3U54A

Crystal structure (type-1) of saicar synthetase from pyrococcus horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
227
structure length
225
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of SAICAR synthetase from Pyrococcus horikoshii OT3: insights into thermal stability
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 70
structure length 225
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3u54A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3u54A02
3QRKA 4RLLA 3BIZA 5FG8A 4X3FC 4I50F 4AS0A 5I9YA 1JKSA 5GIPE 2YWVA 4FL3A 4JG7A 4FTUA 5EYKA 2XM8A 1E4EB 3BV2A 1Q97A 4M8TA 4EH8A 1ZZ2A 4FIEA 4EH5A 3R9HA 3D7TB 1UKHA 3NPCA 1TQIA 3EWHA 4UALA 2WD1A 1OKVA 4IQ6A 3TV4A 4IHJF 1Q99A 4JIAA 5A54A 4FV8A 3MWEA 4G5JA 4QP8A 4X2GA 3BX5A 4FNWA 4F9WA 5A3XA 4CCUA 4F6UA 2QO7A 3ZLWA 3N6RA 3EL7A 3G5DA 4JX3A 3ZO1A 3ZFXA 2RGPA 2UZDA 3COKA 3GU6A 3SE7A 1H01A 4QMXA 4ACGA 5HVYA 5C1OA 3MESA 4NJ3A 2QHNA 4D28A 4MNEA 5BVOA 5AIRA 5L6OA 3UG1A 4XUFA 4XRJA 5EW3A 1Q5KA 4MH7A 5EHOA 5HD4A 2PVHA 3OUUA 3U9SA 4XG3A 5HG5A 1M52A 3HEGA 4PY1A 2H6DA 4BKJA 4ZOGA 5HKMA 1Q8TA 4U41A 4MKCA 3MVHA 1GOLA 4R5SA 5CLPA 4ZZOA 1KE8A 1KWPA 3UODA 1PXJA 3I0OA 3DT1A 3HZTA 4FTQA 5CA1F 3JY0A 2W1HA 3PVWA 5HIDA 2R82A 1IA9A 3TW6A 2A0CX 4LL0A 4EK4A 5CAPA 3ATSA 3MA3A 5FEQA 1YDSE 4EZ7A 3I6WA 2VTOA 5JT2A 2IW9A 5JQWA 1OI9A 3DY7A 3F2AA 2XM9A 4M84A 2ERZE 4S2ZA 3W32A 1PXLA 4XV9A 3UQFA 5HE1A 1OIUA 4ZTNA 1OPLA 3TL8A 2X8DA 3UBDA 2J4ZA 5DT3A 5L2TA 3RPVA 5EOBA 2QF7A 3H10A 3G0FA 2YJSA 3HV6A 4CG9A 2B9JA 4B4LA 3I60A 5KKRB 4U3YA 4XLVA 5ANDA 3RVGA 1U54A 3PE2A 4HVIA 3I5NA 1WMKA 3VHKA 4HVGA 3B2TA 4DFYA 3D15A 3ORKA 5M51A 2ITXA 2E9PA 3QQFA 4PMPA 2H34A 4EYMA 3IKAA 4FFMA 2OJFE 2OKRA 4OBOA 3CTQA 1M14A 1WBWA 3LXNA 4IB3A 1SVGA 4FSRA 4WRSA 5ANOA 5A6NA 4WG3A 3TWJA 4AOJA 2REIA 2EVAA 2W5AA 4M67A 2YZGA 4YJ3F 2UVZA 5KMIA 3GU4A 4ASEA 4GYGA 2BIYA 3TNHA 2R84A 3W2SA 1XHAA 2XIXA 4BGHA 1GZNA 5IH5A 5CU0A 3GU5A 3U4WA 2PUPA 3IONA 3LCDA 5KNJA 3AD5A 2OK1A 5L8JA 1NW1A 5FP6A 2XKEA 1R0PA 2JDSA 3QD0A 4FKRA 4TPTA 3U54A 1KC7A 2QD9A 4LMUA 3VQUA 3WF5A 3QD2B 4O83A 4EOMA 3NS9A 3QQGA 1H0VA 3DOGA 5TT7A 3I1AA 4APCA 4LG4A 4ENYA 5IPJA 4FTMA 5KKRC 2GTMA 3DTCA 1CSNA 2EXCX 3NAYA 3WYYA 1OB3A 1XH4A 4RJ6A 4C36A 4ANBA 4MA0A 3F9NA 3LJ2A 1IAJA 4AGCA 3MVJA 4DFUA 2VU3A 3TINA 1JVPP 3WYXA 3ZO4A 4KINA 3U51A 3DPKA 3F69A 3JYAA 3MFSA 4BCGA 1BI7A 2OO8X 4FT9A 4LRKA 3SV0A 1P5EA 2WEVA 4F1TA 2WMBA 3DKCA 4D5HA 3O50A 3MN3A 4KRCA 4FSQA 4FEWA 3REPA 5KX8A 3EQGA 4IIJF 5CU4A 1WR2A 2G2HA 5JQ5A 3U9CA 1U54B 4N0SA 3FY0A 3NEWA 3NZ0A 1KJ8A 4DH8A 5IQBA 2B9IA 5L2SA 2GPSA 3HRCA 5HIBA 3WNZA 4FKGA 2HXLA 4QTBA 4HCVA 2QOKA 3EFKA 3GI3A 4YZ9A 3BHVA 3UDBA 3GCVA 3COIA 4M3QA 2GHLA 3D7TA 2WMAA 3JR1A 4FNZA 4G5PA 5HCYA 3BG5A 2OU7A 4H36A 4RGJA 3RCDA 4QTEA 2PBZA 2VQDA 4BICA 3Q04A 3TUBA 5L2WA 3LCTA 1XBBA 2WB8A 5EOLA 5CAQA 4YLLA 3PE1A 3LJ1A 5JEBA 1JBPE 4FTLA 4NZWB 5BYLA 3W2QA 2NP8A 3AMBA 4I4EA 4AZWA 3PP1A 3DNEA 3IK3A 3NW7A 2EB3A 4FSYA 4RA4A 3TDWA 5HTBA 1NY3A 2FGIA 4C58A 3CSVA 3NNVA 2GS7A 4ORKA 3ZBFA 4R7BA 3OF0A 3QALE 4GJ3A 4J8NA 3RHXA 1M2RA 2C6TA 2WOTA 3QUEA 4ANSA 4DEDA 2RF9A 3LQ3A 3HA8A 4AT3A 4D1XA 2B9FA 3C5IA 3ZSHA 5HD7A 3NSZA 4PDSA 5FEDA 5FBOA 4BIBA 3TNPC 3UZRA 3IO7A 5H8BA 2YZAA 1Z2PX 2OH4A 2YCFA 5E7RA 5EKNA 2PUNA 3TKUA 3R00A 4F9YA 4I4FA 3TZ8A 3QZGA 3RAKA 4FFPA 3BE9A 3LAUA 4BIDA 5GINE 4QYYA 4H3QA 4U80A 3DKGA 2E2BA 1VR2A 3ZOSA 3GQIA 4G17A 2XK9A 4Z55A 1PKDA 2FPIB 4FI1A 2VWBA 1KE7A 3Q52A 4QMQA 2GHGA 3PG1A 4I6FA 4P7EA 4O2BF 4S31A 1H1RA 3LXPA 5CSWA 1M7QA 4WNOA 4EOQA 5L3AA 4TN6A 1LEWA 4PWNA 1RE8A 4E1ZA 5IEXA 4JQEA 5EH0A 4FYNA 4BZNA 4FVQA 4O0RA 3F5PA 3WE8A 1B6RA 4FSTA 4OW8A 4FSMA 3DZQA 3HA6A 4YZMA 2OXXA 2WMUA 3Q2JA 4FFRA 3UIUA 5IU2A 2QO2A 4OTDA 5DWRA 5FBNC 4USDA 3PFQA 4C4IA 3LLTA 2JAMA 3ACJA 2X81A 4QP9A 3N8DA 3KCKA 3POZA 4C4GA 2I8CA 4IAZA 5BNJA 2W6QA 2ITQA 4PL3A 4X0MA 4CTBA 2XNEA 4ZIMA 1F5QA 3QHWA 2UZEA 3V8WA 5CWZA 4YU2A 2YWPA 4ZY4A 1ZYDA 3K5UA 4S34A 4UXLA 4C35A 3HMMA 1I7LA 3RHKA 3RMFA 3ZTXA 3UOLA 3QRIA 3GFEA 4EBWA 3MY5A 4M12A 4JQ7A 4O91A 4HR7A 4MXXA 4IDVA 2WGJA 4EQCA 4E8AA 5AA9A 5IEVA 4K0YA 5BMSA 4U5JA 1OITA 5ANJA 1Q8UA 3CY2A 3BHTA 3FQEA 4Y72A 4DC2A 4MWIA 3EFLA 3OROA 2WXVA 3T9TA 2WTJA 3VS0A 3UNZA 3ZRMA 3WO1A 3QF9A 2R85A 2VX0A 4BBEA 4G3FA 4WBOA 4CNHA 3HRBA 5CU3A 1ZMVA 2R3KA 2VD5A 4OR5A 4TYJA 4YJTA 3ZRKA 4DFLA 3BWJA 2F9GA 2Z8CA 4YC3A 4LFIA 5CASA 3F3UA 2WELA 4QYEA 5KBQA 1GIIA 1M0WA 2I87A 3RP9A 4NTTA 3ENMA 2PZPA 5AUWA 3V8SA 5CU2A 1R78A 3PTGA 4H05A 4ITIA 3UP7A 2XIRA 4ZK5A 3R8MA 4IVAA 5HQ0A 2J6MA 2WQMA 3ZRLA 2X2KA 2PMLX 3A62A 1SNUA 1J3HA 2FP4B 3MPAA 5DGZA 2VTQA 3E88A 4HCUA 1Y6AA 4F9CA 1DV1A 5CB4F 3GFWA 4YJPA 4V0GB 4J53A 3PIYA 3ETAA 4V04A 3A4OX 1H28A 1PXKA 2F7EE 2YIYA 4XBUA 3RAIA 5IQHA 3JXWA 2G2IA 3HRFA 4FIHA 4DG3E 4YURA 4E4TA 1BX6A 1WBNA 2PSQA 2E9NA 3Q9ZA 4RPVA 5FM2A 4F0FA 2OJIA 3NUUA 4BF2A 3CE3A 4FL2A 5CI6A 4U7ZA 4ASZA 5CEMA 5F20A 1CKPA 3Q53A 5IQDA 5LCJA 2YS7A 3LOKA 4L3PA 3ZS5A 5KMOA 2HY81 4DEBA 5BX0A 4L46A 4ITJA 1XWSA 4G3DA 4W4VA 5FUTA 1P4OA 2G01A 3A60A 4JI9A 1W98A 2UZWE 5EYMA 