3W5OA

Crystal structure of human dna ligase iv
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
596
structure length
577
Chain Sequence
QTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEELDILIVGGYWGKGSGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords DNA ligase 4
publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
total genus 174
structure length 577
sequence length 596
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2013-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w5oA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w5oA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w5oA02
4JCVE 3STBD 3NBHB 1YHAA 1FVIA 3U50C 5D1OB 3H3VH 2IX0A 4A3FG 1VCIA 2D0OA 3T1YQ 1XNRQ 5DISC 3KOJA 2H5XA 1OXXK 1VQJA 1N33L 2IT1A 2JK8A 2MQHA 1SROA 1JJCB 1TWAH 2WFWA 4AH6A 3KLWA 3NC0B 2C35B 1X3FA 5EAYA 1XTDA 3L7ZC 2VQEQ 4UCOA 2B29A 4DR1Q 3OW2A 4A3EG 1PH1A 4LF4Q 1KRSA 2PQAA 1L0WA 4B3TL 1UE7A 4JI2Q 2B63G 1TAEA 1IL2A 4IFDI 3L2PA 3U58A 1L1OB 4JYAQ 4TQUS 1UWVA 4DR2Q 4BXXG 4A3GG 1P16A 4LFCQ 5H1SE 5HY6A 1K3RA 2E2HH 5IE8A 3PN1A 4DK3C 4A3FH 4DV5L 3G48A 2WP8J 4JI8Q 3J81j 1QVFA 4P73A 3GTQH 5FPOA 4R4IA 4YCUA 3S17H 4JV5Q 2A1AA 3TY5A 5GAGC 4DR3Q 4LF5Q 2GVAA 4YHHQ 5LMNQ 3HKSA 4HJAA 2GN5A 4O0AA 2Y0SE 4YY3Q 4A3EH 3GTMH 3UQ8A 2IX1A 3AFQA 2B63H 1EQQA 4UP9A 1CKNA 3F8TA 3CCJA 1BBWA 3GB8B 4BXXH 2F4VQ 2UUCL 4A3GH 3OYYA 1HZBA 2PMZE 5IYDG 4KI0A 1PA6A 3M4OH 2UXCL 1X65A 3VNNA 3TS2A 4HIDA 4OX9L 1YNXA 4GOPA 4A3DG 4JBJA 4DR6Q 2UXDL 1KAWA 2DUDA 4NXML 1N9WA 3HOVG 3CC7A 2R6GA 1L2FA 4AQYL 4YWMA 4GLVB 4IOCA 3RLNA 2FXQA 1PV4A 4EQ5A 4QIWE 3K0XA 3CCMA 3KJOA 3BABA 1N32Q 4DUYQ 3F2CA 1I94L 1IBLL 4YCWA 2LSSA 1EWIA 1EFWA 3OTOQ 4UPAA 3GTPH 4B3MQ 4A3LG 5LMUL 1ASZA 1C9OA 2VS1A 3JC66 3TS0A 3BZKA 3CW2C 5GAEC 4DV2Q 1SLJA 5IYDH 1FJGQ 1H95A 1D8LA 4R4OA 4GKKL 3KDFB 4A3DH 2PNHA 1G6PA 3CCLA 3GTLH 4PG3A 1PVOA 2DGYA 3UE1A 2Q2TA 1XK5A 4NPSA 3PO3G 3PGZA 3HOVH 4B3RQ 2I5HA 3ZJYC 3CF5A 1HNZL 4JI3Q 4DV0L 1VS0A 2AWNA 3W1BA 4X62Q 2ALYB 1KRTA 4DAYB 1O7IA 4A3BG 3PUXA 1PH6A 3PF4A 4JI7L 4A3LH 2JA6G 5M3FG 3UDGA 4JG2A 4YWLA 1X9NA 4Y7NH 1YIJA 2ES2A 2EIFA 4POGA 3GTOH 5M5WH 2BA0A 1E7ZA 3CCQA 1XPOA 4A3IH 2MFIA 1Y1WG 3A5ZB 5GQOA 4JBKA 1N33Q 1KIXA 3Q8DA 4JI5Q 4DV6L 2VL6A 2Z6KA 1RL2A 1HZAA 1UEBA 3FHWA 3AQQA 3H15A 4B3SL 4A3KG 3RTXA 1EQRA 1N36L 1Q86C 4JI6L 4B3TQ 3G4SA 4OO1I 1HR0L 3W1GA 5GROA 1EOVA 2YV5A 2GVBA 4OWTB 1X6OA 1NMGA 2JA6H 1GVPA 3T1HQ 5BR8Q 3HKZE 4DR7L 5J3BA 5JEAJ 4LF6L 2VQFL 4C3IH 3ICEA 4KHPQ 1Z47A 3M4QA 3K81C 4DV5Q 3TY8A 2HVRA 4WJ4A 1K83H 4DAMA 3BAAA 3D31A 3PIOA 2JA8H 2HIVA 3PUWA 5C3EG 4GLXA 3PF5A 3KYHC 4A3KH 5C0XI 5JEAG 2JA5G 3KF6B 4P72A 5HGQA 1HNWQ 1EYGA 2RHSB 4OXPA 1PH8A 1U5KA 1K8GA 3MXNB 4UY8C 4AYBE 5D1OA 2UXBL 3CAMA 4LUVA 4QGUA 2JJQA 4HIMA 4GN4B 2UUCQ 2AHOB 1X3EA 2UXCQ 2E5LL 5M3MG 4JBMA 3RZOH 4OX9Q 4LFAL 1HZCA 4OWXB 4X66Q 1L1OC 1WFQA 1SE8A 2UXDQ 5IY0A 4NXMQ 2AMCB 2YTXA 4AQYQ 3F1ZA 5C3EH 1X55A 4CC6A 1AE2A 4UP7A 2K14A 1R9TH 1VQ5A 2JA5H 1L1OA 3W5OA 4JI0L 3HOWG 2HVQA 