1XK5A

Crystal structure of the m3g-cap-binding domain of snurportin1 in complex with a m3gpppg-cap dinucleotide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
204
structure length
204
Chain Sequence
b'HYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords snurportin-1
publication title Structural basis for m(3)G-cap-mediated nuclear import of spliceosomal UsnRNPs by snurportin1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 45
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2004-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1xk5A01
5FPRA 5D1OA 2HVRA 3W5OA 2OWOA 1TA8A 4EFEA 4E6NA 3BABA 2Q2UA 3L2PA 4PZ6A 4GLXA 2HIXA 5D1OB 2Q2TA 1TAEA 2HIVA 3BA8A 4UCRA 3BAAA 5FPOA 3GDEA 3JSNA 3JSLA 3KYHC 3GB8B 4PZ7A 1X9NA 3GJXB 1XK5A 3VNNA 3W1GA 3NC0B 4UCSA 3QWUA 5D1PA 1P16A 4DRFA 4UCOA 1A0IA 1B04A 3PN1A 1CKMA 1S68A 4UCUA 3NBYB 3S24A 2CFMA 3W1BA 4CC5A 1CKOA 3BA9A 4UCVA 3RR5A 1P8LA 3TY8A 4EEQA 4UCTA 1V9PA 4LH7A 4EFBA 3UQ8A 3RTXA 1VS0A 1FVIA 3TY5A 2HVSA 4UFZA 1DGSA 1CKNB 3NBZB 1CKNA 5DISC 4PZ8A 2VUGA 1XDNA 4CC6A 4LH6A 4EQ5A 2HVQA 3TY9A
chains in the Genus database with same CATH superfamily
3RV3A 5HBRB 1SCUB 3CSWA 2HDKA 2HVRA 2COGA 4IZOA 4Y8VB 1EHIA 4FFPA 2V58A 2X5RA 5BWWA 5BWTA 5CM0A 3JRXA 2W6QA 4FGRA 3JRWA 4CKCA 5BWUA 3V4ZA 4E6NA 2HJWA 1E4EA 4XZ3B 2CNQA 4K6NA 3BABA 4YB8B 4EG0A 3GIDA 1VBHA 2R7LA 4NZNA 1KJ8A 4O83A 2EJ0A 1OBDA 5BPFA 2R84A 2EJ2A 4NZOA 1TAEA 2I8CA 1I2KA 2YZNA 2R7MA 1WRVA 3BAAA 1I1LA 4O7YA 3KYHC 5DAAA 4MV8A 2Q7DA 5CA0F 3U0GA 4PZ7A 3VA7A 5DGIA 3BACA 4CE5A 2V5AA 3ORQA 2QK4A 3MJFA 2W6NA 3W1GA 4M0JA 4ZHQF 3AW8A 4UCSA 2CNUA 4HR7A 1P16A 3R5XA 3I12A 4HNVA 3T9BA 3R5HA 4E4TA 3PN1A 3BG5A 4M9UA 1S68A 4O7WA 3U54A 4C5AA 3NBYB 1C30A 2R85A 1Z2OX 5EZYF 3S24A 3ETJA 4HNTA 4FFRA 1CKOA 2FB9A 1CS0A 2I80A 1P8LA 2NUAB 4EEQA 3WWIA 4LH7A 2PBZA 2YZMA 2HHFA 4PBCA 4YAKB 2DZDA 4FFNA 1EZ1A 2HGWA 3R9RA 4O4JF 3U9TA 4I55F 5I5XA 4O82A 3KAJA 3T54A 4MV1A 3U55A 1A48A 5BYAA 2HGSA 1A3GA 5I47A 5LOVF 4PZ8A 2PVPA 2GLTA 