5AV2A 4GIHA 4D1ZA 5JVLA 2WQEA 5TO8A 5AMNA 3QLGA 2J9GA 3TZ9A 4EL9A 1G5SA 3E3BX 4B9DA 3EZVA 1P4FA 3TKHA 2B52A 4CT2A 5C1PA 4J96A 4I0SA 3ANQA 3E7OA 4KAOA 4AZEA 1KJQA 3DA6A 1H25A 1KE6A 4QTAA 2CZGA 3RV3A 2KULA 2WQBA 3G6GA 2IP4A 2X2LA 2E9UA 4YLJA 3IW8A 5C8MA 3F3TA 5LVPA 3BGPA 2ACXA 2W7XA 1JQHA 2I7QA 2PULA 5IQAA 4AF3A 4AE6A 2W4KA 5CF4A 5IQIA 3JRXA 4QO9A 3KEXA 4GU9A 1E1XA 1H0WA 4FV5A 4JRVA 2IW8A 2R87A 2CKPA 2YCRA 3A7FA 1IRKA 2C47A 2GPHA 4I24A 4UY9A 3ZUVA 4BYIA 4TY1A 4E6QA 3N4VA 2OJJA 4D1SA 2E9OA 1QL6A 4X21A 4U42A 3FYKX 4RZVA 5EW9A 4GFOA 4YHFA 3KB7A 3FL4A 3OZ6A 4BDAA 4XLIA 3R8VA 5A4CA 5HZNA 2W9FB 2GFSA 3O96A 4K9YA 3PXZA 5DOSA 3VRYA 3SAYA 2IW6A 3MWUA 3NUXA 3ENHA 3G51A 4ZTMA 3UOHA 4WBNF 4JNWA 4O6EA 5FP5A 1YXUA 4WUNA 2YM4A 5JFWA 3LW0A 3RUPA 4PTCA 4X3FA 3R8ZA 2R9SA 4QYGA 3VW6A 2BCJA 3PVUA 3VBXA 3LP8A 4FKLA 5AP3A 4I93A 4MVFA 3NNUA 4AGUA 5JKGA 2V22A 2BRBA 2QURA 3KRXA 5B0XA 3TCPA 1UNGA 3HP5A 5CEQA 2QU5A 4EEVA 5BPYA 1NT2A 3LFBA 4RWIA 3O17A 4JS8A 5FXSA 2QR7A 4O84A 4YJUA 4WG4A 4YO6A 3OBJA 3C9WA 5HG9A 5JGAA 2W5BA 2QOIA 4KRDA 4HVSA 3NUSA 4YZBA 4EYJA 3QAME 3KXHA 3FPMA 1DV2A 1Z2OX 4KA3A 3HV4A 4H39A 2DLNA 2ESMA 5CZIA 3OWJA 4DBXA 4ZJJA 1ATPE 3AC1A 4GH2A 4PX6A 4DH1A 2PYWA 4FT3A 1ND4A 5HHWA 4YSJA 4B99A 3OTUA 2X4FA 2BZHB 2KTYA 5M4FA 4LUEA 4PTGA 2HXQA 2XMYA 4J7BA 5E4HA 5EDPA 4M7IA 3UO4A 5CQWA 3OC1A 5LYJF 2X6DA 5DA3A 2RFEA 1JKTA 1ZOEA 2BUJA 5KMNA 3HKOA 2PWLA 2YISA 3NDMA 3TZ7A 2X8IA 3CKWA 3R6XA 2XK6A 1A48A 4FKTA 3W8QA 3FBVA 3QRJA 5BYYA 3U9NA 2DQ7X 3DB8A 1OL5A 1AD5A 2F7ZE 2RG6A 2VTRA 3HMIA 1YOLA 5KZ0A 4UXQA 3TV6A 4DGOA 1VBHA 1CDKA 1Q8WA 3DBQA 3NYVA 4EORA 5DR9A 4B8LA 4FV3A 5JZJA 3ORRA 3ETHA 1H26A 4LGGA 3ULIA 4IZ7A 3ZBXA 2W1DA 2Y6MA 1PX2A 2OZOA 3VC4A 4AT5A 5DBXA 2VGPA 3BRBA 2JIVA 3E5AA 3QTXA 3PUPA 3GB2A 3QD4A 1AGWA 2Z7RA 3I5ZA 4KIOA 1GNGA 2XK7A 3DXQA 2Q83A 4YJSA 4TL0A 5FRIA 3OTVA 2I1MA 3L8SA 3UO5A 3ZXTA 1J7LA 3FKLA 3PY0A 4QP6A 4XP3A 5FDPA 5BVFA 1MUOA 3Q4TA 2UW6A 4LGHA 3DBDA 3UG2A 5ANIA 4I55F 1PMEA 3C0GA 5JFXA 3C13A 4BGQA 4L7FA 4CTCA 4TWCA 5BUEA 2YAAA 4GW8A 4XX9A 3ZM9A 4YMJA 1Y57A 4IVCA 5AUUA 5D7VA 4O4JF 1JKKA 2BMCA 1Q3WA 2QQ7A 4KBAA 4ASDA 2AC5A 3MFTA 3WO0A 4MNFA 3QTSA 1FMKA 4WG5A 2Z7LA 4I3ZA 3PLSA 2YYAA 2NUAB 5DRDA 4Z9LA 3D5UA 4M68A 4D4YA 2JFLA 1PYXA 4GK4A 4JG8A 4M9UA 4XP2A 3AQVA 4PDOA 3KK9A 5KCVA 5IDNA 1YI3A 1XBAA 1JKLA 2GS2A 4E5WA 3C1XA 5AAEA 2YW2A 4FZ6A 4RX8A 4O4HF 2CGXA 2R2PA 4XCUA 1Q24A 4Y73A 4I94A 5E8UA 5M56A 4XEYA 3GCQA 4ITHA 3GT8A 4RWJA 2NPQA 2R0UA 5DVRA 4I5CA 3GLKA 1YI4A 4FFOA 3VBVA 3GU7A 4GJ2A 3H9OA 5HVJA 3A4PA 4QQJA 3RWQA 2OXYA 5GJDA 4GK3A 2XCKA 3R28A 3F2RA 2ITOA 4MF1A 1V0BA 3P7BA 4NCTA 4I22A 4PQNA 3P7AA 4Q2AA 4MV8A 4ZMEA 2QOCA 3QX2A 1EHIA 1KJJA 2X7GA 4BCIA 5D11A 5C1QB 4CT1A 5EQEA 3SW7A 5LWMA 3SKCA 4EH2A 5HBJA 2B55A 5AM7A 2WTIA 1Z57A 5T68A 3TJDA 5BUIA 4FUXA 5AP7A 3HV5A 4XV1A 4I41A 4L67A 4I5PA 5FGKA 1BXRA 4I5MA 4JVGA 2OIDA 3FLWA 5EHLA 3IW7A 3E92A 3BYVA 1YKRA 3C50A 3QFVA 2HCKA 3TUDA 4FV2A 3I79A 2QI8A 3BEAA 4MNEB 4D5KA 4PMMA 3HAVA 2XJ0A 2VN9A 5K4JA 4AZFA 4JJRA 4F63A 1DM2A 3BZ3A 4M0ZA 4XYFA 3WOWA 2FUMA 5A4QA 3TIZA 1NVRA 5H9BA 3UVPA 3R7EA 3O8UA 1Y8GA 2QHMA 4G1WA 4J95A 1Q8YA 2W9ZB 3FQHA 4L7SA 4NFMA 5FTGA 2IN6A 2NRYA 4UV0A 5FM3A 4BI0A 3CD3A 2XNNA 2GCDA 4F6SA 3ODYX 1O6KA 4FT0A 2W6NA 2B54A 4FBXA 5LVLA 3UNJA 4FODA 4MQ1A 3TZMA 2ZB1A 3K2LA 3LIJA 4IM0A 4KKGA 5CSPA 4JBPA 4CKIA 3E93A 2W1GA 3UIBA 2F2UA 5LMKA 2HW6A 5C8NA 4O22A 3MJFA 5IISA 3ZFMA 1M2QA 2UZLA 3OW4A 4O82A 4X3FB 1E9HA 1PF8A 3KULA 3TEIA 1ZYSA 1SM2A 4BCPA 4LUDA 1JAMA 3HB9A 4B8MA 3ORQA 2I6LA 3NNXA 4ACDA 5HU3A 2NU6B 2O2UA 3Q9YA 2O65A 4HGSA 4OGRA 2GNJA 3E64A 3IOKA 2YM6A 3LFDA 5AV0A 2YL2A 3DFAA 1APME 2IWIA 3ETJA 5HBHA 3ZH8A 4KKEA 1UV5A 3HLLA 3ITZA 4M0YA 3S00A 2GNFA 5HNGA 1ZYJA 4M97A 3FXZA 4X6RA 4C3FA 3DDQA 3PG3A 2DWCA 2C6DA 4EGQA 5EDRA 3CCNA 3U6JA 5C4LA 2VTLA 1PYEA 2JDRA 3B8QA 3DLSA 3FMHA 2GNGA 2WTKC 1DS5A 4HGTA 4JBQA 4DA5A 3KC3A 4DFZE 5B2LA 1Q3DA 2YABA 2XJ2A 3UMWA 5EDQA 1EUDB 3WF9A 3L9PA 3EN5A 4IHPA 3BE2A 4YBJA 2XCHA 3OG7A 3QUDA 4R1VA 4WUAA 5AX3A 4C4JA 3NW5A 5LMAA 3G2FA 3V5WA 4HW7A 2PUUA 2DWBA 3MPMA 2BZIB 3VULA 4BTKA 1B6CB 4TTHB 2XK3A 3QTQA 4JIKA 2XNMA 2CNVA 1IG1A 2ZM1A 2Z2WA 3AC4A 3C51A 3FMLA 3LFFA 1BKXA 3NX8A 5DT4A 3SXFA 3BBWA 2J0JA 1NA7A 3NUNA 3NYOA 4J8MA 4AACA 5H80A 1MP8A 1KE9A 2YIQA 2ZYBA 4C0TA 1HCKA 4MX9A 5LA6F 5FXRA 3GU8A 4FTOA 4BCQA 3DQWA 3LMIA 4GV1A 4RC3A 3FXXA 2O3PA 3NMUF 4DTBA 4F70A 3P1AA 5CTPA 3EN4A 3FMEA 4CXAA 1XR1A 4A4XA 4DBNA 3FHRA 4O7TA 4D9UA 3LLAA 3OHTA 3NAXA 4USEA 5EHYA 1XO2B 3JVRA 5IA5A 4EONA 3NIZA 5DR6A 3GBZA 4MD9E 4S33A 2C6OA 2BPMA 1BL6A 3PJ3A 2CGUA 4TT7A 5KMMA 3UE4A 4EOLA 3TQTA 2YIWA 2WO6A 2IG7A 4JDHA 2XRWA 1M2PA 1YHSA 3R0TA 4C3RA 2R3GA 4NYEA 2DUVA 2P2IA 5ACKA 4BN1A 4C5AA 3FZOA 2JLDA 2VRXA 3GCPA 3M2WA 1YWRA 2BROA 2W1EA 4CCBA 1GLVA 3II5A 3D2IA 3L8PA 3ALNA 4TWOA 2R7LA 5IZFA 3R2BA 3R7VA 3FZ1A 2W5HA 3H0YA 4MK0A 3JRWA 5M09A 2XIYA 3LQ5A 4J1RA 3KXXA 4OUCA 4IJ9A 2CLXA 2R5TA 4U43A 1I09A 3MV5A 1B6SA 2QLUA 5HTCA 5EYDA 1EZ1A 4NH1A 3NGAA 4EK5A 4BB4A 2OLSA 4GMYA 2R3IA 4P90A 4O2ZA 4R7IA 3FJQE 