4EZYA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide nrliltg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Chaperone protein DnaK
total genus 71
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezyA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezyA01
4JNEA 4EZZA 4EZRA 3T46A 3DPOA 4HY9A 4EZVA 1CKRA 7HSCA 4EZQA 3DPQA 4JWIA 3D2FA 3T4AG 3T48A 4EZUA 3DOBA 3DQGA 4JN4A 3DPPA 1DKZA 3D2EA 4EZTA 4EZWA 1Q5LA 1YUWA 4FL9A 3QNJA 4F01A 1DKXA 3C7NA 3L3OM 4E81A 2QFFA 4R5KA 3H0XA 4JWDA 1DKYA 2QXLA 4EZPA 4R5GA 4EZXA 4H6HA 4EZOA 4H6IA 5E84A 3T47A 3T49A 4EZNA 4WV5A 4JWCA 2KHOA 4R5JA 4R5IA 4B9QA 4EZYA 4PO2A 4HYBA 2OP6A 2V7YA 4JNFA 4JWEA 4EZSA 1DG4A 5TKYA 3C7NB 4F00A 2WINM 1BPRA 3N8EA 4R5LA 4WV7A 3OHXM 2BPRA 1U00A
chains in the Genus database with same CATH superfamily
4JNEA 1YWMA 3A98A 1I49A 3T46A 3HAIA 3DPOA 2X3WA 2F7PA 4EZVA 2Z8YA 1I4TA 4EZQA 1X03A 3KAVA 3LMFA 2RAKA 1X04A 2WYHA 3D2EA 4EZTA 3D4YA 4H8SA 3Q0KA 1TQTA 3QNJA 5KBPA 4FL9A 4E81A 2OBLA 1LQ7A 2Z0NA 1O7DB 4EZXA 2Q12A 1MJGA 1SU6A 1E2UA 2RAJA 3D52A 3CKDA 3G9GA 2Q13A 4AZ6A 4DYLA 4R5JA 2EX3B 4D8JA 3B52X 1OAOA 4JLCA 3ER9B 2RAIA 4JWEA 3PLTA 1O7DC 1DG4A 4IW0A 4F00A 3N8EA 2YL8A 1E1DA 1HWWA 2EWFA 1R5EA 2YIAA 2YLLA 3BUPA 1U00A 1SU8A 3BUQA 4ILGA 4EZRA 4ILHB 2D1LA 2YL9A 1URUA 2JNSA 2EFKA 3QA8A 1CKRA 4IM3A 3ABHA 2QKWA 3LVTA 3OK8A 4JWIA 4KIKB 3ACOA 4UDXX 3D2FA 2OW6A 4HR1A 4AKVA 4DCNC 3VKHA 3KDRA 3EJUA 4AZIA 3UITA 4ATMA 1Q5LA 1YUWA 1SUFA 2V0OA 3M3WA 1HTYA 1DKXA 3BVTA 3DX4A 3Q84A 2N3KA 5FLEX 1DKYA 2MI7A 3FD9A 1GN9A 2RT6A 1I4DA 4R5GA 2OO2A 1GNLA 1TQSA 4H6HA 4AZCA 4MQDA 1WDZA 2GAFD 5E84A 2C08A 2YIVX 3D50A 4JWCA 3T47A 4FM3A 4R5IA 3B51X 3BUDA 1TQVA 1OA0A 1R33A 3CZSA 4IM2A 2ND1A 3LLLA 3RV0A 5FIGA 3QE6A 2EFLA 3C7NB 1BPRA 3GI7A 4UDYX 3CAZA 3BVXA 3OHXM 3DX1A 3QWEA 3DDGA 4WPEA 3CZNA 3BVVA 2WYIA 2NCZA 3O3OB 2LXYA 3D51A 4E3CA 2YL5A 2JNKA 1TQUA 3DX3A 3VEAA 4EZUA 3ERCC 4NSWA 2O0I1 4IWPA 3EJQA 4JN4A 2Z0VA 1PS3A 