4EZWA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide nrllltg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
214
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 62
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezwA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezwA01
1U00A 7HSCA 4EZRA 1DKYA 3DQGA 1DKXA 2KHOA 1YUWA 3H0XA 4FL9A 3D2FA 4F01A 4JWEA 3C7NA 4R5KA 4JNFA 3T47A 4WV7A 4R5IA 4E81A 3QNJA 4EZYA 5TKYA 4HYBA 4JWCA 2QFFA 4PO2A 2OP6A 3T48A 4H6IA 1DKZA 4H6HA 2V7YA 4WV5A 4EZUA 4EZZA 4EZWA 1Q5LA 4EZSA 1DG4A 4EZVA 4R5LA 4R5GA 4EZQA 3DPQA 3DPOA 2WINM 3C7NB 3DPPA 2BPRA 4JWIA 3T4AG 4B9QA 4EZOA 3T49A 4HY9A 4EZXA 4F00A 3DOBA 3OHXM 5E84A 4JNEA 1BPRA 3N8EA 3L3OM 4JN4A 4EZNA 3T46A 4R5JA 2QXLA 4EZPA 3D2EA 4JWDA 1CKRA 4EZTA
chains in the Genus database with same CATH superfamily
3BUDA 2OW7A 3VEBA 4IW0A 2ALWA 5FIGA 4EZRA 2OBMA 2X5CA 2YL5A 2X3WA 4IWPA 2O0I1 3H0XA 1URUA 3D2FA 1GN9A 2YL9A 1Y2OA 4JWEA 3PLTA 3RV1A 4JNFA 1GNLA 3HAIA 1R5EA 3VEAA 3I04A 3VKHA 3CVRA 3SYVA 1TQVA 2QFFA 3DX3A 4HR1A 3O3MB 1SU7A 4ILIA 2F1AA 2YIVX 1CKRA 4H6IA 4I43A 4H6HA 2QKWA 4EZUA 4EZZA 1Q5LA 4E3CA 2OZNB 3BVWA 1HWWA 3CZNA 3QE6A 3ACOA 3RPMA 3N8EA 1DG4A 2D4CA 2ND1A 2BPRA 4JL9A 4UDYX 4BNEA 3SOGA 3OHXM 5E84A 2EFLA 4JNEA 2C08A 3UITA 4DYLA 2GF4A 1E2UA 1QWNA 2JNSA 3LMFA 2QXLA 3Q0KA 4IWOA 4JLCA 4EZPA 2Z8YA 3DDGA 2F1BA 2RAJA 3D4YA 1DKYA 4AZCA 3ERCC 2Z0OA 4FL9A 1OA0A 3ER9B 3CAZA 3D4ZA 3ER8C 3GI7A 4IM2A 3EJTA 3T47A 3DX1A 4R5IA 2Q13A 1E9VA 2ELBA 3Q84A 4G6QA 5TKYA 1JQKA 4FZSA 1PS3A 2NCZA 4JWCA 5C5BB 4AZHA 4PO2A 3HAJA 4UDXX 2F7QA 4KIKA 2YIAA 3B53X 2YLAA 4DCNC 4EZWA 1O7DC 3CKDA 4R5GA 4EZQA 3DPOA 3D52A 3DX2A 1WDZA 3DPPA 3C7NB 3SBSA 3BVTA 7HSCA 2MI7A 4AZ5A 3BUPA 1UPXA 3O3NB 3EJQA 4HY9A 4EZXA 4ILGA 1TQSA 3SBTB 2Q12A 2PMRA 3BVVA 1O7DB 3A98A 4EZNA 3D2EA 3B52X 2Z0NA 2YL6A 3B51X 2WYHA 5C5BA 1U00A 4NPHA 4FZOA 1X04A 4WPEA 3DX4A 3EJSA 4FM3A 3DQGA 4AZ6A 2KHOA 1YUWA 4IWQA 1ZYLA 3EJRA 2X3VA 