4EBVA 4F7SA 5KHXA 2WMXA 2O63A 4D9TA 3ORZA 4FG7A 4O0UA 4EK3A 2W05A 2B0QA 3R5HA 4EH7A 3D5XA 4YLKA 3HO8A 4FKOA 4AOIA 4GL9A 5IA1A 4UB7A 1XH5A 2OICA 3AOXA 4FK3A 5IF1A 3HP2A 4NUSA 4EZ5A 2C00A 1W8CA 3R5FA 4R1YA 2YRWA 3QKMA 2P55A 4EOJA 1H1SA 5CALA 3R1NA 3QTWA 4QQ5A 4YJOA 2Q0BA 5ANEA 5L6WL 4F0GA 1SCUB 5AWMA 1NVQA 4YAJB 3OUKA 3H9FA 4ZY6A 3K3PA 3EQIA 2FVDA 3KRWA 3TTJA 3PSBA 5EQYA 4AA0A 4AN2A 4NT4A 3PRIA 4FOCA 1AUXA 4ANMA 3AX6A 4EQUA 4RBLA 4FKIA 4A4LA 4C5CA 3WZJA 3ORNA 4D4VA 1PMNA 4FK6A 2FSTX 3V04A 2XJ1A 3IQ7A 1U5QA 1IAHA 3KRJA 5C8YF 3PSDA 3CTHA 2UV2A 2RIOA 3DKOA 4PRJA 5AUXA 5IH6A 5HV6A 2OXDA 3OMVA 4FEVA 3U6HA 3DGKA 2PTKA 1XJDA 5EYCA 4DAWA 2G15A 3LPBA 4UEUA 5AAGA 3EH9A 5C8KA 2WQOA 4QYHA 5AP0A 3EN7A 3F5XA 3FMJA 3H30A 3OD6X 4JR7A 4ZSLA 1UVRA 3EQFA 4GKIA 4IEBA 4XV2A 5LP6F 3H0ZA 4ZZMA 5CF5A 2R3FA 2XNPA 3VHEA 5DMXA 1ZOGA 3R30A 2W1CA 5AUYA 1YXSA 1UWHA 2I0YA 2PY3A 2YZNA 3B8RA 5IDPA 1BYGA 4FIJA 3QWKA 5CYIA 4F9AA 3C4EA 3ELJA 2W17A 3MFUA 2PVFA 1ZARA 3FC1X 3Q9XA 2WU7A 4G9RA 3QC9A 3SXSA 4IX3A 4JDJA 5AV4A 2B4SB 3MH0A 3FAAA 4BZOA 4MXOA 1JSUA 1LP4A 4IE9A 2BILB 3R9DA 3KQ7A 2QU6A 1M0TA 4BBMA 3TIYA 5IQCA 4E93A 4F9BA 1W96A 5K5NA 1ZOHA 1HOWA 3LM0A 4QMYA 4DLJA 2F2CB 4PUZA 3W10A 5JFSA 2UW7A 2HW7A 3SLSA 1CTPE 3C7QA 4GFMA 5M44A 3DK3A 3V4SA 4FEQA 1YI6A 4BZDA 4AGWA 1JDBB 5DIAA 1PXNA 3Q4ZA 4FVRA 4O0XA 1KV1A 5M4UA 2SRCA 1H24A 2WZJA 4E20A 5CT7A 2R3QA 2R3PA 3H4JA 1QPDA 3I81A 3DF7A 4H1MA 2UW9A 2PPQA 1B39A 2PVYA 4L6QA 3SG9A 4ERKA 4CKJA 3RK5A 2PMIA 5FDXA 3QA0A 4YJVA 5CS6A 4FTJA 2YAKA 2PVNA 3OCGA 4AG8A 5D8DA 1B38A 1Q62A 4NM7A 4FEXA 4L00A 3QCXA 3QZHA 4AZTA 2GNHA 4XZ3B 5JVDF 4I5HA 4DE4A 4IH8A 1WVYA 1ERKA 1XBCA 2UW3A 4IX4A 5BVEA 5CEOA 5JGDA 1JDEA 2VR1A 2G2FA 5CNOA 3DJ6A 3F61A 5J9YA 3L8XA 3OWPA 3IDPA 4V0GA 1H1PA 3TG1A 1H27A 3FWQA 4YUQA 2IZTA 4ONAA 2QG5A 2WTWA 3G9NA 2XIZA 4NL0A 4A9UA 3OOMA 1S9JA 2FYSA 3QD3A 4CMUA 1OM1A 3G15A 4CFXA 2VWVA 2R64A 3V51A 4RFYA 5BMMA 3HVCA 4AOTA 1KE5A 5HNIX 3W2PA 2C3IB 5HI2A 3LXLA 5DG5A 3DBEA 4C5BA 4GVJA 4M69B 3R7YA 2VTPA 2ONLC 3MDYA 1TQMA 2QOOA 2X9FA 1OUKA 4K77A 2PZRA 4A9SA 5HO7A 3CEKA 1FBNA 2XKCA 4XJ0A 1LUFA 3SX9A 5JMSA 3ZU7A 5A4TA 5LVNA 5JQGF 5IA2A 3R5XA 5BMVF 4XYMB 5D9HA 5E92A 4XBRA 1QPEA 4D2RA 2NNWB 3TUCA 4YPDA 2BRGA 3MPTA 3VW8A 4WD5A 5JQ8A 2RFDA 3AW8A 4QTCA 4I4TF 4W4XA 1DI9A 1Z9XA 5CX9A 3UVRA 4E26A 1U4DA 3C0IA 4ALUA 4EGJA 3BLHA 1OIYA 1BI8A 2WMQA 2HZNA 1OPKA 3NCZA 4NKAA 1IOWA 4CZTA 1PY5A 4AA5A 5JN2A 3MI9A 4OTQA 3BYSA 3KL8A 2H8HA 3CQWA 4ACCA 1TVOA 3S0OA 4OT6A 3BBTB 3CS9A 3GENA 4FV7A 2W6ZA 4FGRA 4ANLA 1URWA 2WEIA 2VTIA 1CQIB 3BU5A 4H3PA 3COHA 3CPCA 3IG7A 3NNWA 4M13A 2VWUA 4GRBA 4BDDA 4EJNA 3OCBA 2RFSA 5T6KA 3UQCA 3M1SA 4FTCA 3OY1A 3IECA 3HECA 5HLWA 4FSNA 4FA2A 3MJ2A 1OUYA 3PA5A 2PE0A 3CLYA 2GQSA 3GOKA 4RLKA 2H96A 3TNQB 3WZDA 3RPOA 1E4EA 2PL0A 3AXWA 1KSWA 1AQ1A 2J9MA 1PXOA 3SW4A 2VO7A 4BDJA 2OW3A 2XS0A 4FIGA 4IAFA 4A9TA 1W93A 4EK6A 3ZLYA 2R3LA 1JLLB 2DIKA 4BHNA 4FV6A 4LOOA 2A19B 4IVDA 3PJ2A 3EKNA 3IOPA 3Q9WA 3V5JA 4IB0A 2UVYA 3V5QA 1EYZA 1T36A 3NYNA 4F7LA 1VEBA 3EYHA 3KKVA 3LXKA 1FVTA 3GCSA 4RQVA 1SZMA 5E8XA 2PK9A 3DB6A 2PU8A 4FGBA 4E5BA 3Q4UA 1IA8A 4P5ZA 3QXPA 5CVFA 4E6DA 4GG5A 5ANGA 3GC8A 2JD5A 3UPXA 3EB0A 5DN3A 1BLXA 4OLIA 4HYIA 4EZ3A 2ZDQA 2A1AB 2QCSA 1YXTA 3PXFA 4L01A 5ANKA 5ETCA 4GT4A 3R8LA 3UMXA 3BLQA 1IASA 3FEGA 4MWHA 4O0YA 2YS6A 3QGWA 3HMNA 3PPZA 2GNLA 2PMNX 4I92A 2QLQA 2R3MA 3MTLA 1KUTA 3NUYA 3VS1A 4ACMA 4HVHA 3OW3A 5IUIA 2VWIA 1PXMA 2F49A 1EH4A 4UWBA 5C26A 4YJ2F 4FR4A 3AT4A 3BYOA 4IIRA 4DGGA 4F7NA 4O21A 4G3EA 1ZLTA 4DH7A 1G8AA 3I0QA 3ZZEA 3COMA 4QMNA 3FI8A 4WRGA 3ZXZA 3CJGA 2IZSA 5ACBC 4QOXA 3CQEA 1DI8A 1T46A 4UZDA 4Y5HA 3K5IA 5HCZA 4BHZA 5K9IA 3KCFA 2I0EA 1H08A 3E62A 4DCAA 3V4ZA 3LCSA 5HICA 2XNOA 2YHVA 4HJOA 5I9WA 1WVWA 3FSKA 4GVAA 4O86A 5D1JA 1MRVA 4MXCA 2GQRA 3FE3A 3QXOA 4EKKA 5TF9A 4RIXB 3SRVB 1MQ4A 2HK5A 2QVSE 4WKQA 1VKZA 2XD4A 1ULZA 3JUHA 2ITNA 5HE0A 2XYUA 4BDCA 4MAOA 3RPSA 3OXIA 4BRXA 1ZRZA 4IFGA 1WZYA 3MB6A 3PLAE 2YIRA 1PMUA 1P14A 2UW5A 5LARA 2BALA 4L53A 2OF2A 1RW8A 4WSYA 2YRXA 2I40A 3V5PA 2C69A 4WHZA 2XNGA 3R1QA 5ICPA 1OKWA 1LR4A 2NU7B 4FL1A 1R39A 4L3JA 1YDTE 1NVSA 2OBJA 3PRFA 4EUUA 3L9MA 3ZUUA 1SNXA 2ITVA 2JDTA 2X8EA 3E8DA 4FV1A 4K6ZA 3KAKA 3BYUA 3RJCA 4EWHA 4MBIA 5CU6A 5IA4A 2R3NA 4AW5A 3BWFA 3NVMB 3WF8A 1YHVA 2C5VA 1CE8A 1A06A 3QTRA 2OJ9A 4P5QA 2BFXA 1REKA 3ZC6A 5IG1A 2GU8A 2BZKB 2QOHA 3FL5A 3AT3A 3NUPA 4YAKB 2Y9QA 4U3ZA 4TV8F 3ORIA 3UTOA 1E1VA 3CP9A 3VPCA 5AFVA 3HX4A 2BRHA 3DJ7A 4HYHA 5HNBA 3UNKA 1ZY5A 2UW8A 5BPFA 5B2MA 3RKBA 4O4LF 3A2CA 1OL7A 3MIAA 4NM5A 3L9NA 3HAMA 3VPBA 1GZOA 2CMWA 2ITYA 4I6QA 1SVEA 4UWYA 4W8EA 3VBYA 4Z16A 2ZDUA 4KS7A 5A6OA 5JK3A 3T3UA 4O7YA 2BHEA 4LOQA 3VBQA 3WARA 1CS0A 2P0CA 4O81A 2W70A 5ETAA 4RIWB 5IYZF 4HNTA 4HCTA 4S30A 4WBBB 4DITA 3GCUA 3IGGA 2VTNA 5AP5A 3PA3A 2UZVA 3DK7A 1FVVA 3UJGA 2XEZA 3GEQA 4PP9A 1RQQA 1UA2A 2ZJWA 2C0TA 3QU0A 5FTQA 5C27A 4X2NA 2BDWA 2VO3A 5AAFA 3HUBA 4ZTSA 4CMOA 1Y8YA 5J9ZA 3RINA 2GMXA 2PN1A 3R9NA 4F09A 3DK6A 3NLBA 4K18A 4K1BA 4KIPA 4ZY5A 1OIQA 4YJNA 5HVKA 4DG0E 1XH7A 