5D8DA

Crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
303
structure length
282
Chain Sequence
b'SNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDRAFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLDSVIAELGLPVIIKPVHEGSVGMSKVEKAEDFAAAIEKATQHDAVVMAEKWITGREFTISFLNGQPLPVIRLQYGIPCGLSETEEKKLQALCLRAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAAKAVGYSFDELCVAILEQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title The crystal structure of the D-alanine-D-alanine ligase from Acinetobacter baumannii suggests a flexible conformational change in the central domain before nucleotide binding
pubmed doi rcsb
source organism Acinetobacter baumannii acicu
molecule tags Ligase
total genus 83
structure length 282
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5d8dA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5d8dA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5d8dA01
3TW6A 4I55F 2OLSA 4EG0A 1ULZA 2VR1A 4C5BA 2R82A 5BPHA 5LXTF 2QK4A 1E4EA 4MAMA 3NUAA 2W6ZA 4HQ6A 4O7WA 3RV4A 3E5NA 3ETJA 2GPWA 2YZMA 4ZOLF 3HO8A 4EA8A 4DIMA 2NU7B 3MWEA 3HBLA 4O7NA 1M0TA 2C00A 2GLTA 1EUDB 5CA0F 5JH7F 4FFLA 5KKNB 3V4SA 2PBZA 4WD3A 5JVDF 3R5XA 2YS7A 3VPBA 1W93A 2IP4A 4ZHQF 4E4TA 2ZDQA 2NU6B 2R7MA 4ZQIA 1KJ9A 4MV6A 4C5AA 4MA5A 4O7SA 2J9GA 3OUZA 3RFCA 3U54A 4FU0A 5C1PA 2FPIB 3KAKA 2PVPA 2YWVA 4O82A 2DZDA 3G8DA 2YYAA 2VQDA 3U55A 4RZQA 5J2UF 2YS6A 2NUAB 4O86A 2R6FA 4Y8VB 2V5AA 1DIKA 1VKZA 4YAJB 1CE8A 2X0SA 2FPGB 2VHEA 2V59A 4O4LF 3VPCA 1KJ8A 3SE7A 4EGJA 5LOVF 1UC9A 5I47A 4FFOA 3R5FA 4O7RA 4O2AF 2W6NA 1WR2A 2YW2A 4I4TF 4C5CA 4O7LA 2CNUA 1JDBB 2W70A 5JQGF 1IOVA 5K2MA 1C3OA 3Q1KA 4ZI7F 2R86A 3JRXA 4YJ2F 4M98A 2DLNA 4NYEA 1I7NA 4HNUA 3N8DA 3U9SA 2Z04A 4XYMB 1M0WA 3BFPA 3KREA 3R5HA 4QSHA 2R7KA 2I8CA 3TINA 4O84A 2XCLA 4HR7A 2I80A 2DWCA 4O81A 1JLLB 4FFNA 2YZGA 2W71A 1KJIA 4M99A 3ORRA 4FFPA 3ORQA 5GONF 1UC8A 2Z02A 2NU9B 4M9UA 4O2BF 2YRWA 4XX0B 1E4EB 4MV1A 2W6MA 2XD4A 5DMXA 1KJQA 4YBZB 2W6OA 1GLVA 5EZYF 4EABA 1KUTA 2FB9A 1B6SA 2NU8B 3WO0A 4O4HF 4EGQA 5BPFA 3AX6A 4IWYA 3QFFA 4O4IF 3Q2OA 1B6RA 1W96A 4J6EA 3RUPA 2VPQA 3VPDA 2W6PA 1OBDA 1OBGA 5C1OA 3UFXB 1Z2PX 2HGSA 4MV3A 3KALA 5LA6F 3V4ZA 3K3PA 3WNZA 1PX2A 3G8CA 4XZ3B 2W6QA 2PN1A 4FFMA 4O7VA 2YRXA 2WYOA 2R85A 1C30A 3JZFA 5LYJF 1EHIA 5H80A 4M9CA 4GGMX 2ZDGA 2FP4B 3DF7A 4O7YA 3BSWA 1A9XA 1Z2NX 2R7LA 3OUUA 2YL2A 4MV8A 1CS0A 4EA9A 2CZGA 4O4JF 2DIKA 4FGRA 4XYLB 5KX5F 4IHJF 3K5HA 1GSOA 1KEEA 3VMMA 5BMVF 1KC7A 2R84A 3JZIA 1Z2OX 2YZNA 2R87A 1EZ1A 1GGOA 1BNCA 4YB8B 1AUXA 3WO1A 2I87A 3JRWA 2NPOA 2CQYA 3HB9A 1EUCB 5JQWA 4YJ3F 4FFRA 3MJFA 3ETHA 4TUYF 3R9RA 3RV3A 1CQJB 1CQIB 4O7TA 3BSSA 3VOTA 2P0AA 1JDEA 3N6RA 1VBGA 3K5IA 2V58A 5CAEB 4I50F 3KAJA 5J2TF 3TIGA 2CNQA 3BSYA 1IOWA 5D8DA 4TV8F 1VBHA 5FNVF 1M6VA 4MV7A 5CB4F 5HV6A 3R23A 3GLKA 4HNTA 3VA7A 2CNVA 2GQRA 2ZDHA 4O7ZA 4WBNF 4MA0A 2FPPB 1EYZA 4YAKB 1BXRA 3TQTA 1SCUB 5LP6F 3AW8A 1GSHA 1KBLA 1JKJB 4O83A 3TIIA 4ME6A 3U9TA 2R7NA 4IZOA 1PK8A 4L1KA 5C8YF 3LP8A 2GPSA 2SCUB 3MWDA 4IWXA 5CA1F 4MV4A 4MV9A 4HNVA 3I12A 1DV1A 2QF7A 4TV9F 1T36A 3BG5A 2HJWA 1KJJA 1A48A 3GIDA 4EAAA 4DLKA 4FE2A 5HBRB 4IIJF 2YZLA 4EA7A 5IYZF 1DV2A 5JVLA 2GQSA 3LWBA 1AUVA 1GSAA 1I7LA
chains in the Genus database with same CATH superfamily
4G1UC 1NIJA 3MJCA 3V6MA 5KNBD 3JWHA 3HDQA 2QSYA 4NEGA 1PNRA 1JS1X 4EUKA 2UU9B 5JCOA 3DFIA 1WDTA 4BMVA 3L07A 1N33H 5EC8A 2X1LA 4KN8A 3DBRB 2WF8A 2QGZA 4N76A 2FRDC 1KJNA 1J25A 1ZD2P 4J3FA 1J06A 4JBYA 1ZN9A 2PS0A 2C1EA 2A9FA 1WD5A 1ZSVA 1X1AA 1KXZA 2JCBA 1YRAA 2IH2A 3NFRA 4R1OA 3NV9A 2XE4A 4C3VA 4OQFA 3JSXA 3DHEA 4KZPA 1HDCA 3RSGA 4RY0A 2PT6A 5FBKA 2YJ3A 4APMA 1VKZA 2E5LH 1M2HA 1T4DA 4CMCA 5E7IA 3SQDA 3AOEA 1T8SA 2HIGA 3OU2A 1E3MA 3PZBA 5K1ZA 1EA7A 1IUPA 3MCVA 2CV2A 3P9PA 2B92A 4TTTS 4DV0B 3CY6A 1ZO8A 1V16A 1LD3A 5CX1A 2O8NA 4BV2A 4NXNB 4DL9A 4Y30A 5DK4A 5K20A 3KSRA 2FEPA 3IT0A 2I6SA 3D0KA 4E2YA 1TLLA 3EZLA 1HT0A 3B9RA 2P0EA 2XCUA 3WBJA 2HJVA 3F3YA 1AHNA 2PR2A 3GCXA 3KR2A 4YRQA 3W5VA 9ABPA 5LP6C 3O8NA 2QXYA 3RRFA 3TB6A 1ZI9A 2I76A 2RGNA 4GNKA 4B7CA 1F8XA 1KTIA 1NOJA 2WKSA 3IRVA 2Z4TA 3O4JA 1A8SA 1QH8A 2GI4A 5IM5A 2WNIA 3HFGA 1EDZA 2NYVA 3ZNOA 4DLUA 3CLUD 3HJGA 3TRJA 4AYWA 1VSVA 1A8QA 3D1LA 3T1YH 4EBCA 2HIHA 4IV8A 5CW2A 3FNHA 1E2LA 4DAEA 4DV6B 4RE5A 3LA8A 1E2NA 4AT1A 2IEDA 4UEWA 1EX7A 1XL0A 5CDTA 1M8JA 1CIJA 3OPYB 5CXUA 1YZVA 1I33A 4YJ3A 3PQ6A 3WJAA 3EBPA 1IM2A 1B8OA 3ZGOA 5HEKA 1V3UA 4ABYA 2VRCD 3JALB 1O94D 4YI3A 4A93G 3A4LA 3MHPA 1T9HA 3G3EA 3PGVA 1M33A 3GRRA 3DOEA 1GGMA 1Z28A 3I01M 5DTEA 1E8NA 2B34A 4DGQA 2W2XA 1RACA 2ABWA 3P96A 4EHKA 3ZD6A 2V98A 2GVDC 3NXKA 2WYUA 2QTAA 4TQAA 5CR5A 4F2HA 4C76A 4PYMA 4WOJA 4UEKA 2IMWP 3H17A 4ZT5A 2HTEA 1C1HA 4HOYA 4JJAA 2J0UB 4JVLA 1DU4A 5BSKA 3AR6A 1IE3A 3OM0A 2IYOA 3CW8X 5EKDA 5IJ0B 2COKA 2OB2A 5DHRA 2PZEA 2QX9A 5K45A 3UQZA 5BMOA 4PWQA 4S05A 3BSSA 2KE5A 1JQBA 2VDOB 2YHIB 4EL0A 3N6RA 1VBGA 1ZFNA 1GOTA 3WJ1A 3SFVA 2OCXA 3NHWA 2DT5A 1G1AA 2J3DA 4RDXA 1MB9A 2R97A 4BBSG 3HBAA 4FNAA 4DQXA 3RIYA 3U0VA 5BUQA 3DO8A 3WKDA 3ZHRA 3MJEA 1F7UA 2F4VB 2SKCA 2XVAA 