2EQSA 2ID0A 1I94Q 4PZ7A 3S16H 4QJFA 2KENA 5GAHC 3TQYA 1C0AA 1PH7A 5IYBG 5JJKA 1NMFA 5LMUQ 1YJNA 1J5EL 1S68A 2VUGA 1KHIA 1OTCA 1VQ7A 3S2HH 3HOUG 2WAQE 1I5FA 4UCTA 5M3MH 1UE5A 3I55A 3VDYA 4GKKQ 1XJVA 3S1NH 1VQBA 3BU2A 3NENA 4NB3A 1OXVA 1W2BA 1YITA 2YTYA 4FDBA 1VQLA 4MNOA 2A19A 1KL9A 4GN3B 4R1JA 5D1PA 1VQFA 4DV0Q 3CXCA 1PH2A 2NVYH 4APVA 3HOWH 5E7NA 1Q82C 4LFBL 3PIPA 1KXLA 4BY1G 1E22A 2JE6I 1JE5A 1T9HA 2K4KA 1PFSA 3B6YA 4IPDA 3TREA 1U0LA 1QVGA 3TEHB 1NBWA 4P75A 4LWCA 5IYBH 4DV4L 1N8RC 1Q81C 5C0XJ 3A5UA 3DM3A 3HOUH 4QL5A 3CMAA 4GOPC 2A8VA 4UCSA 3I56A 2BA1A 4JI4L 5IP7G 1IXRA 2PI2E 1D7QA 5AJ3L 1EIFA 2L15A 2R7FA 4HJ9A 4LF7L 4UCRA 1A63A 1TA8A 3E9HA 2VY3A 5C0XG 2WB1G 1XMOL 4DR5L 1N34L 1M1KC 2JEAI 4B3SQ 3RLOA 3M3YH 4IOAA 1N36Q 3CCSA 4L5QA 4JI6Q 1VQAA 3J7ZC 1LM0A 4BY1H 4DR4Q 3E9IA 2IY5B 4BY7G 1AH9A 1QVCA 2N49A 1VQCA 3I4OA 4DV3L 1LTLA 3KDFA 1I6HH 1XNQL 3K7UC 3CPWA 1CKMA 3PUVA 5FJ8H 4OONA 4DR7Q 2D62A 3K80C 4LF6Q 1VQ8A 1B8AA 3RN2A 4OWWB 5IP7H 2QEXA 2UUBL 1PH4A 4LF9L 3S1QH 1YJ9A 4IFDJ 4A3IG 4YCVA 2K52A 3PUYA 2HIXA 3ERSX 3S14H 1FL0A 4DUZQ 4HJ5A 4O2DA 1VQMA 1VQKA 4NXNL 3LGJA 2PI2A 1Y1VG 4PZ6A 1NY4A 3G71A 3RN5A 2LXKA 3PUZA 3CCUA 4EFEA 1V9PA 2UU9Q 4BY7H 2OQKA 4IFDG 3UDFA 1B70B 2Q2HA 3I4NH 2R92G 1G291 2HVSA 4LF4L 3I7FA 4JI2L 1X54A 3SGIA 1B7YB 3HOYG 4LFAQ 2Z6KC 2HQLA 1Q12A 2XGTA 2UUAL 2K50A 2RCNA 3UE0A 2ZJRA 1ASYA 4LFCL 4MTNA 1NJIC 1GKHA 1Q46A 3S24A 2HHHL 4LF8L 5C4JH 1FGUA 1J6QA 1GM5A 1CSPA 2E8GA 2K5HA 4HTPA 5LMNW 2IHFA 1TXYA 1Y1VH 4GN5A 4JI0Q 4EX5A 2NVQH 4JV5L 3H0GH 1M90C 3BA8A 5C4XG 3TY9A 4K0KL 4LH6A 4R4TA 4EEQA 1S3OA 1EIYB 2R92H 2VW9A 3ULJA 2ZJQA 3CP0A 5C44G 1HJPA 3GO5A 1NTGA 4UP8A 2NN6I 1YI2A 2Y0SG 3U4ZA 3HOYH 3J7A5 1Q8KA 4JC0A 4A93G 3JAMi 1V43A 2V1CC 1I3QH 3CPFA 3EBEA 3KF6A 1K8AC 5JJLA 3BZCA 4P71A 1OXUA 4DPGA 2KHJA 4JOIA 3F2BA 1K0RA 4ME3A 1LYLA 2QGQA 2LXJA 1SRUA 3M85A 2Q2IA 4R4CA 4A3JG 1S72A 4LFBQ 5M5XH 5C4XH 3GDEA 5K36G 4DV4Q 4A4IA 5IWAL 3CMEA 1KQSA 5C44H 4HJ8A 4X65L 4GNXB 2KHIA 4JI4Q 3PO2G 2JA7G 4GKJL 3E0EA 1OXTA 4B3ML 2NVTH 5AJ3Q 3PV0A 3CCEA 5GADC 4A93H 1AE3A 2CKZB 4BA1I 4LF7Q 1V1QA 4POFA 1FJGL 4L5TA 1XMOQ 1N34Q 4DR5Q 1PYBA 4IPCA 1XMQL 1QUQB 2VZAA 4P74A 1SR3A 1X56A 1PH3A 2F52A 4UCUA 1WCMG 2JA9A 4JI1L 4A3JH 1VQOA 1CUKA 4C3JH 5IP9G 1XPRA 1IBKL 4LNQA 1EUJA 4HIOA 4B3RL 3ER0A 3UDIA 4QY7A 4A3MG 3AEVA 1I50H 4QQBX 1IBLQ 2ASBA 2K75A 3RR5A 4DV3Q 5FLXc 4HTOA 4ALPA 4H02A 1BKBA 1C7YA 3GTKH 1VQ9A 4BA2I 2QA4A 3PO2H 3GD7A 4A75A 2JA7H 2RHQB 3PCOB 2UUBQ 1VQEA 2B3GA 4LF9Q 1SFOH 1PHJA 3NELA 3ULLA 1KC8C 1OXSC 3ULPA 3I2ZA 1HNXL 4GS3A 1K9MC 4NXNQ 2N3SA 1YEZA 2CQOA 3JSLA 1VQDA 4X64L 1WCMH 1HNZQ 2N8NA 3NEMA 4JI5L 5IP9H 3J80c 2YYZA 2K5NA 1Y14B 2ZM6L 1PH9A 4BBSG 1X3GA 3PSIA 4OO1G 4A3MH 1VQNA 2VUMG 4UCVA 1B04A 1YVCA 2NN6G 4JI7Q 4CC5A 3WWVA 2YTVA 4LUOA 5DLQE 1UE6A 3CQZH 3I4MH 2F3IA 2AWOA 3BJUA 5FJ8G 1SMXA 1XDNA 2KBNA 2UUAQ 2R7ZG 3T1HL 1K73C 5ELNA 5BR8L 3FKIG 1W3SA 1JJGA 4IO9A 1LUZA 2R7DA 2PQAB 5FLMG 4KHPL 1P8LA 4LF8Q 4DV6Q 2HHHQ 1TWFH 4GLAC 4DV1L 2NZHA 3HKZG 