3DPPA 4AZHA 4I43A 4EZWA 3B53X 2F7RA 4F01A 1W9MA 2X5CA 1Y2OA 2YI8A 2QFFA 3C7NA 4R5KA 4WPCA 2F1AA 4IWQA 4JWDA 2BPRA 4EZPA 4AZGA 2GF4A 3VEBA 2OW7A 3EJPA 2F1BA 3L3PA 3O3NB 1QWUA 2YKTA 3QNIA 2FYVA 5C5BA 3I2WA 2GA9D 4AZBA 4WV5A 2LM0A 1R34A 2KHOA 3BUBA 1I4LA 4PO2A 2OP6A 1JQKA 3DDFA 4IWOA 4G6QA 2OZNB 2PMRA 2OBMA 3F7WA 4JNFA 3RV1A 3ZEDA 4EZSA 4FZSA 3BVUA 4FZOA 4M0MA 3HAHA 5TKYA 2WINM 1GNTA 2YLAA 1ZYLA 3DX2A 3RPMA 4BNEA 4WV7A 4HR1B 3O3MB 3CVRA 3EJSA 3SOGA 4EZZA 4FZPA 3HAJA 4AZ5A 4HY9A 3D4ZA 3SBSA 1QWNA 2YIBA 4IM0A 7HSCA 3BUIA 3DPQA 3I39X 2ALWA 3ER8C 1E9VA 3T4AG 3T48A 3EJRA 2Z0OA 3DOBA 3DQGA 2F7QA 4AZ7A 1DKZA 4I1QA 3I01A 4ILIA 3EJTA 3L3OM 2F18A 3KAWA 2PY6A 1OA1A 2ND0A 4JL9A 3H0XA 3SBTB 2X3XA 2QXLA 3BVWA 1QX1A 2FICA 2YI9A 3I04A 5C5BB 4AZCB 2YL6A 2ZXQA 3CV5A 4H6IA 4EZOA 3T49A 4EZNA 3ZEFA 3SYVA 4B9QA 4EZYA 2V7YA 3BLBA 2F7OA 2D4CA 1ZWWA 3DX0A 4HYBA 2X3VA 3DYTA 2ELBA 1SU7A 4AVMA 4KIKA 1UPXA 4R5LA 1HXKA 1TQWA 4NQIA 3OWGA 4NPHA
chains in the Genus database with same CATH topology
4JNEA 3A98A 3T46A 3DPOA 4EZVA 2Z8YA 4EZQA 3KAVA 3LMFA 3D2EA 4EZTA 4FL9A 3QNJA 4E81A 2OBLA 4EZXA 1MJGA 1SU6A 1E2UA 4R5JA 2EX3B 4D8JA 3B52X 1OAOA 4JLCA 3ER9B 4JWEA 1DG4A 4IW0A 4F00A 3N8EA 1E1DA 2EWFA 4ILGA 2YIAA 4ILHB 1U00A 1SU8A 4EZRA 2JNSA 3QA8A 1CKRA 4IM3A 3ZEFA 4JWIA 4MQDA 4KIKB 4UDXX 3D2FA 4HR1A 3VKHA 3KDRA 3UITA 1Q5LA 1YUWA 1SUFA 1DKXA 2N3KA 5FLEX 1DKYA 3FD9A 1GN9A 2RT6A 4R5GA 1GNLA 4H6HA 5E84A 2GAFD 3T47A 2YIVX 4JWCA 4FM3A 4R5IA 3B51X 1OA0A 4IM2A 2ND1A 3RV0A 5FIGA 3C7NB 1BPRA 3GI7A 4UDYX 3OHXM 2NCZA 3O3OB 4E3CA 3VEAA 4EZUA 3ERCC 4IWPA 4JN4A 3DPPA 4I43A 4EZWA 3B53X 4F01A 1W9MA 2X5CA 2YI8A 3C7NA 2QFFA 2BPRA 4R5KA 4JWDA 4IWQA 4EZPA 3VEBA 3O3NB 2GA9D 4WV5A 2LM0A 2KHOA 4PO2A 2OP6A 1JQKA 4IWOA 3ER8C 4G6QA 2OBMA 3F7WA 4JNFA 3RV1A 3ZEDA 4EZSA 4M0MA 5TKYA 2WINM 1GNTA 1ZYLA 4WV7A 4HR1B 3O3MB 4EZZA 4HY9A 3SBSA 4IM0A 2YIBA 7HSCA 3DPQA 3I39X 1E9VA 3T4AG 3T48A 3DOBA 3DQGA 1DKZA 3I01A 4ILIA 