5D8DA

Crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
303
structure length
282
Chain Sequence
SNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDRAFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLDSVIAELGLPVIIKPVHEGSVGMSKVEKAEDFAAAIEKATQHDAVVMAEKWITGREFTISFLNGQPLPVIRLQYGIPCGLSETEEKKLQALCLRAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAAKAVGYSFDELCVAILEQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the D-alanine-D-alanine ligase from Acinetobacter baumannii suggests a flexible conformational change in the central domain before nucleotide binding
pubmed doi rcsb
source organism Acinetobacter baumannii acicu
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 83
structure length 282
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5d8dA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5d8dA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5d8dA01
5I47A 4IWXA 3ORQA 3TINA 2HJWA 1ULZA 2YL2A 2PVPA 2ZDHA 5K2MA 3KAKA 2HGSA 2R7NA 4I4TF 3VPBA 4M9CA 4O4JF 4MV8A 2C00A 4XX0B 5JVLA 2FP4B 3RFCA 2QK4A 1OBDA 2R87A 4HR7A 3U9TA 3WO0A 4O4HF 2V5AA 4C5BA 2CNVA 4EGQA 1C30A 2CNUA 3WNZA 1Z2OX 3AW8A 5CA1F 3TIIA 3GLKA 5C8YF 4O83A 5LP6F 4O7RA 1W96A 4HNTA 5CAEB 3RUPA 2XCLA 4TUYF 4XYLB 3VMMA 2I80A 4EGJA 4EG0A 3BFPA 3N6RA 2GPSA 2GLTA 4ME6A 5KKNB 2W6QA 1E4EB 4IIJF 2WYOA 3HBLA 4HQ6A 2P0AA 4EA8A 2R84A 1CQJB 3U9SA 1A9XA 5LYJF 2SCUB 4FFMA 4GGMX 2YS7A 2FPIB 3HB9A 2FB9A 3BG5A 3Q1KA 2CZGA 3RV3A 5BPFA 4O4IF 2YZMA 4QSHA 4I50F 3GIDA 1JKJB 4YAJB 4EA7A 1Z2PX 2YS6A 4O84A 2FPGB 1KJ9A 2NPOA 2V58A 2YZGA 1EHIA 3WO1A 4O7VA 2I8CA 4WBNF 1GGOA 1BNCA 3R5XA 1KJ8A 4YJ2F 2PN1A 4HNVA 2ZDQA 1EUDB 4IZOA 5D8DA 4FE2A 1DIKA 1KUTA 3QFFA 3Q2OA 3ETJA 4HNUA 2ZDGA 4O7SA 1UC8A 2R7MA 2R82A 3SE7A 2YWVA 1CQIB 3DF7A 1M0WA 2YZNA 4MV6A 3BSYA 4RZQA 2W6MA 4DLKA 4XZ3B 2GQRA 4ZI7F 2NU9B 3BSWA 2NU8B 4TV8F 1AUVA 5JQGF 1DV2A 1I7LA 2FPPB 1KBLA 1W93A 3MWEA 3AX6A 4O7YA 1DV1A 3R9RA 4O81A 1IOWA 3JZIA 3R5FA 4MV4A 4EABA 4NYEA 5LA6F 2DIKA 3LWBA 2YW2A 5JQWA 3KREA 1B6RA 3E5NA 2DZDA 4C5CA 4O7NA 4YAKB 3NUAA 3VPDA 3VA7A 1I7NA 5C1OA 5JH7F 1WR2A 3I12A 3VOTA 1GSHA 3HO8A 3TIGA 5HBRB 3R23A 3U54A 2GPWA 4O4LF 2VPQA 4FGRA 2YRXA 3N8DA 5H80A 1C3OA 1GSAA 1JDBB 5GONF 2V59A 1KJIA 3V4ZA 5CA0F 1KJQA 4O2AF 4YBZB 4O7ZA 3K3PA 3V4SA 4WD3A 4FFRA 4M9UA 5BPHA 3BSSA 4EA9A 5EZYF 1VKZA 5J2UF 3KALA 4MV1A 1VBHA 3JZFA 4EAAA 1EUCB 1SCUB 5HV6A 1KJJA 1PX2A 1A48A 3K5IA 5C1PA 4O7LA 4FFNA 1CE8A 3LP8A 5JVDF 4O7TA 3ETHA 5IYZF 4IWYA 1JLLB 2VR1A 1T36A 4FFLA 5DMXA 3G8DA 4MV9A 2XD4A 4MV3A 2W6ZA 5LOVF 5FNVF 1CS0A 2R86A 2I87A 4Y8VB 2NUAB 1EYZA 3MWDA 4IHJF 4YB8B 2VQDA 1B6SA 4MV7A 1E4EA 2NU7B 3ORRA 4ZHQF 1IOVA 1KEEA 3OUUA 4I55F 2W6NA 4FU0A 2R7LA 5CB4F 2DLNA 2Z02A 3VPCA 3RV4A 3JRXA 4ZQIA 3TQTA 4XYMB 1BXRA 3JRWA 5LXTF 2IP4A 4MAMA 2R6FA 4MA0A 2OLSA 4E4TA 4FFOA 5J2TF 1Z2NX 4MA5A 2YYAA 4M98A 2CNQA 4DIMA 4O7WA 2QF7A 4O82A 1UC9A 1EZ1A 2PBZA 4M99A 4C5AA 1KC7A 2DWCA 2R7KA 1AUXA 1M6VA 4O86A 2YZLA 4O2BF 2X0SA 2W6PA 3R5HA 3UFXB 3TW6A 3MJFA 4J6EA 1VBGA 4ZOLF 1GSOA 2NU6B 5BMVF 1OBGA 5KX5F 2W6OA 2W70A 1JDEA 1M0TA 3U55A 1GLVA 4L1KA 2VHEA 2YRWA 1PK8A 2W71A 2CQYA 3OUZA 4YJ3F 2R85A 3KAJA 2J9GA 4TV9F 3G8CA 2Z04A 2GQSA 4FFPA 3K5HA
chains in the Genus database with same CATH superfamily
3IO5A 3QX8A 2WJVA 1RYRA 3CIOA 4KB5A 2C2BA 1KMHA 1L4EA 2E1RA 2VSFA 4H16A 4HEA6 1IRXA 1N0VC 4AX4A 3DZBA 4MR9B 1IHXA 2OSBA 5TRTA 3CVOA 2P9HA 3A6KA 1Q3HA 1AUOA 1P81A 2QRZA 1GY8A 3ROEA 4EZEA 3VFDA 3MJRA 1ZG3A 2FQXA 2ZWIA 4HTFA 5TQ2A 3SJ7A 5HS4A 4C4TA 2O52A 5DHFA 3NBYB 2Y9PB 2XDWA 3TZBA 2ZJ4A 4X92A 2DHDA 3RF7A 4OI2A 3NM5A 1ICIA 4BMVA 1YS9A 4HWTA 4WKPA 4FQ8A 3DMRA 4HUQA 4QDOA 1QCDA 3B78A 1GM5A 5FWXB 3AHCA 4RTPA 1Z0UA 3M6FA 5EIFA 4D9HA 1N6NA 4BWSC 5FJ8G 1PUIA 2IW1A 1NMXA 4RY0A 3GV5B 4XGRA 5DI3A 5CVTA 4RA6A 3HVJA 4IUCS 4EGSA 1T26A 1VJGA 2J3MA 2QLJA 3QY0A 3V7NA 3EPLA 1A9YA 2D5IA 2RKOA 2PYDA 3A1UA 3RUFA 1QOQB 1RKBA 4MV0A 1Z8DA 4C05A 1W75A 1FFEA 4XUEA 5FQNA 3TXYA 2CNVA 4M1EA 1MAHA 4YXFA 4RHYA 5G02A 1UBNA 4IJ5A 1ZRNA 3DDUA 3NU1A 3P1JA 1FUUA 1YKSA 3GNLA 4PGMA 4PQFA 4C88A 4XOIA 1ZA1A 3DR5A 1QQAA 4RA6B 3SVLA 2PV7A 1OYYA 1OZAA 4LVCA 1AKYA 1BGXT 1SCAA 2BZSA 2C29D 3R1IA 4J7UA 4PYKA 1Z6AA 3RBDA 1LK5A 1XDGA 2R8KA 1OAOC 3MOGA 4KGXA 2WAAA 3ZUPA 4XWWA 1TYAE 3IR7A 3QPUA 2AWOA 4I2NA 1FPQA 3KSMA 3ESZA 5A3JA 1PR6A 4XYLB 4Y7DA 5IP7G 4LFBH 4RJTA 2PWBA 4AZ0A 1MFPA 1U8AA 2J6BA 4ZYXA 3ZGXA 2PPLA 1AMOA 5KYVA 1DEHA 3MS2A 3T7EA 1Y33E 1VP3A 2EG9A 4U1RA 1W6RA 4RADA 2A9RA 3D6VA 1F6DA 5KWJA 3EZNA 1Z08A 2PH3A 4DIDA 1LBQA 1ZK1A 2NVBA 1GU7A 4JSYA 4CQJA 4CT5A 1PWXA 4TS4A 5HS6A 4BP3A 2FW8A 3PV0A 4YYZA 5HK9A 2ZSDA 1W1WA 1JSCA 2OQIA 2YHIB 3VC7A 3HADA 3L7MA 4J2TA 3FNFA 4C03A 5AO9A 5GP1A 2XB9A 3V6LA 3MXOA 5JAMA 5EE9A 3R20A 3FYTA 4C0SA 2O8FB 1N1EA 2OYSA 4ZQFA 3RS4A 4RENA 5T3YA 3I8SA 4C7VA 5J2TB 1LEHA 4WOCA 2WP8J 5CLFA 2O2YA 1XRRA 3SE0A 3RF6A 4J0MA 4YRTA 1YS4A 1Z4MA 1XNRB 5CLHA 3WB1A 1F8UA 2JD2A 3QUAA 1ECGA 1A77A 4Y9UA 3CURA 3HDGA 3PFGA 3VXKA 5HRUA 3N74A 4OQFA 3UHJA 1COWD 1RD4A 2J9FA 3ZCXA 2H06A 1A97A 4NJOA 2I5PO 2ZROA 4F6CA 3BD9A 4NNOA 1XMQB 