3T9FA 2C00A 4NYEA 5I5YA 1M6VA 4EGQA 1Z2NX 3VPCA 1CQJB 5FPRA 5BYBA 4NZMA 4ZI7F 3TW6A 2YL2A 3T9CA 2X0SA 2OWOA 1E4EB 1W93A 4EFEA 5J2TF 3HB9A 5CA1F 4FE2A 5I5VA 4JXUA 1I7LA 5JVLA 3L2PA 4GLXA 5C8YF 5GONF 3VOTA 2HIXA 5D1OB 1M0TA 2Q2TA 1A0GA 3KAKA 1IOVA 2HIVA 4O4LF 4XYMB 4CMDA 4Q4CA 3TIIA 4CKEA 2WYOA 2YZGA 3BA8A 1GLVA 4DAAA 4YAJB 5I5SA 2CNVA 4UUGA 1KJQA 2R7NA 4O4IF 4XYLB 3T99A 5JQGF 3GJXB 1XK5A 3VPBA 1C3OA 4ZQIA 2R86A 3T9AA 2W6ZA 3TINA 3WNZA 1M0WA 2YZLA 4O7ZA 5JVDF 3QWUA 5D1PA 4UCOA 3UYYA 1PK8A 4YJ2F 2FPPB 2DIKA 1CKMA 1I1MA 5JH7F 4TVIA 3GLKA 5LA6F 1W96A 3CEBA 2ZGIA 5K2MA 4HNUA 5I5WA 3JZFA 2EJ3A 4Q4DA 2QB5A 5KKNB 2HHFB 2A1HA 2FPIB 4IIJF 3QFFA 3KREA 4UCTA 1KC7A 2EIYA 4C5CA 2ODTX 4EFBA 3RTXA 2XD4A 3UZOA 1FVIA 3TY5A 3WWHA 1PX2A 1B6SA 2NU7B 4UFZA 2OLSA 1ZAUA 2ZDQA 2P0AA 3SGIA 3NUAA 1AUXA 4O7VA 3DTGA 1EUCB 1JLLB 3TIGA 5DISC 1UC8A 2VUGA 5E25A 2GPSA 5I5TA 4O2BF 3UFXB 3E5NA 2DABA 2W6MA 5CE8A 3JZIA 2YW2A 5LP6F 1DV2A 4EGJA 5IYZF 2YWVA 3TY9A 4O7SA 1GSHA 4HN2A 2VQDA 4O7LA 3W5OA 3MWEA 2IP4A 4IHJF 5DMXA 4FFMA 1CE8A 1T36A 2Q2UA 1ULZA 2XCLA 3VMMA 5K3WA 2Z02A 1VKZA 1I1KA 3TEKA 2NU8B 2YYAA 1GSOA 2HG8A 5C1PA 2GQRA 3LULA 3ORRA 4MA0A 1I7NA 1EKFA 4O86A 5FPOA 3DF7A 3GDEA 1KJJA 3WWJA 2VPQA 3JSLA 1OBGA 3GB8B 3PFFA 3HBLA 5DGHA 1X9NA 2YRXA 4O2AF 2DAAA 4O4HF 3VPDA 3G8DA 2W71A 3K5HA 2VR1A 5KS8A 3N8DA 5D8DA 1BXRA 3LWBA 3RFCA 1KTAA 4DQNA 3RV4A 5HV6A 1G2WA 3T9EA 5J2UF 4O7RA 1WR2A 1GSAA 4DLKA 1IYDA 5BWXA 3OUUA 3WO1A 3DAAA 4CMFA 2CFMA 5I60A 1DIKA 2CZGA 4C5BA 1DV1A 1KEEA 3BA9A 3TQTA 4UCVA 3RR5A 5BMVF 3SE7A 3QQMA 3Q2OA 1EYZA 5LXTF 2W6PA 5BPHA 2HVSA 3K3PA 5FR9A 1UC9A 3TW7A 1DGSA 4O84A 4MV4A 3MWDA 3NBZB 1KJIA 3K5IA 2SCUB 4ZOLF 5FNVF 1CKNA 4MV3A 3V4SA 3DTFA 1KUTA 4IWYA 4MV9A 3JZ6A 1GGOA 4YJ3F 1AUVA 4LH6A 4DIMA 4EQ5A 4MA5A 3U9SA 2DLNA 2PN1A 5D1OA 2DWCA 4QSHA 3LP8A 5CB4F 4O7NA 3HO8A 2NU6B 2R87A 2Z04A 1TA8A 5JQWA 1I2LA 4L1KA 1JKJB 3ETHA 2ABJA 1KT8A 2YS6A 4PZ6A 3N6RA 1KJ9A 5BWRA 4HQ6A 4FU0A 2QF7A 2COIA 3KALA 2GPWA 4YBZB 4UCRA 3SNOA 4FFOA 3JSNA 2NU9B 4RCNA 