4IJLA 1IBML 1MKHA 3M9BA 4DV7L 4BBSH 5JJIA 2RF4A 1WJJA 1VQPA 3HOZG 1E3PA 4K0KQ 4J15A 2VUMH 4L5SA 1HR0Q 1E24A 4X6AH 4E6NA 1Q1BA 3I4NG 4LUZA 4PMWA 1HNWL 2MNAA 3KFUA 2HT1A 3GJXB 4RG1A 4XIGS 2OTJA 3DLLA 2VQFQ 3CC4A 2R7ZH 1E1TA 3FKIH 2R93G 4AYBG 1WYDA 3JAMc 5FLMH 1IYJB 3CCVA 1CKNB 1GD7A 2JEBI 1PYSB 4XTCS 4X66L 2XTIA 2E2JH 3T1YL 1XNRL 3CC2A 1VQ6A 3J80i 3H3VI 3HOZH 1UE1A 1VQIA 1PH5A 4EFBA 3H0GG 5IWAQ 1YBYA 1YZ6A 4WJ3M 1NE3A 1HZ9A 4GOPB 2UXBQ 3J81c 4X65Q 2VQEL 3S15H 1BVSA 2ZTEA 4DR1L 2OQ0A 3KJPA 4GKJQ 4Y52H 3BA9A 5FPRA 4RMFA 1JB7A 2BH8A 2E5LQ 1JT8A 3S1MH 1YJWA 2CWAA 2R93H 4C3HH 2MO0A 4JYAL 4TVAB 4DR2L 1XMQQ 1JMCA 3U4VA 1XPUA 4LH7A 5IT9c 4HJ7A 3EN2A 3CD6A 2D0PA 4JI1Q 2WAQG 1A62A 1IBKQ 1YHQA 1A8VA 4JI8L 1E1OA 3M4PA 3RNUA 2NVXH 4DR3L 1Z9FA 3A0JA 2I5LX 5IYCG 4LF5L 1GO3E 2JQOA 4YHHL 5LMNL 2N78A 2YU9H 3RLFA 4DK6C 1J5EQ 1VQHA 2EXDA 4YY3L 2ATWA 3JSNA 1BBUA 1VQGA 3M7NA 1KD1C 5M5YH 2K5VA 3A74A 4A3CG 4IPHA 2OTLA 3FP9A 4JOIC 4BBRG 2KCTA 5ELOA 1RIPA 1JJ2A 4GNXC 1HNXQ 2I0QA 4L5RC 2F4VL 1SN8A 4DRFA 4X64Q 1IZ6A 1DGSA 3PO3H 2ZM6Q 1YHBA 4KHZA 3S2DH 4GNXA 4DR6L 3D0FA 1MJEA 4IPGA 1HR0W 2VNUD 4UFZA 2IHEA 3L0OA 5IYCH 2CCZA 3K8AA 3KF8B 2E2IH 2ZTCA 4KLKA 3J81i 1Q7YC 4DR4L 4A3BH 1MJCA 4JBWA 4YWKA 1QZHA 4DUYL 1TWCH 1CSQA 3CCRA 1N32L 3NBYB 2OWOA 1QUQA 3HOXG 5M3FH 1QZGA 4A3CH 2KCMA 3OTOL 3S1RH 3GTGH 3K7AH 3UDXA 4AIMA 2WB1E 1TWHH 1WI5A 1WOCA 4IJHA 4BBRH 2JA8G 2AKWB 4DV1Q 3AFPA 4HIKA 1VQ4A 4DV2L 1Y1WH 2MO1A 4DNIA 1IBMQ 4DV7Q 3IRBA 3EIVA 2CWPA 4R4QA 4C2MH 2ZTDA 1G51A 3MEFA 2ZJPA 4DUZL 3TRZA 3G6EA 4DKAC 3GTJH 3F2DA 2I5MX 1S40A 4JI3L 2CFMA 1Q1EA 1HH2P 3HFZB 1CKOA 2Q2UA 1XNQQ 3QWUA 4A76A 2UU9L 4X62L 4PZ8A 3STBC 1TWGH 2Z0SA 2BH2A 3HOXH 1A0IA 2OCEA 3AYHB 4MZ9A 3I4MG 3RZDH 3NBZB 2NZOA 1MIUA 4LW1A
chains in the Genus database with same CATH superfamily
4CKCA 4A3EB 2F0WA 1FVIA 4U68A 1PRTD 4RGMA 1EEID 1EYZA 5DISC 1AEXA 3NE5B 3KOJA 2CQAA 4FNFA 2PPBC 1OXXK 5EKLA 2IT1A 1SROA 2R7ZB 1K3BC 4A3GB 1X3FA 4MHEA 2E2DC 4O7YA 4UCOA 1D1IA 1KRSA 1UE7A 2HD3A 4IUTA 4JI2Q 4EQPA 1JWMD 4IFDI 1EKVA 1ET6A 4BS9A 4PV1C 4ZKCB 1L1OB 4TQUS 1UWVA 4BXXG 4ME5A 3MWDA 5J39A 3RFCA 5KX5F 2N88A 5HY6A 1K3RA 5I5UA 2L1BA 3PN1A 4DV5L 1HQRD 3J81j 1B1ZA 3I72A 1QVFA 3GTQH 2QB5A 2EOTA 1PTOF 4YCUA 1BO0A 3TY5A 1WRVA 1W6KA 3BVGA 3S1MB 4CMDA 4LF5Q 1EZ8A 4I55F 3OUUA 4C3HB 5LMNQ 4KN4C 3T56B 3HB9A 1HTPA 1DV1A 2HHFB 1CKNA 5D8DA 1AW7A 1SYGA 1V1PB 2DY7A 2UUCL 3VPDA 4KI0A 3M4OH 2YU9B 3IFTA 4OX9L 1YNXA 2UXDL 1LT3D 4HQ6A 1N9WA 2R6GA 3HBLA 3RLNA 1PV4A 3T7AA 4EQ5A 4QIWE 5BWUA 3RUPA 4YCWA 3QJYA 3PO3B 3OTOQ 1Q8IA 1EQVA 4UDUC 4B3MQ 4A3LG 1ASZA 1KDBA 1SLJA 4V0BA 5IYDH 3C1FA 2E2IB 1M4VA 1U4MA 1H95A 3TW7A 2FPIB 4GKKL 2BOSA 3KDFB 4A3BB 1G6PA 2K5DA 1PVOA 2DGYA 5C5MA 1ENFA 1LTAD 2NBFA 3HOVH 3GTGB 3K7AB 5E25A 3CF5A 2K6AA 5BWRA 3SE0A 1EZ6A 5CR3A 2ALYB 5BPFA 1K83B 3IFDA 5FO8B 1IYEA 5TSSA 4DAAA 4ME6A 1BF4A 3E3XA 4JI7L 1LTRD 3E0JA 3V4SA 2F0SA 5IGEA 3UDGA 3LWUA 4JG2A 3A8JE 3E6ZX 4YWLA 3J7AF 3MWYW 4C3IG 1B4OA 1E7ZA 3CCQA 2L55A 1HPCA 