4ABTA 3IILA 4WESB 4DGSA 5KWEA 1UBSB 4XSHA 2OM2A 3JZDA 4BMNA 4C04A 5BWCA 1IN8A 1ZVJA 3CMCO 2C2YA 2VHTA 2X58A 3GIDA 1GCOA 1DAAA 3HRHA 1V9LA 2WHPB 3WVNA 2JJ2D 3ZBUA 1DJNA 4DABA 2C7OA 3ZDDA 2RFLA 3DBLB 3PL1A 4YDQA 2D7JA 2YNMC 4Q01A 4PXSA 4GDMA 3VRHA 3GAAA 4XA8A 4PNHA 2XH8A 3T1TA 4N01A 1Q20A 2X1LA 1OFGA 3PEYA 2DT5A 1S0MA 1FSZA 3QQMA 2ZGVA 4D8XA 1ZMOA 2XMQA 2BEVB 3QKRB 4OHPA 1L8XA 4BLOA 1U1EA 5B4VA 1U28C 4A2WA 1F6WA 4B6GA 3R9WA 2JGRA 3L1KA 1XZJA 1JX6A 3NEAA 6NULA 2X2EA 2F00A 3EG9A 1FXWF 1O6ZA 3H6HA 4FXOA 5G1PA 5LUBA 2QBYB 4G1BA 2FY8A 5SZHB 3ZY4A 5EHZA 2WFLB 4NHEA 1LDMA 4DR2H 2QZ4A 2Y05A 4QDZA 1HQYE 5JSFA 3Q2OA 1KI4A 2Q5QA 2RHHA 1QG4A 1C0LA 1E98A 4DCJA 4JU9A 1BS9A 4DLYA 1BG6A 4OP3A 1YVUA 2DP4E 2V7WA 3CY6A 3DMTC 3EIEA 3U13A 1A96A 4JB3A 3GGGA 2ZI3A 3KDSE 3DJYA 1KDYA 3IP7A 2C8LA 2OV3A 1BVHA 4AWXA 2YWFA 3PE4A 4DDVA 3F6PA 1RAEA 3CVYA 4MUKA 3LUAA 4TMKA 2JZOA 3L0CA 3DMGA 1JRLA 2WE6A 5LOVB 3BN3A 1XZCA 2IUSA 4NPCA 4B6EA 3JSXA 2PANA 4ZT2A 2ZIGA 4YRFA 4JI4H 1P0CA 1K5GA 3IVMA 4ESOA 5KUTA 3H40A 2ZBDA 2NVUB 4Z1OA 2QNRA 4OY3A 4WZBB 5A0TA 4G1MB 1R0XA 5CDFE 2AQ4A 1V5EA 5DE3A 2W0MA 2IXDA 3L5KA 2QQFA 2QJFA 2WB4A 2PUHA 1XD2B 4AJJA 3K9WA 3RC2A 2CL5A 3WYAA 3M5PA 3Q9NA 4M0JA 2ZLBA 2C96A 1A50B 1M6YA 2IQIA 3FCXA 4Y2JA 5DTJA 4W5WA 1KDOA 4N41A 3SEQA 5EAIA 1YQUA 3NOQA 1DV2A 2NTJA 3IBTA 3OOSA 3I2FA 3FPGA 4D97A 2IMWP 5CMLA 5KFGA 4CEIA 1C7IA 3BJZA 4EL5A 4WKOA 3UAZA 3KDAA 2DPXA 1X3LA 1UMBA 1XRLA 3UB2A 4ZHSA 1LS6A 3ZIAA 5KPDA 1IXYA 2W8BA 4Q1DA 2D1SA 4IR1A 3MTEA 5BR4A 1JILA 1TC1A 3JD3A 3EIFA 4ED1A 2FXIA 4QGGA 4TXHA 1PWEA 4AP6A 4ALJA 3R6WA 2WJYA 4JJ7A 1CHNA 2A9FA 3GFQA 4BC0A 6AT1A 5JHHB 1U3VA 2FMFA 4QYTA 1N9ZA 4YCAA 2LRHA 4A6EA 1Q7GA 5JWOA 1XT6A 3DVLA 3T1OA 4F4IA 3GD7A 2QN8A 4MRMB 4WZAA 4MRSA 3AIOA 3P9KA 4Q3KA 2ODWA 2V7TA 3DFUA 1E1CA 4RZ2A 3T5HA 1OLUA 1X15A 2GNAA 4P22A 3GZTB 4JJFA 4RPKA 3ZK8A 5FBVB 3TTVA 1KYXA 2FF5A 3ENWA 3ZGYA 2IX3A 1HNWB 3FWZA 1A8QA 2FN8A 4NBTA 4IHJA 3SVTA 4F4XA 2ZK7A 4FLMA 3B3GA 1M6NA 3N8DA 1QFSA 4QSMA 1M7BA 1ZCZA 2XKAA 121PA 4P4GA 1I01A 5KVCA 1MXHA 2AR7A 2OEPA 1RHJA 4TSFA 4CLOA 5E9QA 1R37A 1PSZA 5KMGA 1WMAA 4ZDJA 5JNLA 3EF1A 4DNFA 1KJIA 2AXPA 1KZHA 1ZQ9A 1WD7A 5DGAA 3LY5A 2VJLA 3FZQA 2HHAA 4ZI5A 1MA0A 1OXTA 1Q44A 2CFIA 4G5OA 3PN1A 3M7IA 3NLLA 5KT6A 2P6PA 1DXQA 4IJQA 4N7JA 1OROA 2G0TA 1V7ZA 1HMYA 3V4SA 4FWIB 5E6RA 2GR9A 1CUZA 3U7QA 3V1MA 1QIFA 3ICEA 3L7DA 1ESCA 2VQFH 3DKKA 3V4FA 1VE7A 4H77A 1JECA 5CBPA 1F38A 1GU1A 4LF7H 4FLEA 1I80A 1ZOPA 2HDHA 2ZYTX 4O3FA 2DFPA 4OQZA 2O54A 4G65A 1HFEL 1K08A 1F4PA 3RKRA 5E7JA 4TQRA 1WZIA 2J4DA 1A4IA 4Q9JA 1WNFA 3AF3A 3UAYA 5AVZA 1NZJA 1XALA 4HDOB 3S2YA 4AZWA 2FZEA 1PZMA 3EHDA 1UJCA 3FDIA 1U3DA 3L8MA 1RRPA 2B25A 4BEJA 1KPGA 1ZQ7A 3FN4A 4FFNA 4MO2A 3URMA 3SF8A 4BEVA 3IBYA 1WULS 5A4DA 3CVXA 4KQIA 3L8GA 3PUWA 1QVRA 1KI6B 1YE3A 3K9QO 4R8VA 2O5RA 2XKKA 2O8DB 1KS2A 2PA3A 4FOTA 3PWTA 2DFLA 3TL6A 1KOFA 3ND9A 3TFOA 3ZBQA 4XPIA 2IX9A 1FDSA 3GJ4A 3I1YA 3QVGA 1JYFA 2AYZA 3KHHA 1DFHA 2HQBA 4BQOA 1MC8A 5F78A 5DMXA 4WK0B 5LWQA 1P1FA 1N5MA 3OM0A 4FP9A 5ALQA 4GBMA 5IJAA 1H2EA 1R50A 5IARA 2JLYA 4CG3A 1U7PA 1U0JA 2F90A 3PX7A 3O3OB 4G63A 1OFVA 4KAXA 3WLIA 3PXBA 1MJFA 4IS2A 3I2GA 3DMDA 4ODIA 4B82A 5C80A 2D06A 3CF0A 3OLQA 2F1IA 3FVWA 1G17A 3GRRA 2Z09A 4RYLA 2R0QC 2FFJA 1A9SA 2FN7A 1JB1A 2HOQA 2P9CA 1SBTA 3LOUA 2X9GA 1FP4B 4IH4A 2QW0X 4Z1MD 4P9NA 3T0FA 4DZTA 5MDHA 1T8WA 4E5UA 1CR1A 2GX6A 2HCBA 3NHRA 4BB0A 3JWIA 3MMNA 3S8MA 5DGDA 4CDRA 3K6SB 1JA9A 1FNDA 4FR0A 1D1SA 1K1SA 1PG5A 4ECAA 4PY2A 4D8WA 3ICOA 1WG8A 3KHTA 3STXA 3LY7A 3KKMA 4U7JA 3ZE9A 3AR3A 2IEYA 5HIMA 1O08A 3L1VA 3WNCA 2HK6A 3U31A 4EY3A 4EYKA 5A5GA 1VPWA 4FVTA 4DV5H 3PDCA 2GN4A 4A3JG 1C3EA 1IEWA 2WFAA 5KOJB 2PRIA 2XMZA 3DL7A 2ZRFA 1HT3A 4RTQA 1IONA 4PU0A 3OA0A 3LPNA 4XLTA 2H54A 3S40A 3MBOA 4FCTA 4URYR 1U7WA 5GJVC 4E0BA 3HOVG 1VXRA 2R44A 1KVTA 3P2EA 1KYQA 2ATXA 3H1AA 1T4CA 4PRYA 5IULC 4RK7A 3K4HA 3PQ5A 1Z07A 3GPBA 5F3RA 3QEOA 1WXQA 5H3LA 3IP1A 3FETA 3O9ZA 1CCWA 1W29A 2Q4EA 3V3KA 1EFPA 4ZQHA 3SP1A 1AUPA 2DE0X 2NQTA 3NM6B 4RD2A 3WGQA 2ZRCA 2QVYX 1TM2A 2IWHA 1Z8NA 4KIGA 4BNNA 5C1IA 1NVMB 3IEVA 2UVQA 2VAWA 2XWJI 2BHLA 2I33A 1JQLB 3HG7A 4RKFA 3NGMA 3CZCA 2R6FA 5FP0A 1KL7A 4CUZA 1Z45A 2HBZA 4GOXA 4QPZA 3HO6A 5DBOA 2VHQA 3JPYA 2CD7A 3TE6A 2FX5A 4DEXA 1D3AA 2AOTA 1CYDA 2PKCA 3ZZMA 2OENG 5ESRA 3M2TA 3H17A 3CF4A 4BNHA 1QVAA 4ND7A 4DL5A 4KE7A 1MRNA 3CRW1 1SZCA 5EQDA 2VEOA 1PFQA 4BNLA 5JOQA 1F0NA 4Q15A 3DD1A 1KDZA 1KFKB 4ZEMA 2I9KA 2Z6QA 5EOYA 2PMCA 2TMYA 4Q1EA 2C0QA 2PS1A 3O6VA 3KXIA 4RJ2A 5GADl 2PMZA 2QUBA 3TEJA 1ZUHA 4XEUA 1WMFA 1EZ1A 5DHUA 2H65A 4LC0A 1AO3A 1JLRA 1P4AA 1XCGB 3D59A 3LXMA 2C7PA 1XYYA 5CITA 1GSIA 4I8IA 2PT6A 1GPLA 5EHNA 1DIGA 1FCJA 2W6JD 5K0GA 1RFGE 4OXKA 4UNSA 4BVFA 2JA5A 3B89A 3JD2A 1KEWA 3H2BA 3HJCA 4QGHA 5REQA 5JNRA 1K88A 4LDAA 4N03A 4V0RA 2JATA 4DL4A 4D9IA 1W8DA 4GVLA 1NATA 4P80A 3VSCA 4DWVA 3NGDA 3S1AB 3B2NA 3L40A 4O2BF 3M2PA 3OPYI 1N48A 4DR4B 5KQGA 4ND2A 1G6OA 2GK7A 3G6WA 4ETNA 1EUDA 1WDMA 3RHTA 3I04A 5JARA 1HLPA 3Q1LA 4JJAA 5P21A 4TSKA 3RJ9A 4EJFA 1FLDA 5I5GA 2AG5A 2JIDA 2QW8A 2PMKA 1JFSA 5FI0B 5T67A 2QMQA 