3U54A

Crystal structure (type-1) of saicar synthetase from pyrococcus horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
227
structure length
225
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Structure of SAICAR synthetase from Pyrococcus horikoshii OT3: insights into thermal stability
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 225
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3u54A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3u54A02
2NO3A 5JQGF 5HIBA 2OXYA 1QPEA 3PY3A 4FKUA 3RPSA 5KO1A 2GSFA 1L8TA 4C2WA 4FTQA 4I5HA 3HO8A 4CEGA 5M09A 4V04A 3VWAA 3GT8A 4F64A 2HCKA 1ZZ2A 2O8YA 3LLAA 4KBCA 4R5YA 3TDVA 4Q9ZA 2R64A 3UIMA 4EK4A 4EL9A 2JDSA 3TTJA 4FGBA 2PE0A 3ENHA 4KSPA 4BDCA 3R73A 3ZDUA 2GNGA 3BHVA 5BVKA 5IQHA 4QPAA 2NU8B 3FE3A 3R8UA 3R8VA 3SD0A 3LFBA 3S1HA 1TQMA 2H96A 3WF6A 4NJDA 3O7LB 2I1MA 3PPZA 4MTAA 3KMWA 3SQQA 3E8EA 4KIPA 5B2KA 4YZMA 5FBNC 3S0OA 1PK8A 4KS8A 4XV1A 4FFLA 3LXPA 4IZ5A 4MXOA 3ZLXA 4TWPA 3RK9A 2ZDGA 3BHUA 3KA0A 3Q52A 3LMHA 4IWQA 1ZRZA 3VUIA 2YJSA 3N4TA 4TYEA 4HNUA 5IEXA 4EJ7A 3G0FA 3VUMA 1H0VA 3RWQA 4I6FA 4U79A 3I60A 4K0YA 4CZTA 4EEVA 3D5WA 1JKTA 4ZZNA 5J7HA 3HMPA 3OS3A 3DPKA 3CKWA 2VU3A 4JIKA 4QQTA 3Q96A 3H3CA 5CZHA 1UNHA 3MPTA 3LQ8A 3DXPA 3OEFX 3QD2B 2EXCX 3HDNA 3PWDA 4GIHA 3RCJA 2DWBA 1XKKA 4NK9A 3UJGA 4BYJA 3EQBA 3QALE 4XP3A 3QLGA 1A9XA 2HAKA 3QC9A 5DI1A 2HGSA 4RQKA 4CLIA 1W84A 5IDPA 2W4JA 4QQJA 5CY3A 2WOUA 3EN7A 5AEPA 4YPDA 5BYYA 5AADA 3E8DA 3B2WA 4O7RA 3NPCA 2X7OA 2JFLA 2W1FA 1Q5KA 3T9TA 3CQUA 4PP9A 2BZHB 3GLKA 4PQNA 3NR9A 4FVRA 5FP6A 4QMTA 4AA0A 5E8SA 2XKDA 3PVGA 3JXWA 2XNOA 4YURA 3ZFYA 3I81A 2PVHA 3WILA 4J53A 3OD6X 4Z7HA 3FZSA 1E4EB 4QP9A 4NT4A 4O96A 3DTWA 5CI6A 1VR2A 5CU3A 2CLXA 2YZMA 4IEBA 4FZFB 3H10A 4I94A 1BX6A 2JD5A 4QMLA 2YHVA 3F9NA 1OMWA 3BLRA 5C1QB 2BDWA 5KMLA 3DDQA 2ZDHA 2R0UA 3QKLA 4IM2A 2C68A 2CGWA 5LVPA 5D7VA 1WFCA 2BDFA 2OLCA 3OW4A 4L7FA 2X1NA 3L1SA 1F0QA 3GNIB 3MI9A 5AUXA 5HG5A 1OBDA 1KE8A 3JRWA 4FFRA 3PJ3A 1OL1A 4G9CA 4M8TA 4QMPA 4CFWA 2IVVA 4ITJA 2JAVA 4ZLOA 3H4JA 2PVFA 4IX4A 2C0OA 4O86A 5EH0A 2R3MA 4AZSA 2VNWA 3CR0A 4LOQA 4JG7A 3KK9A 2GNHA 1PXMA 2YDKA 4RGJA 1KC7A 3O7LD 1CQJB 3SOCA 5HBHA 3FL4A 4FG9A 2YCQA 3LFCA 3G5DA 2Y4PA 3L8PA 5EM8A 3VN9A 2CGVA 4DEGA 3NVKI 4O27B 2R3HA 3EN4A 4B8LA 1KE7A 2WAJA 3NAXA 2CGUA 3I79A 4Y8DA 4BF2A 3HV6A 1MQ4A 1FQ1B 2WB8A 4FV4A 4FEQA 5DYJA 4D1ZA 5AAEA 3VPBA 3VUGA 1XH5A 4GT5A 4FSQA 4I0SA 3PP1A 5IH6A 2DUVA 2GHMA 3UPXA 4DCAA 2OZAA 3FXXA 4KAOA 3FYJX 4IE9A 3Q04A 1OKVA 3F82A 3IW4A 5HG7A 4FNYA 3F5UA 4U41A 5B7VA 2R86A 1V0PA 3AMBA 4N57A 4Y95A 4QP6A 4WHZA 1I09A 2CKQA 2IW8A 4DITA 4WG3A 2QU5A 3D7TA 3V4SA 2BMCA 5KMIA 5EW8A 3RAHA 3OVVA 3CTQA 4FTCA 3LFQA 1AUXA 4ME6A 3RMFA 4F6UA 3TTIA 4JBPA 4NTTA 4X2JA 4Z7GA 5BUJA 5AP2A 3CSVA 5IMXA 5C9CA 4R6VA 5DR9A 4EOJA 4WNMA 1OIUA 3K5UA 4EH8A 4CCUA 2X0SA 4O81A 4O0VA 4AUAA 4CFXA 4LFIA 2I6LA 4F99A 1E9HA 4A4OA 4A9YA 5JQWA 1WCCA 2HW6A 2ITNA 1APME 4MCVA 4OBPA 2ITTA 2P0AA 4QYYA 3TXOA 4QYHA 4MBJA 4XLVA 5JVDF 2RFDA 4YJ3F 4FL2A 1UV5A 3MY5A 2YIXA 3LXLA 2CCIA 1OPJA 2UZVA 2CGXA 2YITA 5HLWA 3ZBFA 3LFSA 4G31A 4EK6A 3TIGA 3MWEA 5LWNA 4KIQA 2CNVA 4HJOA 4JRNA 4APCA 2C3LA 4ZTHA 3DKFA 3RK5A 4YBKA 5L6WL 4BCHA 3BE2A 4BB4A 5CA1F 1YDRE 5M4IA 3V8WA 2ERZE 4DC2A 4K8AA 1NT2A 4Z16A 2BILB 2R4BA 2PULA 1VKZA 1XWSA 2GPHA 3CY2A 3KK8A 4FZ6A 3UG1A 4A4XA 4ZTMA 4LI5A 3R23A 5D8DA 2EVAA 5KBQA 5CU0A 4MNEB 4EOQA 5F95A 4WBOA 3QTRA 2YFXA 5I5ZA 5IQCA 2VWXA 1U59A 4AN2A 4FKPA 2V62A 2OJGA 3SXRA 4C38A 3MDYA 4C36A 3TUDA 2ITPA 5HD7A 1PX2A 3F66A 3UE4A 3ZBXA 5GIPE 3TNIA 4PUZA 4XYFA 1ATPE 3R7UA 4EZ3A 3Q3BA 3UNZA 1PY5A 3ZC6A 2HWPA 3BGZA 4X2NA 2WU6A 4YBZB 5IA4A 1DAYA 2NUAB 3F6XA 5L8LA 4KNBA 1T36A 3SXSA 4KB8A 4RJ3A 2XEYA 3QHRA 3ETJA 2PYWA 2P4IA 4FTKA 3TZ8A 4XX0B 1R0EA 2YRWA 5C01A 3FLZA 1JAMA 5EQPA 5B2MA 5AAGA 3I0OA 3PG1A 4RZWA 4FIGA 5I0BA 1MRVA 1OB3A 3ZLWA 3IOKA 3RAWA 4M67A 3SXFA 2GS6A 2YISA 3ULZA 5AX9A 3L9MA 1IAHA 2VO0A 5E8UA 4DLIA 4PL3A 2QU6A 3CTJA 2VTRA 4FV8A 5IUHA 2XF0A 3BU6A 4FSMA 3KMUA 3NX8A 3QD4A 4GU9A 4YLJA 2YCRA 3QFFA 4H58A 5GJDA 1ZLTA 3U6HA 2FO0A 4LGGA 1GZNA 3RGFA 3KVWA 3OW3A 3BELA 5E90A 3WE8A 4Q9SA 5GJGA 3GC8A 3ZMMA 3OUUA 2VNYA 4AW1A 3UZPA 1YHWA 4B9DA 4TYJA 4YMJA 2UZDA 2YWPA 4YJQA 2O3PA 3Q2JA 4R7BA 4TT7A 4ANQA 4QNAA 2F57A 2IVUA 2WU7A 2UVXA 4R1YA 1OM1A 1O6LA 4YTHA 4O21A 1H4LA 1JPAA 3S95A 3DKCA 4FV3A 5HTCA 1FVVA 3RHXA 5HGIA 3MA3A 4Y5HA 5C26A 5LWMA 2E9PA 4TUYF 2UV2A 3I5NA 4WUNA 5FBOA 4AOTA 5J1VA 3IGGA 4FSNA 2CKEA 3AGMA 1FBNA 2Y9QA 3IOPA 2PVJA 3EJ1A 1SVEA 1WBVA 3KVXA 4AZEA 3BEGA 4HPTE 3C5UA 3AOXA 2WIHA 2ZMDA 1OI9A 1UNLA 2ZYBA 4L43A 2OIBA 4F7NA 2CLQA 4D58A 4O4LF 5AWMA 4QT1A 4BI1A 3UGCA 3E62A 2YIYA 4H05A 3ZUUA 2HOGA 3EB0A 3AGLA 1JDEA 1UWHA 2QOFA 3AXWA 4EOMA 2VO7A 2WD1A 1YXTA 3VRYA 5CEIA 2JITA 3BRBA 5M53A 2X8DA 3ROCA 2IO6A 5H8EA 3PRIA 1M2PA 2WMUA 4IADA 3HKOA 1WBSA 4NWMA 3C4FA 4ZTSA 3Q4TA 5J2UF 3ZZWA 4BHZA 4ZTLA 4NKSA 3TL8A 4PMSA 3R71A 2GNJA 4HVDA 5HORA 1ULZA 3BWJA 2R3KA 3SVVA 5IYZF 3FHIA 3WZEA 3DLSA 4ALVA 2OF4A 3EKKA 5CB4F 1HOWA 5CEQA 4V0GA 4NTSA 