3KF8A 1TWGB 1N33Q 1CQJB 1KJ9A 3TN2A 4DV6L 2EYJA 2B8FA 3GQBA 4MV8A 3AQQA 4B3SL 4A3KG 5IT9L 5T1IA 4OGQC 4B3TQ 1KJQA 3W1GA 1F9SA 5C3WA 2ODTX 1NMGA 2JA6H 1KBLA 2KJXA 3R5XA 1CHPD 3WWHA 4N8X1 1WTRA 3QWNA 2AQ2B 4Q0FA 4B9XA 3CEBA 4DAMA 1UAPA 1SXTA 1CHQD 3NXWA 5JEAG 2JA5G 3KLSX 5HGQA 2W6OA 2O5JC 1SSOA 4RGNA 3DEOA 3GTQB 1CA5A 2UXBL 3K5LA 4X3KA 3H09A 2Z8LA 5M3MG 2X0SA 5I5YA 4NKLA 3OPOA 1HZCA 4X66Q 1SMYC 4KD4A 5IYZF 1O7ZA 1HCZA 5IY0A 4M0JA 2KVMA 2AMCB 5E4WC 1X55A 4TUYF 2K14A 5C1OA 3D4WA 1L1OA 1XXGA 2EJ0A 3M4OB 3S16H 4ZOLF 2KENA 4FO2A 1CTMA 1SE2A 2YL2A 1PH7A 1NMFA 1J5EL 2F0QA 1OTCA 3AMUA 3S2HH 1K8MA 3ND8A 1UE5A 1STHA 2SNMA 3BU2A 1OXVA 2HHFA 5LA6F 1VQFA 4DV0Q 1PH2A 1JE4A 2PYKA 3VYSA 5E7NA 4XT1B 1T9HA 2XD4A 4Y8VB 3TREA 1U0LA 4P75A 4LWCA 1MI2A 5BWTA 3MXUA 5CV6A 4KN7C 3HOVB 3PMFA 1G91A 3K5NA 1U4LA 1I2KA 4GOPC 4UCSA 2F0TA 4RZQA 1TY2A 1J9OA 3PIO3 5K3WA 5IP7G 1IXRA 1RODA 2ZDQA 5AJ3L 1WVLA 1WTXA 4L6TB 2I07B 3CHBD 4HJ9A 1S5CD 1XMOL 2VY3A 3SHLA 1JORA 1GOZA 4FF1A 3J7ZC 1LM0A 1Y69U 4DR4Q 4O7WA 2IY5B 1QVCA 5I60A 1VQCA 1ICWA 3KDFA 1XNQL 1I6HH 3K7UC 5CR5A 1SCUB 4R9WA 2D62A 4LF6Q 1VQ8A 4OWWB 2UUBL 3ONAB 3RMHA 5BWVA 4IFDJ 1EFID 4A3IG 2A1HA 2K52A 2HIXA 1ESRA 3K5OA 1OO9B 1UEAB 2B2YA 1FL0A 2EIYA 4HN2A 4HJ5A 2JA6B 4O2BF 2B2UA 2EDGA 1HRJA 2PI2A 1Y1VG 2G5DA 4EFEA 4FFNA 1F77A 3I4NH 5BMVF 2R92G 1DXMA 3VR5A 5IGGA 4JI2L 1JDEA 1S5FD 1A3GA 4ODGA 3HOYG 2Z6KC 2HQLA 1Q12A 2X6GA 2C5CA 2K50A 2ZJRA 2X6LA 4O81A 5DM73 2V5AA 3PIP3 2M9VA 1V1OA 1J6QA 1FGUA 2XRSD 5CV9A 4HTPA 5LMNW 3NBZB 2IX3A 1C4QA 1O80A 2MGSA 3I8ZA 4EX5A 4A93B 5CMDA 1G2SA 4H0LC 2KEDA 4OELB 3DF7A 4MA5A 1SYDA 2ZDGA 4YAKB 1QOHA 5DEHA 5C44G 2ZJQA 2D9UA 2Y0SG 3OIPA 3U4ZA 2FPGB 5I4DA 1I50B 3S16B 3KREA 3EBEA 3IKJA 3NHHA 3LNNA 1OXUA 2QCPX 1DYQA 3S2HB 4ME3A 1LYLA 3BABA 4HMIA 1SRUA 4MA0A 1S72A 3VR4A 4RKBA 5LHY1 4ZKBB 5IWAL 3CMEA 2CVRA 4KTAA 2G9HD 4OEMB 1BNZA 4JI4Q 3PO2G 5I9PA 2JA7G 4GKJL 3E0EA 1OXTA 4B3ML 2CKZB 4DU9A 1HA5A 1W96A 4CMFA 4LF7Q 1V1QA 2KA7A 4DR5Q 1PYBA 2RDHA 4RFBA 1TKWB 1X56A 3A56A 1WCMG 3TY8A 1BCPB 4A3JH 4C3JH 4N8FA 5IP9G 1IBKL 4LNQA 1EUJA 3UDIA 1A0GA 2K75A 4KY5A 1A48A 4ALPA 2WKCA 3V4ZA 2HCCA 2B3GA 2VPQA 4LF9Q 4MV9A 1PHJA 3ULLA 2MJ8A 1GUWA 1HNXL 4GS3A 4NDXA 1UUPA 4NXNQ 3JSLA 3K3PA 1IW7D 1HNZQ 3VR6A 5IIFA 4O42A 4OO1G 3TY9A 1QE6A 3AW8A 1VMCA 4A3MH 1VQNA 2KECA 1B04A 1SBBB 3D4DA 3BYYB 4CC5A 2W6QA 4LUOA 5DLQE 3I4MH 2AWOA 2UUAQ 2R7ZG 1EOTA 4DQNA 1JJGA 4IO9A 1LUZA 1II3A 2PQAB 3R2TA 5FLMG 3I4NB 1P8LA 2HHHQ 3HKZG 3K57A 4RGOS 2ZXRA 2H1EA 1AFPA 4K0KQ 2VUMH 2NUAB 2DAAA 1LV9A 1ET9A 3R8BA 4ZUIA 3SE7A 3VA7A 5CV8A 2DZDA 2NTTA 2F3WA 2X5RA 2HT1A 3GJXB 1XWEA 5EKKA 4IWYA 2OTJA 2YZLA 3U0GA 4XYQA 4QCLA 3WDNA 5JOBA 2JEBI 1PYSB 4X66L 2E2JH 3T1YL 1NAPA 1F9RA 3MC0B 1NE3A 5JVLA 4X65Q 3S15H 4DR1L 2OQ0A 4Y52H 3BA9A 1JB7A 1EYCA 2VB3X 1JT8A 2FP4B 3MHBA 1YJWA 4FF3A 1JLLB 3UFXB 4RH6A 3G7LA 4TVAB 1HA6A 1XPUA 4LH7A 1STNA 5IT9c 1VF7A 5DAUA 1I6VC 3VR2A 1A62A 1FR3A 5JH7F 3JAML 3ORQA 4DR3L 1Z9FA 1GXDC 1GLVA 1TU2B 4G7ZC 5J2UF 4HSPA 1VQGA 