5D8DA

Crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
303
structure length
282
Chain Sequence
SNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDRAFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLDSVIAELGLPVIIKPVHEGSVGMSKVEKAEDFAAAIEKATQHDAVVMAEKWITGREFTISFLNGQPLPVIRLQYGIPCGLSETEEKKLQALCLRAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAAKAVGYSFDELCVAILEQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title The crystal structure of the D-alanine-D-alanine ligase from Acinetobacter baumannii suggests a flexible conformational change in the central domain before nucleotide binding
pubmed doi rcsb
source organism Acinetobacter baumannii acicu
molecule tags Ligase
total genus 83
structure length 282
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5d8dA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5d8dA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5d8dA01
4M99A 2ZDQA 3ETJA 2YS6A 1M6VA 1PX2A 1EZ1A 1JLLB 2CNQA 3LP8A 4O84A 4O4LF 3Q2OA 2FB9A 5KX5F 2FP4B 4FU0A 3RUPA 4GGMX 2PN1A 3GIDA 5C1OA 1CE8A 1A48A 2FPGB 4M98A 3R9RA 4O7SA 2IP4A 4XZ3B 3RV4A 1W93A 2R84A 5JVLA 2GLTA 2W6MA 5DMXA 5J2UF 2YZNA 4TV9F 2NU8B 1GSOA 2YWVA 3U54A 5HBRB 3Q1KA 4EABA 1JDEA 4ZI7F 1PK8A 4EG0A 2GQSA 2W6OA 1DV1A 2FPIB 5EZYF 4QSHA 3I12A 4YJ2F 3K3PA 2NU6B 2CNUA 2YW2A 4TUYF 3N6RA 5H80A 1UC9A 3BSYA 5BPFA 3VPBA 4MV3A 2CQYA 3GLKA 2V5AA 4I50F 4IZOA 2C00A 4O7LA 5GONF 3TINA 1KBLA 2I80A 4I4TF 1E4EA 1W96A 1CS0A 4FFRA 2YZGA 1EUCB 1IOWA 2R7LA 1OBGA 1CQJB 4DIMA 2W6NA 4C5CA 1UC8A 3KREA 2OLSA 4MV9A 2HJWA 5CA0F 2NU9B 1JKJB 3TQTA 3V4ZA 2QK4A 4ZHQF 2NPOA 4MAMA 2W6ZA 5KKNB 4O83A 3KALA 1DV2A 3RV3A 1BNCA 3KAKA 4E4TA 4FGRA 1GSAA 4HNVA 4YJ3F 4FFMA 2CZGA 2HGSA 2XD4A 4O4IF 4O2BF 2NUAB 3SE7A 3VA7A 5CAEB 1SCUB 4FFNA 4EGQA 4O7NA 4C5BA 3K5IA 3WNZA 2R7KA 3RFCA 1CQIB 3BFPA 4IWXA 2R7MA 2NU7B 3R5XA 2Z02A 4J6EA 2R82A 3JZFA 5BMVF 3HO8A 4XYMB 3BG5A 4EAAA 1ULZA 1GGOA 1Z2PX 2VHEA 4RZQA 1VBHA 1T36A 4I55F 5LA6F 4TV8F 3MWEA 1BXRA 1KJIA 3NUAA 3MWDA 4DLKA 5K2MA 1KC7A 3UFXB 2SCUB 1I7LA 4FFLA 1B6SA 1EHIA 1OBDA 3G8DA 2J9GA 2GPWA 4O7YA 2W71A 4MV1A 5LP6F 4O86A 3WO1A 5LYJF 1GSHA 3OUZA 3ORRA 2YS7A 2ZDGA 4O4JF 3R5FA 4HR7A 2R6FA 2YRXA 1KJ8A 2ZDHA 3ETHA 5HV6A 4O7RA 5J2TF 2DWCA 1E4EB 1KJ9A 4EA8A 3N8DA 1AUXA 5C8YF 2QF7A 4MV8A 2VPQA 5FNVF 4HQ6A 2I87A 1A9XA 2DZDA 3LWBA 2R7NA 1KJQA 2PVPA 2R85A 3U9SA 1Z2NX 3JRXA 1AUVA 5JH7F 4O4HF 5JVDF 4HNUA 3JRWA 1M0WA 4XX0B 5LOVF 3R5HA 2YZLA 1VBGA 4YAJB 1IOVA 4FFPA 2PBZA 4EA7A 1EUDB 1KEEA 1EYZA 4IWYA 4NYEA 4O7TA 5CA1F 3U9TA 1VKZA 4O7VA 2W6QA 4WD3A 3AW8A 1GLVA 5BPHA 1KJJA 2CNVA 5LXTF 3OUUA 3BSSA 2P0AA 4EGJA 5JQWA 2XCLA 1Z2OX 2YZMA 4ZQIA 3KAJA 2DIKA 3VOTA 1JDBB 3ORQA 1KUTA 4O7WA 2W70A 2VQDA 3BSWA 3VMMA 2VR1A 2V59A 3MJFA 4YAKB 2X0SA 1I7NA 4IIJF 3K5HA 4MV4A 4YB8B 1B6RA 5D8DA 3R23A 2YYAA 3JZIA 2DLNA 4YBZB 4C5AA 1WR2A 5JQGF 4EA9A 3V4SA 2R86A 5IYZF 2GQRA 3VPCA 1C30A 2YRWA 3G8CA 4O82A 2V58A 4Y8VB 1DIKA 3E5NA 3TIGA 3HBLA 4M9UA 5I47A 5CB4F 2WYOA 3TIIA 2GPSA 4XYLB 2I8CA 3TW6A 2W6PA 4MV7A 4MA0A 2R87A 4FFOA 4L1KA 4ME6A 2FPPB 4O81A 1C3OA 3HB9A 3DF7A 4WBNF 4MV6A 4MA5A 3WO0A 4FE2A 1M0TA 4O2AF 4O7ZA 4IHJF 4ZOLF 2Z04A 3VPDA 5C1PA 2YL2A 3U55A 4HNTA 4M9CA 3QFFA 3AX6A
chains in the Genus database with same CATH superfamily
3MLAA 3OJCA 2C04A 1JLLB 2H6EA 1LPNA 1POXA 2RFLA 4OMCA 4ZCPA 5JXHA 4CMEC 5DGTA 5HZKA 3D1VA 3HB1A 4F4JA 2BGUA 4D41A 4MYSA 1OWTA 1B41A 4RVHA 2O8BB 1V8OA 2VYQA 1R0CA 4B3SH 1E2GA 1VE3A 2HX1A 4RJTA 4OJYA 4BTEA 4ZQEA 3WJ1A 3T7KA 3LXXA 2RH8A 4LZWA 2O6LA 3GAFA 4GLLA 3RTEA 2W6OA 2PSHA 4BBPA 3ANTA 1WCXA 4LDAA 3QBEA 4KXUA 1V8PA 4YJ2A 1XCJA 1W85B 4CHTA 3I9V6 4I1UA 4PBTA 1B3BA 4DV4H 4J16A 5KYVA 1IPEA 2A78A 1TA4A 4KE6A 2DWQA 4OA5A 2BRUC 1QV9A 4L0QA 3MWYW 3GRFA 4NEQA 1O6BA 3N0WA 1KK2A 5L3VA 1VMIA 1XAGA 2W6NA 4HAWA 5FO1A 4K6OA 3HM9A 4KK4A 2JH8A 2R2GA 3GBVA 2JA7A 1TVCA 4XR4A 1FP4B 2DULA 3NETA 3N7TA 3LVFO 4UE3S 3GW8A 4Q43A 1VB5A 2A0XA 3I4LA 1XCGB 4M1TA 1OAOC 1J2YA 3TL3A 2BFCB 3RBZA 4B6EA 3ZXIA 1FX0B 5BVGB 1QTRA 3AR8A 2VRNA 5IJXA 4QIWE 3TIXB 2O7SA 3QVKA 2Y4OA 2IWHA 4TQSA 4JBXA 2F3PA 3B5JA 1AGRA 1JX4A 2JANA 4BBZA 1KEEB 1Z3CA 4TMKA 1KQFA 3F9RA 2CXRA 2DBZA 1ULZA 3DT8A 4FI3C 4J03A 2C9MA 2CVFA 2OFPA 4AUEA 3OU2A 2QM7A 3QX8A 4W99A 2O2GA 3ZDXB 4UPDA 2XVXA 1YC2A 2KE5A 3O9VA 4QXPA 5SY6A 1EFVB 3S2EA 3LH5A 1H42A 2VNJA 1KKUA 2QL6A 4HH4A 8ADHA 2XECA 2EHJA 3EG9A 5BRAA 1TUBA 4PONA 2HEGA 4YY3B 3VZCA 1BGVA 2CXXA 5BO5A 5A4JA 3K16A 1YU6A 3Q8SB 1EFDN 4KAAA 4YFVA 1N0VC 3UGJA 1U1FA 2X5XA 4WA8A 1G66A 4XEHA 5T8KC 1AMUA 3IKMB 2VBIA 5LNK1 4JI4H 4DV2B 1XLUA 3IP8A 2FXVA 2OZKA 3IMKA 4BAUA 1AUXA 4ZJPA 1T2VA 3WA6A 2DY1A 3SF0A 3ZTTA 4EDHA 1FNCA 4ZU1X 4DMCA 2I4NA 3ABZA 3KQHA 2ZXFA 3L6BA 4P34A 2GRAA 5FTKA 4UDXX 3ENVA 1QFZA 3K9CA 4TMZA 4CQJA 1UFVA 2PSEA 3ER9A 4UMEA 2FPGA 2I6UA 1DBPA 3A2MA 2J3JA 3K2EA 3GLHE 3N1UA 3VR3D 2PUCA 4ARSA 4DNOA 1WEHA 4PLYA 1QHHA 4MQ5A 2BFDA 2R8BA 3KEOA 1SB8A 1A1SA 3ZQ6A 2LV8A 2Q4EA 1MMFB 4W9MC 3KZCA 1WE2A 2PE5A 1HEYA 3GLUA 4KRXA 2E55A 5ITVA 1Y4SA 1ORHA 3HLYA 721PA 2NSYA 1GKKA 4EB8A 5A71A 3SQOA 2BBOA 2VFAA 1ISJA 2X2EA 