4F01A 1OAOA 3C7NA 3BVUA 4R5KA 3BUIA 1HXKA 2Z0VA 2GAFD 3QA8A 1I49A 3ABHA 1QX1A 4EZYA 3F7WA 1R34A 4HYBA 2YKTA 2OO2A 3LLLA 3QNIA 2FYVA 4ILHB 2V0OA 2JNKA 2F7RA 4M0MA 2YL8A 3DX0A 2OP6A 2EX3B 2WYIA 2ZXQA 3BUQA 3I39X 3I01A 4IM3A 3KDRA 1HTYA 4AKVA 1GNTA 4EZSA 4FZPA 4AZCB 2YI8A 3CZSA 2WINM 2F18A 5FLEX 4AZIA 4JWIA 4EZOA 3T49A 2PY6A 1LQ7A 4NSWA 4F00A 3EJPA 1TQUA 3D50A 3L3PA 2GA9D 2ND0A 4JN4A 4R5JA 3KAVA 3T46A 4WV5A 4JWDA 3D51A 3HAHA 2N3KA 4AZBA 1X03A 2LM0A 1I4TA 1OA1A 1DKXA 1SUFA 2EWFA 2RAKA 2RAIA 2X3XA 3BLBA 4I1QA 2YIBA 4IM0A 2F7PA 2D1LA 2YI9A 3BVXA 3G9GA 3RV0A 3ZEFA 4WPCA 4WV7A 2FICA 3BUBA 3M3WA 4E81A 1QWUA 3O3OB 3QNJA 3DYTA 1YWMA 4H8SA 3EJUA 3DDFA 1MJGA 1TQWA 3KAWA 4AVMA 4KIKB 2F7OA 2OBLA 3FD9A 2EFKA 3I2WA 2OW6A 4NQIA 4ATMA 1E1DA 3T48A 1DKZA 2V7YA 1I4DA 4EZVA 4R5LA 3DPQA 3OWGA 1SU6A 1ZWWA 1W9MA 3T4AG 4AZGA 2YLLA 4B9QA 1R33A 4D8JA 1TQTA 3LVTA 3QWEA 5KBPA 1I4LA 2LXYA 4AZ7A 3OK8A 1BPRA 3DOBA 3L3OM 2RT6A 4HR1B 3ZEDA 3CV5A 1SU8A 4MQDA 4EZTA
chains in the Genus database with same CATH topology
3VEBA 4IW0A 5FIGA 4EZRA 2OBMA 2X5CA 4IWPA 3H0XA 3D2FA 1GN9A 4JWEA 3RV1A 4JNFA 1GNLA 3VEAA 3I04A 3VKHA 2QFFA 4HR1A 3O3MB 1SU7A 4ILIA 2YIVX 1CKRA 4H6IA 4I43A 4H6HA 4EZUA 4EZZA 1Q5LA 4E3CA 2ND1A 2BPRA 4JL9A 4UDYX 3OHXM 5E84A 4JNEA 3UITA 3N8EA 1E2UA 2JNSA 3LMFA 4IWOA 2QXLA 4JLCA 4EZPA 2Z8YA 1DKYA 3ERCC 4FL9A 1OA0A 3ER9B 3ER8C 3GI7A 4IM2A 3T47A 4R5IA 1E9VA 4G6QA 5TKYA 1JQKA 4JWCA 2NCZA 4PO2A 4UDXX 4KIKA 2YIAA 3B53X 4EZWA 4R5GA 4EZQA 3DPOA 3C7NB 3SBSA 7HSCA 3DPPA 3O3NB 1UPXA 4HY9A 4EZXA 4ILGA 3SBTB 4EZNA 3A98A 3D2EA 3B52X 3B51X 1U00A 4NPHA 4FM3A 3DQGA 2KHOA 1YUWA 4IWQA 1ZYLA 4F01A 1OAOA 3C7NA 4R5KA 2GAFD 3QA8A 4EZYA 3F7WA 4HYBA 4ILHB 4M0MA 2OP6A 2EX3B 3I39X 4IM3A 3I01A 1DG4A 3KDRA 4EZSA 1GNTA 2YI8A 2WINM 5FLEX 4JWIA 4EZOA 3T49A 2PY6A 4F00A 2GA9D 2ND0A 4JN4A 4R5JA 3KAVA 3T46A 4WV5A 4JWDA 2N3KA 2LM0A 1SUFA 1OA1A 1DKXA 2EWFA 2YIBA 4IM0A 2YI9A 3RV0A 3ZEFA 4WV7A 4E81A 3O3OB 3QNJA 