3L3OM 3KAWA 2PY6A 1OA1A 2ND0A 4JL9A 3H0XA 3SBTB 2QXLA 2YI9A 3I04A 4EZOA 4H6IA 3T49A 4EZNA 4EZYA 4B9QA 2V7YA 4HYBA 1SU7A 4KIKA 1UPXA 4R5LA 3OWGA 4NPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNE A;  4EZZ A;  4EZR A;  3T46 A;  3DPO A;  4HY9 A;  4EZV A;  1CKR A;  7HSC A;  4EZQ A;  3DPQ A;  4JWI A;  3D2F A;  3T4A G;  3T48 A;  4EZU A;  3DOB A;  3DQG A;  4JN4 A;  3DPP A;  1DKZ A;  3D2E A;  4EZT A;  4EZW A;  1Q5L A;  1YUW A;  4FL9 A;  3QNJ A;  4F01 A;  1DKX A;  3C7N A;  3L3O M;  4E81 A;  2QFF A;  4R5K A;  3H0X A;  4JWD A;  1DKY A;  2QXL A;  4EZP A;  4R5G A;  4EZX A;  4H6H A;  4EZO A;  4H6I A;  5E84 A;  3T47 A;  3T49 A;  4EZN A;  4WV5 A;  4JWC A;  2KHO A;  4R5J A;  4R5I A;  4B9Q A;  4EZY A;  4PO2 A;  4HYB A;  2OP6 A;  2V7Y A;  4JNF A;  4JWE A;  4EZS A;  1DG4 A;  5TKY A;  3C7N B;  4F00 A;  2WIN M;  1BPR A;  3N8E A;  4R5L A;  4WV7 A;  3OHX M;  2BPR A;  1U00 A; 
#chains in the Genus database with same CATH topology
 4JNE A;  1YWM A;  3A98 A;  1I49 A;  3T46 A;  3HAI A;  3DPO A;  2X3W A;  2F7P A;  4EZV A;  2Z8Y A;  1I4T A;  4EZQ A;  1X03 A;  3KAV A;  3LMF A;  2RAK A;  1X04 A;  2WYH A;  3D2E A;  4EZT A;  3D4Y A;  4H8S A;  3Q0K A;  1TQT A;  3QNJ A;  5KBP A;  4FL9 A;  4E81 A;  2OBL A;  1LQ7 A;  2Z0N A;  1O7D B;  4EZX A;  2Q12 A;  1MJG A;  1SU6 A;  1E2U A;  2RAJ A;  3D52 A;  3CKD A;  3G9G A;  2Q13 A;  4AZ6 A;  4DYL A;  4R5J A;  2EX3 B;  4D8J A;  3B52 X;  1OAO A;  4JLC A;  3ER9 B;  2RAI A;  4JWE A;  3PLT A;  1O7D C;  1DG4 A;  4IW0 A;  4F00 A;  3N8E A;  2YL8 A;  1E1D A;  1HWW A;  2EWF A;  1R5E A;  2YIA A;  2YLL A;  3BUP A;  1U00 A;  1SU8 A;  3BUQ A;  4ILG A;  4EZR A;  4ILH B;  2D1L A;  2YL9 A;  1URU A;  2JNS A;  2EFK A;  3QA8 A;  1CKR A;  4IM3 A;  3ABH A;  2QKW A;  3LVT A;  3OK8 A;  4JWI A;  4KIK B;  3ACO A;  4UDX X;  3D2F A;  2OW6 A;  4HR1 A;  4AKV A;  4DCN C;  3VKH A;  3KDR A;  3EJU A;  4AZI A;  3UIT A;  4ATM A;  1Q5L A;  1YUW A;  1SUF A;  2V0O A;  