5D8DA

Crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
303
structure length
282
Chain Sequence
SNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDRAFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLDSVIAELGLPVIIKPVHEGSVGMSKVEKAEDFAAAIEKATQHDAVVMAEKWITGREFTISFLNGQPLPVIRLQYGIPCGLSETEEKKLQALCLRAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAAKAVGYSFDELCVAILEQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
publication title The crystal structure of the D-alanine-D-alanine ligase from Acinetobacter baumannii suggests a flexible conformational change in the central domain before nucleotide binding
pubmed doi rcsb
source organism Acinetobacter baumannii acicu
total genus 83
structure length 282
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5d8dA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5d8dA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5d8dA01
5BPHA 3QFFA 2VHEA 2NU6B 4ZI7F 1OBDA 3RV4A 5H80A 5C1PA 5JVDF 4HR7A 3GIDA 2V58A 1KJ9A 3G8DA 3I12A 3TIIA 4MA5A 4FE2A 4ZOLF 2CNQA 1UC8A 4DIMA 4O84A 1B6SA 4XYLB 3JZFA 5K2MA 3ORQA 2R84A 4O4JF 4FFOA 4RZQA 1UC9A 2PN1A 3KREA 5D8DA 1BNCA 5LXTF 2R7NA 2YW2A 3VMMA 4IIJF 3OUZA 2WYOA 2W6QA 5IYZF 3BSSA 4YAJB 1CE8A 4O7TA 3Q2OA 1OBGA 3U54A 1AUVA 2YZNA 4O7VA 1A48A 4O2BF 1ULZA 1VBHA 4EABA 3R5XA 4ZQIA 1I7LA 2W70A 4O7ZA 2XCLA 2J9GA 1KJJA 5LOVF 4O86A 2NPOA 3TIGA 3JRXA 1KBLA 1CS0A 5LP6F 1SCUB 1PX2A 3VA7A 2HJWA 4ME6A 5C8YF 1BXRA 4GGMX 1E4EB 4XYMB 5CB4F 2GQRA 2ZDHA 1T36A 5KX5F 4XZ3B 4NYEA 5J2TF 4C5CA 2X0SA 4YAKB 1GLVA 5KKNB 4MAMA 4M99A 2YS6A 4HNUA 4J6EA 4HQ6A 1KJIA 2CNVA 3HB9A 1JDBB 2W6NA 4XX0B 4MV3A 2GPWA 3V4SA 2R82A 4YJ2F 1JLLB 4IWXA 2FPGB 2FP4B 4I50F 2YZLA 2YRXA 5LYJF 4I55F 3KAKA 1DV2A 3R23A 2HGSA 3BG5A 5CA0F 3TINA 4WBNF 3DF7A 2W6MA 3K5HA 2YYAA 4IHJF 2Z02A 2R6FA 3ETHA 5FNVF 2SCUB 5BMVF 4EGQA 2CQYA 2I80A 4MV6A 4O4IF 1KC7A 4EA7A 3R9RA 4MA0A 1IOWA 3GLKA 1DIKA 2R7MA 4EA8A 1AUXA 4M98A 2GPSA 3NUAA 4EG0A 4MV4A 1CQJB 5JQGF 2FPIB 2PBZA 1I7NA 1VKZA 5I47A 3LP8A 2I8CA 2R87A 3LWBA 1Z2PX 1DV1A 2NU8B 3K5IA 4EA9A 3ETJA 4O7LA 1GSAA 2DLNA 4O81A 4DLKA 3E5NA 4HNTA 2YRWA 2W71A 5CAEB 4MV8A 4TV9F 4IWYA 2I87A 2VR1A 4L1KA 2ZDGA 3KALA 4O7WA 2YWVA 3K3PA 4MV7A 3MWEA 1EHIA 2R7LA 1E4EA 1EUDB 2R85A 3AW8A 2W6OA 4EGJA 4FFMA 2P0AA 5LA6F 4FFLA 3UFXB 3HO8A 1A9XA 5DMXA 3WO0A 2DIKA 2W6PA 3N6RA 3RFCA 2IP4A 3HBLA 3KAJA 2NU7B 1JKJB 4O7YA 3VPDA 3OUUA 1WR2A 2R86A 4O7RA 2C00A 2VQDA 3G8CA 2GLTA 4FU0A 3TQTA 1CQIB 3MJFA 1KUTA 3RUPA 3VPCA 1GSHA 2R7KA 4MV9A 4YB8B 4ZHQF 4O2AF 3U9TA 5JH7F 1GSOA 3AX6A 3WNZA 3Q1KA 2PVPA 1PK8A 3WO1A 3MWDA 1C3OA 4O4HF 3BSYA 1B6RA 3N8DA 3VPBA 1Z2NX 4HNVA 2NUAB 4YJ3F 4O83A 3SE7A 5BPFA 4FGRA 1JDEA 2FPPB 4Y8VB 3JRWA 2FB9A 3U55A 2CNUA 3TW6A 3VOTA 4M9UA 5CA1F 3JZIA 2QK4A 4WD3A 1EZ1A 4FFRA 2ZDQA 4TV8F 4I4TF 5EZYF 2V59A 2W6ZA 4EAAA 1GGOA 1KJQA 4M9CA 4O7NA 5J2UF 3BFPA 2DWCA 5HV6A 5JQWA 2YS7A 5HBRB 4O7SA 3U9SA 4E4TA 1W93A 2GQSA 4C5AA 3R5HA 5JVLA 2QF7A 1VBGA 2Z04A 2NU9B 2CZGA 2V5AA 1Z2OX 2YZGA 1M0TA 4QSHA 4FFNA 2YZMA 1W96A 1EYZA 2DZDA 1C30A 1IOVA 3BSWA 3V4ZA 4O82A 4MV1A 3RV3A 4IZOA 5C1OA 3R5FA 2VPQA 3ORRA 1M0WA 1KEEA 4YBZB 4C5BA 2XD4A 1KJ8A 2OLSA 1EUCB 1M6VA 4O4LF 5GONF 2YL2A 4TUYF 4FFPA
chains in the Genus database with same CATH superfamily
3L7IA 1J21A 2E4WA 3GJZA 1E3LA 1GNSA 3KSMA 2QX7A 3DL4A 1A7UA 2QAGB 1MJHA 1IC6A 4L72A 2RK4A 4BNIA 1N5DA 2FDXA 3AB7A 1A04A 2OORA 3ZWWA 2Q6VA 3ZK8A 4BRWA 2B5WA 4ZIRB 1W9HA 1IBCA 4W99A 1QVAA 3SSAA 3L8YA 4PYJA 3E82A 5LNK1 3EZNA 1ML4A 1X1RA 3FF4A 3T9BA 4GSYA 4PGGA 1TQ4A 4HN4B 3U7JA 3FFWA 5I5UA 2Q6TA 2YZ2A 1KAHA 4F4UA 4P7JA 1HDGO 3U13A 2FPIA 3WTBA 3LDAA 3DTNA 2C7BA 1LUAA 4QXRA 3SK0A 5KPJA 1LK5A 1IUPA 2R8HA 1T6BY 2ZBVA 3T1OA 2VUHB 2FQQA 4J4BA 3L4KA 4P9NA 1E6CA 4RVCA 3D3NA 4JP8A 4D8TA 2WDZA 2QRVA 4NYEA 2YY7A 3SXUA 2BBSA 4KN5A 4TM7A 2H2AA 4YJKA 5E2AA 4J6EA 4V39A 1SY7A 5E6RB 2QPLA 1KRXA 1KJIA 4WASA 2OCXA 2VUSA 4B0PA 2O1XA 4C4YA 2VT6A 1KF0A 4EKYA 1ORDA 1EFHA 1XVTA 5JYBA 2WWXA 1JG3A 1YB1A 1ODSA 1JAXA 3CRZA 3EF3A 3O9VA 4ZI3A 3ZHBA 2C4KA 2X7JA 2KJQA 4XA8A 4FYVA 3RB4A 4NSNA 5FJJA 1QHIA 1W2WB 2WABA 1P31A 5U4XA 1AZSC 3GT4A 2VP3A 1JHYA 4H7PA 3RTXA 3D7MA 2BFEB 2K87A 3CVZA 2IY9A 3KXPA 3GPIA 3F8TA 3SXJA 2WV7A 5K6TA 4XRGA 2DKOA 4MUYA 2G4VA 2A9KA 1L3CA 2FPIB 3S2YA 4JGBA 2Q4RA 2AF3C 1I3NA 2AA3A 4HDMB 4NDNE 4CV0A 2O03A 3K9LA 2XMZA 3VISA 2JC3A 4NZMA 3GU3A 2DT5A 4JI7B 3UWOA 2YWBA 2CLOB 3NVKI 4O81A 2HV8A 2ATVA 3TR6A 4BLUA 3G9TA 2R8BA 3SI8A 2OC9A 1VDZA 1K4KA 1RBYA 3C3JA 4NEHB 2C5HA 3SU8A 3AXTA 5CM0A 4EHDA 1K75A 1VCIA 1XJ5A 3W90A 4ZK6A 1KI7A 3VJMA 3CCCA 3KTFA 1IUOA 4DCUA 2I54A 2DX7A 5G4KB 4XI9A 3KSDO 1RHRA 3E9MA 3G17A 3LPAA 3LU1A 2UZ0A 4PYKA 3K5WA 1DXHA 2QPTA 2EFEB 5INTA 5JXGA 3ZVNA 1T9BA 4Q8FA 3OPVA 4ARBA 4NFYA 3W79A 1T2VA 2E2WA 2QE6A 8AT1A 1MXFA 4B2YA 1M2OA 2CNBA 3LUPA 2OH2A 5JH7F 5JHHB 3ASZA 1NVEA 2QR5A 5IKEA 1A9YA 1IN8A 2IVFA 3M9WA 2C2KA 5G53C 3WJ1A 3H97A 2HL6A 4V0NA 3V8BA 3U3OA 4R83A 3OOYA 3N74A 4PV7A 3KZ1E 4LZAA 1FDTA 2JFBA 2Q3LA 2GXAA 3ZVRA 2WJWA 1FMJA 2R8ZA 3ZD8A 4KQEA 1YIAA 5DNVA 3LFHA 1JA0A 4PTLA 5HW0A 3BQ9A 2GBFA 