1PW2A 3QKLA 4XMOA 5I9UA 5I9VA 5G1XA 4Y8DA 4O7NA 2VWXA 2Z04A 3MH1A 1R1WA 2WOUA 3KF4A 1IR3A 3DAKA 3R2YA 4IWPA 3RWPA 4DTAA 3WE4A 5TOZA 5K4IA 3DKFA 1FINA 2LGCA 3BHHA 5C4KA 4TRLA 1YXXA 1G8SA 3GP0A 4DLIA 1YXVA 3PIZA 3W16A 2WPAA 2VTHA 4NU1A 5DR2A 3MFRA 4BTJA 4HOKA 3BQCA 3ULZA 5DH3A 3ZDUA 1GIJA 2UZOA 2R0IA 4QTDA 2HZIA 2ITTA 4FSUA 4O7VA 2CDZA 3RI1A 5IMEA 2YZMA 5EZYF 4FNXA 2HWPA 2R7IA 2PUIA 4FSWA 4ZSJA 3ZDIA 4KB8A 3QYWA 4JLCA 4GUEA 4IACA 4KNBA 4O0VA 4UX9A 3EQDA 2CLQA 1YWNA 3OT3A 5K5XA 1H8FA 2QOQA 2X6EA 3GC7A 3IW4A 4V05A 4DLKA 3CGOA 4XX0B 4BCJA 4XG8A 2W6OA 1GIHA 3QC4A 3CKXA 2CCIA 2J0IA 2VO6A 4ZLYA 4DGNA 2CJMA 3FMKA 3MSSA 5DE2A 1UU3A 3QLFA 3OWLA 3KREA 1KOBA 1XQZA 2OI4X 1X8BA 3KXMA 4MAMA 4FTRA 4W8DA 1H4LA 4I1ZA 1SYKA 4FICA 3A7IA 1ZAOA 5BVWA 3VOTA 2FSOX 2GHMA 1FMOE 3OS3A 4ZI7F 3EFJA 5J1WA 1QMZA 3CXWA 4N4SA 3BU3A 2FSLX 5BVNA 3HDNA 4FV9A 5LQFA 3TACA 5CSVA 5LXMA 3O2MA 2XP2A 4GG7A 2V5QA 3QX4A 4EC8A 5CF6A 4FTNA 4IX6A 1W84A 1H1QA 1OKZA 2WHBA 1O6LA 3PXRA 2Z60A 2OGVA 3ALOA 3CPBA 4FUYA 3UQGA 4EK8A 4F6WA 4JDIA 4YTFA 2BRMA 2CHLA 3KVXA 4NJDA 2J90A 3SHEA 4Y5QA 4EOSA 1MRYA 3FYJX 2BAJA 4J98A 2WQNA 1YHWA 1OGUA 3E87A 2EXMA 1BMKA 2GDOA 2ITUA 5I9XA 1GJOA 4FKJA 2ZV8A 3GC0A 4HZSA 2J50A 3CTJA 2YA9A 3TNIA 4ZLOA 3NVKI 3OOGA 4QMMA 1TKIA 3G33A 3TM0A 4F65A 5CSXA 5EI8A 4MV4A 2FSMX 3IPHA 4FU0A 2QC6A 3DCVA 5EW8A 2ZDGA 3LVPA 2YDIA 5I5ZA 4RZQA 3VA7A 1GSHA 3VRZA 2BKZA 1PJKA 1PXIA 4V01A 1VYWA 3QCQA 4IMYA 3QZFA 2Y4IB 3V3VA 4E6AA 3DU8A 4HZRA 2VTSA 3MYGA 2CNUA 2C1BA 1OL1A 3HV3A 3R04A 4RIXA 3SRVA 3DBFA 3R83A 4FZFB 4LQMA 3TTIA 4AQCA 4XG7A 4DT8A 4QSHA 2G9XA 4Y8VB 4C2VA 5LWNA 5J9LA 2WKMA 5A4EA 4HYUA 5GNKA 3N9XA 4N57A 4CG8A 4H1JA 3IW5A 4YJQA 4HNFA 2P33A 1F0QA 4GCJA 4L3LA 2HELA 5DYJA 3QTIA 3D0EA 4AZVA 3V01A 3EHAA 2PZIA 4FV0A 3UPZA 5GJFA 2VTTA 2DS1A 1OECA 4DTKA 3U9TA 3CJFA 3FQSA 3DAJA 5FXQA 2Y4PA 2ETKA 3A99A 4RC2A 4DEHA 4FX3A 3FLQA 4MXYA 4FKUA 3N4UA 1T45A 2O5KA 3EFWA 4GIIA 2CSNA 5IUHA 3S2PA 4FFLA 1VYZA 3KXGA 3RK7A 5KKNB 5I0BA 3FZSA 5KX5F 4R3CA 4ZS4A 4KBKA 4F4PA 1GSAA 3VF8A 3W2RA 4IM3A 3RAHA 4RRVA 3D7ZA 4EHEA 5CXHA 3DXPA 2OFUA 3VVHA 2XEYA 2GS6A 2WTCA 4O7SA 4PMSA 3FPQA 4C7TA 3EQHA 3PJ8A 1YW2A 3N51A 2W96B 4CVAA 3FZTA 4QT1A 3KMWA 2HJWA 1QPJA 3TIIA 3SQQA 5J87A 4O4IF 1R0EA 2BRNA 4NKSA 3SOCA 3SDJA 1XKKA 3KMUA 4BC6A 3AMYA 3FSFA 1L3RE 4QP1A 3O7LD 3VNTA 5FD2A 3C4CA 5CXZA 4CD0A 4AZSA 1ZMUA 4PL5A 5CAUA 3R9OA 4KSQA 4RIWA 5G6VA 4MQ2A 5HLPA 5J8IA 4D0WA 4F1OA 5M4CA 3LMGA 2ZAZA 3O8PA 1OPJA 5IUGA 3VBWA 3HMPA 3UZTA 5DEWA 4DEAA 2F7XE 3D14A 1QPCA 5GHVA 2XA4A 4AWIA 2FO0A 2PVLA 2ONLA 3OCTA 5FQDC 4RG0A 3MVLA 2WU6A 5AP1A 1SVHA 3MH3A 4P4CA 4O0WA 2C4GA 3GUBA 3QRTA 4Q5EA 3EQPA 3ID6C 2C0IA 4IZOA 4MV3A 1LPUA 4RFZA 2CCHA 2OZAA 4OTFA 2OFVA 1KV2A 4L8MA 4EQMA 5AEPA 3Q4CA 4BI2A 4CFNA 3R1YA 2Y8OA 2DYLA 3VS3A 3VO3A 2XKDA 4K2RA 2ITZA 3P78A 2NO3A 3QQLA 4DFXE 2JIUA 4BTFA 5HX8A 2WMWA 5IMXA 1DAYA 4IAAA 4JAIA 5CVHA 2YERA 5AA8A 4O7ZA 5ETFA 2ZV7A 2IVTA 3DV3A 4MTAA 4QP4A 1H00A 4FC0A 3I4BA 2QKWB 4XG2A 3WIKA 4KSPA 1AUVA 4IM2A 4TKSA 3PSCA 4C33A 2J2IB 1OZ1A 2BTRA 3AGLA 4I0TA 1VZOA 3GQLA 3HMOA 1GZKA 4EUTA 5JFVA 4CFMA 1UKIA 4NM3A 2VAGA 3UC4A 4AN9A 2Y0AA 1GZ8A 4II5A 4CV9A 3RALA 2Q0NA 4A07A 3S1HA 1LEZA 5AP6A 3DXNA 5C01A 3E63A 3FLZA 4FTKA 2WYOA 1V0PA 3TIGA 3MJ1A 3KAJA 3F3ZA 2CKOA 3PXKA 4I0RA 3ROYA 4ACHA 3ACKA 2YM3A 2RG5A 2JEDA 1ZY4A 1KBLA 5BQ0A 4FG9A 3UO6A 4R77A 5H2UA 2GQGA 3RM7A 3EL8A 1RDQE 4K33A 2IO6A 4TWPA 2VNYA 4APPA 3PZEA 3BEGA 3ATTA 4QMWA 3LZBA 5J1VA 2R7NA 5DT0A 4TYHB 3FMNA 2JIIA 4QPSA 5TR6A 1OMWA 2J0KA 1XH9A 4O2PA 2GPWA 4RA5A 3ZZWA 3EQCA 2QK4A 4RJ7A 1KJIA 4DGLC 3ZMMA 4YO4A 4C62A 4OTWA 4IANA 2VTAA 4MD7E 4CFVA 4E7WA 4JQ8A 2YCSA 4GEOA 2VX3A 4PDYA 3OXTA 1OBGA 2VWZA 2XUUA 3ZEWA 5HG8A 4EG0A 5TKDA 3FI4A 3Q6WA 3FI3A 4CKRA 5IQFA 2W99B 5HEZA 2J0LA 1UNHA 5LVOA 4E73A 3RNIA 2PZ5A 3ORLA 4L1KA 5AADA 4PDPA 4WNPA 5C03A 3WI6A 4BI1A 4EH6A 2XB7A 5CF8A 4RIYB 1BNCA 2A2AA 2GLTA 2BIKB 4AGDA 3BHYA 3KVWA 2J5FA 4BY9E 4Y95A 1PKGA 2R3HA 2VZ6A 3P4KA 4U44A 2P4IA 4CFFA 4ZHQF 2J0MB 4WT6A 3IDCA 4RT7A 3K5HA 4B6LA 3F5GA 4NWMA 3UGCA 3VS4A 4XP0A 4IJPA 4EH9A 4EI4A 4IZ5A 3SXRA 1P2AA 3D94A 4N6YA 4BCOA 4QQTA 4OT5A 4DF3A 1Z2NX 2ZM3A 3CY3A 2B1PA 3LM5A 3V5LA 3V6SA 5FLFA 2ZDHA 3LFEA 2UZNA 2PVMA 3DNDA 2PHKA 5F95A 4DN5A 4C38A 3ERKA 1GSOA 3F66A 3V8TA 4UBAA 4YHTA 4X3JA 3PY1A 3Q60A 1HCLA 1JPAA 3GOPA 1ZZLA 4O6LA 4RVMA 1UWJA 2IZRA 3KMMA 4FYOA 4BDEA 3G8DA 4AUAA 5KBRA 2PE1A 2YM7A 3AC8A 3PPJA 2R3JA 4WNMA 5HORA 3VS2A 1O6YA 2ZM4A 4G9CA 3TV7A 2QR8A 4QQCA 3HDMA 2FA2A 5H8GA 4E4LA 4AW0A 3PPKA 2BDFA 3R7OA 3UP2A 2WMTA 3PDTA 3K3JA 3PY3A 4FZAB 1MQBA 3EOCA 1Q4LA 4S32A 4AX8A 4YJRA 3U4UA 4DGMA 2C3LA 3R71A 4FOBA 3BYMA 1CM8A 4IAYA 4IWQA 5DFPA 4XHKB 3VUKA 5KHWA 5JH7F 3KFAA 4Y83A 3VBTA 4OBQA 3VS7A 4BDIA 2ITPA 2Z7SA 4IAKA 4K11A 4QRCA 4BTMA 4D55A 4ARKA 4D2SA 3GC9A 4TUYF 2HOGA 2A4LA 4TYEA 3QQUA 4FNYA 2HIWA 3I12A 4JOAA 2WAJA 4FKQA 2H9VA 4YC6A 3ZCLA 2QONA 3LFCA 3JZIA 3QFFA 1OL6A 3OUZA 5AUZA 4B0GA 3W8LA 4ZLZA 3PVGA 4EOPA 5DNRA 1W83A 3F7WA 3GGFA 2P3GX 3NUAA 3D9VA 3JPVA 3OT8A 3QCYA 5LOHA 4ZJVA 5LVMA 