1RE0A 3GLHB 5PNTA 3AVXA 1N34H 4NZNA 1DC5A 1LK7A 1LD3A 1JAZA 2BEJA 3NTUA 3R4VA 5DYIA 4WHXA 5EXSA 1PL7A 2OQRA 2O20A 2C4WA 2PFGA 2QXTA 5ICMA 3X1WA 5THXA 1E7SA 1Y8RB 1GO3E 1HORA 1I0LA 2O6LA 1E6WA 2FCAA 1MP0A 3GJ8A 2ZWAA 5DYGA 5I7FA 1N2JA 1USWA 3B7PA 3L8HA 3ZY5A 5GGXA 2J6TA 1LSUA 3FR7A 4CKCA 4OAOA 2P67A 2ZRMA 2XWQA 3EVZA 4POAA 2AN4A 1FJHA 1RIIA 5EI5A 4YT4A 3SIRA 4CMEA 1NC3A 4YLYA 1M1YB 1M0TA 4MGZR 3BXZA 2W9CB 1NMEA 1ZN9A 1RS0A 1C7RA 2H8KA 4AZ3B 2DBZA 4Q4AA 3VHLB 4HPWA 2V7VA 4GPAA 1LF0A 2WICA 5EQTA 4PLWA 4LC9A 2B69A 3GBVA 3E8MA 1X7ZA 5LKRA 1FJGH 4ZYVA 4E31A 2BHSA 2KB0A 4ZQEA 5JZMA 2IHNA 3NCTA 4BTVA 3KTDA 1I32A 2ORVA 1P1HA 2OR3A 3CO0S 3HH8A 1ORWA 5CA1B 5E1BA 1CV2A 1OLSB 3OEED 5LVAA 4QASA 5AXAA 5FYDA 3UUWA 5H02A 4XFKA 2WSMA 4K6OA 1I4DD 3AF2A 3W5UA 1RQGA 2I66A 2YWRA 3F7MA 1SIWA 3W05A 4IRKA 2NO9A 5E8JA 3NRCA 1ZOIA 2FWJA 1OIVA 2EJWA 3FPLA 3A0UA 5D01A 3K09C 5IC4A 1RJPA 2Q1UA 4WI1A 3TOZA 3T99A 2GXSA 2QYHA 4BKOA 2EW2A 3ZE8A 2PKYX 1SHUX 3DTNA 3UK2A 1S1MA 4XRRA 3V1YA 5JDCA 1SXIA 1N2EA 1DELA 4A0QA 1AQJA 1IBSA 1JTEA 1RAFA 3DTGA 2YVAA 3IJEB 4CBVA 1RAIA 3ZCTA 2O07A 4EQ6A 5BORA 4RK1A 4HAOA 1VIAA 3JAKB 4PHGA 2ZUVA 4TYPA 4DQUA 1W0JD 4R1OA 3I4FA 2DHEA 4JI7H 3KVVA 3U5TA 3T5LA 1NZFA 3TQCA 4IH9A 1XZAA 4HJXA 4KXXA 4LYHA 4BX3A 1AN9A 1N32H 1UBGA 3QW4B 1SVOA 4IO0A 3BRWA 3MWEB 5CGZA 2VRBA 2B92A 3LO8A 4URUR 2O05A 4PHFA 1K1EA 2FPKA 3ONFA 4MEAA 5BUSA 2ZWPA 4C5BA 5B6PA 3F67A 4X1KA 4TTJA 3DDNA 2QL5A 1EK0A 5BW4A 2Y92A 3MEQA 2JIPA 2CFTA 1F8GA 5GWXA 4DPKA 3C7KA 3UB4A 1Z2OX 1XU9A 1DMSA 4XDYA 1RPAA 1TLFA 2Y0BA 1QORA 1WB5A 3KQVA 4NR0A 1ECPA 1S7CA 1EB8A 4D9EA 1SXJE 5I5UA 4O83A 2BY4A 2QN1A 4ZZ1A 2CE7A 4DMRA 3ZOKA 3E5RA 1Z4KA 3M6MD 2UUOA 2G17A 3A3PA 4X00A 1WUIS 4HQOA 2I80A 2CBZA 3WISA 5FKJA 4EH1A 3C5VA 4ZU3A 4L51A 1SUPA 3BPSA 4LY6A 5CLGA 2K7ZA 3F5QA 3WBBA 5CDSA 4KVFA 1D1TA 1HKUA 1N2CB 2YASA 3OURA 4GS5A 1L5WA 1V16B 4HQRA 3HXQA 4B3RB 5ALDA 4EG0A 2YV3A 3E3AA 4WOPA 1X74A 1D2AA 2AEFA 3C8MA 1CIPA 4LF9B 2G5CA 1KO5A 1LTQA 3HN6A 2C3MA 3EJ6A 2R4QA 1R8YA 3PE3A 3QXSA 3AVWA 2FG7C 2SCUA 5I7AA 1ZAKA 1O9BA 2WP0A 4UCVA 4YXWD 1TJYA 2CT8A 2PEYA 3M4ZA 2A92A 3EIUA 2GYWA 4JI0B 4FKZA 3ZW9A 5K3FB 1VJTA 5JQGB 1J06A 2I1VB 4M36A 3GLIE 2H0RA 1WW2A 2PNFA 1NG9A 5FD5A 4WK4B 2ZSHA 1NX9A 1PR9A 4X65B 2GB4A 1PL6A 1BW9A 2PHZA 3NETA 4RYDA 3I32A 3QUCA 3EQZA 3X1JA 2JLQA 5T6BA 5AESA 3JW8A 3KJGA 4GLJA 1Y80A 2B0CA 2R11A 4AMUA 5A2QW 5KREA 2OZKA 1W85A 3RYCA 3HKCA 2ODTX 2D3TA 1JDPA 2NX2A 3AONB 3NVAA 3V2GA 2ERXA 5CX1A 3WL8A 4TYWA 1J99A 2KSQA 4BFXA 2CZGA 1X8LA 3E7XA 3K6KA 1IZ0A 4TTPA 4U6NA 3VR3A 4YX9A 4U3JB 2BKVA 3ADKA 3HLKA 1XEWX 4KXYA 4Z1MA 5AW9A 3HUDA 3NC0C 3F8TA 1ZEJA 4L76A 3SZGA 3UJPA 1B7GO 2PGAA 3VNUA 2V03A 1EJ6A 4JKYA 4LOHA 3VYSB 4D0NA 4X1IA 4F46A 3QXCA 3BB3A 4UAJA 4DL6A 1TK9A 1X38A 4JY7A 3U7GA 1V51A 3C39A 5LC1A 3UMFA 3JD4A 3WG9A 1L7AA 4JR2A 1RQ2A 2RGAA 4EB6A 5LZ4A 2DKNA 3KKZA 2WTUA 3HL4A 4BUJA 4CEHB 3IT0A 1Z4PX 2NPOA 3M4YA 5AD1A 4Z7JA 1L7VC 1R8JA 3O03A 1W36B 5KDLA 2OD2A 5F5LA 4NFLA 3QFTA 5LYJA 4DBVO 1SCIA 4ZZ3A 4PLHA 4HYEA 3BQ0A 4UUNA 4YJ2F 2RBGA 4HGQA 4BO1A 2W2LA 1ZETA 4QX6A 5CW2A 4MPRA 4IDHA 5CX4A 2ZDQA 3T9BA 4E1VA 1FFYA 4LFCH 1QS0B 5J9FA 4B8YA 5JALA 5IVDA 5KFFA 4J4TA 1VB3A 3ZVNA 4F5EA 1MIOA 5BRAA 4IQFA 2AI1A 3NHJA 1SELA 1Z4QA 3QFFA 3LW8A 4TRRA 5DYWA 3UPTA 4DR2B 4MYUA 4B3MH 3D8SA 4NXMB 1C9KA 4O7SA 1A4XA 4MTDA 1N7GA 1ZK4A 4HB3A 1YU6A 5L3QA 2OCAA 3O74A 2QT0A 3H2HA 4DQVA 1LI7A 2CJPA 1P73A 2WZDA 3CLRD 4FKMA 4OUDA 2JEIA 1N0IA 1N9GB 4KFUA 3MT9A 4QM7A 4QYMA 1YQTA 2DX7A 3FRHA 1WPXA 2YWJA 4FUQA 2FZVA 3ISVA 3L79A 2F9MA 1JR2A 1BFUA 1K6IA 2WTAA 2NO7A 3TZEA 4Y2PA 5EVCA 2BKAA 4IOJA 3WGKA 4RZQA 2ACWA 4KDFA 5F3DA 1XIVA 4DLKA 2P75A 1Z6XA 2I6SA 1ZFNA 1PR2A 4WLFA 1C7QA 1Y1PA 1YMQA 2HMTA 5IXJA 3G1WA 4F60A 1OLUB 1COWA 1ESNA 1X13A 1E79A 5KFKA 1ODKA 1F60A 4F97A 1CY6A 4MRMA 1Z0SA 4TV8F 1A5BB 3LMLA 1EM8A 1GVHA 4M49A 2R8ZA 3TZ6A 3NBFA 4B85A 1NBAA 5IASA 3CGGA 4X3PA 1ZK3A 4B44A 1A76A 1Y63A 3TFWA 2C2KA 4HZUB 3PR2B 4ML3A 3CTMA 2JA5G 4P38A 3U4CA 1QC5A 4QFBA 5L3RA 1Y5MA 3NYRA 3VR4A 4RNNA 1HV8A 2B63A 1UBOS 2IK8A 3ZE6A 1RC8A 3A1TA 1Z6ZA 3DE5X 1T9KA 3FY4A 5KB3A 3OOYA 2EGHA 1IOWA 2WPNA 2ID8A 3QTLA 1J07A 1TKCA 3GRZA 3ON5A 2ID4A 3G9XA 4N3BA 1ESEA 3QBVA 5AM3A 3DLPX 1ZEMA 4FZRA 3AU8A 4YT5A 1U1DA 5DBHX 4HUTA 4KO2S 2FMAA 4N39A 1L3IA 2Q4RA 1ABEA 4HDMA 1R6VA 4CWAA 4CEIB 1B93A 3UXYA 2HA5A 3SX2A 3U3MA 4TUYB 2XUGA 1QCCA 1X8KA 4I4IA 5A6SB 1A9RA 2M1XA 1UP7A 2WB1A 2R00C 3PICA 5EUBA 4CF3A 3OQBA 2PBRA 3ROPA 1LSJA 4G4GA 4ND3A 4RKRA 3WHPA 1PTJC 1XCJA 4P3NA 1A9XB 3RAJA 2A1UB 4HFNA 3SYKA 2PGLA 2YN4A 3VYTB 3G0GA 1POXA 3OTHA 3I12A 4EFNA 3UICA 2KI5A 3LKDA 4K1LA 1FFHA 4PGFA 2CXOA 4D82A 2JGAA 4M0DA 5KZMB 3LV8A 2IP1A 2BRUA 2WB2A 1UZUA 2LDXA 3WMFA 4K6FA 4G0UA 3FW1A 3FLBA 1ZK2A 5DP1A 5FB3A 4NBSA 2AJCA 3WLOA 2WEKA 3H97A 1HGXA 2YRXA 1KNXA 1UPXA 3V2UA 5JI3E 5FWNA 1OAKA 1WW8A 2FMIA 4DL3A 1OJLA 4PN7A 1N4AA 4J9UE 1NXVA 5TMDA 2AD1A 4P83A 5H3CA 5IP5A 4N5NA 3G5MA 1XDUA 3RFTA 1XQYA 4UTZA 1JVBA 5AW3A 1FVOA 2W2PA 3VR2A 2D74A 1XVVA 3OHMA 2CXXA 3ANNA 4BV3A 3UHPA 4H15A 4OFZA 1JU4A 2TMGA 4AN0A 2Z6UA 4RABA 3QEBZ 2C2EA 1TXGA 