4EZVA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-bombesin in space group p21212
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 65
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezvA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezvA01
4JNEA 3QNJA 4EZYA 2BPRA 3OHXM 3L3OM 4EZXA 3DQGA 3H0XA 4JWDA 4EZQA 4EZSA 3DOBA 5TKYA 4JWIA 3T4AG 4WV5A 1DG4A 3C7NB 1DKYA 4R5LA 3C7NA 3DPOA 4HYBA 1CKRA 4EZVA 4EZZA 4F01A 4H6HA 2OP6A 4EZPA 4E81A 1DKZA 4EZOA 3T48A 4B9QA 3DPPA 4F00A 5E84A 3T47A 4JN4A 3D2FA 1YUWA 1DKXA 4EZTA 1Q5LA 4FL9A 2KHOA 4JWEA 3D2EA 3N8EA 4HY9A 2V7YA 2WINM 4R5IA 4PO2A 3T49A 4EZNA 4EZWA 4EZRA 2QFFA 4R5KA 1U00A 1BPRA 4EZUA 4JWCA 7HSCA 4H6IA 2QXLA 3T46A 4WV7A 4JNFA 4R5GA 3DPQA 4R5JA
chains in the Genus database with same CATH superfamily
2BPRA 2F18A 3DQGA 4FZOA 4I1QA 2OBLA 4NPHA 3EJQA 4EZQA 1W9MA 4FZPA 4JWIA 4ILHB 3RV1A 2ND0A 4WV5A 1TQWA 5C5BA 1ZYLA 3I04A 4R5LA 2F1AA 4AZ6A 3RPMA 4EZZA 2YIVX 1QX1A 2YL9A 2LXYA 1DKZA 1SUFA 1SU6A 1TQVA 2ZXQA 3OK8A 4B9QA 3T47A 3LMFA 1I4TA 5FLEX 1OAOA 3D2FA 2EX3B 1Q5LA 3CZNA 1X03A 4HY9A 2V7YA 2Q12A 1OA0A 4IWQA 4PO2A 4FM3A 4BNEA 4EZWA 5KBPA 2X5CA 5FIGA 2N3KA 4DYLA 2OO2A 1U00A 2YL5A 1BPRA 3BUDA 4MQDA 3BUPA 4HR1A 2GA9D 1I4DA 2Q13A 3DX2A 3LLLA 3CV5A 4JNFA 2Z0OA 4R5JA 2QKWA 4ATMA 1I49A 4AZBA 1LQ7A 3CKDA 3DOBA 4EZSA 1I4LA 1UPXA 2F7RA 3RV0A 2MI7A 1GNLA 3FD9A 3L3PA 4KIKA 4DCNC 3C7NB 3C7NA 4WPCA 1R34A 2GF4A 3SBTB 2F1BA 3QE6A 2EFLA 3VKHA 1SU7A 2YL6A 3DX0A 2ELBA 3KDRA 3A98A 3DPPA 3HAIA 4F00A 2D1LA 3QA8A 3M3WA 1TQSA 3ABHA 4G6QA 1HTYA 2YI8A 3O3OB 4JWEA 4UDYX 4ILGA 2O0I1 3ZEDA 4AZHA 3D52A 4IW0A 1HWWA 4EZNA 4EZRA 1GN9A 2OW7A 1JQKA 3EJSA 4AZ5A 3O3MB 4JWCA 3DX1A 4H6IA 1GNTA 3B51X 3CAZA 2YKTA 3I2WA 4WV7A 3BVXA 4R5GA 2C08A 2JNKA 3DPQA 3EJRA 3G9GA 1Y2OA 3PLTA 3QNJA 4EZYA 1R5EA 2F7OA 3QNIA 4EZXA 4JWDA 2ND1A 2RAIA 3DDGA 5TKYA 3SOGA 4AZ7A 3ZEFA 1QWUA 4IM3A 3DDFA 4AZGA 2WYHA 2F7PA 4JLCA 4HYBA 1YWMA 1CKRA 4EZVA 4UDXX 