4NW6A 3IS5A 4FTTA 5F1ZA 3LQ8A 3FLYA 5E8ZA 5CAEB 2Y6OA 4RWKA 3VMMA 3ORMA 4EH4A 1URCA 2JKKA 3E8NA 3UYSA 1C3OA 1VBGA 3DFCB 3IW6A 2JKMA 3SA0A 3OP5A 3C4WA 2BVAA 4FMQA 4QMLA 4TWNA 2YJRA 5CQUA 2QOLA 2Y4IC 4RX9A 3KXZA 5CEPA 4MXAA 1U59A 2HENA 3E3PA 3ZEPA 2J7TA 4G2FA 3PVBA 5KMLA 1WVXA 1YVJA 2QNJA 5M08A 4N70A 5M06A 1YWVA 5FNVF 4EHVA 3QL8A 4O7RA 1YRPA 4U6RA 3RCJA 2P0AA 5ITAA 2C5YA 4D4SA 2YM8A 3FMDA 2C5OA 4D58A 2UZUE 4O2AF 4KKHA 2CNQA 3BV3A 3EZRA 2ZV9A 4EJ7A 3MB7A 3DDPA 3W2OA 2NU8B 4L45A 3VIDA 2JBOA 3OVVA 2VTJA 2PMOX 2C1AA 4U97A 4DINA 3KU2A 3UIXA 1FVRA 3DLZA 3P79A 3Q5ZA 4NIFB 4RFMA 3KRLA 3PWDA 4Z7GA 2R4BA 2CKEA 2VWYA 3CD8A 4DCEA 4QMVA 3PJ1A 4H58A 5LMKC 2B7AA 3RTPA 5E1SA 3WBLA 3BGZA 5CT0A 4FVPA 4DHFA 5B2KA 5GJGA 4KBCA 1CMKE 3EQRA 3WZKA 1ZWSA 3QA8A 4O0TA 1UU8A 1CKIA 4DYMA 4FFNA 5J2UF 4G31A 3G6HA 4MXZA 3UYTA 3QQKA 5DI1A 2ZDTA 3TN8A 5JSMA 1PHKA 4XG9A 4KWPA 2VO0A 3MGYA 3W2CA 2I80A 1H07A 4W4YA 1J1CA 1V1KA 3D2KA 3P9JA 3QGYA 4U40A 4AP7A 4GFGA 4ZAUA 4EOKA 1WBVA 5HU9A 4EWQA 5JH6A 4LOPA 5KUPA 4IFCA 1OL2A 4YZNA 4FG8A 5E8WA 4FT7A 1V0OA 4QP2A 5HE2A 1UU7A 1K9AA 1FGKA 2GSFA 3PIXA 4RJ4A 1DAWA 3R8PA 5I4NA 2OJGA 4IC8A 1O9UA 3BU6A 4JDKA 2HAKA 2VTMA 4L68A 5DPVA 3RZBA 4IVBA 4I21A 1RJBA 3QTZA 5EI6A 4AW2A 3UFXB 2CGVA 3HGKA 2C6IA 2HZ0A 2V7AA 2OH0E 4XH6A 4F0IA 2V59A 2XKFA 4DH3A 4PP7A 3BKBA 3UIMA 5AJQA 2W1IA 5I9ZA 3LHJA 1I7NA 3W33A 4QNYA 5AM6A 4IAIA 3ZLSA 4NSTA 3JVSA 2FB9A 1A9XA 2V0DA 3L9LA 5EI2A 4OBPA 4P2KA 4HGEA 3K5VA 4DFNA 4G6LA 2P2HA 4WA9A 5KE0A 4E5AX 3POOA 2JITA 4NTSA 3TI1A 2UW0A 4JX7A 3P7CA 3UOJA 4JL9A 3QBNA 5HBRB 2W1ZA 3FY2A 4DH5A 4ZTRA 4F1MA 3Q96A 4HGLA 3C0HA 4C4EA 3ZLXA 4RZWA 4GSBA 4XG4A 5GIOE 1PRYA 3C4FA 5E8TA 4TZRA 2ITWA 4FTIA 3ZONA 2GFCA 2YZLA 5HIEA 2QG7A 4J71A 4YSMA 2RFNA 3CIKA 2W06A 2WTKB 3ZSGA 1BL7A 5HO8A 4AXAA 4CLJA 5EQPA 2WIPA 2PE2A 3G0EA 3QHRA 4DIMA 2BTSA 4O7WA 4ZSEA 3UOKA 3BHUA 3FC2A 4R78A 1J7IA 3VS6A 3DJ5A 1Y6BA 4A9YA 3PWYA 3HUCA 3R8UA 3UZPA 2C5XA 2RKUA 1YOMA 3OEFX 4BDBA 4BVUA 5AIKA 2JC6A 3OWKA 4R5YA 4USFA 4PMTA 4FZ7A 5L8LA 4MV9A 4AFJA 1YQJA 2AUHA 3OBGA 1ZXEA 4AW1A 2YM5A 2OWBA 4CRSA 2WNTA 4ENXA 1FGIA 4J99A 3DAEA 3Q1KA 2BFYA 4BDGA 3P23A 1GY3A 5DEYA 4UN0C 5KMKA 2I0HA 4CFWA 4YZCA 2OIBA 4QMOA 1CQJB 2CKQA 3EN6A 4KS8A 3O8TA 5DLSA 5DRBA 4BBFA 3T8OA 3ODZX 4IC7A 1JOWB 2X1NA 4J52A 2XK8A 4RQKA 2WMRA 2XVDA 2XBJA 4IX5A 4C37A 3IDBA 3RFCA 1K3AA 5J7HA 1WBTA 2W71A 5H8EA 1PXPA 1JWHA 3NR9A 4ZTQA 3W1FA 4YBKA 5CANA 2BDJA 4IWOA 3EYGA 2C68A 2J5EA 3ZO3A 1WBSA 2WMSA 4ZQIA 2WMVA 2UZBA 3HV7A 2BAKA 3O0GA 4E6CA 2C6MA 4YTCA 4HQ6A 4JBOA 5HG7A 4ANQA 4IDTA 4TW9A 4ZJIA 4YB8B 5KMJA 3VUHA 5CY3A 5BUJA 1I44A 3RAWA 4D4RA 1TQPA 3C5UA 4FKVA 5BVKA 2IVSA 3R9RA 4GK2A 3MA6A 4CQEA 3Q2MA 4Q5HA 4QYFA 1OBDA 4LV5A 4CSVA 5HX6A 4G6NA 2OF4A 2O64A 4I23A 4KUJA 4X2JA 5CEIA 2HWOA 4JAJA 4MBJA 3ZSIA 4PL4A 3JS2A 4JXFA 2C6KA 2YITA 4O38A 4BDHA 3FMMA 3MS9A 4LRJA 4GT3A 3F2NA 5FTOA 1FQ1B 3PA4A 2XRUA 4WOVA 5KO1A 2R3RA 4ALWA 4M15A 3PZHA 2VNWA 3AC2A 2ERKA 3NRMA 5M55A 4C02A 4WNKA 5CNNA 5HE3A 3KGAA 4C4HA 4IWDA 4O7LA 5E90A 2JDVA 3UVQA 4CV8A 4U0IA 3V6RA 3ZHPC 1F3MC 1U46A 3FLNC 2R7KA 3U6IA 5E8VA 5B7VA 4J97A 4ZOLF 5LCKA 3ZFYA 1Y91A 1REJA 3PXYA 4XOYA 4FZDB 5EM8A 3DS6A 3ET7A 4O27B 1XH6A 3LMHA 4ZTLA 2OZAB 1C30A 2ZOQA 4A4OA 4YGAA 4C34A 4RIYA 3QTUA 5DHJA 2JGZA 4QMUA 2X39A 4U79A 5L6PA 3A8XA 2O8YA 4EHGA 3MH2A 3VUGA 5BYZA 4EHZA 3R23A 3P0MA 3F82A 4RJ3A 2DZDA 1NXKA 4L52A 4R3RA 5AUTA 3LCKA 5E91A 2VUWA 4XOZA 3QRUA 2XK4A 1WBPA 3FXWA 3SOAA 2E9VA 4KD1A 4YHJA 3LKMA 2CPKE 1PMVA 3C4XA 3MTFA 4LL5A 5BPHA 4U81A 3M42A 5CAVA 4YBZB 2C6LA 2AYPA 2WIHA 4MV1A 4CZUA 4MV6A 2RL5A 2QO9A 4LI5A 4UYAA 1UU9A 3BI6A 5CEKA 3QYZA 2JKOA 2UW4A 4KABA 4QMZA 3F3WA 2CN5A 1U5RA 2XF0A 3K54A 4RVLA 3KULB 4Y46A 2F4JA 4ERWA 5IA3A 4X6QC 2X0SA 4I6HA 5A14A 4DG2E 2R7BA 4GUBA 4RJ5A 2GNIA 3FKNA 4OTRA 2YCQA 2V62A 4X2KA 3Q32A 3S95A 4AU8A 3DBCA 4RJ8A 3MIYA 4RIOA 2VV9A 3Q3BA 5EM6A 2X7OA 2CGWA 4Y85A 3F3VA 3QWJA 2BKKA 4QP3A 1S9IA 5EKOA 4L43A 3SC1A 4TNBA 3WILA 2GTNA 3U8WA 3A8WA 4FKPA 4ZS0A 4G6OA 4FT5A 4FV4A 4A9RA 4ALVA 2YEXA 3FUPA 3BGQA 5LMBA 5EM5A 5EK7A 4L44A 4ZSAA 3VF9A 3F5UA 3KY2A 5M4IA 4FE2A 4YP8A 2B53A 4ZTHA 5IQEA 2ZB0A 3RPYA 4GS6A 3CR0A 3VQHA 3EQBA 2ZVAA 3KN5A 2VGOA 3OFMA 4R7HA 2Z7QA 3W55A 4OTGA 4UWCA 3A61A 3CBLA 3H9RA 4CLIA 3SD0A 4BDFA 2PVPA 1UNLA 2R86A 2VWWA 3RGFA 2FB8A 3AC3A 3A7HA 5GONF 4MA5A 4QP7A 3RV4A 5JRSA 2A27A 3CC6A 3L1SA 3HL7A 4C3PA 4QMPA 1XH8A 4NM0A 3D5WA 1Z5MA 5EG3A 3GNIB 3O71A 2R3OA 4C2WA 4F7JA 2C3JA 3P86A 4BCNA 3LFSA 4FSZA 4BCFA 2OLCA 2J51A 4HNUA 2PZYA 3LFNA 3WZEA 1J91A 3GVUA 2W6MA 4C59A 4CFUA 3L8VA 4BDKA 5K3YA 3R7UA 2CN8A 5AUVA 3BLRA 4L42A 3WF7A 4W4WA 3AG9A 4EOIA 3T3VA 2YDJA 4NW5A 4BYJA 3I6UA 4BGGA 3I7CA 3QKKA 4GKHA 4U9AA 1PK8A 4D0XA 1SMHA 2UZTA 3A7JA 2IJMA 4IZYA 5CI7A 4YZDA 5F94A 3VUMA 5M07A 2QKRA 3F7ZA 4RMZA 4DEGA 3R7IA 2XYNA 2IVUA 3CQUA 5HCXA 2UVXA 3D5VA 5E8YA 3FLSA 5CZHA 3EMGA 3EN9A 4YTIA 1QCFA 2HZ4A 4I6BA 3FI2A 3KF7A 4Q9SA 5A4LA 4G16A 5A9UA 4R6VA 4EOOA 2PVKA 1Q61A 2BHHA 2IVVA 1JNKA 2V55A 3FZRA 4JG6A 2WFYA 4TYIA 2C0OA 1WBOA 4XRLA 4A06A 4HNIA 5IA0A 