1YO6A 3P2JA 4UUPA 4A8PA 3M3PA 4Z7QB 1W8IA 2WHQA 3TOXA 5KCMA 3UWOA 4F71A 4K81B 5KNBA 1DARA 3PTZA 3HB0A 1YOVA 3IA7A 4UJ3A 4PZZA 5ALZA 4QTTB 4BYMA 3KLBA 1SFRA 3KYDB 1I9GA 3C8DA 1MFZA 4WY2A 5L3SB 2UXBB 4CM4B 1T9GR 2O0LA 5CFMA 5ETJA 3JSLA 3U0VA 4DLLA 3W6UA 4UBMA 4EYOA 1ENPA 2DCMA 1YVPA 1P0QA 4WNAB 2DHRA 4LJ7A 4RAQA 4IXTA 4UBOA 4AJKA 1JSRA 3K5IA 1CUHA 1UFVA 3E9DA 4LXTA 4OSOA 3A9SA 3UC9A 2OESA 3V4VB 3S27A 2Q7XA 3CA8A 2HADA 4R6XA 2ZT7A 5BVGA 5J1SB 4OHUA 5EHQA 4C01A 5FWXA 1JHOA 2BWJA 3TZHA 4CCYB 2QMYA 1Y7LA 3EVAA 3MCZA 3FNRA 3KPWA 4M21A 3AI2A 4D80A 5KFVA 4TVSA 2ZB3A 2C20A 3U1VA 1ZD9A 1HYQA 4BWFB 1JAYA 3DEHA 5KKCA 2GYVA 3D0KA 3L5OA 3NCHA 3I2IA 3WL3A 3PUKA 2Q5HA 4TMTA 3BREA 3PP8A 1OH6A 2FFQA 3VZQA 2JLRA 1M2VA 3G79A 2Z6AA 2OM6A 3DDWA 3EPGA 1NXTA 3A37A 3NBQA 3ZJ5A 1BGVA 4KDEA 4JX9A 4EHJA 5CG2A 2CXSA 5J1TB 4WT7A 4ZV4A 3ZHRA 2HJSA 2JG3A 3RT1A 3PDIB 2OHVA 1DI0A 1F14A 2ZRPA 3BD8A 3PSHA 1S3IA 3FBWA 4GXRA 3MR2A 3D8TA 4FE4A 2MTBA 5KNCD 3GPIA 4RTLA 4JP8A 2P77A 2RGWA 2P6UA 1GYQA 1SOWA 4JS0A 3R7WB 3RKSA 1JBEA 3C70A 3CF4G 2ASDA 3EFHA 1KI3A 1M5UA 4MV7A 4JGBA 2A0XA 1PV2A 5CR9A 1EAMA 4BE4A 1DWOA 4KXQA 1N77A 3ZHUA 4ZN6A 4RB3C 3Q6NA 2Y76A 4P34A 3UHOA 2V7QA 4JOSA 1QRDA 6GPBA 4KQ6A 1E2MA 3L0IB 5EZ5A 1L1RA 3TLEA 2YINC 3FZGA 4ZWNA 2NW6A 2GPJA 1VTKA 2JJYA 3OUUA 4OYRA 5EZQA 4KR3A 4H9GA 3QXXA 1XEWY 2W6NA 1C4KA 2EGUA 2IITA 4HYTA 5CVUA 4DA9A 4IDDA 4Y9TA 3E22B 5B7NA 5E4FA 1R5OA 2FW6A 2YJNA 4E1AA 4CCYA 1MJGM 3FKSD 1P7CA 2R8RA 2EOAA 1EK6A 1R10A 1FTGA 3BFKA 3RS7A 4OATA 2DERA 4X64H 2WB1E 1ZXBA 4HGYA 1QGOA 4QBKA 3WQRA 1XCMA 2WWHA 2GPBA 2D7DA 3NMUF 1Y1QA 2X0RA 5HWSA 1GQYA 4L4ZA 3Q7EA 3RTCA 1SVSA 3A70A 3CNOA 2Q21A 4MZXA 4QJFA 2GILA 2Y8EA 4NRDA 1WSAA 4BOYA 4CF4A 5JAOA 3O8DA 4Q9NA 1TQDA 4UUGA 2XNHA 3LBHA 1Z8HA 1JSXA 3ESXA 1ESZA 2QLLA 3M9WA 3P9QA 4AK9A 4E3WA 4DUZH 2PMWB 1JSZA 1YCDA 5D1OA 2ZB2A 3GEHA 3UT0A 4RGVA 1E62A 1RACA 3GYGA 3IVCA 4AZSA 1VE9A 2H1FA 5E6SB 3VPSA 2OSVA 1B2RA 2Y67A 3H2IA 3N3AC 1T9HA 4TN5A 2ORED 3LLMA 4TV8A 2YYAA 2RAPA 2YVLA 4YK7A 1H5UA 2ZAIA 3PW4A 4RDCA 5JAIA 1YB6A 4OXXA 3HVHA 3VZPA 3CXUA 3PD7A 3R9XB 4KXFB 4J9OA 1J8YF 3V4RA 1XDSA 3LF1A 1QCZA 4HTFB 4Q7MB 2PRZA 1PVVA 4KQWA 3RWBA 4F12A 1TO1E 1EVKA 1XTJA 2PBZA 1DTWB 1OSNA 1CJUC 3CRNA 5LWHA 4HWRA 2DF8A 1IBKB 4KQ9A 4I8XA 5JS1A 4EQ5A 5EWJA 1VL8A 2I6GA 4MTLA 1V7PC 2GHQA 3AZOA 1EG2A 3OHSX 4Y2YA 5JZVA 2B99A 1V8BA 4US1R 3W2IA 2EJCA 3OLZA 5TB5A 1ZO8A 1T24A 1C3XA 1Y3AA 4RJLA 4YHBA 5AKKA 2V5UA 4ZHQA 3X1MA 2X0SA 1NN0A 2HD4A 1XNGA 2FE1A 2C4TA 4PR0A 5D87A 4UBLA 3A11A 5E2AA 2Q2TA 2DQKA 4NE2A 5BUCA 1UPFA 1EK2A 2VP5A 1DAHA 4BVHA 1I4WA 2FP3A 3ZZ1A 4KFRA 2QNIA 1FW8A 1RM3A 2MR5A 5CVCA 5LB4A 3G6KA 1XZFA 5B1DA 3GT7A 5SYMA 4MGHA 3SSAA 3ZU3A 1O1YA 1V35A 1ZGGA 4MGYR 4UPDA 3BORA 2BR0A 3EPJA 2FG5A 4MKGA 3G5LA 1WQ1R 5FT9A 4YP1A 4K8RB 3HUTA 3A2MA 3IMFA 4DSOA 1IUOA 3RWOA 3GTLA 1RI3A 2PFKA 3U4MA 1NGSA 1VSVA 5KQPA 4QPJC 2UZ1B 3DVQX 1J8QA 1Y5NA 2P1DA 3W3AA 4QJ4A 4R8SA 1GCUA 2ZYVX 3AT1A 4BWYA 3G59A 3X1YA 3O26A 1HPLA 1HRDA 4O5OA 1EFVB 2BP7B 4K3UA 1HBJA 4PM4A 2G80A 1XQXA 3SSNA 3VYVA 2XZLA 3VJRA 1EJBA 1A7AA 1QGYA 2JH8A 4YCDA 3OIGA 2Y1EA 4GOKA 3JRNA 4YBRA 2I0FA 1NG1A 3O4IA 2CL6X 3I0MA 4MGEA 1MNAA 3TZQA 4CR8A 3L4BA 5IKMA 2V0NA 1HDOA 4E15A 2XZDA 1NN3A 3MSXA 1RBQA 3SS8A 1PGOA 2CZQA 3QUBA 3ZCQA 2WQ6A 1YA6A 2IEZA 1E2KA 2HHLA 1AHHA 4GQBA 2BGGA 3RYIB 4EMSA 2XNDA 4Y2TA 1R3DA 1SXGA 2FETA 3Q98A 4W6ZA 3VX3A 5KNCH 2XRZA 5CT4A 3D1JA 3OCVA 2VRNA 1DKOA 4IWXA 1XMOB 1JHXA 2QB5A 1UDXA 2O0KA 4YRRA 1W46A 2PVPA 1ECFA 1L2ZA 3LGAA 3FMGA 2CLEB 5IVPA 1LPMA 2J5BA 3RRFA 4J7CA 2OA0A 1XJ5A 4L3WA 8ATCA 2PGDA 4R1TA 5LLDA 2QRMA 2A0YA 4LWZA 1SU6A 3D3EA 3WTBA 1KFEB 1KSHA 3GLTA 4HDNB 4CR6A 3BZBA 2W2QA 1D4FA 1V8FA 3DEZA 5C34B 5IZ4A 4DJAA 1NHGA 1PSWA 3E35A 1HG1A 4OLHA 5DQIA 4LFAB 1QS0A 1XTRA 3IEXA 1UT8A 1NXPA 4Q9IA 2ZQYA 4MIKA 2JDID 1JH9A 2HLDA 3FNGA 4BVEA 1F3OA 2J0SA 3FMFA 2A8YA 3G2IA 3D7NA 3AERB 1W36D 4BIIA 1OYOA 5G0TA 2FGKA 2VNAA 2E55A 5EJMA 1T1SA 3KVOA 2W83A 2PUFA 4LAFA 3KE8A 5SYAA 4PE5B 1MIHA 1L7NA 2QMEA 5CA1F 2HN9A 1K89A 2AFHA 1Y3HA 2ZEJA 3EW9A 1VG0B 3E3NA 1ZNYA 3JQBC 1CEEA 4DLVA 3OJXA 1JEAA 4PYRA 2QTVA 3DYBA 3F74A 1G7SA 1BH6A 5DRYA 3SXUB 2E7ZA 3WRWA 3KS9A 3A8TA 4TPKA 2PS9A 1IM8A 4MVJM 4WBSA 3L4JA 1SH7A 4BWVA 1MQSA 2AX4A 1LI4A 5AMXA 3AU9A 4MKHA 4Y2UA 5E95A 3HHPA 1W76A 3DMFA 1LW6E 5AKHA 5HP4A 4TM7A 4RJJA 1EZ4A 1ODTC 2AMYA 3QE0A 3AI3A 1Z38A 2Q8NA 2QX6A 3DUFA 3EDQA 4I1VA 3THRA 2CVQA 4LCJA 3ZI7A 4EOGA 1AV6A 1ESMA 2I78A 1BW9B 1V41E 1RYZA 2WWRA 3IXLA 1XKLA 4EPTA 4CLRA 1SC1A 1Y6JA 3AFGA 3H9JA 3I30X 2XD9A 5ERXA 5GJCA 1RZRD 4X61A 2IY9A 2PUAA 2B8JA 2IYVA 4MYTA 1QRUA 4O4HA 3CLVA 1A9PA 4FDUA 1SUBA 2R48A 3W1VA 2JD1A 3C3EA 3EFEA 1JA1A 1W9HA 3KLNA 4GF5A 1M1NB 4PIPA 3NH9A 4MYCA 3NUQA 5DMHA 2JLBA 1A69A 3HCBA 3RAPR 4F2HA 1MT0A 3H7IA 4FFMA 4N3GA 3COWA 3H3JA 1R0RE 3Q9UA 1I9CA 4KR6A 4Z53A 3N8GA 1S9DA 2GBLA 1J9GA 1D2NA 4JA2A 2JB9A 3RB8A 3VDNB 4KR0A 1UP6A 2CLKB 2XOKD 2EFHB 1WXHA 4MWCA 5T5QA 3S55A 4LJ4A 2ZANA 3GGSA 1U04A 2G6BA 1YCGA 1W36C 3LYLA 4B7AA 2GCOB 2AFIA 2WW8A 3ZCRA 5K4GA 2JA6G 4GICA 3B5JA 3BA9A 1TZJA 3WHIA 4AXXA 1J2EA 4CXMA 4RTKA 