4F00A

Crystal structure of the substrate binding domain of e.coli dnak in complex with an apidaecin fragment from the bumblebee (residues 3 to 11)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/immune system
molecule keywords Chaperone protein DnaK
total genus 66
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4f00A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4f00A01
3H0XA 4JWEA 4PO2A 4EZXA 1U00A 1DKYA 4WV7A 3T47A 1DKZA 3DQGA 3OHXM 4R5KA 4H6IA 3T46A 3T4AG 4EZTA 4EZUA 4HYBA 4EZPA 4EZYA 4EZQA 3QNJA 4EZOA 1Q5LA 4F01A 2OP6A 2V7YA 4EZRA 2KHOA 4JNEA 4EZVA 3DPQA 1CKRA 4JNFA 4JWDA 3DPOA 3C7NA 3T48A 4FL9A 3T49A 2WINM 4HY9A 4EZNA 3L3OM 3D2EA 3N8EA 4B9QA 5TKYA 4F00A 1DKXA 3DPPA 4EZWA 1BPRA 2QFFA 4JN4A 4JWCA 4R5GA 4R5LA 4E81A 3DOBA 4R5IA 3C7NB 4EZSA 4EZZA 1YUWA 3D2FA 2BPRA 4WV5A 4H6HA 4R5JA 7HSCA 4JWIA 1DG4A 5E84A 2QXLA
chains in the Genus database with same CATH superfamily
2GF4A 3EJUA 4IM3A 3D4YA 4JLCA 1I4TA 1SU6A 2OBMA 2X3VA 1URUA 2YLLA 2Z0OA 3QWEA 4BNEA 3I39X 4H6IA 4JL9A 3DX3A 3A98A 4KIKB 4HYBA 3BLBA 4NQIA 5FLEX 2OP6A 4UDYX 3Q0KA 2ND1A 2YLAA 3SBSA 2OZNB 3EJRA 2F7QA 3DPQA 4IM2A 3DPOA 1JQKA 2YIBA 2YI9A 3G9GA 3EJTA 3D50A 4FZPA 4AVMA 3C7NB 4EZNA 2WYHA 1SU8A 3EJSA 3LMFA 2YI8A 1QWUA 2YKTA 3DDGA 2D4CA 2OW7A 1SU7A 4JN4A 3RV1A 4JWCA 4AZHA 4E81A 3LVTA 1SUFA 4EZZA 3D2FA 4R5JA 4M0MA 1X04A 2F1AA 3CKDA 3D51A 5E84A 2C08A 3HAHA 2YL9A 3OWGA 4PO2A 3I04A 2GAFD 4G6QA 1DKYA 4WV7A 2RT6A 1HWWA 1O7DB 3ACOA 2X3WA 3T47A 2ELBA 3BUQA 3Q84A 3DQGA 4FZOA 2X3XA 2QKWA 4R5KA 3HAJA 3T4AG 4ATMA 4EZYA 2RAJA 2YIVX 2F18A 3SBTB 2ND0A 1E2UA 2EFLA 1WDZA 4AZCA 4DYLA 3M3WA 1CKRA 3RV0A 2RAKA 3BVTA 1E9VA 4JNFA 1O7DC 2F1BA 2F7PA 2PY6A 2OBLA 3C7NA 1GNLA 3O3MB 4HR1B 3CZNA 2Q13A 2V0OA 3SOGA 3HAIA 4AZ5A 1TQUA 4E3CA 4HR1A 1Y2OA 3FD9A 1DKXA 3I01A 4IW0A 3DX1A 2QFFA 3O3NB 4AZCB 3KDRA 3EJPA 4IM0A 7HSCA 3BUBA 2BPRA 1HXKA 3CVRA 3ER9B 3ER8C 4HY9A 3T46A 4EZRA 3DOBA 2JNSA 2QXLA 3ABHA 3B53X 4JWEA 3KAWA 4KIKA 1PS3A 