3I12A 4QRCA 4MBIA 3SC1A 3G51A 5KZIA 3PZEA 2PUPA 1PHKA 4ZP5A 4FKWA 4CLJA 4GT4A 5IZFA 2HWOA 2XK4A 4MV8A 4GSBA 4IC7A 2OH0E 4AS0A 3BU5A 3WF5A 3FMKA 2IW9A 3QZIA 5CS6A 2SRCA 2VQDA 4DFBA 1IRKA 1BMKA 5H9BA 3O8PA 4D4RA 3VIDA 3FZPA 4C59A 2H34A 2XP2A 4F9BA 3LM5A 4GJ2A 2VN9A 3RZBA 5M44A 3LKMA 5DOSA 1J1CA 4O7LA 3SAYA 4ANLA 1FMOE 2OF2A 3ORZA 3U87A 4ZJIA 1IOVA 3U9CA 4QP8A 4TKSA 4X6QC 2QK4A 2I0EA 2YM5A 5TO8A 4PMTA 3BQCA 4EKKA 3L9PA 4A06A 4KA3A 2R0IA 3ZDIA 4UEUA 5AA9A 4LOPA 3D9VA 3VQUA 5TR6A 2QO9A 5FGKA 1FGIA 1ZOHA 1ZYSA 2BPMA 3MB7A 4C3RA 4DEAA 4ZS4A 3CGOA 3E3PA 2AC5A 4FKIA 3I7BA 2GLTA 4IAKA 4E4XA 5J9YA 4FEUA 4PTCA 3QQGA 4PDOA 4YNOA 3LOKA 4FU0A 3QZHA 4ASXA 3N8DA 3R5XA 5ANDA 2R9SA 1GOLA 5FRIA 1MRYA 3ULIA 3KRJA 3AT3A 5ACKA 3KRXA 2JKQA 2XJ1A 4DH1A 3EQHA 4YO4A 3RFCA 2I7QA 4ZJJA 2C6EA 3OBGA 4IAZA 5LMAA 4LL0A 3SLSA 3NW6A 2WMAA 3NUSA 2IJMA 3PWYA 4FKRA 5HG9A 4MA0A 3AG9A 2CMWA 5I9YA 1CTPE 1BI7A 4U3YA 2ZOQA 4FTIA 3QWJA 4I0TA 3ZEPA 5C8KA 2GQRA 3JUHA 2WIPA 4RVTA 3ZO4A 4F63A 3KFAA 2WHBA 3ORPA 4HOKA 1PYEA 4YJVA 4J1RA 4ITHA 4ZEGA 4IW0A 4TNDA 3ZRLA 3WBLA 4ZTRA 3DBDA 4DINA 1MUOA 5D10A 4PMPA 2V58A 4EHGA 5CVFA 4CTCA 2JDTA 1XH7A 1KOAA 2VTSA 3F3UA 3TZ9A 3ORQA 4JR3A 3AD4A 5E8WA 1A9UA 2QO7A 4JT3A 3FAAA 3QX4A 2CZGA 5M08A 4U6RA 1GZKA 4EC9A 3F61A 3R1QA 4QMQA 3F7ZA 3AT2A 4EC8A 3RNIA 3DAEA 2O0UA 4YAJB 5JKGA 3DU8A 5CWZA 1IG1A 3AC2A 3DJ6A 2VZ6A 3P08A 2CN5A 2ZM3A 1W7HA 2FPIB 3IS5A 3LWBA 2WQEA 3QUPA 5KHXA 4F65A 4IVBA 4D9UA 3PG3A 3PY0A 3FMHA 3VUDA 2HJWA 3AC3A 4AT3A 3FZOA 3FLSA 4D4VA 1ZXEA 3GU7A 4AQCA 2WTCA 4JOAA 3V3VA 3EWHA 1O9UA 4FZDB 2JC6A 2H9VA 1OBGA 4FE2A 4FTOA 5ANGA 3EKNA 2YCFA 3NVMB 1STCE 2ETMA 3VUKA 3BIZA 4G9RA 4D55A 2GMXA 1M7QA 3VJNA 3G9NA 5J9LA 4BGQA 5BPHA 3NUAA 1YWRA 3C4EA 4N6YA 4NFMA 1Q3DA 5IUGA 5DLSA 2QHNA 2VAGA 2VX3A 3KL8A 4MAMA 2R84A 3QX2A 2WFYA 5EHYA 4EUTA 4G34A 2VX1A 4RX8A 5H8BA 5KUPA 3LJ2A 2JBPA 1FINA 2NNWB 2X2LA 4AGWA 3R30A 3NNXA 3DQXA 5A46A 5JQ8A 5BVNA 4HYHA 3CS9A 3E3BX 1OL2A 4LGHA 3EH9A 2W5BA 3BU3A 1WBNA 5LVLA 4AT5A 3UYSA 3HNGA 1ZYJA 3V6SA 5GIOE 1I7NA 4YJPA 3FMLA 3EQRA 3CD3A 3UO5A 2QOLA 4I93A 4EG0A 4XMOA 3R7EA 3QFVA 2PUIA 1E1XA 3P23A 1XBCA 3MIAA 4DF3A 2PL0A 5T3QA 4BKJA 3FJQE 1H8FA 2XNPA 2PSQA 2QNJA 3LHJA 4JDKA 4GT3A 4XOZA 4IFCA 4E7WA 1VJYA 1RJBA 2OJIA 4L01A 5HI2A 5IH5A 2R87A 3R2BA 2PMOX 4YGAA 2Y6MA 1Q8TA 2ITQA 4DBXA 2BROA 3BEAA 2A4LA 3ZLSA 1H1WA 2WTIA 3HP5A 1OIRA 1K3AA 5E8YA 3H9FA 5LYJF 4I6HA 4R1VA 5ACBC 3CLYA 3Q9YA 4CFFA 3MS9A 5EW3A 3ZLYA 1KJ9A 1L3RE 1WVWA 3G15A 3RVGA 4C4JA 1M0TA 2Z04A 3HUCA 3TV6A 4JX3A 4CKRA 5LOHA 5LVMA 3ETHA 3VPCA 3ZU7A 2OBJA 3MVMA 3VS0A 4BDJA 2ZVAA 3PTGA 4WT6A 1JOWB 3O23A 4RC3A 1P4OA 2VTPA 4IC8A 4J95A 5KKNB 5BVEA 3KXNA 5FEDA 2F9GA 2C6DA 4ZSGA 4XRJA 3R9RA 4G6NA 4HNVA 1U4DA 4E6CA 3QQKA 4Y73A 4IJ9A 3KXXA 3PVWA 4GG5A 3PPKA 3JPVA 4HW7A 2IG7A 4L3LA 1QL6A 2BAKA 5AUWA 2J6MA 3PSCA 4CRLA 1R39A 4YJNA 5HX6A 3K54A 1YWVA 5KHWA 4CFMA 3U8WA 3V8SA 5JFSA 1ZOEA 2W9ZB 1ZMUA 4PL4A 4KIOA 4BGHA 4WSYA 5EDRA 3KN5A 5FLFA 1W98A 1H1RA 3K3IA 2V0DA 4MV9A 5AA8A 2P2HA 1BNCA 3PVUA 1JNKA 2ZB0A 3R21A 4UZDA 4YLKA 1T46A 4BICA 5KMMA 3S00A 2YRXA 2RFSA 4JS8A 5DMXA 2PVNA 4TRLA 3OXZA 4QP2A 3O96A 3CXWA 4UX9A 5I9WA 4EK5A 3GOKA 4IWPA 4IMYA 3KXZA 3AW8A 3SOAA 5M4CA 3P5KA 4FV7A 4FTTA 1YW2A 3FI8A 3FZRA 2DIKA 2VD5A 4E6DA 3JY9A 2QOCA 2W4OA 1IA8A 3QF9A 2UVZA 4FKSA 1Q62A 3OCBA 4EBWA 4QQ5A 3P1AA 3QQJA 1WZYA 2BIYA 3MN3A 2VTLA 4N6ZA 4RG0A 2DWCA 1M2RA 2VWWA 4FTJA 4GYIA 5A4EA 3ITZA 4IB5A 4GFGA 4RIYA 1OKWA 5CAQA 3FMNA 4TV8F 2QI8A 2PZRA 3QD3A 4QMMA 3LCKA 4FSTA 1Z9XA 3THBA 3M42A 4PY1A 4GRBA 3T3VA 2I8CA 2QOBA 5E7RA 2CSNA 3QZGA 4ID7A 4NM0A 4NM5A 4IDTA 4RPVA 4YZ9A 4HNIA 4B6LA 4XP2A 4JAIA 2XKFA 5HESA 2VTQA 1Y91A 4DG0E 4FUXA 5IISA 5JRQA 3QQHA 3P4KA 2XBJA 5D7AA 2EB2A 4M68A 5A3XA 4RJ5A 3SE7A 4RJ8A 4RLKA 4AW2A 4FK3A 1NVSA 4BDAA 4AZVA 3OXTA 4Q5EA 3DAKA 3COIA 2ITOA 5DFPA 2RGPA 2PVLA 3AMYA 3U4UA 3JY0A 2BALA 3T3UA 2XYNA 2XM8A 4UXQA 4DG3E 3MIYA 3CQEA 2BDJA 4TPTA 2PUUA 4E20A 2WMRA 3UOKA 3DK7A 3A8WA 3W8QA 2XD4A 4Y8VB 4E8AA 2C47A 4CG9A 3QCQA 3ZTXA 4BY9E 2BTRA 3ET7A 4GVAA 5DT3A 2YCSA 3MB6A 3SV0A 4MWHA 3Q60A 1WMKA 4H39A 4L8MA 4UXLA 5EYCA 2W6OA 2FH9A 1XBAA 5TF9A 4ACMA 2BAJA 1VBGA 5IDNA 1K2PA 4I4FA 4WOVA 3TM0A 3TNHA 4CNHA 4RIOA 4BGGA 3R01A 4PNIA 2HZ4A 5AAFA 2BRNA 2AYPA 3PXFA 5AUZA 2B53A 3HEGA 3TUBA 3QTWA 1JVPP 4FIIA 4DN5A 4PDSA 3FKNA 3FSFA 4FSZA 4ACDA 2UW6A 4Y5QA 5M57A 5L6OA 4TN6A 5K9IA 2WTVA 4AU8A 4RVMA 5AFVA 3RAIA 4A9RA 1CMKE 3ZO1A 1J1BA 4YB8B 4L46A 4DGMA 3GCPA 3VS2A 4FV9A 3UDBA 3RK7A 5ANOA 3OWPA 5LA6F 2UW0A 3VW6A 1H28A 4ACGA 3EN9A 2XM9A 4G3GA 2C5NA 4ANBA 4W4WA 4AE9A 1OGUA 4LV8A 2OIQA 4L9IA 4XYLB 3PJ2A 3N6RA 1H1SA 3EN6A 2W1HA 3N4VA 4C02A 5CQUA 3G8DA 4AXAA 3PXRA 4LRJA 1CKJA 2AUHA 4GVJA 4BCIA 4JQ7A 5KNJA 4Y83A 3DS6A 4I41A 4F9WA 4H1JA 1ZWSA 4H3QA 1TQIA 5KMJA 1LUFA 4TNBA 4TYHA 1P4FA 2E9UA 5E8ZA 4TV9F 4WKQA 4I20A 5M4FA 3ZOSA 5CAPA 4M7IA 1OIYA 1SM2A 4IWDA 4EJNA 3MFTA 1SZMA 5LMBA 2W0JA 1IEPA 1NW1A 1Q8YA 3FSKA 4HZSA 2VTJA 4PDYA 4CQEA 3BBWA 3TT0A 4FEVA 3ZYAA 5J5SA 5EW9A 1XH4A 3FEGA 4TTHB 2E9OA 3MJ2A 5KKRB 1TKIA 