1MJGA 3KAWA 4KIKB 2OBLA 3FD9A 1E1DA 3T48A 1DKZA 2V7YA 4EZVA 4R5LA 3DPQA 3OWGA 1SU6A 3T4AG 1W9MA 4B9QA 4D8JA 3DOBA 1BPRA 3L3OM 4HR1B 2RT6A 3ZEDA 1SU8A 4MQDA 4EZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U00 A;  7HSC A;  4EZR A;  1DKY A;  3DQG A;  1DKX A;  2KHO A;  1YUW A;  3H0X A;  4FL9 A;  3D2F A;  4F01 A;  4JWE A;  3C7N A;  4R5K A;  4JNF A;  3T47 A;  4WV7 A;  4R5I A;  4E81 A;  3QNJ A;  4EZY A;  5TKY A;  4HYB A;  4JWC A;  2QFF A;  4PO2 A;  2OP6 A;  3T48 A;  4H6I A;  1DKZ A;  4H6H A;  2V7Y A;  4WV5 A;  4EZU A;  4EZZ A;  4EZW A;  1Q5L A;  4EZS A;  1DG4 A;  4EZV A;  4R5L A;  4R5G A;  4EZQ A;  3DPQ A;  3DPO A;  2WIN M;  3C7N B;  3DPP A;  2BPR A;  4JWI A;  3T4A G;  4B9Q A;  4EZO A;  3T49 A;  4HY9 A;  4EZX A;  4F00 A;  3DOB A;  3OHX M;  5E84 A;  4JNE A;  1BPR A;  3N8E A;  3L3O M;  4JN4 A;  4EZN A;  3T46 A;  4R5J A;  2QXL A;  4EZP A;  3D2E A;  4JWD A;  1CKR A;  4EZT A; 
#chains in the Genus database with same CATH topology
 3BUD A;  2OW7 A;  3VEB A;  4IW0 A;  2ALW A;  5FIG A;  4EZR A;  2OBM A;  2X5C A;  2YL5 A;  2X3W A;  4IWP A;  2O0I 1;  3H0X A;  1URU A;  3D2F A;  1GN9 A;  2YL9 A;  1Y2O A;  4JWE A;  3PLT A;  3RV1 A;  4JNF A;  1GNL A;  3HAI A;  1R5E A;  3VEA A;  3I04 A;  3VKH A;  3CVR A;  3SYV A;  1TQV A;  2QFF A;  3DX3 A;  4HR1 A;  3O3M B;  1SU7 A;  4ILI A;  2F1A A;  2YIV X;  1CKR A;  4H6I A;  4I43 A;  4H6H A;  2QKW A;  4EZU A;  4EZZ A;  1Q5L A;  4E3C A;  2OZN B;  3BVW A;  1HWW A;  3CZN A;  3QE6 A;  3ACO A;  3RPM A;  3N8E A;  1DG4 A;  2D4C A;  2ND1 A;  2BPR A;  4JL9 A;  4UDY X;  4BNE A;  3SOG A;  3OHX M;  5E84 A;  2EFL A;  4JNE A;  2C08 A;  3UIT A;  4DYL A;  2GF4 A;  1E2U A;  1QWN A;  2JNS A;  3LMF A;  2QXL A;  3Q0K A;  4IWO A;  4JLC A;  4EZP A;  2Z8Y A;  3DDG A;  2F1B A;  2RAJ A;  3D4Y A;  1DKY A;  4AZC A;  3ERC C;  2Z0O A;  4FL9 A;  1OA0 A;  3ER9 B;  3CAZ A;  3D4Z A;  3ER8 C;  3GI7 A;  4IM2 A;  3EJT A;  3T47 A;  3DX1 A;  4R5I A;  2Q13 A;  