1CQIB 1IYEA 1Z2PX 2FPGB 3Q1KA 4RZQA 5HNEA 3HT5A 4WHXA 2ZDHA 3VNNA 5CAEB 4IWXA 3NC0B 2R82A 2YRWA 4I4TF 1B6RA 3AX6A 5I5UA 2R7KA 4I50F 4CKBA 4CHIA 4DRFA 4MV7A 3WO0A 2W70A 4MAMA 3G8CA 4TM5A 1A0IA 1EKPA 1ET0A 1B04A 4TUYF 2YS7A 4UCUA 1DAAA 1BNCA 2GQSA 4TV9F 3R5FA 4GLWA 5C1OA 1EKVA 3W1BA 4CC5A 5CR5A 1EUDB 4ME6A 3T7AA 2W6OA 2FP4B 2HGXA 3TY8A 1V9PA 3UQ8A 1JDBB 5KX5F 1VS0A 1IOWA 4TV8F 4XX0B 1KBLA 1CKNB 2ZDGA 2I87A 3T9DA 5BWVA 1A9XA 2V59A 3UZBA 3RUPA 4O7TA 2Y4RA 5H80A 5LYJF 1VBGA 3OUZA 2COJA 1XDNA 2J9GA 1JDEA 4CC6A 4WBNF 4O81A 3LQSA 4FFLA 2HVQA 3R23A 4MV6A
chains in the Genus database with same CATH topology
5FPRA 5D1OA 2HVRA 3W5OA 2OWOA 1TA8A 4EFEA 4E6NA 3BABA 2Q2UA 3L2PA 4PZ6A 4GLXA 2HIXA 5D1OB 2Q2TA 1TAEA 2HIVA 3BA8A 4UCRA 3BAAA 5FPOA 3GDEA 3JSNA 3JSLA 3KYHC 3GB8B 4PZ7A 1X9NA 3GJXB 1XK5A 3VNNA 3W1GA 3NC0B 4UCSA 3QWUA 5D1PA 1P16A 4DRFA 4UCOA 1A0IA 1B04A 3PN1A 1CKMA 1S68A 4UCUA 3NBYB 3S24A 2CFMA 3W1BA 4CC5A 1CKOA 3BA9A 4UCVA 3RR5A 1P8LA 3TY8A 4EEQA 4UCTA 1V9PA 4LH7A 4EFBA 3UQ8A 3RTXA 1VS0A 1FVIA 3TY5A 2HVSA 4UFZA 1DGSA 1CKNB 3NBZB 1CKNA 5DISC 4PZ8A 2VUGA 1XDNA 4CC6A 4LH6A 4EQ5A 2HVQA 3TY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPR A;  5D1O A;  2HVR A;  3W5O A;  2OWO A;  1TA8 A;  4EFE A;  4E6N A;  3BAB A;  2Q2U A;  3L2P A;  4PZ6 A;  4GLX A;  2HIX A;  5D1O B;  2Q2T A;  1TAE A;  2HIV A;  3BA8 A;  4UCR A;  3BAA A;  5FPO A;  3GDE A;  3JSN A;  3JSL A;  3KYH C;  3GB8 B;  4PZ7 A;  1X9N A;  3GJX B;  1XK5 A;  3VNN A;  3W1G A;  3NC0 B;  4UCS A;  3QWU A;  5D1P A;  1P16 A;  4DRF A;  4UCO A;  1A0I A;  1B04 A;  3PN1 A;  1CKM A;  1S68 A;  4UCU A;  3NBY B;  3S24 A;  2CFM A;  3W1B A;  4CC5 A;  1CKO A;  3BA9 A;  4UCV A;  3RR5 A;  1P8L A;  3TY8 A;  4EEQ A;  4UCT A;  1V9P A;  4LH7 A;  4EFB A;  3UQ8 A;  3RTX A;  1VS0 A;  1FVI A;  3TY5 A;  2HVS A;  4UFZ A;  1DGS A;  1CKN B;  3NBZ B;  1CKN A;  5DIS C;  4PZ8 A;  2VUG A;  1XDN A;  4CC6 A;  4LH6 A;  4EQ5 A;  2HVQ A;  3TY9 A; 
#chains in the Genus database with same CATH topology
