3U54A

Crystal structure (type-1) of saicar synthetase from pyrococcus horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
227
structure length
225
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Structure of SAICAR synthetase from Pyrococcus horikoshii OT3: insights into thermal stability
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 70
structure length 225
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3u54A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3u54A02
2PPQA 2GNLA 5M51A 4MA5A 4XS2A 4IIRA 1MRUA 2GHMA 5DNRA 4XOZA 4DBNA 5TF9A 4FYOA 3OXTA 3V8WA 4S31A 2ITXA 3BU6A 3QC9A 3RMFA 3R2YA 5AP1A 1EH4A 1P2AA 3C13A 1KBLA 2OO8X 5M08A 2WQOA 5AV2A 3O8UA 4FKLA 3D7TA 3LMIA 5HE1A 1KE9A 4H05A 3BYUA 3NCGA 4D1SA 4I4EA 4QTCA 4JR7A 2QOOA 3QTQA 3U9SA 3AOXA 3VS0A 3FZPA 5FM2A 1DAWA 2R7MA 4I5PA 3UFXB 5K4JA 2PZYA 3CTHA 3GT8A 3V04A 3LCDA 1A48A 4FIHA 3NRMA 4IHPA 1YXXA 4ORKA 5M4IA 4KWPA 4L8MA 2JBPA 4UZDA 2J4ZA 2OKRA 3RJCA 4EHEA 4K18A 2QK4A 2XCLA 5IQBA 3BGZA 4FTAA 3UVQA 5KKRC 4JAJA 4F9CA 1FMOE 3BEGA 3C5UA 2WEIA 3LQ3A 3QHRA 5AMNA 2C47A 3EZVA 2J0MB 3DXQA 3ZLYA 3L9PA 1DAYA 5DRDA 3T3VA 4N0SA 3SDJA 4TWCA 2CZGA 4FR4A 2WQNA 2YYAA 2BFXA 2VV9A 2QOFA 3BELA 5DT0A 5BMSA 3TZ9A 3NNUA 4EK3A 2CNQA 1YWRA 2QKRA 4ITHA 4EUTA 4TYIA 2W1DA 2ZDTA 4O0VA 4RIOA 5CAUA 3G51A 4C4IA 2FSOX 4MK0A 4B9DA 4OTHA 5EM7A 1M2QA 3HMMA 3MH3A 4ZI7F 2B54A 3QA0A 3CC6A 4MV9A 3WF8A 3H30A 3UYTA 4FEWA 5AA9A 4Y73A 4O7WA 4BB4A 1STCE 3R22A 1RJBA 2W4OA 2VTOA 4U9AA 3UVRA 4ENXA 4EONA 5I5ZA 2O8YA 2XBAA 4FTJA 1GZNA 5KZ0A 5C26A 4O7RA 3FDNA 1HCLA 3FXXA 4HVDA 5JQ8A 2YZMA 2VTAA 3UG2A 3IDCA 3F61A 3HRBA 5EKOA 3QQHA 3KK9A 1PXIA 4GIIA 4D1ZA 1W84A 1U5QA 3PG3A 4JR3A 5C1QB 2PE0A 5CAPA 4EK8A 4YTFA 3HBLA 4I55F 4FSWA 3BQRA 5CEOA 5C4KA 5IH5A 3C4WA 4U3YA 3B8RA 4ANSA 4WT6A 5DLSA 3SV0A 4OTWA 2P33A 4ALVA 4DH8A 1YI6A 2R3NA 5J9ZA 2J9GA 5L6PA 2YDKA 3FY0A 2B55A 2I0EA 3TJDA 1RW8A 2LGCA 4RQKA 5D1JA 4YU2A 2ZV9A 5HCZA 4PF4A 1CQJB 2XMYA 4RWIA 4X2JA 4AUAA 3R9NA 1RQQA 3C0GA 4EOMA 2I40A 4BBMA 2PZPA 5HG5A 3A61A 1H1QA 1ZOHA 2R3QA 2XH5A 3PPZA 3POOA 4JX3A 3QZHA 5L8KA 3MA6A 3OZ6A 2WOTA 1H27A 1ND4A 4PMPA 3LWBA 3QYWA 4FZ7A 4U41A 4IM3A 5M4CA 1M7NA 1Q8WA 3NUUA 4YHTA 1BUHA 3H0ZA 3PA4A 5CF5A 3AC2A 4G3DA 3QGYA 3RPOA 4F0FA 3RALA 5AP3A 5AA8A 3B2TA 4FEVA 1ZY4A 4Y85A 4JBPA 4DEBA 4BZDA 4MD8E 3VN9A 4Y46A 1WCCA 4FG8A 3WF6A 4UN0C 3OVVA 4U79A 4V04A 5CAVA 3KGAA 3ORKA 2OIQA 3RAHA 4ZLZA 3QQJA 4ZS4A 3S0OA 2DZDA 3GC0A 3NLBA 3QX2A 5AP2A 5FTGA 4F65A 2XCHA 4HGTA 3M11A 1U59A 4AN3A 3TUCA 1U46A 2QOCA 2UW9A 3TKIA 3TZ8A 5ANEA 4D4VA 3G8DA 4RIYA 2FA2A 2OLCA 2W5AA 4RX7A 2KTYA 2BRNA 3QQLA 2JKQA 4IAYA 4FZ6A 4RWJA 3OD6X 4WO5A 2REIA 5FUTA 4MF1A 3HB9A 4D58A 5CU3A 4OTFA 4ID7A 1XH9A 2PMNX 3KB7A 4MCVA 3OFMA 3KF4A 4YSJA 1TKIA 4ZSGA 5DEYA 2FSLX 1JKJB 1IOWA 1OM1A 3C5IA 3A7IA 4IIJF 2HYYA 4I6HA 2R7BA 1M17A 2UW3A 2ACXA 5CF6A 1YXTA 3UZPA 4LRMA 1PXJA 1L8TA 3F7ZA 3LCTA 1Z5MA 4JQ7A 3PVUA 2ZDQA 3ATSA 3WYXA 3CLYA 3WIKA 3QWJA 3WILA 3EFWA 1GY3A 3I1AA 3V5TA 4RG0A 3ORTA 4AW1A 1LUFA 5AP5A 1ATPE 2C3LA 1KJIA 1JLLB 4AAAA 2PTKA 4EYMA 1GZOA 4Y5QA 3DDQA 2P2IA 3RV3A 3LFQA 4QTBA 2AC3A 5A4TA 3PLAE 4WSYA 2OICA 4QP6A 2PY3A 4RJ3A 3VRZA 2RGPA 4ZTRA 5GJFA 4BCPA 3AMBA 4FKTA 4YBKA 3KXMA 4E4TA 2SCUB 3MI9A 3PIYA 4L9IA 3U87A 3SG8A 4F08A 1Q62A 2R3PA 1UU9A 4R7IA 3NAYA 4FMQA 3JYAA 4IVDA 4R3PA 4ZSEA 3HO8A 2OGVA 3KRRA 1U54A 3NSZA 3D2IA 3PTGA 4DEEA 1UNHA 3Q53A 3U9TA 1GZ8A 4M68A 4YPSA 1PK8A 3QHWA 2QOLA 4ALWA 3EFKA 5DE2A 4WG5A 4W4VA 3Q2JA 3CXWA 2VD5A 4O6LA 4QYFA 3LFNA 1T45A 2QONA 4WD5A 2PMIA 1Y91A 4DH1A 3F2AA 4Q2AA 3IDPA 4GK3A 3C0IA 4EQMA 3DXPA 4MNEA 4RT7A 2QC6A 4IHJF 4P4CA 3PE2A 2R82A 3QUDA 5L6WL 3QL8A 3DKCA 1AUXA 5ANOA 5IQEA 2R7LA 4FKOA 2R3MA 3UC3A 5HVJA 4C59A 2W4KA 4FGRA 3AX6A 3F3ZA 4ZJJA 4GL9A 1IAHA 2QLQA 4I0TA 2BCJA 4O82A 4PY1A 3V51A 4A4LA 3MWDA 5GONF 3C9WA 4JBVA 5C27A 3DTWA 3GI3A 4ANLA 4QP3A 2VPQA 2WYOA 3A7FA 4BDDA 5AWMA 4CKRA 1IR3A 4HYIA 3VA7A 4I6FA 3IG7A 3KF7A 2RFNA 3QQGA 3GCSA 4MNFA 3C4XA 2ZM1A 4GT5A 2Z7QA 4DITA 3NUAA 2EB3A 2GS2A 4FBXA 4EH4A 4EJ7A 4EL9A 3H4JA 1XWSA 1E4EA 3DAEA 3KVXA 3LFDA 3PVGA 3GOKA 4OBPA 5EHYA 3MW1A 3FBVA 5D9HA 3LJ2A 4FNXA 2R7IA 2FSTX 3K5VA 3FXZA 3K5UA 4DEAA 5HG9A 4F1TA 1J7LA 3DJ6A 1IEPA 2ITUA 1H24A 1OPJA 3BPRA 3G2FA 3VS6A 4K9YA 3HL7A 4A9UA 4PP9A 3HRCA 2VNYA 4FYNA 5G1XA 3T8OA 3WI6A 2PWLA 4OLIA 3RAKA 3QCQA 1REJA 3KXZA 3ODYX 3OBJA 5LVLA 2JFMA 4WNOA 4Q5HA 2GS7A 1PY5A 2H6DA 2XYNA 4EH7A 3D5VA 4GW8A 3QGWA 4BDGA 5A9UA 4DG0E 5FTQA 4C02A 5DR9A 5CEQA 2YWPA 5JT2A 2YA9A 4MTAA 4FV2A 4P90A 4F0IA 2R84A 3G33A 1TQPA 2ZDUA 4DFLA 4D4YA 3L8SA 2ITQA 5IG1A 1OUKA 4K11A 4F64A 2W1GA 3QTXA 5CLPA 2V22A 3OF0A 3TV6A 3UBDA 3Q04A 1GNGA 2FUMA 3GU5A 3R02A 4UWCA 4ZY4A 1AQ1A 2R3IA 2VU3A 4JDIA 2UW6A 4M97A 5TOZA 4EJNA 5I0BA 3L8PA 3TZMA 5HNIX 4F7NA 1Y6BA 3LAUA 1PMNA 3ZEPA 2WO6A 4JXFA 4E93A 3FHRA 2GPSA 3ANQA 3BIZA 2C6DA 4UXLA 1B6SA 3IPHA 3O7LB 4C5AA 4CMUA 1GZKA 4XG3A 3VULA 5CEMA 1ZZLA 4C4EA 5CNNA 3U9NA 3QC4A 2JBOA 4KUJA 2VWIA 1H1RA 4FEQA 4FZDB 3VUIA 1GIHA 3NIZA 3I6UA 3VVHA 3ORLA 2O5KA 5HGIA 5CAQA 