1E9V A;  2ELB A;  3Q84 A;  4G6Q A;  5TKY A;  1JQK A;  4FZS A;  1PS3 A;  2NCZ A;  4JWC A;  5C5B B;  4AZH A;  4PO2 A;  3HAJ A;  4UDX X;  2F7Q A;  4KIK A;  2YIA A;  3B53 X;  2YLA A;  4DCN C;  4EZW A;  1O7D C;  3CKD A;  4R5G A;  4EZQ A;  3DPO A;  3D52 A;  3DX2 A;  1WDZ A;  3DPP A;  3C7N B;  3SBS A;  3BVT A;  7HSC A;  2MI7 A;  4AZ5 A;  3BUP A;  1UPX A;  3O3N B;  3EJQ A;  4HY9 A;  4EZX A;  4ILG A;  1TQS A;  3SBT B;  2Q12 A;  2PMR A;  3BVV A;  1O7D B;  3A98 A;  4EZN A;  3D2E A;  3B52 X;  2Z0N A;  2YL6 A;  3B51 X;  2WYH A;  5C5B A;  1U00 A;  4NPH A;  4FZO A;  1X04 A;  4WPE A;  3DX4 A;  3EJS A;  4FM3 A;  3DQG A;  4AZ6 A;  2KHO A;  1YUW A;  4IWQ A;  1ZYL A;  3EJR A;  2X3V A;  4F01 A;  1OAO A;  3C7N A;  3BVU A;  4R5K A;  3BUI A;  1HXK A;  2Z0V A;  2GAF D;  3QA8 A;  1I49 A;  3ABH A;  1QX1 A;  4EZY A;  3F7W A;  1R34 A;  4HYB A;  2YKT A;  2OO2 A;  3LLL A;  3QNI A;  2FYV A;  4ILH B;  2V0O A;  2JNK A;  2F7R A;  4M0M A;  2YL8 A;  3DX0 A;  2OP6 A;  2EX3 B;  2WYI A;  2ZXQ A;  3BUQ A;  3I39 X;  3I01 A;  4IM3 A;  3KDR A;  1HTY A;  4AKV A;  1GNT A;  4EZS A;  4FZP A;  4AZC B;  2YI8 A;  3CZS A;  2WIN M;  2F18 A;  5FLE X;  4AZI A;  4JWI A;  4EZO A;  3T49 A;  2PY6 A;  1LQ7 A;  4NSW A;  4F00 A;  3EJP A;  1TQU A;  3D50 A;  3L3P A;  2GA9 D;  2ND0 A;  4JN4 A;  4R5J A;  3KAV A;  3T46 A;  4WV5 A;  4JWD A;  3D51 A;  3HAH A;  2N3K A;  4AZB A;  1X03 A;  2LM0 A;  1I4T A;  1OA1 A;  1DKX A;  1SUF A;  2EWF A;  2RAK A;  2RAI A;  2X3X A;  3BLB A;  4I1Q A;  2YIB A;  4IM0 A;  2F7P A;  2D1L A;  2YI9 A;  3BVX A;  3G9G A;  3RV0 A;  3ZEF A;  4WPC A;  4WV7 A;  2FIC A;  3BUB A;  3M3W A;  4E81 A;  1QWU A;  3O3O B;  3QNJ A;  3DYT A;  1YWM A;  4H8S A;  3EJU A;  3DDF A;  1MJG A;  1TQW A;  3KAW A;  4AVM A;  4KIK B;  2F7O A;  2OBL A;  3FD9 A;  2EFK A;  3I2W A;  2OW6 A;  4NQI A;  4ATM A;  1E1D A;  3T48 A;  1DKZ A;  2V7Y A;  1I4D A;  4EZV A;  4R5L A;  3DPQ A;  3OWG A;  1SU6 A;  1ZWW A;  1W9M A;  3T4A G;  4AZG A;  2YLL A;  4B9Q A;  1R33 A;  4D8J A;  1TQT A;  3LVT A;  3QWE A;  5KBP A;  1I4L A;  2LXY A;  4AZ7 A;  3OK8 A;  1BPR A;  3DOB A;  3L3O M;  2RT6 A;  4HR1 B;  3ZED A;  3CV5 A;  1SU8 A;  4MQD A;  4EZT A; 