1Z2PX 3EHAA 4QTCA 2WMQA 5AUTA 1EH4A 4I4EA 4YHTA 3UC4A 3UNKA 3EQCA 5AV1A 3MJ1A 4ZTNA 3U51A 1WBWA 1OECA 5HBEA 1R78A 5JGBA 4IHJF 2QKRA 2QOOA 2ZV2A 1KE6A 5JZNA 1B6RA 1GJOA 1KV2A 4G3EA 3H0ZA 3HA8A 2R3IA 4QMXA 1GZ8A 5CZIA 2IVSA 2Y6OA 1M7NA 1UKIA 5JEBA 2J90A 3W2SA 3NUYA 2XKEA 3ZH8A 4G6LA 4FIFA 3FMEA 4DTBA 1JLLB 1W8CA 4FI1A 4QMSA 4Z55A 3ATTA 1Z2NX 3MY1A 4YC6A 3RHKA 3VJOA 4AW5A 2WQOA 5M07A 5E8VA 4C4GA 5ETAA 4BZNA 1XH8A 4RSSA 2XK9A 4OLIA 3HV4A 3BKBA 3TW6A 4WBNF 3QQUA 2F4JA 5C8NA 1NXKA 2WEIA 3H9OA 4UALA 1Y8YA 2QURA 4WUAA 4JDHA 1NVRA 4RA5A 4WRSA 3WYXA 4HNTA 3AMAA 1IR3A 4X21A 3NW7A 3W2OA 3EYHA 5C27A 2I40A 3HLLA 4FKGA 3GGFA 2VWYA 4U80A 1U5RA 3BYSA 3P79A 5LQFA 3CCNA 2OZAB 1PJKA 5DNRA 1QMZA 1YOMA 3FPQA 2XMYA 3LIJA 3A60A 5BUIA 4D1XA 1REKA 1WVXA 4YZBA 3ROYA 4PL5A 3TKHA 3TV7A 5M55A 4DT8A 1PXJA 2EWAA 1EZ1A 3CY3A 3D5XA 4B0GA 4Q2AA 4FNXA 4MQ2A 3D7TB 1Q41A 3VAPA 3OEZA 2UW4A 3HA6A 3BQRA 3IGOA 4D0XA 2R7NA 2BFXA 5AMNA 3ACKA 2WQNA 3R1NA 4FIJA 4HCTA 4YJRA 2XB7A 4FMQA 5FDPA 3NYOA 2C6LA 4O6LA 3RPRA 3ORRA 3FPMA 4MD7E 3TCPA 3RP9A 5K5XA 4E6AA 1GIIA 3UIXA 5CVHA 2CHLA 3IW6A 4KKHA 2ZM4A 4UYNA 3DF7A 1PMEA 3P9JA 4J8MA 5ANJA 2XNMA 2XCHA 3MPMA 4JRVA 2R3JA 3MH1A 3V5JA 2ZB1A 4DFNA 2R3NA 2QODA 5HO8A 5TOZA 4EH9A 3Q4CA 3KXMA 4XV3A 3MH2A 4ZTQA 2W9FB 4MVFA 5AUYA 2XCKA 1DI8A 2BR1A 3UVQA 2GS7A 3U55A 3SW7A 1I44A 1HCLA 4IVCA 5EDQA 5CU2A 4TWNA 5I4NA 2WGJA 4J98A 4QMNA 3E5NA 4ZHQF 4ZLZA 3MSSA 2X7FA 3ALOA 2DS1A 4GKHA 3RI1A 2R3GA 4F0IA 5EKOA 4A4LA 1GGOA 4YU2A 4MD9E 2PVKA 4JG6A 2BZKB 4RT7A 3F2RA 4EONA 4J99A 4HYUA 3ZSGA 5IA1A 4E93A 4CFNA 4EORA 5CYIA 4NCTA 2OXDA 4YLLA 1ERKA 4HVGA 4E4TA 1KJIA 3UFXB 2OU7A 5TT7A 4FL3A 5BQ0A 4FYOA 4LYNA 4FK6A 3L8XA 1SNXA 2WELA 3FQEA 1AGWA 2WMSA 4YJTA 3MVHA 3HAMA 3IKAA 2OI4X 4II5A 4HNFA 1GLVA 5IQGA 4F09A 3PIYA 2KTYA 3BHHA 4TZRA 5EKNA 1CKPA 3LM0A 2XBAA 4IIRA 4NYEA 1G5SA 2W6NA 4FG7A 2BHEA 2HZIA 4FSRA 2R3RA 2C4GA 2NRUA 4IAAA 4DHFA 3KB7A 3JVSA 4OT6A 2JGZA 4UWBA 5HEZA 3QUEA 2GQSA 4OR5A 2X6DA 3CC6A 2X0GA 3A7FA 1GIHA 2W1CA 3MTFA 3OWKA 3ZXZA 4DEHA 1UA2A 4EHEA 3O51A 2QOQA 4G1WA 5LCJA 4U81A 4O7WA 3DNEA 4W4YA 1VBHA 3NUNA 5A54A 5K4IA 2X6EA 4O4JF 4O22A 4ONAA 3M11A 3R6XA 2LAVA 4BN1A 3PY1A 4FG8A 4FT3A 3DFCB 4GU6A 4WIHA 1YXUA 1DS5A 1R0PA 2ZJWA 3DKGA 5FUTA 5BMVF 4FVPA 3WOWA 2CNUA 4BDBA 3MH3A 4O7VA 4I55F 4DBNA 4U40A 4QP4A 5EYKA 3E92A 3VRZA 3HGKA 4YTIA 4FNWA 1Q61A 1GAGA 1XBBA 2RF9A 3HVCA 3NGAA 3ALNA 4R3RA 4XJ0A 4YZNA 3NNUA 3O17A 2X8EA 4K1BA 4YHJA 2UUEA 1W96A 3IG7A 1XH6A 4KUJA 3R7VA 4YNEA 3SG9A 3OUZA 4D4YA 2WQBA 1AD5A 1YQJA 2YJRA 4TYGA 4FV5A 2CPKE 3BE9A 1V0BA 3HUBA 4ZIMA 3RUPA 5A9UA 4PTGA 2F2CB 2GDOA 4S32A 4I4TF 2REIA 4M15A 3A7IA 3VVHA 4X2GA 5BUEA 3TN8A 2ETKA 3PXYA 3MFSA 4JBVA 3A7GA 4W8DA 3RWPA 3DXNA 2ITZA 2LGCA 3KREA 4DFLA 4LMUA 5KKRC 1IA9A 1RDQE 4F1OA 3TNQB 3NYXA 5IPJA 3BGPA 5AV3A 1Y57A 2JKKA 2JDRA 2YS7A 4L3PA 4TW9A 3MWDA 1PXOA 5HIDA 4ANMA 5HE1A 3MWUA 5DBXA 3EFLA 4IZYA 3IK3A 5FQDC 3RM6A 1Q3WA 3A7HA 3TWJA 1YWNA 5EI8A 5KBRA 3EQPA 3Q1KA 4I5CA 1H01A 2O65A 3F5GA 4XV9A 3T9IA 4EQCA 4ERKA 4EGQA 5FXQA 4O4HF 4RMZA 3Q9WA 3E93A 3OY3A 5LMKA 1PXKA 4M97A 4RWLA 4Y46A 3M1SA 2X9FA 5D9HA 4OTQA 4FKJA 3JZIA 2ONLA 3CKXA 3FKLA 3PFQA 3OWLA 1W0XC 5IF1A 3UIUA 3DK6A 4XV2A 4EOKA 2Z7QA 5BPYA 5CNNA 1E1VA 3KXHA 4LRKA 4PTEA 4X0MA 4AWIA 3RV3A 3R8MA 3I7CA 3UZTA 3HECA 2VWBA 4XUFA 3KRLA 4CMUA 4HCUA 1Y6BA 3K5IA 3C4WA 1PXLA 4K18A 2UZWE 4DGGA 1ZY5A 2C6MA 1RW8A 2VTTA 3NLBA 4GIIA 4I21A 3N9XA 4C37A 4C58A 4XZ3B 3VMMA 4IACA 4IAYA 4YZCA 3FDNA 2VX0A 4UYAA 4CG8A 3FYKX 4USDA 2GFSA 4V0GB 3FLQA 2OO8X 5HNIX 3AD6A 3JS2A 4ZXTA 4KABA 3BYVA 3WZKA 4QO9A 1DV2A 1M6VA 5JFXA 2H8HA 1JDBB 3OHTA 4FGRA 1KUTA 5D12A 4ZY6A 2V55A 2HZ0A 3POZA 3PRFA 4G3DA 4AN9A 5CAOA 5K4JA 3ACJA 3DLZA 3PA5A 4NCTC 4TWCA 4EH5A 2XJ0A 5GINE 4O0UA 2W71A 4LMNA 3CJGA 1XH9A 3W2PA 3ZRMA 2W6QA 2BKZA 5E9EA 2XRUA 4AGUA 5BMMA 3UG2A 1J7LA 3MY0A 3UYTA 3FI4A 1LPUA 2HXQA 1VYWA 4O7TA 4RQVA 4F1MA 5C4KA 5LXMA 3E88A 5DHJA 3T8OA 1WVYA 2FSOX 2QD9A 2XNBA 3NIZA 4BC6A 4DT9A 5J1WA 3KMMA 4P4CA 4RX9A 2VO6A 5EDPA 2YA9A 1OUYA 5KE0A 4RX7A 5EHOA 5DR2A 5EM7A 4JI9A 3ZS5A 4KRDA 4CV8A 3VA7A 4GW8A 3DXQA 4OTRA 4XG6A 5AP6A 5ETFA 4BDEA 3QYWA 2VWIA 3C1XA 4GKIA 3ZHPC 4GH2A 2QG5A 4IQ6A 1JKSA 1Q8WA 3LCOA 3ZXTA 4CV9A 5H2UA 1OL7A 4ZOLF 3VF8A 3BGQA 3IW8A 5D1JA 1M0WA 3IDCA 3R1SA 2GNLA 3C5IA 3R2YA 1PW2A 3GQLA 4FTAA 5F1ZA 4N70A 4PNKA 4DAWA 3FQHA 4C4IA 2GHGA 4G3CA 2P3GX 5CXHA 2RG6A 3CJFA 5IU2A 3EFWA 3ORMA 3LFEA 2XEZA 4IAIA 3DKOA 4G2FA 4IBMA 3ZFXA 4BTMA 4C35A 4CTBA 3WI6A 5G1XA 1VZOA 2R3PA 2UZBA 2GFCA 4CGAA 5JSMA 2GPWA 3UVRA 2G9XA 3ZM4A 2YAAA 3TINA 2OW3A 4I24A 4NH1A 4RVLA 5B0XA 1FVRA 4EH2A 3G6GA 3QQLA 3R9HA 4FYNA 4A7CA 3ZUVA 4P2KA 3C7QA 5HCZA 3HV3A 5DVRA 4I50F 3RALA 1XR1A 1H1QA 3SRVA 4PP7A 2YIQA 4USFA 4JDJA 5CF6A 1KWPA 3WE4A 3G9LX 4O7YA 4ZJVA 2W6PA 2OH4A 3FLYA 3VS6A 5KMOA 1M2QA 4WD5A 5CNOA 4DH3A 3COMA 1U54A 3HMIA 3LZBA 1FOTA 3PYYA 4RA4A 1DIKA 1G8SA 3R1YA 4M69B 5JGDA 4BCGA 4FKQA 3D7ZA 3FUPA 3U9SA 2OJJA 5J9ZA 2YERA 2WO6A 3E7VA 4RIWA 3K5VA 4C5CA 4E5AX 5GONF 3B8RA 5AP0A 3OMVA 3A2CA 3FXZA 4CFVA 3QU0A 4LV5A 