2VQDA 5EDQA 5FEEA 4TKSA 3F69A 4FKGA 2H34A 5BVOA 5IF1A 1DIKA 5JVLA 1NXKA 5CXZA 4U45A 4Z7GA 5BMVF 2RG5A 4GVJA 4XRJA 4WUNA 4FFRA 3KU2A 1OB3A 1Q8UA 1JDEA 2BR1A 2YN8A 4O81A 3R7OA 3R7YA 4RC4A 4ANBA 3DBCA 2JDOA 1XQZA 3F3VA 1Y57A 3COHA 1WVWA 4L00A 4O2PA 2VX0A 3F3TA 5J8IA 2BRGA 3W8LA 2H9VA 2VO3A 4YO4A 3ZRKA 5KNJA 3DA6A 4FSTA 4E6AA 5KX5F 3OTVA 4F4PA 4A07A 4C7TA 3FZRA 2W99B 3F2RA 5FXSA 2I0HA 3Q52A 3W55A 3NUYA 5FEQA 2VZ6A 1OMWA 3GENA 3MESA 5M44A 3F9NA 3TM0A 4WRGA 4GV1A 3VAPA 3FYKX 4TW9A 3SRVB 2A2AA 4XEYA 2IPXA 4UALA 3QZGA 5D10A 4IC7A 4CFMA 1SNXA 2JEDA 1KJ8A 3PXZA 3TQTA 1R78A 3HMOA 2B9FA 3C4FA 4WRSA 3CS9A 2JDVA 1HCKA 2YM3A 3OHTA 3QCYA 2CCHA 2NP8A 3Q6UA 4O2BF 2PUIA 3WOWA 1FVTA 1YDRE 4Z16A 4J71A 2WKMA 3W33A 5CSPA 3BGPA 3RPVA 4YJ2F 4S34A 5E8WA 2X8EA 4YMJA 5AJQA 2QU5A 3LHJA 5AP6A 3FMNA 3RAIA 2XP2A 2JFLA 4JL9A 4AZSA 2PMLX 1O6KA 3BBTB 4DEIA 3PZEA 4LYNA 3HV6A 4JDJA 2BRBA 5A4EA 1GSAA 4YJUA 4UEUA 4Y8DA 3RTPA 3UOJA 2IVUA 3QD4A 2UW7A 5LOHA 1BMKA 5H8EA 3RKBA 4DF3A 3D5UA 3P7AA 3QBNA 5CU2A 4EZ7A 4IQ6A 3NUSA 3PXKA 4I3ZA 5EM5A 3SG9A 5HU3A 3ACJA 3VUHA 5BNJA 4MV1A 2XNNA 5IYZF 3ULIA 4YZBA 3UMXA 5AUTA 3NUXA 1YKRA 2JIVA 3PRIA 2W1IA 4G3EA 5J2UF 4TZRA 3BWJA 3QKLA 4IWDA 2OFUA 2UW4A 3AMAA 3AC8A 3HDNA 4NIFB 1JDBB 2PSQA 3K54A 3MWUA 5CWZA 1C3OA 3ORQA 4FUYA 4C3FA 4L43A 3F88A 4YBZB 3A7JA 2AUHA 4BDCA 4E8AA 2PUPA 2FH9A 4R7BA 3G5DA 4R5SA 5M4FA 2HCKA 4QMUA 4EH9A 3R1QA 4EH3A 3FL4A 5DN3A 3ZDUA 5IA2A 4BCNA 2VGOA 3HGKA 2BFYA 2DWCA 1FVVA 3AT4A 3H0YA 4TTHB 3QKKA 4IE9A 4CLIA 2DS1A 3ENMA 4G9RA 4AE6A 4HYUA 4PMTA 2YJRA 2C4GA 4I23A 3ZDIA 3EIDA 1W96A 3HMPA 3DCVA 1I7LA 5M57A 3C1XA 4K2RA 4RQVA 4BHNA 2NUAB 3BX5A 4C62A 5DYJA 2V59A 1G8AA 4UBAA 2VTRA 3EN7A 4WG3A 3ZM9A 2EWAA 3MVHA 5H8BA 5IEXA 2OG8A 3FKNA 2Z7LA 4IWOA 4X3FB 3BYOA 2QG7A 1Q3DA 2UZNA 3U6HA 3R23A 4G16A 5HVYA 3SD0A 4KKHA 2YERA 5EW3A 3ROCA 4A4XA 2B0QA 3ORRA 4R1VA 3IECA 4BBFA 1YOMA 5KKRB 3FEGA 2ITYA 4FV6A 3R7IA 2YS6A 1H1SA 1M52A 1YWNA 3DLSA 5TR6A 3RK5A 4QT1A 2XM9A 4EK4A 1UU3A 4RVTA 4C35A 2PYWA 5K5NA 3UYSA 4XG2A 3P5KA 1UKHA 3IW5A 3EL7A 5IA0A 3CY2A 4G2FA 4NW5A 4DE4A 2QOBA 4ACDA 3FQHA 4JLCA 5AUZA 3CPCA 1PW2A 1UVRA 4X2GA 5T68A 5FRIA 3KULB 3PXFA 4DT8A 4D9UA 5HD7A 5LQFA 4IAZA 4KS7A 2X7FA 4C5CA 4EOJA 2W0JA 5M55A 1UV5A 1P4OA 4BCHA 3LCSA 3NNVA 1C30A 3UTOA 3UC4A 4GK2A 2R3KA 5EK7A 5LVOA 3Q3BA 2W4JA 5IEVA 5J7HA 5KMMA 5CAOA 5C8KA 3H3CA 3DF7A 3DJ7A 1YOLA 2PBZA 5CU6A 4D2RA 2CJMA 2BMCA 2NRYA 4HVSA 5CENA 4ERKA 2VTSA 2GQGA 4IC8A 4PTEA 4XYFA 4AGCA 2XD4A 3LXNA 1ZOEA 2XCKA 1I7NA 4RGJA 4CFWA 3I4BA 3JRWA 4WOVA 3WF5A 4YZMA 4GMYA 5C8MA 5ETFA 2H96A 2OZAB 2Z7SA 2RG6A 4W8EA 1R3CA 3MWEA 3PJ3A 5FLFA 2PVMA 3UZRA 2GHGA 3NDMA 4AW5A 4HZRA 2IJMA 2PZIA 4NM0A 1YWVA 3DTCA 3FWQA 5JEBA 3LMGA 3LFCA 2BKKA 3NYOA 4YZNA 2CNUA 4QSHA 2BALA 3QQFA 3B8QA 2P3GX 2OK1A 4YC6A 4CFXA 5B2MA 4C0TA 2QCSA 3DKFA 4FT3A 4HCVA 2GLTA 2G1TA 3DNDA 5CTPA 2PVJA 4AX8A 4IVBA 3E8EA 1OL6A 3KRJA 5FBNC 4KRDA 4ZMEA 2DYLA 2J5EA 2VTNA 4I24A 2R3JA 5E91A 1B6CB 2XIXA 3QKMA 4ZOGA 4YNEA 4QQ5A 3MH0A 5FDXA 5HU9A 1ZRZA 2WU7A 3OCGA 4PMSA 1TVOA 4EHVA 4V0GB 2GNGA 3ZBXA 4FA2A 1QCFA 4AT5A 4TUYF 4XNEA 4R78A 4TYHA 3PSCA 4NTTA 4QYHA 1NVRA 5BVWA 2YDJA 2FPGB 3FXWA 4RIXA 3JZIA 2C6KA 2YIWA 4YC3A 4JVGA 4BDKA 4QPAA 4XV1A 3OROA 3MH1A 4F63A 5AIKA 3ZTXA 4FVQA 2J9MA 1KEEA 2J2IB 2Z8CA 3IK3A 4EG0A 4BZNA 3BYVA 4O0RA 5JGBA 3TV7A 3I0OA 2R0IA 2BHEA 2QR8A 3D0EA 3ENHA 4B7TA 1OL1A 5IQAA 5LA6F 3DFCB 3G15A 2I0VA 3MA3A 4WUAA 4DGNA 3BHYA 3F66A 3VUKA 4K6ZA 5BUJA 3N6RA 3K2LA 3F2NA 4O83A 4O7ZA 1DI8A 4M9UA 3KRWA 2IZRA 4YZDA 3NMUF 2RFSA 2XJ0A 2YCSA 1BXRA 5HHWA 2XNMA 3KREA 1R39A 5D41A 3ZFYA 4IANA 1BI8A 5IMXA 1I09A 4D4SA 3DKOA 1NVSA 4NFMA 3KRXA 5A14A 3KK8A 4F6UA 1GJOA 2OJIA 3QCXA 5CA0F 1ZMUA 3KY2A 3PVBA 4FG7A 4IX5A 3GC7A 4FIEA 3FSKA 4PTGA 4Y5HA 3RAWA 3LFEA 3P9JA 2FB8A 4E6QA 2ETRA 2HOGA 3KCFA 1G8SA 5DRBA 2Y8OA 3TNWA 3JRXA 3BV3A 3AD4A 2DQ7X 4I4FA 1PYEA 2VNWA 2XJ2A 1OZ1A 3F5XA 4FIGA 4FKIA 3CQWA 5EG3A 3TXOA 2WIHA 3DPKA 3SX9A 3ZC6A 4XYLB 3WNZA 2VX1A 5CYIA 3CCNA 5EZYF 4XOYA 1HOWA 3W18A 2G01A 4A9YA 4CT2A 4JQEA 5DI1A 1PX2A 1MRYA 3NAXA 1Z2PX 3ACKA 4I0SA 2AC5A 4ZTMA 1RDQE 3DNEA 2G15A 3HUBA 3D15A 3QQKA 1LR4A 2JLDA 2PVRA 4FG9A 3COKA 4YJQA 4ZK5A 1Z2OX 4JX7A 2EU9A 3IS5A 5DIAA 2OBJA 4LOPA 4AA5A 3VF9A 4JRNA 3W10A 2WD1A 4O7YA 5KHXA 3ZYAA 1BI7A 3EQIA 4GUBA 2CN5A 4QMXA 4EH2A 2OLSA 3IGGA 3FV8A 4FTNA 3GBZA 4TL0A 4ZP5A 4ZTLA 4Y83A 3C7QA 4UXQA 3IOKA 4F7LA 4ZAUA 4BTKA 3JPVA 3PFQA 2E9PA 4RIWB 2Z7RA 3MN3A 1FVRA 1AD5A 5A6OA 2XIRA 5M56A 3FL5A 4RRVA 4YJSA 3OXIA 4BYIA 4QMQA 3FLWA 5E8YA 3U9CA 3E5NA 2XS0A 3MY1A 3KMUA 3ULZA 2NU6B 4DGMA 4WBNF 2C69A 1SM2A 3KVWA 5GINE 4W4XA 5HE2A 4GFOA 3E63A 4FODA 4FSNA 3OXZA 4UWYA 4I0RA 4IJ9A 3F3UA 5I4NA 2ITWA 3KXXA 3P1AA 4KIOA 5EYCA 4ZY6A 4DGOA 3PJ2A 4I5MA 4MHAA 2GPWA 3PJ1A 5IQIA 5EQEA 4DTAA 5LWMA 5BUIA 5LMKA 4QP2A 2YW2A 1PKGA 2YITA 3WE4A 1P14A 4LGHA 3EQCA 2GTNA 4J98A 3ZS5A 4DAWA 2BILB 2X8DA 5HG8A 3KEXA 4EGJA 3A4OX 5BVFA 2B4SB 1EZ1A 2JITA 2QKWB 4F99A 3D94A 5DG5A 5HCYA 4W4WA 4XG8A 3BYMA 1Y8GA 2W06A 4CEGA 4U5JA 4PDSA 4S2ZA 3D5XA 4QRCA 5AADA 4NT4A 2GHLA 