5M5YH 4A3JB 4C3JB 3GTJB 1B9NA 3NTKA 4K6NA 1LTGD 4X64Q 5G3LD 3MA2B 1SYEA 1PLFA 4GZYC 1A2TA 4DR6L 2Z4HA 3NUAA 2VNUD 3KUPA 3L0OA 5IYCH 1JDBB 2CCZA 1EY8A 4KLKA 1IL8A 4DR4L 4IUNA 4YWKA 3E5SA 1N32L 5KNBA 4DUYL 1CSQA 5M3FH 3HOXG 1QZGA 3S1RH 1YNJD 1BCPD 3N52A 3MTSA 2WB1E 1TWHH 3A8KE 1F9PA 4BBRH 3CU7A 4A3MB 4ILWA 3UZOA 4DV1Q 4HIKA 1Y1WH 3IAYA 1WD0A 1GSAA 5IT9E 3I4MB 3EIVA 4C2MH 3TRZA 2ZJPA 1ENCA 4NW2A 2K03A 1DZ1A 2KHSA 1S40A 1KNEA 4CJ2C 5DMXA 4E4TA 1HH2P 4C1NK 4PZ8A 5JQWA 1PRTC 5I5XA 4MZ9A 3RZDH 1BNCA 1MIUA 3TIGA 2F0VA 3NBHB 3X3MA 5KIXA 2YRWA 3DAAA 2IX0A 3K5IA 1VCIA 2D0OA 1XNRQ 2A6HC 4O7TA 2E76C 1L0XB 2KCCA 4AH6A 2WFWA 1T5XD 3NC0B 3J7YW 1DOKA 1B53A 3DWPA 2PQAA 1L0WA 4L8JA 2E2JB 5BN3A 1IL2A 1TAEA 2HGSA 4O4JF 4HMJA 1I4XA 3U58A 3JZ6A 1OBDA 4JYAQ 1GUGA 1P16A 4LFCQ 1TS4A 5H1SE 4YBZB 2E2HH 2CNQA 1KABA 4KKTA 5EBCA 4DK3C 4DK0A 4A3FH 3S15B 3G48A 2WP8J 1IOVA 4P73A 5FOBB 1CS0A 4DK1A 4DNRB 5GAGC 3LP8A 2GVAA 1C3OA 4AYBB 1HQMC 4YY3Q 4A3EH 1JICA 5K2MA 4CJ0B 1STGA 3KLSA 3J80L 3AFQA 2B63H 5KYIA 3SDZA 1IYUA 3GIDA 1PRTF 4PBCA 5EZYF 1BBWA 4O2AF 4MTKA 2F4VQ 4A3GH 3OYYA 3U9TA 3T16A 5IYDG 1PA6A 5DM63 4EGQA 4JXUA 2F0DA 2AQ3B 2KUMA 2Z04A 5M5YB 2DUDA 3HOVG 3CC7A 4AQYL 3P1HA 4GLVB 5KGUA 4IOCA 1PTOH 1ILQA 4MV6A 5KYLA 2FHTA 1D1KA 3QOJA 2WAQB 1EWIA 2F3VA 3L9AX 5LMUL 1C9OA 3TS0A 5GAEC 1KLUD 1FJGQ 4M8AA 3TIIA 4TRDA 1U4RA 1SDFA 3SXHA 4A3DH 3GTLH 4PG3A 2Q2TA 3PGZA 5M3FB 4B3RQ 3S1RB 4RHSA 1UC9A 1HNZL 1ILPA 3SEBA 3A54A 1TWHB 4BBRB 4JI3Q 3K5HA 4C5AA 1VS0A 2AWNA 1S4ZA 2B2VA 1EY7A 5FKAC 4X62Q 1Y1WB 2YZMA 1KRTA 3LULA 2RSNA 2IL8A 4FVMA 4DAYB 3VYUA 1BXRA 2PNRC 3PUXA 1GSHA 5BWXA 2R87A 4C2MB 5EBDA 2JA6G 1TT2A 2EJ2A 2ES2A 1X9NA 1S5ED 3I4LA 5LL6S 3J81L 1LTBD 4POGA 5M5WH 1XPOA 2MFIA 3R93A 2TMPA 3A8IE 3SK4A 1SNQA 2WINB 4JI5Q 3P20A 1RL2A 3RZDB 1EUDB 3FHWA 3BDCA 1I1KA 1N36L 1Q86C 3G4SA 1CQIB 4K8JA 2RDFA 1EOVA 3GV3A 2GVBA 4OWTB 1XYIA 3RD4A 3FDTA 3T1HQ 4FFLA 5BR8Q 3QOLA 1F2LA 4DR7L 1KDCA 5J3BA 2MUYA 4TKOB 3ICEA 1PZID 1Z47A 3K81C 4WJ4A 1K83H 5I9OA 2J9GA 1Z7TA 2BE5D 2JA8H 2HIVA 1LTID 3K58A 3LWEA 1RJTA 1TIID 4FFPA 1EWHA 4OHJA 2E2HB 4IUUA 2A68D 4NYEA 4A3FB 3MXNB 3NBHA 3MFGA 4UY8C 2OLSA 3FPUB 3NK9A 2JJQA 2CH4W 4GN4B 2AHOB 1X3EA 2EJ3A 2UXCQ 2W6MA 4JBMA 1BBXC 4NZNA 3OHXC 4OWXB 1L1OC 5CYUA 1WFQA 1RD9D 2B63B 4NXMQ 4H13C 4DAPA 4CC6A 4UP7A 3R23A 3HGBA 2HVQA 2EQSA 4ZAIA 1I94Q 1KTAA 4KMUC 2R3ZA 1C0AA 3MAQA 2K01A 5LP6F 3JRWA 5D3IB 2A69D 1EKFA 1MD2D 3OIQA 1SNPA 4B08A 3VDYA 2F1MA 1PTOB 3TINA 1VQBA 1VF5C 2B2WA 4RWSC 4NB3A 4OIJA 3MWEA 3HZXA 2YTYA 2DJFC 2Z6BA 2A19A 4R1JA 5IGFA 2G9DA 3CXCA 4APVA 1Q82C 4LFBL 4HNUA 1E22A 3B6YA 2K4KA 4NZOA 4A3DB 1B6RA 1NBWA 3GTLB 1N8RC 4DV4L 3VYRA 4IWXA 4ZQ3A 5C0XJ 3DM3A 4CHTB 3WOFA 1PMRA 2AUJD 4DAVA 2QDLA 2R7FA 3R3OA 3U55A 1A63A 1TA8A 2E74C 1TS3A 2CH4A 5IOCA 3RLOA 3CCSA 3EJIA 4JI6Q 1VQAA 5I5WA 2FMCA 1I4RA 5M5WB 3E9IA 4HSVA 1BQQT 3SK8A 1AH9A 1W6JA 4WBNF 2N49A 4F87A 1LTLA 2ZGIA 2Q8IB 3C3LA 2COGA 2KQ3A 2QEXA 3KK7A 3TP5A 2EY2A 2K28A 3S14H 4LK1C 1CM9A 4ZUJA 1I7LA 4FFOA 