2UUEA 4ZZNA 1ZMWA 2IPXA 4RVTA 4DEIA 1GGOA 2ZMCA 4ZXTA 2HGSA 3ZYAA 3MWDA 4MV7A 4XV3A 2NU9B 4HNVA 1MRUA 4FIIA 1R3CA 1JSTA 3LFQA 4TNDA 2C5NA 3CGFA 3R22A 3F6XA 5D7AA 5M53A 4BIEA 2V58A 4G3CA 2ETMA 2I0VA 4XNEA 4U8ZA 4MYGA 4NK9A 5AX9A 4YC8A 1H1WA 4RSSA 3UC3A 3EIDA 5A46A 3R73A 5JZNA 5HLNA 4CRLA 5CVGA 4IADA 5E9EA 5EM7A 3ROCA 3E7VA 5JRQA 3SGCA 3PXQA 3G8CA 4ZP5A 4OTHA 3OUNB 5AV3A 4AN3A 2XH5A 5LXTF 3GIDA 4RWLA 4O0SA 3S4QA 2X2MA 3K3IA 5H3QA 2WTDA 4ID7A 4JRNA 3NWWA 4CMTA 2XCLA 3KN6A 3P5KA 4XS2A 1BUHA 1STCE 4RVKA 4PNKA 3FZPA 4M14A 5LOVF 1M17A 2XZSA 1G3NA 3E8EA 3PYYA 3KA0A 4GYIA 3RPRA 3TT0A 3W18A 3FKOA 4ZEGA 4JT3A 3QUPA 5J95A 3A7GA 2YACA 3D83A 3B2WA 4B7TA 2BR1A 4ZMFA 1M6VA 2C3KA 2EWAA 4UYNA 2BZJA 4A7CA 3THBA 2W4OA 3HYHA 4AFEA 3ORTA 5D12A 4FKWA 3N4TA 3QZIA 3VUDA 4QNAA 4IW0A 1KOAA 1YDRE 1JLUE 5CA0F 1W0XC 3IGOA 3OY3A 3VUIA 3MVMA 2W0JA 3T9IA 5L2IA 4WO5A 5HESA 1IOVA 2X7FA 3R01A 4C61A 4CEGA 3QCSA 4K8AA 3BQRA 4O96A 1WFCA 4MHAA 5CENA 1KJ9A 4R3PA 3WIGA 3D4QA 3LE6A 4TV9F 2QOFA 4X7QA 5BVDA 5EFQA 1DIKA 4BCKA 2B9HA 1W7HA 3BPRA 3LCOA 4ASXA 3OXZA 5HGIA 3JY9A 2YIXA 4EKLA 4ME6A 4AA4A 1K2PA 2W4JA 3DZOA 3WZUA 3G9LX 3S3IA 3KXNA 4JBVA 4XYLB 4HYSA 1J1BA 3R21A 3MBLA 4E4MA 5JGBA 1W82A 4FKSA 4TXCA 4EH3A 5F4NA 3G90X 3KK8A 5T3QA 3ORXA 4GU6A 1L8TA 1A9UA 3MY1A 3HNGA 4BCHA 2WTVA 1CKJA 4IBMA 4XG6A 2Z02A 3TNWA 2V5AA 1JKJB 2XBAA 3AT2A 3MY0A 1OVEA 3OEZA 3NIEA 5E8SA 3SG8A 4X2FA 4LMNA 2R7MA 3PJCA 2FPGB 3O23A 5J2TF 2VPQA 3DQXA 2OSCA 4YNOA 3P08A 4RX5A 4E4XA 4AAAA 3TXOA 4C4FA 4FEUA 2EU9A 2NRUA 5E1EA 3VAPA 1GAGA 4AT4A 3GXLA 3KRRA 2JBPA 3F88A 2V7OA 4PNIA 3RK9A 5CSHA 3VS5A 5FEEA 3AD4A 5C9CA 3VWAA 3Q2OA 2XIKA 3LJ0A 3ORPA 3Q6UA 3TKIA 3TJCA 4N6ZA 4LM5A 5CAOA 3SVVA 3EKKA 2VX1A 5L8KA 4WIHA 3AGMA 2QODA 4MD8E 3LFAA 2OIQA 2BAQA 2ETRA 4ZSGA 4EC9A 3RM6A 4BR3A 5ETIA 5LJJA 4G3GA 3I7BA 1ZYCA 2JKQA 1OKYA 2OG8A 3QQJA 2EUFB 3VN9A 2G1TA 3OCSA 2SCUB 3C4ZA 2O0UA 5IEYA 2ZMDA 4LV8A 3MW1A 3PP0A 4L9IA 3FHIA 2YFXA 5KZIA 5D41A 1J7UA 2FH9A 3KALA 3R02A 2X9EA 1WAKA 2W6PA 4QMTA 3FV8A 4AE9A 4E4NA 4YPSA 2AC3A 1Q8ZA 3ZO2A 3NCGA 1VJYA 3EJ1A 4RX7A 3VJOA 4Z7HA 3NW6A 2FPPB 4BCMA 5AV1A 4TYGA 5IH4A 4TYHA 3HBLA 4G34A 4PV0A 4I20A 4F99A 3AD6A 4KIQA 4MEDA 4Q9ZA 3VJNA 4Z3VA 4NFNA 2JAVA 4F64A 2HY0A 2YDKA 4HPUE 5D10A 1FPUA 3R63A 3H3CA 2JDOA 4MBLA 3ZC5A 4OTIA 3TDVA 2Y7JA 2XNBA 3V5TA 5M57A 3JZFA 2JFMA 2X4ZA 4IZAA 2PVRA 3BCEA 2IZUA 4YNEA 4H3BA 3Q5IA 4DEEA 3R1SA 2ZV2A 1OIRA 3LWBA 4JR3A 4YTHA 4F08A 5J5SA 2X0GA 4IB1A 3DTWA 4DT9A 3FDNA 2YN8A 2C6EA 4QPAA 3ZUTA 1JSVA 4FTAA 4PF4A 5AP4A 3ZM4A 3U87A 5IQGA 5F9EA 3M11A 3E8CA 2QOBA 4DFBA 1IEPA 2C30A 3WF6A 2HYYA 5HBEA 4YR8A 4RC4A 4LYNA 4CGAA 2F57A 3AC5A 4MCVA 5AP2A 4QMSA 2PVJA 1EUCB 1WCCA 4GT5A 4NCTC 3ANRA 2EB2A 3NYXA 3AMAA 4U45A 4FIFA 4UZHA 3QQHA 3O51A 4HPTE 3O7LB 3U55A 1Q41A 4HVDA 1KEEA 4PTEA 1M7NA 3BELA 2W1FA 4IB5A 4LRMA 3E5NA 1FOTA 2LAVA 1YOJA
chains in the Genus database with same CATH superfamily
3QRKA 4RLLA 3BIZA 5FG8A 4X3FC 4I50F 4AS0A 5I9YA 1JKSA 5GIPE 2YWVA 4FL3A 4JG7A 4FTUA 5EYKA 2XM8A 5D1PA 1E4EB 3BV2A 1Q97A 4M8TA 4EH8A 1ZZ2A 4FIEA 4EH5A 3R9HA 3D7TB 1UKHA 3NPCA 1TQIA 3EWHA 4UALA 2WD1A 1OKVA 4IQ6A 3TV4A 4IHJF 1Q99A 4JIAA 5A54A 4FV8A 3MWEA 4G5JA 4QP8A 4X2GA 3BX5A 4FNWA 4F9WA 5A3XA 4CCUA 4F6UA 2QO7A 3ZLWA 3N6RA 3EL7A 3G5DA 4JX3A 3ZO1A 3ZFXA 2RGPA 2UZDA 3COKA 3GU6A 2EJ2A 3SE7A 3TEKA 1H01A 4QMXA 4ACGA 5HVYA 5C1OA 3MESA 4NJ3A 1P8LA 4RCNA 2QHNA 4D28A 4MNEA 5BVOA 5AIRA 5L6OA 3UG1A 4XUFA 4XRJA 5EW3A 1Q5KA 4MH7A 5EHOA 5HD4A 2PVHA 3OUUA 3U9SA 4XG3A 5HG5A 1M52A 3HEGA 4PY1A 2H6DA 4BKJA 4ZOGA 5HKMA 1Q8TA 4U41A 4MKCA 3MVHA 1GOLA 4R5SA 5CLPA 4ZZOA 1KE8A 1KWPA 3UODA 1PXJA 3I0OA 3DT1A 3HZTA 4FTQA 5CA1F 3JY0A 2W1HA 3PVWA 5HIDA 2R82A 1IA9A 3TW6A 2A0CX 4LL0A 4EK4A 5CAPA 3ATSA 3MA3A 5FEQA 1YDSE 4EZ7A 3I6WA 2VTOA 5JT2A 2IW9A 5JQWA 1OI9A 3DY7A 3F2AA 2XM9A 4M84A 2ERZE 4S2ZA 3W32A 1PXLA 4XV9A 3UQFA 4I6LA 5HE1A 1OIUA 4ZTNA 1OPLA 3TL8A 2X8DA 3UBDA 2J4ZA 5DT3A 1EKPA 5L2TA 3RPVA 5EOBA 2QF7A 3H10A 3G0FA 2YJSA 3HV6A 4CG9A 2B9JA 4B4LA 3I60A 5KKRB 4U3YA 4XLVA 5ANDA 3RVGA 1U54A 3PE2A 4HVIA 3I5NA 1WMKA 3VHKA 4HVGA 3B2TA 4DFYA 3D15A 4MUQA 3ORKA 5M51A 2ITXA 2E9PA 3QQFA 4PMPA 2H34A 4EYMA 3IKAA 3W0RA 4FFMA 2OJFE 2OKRA 1I1MA 4OBOA 3CTQA 1M14A 1WBWA 3LXNA 4IB3A 1SVGA 4FSRA 4WRSA 5ANOA 5A6NA 4WG3A 3TWJA 4AOJA 2REIA 2EVAA 2W5AA 4M67A 2YZGA 4YJ3F 2UVZA 5KMIA 3GU4A 4UCSA 4ASEA 4GYGA 2BIYA 3TNHA 2R84A 3W2SA 1XHAA 2XIXA 4BGHA 1GZNA 5IH5A 5CU0A 3GU5A 3U4WA 2PUPA 3IONA 3LCDA 5KNJA 3AD5A 3KYHC 2OK1A 5L8JA 1NW1A 5FP6A 2XKEA 1R0PA 2JDSA 3QD0A 4FKRA 4TPTA 3U54A 2QB5A 1KC7A 2QD9A 4LMUA 3VQUA 3WF5A 3QD2B 4O83A 4EOMA 3NS9A 3QQGA 1H0VA 3DOGA 5TT7A 3I1AA 4APCA 4LG4A 4ENYA 5IPJA 4TVIA 4FTMA 5KKRC 2GTMA 3DTCA 1CSNA 2EXCX 5BWVA 3NAYA 3WYYA 1OB3A 1XH4A 4RJ6A 4C36A 4ANBA 3JSLA 4MA0A 3F9NA 3LJ2A 1IAJA 4AGCA 3MVJA 4DFUA 2VU3A 3TINA 1JVPP 3WYXA 3ZO4A 4KINA 3U51A 3DPKA 3F69A 3JYAA 3MFSA 4BCGA 4AQKA 1BI7A 2OO8X 4FT9A 4LRKA 3SV0A 1P5EA 2WEVA 4F1TA 2WMBA 3DKCA 4D5HA 3O50A 3MN3A 4KRCA 4FSQA 4FEWA 3REPA 5KX8A 3EQGA 4IIJF 4E6NA 5CU4A 1WR2A 2G2HA 