3CTJA 5LVMA 2Z2WA 4MH7A 5IPJA 4MV6A 2CGUA 4OW8A 3VW6A 2CN8A 4FKJA 4N6YA 3QRUA 4LGGA 1CTPE 4WNMA 1Y6AA 4NJDA 3PSDA 4FK3A 2YL2A 2XNGA 3E64A 1WZYA 4RC2A 2NU8B 5AAEA 5JGAA 3QZIA 4QP7A 3JVSA 4ZY5A 1Q41A 4IEBA 3P79A 5ETCA 4FNWA 5L2WA 5H80A 3SHEA 3R8UA 5JH7F 5CEIA 4Z55A 2X4FA 3OBGA 2XBJA 2C6LA 5DR6A 4DCEA 4ZEGA 4OBQA 4UWBA 1BL6A 4YHFA 2IP4A 4Y8VB 3WZUA 3ZXZA 4C34A 4MQ2A 3E62A 4MAOA 5JZNA 5IMEA 1TQMA 5JFVA 4OT6A 3GIDA 3H9FA 4HGEA 4BI0A 4FKQA 1YXSA 3AC4A 3HV3A 4JRVA 5E1EA 2O0UA 4L52A 4FICA 4O22A 2OJFE 1PXPA 3FQEA 4ZTNA 3HV7A 1VR2A 4HVGA 4IMYA 2WTDA 2HWOA 4F1MA 3GU4A 4KIPA 4CZTA 4YR8A 1XO2B 3WARA 3TIGA 2V0DA 3VHKA 4LOOA 3DXNA 2QD9A 3DJ5A 3R1YA 5HCXA 2B9HA 3TN8A 4O7VA 2XRUA 3UIBA 3EKKA 4J96A 1CSNA 4G3GA 4O7NA 3WZJA 3A4PA 4PDPA 1H07A 3KRLA 3ORIA 1YI4A 3A7GA 4FKRA 4NL0A 5DEWA 2VTIA 5HNBA 5EOLA 4E5WA 1XBCA 3I6WA 4QP9A 5GJGA 1Q5KA 2YM7A 3VRYA 3VS3A 3R8PA 2BIYA 3LM0A 4UYAA 5AM6A 2BDWA 1PF8A 4ZTSA 4C36A 3IW6A 4CRSA 4XJ0A 2UVZA 3NGAA 3TTIA 1PXNA 4GSBA 4QMSA 2WELA 2QHNA 4QMZA 5L8LA 3MSSA 4F09A 4E73A 4W8DA 3ZLWA 5BYLA 2W6NA 5HE3A 4IX4A 3JZFA 4V01A 1F0QA 1AUVA 2X7OA 3DZQA 2UZEA 4DGLC 2PE2A 4RMZA 4FFOA 2JKKA 2ITNA 2X8IA 4FGBA 4G5JA 4Q9ZA 5L8JA 5LXTF 3EYGA 1QPJA 3KALA 3HMIA 1ZYDA 3MGYA 3OEFX 4B8LA 4MA0A 5JZJA 3EKNA 3G9NA 4DTKA 3NUNA 4R3CA 5JSMA 4ME6A 1V0BA 3GB2A 4U81A 3Q5IA 4FTLA 2P0AA 2WB8A 5IU2A 2PMOX 1KE6A 4EK6A 3GFEA 4NFNA 4Q5EA 2EB2A 3V5QA 4YLLA 2CLXA 3R1NA 3OW4A 4EWQA 4RJ5A 2PZ5A 4I4TF 4YO6A 4ACGA 2YRXA 2R3OA 3WF9A 1NVQA 2HZ0A 3ALNA 3SXFA 4YJTA 4FV4A 3WO0A 2QG5A 4BKJA 4C33A 2C3KA 4FEXA 2XK8A 4YTHA 3BV2A 4U42A 5FM3A 3TIYA 2GS6A 3PJCA 2R9SA 1IRKA 2YFXA 4FSZA 3LOKA 4PP7A 4O6EA 4O27B 2R85A 5E8UA 4AZFA 2VTLA 3MJ2A 3EB0A 1Z57A 3O51A 4R77A 5BVKA 3VC4A 2PULA 1JWHA 3OP5A 4RX8A 4BCFA 3ZBFA 3O17A 4IZ7A 1PXKA 3QTRA 4XX9A 3QLGA 4E5BA 2VGPA 4AZEA 5IQDA 5AFVA 3NZ0A 4HVHA 2H8HA 2BKZA 2IW9A 2GNJA 5HE0A 4E20A 4ACMA 1SMHA 4PNKA 3NYNA 4M3QA 5KHWA 4YLKA 1G5SA 1YVJA 5DT3A 3G9LX 1KOAA 3RHKA 5LMKC 1LPUA 1E4EB 4O7SA 3REPA 3VUDA 4QMTA 4K33A 4NK9A 1OITA 4HCTA 2C0IA 3DBDA 4IWPA 2V58A 2OJJA 3OOGA 3QALE 4IADA 3BLQA 3OEZA 2IW8A 2R7NA 2V55A 3IOPA 1WBWA 2PU8A 3GQIA 3QXPA 2VTTA 4XG9A 3R01A 4ALUA 3MV5A 4FV3A 4O2ZA 3SW4A 1KSWA 3A7HA 4FL1A 1YHWA 3U55A 1FQ1B 5H9BA 3GU8A 5GIPE 5DPVA 4MV4A 4O7TA 1PXLA 4KSPA 4U40A 4CQEA 5EW9A 3ZU7A 3D4QA 2PL0A 4KSQA 4MWIA 5EQYA 2RF9A 5LMAA 5HQ0A 5HX8A 2XKEA 4MXXA 4Q9SA 4TYJA 4BDEA 1FPUA 4AFJA 3I81A 4GFMA 2F7ZE 4E7WA 3COIA 5ANIA 3R0TA 4LUDA 4R5YA 5AV0A 1XH5A 1MUOA 2CNVA 4MQ1A 3UJGA 3QQUA 3GP0A 3W2SA 4O4IF 2XIKA 4E4LA 4MV7A 1MRVA 3BCEA 4H58A 4ARKA 5CZIA 4ANQA 3P08A 4FL3A 3SOAA 3DQWA 3E3PA 2X9EA 4CG9A 1R0EA 2QLUA 2UZUE 1NT2A 5IDNA 3ITZA 2FPIB 3VPBA 3ZHPC 1SYKA 1ZY5A 2W6ZA 4IAAA 2Y7JA 3GOPA 3KMWA 5A4CA 2NU7B 4R7HA 2HENA 2I87A 4WA9A 3R71A 2I6LA 4FTUA 3TUBA 3NX8A 4FZAB 3EQPA 5A54A 2UUEA 3JS2A 4P7EA 4CD0A 4GJ3A 2E9OA 4L68A 5KE0A 3W2CA 1CE8A 2HY81 3PUPA 2XNOA 3PG1A 3ORMA 4EQCA 4L6QA 2BAKA 3G6GA 2VWWA 3ELJA 4BR3A 3EL8A 4FKWA 4PL5A 4LL0A 1XR1A 1PMVA 2QU6A 4M69B 1M2RA 2NRUA 2OIBA 5HG7A 4E6CA 5JGDA 4C5BA 2YZGA 2C6MA 4O0YA 1UU8A 1XJDA 3ORPA 4FE2A 2P0CA 4G6LA 4IZYA 4DFNA 4J1RA 4CRLA 3GLKA 4KKEA 5KMJA 4X0MA 3TNPC 3TUDA 2ITZA 2W71A 4OBOA 2YIYA 4FTMA 3H10A 1ZWSA 5IA3A 3OUKA 4MXYA 2ITTA 3ZRMA 4E4NA 3RM6A 2C5XA 3CP9A 4FIJA 4LQMA 4C2VA 1JKSA 4IX6A 3KXGA 4J99A 2YABA 2PVPA 3DU8A 2GPHA 3CJGA 4W4YA 5EYMA 2WTKC 5A46A 2XNPA 3BLRA 2O65A 5FD2A 4EI4A 3MJFA 1PJKA 2CKEA 3MPMA 1GLVA 3OCSA 4QMNA 1U5RA 3TKHA 3VS5A 2WMRA 3PWDA 2W7XA 4B6LA 4PV0A 2R3HA 3DAKA 2C5OA 4AE9A 2F49A 4L46A 1OIQA 4AOJA 4BDJA 4L45A 2BRHA 2OWBA 4IW0A 4YJOA 5A4QA 2W05A 1WR2A 1H1PA 1JSTA 3N9XA 1J1CA 4V05A 3MY5A 3PE1A 2W1EA 4QTDA 3VUGA 4IZOA 2XKFA 3AD6A 4ZSLA 5AUWA 1NW1A 4LOQA 1M14A 3LLTA 3R6XA 5HBRB 3MPAA 2B53A 3A99A 1H1WA 3EQBA 4C38A 4Y72A 2PVLA 3FZ1A 2W96B 3QF9A 4GEOA 5AX9A 3RCDA 1XH7A 4BZOA 4MV3A 3EH9A 4IAKA 3I7CA 3V6RA 2C3IB 5EDRA 1RE8A 5HTCA 5KBQA 2O63A 3CY3A 4FSMA 1CKIA 5JMSA 2I1MA 4FNZA 4D1XA 3EOCA 4H1JA 4EZ3A 1FBNA 4JQ8A 3RINA 3O7LD 2XIYA 2ONLA 4BICA 2I7QA 3P23A 4CTBA 3NS9A 4B8MA 5HV6A 5E1SA 1S9JA 2J90A 3DQXA 4ASEA 4C3PA 5A4LA 2ERKA 4UV0A 2Y4IC 3HUCA 3Q96A 3V8SA 5M07A 5E8TA 4DG3E 4BGGA 4JNWA 4KS8A 2J0KA 2WMAA 3CQUA 3CEKA 1OIYA 4I6QA 4E4MA 2F9GA 4ZOLF 4DYMA 2ZMCA 1K2PA 4LUEA 2NPQA 4DFZE 4DA5A 4XX0B 1JLUE 1VYZA 5M06A 2J0JA 3R9OA 3QUEA 1W83A 1IOVA 2GTMA 3COMA 2WQBA 4XZ3B 4ZHQF 1H4LA 1R1WA 4MWHA 2JDTA 3W1FA 2R3GA 2P4IA 1W98A 4RBLA 5CQWA 3PP0A 2YDIA 5CEPA 1O6LA 2QURA 3MIYA 5HO7A 4FUXA 5HEZA 3UQGA 3DGKA 4O0SA 2VTMA 2KULA 4KB8A 3RPSA 3ZZWA 3R63A 4HNIA 3TEIA 3OC1A 5J1VA 5HD4A 4EK5A 4QQTA 3F5PA 4XLIA 4BN1A 3GXLA 3U6JA 4HYSA 4RFYA 3DT1A 1ZMWA 4APPA 3R5HA 2VN9A 3GQLA 4M13A 4AF3A 3THBA 4EOPA 3PJ8A 2W6MA 1H8FA 2X81A 5AIRA 2VO0A 3AQVA 4BDHA 2DLNA 5IA5A 4HQ6A 2ZB0A 3QTIA 2HAKA 2A27A 2JDRA 5KUPA 2OI4X 2VTHA 3JUHA 1AGWA 1YHSA 3QTUA 3VS4A 2W6PA 2YM4A 3ID6C 4GIHA 1XH4A 4G6NA 5M53A 3UP2A 2C68A 3EMGA 4FSUA 1WFCA 4GFGA 2BZIB 2BAQA 3AG9A 4TWNA 5HBHA 5CVHA 5K9IA 4MKCA 3N4VA 3FYJX 4KINA 3MFTA 4L44A 3OUUA 2CGVA 2Q0BA 4IVCA 