1U3DA 5EWGA 2PGIA 1J5EB 1SCUB 4XEHA 2FUG6 3AW8A 4AY4A 1E96A 1GXSA 3NDPA 1NXPA 1ODSA 1D2NA 4UXHA 4DB4A 1WV1A 4JOCA 3UUFA 4UUMA 4HQKA 3R7SA 5B53A 3RTXA 3I32A 3C1OA 1GNQA 4ZO9A 2K7FA 1PSZA 3RIEA 5TF4A 4ZQBA 4LYGA 3JWJA 3OC0A 4RZ2A 3IVXA 4D6PA 5FBLB 2JI4A 2OSBA 4QUHA 1TRKA 2W22A 4RVCA 1N57A 2OA0A 2R5WA 1Y1RA 1CBUA 3MTIA 5EQDA 1GQSA 5DHSA 1BVYF 2AD1A 2H8KA 3KM0A 5G2OA 1B2LA 1XCMA 4KDEA 1YFLA 4O4IB 4CMDA 4MRMA 2MSCB 4L7QA 3UWKA 4Q7KA 3A1EA 1OVMA 4P92A 1H05A 4XWKA 2JJ8A 2O0HA 3EDMA 1P7YA 2G9RA 2A88A 2VPPA 2P35A 2NZYA 4BLQA 4POAA 2PANA 5DBHX 3DV0A 4REQB 3DLHA 1MD9A 3GT3A 1RLIA 2J30A 3NZEA 1GPBA 3SZRA 2Z2ZA 3MPOA 5JZVA 1RYZA 4A8TA 2VNAA 3K31A 1OH6A 3DZIA 4Q3NA 1XJWA 4EFKA 1C1XA 4KE6A 2AVDA 4D8VA 5EP3A 4X7MA 3LCVB 2YASA 3CG4A 5C51B 4R8KA 1SVIA 1HFJA 3BN3A 4DL2A 2ZJFA 4UUPA 3MT7A 3L6DA 2VUMG 4KVZA 1UM9A 2XUKA 1CUEA 2VF2A 5DM4A 2NUTB 4MIKA 5KFIA 3F5QA 4D9KA 1K27A 3EMVA 3PC7A 3B6JA 3TR6A 4X90A 1S2NA 3H83A 3RHSA 3ICCA 4QTTB 3QYAA 4EMTA 2P5YA 5BNWA 2X0EA 2G36A 1NVFA 4E51A 3WXMA 5L3QA 1XNQH 3M1LA 3VSEA 3ZK7A 1GTL1 5DGHA 4GZ3A 2D2VA 4KR6A 1CRPA 3HYNA 1NU6A 3UAYA 3T7EA 2ZJAA 4HR7A 3WC4A 4M9XA 3I5YA 2EWWA 1A0IA 1RWXA 5TGDA 4DR1B 3NQ41 3TD2A 2PZMA 1R10A 3I5XA 1TE2A 2GEDA 1T5IA 2YC2C 3HYSA 4J75A 4PHTA 5DB4A 2UVDA 3D8NA 1WOMA 5DLDA 3M6UA 3I2HA 1JTEA 1KKMA 2YR0A 4HQLA 4CQNA 1H0SA 2NVUA 4NS1A 2ODQA 2PJZA 3LKVA 1ABBA 4FR5A 4JQSA 1WXHA 3EXFA 6REQA 4JB8A 1YO6A 5F12A 3EQ9A 3TN7A 4B7XA 5LQCA 1KQPA 1X19A 4Q12A 1KNXA 2FWBA 4YMWA 5IF9A 2ISSD 4PPGA 1WOYA 3WYFA 3QF7A 5BORA 1EFPB 1RJ9A 1I2CA 3HEMA 2P4SA 4Q19A 1FVXA 4O4JF 1SG9A 4LHWA 2PQMA 4EY4A 3PR3A 3RGWS 1MNAA 1TTTA 2WF7A 5TQJA 1WNTA 3BPSA 4ALLA 2DPIA 2Y2UA 3P9YA 5DCLA 1R15A 2B2NA 3RAGA 4CMJA 3EXG2 3CVZA 2IY8A 2FW0A 4PE5B 4QVKA 3T7CA 3GFSA 2XNJA 3LY7A 3MWYW 1PLLA 3BULA 1W88A 1G5FA 2RDJA 1REQB 1J2EA 1KK1A 1FUEA 2E18A 4O7TA 5IWAH 2PD4A 3G0IA 2IA5A 3ZKWA 4IQ4A 4W99A 4RY8A 3EW9A 3I9V1 3M1IA 5GIPE 3EQ2A 3C8HA 1RCTE 3FNGA 1ADCA 4ABTA 5KFDA 4QGBA 1YAJA 3OETA 5ISMA 3ACCA 4EO9A 4JFRA 1FY2A 2A7XA 4TPKA 5HF9A 4CM1A 3Q5EA 1XTVA 4CW7A 2I99A 4RV5A 4DBLC 3QY9A 4JROA 3ZWCA 2R7ZA 1NN0A 2B37A 2IS2A 3ZE8A 2ON6A 2PL9A 3H0GA 3EEIA 2WYVA 4B7ZA 4WN9A 4TKLA 4EI8A 4N1AA 1QC5A 1Y9ZA 2ZP1A 2WA1A 1T6XA 5DYYA 3VRHA 4JI2H 2WQ6A 1UZAA 5JJCA 4HNVA 1USUA 5FUMA 4IJ6A 1TWGA 4TYYA 3OZUA 1Z8NA 4Q3BA 4IAJA 5E7QA 1ZOPA 3CR7A 1Q1GA 4EWLA 2X14A 3CPEA 4O1HA 3ADOA 3QUAA 1RJGA 1GEEA 1CDEA 1YRBA 3H6HA 4A3CG 1IJBA 5ALQA 1O9GA 1N1MA 3TJMA 4X6YA 1U0HC 3MQ2A 2NU8A 3AI2A 3QVWA 5FR2A 3RS3A 1QP8A 2IODA 1A71A 1BD4A 1U0JA 1TKCA 4Q0MA 4DDUA 1MG5A 1IXYA 4M8LA 2JK0A 4QPPA 3A6GA 4PZ7A 2CUNA 3EX7C 1FMJA 5TT0A 4MQFA 4BO6A 4XOIA 5BNFA 5LYJB 1KRHA 1NW7A 2DBZA 2IYPA 3D7KA 4RANA 1EIZA 2HBZA 4KXMA 1ADBA 4DNOA 2CFRA 5BV7A 5J2UF 4FE4A 1D09A 4YT5A 3VYRB 4PZ8A 5NLLA 1NM5A 1GY8A 3CRW1 1UCFA 4MCIA 3RB8A 3AY6A 3JVVA 1YQGA 3O74A 3LMKA 5DWQA 4BWSC 4JXUA 4EGJA 1Z2CA 2A86A 2YXDA 3VQTA 1UC9A 1Z88A 4UQPA 1NMQA 3FYSA 3I5AA 5D86A 4QBGB 4X3OA 3D3EA 4HEA1 2GBFA 1BXRB 4L16A 2Z58A 3NGXA 2PH1A 1WQ1R 1FSPA 2C2DA 1YIOA 1L4HA 4RZIA 5K8LA 5CA0B 1RI4A 5HQJA 4LYJA 1CFJA 1ZHQA 5THQA 4JOSA 1QOQB 2V4MA 3ZHYA 5JADA 4V3CA 5K99A 4PY2A 1I0LA 4J0FA 5HS4A 2O8DA 4CYMA 1SUPA 2ECFA 5CT8A 1HYHA 2FSHA 4LGYA 5EKXA 1ACMA 2ZB4A 4JI4H 1MX3A 2IUYA 5FTKA 5KCZA 5JCJA 3ADBA 2ZRFA 1F5SA 4D0LB 4XIFA 4D4JA 2J07A 3OG9A 1OBFO 4BFCA 3Q7SA 1C1DA 4YGYA 1QO0A 2EZ8A 1TM1E 1BN6A 3G9UA 1DIHA 2O4CA 1PFUA 2FQWA 4E09A 1GRRA 4LYHA 2CK3A 1H2WA 1LK0A 2Y0SA 3WQRA 3W9UA 4UPVA 4G0MA 1P77A 3CB4A 5KMGB 3A1VA 4Q4AA 2C3UA 4QGFA 4J16C 5EQTA 5HM6A 1K0UA 2B4KA 1S9DA 4QBHA 5EZSA 2OVFA 4FJ1A 3JQAB 1O87A 2I3AA 5IVPA 3N58A 3D0OA 1US8A 3U39A 2QU7A 4N54A 5IBRA 2AW5A 4H0FA 1ESCA 1FXWF 2V9PA 5F73A 2GBPA 3EPRA 1O89A 2MSDB 3LZ6A 2ZYGA 1XVAA 5BR1A 1Z06A 2QVCA 4H7KA 5CA1A 3JPWA 1H3NA 1FLVA 4C22A 2V7UA 1LLFA 3GPBA 5TDHA 2E6KA 2XUPA 4UBIA 4HRVA 3V8QA 3OCWA 2P0AA 4DUGD 2ALZA 4IRKA 1PP4A 2W00A 2OC4A 2NUBA 2O8BA 5F2KA 4I55A 1V11A 3FZNA 5HRAA 3OTIA 3V4OA 4OX9Y 2OP0A 2KBFA 2NTVA 2AZXA 2X6TA 3V7UA 1HDIA 2Z6QA 4WERA 3QUQA 1GG2A 4PF1A 1R0RE 2LW7A 1JILA 5DRTA 5JZMA 8ATCA 2RAVA 4GECA 2GK7A 4FP9A 1JFFB 4ZI7B 1LNZA 2FQXA 1TYEB 3UH0A 1SEPA 5C8YF 1M8GA 5E7MA 1G0OA 2VNHA 3OHSX 3QVLA 4C05A 4PBCA 1FDTA 3I6MA 3M2TA 2VJLA 3DKVA 2QTGA 4QIHA 3LM8A 4I5DA 3EDCA 2BD0A 1KJJA 1F5NA 1TRHA 2J3QA 3HG7A 2NSLA 4DIDA 1D3AA 1TVEA 1X87A 1P61B 4DLAA 4ECAA 2X8WA 3OWOA 3SBXA 1UKYA 1LC0A 3SQXA 1IWPB 3RF7A 5EUMA 1E66A 2CJYA 3D6JA 3Q2IA 2YZMA 1RYBA 2ET6A 4RK1A 2UZ1A 3TX6A 8GPBA 5IBQA 1XTIA 2PUWA 2A9OA 2Q62A 5CHYA 4F92B 1LI5A 1JQKA 5ITWA 5JWRA 1Q1ZA 3L4SO 3DKRA 1XB2A 3KLBA 4EEQA 1J33A 2DFDA 3IE0A 1FFCA 3R5XA 4ETWA 1CYEA 3GGPA 1K98A 1PS8A 2HM7A 4JZYA 3AI1A 2AUTA 3UHFA 1AVTA 4G0QA 4R9RA 1CR4A 1Q14A 1UKCA 7REQA 1MVNA 3N2GB 1ECPA 4RSHA 3DE7X 3UXHA 3CBQA 1F7VA 2XTZA 1NOIA 4EBBA 1UWLA 3Q9NA 5BWOA 3KOWA 4OYYA 3TL2A 1CE8A 4KUHA 4QQKA 5KNBH 4WZAA 4QYIB 3NP7A 1ZC4A 5KYWA 3KVRA 3FPFA 4NBVA 1CSEE 3V8RA 4ECEA 3H5NA 2KI5A 2XZLA 4BLVA 1BDJA 1V8OA 3DR3A 4A10A 4DV7H 2O52A 4EDHA 1PFVA 3H9BA 3WYDA 3MVEA 1K6IA 4HC4A 3KSBC 1SU6A 4HNSA 5FCDA 3OOHA 2IX3A 4ACAA 2CBXA 