2ODQA 4Q9HA 1EHCA 1CKMA 3EW9A 2P3OA 4FJ2A 4P83A 2G25A 1A04A 3A3OA 1D03A 3WRVA 2V9WA 4DJ5X 1FUIA 4O82A 3CQZA 4J0EA 5KYWB 1UKBA 3ZCTA 1XAHA 2M32A 3EYWA 4GO1A 1ZNZA 5ENVA 3QVJA 3CX3A 1F8FA 2ZE8A 4O3RA 4L15A 3OE1A 1ZI9A 3M9WA 1V8FA 1BWPA 4DIKA 3ITDA 2J59A 1WVMA 1QKJA 2J9FA 5SV2A 4LJKA 4NX2A 4PFSA 3G1UA 2BGJA 3GG9A 1ZNQO 4I3FA 2DERA 4OMUA 5DHUA 3W79A 2G5TA 4WK4B 3B1XA 2ID4A 3C1UA 2X5JO 3DYBA 1CRZA 3CLUD 4M9CA 2ZT5A 3W5CA 2DC1A 2W6IA 5L9XA 1QU2A 4YPFA 2H1IA 1E1CA 2DR0A 3EUAA 4HBGA 4O4HB 3K2BA 4L07A 4JR2A 1LLUA 3WMFA 4LHZA 2C3YA 4BE7B 4UXJA 2P9ZA 3Q9SA 2PKEA 1SXJC 5HFNA 3LPDA 2WYVA 2PWAA 2J0VA 4AUNA 1CY4A 1KGDA 2TSYB 4F45A 4M53A 4PC6A 1T8SA 2EERA 3G5TA 4FT2A 4LOKA 2QN3A 1JG1A 2LPMA 2VJLA 3MR5A 1L5SA 2B3DA 4F93B 4Q6WA 4IXNA 2D1FA 2P67A 3R7FA 1XKXA 4KNYA 3BUSA 5DLPA 4HJXA 1DMSA 1Z16A 1MGOA 1XDBA 2QD4A 3D81A 1KI9A 1NN0A 2BLNA 1IE3A 3P9QA 2IYEA 1GZSA 1TWFA 3A2LA 5CA0F 3STTA 3RRFA 1CUYA 2XF8A 2C4MA 3TI9A 1YFZA 3I3OA 4GFDA 4E22A 4U9IS 2VK1A 3AVVA 1AD2A 2ACEA 2CK3D 1GQOA 1NE7A 3MXTA 4P3OA 4GKJH 1ZCJA 3ZGOA 5F23A 5GY7A 3B1YA 3PRJA 2B5VA 4E21A 2ILTA 2RAPA 4JY7A 3HR7A 5SYNA 1MJNA 4FOPA 5A6SB 2QVLA 1QF9A 2MHCA 1Z4MA 1P8LA 1Q74A 4RK4A 1PQ4A 1UP7A 4E5KA 3WGIA 4KRGA 1BSVA 2WQ7A 3RUAA 3C7TA 1NVVQ 2HIHA 3L9XA 4PHCA 3PHLA 5JHGB 3LECA 1V0JA 5H02A 2NO6A 3COJA 4JIGA 5BN1A 1CR4A 2I29A 4IQ8A 2MYNA 4E3ZA 4TV8F 4JQSA 3NJ4A 1I1HA 5LA6A 2JIZA 2HIVA 5HRCA 2AD1A 3N8NA 4IXDA 4KO3S 5E9WA 2QTVA 5EJ6A 4WA7A 3VUFA 3UMFA 2PMWB 5E95A 5KFLA 3ZE6A 1EESA 1PFWA 4B45A 3FR8A 4DZTA 4Z2AA 2YJ6A 4D7AA 4I5FA 3IOYA 2VPIA 2Y71A 5J2TA 1GGNA 1UNNC 4KDCA 3LLCA 4R51A 3DBIA 3ESBA 3HUUA 4A3GG 1ZD1A 1I4WA 1C8VB 2LP4Y 1SWWA 4QXAA 3FF1A 5JCPA 4F5EA 1GZVA 4QQRA 4OXQA 5FWYA 1IY9A 4V03A 3MGGA 3WMGA 1P2TA 3R7WA 1AUOA 3LULA 5C7YA 2WM2A 4U5XA 3MPOA 2HUPA 1FDOA 3BJIC 3H6GA 2Y2VA 4UEQA 1KJJA 4LC1A 2J7KA 4N54A 3GJZA 2IZ1A 2GBIA 3U44B 3HN2A 1JTEA 2I7VA 5K8LA 1NBOA 5TEVA 4BN4A 2Q5QA 4IVPA 1V7CA 2EOAA 1LDBA 4D1YA 5FBZA 4URZR 2PKQO 4FFDA 4A23A 2Y2UA 2GEFA 5K05A 1W36B 4NR0A 4TV9B 3W8NA 1H5UA 3MJFA 2W2KB 1IFXA 2Z5FA 2ZUSA 2J5RA 4PLVA 4COOA 1CRWG 3SYRA 3ZX4A 4OXIA 2JLSA 4PGHA 4YR9A 1MFPA 4DLRA 1F6BA 5C37A 4QXQA 4G5QA 2X3UA 2YASA 2QN1A 5TGZA 2EEZA 5JSFA 2B2NA 1T9GS 1O4VA 1WB9A 2KSQA 3LDAA 2WSYB 2R2AA 4FE2A 4BVFA 5IFLA 3S8YA 3EE6A 2QSJA 2BEVB 1ZOOA 1XA0A 4B6SA 1AKTA 3HWWA 4HDQB 4L4YA 2IPOA 3G85A 4JSRA 1NF3A 4B3HA 5C7LO 3AY7A 3LPLA 3EUWA 1UEJA 2EFGA 3EVZA 1E20A 2FPXA 2WKQA 2Z8YM 1OGIA 1ABFA 2G76A 4L4RA 4YJHB 1ZVKA 3HSYA 3PW7A 2OM2A 3GB9A 1JALA 1PTJC 5DEIA 4XFDA 3V1YA 2HSJA 3KJQA 2L69A 3FWNA 5GZ6A 1V48A 1OYOA 4TV8A 4E07A 3VPBA 5IJ9B 1SPXA 5BW4A 4DARA 5ALFA 5DWDA 3NVDA 5LQAA 3B8HA 3UEOA 2Z6QA 2NVXA 4CMCA 3QMMA 2GA8A 2B83A 3L7OA 1ISFA 3ZS9A 2CCJA 1HPLA 2REQA 3M3PA 1U80A 3ICOA 5ADUS 2WB4A 5A9TA 3K53A 4Y2GA 4BMZA 3KALA 5HZHA 3KTFA 3LZ6A 3ZYCA 4WBXC 1INLA 4AWBA 5LJIA 4YRCA 1Q7BA 5KOYA 1BDJA 1BVYF 2JFZA 3AEKA 2GS9A 2BSXA 2JD1A 1I3OA 4N41A 3ZZ1A 4LJ6A 2JIPA 2DFNA 4MQEA 2VJDA 3JQ7A 3J7AC 1ZRSA 3KJHA 3RCBA 4WV3A 4OHKA 1Q3KA 3EXEA 3SYLA 3LHIA 3AUKA 1DOAA 4N7BA 1TKCA 1UC5B 4OKSA 4Q3DA 1NIJA 3EODA 4JLPA 4JELA 2BHNA 2YN4A 4U2EA 1EK5A 1P1HA 2J09A 2FSUA 5C81A 2R7ZA 4EVQA 4JQCA 3KZOA 4PGFA 5KFUA 1F2UA 3MM4A 1O0BA 3UYLA 3AB8A 1QQTA 4OD0A 4RK5A 4YUXA 3E22A 4DV0B 1YL5A 1CYDA 3KJGA 3QW2A 4JUCA 3W05A 4RF5A 2O8EA 4EY8A 2J9GA 4ILEA 4PZYA 1UH5A 2AQ4A 4YCDA 1PWXA 4D8UA 5K0FA 4EBDA 3BHJA 1OLSA 5K45A 3NZEA 4NYIR 4KQ9A 2QG4A 1UBMS 5JDCC 1M54A 4WZ6A 1I6WA 5EY5B 1XF9A 4LWOA 1E4EB 1PV2A 3U6BA 1D6SA 3ZY4A 2HZ7A 3UUGA 5KFJA 2WD8A 4G67A 3KR1A 3TLGB 5FV7A 1L9KA 1V4YA 1G8HA 5CYOA 2J5QA 4A3FG 2PIAA 5KG5A 4GKBA 1QHIA 3MJDA 2HHJA 2B8TA 3BL5A 1VCOA 1A9QA 2I4MA 3JR7A 1TOAA 2VEDA 1G8GA 1P6XA 1GA1A 4WLVA 5J23A 4F11A 2FLPA 4DLYA 1H23A 5AIAA 1OC4A 4LV8B 1N8KA 1RWNA 1MO3A 3PNMA 2H51A 4F2PA 4LJ4A 1UMDB 1OMOA 2ISQA 1Y1QA 4DMKA 4DWVA 3JWEA 5AM4A 4E5NA 2QENA 2CXHA 5H1YA 4L16A 5CURA 2F4VH 2V59A 4NLLA 2G1PA 1JEQA 4IOLA 3H0GA 1FVFA 1WKVA 2DP4E 1NUHA 2YVUA 5L1LA 3R23A 4N49A 4FMBB 2BL4A 2HC9A 4UHKA 3HVKA 4WI1A 1N36B 3NNDA 3LY8A 4W9RA 3V8NA 3PX7A 3OLZA 1WUHS 4OH1A 3F2VA 1QOQB 2P3QA 1YK1A 2BKAA 1Q0HA 5JSKA 4R0MA 5I7FA 4NPHA 1T8RA 3KG2A 3I61A 3BXHA 1VKRA 1WP9A 1FU8A 4AD8A 3IMFA 3LBIA 1D9ZA 4QPZA 1JI0A 4B46A 1ZC3A 1I5RA 5K09A 1JR2A 4LJ9A 4YQWA 1J8MF 4KWIA 3PNKA 3SEAA 5JECA 5K0BA 2RG7A 4NXNB 2FKLA 1N75A 1HT0A 3SHOA 3NDIA 4UEWA 4ER3A 3DOFA 2JF0A 2R4UA 3MLEA 2FDXA 2PN1A 2GK4A 3ZGLA 2G4CA 1FS6A 3D5EA 3L1VA 4O7SA 5LDHA 3TOCA 4Y1GA 2B20A 3OF3A 3KHHA 3MFIA 3L6CA 1FS5A 3NM4A 4JEIA 3BWEA 2XB4A 3FIUA 4GRIA 4RPJA 3W5AA 2OQRA 2PZLA 3ITKA 3HZZA 2IOHA 1H1DA 4QGGA 1WRVA 3K0KA 3FBWA 1TZCA 4ERNA 3H0KA 1WQ1R 5BN4A 2GEBA 4BMYA 2PXCA 2RGNC 1KOLA 4BNWA 3N39C 2GJAA 3IYLW 1Z6AA 1HDYA 3T5LA 1P5HA 3BIFA 3QG1A 1V5EA 4OFXA 2AMYA 3VV3A 4FGZA 3A1VA 2PUJA 3P52A 2HDWA 4Y1RA 4RS3A 1QK5A 2H4YA 3Q7RA 4DABA 3IHLA 3L8YA 1DKMA 4OLFA 9LDTA 4UVHA 2GR9A 4RHUA 4C4OA 4LVUA 1MB4A 4WJKB 4BP8A 5AKYA 4F3NA 4BGDA 4AP9A 2GNPA 2AC4A 1NBMA 1HDXA 1F60A 1YJQA 4L0CA 4LRTB 4IIYA 2OO3A 4MDHA 3E6AA 2FRVA 4J76A 2FKNA 4Q01A 2HF8A 4L9RA 2GK3A 4JSYA 1T1IA 5AVRA 