 3RV3 A;  5HBR B;  1SCU B;  3CSW A;  2HDK A;  2HVR A;  2COG A;  4IZO A;  4Y8V B;  1EHI A;  4FFP A;  2V58 A;  2X5R A;  5BWW A;  5BWT A;  5CM0 A;  3JRX A;  2W6Q A;  4FGR A;  3JRW A;  4CKC A;  5BWU A;  3V4Z A;  4E6N A;  2HJW A;  1E4E A;  4XZ3 B;  2CNQ A;  4K6N A;  3BAB A;  4YB8 B;  4EG0 A;  3GID A;  1VBH A;  2R7L A;  4NZN A;  1KJ8 A;  4O83 A;  2EJ0 A;  1OBD A;  5BPF A;  2R84 A;  2EJ2 A;  4NZO A;  1TAE A;  2I8C A;  1I2K A;  2YZN A;  2R7M A;  1WRV A;  3BAA A;  1I1L A;  4O7Y A;  3KYH C;  5DAA A;  4MV8 A;  2Q7D A;  5CA0 F;  3U0G A;  4PZ7 A;  3VA7 A;  5DGI A;  3BAC A;  4CE5 A;  2V5A A;  3ORQ A;  2QK4 A;  3MJF A;  2W6N A;  3W1G A;  4M0J A;  4ZHQ F;  3AW8 A;  4UCS A;  2CNU A;  4HR7 A;  1P16 A;  3R5X A;  3I12 A;  4HNV A;  3T9B A;  3R5H A;  4E4T A;  3PN1 A;  3BG5 A;  4M9U A;  1S68 A;  4O7W A;  3U54 A;  4C5A A;  3NBY B;  1C30 A;  2R85 A;  1Z2O X;  5EZY F;  3S24 A;  3ETJ A;  4HNT A;  4FFR A;  1CKO A;  2FB9 A;  1CS0 A;  2I80 A;  1P8L A;  2NUA B;  4EEQ A;  3WWI A;  4LH7 A;  2PBZ A;  2YZM A;  2HHF A;  4PBC A;  4YAK B;  2DZD A;  4FFN A;  1EZ1 A;  2HGW A;  3R9R A;  4O4J F;  3U9T A;  4I55 F;  5I5X A;  4O82 A;  3KAJ A;  3T54 A;  4MV1 A;  3U55 A;  1A48 A;  5BYA A;  2HGS A;  1A3G A;  5I47 A;  5LOV F;  4PZ8 A;  2PVP A;  2GLT A;  3T9F A;  2C00 A;  4NYE A;  5I5Y A;  1M6V A;  4EGQ A;  1Z2N X;  3VPC A;  1CQJ B;  5FPR A;  5BYB A;  4NZM A;  4ZI7 F;  3TW6 A;  2YL2 A;  3T9C A;  2X0S A;  2OWO A;  1E4E B;  1W93 A;  4EFE A;  5J2T F;  3HB9 A;  5CA1 F;  4FE2 A;  5I5V A;  4JXU A;  1I7L A;  5JVL A;  3L2P A;  4GLX A;  5C8Y F;  5GON F;  3VOT A;  2HIX A;  5D1O B;  1M0T A;  2Q2T A;  1A0G A;  3KAK A;  1IOV A;  2HIV A;  4O4L F;  4XYM B;  4CMD A;  4Q4C A;  3TII A;  4CKE A;  2WYO A;  2YZG A;  3BA8 A;  1GLV A;  4DAA A;  4YAJ B;  5I5S A;  2CNV A;  4UUG A;  1KJQ A;  2R7N A;  4O4I F;  4XYL B;  3T99 A;  5JQG F;  3GJX B;  1XK5 A;  3VPB A;  1C3O A;  4ZQI A;  2R86 A;  3T9A A;  2W6Z A;  3TIN A;  3WNZ A;  1M0W A;  2YZL A;  4O7Z A;  5JVD F;  3QWU A;  5D1P