4FTNA 5AV4A 4ZQIA 2R5TA 3ENMA 5IA3A 5J2TF 1KSWA 4RIXA 5DN3A 4YJOA 5A6OA 4F9CA 1Z2OX 4EHVA 4MNFA 2W06A 5BYLA 2R7IA 2XVDA 3BI6A 5ITAA 3A4PA 2JAMA 4K33A 4DFXE 2XK8A 4DIMA 3D0EA 4I3ZA 4F70A 3NNVA 4RWJA 4FFPA 4XBUA 3UZRA 3QCYA 3HBLA 3DV3A 5T6KA 2X7GA 2UW8A 2P0CA 3PJ1A 3QL8A 1T45A 4S2ZA 2PPQA 5DR6A 3VBTA 4D2RA 5BVDA 3OROA 3KF7A 3C9WA 4FIEA 3I4BA 5GNKA 5BYZA 4EYJA 1B6SA 3OP5A 4LUDA 4DEBA 4CD0A 1EUCB 5CT7A 4AZWA 4PMMA 4AAAA 2Q0NA 2OJFE 3O71A 5HU3A 5CEPA 4QMUA 5CANA 4F6WA 2RL5A 4KRCA 2RG5A 1URCA 3DDPA 3FV8A 4R3PA 3FXWA 3DJ7A 4FX3A 4O0RA 4WO5A 4C62A 2F7XE 5IQBA 2OXXA 4XRLA 5H8GA 3FZTA 3TKIA 2R82A 3ZUTA 2I80A 2X8IA 5IQIA 2A2AA 5HU9A 3TDWA 2JDOA 1Q8ZA 3HX4A 4OBOA 5K3YA 5H3QA 3S3IA 3VS4A 4U43A 2C6TA 1OL5A 2VO3A 3NUXA 4YAKB 4Q5HA 5EYDA 4LM5A 3U6IA 2GS2A 4IWOA 2HY81 3K3JA 3OTVA 4O0XA 3AC1A 3FC1X 2OFUA 5HCXA 3VHKA 4OTFA 4ZY4A 3ANQA 1GSAA 4B4LA 3B8QA 4BDHA 3F88A 4MHAA 5CX9A 3V5TA 4C2VA 3DZOA 2HELA 3CP9A 3KCFA 3UQFA 5HE2A 1SVGA 3A99A 3JRXA 1IASA 5FEEA 1BXRA 5CEKA 1OKZA 1V1KA 2W96B 4FICA 4FSYA 3QRJA 2Y8OA 5BVFA 2JIVA 2R2PA 2G15A 4QP7A 3F3VA 4F08A 4MXZA 5HV6A 4X3FA 4FT9A 2J0IA 2QOHA 1F5QA 3QLFA 4MD8E 5K5NA 1JBPE 3GBZA 3ORNA 3PJCA 3QC4A 2XIXA 4I92A 5IEYA 2QLUA 3QAME 4O7ZA 2A1AB 2VWVA 3FHRA 2B9JA 3MESA 4FKTA 3HRFA 5JK3A 2J4ZA 5LVNA 3W2QA 5FP5A 4BDIA 4MXXA 3V5WA 4FUYA 3C50A 2BUJA 1O6YA 2W7XA 4DTKA 4M14A 3PXKA 1KE5A 1P2AA 3P0MA 3PZHA 1IAJA 3NUUA 3WZUA 3VS7A 2GTMA 4AP7A 4W8EA 4FTLA 4BBMA 1NA7A 4MV4A 4O38A 4WG5A 4AX8A 4FEXA 4IVAA 2X2MA 2OK1A 3TZ7A 3V5LA 3VF9A 4BHNA 2RFEA 3OY1A 1TVOA 2BFYA 4OTIA 4AF3A 3H30A 5ANEA 4IB0A 2ESMA 2UW5A 2VR1A 2R7BA 3BV3A 2BRGA 2WTDA 1Q97A 4O2PA 3UBDA 2J2IB 2XIRA 3LAUA 2HW7A 4F0FA 4N0SA 5CAVA 4S34A 3WF8A 5L2TA 4L42A 4QYGA 2HK5A 3WARA 3VC4A 3QXPA 5ANKA 4L53A 2FPGB 4U97A 1DAWA 2V7AA 3LMIA 2WOTA 4O0SA 4YZDA 4E4NA 3NWWA 4QP3A 4WG4A 4RIYB 3MV5A 5KMNA 2C6IA 4ARKA 2IW6A 3WNZA 3UOHA 2PE2A 4YBJA 3GU5A 4WA9A 5EG3A 2WYOA 5DWRA 3KF4A 5EOBA 3PLSA 5M51A 3QA8A 3AC5A 3PUPA 3A62A 3SG8A 3R0TA 1FGKA 3IQ7A 4M13A 3ZCLA 5H80A 2QCSA 2ITWA 1GSHA 4HGTA 5AP4A 2YWVA 3EFKA 1CQIB 4BZDA 1U5QA 2G1TA 2VTNA 3NNWA 2FUMA 4ASEA 4DH5A 2B9IA 4E5BA 2J0MB 3BCEA 1WAKA 2C3JA 2VRXA 2YACA 4G3FA 4OW8A 4CCBA 2PY3A 3CPCA 3RKBA 5LXTF 2ZAZA 4C4FA 3R7OA 4QYFA 4C61A 1QPJA 4I23A 5HLPA 1Q8UA 3DT1A 2X2KA 3SGCA 3F3ZA 4EBVA 5E91A 3QWKA 4HCVA 2ITXA 4MXYA 2PE1A 4EGJA 3GUBA 5CALA 1Z5MA 3FLNC 4MXAA 4J71A 4O0WA 2P55A 2J9MA 3LE6A 5JRSA 2VUWA 5L8KA 2UZNA 2I0HA 3R63A 3GCSA 3LFDA 3Q5ZA 4DGNA 5I9XA 1GZOA 1LR4A 4I0RA 4QNYA 5FM3A 4AW0A 2SCUB 1KOBA 3CEKA 4UV0A 2E9VA 4EHZA 1J3HA 2W1IA 2OJ9A 4C0TA 5F20A 1FPUA 2R3QA 4M84A 3W18A 2Z02A 4EH6A 2G2FA 5ETIA 1WR2A 4O83A 2PVYA 2J0KA 3BPRA 4EOLA 1A06A 3TUCA 2ETRA 3RJCA 3HV7A 5M4UA 5AP1A 4Y85A 2WMXA 5J95A 5D11A 4DTAA 1ZY4A 4OTWA 5JGAA 3ODYX 5ETCA 2XYUA 2QQ7A 2ZV8A 3E8NA 3F5XA 4P7EA 3LMGA 4L45A 4XG3A 2BRHA 2KULA 2B54A 3L8SA 3WIKA 4CKIA 3VNTA 3D94A 3R8LA 4BCJA 5FTGA 4BI2A 4BIDA 4NJ3A 3FY2A 5CQWA 3GENA 5AIKA 1J7IA 2ZMCA 4GL9A 3V4ZA 3QGYA 3G90X 4CSVA 5FNVF 1GIJA 5BNJA 2XK7A 1UU3A 5HTBA 4L6QA 4PRJA 2QKWB 3NW5A 3PVBA 1XJDA 4RJ4A 4WBBB 5ANIA 1BL7A 2YAKA 3UOLA 2WMBA 1URWA 3EOCA 4P5QA 4D28A 5IG1A 4F7SA 4MV7A 4JG8A 3TI1A 4LRMA 4I6BA 2DZDA 2JIUA 4TYHB 3KXGA 2J50A 4JBOA 2YM3A 4L67A 2OZOA 4C7TA 2X81A 3R9DA 3JVRA 3ODZX 4L52A 3R22A 3LCDA 4FC0A 5EI6A 3ZM9A 3NUPA 2W4KA 1H00A 2UZUE 4ZZOA 3ETAA 4WNKA 4QPSA 1ZARA 4BVUA 1W93A 3WZJA 3DCVA 4ACCA 4IH8A 2Z7RA 4RJ7A 3MFUA 3TNWA 2PU8A 1OUKA 4QP1A 1W83A 4IX6A 4K77A 4R5SA 1TQPA 3Q2OA 4HVSA 4LL5A 1LP4A 3DBQA 3V01A 3BBTB 4MV3A 2CJMA 2PZYA 4O0TA 2PTKA 3UMWA 5CAUA 1EHIA 3OCSA 2FP4B 4OTGA 2UVYA 3QKKA 4S33A 3ZSHA 3CIKA 4EUUA 5DPVA 4OTDA 4YTFA 4JR7A 5IA2A 3S4QA 3W16A 4B8MA 1OVEA 2IWIA 4NZWB 3VBWA 5HQ0A 1JQHA 2R3OA 1NVQA 3GB2A 3QKMA 2PVPA 2W70A 3NIEA 3DOGA 4IB3A 3R5HA 1H1PA 1UVRA 3P7CA 3OZ6A 3R7YA 3OT3A 3LJ0A 2BTSA 3ORTA 4PX6A 1J91A 5EOLA 2ZM1A 4ASZA 4ZSAA 2GHLA 4J7BA 4BR3A 5LCKA 2HYYA 4CFUA 4L7SA 3DGKA 3KULA 3QD0A 3BHYA 4E4LA 4O2BF 3TZMA 3NS9A 2R85A 5CSWA 3KRRA 1H07A 2YEXA 2YZAA 1SNUA 4E73A 2YW2A 3QCXA 1PF8A 3M2WA 4GK4A 3O50A 3W55A 3QGWA 4I5MA 4P5ZA 4BBFA 5BX0A 3FI2A 3GFWA 4HGLA 4RWIA 1WBPA 4AGDA 4EWHA 1KV1A 2F2UA 2WKMA 3MPAA 3DB6A 3F2AA 4USEA 2CKPA 5L8JA 3SKCA 3UO4A 2OFVA 2J5EA 3A61A 4JVGA 4FV2A 3W33A 3U54A 3UP2A 2ITYA 3COHA 4AOIA 4BZOA 2F7EE 3UQCA 3HDMA 4A9SA 4U0IA 3PE2A 5CSHA 4PF4A 4BI0A 3ZEWA 4EH7A 3ID6C 5CTPA 4FVQA 4IZOA 5D41A 4R7IA 1IOWA 4RLLA 4E5WA 1YI6A 1OL6A 4IANA 5BVWA 2ERKA 4NUSA 4QQCA 2VWUA 3FQSA 5L2WA 4HVIA 2PHKA 3LFFA 2HXLA 1NY3A 3MYGA 4G17A 4O2ZA 2PUNA 2UZOA 4FKOA 3QUDA 2FVDA 4JQ8A 3G8CA 1UWJA 2X4ZA 3OG7A 4EKLA 2FSLX 4FSUA 4E4MA 1YHVA 3VW8A 3ZO2A 3TIZA 5AX3A 2PVRA 5LJJA 4IJPA 2AC3A 4D2SA 4FOCA 3FC2A 3C0HA 1CDKA 2B55A 1M14A 5JQ5A 1OPLA 2W1ZA 5G6VA 4AE6A 1JKJB 3E5AA 3ORXA 2Q83A 4IAFA 3GXLA 5DE2A 4BCFA 3MJFA 4X2FA 4YPSA 3NRMA 5E1SA 2Z60A 4QYEA 4W4VA 3D2KA 3HMMA 4QTBA 2XK3A 3NEWA 4FFOA 4F1TA 3I1AA 2X39A 3EQIA 4U5JA 4FTRA 5KMKA 5FXSA 5DT4A 5CXZA 3R5FA 3NMUF 2PZIA 3RAKA 1U46A 5HVYA 4XLIA 5KCVA 3HRBA 3NSZA 5T68A 3BX5A 1ZZLA 