3G23A 5JH7B 1C8BA 3QEJA 3WLFA 2XQKA 4JBLA 2VS1A 1EFKA 4B0OA 2HHHH 3KUDA 5JYDA 3AI2A 3ADBA 4NWIA 2NQTA 2QD3A 4BB6A 3W9BA 5HF5A 5KHOC 4G0UA 2IODA 2ZYSA 4X95A 3AIOA 2V6JA 1KO7A 1SZDA 4DDMA 1ILEA 1GO3E 2NO1A 2H63A 1A2BA 3FGZA 1LQ2A 4OX9Y 4XCXA 4AKIA 4E2XA 2EJVA 4EGCB 5H70A 3RBXA 5KFAA 3VSDA 2CDCA 4E15A 4FYVA 1H9CA 1V8BA 1LS6A 2IBKA 2BC9A 3IHTA 1KAQA 3FHLA 1JFFA 4ZYWA 3KSUA 3WZ2A 3STVA 3FUWA 3PO3G 2ZI7A 5G40A 2OV6A 3NBQA 3B85A 5AJZA 3E2PA 4D9MA 1DB3A 4BNLA 3FCYA 3ZJVA 5I48A 4S12A 4CE6A 4GXRA 1T13A 4MKZA 1KO4A 3JSLA 1M0WA 2BUAA 2HA7A 3KZMA 4OJQA 3DULA 4PZ8A 1JL3A 1M1XB 3TLJA 4JV1A 3ZLUA 1QC5A 1ESNA 1RFLA 4YRLA 4BATA 1BVRA 3WDSA 4XM1A 3CM0A 4DG9A 1RYMA 4V0OA 4KWTA 1CUZA 4DQNA 1KKMA 4ARZB 2ARKA 2ZUEA 5BR8B 3MC1A 1ZYUA 3L40A 1AGYA 5KNBD 1V39A 3LIIA 3TTUA 2Y0PA 1ZW6A 3AERA 4PR3A 3Q8PB 1G8SA 3AUYA 2DBRA 4BZXA 1MC8A 4IIFA 3MSCA 1TTPB 3BXOA 3ONEA 1GYQA 2GVNA 1XEXB 1B74A 3OJEA 4RAQA 1TAUA 3RBDA 3EVDA 3VNSA 1A88A 3G7SA 4BQFA 4WXEA 3A4VA 3UXEA 4UBNA 5A4DA 2OLEA 5C46F 1G38A 4FFOA 4BNTA 4UCSA 4V3CA 4I1PA 2QX7A 2WKSA 5J4VA 1WF3A 2HWWA 2J6IA 3NC0C 1ZN9A 1XXLA 3QWHA 4NHEA 2VI5A 1NPTO 4WCFC 1XWWA 2EG9A 4DTCA 5G0WA 3R3VA 2WJJA 1OV4A 1SIBE 3LPMA 1WUKS 4W8HA 4RFVA 2GKGA 3IBSA 1ZS9A 5HIAA 2ZRJA 2FFBA 4CEHA 5HVNA 3T7RA 5C4MA 3O84A 4I5GA 2AMJA 3MJCA 2C2MA 1ZA2A 3NOOA 4BB5A 2IVZA 5DMXA 3UHPA 3UNXA 2OWDA 4O1MA 4YCAA 4JNKA 2I6GA 2PIDA 1EXMA 3N0TA 4MQFA 1MV5A 5HA5A 1QWSA 2HD4A 2MDTA 4GNKA 3DAOA 3FNEA 5DF1A 4KQ2A 4F2DA 4YDQA 3KOWA 2FPMA 1RHQA 4LVOA 3UO8B 3UM9A 3SYKA 1UWVA 5JV5A 2WYUA 5EE3A 2IA5A 3P9RA 4CM3A 3I9JA 4P7FA 1NI4A 1K8YB 3ZG6A 3F6YA 1T8PA 4JT4A 2W6ZA 4QEDA 1OBCA 4AECA 3BD8A 3KUXA 1AT1A 1TK9A 1F6DA 1Z7WA 2O8NA 1DCFA 2CL6X 4DCUA 5HUQA 4P4TA 3IQXA 1W8IA 4MUFA 3ACCA 2DE0X 5CVJA 4RA6B 3EZ7A 4OBEA 1M6HA 1TYDE 2YINC 1TYEB 3NDJA 1Q0RA 4MVJD 1CQIB 1U3WA 1TT7A 1BCSB 3M6MD 4G0XA 3TLBA 4JR0A 3D4BA 4GX0A 4R5MA 4LK2A 4L6CA 5FLEX 3X1WA 5A06A 2X4GA 2CJWA 3AHJA 5IWAB 1KO1A 3I09A 2JDID 2XXAA 1E2IA 2RG1A 1XTKA 4UBLA 1D1SA 2YV3A 5IH3A 4IQ0A 4UCOA 3PUVA 1VMDA 2QYTA 5DSZA 3ZGVA 3OPYI 5JZMA 1QAQA 4O86A 5LYJA 4IDDA 1QYWA 1BMFA 3QXCA 1IXYA 3TTVA 5EE1A 3E35A 4NJEA 1UKYA 2VA2A 2BF4A 1KSHA 4I1YA 2O20A 1HE5A 4CHGA 4EF5A 2PL5A 3J81A 1P0MA 1QOPB 4BCCA 1WNTA 2AZMA 1S01A 4CM8B 4OPMA 5A2QA 4IDEA 1NSFA 3IB3A 4ZT6A 2COGA 3PQ3A 1H8HA 3B13B 3R5HA 5B1DA 3S81A 3B7WA 4QU9A 2FUG6 1PR4A 5KG6A 3PI6A 4X6XA 3VM6A 2N9UA 1GLVA 4AG6A 6PFKA 1J5XA 3L8DA 2GGSA 4BN0A 5CFNA 3GLVA 1DTWA 4W1RA 4KQJA 3ZXYA 1CU1A 4ASUA 5CDHA 3SP1A 1CUJA 4G1UC 5JMPA 5AVKA 4C0SA 2QVYX 5YASA 3U61B 1CKNA 2ODBA 4XW2A 3O3CA 3MCAA 1IAQA 1GPJA 3P9ZA 4A4DA 2XOKA 4G8BA 5K3CA 4OM7A 3T5TA 2BI8A 1AVTA 4B8ZA 1H05A 4Y8VB 1ENZA 1UAYA 4HY3A 4EJ6A 5GJBA 3TQIA 1N2BA 1T0IA 4RAYA 4WE3A 5G02A 2ZCUA 1MIOB 3RJTA 1VA5A 3A6GA 3WG9A 1N8TA 4L76A 5LQCA 4ME6A 5G41A 3VX3A 3LYAA 2D1YA 3JTEA 2ZKIA 4M0PA 3HDHA 3LJKA 3WIBA 4CLOA 3RVPA 3BD6A 4X7MA 5TT0A 4ZOLF 2V6GA 4EEXA 4IHJA 1NN1A 4FFBB 3LUBA 1MDFA 4G0YA 3PZPA 1M6VA 2K87A 5ISMA 3D3WA 3KTAB 2QQFA 4J7AA 2OHOA 4UNNA 2IDKA 3K0AB 2O5VA 4L78A 3LM8A 3F3MA 2P4QA 1ODLA 1NXWA 1XZMA 4Q15A 1KFJB 1RM3A 3QXSA 2WU8A 3JALA 4RADA 4RTPA 5D1NA 1GSOA 2NUPB 1WDTA 3EPPA 3GLGB 5CDSA 4JI1H 3GXBA 4Q7MB 2PRJA 1OPRA 5F1PA 2NMVA 1XRQA 4MINA 2EFCB 1ZD8A 3WC4A 2AC7A 3CHYA 2O3RA 2X8JB 1P1CA 1NHGA 4L0MA 3UANA 1YQWA 4KR6A 4HL6A 3NOXA 4Z54A 4ZGGA 2HB6A 1PJRA 2ZR7A 3QA3E 1SZPA 4GZ6A 2ZAIA 2FN7A 3MB8A 3IAXA 4RY0A 3FWYA 5COQA 3QGMA 2QN9A 3FD8A 5ES3A 3DHNA 1WXIA 3F5SA 3WFJA 5KG4A 3EBPA 3R41A 4XFJA 3DAYA 2AQHA 5IEJA 3AL0C 4QD3A 3HFJA 4RANA 1DEOA 5PNTA 4HNVA 2R8ZA 1GN8A 5C35A 1P45A 5THXA 3BA1A 2J0SA 2NYAA 4HYEA 1K0FA 3QJGA 1ESMA 4MIOA 3FNGA 2JHPA 1JU4A 3AHHA 4BXOA 1R37A 1BA2A 2W83A 3JATB 3UJPA 3OHMA 4UZFA 3FMOB 1EE2A 2OXIA 5DM60 3HFGA 2CFTA 4ESHA 2HMWA 4B32A 2HV8A 1A96A 4P4UA 2B6HA 1H1LB 4L5YA 3DOOA 5IZCC 3RGXA 2WINI 4FSDA 4U0KA 3N86A 5DTJA 1FNSA 4DLKA 1FNNA 2X23A 4PANA 3GRAA 3IDAA 4HVAA 2O0LA 1FUUA 3DMNA 2ZCVA 4F3RA 3O4HA 3GH3A 2GPWA 2FZCA 3U4DA 4J0MA 2WYHA 1YOVA 3HG7A 1DC8A 4Q48A 1LWNA 1ND5A 4MW5A 1PYDA 2X8LA 1ZR2A 1CY8A 2YRXA 4L7QA 4ZI5A 3DT6A 3LI2A 1K66A 1OREA 4LAFA 5L3SB 4W5NA 4ZYTA 2ABJA 3RBVA 3FN4A 4BNDA 4DGQA 4QWAA 3U9SA 2AJDA 2QE7D 4FGWA 2VHXA 4L8LA 1IXRC 1SCUA 4Y1FA 2VJMA 2UYOA 4X45A 4FMCB 2JARA 3VSAA 2E4ZA 4J0GA 4AX4A 2A8YA 4IIBA 5LWQA 1BROA 3UB3A 3H0CA 4GR4A 4GI7A 1SXJB 4MICA 4TMVA 3UK1A 3GWGA 1FFBA 4QTXA 1Z7YA 3EEFA 4NBWA 1Z2OX 1E4YA 5JIBA 4EKEA 2EX1A 1CE8B 1R3UA 2DIKA 5K7SA 1BTOA 2RH9B 2CE2X 4PSUA 3HYRA 4HP8A 4G5XA 1N2ZA 4HSEA 4CJXA 3QWFA 1N1GA 1G5PA 2GM3A 1GG9A 3FPHA 3VJKA 3PFWO 2WJ3A 4NH4A 2J0UB 1TF2A 1V41E 4Q12A 1J39A 5IYZA 2CUZA 3M5PA 4L8VA 1Y3HA 2Q1XA 5DLQC 1TQ2A 4Q1EA 4D4KA 1MC1A 1G2QA 4KPEC 4UEJA 2GPJA 2OY0A 4I5IA 5FR1A 1CR2A 4MB6A 2UYYA 4AJNA 4R1QA 4RHTA 3VR5D 4KRYA 1MV8A 2C97A 4MDEA 1PR9A 4BGEA 1NDQA 3NW9A 2NM0A 1K1EA 3KDPA 3AETA 1AQNA 1XZGA 2WKWA 2X4DA 4XWKA 3X0DA 2NADA 2PMDA 4B4KA 3JVUA 2FB9A 3FLEA 1EAYA 3HNOA 2B4KA 5GPBA 1SUPA 2ECKA 4TT8A 1LBHA 1JXAA 4DM7A 3CTMA 2QRPA 4EG3A 5EJ4A 1T3GA 4TQ9A 3NORA 4EUEA 4RVFA 2VK2A 3BRWD 5DCWA 1NQAO 4YJ2F 3IDZA 4QIHA 1E59A 