2LM0A 2X5CA 4WPCA 1U00A 1X03A 3SYVA 1OAOA 4EZXA 2FICA 2Z0NA 3OHXM 1HTYA 4EZTA 2Q12A 3DDFA 4FM3A 2V7YA 4EZQA 4FZSA 2WYIA 4EZOA 3N8EA 4I43A 4NSWA 2LXYA 2RAIA 5C5BA 4ILIA 4ILGA 1OA1A 2KHOA 3ZEFA 1GNTA 4DCNC 4EZVA 1R5EA 3QE6A 4JWDA 1QWNA 1W9MA 3T48A 3T49A 1I4LA 2ZXQA 3BVUA 3I2WA 3DX4A 3BVWA 3D2EA 1QX1A 3PLTA 2FYVA 4IWPA 4UDXX 3BUPA 3LLLA 5TKYA 3VEBA 3VKHA 1MJGA 3EJQA 1BPRA 2Z0VA 4R5GA 3RPMA 2MI7A 1YWMA 3F7WA 4R5LA 3BVXA 1UPXA 4R5IA 2D1LA 4WV5A 1DG4A 4NPHA 1TQSA 2Z8YA 4JNEA 4AZ7A 3QA8A 2PMRA 2YL5A 2EX3B 3CV5A 1R34A 2O0I1 2GA9D 3H0XA 1R33A 2YIAA 4MQDA 2NCZA 1GN9A 3KAVA 3ZEDA 1E1DA 2EFKA 1ZWWA 4D8JA 1I49A 1DKZA 1LQ7A 2OW6A 4AZGA 4EZUA 4EZPA 3O3OB 3DX0A 1Q5LA 1TQTA 3QNJA 4F01A 1TQWA 2YL6A 3D4ZA 5KBPA 2ALWA 3VEAA 3DYTA 3OK8A 4ILHB 2EWFA 4IWQA 5FIGA 4AZ6A 3ERCC 4AZIA 4FL9A 2OO2A 2WINM 2N3KA 3L3OM 4IWOA 4WPEA 2YL8A 4B9QA 4I1QA 4F00A 1TQVA 3BUDA 3DPPA 3CZSA 3DX2A 3BUIA 3D52A 3GI7A 4H8SA 3BVVA 4EZWA 2F7RA 3L3PA 3B52X 3QNIA 1I4DA 2JNKA 3CAZA 2F7OA 3UITA 4AKVA 1OA0A 3B51X 4AZBA 4H6HA 5C5BB 4EZSA 4JWIA 1YUWA 1ZYLA
chains in the Genus database with same CATH topology
4IM3A 4JLCA 1SU6A 2OBMA 3I39X 4H6IA 4JL9A 4KIKB 3A98A 4HYBA 5FLEX 2OP6A 4UDYX 2ND1A 3SBSA 3DPQA 4IM2A 3DPOA 1JQKA 2YIBA 2YI9A 4EZNA 1SU8A 3LMFA 2YI8A 1SU7A 4JN4A 3RV1A 4JWCA 4E81A 1SUFA 4EZZA 3D2FA 4R5JA 4M0MA 5E84A 3OWGA 4PO2A 3I04A 2GAFD 4G6QA 1DKYA 4WV7A 2RT6A 3T47A 3DQGA 4R5KA 3T4AG 4EZYA 2YIVX 3SBTB 2ND0A 1E2UA 1CKRA 3RV0A 4JNFA 1E9VA 4HR1B 2PY6A 3C7NA 2OBLA 3O3MB 1GNLA 4E3CA 4HR1A 3FD9A 3I01A 1DKXA 4IW0A 2QFFA 3O3NB 3KDRA 4IM0A 7HSCA 2BPRA 3ER9B 3ER8C 3T46A 4EZRA 3DOBA 3B53X 2QXLA 2JNSA 4JWEA 3KAWA 4KIKA 2LM0A 2X5CA 4EZXA 1U00A 1OAOA 3OHXM 4EZTA 4FM3A 2V7YA 4EZQA 3N8EA 4ILIA 4EZOA 4ILGA 1OA1A 2KHOA 3ZEFA 1GNTA 4EZVA 4JWDA 1W9MA 3T48A 3T49A 4HY9A 3D2EA 4IWPA 4UDXX 5TKYA 3VEBA 3VKHA 1MJGA 1BPRA 4R5GA 3F7WA 4R5LA 1UPXA 4R5IA 4WV5A 1DG4A 4NPHA 2Z8YA 4JNEA 3QA8A 2EX3B 3H0XA 2GA9D 2YIAA 4MQDA 2NCZA 1GN9A 3KAVA 3ZEDA 