2YFKA 4BFYA 4F4DA 4YMGA 5ESWA 3SMVA 4C0QC 3GJXC 1HG1A 3HUDA 2OXIA 2PYDA 1Y8RB 4GX5A 3RFVA 2PVCA 3LBAA 3M9LA 3E05A 5AUPB 3IPXA 5C0OE 2PANA 1C4OA 3V46A 4ILEA 2YV4A 2H9IA 3INGA 2ZITA 4LS3A 4RQAA 3P0RA 1KS9A 4O82A 3SIWA 2OWEA 3WLHA 3NBXX 3CNHA 4FYYA 1QHGA 3OI7A 2GGSA 5LB2A 5CH5A 2HWXA 1FP7A 1NBME 3DPSA 4G0ZA 4DL4A 2QAGC 5C5DA 1M2OB 3PDIB 2WTBA 1SG6A 2D1TA 3NTOA 3G82C 5IN4A 4MW1A 3KOUA 2CMKA 4TRJA 1KNQA 5DVZA 2D2FA 2IBSA 2DT8A 2UZ1B 3FBGA 3V7YA 1E2DA 4AROA 1XTBA 3IVGA 3TNYA 1XZBA 3FVTA 3AVYA 2X5OA 1E59A 2ZRQA 2O3SA 3OCYA 1PSWA 2PJUA 4LF5B 1GCAA 4BEWA 3FLEA 1ZSYA 2V9ZA 3GJ4A 1OB5A 4RV5A 1RNLA 4RADA 1AS3A 4B6GA 1DJOA 4CGYA 2GZAA 4MUFA 3A9TA 2CVOA 3IELA 1B4DA 1CY1A 4KUGA 3O8NA 4LJ9A 4HAXA 3TRDA 4WNYA 5IAKA 4WJKB 3GMDA 4HGNA 2CZCA 2O5CA 4RK5A 3G0CA 4DSUA 2GN4A 3PUIA 4W1PA 1UIMA 1JI0A 3S81A 2O2SA 2NM0A 4L7QA 1T1GA 1BRMA 2H1IA 1N75A 5ANRB 1R6XA 3VUFA 3CHYA 1QZXA 5HIMA 1MVNA 5G40A 4N40A 1C4WA 1QYRA 4XARA 9GPBA 2TMDA 2OORC 1DVRA 1VE7A 1JHMA 3SNKA 3GEBA 3GJSA 3BXXA 3ICCA 2WG0A 2FLVA 3LBIA 421PA 1VBFA 3FDJA 3GOQA 2R7ZA 1S3FA 2PUHA 4DCNA 4ISCA 5I8ZA 4M1MA 4LVCA 1OX5A 1XRRA 3QPUA 3DVSX 5K0GA 4NCHA 5GIOE 2WU3A 5I4IA 1Z15A 4K9NA 2JA6G 3WKCA 1SYXB 5F7JA 4EG8A 5BMOA 3CS3A 1ORHA 3Q7PA 4Z99A 4TVSA 4TV8A 1WCWA 3BIWA 4DEXA 1GZDA 3PNOA 4P2BA 3WP0A 3QUBA 3X1YA 1YB7A 4S1TA 4HNTA 1AO3A 3SZOA 4US2R 2W5UA 3RYIA 1YS7A 3NRJA 2O8FA 4TWAA 3CRW1 1TU0A 1L8XA 1H3FA 4KODA 4KPGA 2QLFA 1L5RA 1HL7A 5CB0A 1AQ6A 6AT1A 5IW8A 1L5LA 1PWXA 4L7VA 2FFRA 1I5EA 3TLGA 1K08A 2J3MA 4J07A 5AUOB 1RYHA 2VHCA 2XUKA 5LQUA 3OKPA 4PZAA 3GGCA 4A3IG 4PCUA 1U1IA 2ZWVA 4HNSA 4TTIA 2C98A 3U0VA 4MGYR 1ZPDA 2PYZA 2A5FA 3ICWA 3W6NA 4JHXA 4FB4A 2J6CA 4WNIA 4ZU6X 2QXUA 1WOMA 4BUZA 4XGIA 3GNLA 3CCFA 4B73A 1EUZA 1VE9A 2ZIUB 3E1SA 3TS1A 1I9GA 4OBWA 2P5SA 3QWAA 2CWWA 3KWLA 4MWDA 3GMIA 3DZFA 1MOZA 4TV8B 3HCOA 3AB3A 1KY4A 1PR2A 3K8OE 4BWFB 3MF4A 4FUQA 4LJSA 2PTGA 4HWKA 4ZVNA 3EZGA 4JAVC 1BEEA 2DWCA 3H2SA 2O8FB 4P22A 4W6QA 3E8MA 3LQYA 2BM9A 2BOVA 4EFEA 2PMDA 2XKBA 1BWRA 1UWKA 4O8ZA 1P1BA 3CGGA 1Z22A 2WIAA 2R97A 2G63A 1Q2XA 2O7SA 3V80A 3OVMA 4FYPA 2MHCA 1CB7A 4JJIA 2RC6A 3G88A 3ET5A 3Q9UA 4PC3A 5EIHA 3EDQA 4M1TA 1ULHA 1SEVA 4IFEA 2FZCA 5LMCA 2AFHB 3DZCA 5JW6A 2ZTHA 1OFVA 1GTVA 4BNJA 4JVNA 2YJGA 3A31A 1XOIA 4D5GA 1OWMA 1E61A 3OJLA 4KQCA 5TMEA 3MGKA 3SVTA 3HBFA 2IBTA 1XROA 5FQNA 1ZXXA 3IUJA 4F7DA 3FHCB 1T2AA 4U2DA 5L6MB 1YZNA 2YR0A 1KHTA 3H5AA 1J09A 4CV2A 4LWOA 1DPGA 5DSXA 3GGDA 1Z74A 1X1EA 1A48A 4KQ1A 5EXEA 5BWLA 1UP7A 2C3YA 4NU8X 1B6GA 1RD4A 3QNUA 4L8WB 5A05A 1TAGA 3ICPA 1RVDA 1X3SA 1XU4A 3RC8A 1SZJG 2OR3A 3SGLA 2PKQP 4MW0A 3RUEA 4E13A 4AN4A 1KZ1A 2D0OB 1N57A 1T9DA 2B69A 4GLOA 3IMCA 1RC8A 4ZJYA 1DAGA 2XMSA 3ESZA 4YAKB 4M37A 5KNLA 5D6OA 1ZK2A 3L02A 3CMCO 3PQCA 4RMNA 5NULA 1XRMA 2J3EA 1FXUA 4MEJA 2VT7A 1D04A 2X13A 4Z9XA 1AX9A 3G6KA 2YZKA 2BUBA 4DYHA 2QSUA 5CT6A 1G8AA 1ZGAA 4ZCQA 2MOKA 3Q9SA 3AG5A 4KE8A 1UZLA 3LZCA 2V98A 3CFYA 2CNKA 4EUNA 1IBMB 4P4TA 1GL3A 3O8OB 4AP6A 3IVRA 2BSAA 3PTLA 3OWOA 3AKEA 2V7TA 3T5LA 4NPCA 1RAAA 3VSEA 1V4BA 2XGPA 2AGPA 1B93A 3UK7A 2YJ3A 5HP4A 4HWGA 5TPWB 2PGIA 2H4JA 4ECVA 4FP9A 4YMTA 2WKPA 5JY6A 3HVJA 3O21A 4O2BA 1TCBA 1EQAA 1LW7A 4KOAA 4OGFA 3TRHA 4UAJA 1W5EA 5DGXA 1ADBA 3P9RA 3T41A 1QQAA 3SD7A 3UJ9A 2PFSA 1JJIA 3AILA 3QU9A 2POQX 4R7TA 1VG8A 3ZLTA 4DQUA 1EPUA 1XN1A 2EEZA 4JT2A 3PE3A 4R0NA 4WGFA 2OMEA 4APMA 2PKQO 4A26A 3F5MA 2IC5A 3W4JA 3U7GA 1JLKA 1Y9DA 5B1DA 1ULUA 1P60A 3F73A 4IR1A 1A72A 4LRUA 2A2ZA 1V3UA 1CJMA 3D2BA 4BAZA 4IDBA 3DEHA 5COQA 3KXLA 3UN1A 1X8LA 7GPBA 2DWOA 4UMDA 3V33A 3ZVMA 2LXNA 1XC7A 1P72A 2NU6A 1YI0A 3BMOA 4ZP1A 3K31A 3D6TB 4YRZA 4E5YA 4BNGA 3MT0A 4NBRA 3Q8SB 1KAOA 1CP3A 4JI8H 3CNBA 2WTEA 4CIXA 2PZAA 1W2HA 3A25A 2WTXA 3X1ZA 2WA1A 3TE7A 2O54A 3U55A 4IDPA 3NP9A 2RH4A 3AVPA 1NR1A 3PWTA 3Q7IA 1LRLA 3KZVA 3SYKA 3P9SA 1GCOA 1C1HA 1OBFO 5D1HA 1C3EA 2B1RA 1P61B 2PJZA 2C2XA 4LJ6A 1FYXA 3PCRB 4A3CG 1E96A 4ALIA 1ADFA 5M7EA 4MRPA 2FN4A 4QBIA 3R09A 5FLMG 1HTBA 3TQCA 5J2TA 3FLBA 3ADDA 3Q0TA 4HH4A 3EIFA 4PX9A 5KFQA 1XE3A 1CR0A 3H6HA 5CLJA 4UQLA 3PDHA 2VOJA 4ZQBA 2OAGA 2IMWP 4JI1B 5KTNA 2C61A 4ECWA 2WIFA 1OFHA 2BDTA 2EYUA 5AI6A 1V11A 3KEQA 3A8TA 3QXSA 1RWBA 5JMPA 2COGA 2DLCX 2NU6B 4LNUA 1VIDA 4K86A 4Q6BA 4G84A 4OQZA 4R69A 3GEGA 5M2QA 3UJ7A 5DE3A 3JZ6A 5JAIA 1NNUA 2FMUA 2FRVA 4QJFA 2WWWA 3SHWA 2IXGA 1K92A 4FDUA 3CKYA 1QYDA 5C51B 4P32A 2JJQA 2ZRNA 4CQNA 1PWZA 1YXMA 4QLAA 1L4LA 3IPYA 3F90A 3UH0A 2QTHA 4TKVA 5CA1A 2JAHA 4O1HA 3LS2A 1RP1A 4YWHA 1Q0RA 3RAQA 3H1GA 3B6KA 1WKVA 4BMDA 5DOZA 2RI6A 5FP0A 3MBIA 2FN9A 3MYYA 5J2UA 4PO3X 1QDEA 2ADOA 5J2TB 3EXEA 1GUZA 5CAEA 3CJRA 2PUEA 2OZVA 4YY3B 2AUNA 4BV2A 1DBRA 5EQFA 5B7GA 4J0HA 4D7AA 4MVJH 4LE1A 2I9PA 3ND9A 4F4ZA 2CYBA 2G9VA 2B36A 2IWHA 2YTZA 3RIHA 4AICA 4BMVA 2VTKA 2TECE 2R11A 1P80A 2ACEA 2FEPA 1B2LA 1YBFA 3I1JA 2AG5A 1TF5A 5D00A 6REQB 2BH2A 2AJDA 5D7BA 1EFRA 4ETWA 3B38A 1TF2A 1XZFA 5FNVF 1ZHFA 4D44A 2IW1A 2FUKA 1PFWA 2QGZA 3KHHA 4LXGA 2QM8A 1Z4IA 1RC1A 3FTDA 4PYLA 1GRNA 3CVWA 1TYCA 2OXTA 4Z4CA 3KHKA 5BUQA 4MWSA 4CPDA 1C4KA 4ZAYA 4DR4B 3RAJA 4ZYUA 4URUR 1ZOOA 1EZZA 4YRGA 3RGZA 