1DAKA 3D8UA 4B2IA 2A94A 1CJUC 3IT2A 3N2EA 2W43A 3WRYA 2IW3A 4JR1A 3DFUA 1P61B 3DVAA 2CMHA 1SRRA 4UM8B 2PHZA 2XUDA 4QT4A 3BXZA 3GN2A 5DOVA 3LXRA 2ZKLA 3QVGA 3PLAE 3IPAA 5B1YA 4TLEA 3QG5A 4H0NA 1U3DA 2WT9A 1ZJWA 2F4NA 1IRXA 4XPIB 1J22A 4CMAA 2WM8A 3TW4A 3EGWA 2COIA 3ETNA 4URWR 4C6SA 4CCYB 1M2VB 3KOXA 1JFTA 2CCKA 3WRXA 4L74A 1TWHA 3NUGA 4DQLA 3BRSA 4HGQA 3LX5A 2WVGA 3FTDA 2X6QA 4AJ1A 3QEKA 3HEAA 1VLMA 5JXJA 2WT8A 3OBBA 4N47A 1LPOA 1ZJ5A 3NGDA 2R7MA 4X97A 2OUIA 3BWMA 3W7AA 1HETA 5K0EA 2R82A 2WPDA 2VPYA 4K7JA 2M98A 3SX4A 3RVSA 4DA0A 4PYQA 3CVZA 5DW0A 4NC9A 4C6TB 1P91A 1ACLA 4IKPA 4QDUA 4QA9A 3MWEA 5ENZA 1AUPA 4ZCLA 1VHQA 3E0QA 1DLJA 4QW8A 1ADFA 1TPYA 4MIYA 2H4XA 3H99A 4FFLA 2XDAA 1KPIA 3UIEA 3V1TC 3LLUA 1HOTA 3DBRB 2V1UA 5A5GA 2I7CA 4G6ZA 4XWGA 1CJVC 1DDGA 3U62A 3PQ4A 1FRFS 5KVVA 1GR0A 3BBPA 4BMSA 2PRKA 3W5SA 3LUPA 4HX5A 3RYFA 1T9KA 3T34A 1KJ9A 3N8DA 1KVRA 5TMEA 3NNNA 5L9AA 3T5GA 1HYGA 8GPBA 4LG1A 5AI5A 2VTBA 4A2BA 1TTHA 5AMXA 4CLDA 1R0YA 1LSUA 5FBVB 1PLJA 1X1RA 3MOIA 4B8YA 3OOSA 5ALLA 2IHJA 2QP3A 3KJZA 1DCKA 1JHDA 1OFTA 3KB2A 4UBKA 2IHUA 4C2UA 2AW5A 4KYVA 3O73A 3SCZA 1C7IA 5TGTA 4UUBA 2BE9A 3C7AA 1W5EA 2A7XA 4TYMA 4C03A 3GROA 3COSA 4TQGA 4QUBA 1XMOB 3KQPA 1E8MA 3DQPA 2OGWA 1YKGA 4F4ZA 1RBZA 1ISSA 4YK7A 3OEEA 4M1EA 1DQPA 2D5LA 3NUQA 3X43A 1D2HA 1DJNA 4Y6OA 1N7IA 2ZJ5A 5EP3A 1IM2A 2QP9X 1VPDA 2ZAGA 1ZUNB 3FMPB 4ZEWA 1QYCA 2NU9A 4MVCA 3GZJA 1N6HA 3J80W 5C7OO 5H9VA 1CS0B 4PIVA 1HFJA 3B78A 2ZVDA 1O0CA 3NQ41 1ND6A 3BBLA 4B3GA 4IJKA 1ZKMA 4M8SA 2HYIC 4DF3A 2G5GX 2O3QA 3SOZA 4YP7A 3LOQA 1KYTA 4QDJA 3TOXA 1JQBA 2W2TA 5HQJA 1ZETA 3AX6A 2FWIA 2H59A 4M0CA 1VZ2A 3IL2A 1MC5A 3TQOA 4BFTA 4GPTA 3KYIB 1YB1A 5T57A 3L2OB 1MVLA 4WX2B 3D7NA 1QHSA 1NSYA 1FFDA 4CIVA 2XDYA 2D5IA 1V7PC 1XPUA 5K0SA 2BWJA 2IUUA 4DAOA 1UDWA 4NENB 1X7GA 2BBSA 2QL5A 4YH1A 5MGBA 3RREA 5DOZA 1B16A 4PN7A 1N7JA 1JB1A 1B33N 4YMLA 2R96A 2F1RA 4EP1A 4G5RA 3KWFA 2XUQA 3GIQA 2C88A 2R9VA 1ZM7A 4IICA 4TTPA 2WJAA 1PKXA 4ATNA 2BFBA 3DS8A 3HDJA 3K0FA 3N6RA 5JY1A 1K88A 4ABTA 2JEGA 1Y6RA 4MW2A 5IK2D 2YWJA 3WLEA 4JUDX 3N2KB 3CO5A 3ED5A 2CV0A 2IY9A 1SKYB 4M2LA 2OV1A 2AN5A 4IRKA 3WDMA 4XAQA 4QFDA 4B6PA 1DAMA 5DNWA 1LDYA 2CT8A 3UA4A 4H9GA 3E9YA 4D6PA 4J9VA 4O83A 2DUNA 4YRTA 1T91A 3PFCA 1BNCA 5D5QA 4UPVA 1AHNA 3MYRA 2ZT6A 1OTHA 1PWYE 1RRVA 3LC1O 4R8MA 3Q8KA 3KKZA 4I8IA 2JD0A 2ODEA 2P9TA 4EYGA 2V7GA 5F52A 4DV1H 5TC4A 3F5FA 1IPFA 1N8SA 2BDEA 5AUQA 5ICGA 3OTQA 4J29A 5D3KA 4IILA 1X7WA 5DK6A 5D3ZA 1XRMA 4OQMA 3PUHA 1F06A 2CCGA 2YZ2A 2QMUA 4RKFA 4W1SA 3G5AA 5LA6F 4W7IA 2H9YA 1BXRA 2JFGA 4ZOCA 1W19A 2BP7A 3WXBA 3CVYA 2WT4A 4O25A 2ZUVA 2Y1DA 4HJRA 1WG8A 1XA4A 5A62A 1DJPA 1YBVA 3HCWA 1SO8A 2D8AA 4ND8B 1ZOIA 3B9RA 3G8DA 1H2WA 1A69A 2EKLA 1II9A 5JANA 2WU4A 1N6LA 3JAWB 5I7WA 4X94A 3RK0A 1OZ0A 4X44A 5HG0A 4GG1A 4AY2A 3ETHA 1P4HA 5J2TF 5GP1A 4DLUA 2JS7A 2XZLA 4C2MA 3W5VA 4DJFC 1K7SN 1XMQH 1WPGA 1UMKA 3BERA 2XUZA 3LWBA 1IZ9A 2IX3A 2JK1A 1H9BA 1BKDR 3ORFA 1JFLA 5JXGA 3KOMA 4X1IB 2H2GA 1NVVR 3L8FA 3Q7TA 1OPXA 1TRHA 4UEKA 1VBGA 4AICA 4FFPA 2JGDA 5ER9A 4NRDA 4Q7EA 2OFOA 2R93A 1JYFA 3JASA 3N9IA 4B3DA 2V5UA 1JDZA 1MFZA 4O3SA 2IPMA 3DPUA 1OT5A 3H97A 3KLNA 1VPEA 1X7YB 1PJ2A 2I91A 3UT5A 4BIIA 2YZMA 4KSCA 1IBCA 3LVRE 5D6OA 5JASA 2GD2A 1AZSC 3C3KA 3VOTA 4L8GA 1DCMA 1Q2XA 4P7GA 4XVQA 3S40A 1H2EA 1MJGM 5J2UB 3NWEA 1RLJA 4KHPB 3O95A 3GMDA 1CY2A 1D5WA 2IEAA 5E25A 3DOHA 4DHEA 2A4MA 3ROMA 2VQ6A 3CG4A 3TOZA 4F46A 3RIYA 4R2JA 2CNNA 4JUFA 2WVAA 4F5YA 1W2HA 3BA8A 2ZIXA 2B82A 1OBHA 2JZNA 3KSAC 1BS1A 2VUMG 5BSGA 1SCNE 1EB8A 4OM8A 2HWYA 3COWA 4E4RA 1EXDA 3OJOA 4Q45A 5JDIC 3Q5GA 3BQ1A 5FTLA 3LY9A 4KREA 1NL3A 5D1OB 5DBIA 1ZM3A 1TMOA 3EEYA 1YTLA 1CRPA 2K7FA 1KYQA 4INAA 3HA2A 4AKGA 4P35A 2ZSIA 3EUFA 3HXLA 4Q3CA 3I6MA 4EVSA 3QF7A 3GAAA 3U4MA 4RF4A 3L0PA 5CYGA 4IGIA 4HVTA 1R00A 1BQ3A 2MYTA 1J06A 1P4RA 4DQKA 3BGOS 2I54A 3INRA 3T0GA 2DWPA 5C53B 2O8CB 1JMYA 1XNGA 3K5WA 3KEFA 1MO4A 4HGOA 2P11A 3UCFA 1FW8A 1RJDA 1K0UA 3ENNA 1VL0A 4KEAA 4E31A 1DDOA 4AYBE 4KXMA 1AKNA 3B3AA 3HJHA 1B1AA 2HOQA 5JROA 2C00A 1D6NA 2Z1DA 2Z3ZA 2OQVA 2ORIA 4IQFA 3AFIA 3GTKA 1QOZA 1OIWA 1OBGA 3GEEA 4QXMA 3G6WA 1YH3A 4AN1A 1UWCA 1NFQA 3X2FA 1NLMA 4MV5A 3KHKA 1FRNA 1RRPA 4DV6H 3HCRA 5JLJA 2F64A 3N3AC 3RRZA 2NLOA 1X70A 3UPUA 4LSGA 4RGYA 3P9YA 1NQOA 1IK6A 1NMZA 3CZPA 1JDVA 2LKCA 4X1KA 2TS1A 2FU5C 2A0KA 4Z86A 4BC0A 4GC6A 3RASA 1VJDA 3G7NA 4N65A 2B2XA 4LBZA 4MNTA 5L40A 2G6TA 4TGLA 2Q9AA 2WA2A 4K2HA 3EEBA 1HTTA 1II0A 3AEYA 1H3NA 3PW2A 2O0KA 3E1SA 3HJGA 1Q7GA 2ZWMA 1TDJA 1ZHQA 4RVOA 3QKSA 2JLUA 3IT0A 1XPJA 5FJ8G 2FK8A 1JHYA 3ROPA 4BZQA 1WU7A 4BGIA 2DEUA 5K4GA 3CUTA 1UMBB 2IS1A 1BA3A 3ETGA 2NTVA 5M5BA 5BOSB 5EAIA 3HYCA 4D4MA 1WXQA 1ZP6A 5IFKA 1P2VA 2A9KA 1X7ZA 2VHQA 1WO8A 1HGXA 2I03A 2PFSA 4WZBA 5LMZA 1M0SA 2ODAA 3G3EA 2VDKB 3HN7A 2EX0A 3NC0B 4RNOA 5TE9A 4RL4A 5DBEX 4MV8A 1NSTA 4WCFB 3T3DA 1KOFA 2OQ2A 1B2RA 1N2CE 1ODFA 2P9FA 4C14A 4MRPA 1QHXA 1XDWA 2Q9UA 3ILXA 1L5NA 1FUEA 3ZW9A 3AFGA 4UHJA 1OW3B 4B71A 1I4OA 4UM9B 1KFCB 3A31A 2WNIA 3ICQB 4YA6A 4H7EA 3SYTA 5K3DA 3NU1A 5B36A 3BGWA 3VU8A 4ETNA 3EPIA 1NM5A 1SBHA 3FDFA 2R5NA 