3F7WA 4UY9A 1PYXA 4JNWA 3U6JA 2IP4A 3DBFA 2X4FA 3D5VA 2WPAA 3TEIA 4EYMA 2A0CX 2YM7A 4RC4A 5AUUA 3KAKA 2WTJA 2Y7JA 4I22A 4C3PA 4K2RA 4KBAA 3LP8A 3ERKA 3FL5A 4RX5A 5CU4A 5HE3A 2YZGA 4IFGA 4YUQA 4IIJF 1Q24A 3PA4A 4FKVA 2PN1A 1YOLA 3TG1A 3U9TA 4XG2A 2WNTA 3GC9A 3EZVA 2VGPA 4U42A 3D83A 3DBEA 5DEYA 3E87A 2ZDQA 4J97A 5A14A 2R7MA 4XBRA 5AV0A 3MFRA 3GIDA 4G5JA 3D15A 3R04A 4GS6A 2XS0A 3KU2A 2O63A 2R3FA 3F3WA 1PMUA 3GVUA 5HNGA 3ZZEA 3G2FA 2UW7A 5HE0A 3RM7A 1HCKA 2ITVA 2B7AA 2JIIA 3R9OA 1E4EA 3IDPA 3F5PA 4RC2A 3PJ8A 5A6NA 2Y4IB 1A48A 5AJQA 4AGCA 1YKRA 2XUUA 2B9HA 2Z7SA 4EQUA 3BZ3A 3D4QA 2C5OA 4FL1A 3UC3A 3HP2A 3VULA 3UOJA 1M17A 3FKOA 2JBOA 3ATSA 4ZY5A 5KX8A 3QBNA 1AUVA 2VTAA 2EU9A 3R9NA 1ZMVA 5AUVA 4GK3A 3OTUA 1CS0A 3R83A 1WBOA 5E92A 4EH3A 3BHTA 4AACA 5HG8A 3LFAA 4DE4A 3R8ZA 1AQ1A 2A19B 3FLWA 4RJ6A 1PKGA 4CMOA 1I7LA 2EXMA 3KAJA 4XOYA 1PRYA 3U4WA 2JKMA 3OC1A 4L00A 4L44A 4N4SA 4EI4A 1F3MC 4H3BA 4I6QA 4IM3A 4A9UA 3PP0A 4EZ5A 4CRSA 1GNGA 2YIWA 5L6PA 4ZMFA 1EYZA 4X6RA 3I0QA 5CA0F 4UZHA 3BYUA 4LQMA 2G2IA 3Q6UA 3RINA 2J0LA 3V04A 3OFMA 4FV1A 3F3TA 1J7UA 5F4NA 5CU6A 4MV6A 2C69A 3JZFA 2VPQA 4M12A 4CKJA 2YM6A 1KE9A 4E26A 3QYZA 5CENA 5TKDA 2UZTA 3R7IA 1BLXA 4D4SA 4GMYA 4OTHA 4UWYA 4GEOA 3RCDA 1R1WA 1UU7A 4IDVA 4YSMA 3DJ5A 2HENA 2PK9A 3C4XA 3L8VA 5DA3A 3OCTA 2WMVA 4IX3A 4O0YA 1YHSA 4O82A 4UB7A 4ZOGA 1G8AA 3MTLA 2YDJA 2BAQA 3DK3A 3GP0A 2BZJA 3BLQA 4IVDA 3OBJA 3HMOA 4C34A 4J8NA 2V59A 2WEVA 4G5PA 5C8YF 2C00A 2GQGA 3QQFA 4A07A 1RE8A 2EUFB 4U3ZA 2NU6B 1PXIA 3UPZA 1Q99A 1VEBA 4HZRA 4Y72A 2GTNA 3P86A 4QOXA 1OPKA 5E4HA 2W1DA 5LVOA 3LW0A 4NU1A 4FZ7A 5C03A 3AX6A 4M9UA 2E2BA 3OT8A 1C30A 3I5ZA 2WMTA 4BCKA 2NU9B 3FI3A 4FEWA 4DEDA 3AD5A 4QTAA 3DA6A 5FEQA 3LJ1A 3RV4A 1REJA 5JH6A 3MH0A 4JLCA 3A4OX 5ICPA 5IMEA 4FV6A 2W6MA 5BPFA 2QOIA 4BTFA 2OLSA 5DEWA 1JSTA 5BMSA 4JX7A 3E7OA 2W5AA 3AC8A 5CVGA 1OIQA 2XNEA 5L2SA 2WQMA 4UBAA 2X9EA 3R28A 4XG8A 4E6QA 2JEDA 3D14A 4IZ7A 1MQBA 5IUIA 4NW6A 3GI3A 2OIDA 3LCSA 5AM6A 1YI4A 3LXNA 3P7BA 4FTUA 4TXCA 4ANSA 4NW5A 5HLNA 5C1PA 4TWOA 4JBQA 5HNBA 3V5QA 2IZRA 1QPCA 3GCVA 4ENXA 1S9JA 1YXSA 4V01A 4FZAB 3IONA 4LUEA 3UNJA 1B38A 4DLKA 4EQMA 4YTCA 5JFVA 5FD2A 4WNPA 5EHLA 2I87A 4OUCA 1Q4LA 4BDKA 3II5A 3N51A 1KJJA 4MXCA 2OKRA 3S2PA 3E8CA 4AZFA 3A8XA 4K11A 4XH6A 4RZQA 5IQEA 3EL8A 1K9AA 3EQGA 2DLNA 4C5AA 1YRPA 5IH4A 3D2IA 2W05A 4FT0A 4O84A 5IEVA 4GV1A 4MEDA 4X7QA 2W99B 4BCPA 3QTIA 1YXVA 2VTOA 4DGOA 4DYMA 4MNEA 5J8IA 2G01A 4M0YA 2QLQA 2XKCA 3A7JA 1PXPA 4MWIA 5FTQA 1PXNA 3D5UA 3MVJA 4BDGA 5CAEB 3CE3A 5C8MA 4UN0C 1JWHA 3SA0A 2XIZA 4GUEA 4H1MA 3BV2A 4MA5A 1SVHA 2V5AA 3IECA 5EFQA 4ZSEA 2G2HA 1XO2B 3BYMA 3DNDA 4DCEA 4CMTA 1YI3A 4ZSJA 3P7AA 2P33A 3ANRA 1S9IA 5CEOA 4ALWA 3OUNB 3C13A 3UVPA 5JT2A 2PMIA 5GJFA 5HBJA 4RFMA 1Y6AA 3WO0A 3FWQA 5I9VA 3QHWA 4JXFA 4FV0A 3DY7A 3GCUA 4QMOA 1H27A 4EK8A 3MGYA 2OSCA 1ZYDA 2RFNA 3AC4A 2YM8A 3CQWA 4AT4A 3PPJA 1JKKA 1PKDA 3E63A 4YC8A 1CE8A 1SCUB 1UU9A 3UTOA 5GHVA 3VS3A 3ZO3A 3L9NA 4FNZA 3FMJA 2V5QA 4BBEA 3PA3A 3KRWA 3UP7A 5DG5A 3SRVB 1BL6A 3TJCA 2PWLA 4YJ2F 3QRTA 3PE1A 2WXVA 4AA4A 3O8UA 2YS6A 2QF7A 4LG4A 5A4TA 1H26A 2B4SB 3Q6WA 2VTMA 4BCQA 5HX8A 4JAJA 1P5EA 3QXOA 1U54B 3DAJA 1Z57A 1XHAA 3KEXA 2JDVA 3IW5A 1JSUA 3DB8A 3EIDA 5DRBA 1KBLA 3ZONA 2XZSA 4Z3VA 1R3CA 4MBLA 4XG4A 1DI9A 4RIWB 4L1KA 2C5YA 4BDDA 4D0WA 2J7TA 1B6CB 4TYIA 2C30A 3GU4A 5EM5A 3EN5A 2V7OA 3Q4UA 2Y4IC 2J9GA 4KWPA 5I9UA 3LXKA 4RIXB 2GNFA 2ZV9A 2NP8A 4BCOA 2ACXA 1B39A 4H3PA 5E1EA 2QG7A 1ZMWA 2GNIA 3OUKA 4BIEA 3ORIA 2C0TA 3L9LA 4AOJA 4EOPA 5IQDA 2J51A 4XHKB 4R3CA 3W10A 2Z2WA 4YHFA 4CVAA 1H24A 4D9TA 2BKKA 3GCQA 3O0GA 3PXQA 2BZIB 4FSWA 4IZAA 2VTHA 4TL0A 5AP3A 5CF8A 4PWNA 2OGVA 2BRMA 4KD1A 3Q9XA 3V5PA 4JL9A 3Q9ZA 5EI2A 3GC0A 4OGRA 2PZPA 3P78A 3VQHA 4CZUA 4FT7A 3DQWA 4W4XA 4GK2A 3TIYA 3MBLA 1G3NA 4YP8A 3VS1A 5L3AA 3HV5A 1CKIA 1H25A 3PLAE 4FODA 4XG7A 4HYSA 4MYGA 5CSXA 3ZRKA 1GSOA 3FBVA 2YYAA 2XNNA 4O6EA 3TACA 3AQVA 5HHWA 1UU8A 4YO6A 2RKUA 2IPXA 5LARA 4J52A 1CM8A 4IB1A 4BIBA 3JYAA 4WNOA 1XQZA 2IN6A 2B9FA 2BVAA 3CBLA 5HCYA 4ZLYA 4APPA 2JLDA 3QTSA 1V0OA 3QRIA 1QPDA 4F7JA 3KN6A 4C4HA 2QR7A 3BLHA 5LMKC 3O8TA 5FXRA 1ND4A 2YIRA 4K6ZA 3KQ7A 4RRVA 4ZMEA 4QSHA 4NFNA 4AN3A 5FM2A 2ONLC 2IZSA 3LPBA 4O4IF 4ENYA 3Q5IA 3EFJA 4LOOA 3H0YA 3F2NA 4IHPA 4MH7A 4KKEA 4RVKA 4IM0A 5CI7A 4AA5A 4AFEA 4S31A 3VBVA 2F49A 2J0JA 2ZDTA 4QTDA 5E8TA 3UODA 2WTKB 3CGFA 4O91A 2C6OA 2DYLA 2QO2A 4X3JA 1Y8GA 4XEYA 5HZNA 4FKLA 1C3OA 4H36A 4HGSA 5LP6F 3CTHA 4NL0A 4FR4A 4X3FB 3GOPA 2H6DA 2UW3A 4WRGA 2C1BA 2QONA 4HQ6A 4ZZMA 4DA5A 5DIAA 3R00A 4EOSA 2CCHA 4FOBA 5JZJA 3QTXA 4DH7A 1CSNA 1UKHA 3PIXA 5JVLA 5CLPA 3KY2A 4UWCA 4F0GA 3RTPA 4B99A 3GQIA 5DH3A 1DV1A 3NDMA 1OKYA 2VGOA 4C3FA 3B2TA 4QMWA 2UZEA 1KJ8A 2PMNX 1ZOGA 2ZDUA 3DZQA 3W2RA 2C1AA 2C3IB 4KS7A 3K5HA 1JKLA 2YN8A 3VHEA 3DTCA 3C4CA 3FMDA 3I6UA 4DLJA 3G0EA 2GPSA 4CT2A 1GY3A 4DH8A 3NYNA 4U45A 4HGEA 4EK3A 2WTWA 5LOVF 4NM7A 2W1GA 4D5KA 4HPUE 3FZ1A 5A4LA 4OT5A 4AFJA 3EMGA 4U7ZA 5DGZA 3RPOA 3VOTA 4KKGA 3BWFA 3NCGA 3I6WA 1BI8A 2JFMA 3SHEA 3QA0A 3GC7A 4O2AF 2QVSE 