4L27A 4J1QA 4BV9A 3T7CA 3FDXA 2ZSHA 4US1R 2QGNA 4BNWA 1JRLA 3EXEB 1A2QA 3WK7A 5CAEB 2Q5FA 4LOKA 2HZBA 4XDZA 5C7LO 1JYSA 3AKCA 3A6PC 3NGDA 3PT5A 5JTTA 1I8TA 4XB6B 4BNXA 3ROQA 2PUCA 1WV1A 4LF9H 4QYIB 4BFLA 2FPOA 4QWDA 1W75A 4F9GA 4C4OA 1E2JA 1VE3A 5C18A 4GC9A 1BS1A 3O2SB 3FPSA 3FNBA 4ECEA 4JYCA 3I32A 5TVGA 1GG9A 4N47A 2A5DA 1PFKA 2R5NA 2IP4A 4HVAA 2OV3A 2NVBA 4OHUA 1H1DA 1UMCA 5CH3A 4J0FA 3EIHA 2R92A 3CG4A 3FSGD 4IDEA 1OVGA 2R1VA 4JENA 3BBPA 4GX0A 5DX0A 3ZJVA 3AESB 4NYMR 1RWQA 3L18A 1I50A 2GFQA 2C4TA 1TTQB 1K89A 3NTXA 3E61A 1Z7WA 3FPFA 1NMQA 2A9VA 3V6KA 2BV3A 4KDEA 5BPFA 2GYYA 2Y4NA 2I8LA 5GOZA 1UWLA 3AO0B 3WK5A 1BQEA 2NO5A 1EP2B 4LJ4A 4OQLA 3QHQA 1SIBE 5IARA 1UCFA 4DWWA 1OJ7A 2VSFA 2P6NA 4HQOA 4RZUA 3A1EA 4L28A 2X2EA 3A7DA 1ZLXA 2JAWA 1NPYA 4DJDC 2W98A 2XDAA 1CQXA 3EAFA 3R6TA 3KZNA 2WLSA 2ODQA 2BTQB 1S7CA 1QRSA 4P5PA 3H1EA 1GXSA 1UOEA 3KYIB 4AKGA 1E1DA 1Z6TA 2E1PA 1X9GA 1GUAA 3S1LA 1GNTA 3KHLA 2B94A 1KA9H 2WD8A 1IPEA 1IHOA 2JGMA 1NVVQ 1JQJC 4PIMA 4B3RH 1C7QA 1KY5A 3INRA 1UMCB 4K2HA 3COYA 4E21A 2GEVA 4DMUB 3DZGA 1YCFA 3GJ0A 2R1VB 3EPKA 4JWKA 3TRIA 2QZ4A 3N0XA 2CJWB 3QYJA 4W5QA 1KI4A 1NW3A 4CMHA 5EOVA 4Q9KA 4QYXA 3F3SA 3FNHA 5EVCA 2BI8A 1SCDA 3PBKA 1RM4A 3DO6A 3W7VA 2I66A 4O2RA 2UU9B 2PSHA 5DLQC 2I4TA 3OUZA 4GU5A 5HJEA 2N1MA 3AETB 2REOA 4J7XA 4JYPA 1J2EA 3WGOA 2Z4SA 4IFIA 3F2VA 3NAZA 2ZXEA 3HTXA 2J8ZA 3C3AA 4LXYA 4DUYH 2I2CA 5HRAA 3HCEA 1BJRE 3FKIG 1RLUA 3LXRA 1OH5A 1O95A 2ERXA 1GXSB 1Y3BE 5KX5B 4Y18A 2ZB3A 4AZ3B 1LPNA 3OE7D 4HD8A 3SDSA 1BVRA 2B9EA 5TQJA 3Q0IA 3H5RA 3LKVA 3H3VH 4Q3BA 2FUEA 1NXXA 2R82A 1ZCFA 4IDHA 2R8GA 2B61A 2G06A 5BURA 4MYRA 1ENYA 1XCBA 1GPWB 2ZEJA 3HWSA 1SCNE 4N8EA 5FD6A 2J67A 3FOZA 1HZZA 2JEJA 5K0BA 1HRDA 3NBKA 2VNKA 5AP9A 4QPNA 1U0HC 2C5SA 5JSYA 2JCXA 4IQ4A 1MKYA 4JKIA 2DH5A 1T35A 2YJ4A 1T5BA 3P0IA 5DQHA 1MX3A 3ZQJA 4ZPXA 3FTQA 3Q7EA 1XRQA 1PT9A 4F2PA 2A0KA 4RZIA 3SS8A 4IW3B 3E22A 2NYAA 2QTRA 3X1DA 3J7AK 1ZU5A 4DPLA 2GS9A 3UPTA 3LWBA 1YDFA 3RTAA 4AO7A 4YR9A 2G88A 4I8DA 4MR9B 1W1IA 3EWIA 3PSAA 4MDFA 3I72A 1XO1A 5E0KB 4EHJA 1QCZA 2CDRA 2WAAA 4N4AA 5DW0A 4DL7A 2CYCA 4GHWA 3IP5A 2NMVA 1VGRA 2C54A 3O6VA 1D1QA 1N56A 5LKRA 2P7HA 1E4EA 4F12A 2IBMA 3OIGA 3BD7A 1YE8A 1FUEA 1AKRA 5BQ5A 2W6IA 4F46A 3AW8A 1QC5B 1R6BX 4B3JA 4TZKA 4OXYA 3WBBA 4MCIA 2ZUUA 6ABPA 2V6IA 2HIXA 1SZPA 4OA8A 5BN3B 4MB2A 1OWNA 3QY0A 2A7XA 1ULTA 2YUTA 2P2NA 4JI0H 4LHYA 4GLWA 4KHZA 3KCNA 4K40A 4OGLA 4XQGA 2YNMA 3ANNA 3NEPX 5CDGA 3WJ2A 1VPWA 2I76A 3HWRA 3PX7A 3V9AA 4I2VA 4N0QA 1K2WA 4IDGA 3FNEA 4PZPA 2OZEA 2FJPA 4ZVTA 1CIJA 4XAQA 4PPQA 4N18A 1T0BA 5HM8A 3W78A 3RHSA 4XTRA 4WZZA 3DFZA 4QJ5A 1E79A 4YXFA 3O8QB 3HDQA 5DF1A 4D9JA 1Q44A 3OHBA 4PTZA 2R62A 5EQJB 2IU6A 4IOJA 1ZD4A 2C7QA 1V26A 4IQ8A 1LDGA 3WLQA 4FIZA 4P3KA 1ZNZA 4F21A 3WYCA 2C92A 1SU8A 5JR3A 1N4AA 1OYWA 5I7AA 3ET4A 4RNDB 2NSYA 3RJ5A 2C04A 2OXEA 1W9MA 1SO8A 3GLHA 3PRKE 4EEKA 3OY7A 3RVKA 1ZGGA 2CZQA 2X5NA 4AIIA 4IDAA 5MGNA 2ZIWB 1OU4A 2HHJA 1CUWA 4PLWA 4CEIB 3UY4A 2V4UA 5JMWA 3STWA 4PSDA 2OBNA 3FA2A 4UUGA 1NUSA 4RAQA 1H66A 1FCJA 3TUZC 3VNAA 1XBTA 4JT8A 3FRIA 3HCWA 1XVUA 3CVYA 3WQHA 4MK4A 1Q1GA 4UEJA 1KY2A 1NRXA 4NZYA 3LZDA 3LCRA 4JLVA 5ILQA 3BZUA 4AYTA 1X87A 1KJ9A 2PGOA 3AUXA 4UBOA 3MILA 2E4VA 4X65B 1COZA 2R1ZA 1KSJA 2AD5A 2EZUA 4YUWA 4W1QA 3ZQKA 1S0NA 1YVRA 1DKNA 5BWWA 5G3ZA 4PSVA 5FFFA 3DTGA 5DQIA 4A3KG 5EJAA 3E1GA 3DOHA 3OFVA 2GD6A 2QJRA 1DHRA 4QSMA 3O94A 5A5VA 5JBQA 1IY1A 4OP1A 2HWKA 3WS7A 2PQ6A 2ZUFA 1FDUA 3O4IA 4COKA 1K83A 2X8LA 2D2VA 4LYGA 4A8JB 3UMYA 5AK0A 1UKEA 2X3UA 1MO4A 5H4GA 4MUNA 3GLHB 1NN5A 5HPYB 3KEGA 1T24A 1QHNA 1FDSA 3Q6MA 3FYSA 1WD5A 4HQFA 4EJ2A 5H83A 1GZ7A 4N0PA 4X5OA 3RRFA 3OU7A 2XKJE 5FLEX 3PJGA 1SNYA 3IEUA 2EKPA 5JSHA 2XDWA 2XVXA 3TQFA 1C0EA 5AW1A 2CNVA 3ITNA 3R2JA 4JNCA 3JWJA 4KO2S 3P9PA 3O3MB 2LVBA 4B4OA 3AM4A 4IWXA 2B7BA 2PD6A 4EH1A 3CNNA 4QQRA 2IPLA 4DOMA 5TDHA 1PLJA 1JFRA 3OPMA 10MHA 3ASYA 1O6BA 2RGXA 1IIBA 2ZI7A 3H99A 4IKPA 5MN5A 4ID3A 4TM5A 3UO8B 2R6FA 2SCUB 3PGVA 2Q3FA 3U4MA 4TT8A 2Y0BA 4GOXA 1X8JA 1XDSA 2ZE8A 4M9XA 5CVCA 4X6YA 4BJ6A 3PR1A 3CLUD 4ZV9A 3IXLA 4M49A 4PC2A 1WKCA 1BJTA 4ZQFA 2R6R1 4LK3A 1RKUA 3ZXSA 3I58A 1AD2A 4U9HS 1O95C 2VCEA 2ZIFA 1TZ2A 4W9MC 5ICMA 4Q1BA 4XEUA 2VFAA 3CRQA 3MJHA 2FX3A 3WBJA 3LE8A 1T4DA 3LDHA 2ZZMA 2C2ZA 2VZ0A 4IRUB 2DBQA 3U6BA 2YWVA 4M1YA 1BWSA 4R2KA 4IQ0A 4BHTA 4EG6A 2I1WA 2HPAA 1NASA 3M81A 2JB9A 3H2IA 1CDDA 3W5IA 4TLMB 2VHJA 3KQOA 4C6SA 3QU7A 2E18A 2AX4A 5EERA 1ULAA 1Z0UA 2JAOA 5DYWA 1YL5A 2XCRB 1WXIA 1HZZC 4MGKR 3B1YA 1LPPA 5F7OA 4FSHA 3Q41A 1B16A 2NVUA 2RGVA 1ZUD1 4BLQA 2X8BA 1YDHA 4BZZA 2BI4A 4RK0A 4DSNA 1G2WA 1R4MA 4Y67A 4GH5A 4TYPA 2JLUA 2UVRA 2IWRA 2Z3WA 3N2GA 3OC6A 4EYOA 4UTVA 3NGMA 4GMGA 1ZVQA 4WH0A 3IPAA 3FETA 5JI2E 3N86A 2Q07A 2OXCA 2PSFA 4JMPA 4TTPA 2XECA 5AKLA 4XSHA 5FOQA 3C5EA 1UXOA 2V97A 5EP2A 3EEFA 4CT4B 2ROQA 1Z7YA 2HLPA 3PGXA 2OHHA 1USUA 3A4IA 1WUKS 5DWVA 4KFRA 1VSUA 1VJ5A 1IN1A 4N7JA 4D9FA 1Z45A 2A3NA 4L5AA 3FUVA 1MUUA 4ZODA 4OX9B 1PCXA 1GRVA 4JYAH 1J42A 2HMYB 2ZRGA 3FYTA 1NQOA 3EYWA 4ZOBA 3NBFA 2DZDA 1D9XA 1CUCA 5E2BA 3C3CA 1EE1A 4MGIR 4OJNA 1U1CA 3BEOA 