1WPXA 1L4YA 4LGYA 4BMNA 1RQ2A 1L4HA 2QYHA 5BWMA 4DW8A 4QUKA 3UYYA 3T5JA 4JN6B 3K9FC 3VKVA 3W2FA 2JCBA 5EG5A 4DL5A 4XD7A 1U11A 1S7CA 3FZQA 5HKLA 1ZDMA 5FWXB 2JJMA 3I9V1 3PT9A 5DHSA 1TM7E 2QZJA 5AVQA 4UE2A 4L5BA 5L7WA 3DT9A 1M5UA 2XLBA 2A0WA 2WYOA 3L4KA 4EZBA 3CEBA 1Z6PA 4RJIA 1X3LA 1VE5A 4P80A 7ABPA 2L18A 2VA9A 1Y5MA 3LQ2A 3DW1X 3IC5A 4CM1A 1B0AA 2N47A 1WULS 2ZDQA 2LZ0A 1ODCA 1U1GA 5AKHA 1WDWB 3T3PB 4A6PA 4B3XA 2VT3A 1Q16A 3TSYA 3AG5A 4ABYA 4X5OA 1FLNA 3TKAA 4ZO8A 4WY8A 4FU0A 1Y9DA 3WYBA 2DFPA 1W4LA 3NRBA 3DDNA 4ON9A 2NSLA 4B74A 1H85A 2CFSA 3LMLA 2VHVA 2W2LA 4YR2A 3C5CA 3WNDA 4RB3C 3A26A 4URFA 3E9DA 1SBNE 4EHAA 5GAJA 5IDQA 4HAIA 1OIVA 1T36B 1O0SA 4YR0A 3SIWA 2CYAA 1NU8A 1CZRA 3AC0A 2ONJA 3MA0A 1DWOA 3BB3A 4KIFA 3D4IA 4MUMA 2W4QA 2R1TB 3OWOA 1N2GA 4MKFA 3QPWA 1DJQA 3DEFA 3LKVA 3V46A 2YOFA 1GAEO 3GTQA 5FTNA 5BV2P 1YE3A 3KKMA 2XCUA 1YAHA 2R0QC 4FOSA 4TMTA 4XUCA 3SC2B 4FYJA 4WVLA 4XWOA 1SCKA 4K3VA 4BVLA 2H1HA 2YBEA 1LBSA 3ABRB 2CL7X 4HQFA 3ZV4A 3C5HA 5G1PA 4RK7A 3S5UA 3QEOA 2O07A 1KO8A 4RX1A 1W0KD 3GF4A 3G68A 3ACBA 1IB6A 2YFQA 2AI3A 5TF4A 1AK1A 1XXHA 1JXMA 4TLDA 4HQOA 2RGBA 4EENA 4CODB 2EP8A 1ZQ9A 3NH9A 3T7SA 4TX1A 4WQMA 5K3FB 2XWPA 3PFFA 4FEGA 1SVUA 2X41A 3GRZA 4DRFA 4DDWA 5K20A 2FLNA 1Z63A 2XUKA 4W6ZA 4RZQA 2HHAA 1KY2A 1ORVA 3EAQA 1IUOA 1NYTA 4YRAA 4WMLA 1F1JA 2BJHA 2PRYA 1OB2A 4OQEA 1TC1A 1O6FA 1T4BA 3EOAI 4MYTA 3DZFA 4MUKA 1FW6A 1L4FA 4BNXA 1G0OA 4FXPA 1BE1A 1UBLS 5B2EA 3QLUC 2GFIA 3TVTA 4ALJA 3JQ6A 1KAOA 2YFHA 4M0LA 1LS1A 5JBQA 1N34B 1JG7A 3FZEA 2OBBA 4DQVA 5EIAA 2Z9DA 2HBYA 5F1KA 5FXMA 1WMFA 1HMPA 2RI6A 4EPRA 1ZVJA 2XMZA 3PVSA 3RRNA 2QTHA 1N4AA 1E2LA 2WWWA 3SVZA 3CUEF 2AW3A 1I4TD 5IHXA 1WCMG 4Z3DA 2GAJA 1Q11A 3ZZTA 2B30A 3ENWA 3CB2A 1USUA 4X65B 3GTOA 2BDTA 2AR7A 2ZSHA 2PMBA 2GHQA 4P4LA 5NLLA 3M4ZA 4X64H 4BYMA 1M2JA 3L5OA 3OLYA 2XA2A 1U5BA 2EFHB 3WIDA 1Q7CA 2OORA 4RD6A 3RTBA 1ENYA 4FOTA 3E8XA 2NVBA 4KFCA 3F4BA 4A16A 1VDMA 5TXGA 4EWLA 1CUVA 2QX6A 4DBZA 2C31A 3RC9A 3KB6A 4ENUA 3QPUA 1XROA 2Z4TA 3TEMA 2WWGA 2H8GA 3JVDA 3H05A 2OFWA 3ZDYB 3A6JA 1BE6A 4CG2A 4JLAA 4QQFA 1RC0A 3A27A 3WHKA 1R27A 4JDPA 3V9PA 3C70A 4WKOA 1HYQA 1E9RA 4PYLA 4YDHB 1J24A 2C7BA 2XKAA 2IHZA 1VCNA 1MB3A 4GOOD 1V47A 1CUFA 1KC3A 5J40A 5FJJA 2Y66A 2R48A 1CERA 3BCSA 3MSXA 5IM4A 1IOZA 1I7NA 3FDZB 4F21A 3LP6A 1WR2A 5FPRA 2VDQB 1R4MA 4HUTA 4RHXA 2Q0HA 2V4ZA 3TQSA 4B7CA 3U4QA 3EISA 3KIPA 2H2DA 4B0PA 4FP9A 2HZBA 4OK6A 4YJGA 1YV9A 4BWGA 1J1ZA 1SUSA 4XFKA 2YVAA 3BFXA 1Y8ZA 2JLQA 1VMAA 4FB4A 1MW8X 2CYBA 2AEMA 3MF4A 5AXBA 3F78A 4N9QA 2O0MA 3HZOA 1JQKA 1HFEL 2RKBA 2ZG6A 4K1LA 1IUNA 2P3LA 1C14A 2XA1A 3H5NA 4K3UA 1F8YA 4KBGA 1OA0A 5A0TA 2CNQA 3TBFA 3Q85A 1Y14B 2DKOA 2B6NA 4GOLD 4MR8A 1IN5A 1E2MA 5H4GA 2ZJFA 2HY7A 5EXDA 4Z9FA 3WAKA 1SHJA 4L8FA 4Y2QA 4PG5A 5L7YA 2GAAA 2C9BA 4B4UA 4BMCA 2HGZA 5JPDA 2IP4A 5B30A 4KO4S 1VG9B 2Z57A 3E7XA 3ODPA 2ZJ7A 4PM4A 4PNHA 1AN9A 1TI7A 1PLKA 4MVJE 2WV7A 1DZIA 5JI2E 5EXEA 2QIOA 2XF2A 2GM4A 1UBEA 2RB4A 1M34E 4XX1A 2DFKB 4ZHSA 4PPYA 4XYEA 4J07A 5GONA 2XQFA 2WTBA 3RIXA 2C07A 2HXSA 4GVXA 4L5CA 3GGSA 3QBVA 4B3RH 3MINA 2VDNB 5F4ZA 4X71A 1U8FO 2ZITA 2D2IA 3C48A 4CKBB 4Q9LA 2W58A 2HDKA 1NP3A 1U5AA 4BBAA 3BVPA 2L19A 5BQXA 2COKA 2CHUA 3A4LA 4M0MA 2FX2A 3NWJA 3ZWOA 2V03A 4TM8A 4HV4A 5HIMA 2E18A 2Q3FA 5I7SA 1J6UA 4HLUA 3UG7A 1YJAA 5DISC 3P26A 3R0IA 1OBFO 4EGQA 2A2ZA 3D3QA 3GRVA 3A6FA 4M8IA 4MPTA 2Z02A 3F6EX 3A1NA 1WUYA 2QKYA 1V9CA 2ZRCA 5JW6A 3KHTA 4RXUA 2VHEA 1HKUA 1JP7A 3W1VA 4GBMA 4IDHA 3OKAA 3ROTA 1X1BA 3G0GA 4PCUA 4Y2XA 1OWLA 3OETA 2H18A 3QU4A 2GDZA 3ADCA 3FSRA 1GGEA 4LKOA 5LWHA 5LYJF 1U8UA 2WOJA 3T3NA 3TR5A 2O8FA 3WQSB 1YHYA 3EPHA 2ZRLA 4WKNA 3GAMA 1G2PA 1K5PA 1QGUA 2P35A 3B6IA 5TB5A 5KFTA 2IYQA 2CVHA 5JCZA 2LCFA 2W2NA 2PUAA 1MAVA 4ZCRA 1Z0UA 1W0CA 2ATIA 4MDFA 2X4IA 1U9CA 2VAXA 5AI6A 3UA3A 2VPSA 3QYFA 1OKKD 1Z8NA 2IYOA 4CCSA 4DLWA 4E14A 4G84A 3DEHA 4JI0B 1KR5A 3OCZA 4ZZ2A 1MQ8B 2YQ5A 5BW8A 5DCUA 3ZLTA 1PEYA 2B2CA 3EGXA 2GEKA 5FKJA 2FTKE 1U4NA 2PKRA 2O8DB 1RCTE 1NUQA 3FF4A 4ZXPA 1P4JA 4KIWA 5AW7A 1GDHA 3KR9A 3JAMW 4UMVA 4RMGA 5KMGB 4JUBA 1I36A 2VJPA 1HEIA 1J20A 4D4HA 2NPFA 4UCFA 4HH1A 2V7VA 3WGKA 5KFEA 1TCAA 4JJ7A 3BSWA 1UT6A 5E4TA 1S2MA 1K1QA 2Q99A 4YAKB 3EXHC 2WG2A 2VWHA 4KOEC 3JQEA 1UKVY 2FJUA 3ROXA 1FVXA 2V55B 4YDSA 4OB7A 2GF9A 4MI1A 3KYCB 4UHFA 3Q87B 4AY5A 2PWBA 3TM4A 3WK9A 4DT1A 4EG7A 4CVNA 2WUGA 4GS5A 1SQSA 2ZVQX 1XT6A 5K8UA 3STHA 4IJ5A 1QIKA 4JT2A 3R4VA 3H2YA 4PAGA 3AJ8A 3E7DA 1Q7TA 3NEPX 3BACA 3SN6A 1W5BA 1O89A 3DFFA 3G1TA 4BVEA 3I8XA 4X85A 2FR8A 2I1WA 4LGCA 5B37A 5KPJA 4IHJF 1F8UA 1MOQA 2HJSA 3TS1A 1C8LA 1RBYA 1BHO1 5BQ3A 3DC2A 5A1TA 1VGQA 3DTVB 5JADA 1PX2A 2NTYC 4BNKA 3H3JA 3LQRA 2F3UA 4YJ3B 3BPSA 4WLFA 2IBSA 1IHUA 3RR2A 4GBED 4XYMA 4EHHA 4GWLA 3M0EA 3OOYA 2AOUB 2NT3A 4WOKA 5C1OA 1WD7A 3WIEA 4JI3H 5BOVA 3T1YB 3FCAA 1N2HA 3WKAA 4CRWB 3I04A 5CD9A 5JCJA 2H4HA 1B00A 4HDNA 1SBTA 2ZIWB 5HBRB 4EG0A 2XD9A 3DV2A 4ZI2A 5IG2A 1E1DA 2L82A 4L08A 2YW2A 2VJQA 1PT8A 4C3UA 3EA4A 2FF5A 4RABA 3WK4A 4QIWA 1H2YA 4H1TA 4WLNA 4RWEA 3X1DA 3VR2D 5BWLA 2P4EA 5TSDA 3ZIUA 3L2PA 2DKNA 3BM5A 1O96A 2R7LA 4RFSA 