2XA4A 4A06A 4DEDA 4C4JA 2OFVA 5JQWA 4D5KA 4YSMA 1CDKA 4BCIA 2HGSA 4DBXA 2BVAA 1CKJA 4EORA 1MP8A 5IQCA 2Y0AA 2VWUA 3E5AA 4TRLA 2OXYA 1GSOA 4YAJB 5CASA 4M12A 3HAVA 4JG7A 1ZMVA 2PVHA 4EEVA 4YJVA 3FMKA 4OGRA 2NO3A 3FHIA 3N51A 5AV4A 1F5QA 1W93A 1IG1A 2W1CA 4AP7A 5EDPA 2XKDA 2PVFA 4M14A 2QOQA 4O0XA 3MBLA 3E8DA 5TKDA 4EWHA 5EYKA 2B52A 4NCTA 3U4WA 1ZXEA 4IAIA 4BYJA 3UO5A 4KBKA 4D2SA 4YJRA 4N57A 4ASXA 4IACA 2ZDHA 5JVDF 4CV8A 1BL7A 2GDOA 3NR9A 5J87A 3UE4A 4X2KA 4YHJA 4PNIA 3DBQA 4CZUA 2C00A 1JQHA 2G2FA 4FV1A 4GKIA 4KRCA 3GU7A 5KO1A 3R30A 4QMYA 4TYEA 5D7AA 5IZFA 3LKMA 4FOBA 4FSQA 2ETMA 1YI3A 4PMMA 1H0WA 4O96A 4IBMA 2CDZA 2XRWA 3QU0A 4M0ZA 3UPZA 2B1PA 2VAGA 5JRQA 1JBPE 3Q2MA 4U80A 3V4SA 3HRFA 4FV0A 1DV2A 3ODZX 4CG8A 3E92A 1KUTA 4YAKB 2WNTA 4O4LF 3HP2A 2R4BA 4AT3A 3BBWA 2VTQA 4YJPA 4A7CA 2IZTA 2QO7A 3O23A 4IH8A 4USDA 5EHLA 3BHVA 3DOGA 5ACKA 2BDJA 4I1ZA 4ITJA 3TIZA 2R86A 2ZJWA 3RK7A 4L1KA 1NA7A 5GNKA 3ZC5A 1W7HA 3FI4A 5C01A 3MH2A 3DAJA 5GHVA 1SVGA 3LFSA 1JSUA 3V6SA 3HA6A 5CANA 1LEZA 4FKSA 3LJ0A 3BLHA 2WXVA 3T3UA 3VF8A 4HNUA 1PRYA 4U8ZA 3FKLA 3ZUUA 1B6RA 4JJRA 1FMKA 4QNYA 3RFCA 4L3JA 4LV8A 4X21A 1PXMA 4G17A 2ZV8A 3UQCA 2ONLC 3R8VA 4MVFA 2WTIA 1URWA 4BCJA 4AA0A 1JKKA 2C0TA 2GCDA 1MQBA 2WAJA 2GU8A 1TQIA 3BE9A 3FC1X 5KBRA 2EVAA 3KMMA 4RZWA 4IB5A 3A2CA 1EHIA 4D4RA 3FUPA 3KC3A 4MD7E 5CI7A 4AW0A 3AMYA 2WHBA 3SOCA 4FTIA 1UKIA 5GJDA 3QX4A 1WBSA 4EOSA 5BPYA 5JN2A 5K4IA 3AW8A 5LMBA 4D0WA 4OTGA 2UZLA 4EQUA 3HYHA 3BQCA 2QOKA 3HKOA 4USFA 3OWPA 3HX4A 3ZH8A 4DG2E 5IISA 4CFVA 3AD5A 2GFCA 2VRXA 4XYMB 2Q83A 3LW0A 3CJFA 3TIIA 4RJ7A 1GIIA 4FFNA 4GG5A 4IX3A 3SAYA 5C8NA 4EBVA 3I5ZA 4RLKA 3A8WA 4XH6A 3S95A 2GNIA 2X9FA 1OGUA 2V5QA 3GCQA 4QP1A 3EWHA 3OUZA 4X3FA 5JQ5A 4FK6A 4O7LA 3LFBA 4FV9A 1A06A 3EQRA 3LCKA 5FG8A 2FO0A 1NY3A 3NVMB 3Q32A 2LAVA 2HELA 2PE1A 2YWVA 3HV4A 1UA2A 1PMEA 3P4KA 4LV5A 5HX6A 4ZSAA 1M7QA 3BWFA 4JAIA 4XBUA 5IH4A 1YDTE 3CKXA 3NNWA 4KBCA 3OWJA 4YGAA 2HW7A 4BGQA 3NYXA 2W70A 2V62A 4LM5A 3EFLA 3C0HA 1OBGA 2HJWA 3QD2B 5TO8A 4FVPA 5HICA 5ETAA 2WPAA 5L6OA 3OCBA 4YPDA 5ICPA 2BZKB 3UMWA 5D11A 3QUPA 4AN9A 5LOVF 1VJYA 3ZFXA 5LP6F 2JAVA 2HZ4A 3KULA 4CCUA 1Q4LA 3GNIB 4HPUE 1GAGA 3VUMA 5BVNA 2O2UA 3DV3A 4ZLOA 4AGDA 4B99A 3P86A 4QP8A 3KXHA 1O6YA 2QOIA 1SCUB 3PDTA 3VWAA 4OT5A 3MJ1A 5AUVA 4E1ZA 4XRLA 4K8AA 3TZ7A 5CT0A 3ZZEA 3QXOA 4LG4A 3DK3A 4WHZA 3POZA 4JDKA 1UWJA 3B2WA 4WBBB 4ZTQA 2CKOA 1E9HA 5B2KA 1W8CA 3ZEWA 4DCAA 3KL8A 4EOKA 3FLSA 5CU4A 1VKZA 2XKCA 5I9YA 2HWPA 3ZFMA 4DH5A 5EH0A 2I0YA 3D7TB 3MTFA 4N4SA 3PSBA 5AUYA 2ZOQA 3C4CA 1JKLA 3UNKA 2GMXA 4FV8A 4NU1A 5GIOE 3E8NA 3R7UA 2RFEA 3VW8A 2OZAA 1KJ9A 1Q61A 3W8QA 4M15A 5IUGA 2BROA 3D83A 2DWBA 3SKCA 1OIUA 3FMHA 1W82A 4NM7A 4FTRA 4U6RA 3BZ3A 2UW5A 2XF0A 3QLFA 5EM8A 4BCQA 4BDFA 4CLJA 3IW8A 3TNIA 4JT3A 4I5HA 4DC2A 3DY7A 3LQ8A 4BCOA 5CQUA 3R73A 2XJ1A 4PRJA 5L2TA 2OH0E 3E88A 5I9XA 2ZB1A 1IAJA 2GSFA 2R7KA 4AXAA 4AFEA 3V5PA 1XBAA 4PUZA 2XEZA 3RM7A 4J53A 4QTAA 3WZKA 4F70A 3VPCA 4DFXE 1M0TA 3BHHA 4OR5A 5HKMA 3G8CA 3QA8A 4MAMA 3BKBA 1E1VA 1WMKA 2PVYA 3OMVA 4ZS0A 3RGFA 2YIXA 4RVLA 2XK4A 1UNLA 5HTBA 4V0GA 2UZWE 4IB0A 4M8TA 4OUCA 5E90A 5CVGA 3UO4A 1EYZA 4GG7A 3WBLA 3W32A 3I7BA 3LCOA 3DK7A 3IONA 4O84A 4CTCA 3FKOA 1W0XC 4G9CA 4L3PA 1WBOA 2JIUA 4N70A 2I8CA 2NNWB 5I9ZA 4BDAA 1P4FA 1Q99A 5HI2A 4BI2A 1ZAOA 4GYIA 5ANGA 4L53A 4E4XA 3E87A 1OBDA 2AYPA 4TN6A 1BX6A 1Y8YA 3ZSIA 4TV8F 2GNFA 2J0LA 4KBAA 4ZZNA 2Y6OA 1V0PA 4L7SA 3UDBA 4BI1A 2J6MA 5HO8A 4BIEA 3AC5A 4PQNA 4ZIMA 4C2WA 3FE3A 2WTVA 2Y6MA 1LP4A 2XUUA 2C6IA 2C6TA 5T6KA 4BTFA 4EGQA 3BYSA 4UB7A 4DINA 4RWLA 4AACA 2WQEA 5EI6A 2WTJA 3UOLA 2PK9A 2CSNA 3MPTA 3KN5A 3F5UA 3DKGA 5CSWA 4RSSA 3QRKA 3OUNB 4FU0A 4WKQA 2YJSA 4XBRA 1CM8A 2PHKA 4D0XA 2OF2A 3EN6A 3NYVA 4II5A 5FQDC 4NH1A 1ZLTA 3ZO3A 3O50A 4NW6A 4DLIA 1YDSE 2ITPA 2JGZA 3EN4A 4YB8B 4I5CA 4IFGA 5H8GA 2W17A 3CR0A 5BPHA 4AW2A 3HNGA 4FKUA 2WTKB 4X3FC 2OJ9A 3PWYA 3VMMA 2J50A 4XCUA 2YAKA 3WIGA 4HNTA 4LRKA 1SZMA 4RX5A 5ACBC 3E8CA 3KKVA 2A0CX 4YP8A 1BLXA 4X2FA 1H0VA 2CGXA 5HBJA 3HLLA 3FZOA 4O0TA 2GQRA 2YIRA 4RFMA 2R0UA 3H9OA 1Z9XA 2CHLA 1QPDA 3IW4A 4DIMA 4ZMFA 4EHZA 2X2KA 4RIYB 2X4ZA 1WBTA 4XLVA 3UP7A 3SC1A 1BYGA 5H3QA 4EHGA 4F6SA 2VR1A 5KMIA 3EQDA 1YOJA 4GYGA 3W2OA 5KMNA 4HW7A 1B38A 3R2BA 4IWQA 3ALOA 5E8SA 2VTJA 4B0GA 5AM7A 3F6XA 4BCMA 4C58A 5J1WA 2GNHA 1VZOA 4O4HF 3RK9A 3EJ1A 4YBJA 4RIWA 1BNCA 2FPPB 2YHVA 5HLPA 4BHZA 5D7VA 1APME 1Q8ZA 2XNBA 3V5LA 4EOIA 3G6HA 4LL5A 4RZVA 5EHOA 2OXXA 1YXVA 4NKAA 4DH3A 5F4NA 4FIFA 4GU9A 4PTCA 5KX8A 3MIAA 1DI9A 4HNVA 3LE6A 2Y4IB 3CGOA 2O64A 3EQGA 5H2UA 2VO7A 5FGKA 2W6QA 3SA0A 1L3RE 3LVPA 1XBBA 3VNTA 5JQGF 4MXOA 3LLAA 4DFBA 2IZUA 3OT3A 4FV7A 1V0OA 4F6WA 3UIUA 5AP0A 3IGOA 2ERZE 2C30A 2WFYA 4C61A 5FP5A 5EFQA 5ANKA 3Q5ZA 3ANRA 1ZARA 2W5HA 3HP5A 2X1NA 3L8XA 2ZYBA 3LXPA 2E9NA 4FV5A 4AZVA 2IWIA 5CX9A 5B0XA 3D14A 2DUVA 4M67A 4TWPA 3R8LA 5HBEA 4U0IA 3MTLA 2E2BA 3FAAA 4TT7A 5F9EA 1OVEA 2VWVA 4L42A 5BYZA 4DH7A 5C4LA 3EZRA 4PX6A 4F9BA 4IM0A 4IB3A 5F95A 5C1OA 5CB4F 3QRJA 3GUBA 3ZMMA 5E9EA 1U54B 4S32A 4R3RA 4S33A 5E8XA 