3L82B 2YNMC 4JA0A 3CX4A 1UKZA 4PZUA 2Z3ZA 2NVUB 2VHEA 3H5WA 3ZHTA 3GLSA 4Q3CA 1XP8A 5TSDA 2NU7A 1JHXA 2W6JD 2CVQA 2ZBRA 4YUYA 1R4MB 3FHTA 1BO6A 1U1FA 3VVCA 4KN6A 2FKLA 2O2HA 3N2GB 4MRMB 1Y4ZA 3K70D 1QAQA 5E1OA 4TS3A 2XCIA 4FNMA 5TT0A 3FGPA 5JYEA 4EHAA 2BDEA 4UFZA 5JCZA 5BYJA 3WLKX 3T5TA 2A58A 1SKBA 4BGIA 2BKXA 5BNZA 2IV3A 4OREX 5C8VA 3TKLA 1WSAA 5F23A 3TAXA 2ZE6A 5IXYA 2GEFA 3K1JA 4EB8A 3NVAA 1OOEA 2AUTA 4AURA 2ZVDA 3D4NA 4GF5A 4ZVOA 2GJKA 1I10A 5C8YF 3MYRA 3OEWA 2CMFA 1O94A 1ONSA 5HIJA 3IGFA 1E9AA 3JQEA 3D5EA 3PKZA 3WYDA 3N8HA 2IHTA 3CONA 5KFRA 4V03A 3T3EA 2PUDA 3NRBA 1JXLA 4KB5A 4ZEVA 4XDGA 3Q3IA 5JHGB 3UFXA 5B64A 1HH4A 2XWSA 1XPUA 3WMEA 4XYEA 3U31A 3CN7A 4GKJH 1NX6A 4W1RA 2VCYA 1FEZA 2B78A 4ED6A 1EBUA 3MQFA 4Y2SA 4A8TA 2HGSA 4E5NA 1RM0A 3QF4B 3CF0A 2ZXUA 2VRWA 3HKCA 1S2DA 1HG0A 2WHEA 3DM9B 3VR1A 2Q3JA 4EI9A 3T4UA 5HTOA 1I24A 5LLDA 2BQRA 3PNVA 1E6EA 2MSCB 2ZYWX 2R7MA 5LCXA 1WPRA 5EJIA 3L1UA 4IUYA 4ZIRA 3PEFA 4NV3A 3UV7A 3L43A 2YUIA 1YWGO 3MUFA 1Y9EA 4DR5H 2YXEA 3SZMA 2UVVA 4A93G 3UMVA 2IYVA 1WW3A 3UJNA 2RIPA 4N41A 2YQ5A 3RS0A 3KQWA 2C1EA 1Z2AA 3B82A 1Q77A 4PYNA 3GH1A 2JJ1A 3AK4A 2QYHA 3PXAA 8MHTA 3G0GA 2JD1A 3DNPA 1PWEA 1SOVA 4UDOA 5ED4A 3PJRA 4E12A 3E3AA 4L85A 4FJ0A 4O7WA 3OIUA 4U7FA 1SOUA 1HFJA 3GQVA 2QW8A 1M8GA 4I3GA 1PT6A 3ZV7A 3QPCA 2EOAA 2OE2A 1OX6A 4TM8A 4RE5A 2GCIA 2NZYA 1LJ8A 3IDQA 4RESA 2RDMA 3UFXB 4ABTA 5FFNA 3L6RA 1N5OX 1Q19A 3RUAA 4DV6B 5E6RA 1WKBA 3HJRA 1QRRA 3LGAA 1NLZA 2BM0A 5K09A 3ANYB 3LP5A 3VR6D 3HKCB 5HSGA 2OLEA 3OJWA 1M66A 3KOXA 3O1JC 1MLDA 5CDSA 3GX1A 1HE2A 4TS4A 1LPSA 4XIYA 2CLLB 5EE3A 2FZ5A 2EJ2A 3PFFA 3KKLA 1U63A 4DZTA 3RODA 4LH7A 3IR5A 2VJDA 1W87A 4ZJZA 5IDYA 5HKBA 4B7CA 2FX2A 2ET6A 2HVSA 3DBHA 2PL5A 5HS4A 2BFEA 3C8MA 4II7A 3D4BA 2GZ3A 2YZ7A 3PX2A 3JZIA 1FVOA 1DG9A 1II9A 1VTKA 1TKCA 3ZCPA 6ADHA 2R47A 3NBZB 1J9GA 2ZAYA 2YCBA 2QD5A 4H1HA 4N0EA 4HDMA 3KJFA 1MZVA 3N6XA 3RHZA 4YP7A 3RNLA 5T14A 3GVXA 1KTIA 3A0UA 3AR6A 3P97A 1UPAA 3VKUA 4B5LA 4D9EA 1IMJA 4O8CA 1OROA 4YMSA 4N39A 3UH1A 3K8ZA 1F5SA 2C2HA 4DUZB 4ML3A 1IWOA 4E2WA 1WCV1 2DU8A 3OJ0A 3OTIA 5DX8A 5KFDA 1R0WA 1SQGA 3EXAA 3JYLA 5G4KA 4NHEA 1RI4A 2BEUA 4RHFA 2I7DA 2ABJA 5HDBB 4HDOB 4X95A 1GD1O 4F84A 4PR3A 4NOMA 4JB3A 5JYCA 3FMVA 1X70A 1ZHQA 5DNCA 4OHCA 3AJDA 4L4UA 1TEVA 1R0ZA 1ND6A 2B1GA 3T1QA 3DBHB 3TZCA 2PPLA 1YZFA 3C7KA 1Z07A 2FPWA 2NO7A 3NJ8A 2GCOA 1E9DA 4YT8A 1J23A 1JSRA 3GXBA 2WOJA 4DZRA 3N44B 1WA5A 3TFOA 2QZJA 1PDOA 1DEHA 2GD1O 4NHOA 1EFLA 3HPRA 3NH9A 1BXRA 3UCFA 1LY1A 3Q6IA 2IQ5A 4MYUA 3OPXA 1FPMA 3ZV4A 4R68A 1NW8A 4DA8A 1SELA 3RNOA 3SQWA 5T4EA 1Y8RA 3C45A 1W35A 4D3SA 3OPNA 1QGAA 1U0OC 2CCKA 2A9RA 3C1AA 4QBTA 4CKXA 1F2VA 1LWOA 2GCNA 2JA5G 3QEKA 5F1OA 2VSQA 4GBGA 1NY6A 3PVXA 2HQ1A 2QRLA 3VSCA 2MYTA 2VPPA 4A9AA 4UC0A 4CLRA 5K05A 1FIUA 3VR5D 2HMVA 1IMOA 1N1MA 2BEUB 3VOAA 1P1JA 1I6WA 2P68A 2O8DA 2ID4A 1VFNA 4L4RA 1KP9A 5IASA 3WC4A 1Z6QA 5CK5A 5C5CA 4FR0A 2I80A 3PDIA 3D6HA 1AZWA 1U3VA 4FOPA 3QGMA 4MJ3A 1YFZA 4BQSA 2W4IA 5GV7A 4ECRA 1U4NA 2GCOB 5LWQA 1RVV1 1TUEA 3UYKA 5JISA 2IXDA 3HWX1 1D0SA 5JTUA 2UZ1A 3QPVA 2H2DA 3WLJA 4V1CI 1KJNA 1TUGA 4DIOA 1GPKA 1AGRA 3L8GA 4UZEA 5DT2A 1BXRB 1O94C 1O1YA 3BQNB 1DJMA 3DL0A 4DDKA 3KKMA 4IRDA 2O2ZA 3NQ41 3CWZA 3VPAA 2BKLA 3HCCA 4RF2A 1H9AA 3HDJA 5MFZA 3DWIA 3KQTA 1N2GA 4KQMA 4CM9A 3D8RA 1Z82A 1RM3A 4D9BA 1RRGA 5L8VA 2V3CC 2QD2A 4RO0A 1NC1A 4X61A 1KK1A 1G60A 3EEIA 4CLRB 1E0JA 5EFZA 2W8LA 5LQDA 2QRQA 5EHQA 4CF6A 3RFCA 3ONEA 3RIXA 3I8SA 4H6WA 4B8WA 3HYRA 2FY8A 4D6YA 2O8DB 4FKZA 3LBNA 1E60A 1Y8CA 2CHFA 1UANA 1ZNXA 5JD3A 1Z5GA 1PV2A 4A6PA 2QNRA 4KH0A 3K09A 5FH9A 4ZVQA 2IODA 4F86A 2HGXA 1E1KA 3AFMA 3TCKA 3WNQA 1DDGA 2EBWA 1NXOA 2ZK7A 4DNOA 2EZ4A 4ENVA 4RFLA 1QK4A 1SHJA 2ADFA 3N75A 2C9YA 1ZVVA 3BXOA 5E7MA 3BXGA 3NBZC 3QX3A 1YZQA 2D1FA 1GUYA 4JYMA 1U0FA 4WVLA 4TMYA 5EXDA 2GK4A 2WUEA 3BOSA 3UMRA 2OSVA 4HGYA 2J3QA 4OCZA 5HF6A 3N2YA 3ILHA 2I67A 1QE0A 3QXJA 2VSOA 3VGPA 5F73A 4HC4A 2QZPA 5CLFA 5EJEA 2CZGA 2QIOA 2YMMA 2DABA 1AHIA 3IP8A 4XZ3A 4ZGBA 4AJEA 2VZ8A 3N87A 5REQA 1KAGA 3BPSA 2YMPA 4A3MG 3MMZA 4PNHA 2FE3A 1TMYA 3GG2A 1DKQA 1Y6RA 4R8SA 3R44A 3DMFA 2QRKA 5D3ZA 5LYYA 4G0OA 4GZ5A 4EF5A 1XNRH 5KG5A 1JLLA 3D4LA 8ABPA 2ZJ1A 1LNSA 2XVZA 1K66A 4QEKA 2PWYA 2C9CA 4QWAA 1TVEA 4FCWA 4ROSA 1Z4OA 7ADHA 1RQ7A 4TKZA 2D4AA 4MS1A 1FE8A 1H2RS 2B2XA 2VKQA 4N5IX 1V1JA 4YREA 1JDVA 2KW5A 5IYZF 2F3RA 3ROZA 4KWCA 3MIIA 4Y2GA 1LBSA 4IJKA 1UDCA 4QRIA 4F2WA 2RHOA 1E4VA 3ID6C 3H86A 1QM5A 1GEEA 3P2KA 3W2EA 4FC7A 4AZ0B 4AWAA 3S8EA 4RVUA 3E9ZA 1S9DA 5AI9A 2K6GA 3UVEA 3QEMA 4P4GA 5IT9W 4XZ3B 5ALNA 4G25A 2MR5A 5REQB 2PE5A 2R60A 4MNTA 4BN0A 1CKMA 3KHUA 4URFA 1NVBA 4ZCIA 1JLLB 1DAEA 5ALZA 1KRWA 3H9CA 2BHTA 2PAAA 2BQ3A 2DQZA 4YPOA 4MS4A 5I3ZA 2WIDA 1MG5A 4FOLA 2W6MA 3Q9LA 1TQ6A 2ES4A 2FZVA 2AFHA 4B75A 1T0PA 4MS1B 2Y3IA 1RM5A 2XUIA 3TQIA 3MCAA 4OMFG 5CLQA 2BTOA 2JL1A 1KYTA 1P29A 2X6TA 3DE4X 4G0XA 2P5YA 2HRCA 2CMDA 5KNCA 2ATCA 2OHFA 2FETA 4QM6A 4KLAA 1L5KA 3DLBA 1KU0A 1M75A 1TXGA 1JU3A 4LFAB 2D06A 4KIFA 4NESA 4OLHA 4Q45A 3PS9A 4ED1A 3PEEA 2PH1A 4YDRA 1TYZA 1DTWB 4EKNB 3W04A 3QEMB 3CISA 2ACKA 3CLKA 