1E1DA 4D8JA 1DKZA 4EZUA 4EZPA 3O3OB 1Q5LA 3QNJA 4F01A 3VEAA 4ILHB 2EWFA 4IWQA 5FIGA 3ERCC 4FL9A 2WINM 2N3KA 3L3OM 4IWOA 4B9QA 4F00A 3DPPA 4EZWA 3GI7A 3B52X 4I43A 3C7NB 4EZSA 3UITA 1YUWA 1OA0A 3B51X 4H6HA 4JWIA 1ZYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0X A;  4JWE A;  4PO2 A;  4EZX A;  1U00 A;  1DKY A;  4WV7 A;  3T47 A;  1DKZ A;  3DQG A;  3OHX M;  4R5K A;  4H6I A;  3T46 A;  3T4A G;  4EZT A;  4EZU A;  4HYB A;  4EZP A;  4EZY A;  4EZQ A;  3QNJ A;  4EZO A;  1Q5L A;  4F01 A;  2OP6 A;  2V7Y A;  4EZR A;  2KHO A;  4JNE A;  4EZV A;  3DPQ A;  1CKR A;  4JNF A;  4JWD A;  3DPO A;  3C7N A;  3T48 A;  4FL9 A;  3T49 A;  2WIN M;  4HY9 A;  4EZN A;  3L3O M;  3D2E A;  3N8E A;  4B9Q A;  5TKY A;  4F00 A;  1DKX A;  3DPP A;  4EZW A;  1BPR A;  2QFF A;  4JN4 A;  4JWC A;  4R5G A;  4R5L A;  4E81 A;  3DOB A;  4R5I A;  3C7N B;  4EZS A;  4EZZ A;  1YUW A;  3D2F A;  2BPR A;  4WV5 A;  4H6H A;  4R5J A;  7HSC A;  4JWI A;  1DG4 A;  5E84 A;  2QXL A; 
#chains in the Genus database with same CATH topology
 2GF4 A;  3EJU A;  4IM3 A;  3D4Y A;  4JLC A;  1I4T A;  1SU6 A;  2OBM A;  2X3V A;  1URU A;  2YLL A;  2Z0O A;  3QWE A;  4BNE A;  3I39 X;  4H6I A;  4JL9 A;  3DX3 A;  3A98 A;  4KIK B;  4HYB A;  3BLB A;  4NQI A;  5FLE X;  2OP6 A;  4UDY X;  3Q0K A;  2ND1 A;  2YLA A;  3SBS A;  2OZN B;  3EJR A;  2F7Q A;  3DPQ A;  4IM2 A;  3DPO A;  1JQK A;  2YIB A;  2YI9 A;  3G9G A;  3EJT A;  3D50 A;  4FZP A;  4AVM A;  3C7N B;  4EZN A;  2WYH A;  1SU8 A;  3EJS A;  3LMF A;  2YI8 A;  1QWU A;  2YKT A;  3DDG A;  2D4C A;  2OW7 A;  1SU7 A;  4JN4 A;  3RV1 A;  4JWC A;  4AZH A;  4E81 A;  3LVT A;  1SUF A;  4EZZ A;  3D2F A;  4R5J A;  4M0M A;  1X04 A;  2F1A A;  3CKD A;  3D51 A;  5E84 A;  2C08 A;  3HAH A;  2YL9 A;  3OWG A;  4PO2 A;  3I04 A;  2GAF D;  4G6Q A;  1DKY A;  4WV7 A;  2RT6 A;  1HWW A;  1O7D B;  3ACO A;  2X3W A;  3T47 A;  2ELB A;  3BUQ A;  3Q84 A;  3DQG A;  4FZO A;  2X3X A;  2QKW A;  4R5K A;  3HAJ A;  3T4A G;  4ATM A;  