3QCSA 3BYOA 4GJ3A 5KZ0A 1KEEA 3Q53A 5B2LA 2UW9A 4S30A 2FB8A 5FTOA 2FA2A 4JIAA 4CT1A 2FYSA 4ZK5A 5C1OA 4BYIA 4BRXA 4BDFA 4NM3A 4DG2E 3LLTA 4ORKA 4MF1A 3KALA 1JLUE 3OOGA 3C51A 4PDPA 4QMZA 4ZI7F 3LQ5A 4QMYA 4XYMB 3NCZA 5J87A 3R02A 3GU6A 2IZUA 5CT0A 4HR7A 4C4EA 4JDIA 5KX5F 2BCJA 5IA5A 4DFYA 1W82A 2IVTA 2E9NA 2QOKA 3Q4ZA 3QZFA 4GUBA 2HIWA 3IW7A 3KC3A 2GCDA 3WF7A 5DT0A 4J96A 4U44A 3VO3A 2XA4A 2ZV7A 3PXZA 3QTZA 2VWZA 4HYIA 2CDZA 4ITIA 3BG5A 4F4PA 3WF9A 2A27A 2C0IA 2FGIA 4QMVA 3VS5A 5L2IA 3UMXA 1YVJA 3PIZA 3V51A 2VV9A 4F6SA 3HAVA 4RBLA 3RPVA 2C6KA 4GFOA 5E8XA 2PBZA 5EQEA 4ZSLA 4I1ZA 3EQFA 3QTQA 3U9NA 3HZTA 2CNQA 3DBCA 3LFNA 3V6RA 4DFUA 4XP0A 4MKCA 4R7HA 4EWQA 1DM2A 3EL7A 4FFMA 5EZYF 1YDTE 4B7TA 4C5BA 2CN8A 4IX5A 3Q32A 4V05A 4EOIA 2UZLA 4QTEA 4HVHA 4KBKA 5EQYA 3KKVA 1BYGA 2OG8A 1P14A 2O5KA 3H9RA 3DFAA 4EOOA 1ZAOA 4KINA 4BTKA 4BCNA 4U8ZA 3Q2MA 5CF5A 4ZS0A 3OCGA 5JH7F 1MP8A 2VTIA 3MA6A 3WO1A 4JJRA 3CPBA 4XS2A 4F9YA 2OWBA 4DGLC 5AM7A 2HZNA 5M56A 2F7ZE 5HICA 1OZ1A 5IQAA 3NZ0A 5EM6A 3NAYA 2B1PA 5HD4A 1KJQA 1EUDB 4D5HA 4ERWA 5FDXA 2QC6A 3REPA 2XIKA 4GYGA 4DEIA 3ORKA 1SYKA 5AP7A 3KGAA 4RWKA 4RZVA 3ORLA 2C3KA 1RQQA 5A4CA 4XCUA 3RPYA 4P90A 3VUHA 3QTUA 2FSMX 3MW1A 3G6HA 4MX9A 3FY0A 4FBXA 4C33A 4RFYA 3O2MA 4U9AA 2DQ7X 1JSVA 3C0GA 4ZAUA 5EYMA 1UNGA 3ZSIA 5AP5A 2FPPB 3R8PA 3UIBA 4YC3A 4YJUA 3WYYA 4XX9A 2YL2A 4BCMA 5CASA 2YZLA 4L3JA 3TIIA 4AG8A 4Z9LA 1ZYCA 4R77A 5JN2A 2XK6A 4EZ7A 2B52A 1H08A 3GU8A 2J5FA 2XH5A 3K2LA 3VBYA 3QRKA 3F69A 2R3LA 4KSQA 3MVLA 4G16A 4CXAA 4EH4A 1YOJA 5HVKA 3NYVA 2GU8A 1PMNA 1OITA 2BRBA 2JKOA 2XNGA 4XNEA 1LEZA 3POOA 3HRCA 3V8TA 5F9EA 5CSPA 2I0YA 3WZDA 3W2CA 4MQ1A 4TY1A 1PMVA 5F94A 5JMSA 4YJSA 5BVOA 5EK7A 2XCLA 5CF4A 4NSTA 2PVMA 2BHHA 4PV0A 3IO7A 2XRWA 3OXIA 4O7NA 4ALUA 2W5HA 4K9YA 3HMNA 5CSVA 3VBQA 2O64A 4NIFB 2Q0BA 4MV1A 3GFEA 2PMLX 2HY0A 2CKOA 4GCJA 3QRUA 1LEWA 4A9TA 1X8BA 4M0ZA 4GG7A 4JQEA 3C0IA 3TJDA 2QR8A 2EB3A 4G6OA 4RFZA 3W1FA 3G33A 4YR8A 2WZJA 3LCTA 4BTJA 3SX9A 3W8LA 1FMKA 2YABA 4DFZE 1MRUA 3LQ3A 2Z7LA 2WTKC 4GFMA 4FA2A 3ZC5A 4R78A 3TV4A 4E1ZA 2NRYA 2Y0AA 3E64A 5M06A 3EYGA 2PZ5A 4F9AA 3PSBA 2XJ2A 3VBXA 3WIGA 4X3FC 2ITUA 2WMWA 2NPQA 2XIYA 3FMMA 2YM4A 5I9ZA 2YZNA 4FFNA 4L68A 5DRDA 3ELJA 3KULB 5AV2A 5IA0A 5HKMA 3SDJA 2YDIA 2O2UA 3TKUA 1BKXA 2Z8CA 3OOMA 2FSTX 2W1EA 2R7LA 2B0QA 4D1SA 5CEMA 3IDBA 2FB9A 2C5XA 3JR1A 5HO7A 2I0VA 3AT4A 4FIHA 4OBQA 2OICA 3N4UA 2RIOA 5AIRA 5A4QA 2W6ZA 3HB9A 4F7LA 3OWJA 1VYZA 4X2KA 3W32A 3PDTA 2BIKB 2V22A 4ASDA 4I5PA 2QHMA 5HBRB 2W17A 3COKA 5C4LA 3HYHA 3PSDA 3IPHA 3HL7A 1YXXA 4FT5A 3KCKA 3C4ZA 4FTMA 4NKAA 4ACHA 5IQFA 2NU7B 3CD8A 2R7KA 1QCFA 1BUHA 3LVPA 4MAOA 1WBTA 3EQDA 4YSJA 3UO6A 3TQTA 3GEQA 4MK0A 1FVTA 3UQGA 4DEEA 1YDSE 1O6KA 3OF0A 3ZFMA 4M3QA 4XG9A 1H0WA 5HVJA 1M52A 3EZRA 5JFWA 3K3PA 5HIEA 2C5VA 2P2IA 4AZTA 3SW4A 3TNPC 5FG8A 2IZTA 1SMHA 4O7SA
chains in the Genus database with same CATH superfamily
2NO3A 5JQGF 5HIBA 2OXYA 1QPEA 3PY3A 4FKUA 3RPSA 5I5UA 5KO1A 2GSFA 1L8TA 4C2WA 4FTQA 4I5HA 3HO8A 5CM0A 4CEGA 5M09A 4V04A 3VWAA 3GT8A 4F64A 2HCKA 1ZZ2A 2O8YA 3LLAA 4KBCA 4R5YA 3TDVA 4Q9ZA 2R64A 3UIMA 4EK4A 2XANA 2JDSA 3TTJA 4EL9A 4FGBA 2PE0A 3ENHA 4KSPA 4BDCA 3R73A 3ZDUA 2GNGA 3BHVA 5BVKA 5IQHA 4QPAA 2NU8B 3FE3A 3R8UA 3R8VA 3SD0A 3LFBA 3S1HA 1TQMA 2H96A 3WF6A 4IWXA 3NFGB 4NJDA 3O7LB 2I1MA 3PPZA 4MTAA 3KMWA 3SQQA 3E8EA 4KIPA 5B2KA 4YZMA 5FBNC 3S0OA 1PK8A 4KS8A 4XV1A 4FFLA 3LXPA 4IZ5A 4MXOA 3ZLXA 4TWPA 3RK9A 2ZDGA 3BHUA 3KA0A 3Q52A 3LMHA 4IWQA 1ZRZA 3VUIA 2YJSA 3N4TA 4TYEA 4HNUA 5IEXA 4EJ7A 3G0FA 3VUMA 1H0VA 3RWQA 4I6FA 4U79A 3I60A 4K0YA 4CZTA 4CC5A 4EEVA 3D5WA 1JKTA 4ZZNA 5J7HA 3HMPA 5BWUA 3OS3A 3DPKA 3CKWA 2VU3A 4JIKA 4QQTA 3Q96A 3H3CA 5CZHA 1UNHA 3MPTA 3LQ8A 3DXPA 3OEFX 3QD2B 2EXCX 3W0QA 3HDNA 3PWDA 4GIHA 3RCJA 2DWBA 1XKKA 4NK9A 3UJGA 4BYJA 3EQBA 3QALE 4XP3A 3QLGA 1A9XA 2HAKA 3QC9A 5DI1A 2HGSA 4RQKA 4CLIA 1W84A 5IDPA 1EKFA 2W4JA 4QQJA 5CY3A 2WOUA 3EN7A 5AEPA 4YPDA 5BYYA 5AADA 3E8DA 3B2WA 4O7RA 3NPCA 2X7OA 2JFLA 2W1FA 1Q5KA 3T9TA 3CQUA 4PP9A 2BZHB 3GLKA 4PQNA 3NR9A 4FVRA 5FP6A 4QMTA 4AA0A 5E8SA 2XKDA 3PVGA 3JXWA 2XNOA 4YURA 3ZFYA 3I81A 1I2KA 2PVHA 3WILA 4J53A 3OD6X 4Z7HA 3FZSA 1E4EB 4QP9A 4NT4A 4O96A 3DTWA 5CI6A 1VR2A 5CU3A 2CLXA 4AAYA 2ABJA 2YZMA 4IEBA 4FZFB 3TY9A 3H10A 4I94A 1BX6A 2JD5A 4QMLA 2YHVA 3F9NA 1OMWA 3BLRA 5C1QB 2BDWA 5KMLA 3DDQA 2ZDHA 2R0UA 2ZGIA 3QKLA 4IM2A 2C68A 2CGWA 5LVPA 5D7VA 1WFCA 2BDFA 2OLCA 3OW4A 4L7FA 2X1NA 3L1SA 1F0QA 3GNIB 3MI9A 5AUXA 5HG5A 1OBDA 1KE8A 3JRWA 4FFRA 3PJ3A 1OL1A 4G9CA 4M8TA 4QMPA 1CKMA 4CFWA 4PBCA 2IVVA 4ITJA 2JAVA 4ZLOA 3H4JA 2PVFA 4IX4A 2C0OA 4O86A 5EH0A 2R3MA 4AZSA 2VNWA 3CR0A 4LOQA 4JG7A 3KK9A 2GNHA 1PXMA 2YDKA 4RGJA 1KC7A 3O7LD 1CQJB 3SOCA 1G8KA 5HBHA 3FL4A 4FG9A 2YCQA 3LFCA 3G5DA 2Y4PA 3L8PA 2VUGA 5EM8A 3VN9A 2CGVA 4DEGA 3NVKI 3W0MA 4O27B 2R3HA 3EN4A 4B8LA 3W0RA 1KE7A 2WAJA 3NAXA 2CGUA 3I79A 4Y8DA 4BF2A 3HV6A 1MQ4A 1FQ1B 2WB8A 4FV4A 4FEQA 5DYJA 4D1ZA 5AAEA 4PZ6A 3VPBA 3VUGA 4NZMA 1XH5A 4GT5A 4FSQA 4I0SA 3PP1A 5IH6A 2DUVA 2GHMA 3UPXA 4DCAA 2OZAA 