2QVCA 5LN1A 2W11A 4EGCB 5TS2A 3PPXA 5JC8A 3HYCA 4AECA 4QRHA 1XQYA 3TZKA 4W8HA 3DOIA 5FJIA 1XTPA 4FYWA 2XCAA 3MR6A 5LIPA 3GNSA 4YAKA 4FFLA 4YAIA 2I33A 1K1QA 4GL4A 2XTJA 5M5BA 2XZLA 2XA9A 4UD2A 3WISA 4DDUA 1UKYA 4MS4B 2VQEB 3BABA 1XL0A 5IAJA 3R74A 4B48A 2XGJA 3DLIA 2XUAA 3PNYA 2HN9A 3VRHA 4ZT3A 3NU1A 3Q5EA 4Y6PA 4U7GA 4Z49A 2INGX 2BHRA 4CLOB 1UJBA 1CE8B 1OYYA 4RA6B 4U7PB 4F9FA 3GIKA 3T5HA 3NWEA 3ZOZA 4F60A 3TQOA 1I7QB 3O8OA 5KNDD 3DXZA 3CLRD 4FFRA 5EXTA 4RDIA 4Z4GA 3MR5A 1AQLA 1J7KA 2XMQA 5TPWA 3UNXA 1CJCA 3A3KA 3ZLUA 4DJ5X 3EC7A 4KFCA 4MWEA 4O59O 1ZYUA 2N0SA 2WJGA 4X1KB 1D5WA 2RB4A 3Q3VA 3H2ZA 2AMLA 3RRXA 2YZMA 2HWYA 1OAOA 2IOQA 1XEWX 4OFWA 5IRCD 3K9QO 3I73A 3GY0A 1VZ2A 3G68A 1XTTA 4KXXA 3BFJA 1V4NA 2A7QA 1JFFA 1N5MA 1H9BA 1YRQA 1VIAA 1HT1E 5CEJA 1KRHA 3FUXA 3B5IA 1G1MA 5EJGA 1QE5A 2OM6A 1UBEA 1ZP6A 4V24A 4DLVA 2YOHA 3UZUA 2G1JA 2JJ2D 4FSXA 1W44A 3K09C 1GZ4A 2I6FA 5K7SA 1T1SA 4YO8A 5BR1A 3BKWA 2PXAA 3AR3A 5TC4A 1WEHA 1XZNA 2IF2A 3HM2A 2UUCH 5UKDA 1H4SA 1PFUA 1XNJA 4ECZA 5G41A 1ZY2A 1N2BA 4Z8YA 3T5JA 2Q8PA 5SYAA 1HKHA 1P7YA 1CETA 3GF4A 3GFRA 3JASB 3X44A 5ENZA 3I2HA 2HVQA 1NW6A 1NLYA 3RGWS 2RFLA 3CZPA 1WUIS 1KFEB 4HDSA 4J0GA 4D79A 3FAZA 1HDRA 3MWEB 5GADl 3CEBA 2J6SA 3AEZA 3CUYA 3FW1A 3CLTC 2UYOA 3LC0A 1SPBS 5C32A 4YC7A 5KG0A 2C5FA 4I5IA 2YS6A 4JGGA 4GPTA 5HKKA 4YJGA 1TL7C 1JFFB 4IDCA 3MELA 3BRCA 3WLRA 4DR1H 4JLWA 2ZGVA 1R1DA 1S4MA 2EJCA 4EYSA 4BLRA 2VDLB 5L6LB 3VPFA 3SP1A 4EHKA 2GK6A 4G01B 3R23A 5DBOA 5CDUA 5BRNA 3H5LA 4G4IA 3NDJA 4FX2A 1WDTA 4EJMA 4LY0A 3SJBA 5JVDA 4UULA 1VKNA 1WDWB 1G4AE 4OHRA 4MVXA 4PLTA 2CCGA 3THYB 2X4IA 4Y2XA 1BU5A 4IIXA 4MEBA 3QI2A 3CX8A 3DA8A 3VQTA 3V4RA 1G5HA 4ZGGA 3CR3C 5ARCA 3D6MA 3EVDA 3RVDA 3TXYA 2KQUA 3LP8A 2GQ0A 1VL5A 4M8IA 2RDIA 4HDSB 4PC7A 4FTWA 4BB5A 1JJBA 4RVNA 3BA6A 2HRRA 1BG6A 1FFSA 5I8PA 3FGNA 2VYNA 3OQ1A 4CTOA 4F6LA 2IELA 2Q2UA 2Z8XA 4WQMA 2AFIA 4CMFA 1L7EA 4KQGA 2Q3BA 3NHYA 2H4WA 2HIHA 1JEOA 1TCCA 4YJGB 4DCVA 4OQEA 1UOQA 1LX7A 3UWKA 3WSVA 3O90A 1L4FA 3TXXA 3LYAA 3U19A 3SS9X 4KTVE 4F93B 3PLAE 1YCGA 4HCJA 1U1GA 4I1PA 2XLBA 1CERA 5KSOA 4PLHA 2WWTA 5BWRA 1XA0A 5BNTA 4ZAFA 4N5NA 4ZTUB 3K96A 3VPCA 2Y9PB 5JVDB 3TZEA 1E66A 2I3AA 4INZA 2ASEA 2AG1A 1F48A 5TEVA 5J4YA 1H1LB 6REQA 4JUCA 1L9XA 2J0UA 3OCCA 3FMFA 4RHYA 3Q1LA 4JVLA 4EZIA 3SE7A 4XPIA 1DIOB 5JPDA 3KRTA 3HNPA 4DQ0A 1CRQA 3RBAA 3L1VA 2YX1A 4Z3KA 2HU5A 4TKLA 5KG4A 3B3FA 3OT1A 4BWYA 5K9ZA 2O52A 5CB6A 4J7UA 3C70A 4XW2A 2WAYA 5YASA 2J3HA 5LQJA 2AFIB 3F9IA 3DF9A 2Q0SA 1A8IA 1V9LA 4WCVA 3FUTA 3LX6A 2QF7A 3OESA 4EWLA 3LY5A 4F97A 1EX9A 1NYTA 5AHRA 3FVQA 4KR0A 4WZ6A 1Y1LA 1OLOA 1FFDA 1RCTE 4YTEA 4DCJA 1M34B 1YUBA 1NRJB 2VAMA 2F9FA 4K9OA 4N65A 4QYIA 2P9FA 1JAZA 5HMLA 3NNSA 1Y7LA 5KFCA 1QYVA 3IOYA 1A5ZA 2HWUA 1NN3A 2IYRA 3WADA 1HRKA 4A1FA 4YCJA 4MO2A 1D5CA 3RV4A 1UBRS 2BKVA 3L5OA 4MP3A 2GN1A 2N42A 3GTKA 4G41A 2J0UB 5JJ5A 1V7QA 1IJBA 1R10A 1E2GA 4YN3A 4RF5A 1NONA 4O4IA 4QQFA 5L95A 2FCRA 4XPIB 3UAOA 3AESA 3ZQ4A 4IMIB 5TQ2B 4DW8A 2HR1A 1SKUA 3PC2A 5A5EA 2HIAA 1AGXA 3K4HA 3C2QA 4TTVA 2DFKB 4Q7QA 4MUKA 3U3MA 3OT1B 4B7XA 3LT0A 1SRRA 1Z88A 2EWMA 1X39A 5CW2A 3BGVA 4R7ZA 3VC3A 1Q22A 2DJ5A 1IXRC 1KQGA 1OAOC 5EPOA 1E9RA 3GTPA 2W2NA 4AJ1A 3PUJA 4C05A 3ZTWA 2Q6IA 1O6CA 2AYYA 1SKQA 3AIIA 5D85A 4G9EA 3UMSA 3VU9A 3SLRA 2BTQA 2G1AA 2NSHA 4I0WB 3I5UA 1XDUA 3ZBPA 4L74A 3O7WA 1O0BA 2FSFA 3CW8X 3QUCA 5SY9A 1M6HA 2QV0A 5I7OA 4KAAA 4MMXB 3LF1A 1VYUA 1I14A 5BV8A 1JH9A 2WUFA 1ND5A 5DASA 2RARA 3FB1A 2PNJA 5DX1A 5HGXA 4W5OA 3UT6A 3Q8WA 2GO7A 1LVGA 4DLNA 1VSVA 1FZQA 4IJVA 1RAEA 4O4IB 3X1MA 2CJWA 3P5BA 2ORIA 1KQPA 3DE3X 3R9RA 4BFUA 3PFHA 1V35A 4UE3S 3GELA 3RUIA 1RYFA 2G5CA 1HBJA 4LBYA 3WNDA 7AT1A 1CVRA 2W2LA 2QX9A 1C3JA 3WA6A 3VMFA 2FPPA 4HGQA 5F3WB 3KELA 4ZZIA 2MIIA 2VHTA 5IM4A 2QI9F 3TTUA 1QQ5A 2H2WA 4A2AA 5F12A 2V9WA 2IYQA 3ZTTA 3STXA 3AETA 2BGGA 5KFWA 4LFBB 1CF4A 4O7LA 1KFBB 2G70A 3RCBA 4B80A 3ECCA 1XP5A 1MRSA 1E6WA 5ALHA 4C29A 3LCJA 3AUFA 1EA5A 3A36A 2JASA 4L1KA 4B40A 3VU9B 4PS0A 1Z34A 3PNBA 4C4XA 4GM4A 4QOFA 1JECA 3BAAA 2VK1A 5KX5A 1X0VA 1CYEA 2AWOA 3W1WA 2C9MA 4AZ3A 4PQYA 4OK3A 3OJXA 5I5TA 4FK8A 4ZVUA 3N2IA 1SXQA 1GKUB 1PS8A 2Z1DA 5ICGA 3RC3A 3F8NA 1K9SA 4O7YA 3C7CB 2PGXA 4CHGA 1E2KA 4O7RA 5FD5A 4PLCA 5AICA 3OEED 4D57A 3T7RA 3EFEA 3D64A 1EX7A 1D03A 2C9ZA 3L7JA 1CLUA 1CPYA 4UNPA 1TK3A 1TT7A 1DWPA 3EZFA 2JFOA 1MO6A 2FUNB 2C9BA 4AYBE 2P9BA 3ZDQA 2WAQE 4WMLA 2PS0A 1QRTA 1OZFA 1YQWA 3PFIA 1HSOA 3IEXA 3I92A 3SFVA 1M1UA 4OLBA 1S2NA 2FPPB 2HV9A 5AI8A 4ERNA 1E7YA 1L4EA 1U6IA 4PSCA 3T4EA 5JAZA 2XPCA 2R5FA 4J9OA 2VPSA 2GEKA 2R4QA 4DNFA 3DMTA 2Z8YA 1F8UA 4PGAA 3F4BA 2A0YA 1WCYA 2FWRA 1EKFA 521PA 4MR9A 3GAAA 4O63O 1VLJA 5L3RA 4RPLA 1TK9A 3AOGA 4Z5XA 3R5HA 1JHDA 2YCHA 4QIHA 4DL9A 3W3ZB 1ODJA 4GS5A 1IY0A 1DLJA 3TR5A 2GBIA 4IRCA 1M0WA 2XBMA 1G3QA 5GAJA 1XZKA 2YWFA 2DERA 5H9VA 1MQ8B 3B52X 5JWHA 4H31A 3ZI7A 1CJBA 5E3HA 1QC5A 3EXFA 2CLMB 4ED7A 4OQMA 1L7OA 5AJWA 4PICA 1I4OA 1QKIA 3RT7A 3DKRA 1DFHA 1YRBA 5J3JA 1TF7A 5BN3A 5TGZA 4CJXA 5ALUA 1ZUIA 4EMBA 2QX6A 5B4UA 1S7GA 2OCKA 3K0AB 3AVUA 3M83A 5FCDA 4ABYA 3H16A 3EFHA 4C4SA 3QWUA 4JH0A 