA 2NOIA 2MJ7A 1D3UA 3IH7A 4I8OA 1W80A 2D0BA 2NOBA 1KYUA 1R4XA 2NOHA 1VTLE 1KYFA 3RPJA 1VOKA 1AISA 1TBAB 1YQKA 2XHIA 1N3CA 2FGTA 5IYBP 2LAEA 1EBMA 2Z8UA 1LWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASM A;  2D0A A;  4B0A A;  2D0C A;  1QTS A;  3H1Z A;  1MP9 A;  1QTP A;  1QN4 A;  1KY7 A;  1B9K A;  3OCI A;  3HS9 A;  2MJ7 A;  1JFI C;  1RM1 A;  1D3U A;  1PZD A;  1KY6 A;  1QN6 A;  1W80 A;  4ROE B;  1NH2 A;  1TBP A;  2D0B A;  1VTO A;  1KYU A;  1R4X A;  1TGH A;  5IYD P;  1NVP A;  1VTL E;  4PY5 A;  1CDW A;  2VJ0 A;  2IV8 A;  4ROC B;  1QN3 A;  1VOL B;  1QNB A;  1KYF A;  1YTB A;  1QN5 A;  2IV9 A;  3EIK A;  1QN7 A;  1QNC A;  1VOK A;  4ROD B;  1TBA B;  1E42 A;  3OC3 C;  1AIS A;  4WZS D;  1QN9 A;  1PCZ A;  1C9B B;  1NGM A;  5IYB P;  1YTF A;  2Z8U A;  5IYC P;  3HS8 A;  3VN5 A;  1QNE A;  1QN8 A;  1KYD A;  2G30 A;  1QNA A; 
#chains in the Genus database with same CATH topology
 2D0A A;  4B0A A;  4EAJ A;  3CWA A;  2H4L X;  1MP9 A;  1KY7 A;  2DKA A;  2R5X A;  4TPS A;  3HS9 A;  1JFI C;  1RM1 A;  1QN6 A;  1PZD A;  1KY6 A;  3C04 A;  4WX8 A;  1LXT A;  4DUL A;  1TGH A;  1C47 A;  2NOL A;  2NWV A;  1CDW A;  2VJ0 A;  2IV8 A;  3OST A;  3OH9 A;  1M3H A;  1YQR A;  3CWT A;  4ROC B;  4CFF A;  1QN3 A;  4BJU A;  3PDK A;  1QNB A;  2PWW A;  2HZS A;  1KO9 A;  4D7Q A;  1YTB A;  3OLP A;  4C7P A;  1QN7 A;  2Z0F A;  4WZS D;  1QN9 A;  1YTF A;  2V8Q A;  2NOF A;  5IYC P;  4WXA A;  3VN5 A;  1QNE A;  3D7Q A;  5BMP A;  2JOI A;  1JDY A;  3ENC A;  1FN7 A;  1LWY A;  3TE5 A;  3ASM A;  3N89 A;  2HKP A;  3I3W A;  2D0C A;  1QTS A;  3OH6 A;  2NOZ A;  1TUO A;  3I0W A;  1NH2 A;  1TBP A;  3OSE A;  3TDH A;  5IYD P;  3EAY A;  3T4N A;  1Q9U A;  3DPT A;  1HU0 A;  1VOL B;  2NOE A;  1N39 A;  5KL0 A;  2IV9 A;  1YQL A;  1WJW A;  3OC3 C;  2YH5 A;  1C9B B;  3SNS A;  1NGM A;  2F7L A;  2HL8 A;  2DKC A;  3NA5 A;  3DPU A;  1YQM A;  1KYD A;  3BKQ X;  2G30 A;  2EHB D;  2YA3 A;  3ULX A;  4EAI A;  1P5G X;  1QNA A;  3KRM A;  3OSM A;  4EJZ A;  3H1Z A;  1K2Y X;  1QN4 A;  1EUV A;  1UT7 A;  5AN4 A;  1M3Q A;  4Q11 A;  3CW7 A;  3OGD A;  1VKL A;  3ENO C;  2MZ8 A;  2QRD A;  4ROE B;  1VTO A;  1P5D X;  1NVP A;  4PY5 A;  2HZM A;  1PCJ X;  2FUV A;  3F10 A;  3F0Z A;  2QLV A;  3I0X A;  