2QRQA 1RZUA 4OA5A 1U7OA 3ZIAA 3Q1LA 4J9NA 3AJDA 2QAGA 1J56A 3QJYA 3G6WA 3DBLA 4FYWA 4JEHA 2X9LA 5B1SA 4ZTUB 3GLGE 5J1TB 2VSOA 2PHZA 2IW3A 1W46A 1JQEA 4P5DA 3OT5A 3ADCA 4HH1A 1B8PA 3AILA 2ISCA 2GD2A 3O2JA 2UUPA 3RNOA 3QBVA 5D1OA 4WFQA 1VKOA 4PX3A 4EEXA 2WU4A 5HF8A 4CLRA 2INGX 3IH5A 3CZQA 4BGIA 2QORA 1VHLA 2E87A 1YA8A 1RPTA 2C2XA 2GA8A 3DOOA 3DEJA 1RI1A 2FUNB 2IYVA 5EP2A 4MMXB 4FD2A 3AHHA 4L4XA 3UXEA 1RLUA 3SK0A 5EJMA 4XB2A 5DG8A 4GGMX 5AKLA 5AW4A 4M88A 2DPHA 3P0EA 4WBNA 2J6IA 2ZREA 3RRNA 4FHDA 5JH7B 1XR3A 4D9BA 4Y9RA 5K0JA 1YHNA 4ENRA 2C2HA 2FZEA 4NOKA 2C3MA 3RTDA 1XCLA 5AUPB 2HHHB 4R2HA 3LRXA 4NLLA 2P2GA 2JA7A 2W2LD 5IAJA 3GLVA 4GGOA 4ZTBA 3QI7A 4GBED 2HA5A 3OX1A 2HNBA 1ESEA 1G5QA 2OEPA 4TV9A 4P3OA 2P77A 2XWBF 2A4MA 2A14A 4PG5A 4QTZA 1XO1A 5ALRA 1I7SB 4UDXX 3PXGA 5L53A 4LXXA 4D44A 3FCUB 5FD5A 1N7IA 1SXIA 4OHRA 3W4JA 2VC2B 3CX8A 3DEHA 3VPGA 3SE0A 1X8XA 3TD6A 3U48A 1XDBA 3O4FA 4RF4A 3A1FA 4KE8A 2OK8A 4NVRA 4CCYA 4TRMA 5GPBA 4HN2A 3FZEA 2GCIA 2HJRA 3HP1A 4JEIA 4V0RA 3P9XA 1GYQA 1ZLXA 5ELMA 1YJ5A 4IYRA 1HE4A 4CTMA 1PL6A 4E2WA 5JPIA 5GY7A 2EIYA 4FUTA 1QE3A 5FR9A 4K26A 4Y1GA 4ZHQA 4UZSA 1LWNA 1VECA 1M34B 2IEGA 1X3SA 4ZXPA 4YXFA 3OQBA 2NXCA 4UATA 1RZRA 3AB8A 1U8AA 1WR8A 4IIJF 2R1VB 4CN8A 2V7QA 1W6UA 4S1NA 3KVYA 4J0DA 4WCVA 4LGVA 2WJ4A 1E60A 5SV2A 1G2OA 2AHRA 4RHEA 4EG5A 3WLFA 5ANRB 3SC2B 1KJWA 4OXIA 1RVV1 2GQ0A 4YLEA 5JAZA 2H5EA 3ZY2A 2ZBUA 1KO8A 2BGKA 5EE1A 2ZVDA 3VDNB 2V4RA 3B38A 2OVBA 4IJ5A 1PE0A 3PHCA 4L9WA 2XUJA 2XUAA 3H2IA 2Q3JA 1S8OA 4ED3A 2XEDA 2AUMA 3K0FA 4G0NA 3TI7A 5AQ1A 4Q1EA 1BWQA 1QPGA 2CJPA 1Q19A 3PDIA 4XCQA 2W90A 2BKAA 2YWXA 2FJZA 1ZI8A 2JIZA 3TQCA 3SQOA 1SWVA 3OQIA 2VUMA 2XKAA 4R1PA 2P68A 2QNBA 3VNQA 4DLWA 4H59A 2V5AA 2E2HA 3H05A 4DBLE 2F90A 1NT4A 2VTKA 1CD5A 3FCXA 1N6IA 3WRYC 2ZUDA 3LX4A 2P9QA 3R5FA 3WYCA 1R5BA 2WIJA 4IDEA 5FULA 2QRUA 2W9AA 4C07A 4QM6A 3A2KA 5ILOA 1PR5A 4S1OA 2VO1A 1OBCA 1QRUA 3LUKA 1M0SA 1M2FA 3JQPA 1BWPA 3KJQA 1SXJC 3V97A 4U02A 5JRJA 4CLOB 3GD7A 1UPUA 2K2WA 3V34A 3T9AA 5EE0A 3FI0A 4AJHA 3ZYCA 1MX1A 1YULA 3C24A 5I9NA 3A4YA 3PFWO 4ANFA 1A3GA 2VSXA 3EBOA 4S0ZA 5SYMA 2H92A 1CUSA 4CMEC 3HEBA 5CT4A 3UMYA 5HXAA 1IDN1 3WG9A 3IDFA 3NBZC 3OIWA 4E30A 1UT8A 1HETA 3ORSA 2QW1A 4GZ6A 3V4RA 2E4YA 1YDMA 3AUTA 2QRPA 4EUSA 5IT9A 4CQJA 3QBEA 1YB7A 3ONNA 3W3AD 4GRIA 3U61B 1GJRA 2OECA 5JCPA 3G49A 4GZLA 4QIWE 2NZUG 3GG2A 1CZKA 1OGIA 3H0EA 2B1GA 2GJ4A 2D1SA 3MF4A 3AOGA 3ZNNA 1UBHS 5KFLA 1QBGA 1H85A 4BWYA 3KHTA 1YE3A 4DIEA 2HVQA 3DTFA 3WGTA 1K89A 3WL3A 1F0PA 3UVEA 5U9CA 3MWDB 4R8VA 3FYUB 5HZKA 1N3YA 1NBMD 3ZHVA 4BN0A 3PXCX 4TSFD 2QE7A 4LXGA 1R0WA 1SUEA 1Z15A 4L6AA 1IJKA 2BE9A 5EJ2A 4Y2RA 4CIBA 3TUZC 3FYTA 4WOKA 2HMWA 3T7AA 3GHYA 4DCSA 4RD3A 1DOZA 4Y2YA 4X64H 3LUGA 1JR4A 3TMYA 5ALZA 1N3LA 1W581 4WNAB 3CJQA 5HOQA 1JH9A 3NTQA 2G67A 2CL5A 5CVTA 1LI7A 4I3HA 4J0IA 4LDNA 3A32A 2CWDA 5EJ7A 2V5VA 4YR3A 4CKBA 1PLKA 3KHLA 2AEEA 3PNKA 2C8JA 3OP1A 3IQIX 2ZJ3A 1K4YA 2Z98A 1OI4A 5IP9G 1XUOA 4RVDA 3WA6A 5GZ1A 2C31A 4MIOA 4UCTA 1JA0A 4RGVA 1ZSYA 3IQDB 4HAOA 3JSNA 1GPH1 1XD9A 4HZUA 3ZGVA 2G3YA 4UHKA 1BROA 2AGOA 1G8PA 3ZZUA 1P44A 4EENA 2GYUA 2QRLA 4CJXA 1GGVA 4MRSA 1JHYA 2OXRA 1WE2A 1CP3A 4GXRA 1M66A 1QV7A 4CFSA 4L4UA 4W1QA 1PFKA 2ZM6H 2XYQA 3L43A 2OCDA 3E6AA 2H65A 1C9MA 4C29A 4QWAA 1JZSA 1EAMA 1N6PA 3RE1A 4GKBA 4AS3A 4QG3A 2CE7A 3RWMB 4EB0A 2NZ2A 1V9CA 3TE6A 1SC3A 3BKWA 5LUAA 1XZDA 2ZE6A 3F6RA 5KFWA 3D4IA 2FEXA 1OGYA 3IUPA 4BTEA 3EGOA 3LSTA 4X20B 4DA8A 4FYMA 2WZCA 1GO2A 4TQSA 1A9PA 1YDFA 5KNDD 5HKKD 4MCJA 3L5KA 3HLTA 1R0KA 4XWAA 5C5IA 3BQNB 2RHBA 4O7LA 5A6SA 3TNDA 4UFNA 4UNNA 1SM4A 3RT1A 3O8DA 8OHMA 4N6OA 2IOYA 5A0TA 4HWTA 3QIAA 3JRXA 4FCWA 1T2AA 5LA6A 4RPGA 4QDTA 5FR1A 1X8LA 4CFYA 3W1BA 2OCLA 2LWIA 3AEKA 3U2QA 1A7JA 1KSGA 4P6VF 3DZHA 4O81A 5K0LA 1DJQA 4NU8X 3LZDA 3E8MA 1MA0A 1TQ2A 1IHPA 4ER0A 2PBRA 3TRKA 3W1VA 1ZEMA 3KIPA 1RAHA 3V1LA 4EF5A 5AXCA 5AFSA 1E8DA 1M2KA 3CTMA 2YWFA 3RB4A 5JISA 5G1PA 3JR3A 3M4IA 1XN1A 3A6EA 1KO7A 1KU6A 3OF2A 4FBUA 3DVLA 4ECQA 3W5OA 4KUGA 2H7YA 4Y6LA 3OTGA 5C1OA 2QN7A 4EY7A 3HVIA 3QPAA 1YK1A 1Z56C 3GIWA 2X86A 4DC9A 3SX0A 3IA7A 2RONA 1Z5OA 2Y76A 2BFCA 5ER9A 1UUFA 5TS3A 2HFKA 4YRKA 2V5UA 3C87A 3MERA 3LBIA 4HI0E 5ITSA 4XJTA 3F4KA 3RAJA 5HMMA 3GNLA 3HOZG 4IDHA 4UKDA 2HA0A 2GFHA 4UU8A 4QBKA 2NN3C 1V43A 1Y3BE 1GKLA 5AD1A 5EOYA 3GLHA 4W5OA 2FG7C 5FTMA 3O3NB 1FX0A 1RKUA 3EASA 1OOEA 1H2YA 2BI7A 2QMZA 1F2UB 2PFGA 2WG0A 3T41A 5BSEA 4LI3X 1GV0A 1N2SA 3Q8PB 4J9SA 2X7HA 5IS2A 3GD5A 1TM2A 2GDJA 4G07A 4AN4A 2FK1A 4FTWA 3PEFA 2I7DA 1ZUNB 4B0OA 3HP4A 2VJAA 5KQPA 4G89A 4KO1S 4AF6A 2RSLA 3EDOA 4XQ0A 1U2GA 3WGVA 4YDSA 3KAJA 2QWXA 1D0VA 2BI8A 4F97A 4FFVA 2Y0PA 4WAUA 1PR0A 1SIUA 4F9TA 2EJ2A 5L7YA 1PYGA 3VAYA 3A1CA 3D6TB 5J1SB 1J20A 5AWFC 3UYKA 1USIA 3CRVA 3NATA 2MYNA 3AP1A 3GJ6A 3UAVA 3M9XA 3G1TA 3OCVA 2Q8QA 4TL7A 3QWIA 2KJQA 4IP0A 2VHXA 2RARA 2HMSA 2AJCA 4CETA 5AI4A 4Q3AA 4F45A 1TK2A 1B41A 5KZMB 2G7ZA 4MV9A 2AFHB 4UC0A 3HADA 4L08A 5AW2A 1K3UB 2BJVA 1BMFA 2RHCA 2VUSA 5JMPA 2WAMA 4DEYA 3UQYS 2PT9A 3EN0A 4LHVA 3OEHA 1KMNA 3IMCA 3GPDG 4HYQA 3IBGA 3OQPA 3QXCA 1QHNA 1ZZEA 3GFGA 