4EZY A;  2RAJ A;  2YIV X;  2F18 A;  3SBT B;  2ND0 A;  1E2U A;  2EFL A;  1WDZ A;  4AZC A;  4DYL A;  3M3W A;  1CKR A;  3RV0 A;  2RAK A;  3BVT A;  1E9V A;  4JNF A;  1O7D C;  2F1B A;  2F7P A;  2PY6 A;  2OBL A;  3C7N A;  1GNL A;  3O3M B;  4HR1 B;  3CZN A;  2Q13 A;  2V0O A;  3SOG A;  3HAI A;  4AZ5 A;  1TQU A;  4E3C A;  4HR1 A;  1Y2O A;  3FD9 A;  1DKX A;  3I01 A;  4IW0 A;  3DX1 A;  2QFF A;  3O3N B;  4AZC B;  3KDR A;  3EJP A;  4IM0 A;  7HSC A;  3BUB A;  2BPR A;  1HXK A;  3CVR A;  3ER9 B;  3ER8 C;  4HY9 A;  3T46 A;  4EZR A;  3DOB A;  2JNS A;  2QXL A;  3ABH A;  3B53 X;  4JWE A;  3KAW A;  4KIK A;  1PS3 A;  2LM0 A;  2X5C A;  4WPC A;  1U00 A;  1X03 A;  3SYV A;  1OAO A;  4EZX A;  2FIC A;  2Z0N A;  3OHX M;  1HTY A;  4EZT A;  2Q12 A;  3DDF A;  4FM3 A;  2V7Y A;  4EZQ A;  4FZS A;  2WYI A;  4EZO A;  3N8E A;  4I43 A;  4NSW A;  2LXY A;  2RAI A;  5C5B A;  4ILI A;  4ILG A;  1OA1 A;  2KHO A;  3ZEF A;  1GNT A;  4DCN C;  4EZV A;  1R5E A;  3QE6 A;  4JWD A;  1QWN A;  1W9M A;  3T48 A;  3T49 A;  1I4L A;  2ZXQ A;  3BVU A;  3I2W A;  3DX4 A;  3BVW A;  3D2E A;  1QX1 A;  3PLT A;  2FYV A;  4IWP A;  4UDX X;  3BUP A;  3LLL A;  5TKY A;  3VEB A;  3VKH A;  1MJG A;  3EJQ A;  1BPR A;  2Z0V A;  4R5G A;  3RPM A;  2MI7 A;  1YWM A;  3F7W A;  4R5L A;  3BVX A;  1UPX A;  4R5I A;  2D1L A;  4WV5 A;  1DG4 A;  4NPH A;  1TQS A;  2Z8Y A;  4JNE A;  4AZ7 A;  3QA8 A;  2PMR A;  2YL5 A;  2EX3 B;  3CV5 A;  1R34 A;  2O0I 1;  2GA9 D;  3H0X A;  1R33 A;  2YIA A;  4MQD A;  2NCZ A;  1GN9 A;  3KAV A;  3ZED A;  1E1D A;  2EFK A;  1ZWW A;  4D8J A;  1I49 A;  1DKZ A;  1LQ7 A;  2OW6 A;  4AZG A;  4EZU A;  4EZP A;  3O3O B;  3DX0 A;  1Q5L A;  1TQT A;  3QNJ A;  4F01 A;  1TQW A;  2YL6 A;  3D4Z A;  5KBP A;  2ALW A;  3VEA A;  3DYT A;  3OK8 A;  4ILH B;  2EWF A;  4IWQ A;  5FIG A;  4AZ6 A;  3ERC C;  4AZI A;  4FL9 A;  2OO2 A;  2WIN M;  2N3K A;  3L3O M;  4IWO A;  4WPE A;  2YL8 A;  4B9Q A;  4I1Q A;  4F00 A;  1TQV A;  3BUD A;  3DPP A;  3CZS A;  3DX2 A;  3BUI A;  3D52 A;  3GI7 A;  4H8S A;  3BVV A;  4EZW A;  2F7R A;  3L3P A;  3B52 X;  3QNI A;  1I4D A;  2JNK A;  3CAZ A;  2F7O A;  3UIT A;  4AKV A;  1OA0 A;  3B51 X;  4AZB A;  4H6H A;  5C5B B;  4EZS A;  4JWI A;  1YUW A;  1ZYL A; 