4BX9A 2PLAA 3ZWCA 4BZQA 3KB2A 3PT5A 5AJXA 1WQ4A 5CW1A 3EAGA 4W9MC 3ZWVA 4XD2A 2GEFA 3J81W 1LPBB 1QAMA 4L9WA 3MHTA 1O5TA 2KSWA 3A9VA 2WVJA 5IYDG 3R5JA 3VX4A 2OOKA 4KFSA 4FN5A 2HA3A 5SYNA 3RT7A 5IZCA 2FPMA 4J4HA 1V3TA 3W5VA 3TWOA 1UAAA 4P82A 2ZT5A 1ITZA 4DMFA 4PC7A 5FBQB 4X71A 3CBQA 1V8ZA 5KTPA 3AF1A 3IOBA 1FNBA 1JEQA 5D8DA 4KTVE 1O94C 2ODAA 2H29A 4HRXA 2QUJA 3QVKA 1NONA 2BFOA 3EXFB 3FUWA 4XZ3A 4BX0A 1EDZA 4UNNA 3A3NA 2ISQA 2RG1A 5BYJA 1QYIA 3D7MA 3F5MA 3DNPA 2OG2A 1PT5A 5FNVB 4DYVA 3G8BA 2NP7A 1XFDA 4DA6A 4FINA 1DTWA 1XL0A 1T34A 1T5IA 2CLDX 4GR5A 4CF7A 1NVTA 2OD9A 1Y7HA 2FOXA 4AT1A 4EUNA 1LFDB 2HT6A 2RH8A 2FVYA 3WJAA 1VLLA 1CYEA 1T2VA 1OW3B 1DBPA 2INGX 3EWIA 3DCYA 1IJEA 3KYIB 4NYJQ 3DBOB 1QHSA 4ZT3A 4CLHA 4H60A 2X76A 3K73O 1GZSA 1OV6A 4UE3S 1CRPA 1H4TA 3HP4A 2RKWA 3O8LA 4ZQGA 2JA6A 1XD8A 3O8CA 4TV8B 3U17A 2QKYA 1YF3A 1Z35A 5AWFC 2ECOA 4ARZB 1QHHA 1K7YA 1Z47A 2SECE 2Y1LA 3I23A 4JT9A 2ADMA 2GAJA 4GMFA 1Z5VA 2JFHA 3BF7A 3GNSA 4QELA 3RVSA 3R0QA 4PRLA 1UH5A 2XOXA 4B74A 3BJEA 1UWCA 5K8JB 5KNBH 2OGSA 3UAGA 3MRVA 4AS1A 2VAXA 1R4NA 1XP8A 1PJ4A 2RGBA 3HCCA 3RBEA 1J8VA 3KG2A 3LBFA 4W7SA 4M46A 3HN2A 3LSTA 4I3GA 4NK4A 4PHHA 4XD7A 3GN2A 2JJ2A 1HC7A 3L7NA 2FPWA 4F96A 4LF4B 2PKQP 1JYEA 3UWDA 3A10A 4ZOQI 5BUZA 3R3UA 3D3WB 1R9TA 2BFCA 2YY5A 2VCEA 4CKCB 1IUKA 5JZ9A 1SPXA 1OY1A 1IJKA 1U2PA 5CYOA 4C4ZA 4E6PA 2O8EA 3K53A 2IOFK 4DV1B 4Q3BA 3MCWA 1VSUA 1DHRA 3DZHA 4YMTA 1EHCA 3PCXA 3RAEC 3WLSA 1PFVA 4FFVA 1YCFA 1D03A 2Q4TA 5FLEX 4DLTA 4K86A 8LDHA 3RIMA 3QP9A 5DJ5A 3M49A 5GV7A 1F5SA 1W4LA 5EIWA 3ZNOA 2DZDA 1R18A 3SC3A 3ONDA 3PVXA 4JEUA 2VI5A 3LJKA 4C3UA 1SK8A 4QUGA 4GL4A 3VPDA 4J9KA 4DR4H 3KUCA 4JXZA 5LQSA 3KXYT 3A2LA 2LIPA 1T6BY 2QRLA 4DLSA 4KQMA 5DBGA 1BFKA 3NHAA 4FEGA 1JZTA 3R7WA 4IVQA 4AFNA 1EX1A 3BFVA 2BM9A 2GPWA 4ETIA 2XUQA 3F47A 2O23A 5HA5A 4BN4A 4D9BA 2XQJA 1E3EA 5REQB 4ND5A 1QDUA 2B61A 3PZBA 4TVIA 1E2QA 1EKPA 2DSNA 1AGXA 1JDBB 4IX9A 1V4VA 1M2VB 2O1EA 3TQQA 4UCXA 3TJRA 5JH7B 4YFYA 4A5OA 3L06A 1SEPA 5JCXA 4O3SA 1KBOA 2QLBA 5TV2A 1LV8A 3AHHA 1LPAB 4R8MA 2BT4A 3DBRA 3HEAA 5D5PA 1YHNA 1ZX1A 3UG6A 1NV8A 4ZTBA 1QZUA 2VP0A 2ES4A 4AJNA 1FLVA 3AJ8A 5C37A 2BGUA 2FMKA 3NG1A 4B6FA 2JFNA 5COBA 4F8EA 1CJKC 3THYA 4GHWA 3FCCA 2A6PA 5ELMA 4OKNA 4D9CA 3Q7SA 3AEQA 2PRSA 4IKPA 1VKZA 1C9MA 1ODSA 1OLXA 1U65A 2YW9A 1AZTA 2MMGA 3H2ZA 1P60A 1W5EA 4HN9A 1YBHA 3RFUA 1JLHA 3P9IA 5GONB 2AFRA 4JVSB 3OX3A 3WXBA 1ZMRA 4U2DA 3KHKA 3KZVA 1MTOA 1VLHA 2C5FA 2VSOA 4NENA 5F9MA 2JJ8A 3NRJA 2WA1A 2XA1A 3RTAA 3HCOA 1PD0A 1KS9A 3CINA 3OETA 3BWVA 4QW9A 3G9TA 1FMLA 3HZZA 3TOSA 2PE5A 1QQ6A 3LUGA 4MB0A 4F91B 4R8KA 1L7DA 4QWAA 4YIKA 5GJBA 3C85A 3MJCA 4XGQA 1IZ7A 4M3NA 5JZOA 4YAJA 5ALKA 2CD9A 2NSJA 4GZ6A 2H7CA 2XX3A 1T4CB 1Y1KE 4ILKA 3UGJA 1KXJA 3JYQA 4TL9A 3ZXYA 1DUIA 5JNTA 3M6UA 5I5XA 5LQCA 3G2KA 1BYUA 3T4PA 3TQOA 2C94A 2FEPA 5DHSA 3RR2A 1JMKC 3E03A 3C0KA 1I1MA 1DRVA 2PMFA 4W5HA 3RTGA 3M70A 2PT9A 1Z83A 3QJYA 3LT0A 5LP1A 1VG8A 5HM8A 1EX7A 3T1QA 1HDCA 3DAYA 1SHJA 3ZDQA 3ZWBA 1JF8A 1I1KA 3LX6A 3OFND 5K51A 4GE0A 2Q8PA 3WBKA 3ZJUA 2A7XA 4RB2C 3LA6A 4GLFA 4JJ6A 3W7VA 1EE9A 3PXEA 3SICE 1KIFA 3DS8A 3NC1C 2IYZA 4IZHA 2QJOA 1HYGA 1NPTO 4NS4A 5BV0A 1RXUA 2QPTA 3RVPA 3GELA 5CP8A 3U44B 2GTPA 2P4HX 1HE1C 1EZZA 2XMCA 3Q8SB 4K0KH 3ADPA 4NV3A 3HJBA 3DONA 1XEXB 1E0JA 1T5BA 1VM6A 1KHHA 1EKXA 4FSXA 4IJMA 4QRDA 4FHGA 3UKJA 4C4OA 3K6RA 2IYTA 1WXXA 3K0CC 1UKYA 4UEQA 1B6SA 3FKIG 2KX7A 1I24A 2XVMA 4KUGA 3D4PA 4CV2A 1A8HA 5DNEA 4C3OB 2NV6A 5JDCC 3FJ1A 1XDDA 5ED0A 2FEWB 4Y6GB 1G1AA 1VL0A 4Q21A 4ZZIA 3GVHA 3PGKA 4EPWA 1NVVR 1KEEA 2FSVA 3GV0A 3IERA 4HDMB 3I8OA 1J23A 2HIHA 1V9CA 3KR0A 1RQ7A 3S99A 2QVXX 4LCBA 2G08A 4ZODA 3VU3A 3UOAB 5L1IA 2P5UA 4MP6A 4MVXA 3BCRA 1DC7A 5DK6A 2Q7OE 4CQMD 5C8ZA 3FYHA 1H22A 3C4JA 1WU8A 1FTQA 3K0FB 2O8DA 3WI7A 5CVDA 4O5AA 3ME5A 4RM2A 3GLIB 2WYHA 3HL0A 2ZZMA 3IV7A 4K9RA 5SV2A 4DTCA 5L7WA 3DOEA 3OMXA 1QE5A 2BBWA 2HLPA 2JVJA 1LC3A 2C03A 4L8VA 4R4JA 3UK0A 5HKOA 3TQTA 3MJSA 4GLXA 4I7HA 4HZUA 4TWZA 5IVIA 1FTNA 2NSDA 4W1QA 4YDRA 1OMOA 2VPXA 3D7RA 3JTEA 3OM8A 2FPPA 1CP3A 3O2QB 4PQRA 2VJQA 5F1OA 1THMA 1W35A 3AZPA 4MA0A 5EE0A 5HIIA 2X7XA 4ZU6X 1VIVA 4FNMA 2Z9CA 1GTL1 4JV2A 3OLWA 1CF9A 3HVUA 1C3LA 2P9EA 3IBFA 4M60A 2CNLA 3BXFA 4KYUA 1DKQA 3H4VA 1T6YA 4CQNA 3LF2A 3RGWS 3T3MB 2VJMA 2OUIA 3O4JA 5BWVA 2NZ8A 4GBED 2H63A 3ORYA 3PGXA 2AV6A 5KFBA 4WQMA 2GT1A 5ILOA 3DFIA 4DIMA 1JP7A 1H93A 2A5DA 3RFVA 2J0UB 3ZIAD 5KFWA 2ANBA 3BH0A 3TM4A 2QI9C 4QPPA 5KNCA 2A84A 2JIOA 3I9MA 3K8ZA 4OGKA 4ECRA 3K9HA 3RR5A 3AUJB 2R8OA 2FK7A 1XP5A 4AYBE 3D6JA 3W5CA 2PUCA 3L46A 4M99A 5E1OA 4JL5A 2EW1A 2Q5FA 4PFJA 4V2IA 4TZ6A 1N5RA 3VDXA 4EJ0A 3O1JC 5BYBA 4OB6A 4YH1A 1TRKA 5JS6A 4F50A 2BR4A 1VBFA 5ISMA 1XCPA 5CJJA 2QLTA 1P3Y1 3JYLA 4P08A 5IMBA 3W04A 1US8B 2ZVDA 5DWDA 3WADA 2R7KA 5CDFA 2QG4A 1M6VA 3R7FA 4IEIA 5KWVA 5CAEA 2BZGA 3X2SA 2IGTA 1ECCA 4LZPA 4KAFA 2ZIFA 3PX2A 4U2FA 2COIA 3FWYA 3CZPA 5HZKA 3WB0A 3EUEA 4GLBA 4I55A 5AYVA 2DBVO 2QGFA 2JIZD 4X1OA 1L4LA 1QIGA 3HUEA 4IIHA 2JLZA 1TWGA 3BJIC 1PG2A 4H59A 2HUNA 4YMHA 4WK2B 4B4DA 2QTTA 2J7PD 5ALUA 3VO1A 2F6RA 4BZPA 2CMGA 2R1TB 