3Q1KA 4DEGA 1PXOA 4YJ3F 3BE2A 4Z9LA 1UNGA 4EC9A 3ETHA 3ZXTA 4FTKA 5EW8A 1OECA 2R3RA 4I21A 3ORZA 2ZM4A 3R1SA 5EI2A 3QFVA 2OW3A 3MFRA 3R00A 3ZSHA 2RFDA 4AS0A 4MNEB 4R1YA 1GGOA 2PVKA 4G1WA 2OH4A 4HCUA 1IA8A 3MDYA 3DDPA 2QQ7A 5C9CA 2ZV7A 4QTEA 5AUUA 5C8YF 4DLJA 2WMVA 2Y4PA 5JK3A 4JG6A 4FT7A 5K3YA 3ROYA 3PA5A 3GU6A 5DH3A 4NWMA 3HV5A 4RPVA 3D7ZA 3EQHA 4ACHA 3G0EA 3R21A 3VQHA 5DT4A 3ZO4A 4FEUA 4FT5A 2R3FA 3F5GA 4QYYA 3HDMA 3TI1A 3V3VA 3ORNA 3RZBA 1OL5A 4CT1A 2CGWA 3OY1A 2QHMA 4G31A 4MD9E 4K1BA 2JIIA 4U97A 4ZLYA 2V7OA 3LM5A 3VS2A 2W6OA 4I50F 4XG4A 4YTCA 3TJCA 3D2KA 3FMLA 5DFPA 4O91A 3ETAA 2BUJA 2ZV2A 1QL6A 3AT2A 4K0YA 3S4QA 3CBLA 3UOKA 4DFYA 5LWNA 4MBLA 1A9XA 3DB8A 5D8DA 4D5HA 5JKGA 3BHUA 1WBPA 3AC3A 1ZYCA 2X0SA 1JKTA 2BTSA 4F0GA 5JRSA 4AWIA 3UNZA 2X2LA 2HIWA 3G0FA 3MFSA 2CKPA 3SLSA 1M2PA 1ZYJA 4FNYA 3SXSA 2OIDA 4U7ZA 3TKUA 2FVDA 3VBWA 3RPRA 4GKHA 3PPKA 4HGLA 4I41A 3ZLXA 1URCA 1K9AA 3QCSA 3C4EA 5C1PA 2J51A 4USEA 4O86A 3I5NA 2IW6A 1GSHA 3VIDA 2YS7A 3CTQA 1OPLA 4I93A 3ET7A 4L7FA 4RWKA 5F1ZA 4BTMA 4EC8A 1IASA 1SVHA 3AT3A 3JR1A 3HZTA 5CZHA 3WE8A 4A9RA 2Q0NA 3MYGA 4HJOA 3R9RA 1WAKA 4AGUA 2J5FA 3CKWA 4X7QA 4QO9A 3V8TA 4QMVA 3PA3A 3BU3A 3NCZA 1FOTA 1P5EA 5FBOA 2CLQA 3NW7A 4QYEA 5BMMA 3S2PA 4F1OA 1T46A 4TWOA 3PY3A 3C4ZA 2R3LA 3HMNA 2F4JA 1ULZA 2ZM3A 3R9DA 2YM5A 2CPKE 3U51A 4D55A 4Z7HA 2ZVAA 1PMUA 4XV9A 4CCBA 4DTBA 5L2IA 4M0YA 3Q6WA 2BPMA 5EKNA 3ZCLA 2WU6A 2YAAA 4FIIA 2FSMX 4E5AX 4BF2A 4NKSA 4HNFA 3K3PA 3R7VA 4IB1A 1FINA 3K5HA 4G5PA 2HY0A 2CCIA 3GGFA 4WBOA 5BVDA 1S9IA 4YTIA 5CU0A 4R6VA 1CQIB 1M6VA 3FZSA 2BHHA 4FSYA 4AGWA 3PIXA 1A9UA 4HZSA 2X0GA 4AQCA 5AV3A 3KAJA 2EUFB 3QAME 4HVIA 2UW0A 5HIDA 4BCKA 3LIJA 5TT7A 2NU9B 4ANMA 5LJJA 1OUYA 4NYEA 4PWNA 4NZWB 3K3IA 3EHAA 2UZDA 4J95A 2Z60A 3GC8A 3VS1A 3PP1A 3R04A 4QOXA 1YRPA 4RJ8A 3AGLA 4C4GA 1E1XA 2YCFA 4DLKA 2QODA 2QI8A 2B9IA 3NIEA 4YUQA 4EKKA 4UX9A 3LXKA 5AP7A 5EOBA 5IDPA 3WF7A 2ITOA 4I92A 4LFIA 4NM5A 3I79A 4JDHA 4QP4A 3L9MA 4M84A 5E8VA 2QR7A 1QPEA 5BYYA 1DM2A 1WVXA 2ETKA 3Q9WA 3V5WA 4ENYA 4XV2A 4X6QC 3PVWA 4EOLA 4IZAA 5JH6A 2G2HA 3R28A 3QTWA 3RWPA 1O9UA 5J95A 2OF4A 5F94A 1OKZA 3IQ7A 3SXRA 1R0PA 4FTQA 4ZXTA 3TL8A 1H00A 1VBGA 2YISA 5CI6A 2F7EE 5DHJA 1JPAA 3W2PA 4C4HA 5KMKA 3L9NA 4IDVA 2B7AA 5DOSA 4JI9A 4JOAA 3P78A 3S1HA 3OWLA 1JVPP 1T36A 2UZVA 3VO3A 3RV4A 3NVKI 3FLZA 2XK3A 3MVLA 3TT0A 3PXYA 4FI1A 3GFWA 4KNBA 4AT4A 3K5IA 2BZJA 5AX3A 2BAJA 2FP4B 2WEVA 2YZLA 2JC6A 3VBXA 1V1KA 3TNQB 2QF7A 2C5VA 3UGCA 3UNJA 5KKNB 4EYJA 1Q24A 1OL2A 3MVJA 4QQCA 5AAFA 2CKQA 4Z3VA 5LVPA 2PN1A 2R87A 2W9ZB 1KC7A 2HZNA 4XP0A 1OL7A 3KQ7A 3LMHA 4FTTA 3RVGA 3ZM4A 4BVUA 3SE7A 4JIAA 3TG1A 2IG7A 4BGHA 4CKIA 5CEKA 3MFUA 4QYGA 2Y9QA 5HVKA 5IQHA 5HLWA 2FYSA 3GCPA 1KE8A 2SRCA 3QTSA 4FOCA 4M7IA 3IKAA 4O2AF 1OI9A 2J7TA 1DS5A 4XG6A 3Q2OA 2WTCA 5KZIA 4FC0A 4FL2A 1REKA 2WZJA 1UWHA 3C51A 2HXQA 4JG8A 2QO9A 2WGJA 5FEDA 3R8ZA 4GH2A 1EUCB 2XK9A 4OTRA 3C50A 3OW3A 2XZSA 4OTQA 4CGAA 2XM8A 1EUDB 4CMOA 3QWKA 4GT4A 4DEHA 4HYHA 3GCVA 3NNXA 4YZCA 4HGSA 4AN2A 1J1BA 4XUFA 2W5BA 3PIZA 1YHVA 3S3IA 3VBVA 3PPJA 4ASZA 3UO6A 4ZQIA 1OKVA 3FPMA 3N8DA 4HPTE 5CXHA 2IO6A 3FI3A 1YXUA 2XNEA 4ZZMA 1KWPA 4N6ZA 2VTPA 4P5ZA 4EBWA 1WBVA 4RVKA 4TNDA 4BRXA 4MBJA 3HECA 2X6EA 1PKDA 2BDFA 3JY9A 4L01A 4DN5A 4KD1A 4PDYA 4A4OA 4RJ6A 4WG4A 1J7IA 5DBXA 3TWJA 3NUPA 3WO1A 3CD3A 3DZOA 5I9VA 5FDPA 2C1BA 3FZTA 3LFFA 4BDBA 3VOTA 1FGKA 5FXQA 3EYHA 4YURA 3L1SA 2IVVA 2UZBA 3OT8A 4WIHA 5HNGA 4BTJA 4ZZOA 5CA1F 2IVSA 2UW8A 5FNVF 4J97A 2WQMA 3M1SA 3PZHA 1OIRA 3QFFA 1X8BA 4QMPA 5ANJA 2YM8A 3CSVA 3TACA 2DIKA 4BIBA 4NUSA 1XHAA 4QMLA 2G2IA 4GCJA 5HZNA 3MB6A 4K77A 3A62A 5FTOA 3R8MA 1WVYA 4G34A 4CKJA 2C6OA 3MS9A 3S00A 2IN6A 4FTCA 2RKUA 1WBNA 4FVRA 3WYYA 5E4HA 4E6DA 1JOWB 3ZOSA 1J3HA 4MX9A 3Q4TA 1SVEA 4P5QA 3U54A 5CALA 4A9SA 2HW6A 4KABA 3CPBA 4FFPA 2IVTA 2WMXA 3VS7A 3FLQA 1I44A 3ERKA 3F7WA 4ITIA 1KV2A 4O0WA 3BU5A 4TV9F 2EXCX 3MB7A 2XK7A 4CFFA 4RLLA 3UOHA 5CF8A 1H08A 2PUNA 2W1ZA 5CSVA 2BIKB 4FFLA 5ETIA 5IA1A 4MEDA 2PZRA 3KA0A 4I22A 3PY0A 1H01A 3NEWA 4XP3A 2YACA 3FMDA 4YZ9A 5EQPA 3PY1A 2F2CB 2R5TA 3Q9ZA 5AUXA 3BI6A 3OCTA 5D12A 2OJGA 4PDOA 4UY9A 3E7VA 5HORA 1KE5A 3DBEA 3EN5A 2QO2A 3BHTA 4YNOA 5DA3A 3OOMA 5E92A 1PYXA 2JKMA 3ZRLA 4H39A 1UU7A 3UG1A 2B9JA 4RJ4A 3FMJA 3HAMA 4GRBA 2PUUA 3DB6A 4GVAA 3SW7A 3FLNC 2XK6A 1H28A 3DK6A 4JS8A 4WNPA 1Z2NX 4O0UA 3ZO1A 4FT0A 4FKVA 4KKGA 4TNBA 1SNUA 3DBFA 4Y95A 5DVRA 3TV4A 4RX9A 3RNIA 3TDVA 4C4FA 3D5WA 3W2QA 2C3JA 2OSCA 4GU6A 1KJQA 3ZO2A 3SGCA 3FMMA 2ITVA 3SRVA 3DFAA 4CMTA 2W1HA 4J7BA 3RHXA 4DFUA 3RI1A 2Z04A 4MBIA 3Q4CA 1K3AA 4NSTA 5DWRA 3TDWA 3QYZA 4KA3A 5CSHA 4FTOA 3GVUA 5IUIA 4ERWA 4I94A 3FLYA 4AZWA 4C3RA 2ZAZA 3FC2A 3NW5A 4BBEA 4RZQA 3NPCA 5CNOA 4AOTA 3LP8A 1XH6A 3P0MA 2VUWA 4KAOA 4QMWA 3E3BX 3ATTA 5BQ0A 3AXWA 2WMTA 3RCJA 3F82A 3OG7A 3KXNA 4G3FA 3OY3A 4AZTA 3GCUA 2W9FB 4I6BA 4G3CA 1BKXA 4H36A 4TYHB 3I60A 3U6IA 2A1AB 3L9LA 2P55A 4ZSJA 4TXCA 5A3XA 4O4JF 2FGIA 5L3AA 3CE3A 4RIXB 3ETJA 3VBQA 1JSVA 1PHKA 4IZ5A 4S30A 2CMWA 4D28A 2YEXA 3KFAA 2VWZA 4U43A 4IM2A 3FQSA 2VWYA 