3FXXA 4KAOA 3FYJX 4IE9A 3Q04A 1OKVA 3F82A 3IW4A 5HG7A 4FNYA 3F5UA 4U41A 5B7VA 2R86A 1V0PA 3AMBA 4N57A 4Y95A 4QP6A 4WHZA 1I09A 3BLAA 2CKQA 2IW8A 4DITA 4WG3A 2QU5A 3D7TA 3V4SA 3DAAA 2BMCA 5KMIA 4DDIA 5EW8A 3RAHA 3OVVA 3CTQA 4FTCA 4IWYA 3LFQA 1AUXA 1EKVA 3RMFA 4F6UA 3TTIA 4JBPA 4NTTA 4X2JA 4Z7GA 5BUJA 5AP2A 3CSVA 5IMXA 5C9CA 4R6VA 5DR9A 4EOJA 4WNMA 1OIUA 3K5UA 4EH8A 4CCUA 2HG8A 2X0SA 4O81A 5E25A 4O0VA 4AUAA 4CFXA 4LFIA 2I6LA 4F99A 1E9HA 4A4OA 4A9YA 5JQWA 1WCCA 2HW6A 2ITNA 1APME 4MCVA 4OBPA 2ITTA 2P0AA 4QYYA 3TXOA 4QYHA 4MBJA 4XLVA 5JVDF 2RFDA 4YJ3F 4FL2A 1UV5A 3MY5A 1P16A 2YIXA 3LXLA 2CCIA 1OPJA 2UZVA 2CGXA 3DTFA 2YITA 5HLWA 3ZBFA 3LFSA 4G31A 4EK6A 3TIGA 3MWEA 5LWNA 4KIQA 2CNVA 4HJOA 4JRNA 4APCA 2C3LA 4ZTHA 3DKFA 3RK5A 4YBKA 5L6WL 4BCHA 3BE2A 4BB4A 5CA1F 1YDRE 5M4IA 3V8WA 2ERZE 4DC2A 4K8AA 1NT2A 5BWVA 4Z16A 2BILB 2R4BA 2PULA 1VKZA 1XWSA 2GPHA 3CY2A 3KK8A 4FZ6A 3UG1A 4A4XA 4ZTMA 4LI5A 3R23A 5D8DA 2EVAA 5KBQA 5CU0A 4MNEB 4EOQA 5F95A 4WBOA 3QTRA 2YFXA 5I5ZA 5IQCA 2VWXA 1U59A 4AN2A 4FKPA 2V62A 2OJGA 3SXRA 4C38A 3MDYA 4C36A 3TUDA 2ITPA 5HD7A 1PX2A 3F66A 3UE4A 3ZBXA 5GIPE 3TNIA 4PUZA 4XYFA 1ATPE 3R7UA 4EZ3A 3Q3BA 3UNZA 1PY5A 3ZC6A 2HWPA 3BGZA 4X2NA 2WU6A 4YBZB 5IA4A 1DAYA 2NUAB 3F6XA 5L8LA 4KNBA 1T36A 3SXSA 4KB8A 4RJ3A 2XEYA 3QHRA 3ETJA 2PYWA 2P4IA 4FTKA 3TZ8A 4XX0B 1R0EA 2YRWA 5C01A 3FLZA 1JAMA 5EQPA 5B2MA 5AAGA 3I0OA 3PG1A 4RZWA 4FIGA 5I0BA 1MRVA 1OB3A 3ZLWA 3IOKA 3RAWA 4M67A 3SXFA 2GS6A 2YISA 3ULZA 5AX9A 3L9MA 1IAHA 2VO0A 5E8UA 4DLIA 4PL3A 2QU6A 3CTJA 2VTRA 4FV8A 5IUHA 2XF0A 3BU6A 4FSMA 3KMUA 3NX8A 3QD4A 4GU9A 4YLJA 4LDTA 2YCRA 3QFFA 4H58A 5GJDA 1ZLTA 3U6HA 2FO0A 4LGGA 1GZNA 3RGFA 3KVWA 3OW3A 3BELA 5E90A 3WE8A 4Q9SA 5GJGA 1VLRA 3GC8A 3ZMMA 3OUUA 2VNYA 4AW1A 3UZPA 1YHWA 4B9DA 4ME6A 4TYJA 4YMJA 2UZDA 2YWPA 4YJQA 3VONA 2O3PA 3Q2JA 4R7BA 4TT7A 4ANQA 4QNAA 2F57A 2IVUA 2WU7A 2UVXA 4FJVA 4R1YA 2OWOA 1OM1A 1O6LA 4YTHA 4O21A 1H4LA 1JPAA 3S95A 3DKCA 4FV3A 5HTCA 1FVVA 3RHXA 5HGIA 3MA3A 4Y5HA 5C26A 5LWMA 2E9PA 4TUYF 2UV2A 3I5NA 4WUNA 5FBOA 4AOTA 5J1VA 3IGGA 4FSNA 3GJXB 2CKEA 3AGMA 1FBNA 2Y9QA 3IOPA 2PVJA 3EJ1A 1SVEA 1WBVA 3KVXA 4AZEA 3BEGA 4HPTE 3C5UA 3AOXA 2WIHA 2ZMDA 1OI9A 3W0NA 1UNLA 2ZYBA 4L43A 2OIBA 4F7NA 2CLQA 4D58A 4O4LF 5AWMA 2QB5A 4QT1A 4BI1A 3UGCA 3E62A 2YIYA 4H05A 5BYBA 3ZUUA 2HOGA 3EB0A 3AGLA 1JDEA 4QEBA 1UWHA 2QOFA 3AXWA 4EOMA 2VO7A 2WD1A 1YXTA 3VRYA 5CEIA 5BWWA 2JITA 3BRBA 5M53A 2X8DA 3ROCA 2IO6A 5H8EA 3PRIA 1M2PA 2WMUA 4IADA 3HKOA 1WBSA 4NWMA 3C4FA 4ZTSA 3Q4TA 5J2UF 3ZZWA 4BHZA 4ZTLA 4NKSA 3TL8A 4PMSA 3R71A 2GNJA 4HVDA 5HORA 1CKNA 1ULZA 3W0PA 3BWJA 2R3KA 3SVVA 5IYZF 3FHIA 3WZEA 3DLSA 4ALVA 2OF4A 4GLWA 3EKKA 5CB4F 1HOWA 5CEQA 4V0GA 4NTSA 3I12A 4QRCA 4MBIA 3SC1A 3G51A 5KZIA 4LH6A 3PFYA 3PZEA 2PUPA 1PHKA 4ZP5A 4FKWA 4CLJA 4GT4A 5IZFA 1B04A 2HWOA 2XK4A 4MV8A 1TFFA 4GSBA 4IC7A 2OH0E 4AS0A 3BU5A 3WF5A 3FMKA 2IW9A 3QZIA 5CS6A 2SRCA 2VQDA 4DFBA 1IRKA 1BMKA 5H9BA 3GB8B 3O8PA 4D4RA 3VIDA 3FZPA 4C59A 2H34A 2XP2A 4F9BA 3LM5A 4GJ2A 2VN9A 3RZBA 5M44A 3LKMA 5DOSA 1J1CA 4O7LA 3SAYA 4ANLA 1FMOE 2OF2A 3ORZA 3U87A 4ZJIA 1IOVA 3U9CA 3AKKA 4QP8A 4TKSA 4X6QC 2QK4A 2I0EA 2YM5A 5TO8A 4PMTA 3BQCA 4EKKA 3L9PA 4A06A 4KA3A 1X9NA 3HT5A 2R0IA 3ZDIA 4UEUA 5AA9A 4LOPA 3D9VA 3VQUA 5TR6A 2QO9A 5FGKA 1FGIA 1ZOHA 1ZYSA 2BPMA 3MB7A 4C3RA 4DEAA 4ZS4A 3CGOA 3E3PA 4QDVA 2AC5A 4FKIA 3I7BA 4HN2A 2GLTA 4IAKA 4E4XA 5J9YA 4FEUA 4PTCA 3QQGA 4PDOA 4YNOA 3LOKA 4FU0A 2Q2TA 3QZHA 3T99A 4ASXA 3N8DA 3R5XA 5ANDA 2R9SA 1GOLA 5FRIA 1MRYA 3ULIA 3KRJA 3AT3A 5ACKA 3KRXA 2JKQA 2XJ1A 4DH1A 3EQHA 4YO4A 3RFCA 2I7QA 4ZJJA 2XAMA 2C6EA 3OBGA 4IAZA 5LMAA 4LL0A 3SLSA 3NW6A 2WMAA 3NUSA 2IJMA 3PWYA 4FKRA 5HG9A 2EJ2A 4MA0A 3AG9A 2CMWA 5I9YA 1CTPE 1BI7A 4U3YA 2ZOQA 4FTIA 3QWJA 4I0TA 3ZEPA 5C8KA 2GQRA 3JUHA 2WIPA 4RVTA 3ZO4A 4F63A 3KFAA 2WHBA 3ORPA 4HOKA 1PYEA 4YJVA 4J1RA 4ITHA 4ZEGA 4IW0A 4TNDA 3ZRLA 3WBLA 4ZTRA 3DBDA 4DINA 1MUOA 5D10A 4PMPA 2V58A 4EHGA 4E6NA 5CVFA 4CTCA 2JDTA 1KT8A 1XH7A 1KOAA 2VTSA 3F3UA 3TZ9A 3ORQA 4JR3A 1V9PA 3AD4A 5E8WA 1A9UA 5KS8A 2QO7A 4JT3A 3FAAA 3QX4A 2CZGA 5M08A 4U6RA 1GZKA 4EC9A 3F61A 3R1QA 3RNYA 3F7ZA 3AT2A 4EC8A 4QMQA 3RNIA 3DAEA 2O0UA 4YAJB 5JKGA 3DU8A 5CWZA 1IG1A 3AC2A 3DJ6A 2VZ6A 3P08A 2CN5A 2ZM3A 1W7HA 2FPIB 3IS5A 3LWBA 2WQEA 3QUPA 5KHXA 2XAOA 4F65A 4IVBA 4D9UA 3PG3A 3PY0A 3FMHA 3VUDA 2HJWA 3AC3A 4AT3A 3FZOA 1ZYLA 3FLSA 4D4VA 1ZXEA 3GU7A 4AQCA 2WTCA 4JOAA 3V3VA 3EWHA 1O9UA 4FZDB 3NBYB 2JC6A 2H9VA 1OBGA 4FE2A 4FTOA 5ANGA 3EKNA 1KTAA 3L2PA 2YCFA 3NVMB 1STCE 2ETMA 3VUKA 3BIZA 4G9RA 4D55A 2GMXA 1M7QA 4QDEA 3VJNA 3G9NA 5J9LA 4BGQA 5BPHA 3NUAA 1YWRA 3C4EA 4N6YA 4NFMA 1Q3DA 5IUGA 5DLSA 2QHNA 2VAGA 2VX3A 3KL8A 1P8LA 1WRVA 4MAMA 5I5VA 2R84A 3QX2A 2WFYA 5EHYA 4EUTA 4G34A 2VX1A 4RX8A 5H8BA 5KUPA 3LJ2A 2JBPA 1FINA 2NNWB 2X2LA 4AGWA 3R30A 3NNXA 3DQXA 5A46A 5JQ8A 5BVNA 5CR5A 4HYHA 3CS9A 3E3BX 1OL2A 4LGHA 3T9EA 3EH9A 2W5BA 3BU3A 1WBNA 5LVLA 4AT5A 3UYSA 3HNGA 1ZYJA 3V6SA 4AXEA 5GIOE 4YJPA 1I7NA 2HHFB 3FMLA 3EQRA 3CD3A 3UO5A 2QOLA 4I93A 4EG0A 4XMOA 3R7EA 3QFVA 2PUIA 1E1XA 