5KFYA 3VTFA 5DNWA 2RHGB 3L8HA 5J5AA 3D3WA 3JWPA 4M53A 4C7VA 2BGUA 5JNTA 1KOFA 2ZT8A 5DCYA 4EEYA 3DC7A 4DIMA 1E0JA 4QPNA 2FQ1A 2PCJA 4Q03A 1X6VA 4RKQA 4GPBA 5KFXA 2H1HA 5KKNB 1AO3A 3D0RA 4DLNA 3K71B 3DMFA 3BTVA 1KJ9A 1CVIA 2PRYA 2NAPA 4IVNA 4GM4A 1VJRA 5JD6A 1C8LA 5TRTA 3JARA 3VR4H 1Z7WA 2PVPA 3RYIA 2J7KA 2IKSA 5COBA 1HEIA 2ODWA 4I5FA 4QHTA 4H08A 1TD1A 4HQFA 4HBZA 1OXSC 3EPHA 5EJFA 4R05A 4AY5A 4RFVA 1AKQA 1VHWA 3R8XA 3M6VA 4A2QA 3PNYA 4IGFA 1ZU4A 3VPCA 3WADA 1IIBA 3DQQA 3KVOA 4DANA 3HMQA 3EZ7A 3Q4GA 4AIIA 1I6WA 1Y3AA 1L7NA 3AETB 2QMHA 2Y68A 1WMAA 4UHHA 4YYEA 2B3DA 4QJIA 3ABQB 3RJMA 3AHCA 3W06A 3PHGA 4KEAA 4ND8A 1VJGA 5BT8A 4K6KA 1A7KA 3ZVNA 2VATA 2GTPA 3OE7A 5LQRA 1YVDA 2XCOA 3KREA 1U7HA 1SZPA 4B6FA 1L8XA 4F3YA 1W5BA 1SN7A 1I8TA 1KR5A 3V6JA 5D6OA 1T3NA 1PT5A 1DO2A 4ZHSA 5FEMA 4KPUA 4WWHA 1EP2B 3WRWA 1E4EB 4KPFC 1RQGA 3WMRA 5DQIA 4GMKA 3IS3A 1ODKA 3ZQ4A 3I5UA 2X8JB 4O3OA 4XVUA 1QMGA 4LJKA 1SGWA 5JBQA 4ZC8A 5L4LA 3LGAA 4CTKA 1Q3TA 1DARA 4HFMA 4F11A 1ODJA 3WTBA 3TBHA 3MQ4A 2ZRGA 2Q0SA 1UEXC 3PUWA 2C9ZA 3P1JA 2NO9A 2GESA 1V26A 5J23A 4W9MC 3D4BA 4Z4IA 1BRTA 1CEXA 2XCAA 1PF7E 4X1YB 5CRIA 4BQIA 2P4QA 3UT5A 3OIFA 5IABA 4IF4A 4YRSA 4KRFA 1DC5A 3HB1A 4TSRA 2HX1A 5DX8A 1PNVA 5JNRA 1VAJA 4BMOB 4Y2PA 5KU1A 4FILA 3IOBA 5GAJA 3UO8B 1NMZA 4AUNA 4RMNA 1OI3A 2YJZA 5BVHB 3ZK8A 3GC6A 3NH9A 3N6XA 3BM5A 5FV4A 4QXAA 3M1YA 1N34B 1CQIB 4I7EA 3SXPA 3GPLA 2DTEA 1VG9B 2GN0A 4EFDA 5LMCA 2H8GA 3S3TA 5LPNA 4GLFA 4R1SA 2ID7A 4CPDA 5KFGA 3LDUA 4O33A 2O2GA 4OGFA 1GG8A 3RYFA 5E6SA 3C4QA 1CF2O 3M5DA 3T3MB 1C3EA 1AUOA 4NU5A 4EG3A 4G23A 2VXOA 1XRNA 4TZTA 4OQNA 4RQAA 2IBKA 4Q8EA 1YJXA 2QE6A 3MCZA 5DN6D 3AHIA 4DLRA 2ZZNA 1UIMA 1GFSA 5KG1A 1AKMA 4ED6A 3I3SR 1W2GA 3C3XA 1M7HA 3GCZA 4FUQA 1G8YA 1KKLA 3V7NA 1AV6A 5DM2A 3O21A 2WMOB 3DTVA 4Y7CA 2QUHA 2RGAA 3WLJA 1WCYA 3OX3A 1UPFA 4NJEA 5DGDA 2BHLA 1Z6ZA 2XCQA 1RCUA 3DKIA 3L05A 3RV4A 3PO3G 3U81A 5CCBA 4DV4H 1RM0A 4YJFA 3Q3VA 1HH4A 2YY7A 1O95A 4DC0A 3DHVA 1UC5B 1YJCA 3NYRA 4IRMA 1Y4SA 3AFGA 3ZEIA 1E9CA 2O6LA 4YAKA 4QJ5A 3DMTC 3W8NA 3GRPA 1T0HB 2JJ1A 3DT6A 2XD9A 4ZAWA 3FBWA 1IN8A 4OH1A 4A3DG 5B1EA 4TN1A 5EA2A 2I2DA 2QMYA 1X9IA 4Q6WA 3P0JA 3KELA 2MR5A 4ED9A 4OMFG 2PX6A 2CMKA 1Z3CA 4I4CA 3PSHA 2D3WA 1TQ4A 4ND5A 1E1KA 3HOUG 4DADA 4O2BA 2R8PA 3R5TA 3V2UA 1CJBA 1YR2A 4LK3A 4U7CA 1AO0A 4I1OA 4KVGA 4JBXA 2H5LA 2BP7A 1OAOA 1JIUA 1Q17A 3I01A 3IT2A 1JDBB 2XAAA 4JX9A 2AFVA 3SC4A 5ADHA 3GUHA 3AKCA 4AURA 1OLXB 1A0GA 1GPYA 3EIOA 1YJAA 5FO1A 4Q66C 5KQGA 4C2TA 3A4TA 5DISB 2JIBA 3IP9A 5IHXA 4ONEA 4FMDF 4LHXA 5JDIC 5C1BA 1RYFA 3ETEA 3N42B 3TLJA 5GM1A 3QWHA 4XDZA 2JFHA 4PPQA 1G4HA 2WT4A 1N0WA 2E4WA 3I1JA 4IDQA 3IPXA 2VH2A 2XNKA 4UU7A 4UHJA 4CI9A 3OPYI 2CYCA 5ENDA 4QXRA 2YH2A 4O8ZA 2HF7A 2ILTA 2QX8A 5THXA 3I09A 3VNUA 1QDEA 1IAQA 2FB9A 1QZZA 3UMGA 3B52X 1TZJA 2ZRAA 4HDRB 2CDRA 3N59A 2Q5HA 1OC4A 3AGQA 4YRRA 2W6PA 2OC9A 4NZYA 4D8UA 4KITB 1CW2B 3ZBTA 5SY4A 2GXAA 5LJIA 4EHIA 3WNZA 2BFWA 1JVNA 4ER5A 1ODIA 1M6VB 3DXYA 2V7WA 2HWUA 4NDZA 4MULA 3IP7A 4RTRA 1AXGA 3G23A 5G0WA 2IEZA 4QPDA 5ERYA 1NW8A 3UQ8A 2IE8A 3TQQA 1NVVR 4RTSA 4D3FA 3FMVA 1QG2A 3S1SA 5E6UB 2WB1E 2GN6A 4KR3A 5KYUB 5L7TA 3F5SA 4MROA 4TWAA 4DIKA 2DFLA 3DEAA 4F4CA 1YCHA 3AXSA 1RK5A 2PL3A 4DR4H 1CDDA 4BMNA 3IHLA 5D3QA 3C16C 1DQPA 4YJ3F 2E7ZA 3OOEA 1V71A 2ZETA 3GI1A 4TGLA 5CLJA 1G21E 3FTDA 1Y3FE 3OURA 5H3HA 1ICEA 3W3AH 4KK4A 5CURA 5BN3A 1Z8FA 3QLTA 2Y1XA 1VI6A 4NK5A 4LFAH 4TX1A 4EUEA 4DL5A 4DBVO 3NC0B 2BR4A 1EFAA 2XUZA 3HS3A 2XCSB 4I8XA 3OT1A 1EXWA 1KU0A 2CFSA 3Q15C 2YKGA 4CF3A 5CU7A 1PAUA 1M2GA 3P4YA 1XMOB 5JU6A 3WWOA 2HV8A 3DH0A 3V1YA 3MOSA 3R0XA 4LXYA 2RAUA 2POCA 4B6RA 3AZQA 6NULA 5I01A 3CZRA 1VXRA 3WAGA 3KTFA 1DB3A 3SNKA 4FGLA 2FR8A 1VCOA 3KHSA 1U7XA 1W94A 5FYQA 2AMJA 3B1YA 3MCTA 2BGTA 2ST1A 1HTWA 3K09C 3AVWA 2DY0A 1P2UA 3TOXA 5LYYA 5KTMA 1JU4A 2FG5A 1ZM9A 5M04A 3OLVA 4RY9A 3ZNPA 4F1KA 1F4VA 2D7DA 1U8CB 5ALKA 2JKYA 2CCGA 2WWRA 3IV6A 4LC0A 1U5BB 4CI0B 1AKVA 4R8LA 1O1YA 5EIXA 1YUMA 1J22A 1L8AA 5ESRA 4DDWA 4LDQA 5JZOA 2Q9AA 2YWJA 1ZJYA 4FK8A 1Z4OA 4REMA 1Z4KA 5NULA 1MNQA 4LWZA 4LXQA 4DV2H 5EWJA 1BSVA 5F3WB 3DMHA 2F3PA 3IDQA 4J6FA 3EVZA 4P0TA 4EG4A 2BM1A 1JPNA 1P1HA 2PMZA 3ZTWA 4Y2UA 3TDNA 1Z6PA 3QMWA 1S10A 1BDIA 1PFQA 5DF1A 1P60A 3AF0A 1NKSA 1LPNA 4AP6A 3IIKA 5HJ7A 3X1XA 4JH0A 1ZXLA 1L1EA 2YYYA 1GG9A 2JGRA 2V96A 4ZYWA 2L18A 1LKZA 4N3CA 3I45A 1Z74A 1T13A 3VJMA 2JLAA 4AJLA 4UASA 2C2BA 2J6HA 2VF7A 3O8QB 3T34A 3Q9LA 5I7HA 5B1DA 5DJ5A 4PU0A 5G1OA 2C4MA 1I7QB 3C8UA 3A0UA 2X0FA 1WD7A 1NFQA 3KEFA 3OSNA 1BYIA 2HADA 4LIPD 4BJ6A 3OZFA 1N6OA 4C2BA 5HIIA 1C9DB 4KIGA 3W4KA 2X0IA 3DKKA 4KLRA 2A3RA 1S1CA 2G1AA 4LWQA 3GDHA 3TZ6A 1XMSA 5JATA 5KNDH 5SZJA 3U26A 4KI7A 4RF3A 1G64A 2VJOA 1E79D 2DOKA 2PSEA 1JHMA 4UD2A 1RIIA 2ZIGA 1OU4A 2QR2A 3VZBA 3MRSA 1MZPA 4GX1A 3ENNA 3D4LA 1DBSA 3IOYA 4EHLA 1G8GA 4V39A 1WF6A 2GN9A 3COSA 3DR5A 4ZALA 1CRZA 2BHNA 3EFOA 5D3ZA 3KV3O 1E1CA 4HATA 3OOJA 1UF9A 4KHZA 1O6BA 5J5CA 1TJ5A 4MPTA 4JI6B 1DJLA 3P9IA 3AM4A 3IDOA 1QGUB 3TEKA 5CJ2A 5ER6A 3JATA 3V8VA 5JAHA 5J3JA 1N2XA 1G3QA 2HRBA 3SHTA 4MYCA 5JYEA 5DE3A 1YUBA 4IR1A 3EXIB 