3SQQA 3RPYA 2QOHA 3FI2A 1J91A 1Q8TA 5KMLA 5C03A 5B7VA 3R83A 4EOOA 2P2HA 4X6RA 4RA4A 4A9TA 2GFSA 2JD5A 1H26A 2JDSA 3O8PA 4QMOA 3LJ1A 5AP4A 3CIKA 4NJ3A 2WMQA 1VBHA 5M4UA 3OTUA 5LVNA 4UZHA 5I9UA 3IW7A 3LXLA 2XEYA 4DGGA 3JXWA 2X39A 3BG5A 3VBTA 4ZJVA 1YW2A 3FJQE 3A60A 5KCVA 3KN6A 1OKWA 1XKKA 4LRJA 1QPCA 5K5XA 5FXRA 2UZTA 4BY9E 3UIXA 4GJ2A 4WNKA 2XVDA 1M0WA 4IFCA 2QNJA 3MY0A 4XG7A 4EH6A 1OKYA 2WMWA 2C5YA 2UZOA 3Q9XA 2WMUA 3CGFA 2XB7A 4FX3A 4U3ZA 4RC3A 2V7AA 2OZOA 5CSXA 3HVCA 5HIEA 5IEYA 3NW6A 3LPBA 4APCA 3TTJA 4ACCA 3N4UA 3Q60A 4J8NA 5CF4A 3D9VA 3HEGA 3GEQA 3HA8A 4L3LA 4QQJA 5IQGA 3IO7A 1B39A 3BRBA 3T9IA 3IDBA 4EH8A 3ZUVA 1XH8A 5CT7A 2UVXA 5JFXA 4J52A 2XYUA 5HLNA 2YM6A 4DHFA 3FI8A 3R9HA 5AAGA 4H3QA 1KJJA 1Q97A 5IQFA 5BUEA 5J2TF 5T3QA 4X2NA 3II5A 4BC6A 2R64A 4LI5A 3E93A 3FMEA 3UIMA 1GIJA 3I12A 4MXAA 3TCPA 1Q8YA 1GOLA 5I9WA 4OTDA 1ZOGA 3ZONA 3O2MA 2HZIA 3Q4UA 1MQ4A 2RIOA 4MXCA 2HK5A 4EH5A 4GUEA 3TINA 1JNKA 2A4LA 4LMNA 4PL4A 3UVPA 2RL5A 5J5SA 1ZYSA 4QNAA 4ZJIA 4DT9A 4QPSA 5LCJA 4JBOA 1VEBA 2FB9A 2G9XA 3TW6A 3PRFA 3LZBA 3UODA 1CKPA 3LQ5A 1ZZ2A 4XMOA 5F20A 2YZNA 2EXMA 2X2MA 2E9VA 3JVRA 1FGIA 3JY0A 5FP6A 3T9TA 2YRWA 4ASDA 2C1AA 3V01A 3ZSGA 2WOUA 4H3BA 2ESMA 4QMMA 3V4ZA 3G90X 3F3WA 5LARA 4UYNA 3L8VA 5CS6A 3VHEA 4AG8A 3R5FA 3P7BA 4JIKA 3MVMA 2J0IA 4LMUA 5DGZA 1JAMA 4XV3A 2A19B 4F7SA 4X3JA 4YC8A 3OS3A 3WZDA 4AU8A 5A6NA 3E7OA 1KV1A 3UZTA 2Z02A 4OTIA 5CY3A 4BIDA 3M42A 4AOIA 2OXDA 4MV8A 4YJNA 4PL3A 4RA5A 2VWBA 4F9WA 1J7UA 2BRMA 4FT9A 4O38A 5CVFA 3DS6A 3U4UA 3RUPA 3UPXA 4E26A 2E9UA 4B4LA 3QTZA 4P2KA 2WMBA 5BVEA 3QD0A 2XIZA 2I80A 4FSRA 4KIQA 3KAKA 4H3PA 1Q3WA 1IA9A 2VO6A 5ITAA 3ZUTA 4EZ5A 3QZFA 4BCGA 5J9LA 1LEWA 4L67A 5ANDA 3FSFA 1DV1A 3PLSA 1CS0A 4F9AA 4CNHA 4NCTC 2VWXA 4ONAA 4EUUA 2YZAA 4CSVA 3CD8A 3W2RA 3R5XA 2BTRA 5J9YA 5EM6A 3DLZA 3H9RA 3K3JA 2WMSA 2PVNA 5B2LA 4GK4A 5LYJF 1OPKA 4GS6A 2YIQA 2IZSA 3BEAA 4XHKB 2QVSE 4D9TA 2C6EA 4TPTA 5CAEB 2F57A 3R7EA 1ERKA 2F7XE 3O8TA 5E8ZA 1QMZA 3RWQA 4FKPA 2YCRA 5EYDA 4JBQA 2OU7A 3I0QA 3U8WA 4FFMA 5JFSA 2R2PA 4ZTHA 2UVYA 3V5JA 4CXAA 2WIPA 3ZLSA 4H1MA 2GQSA 4TYGA 3VJOA 5IUHA 3FY2A 2V5AA 5IH6A 4F7JA 3AGMA 5AEPA 1KE7A 3EFJA 3O96A 3AC1A 4MXZA 2VX3A 3KCKA 3LFAA 4XP2A 4EOQA 5LXMA 4HR7A 4MYGA 5BPFA 4IDTA 2WTWA 4CFUA 3O71A 5HESA 4O21A 4AA4A 3QRTA 4FZFB 5HIBA 1U4DA 5JFWA 3CQEA 3VJNA 5DR2A 4G6OA 4C37A 3QD3A 2O3PA 3O0GA 5LCKA 4NM3A 5KMOA 2JKOA 3PXRA 5DMXA 2C5NA 2W1FA 3NWWA 3BGQA 3M2WA 3WZEA 3UQFA 3EN9A 4J8MA 3VQUA 3P7CA 4RFZA 5EI8A 2ZDGA 5M09A 2HXLA 4RVMA 4CV9A 3GC9A 3N4TA 4BDIA 1CMKE 2F2UA 3EQFA 4GT3A 5E7RA 3W16A 4CFNA 5BX0A 3A8XA 3OWKA 3FPQA 3SVVA 2X7GA 4U44A 2ZMDA 4EKLA 3Q9YA 4CVAA 3QRIA 5AV1A 2BZHB 3VBYA 3RP9A 1G3NA 1KOBA 4TY1A 5L2SA 5G6VA 3PXQA 4HOKA 2C0OA 4YLJA 2JAMA 3Q4ZA 4F9YA 4IJPA 3TNHA 5IA4A 2UV2A 4NTSA 1YQJA 4IAFA 2YCQA 4IVAA 3PYYA 1F3MC 1VYWA 1H25A 2X6DA 4I20A 3ORXA
chains in the Genus database with same CATH superfamily
2PPQA 2GNLA 5M51A 4MA5A 4XS2A 4IIRA 1MRUA 2GHMA 5DNRA 4XOZA 4DBNA 5TF9A 4NZMA 4FYOA 3OXTA 3V8WA 4S31A 2ITXA 3BU6A 3QC9A 3RMFA 3R2YA 5AP1A 1EH4A 1P2AA 3C13A 1KBLA 2OO8X 5M08A 2WQOA 5AV2A 3O8UA 4FKLA 3D7TA 3LMIA 5HE1A 1KE9A 4H05A 3BYUA 3NCGA 4D1SA 4I4EA 4QTCA 4JR7A 2QOOA 3QTQA 3U9SA 3AOXA 3VS0A 3JZ6A 3FZPA 5HNEA 5FM2A 1DAWA 2R7MA 4I5PA 3UFXB 5K4JA 2PZYA 3CTHA 3GT8A 3V04A 3LCDA 1A48A 4FIHA 3NRMA 4IHPA 1YXXA 4ORKA 5M4IA 4KWPA 4L8MA 2JBPA 4UZDA 2J4ZA 2OKRA 3RJCA 4EHEA 4K18A 2QK4A 2XCLA 5IQBA 3BGZA 4FTAA 3UVQA 5KKRC 1B04A 4JAJA 4F9CA 3T99A 1FMOE 3BEGA 3C5UA 2WEIA 3LQ3A 3QHRA 5AMNA 4TM5A 2C47A 3EZVA 2J0MB 3DXQA 3SNOA 3ZLYA 3L9PA 1DAYA 5DRDA 3T3VA 4N0SA 3SDJA 4TWCA 2CZGA 4FR4A 2WQNA 2YYAA 2BFXA 2VV9A 2QOFA 3BELA 5DT0A 5BMSA 3TZ9A 3NNUA 4EK3A 4GLWA 2CNQA 1YWRA 2QKRA 4ITHA 4EUTA 1CKOA 4TYIA 2W1DA 2ZDTA 4O0VA 4RIOA 5CAUA 3G51A 4C4IA 2FSOX 4MK0A 4B9DA 4OTHA 5EM7A 1M2QA 3HMMA 3MH3A 1I2LA 4ZI7F 2B54A 3QA0A 3CC6A 4MV9A 3WF8A 3H30A 3UYTA 4FEWA 5AA9A 4Y73A 4O7WA 4BB4A 1STCE 3R22A 1RJBA 2W4OA 2VTOA 4U9AA 3UVRA 4ENXA 4EONA 5I5ZA 2O8YA 2XBAA 4FTJA 1GZNA 5KZ0A 5C26A 4O7RA 4UCRA 3FDNA 1HCLA 3FXXA 4HVDA 1EKFA 5JQ8A 2YZMA 2VTAA 3UG2A 3IDCA 3F61A 3HRBA 5EKOA 3QQHA 3KK9A 1PXIA 4GIIA 4D1ZA 1W84A 1U5QA 3PG3A 4JR3A 5C1QB 2PE0A 5CAPA 4EK8A 4YTFA 3HBLA 4I55F 4FSWA 3BQRA 5CEOA 5C4KA 5IH5A 3C4WA 4U3YA 3B8RA 4ANSA 4WT6A 5DLSA 3SV0A 4OTWA 2P33A 4ALVA 4DH8A 1YI6A 2R3NA 3W0MA 1VLRA 5J9ZA 5L6PA 2YDKA 3FY0A 2B55A 2I0EA 3TJDA 1RW8A 2LGCA 4RQKA 5D1JA 4YU2A 2ZV9A 5HCZA 4PF4A 4BJJA 2XMYA 4RWIA 1CQJB 4X2JA 4AUAA 1I1KA 3R9NA 1RQQA 3C0GA 4EOMA 2I40A 4BBMA 2PZPA 5HG5A 3A61A 1H1QA 1ZOHA 2R3QA 2XH5A 3PPZA 3POOA 4JX3A 3QZHA 5L8KA 3MA6A 3OZ6A 2WOTA 1H27A 1KTAA 1ND4A 4PMPA 3LWBA 3QYWA 4FZ7A 4U41A 4IM3A 5M4CA 1M7NA 1Q8WA 3NUUA 4YHTA 1UC9A 1BUHA 3H0ZA 3PA4A 5CF5A 3AC2A 4G3DA 3QGYA 3RPOA 4F0FA 3RALA 5AP3A 5AA8A 3B2TA 4FEVA 1ZY4A 4Y85A 4JBPA 4DEBA 4BZDA 4MD8E 3VN9A 4Y46A 1WCCA 4FG8A 3WF6A 4UN0C 3OVVA 4U79A 4V04A 5CAVA 3RR5A 3KGAA 3ORKA 2OIQA 3RAHA 4ZLZA 3QQJA 4ZS4A 3S0OA 2DZDA 3GC0A 3NLBA 3QX2A 5AP2A 5FTGA 4F65A 2XCHA 5BWRA 4HGTA 3M11A 