3M3W A;  1HTY A;  1DKX A;  3BVT A;  3DX4 A;  3Q84 A;  2N3K A;  5FLE X;  1DKY A;  2MI7 A;  3FD9 A;  1GN9 A;  2RT6 A;  1I4D A;  4R5G A;  2OO2 A;  1GNL A;  1TQS A;  4H6H A;  4AZC A;  4MQD A;  1WDZ A;  2GAF D;  5E84 A;  2C08 A;  2YIV X;  3D50 A;  4JWC A;  3T47 A;  4FM3 A;  4R5I A;  3B51 X;  3BUD A;  1TQV A;  1OA0 A;  1R33 A;  3CZS A;  4IM2 A;  2ND1 A;  3LLL A;  3RV0 A;  5FIG A;  3QE6 A;  2EFL A;  3C7N B;  1BPR A;  3GI7 A;  4UDY X;  3CAZ A;  3BVX A;  3OHX M;  3DX1 A;  3QWE A;  3DDG A;  4WPE A;  3CZN A;  3BVV A;  2WYI A;  2NCZ A;  3O3O B;  2LXY A;  3D51 A;  4E3C A;  2YL5 A;  2JNK A;  1TQU A;  3DX3 A;  3VEA A;  4EZU A;  3ERC C;  4NSW A;  2O0I 1;  4IWP A;  3EJQ A;  4JN4 A;  2Z0V A;  1PS3 A;  3DPP A;  4AZH A;  4I43 A;  4EZW A;  3B53 X;  2F7R A;  4F01 A;  1W9M A;  2X5C A;  1Y2O A;  2YI8 A;  2QFF A;  3C7N A;  4R5K A;  4WPC A;  2F1A A;  4IWQ A;  4JWD A;  2BPR A;  4EZP A;  4AZG A;  2GF4 A;  3VEB A;  2OW7 A;  3EJP A;  2F1B A;  3L3P A;  3O3N B;  1QWU A;  2YKT A;  3QNI A;  2FYV A;  5C5B A;  3I2W A;  2GA9 D;  4AZB A;  4WV5 A;  2LM0 A;  1R34 A;  2KHO A;  3BUB A;  1I4L A;  4PO2 A;  2OP6 A;  1JQK A;  3DDF A;  4IWO A;  4G6Q A;  2OZN B;  2PMR A;  2OBM A;  3F7W A;  4JNF A;  3RV1 A;  3ZED A;  4EZS A;  4FZS A;  3BVU A;  4FZO A;  4M0M A;  3HAH A;  5TKY A;  2WIN M;  1GNT A;  2YLA A;  1ZYL A;  3DX2 A;  3RPM A;  4BNE A;  4WV7 A;  4HR1 B;  3O3M B;  3CVR A;  3EJS A;  3SOG A;  4EZZ A;  4FZP A;  3HAJ A;  4AZ5 A;  4HY9 A;  3D4Z A;  3SBS A;  1QWN A;  2YIB A;  4IM0 A;  7HSC A;  3BUI A;  3DPQ A;  3I39 X;  2ALW A;  3ER8 C;  1E9V A;  3T4A G;  3T48 A;  3EJR A;  2Z0O A;  3DOB A;  3DQG A;  2F7Q A;  4AZ7 A;  1DKZ A;  4I1Q A;  3I01 A;  4ILI A;  3EJT A;  3L3O M;  2F18 A;  3KAW A;  2PY6 A;  1OA1 A;  2ND0 A;  4JL9 A;  3H0X A;  3SBT B;  2X3X A;  2QXL A;  3BVW A;  1QX1 A;  2FIC A;  2YI9 A;  3I04 A;  5C5B B;  4AZC B;  2YL6 A;  2ZXQ A;  3CV5 A;  4H6I A;  4EZO A;  3T49 A;  4EZN A;  3ZEF A;  3SYV A;  4B9Q A;  4EZY A;  2V7Y A;  3BLB A;  2F7O A;  2D4C A;  1ZWW A;  3DX0 A;  4HYB A;  2X3V A;  3DYT A;  2ELB A;  1SU7 A;  4AVM A;  4KIK A;  1UPX A;  4R5L A;  1HXK A;  1TQW A;  4NQI A;  3OWG A;  4NPH A; 