2W8BB 1U28A 5C1IA 4AURA 4QOFA 5CVUA 3K4QA 1U7HA 3CF2A 3BJMA 3QLJA 2FMKA 1ZL0A 4LW8A 4BFLA 1ZWKA 1AS3A 1C7QA 1KY3A 3GEMA 4K26A 1E9DA 2Q2QA 4M49A 1GA4A 1RADA 4PNZA 5FP0A 1P72A 3NHWA 4J1TC 1PS0A 4JSTA 3DBHA 5BNFA 2PKQP 3N7AA 2OD9A 4J0JA 3RRMA 5KSOA 4UU8A 3VGPA 1TT5B 1XRLA 3LY7A 2CLSA 3V42A 3D6UA 1BN6A 4QUHA 1D0IA 2R6CA 4NYMQ 4W1QA 3F6CA 1QUFA 2JEOA 1P9LA 4YACA 2NU7B 4CKEB 2WV9A 1X7XA 3H7IA 2RGVA 4RD0A 4GI3A 3E9CA 3PD0A 5IUNC 4BRUA 1X1TA 5BMVA 5KTKA 5TARA 2Q5LA 1OCEA 3OT1B 5KDDA 3U39A 3LT5A 3EBOA 3GG2A 3HUDA 2D3TA 4R4JA 1L5FA 1XEWY 2FK2A 2B8NA 3CE6A 5K2MA 1ZL2A 4Q7LA 3WMXA 3QBJA 3PXXA 1K7CA 3L3BA 4X7RA 1RQPA 2BIFA 3R3SA 3ZHUA 2FEOA 4YRMA 1U6JA 1GTZA 2ADOA 2DB3A 4NXMH 3OUTA 1ZN2A 1I6MA 1GG5A 1H8EA 2WAQE 4TYQA 3L7AA 3BQ2A 4QKQA 5LIPA 4HS9A 3GLHA 2L17A 2SKDA 3Q4GA 2MSWA 3ZWWA 2APJA 5JQGB 3LRTA 2AU0A 3TBHA 1PSZA 1WOYA 1ZM2A 4LDPA 5H82A 1CHNA 3ZJYA 1Y1PA 3MGKA 1CUEA 3GCXA 4ENTA 3TRFA 4M1YA 3IAM6 1S2GA 5FUYA 4HYTA 5CLIA 1VBFA 3GGPA 3KK0A 3MWLA 4DR4H 4BQNA 4ARUA 2P5SA 1ML4A 4FGSA 2HF7A 5AQ1A 4RB1A 2WHRA 1H6DA 5DFAA 4UTNA 4FEYA 1IATA 3ZGNA 1MVOA 2RCYA 3K8OE 3S2IA 2CB0A 4BLQA 2VYVA 3BFKA 1VKZA 2OGSA 5C5EA 4I66A 4JC5A 2VDWB 3IJRA 2XB8A 1T0HB 4XDZA 1O5OA 4JU9A 4E46A 1T43A 3E3MA 5JAQA 1XBTA 5DI9A 2I3BA 2PKYX 2WLSA 4X8OA 4DPLA 4KQHA 4FW8A 4F2GA 4LCBA 1KUTA 1WETA 4US2R 4R9RA 3PQCA 5BY2A 1R8JA 5CH3A 4L5AA 3SWWA 2J67A 1VG0B 3RUFA 2C2BA 1X14A 4CUZA 1Y9EA 1AS2A 1ZEJA 1L5LA 5IYZF 2CW8A 2OCDA 2IY8A 3CXRA 4M86A 4EFLA 3TE6A 4J43A 2F43B 2NAFA 5CB4A 4QBGB 2VSQA 2C95A 4JBYA 5A4KA 4BX8A 2EX4A 1OZHA 3DF7A 5K6AC 3UBTA 2O2CA 4ECXA 1YI1A 2A3RA 1ES9A 3THSA 4E94A 4W5RA 1V2GA 4MOWA 2Q2VA 1E62A 3GJXC 2YXNA 2VRWA 2ZWAA 1QVWA 1NW7A 3QV1A 1BH6A 2GBCA 4Z7NB 4PLFA 3IBFA 4L28A 1EPUA 4L3OA 3P0FA 4BJHB 2F1KA 2QZZA 3PWSA 4CM5A 2RGRA 3O75A 2EJBA 1V37A 4R69A 4MROA 1I1NA 2YZNA 2GI4A 1OD6A 4EO7A 3PGA1 4MCJA 2GQSA 3FVTA 1SQFA 3TQHA 4EFKA 2ZPTX 2QJWA 1EVYA 3RVLA 2H85A 3GEHA 5AOBA 4QYXA 3ASUA 3BSYA 2GK6A 4PVCA 4LOJA 4W8OA 5FOSA 2QS9A 4B3IA 3DLBA 3NDPA 3RJZA 4BZWA 4FK8A 3L01A 2XTMA 4EBBA 1J5EH 4IQGA 3JQ8A 1CG6A 4FGLA 5DGIA 1PTKA 1ZNYA 2OO5C 4KXFB 1EGHA 3MJEA 4ENVA 3IMEA 1EQUA 1RS0A 1KMIY 1EWRA 3SHVA 3VFDA 1K7XB 5EFOA 1MHTA 1GZHB 4LYFA 4HMQA 4EATA 5AW4A 1AA6A 2NZYA 4HMPA 5C8YB 1H66A 1BDIA 4BFCA 1V25A 5JR3A 3DGFC 1UMCB 3HWRA 1R66A 4O2BA 2VK4A 3UPDA 4FFNA 1DUVG 4YDRA 2HJRA 4LYGA 3KTOA 3SJBA 1WZNA 1SK9A 1IIRA 2LR0A 1LV7A 2PLWA 4UQLA 5ULLA 4RMHA 1FC0A 5F76A 4UXIA 4MP3A 4YQEA 2WJWA 4NV3A 2B99A 1GXSB 3EC2A 4OHRA 5KYUB 2E4AA 2WEKA 4RF2A 1VMKA 3TL2A 3U3JA 4KXXA 3PDIA 2ZPAA 4O7YA 1KNXA 4WUTA 3B5IA 1YQUA 2TECE 1WQ3A 1E6LA 3PG5A 3UV3A 2A3NA 2FZWA 2QYZA 2D5CA 2RJOA 2C5HA 3AI7A 1SEPA 3S5JA 1QK4A 1JQAA 4LE2A 4D8VA 2ZWOA 3QUTA 4CIBA 3H83A 4F5DA 4FEAA 4DCVA 1UFOA 3WGHA 3WGVA 1W4RA 1SC9A 1GNTA 3NTVA 1BMDA 3O8NA 4K0RA 3LE8A 2G1AA 3M1AA 1Y4ZA 3DAAA 1Y48E 4F9TA 4TXNA 4OQPA 4IXWA 3VMFA 5EWMA 4J2HA 5I7EA 5F9NA 3RWBA 1DIGA 5E4YA 4IZIA 1TZMA 4AK9A 3B53X 1HR0H 3IEKA 1R50A 5CXXA 5I5WA 1Z15A 4TT3D 1OT3A 1RP1A 1NTRA 4UZSA 3TFWA 3GJ6A 1D09A 3U7IA 4PX9A 4TKVB 3EX7C 1YJ5A 5AXDA 4O0LA 2WJYA 1P19A 4ZVSA 4PO1A 4LNUA 1ZX1A 5JYEA 1K8ZB 3LWZA 4CL2A 1X9HA 1F0PA 1A4UA 1ML3A 2VHJA 4U4AA 2YFKA 4UU1A 4RGQA 2B7LA 5DM1A 3U26A 1VOTA 3JARA 2Q3MA 1DX4A 1U9YA 4M9XA 2QROA 4C6RA 2QSZA 5D1PA 3FR7A 2IHKA 2YZKA 2EBFX 2FK3A 3ETEA 2IBMA 2NV6A 4D96A 4II2A 3ZWYA 2D4HA 1NRWA 3GQBB 3I9FA 3U55A 3IHWA 4PY2A 4M9ZA 2IYXA 1C1DA 1G9TA 3KLMX 4AYWA 1DIRA 2C4UA 4X7BA 1AF4A 2YC4C 5EXSA 3TRHA 4EJSC 4P82A 3RAQA 3VKHA 3OE7D 3PA6A 5BW6B 4QYMA 2P9GA 1TFUA 1U8CB 1QCYA 3IVAA 1P60A 3VTKA 3EG5A 4N5IX 3K32A 1FDTA 3VTAA 3U19A 2ZRMA 1KMCA 1LC3A 3R5KA 1R5JA 1MORA 3JWIA 4KNWA 1JHVA 2AI2A 4U2DA 2EWMA 2XB2A 2ONZA 5GOZA 4A8JA 3FDJA 2IHYA 2X9GA 3Q8LA 1Z5ZA 10MHA 4ADSG 1Q57A 3K9LA 1EAMA 2HFJA 4C89A 1KBLA 1PV4A 1DBIA 2XVZA 4APMA 2J3QA 3THOA 3FI9A 1UKCA 4GPD1 4LQCA 1O95A 1L8XA 4PICA 1KDYA 1DZ3A 2H57A 5PGMA 4HPWA 3T94A 3D6NB 2YHIA 5HKOA 4GPZA 3PFHA 3M3HA 2CLDX 4AZVA 4FDLA 3LGSA 2G7MC 3CURA 4KR3A 4ZU3A 1IY0A 3DW3X 4MPPA 1WZCA 4TKUB 3NP7A 1NUAA 1V1MA 4KSBA 1G3MA 5FX2A 1L5WA 5KFKA 4PQGA 1CTQA 5J59A 3BE8A 5FFMA 2FGJA 2Z6AA 2VQFH 2HYDA 3MERA 5AK0A 1E79D 2VG8A 4N4AA 3RSHA 4LF8B 2UUPA 3JZFA 3U9LA 2W4IA 1SVOA 5DM2A 3RSOA 3A36A 1LK7A 3K30A 6GPBA 5KT6A 1E5QA 1UBGA 2FLLA 5CR5A 4X6LA 1MAWA 2PQMA 2VTKA 4D81A 1N1MA 4M46A 4YT4A 3CNOA 1XHLA 2ZGVA 1CY0A 2P6PA 2GYYA 3CIOA 4OGLA 1XZAA 4H1HA 4W5OA 1LUAA 2HVSA 3OURA 4L85A 1YFKA 4M8NE 5EZYB 2VH2A 5HJ5A 1D2MA 1QFYA 3H7AA 4DL2A 1D0VA 3ZBPA 2Q5EA 5HMLA 3L8GA 2H4JA 3GQCA 4LJYA 1KFKB 1ATZA 5JWOA 2RK3A 4R2MA 1P8JA 3R9IA 4O7RA 1GPWB 1A8UA 2ICAA 2RI0A 1RI2A 4BLRA 1KXJA 1UODA 3V2IA 4S1OA 1KH3A 3WYCA 2WAMA 3PHJA 2A84A 4H0FA 4WADA 2ZW9A 1MO2A 5TQ2B 1KS2A 2ZB8A 3EIOA 3CPEA 5I5YA 1YNOA 3Q7SA 1UKZA 5KKCA 2XVYA 6CHYA 4A10A 1CEYA 4F50A 4ED7A 4Z51A 1MH1A 4D3YA 1RNLA 2ISCA 1Y5NA 4MUAA 1IWBB 1P8AA 2F9LA 5CRIA 5C5JA 1PS8A 3QWUA 4B3MB 1ZAKA 1NP6A 1MXFA 5CEEA 2VJKA 3DV0B 4B83A 2ETXA 2BKXA 3NBFA 4AP6A 4M0FA 2Q7DA 3TB4A 5AK3A 1YCHA 2Q07A 3TMAA 2LDBA 2V7EA 4A27A 1I3QA 1DO8A 4N8DA 2X4LA 1XJ5A 1NVBA 1NMEA 