3P23A 1XBCA 3MIAA 4DF3A 2PL0A 3GDEA 5T3QA 4BKJA 3FJQE 1H8FA 2XNPA 2PSQA 2QNJA 3LHJA 4JDKA 4GT3A 4XOZA 4IFCA 4E7WA 1VJYA 1RJBA 2OJIA 4L01A 5HI2A 5IH5A 2R87A 4EEQA 3R2BA 2PMOX 4YGAA 2Y6MA 1VS0A 1Q8TA 2ITQA 1XDNA 4DBXA 2BROA 3BEAA 2A4LA 3ZLSA 1H1WA 2WTIA 5DISC 3HP5A 1OIRA 1K3AA 5E8YA 3H9FA 5LYJF 4I6HA 4R1VA 5ACBC 3CLYA 3Q9YA 4CFFA 3MS9A 5EW3A 4AXDA 3ZLYA 1KJ9A 4AXCA 1L3RE 1WVWA 3G15A 1XMLA 3RVGA 4AQKA 4C4JA 3HUCA 3TV6A 4JX3A 4CKRA 5LOHA 5LVMA 3ETHA 3VPCA 3ZU7A 2OBJA 3MVMA 3VS0A 4BDJA 2ZVAA 3PTGA 4WT6A 1JOWB 3O23A 4RC3A 1P4OA 2VTPA 4IC8A 4J95A 5KKNB 5BVEA 3KXNA 5FEDA 2F9GA 2C6DA 4ZSGA 4XRJA 3R9RA 4G6NA 4HNVA 1U4DA 4E6CA 3QQKA 4Y73A 4IJ9A 3KXXA 3PVWA 4GG5A 3PPKA 3JPVA 4UCTA 4HW7A 2CFMA 2IG7A 4L3LA 1QL6A 2BAKA 5AUWA 2J6MA 3PSCA 4CRLA 1R39A 4YJNA 5HX6A 3K54A 1YWVA 5KHWA 4CFMA 3U8WA 3V8SA 5JFSA 1ZOEA 2W9ZB 1ZMUA 4PL4A 4KIOA 4BGHA 4WSYA 5EDRA 3KN5A 2HDKA 5FLFA 1W98A 1H1RA 3K3IA 2V0DA 4MV9A 5AA8A 2P2HA 1BNCA 3PVUA 1JNKA 2ZB0A 3R21A 4UZDA 4YLKA 1T46A 4BICA 5KMMA 3S00A 2YRXA 2RFSA 4JS8A 5DMXA 2PVNA 4TRLA 3OXZA 4QP2A 3O96A 3CXWA 4UX9A 5I9WA 4EK5A 3GOKA 4IWPA 4IMYA 3KXZA 3AW8A 3SOAA 5M4CA 1XMMA 3P5KA 4FV7A 4FTTA 1YW2A 3FI8A 3FZRA 2DIKA 2VD5A 4E6DA 3JY9A 2QOCA 2W4OA 1IA8A 3QF9A 2UVZA 4FKSA 1Q62A 3OCBA 4EBWA 4AXFA 4QQ5A 3P1AA 3QQJA 1WZYA 2BIYA 3MN3A 2VTLA 4N6ZA 4RG0A 2DWCA 1M2RA 2VWWA 4FTJA 4GYIA 5A4EA 3ITZA 4IB5A 4GFGA 4RIYA 1OKWA 5CAQA 3FMNA 1M0TA 4TV8F 2QI8A 5D1OB 2PZRA 3QD3A 4QMMA 3LCKA 4FSTA 1Z9XA 3THBA 3M42A 4PY1A 4GRBA 3T3VA 2I8CA 2QOBA 5E7RA 2CSNA 3QZGA 4ID7A 4NM0A 4NM5A 4IDTA 4RPVA 4YZ9A 4HNIA 4B6LA 4XP2A 4JAIA 2XKFA 5HESA 2VTQA 1Y91A 4DG0E 4FUXA 5IISA 5JRQA 3QQHA 4DRFA 3P4KA 2XBJA 5D7AA 2EB2A 4M68A 5A3XA 4RJ5A 3SE7A 4RJ8A 4RLKA 4AW2A 4FK3A 2Q2UA 1NVSA 4BDAA 4AZVA 3OXTA 4Q5EA 3DAKA 3COIA 2ITOA 5DFPA 2RGPA 2PVLA 3AMYA 3U4UA 3JY0A 2BALA 3T3UA 2XYNA 2XM8A 4UXQA 4DG3E 3MIYA 3CQEA 2BDJA 4TPTA 2PUUA 4E20A 2WMRA 3UOKA 3DK7A 3A8WA 3W8QA 2XD4A 4Y8VB 4E8AA 2C47A 4CG9A 3QCQA 3ZTXA 4BY9E 2BTRA 3ET7A 4GVAA 5DT3A 2YCSA 3MB6A 3SV0A 4MWHA 3Q60A 1WMKA 4H39A 4L8MA 4UXLA 5EYCA 2W6OA 2FH9A 1XBAA 5TF9A 4ACMA 2BAJA 1VBGA 5IDNA 1K2PA 4I4FA 4WOVA 3TM0A 3TNHA 4CNHA 4RIOA 1ZAUA 4BGGA 3R01A 4PNIA 2HZ4A 5AAFA 2BRNA 2AYPA 3PXFA 5AUZA 2B53A 3HEGA 3TUBA 3QTWA 1JVPP 4FIIA 4DN5A 1G2WA 4PDSA 3FKNA 3FSFA 4FSZA 4ACDA 2UW6A 1A3GA 2HVSA 4Y5QA 2HGXA 4DAAA 5M57A 5L6OA 4TN6A 3PUFC 5K9IA 2WTVA 4AU8A 4RVMA 5AFVA 3RAIA 4A9RA 1CMKE 3ZO1A 1J1BA 4YB8B 4L46A 4DGMA 3GCPA 3VS2A 4FV9A 3UDBA 3RK7A 5BYAA 5ANOA 3OWPA 5LA6F 2UW0A 3VW6A 1H28A 4ACGA 3EN9A 1IYEA 2HIXA 2XM9A 4G3GA 2C5NA 4ANBA 4W4WA 4AE9A 1OGUA 4LV8A 2OIQA 4L9IA 4XYLB 3PJ2A 3N6RA 1H1SA 3EN6A 2W1HA 3N4VA 4C02A 5CQUA 3G8DA 4AXAA 3PXRA 4LRJA 1CKJA 2AUHA 4GVJA 4BCIA 4JQ7A 5KNJA 1UC9A 2HVQA 4Y83A 3DS6A 4I41A 4F9WA 4H1JA 1ZWSA 4H3QA 1TQIA 5KMJA 1LUFA 4TNBA 4TYHA 3T9FA 1P4FA 2E9UA 5E8ZA 4TV9F 4WKQA 4I20A 5M4FA 3ZOSA 5CAPA 4M7IA 1OIYA 1SM2A 4IWDA 4EJNA 3MFTA 1SZMA 5LMBA 2W0JA 1IEPA 1NW1A 1Q8YA 3FSKA 4HZSA 2VTJA 4PDYA 4CQEA 3BBWA 3TT0A 4FEVA 3ZYAA 5J5SA 5EW9A 1XH4A 3FEGA 4TTHB 5D1PA 2E9OA 4EFEA 3MJ2A 5KKRB 1TKIA 1Z2PX 3EHAA 4QTCA 2WMQA 5AUTA 1EH4A 4I4EA 4YHTA 3UC4A 4M0JA 3UNKA 3EQCA 5AV1A 3MJ1A 4ZTNA 3U51A 1WBWA 1OECA 5HBEA 1R78A 5JGBA 4IHJF 2QKRA 3U0GA 2QOOA 2ZV2A 1KE6A 5JZNA 1A0IA 1B6RA 1GJOA 1KV2A 4G3EA 3H0ZA 3HA8A 2R3IA 4QMXA 1GZ8A 5CZIA 2IVSA 2Y6OA 1M7NA 1UKIA 5JEBA 3QWUA 2J90A 3W2SA 3NUYA 2XKEA 3ZH8A 4G6LA 4FIFA 3FMEA 4TM5A 4DTBA 4JMQA 1JLLB 1W8CA 4FI1A 4QMSA 4Z55A 3ATTA 1Z2NX 3MY1A 4YC6A 3RHKA 3VJOA 4AW5A 2WQOA 5M07A 5E8VA 4C4GA 5ETAA 4BZNA 1XH8A 4RSSA 2XK9A 4OLIA 3HV4A 3BKBA 3TW6A 4WBNF 3QQUA 2F4JA 5C8NA 1NXKA 2WEIA 3H9OA 4UALA 1Y8YA 2QURA 4WUAA 4JDHA 1NVRA 4RA5A 4WRSA 3WYXA 4HNTA 3AMAA 1IR3A 4X21A 3NW7A 3W2OA 3EYHA 5C27A 2I40A 3HLLA 4FKGA 3GGFA 2VWYA 4U80A 1U5RA 3BYSA 3P79A 5LQFA 3CCNA 2OZAB 1PJKA 5DNRA 1QMZA 3T9BA 1YOMA 3FPQA 2XMYA 3LIJA 3A60A 5BUIA 4D1XA 1REKA 1WVXA 4YZBA 3ROYA 4PL5A 3TKHA 3TV7A 5M55A 4DT8A 1PXJA 2EWAA 1EZ1A 3CY3A 3D5XA 4B0GA 4Q2AA 4FNXA 4MQ2A 3D7TB 1Q41A 3VAPA 3OEZA 2UW4A 3HA6A 3BQRA 3IGOA 4D0XA 2R7NA 2BFXA 5AMNA 3ACKA 2WQNA 3R1NA 4FIJA 4HCTA 4YJRA 2XB7A 4FMQA 5FDPA 4GLXA 3NYOA 2C6LA 4O6LA 3RPRA 3ORRA 3FPMA 4MD7E 4F78A 3TCPA 3RP9A 5K5XA 4E6AA 1GIIA 5I5SA 3UIXA 5CVHA 2CHLA 3IW6A 4KKHA 2ZM4A 4UYNA 3DF7A 1PMEA 3P9JA 4J8MA 5ANJA 2XNMA 2XCHA 3MPMA 4JRVA 2R3JA 3MH1A 3V5JA 2ZB1A 4DFNA 2R3NA 2QODA 5HO8A 5TOZA 4EH9A 3Q4CA 3KXMA 4XV3A 5FR9A 3MH2A 4ZTQA 2W9FB 4MVFA 3WWJA 5AUYA 2XCKA 1DI8A 2BR1A 3UVQA 2GS7A 3U55A 3SW7A 1I44A 1HCLA 4IVCA 5EDQA 5CU2A 4TWNA 5I4NA 2WGJA 4J98A 4QMNA 3E5NA 3JSNA 4ZLZA 4ZHQF 3MSSA 1I2LA 2X7FA 3ALOA 2DS1A 4GKHA 3RI1A 2R3GA 4F0IA 5EKOA 4A4LA 1GGOA 4YU2A 4MD9E 2PVKA 4JG6A 2BZKB 4RT7A 3F2RA 4EONA 4J99A 4HYUA 3ZSGA 5IA1A 3BABA 4E93A 4CFNA 4EORA 5CYIA 4NCTA 2OXDA 4YLLA 1ERKA 4HVGA 4E4TA 1KJIA 3UFXB 2OU7A 5TT7A 4FL3A 5BQ0A 4FYOA 4LYNA 4FK6A 3L8XA 1SNXA 2WELA 3FQEA 1AGWA 2WMSA 4YJTA 3MVHA 3HAMA 3IKAA 2OI4X 4II5A 4HNFA 1GLVA 4K6NA 5IQGA 4F09A 3PIYA 2KTYA 3BHHA 4TZRA 5EKNA 1CKPA 3LM0A 2XBAA