#chains in the Genus database with same CATH homology
 4IM3 A;  4JLC A;  1SU6 A;  2OBM A;  3I39 X;  4H6I A;  4JL9 A;  4KIK B;  3A98 A;  4HYB A;  5FLE X;  2OP6 A;  4UDY X;  2ND1 A;  3SBS A;  3DPQ A;  4IM2 A;  3DPO A;  1JQK A;  2YIB A;  2YI9 A;  4EZN A;  1SU8 A;  3LMF A;  2YI8 A;  1SU7 A;  4JN4 A;  3RV1 A;  4JWC A;  4E81 A;  1SUF A;  4EZZ A;  3D2F A;  4R5J A;  4M0M A;  5E84 A;  3OWG A;  4PO2 A;  3I04 A;  2GAF D;  4G6Q A;  1DKY A;  4WV7 A;  2RT6 A;  3T47 A;  3DQG A;  4R5K A;  3T4A G;  4EZY A;  2YIV X;  3SBT B;  2ND0 A;  1E2U A;  1CKR A;  3RV0 A;  4JNF A;  1E9V A;  4HR1 B;  2PY6 A;  3C7N A;  2OBL A;  3O3M B;  1GNL A;  4E3C A;  4HR1 A;  3FD9 A;  3I01 A;  1DKX A;  4IW0 A;  2QFF A;  3O3N B;  3KDR A;  4IM0 A;  7HSC A;  2BPR A;  3ER9 B;  3ER8 C;  3T46 A;  4EZR A;  3DOB A;  3B53 X;  2QXL A;  2JNS A;  4JWE A;  3KAW A;  4KIK A;  2LM0 A;  2X5C A;  4EZX A;  1U00 A;  1OAO A;  3OHX M;  4EZT A;  4FM3 A;  2V7Y A;  4EZQ A;  3N8E A;  4ILI A;  4EZO A;  4ILG A;  1OA1 A;  2KHO A;  3ZEF A;  1GNT A;  4EZV A;  4JWD A;  1W9M A;  3T48 A;  3T49 A;  4HY9 A;  3D2E A;  4IWP A;  4UDX X;  5TKY A;  3VEB A;  3VKH A;  1MJG A;  1BPR A;  4R5G A;  3F7W A;  4R5L A;  1UPX A;  4R5I A;  4WV5 A;  1DG4 A;  4NPH A;  2Z8Y A;  4JNE A;  3QA8 A;  2EX3 B;  3H0X A;  2GA9 D;  2YIA A;  4MQD A;  2NCZ A;  1GN9 A;  3KAV A;  3ZED A;  1E1D A;  4D8J A;  1DKZ A;  4EZU A;  4EZP A;  3O3O B;  1Q5L A;  3QNJ A;  4F01 A;  3VEA A;  4ILH B;  2EWF A;  4IWQ A;  5FIG A;  3ERC C;  4FL9 A;  2WIN M;  2N3K A;  3L3O M;  4IWO A;  4B9Q A;  4F00 A;  3DPP A;  4EZW A;  3GI7 A;  3B52 X;  4I43 A;  3C7N B;  4EZS A;  3UIT A;  1YUW A;  1OA0 A;  3B51 X;  4H6H A;  4JWI A;  1ZYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...