4HJH A;  2DKD A;  2O3O A;  2OOX A;  4EJY A;  2NVM A;  2V9J A;  1UL7 A;  1KFI A;  1K35 A;  2FKF A;  1QN5 A;  1M5Q 1;  3EIK A;  3PMG A;  1QNC A;  1UT4 A;  4ROD B;  1E42 A;  5JMV D;  1PCZ A;  3CWU A;  1J3M A;  1QN8 A;  3HS8 A;  2V92 A;  5JN5 A;  1MPG A;  2OOY A;  2ZFD B;  3KTU A;  3UW2 A;  1DIZ A;  3RSM A;  5BMN A;  1QTP A;  2QR1 A;  1N3A A;  5F9C A;  1B9K A;  4EAK A;  3OCI A;  5EPC A;  1LWW A;  2I5W A;  2Y8L A;  2MJ7 A;  1D3U A;  2NOI A;  1PCM X;  3IH7 A;  4I8O A;  4EAG A;  1W80 A;  2QRC A;  2D0B A;  2NOB A;  1KYU A;  1R4X A;  3D4V A;  2NOH A;  1VTL E;  2HL9 A;  5HSH A;  2Y8Q A;  1C4G A;  1XSZ A;  3CVT A;  2NLV A;  4D7R A;  1V5S A;  1KYF A;  4IL8 A;  4MRQ A;  3CVS A;  2H5A X;  3RPJ A;  3CWS A;  1VOK A;  4EAL A;  1TBA B;  1AIS A;  1KFQ A;  1WQA A;  2QRE A;  1YQK A;  2JPI A;  2XHI A;  1N3C A;  2FGT A;  5IYB P;  2LAE A;  1EBM A;  4QG5 A;  1T6A A;  2JHJ A;  2Z8U A;  1LWV A;  1PVS A;  2JHN A;  2FKM X; 
#chains in the Genus database with same CATH homology
 2D0A A;  4B0A A;  1MP9 A;  1KY7 A;  4TPS A;  3HS9 A;  1JFI C;  1RM1 A;  1QN6 A;  1PZD A;  1KY6 A;  4DUL A;  1TGH A;  2NOL A;  1CDW A;  2VJ0 A;  2IV8 A;  3OST A;  1M3H A;  1YQR A;  4ROC B;  1QN3 A;  1QNB A;  2HZS A;  1KO9 A;  1YTB A;  1QN7 A;  4WZS D;  1QN9 A;  1YTF A;  2NOF A;  5IYC P;  1QNE A;  3VN5 A;  2JOI A;  1FN7 A;  1LWY A;  3ASM A;  3N89 A;  2D0C A;  1QTS A;  2NOZ A;  3I0W A;  1NH2 A;  1TBP A;  5IYD P;  3DPT A;  1HU0 A;  1VOL B;  2NOE A;  1N39 A;  2IV9 A;  1YQL A;  3OC3 C;  2YH5 A;  1C9B B;  3SNS A;  1NGM A;  3DPU A;  1YQM A;  1KYD A;  2G30 A;  1QNA A;  3ULX A;  3KRM A;  3OSM A;  3H1Z A;  1QN4 A;  1UT7 A;  5AN4 A;  1M3Q A;  4Q11 A;  2MZ8 A;  4ROE B;  1VTO A;  1NVP A;  4PY5 A;  2HZM A;  3F10 A;  3F0Z A;  3I0X A;  2O3O A;  4EJY A;  1QN5 A;  3EIK A;  1QNC A;  1UT4 A;  4ROD B;  1E42 A;  1PCZ A;  1QN8 A;  3HS8 A;  3KTU A;  1N3A A;  1QTP A;  2I5W A;  4EJZ A;  1B9K A;  1LWW A;  3OCI A;  2NOI A;  2MJ7 A;  1D3U A;  3IH7 A;  4I8O A;  1W80 A;  2D0B A;  2NOB A;  1KYU A;  1R4X A;  2NOH A;  1VTL E;  1KYF A;  3RPJ A;  1VOK A;  1AIS A;  1TBA B;  1YQK A;  2XHI A;  1N3C A;  2FGT A;  5IYB P;  2LAE A;  1EBM A;  2Z8U A;  1LWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...