4F01A 4H6HA 2OP6A 4EZPA 2Z8YA 4WPEA 3H0XA 4EZOA 3T48A 3B52X 3DX3A 1TQTA 2YL8A 2RAKA 3EJPA 4JN4A 3VEBA 2EFKA 1DKXA 1X04A 3F7WA 2YLAA 4EZTA 1YUWA 4IM2A 2KHOA 3BLBA 1E1DA 3D2EA 1OA1A 4R5IA 1O7DC 3B53X 2OW6A 2YI9A 2ALWA 3Q0KA 4JL9A 3UITA 2PY6A 2Z0VA 4R5KA 1SU8A 2X3VA 4EZUA 3ER8C 3ERCC 1R33A 3I39X 1HXKA 4M0MA 3ACOA 3DYTA 3BVVA 4NQIA 3VEAA 2YIBA 3EJUA 1O7DB 3I01A 3T46A 4AZIA 2YIAA 4JNEA 3QWEA 3OHXM 3L3OM 4AZCA 3HAHA 4ILIA 4IWPA 3BVTA 3BVUA 4IM0A 1DG4A 2GAFD 4E3CA 3D4ZA 3GI7A 3SYVA 2FYVA 3D50A 3T4AG 1QWNA 2YLLA 1DKYA 3BUQA 2Z0NA 2FICA 2JNSA 4H8SA 3DPOA 2RAJA 4E81A 3Q84A 4FZSA 4HR1B 2EWFA 5E84A 4D8JA 1PS3A 3DX4A 1WDZA 3BUIA 2D4CA 4AKVA 3KAWA 4FL9A 2NCZA 2OZNB 4NSWA 4AZCB 3BVWA 1ZWWA 3CVRA 2WYIA 3N8EA 4KIKB 1E2UA 3CZSA 2WINM 3O3NB 2F7QA 2V0OA 2X3WA 1URUA 2X3XA 3HAJA 5C5BB 3T49A 4AVMA 3KAVA 2OBMA 2QFFA 4I43A 3SBSA 3OWGA 7HSCA 2PMRA 3BUBA 3ER9B 2QXLA 1MJGA 2RT6A 3D51A 3D4YA 3LVTA 1E9VA 1TQUA 2LM0A 4IWOA 3EJTA
chains in the Genus database with same CATH topology
2BPRA 3DQGA 2OBLA 4NPHA 4EZQA 1W9MA 4JWIA 4ILHB 3RV1A 2ND0A 4WV5A 1ZYLA 3I04A 4R5LA 4EZZA 2YIVX 1DKZA 1SUFA 1SU6A 4B9QA 3T47A 3LMFA 5FLEX 1OAOA 3D2FA 2EX3B 1Q5LA 4HY9A 2V7YA 4IWQA 1OA0A 4PO2A 4FM3A 4EZWA 2X5CA 5FIGA 2N3KA 1U00A 1BPRA 4MQDA 4HR1A 2GA9D 4JNFA 4R5JA 3DOBA 4EZSA 1UPXA 3RV0A 4KIKA 1GNLA 3FD9A 3C7NB 3C7NA 3SBTB 3VKHA 1SU7A 3KDRA 3A98A 3DPPA 4F00A 3QA8A 4G6QA 2YI8A 3O3OB 4JWEA 4UDYX 4ILGA 3ZEDA 4IW0A 4EZRA 4EZNA 1GN9A 1JQKA 3O3MB 4JWCA 4H6IA 1GNTA 3B51X 4WV7A 4R5GA 3DPQA 3QNJA 4EZYA 4EZXA 3H0XA 4JWDA 2ND1A 5TKYA 3ZEFA 4IM3A 4JLCA 4HYBA 1CKRA 4EZVA 4UDXX 4F01A 4H6HA 2OP6A 4EZPA 2Z8YA 4EZOA 3T48A 3B52X 3VEBA 4JN4A 3F7WA 1DKXA 4EZTA 1YUWA 4IM2A 2KHOA 1E1DA 3D2EA 1OA1A 4R5IA 3B53X 2YI9A 4JL9A 3UITA 2PY6A 4R5KA 3ER8C 1SU8A 4EZUA 3ERCC 3I39X 4M0MA 3VEAA 2YIBA 3I01A 3T46A 2YIAA 4JNEA 3OHXM 3L3OM 4ILIA 1DG4A 4IWPA 4IM0A 2GAFD 4E3CA 3GI7A 3T4AG 1DKYA 2JNSA 3DPOA 4E81A 4HR1B 2EWFA 5E84A 4D8JA 