2R82A 4V190 4DAYA 5C0XH 3EROA 1FNVA 4HR7B 2OF1A 4PZ6A 5ELFA 5A2QL 3G71A 1KJJA 1STYA 2LXKA 4F88A 2OQKA 4IFDG 3UDFA 4FF2A 2Q2HA 4O84A 1GHKA 1MGSA 2JA8B 4XYLB 4RCOA 1IYVA 1B7YB 4LFAQ 2IWHA 2ENBA 4LFCL 4MTNA 1NJIC 3I12A 1GKHA 1UNSA 3PQIA 2K5WA 1JQYD 1Y8PB 2WACA 4JI0Q 2IHFA 4GN5A 2GA4B 1PZJD 2W6PA 2ICEC 4FFRA 2A73B 2VW9A 2RVLA 1DD2A 3ULJA 2PN1A 4UP8A 1B2TA 2HG8A 4JC0A 1JWSD 3TP6A 2V1CC 3JAME 1K8AC 3QB3A 2C9OA 3MXNA 4P71A 2WIIB 4JOIA 1K0RA 1Z2PX 4A3JG 4C3JG 3M85A 4R4CA 5M5XH 5C4XH 4ZLTF 3GDEA 1SYCA 1WTHA 3HP3A 5K36G 5DGHA 5LXTF 3T13A 1KQSA 4R8IA 1E2ZA 3H6MA 4K6LA 4GNXB 3JZFA 1IKLA 2KHIA 2AUKA 2CW0D 2NVTH 3PV0A 4A93H 3N6RA 1FJGL 4L5TA 2QILA 1N34Q 1XMQL 2CNUA 3QQMA 4CDEC 4B3RL 4A3MG 1I50H 1IBLQ 2ASBA 4DV3Q 2DIKA 4HTOA 1PTOD 1TWFB 4LJZC 4HAEA 1C7YA 1LT5D 1VQ9A 2EY1A 3PCOB 5CB4F 1VQEA 1MSHA 1IW7C 3T9FA 4R8NA 1SFOH 3ULPA 1K9MC 2NUCA 2N3SA 4XYOA 1VQDA 3TMEA 1HUNA 4ZK9B 2Q8RE 4K5VA 4JI5L 3NEMA 5JPNC 3J80c 2ZM6L 3PSIA 2RSOA 4WFN3 2VUMG 1X3QA 3TBIB 3NPPA 3S14B 2EYFA 3R5FA 4C5CA 3BG5A 4J1MA 4G7HC 1UE6A 3CQZH 4O83A 3BJUA 5FJ8G 2R7MA 5J22A 3T1HL 1K73C 5ELNA 1R4QB 5BR8L 5C5LA 3Q2OA 2I80A 4FXDA 4LF8Q 5FNVF 2B2TC 2NZHA 1BUVT 1MKHA 4DV7L 1A6XA 1X3PA 1VBHA 1VQPA 4L5SA 3R5HA 2EXZA 2F03A 1Q1BA 2NN6H 3ERQA 2GQSA 4O7LA 5C8YF 2VQFQ 1KUTA 4HR7A 2L11A 2HDKA 2BCOA 4AYBG 1WYDA 3EA6A 1IYJB 5I47A 2NWGA 5I5TA 4O4IF 2EYMA 3TZDA 4XTCS 4K2KA 3CC2A 3HOZH 1VQIA 4IUQA 2F4IA 5F2DA 1PH5A 4EFBA 3H0GG 3J80E 1YBYA 1H9JA 4GOPB 3J81c 2PZTA 1XTCD 5FPRA 4HCEA 2ZXOA 4YJ2F 3H3VC 4DGZA 3K6OA 1KJIA 5M5XB 5C4XB 2CWAA 2R93H 2HQEA 1JMCA 3L3OC 3M7GA 4K14A 3G6JB 1RDPD 5I2XA 3EN2A 2D0PA 4JI1Q 2WAQG 1YHQA 1A8VA 2VR1A 4WJWA 3CRKC 5CGKA 3RNUA 2NVXH 1ZXTA 2NVTB 1EZ1A 2FMMA 5BN4A 3MJFA 2N55A 5IYCG 2I5LX 3D6CA 4LF5L 1GO3E 5LMNL 2N78A 2EXDA 2SOBA 3JSNA 3M7NA 2EYLA 3T51B 1A3TA 1JOOA 1QCBD 3FP9A 4BBRG 2I0QA 5ELOA 1RIPA 2W6NA 2YS7A 4MV1A 3NBIA 4L1KA 4QIWB 3S2DH 4GNXA 4BWGB 1NNXA 2NYZD 1HR0W 1E2WA 2Z9HA 1SFOB 5DNFA 1YNJC 3AU7A 1BCPC 4X3SA 4EGJA 4XQJA 1MJCA 4RKLA 3KLRA 3J81E 5KNCA 2X69A 3BZDB 3T4AC 4A3CH 4RCNA 4XZ3B 1DOLA 2B8GA 2KCMA 3OTOL 3OWFA 1GHJA 5EKIA 4Q4DA 3R2IA 5DAAA 1CE8A 2MO1A 1IBMQ 3OW7A 1RKNA 3CQZB 1M0TA 3IRBA 2ZTDA 3MEFA 3GTJH 2YS6A 4G57A 2XCLA 2CFMA 1Q1EA 1FGBD 3HFZB 3V2TA 2Q2UA 3U9OA 1DONA 1F2ZA 3UYYA 2OCEA 5G3LF 2IHEA 2TSSA 4LW1A 2HGXA 1WTWA 1F9QA 3STBD 1HHVA 4A3FG 4H44C 4ULLA 2H5XA 1N33L 2K33A 2MQHA 5BPHA 2K1BA 3KLWA 1EYAA 2F0LA 1XTDA 2VQEQ 1I4QA 2B29A 4A3EG 2JYOA 1PH1A 3JZIA 2M00A 4B3TL 2MPMA 2B63G 2ZDHA 4FU0A 3L2PA 3HOZB 3FVQA 3WWJA 5IGDA 4DR2Q 3Q6SA 4A3GG 2LMCB 5E3FA 5IE8A 1A15A 1I1LA 1YNNC 4JI8Q 5FPOA 4R4IA 4HCSA 3S17H 5I2YA 3VYTA 1H9KA 3I90A 2R93B 4YHHQ 2EE1A 3HKSA 4HJAA 2Y0SE 1GJXA 1ESFA 3D4RA 4H7BA 3RUZA 3GTMH 3UQ8A 3K0YA 2IX1A 1DOMA 3EQLC 5DGIA 1EY9A 3F8TA 4OIKA 4X3TA 2NVXB 2C00A 3HEJA 2E75C 2F0UA 2QEJC 4C3HG 1EEFD 4O1NA 4CHIA 5EGTA 2YZNA 4RHRA 1S5DD 4GOPA 4A3DG 1E4EB 1EU3A 4QB4A 4IUVA 4ZYSA 1IYDA 1KAWA 2F0IA 1L2FA 1SYFA 4YWMA 5LL6X 1ZKOA 3CCMA 3C2PA 2CNVA 3F2CA 