1W47A 3S55A 2BFBA 3T5DA 2WTAA 2E5FA 1WEKA 3UJBA 2OBLA 4J9QA 1N9KA 4IDPA 1WZUA 5A03A 1IMOA 4IOKA 4W1PA 5FBRB 1UJMA 3B3GA 1L3BA 1J99A 1K6JA 1B0PA 1D6SA 4HMOA 4KHPH 1W5AA 3DV9A 3P52A 4AMBA 3DOFA 3KXKA 2VG8A 3RF6A 3LWZA 3NOVA 3UZBA 2PWAA 4PEVA 1W0CA 1QIFA 4KQEA 2JC3A 1U0OC 2Q5CA 1Z5UA 3EVNA 1UBSB 1H5QA 1E2IA 3PT5A 3KKQA 3K4HA 4FDUA 4ZZ0A 5L3SB 2SCUB 4X6LA 4EMSA 1J2YA 1Y5IA 3S44A 4WNYA 4KQ2A 4PG4A 3WP0A 2J5XA 4GLWA 3QKRB 2AQ4A 4TMWA 3GRUA 1KWKA 1I2LA 1VLHA 2D5IA 2CV0A 1ZRMA 3PE3A 5C52B 1Z07A 3VHLB 4OFBA 2KM1A 1Z62A 4RFSA 2ZUUA 5FPQA 3ZXUB 4WY5A 2PQ6A 2R82A 1CNEA 2JDID 1CU1A 1ZMXA 1LVGA 1FDSA 4BU0A 2VUIB 3AMVA 3S2GA 1M6NA 2OHFA 5HP4A 3NT5A 3LE8A 4EJ6A 5A04A 1YK0A 1F8UA 5CXSA 2Y05A 1PEYA 3CH6A 4NU6A 5JSZB 3AHDA 3P0HA 1Z7YA 4LVOA 1RU3A 1EUDB 2LNDA 1DOHA 2JPDA 2OGSA 4LCEA 3WWCA 4TXHA 4HWSA 1T0BA 4P83A 4AJOA 2NU6B 1WUYA 1XZCA 4LYFA 5MN5A 2XT0A 1Q0QA 5EJ9A 1OKKD 4RWEA 2C28A 3GN1A 3N70A 2R8HA 1Z4JA 1BEZA 2AOUA 1D6JA 3RYHA 4H77A 2IDMA 3FLMA 3WIEA 4PFQA 1BHSA 3WLRA 2UZIR 1YHZA 4WHXA 5TGTA 3QBJA 2W8ZA 3UANA 1XPRA 4RJJA 1S7CA 2CL0X 4ND7A 2QZZA 3RUDA 4W8OA 1K06A 3H8SA 3ICVA 4PQFA 3QKSB 1QU2A 2WSYB 2D4AA 3KPVA 3GZNB 3PUKA 1VE3A 2ZJ1A 4CU2A 2F9FA 5K8JB 3N8KA 1X77A 4BASA 2CLFB 2QLTA 5FTJA 1NI4A 3GV5B 5FYDA 1A1VA 4A3LG 3N0WA 2A78A 3GJ8A 2PMBA 3KR0A 3EODA 3ANLA 3KBOA 5KTYA 1WKVA 3FLBA 5BR8B 5FWNA 1AKEA 3J81A 1ZNXA 2Q5IA 3DL2A 2J48A 3NVDA 4LH7A 1R18A 4AZSA 2EW8A 3QKTA 1B00A 3VR5A 3JSAA 2IGBA 4YV2A 2O5VA 3C3MA 3ZE0B 5HCIA 3STTA 3CB2A 3M3HA 2ZI5A 3EGIA 3BMOA 3SYLA 2GEUA 5ITVA 3H1PA 2YNMD 2RI1A 1DCKA 3E9MA 2Q6TA 5BUSA 2ZVJA 1FNSA 1WXFA 1VP9A 3VMFA 2PR7A 4NAVA 2Q4DA 1S9FA 1T2DA 1F8YA 2R2AA 5D51S 3WGYA 4RKYA 4W9RA 4FWIB 1XPUA 1D0SA 2VN8A 2HREA 3H40A 1AE1A 3ER6A 5BQFA 4R7RA 2V4UA 4K86A 2EX4A 3AM5A 4ZQFA 3QK7A 1QCCA 4QW9A 3E03A 2BUAA 3KETA 1NASA 1QVZA 2A0UA 4ZV9A 2R6R1 4DB2A 3E15A 4GKKH 2FPMA 2N1MA 2H85A 4BLPA 4UE6A 1Q2UA 1BWRA 3KEMA 5EYPA 4DT1B 3QXSA 5HKAA 2NYUA 2PGXA 4N3BA 1QGAA 2PG3A 4NCHA 2CQYA 4HVLA 1AM4D 4JEUA 5KSWB 3WE7A 3UV6A 4ND2A 1N8TA 4M22A 1Z5ZA 4NCBA 1I6MA 2ZYVX 4Z5XA 4R69A 1SVMA 4HX5A 3FSRA 3PUIA 5BWBA 5CBPA 3TPZA 2WWYA 2CVZA 1U4SA 5C32A 2NGRA 4YLGA 1MQSA 3JD0A 3MWEB 3CUSA 3SJBA 3OMXA 4MWDA 3EG9B 4HXGA 3D9QX 2ZUVA 2R7NA 2IPMA 4UMDA 1IHXA 2I8LA 4URFA 2UYGA 5BWMA 2WV9A 5EDWA 5CA1F 3UHPA 3KU1A 3ZD7A 1ZI6A 1GZUA 2ZBVA 4X6UA 3T94A 4AZ0B 4E2XA 2EEZA 1N2OA 3KFXA 4I46A 3AKDA 4K03A 2BOVA 4I55F 1OV4A 4OU5A 1F1BA 4Z3KA 5EWMA 4BX8A 4E15A 4RTJA 5K05A 1QZTA 3BGSA 3ZW7A 4FS3A 3BXPA 2E5WA 3WNBA 2B9EA 5IH7A 4EJMA 2ZCUA 3R9IA 2IEIA 1Q1EA 3HFSA 5JJLA 4IINA 5ALJA 2VP5A 3LBFA 4JLBA 3FPCA 4O5OA 4J1TC 1CHNA 2JATA 4F5EA 2CXRA 2ZBGA 1YZLA 1CTQA 1GCUA 3WRXC 3AY7A 3WLHA 3MJTA 2BUCA 2WJAA 3FGZA 2ZDQA 3EVBA 4JZKA 3I2KA 1JMYA 4PLPA 3GAZA 4KR7A 3ANSA 3G7UA 2VBFA 4O3SA 2B30A 3D31A 1O5TA 4RLFA 1OZHA 3A3OA 3EWIA 5IP7G 1V45E 3FHOA 1BVHA 2WUVA 4E22A 1COWD 3FBTA 1KEWA 4LK2A 2VSNA 3QPDA 5DLPA 3EFHA 3CEMA 4UMVA 1UFQA 5DQHA 2H11A 1NPYA 5KNCA 3G2IA 1I94H 3IIJA 3ZS8A 3JD3A 5FIUA 4DR7B 1S2GA 2JAOA 1P9LA 2A1IA 4JVNA 1NF9A 4LE0A 5FXMA 4HNAA 3H9JA 5FL3A 5EAIA 2ZWAA 4LOJA 4NBLA 1O3YA 3QLUC 1GKYA 4GWKA 4QECA 4LZOA 1T3ZA 3HXPA 3CV3A 2H5JA 4JK3A 1DT3A 3BXGA 3T3OA 1XKQA 2LRHA 4UHCA 3O0DA 3UAXA 4BCCA 1JKMA 3H1GA 3NS7A 1SPBS 4J07A 4XSHA 2NSJA 3GP3A 1DMSA 16PKA 1UDCA 1V5FA 2L19A 2BFDB 3D6UA 3L8FA 5B55A 3SGLA 4GQBA 5E7JA 2BZ1A 1WQ4A 1YA6A 1RRCA 4AC9A 3NHFA 5B57C 1XROA 4ZQEA 2AG5A 4PTLA 3ZWPA 3LWNA 3KWMA 5FUQA 1WP4A 2FK8A 2G82A 3PEVA 3JWIA 8LDHA 4K0RA 4EW1A 1SWWA 3KUXA 1QGOA 3QUSA 1O0CA 1EVIA 1N92A 2BIFA 1ZGJA 1XPJA 3RAEC 3HU3A 2X4IA 1ZM3A 4HDKB 1T5BA 3NTUA 4LPSA 1OFUX 1Q57A 1LPPA 5G40A 4K0KH 4KVFA 3KHRA 2XGSA 3MTGA 1A9XA 3MGAA 1VG1A 1O2DA 4YY3B 2CZGA 1ZHFA 3DV2A 1B76A 1SULA 3UJ7A 4TWRA 1PKEA 1Z4NA 2IYSA 4KOEC 1K8XB 4F46A 5EXPA 3PNOA 2P3QA 2ZYAA 4MCAA 4HNQA 2GO1A 2N42A 5EJGA 4QTYA 3QU9A 1G2QA 3PI6A 4YAIA 1HQYE 2YUIA 3SS8A 2ZUFA 1VYVA 2P3LA 4L57A 5KYXA 1E3QA 3FHTA 1MPXA 4YRGA 1ISIA 3WNQA 3FFTA 4LF8B 3K30A 2F9MA 3DLPX 1GQFA 3E70C 3UUEA 1YV9A 3RRJA 4YAJA 2OCKA 1TF2A 1WU7A 2EFYA 1ZOOA 3UG6A 1E32A 1Z5PA 3O6VA 3CJTA 1D5WA 2DH5A 4JA0A 4WBNF 1RSZA 1P4SA 3M70A 2RHJA 1XIVA 3OZSA 1PZFA 5KFQA 3DZJA 2BCEA 1N5DA 1LJLA 1VE9A 1RQRA 3GIPA 4DQNA 3WZ2A 4FCCA 4C2AA 3ABZA 2NM0A 5DNUA 1NRXA 3N7AA 4TV9F 4BZQA 4IWNA 1WB4A 3FIJA 4ZCLA 2IZ1A 5DBGA 4Q37A 3ER9A 1OHHD 3TG8A 4JN6B 2XGQA 5E3IA 1BAPA 2JGDB 2GQSA 3LUDA 1II9A 1R37A 3B12A 2PIDA 5EN4A 1KAOA 1G3UA 3QZ7A 1A9SA 3PWSA 3CF0A 2VP9A 5LMNH 1ST3A 3OZTA 5JAOA 1HSZA 4RD0A 1Z9BA 1EFLA 1BVUA 1VE6A 2ZJ7A 4P3NA 4CG3A 1QO9A 3TXAA 1JLKA 1DSSG 4FB4A 2PEYA 5HHTA 5F9MA 4UNQA 2VBCA 5HKLA 2FWPA 1ENYA 4H1TA 4IFTA 3LGXA 4ZHQF 3OKCA 5IRCD 5AHWA 2QVYX 1HM5A 5I5WA 4RTPA 5CJPA 3B85A 4AZ3A 1DO8A 4MW0A 4CVNA 3VUEA 3EIQA 2VJCA 2QD5A 1B0AA 4LSGA 1KEPA 3CT6A 3H11A 3TTXA 3WSWA 2ZTLA 2C9DA 3KQOA 2L42A 3QEKA 4RCVA 1GO3E 1QFSA 2JD0A 5JEEA 3MR2A 3LPMA 3G2QA 4WQMA 3A6DA 4Q16A 2BGNA 1OX4A 1QF6A 3MUFA 2E4VA 1YBVA 2WHYA 4KXNA 3BXEA 1M10A 4C5CA 3B70A 3FCYA 2EHJA 4LWOA 4U5QA 2GKGA 4ENTA 5AT1A 3AKYA 4IDFA 2OYSA 4X8OA 4JOBA 1I7NA 1I2BA 3NH6A 1B4DA 