1U59A 4AN3A 3TUCA 3BA9A 1U46A 2QOCA 2UW9A 3TKIA 3TZ8A 5ANEA 4D4VA 3G8DA 4RIYA 2FA2A 2OLCA 2W5AA 4RX7A 2KTYA 2BRNA 3QQLA 2JKQA 4IAYA 4FZ6A 4RWJA 3OD6X 5I47A 4WO5A 2REIA 5FUTA 4MF1A 3HB9A 3L2PA 4D58A 5CU3A 4OTFA 4ID7A 1XH9A 2PMNX 3KB7A 4MCVA 3OFMA 3UDSA 3KF4A 4YSJA 1TKIA 4ZSGA 5DEYA 2FSLX 1JKJB 1KT8A 1IOWA 1OM1A 3C5IA 3A7IA 4IIJF 2HYYA 3UZOA 4I6HA 2R7BA 1M17A 2UW3A 2ACXA 5CF6A 4LH7A 1YXTA 3UZPA 4LRMA 1PXJA 1L8TA 3F7ZA 4AXDA 5KS8A 3LCTA 3W5OA 1X9NA 1Z5MA 4JQ7A 3PVUA 2ZDQA 3ATSA 3WYXA 3CLYA 3WIKA 3QWJA 3WILA 3EFWA 1GY3A 3I1AA 3V5TA 4RG0A 3ORTA 4AW1A 1LUFA 5AP5A 1ATPE 2C3LA 1KJIA 1JLLB 4AAAA 2PTKA 4EYMA 1GZOA 4Y5QA 3DDQA 2P2IA 3RV3A 3LFQA 4QTBA 2AC3A 5A4TA 3PLAE 4WSYA 2OICA 4QP6A 2PY3A 4RJ3A 3VRZA 2RGPA 4ZTRA 5GJFA 4BCPA 3AMBA 4FKTA 4YBKA 3KXMA 4E4TA 2SCUB 3MI9A 3PIYA 4L9IA 3U87A 3SG8A 4F08A 1Q62A 2R3PA 1UU9A 4R7IA 3NAYA 4FMQA 3JYAA 4IVDA 4R3PA 4ZSEA 3HO8A 2OGVA 3KRRA 1U54A 3NSZA 3D2IA 3PTGA 4DEEA 1UNHA 3Q53A 3U9TA 1GZ8A 4M68A 4YPSA 1PK8A 3QHWA 2QOLA 4ALWA 3EFKA 5DE2A 4WG5A 4W4VA 3Q2JA 3CXWA 2VD5A 4O6LA 4QYFA 3LFNA 1T45A 2QONA 4WD5A 2PMIA 1Y91A 4DH1A 3F2AA 4Q2AA 3IDPA 4GK3A 3C0IA 4EQMA 4EFEA 3DXPA 4MNEA 4RT7A 2QC6A 5I5VA 4IHJF 4P4CA 3PE2A 2R82A 3QUDA 5L6WL 3QL8A 3DKCA 1AUXA 5ANOA 5IQEA 2R7LA 4FKOA 2R3MA 3UC3A 5HVJA 4C59A 2W4KA 4FGRA 3NFFB 3AX6A 3F3ZA 4ZJJA 4GL9A 1IAHA 2QLQA 4I0TA 2BCJA 4O82A 4PY1A 3V51A 4A4LA 3MWDA 5GONF 3C9WA 4JBVA 5C27A 3DTWA 3GI3A 4ANLA 4QP3A 2VPQA 2WYOA 3A7FA 4BDDA 4E6NA 5AWMA 4CKRA 1IR3A 4HYIA 3VA7A 4I6FA 2XALA 3IG7A 3KF7A 2RFNA 3QQGA 3GCSA 3AKLA 4MNFA 3C4XA 4DDGA 2ZM1A 4GT5A 2Z7QA 4DITA 3NUAA 2EB3A 2GS2A 4FBXA 4EH4A 4EJ7A 4EL9A 3H4JA 1XWSA 1CKMA 1E4EA 3DAEA 3KVXA 3LFDA 3PVGA 3GOKA 4OBPA 5EHYA 3MW1A 3FBVA 5D9HA 4CKCA 3LJ2A 4FNXA 2R7IA 2FSTX 3K5VA 3FXZA 3K5UA 4DEAA 5HG9A 4F1TA 1J7LA 3DJ6A 1IEPA 2ITUA 1H24A 1OPJA 3BPRA 3G2FA 3VS6A 4K9YA 3HL7A 4A9UA 4PP9A 3HRCA 2VNYA 4FYNA 5G1XA 3T8OA 3WI6A 2PWLA 4OLIA 3RAKA 3QCQA 1REJA 3KXZA 3ODYX 3OBJA 5LVLA 2JFMA 4WNOA 4Q5HA 2GS7A 1PY5A 2H6DA 2XYNA 4EH7A 3BACA 3D5VA 4GW8A 3QGWA 4BDGA 5A9UA 4DG0E 5FTQA 4C02A 5DR9A 5CEQA 2YWPA 5JT2A 2YA9A 4MTAA 4FV2A 4P90A 4F0IA 2R84A 3G33A 1TQPA 2ZDUA 3TMOA 4D4YA 3L8SA 4DFLA 2ITQA 5IG1A 1OUKA 4K11A 4F64A 2W1GA 3QTXA 5CLPA 2V22A 3OF0A 3TV6A 3UBDA 3Q04A 1GNGA 2FUMA 3GU5A 3R02A 4UWCA 4ZY4A 1AQ1A 2R3IA 2VU3A 4JDIA 2UW6A 4M97A 5TOZA 4EJNA 5I0BA 3L8PA 3TZMA 5HNIX 4F7NA 1Y6BA 3LAUA 1PMNA 3ZEPA 2WO6A 4JXFA 4E93A 2A1HA 3FHRA 2GPSA 3ANQA 3BIZA 2C6DA 4UXLA 1B6SA 3IPHA 3O7LB 4C5AA 4CMUA 1GZKA 4XG3A 3VULA 5CEMA 1ZZLA 4C4EA 5CNNA 3U9NA 3QC4A 2JBOA 4KUJA 2VWIA 1H1RA 4FEQA 4FZDB 3VUIA 1GIHA 3NIZA 3I6UA 3VVHA 3ORLA 2O5KA 5HGIA 5CAQA 2VQDA 5EDQA 5FEEA 4TKSA 3F69A 4FKGA 2H34A 5BVOA 5IF1A 1DIKA 3DTGA 1NXKA 5JVLA 5CXZA 4U45A 4Z7GA 5BMVF 2RG5A 4GVJA 4XRJA 4WUNA 4FFRA 3KU2A 1OB3A 3UDTA 1Q8UA 1JDEA 2BR1A 2YN8A 4O81A 3R7OA 3R7YA 4RC4A 4ANBA 3DBCA 2JDOA 1XQZA 3F3VA 1Y57A 3COHA 2VUGA 1WVWA 4L00A 4O2PA 2VX0A 3F3TA 5J8IA 2BRGA 3W8LA 2H9VA 4CKEA 2VO3A 4YO4A 3ZRKA 5KNJA 3DA6A 4FSTA 4E6AA 5KX5F 3OTVA 4F4PA 4A07A 4C7TA 3FZRA 2W99B 3F2RA 5FXSA 2I0HA 3Q52A 3W55A 3NUYA 5FEQA 2VZ6A 1OMWA 3GENA 3MESA 5M44A 3F9NA 3TM0A 4WRGA 4GV1A 3VAPA 3FYKX 4TW9A 3SRVB 2A2AA 4XEYA 2IPXA 4UALA 3QZGA 5D10A 4IC7A 4CFMA 1SNXA 2JEDA 1KJ8A 1A0GA 3PXZA 3TQTA 1R78A 3HMOA 2B9FA 3C4FA 4WRSA 3CS9A 2JDVA 1HCKA 2YM3A 3OHTA 3QCYA 2CCHA 2NP8A 3Q6UA 4O2BF 2PUIA 3WOWA 1FVTA 1YDRE 4Z16A 4J71A 2WKMA 3W33A 5CSPA 3BGPA 3RPVA 1EKPA 4YJ2F 4S34A 5E8WA 2X8EA 4YMJA 5AJQA 2QU5A 3LHJA 5AP6A 3FMNA 3RAIA 2XP2A 2JFLA 4JL9A 4AZSA 2PMLX 1O6KA 3BBTB 4DEIA 3PZEA 4LYNA 3HV6A 4JDJA 2BRBA 5A4EA 1GSAA 4YJUA 4UEUA 4Y8DA 3RTPA 3UOJA 2IVUA 3QD4A 2UW7A 5LOHA 1BMKA 5H8EA 3RKBA 4DF3A 3D5UA 3P7AA 3QBNA 5CU2A 4EZ7A 4IQ6A 3NUSA 3PXKA 4I3ZA 5EM5A 3SG9A 5HU3A 3ACJA 3VUHA 5BNJA 4MV1A 2XNNA 5IYZF 3ULIA 3KYHC 4YZBA 3UMXA 5AUTA 3NUXA 1YKRA 2JIVA 3PRIA 3W0OA 2W1IA 4G3EA 5J2UF 4TZRA 3BWJA 3QKLA 4IWDA 2OFUA 2UW4A 3AMAA 3AC8A 3HDNA 4NIFB 1JDBB 4AXEA 2PSQA 3K54A 3MWUA 5CWZA 1C3OA 3ORQA 4FUYA 4C3FA 4L43A 3F88A 4YBZB 3A7JA 2AUHA 4BDCA 4E8AA 2PUPA 2FH9A 4R7BA 1DGSA 3G5DA 4R5SA 5M4FA 2HCKA 4QMUA 4EH9A 3R1QA 4EH3A 3FL4A 5DN3A 3ZDUA 5IA2A 4BCNA 2VGOA 3HGKA 2BFYA 2DWCA 1FVVA 3AT4A 2HGXA 3H0YA 4TTHB 3QKKA 4IE9A 4CLIA 2DS1A 3ENMA 4G9RA 4AE6A 4HYUA 4PMTA 2YJRA 2C4GA 4I23A 3ZDIA 3EIDA 1W96A 3HMPA 3DCVA 4PZ8A 1I7LA 5M57A 3C1XA 4K2RA 4RQVA 4BHNA 2NUAB 3BX5A 4IWXA 4C62A 5DYJA 2V59A 1G8AA 4UBAA 2VTRA 3EN7A 4WG3A 3ZM9A 2EWAA 3MVHA 5H8BA 5IEXA 2OG8A 3FKNA 2Z7LA 4IWOA 4X3FB 3BYOA 2QG7A 1Q3DA 2UZNA 3U6HA 3R23A 4G16A 5HVYA 3SD0A 4KKHA 2YERA 5EW3A 3ROCA 4A4XA 2B0QA 3ORRA 4R1VA 3IECA 4BBFA 1YOMA 5KKRB 3FEGA 3T9DA 2ITYA 4FV6A 3R7IA 2YS6A 1H1SA 1M52A 1YWNA 3DLSA 2Q2TA 5TR6A 3RK5A 4QT1A 2XM9A 4EK4A 1UU3A 4RVTA 4C35A 2PYWA 5K5NA 3UYSA 4XG2A 3P5KA 1UKHA 3IW5A 3EL7A 5IA0A 3CY2A 4G2FA 2ABJA 4NW5A 4DE4A 2QOBA 4ACDA 3FQHA 4JLCA 5AUZA 3CPCA 1PW2A 1UVRA 4X2GA 5T68A 5FRIA 2CFMA 3KULB 3PXFA 4DT8A 4D9UA 5HD7A 5LQFA 4IAZA 4KS7A 2X7FA 3ML1A 5I5SA 4C5CA 4EOJA 2W0JA 5M55A 1UV5A 3W0SA 1P4OA 