1NF2A 3R20A 2WG1A 5D8DA 2BPOA 3JZIA 1BOOA 1Z0KA 2AXPA 2GF2A 4MUYA 4J3JA 1JZQA 1VXOA 3I9LA 4JUIA 5ILQA 2IPLA 1OASA 5GIPE 4RJ2A 1PW5A 2XEXA 3S1AA 5T4FA 1XE3A 2ASEA 3T5KA 3VPSA 3UXHA 3TX6A 1RWPA 3CLSC 3PXGA 1X1QA 1OH5A 2IP2A 4HMOA 2G4VA 1N4DA 4BFWA 1SELA 2XR1A 4YMTA 4UBIA 3CH4B 3OAAD 5DTMA 4WLUA 1NX6A 2R8XA 5KSZA 3IA2A 1WD5A 3FCEA 2H5LA 1M0TA 2GBLC 4D02A 4PPGA 4R8UB 5IKPA 3WWZA 3EYYA 3TRKA 2HRRA 4IGFA 3V7UA 2M6RA 2JA6A 3MVEA 1NVKA 3VPGA 5JRDS 4A1FA 3G0DA 4PHTA 2QZPA 4GX1A 2H7YA 2FOXA 1YZQA 1L0BA 5LU9A 5ALOA 3VPXA 5CTAA 3AHEA 3UOWA 5TPWB 5J4YA 3PUWA 1VIAA 4MRMB 4HDCA 1MC4A 1SVLA 5ICEA 1ZWLA 4EA6A 2VUTA 3TD2A 1NW8A 521PA 1PG5A 1PSDA 2FRDA 4AMZA 5FD8A 1ZIDA 4HX2A 1JLKA 3HXPA 5G0VA 5K3EA 2D4AA 1X1EA 3BIOA 2XXBA 4BNYA 1XG5A 2ECFA 2YU9A 3TTWA 5DYNA 4TQAA 2BHTA 5A6VA 2W6CX 4HG2A 4R8KA 2OHHA 5GWXA 1Z6YA 4F7WA 3QVVA 1EUCB 1Y5IA 3P2KA 5BQFA 2J32A 2WZQA 3W8EA 5FOQA 5C52B 4HKTA 5JU6A 2EJWA 3B5EA 1R4ZA 2JAWA 1TM3E 4KPUA 1EDBA 3U0BA 1XU7A 4JYPA 2E48A 5KTMA 5D51S 3T5CA 3EWIA 1FTNA 2OILA 3NAZA 2W57A 1RYZA 1UDAA 3IMCA 5U1PA 3N76A 3PV0A 5ALQA 4E5MA 4ED9A 1FP1D 4DIUA 1HE3A 4O7NA 3U4IA 4DUGA 4X20A 4NL4H 3MUNA 4RTLA 5IVHA 3WRWA 3CH7A 2XRYA 3VR1A 1PI3A 4Q4AB 2G83A 4OXRA 3GV7B 1ZCFA 4EAAA 1LU9A 4R3WA 2I4OA 4TWBA 3ITNA 4F4UA 1RJ9A 1DUSA 3EGVA 3GX1A 5LBUA 4U6NA 5C4XG 3FVRA 2RBEA 3G02A 1KPGA 2MYUA 1P3JA 5LD2C 2I3GA 2ZJ8A 4ZVPA 4GM0A 4J4BA 2QLBA 5BSEA 1HNWB 1L2ZA 1I7LA 4NVRA 4KE8A 5LCXA 1EZ4A 1Z5PA 2H1FA 5CJJA 2ID7A 3GA7A 1NOKA 4I36A 2BW0A 1ZRMA 4QYIA 2MSCB 1CQJA 3ZD8A 4LF7B 3PDWA 2G77B 5ERGB 3TQCA 3HDVA 2CNLA 3BFJA 3ZHQA 4NCHA 3QH4A 4F8EA 2C3MA 2R6HA 4KUHA 1XAJA 5DT2A 1O75A 4RKYA 3INYA 1NI3A 4AG3A 4DWWA 3VC3A 3EOZA 4NCXA 3EXFA 2GO7A 3HCEA 4IDCA 5J5CA 5BWWA 2E2WA 1ZQ7A 2Z56A 5B7GA 1PU2A 4S1WA 3LSYA 4B34A 5JVDA 1NWCA 1JLSA 2YZLA 1T5IA 3K4PA 3L18A 5FL3A 2NZXA 1VP9A 3PJFA 2Y27A 3ZQKA 3UMMA 1ODKA 2C7QA 5DASA 4F56A 5C2JB 1DKQA 1S9FA 2Y1KA 4WDRA 1J0XO 5KC8A 3L7BA 1QX4A 2W48A 2HSGA 1TA8A 3KU4A 1NW6A 1JUDA 1JVBA 4BDSA 4AQ7A 2JBAB 1M7GA 4S0ZA 1P1FA 4ZQHA 2EFYA 5FO0A 1PW7A 2GZ1A 4BFSA 3VQTA 4LRSB 1P62B 3HY3A 4GU5A 4F4CA 1ZXLA 2P91A 3MCWA 1JHUA 4LCEA 5IYBG 3S1LA 3QVLA 3WSWA 3RJ0A 5CIQA 1WB6A 1Q17A 5ETJA 2RK4A 3OEWA 1NMSA 3ME5A 3B6EA 1U8XX 2JD2A 1J1UA 4D0RA 4YREA 3QMVA 8AT1A 4QUEA 3PGVA 4G07A 2PL1A 3O0DA 3GLQA 3ZIDA 2XWQA 4GM1A 3SVLA 4DUPA 4FOLA 1J07A 2HO4A 1Z7BA 3TEKA 3O0TA 4G25A 1BGXT 4CM4B 4EDFA 3GPLA 3T41A 5FLXA 3I83A 1T4CA 3JQ9C 1UT5A 3RYHB 4X91A 3NTOA 2H2WA 5DISB 1U2PA 1YZFA 3H1GA 5F2NA 2RHGB 5D2CA 5AJYA 4EPWA 2E49A 4MTCA 1TCCA 5CGZA 2W2MA 2C28A 5B4UA 3OZVA 5AW2A 1P4SA 2CVPA 4A92A 2HCBA 2KYRA 3Q2OA 3I39X 4MAAA 3H1PA 1SBQA 4CE5A 4FHDA 1CUIA 4QLBA 4J9MA 1UPTA 4KLCA 2QW8A 4HRYA 3I53A 1YRHA 2JAHA 1Z08A 1UXKA 2JA5A 3R3ZA 3RKSA 4K9KA 3DDHA 5JNRA 1KJYA 1YBAA 1OVGA 4PYKA 4L3VA 3JQQA 1V11B 1FTYA 1A9TA 2FEPA 1NPDA 2R11A 2XOEA 1EFRA 1WUJS 1T8TA 1KOJA 2NTJA 3AU8A 1WZEA 4LDJA 4L2IA 3GJSA 2EL7A 1QV7A 4HDMB 3CZQA 2FMAA 1RFGE 2DAPA 1GZ7A 5GGXA 2Q4RA 4TWZA 1L4LA 3GRYA 2O5RA 1FZTA 3NIGB 2GN6A 3IV9A 2PGOA 4RPGA 3MBOA 1WY5A 3F2IA 4TSRA 3ZNQA 8OHMA 3KLBA 1MABB 5CFOA 4ZT2A 4MQBA 2I4LA 5EJMA 2RI1A 4EO4A 4GLOA 2QN2A 4QNMA 3DYVA 4OGKA 1U6KA 1YRAA 1RKUA 4RY9A 2EBHX 3G9UA 1KZYC 2FYTA 5T64A 1UBKS 3FM9A 1JI3A 1EHYA 4NZZA 1OHHA 2QQEA 1OV6A 2GJ8A 5TJ9A 1WEKA 1UF9A 5CFQA 2R47A 4YAWA 1P7CA 1E18A 3GLTA 3LNCA 1L3IA 3K0HA 5KWJA 2K2WA 4RHCA 3QPVA 5DGHA 1NJFA 1DO0A 5CYPA 3EXHB 5DI3B 3EPGA 2FWMX 2R44A 1L7XA 4O3FA 4NMXB 4WCVA 1T1RA 4FCTA 5E9AA 1AXGA 2W9XA 4N76A 4U7GA 3WBBA 1GV1A 1IB0A 2ZRDA 4G1VA 3WP0A 4AZSA 3PD7A 4Q9AA 4IDNA 5I01A 1NJ8A 2OK8A 3PTZA 2M2IA 1EI9A 4QBHA 3GRPA 3ORYA 1B76A 2WIAA 5F3WB 3KKKA 2C8KA 3L84A 5JPIA 3CEMA 5CX1A 2XNDA 4YS6A 3LT2A 3KVRA 2MSKA 4E2FA 5JZVA 1BRTA 2WW8A 4OUKX 2GN2A 3V7YA 1OJ7A 1V9LA 2KSWA 3BXPA 4TZTA 4PXSA 3EQ9A 3T1QA 2FE1A 3RSQA 2QGNA 1JVNA 2O57A 4Y18A 4RJJA 3RF7A 1MX5A 4XA8A 1U31A 1GCGA 3VAZA 2AUNA 1BH2A 3BHNA 5TJHA 2AX3A 2VAMA 4RK0A 3DG9A 2C61A 1XUOA 1YDWA 2B78A 2D54A 1WUTA 4KP7A 3QA9A 4IM7A 3AKCA 3ZNOA 3U4HA 1A77A 4IO1A 3RS2A 2EV9A 2JJ2A 1U0JA 1GHTA 4ONEA 4TPKA 2AVDA 1VTKA 1GRNA 1UPFA 1BHQ1 3I58A 3D5QA 3O38A 4D0GA 3BB1A 5IM4F 2X0EA 4D9NA 4BLVA 3LVBA 3KZ1E 3WIUA 1SM4A 1XK5A 4V0ME 3EXIB 4QM7A 1CVRA 4OATA 1I3LA 1PR0A 3IJ5A 2OL4A 4OV6B 1FOEB 1SCIA 5CHEA 4EUHA 1PWHA 3U3RA 3G9ZA 1E63A 2GCOB 3LV8A 5FH9A 2IXFA 3AB3A 4QYSA 3U37A 2UUOA 1C3OA 5HHTA 1U8TA 4DREA 3CVOA 2W5UA 1O87A 5EZ5A 1XKLA 4FONA 5JS2A 4GC9A 2C1EA 4JI5H 4EI2A 4YRIA 5BVHA 4CKZA 3B12A 3OIDA 1ONSA 1NU6A 2PD3A 3MT9A 3V00A 2A5GA 4UOZA 3AV0B 1DBWA 4MCAA 2PGXA 4PU0A 4C08A 3AWDA 1H9AA 2JEYA 3SBEA 3KYDA 2RONA 3IB6A 2YR0A 4BBSG 4TL6A 1YKFA 5CK4A 4LQ4A 3ER6A 4PZZA 4LZZA 3U1VA 4QODA 4X63A 3RR5A 1UJCA 4JGGA 4DY6A 1V35A 1PIWA 3D6MA 4HEJA 3LF2A 3H4BA 5M2QA 4X66B 1G2OA 1D0SA 2OCAA 4MV3A 2R8JA 2X5NA 3K1AB 5KT4A 3D0KA 2CDNA 4MGHA 1O97C 5GONF 5I7UA 5B6PA 2P27A 1LPSA 4BQOA 2YFYA 5FD5A 2FW1A 3IDFA 3I64A 2PAFA 3ZCVA 3PGKA 2MMGA 3EA0A 2PUWA 4I9NA 4ND6A 2J9ZB 5KQSA 1OXVA 5E9QA 3O8QB 3ND8A 4ZDKA 5FULA 4CM9D 5JZSA 4ZVMA 2CZGA 1EGQA 4TYNA 5F9LA 2I2XB 1ZK0A 1L4NA 5LQKA 2BGWA 2ZYWX 