4FL9A 3KAWA 2NCZA 3N8EA 4KIKB 1E2UA 3O3NB 2WINM 3T49A 4I43A 3SBSA 3KAVA 2OBMA 2QFFA 3OWGA 7HSCA 3ER9B 2QXLA 1MJGA 2RT6A 1E9VA 2LM0A 4IWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNE A;  3QNJ A;  4EZY A;  2BPR A;  3OHX M;  3L3O M;  4EZX A;  3DQG A;  3H0X A;  4JWD A;  4EZQ A;  4EZS A;  3DOB A;  5TKY A;  4JWI A;  3T4A G;  4WV5 A;  1DG4 A;  3C7N B;  1DKY A;  4R5L A;  3C7N A;  3DPO A;  4HYB A;  1CKR A;  4EZV A;  4EZZ A;  4F01 A;  4H6H A;  2OP6 A;  4EZP A;  4E81 A;  1DKZ A;  4EZO A;  3T48 A;  4B9Q A;  3DPP A;  4F00 A;  5E84 A;  3T47 A;  4JN4 A;  3D2F A;  1YUW A;  1DKX A;  4EZT A;  1Q5L A;  4FL9 A;  2KHO A;  4JWE A;  3D2E A;  3N8E A;  4HY9 A;  2V7Y A;  2WIN M;  4R5I A;  4PO2 A;  3T49 A;  4EZN A;  4EZW A;  4EZR A;  2QFF A;  4R5K A;  1U00 A;  1BPR A;  4EZU A;  4JWC A;  7HSC A;  4H6I A;  2QXL A;  3T46 A;  4WV7 A;  4JNF A;  4R5G A;  3DPQ A;  4R5J A; 
#chains in the Genus database with same CATH topology
 2BPR A;  2F18 A;  3DQG A;  4FZO A;  4I1Q A;  2OBL A;  4NPH A;  3EJQ A;  4EZQ A;  1W9M A;  4FZP A;  4JWI A;  4ILH B;  3RV1 A;  2ND0 A;  4WV5 A;  1TQW A;  5C5B A;  1ZYL A;  3I04 A;  4R5L A;  2F1A A;  4AZ6 A;  3RPM A;  4EZZ A;  2YIV X;  1QX1 A;  2YL9 A;  2LXY A;  1DKZ A;  1SUF A;  1SU6 A;  1TQV A;  2ZXQ A;  3OK8 A;  4B9Q A;  3T47 A;  3LMF A;  1I4T A;  5FLE X;  1OAO A;  3D2F A;  2EX3 B;  1Q5L A;  3CZN A;  1X03 A;  4HY9 A;  2V7Y A;  2Q12 A;  1OA0 A;  4IWQ A;  4PO2 A;  4FM3 A;  4BNE A;  4EZW A;  5KBP A;  2X5C A;  5FIG A;  2N3K A;  4DYL A;  2OO2 A;  1U00 A;  2YL5 A;  1BPR A;  3BUD A;  4MQD A;  3BUP A;  4HR1 A;  2GA9 D;  1I4D A;  2Q13 A;  3DX2 A;  3LLL A;  3CV5 A;  4JNF A;  2Z0O A;  4R5J A;  2QKW A;  4ATM A;  1I49 A;  4AZB A;  1LQ7 A;  3CKD A;  3DOB A;  4EZS A;  1I4L A;  1UPX A;  2F7R A;  3RV0 A;  2MI7 A;  1GNL A;  3FD9 A;  3L3P A;  4KIK A;  4DCN C;  3C7N B;  3C7N A;  4WPC A;  1R34 A;  2GF4 A;  3SBT B;  2F1B A;  3QE6 A;  2EFL A;  3VKH A;  1SU7 A;  