5EKXA 1QGUB 4GP6A 2D4HA 3KLMX 1B00A 3PZRA 4PG5A 5LMUB 3GYBA 2IXFA 1RJPA 3D81A 3O8QA 1RXYA 1Z39A 2ZXFA 5TLSA 3A1SA 1RLTA 2IUUA 1VIVA 4QEDA 1NQXA 2CFTA 1QZUA 3ENWA 3HB7A 4M8NE 1U3CA 1D1TA 1J22A 1KGSA 3ZV5A 1JAYA 1G4UR 5C3MA 1TEZA 3W9YA 3ZG6A 2NOAA 2VI5A 2XUZA 3LX5A 3IIKA 2X0SA 2JLRA 1K3FA 3FUCA 3LK6A 1K2VN 3M1IA 5GGYA 5DK6A 3MJTA 1G20E 4TXNA 2BFNA 4TN1A 1RKVA 2NAPA 2RHLA 2QN1A 1NNI1 2HDWA 3EXFB 3CEPB 3RBXA 2GPWA 4ZDKA 4CEIA 1FUIA 1QLHA 5KT7A 2V1XA 1KDPA 1NBOA 4QGAA 1D2CA 3HEBA 1JTFA 2QW1A 5E9AA 5I5XA 2DQ4A 1UFQA 3AFIA 4M83A 2NXJA 3UGQA 3L8DA 3EMDA 2QPOA 4EA7A 5JPIA 1EDEA 3D4IA 4A0GA 5JMTA 1T6ZA 3D3KA 2OCDA 3D3QA 3QX9A 3C16C 4E03A 1CX9B 4ADSG 4RLHA 4YMWA 5B1EA 5JNLA 4M0CA 5IJ0B 4JR1A 3PA6A 1K5PA 1AVTA 3BMXA 4BFSA 2JI9A 3G2IA 3KL4A 5IP5A 4JIMA 5CFQA 1GSAA 5FPQA 3K0EA 3RPEA 2IY7A 3ZS8A 4JXXA 1MAVA 1XMOH 2GO1A 1U81A 3EISA 3MG9A 4A8JA 4JP3A 4H0CA 3NT4A 1TYBE 2BD0A 2V74B 5LB4A 2A5JA 2QEQA 4MEAA 3TB4A 1E2MA 2O2DA 2AMYA 1AGYA 2R00A 1H6BA 2P35A 4YHHB 2HFJA 2Z6VA 4N76A 1RAHA 5ESRA 3PTZA 3AFNA 3RB3A 5LJLA 4ZVVA 2L17A 4UHJA 1N5IA 4EELA 2FW7A 1E89A 3KPUA 4BFXA 3X1XA 2VYCA 3KP1A 3TNDA 1BE1A 3JQDA 4O33A 5JEDA 5IS2A 3JPWA 1H42A 1Z8DA 1MO3A 1S1MA 4X64H 5ELMA 4RL6A 3GLIE 5EZSA 1QAOA 3REQA 4CL0A 2SCUA 1E1NA 4DLBA 3VDXA 2YU9A 1E20A 3AM1A 2E7ZA 4UBMA 2ZKIA 4BE4A 2I4RA 5KFZA 5DTIA 3FUWA 2PAFA 4W5RA 1L8LA 1ZKDA 3HUUA 3DP9A 1VCMA 1C7ZA 3RB0A 1I94B 1E64A 1WS6A 4F1KA 5E4TA 4A3GG 2WWYA 3ZE8A 5HX7A 3I04M 4CETA 3N2EA 1ECJA 4O7SA 1CY7A 1ABBA 2I5PO 2QTVA 2FV8A 2QA5A 1G5TA 2FLKA 1KZ4A 1YZHA 1JLHA 2AOTA 5F4ZA 5ITSA 3DFFA 1P9WA 1G291 3RIMA 4EW2A 3LFTA 3HFGA 1JFTA 1WM1A 4CMDA 4ZREA 2ZYVX 2Y0CA 1C8VB 3HL4A 4LVNA 3NOXA 3DYIA 1GFSA 3GQCA 3EPGA 3HI6A 3W7BA 4MTEA 4G0UA 2PMFA 2YYYA 4XQEA 1AU9A 4FX5A 4ARCA 3L0SA 1N2ZA 3C7AA 4EQ5A 4YLEA 2OGZA 2BGKA 3REQB 3G2KA 1MMFB 4O29A 4YR0A 1NF2A 2DUJA 2ZCVA 4GXTA 4MQUA 2I1LA 3MFIA 5IYCG 3Q8MA 3KDPA 4B3SH 3KSRA 3FOCA 4O3NA 1GTMA 1ZK1A 3DMTC 2XSZA 3N42B 3V2UA 3C6YA 2IYLD 8ADHA 2VJYA 2IU4A 3FH0A 4FVTA 3EQ9A 4P6VF 3OTOB 2IHNA 1VFPA 1H23A 2QTVB 2LKCA 4ZKDA 4CF3A 3UMJA 2AOTB 3IMFA 3GTQA 1KDVA 2YHBA 3IVAA 4HQKA 4D4IA 3H9UA 2OCPA 4PN3A 1GLVA 3IMEA 3IPRA 3G5MA 3ZI4A 1V8FA 4NABA 4DR3B 3CN9A 4F3TA 4RTMA 4F3KA 4KV7A 2IPNA 1I7SB 4I1VA 1Z6YA 2ZRFA 3W3AH 2GERA 2VBCA 3ZWNA 3HHPA 3L79A 2HJHA 5KKAA 2VJAA 1AGPA 1H6CA 5LYJF 2VP2A 3BIXA 1K4MA 3BHMA 4Z3DA 4LVOA 5HJ2A 3ZHXA 3MMPA 2CXRA 1B14A 3RIGA 5JS7A 5AVYA 5B57C 2VP6A 3SHOA 1TZKA 1R8YA 5FBKA 2GCGA 3BTOA 5SZJA 5IFKA 3GDEA 4MRMA 1Z36A 4MVCA 4CT0A 1RCUA 1XNHA 2PA0A 2RHJA 4ZQCB 1A71A 1V43A 4IDFA 5FORA 4JU9A 2R79A 3W5OA 2OPHA 2Z43A 3C4VA 3D8BA 3LRXA 1UKBA 2Q2OA 4F8EA 4GNRA 3KYHC 4DSAA 3EPJA 4RHTA 3ZHZA 1M2JA 3BXHA 3MIZA 3ZXXA 5E3JA 2PD4A 3B1ZA 2H1RA 2GF2A 1E0SA 3GDGA 5ADVA 3Q7SA 4JJ8A 4B3CA 4AAYA 2IL1A 2FOXA 2VPWA 3G6VA 2RH9B 1WIWA 3U2QA 4K9DA 1JIJA 3V9PA 1JLSA 4OMUA 2ZLBA 1Z56C 3L4EA 2JEOA 1IL0A 4ASUA 5AHOA 2QVZX 3K6RA 3G59A 3E7PA 4X1YA 3CVVA 4C2TA 5FI0B 3BMQB 5I60A 1HE4A 2NACA 4LQ4A 1KVRA 3IURA 3CNEA 1WU7A 2Q45A 1L3IA 3NJRA 3DKVA 2AYXA 3SHQA 5AI0A 1BEZA 2H9YA 1D0VA 2Q6OA 4D8UA 4FI3C 4H59A 3RJ0A 4HQRA 5ES3A 3QF4A 4RYDA 4RH0A 4Q7MB 4ZJUA 1C3OA 4EI8A 1T0HB 2WM8A 1UJ6A 1YRWA 3H2KA 1Y37A 4IOMA 3UOGA 1P8LA 3AHIA 3TJZA 3C6KA 1KT8A 5IAGA 3P9XA 1DSSG 1II0A 4MWZA 3LNTA 5BT9A 2QE7A 4JCCA 2O7NA 1SMKA 3X43A 1UXKA 1QPZA 5FWYA 3GN2A 3K35A 2FFJA 4A8JC 1V7ZA 2VOBA 1NQUA 5GMOA 3ZGYA 3ZY5A 1ILWA 4ENUA 3OICA 1FA9A 1KJWA 1NZDA 4K6NA 1CY8A 5JLJA 5EP1A 3AU8A 2GMWA 3OCVA 5IBCA 3BF8A 2H29A 1EKXA 1MNQA 3V1YA 1CBUA 2R00C 3RTBA 2OV2A 3PHJA 3O75A 4JI3H 1WXXA 3B7GA 3C6QA 2DBVO 1DEXA 1LLQA 4X1YB 3HVUA 2ZPTX 2LD4A 1TD1A 1FLNA 1YMQA 3A37A 3OZDA 4YXWA 1Z3IX 2O0JA 3KXYT 3P20A 1XLUA 1EBFA 2C7RA 3GILA 1YE5A 3I2KA 2BFCA 4WAUA 1SULA 1G6OA 1RPNA 4BYMA 2C4HA 2C3UA 4TYMA 1OJLA 1TJ5A 3HU1A 3ANLA 4JJEA 4WBNA 3DVAA 4JC5A 4JBIA 1C3OB 1XMSA 2XOXA 4NZPA 3OAAA 2IIPA 3NAQA 4I9UA 4MZXA 2WYOA 1JVBA 4IV0A 2VP9A 4YAJB 2O6LA 4AY2A 4DMKA 3RVRA 2VAWA 1H1TA 3CC8A 2K2WA 1P9OA 2AHOA 5A7HA 2AEEA 1Z5OA 1P2BA 2TYSB 5FWYB 4AIRA 2NTVA 2HJ9A 1O87A 3BXZA 5ILOA 1E9BA 1LTKA 1ISGA 2B9VA 3OU2A 1WG8A 4JUAA 1I0IA 4DR2B 1TIKA 4J7CA 3KQNA 2DFTA 3M9MB 2QTCA 5IABA 3ENNA 1XT6A 1AV7A 3RS3A 5HBGA 4HLNA 1XF1A 2BVNA 4HMOA 3TX6A 1KC1A 2C22A 3FMIA 5CUQA 4P0TA 1ANKA 1NATA 5PNTA 4EI7A 1FVHA 4I50B 2BFCB 5C1DA 4RCZA 3FPCA 2A1TS 2GUGA 2JW5A 2JA2A 4B3IA 2A30A 1PFQA 4CNQA 3IQXA 3EBOA 3M4JA 4PLZA 4WPGA 4A0SA 4ENTA 4WBNB 3K71B 3DVAB 1YQGA 3JYNA 1PQUA 3GP3A 4UTNA 3RRBA 4M1QA 3R6GA 1GM5A 2H17A 4XUGB 4BMZA 3TFQA 2QLLA 5KTKA 4MQ5A 5B30A 1Z6ZA 2OFPA 1M33A 5FL7A 1IM2A 3GD7A 2DWPA 4HUJA 4B2LA 3VTAA 2HGZA 1RXIA 2X1HA 2XGSA 1CXZA 2H07A 3F9RA 1N3YA 4N6NA 1XJCA 2G7ZA 4CNBA 2UXBB 2Q4OA 3GEPA 4DL6A 5KNBA 2ZIEA 3WGLA 3GTJA 1A5BB 2O2CA 5JCJA 1A4RA 4FOTA 2OHJA 3ON5A 4HLDA 3PENA 3MBOA 4BNDA 4LDPA 3ZX4A 4CIYA 4QGBA 1VSQA 5K8TA 2ST1A 4DUPA 2MSDB 5JATA 3AI3A 3GNTA 5ERXA 1L5MA 3DV2A 4RPIA 5FPKA 4DQDA 3LQ4A 2GFIA 1XZHA 2XOEA 2QYSA 5DHUA 5ALFA 5HOQA 3H0GG 2RGBA 4B6EA 1QVVA 3QBEA 4TQ9A 3MCZA 1KUTA 2R7KA 1D2GA 1CRZA 4OOEA 3IKVA 4M55A 2W43A 4WBXC 3E7DA 4K7JA 