4C5BA 1IBLL 2JSOA 3MXPA 1EFWA 1LABA 3S2DB 2VS1A 2EY5A 1SNDA 3BZKA 4DV2Q 4LAAA 3W3AA 1A3VA 2B2VC 3PO3G 5JVDF 4B9WA 3NQTA 3LQSA 3ZJYC 1ET0A 1KNAA 1C8CA 4IHJF 4DV0L 3W1BA 3O13A 3MVVA 4A3BG 1LTTD 4JPBW 1PH6A 3PF4A 4FF4A 3KBGA 3ZYYX 4CKEA 1YIJA 2YZGA 2BA0A 5D3DA 4A3IH 2I8CA 1E2VA 1SJHD 4QUCA 5A2QE 3Q8DA 2NU8B 2VL6A 2Z6KA 1WTPA 2EPBA 2PBZA 1GUSA 1HZAA 1R4PB 3AB9A 3H15A 5I5SA 1EQRA 1H9SB 3C1EA 1DIKA 5GROA 2L12A 1VBGA 3HKZE 2BE5C 4LF6L 3MEHA 1PXUA 3TSSA 2VQFL 3M4QA 4KHPQ 4DV5Q 3WO1A 2EYPA 2HVRA 1NR2A 2SDFA 4O7VA 2A68C 4GLXA 3PF5A 3KYHC 5M3MB 5C0XI 1TS2A 4KK7A 2XNAC 1HNWQ 1PH8A 1O7YA 1U5KA 4KHVA 1K8GA 4TVIA 3URYA 1V8QA 3CAMA 4QGUA 1JOKA 2O2LD 2BDOA 3S17B 4HIMA 2UUCQ 3U9SA 2J4XA 1PYWD 1VMPA 4I4TF 1HFNA 4FXGC 4PNYA 4OX9Q 1FNUA 3GTMB 1S5BD 2UXDQ 1SE8A 1EWCA 2YTXA 1KTKA 5C3EH 1AE2A 1SYBA 1R9TH 1QNKA 1EIGA 2VB2X 1VQ5A 5JAVA 2A69C 2DNEA 4PZ7A 2L4NA 4QJFA 5GAHC 1O78A 5JJKA 1YJNA 2VUGA 2M2LA 1VQ7A 4N9PA 5BN5A 3GLKA 1I5FA 3T9AA 3I55A 4GKKQ 4GLWA 1WR2A 1ZYRD 4KY7A 4UAIA 1AZQA 2PQEA 5EJWA 3NQIA 4ZCKA 1W2BA 1YITA 3V05A 1VQLA 4MNOA 4GN3B 5D1PA 2R7NA 4Z9CB 3HOWH 4NZMA 2AQ1B 2K04A 1PFSA 4YAJB 3TEHB 3I73A 5IYBH 2KOLA 3I3CA 3ND9A 1E4EA 4U673 3HOUH 4K5XA 2XIWA 2XN9C 2BA1A 4JI4L 2KEEA 2PI2E 1A2UA 3A55A 4LF7L 5I6WA 2YW2A 1M1KC 5C0XG 4DR5L 4IOAA 3M3YH 4B3SQ 2V58A 4ABNA 4YB8B 4L5QA 4CJ1B 4BY1H 4A3IB 1PFBA 2QK4A 5CA1F 3RV3A 2F0FA 2RKSA 3CPWA 1CKMA 3PUVA 4OONA 4MV3A 3DUZA 4E6IA 5I6YA 5CM0A 1PH4A 4LF9L 1IHZA 2XRQD 1WTQA 3PUYA 3ERSX 3DTGA 3CKIB 4O2DA 1VQMA 1VQKA 1BOSA 4NXNL 2Z4IA 3LGJA 3RN5A 1NY4A 3NWTA 3PUZA 3CCUA 1CQFA 4QF4A 1V9PA 2UU9Q 4BY7H 2ZT9C 3GP7A 4DXFA 2D5DA 1G291 3T54A 3I91A 2HVSA 1B44D 3I7FA 4QSHA 3VPCA 1BR9A 3OSOA 5I5VA 2UUAL 1ASYA 1H9SA 3DMUA 1I2LA 4OL7A 5HV6A 1JCKB 4K6DA 3S24A 2HHHL 3A7LA 3BA8A 1CSPA 2K5HA 1D6EC 5C4XG 4K0KL 4LH6A 4R4TA 4EEQA 1Y8OB 1S3OA 1EU4A 1EIYB 3VR3A 2WKDA 2OEOA 3CP0A 2PVPA 1WTOA 1NTGA 5C3EB 2NN6I 1YI2A 2NU6B 1R9TB 1GUTA 4IZ8A 1D2BA 3HO8A 2NZ1D 1Q8KA 2J7ZA 1VDZA 5J1ZA 3JAMi 4A93G 3CPFA 1I3QH 5T1GA 4O86A 4KJOA 4DPGA 5CBEE 2XVSA 1D5ZC 1PDQA 3F2BA 2LXJA 2F0MA 3E5NA 2CW0C 5IGCA 2EVBA 5E4XA 4HJ8A 4X65L 2R7KA 1HUMA 1OBGA 3P75A 3HOWB 5AJ3Q 3GV6A 3CCEA 5GADC 5J2TF 1AE3A 4BA1I 5H80A 2NU7B 1XMOQ 5L37A 4IPCA 3NUCA 1PH3A 4EQOA 2F52A 3HOUB 1VQOA 1C30A 2FPPB 3C46A 2OT2A 2YWVA 3AEVA 4QQBX 5EPLA 4I50F 4N9TA 1KAAA 1EIHA 1KJ8A 2RBMA 5A35A 4H02A 1BKBA 1AUXA 4DNTB 2PCFB 4BA2I 2QA4A 3M3YB 4Q5VA 2UUBQ 1QG7A 3T9EA 3DXJC 1EQTA 4BY1B 2LKVA 1KC8C 1OXSC 5BYBA 5KNDA 2CQOA 4X64L 1LACA 2N8NA 3T9BA 3LX0A 1PH9A 3BVMA 1X3GA 4IUPA 2O5IC 2A6HD 5JJZA 1STEA 2NN6G 4XQQA 2HDMA 3HKZB 3X3NA 4DFAA 2O4XA 2WB1B 2YTVA 2EYOA 1IOWA 2F3IA 3ITPA 3DWQA 5CORA 4HNTA 1TY0A 4BY7B 4KHPL 1TWFH 4DV1L 1QJOA 1FD7D 1SNOA 2J0TD 4BBSH 5JJIA 3HOZG 1WJJA 4J15A 3D8GA 1HR0Q 4EG0A 1E24A 4X6AH 4IURA 3I4NG 1HNWL 5ELDA 1M0WA 2A6ED 2MNAA 3KFUA 1B50A 2EJMA 5CA0F 2A5HA 3NP8A 2B2YC 3CC4A 1E1TA 3FKIH 2R93G 3TEKA 3IL8A 2B2UC 3JAMc 2R86A 4WRDA 4JW0A 4DIMA 1XNRL 4LMQD 1VQ6A 3J80i 1UE1A 5CAEB 