2FLPA 3IXMA 3PL5A 3ZDRA 1KMQA 4YR3A 2B35A 1K8YB 3LCMA 4H31A 3ZWYA 3LUCA 4A3KG 1GNLA 2I7CA 3C7CB 3Q7PA 4FR2A 4KHPH 2GWHA 3ZJYA 3H0GG 5KYUB 3K2QA 4Y67A 2NSYA 2HQSA 1Y3IA 1SZPA 1Z34A 3PRKE 4AUNA 3SFVA 3O0TA 4R2JA 4LZOA 4MWTA 5BMVA 4PO9A 3ETDA 3RFFA 4HF7A 4DLBA 4DNXA 2GJ9A 4YUVA 3BMQA 2CJFA 3ET5A 4UMFA 3U55A 4ITVA 2SKEA 4I6JA 3F3KA 3OIYA 3EXG1 3HKCB 3QK7A 1G5TA 3IPCA 1W85B 1YFKA 3IQZA 4S1NA 1QK4A 3EODA 4W5TA 1HEIA 1ES9A 3R7BA 4Z0NA 1FJGB 3NWPA 3OSZA 4CMFA 3GT4A 1J09A 4JB0A 1ACMA 5AK5A 2G1PA 4JIGA 1H2AS 2VWQA 1XZHA 5KFNA 3GTGA 4J0KA 3C3CA 2D54A 4PO8A 4W82A 3IX7A 4WCDA 1IH8A 2V7PA 4LDRA 4ZVQA 4C7XA 5IU6A 4Z2AA 2BD0A 2HHCA 4JV5H 2KYRA 2AZXA 3PC3A 3FOWA 3QEMA 5L45A 1I4OA 1PHPA 4L5YA 2CLMB 1PW5A 2P90A 4FFPA 1CNEA 2EHDA 4WZBA 4CGYA 5GIOE 3KJEA 3NXKA 1U0EA 4WBXC 4PEVA 4PQGA 4B3BA 3TINA 1ADFA 2NADA 1WM1A 3NYWA 4GU5A 4PPYA 1L4BA 1VZ2A 4F8JA 2WD8A 2QS9A 3EULA 3PNSA 2L2QA 1JXMA 4G6ZA 4O3QA 2AI3A 4DM7A 3RB0A 1KJZA 1GXSA 1E5XA 2P8JA 3R9IA 4EJSB 2IXGA 5J23A 5LQMA 3FX2A 4AJ1A 1RYYA 4LGCA 4QICA 2MDTA 2OCIA 4KMMA 1L8LA 4F3CA 3O1HB 2H31A 1GCIA 4FTWA 3MC1A 3UW1A 4WNYA 1YZ3A 5JECA 3H4BA 3REGA 1ZHHA 3T5CA 4MJLA 4MV8A 2HGXA 1HYBA 1R8SA 2XMSA 5CGQB 1W5FA 2WFLA 2BMEA 2HMAA 2YDXA 1GUBA 1I36A 2W2KA 3T1NA 4LNHA 5F12A 4D6YA 2JL1A 4XWOA 1G2QA 3RM3A 4MUEA 1T0PA 1JIHA 1SXHA 3B1WA 2R87A 3NKVA 3EAQA 1DX9A 4MS3A 3TL3A 1E18A 4DJDC 2QENA 5DW3A 4XGIA 1AKEA 3AR6A 3S24A 3TB4A 4G0OA 4FJ0A 4KO1S 4B47A 1QIMA 3RRMA 1BSVA 1S2IA 2JBHA 5GONA 2EXXA 2HTFA 2VLIA 1PJTA 3DTVD 3WNZA 2NTYC 3MT7A 3EWSA 4UZFA 2Y1FA 3RI3A 2Z8ZA 1PQUA 2WA2A 3BS4A 2CDCA 3DDHA 3AXSA 4DLUA 4BMCA 5LP6C 4IDQA 4CF5A 3D3JA 4WEOA 5F33A 4O7RA 1C7FA 3BRQA 4JENA 5JYCA 4LPKA 3RHZA 1PZGA 2ODEA 4V0QA 2NPIA 3ICVA 2V4MA 3AOGA 4R2HA 3T5PA 1EGHA 3T5AA 1CUCA 4OIFA 2ZUTA 2HHHH 1Q1GA 1ZJZA 2YWXA 2IP2A 2C5GA 4XRGA 2HCFA 3ISJA 4D3ZA 4EGJA 1YQDA 3VKHA 2XUHA 2R00A 3B7GA 1SO8A 1T2NA 2E21A 1TD1A 2J9FB 2P9GA 3H65A 1JB9A 3GDGA 4CFYA 1ISIA 4M53A 3CLUC 1F2TA 3FB4A 4Q9DA 5HJ2A 1N25A 2ENWA 1NBOA 4YQFA 3ZW8A 4B73A 2QYZA 3TZCA 3M82A 1H2HA 2BGTA 3ILHA 4LE1A 1OTYA 1SKAA 3W2FA 1BWPA 2F55A 4F4FA 3U80A 4JL6A 1TNDA 2GLTA 1QB7A 5I5SA 4MPJA 1UFKA 3SFTA 3QE4A 1GNVA 1UWKA 4NDNE 4NSNA 4UE6A 5CFPA 3I6BA 5KINB 1IJBA 4ZAWA 3FTQA 1OXBB 3NYIA 2MWMA 2A9JA 3O21A 3IQGX 4NOKA 1H5QA 3BWDD 1NVUQ 1QH8B 1VJRA 4H7PA 1ESDA 1X8JA 2B7CA 1SYXB 3KKKA 4PAQA 1HSZA 4U5QA 4DDMA 5JIBA 1Z56C 2YV5A 4N5IX 2AG6A 2EBFX 4IFEA 3RSOA 2GBLC 4QHYA 4WBNA 2OTCA 1OV4A 4ZMBA 4OK6A 1H0RA 4KO4S 2WJPA 3UWKA 4XVQA 3S3TA 4B43A 1PZFA 1P7WA 4TX1A 4Q4LA 1GPBA 1Q21A 2FB9A 2A30A 3BQ9A 3K1YA 5A5DA 3LUFA 4A23A 4LFBB 3B70A 4KVGA 2IODA 3PGMA 3IIIA 2ZRIA 4OYYA 2IOHA 1Q0ZA 3W1WA 3RS2A 4BV2A 3I9LA 2XUFA 3PYMA 1EDOA 2YXBA 5EN4A 1KZGB 5DYTA 1XZIA 2BFCB 4ZI7B 4M22A 4QSHA 1X94A 4MUGA 3NTLA 2Z83A 1YQ9A 4P7FA 5BR1A 2HC9A 4AJOA 1CPYA 4IR9A 1JFVA 1ZRHA 1LNQA 1A7UA 2Q9AA 5ITWA 2VTBA 2I2XB 3IUEA 2R1VA 4FS8A 4F45A 3ZCUA 5ES3A 1V9PA 2E4AA 2RH4A 2YS6A 3G0HA 1HTBA 4CM6A 4IXMA 4B6SA 1AQYA 2R6GA 4Y2HA 2HWXA 3LDFA 5DXFA 1H6CA 2PQMA 1JT2A 1QGED 5I5TA 2CN1A 2RHCA 2H11A 3NWEA 1EAYA 4XM2A 3UGQA 1LSOA 3JQGB 1GYFA 3F8WA 1VL2A 4BN0A 1BNCA 5JTTA 1Q7TA 3RSQA 2V6GA 2FRDA 2XJ9A 3V2HA 3FNIA 2PN1A 4FOPA 1K7FB 1VBKA 3H42B 3H7AA 2W7TA 2W9BA 1ZD5A 5A05A 3DLHA 3IALA 2CJYA 1QX4A 4QQFA 2OCXA 3DM9B 1KK0A 3L93A 2AW5A 4PN3A 3NORA 2C2GA 2IKSA 1EINA 1K68A 1MRSA 2KW5A 4FQ5A 2EHJA 2FFBA 4M9RA 5JZSA 2HVQA 1RIFA 3TVYA 1W94A 4A6XA 2QX9A 3JZ6A 4FE7A 4XB2A 5EEGA 4DV3H 2UUPA 5BOSA 5L9AA 2VT7A 1P1KA 2Z2XA 2XSZD 1NE7A 2RBEA 2YWVA 1QKIA 2AI2A 2XUZA 3AEUB 3DF7A 2OFOA 4KI7A 1GL6A 3H20A 3EJWA 3G5AA 4V0NA 5HFAA 4CMKA 1TUEA 4II3A 1I2DA 5FLKA 5JXWA 3NDBB 1Z13A 4HLNA 2XYPA 4PCVA 5CB4A 3MUEA 2G40A 1N0HA 1ULAA 1VL6A 1QAQA 2GQRA 1TW3A 3LUPA 4G23A 4G0MA 3PXCX 1Z5NA 4HAZA 5SZJA 1J56A 1RJFA 5DCUA 1I1HA 5E6UA 3ZWMA 2X0IA 3V32A 2X8LA 1K83A 1LKZA 2CLHB 3MERA 3S5JA 4KLRA 1ZJWA 1GAXA 2QUIA 1O5OA 3RSFA 3RWMB 1Z0DA 4BL5A 1NBIA 2YU9A 1Q84A 3UJ3X 5CEFA 1F7VA 1IZ8A 2XQFA 2Z1MA 2CNBA 4AY3A 2I4MA 3C43A 3IVXA 3KHGA 3MRTA 3GEBA 2CYCA 2WDTA 2WV7A 3R9RA 4KG7A 4PWYA 4PZ9A 4XI9A 5J47A 1Z17A 1QXSA 2B94A 1RQRA 4UM5A 4JASB 2XRYA 4NYEA 5E7IA 2EJUA 3LDAA 4J76A 3QZ8A 2PSJA 4RL4A 5J4LA 2I2CA 4U9IS 3FDSA 1NW6A 2FZ5A 2QUZA 1QTIA 3C4VA 4YGYA 3JWPA 4KVAA 3BGWA 3EYYA 5KG0A 2VHYA 3WTCA 1AXGA 2VA9A 3TI9A 4A8JA 3SS9X 1VMKA 2B1QA 5CFOA 1TQ6A 2OMKA 3IAEA 4R9NA 4R9UC 4F4JA 1UJ2A 5BWMA 1CTQA 3OCCA 3PW7A 4WVLA 4CDMA 1CBUA 1ZGAA 5AW4A 2GM4A 2FZGA 9MHTA 3VA7A 1FP4A 1I7NA 4NJEA 1ID1A 3EZFA 3JQBA 3NFYA 4L22A 5K0TA 1JG2A 3EDMA 1NOIA 4RJKA 3EGOA 3TQRA 3RIEA 1DAMA 3GIKA 1P6XA 1NQTA 2NO4A 2ZRBA 1ECLA 3A4LA 1B6TA 1OVGA 3C7TA 2BHTA 3EUAA 1NLUA 2WJ6A 3IQHX 3OT4A 3SOZA 5JYDA 3K70D 4J0GA 5JFTA 4BNUA 4YLGA 5C31A 1KE2A 3FMAA 2WE7A 4H1VA 2DHQA 2ZBVA 5JWRA 1OBCA 3R3VA 3MT8A 3T41A 2AGOA 2Z8YA 1YB7A 2QPOA 3DOOA 5IBCA 5CB6A 2YIDA 3GLGA 4MQBA 1RWOA 4XWYA 2RF4A 3X2EA 3ASUA 4QXAA 1ET0A 1F9AA 2QX8A 3VHRA 5LLTA 4B9AA 2XTZA 3O9VA 3PC6A 3KU1A 4CKEA 4A2CA 4DGQA 1Q22A 4FBMA 1Z0KA 4AN4A 3I5UA 1AN0A 1XDZA 1RHKA 3PGLA 2HYIC 3OY7A 3V48A 1M33A 1MV5A 6CHYA 2G5GX 4CYMA 4P92A 