3I4CA 3NGLA 1J97A 1SG6A 3SJAA 5C3MA 2H2FA 4I6JA 5JXWA 1A77A 1VJCA 3VR2D 1X7WA 2XUGA 3HU5A 4XCVA 1QQ7A 3VSBA 3JZDA 2DJIA 2C3YA 2AQIA 4RABA 2AOTB 5MGNA 2Q28A 2NO4A 5U1PA 1SMKA 3V55A 1E63A 1YR6A 4IHJA 3QSYA 3KT6A 3C1UA 3HCWA 3REOA 4CBVA 4DOMA 5LDGA 3RR2A 2Z83A 3D1VA 3PDJA 5TJ9A 1MQ8B 3FSEA 1C7QA 1QFYA 3HB0A 2A67A 1LBSA 2QYOA 3URKA 3JTMA 1KQGA 4CU5A 1I2KA 4JBGA 1EVLA 2P78A 3K8OE 5ICCA 3AINA 1YB6A 3FNFA 4JJ4A 2HCJB 5BV8A 4RHYA 1G5RA 1DAPA 1RQ7A 3AVQA 1P1CA 4BKRA 9GPBA 1C14A 1NLMA 4DJJA 3NTRA 5FTNA 5KWSA 1ST2A 3V80A 4EVQA 2YJNA 5AR1A 3CM0A 2BR5A 1SHZA 3VBCA 1MKYA 3JD4A 3GJTA 1L5KA 4LFCB 1SC9A 4DZTA 3BWEA 4DLYA 4YI5A 1RHKA 4AULA 3PFKA 4V2UA 5A0VA 1ML4A 2IUUA 3KQKA 4UMFA 5J2UB 1CJVC 1VLMA 2FPKA 4YJKA 4NQRA 3GWGA 4UNPA 1R2QA 2ARKA 4ED7A 2Q0HA 1P1FA 4QGAA 2XUIA 3U9LA 5DWVA 3LS2A 5FA6A 5IN5A 2VJMB 5FI0B 3BBLA 2GYVA 2Z09A 4CKCB 1DBWA 3S8YA 3INRA 5KFSA 5BXQC 2P9GA 4KR9A 4EGAA 3WNVA 4M89A 4I7HA 4ZN6A 5DXFA 4WBSA 4RETA 5KFCA 1S2DA 3N40P 4C6TA 3DMYA 4ARCA 3ZWBA 2PJDA 4KYIB 4EKGA 2XVXA 5JHHB 1YS4A 3RSCA 4KJZA 5C81A 1SA0B 4PHCA 3HU1A 4RNCA 2AS0A 4D97A 2JH8A 4KN6A 1M7BA 1PSWA 1V1MB 1KXJA 3MR6A 2VPYA 3W5JA 4M0DA 1EWYA 3FRHA 1L7RA 2AI1A 1D1QA 3JQFC 3T7KA 3CZ9A 1K86A 1IN7A 2OCPA 3QKUA 4QHSA 4WL0A 3H2BA 3P45A 4RB1A 3CH5A 3Q6NA 3AH8A 1VZ2A 2JVKA 5B3JA 4C04A 1BVRA 4U63A 3L46A 1VTKA 3I92A 2PIAA 3LGSA 2DCMA 4NNOA 1A50B 1MDFA 2BHRA 1BKDR 3HXOA 4EYIB 2FFBA 4M1WA 2A9VA 5GTDA 3K70C 1QK4A 3ESCA 2F1KA 4G5SA 4BMCA 4I1IA 4ZQIA 2CLSA 1WKBA 1R6VA 1XV5A 4WT7A 3CNHA 6YASA 1BW9A 1NJ5A 2IYLD 1KEVA 2Q46A 2NZXA 1U3WA 4R2IA 3NONA 5IXJA 1FBTA 4IDNA 3KOUA 1ZSNA 4ENUA 2WJPA 1H23A 1KBQA 3CLRD 4JR1A 1NLZA 1SD5A 3IMFA 4GZMA 5C8XA 3PQ3A 3S7ZA 2EFCB 3DL0A 4KZKA 1E1NA 2FKAA 1JX6A 4CM8A 1PWXA 1W87A 2ERYA 4YXWD 1JJFA 4MVJD 2O7SA 3E7DA 2CF6A 4OFZA 1QK5A 1PTJC 3JQGB 3BA8A 4HGYA 1C30B 4NECA 3TRHA 2R4TA 1QWOA 3OPMA 4NLGA 5AVSA 4H2DA 4IIEA 4NP6A 1DWUA 3EGDA 1SK9A 4EY8A 3HA2A 3WIVA 2YZGA 1XE3A 1KORA 4KMRA 3BWBA 1I3MA 3LUHA 1Y6ZA 3RC1A 1TPZA 2B8JA 3ESDA 4KDCA 3ORRA 2FRDA 1LNSA 2GILA 1IZ9A 4U2CA 1ZVVA 4J0EA 4NYIR 4M9UA 2H0RA 2PU7A 2QIOA 5A06A 1RJEA 5C8YB 5I5VA 3FH0A 2W37A 4XFDA 2ZTMA 3HOWG 2ETXA 3H19A 5HVNA 4GPEA 5DX0A 1EJ2A 2XQKA 3H2GA 1A27A 2Q99A 3FKIG 1V6SA 5BVGB 1X7YA 3GW8A 1E92A 1VC2A 3O92A 4A27A 3QEMA 1TF7A 1OBDA 3GFTA 3QG5A 3H87A 5LA6F 1K6XA 5JQGB 5HE8A 3UK1A 3HLKA 4MW9A 3EULA 1F6BA 3DLCA 2COUA 4FDLA 2JRCA 1WB5A 5KG6A 3PENA 2C1ZA 2VDJA 3I53A 2OPBA 3D7NA 2GNPA 2BCJQ 4EJ2A 4ARZA 2OBNA 1P45A 3PPYA 1QRSA 4OSEA 3L1UA 2PWBA 1IMJA 4L5JA 1RHJA 3VYWA 5LP6A 4G0XA 4JL5A 3LQ2A 4GR5A 3VH3A 1NBIA 1QS0B 5JS7A 1TQDA 1Q11A 5DEOA 1X7HA 3W6PA 1IXKA 4Z1MA 4GXNA 1VL6A 3DMTA 2HQ1A 2NPOA 5BN5B 1XZQA 2BMEA 3UGQA 4TTQA 4IG9A 3KR1A 3UPDA 4LJ7A 2OKCA 1LBEA 1H93A 4AKTA 2A0KA 1HFEL 3NM5A 1XBTA 1J9ZA 3RTGA 4PYRA 2Y67A 2VHWA 1DAIA 3WZLA 4S2EA 3RYCB 4IDAA 2AX4A 1WBBA 3BSYA 1IB6A 3HOVG 3K3VA 3I9JA 3E9CA 4CQMB 3LLCA 4BNMA 4IG4A 1GM5A 4L5BA 2BKLA 3E2IA 3UYLA 3LT0A 3WBKA 1EJ0A 2EFJA 1N2HA 4MA0A 4FWBA 2RJNA 1GSHA 4Q34A 1DKUA 1UBGA 4W6ZA 1NZJA 2Z5GA 5DQGA 5A7GA 4L8GA 2CVQA 4DJ5X 2MYPA 4JLVA 2ZVPX 1RI5A 1Z68A 4MRPA 1Y6RA 3EDQA 3CX6A 2JZCA 4C1NA 1KARA 4YRPA 1PS9A 4DLKA 2HLHA 1KH1A 4MGKR 4PYJA 1N7HA 1X9NA 2AEFA 5ULLA 4RVGA 2R9VA 1GSAA 2WA2A 4ZVTA 5LVAA 2EXXA 4CIAA 1JHDA 3ENVA 1O08A 3QXGA 3AM3A 4UCOA 1GRCA 3P5BA 1OX5A 2NZWA 4ZCPA 1NLYA 1MCZA 3E3OA 3V8NA 5J43A 4H9GA 2DABA 1YZHA 2J9FB 1PT9A 1G7CA 2B21A 2W7TA 2WTUA 4HF7A 3QELB 2CJXA 3KQNA 3IOMA 1T5DX 5ILGA 3IUMA 4BRWA 4CR6A 3VXKA 4ARIA 2E2IA 2P2DA 3AR3A 3FPLA 2EATA 3TLGA 3AHFA 1OLUB 4QAJA 3ZCUA 4BPRA 1RKQA 1YB2A 1JZTA 5FWXB 4KU4A 4DRYA 4KOAA 4DG5A 2Z8YM 3ZHTA 5IT0A 3UMJA 4PCAA 1KY2A 3G7SA 2ZR0A 3HYCA 4TL6A 4BLTA 3ZOZA 3N2ZB 4EH1A 2FVXA 5JG7A 2D1RA 3SF8B 2JLCA 5D7BA 3EAFA 3IP3A 2LKCA 2YWBA 4H6WA 1BEUB 2P4UA 4GQAA 1BX3A 5DNDA 2Y3IA 3VC7A 5IYCG 1NW6A 4UTVA 2JFWA 4ZRDA 4EGCB 1KDPA 4XGQA 3CH4B 2PLWA 5K6AC 2YW2A 5GGYA 2ZR8A 4JR0A 1HNWB 2DLCX 3DHYA 3EXEB 4BO0A 3D6VA 5I4CA 2CWWA 3T5CA 3DDOA 4JLMA 1T8PA 2XVZA 3IVAA 3LRPA 2XUFA 4LHEA 3GLGA 4H4DA 5DGCA 4Z2AA 4YACA 4X1KA 4QQ8A 1KJIA 1PZMA 3UMSA 1O54A 1VPWA 4J4BA 1YJQA 4BKUA 1SXJE 1S89A 3THOA 5JSQA 5DFAA 1T9BA 1IN5A 1ATZA 4M9RA 1MOPA 5LQJA 3GY0A 5FQOA 1JQLB 3KUUA 5BR4A 4M86A 3WFJA 5K09A 3LX5A 3T95A 2PA3A 3NORA 1ZCJA 2BTEA 2YINC 4A82A 1ZK4A 4KO4S 3OTOH 2YHSA 3PUVA 3WYBA 1HYQA 4IIJB 1QF9A 4NV0A 3GGCA 1VE5A 4MIYA 2WWFA 2ODPA 4AF7A 1PT7A 5IMBA 1V1RB 2WE6A 2W83A 1A9OA 2G63A 1KYXA 1PJTA 4CM3A 3OEEA 3WR5A 4G4GA 1EHYA 2RHMA 4B5LA 1E6MA 4GLBA 2BI4A 4MEJA 4MW2A 3O4VA 3GJXB 1WW2A 5EPEA 1QQTA 1Z0KA 2QZJA 1IWBB 3GQBB 3ER8A 2VQFB 2DIKA 4FGRA 4XYLB 2W9CB 3DZCA 1EM8B 2I1LA 3KHHA 4DNPA 2QVXX 3EHDA 3ML1A 4H1HA 3FBGA 4GEGA 1MIOA 3P27A 4KWTA 4HD8A 2P9EA 3L7DA 1HURA 4DIOA 3B6EA 3SOZA 1N6HA 1ZIXA 1HEUA 3HDYA 3ELBA 4RGYA 3RTAA 1NXTA 4UAJA 4KRXA 3F1KA 1E1RD 3F73A 4IQFA 1P5RA 4IYJA 2R5NA 2QRZA 4DMKA 4G1VA 3L0IB 4UUGA 3GNSA 4DAOA 3YASA 3GJZA 3RWBA 1H3EA 1WPRA 2G4VA 3E9ZA 3F67A 1NNI1 4XUDA 2YQ4A 2HLDD 3FG9A 3HYRA 3L0SA 3CLUC 3NNSA 1R4AA 5D2CA 1E2KA 4K9PA 2QL6A 4TQUS 2PJUA 1QFXA 4ID9A 4OGGA 4MH0R 3PA6A 