#chains in the Genus database with same CATH homology
 4JNE A;  3A98 A;  3T46 A;  3DPO A;  4EZV A;  2Z8Y A;  4EZQ A;  3KAV A;  3LMF A;  3D2E A;  4EZT A;  4FL9 A;  3QNJ A;  4E81 A;  2OBL A;  4EZX A;  1MJG A;  1SU6 A;  1E2U A;  4R5J A;  2EX3 B;  4D8J A;  3B52 X;  1OAO A;  4JLC A;  3ER9 B;  4JWE A;  1DG4 A;  4IW0 A;  4F00 A;  3N8E A;  1E1D A;  2EWF A;  4ILG A;  2YIA A;  4ILH B;  1U00 A;  1SU8 A;  4EZR A;  2JNS A;  3QA8 A;  1CKR A;  4IM3 A;  3ZEF A;  4JWI A;  4MQD A;  4KIK B;  4UDX X;  3D2F A;  4HR1 A;  3VKH A;  3KDR A;  3UIT A;  1Q5L A;  1YUW A;  1SUF A;  1DKX A;  2N3K A;  5FLE X;  1DKY A;  3FD9 A;  1GN9 A;  2RT6 A;  4R5G A;  1GNL A;  4H6H A;  5E84 A;  2GAF D;  3T47 A;  2YIV X;  4JWC A;  4FM3 A;  4R5I A;  3B51 X;  1OA0 A;  4IM2 A;  2ND1 A;  3RV0 A;  5FIG A;  3C7N B;  1BPR A;  3GI7 A;  4UDY X;  3OHX M;  2NCZ A;  3O3O B;  4E3C A;  3VEA A;  4EZU A;  3ERC C;  4IWP A;  4JN4 A;  3DPP A;  4I43 A;  4EZW A;  3B53 X;  4F01 A;  1W9M A;  2X5C A;  2YI8 A;  3C7N A;  2QFF A;  2BPR A;  4R5K A;  4JWD A;  4IWQ A;  4EZP A;  3VEB A;  3O3N B;  2GA9 D;  4WV5 A;  2LM0 A;  2KHO A;  4PO2 A;  2OP6 A;  1JQK A;  4IWO A;  3ER8 C;  4G6Q A;  2OBM A;  3F7W A;  4JNF A;  3RV1 A;  3ZED A;  4EZS A;  4M0M A;  5TKY A;  2WIN M;  1GNT A;  1ZYL A;  4WV7 A;  4HR1 B;  3O3M B;  4EZZ A;  4HY9 A;  3SBS A;  4IM0 A;  2YIB A;  7HSC A;  3DPQ A;  3I39 X;  1E9V A;  3T4A G;  3T48 A;  3DOB A;  3DQG A;  1DKZ A;  3I01 A;  4ILI A;  3L3O M;  3KAW A;  2PY6 A;  1OA1 A;  2ND0 A;  4JL9 A;  3H0X A;  3SBT B;  2QXL A;  2YI9 A;  3I04 A;  4EZO A;  4H6I A;  3T49 A;  4EZN A;  4EZY A;  4B9Q A;  2V7Y A;  4HYB A;  1SU7 A;  4KIK A;  1UPX A;  4R5L A;  3OWG A;  4NPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...