4BCHA 3LCSA 3NNVA 1C30A 3UTOA 5FR9A 3UC4A 4GK2A 2R3KA 5EK7A 5LVOA 3Q3BA 2W4JA 5IEVA 5J7HA 1I2KA 4QEBA 5KMMA 5CAOA 5C8KA 3H3CA 3DF7A 3DJ7A 3BL9A 1YOLA 2PBZA 5CU6A 4D2RA 2CJMA 2BMCA 2NRYA 4HVSA 5BWTA 5CENA 4ERKA 2VTSA 2GQGA 4IC8A 4PTEA 4XYFA 4AGCA 2XD4A 3LXNA 1ZOEA 2XCKA 1I7NA 4RGJA 3P5JC 4CFWA 3I4BA 3JRWA 4WOVA 3WF5A 4YZMA 4GMYA 5C8MA 5ETFA 5I5TA 2H96A 2OZAB 2Z7SA 2RG6A 4W8EA 1WRVA 1R3CA 3MWEA 3PJ3A 5FLFA 2PVMA 3UZRA 4IWYA 2GHGA 3NDMA 4AW5A 4HZRA 2IJMA 2PZIA 4NM0A 1YWVA 3DTCA 3FWQA 5JEBA 1CKNB 3LMGA 3LFCA 2BKKA 3NYOA 4YZNA 2CNUA 4QSHA 3VNNA 5I5YA 2BALA 3QQFA 3B8QA 2P3GX 2OK1A 4YC6A 4CFXA 5B2MA 4C0TA 2QCSA 3DKFA 4FT3A 4HCVA 2GLTA 2G1TA 3DNDA 5CTPA 2PVJA 4AX8A 4IVBA 3E8EA 1OL6A 3KRJA 5FBNC 4KRDA 4ZMEA 2DYLA 2J5EA 2VTNA 4I24A 2R3JA 5E91A 1B6CB 2XIXA 3QKMA 4ZOGA 4YNEA 4QQ5A 3MH0A 3PFYA 5FDXA 5HU9A 1ZRZA 2WU7A 3OCGA 4PMSA 1TVOA 4EHVA 4V0GB 2GNGA 3ZBXA 4FA2A 1QCFA 4AT5A 4TUYF 4XNEA 4R78A 4TYHA 3PUFC 3PSCA 4NTTA 4QYHA 1NVRA 5BVWA 2YDJA 2FPGB 3FXWA 4RIXA 3JZIA 2C6KA 2YIWA 4YC3A 4JVGA 4QDEA 4BDKA 4QPAA 4XV1A 3OROA 3MH1A 4F63A 5AIKA 3ZTXA 2COJA 4FVQA 2J9MA 1KEEA 2J2IB 2Z8CA 3IK3A 4EG0A 4BZNA 3BYVA 4O0RA 5JGBA 3TV7A 3I0OA 2R0IA 2BHEA 2QR8A 3D0EA 3ENHA 4B7TA 3WWIA 1OL1A 5IQAA 5LA6F 3DFCB 3G15A 2I0VA 3MA3A 4WUAA 4DGNA 3BHYA 3F66A 1I1LA 3VUKA 3T9BA 4K6ZA 5BUJA 3N6RA 3K2LA 3F2NA 4O83A 4O7ZA 1DI8A 4M9UA 3KRWA 2IZRA 4YZDA 3NMUF 2RFSA 2XJ0A 2YCSA 1BXRA 5HHWA 2XNMA 3KREA 1R39A 5D41A 3ZFYA 4IANA 3CEBA 1BI8A 4EFBA 5IMXA 1I09A 4D4SA 3DKOA 1NVSA 4NFMA 3VONA 3KRXA 5A14A 3KK8A 4F6UA 1GJOA 2OJIA 2DAAA 3QCXA 4UCUA 5CA0F 1ZMUA 3KY2A 3PVBA 4FG7A 4IX5A 3GC7A 4FIEA 3FSKA 4PTGA 4Y5HA 3RAWA 2COGA 3LFEA 3P9JA 2FB8A 4E6QA 2ETRA 2HOGA 3KCFA 1G8SA 5DRBA 2Y8OA 3TNWA 4AQKA 3JRXA 3BV3A 3AD4A 2DQ7X 4I4FA 1PYEA 2VNWA 2XJ2A 1OZ1A 3F5XA 4FIGA 4FKIA 3CQWA 5EG3A 3TXOA 2WIHA 3DPKA 3SX9A 3ZC6A 4XYLB 3WNZA 2VX1A 5CYIA 3CCNA 5EZYF 4XOYA 1HOWA 2XAOA 3W18A 2G01A 4A9YA 4CT2A 4JQEA 5DI1A 1PX2A 1MRYA 3NAXA 1Z2PX 3ACKA 4I0SA 2AC5A 4ZTMA 1RDQE 3DNEA 2G15A 3HUBA 3D15A 3QQKA 1LR4A 2JLDA 2PVRA 4FG9A 3COKA 4YJQA 4ZK5A 1Z2OX 4JX7A 2EU9A 3IS5A 5DIAA 2OBJA 4LOPA 4AA5A 3VF9A 4JRNA 3JSLA 3W10A 2WD1A 4O7YA 5KHXA 3ZYAA 1BI7A 3EQIA 4GUBA 2CN5A 4QMXA 4EH2A 2OLSA 3IGGA 4DHZA 3FV8A 4FTNA 3GBZA 4TL0A 4ZP5A 4ZTLA 4Y83A 3C7QA 4UXQA 3IOKA 4F7LA 4ZAUA 4BTKA 3JPVA 3PFQA 2E9PA 4RIWB 2Z7RA 3MN3A 1FVRA 1AD5A 5A6OA 2XIRA 5M56A 3FL5A 4RRVA 4YJSA 3OXIA 4BYIA 4QMQA 3FLWA 5E8YA 3RTXA 3U9CA 3E5NA 2XS0A 3MY1A 3KMUA 3ULZA 2NU6B 4DGMA 4WBNF 2C69A 1SM2A 3KVWA 5GINE 4W4XA 5HE2A 4LH6A 4GFOA 3E63A 4FODA 4FSNA 3OXZA 4UWYA 4I0RA 4IJ9A 3F3UA 5I4NA 2ITWA 3KXXA 3P1AA 3W0RA 4KIOA 5EYCA 4ZY6A 4DGOA 3PJ2A 4I5MA 1ST4A 4MHAA 2GPWA 3PJ1A 5IQIA 5EQEA 3NC0B 4DTAA 5LWMA 5BUIA 5LMKA 4QP2A 2YW2A 1PKGA 3UYYA 2YITA 3WE4A 1P14A 4LGHA 3EQCA 2GTNA 4J98A 3ZS5A 4DAWA 2BILB 2X8DA 5HG8A 3KEXA 1ZAUA 4EGJA 3A4OX 2EIYA 5BVFA 2B4SB 1EZ1A 2JITA 2QKWB 4F99A 3D94A 5DG5A 5HCYA 4W4WA 4XG8A 3BYMA 1Y8GA 2W06A 4CEGA 4U5JA 5DISC 4PDSA 4S2ZA 3D5XA 4QRCA 5AADA 4NT4A 2GHLA 3CTJA 5LVMA 2Z2WA 4MH7A 5IPJA 4MV6A 2CGUA 4DQNA 4OW8A 3VW6A 3BABA 2CN8A 4FKJA 4N6YA 3QRUA 4LGGA 1CTPE 4WNMA 1Y6AA 4NJDA 3PSDA 4FK3A 2YL2A 2XNGA 3E64A 1WZYA 4RC2A 2NU8B 5AAEA 5JGAA 3QZIA 4QP7A 3JVSA 4ZY5A 1Q41A 5D1OA 4IEBA 3P79A 5ETCA 4FNWA 5L2WA 5H80A 3SHEA 3R8UA 5JH7F 5CEIA 4Z55A 2X4FA 3OBGA 2XBJA 2C6LA 3BL7A 5DR6A 4DCEA 4ZEGA 4OBQA 4UWBA 1BL6A 4YHFA 2IP4A 4Y8VB 3WZUA 3ZXZA 4C34A 4MQ2A 3E62A 4MAOA 5JZNA 5IMEA 1TQMA 5JFVA 4OT6A 3GIDA 3H9FA 4HGEA 4BI0A 4FKQA 1YXSA 2XANA 3AC4A 3HV3A 4JRVA 5E1EA 2O0UA 4L52A 4FICA 4O22A 2OJFE 4UCSA 1PXPA 3FQEA 4ZTNA 3HV7A 1VR2A 4QDVA 4IMYA 2WTDA 2HWOA 4F1MA 4HVGA 3GU4A 4KIPA 4CZTA 4YR8A 1XO2B 3WARA 3S24A 3TIGA 2V0DA 3VHKA 4LOOA 3DXNA 2QD9A 3DJ5A 3R1YA 5HCXA 2B9HA 3TN8A 1OGYA 3WWJA 4O7VA 2XRUA 3UIBA 3JSNA 3EKKA 4J96A 1CSNA 4G3GA 4O7NA 3WZJA 3A4PA 4PDPA 1H07A 3KRLA 3ORIA 1YI4A 3A7GA 4FKRA 4NL0A 5DEWA 2VTIA 5HNBA 5EOLA 4E5WA 1XBCA 3I6WA 4QP9A 5GJGA 1Q5KA 2YM7A 3VRYA 3VS3A 3R8PA 2BIYA 3LM0A 4UYAA 5AM6A 2BDWA 1PF8A 4ZTSA 4C36A 3IW6A 4CRSA 4XJ0A 2UVZA 3NGAA 3TTIA 1PXNA 4GSBA 4QMSA 2WELA 2QHNA 4QMZA 5L8LA 3MSSA 4F09A 4E73A 4W8DA 3ZLWA 5BYLA 2W6NA 5HE3A 4IX4A 3JZFA 4V01A 1F0QA 1AUVA 2X7OA 3DZQA 2UZEA 4DGLC 2PE2A 4RMZA 4FFOA 2JKKA 2ITNA 2X8IA 4FGBA 4G5JA 4Q9ZA 5L8JA 5LXTF 3EYGA 1QPJA 3KALA 3HMIA 3HT5A 1ZYDA 3MGYA 3OEFX 4B8LA 4F78A 4MA0A 5JZJA 3EKNA 3G9NA 4DTKA 3NUNA 4R3CA 5JSMA 4ME6A 1V0BA 3GB2A 4U81A 3Q5IA 4FTLA 2P0AA 2WB8A 5IU2A 2PMOX 1KE6A 4EK6A 3GFEA 4NFNA 4Q5EA 2EB2A 3V5QA 3GDEA 4YLLA 2CLXA 3R1NA 3OW4A 4EWQA 4RJ5A 2PZ5A 4I4TF 4YO6A 4ACGA 2YRXA 2R3OA 3WF9A 1NVQA 2HZ0A 3ALNA 3SXFA 4YJTA 4FV4A 3WO0A 2QG5A 4BKJA 4C33A 2C3KA 4FEXA 2XK8A 4YTHA 3BV2A 4U42A 5FM3A 3TIYA 2GS6A 3PJCA 2R9SA 1IRKA 2YFXA 4FSZA 3LOKA 4PP7A 4O6EA 4O27B 2R85A 5E8UA 4AZFA 2VTLA 3MJ2A 3EB0A 1Z57A 3O51A 4R77A 5BVKA 3VC4A 1TAEA 2PULA 1JWHA 3OP5A 4RX8A 4BCFA 3ZBFA 3O17A 4IZ7A 1PXKA 3QTRA 4XX9A 4RCNA 3QLGA 4E5BA 2VGPA 4AZEA 5IQDA 5AFVA 3NZ0A 4HVHA 2H8HA 2BKZA 2IW9A 2GNJA 5HE0A 4E20A 4ACMA 1SMHA