4NMWA 4E5SA 1NR1A 1VCMA 5CIWA 1MABB 4N0QA 2DERA 5IJ9A 3LWDA 1X2EA 4GC5A 3EFBA 3WTCA 5L9XA 1XZAA 2QPOA 1OXBB 3GJSA 2D0DA 1Z4LA 4BN5A 4ZK6A 2CNDA 4X24A 5AVOA 2WTEA 1O94C 3LCUA 2O0MA 2NXJA 3NHAA 1T10A 1RRGA 5JNVA 4RD6A 1YRQA 4HWRA 4EG6A 3RJ9A 1VXOA 4B46A 5AKXA 3IEVA 1MC4A 4R2JA 1YBFA 1A9QA 1Z0UA 4UTZA 2GZRA 2WF5A 1D2RA 2WJZB 3EEBA 1FCJA 3HXTA 4GP9A 3BQ9A 4X45A 2VYCA 3UTDA 3Q10A 4FYXA 1WZNA 2EYQA 2ATXA 5F76A 5AW3A 2IU3A 3FNEA 5LQKA 3MK31 3C41J 2M1ZA 4IW3B 2PX4A 2CF5A 4I1PA 3GH3A 5D5HA 4RJIA 4E3WA 1DEOA 4BX3A 3SR0A 2O8EA 3DW3X 1YR8A 4MWEA 4PN3A 1UIRA 3WGHA 5DHQA 4G0VA 1YS7A 5B5SA 4RESA 1QUEA 3H1AA 1T94A 2YYSA 4QZVA 2QZ4A 1U0NA 1M1XB 2WZBA 1KSHA 4EJSB 2UUCH 4OL9A 2BCGY 3DSRA 4WOPA 5JZBA 4KIWA 3ZVLA 4MOWA 1Z4IA 3VKGA 3AJRA 4J2OA 2AFIB 1KAHA 3IVRA 3PWTA 5D1HA 1I13A 4OFXA 3THWA 4Z4EA 2FE1A 3CGWA 3ZD9A 4JJIA 1M6WA 5FLYA 3QE0A 1U2TA 3F5FA 3OFSA 3QVGB 2VDNB 3CBGA 2G07A 2FRVA 1Q0LA 3FYHA 5K2MA 3FKJA 4BNIA 3P5SA 3GTJA 2MMCA 2I4NA 2JHAA 2CLDX 2Z04A 1H4QA 2HNKA 2XZTA 2PAFA 3QZ8A 4D8XA 4JIMA 1H5UA 3JQ8A 3NWOA 1IIRA 3LPNA 5C53B 1IBKB 3D43A 1HG1A 2O54A 1NQOA 4E12A 4WKCA 3N0RA 1ODTC 4O2BF 2I2XB 5DSZA 3VKVA 4G84A 2AQ8A 1UBJS 3TB4A 3UM9A 1Z36A 4BJ1A 1OXUA 5F5XA 4JYMA 4NHOA 2JAHA 8AT1A 3HYTA 4QIWA 2XDQA 1QMPA 4J6EA 4C0BA 4QDUA 2IELA 2EU8A 1FUYB 1II8A 2F67A 4ZRNA 1X80B 4N47A 1T2FA 2GCPA 2ZIVB 3ZWKA 1IEWA 1GKIA 4JU9A 2WYOA 1MVLA 4QW8A 3OOWA 4L2IB 4P4SA 5JW6A 4LJ4A 4O1IA 1H4SA 1P8JA 2PXAA 1QIGA 3HKDB 2IS6A 3SR3A 3GRYA 2ZJ6A 4JENA 3LQKA 1FDOA 3PHIA 4JMPA 4RF5A 3ROPA 4BVHA 2R5FA 4R16A 1K1EA 4INPA 3R9WA 2VAMA 1WPQA 1I10A 4NX2A 1FL9A 5I7RA 1HEYA 2BTOA 5BO5A 4C7BA 1NVKA 5BWUA 3JSLA 2BLNA 2R8ZA 1UBMS 2QAJA 3AEYA 4PLGA 4MVYA 1MUUA 1D9ZA 3AR5A 3REFA 5G4KB 1LH0A 4DJAA 1ZW1A 4DV3B 2MSEB 5ABPA 2GK6A 1QHSA 1G8JA 4AJKA 5JTUA 4B6SA 1ZA2A 5LXTA 2A5JA 1NYTA 4E32A 4YQZA 2DHCA 1CS4C 5CM8B 5DYGA 2CHUA 2H07A 5EFZA 3SDBA 1KWGA 3LTNC 3R3XA 3D3JA 5A9TA 3TQTA 1JJBA 3AG6A 1DLIA 2WU1A 5IUJC 2Q1YA 1I1QB 4J16A 1GAEO 4NCXA 3N2EA 3V2HA 1Z12A 4F9GA 4ZO4A 2DUJA 3TY5A 3T5AA 3A9CA 1NXQA 3Q5DA 4JT4A 4QLBA 4C3UA 3TUIC 1V8PA 1MO2A 1YZUA 4M1QA 1U8YA 1BXGB 5L45A 3J81k 3LWBA 2FQQA 4YRJA 3O8OA 3TZHA 1MTZA 3A1DA 5H83A 3Q9SA 1WAMA 1VMIA 1RXYA 4HQ6A 4P4TA 1HK7A 5KAMA 4ZCSA 3QHQA 4KQWA 4MGZR 2QTVA 2HGZA 3V7WA 4KGZA 5T14A 5LD2C 4XTCS 5DYIA 3R41A 3GFVA 5ALDA 1PZHA 2Y9MB 4NJMB 1XK6A 2XUOA 1QHIA 4NYMQ 5FJ8G 3GVXA 4NZPA 5DX1A 2GZMA 1Y6GA 2VDWA 2YMPA 2AXEA 1DJPA 4ZEVA 4BGUA 1T3SA 1JEYA 3T3PB 4XE5A 1OYVA 4CNQA 3QMPA 2WAYA 5K0SA 4TL9A 1O0BA 1EFVA 4B3BA 3VDXA 4DUYB 3ROMA 1WDKA 1Q0UA 3NJ4A 2WNSA 1Z5GA 3G2KA 3DE3X 5CVUA 1Z22A 4JUIA 4BDTA 3AP2A 1M54A 3ZG6A 1JXAA 3PNBA 1PJ3A 5GV7A 2IVZA 3U17A 1VJDA 4O3QA 3DLBA 3SKVA 2CKMA 4X44A 3QEAZ 2PRIA 4RUAA 1VPTA 2GBLC 1SUBA 2H7VA 2GXQA 1V2GA 4LNAA 4HN4B 4AD8A 1VMAA 1Y8CA 3IPAA 4M9QA 2HKIA 2LCIA 3UOGA 1AKUA 2MYTA 4P31A 2JFGA 4YAFA 3U7RA 1FMCA 4X63A 3M34A 1UC8A 4N8EA 1N5KA 3G59A 3ZIDA 3FKIA 3CC8A 2G25A 4A92A 3GLFE 4PYOA 4RKWA 5MF6A 1JYEA 3BIOA 2MTBA 2IIQA 3FMFA 1HKUA 1RAAA 5IP5A 3R74A 5K6TA 2C0PA 4O2AB 1RJFA 1POXA 2UUAB 1RQPA 5AW6A 1ZD8A 4HXYA 5JBIA 4MVJH 3KYCB 3FTPA 5KKAA 5A2QW 1UZNA 2ZJ0A 1ZUHA 4N18A 3IO5A 4QWWA 3DWGA 4IJWA 1NU8A 2WFZA 3L7BA 2CHEA 3FCAA 2BR0A 3BT7A 4FT2A 3PC4A 3BABA 2UVPB 2FR1A 3ZXYA 4LF7H 2D54A 4RCZA 5JZ9A 3ZWDA 3SM9A 1QH0A 2AG8A 4OOEA 4M83A 4OHKA 3QOFA 5F7ZA 5GONB 5BN1A 1G60A 4MZDA 4TS9A 4LKOA 2CMDA 1T25A 1PV4A 3REQB 2D4HA 4OVKA 4TKZA 2YZNA 3A11A 4FLMA 3RB0A 4YBZA 3BA1A 2X9QA 2GRJA 2C4NA 3G2NA 5JYCA 3H2KA 4URVR 2NTEA 1FNMA 3A70A 3WIUA 4CCAA 3LQYA 3PQ4A 1JIVA 2UYCA 3JAMW 1MC8A 1DXYA 3QFHA 3IL2A 1LF5A 1E7SA 1CUVA 4RQBA 3SU8A 4A0SA 1DTWA 5J4HA 4AW9A 4B2PA 2WMDA 5DULA 1QK3A 1NDUA 4CV1A 4A6XA 1Y7TA 1QG0A 5JJ5A 5EVJA 2JA8G 4J3JA 2QLBA 3GUCA 3P2OA 4JLKA 3V6HA 3MFIA 4DSUA 3TLYA 1BH2A 1CUDA 4O63O 2FKLA 3QG1A 1FW8A 4QU5A 5BSHA 3FYDA 2P75A 4YAWA 5JHGB 5DSXA 1WSBA 2R751 4W5JA 4DYHA 1L5RA 1U2PA 3NDBB 2PKCA 5TPZA 1T8WA 4YAGA 4MDFA 2H08A 2CVPA 3DOCA 3ANXA 4INZA 1J09A 1QXSA 2RGEA 1KYIA 1P2SA 4EAAA 3U44A 3DXFA 3H1BA 3OM1A 2RJ3A 3DJYA 2CD7A 3A4NA 2NUPB 4P5PA 1DAKA 5EFOA 3Q41A 2HHFA 4PLCA 2IYXA 4M1KA 1B1AA 4B85A 4YMUA 3MGKA 5EUCA 4G09A 4KLNA 5E9AA 4GT1A 2Q5OA 3PTLA 1F12A 1LJUA 3NUQA 5JS8A 5IDXA 3I2FA 4YREA 2EIHA 1J0DA 4NE7A 2IHYA 4EECA 1TC2A 3IQWA 4CMHA 4OK5A 2XI4A 1XTPA 3UV3A 4YUXA 4DEXA 2FPUA 3MMZA 5SZIA 2IP4A 3KAQA 3SYTA 5AKHA 1N0UA 5G53C 4H1UA 4L22A 1PNOA 4YJGA 1S3IA 4C6SA 3PUXA 3P97A 4W5WA 1GZ4A 2D7JA 2OXCA 4HB2A 4TLCA 2EF0A 1NE7A 2BUBA 1D1TA 3CF2A 4KPGA 3AEQA 2Q1SA 1B93A 1H8EA 4JQYA 1SR8A 1LDNA 4Y8VB 5KO2A 1KY4A 4JL8A 4ZMBA 3H4VA 3BCSA 4UTPA 4B4OA 1X0XA 4YS6A 3GARA 1OY1A 2ZUEA 4HWPA 4FFOA 4EPYA 3SDSA 3TDKA 2RIPA 4O4HA 1MV8A 3QEBZ 3MS4A 4RLHA 5FEUA 4UE2A 1VYTA 4NPCA 2RHHA 4UQLA 4MGIR 4D3YA 3D1JA 1DXQA 1P29A 4XVCA 2JASA 5AYVA 1YZKA 4L07A 1OFTA 4BNWA 3TLMA 3BX1A 5TSDA 3VX3A 4B0PA 3VKWA 4F2WA 4A23A 1JLLB 3SSAA 3U4HA 2R8BA 4FBLA 1E2QA 1XOIA 1AZLA 3INNA 2F43A 3U4AA 1WMBA 2PMFA 2WM3A 5IVDA 3OTWA 2YRWA 3OO0A 2REQB 1NBWB 2JD1A 4PAQA 1HNNA 1QKKA 2B94A 1OZFA 4R1NA 1EXNA 3UOAB 1VSTA 4QAQA 3VOBA 2QRVB 1BJTA 4GC6A 2WJYA 