5ALQA 1NNSA 1U6KA 3NANA 4Q01A 3G3EA 5T3UA 4LHWA 2XUFA 3LPCA 2OFWA 1S3GA 2JFQA 1DJNA 2WT9A 2O8BB 2EJVA 3CVJA 1XHLA 4CN9A 4DHEA 2QM0A 4MLCA 4M0MA 5H4HA 1S0OA 3U4DA 2XEXA 1B04A 2ZE5A 5D5QA 2H51A 1UPCA 2ZULA 4MVJI 3DXYA 1T9AA 3UKDA 4BNDB 1W93A 5L7YA 1P44A 1K1SA 1FFYA 3ETEA 2CLHB 1SVNA 1Q92A 4BB9A 2DQYA 2RHCA 1M9NA 3T5CA 3DOOA 2F48A 1T3GA 3CR7A 2D5IA 5IVHA 3KL2A 1ONPA 3EZ9A 3F0TA 3H19A 2OHIA 2VRCA 1CF2O 3GP5A 1O6GA 2CL5A 4LYDA 2WE7A 1FFEA 4QFDA 4X62H 2WJ6A 3VKFA 3HWWA 1FMFA 4HOYA 1AN0A 3K0FB 4QDKA 2A94A 2FN7A 4Q05A 1AE1A 4J2HA 3V1LA 4AXXA 4QNRA 4ENQA 1K8ZB 2Z3VA 2PJRA 4KV9A 5BWBA 3VFDA 3OWHA 4DBLC 1UJNA 1C9YA 4BVHA 2X23A 4LSWA 1JXQA 3CZQA 3O1HB 5G02A 1BMQA 3AONB 1OZ0A 2E5LB 1IQUA 1WE2A 4IIJF 1X7GA 1JX4A 5EVJA 1FJ2A 4G9BA 3GRCA 1CUEA 5D1NA 4PZ8A 4HV4A 1F1JA 3U54A 1KK2A 2AGVA 2YWEA 3I64A 3RADC 1PR1A 3PPWA 2XUPA 2VA2A 3PRHA 1KJJA 3BCHA 1GZ3A 4LX0A 3GVIA 1W47A 3ZCTA 3LVBA 2JANA 2FR8A 1PYGA 5BXYA 2B2NA 1JGTA 4DPKA 4PYRA 2QL5A 4MYTA 1L4MA 1G6KA 4ITUA 2B1JA 3KEOA 2A4MA 3AEKB 1AIPA 2Y4RA 1ZH4A 3ETCA 3C3MA 4CG1A 2VRBA 5EKUA 2VJQA 3PQ2A 3V8EA 3S29A 1ISMA 4KI7A 2HK6A 2P9TA 1GG2A 5B7PA 3A70A 1GKLA 1GN8A 2WVJA 3ZU2A 4UQOA 4AM8A 3B3AA 3JVUA 3TINA 1I1LA 1ZINA 4LEIA 1ZC3A 4HTFA 4MQFA 3H4BA 1CQIA 4DIKA 3OFND 3L6UA 1IXYA 3MS4A 3KLOA 2I9KA 3F46A 1J2TA 4FR2A 4WE3A 3T7DA 2FSHA 3BACA 2VQ6A 2QTLA 3K92A 3WL7A 4YRQA 4FMPA 4EW3A 2WZQA 3D1LA 3SOZA 4DJTA 1JMYA 4PVDA 3UW1A 5FOVA 1P7WA 3J80W 3DDZX 1TZJA 3L7LA 5SY4A 2HI0A 2FHPA 3M9OB 1ESEA 5C81A 3NTQA 4CCWA 1E1MA 4AZ0A 1I1KA 3BJEA 2HQBA 3Q72A 1GTL1 3H4MA 1BRTA 2FMKA 1TM5E 1YZGA 4AKHA 3HABA 1IEWA 1RJ9A 5JV5A 4QIWA 1OZGA 2G9NA 1C7FA 1L5FA 1HDEA 5AK4A 4HXGA 3DLPX 4N6GA 3A6JA 1DNPA 1BDJA 1DAIA 2XYGA 3S2GA 1R9JA 2JHFA 4HTFB 4MQFB 1CQIB 3MJFA 2ZR7A 1TGVA 2WWVD 1R0BA 4K03A 3KTDA 4C89A 1QO9A 1TVKA 1WRBA 5JO0A 1PUXA 4LCJA 3H4DA 4AW9A 3TX2A 4YFVA 2FQ1A 5AVRA 1RKBA 2GRJA 4F7WA 2QT9A 5CFMA 4R98A 1BSVA 2JK0A 4WKBA 3VDRA 2FA9A 1J8MF 3SMQA 4M9UA 1C9EA 7YASA 3QFSA 3CF2A 4HYYA 3L7KA 3F3MA 3LCMA 2TMKA 4FS1A 2FMIA 4RU1A 3DT9A 1I01A 1N1GA 4RXMA 2FSSA 4YI5A 4A6EA 4BXOB 2BPOA 1IXKA 1DTWA 1JG2A 5B2EA 1VP9A 3LYHA 1RJ9B 4AMUA 4RTNA 1RK6A 4E5KA 4RAZA 4UZSA 1NC3A 1R0XA 4S04A 4JQSA 4L5CA 3MNFA 2CFIA 5KYYA 4PHFA 2G0TA 4O4LB 3NZEA 1YK0A 3H2HA 2B25A 2Y66A 1MRZA 2WUVA 3QFFA 3RG2A 3NFYA 1BHO1 1Z0ZA 4UCQA 5IMSA 3HSYA 4IP0A 2XI4A 3W8DA 3E18A 3INYA 1TVKB 1URPA 4LVUA 4BNTA 4Q15A 4KWEA 1PFVA 3HCDA 3D6NB 1BAPA 1G55A 1BNCA 3KXKA 1I5RA 4CLOA 1CE8A 5B1HA 2HPVA 2FK8A 4RA6A 3HBMA 5B2FA 3H9GA 1IUNA 5ICCA 3VR4H 2Q7DA 2H4ZA 4DMLA 4O7ZA 1IM8A 5DWQA 1F60A 5EMLA 4X44A 3QSGA 2FW9A 5ER9A 3BE5A 2BUAA 2C5AA 2Y99A 5A0TA 1FF9A 3A27A 2GILA 1EFRD 2GM5A 3QPDA 3HN6A 3MJVA 1ZGHA 3TR0A 2LW7A 3FZNA 4PBTA 4DJFC 1Y8ZA 4LF6B 4D4JA 3UGTA 1Y5NA 3TOXA 1JIKA 4X1KA 3NPAA 5KKNB 4LN1A 2H1HA 1Q91A 2V3WA 1WCMA 4HNUA 1SG0A 5KYYB 1YKSA 1N25A 3R3UA 1FXWF 2WOOA 4KNVA 4YJ2B 1TA9A 4DAOA 1ZD2P 4EFDA 5HNEA 1AC5A 3GFPA 3A6EA 1L4KA 3JTEA 1GKIA 2H1SA 2CFMA 5B4TA 4COOA 2A5YB 2E4AA 3FHJA 1U3UA 3V4OA 3GW8A 1SN7A 4LMBA 4DHWA 4Z8XA 4F06A 4KYIB 3LUCA 1UAAA 1HGXA 1UZMA 3UXYA 4U6NA 1AK2A 2C7GA 5CPBA 4FYIA 2GDZA 2OBBA 2XWBF 3H5NA 1V6AA 5K03A 2DFLA 4PFSA 1TYEB 3AF0A 1Z18A 1AUXA 1D2HA 1Z4QA 3HYSA 1Z13A 4WA7A 1I2CA 3MLEA 3K5PA 5GJCA 1V0JA 4Y8VA 4QEZA 2BZGA 4HYEA 1NJGA 4YDSA 2C1ZA 3WLOA 2OUKA 5JBIA 2FR8C 2JZCA 3BQ1A 4WLVA 3JASA 4JHLA 3EY9A 2ZM6B 4FHFA 1JALA 2GAIA 3WFZA 3DYVA 2SKCA 3GJ6A 2PCJA 5FL3A 4YX9A 1WV0A 2DB3A 1DI0A 4LYJA 2IYYA 4ZT5A 4DM7A 1Z12A 4L8VA 3MWEA 4M76B 1XNQB 2NP7A 4F0JA 1N36B 2IEAA 5HRCA 5JU6A 1Q0SA 4FFMA 3ORYA 1ISHA 3M5PA 3VVLA 1A2BA 1EFVA 1U6JA 1A50B 5JO9A 3K20A 3M6IA 4G67A 4XB2A 1QNFA 4XOUA 5EMMA 2ORWA 3KSAC 1R16A 1ONNA 1G38A 2CCJA 1WW2A 3JR3A 1ISPA 3EOBI 1US8A 3ZLJA 2QQGA 4X9XA 1LX6A 4CUKA 1NP3A 4PZ9A 4X8MA 2EKDA 3EC1A 1EMDA 2CXSA 3F98A 4J9QA 4OKNA 4ERXA 4Y8VB 3THYA 3QVMA 3JWIA 3CW9A 3ZVLA 5LQNA 4J3FA 1ZKMA 4E4YA 3PUHA 4OB8A 3I2YX 4R2IA 2ODNA 1X38A 4E32A 1N2CA 5TX7A 4HBZA 2JCVA 1I1NA 1V9CA 1QV9A 3CE9A 1XZLA 1U8FO 1VI6A 3NM6B 5BV7A 3CW2A 4IIFA 3ZCVA 4LCEA 3MHTA 4TV9A 4BMNA 4XOIA 4OGWA 4RXUA 1HDIA 2ZT7A 5M29A 1S03G 1BKDR 1EFVB 3OZIA 4CIAA 1YS1X 1SGWA 1JBEA 2H59A 3QVSA 2V7EA 5GONF 2VF2A 2ZJ6A 1XWWA 3T94A 3JVDA 4HRYA 4OA5A 1ZQ1A 5EUMA 2HA2A 1US8B 3OSPA 3KJGA 3JYOA 1MV8A 2QRNA 4QAQA 1U2ZA 1T1IA 1S2LA 2FRDA 5EDWA 1O95D 4ALJA 5F98A 2AZTA 1Z5UA 3ZNPA 4GRAA 2IZ1A 1IHPA 4MLDA 3M6WA 4AVYA 3G1WA 3S3TA 3INTA 4O02B 1WNTA 3FZEA 2J7KA 2ZVJA 4NYMQ 1DAPA 1H1LA 3PPIA 4BO1A 5DG7A 2GHQA 3Q7TA 1M1YA 3NXKA 2JJMA 4MLZA 4H3HB 5F51A 3NAMA 3UB3A 1ENPA 1VBHA 3TLJA 4CW7A 4RNMA 1A7JA 2OCIA 1QH0A 5FDFA 1JQAA 1N2CB 3ZGLA 1MXHA 2IEGA 2AEJA 4WXYB 3GTGA 3MOGA 2ZTSA 4WRRA 3EZ7A 3DULA 3E27A 3N43B 2P8JA 4GD3Q 4BOYA 2ASLA 1ODFA 1DZ3A 1XN4A 2LE0A 4TV9B 6GPBA 4DGQA 3T8YA 1M1NB 4WK0B 3UA3A 1UDAA 3D3WB 4UM5A 2GB4A 3OPYI 4BX2A 4E6EA 5IVKA 2QAIA 3A6GA 3ZHSA 1X9HA 5HUHA 1RI3A 3T9DA 4C06A 3WIOA 2DPJA 1E7SA 1XK7A 4LDJA 1R00A 2H5IA 1M34A 4WZBE 2DETA 1LFAA 3ZWCA 3FJYA 3ICEA 4ZDIA 2GF0A 1SPXA 3KQHA 1O9GA 1XMPA 2JGDA 5FRDA 3AIKA 3UGKA 4YP6A 4AP9A 3ZNNA 4I4IA 4C07A 2HPHA 5CT9A 