3PITA 2J9YB 3NTRA 3SBEA 1CKNA 4MKRA 4M89A 3AWDA 4J3NA 3W78A 1RWXA 3KALA 1MABA 4CRWB 1C9EA 4JC0A 1TTPB 1GA4A 4K2HA 1EVQA 3AUUA 4B09A 1G9SA 5A9SB 1JU9A 2K2WA 1DSSG 1NT4A 2PQ2A 2P6RA 5TVKA 4OBWA 3ZY3A 2V6IA 3OCWA 3AJDA 2HF8A 3BOSA 3IQFA 1TCUA 3KBBA 4UHFA 3BA6A 4B8WA 1H0HA 1WPRA 2C92A 2VTVA 3M83A 4BBZA 4GRDA 5LMUH 3MTBA 2I91A 2YCLA 4KQGA 4LS3A 3CU5A 3ULKA 5K6AA 2QMOA 1EJ2A 2D4HA 4X0EA 4F9EA 5JXJA 4DFDA 4C7OA 1IBKH 3UAOA 4R0MA 2VJCA 2I22A 2I4NA 3EIWA 4GP6A 2OBMA 1VHJA 1ABFA 4D9FA 3F8SA 5LJLA 4FCCA 3UV7A 1EE2A 3IT1A 2VR1A 1QG0A 4MRNA 2ZAGA 5BSUA 3A1WA 3HB7A 2UZ3A 5JRDS 1C50A 4EVQA 4XX1A 1E94E 3L4BC 4JOQA 3WWJA 4HQLA 1X7GA 2NNWB 4KWEA 4AL4A 4F4CA 4CKBA 2GCEA 5FWAA 2FUKA 2O2GA 1U8CB 1E4YA 3MS4A 4RD4A 4DDUA 1Z7YA 3E53A 4EDHA 2QTCA 5AM4A 2X14A 4EAQA 5I51A 1TAUA 5DBFA 3AM1A 2LTAA 3DOHA 3V9AA 2WZBA 3FWKA 3R0IA 1NF2A 1G2OA 3OIFA 4IDGA 2P68A 4Y8VB 4L74A 2FN4A 2PSHA 3AUAA 3R3HA 2B4QA 3CTPA 4UTRA 4AF7A 3CRRA 1ZSNA 5TQVA 3B9QA 3HBAA 3WYCA 3MWDA 3FPEA 4MUMA 4R51A 4ZCQA 4OI1A 4C4SA 4EIWA 3SYRA 3FA2A 3MLEA 4IGIA 4PBTA 1E4EA 1OZFA 2C2XA 4G8JA 1B8OA 3G3EA 1YZLA 4TKUA 5EPOA 4XIGS 1G7RA 4NCBA 3O1IC 1V45E 3TGLA 1B0UA 1F1BA 1ZM4A 2OKCA 3G2NA 4UUQA 1BRMA 3GDWA 4JLVA 1BEEA 3MW8A 3WLTA 3A1SA 2HKIA 2P9QA 2KE5A 2ZB4A 4JFAA 1BDMA 3ORHA 4LYEA 4TL7A 1D2EA 3LX8A 3ZZTA 2VK1A 2AE2A 2YXLA 2YC2C 1OXUA 1R16A 3BIFA 3SHWA 3MCAA 2XUKA 3N53A 3AETB 4RTRA 1YZGA 4PWZA 3RGGA 2DT8A 2FSGA 4TQGA 3ZDYB 1O9HA 1LJLA 2JVKA 1BDJA 4R41A 2H85A 1D09A 3T3NA 3B38A 4TS1A 3D8BA 4OKIA 1MO5A 1HNXB 5A3VA 5C0OE 1NZDA 4PLTA 4GKKB 4DR5B 2M9MA 1VKJA 1RWVA 4EW1A 3TRFA 3T8YA 2AQHA 1BXRA 3N6XA 4ARAA 4H18A 3DMTA 4AJ2A 4QLOA 3WWCA 3GB9A 2HA2A 3GAFA 4GRIA 2G9ZA 4F2GA 3GP8A 5BR8H 2GXQA 4COKA 1WZNA 2OLSA 3NAZA 3AKCA 3AVQA 1CUUA 3W7AA 1NYQA 4YO8A 3GYBA 3RE1A 3ITNA 1I3QA 2O3UA 1I1NA 3Q7IA 3WMRA 4CL2A 4JZYA 1NF3A 2NZ2A 1O4WA 3H1FA 5DU2A 5E4JA 4BQFA 2E48A 5AI8A 4O08A 2ROQA 2NU9A 4JVLA 3U7JA 1HEUA 3C1OA 2I67A 4QAJA 3CT4A 2OCKA 5EWMB 1BDHA 2WKQA 3FKSA 2MT9A 4BNKA 3BRSA 1O95A 4TWIA 4OU5A 4P2BA 2IVZA 1CHDA 1HL7A 2QN6A 1MH9A 1J5XA 4ZVSA 3B9RA 2Q8QA 3P2MA 5EWJB 2H16A 1LFAA 4R5HA 4PLYA 1SD2A 1Q1EA 5EINA 3WIDA 1ZOSA 2EQ5A 2OFXA 2XXJA 1PFKA 3MBIA 5JEDA 1NFFA 2CZCA 4MTCA 4W1PA 3S2FA 1VLZA 2DUNA 1W0KA 3NHPA 4NYMR 4W8GA 3TTSA 4J9SA 2DR2A 3NBYC 1IVNA 3V6JA 1VE6A 1JHPA 3ZY6A 4I0WB 4WGGA 4ZOAA 4BGUA 4MVJI 3OU7A 3O4FA 2IELA 1THGA 4G5QA 4YMIA 2WAQE 1G3UA 1LBHA 1N1GA 1WDTA 1OWTA 4P31A 4EI7A 2OQ2A 5K0CA 5LSAA 4YP7A 1SRQA 1GPNA 1UNNC 1R5JA 2EWMA 3IVRA 3NO4A 2WSLA 4G37A 4QIHA 1OWNA 1CT9A 3W7BA 2JLWA 3GFGA 3GIMA 1NRXA 3WLEA 1XFAA 2G4CA 2PAAA 3EQ2A 3J80W 1DC4A 1DOHA 4M55A 3ZGLA 4CV1A 1Z29A 3TJMA 3X1XA 4F3YA 4PZ8A 1WB6A 4X24A 3C45A 4DV4B 1M34A 2AMLA 4CGZA 1E9BA 3L4EA 2UZIR 4KIFA 3HUUA 2F64A 1DXYA 1XZPA 1T0JB 4LX8A 4DKJA 1O54A 1Z4OA 1TVMA 1KI1A 1MVOA 2B8NA 2WHPA 1GSOA 1E2LA 3C3AA 4BXXG 3O1LA 4JJZA 4KLCA 5AM1A 4EVSA 4ENRA 2DPMA 1Z2CA 1CY7A 1R2QA 4W9RA 3URKA 4IG9A 3DZ8A 1JDJA 1NDUA 1RWQA 4DUPA 1X7YA 1VPVA 3N8NA 2ATEA 4XARA 4DUZB 1H9BA 2C7BA 3M9XA 3ANTA 4GM4A 4Q7KA 4RV4A 3NIBA 5LMNB 3FHCB 2ZXEA 1KI7A 3H5VA 3WKCA 1G4UR 2AR9A 2RGNA 1HTTA 3V7FA 3V8PA 5GAJA 2XECA 1G6Q1 1VRWA 3CRMA 2IZ5A 3BD7A 2Y0PA 3JV7A 4AP9A 2RJ3A 1OLOA 2BCGY 1Y81A 4OH7A 1Q1NA 1T1GA 4UQPA 2F43A 3GY0A 4AYXA 3QVJA 1VMEA 3A4VA 4EHFA 1Q6ZA 4TRNA 2FMXA 1N34B 4RIIA 2PRYA 3ZIUA 5GZ3A 1FZQA 13PKA 4QARA 2JAHA 2G82A 3MGCA 3SJAA 2PLNA 2XE4A 1ORTA 2OBNA 2ZJZA 5FUYA 3OE1A 1BE8A 3GNQA 4OHBA 3LBIA 5IK2A 4IJKA 1G8HA 1UINA 3FG9A 3NQ41 3T3DA 3WYFA 4DVJA 2FEKA 3NHFA 5HBGA 5ENZA 1ULZA 4LOKA 3EPHA 1JL3A 5K2MA 1Z88A 2Z43A 4NU6A 3W34A 4DCCA 2F59A 4YR9A 3WIVA 2KLHA 5IDWA 4A3BG 4Z4QA 4J9QA 1R15A 1I1QB 1GO2A 3JQFA 4Z6KA 1R0ZA 5HFNA 3KSAC 1C9YA 3WGMA 1VHQA 5AHWA 1FNCA 3D7LA 3UAWA 4TM8A 1XN4A 3L7YA 4L02A 4EEXA 2YWBA 5T8KA 5KFUA 1MC5A 3J7TA 2GZHA 4YC7A 3TZLA 2C00A 3PNBA 3HNOA 4MVJD 4ENSA 5JVLA 3N2KA 4MVJA 4IIJB 4UKDA 4EEZA 2WZCA 2PT5A 3GMDA 1XTPA 4RZIA 4GWLA 4A3SA 4INAA 1TRHA 3ZZ0A 2FZ4A 4B17A 1EIZA 3D4IA 5DLPA 2EJ0A 4QYIB 1MN6A 5AM0A 5TMEA 3L92A 4O59O 5F64A 1I1OA 2ETXA 1N2GA 4GX0A 5G0UA 1WKVA 3ANXA 3I05A 4NCNA 4CM4A 3MFHA 2ZKLA 4U8HA 2JLVA 3WA6A 6REQB 5CNJA 3G68A 2C2ZA 2YJ4A 5EQJB 5DISB 4U39A 3AW8A 3QWHA 4PNPA 2D0IA 5DLYA 1KQGA 2F4VH 2WWGA 3ANLA 5DI3B 2ORYA 2VSQA 3LW7A 2IJGX 3IE1A 3QVVA 2OKGA 1PR5A 2J45A 2C7VA 2CMKA 2P7HA 4YLEA 1EFTA 4G85A 5GINE 4N6OA 3PEUA 2NSLA 2A9VA 4EYHB 1R8XA 3ONWA 5GVSA 2IHUA 3PZRA 1DT3A 4NL4H 1T3ZA 1Y7TA 1GNSA 2NZJA 4V3CA 2TYSB 3VR6H 2RI0A 5UKDA 2EG5A 2PJDA 1OVMA 2WF8A 4GX5A 1UF9A 2HRCA 3O8QB 4GPTA 3KM0A 5B3AA 3ZHZA 4OBEA 4DLAA 1CY0A 2QJWA 3GFVA 3MLBA 3E7DA 2V0GA 2J32A 4GPIB 4E5DA 1NXOA 2RH5A 4MITA 3U49A 3P0JA 5EJIA 4IQ4A 4LJ5A 1E4FT 4WNCA 2BW0A 2REOA 4O2RA 3BFJA 4JLKA 4HMPA 3R8CA 4O3NA 2Y2UA 3CV3A 1LVHA 1R0YA 2HBQA 3KU4A 4PG8A 4RSGA 5D2CA 4V2UA 2GLXA 3BVPA 1A8UA 4N7RA 2BFAA 1QTRA 4PC1A 4YJGA 5DCLA 5FL3A 3TSCA 4DDHA 4EW2A 1IZZA 3R0JA 1MTZA 1KJYA 4FYIA 1J1IA 2MR6A 5BWBA 1EA7A 5EXXA 4QU8A 5AJUA 4H7EA 4JI6B 3U7QB 1JDTA 2WAOA 3GX1A 2RHOA 4RKYA 2YJGA 5JJIA 5CT5A 2WUVA 2EP7A 2YBEA 2ZJ0A 3KFLA 4FN4A 3F4BA 4BO4A 4JODA 