A;  4UCO A;  3UYY A;  1PK8 A;  4YJ2 F;  2FPP B;  2DIK A;  1CKM A;  1I1M A;  5JH7 F;  4TVI A;  3GLK A;  5LA6 F;  1W96 A;  3CEB A;  2ZGI A;  5K2M A;  4HNU A;  5I5W A;  3JZF A;  2EJ3 A;  4Q4D A;  2QB5 A;  5KKN B;  2HHF B;  2A1H A;  2FPI B;  4IIJ F;  3QFF A;  3KRE A;  4UCT A;  1KC7 A;  2EIY A;  4C5C A;  2ODT X;  4EFB A;  3RTX A;  2XD4 A;  3UZO A;  1FVI A;  3TY5 A;  3WWH A;  1PX2 A;  1B6S A;  2NU7 B;  4UFZ A;  2OLS A;  1ZAU A;  2ZDQ A;  2P0A A;  3SGI A;  3NUA A;  1AUX A;  4O7V A;  3DTG A;  1EUC B;  1JLL B;  3TIG A;  5DIS C;  1UC8 A;  2VUG A;  5E25 A;  2GPS A;  5I5T A;  4O2B F;  3UFX B;  3E5N A;  2DAB A;  2W6M A;  5CE8 A;  3JZI A;  2YW2 A;  5LP6 F;  1DV2 A;  4EGJ A;  5IYZ F;  2YWV A;  3TY9 A;  4O7S A;  1GSH A;  4HN2 A;  2VQD A;  4O7L A;  3W5O A;  3MWE A;  2IP4 A;  4IHJ F;  5DMX A;  4FFM A;  1CE8 A;  1T36 A;  2Q2U A;  1ULZ A;  2XCL A;  3VMM A;  5K3W A;  2Z02 A;  1VKZ A;  1I1K A;  3TEK A;  2NU8 B;  2YYA A;  1GSO A;  2HG8 A;  5C1P A;  2GQR A;  3LUL A;  3ORR A;  4MA0 A;  1I7N A;  1EKF A;  4O86 A;  5FPO A;  3DF7 A;  3GDE A;  1KJJ A;  3WWJ A;  2VPQ A;  3JSL A;  1OBG A;  3GB8 B;  3PFF A;  3HBL A;  5DGH A;  1X9N A;  2YRX A;  4O2A F;  2DAA A;  4O4H F;  3VPD A;  3G8D A;  2W71 A;  3K5H A;  2VR1 A;  5KS8 A;  3N8D A;  5D8D A;  1BXR A;  3LWB A;  3RFC A;  1KTA A;  4DQN A;  3RV4 A;  5HV6 A;  1G2W A;  3T9E A;  5J2U F;  4O7R A;  1WR2 A;  1GSA A;  4DLK A;  1IYD A;  5BWX A;  3OUU A;  3WO1 A;  3DAA A;  4CMF A;  2CFM A;  5I60 A;  1DIK A;  2CZG A;  4C5B A;  1DV1 A;  1KEE A;  3BA9 A;  3TQT A;  4UCV A;  3RR5 A;  5BMV F;  3SE7 A;  3QQM A;  3Q2O A;  1EYZ A;  5LXT F;  2W6P A;  5BPH A;  2HVS A;  3K3P A;  5FR9 A;  1UC9 A;  3TW7 A;  1DGS A;  4O84 A;  4MV4 A;  3MWD A;  3NBZ B;  1KJI A;  3K5I A;  2SCU B;  4ZOL F;  5FNV F;  1CKN A;  4MV3 A;  3V4S A;  3DTF A;  1KUT A;  4IWY A;  4MV9 A;  3JZ6 A;  1GGO A;  4YJ3 F;  1AUV A;  4LH6 A;  4DIM A;  4EQ5 A;  4MA5 A;  3U9S A;  2DLN A;  2PN1 A;  5D1O A;  2DWC A;  4QSH A;  3LP8 A;  5CB4 F;  4O7N A;  3HO8 