5JQ5A 3U9CA 1ST4A 1U54B 3FY0A 3NEWA 3NZ0A 4N0SA 4DH8A 1KJ8A 5IQBA 2B9IA 5L2SA 2GPSA 3HRCA 5HIBA 3WNZA 4FKGA 2HXLA 4QTBA 4HCVA 3T9DA 2QOKA 3EFKA 3GI3A 4YZ9A 3BHVA 3UDBA 3GCVA 3COIA 4M3QA 2GHLA 3D7TA 2WMAA 3JR1A 4FNZA 4G5PA 5HCYA 3BG5A 5BWWA 2OU7A 4H36A 4RGJA 3RCDA 4QTEA 2PBZA 2VQDA 4BICA 3Q04A 3TUBA 5L2WA 3LCTA 1XBBA 2WB8A 5EOLA 5CAQA 4YLLA 3PE1A 3LJ1A 5JEBA 1JBPE 4FTLA 4NZWB 5BYLA 3W2QA 2NP8A 3AMBA 4I4EA 4AZWA 3PP1A 3DNEA 3IK3A 3NW7A 2EB3A 4FSYA 4RA4A 3TDWA 5HTBA 1NY3A 2FGIA 4C58A 3CSVA 3NNVA 5I60A 2GS7A 4ORKA 3ZBFA 4R7BA 3OF0A 3QALE 4GJ3A 4J8NA 3RHXA 1M2RA 2C6TA 2WOTA 3QUEA 4ANSA 4DEDA 4DAAA 2RF9A 3LQ3A 3HA8A 4AT3A 4D1XA 2B9FA 5BWUA 3C5IA 3ZSHA 5HD7A 3NSZA 4PDSA 5FEDA 5FBOA 4BIBA 3TNPC 5K2MA 3UZRA 4LDTA 3IO7A 5H8BA 2YZAA 1Z2PX 2OH4A 2YCFA 5E7RA 5EKNA 2PUNA 3TKUA 3R00A 4F9YA 4I4FA 3TZ8A 3QZGA 3RAKA 4FFPA 3BE9A 3LAUA 4BIDA 5GINE 4QYYA 4H3QA 4U80A 3DKGA 2E2BA 1VR2A 3ZOSA 3GQIA 4G17A 2XK9A 4Z55A 1PKDA 2FPIB 4FI1A 2VWBA 1KE7A 3Q52A 4QMQA 2GHGA 3PG1A 4I6FA 4P7EA 4O2BF 4S31A 1H1RA 3LXPA 5CSWA 1M7QA 4WNOA 4EOQA 5L3AA 5I5YA 4TN6A 1LEWA 4PWNA 1RE8A 4E1ZA 4F78A 4JQEA 5IEXA 5EH0A 4FYNA 4BZNA 4FVQA 4O0RA 3F5PA 3WE8A 1B6RA 4FSTA 4OW8A 4FSMA 3DZQA 3HA6A 4YZMA 2OXXA 2WMUA 3Q2JA 4FFRA 3UIUA 5IU2A 2QO2A 4OTDA 5DWRA 5FBNC 4USDA 3PFQA 4C4IA 3LLTA 2JAMA 3ACJA 2X81A 4QP9A 3N8DA 3KCKA 3POZA 4C4GA 2I8CA 4IAZA 5BNJA 2W6QA 2ITQA 4PL3A 4X0MA 4CTBA 2XNEA 4ZIMA 1F5QA 3QHWA 2UZEA 3V8WA 5CWZA 4YU2A 2YWPA 4ZY4A 1ZYDA 3K5UA 4S34A 4UXLA 4C35A 3HMMA 1I7LA 3RHKA 3RMFA 3ZTXA 3UOLA 3QRIA 3GFEA 4EBWA 3MY5A 4M12A 4JQ7A 4O91A 4HR7A 4MXXA 4IDVA 4LV7A 2WGJA 4EQCA 1CKOA 4E8AA 5AA9A 5IEVA 4K0YA 5BMSA 4U5JA 1OITA 5ANJA 1Q8UA 3CY2A 3BHTA 3FQEA 4Y72A 4DC2A 4MWIA 3EFLA 3OROA 2WXVA 3T9TA 2WTJA 3VS0A 3UNZA 3ZRMA 3WO1A 3QF9A 3NC0B 2R85A 2VX0A 4BBEA 4G3FA 4WBOA 4CNHA 3HRBA 5CU3A 1ZMVA 2R3KA 2VD5A 4OR5A 4TYJA 4YJTA 3ZRKA 4DFLA 3BWJA 2F9GA 2Z8CA 4YC3A 4LFIA 5CASA 3F3UA 2WELA 4QDEA 4QYEA 1GIIA 5KBQA 1M0WA 2I87A 3RP9A 4NTTA 3ENMA 2PZPA 5AUWA 3V8SA 5CU2A 1R78A 3PTGA 4H05A 4ITIA 3UP7A 4NZMA 2XIRA 4ZK5A 3R8MA 4IVAA 5BWXA 5HQ0A 2Q2TA 2J6MA 2WQMA 3ZRLA 2X2KA 2PMLX 3A62A 1SNUA 4AXDA 1J3HA 4AXEA 2FP4B 3MPAA 5DGZA 2VTQA 3E88A 4HCUA 1Y6AA 4F9CA 1DV1A 5CB4F 5I5WA 3GFWA 4YJPA 4V0GB 4J53A 3PIYA 3ETAA 4V04A 3A4OX 1H28A 1PXKA 2F7EE 2YIYA 4XBUA 3RAIA 5IQHA 3JXWA 2G2IA 3HRFA 4FIHA 4DG3E 4YURA 4E4TA 1BX6A 1WBNA 2PSQA 2E9NA 3Q9ZA 4RPVA 5FM2A 4F0FA 2OJIA 3NUUA 4BF2A 3CE3A 4FL2A 5CI6A 4U7ZA 4ASZA 5CEMA 5F20A 1CKPA 3Q53A 5IQDA 5LCJA 2YS7A 3LOKA 4L3PA 3ZS5A 5KMOA 2HY81 4DEBA 5BX0A 4L46A 4ITJA 1XWSA 4G3DA 4W4VA 5FUTA 1P4OA 2G01A 3A60A 4JI9A 1W98A 2UZWE 5EYMA 5AV2A 4GIHA 4D1ZA 5JVLA 2WQEA 5TO8A 5AMNA 1DAAA 3QLGA 2J9GA 3TZ9A 4EL9A 1G5SA 3E3BX 4B9DA 3EZVA 1P4FA 3TKHA 2HGXA 2B52A 4CT2A 5C1PA 4J96A 4I0SA 3ANQA 3E7OA 4KAOA 4AZEA 1KJQA 3DA6A 1H25A 1KE6A 4QTAA 2CZGA 3RV3A 2KULA 2WQBA 3G6GA 2IP4A 2X2LA 2E9UA 4YLJA 3IW8A 5C8MA 3F3TA 3PFYA 5LVPA 1EKFA 3BGPA 2ACXA 2W7XA 1JQHA 2I7QA 2PULA 5IQAA 4AF3A 2ZGIA 4AE6A 3W5OA 2W4KA 5CF4A 5IQIA 3JRXA 4QO9A 3QQMA 3KEXA 4GU9A 1E1XA 1H0WA 4FV5A 4JRVA 2IW8A 2R87A 2CKPA 2YCRA 3A7FA 1IRKA 2C47A 2GPHA 4I24A 4UY9A 3ZUVA 4BYIA 4TY1A 4E6QA 3N4VA 2OJJA 4D1SA 2E9OA 1QL6A 4X21A 4U42A 3FYKX 4RZVA 5EW9A 4GFOA 4YHFA 3KB7A 3FL4A 3OZ6A 4BDAA 4XLIA 3R8VA 5A4CA 5HZNA 2HGWA 2W9FB 2GFSA 3O96A 4K9YA 3PXZA 5DOSA 3VRYA 3SAYA 2IW6A 3MWUA 3NUXA 3ENHA 3G51A 4ZTMA 3UOHA 4WBNF 4JNWA 4O6EA 5FP5A 1YXUA 4WUNA 2YM4A 5JFWA 3LW0A 3RUPA 4PTCA 3DTGA 4X3FA 3JZ6A 3R8ZA 2R9SA 4QYGA 3VW6A 2BCJA 3UZBA 3PVUA 3VBXA 3LP8A 4FKLA 5AP3A 4I93A 4MVFA 3NNUA 4AGUA 5JKGA 2V22A 2BRBA 2QURA 3KRXA 5B0XA 1KT8A 3TCPA 1UNGA 3HP5A 5CEQA 2QU5A 4EEVA 5BPYA 1NT2A 3LFBA 4RWIA 3O17A 4JS8A 5FXSA 3NBYB 2QR7A 4O84A 4YJUA 3VPDA 4WG4A 4YO6A 3OBJA 3C9WA 5HG9A 5JGAA 2W5BA 2QOIA 4KRDA 4HVSA 3NUSA 4YZBA 4EYJA 3QAME 3KXHA 3FPMA 1DV2A 1Z2OX 4KA3A 3HV4A 4H39A 2DLNA 2ESMA 5CZIA 3OWJA 4DBXA 4ZJJA 1ATPE 3AC1A 4GH2A 4PX6A 4DH1A 2PYWA 4FT3A 1ND4A 5HHWA 4BJJA 4B99A 3OTUA 2X4FA 2BZHB 2KTYA 4YSJA 5M4FA 4LUEA 4PTGA 2HXQA 2XMYA 4J7BA 5E4HA 5EDPA 4M7IA 3UO4A 5CQWA 3OC1A 5I5XA 5LYJF 4UCTA 2X6DA 5DA3A 2RFEA 1JKTA 1ZOEA 2BUJA 5KMNA 3HKOA 2PWLA 2YISA 3NDMA 3TZ7A 4NZNA 2X8IA 3CKWA 3R6XA 2XK6A 1A48A 4FKTA 3W8QA 3FBVA 3QRJA 5BYYA 4CMFA 3U9NA 2DQ7X 3DB8A 1OL5A 1AD5A 2F7ZE 2RG6A 2VTRA 3HMIA 1YOLA 5KZ0A 4UXQA 3TV6A 4DGOA 1VBHA 1CDKA 2Q2UA 1Q8WA 4NZOA 3DBQA 3NYVA 4EORA 5DR9A 4B8LA 4FV3A 5BYBA 5JZJA 3ORRA 3ETHA 1H26A 5FPOA 4LGGA 3ULIA 4IZ7A 3ZBXA 2W1DA 2Y6MA 1PX2A 3BAAA 1VS0A 2OZOA 3VC4A 4AT5A 5DBXA 2VGPA 3BRBA 2JIVA 3E5AA 3QTXA 3PUPA 3GB2A 3QD4A 1AGWA 2Z7RA 3I5ZA 4KIOA 1GNGA 2XK7A 3DXQA 2Q83A 4YJSA 4TL0A 4FJVA 5FRIA 3OTVA 2I1MA 3L8SA 3UO5A 3W1GA 3ZXTA 1J7LA 3FKLA 3PY0A 4QP6A 4XP3A 5FDPA 5BVFA 1MUOA 3Q4TA 2UW6A 4LGHA 3DBDA 3UG2A 5ANIA 4I55F 4LH6A 1PMEA 3C0GA 5JFXA 3W0MA 3C13A 4AXFA 4BGQA 2HIXA 4L7FA 4CTCA 4TWCA 5BUEA 2YAAA 4GW8A 4XX9A 3ZM9A 3TY9A 4YMJA 1Y57A 4IVCA 5AUUA 5D7VA 4O4JF 1JKKA 2BMCA 1Q3WA 2QQ7A 3P5JC 4KBAA 4ASDA 2AC5A 3MFTA 3WO0A 4MNFA 3QTSA 1FMKA 4WG5A 