#chains in the Genus database with same CATH homology
 3VEB A;  4IW0 A;  5FIG A;  4EZR A;  2OBM A;  2X5C A;  4IWP A;  3H0X A;  3D2F A;  1GN9 A;  4JWE A;  3RV1 A;  4JNF A;  1GNL A;  3VEA A;  3I04 A;  3VKH A;  2QFF A;  4HR1 A;  3O3M B;  1SU7 A;  4ILI A;  2YIV X;  1CKR A;  4H6I A;  4I43 A;  4H6H A;  4EZU A;  4EZZ A;  1Q5L A;  4E3C A;  2ND1 A;  2BPR A;  4JL9 A;  4UDY X;  3OHX M;  5E84 A;  4JNE A;  3UIT A;  3N8E A;  1E2U A;  2JNS A;  3LMF A;  4IWO A;  2QXL A;  4JLC A;  4EZP A;  2Z8Y A;  1DKY A;  3ERC C;  4FL9 A;  1OA0 A;  3ER9 B;  3ER8 C;  3GI7 A;  4IM2 A;  3T47 A;  4R5I A;  1E9V A;  4G6Q A;  5TKY A;  1JQK A;  4JWC A;  2NCZ A;  4PO2 A;  4UDX X;  4KIK A;  2YIA A;  3B53 X;  4EZW A;  4R5G A;  4EZQ A;  3DPO A;  3C7N B;  3SBS A;  7HSC A;  3DPP A;  3O3N B;  1UPX A;  4HY9 A;  4EZX A;  4ILG A;  3SBT B;  4EZN A;  3A98 A;  3D2E A;  3B52 X;  3B51 X;  1U00 A;  4NPH A;  4FM3 A;  3DQG A;  2KHO A;  1YUW A;  4IWQ A;  1ZYL A;  4F01 A;  1OAO A;  3C7N A;  4R5K A;  2GAF D;  3QA8 A;  4EZY A;  3F7W A;  4HYB A;  4ILH B;  4M0M A;  2OP6 A;  2EX3 B;  3I39 X;  4IM3 A;  3I01 A;  1DG4 A;  3KDR A;  4EZS A;  1GNT A;  2YI8 A;  2WIN M;  5FLE X;  4JWI A;  4EZO A;  3T49 A;  2PY6 A;  4F00 A;  2GA9 D;  2ND0 A;  4JN4 A;  4R5J A;  3KAV A;  3T46 A;  4WV5 A;  4JWD A;  2N3K A;  2LM0 A;  1SUF A;  1OA1 A;  1DKX A;  2EWF A;  2YIB A;  4IM0 A;  2YI9 A;  3RV0 A;  3ZEF A;  4WV7 A;  4E81 A;  3O3O B;  3QNJ A;  1MJG A;  3KAW A;  4KIK B;  2OBL A;  3FD9 A;  1E1D A;  3T48 A;  1DKZ A;  2V7Y A;  4EZV A;  4R5L A;  3DPQ A;  3OWG A;  1SU6 A;  3T4A G;  1W9M A;  4B9Q A;  4D8J A;  3DOB A;  1BPR A;  3L3O M;  4HR1 B;  2RT6 A;  3ZED A;  1SU8 A;  4MQD A;  4EZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...