A;  2NU6 B;  2R87 A;  2Z04 A;  1TA8 A;  5JQW A;  1I2L A;  4L1K A;  1JKJ B;  3ETH A;  2ABJ A;  1KT8 A;  2YS6 A;  4PZ6 A;  3N6R A;  1KJ9 A;  5BWR A;  4HQ6 A;  4FU0 A;  2QF7 A;  2COI A;  3KAL A;  2GPW A;  4YBZ B;  4UCR A;  3SNO A;  4FFO A;  3JSN A;  2NU9 B;  4RCN A;  1CQI B;  1IYE A;  1Z2P X;  2FPG B;  3Q1K A;  4RZQ A;  5HNE A;  3HT5 A;  4WHX A;  2ZDH A;  3VNN A;  5CAE B;  4IWX A;  3NC0 B;  2R82 A;  2YRW A;  4I4T F;  1B6R A;  3AX6 A;  5I5U A;  2R7K A;  4I50 F;  4CKB A;  4CHI A;  4DRF A;  4MV7 A;  3WO0 A;  2W70 A;  4MAM A;  3G8C A;  4TM5 A;  1A0I A;  1EKP A;  1ET0 A;  1B04 A;  4TUY F;  2YS7 A;  4UCU A;  1DAA A;  1BNC A;  2GQS A;  4TV9 F;  3R5F A;  4GLW A;  5C1O A;  1EKV A;  3W1B A;  4CC5 A;  5CR5 A;  1EUD B;  4ME6 A;  3T7A A;  2W6O A;  2FP4 B;  2HGX A;  3TY8 A;  1V9P A;  3UQ8 A;  1JDB B;  5KX5 F;  1VS0 A;  1IOW A;  4TV8 F;  4XX0 B;  1KBL A;  1CKN B;  2ZDG A;  2I87 A;  3T9D A;  5BWV A;  1A9X A;  2V59 A;  3UZB A;  3RUP A;  4O7T A;  2Y4R A;  5H80 A;  5LYJ F;  1VBG A;  3OUZ A;  2COJ A;  1XDN A;  2J9G A;  1JDE A;  4CC6 A;  4WBN F;  4O81 A;  3LQS A;  4FFL A;  2HVQ A;  3R23 A;  4MV6 A; 
#chains in the Genus database with same CATH homology
 5FPR A;  5D1O A;  2HVR A;  3W5O A;  2OWO A;  1TA8 A;  4EFE A;  4E6N A;  3BAB A;  2Q2U A;  3L2P A;  4PZ6 A;  4GLX A;  2HIX A;  5D1O B;  2Q2T A;  1TAE A;  2HIV A;  3BA8 A;  4UCR A;  3BAA A;  5FPO A;  3GDE A;  3JSN A;  3JSL A;  3KYH C;  3GB8 B;  4PZ7 A;  1X9N A;  3GJX B;  1XK5 A;  3VNN A;  3W1G A;  3NC0 B;  4UCS A;  3QWU A;  5D1P A;  1P16 A;  4DRF A;  4UCO A;  1A0I A;  1B04 A;  3PN1 A;  1CKM A;  1S68 A;  4UCU A;  3NBY B;  3S24 A;  2CFM A;  3W1B A;  4CC5 A;  1CKO A;  3BA9 A;  4UCV A;  3RR5 A;  1P8L A;  3TY8 A;  4EEQ A;  4UCT A;  1V9P A;  4LH7 A;  4EFB A;  3UQ8 A;  3RTX A;  1VS0 A;  1FVI A;  3TY5 A;  2HVS A;  4UFZ A;  1DGS A;  1CKN B;  3NBZ B;  1CKN A;  5DIS C;  4PZ8 A;  2VUG A;  1XDN A;  4CC6 A;  4LH6 A;  4EQ5 A;  2HVQ A;  3TY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...