2YL6 A;  3DX0 A;  2ELB A;  3KDR A;  3A98 A;  3DPP A;  3HAI A;  4F00 A;  2D1L A;  3QA8 A;  3M3W A;  1TQS A;  3ABH A;  4G6Q A;  1HTY A;  2YI8 A;  3O3O B;  4JWE A;  4UDY X;  4ILG A;  2O0I 1;  3ZED A;  4AZH A;  3D52 A;  4IW0 A;  1HWW A;  4EZN A;  4EZR A;  1GN9 A;  2OW7 A;  1JQK A;  3EJS A;  4AZ5 A;  3O3M B;  4JWC A;  3DX1 A;  4H6I A;  1GNT A;  3B51 X;  3CAZ A;  2YKT A;  3I2W A;  4WV7 A;  3BVX A;  4R5G A;  2C08 A;  2JNK A;  3DPQ A;  3EJR A;  3G9G A;  1Y2O A;  3PLT A;  3QNJ A;  4EZY A;  1R5E A;  2F7O A;  3QNI A;  4EZX A;  4JWD A;  2ND1 A;  2RAI A;  3DDG A;  5TKY A;  3SOG A;  4AZ7 A;  3ZEF A;  1QWU A;  4IM3 A;  3DDF A;  4AZG A;  2WYH A;  2F7P A;  4JLC A;  4HYB A;  1YWM A;  1CKR A;  4EZV A;  4UDX X;  4F01 A;  4H6H A;  2OP6 A;  4EZP A;  2Z8Y A;  4WPE A;  3H0X A;  4EZO A;  3T48 A;  3B52 X;  3DX3 A;  1TQT A;  2YL8 A;  2RAK A;  3EJP A;  4JN4 A;  3VEB A;  2EFK A;  1DKX A;  1X04 A;  3F7W A;  2YLA A;  4EZT A;  1YUW A;  4IM2 A;  2KHO A;  3BLB A;  1E1D A;  3D2E A;  1OA1 A;  4R5I A;  1O7D C;  3B53 X;  2OW6 A;  2YI9 A;  2ALW A;  3Q0K A;  4JL9 A;  3UIT A;  2PY6 A;  2Z0V A;  4R5K A;  1SU8 A;  2X3V A;  4EZU A;  3ER8 C;  3ERC C;  1R33 A;  3I39 X;  1HXK A;  4M0M A;  3ACO A;  3DYT A;  3BVV A;  4NQI A;  3VEA A;  2YIB A;  3EJU A;  1O7D B;  3I01 A;  3T46 A;  4AZI A;  2YIA A;  4JNE A;  3QWE A;  3OHX M;  3L3O M;  4AZC A;  3HAH A;  4ILI A;  4IWP A;  3BVT A;  3BVU A;  4IM0 A;  1DG4 A;  2GAF D;  4E3C A;  3D4Z A;  3GI7 A;  3SYV A;  2FYV A;  3D50 A;  3T4A G;  1QWN A;  2YLL A;  1DKY A;  3BUQ A;  2Z0N A;  2FIC A;  2JNS A;  4H8S A;  3DPO A;  2RAJ A;  4E81 A;  3Q84 A;  4FZS A;  4HR1 B;  2EWF A;  5E84 A;  4D8J A;  1PS3 A;  3DX4 A;  1WDZ A;  3BUI A;  2D4C A;  4AKV A;  3KAW A;  4FL9 A;  2NCZ A;  2OZN B;  4NSW A;  4AZC B;  3BVW A;  1ZWW A;  3CVR A;  2WYI A;  3N8E A;  4KIK B;  1E2U A;  3CZS A;  2WIN M;  3O3N B;  2F7Q A;  2V0O A;  2X3W A;  1URU A;  2X3X A;  3HAJ A;  5C5B B;  3T49 A;  4AVM A;  3KAV A;  2OBM A;  2QFF A;  4I43 A;  3SBS A;  3OWG A;  7HSC A;  2PMR A;  3BUB A;  3ER9 B;  2QXL A;  1MJG A;  2RT6 A;  3D51 A;  3D4Y A;  3LVT A;  1E9V A;  1TQU A;  2LM0 A;  4IWO A;  3EJT A; 