1HDZA 1TVCA 2DFKB 2HSWA 4H4CA 1TAHA 2IIVA 4MW6A 5DK4A 5EKXA 3TEFA 3Q3IA 1JN0A 4BB6A 3H8JA 4MP3A 4B4VA 4HXFB 3SFZA 4HGNA 2Z3VA 1E3WB 3FCYA 3GJQA 4CI9A 5H7XA 1DVRA 4ZI2A 3EYWA 3DBVO 3IP8A 4X45A 4AIRA 5J5VA 2NWQA 2VCYA 1JNXX 2GFQA 2PGJA 5DNCA 5BNFA 5LR6A 1IJFA 1HEYA 5IT9W 1OREA 2VO1A 1LTHR 4N7BA 1F2VA 1UJ6A 3JWGA 4JVNA 4O84A 1DQZA 4RIHA 4NEGA 1M83A 3KK0A 1DHTA 1HL3A 3DMPA 1DPFA 3DEKA 4AU1A 1JQ3A 1S6YA 2BR5A 2G83A 1NR5A 3DTVB 1KIAA 3GUUA 5DYNA 2C7GA 4JCOA 1ADCA 5J63A 2VA3A 3EZXA 3W5IA 4WBNF 1ADBA 1UFRA 1W5BA 1YJXA 2L82A 2ZR7A 4MUYA 2QEQA 1N78A 2IS6A 3ZWNA 4LJ6A 3CUEF 2YIVX 2UZ0A 4G3XA 5DCWA 5U4QA 3UBTA 3EVBA 3NASA 3KQHA 1D0VA 4KO8A 3DYIA 2V9CA 3W5OA 4R3UC 2ABJA 4OOEA 5BSKA 4TZ0A 1KQOA 2AN5A 4BRWA 1Q0LA 1OT5A 1NQXA 2CXHA 3OE4A 4E6NA 3LHSA 3PRHA 5E4YA 1S2GA 4CLXA 4HNUA 5FPYA 1J8MF 4F2DA 1J5PA 1TUBB 3HEBA 4KKVA 4E5YA 1U1GA 4WJLA 2GDZA 3BX1A 3AIMA 4QNMA 3JWJA 1HQCA 1G3QA 1PCXA 2XF8A 1T3SA 2KHZA 4GD3Q 5L7YA 1XCLA 4KSYA 5GOTA 2R82A 4O4IA 2DUUA 2AN3A 5ERGB 3SHOA 3EXEA 1YACA 1FB5A 1HNZB 2CVOA 5ALVA 1VKRA 3BSYA 2SBTA 4LQLA 2QV7A 3R41A 5TC4A 4FPXA 1R9NA 1K7CA 3L1IA 4K28A 1NOJA 5JCOA 4ZI7F 3MR6A 3KLPX 3BCSA 1P5RA 2JH3A 3AG5A 4DXAA 4TYMA 3IB3A 5GQSA 4BECA 2LCFA 1VHDA 5JCOC 4DV2B 1L8QA 2FV8A 5KT4A 3MFYA 4KKXB 4XFJA 4ZYWA 2W6JA 4CKZA 2QAIA 1FF9A 1ZONA 2C9BA 4W8HA 3C1AA 3KQWA 1UIRA 3JQRA 1Q2UA 1YNSA 3GVPA 4CEHA 5FULA 4EO7A 5IKOA 1KBLA 3RUEA 1INLA 4B2YA 1JBQA 1K4KA 1GL9B 1E2NA 3C98A 4Q4DA 3BWXA 2HV9A 3PGA1 1OXSC 3QWIA 4G86A 4IJ6A 4F86A 1TYCA 4DT1B 1R4ZA 4Y1FA 4GOND 4ENQA 5KTRA 4J49A 4D1YA 1XAHA 2IIQA 2QQEA 1JG1A 4GZ5A 4C0KA 1RE1A 1NT2A 2POQX 3QOYA 2JIZA 4NCIA 5LQUA 3TOCA 1U9IC 1P0MA 3I0ZA 2ZTMA 3OPNA 1YI0A 3WL6A 3DWEX 1JQAA 2BL4A 3V00A 4MRAA 3LWBA 1P0FA 3UC5A 4A7PA 5I9NA 3ER6A 2O2DA 3QITA 4WUVA 4UFOA 3WBFA 2D1FA 3BSFA 5IT9A 2EQBA 1FXSA 4G4SO 1A71A 4MW7A 1LPPA 1EK1A 1UMCA 2CNOA 2JGLA 4KQ2A 4NOLA 4XKJA 3VPAA 4FOOA 3GV8B 3VR5H 4BTEA 3BXPA 3JU3A 2WU3A 5ANRB 5SY4A 4X8OA 4WBNB 5IAOA 1P7VA 2HWWA 1OHHD 3FLMA 4D8TA 3T7AA 4M1SA 9ATCA 1WCV1 3MINA 5C8YA 1X7WA 2GZAA 3PNLA 3G0OA 3Q2KA 3JD0A 4EY4A 4O3MA 1Z63A 2CHGA 1AGNA 4XPZA 2DR3A 2XT6A 4XJXA 4TS9A 1HG0A 4LWQA 5HBRB 1A8PA 2C1EA 1ISHA 4O4LF 4WUTA 2OP0A 1JDZA 2HK7A 4BFWA 4IH1A 1NP3A 1ZM7A 1V39A 3F0TA 4NH0A 5F7JA 3RADC 1TFUA 4L4SA 5FPHA 3UXEA 5DULA 1JZSA 3AFHA 3N8KA 1AK2A 2QI9F 3OE5A 5DYYA 1SKYB 1DLIA 1T5OA 2B8WA 2AR0A 3PX3A 4YCLA 4B35A 3WSWA 5TXGA 4RMHA 2FWNA 3ZXXA 2YXPX 3G9ZA 1U8UA 2B21A 3INRA 4JBLA 5HGXA 3GU3A 3JCZA 2YWHA 4N9QA 3R0ZA 4QAQA 4O2AF 2WYVA 3PR5B 1USVA 3KOMA 3I83A 2HIXA 3LQQA 1QWOA 2ZT8A 4HH3C 4C0XA 5K3AA 1RRVA 3P5BA 3NBZB 3QPCA 2BYTA 5ADUS 5CTAA 5BPHA 1CIJA 2XQGA 1MNQA 2QN3A 1Q77A 3QEJA 1Y4SA 1MBZA 3M5WA 3OQ6A 3RSLA 5BYAA 5DXJA 5CA0B 1YGYA 2VBGA 5KFMA 2HREA 2XVYA 3CW9A 4B83A 1UZLA 5K9ZA 2QTRA 2AC2A 4X1KB 4ETWA 1UDAA 2J67A 3V8RA 2YZKA 5GM1A 3V4LA 3HJGA 1XNHA 3I53A 4RNCA 1Y5RA 3R2JA 4JYBA 3T5JA 1SK9A 2X5RA 4DR5H 1ULSA 1FTWA 3DW1X 3QYFA 4OJMX 1OYVA 3GCDA 3NBZC 2O3JA 1V11B 4M86A 3GJYA 4RVGA 3F96A 4QTUB 5F2OA 1JLSA 5CA0A 2ZCJA 1H85A 3IAS6 2AOWA 4ND8B 3HB4X 1JKJA 4K6HA 2JGFA 1PR3A 1P7YA 3AY0A 3D0RA 5TS3A 4TVOA 1DQSA 4BYGA 2XY4A 3NEJA 2GK6A 5K6AC 3HTXA 3M81A 4FHZA 1RM0A 1YDMA 3MUOA 4PYNA 2Y1KA 3GJRA 3B2EA 4LZZA 5DTIA 3F6CA 3LP6A 4LNUB 2J3DA 3BHNA 1OASA 4QHTA 2CJWA 2GCIA 3MMPA 2YN0A 3QUSA 4KJZA 4JR0A 5AK0A 1EP3B 2GEUA 1GGKA 5KHLB 1E63A 4UCSA 2XXBA 3E3LA 4O2BB 2FPOA 2NAPA 2QRQA 3QHAA 3QBJA 4D8UA 3NUZA 2VP6A 2XUAA 2NV2B 2ZBPA 1NW7A 4FS3A 2R6ZA 5CJPA 4OBBA 3QKIA 1GDHA 3G89A 3OECA 4ONEA 4TV9A 5KYGA 3Q40A 3VYWA 3HR7A 1T91A 1IEVA 1I3LA 2IXFA 3HKEB 3IEIA 4NAHA 3E0QA 4W9NC 3GR6A 5HBRA 2H4ZA 1ZL2A 1N8KA 2GKGA 3AEZA 5J59A 3TBHA 3HRKA 1DE0A 1XXLA 5A71A 5FO0A 4EO9A 4OH1A 5IJ9B 1X7WB 4Y6RA 2OFFA 4URWR 3HDVA 3JYNA 5AICA 3LSYA 4Z9FA 5EKTA 1ZBDA 3WC4A 1JEDA 1R4AA 5C53B 3THWA 3DMNA 2BUBA 5E2BA 4BO5A 3W8DA 4ZDIA 1PNQA 4AKGA 3GIJA 1XEFA 4RGBA 2QMZA 1XMPA 1Z9BA 1AKQA 3PFBA 2Z1NA 4P7GA 3RFXA 3OE7A 1RZ3A 1ZD2P 3F5SA 5JZBA 2J59A 3P9NA 3ID6C 5C8VA 1A0OA 3LP5A 1X92A 4P3XA 3GLQA 4JI0H 4V39A 3EFOA 1B2LA 3WK5A 2FG6C 5DNYB 1I6MA 4L9AA 5CR5A 2CVZA 3B2QA 4G5FA 1NE2A 3FKQA 2H5IA 3RNOA 3ZWQA 2NMVA 3KZ1E 1Z6TA 4FHDA 1GPKA 1U0TA 3LH5A 4C6TB 4ENVA 4CG1A 2FSUA 3DPIA 2R4TA 5AVRA 4H6XA 1QH9A 3T54A 3GXOA 1B0AA 5LL6b 3DULA 5D84A 5BT8A 5KQLA 2X2PA 4FGJA 4QFMA 3EVTA 2EDCA 4G41A 3HJNA 1RJDA 4FUTA 1QONA 4P4LA 3E5MA 4E11A 2O9JA 1T29A 4WKCA 1JZQA 4R1UA 5EJ7A 2ONKA 1XTVA 2WYUA 3VNAA 2IOFA 5JUMA 5C4XG 3BERA 4YYEA 4CT0A 5C7YA 4LF8B 1W581 4MWGA 3V46A 1O6FA 1OYWA 2XCOA 1I8TA 1TMYA 2O2JA 2GEBA 4EELA 1PL8A 1RVDA 1TQ2A 2XLCA 1HYHA 2XMPA 2O5EA 3RVQA 1UIMA 4LSZA 3STWA 4YCSA 4MA5A 4HKTA 4M98A 2BPOA 4RELA 3QLVA 4CM8B 3GD5A 1C1HA 1XLTC 3L43A 4LGMA 4NMLA 3MMZA 3U7RA 2B0JA 3VU1A 2FUNB 3FMPB 4G0VA 4G8DA 3PW5A 3PCTA 4BGIA 1P61B 3G02A 3R3SA 4YCBA 1EVZA 1G55A 1PWZA 3HKBA 3FPCA 5D7NA 2M6KA 3NV7A 2QRNA 3BAZA 3FGZA 5CYGA 1QU2A 4NHOA 1QFYA 4EMBA 3I6ZA 1TZCA 2JCGA 3RIZA 5H0IA 5IH3A 3TSZA 4BFLA 1KC7A 1C3VA 4IJUA 1YDHA 4LSMA 5MF6A 3NT2A 4EITA 1FUIA 1C81A 4QFDA 1DQYA 5MN6A 4P84A 5FR2A 2DC1A 3HYTA 1H1LB 1LLDA 4G1CA