3MMNA 4Q9NA 2NP7A 4MV3A 3HKEB 3WRYA 4YCAA 1Y34E 2Q9UA 2OO3A 4HYYA 4RVNA 4U7JA 1NC3A 3UH1A 4D3XA 4ESOA 5C5CA 1NI3A 4J9UE 1G0NA 4BTLA 5B7QA 1JHQA 1YVUA 1HR0H 2YRFA 4ZDJA 3S28A 3EUEA 1RYRA 4A6DA 5FP0A 1SXJA 2W4IA 3RRZA 1XNJA 3KLOA 5DN9A 1RM5A 3BERA 3OKAA 3V2IA 4JC0A 1T91A 2A1UA 4BP1A 3JZIA 2VWHA 1P5JA 3RTCA 3JQRA 1SHTX 1BU8A 4L8YA 4CT5A 3KQYA 1OH7A 2PGLA 5AM0A 2GPTA 1UXJA 4DR2H 3HSSA 2Q2QA 2YUTA 4ZANA 4CMEA 4CUZA 4EW3A 4XYGA 3DE2X 5EOVA 3SHQA 3OJEA 3HKBA 4X93A 4DUPA 1KZ9A 1NC1A 1ZK3A 1V8ZA 2R96A 4OI4A 2GS9A 3H5AA 2R62A 3SMQA 4PZUA 2AOVA 2Y92A 1VL2A 1EKVA 1E5XA 4LG1A 4F96A 1OV6A 2P0YA 3WP1B 1XHEA 1K3FA 3M5PA 1M5TA 4NICA 1K63A 1ZESA 3RO7A 2DFNA 4KFSA 4CEHB 4TYNA 3K6SB 1RAEA 1KE2A 4JGGA 1OFUA 1MMFB 3DNFA 4F3RA 3OH8A 2AK2A 3RVBA 5CB6A 4OYHA 3ITEA 3QWAA 4I5IA 4RTKA 2O2XA 4J1NA 1RM3A 1U5AA 3V7FA 2YCHA 3EOZA 2TMDA 1SURA 1JI3A 1FNNA 4QPCA 3ZHQA 1AKNA 4B76A 4UTOA 1MT3A 3DTYA 3GEMA 2QI9C 3PVCA 1SCIA 3MJDA 4CF4A 6ADHA 3DXXA 3GLRA 1NRWA 4BECA 2G5GX 4B3SH 2E82A 3SJZA 1RXSA 1TX4B 1V16B 5CX1B 4PO3X 2HU8A 2ZJBA 1G5IA 1TIBA 1J6UA 1P6QA 1Z83A 4QRIA 3M33A 2OORC 4DUZB 2FSVC 4INJA 3T4XA 3BWMA 3P9QA 4E2FA 3ONWA 2YXEA 4M9SA 5CFNA 4F2PA 2VXBA 4TXJA 2GWRA 1ECFA 2YJ4A 4KDRA 5CT9A 4L72A 1QH8B 1CUFA 2IIBA 4KXQA 1YSCA 4TT3A 4DCTA 1FJXA 4DV5B 3GDEA 3IE1A 1JR3D 3ASUA 1PZGA 3SIPA 1E7MA 1R0YA 3STHA 1S5PA 4DCGA 2AF3C 2V8BA 1IVYA 4O86A 2GJKA 5CNIA 2XA2A 4G9BA 4H0CA 2PTHA 3G8AA 2EGGA 4B71A 1GYFA 3L2PA 3QA9A 3GA0A 4XFJA 2NQTA 2Z30A 1XDSA 4L4YA 2I78A 4YJ3B 3BD6A 4OHMA 3USES 4HBGA 3GEGA 4N01A 4EHHA 3KQHA 3IO3A 3LNCA 4HRYA 5DBOA 4DSOA 4Z3OA 2PZKA 5KI6A 3DM9B 5IH3A 1A5ZA 3WB2A 3WVNA 4TXLA 4HPXB 5AI6A 1TJ4A 4W63A 2P30A 2C2KA 3MD0A 4IR9A 3F97A 2G08A 1VM6A 4IDBA 2FN9A 4F4WA 4MWOA 4ND6A 1GQYA 2JKVA 3OCJA 3G2LA 1MRNA 4MV1A 2W6MA 3CX3A 4U7TB 4MDEA 5CFQA 3IV7A 4NC9A 3VR3A 4EABA 4A5OA 1DL5A 2DHEA 1GRNA 2VUTA 5BYBA 1U2DC 4AUMA 2PVSA 1JWAB 2Z43A 1XHFA 4B8ZA 3PF9A 4QC2A 3EPPA 1LPSA 3V4ZA 3KSUA 3KZXA 1N3BA 1JMVA 5KUTA 4A1FA 2FUG1 2WB1A 1PLJA 1E9RA 2BVNA 3VC1A 1CY6A 2ZIAA 4DLBA 1FTYA 4PQEA 1EVJA 3T15A 1K7EB 2VAWA 1J8VA 2BT4A 1UANA 4B75A 5JAQA 4ZEMA 1SBIA 3H99A 2P1DA 2HA3A 1GXSB 5BSFA 4LISA 3DP7A 4NBSA 2J4CA 1G21A 5FKJA 1W29A 2R6AA 4JLSA 4RIIA 4XWYA 2GEBA 1U0BB 1OT5A 4OJTA 5FOVA 2PO7A 1NXWA 4M1SA 3HNOA 3TZKA 3M49A 2EP7A 2P3SA 2E1RA 1S9HA 3AR7A 1I0IA 5CB0A 3GHHA 1UINA 3SSOA 4XAQA 1RNLA 4AY6A 3N43B 1QFZA 1U63A 5IYZA 5FL7A 1CKMA 4IO0A 3QX9A 3BD9A 3ILSA 2JGAA 3CGGA 4C0HA 4XD7A 1B14A 2VKTA 4I0WB 3PL5A 4LQCA 2HU7A 1WTAA 2QUZA 4MRMB 3NOXA 1AIPA 3M5CA 4WFIA 3FPGA 2QG4A 4ZAFA 1R4MB 1UJ6A 3CZ5A 3FUWA 3UGJA 3IURA 4O4JB 2X5XA 1AHPA 1VP3A 4PICA 3DV0B 1J0BA 5DLYA 5DAAA 1Y8ZA 4UXIA 2IPOA 1OWOA 4NBKA 5BSRA 3N74A 3L06A 2AJDA 3ZHOA 1YBAA 1RPZA 4P54A 2A9QA 1RW4A 1NJ1A 4HLUC 3A58B 3GIDA 2KSWA 5G4LA 3OMWA 4NOLA 3IV9A 5AVWA 1CJSA 1SEIA 4Y2XA 3GTLA 3CSUA 3F7MA 1D2EA 1QZUA 4MR8A 1U8XX 4ZYXA 2N0SA 1J70A 4NE2A 5LLTA 1AKRA 3RTEA 4B3TH 3FVVA 4H60A 3VU9B 2PMCA 2FLNA 1PG5A 2G0NA 2LTAA 1W75A 3KOMA 3O8CA 1FJ2A 3PFBA 4N7JA 2E4AA 5SY6A 2JFZA 5LC1A 2XBUA 4K2HA 1TEXA 1PZXA 1U3GA 1CKEA 1JLRA 1E0AA 3MGBA 4YCJA 2VYNA 1U1CA 4ARUA 4C20A 1HKHA 4D79A 1JKJA 3A7EA 4LJ6A 3U6KA 3FPJA 3DEZA 2L17A 5FBWB 5I9LA 4L3OA 4A0HA 5KHLB 2J9XB 3QFRA 3U7JA 3GV0A 4W5NA 2AI2A 4YJHA 3GX1A 1YKFA 4JV5B 1RJDA 1YTUA 3LHKA 1E98A 5FNZA 3Q8KA 3JYOA 3O2SB 1PR1A 3GIJA 4UTNA 5U4QA 1FLDA 1JX4A 3O75A 4WXEA 3BOSA 2ZJ5A 1Q0ZA 5HUHA 2JFNA 4J0QA 3VNBA 4XPZA 3GB8B 3W3ZB 2BZGA 3H4DA 3I6IA 1A5BB 1JAXA 2W6NA 4C89A 3EXFB 6REQB 5CDSA 2PRSA 4DR5B 1XC7A 1KERA 2XADA 5CEFA 2PX3A 1RJ9B 4RJKA 1K92A 3WY9A 2BF4A 4M7WA 5ARDA 1QYVA 2R3SA 2BZ0A 3LW7A 4KO3S 3IP5A 1H2RS 2ZUSA 4UW9A 3E1SA 2W71A 2MMGA 1TDJA 2ZSJA 5ENZA 1JL3A 1M6YA 1XI2A 4C0KA 1F2TA 1FFDA 3OTQA 5B7NA 1WHTA 2R2GA 4MSUA 1VL1A 4DR3H 5SICE 1T4MA 1PVVA 3U1TA 1F48A 1IN6A 3KVNA 1W88B 3KSDO 5DSTA 3DUFA 5BPFA 5F64A 2BFAA 2HPHA 3DPSA 5FA8A 1NVGA 4L8WB 3CKKA 3ICPA 3CO5A 1S2LA 4BY1G 4PR0A 5F5LA 4YCSA 1BE1A 3ZKWB 3CR8A 4Z4FA 5I7WA 1GVHA 2OZLA 2J7PD 2QRJA 1E7RA 5I5XA 1LDBA 3BTUA 2HB6A 4F84A 4Y9DA 3DPUA 4O7VA 3E23A 1OQAA 3E3NA 3GYBA 4EELA 5FO0A 4O6VA 4ZQGA 3GT4A 4J0GA 1C50A 2PBLA 4BN4A 1KYTA 2QYSA 3BGOS 4E31A 1K6MA 1RC8A 1W8IA 1FB5A 1OW3B 5A3SA 1NXVA 2ZPUA 5K3EA 2QM8A 4WN9B 1QC5B 4JUCA 4IHJF 3UZUA 3OM8A 4BQSA 3PD1A 4FFWA 4DARA 4MO2A 3C2QA 5IAEA 3WDMA 2YFKA 2P27A 1AK9A 3NRBA 3VO2A 1FYDA 3KZNA 3AU8A 4BATA 2BEWA 3DWIA 2JBAA 4MQMA 1V3TA 1FQKA 3TAHA 3H3FA 5H59A 4FEEA 4I5EA 2X5NA 3F46A 3UK2A 1XD8A 1YI1A 2ZITA 1YRWA 4N5HX 2WFLA 3PXUA 2XCRB 1IBCA 1QIEA 3K4QA 2O6HA 4LDJA 3HLYA 1L2ZA 3GTMA 1XEFA 1NZFA 4D9MA 4L0DA 1GTRA 3F7TA 3ZHZA 2E1PA 1KFKB 3WL5A 2QUAA 3FHLA 3KKMA 3T5TA 1ZJJA 2XR1A 1U31A 3EEYA 1OBOA 3STXA 4MQFB 1GTVA 1ZGGA 1ZHHA 7YASA 4M1YA 4X3CA 4BKPA 3ITNA 3SSNA 2XT9A 3ZWMA 1P0IA 3TPFA 1MXHA 2ANBA 4ZCRA 2QJFA 4ERNA 3PICA 3PXEA 3JZAA 2XNDD 1AHHA 4LOIA 1GU1A 2WPDA 4GL2A 1H2HA 5BPHA 4WFKA 3HJCA 3U7FB 1MQ9A 2OMEA 2Q5FA 3IFSA 3T54A 1W5SA 5FB3A 5E95A 8ADHA 4A3GG 3M1AA 4JSYA 4URZR 3OQ6A 1D1SA 4FFLA 5FBVB 2VT7A 4TMVA 2PBZA 5JRZA 3ESQA 3LF2A 5ELLA 4FI3C 4IOMA 2JIQA 3RIZA 4QDKA 1QIKA