4MUJA 2UZ3A 3UN1A 3R9XB 2X76A 2MOKA 1ZJZA 5EHQA 2XMRA 3ZZMA 1JAYA 1S02A 4N39A 2PYIA 4GXQA 4Y9SA 1BXGB 3UMVA 3S99A 1ZINA 1W1UA 4OI0A 1DGSA 2ZPUA 5DHTA 3G8YA 1DVRA 2PDAA 3HJCA 2NV0A 4B6RA 2PWYA 2QBYB 5DTRA 1ZU5A 3OQIA 1DXQA 1PFKA 3KHLA 3RYCB 3OD5A 4DSUA 1QZ3A 2VHYA 1L1RA 1W7AA 2YWBA 1SCJA 1ABEA 4D9CA 4R3UC 2FSSA 2QRVB 1NVUQ 4LHSA 4CL0A 2FPSA 2YS7A 1QAOA 4NPAA 4YQZA 1TQDA 1JKJA 5L51A 4ZANA 2EJ3A 1Z75A 5FQOA 1VKJA 1XR3A 1TLTA 2V5VA 3MMXA 4PC2A 1A2OA 4X1YA 3GJXB 4L22A 1XZJA 4Q1DA 3WLJA 5EIHA 1MW9X 3C98A 1IZZA 3NJRA 3HA3A 2PJRA 3FSJX 3KFXA 1YOBA 2P9YA 1IN8A 4CWAA 3OPYB 1LKZA 2YNMC 4LHEA 1RW4A 3RS9A 1TF5A 2J6BA 1J56A 2CLCX 1M8PA 4BRZA 1XZBA 3CR7A 5DHAA 2JHAA 1ZD5A 3T5HA 1DOHA 1PJAA 3O74A 3BB4A 3ADPA 4UAVA 2ISSD 2I3ZA 1R7RA 3N58A 4KMSA 1FYXA 1CR0A 3UW3A 3SSAA 3KEMA 5AWFC 2NWQA 1QF7A 4JEMA 2E7ZA 5BORA 4CC5A 3LHFA 2WTUA 4TYWA 2OHVA 1ZD4A 4AJOA 3OT5A 4YASA 3I1IA 1M72A 4R1TA 4OHOA 1QSGA 4WVFA 2G0NA 4BNMA 2QORA 2XNSA 4J9SA 4DVGA 2OKCA 1QMPA 2IL1A 4DNPA 4DXHA 1OFUA 3HKZE 3MJTA 3L8MA 2X86A 4V1CA 3PITA 4LSWA 2CLFB 1FFYA 1RR6A 4DSTA 5BMOA 4C07A 4F6RB 3ZUPA 1RHKA 4NZYA 1GM5A 2Q8PA 3PICA 2P65A 1F6WA 3N5KA 3AXSA 5EGNA 3EEQA 4PC1A 2F8TA 2D7CA 2OT3B 4AJEA 1EVZA 3NOQA 4BZPA 1KQOA 3TVYA 1H0RA 2WIDA 2RHCA 1K83A 5EWLA 3MT8A 3C43A 1PNRA 2FSHA 4ZYXA 1KBZA 4YI3A 2R6DA 4H3VA 3M6UA 5DX1A 4ZAFA 2CL0X 5L7TA 3R9RA 4PZ6A 3IPYA 2YZ7A 2P69A 4NFLA 4L9AA 1TC2A 2D5AA 3DCIA 2VF5X 2R92G 3SBDA 2HRCA 1V4VA 1JB9A 3LKDA 4P3NA 4K9PA 1T9ZA 5TS2A 2YC2C 3HVUA 4KJXA 1A4XA 1U98A 3A9SA 2FFJA 4YCCA 2PMEA 4Q9DA 1A5SB 1TAEA 3ZJTA 2ZRAA 3GZNB 2WAAA 4AO7A 3RUIA 3G2JA 2BMFA 1KKLA 1XVUA 4J1NA 4ARVA 3I2IA 3IE1A 3WB9A 3UKJA 4XUEA 3GZ4A 2IUFA 3RSCA 2VC2B 2OWEA 3OZXA 5FR2A 3KAKA 2FAXA 3VR3A 1CKEA 4AIIA 1EUZA 3AM4A 4EPYA 3K09C 4EJ2A 3B9BA 4D43A 1DRWA 2J4CA 4DXDA 2ES4A 1NUUA 1YHZA 4QTYA 3BFPA 3PB3A 1I0ZA 3COYA 4JD5A 1SG9A 3MILA 1TVMA 5BMVF 4BAGA 3O3OB 1Z2PX 4QM6A 3IR5A 3REQA 1TCVA 1VP3A 2O06A 2XGPA 2INGX 1GZDA 5CVTA 2AR0A 2VXOA 4XIGS 2NU6A 5KYNA 1JR6A 1DBVO 1G7CA 1OSNA 4AC9A 4C87A 3R9KA 1X8XA 4JLBA 4QOHA 1UOQA 1W36D 3CEPB 5KFNA 1UZLA 2QZ9A 4BQPA 1SUWA 2QSUA 1MT0A 4AZ3B 1PLLA 2C9YA 4TQUS 1P9OA 5EPUA 1ZH6A 4IDFA 1R4NB 1A8SA 3FYSA 3URMA 4L6AA 5BWUA 5A05A 3PXCX 2KPOA 1M9NA 1NVWQ 2VF7A 2OP0A 1A9XA 4NYMR 4YUAA 3EAGA 3GFQA 4F4FA 1AN0A 3U4AA 3QKTA 5FQNA 3MQ4A 3O4JA 3R5SA 4G1MB 2C2XA 2H1RA 3CVXA 3BF8A 4AN0A 2VJAA 4QJ5A 2A5LA 3OY7A 1W6RA 1R18A 4EJSB 2CLLB 4O7TA 3HUEA 4DPMA 4W8GA 3EQ8A 4UM9D 4UCUA 1CK4A 2HIXA 1JPNA 1XNQH 3AESB 1L5QA 2WPNA 3L1IA 2OM6A 3IOEA 1L7BA 1VCIA 5G4KB 2DCUA 2R6GA 4B3BA 1HE4A 2IYTA 1XTUA 3HL0A 4N0DA 2NXWA 1G8AA 1Q0SA 2CHVA 4IH9A 1E6CA 1PGJA 4ARAA 5HM6A 1VL8A 5CEJA 3K15A 2WK1A 5I7HA 2CHFA 2QMOA 2PJDA 3FHCB 4QASA 4PZUA 3D8NA 1B6RA 3OQNA 6NULA 3A3YA 1WHSA 1BKYA 1QAMA 4A93G 2A9OA 4EA9A 2QAIA 3ODGA 2IA6A 2J3KA 2GYVA 3B82A 2CK3A 2VUIB 4DB2A 5IDWA 5CB4F 1EX1A 1IY2A 2AR9A 3IEUA 5CFLA 1L7MA 1XD2A 1C1XA 1RIIA 1X87A 4BMVA 2FPPB 4FXOA 2GF0A 4J91A 3GJ0A 1Z6XA 2H2IA 3FNBA 5LZ9A 4GOJA 1Y1WA 1M7BA 2LWIA 1FFCA 4EFEA 2GWHA 3VBCA 3LBAA 3PJDA 2ZAOA 3T7DA 4YECA 1YR6A 3PR3A 4MEAA 2FDCA 1X80A 3NTLA 1JF8A 3D6AA 5EZ6B 3FMGA 3FE2A 3CRMA 1WTCA 1Z29A 3EH1A 1SOAA 3DL0A 1DKPA 4OLHA 3SBXA 3OCVA 1A5AB 1QIDA 2OGZA 4RA9A 3KXYT 5HCNA 5JAUA 1DV1A 1J90A 1WPQA 1X1SA 4R2WA 4TMYA 2L0XA 3QZ8A 3HYSA 4OQNA 1NQVA 1T0UA 2PANA 1YC5A 2BEUB 1KO5A 1N9ZA 2VH5R 1KDOA 5JT1A 1MP0A 3UAZA 4YWJA 4B3TH 4Q3NA 2YZGA 2UU9B 1G3UA 2Q3LA 1RKVA 4YGXB 4RZSA 1NF8A 4MYCA 4GQAA 1DXOA 4D3XA 3I6ZA 3H2SA 2CN1A 2MJLA 4EPTA 3M34A 1A7KA 1JIJA 4GPEA 4ZHQA 3QTLA 4Q8EA 4G4GA 1QO7A 2Z8ZA 3CRW1 2R4TA 4WZAB 2MINB 2VP3A 2Z08A 2YMMA 1I1QB 3U7QA 2A33A 4O2BF 1HBJA 2CNDA 4KR7A 3FRJA 5A5FA 1F51E 4BL5A 4GL4A 4LISA 2PMZE 4IF6A 2IY7A 3IKLA 1HQKA 5IVKA 2VXYA 2JW5A 2TMYA 3KVYA 4EI9A 3A14A 1W29A 3P2JA 3MYYA 5KT5A 2JGIA 4PIMA 1MNQA 3GD5A 4JL6A 3R3YA 1DC7A 3JYPA 1G5FA 2UXBH 1TMYA 5T4EA 2I1QA 4MW6A 1K3FA 1T6YA 4DR1B 4YIKA 2AN3A 3RBEA 5K3AA 2NVOA 5DNAA 4CL3A 1XO1A 3RTGA 4XJSA 4CPDA 1KU0A 4L95C 4PGMA 2VPXA 2IW1A 3AP2A 4IIJB 3HR4A 4WIAA 2BGLA 3PDUA 3BHMA 3H4VA 3EJ6A 4I6GA 3RT7A 1M8FA 2I2FA 3PNVA 5AW3A 3P0JA 2QI9F 2VA8A 5E7IA 1E3LA 1M8KA 1YMUA 3KLOA 1XA3A 5HM8A 1TYAE 1BEEA 4E3WA 1AF7A 1D1PA 2OG2A 4KN9S 3MMSA 1UDRA 2ZTLA 1C9JA 3ZXSA 2E5LB 1MUUA 1X0XA 1PEKE 2H5JA 5BWRA 1E98A 3V8MA 4CLRA 1M1NB 4Y6LA 3K35A 5K8VA 5HNEA 1J9EA 3DZ8A 4BAZA 1IMOA 3BKXA 4IUBS 4UNSA 2HHFA 4FCWA 1Y3DE 1BW9B 5HIJA 4H35A 4WD3A 3DEZA 1E66A 1L8AA 3FUTA 3UPTA 4B87A 4UXHA 3HKBB 2CNVA 3ROGA 1ARZA 3S70A 4E03A 4DQXA 3UAOA 1UDBA 3PI7A 2G63A 1Z7EA 1TKRA 4S2EA 1P4GA 3O26A 1NJ1A 3CNNA 3K0CA 5J5VA 4XJTA 4S04A 2PQ0A 3S44A 4PSKA 5KIAA 1AE1A 5EE9A 2W7PA 2PU5A 4BE9A 2GNOA 3PCXA 1GY8A 2O2JA 2CJXA 1V4BA 3AQIA 3Q6MA 1YJ8A 4A82A 1CD5A 4P4SA 4S24A 4FZJA 3V1NA 2X9VA 3Q8RB 4MS4A 1W47A 3EMVA 3T7CA 4B4DA 3UZOA 2FLWA 3QFHA 2ZWVA 1LSOA 4UULA 3CUYA 5I5GA 1B0ZA 1HG1A 1DXHA 2CSXA 1HNZB 3N2GB 2WFMA 4HVLA 4HH3C 3GNTA 1VGRA 3R6GA 3EAFA 4AYBA 2XV1A 2O1WA 1J00A 4AKHA 2DETA 2BM0A 3CUVA 2NO5A 4LXTA 2C4TA 4CNBA 1F9EA 3CVVA 1JEYB 4OOEA 4JJFA 3FCSB 3P96A 2Q27A 3GLIB 1O1YA 3F9CA 1D7AA