2Z7LA 4I3ZA 4CC6A 3PLSA 2YYAA 2NUAB 5DRDA 4Z9LA 3D5UA 4M68A 4D4YA 2JFLA 1PYXA 4GK4A 4JG8A 4M9UA 4XP2A 3AQVA 4PDOA 3KK9A 5KCVA 5IDNA 1YI3A 1XBAA 1JKLA 2GS2A 4E5WA 3C1XA 5BWRA 5AAEA 2YW2A 4FZ6A 4RX8A 4O4HF 2CGXA 2R2PA 4XCUA 1Q24A 4Y73A 4I94A 5E8UA 5M56A 4XEYA 3GCQA 4ITHA 3GT8A 4RWJA 2NPQA 2R0UA 5DVRA 4I5CA 3DTFA 1YI4A 3GLKA 4FFOA 3VBVA 3GU7A 4GJ2A 3H9OA 5HVJA 3A4PA 4QQJA 3RWQA 1IYDA 2OXYA 5GJDA 4GK3A 2XCKA 3R28A 3F2RA 2ITOA 1ET0A 4MF1A 1V0BA 3P7BA 3RNYA 4NCTA 4I22A 4PQNA 3P7AA 4Q2AA 4MV8A 4ZMEA 2QOCA 3QX2A 1EHIA 1KJJA 2X7GA 4BCIA 5D11A 5C1QB 4CT1A 3CEBA 5EQEA 3SW7A 5LWMA 3SKCA 4EH2A 5HBJA 2B55A 5AM7A 2WTIA 1Z57A 5T68A 3TJDA 5BUIA 4FUXA 5AP7A 3HV5A 4XV1A 4I41A 4L67A 4I5PA 5FGKA 1BXRA 4I5MA 4JVGA 2OIDA 3FLWA 5EHLA 3IW7A 3E92A 3BYVA 1YKRA 3C50A 3QFVA 2HCKA 3TUDA 4FV2A 3I79A 2QI8A 3BEAA 4MNEB 4D5KA 4PMMA 3HAVA 2XJ0A 2VN9A 5K4JA 4AZFA 4JJRA 4F63A 1DM2A 3BZ3A 3AKJA 4M0ZA 4XYFA 3WOWA 2X5RA 2FUMA 5A4QA 3TIZA 1NVRA 5H9BA 3UVPA 3R7EA 3O8UA 4GLXA 1Y8GA 2QHMA 4G1WA 4J95A 1Q8YA 2W9ZB 3FQHA 4L7SA 4NFMA 5FTGA 2IN6A 2NRYA 4UV0A 5FM3A 4BI0A 3CD3A 2XNNA 2GCDA 4F6SA 3ODYX 1O6KA 4FT0A 2W6NA 2B54A 4FBXA 5LVLA 3UNJA 4FODA 4MQ1A 3TZMA 2ZB1A 3K2LA 3LIJA 4IM0A 4KKGA 5CSPA 4JBPA 4CKIA 3E93A 2W1GA 3UIBA 2F2UA 5LMKA 2HW6A 5C8NA 4O22A 3MJFA 5IISA 3BLAA 3ZFMA 1M2QA 2UZLA 3OW4A 4O82A 4X3FB 1E9HA 1PF8A 3KULA 3TEIA 1ZYSA 1SM2A 4BCPA 4LUDA 1JAMA 3HB9A 4B8MA 3ORQA 2I6LA 3NNXA 4ACDA 5HU3A 2NU6B 2O2UA 3Q9YA 2O65A 4HGSA 4OGRA 5K3WA 2GNJA 3E64A 3IOKA 2YM6A 3LFDA 5AV0A 2YL2A 3DFAA 1APME 2IWIA 3ETJA 5HBHA 3ZH8A 4KKEA 1UV5A 3HLLA 3ITZA 4M0YA 3S00A 2GNFA 5HNGA 1ZYJA 4M97A 3FXZA 4X6RA 4C3FA 3DDQA 3PG3A 2DWCA 2C6DA 4EGQA 5EDRA 3CCNA 3U6JA 3RR5A 5C4LA 2VTLA 1PYEA 2JDRA 3B8QA 3DLSA 3FMHA 2GNGA 2WTKC 1DS5A 4HGTA 4JBQA 3W0OA 3KC3A 4DA5A 4DFZE 5B2LA 1Q3DA 2YABA 2XJ2A 3UMWA 5EDQA 1EUDB 3WF9A 3SGIA 3L9PA 3EN5A 4IHPA 3BE2A 4YBJA 2XCHA 3OG7A 3QUDA 4R1VA 4WUAA 5AX3A 4C4JA 3NW5A 5LMAA 3G2FA 3V5WA 4HW7A 2PUUA 2DWBA 3MPMA 2BZIB 3VULA 4BTKA 1B6CB 4TTHB 4DDGA 2XK3A 3GDEA 3QTQA 5DAAA 4JIKA 2XNMA 2CNVA 1IG1A 2ZM1A 2Z2WA 3AC4A 3C51A 3FMLA 3LFFA 1BKXA 3NX8A 5DT4A 3SXFA 3BBWA 2J0JA 1NA7A 3NUNA 3NYOA 4J8MA 4AACA 5H80A 1MP8A 1KE9A 2YIQA 2ZYBA 4C0TA 1HCKA 4MX9A 5LA6F 5FXRA 3GU8A 4FTOA 4BCQA 3DQWA 3LMIA 4GV1A 4RC3A 3FXXA 2O3PA 3NMUF 4DTBA 4F70A 3P1AA 3RTXA 5CTPA 3EN4A 3FMEA 4CXAA 1XR1A 4A4XA 4DBNA 2XARA 3FHRA 4O7TA 4D9UA 3LLAA 3OHTA 3NAXA 4USEA 5EHYA 1XO2B 3JVRA 5IA5A 4EONA 3NIZA 5DR6A 4DHJA 3GBZA 4MD9E 4S33A 2C6OA 2BPMA 1BL6A 3PJ3A 2CGUA 4TT7A 5KMMA 3UE4A 4EOLA 3TQTA 2YIWA 2WO6A 2IG7A 4JDHA 2XRWA 1M2PA 1YHSA 3R0TA 4C3RA 2R3GA 4NYEA 2DUVA 2P2IA 5ACKA 4BN1A 4C5AA 3FZOA 2JLDA 2VRXA 3GCPA 3M2WA 1YWRA 2BROA 2W1EA 4CCBA 1GLVA 3II5A 3D2IA 3L8PA 3ALNA 4TWOA 2R7LA 5IZFA 3R2BA 3R7VA 3FZ1A 2W5HA 3H0YA 4MK0A 3JRWA 5M09A 2XIYA 3LQ5A 4J1RA 3KXXA 4OUCA 4IJ9A 2CLXA 2R5TA 4U43A 1I09A 3MV5A 1B6SA 2QLUA 5HTCA 5EYDA 1EZ1A 4NH1A 3NGAA 4EK5A 2HVRA 4BB4A 2OLSA 4GMYA 2R3IA 4P90A 4O2ZA 4R7IA 3FJQE 4EBVA 4F7SA 5KHXA 2WMXA 4DHZA 3U0GA 2O63A 4D9TA 3ORZA 4FG7A 4O0UA 4EK3A 2W05A 2B0QA 3R5HA 4EH7A 3D5XA 4YLKA 3HO8A 4FKOA 4AOIA 4GL9A 5IA1A 4UB7A 1XH5A 2OICA 3AOXA 4FK3A 5IF1A 3HP2A 4NUSA 4EZ5A 2C00A 1W8CA 3R5FA 1KTAA 4R1YA 2YRWA 3QKMA 2P55A 4EOJA 1H1SA 5CALA 3R1NA 3QTWA 4QQ5A 4YJOA 2Q0BA 5ANEA 5L6WL 4F0GA 1SCUB 5AWMA 1NVQA 4YAJB 3OUKA 3H9FA 4ZY6A 3K3PA 3EQIA 2FVDA 3KRWA 3TTJA 3PSBA 5EQYA 4AA0A 4AN2A 4NT4A 3PRIA 4FOCA 1AUXA 4ANMA 3AX6A 4EQUA 4RBLA 4FKIA 4A4LA 5HNEA 4C5CA 3WZJA 3ORNA 4D4VA 1PMNA 4FK6A 2FSTX 3V04A 2XJ1A 3IQ7A 3TY5A 1U5QA 1IAHA 3KRJA 3WWHA 5C8YF 3PSDA 3CTHA 2UV2A 2RIOA 3DKOA 4PRJA 5AUXA 5IH6A 5HV6A 2OXDA 3OMVA 4FEVA 3U6HA 3DGKA 2PTKA 1XJDA 5EYCA 4DAWA 2G15A 3LPBA 4UEUA 5AAGA 3EH9A 5C8KA 2WQOA 4QYHA 5AP0A 3EN7A 3F5XA 3FMJA 3H30A 3OD6X 4JR7A 4ZSLA 1UVRA 3EQFA 4GKIA 4IEBA 4XV2A 5LP6F 5CE8A 3H0ZA 4ZZMA 5CF5A 4PZ6A 2R3FA 2XNPA 3VHEA 5DMXA 1ZOGA 1A0IA 3R30A 2W1CA 5AUYA 1YXSA 1UWHA 2I0YA 2PY3A 2YZNA 3B8RA 5IDPA 1TFFA 1BYGA 3PN1A 4FIJA 3QWKA 5CYIA 4F9AA 3C4EA 3ELJA 2W17A 3MFUA 2PVFA 1ZARA 3FC1X 3Q9XA 2WU7A 4G9RA 3QC9A 3SXSA 4IX3A 2HVQA 5I5SA 4JDJA 5AV4A 2B4SB 3MH0A 3FAAA 4BZOA 4MXOA 1JSUA 1LP4A 4IE9A 2BILB 3R9DA 3KQ7A 2QU6A 1M0TA 4BBMA 3TIYA 5IQCA 4E93A 4F9BA 1W96A 5K5NA 1ZOHA 1HOWA 3LM0A 4QMYA 4DLJA 2F2CB 4PUZA 3W10A 5JFSA 2UW7A 2HW7A 3SLSA 1CTPE 3C7QA 4GFMA 5M44A 3DK3A 3V4SA 4FEQA 1YI6A 4BZDA 4AGWA 1JDBB 5DIAA 1PXNA 3Q4ZA 1UC9A 4FVRA 4O0XA 1KV1A 5M4UA 2SRCA 1H24A 2WZJA 4E20A 5CT7A 2R3QA 2R3PA 3H4JA 1QPDA 3I81A 3DF7A 5D1OB 4H1MA 2HHFA 2UW9A 2PPQA 1B39A 2PVYA 4L6QA 3SG9A 4ERKA 4CKJA 3RK5A 2PMIA 5FDXA 3QA0A 4YJVA 5CS6A 4FTJA 2YAKA 2PVNA 3OCGA 4AG8A 5D8DA 1B38A 1Q62A 4NM7A 4FEXA 4L00A 3QCXA 3QZHA 4AZTA 2GNHA 4XZ3B 5JVDF 4I5HA 4DE4A 4IH8A 1WVYA 1ERKA 1XBCA 2UW3A 4IX4A 5BVEA 5CEOA 5JGDA 1JDEA 2VR1A 2G2FA 4JMQA 5CNOA 3DJ6A 3F61A 5J9YA 3L8XA 3OWPA 3IDPA 4V0GA 1H1PA 3TG1A 1H27A 3FWQA 4YUQA 2IZTA 4ONAA 2QG5A 2WTWA 3G9NA 2XIZA 1ST0A 4NL0A 4A9UA 3OOMA 1S9JA 2FYSA 3QD3A 4CMUA 4UFZA 1OM1A 3G15A 4CFXA 2VWVA 2R64A 3V51A 4RFYA