#chains in the Genus database with same CATH homology
 2BPR A;  3DQG A;  2OBL A;  4NPH A;  4EZQ A;  1W9M A;  4JWI A;  4ILH B;  3RV1 A;  2ND0 A;  4WV5 A;  1ZYL A;  3I04 A;  4R5L A;  4EZZ A;  2YIV X;  1DKZ A;  1SUF A;  1SU6 A;  4B9Q A;  3T47 A;  3LMF A;  5FLE X;  1OAO A;  3D2F A;  2EX3 B;  1Q5L A;  4HY9 A;  2V7Y A;  4IWQ A;  1OA0 A;  4PO2 A;  4FM3 A;  4EZW A;  2X5C A;  5FIG A;  2N3K A;  1U00 A;  1BPR A;  4MQD A;  4HR1 A;  2GA9 D;  4JNF A;  4R5J A;  3DOB A;  4EZS A;  1UPX A;  3RV0 A;  4KIK A;  1GNL A;  3FD9 A;  3C7N B;  3C7N A;  3SBT B;  3VKH A;  1SU7 A;  3KDR A;  3A98 A;  3DPP A;  4F00 A;  3QA8 A;  4G6Q A;  2YI8 A;  3O3O B;  4JWE A;  4UDY X;  4ILG A;  3ZED A;  4IW0 A;  4EZR A;  4EZN A;  1GN9 A;  1JQK A;  3O3M B;  4JWC A;  4H6I A;  1GNT A;  3B51 X;  4WV7 A;  4R5G A;  3DPQ A;  3QNJ A;  4EZY A;  4EZX A;  3H0X A;  4JWD A;  2ND1 A;  5TKY A;  3ZEF A;  4IM3 A;  4JLC A;  4HYB A;  1CKR A;  4EZV A;  4UDX X;  4F01 A;  4H6H A;  2OP6 A;  4EZP A;  2Z8Y A;  4EZO A;  3T48 A;  3B52 X;  3VEB A;  4JN4 A;  3F7W A;  1DKX A;  4EZT A;  1YUW A;  4IM2 A;  2KHO A;  1E1D A;  3D2E A;  1OA1 A;  4R5I A;  3B53 X;  2YI9 A;  4JL9 A;  3UIT A;  2PY6 A;  4R5K A;  3ER8 C;  1SU8 A;  4EZU A;  3ERC C;  3I39 X;  4M0M A;  3VEA A;  2YIB A;  3I01 A;  3T46 A;  2YIA A;  4JNE A;  3OHX M;  3L3O M;  4ILI A;  1DG4 A;  4IWP A;  4IM0 A;  2GAF D;  4E3C A;  3GI7 A;  3T4A G;  1DKY A;  2JNS A;  3DPO A;  4E81 A;  4HR1 B;  2EWF A;  5E84 A;  4D8J A;  4FL9 A;  3KAW A;  2NCZ A;  3N8E A;  4KIK B;  1E2U A;  3O3N B;  2WIN M;  3T49 A;  4I43 A;  3SBS A;  3KAV A;  2OBM A;  2QFF A;  3OWG A;  7HSC A;  3ER9 B;  2QXL A;  1MJG A;  2RT6 A;  1E9V A;  2LM0 A;  4IWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...