4V38A 3AWDA 4WY5A 4QBKA 4ND7A 4EHLA 2V7QA 3A6KA 1DIKA 1M1YB 4NV0A 4H2DA 1OX4B 2W6ID 2JH3A 3GLFE 2CNDA 5D6NA 2QNIA 5TQ2A 4AMBA 4JQYA 5TQ0A 4HG2A 2H0RA 2NU8B 1IWBB 3HR7A 4A2QA 4MWCA 1DUIA 3IMGA 3SY8A 4KBFA 3ZDRA 1ZRHA 2AE2A 3BJYA 1HYQA 4RUKA 5BUSA 4G5HA 1T13A 1U5CA 3NV7A 3I52A 3OQ6A 3D8NA 3CKKA 2AJTA 3L7OA 4A3SA 4W7SA 3DSRA 3KVYA 3I9OA 3MWFA 1E79D 3OOWA 3CVXA 1X8XA 2NNWB 2IOFA 1GPAA 3EXG2 2I3GA 2W6PA 2NUTB 3K0KA 2UKDA 1I80A 2JGDB 5I5SA 3C3WA 3SYLA 4ESVA 3BCSA 1XTSA 1J5EB 4E07A 4X66H 2CHGA 4LG1A 1M6YA 3IR6A 3LQKA 3K1ZA 4HH1A 5ALKA 3FROA 4ARZB 3G2JA 1R88A 3ZV3A 2HF9A 2BGMA 4FGLA 1HEIA 2WJJA 4JB2A 5KSPA 4YJ3B 5A6SB 3A10A 4DQXA 2Y0SE 1TDJA 5BOSA 3V7UA 4LGMA 1PG5A 4LV8B 4V0ME 5AW9A 3RYCA 3ADCA 2PZMA 4G26A 5TQ0B 3AR4A 3OJEA 1VPEA 1X1AA 1Q6YA 1MC4A 4KUHA 2PMCA 3HJCA 2VBFA 1JEQB 3B6JA 1U65A 3SFTA 2NN3C 3T1VA 2IUEA 4LZPA 5AHWA 1Z5NA 3W8FA 1OXVA 3R0QA 5F9HA 1M10A 3OHPA 3ANTA 2PWPA 2WR8A 3NDRA 2L69A 3ESXA 5I5GA 1X13A 4C1NA 3CSSA 2UAGA 1O77A 3I9KA 2F1RA 1TAQA 1YKGA 3OKFA 1TJ3A 1TZCA 2YOGA 3TGWA 2AG8A 1OI2A 4WZAE 1X1BA 1V8ZA 2H54A 3AVVA 1VPDA 4U2EA 1Z0SA 2HWWA 4YQYA 3IH5A 2HEGA 2HJRA 1LFDB 2Q99A 3DTVA 4LC9A 5ER6A 5FOWA 2E5FA 1PSZA 1LSJA 2HMSA 4RVFA 5KSZA 4E94A 5BOSB 4C0SA 1LZKA 3BB3A 4MTDA 1JZTA 2GVZC 3IT3A 5AM4A 1BHSA 2PKYX 3RYCB 4B3MB 4YCCA 4G4SP 2W6QA 4C08A 3DTFA 3CBGA 4FBGA 1XEXB 3FNRA 4H4DA 1F3LA 3N0TA 4C4ZA 2Z1MA 3UEOA 1IOLA 2ZUCA 5HK8A 4EFMA 4MVJF 1B1AA 2ZTLA 1XX6A 1Y1QA 4REMA 1CR2A 4M54A 4YASA 1VMAA 1OWLA 3ZXIA 1JYFA 3FRHA 5CVUA 1BE0A 4KAFA 1TJ4A 3H7IA 3PT9A 4DMCA 2UUBB 4EKEA 4GR5A 3N59A 1PIWA 5EJ6A 4MAMA 3CY6A 4L4SA 3DL2A 4LFCB 3SVLA 5KFKA 2A86A 4GKAA 4WGGA 3UPDA 1FNNA 1TQHA 4PXAA 4CU5A 3V1MA 2BR3A 3OQOA 3EODA 3NHRA 2I4IA 3LQ1A 1E99A 2XQFA 5JALA 3HKDA 5LVAA 3KUKA 1QPBA 1QO0A 3GYGA 1SD5A 2FRDC 1KR2A 4Y2HA 3ACCA 4WN9A 4Y7DA 3P26A 1MG0A 4Y9RA 3DTVB 1E69A 3TW4A 3UWDA 3NHUA 3W5DA 2HA5A 3KSUA 4HZIA 5JH7A 2GCPA 3QHPA 1LPMA 4NENA 3C41J 4PX5A 1QIFA 3K0AA 4B7AA 3JSAA 2WWHA 1UMDB 2JFZA 4ED3A 1T2DA 1QGUA 3QBTA 4P0PB 1GQOA 2HBRA 4UATA 4ZFNA 3ETDA 4KQHA 1BMFD 3HA7A 5A03A 3AKDA 4G4SO 4RWZA 2EP8A 1OF1A 1XRSB 4TMKA 1GKYA 1J07A 3HDHA 2Q3DA 4KWTA 5A4MS 2WKSA 3FXAA 2OKGA 1D7AA 4O6VA 3C98A 1P75A 3PW5A 4ZEXA 2FMXA 2Z4TA 3GPDG 1TPZA 5KCZA 3ZDZB 6LDHA 3OU6A 3QMVA 5HZHA 4ZOEA 4DDMA 1ADYA 3HN7A 1ZOIA 1VZ3A 3HKDB 1QZ3A 2ACVA 1FDOA 3EVNA 3FNGA 2B34A 1NKSA 4WN9B 3U7IA 3RRMA 3RLFA 5DYYA 1E7RA 3DMHA 1GPDG 2D1SA 4RKEA 2XC9A 2D54A 4EY3A 2EJ0A 2VYQA 5J5VA 4RJJA 2QU8A 5JH7B 2HUNA 3X0DA 5AJUA 3OWXA 4WVFA 2BE7A 4JI6H 4NENB 4D9IA 1GGNA 2IA5A 1P0FA 3HPQA 1M76A 1UODA 2O7QA 1FU7A 1KS2A 621PA 1HQKA 2DR3A 4EMSA 1UT6A 5G0SA 5AM2A 5K0LA 5IAEA 5KI6A 1O8BA 3FM9A 3VI3B 1GT6A 5IJ0A 3VNNA 1Z16A 4CXMA 3H8VA 3FG9A 4LW8A 2HSJA 2MSLA 3SYTA 2XHZA 1CQZA 1HFWA 3VKVA 2I78A 1W73A 3WMRA 2HHHB 4MPPA 1Z2OX 2OC4A 3KYCB 1WW8A 1XZ8A 3LA6A 3HDVA 2QUIA 2Z98A 1N6KA 4XWOA 4A0RA 4R0MA 5BQPA 1L9KA 3KUCA 2ZRJA 4YR7A 1LV8A 4LYYA 4OI1A 1W5FA 3DQZA 3VJLA 2IQIA 3BB4A 3WHLA 2OGTA 4XX0A 1L7MA 1ZD3A 1T9CA 5DHSA 2ZB8A 3A1DA 3QYFA 3AIOA 2JGLA 5H80A 1MJFA 2J3JA 3IOEA 1FSZA 2DPMA 3WK8A 1L5ZA 4ZOLF 1H0SA 5IC4A 1I0LA 3VHQA 3EULA 3FZGA 4U9UA 2ZI6A 1UK6A 2I99A 5DEIA 3F6CA 3VR2A 5EL0A 1IN6A 5CBPB 4UCXA 3KQKA 2PLWA 2YZNA 2AL7A 2JFFA 3NLLA 1CRPA 2Q3CA 5JMOA 1VJ0A 4ECUA 1IK4A 2UYHA 3PC4A 2I4OA 2ZOSA 4JBNA 1IB6A 1VLLA 1COWA 2V4QA 5TF4A 4MJ7A 5IT5A 2Y6VA 5I01A 3UTCA 1T5TA 4J3JA 2ZJ4A 4DV0B 1QKKA 5BT8A 1V45E 1OI3A 3PHCA 3PO3G 4INJA 1H8HA 1K5GA 5JUWA 1Y7IA 2P3OA 1OIXA 1PKXA 5EMNA 2ATXA 2I03A 3EVEA 4ETSA 2J6IA 2W9CB 3GXOA 5IWAB 1X1SA 2Q8NA 3SHTA 1WPGA 3PEYA 1M2FA 4XX0B 2L2QA 1OXKB 3AINA 5AI4A 1L4NA 4RSGA 2QENA 4URZR 1DLIA 2Q7OE 1TJNA 4YALA 1P5RA 2HYIC 1JXOA 3I0ZA 4BKUA 1EVLA 2FZ4A 2JJ1D 1YVPA 3KUUA 1JNYA 1W0JA 2EG9A 5DLEA 2K2QB 1E98A 1QFZA 1O3YA 1USIA 1QCYA 3Q8QB 3UC5A 5EIEA 4IJWA 1QZZA 2B4YA 4KXUA 2BC9A 2NQTA 2VTDA 2O8VA 3QK7A 3O9MA 5JADA 4JXKA 4EYIB 3OO0A 2Q28A 2AMJA 1LPBB 2IP1A 2X9QA 4X92A 5AKZA 2EQBA 3EHEA 3E03A 1FL9A 1XQWA 4JVOA 4AJPA 1DKLA 3R7NA 4EVQA 1DX4A 1YZUA 3GJQA 5DV9A 2EGHA 1NW9B 3EA4A 4CIBA 1E6UA 1ZJ6A 2VYVA 1VL6A 4P93A 5DULA 1FTNA 1OZHA 4ZXPA 2XRZA 3F78A 2E37A 4XQ0A 2F1HA 1LLFA 4AWXA 1W34A 3S1SA 4I6JA 3MTQA 3PQ3A 4X3PA 5HKLA 3AJ8A 4EECA 4BO5A 3AC0A 2JATA 3UQYS 4ARSA 1Z0FA 2H2FA 5E9JA 4RULA 4AKSA 1DRWA 2CDBA 3HVIA 5LZ8A 1M2GA 3LXMA 4JUZA 1A9OA 4KIGA 2FGKA 2J30A 4NIMA 5A3JA 3AUTA 3DOEA 1UP6A 4L08A 3CPEA 3ZC3A 4DIDA 3PGJA 3BORA 2FK7A 1QG2A 5I9IA 3G8YA 4ZHQF 2WE6A 4Z9FA 2VK4A 1LS6A 4LPKA 5HR5A 2IS4A 2I6XA 1YC2A 3DHNA 1PR0A 2ECKA 1TCUA 3ZJ5A 2O50A 4TKMA 5ALMA 3J81k 1A4IA 3AFHA 4OXQA 1TOAA 4NARA 1BE6A 3RW9A 2HO5A 4F5ZA 5KBYA 4OLAA 2Y0PA 1YFLA 1JILA 4KPYA 3D5QA 5JZOA 5B55A 4V02A 2YMLA 3L0BA 3FVVA 1RMTA 2B4QA 1N5LA 1PS9A 2DP4E 4UBKA 4QOJA 1KFKB 2P3LA 4NFHA 1XHEA 3BICA 2RK3A 3WZ2A 3U16A 4GMXA 5L1LA 1N32H 5FD8A 5FOUA 4BO8A 1Y3AA 1Z17A 1WZCA 3ROPA 3DCNA 3L8CA 3GLTA 1T6YA 3HCRA 3REGA 4TMVA 3KKPA 3HEMA 2UYGA 3QWBA 2XUJA 3NNDA 3D6UA 3DBRB 3ZVKA 1I3CA 1N3LA 4OYYA 3ZHQA 3BMQA 3WYAA 4B76A 4HR7A 4IDQA 4BUCA 1PJ4A 2VUIB 3G49A 1Q3KA 1GR1A 4QASA 3ZWAA 3T5PA 3OOEA 1P1H