1SAPA 1F2YA 1B9MA 2DJGC 5IWAQ 4DXGA 1YZ6A 1I3QB 4CDDC 1BVSA 3DEPA 4I7AA 4GKJQ 4PMCA 4KD3A 1LT4D 1LLRD 2LY7A 2F0PA 2E5LQ 1J8IA 3WWIA 5JVH3 1GUNA 3VOTA 3TW6A 3FRPB 4JYAL 3U4VA 3Q0AA 4HJ7A 3NTIA 1IBKQ 1A9XA 2JXMB 3M4PA 3U54A 3KAKA 4DK6C 1VQHA 4YY3L 1GSOA 4C56C 1BBUA 4O4HF 1KD1C 2K5VA 3A74A 4A3CG 1SEBD 1JJ2A 1D5XC 2KCTA 2F4VL 4GNXC 1HNXQ 4Q4CA 3Q22A 4DRFA 3HOXB 4KHZA 5K5PA 1MJEA 1M8AA 1DAAA 1NR4A 4CDFC 1I7NA 4O4LF 3K8AA 1KT8A 2RDGA 5LOVF 3J81i 1Q7YC 4ID6A 4JBWA 3SR1A 1BXTA 1TWCH 4K2LA 3NBYB 3HT5A 2OWOA 2Y4RA 5ELCA 1K28A 4NP5A 4AIMA 1WOCA 1WI5A 4IJHA 1TR5A 1EKPA 2AKWB 3AFPA 1VQ4A 1E0BA 5CE8A 2DLNA 1B3AA 2L5TA 1WD1A 4R4QA 1U4PA 5AFWA 3G6EA 4DKAC 5D65A 2I5MX 3K5MA 3WO0A 4HNVA 4JI3L 1JOQA 3QWUA 1CKOA 5FR9A 4A76A 2UU9L 4X62L 3STBC 2K32A 4ZI7F 2XSCA 2Z0SA 2BH2A 1A0IA 2RCFA 3AYHB 3I4MG 4BBSB 1F2MA 2Q7DA 3J7A5 4EQNA 2FB9A 1RF2D 4JCVE 1ZAUA 4CBVA 1ONLA 1YHAA 3U50C 5D1OB 2SNSA 2HCIA 3H3VH 2Z1CA 3UI2A 3T1YQ 2JP1A 1VQJA 2JK8A 4MAMA 1JJCB 1TWAH 4F7XA 2I87A 3HS0C 2C35B 3FKIB 4FYDA 1DCZA 1Y8NB 2FINB 3L7ZC 5EAYA 1LT6D 4FP5D 1B3QA 3A7AB 3W2DA 4DR1Q 2R61A 3OW2A 1DV2A 1ZEQX 4LF4Q 3HRZC 2RA4A 2DWCA 2CHBD 1GGOA 5JQGF 2LS01 3Q24A 5EPJA 1GUOA 5FLXL 1H9MA 1SE4A 1QWYA 1NSNS 3M4YA 1MSGA 2V59A 1LO5D 4JV5Q 2A1AA 3SK5A 4DR3Q 4KJNA 1V1PA 2R7LA 2GN5A 4O0AA 2K5QA 5JVG3 1EQQA 1UC8A 4UP9A 3CCJA 1AUVA 3GB8B 1CZGA 4BXXH 5C6AA 1HZBA 2PMZE 2UXCL 2IJ0A 1X65A 3VNNA 3TS2A 4HIDA 3T99A 4JBJA 4DR6Q 2ICIA 4FXKC 4TM5A 4DLKA 4NXML 4ZHQF 2GQRA 1K8OA 4TV9F 4M1UB 2Z02A 2FXQA 2GPSA 5HNEA 2F0GA 3K0XA 5FO9B 3KJOA 2F0OA 5KRUA 4ZQIA 1N32Q 4DUYQ 1I94L 4RA8A 2F0EA 2LSSA 2H4OA 1PFNA 3FEWX 1HTLD 2F0JA 4HTHA 3K59A 4UPAA 3GTPH 4YJ3F 3NTHA 3JC66 3CW2C 5KS8A 5HGTA 1D8LA 3MFYA 4R4OA 2PNHA 3KBXA 3CCLA 2FFKB 1XK5A 3OOCA 1TWCB 3UE1A 4I7ZC 4NPSA 3QO2A 1Z2OX 4I65A 2PZUA 3QIAA 1TVXA 2I5HA 5ELEA 1AP0A 5KEEA 2VXWA 1TS5A 5C3XA 2COJA 2DNCA 5EQ0A 1QB5D 5JPMC 1O7IA 4O82A 2VQDA 3D3RA 4A3LH 5M3FG 4RAUC 4IIJF 3FMCA 4Y7NH 2EIFA 3UZBA 3DWAA 3GTOH 5EPKA 1Y1WG 3A5ZB 3QG1A 5GQOA 1KIXA 5NUCA 4KY6A 1UEBA 4F8MA 1EYDA 3RTXA 3BS1A 4JI6L 4IFDH 3LWBA 4OO1I 1HR0L 1Q90A 1U9RA 2YV5A 1X6OA 2MP1A 4RGTA 1GVPA 1TWAB 3ETHA 5JEAJ 1FYCA 3NWSA 4C3IH 1O7LA 1G2WA 2PW7A 4PMBA 3Q1KA 3ETJA 3BAAA 4EGVA 3D31A 3PIOA 3PUWA 3HG9A 5C3EG 1G6ZA 3G8DA 4S3SA 1AZPA 4A3KH 1JWUD 3KF6B 4P72A 1EYGA 2RHSB 4OXPA 1I4PA 4AYBE 5D1OA 3DHQA 5CV5A 4LUVA 1HFGA 1B6SA 2E5LL 2BDNA 3RZOH 3CSWA 3SK6A 2IP4A 4LFAL 4IALA 3VPBA 4HEDA 2D2CC 1JR0D 3VA5A 1TQOA 4AQYQ 3OMGA 3F1ZA 5JEAH 2JA5H 3W5OA 1SMYD 4JI0L 3HOWG 2ID0A 5K36H 1BCPF 1JC7A 3TQYA 1JKJB 5BWWA 5IYBG 3H91A 1ZYRC 4PQXA 5LMUQ 1S68A 1EUCB 1FNWA 1KHIA 3HOUG 5BYAA 2EY6A 4J8QA 2WAQE 3I70A 4UCTA 4MV4A 5M3MH 1XJVA 3S1NH 1Z6HA 1VKZA 3NENA 2DY8A 3T9DA 1I6HB 4FDBA 3GTPB 2COIA 1KL9A 3BG3A 5D14A 4DA2A 2NVYH 2RQXA 5CC4A 4YIJA 3PIPA 4BY1G 2JE6I 1KXLA 1JE5A 4IPDA 1WTVA 3EFXD 1QVGA 1I4HA 1Q81C 3A5UA 5E1FA 4QL5A 3CMAA 2A8VA 2W6ZA 3I56A 4XQNA 1Q3LA 5M9OA 1D7QA 2P0AA 2A74C 1EIFA 1STAA 1ENAA 2L15A 4CDCC 4CE5A 1I4GA 4UCRA 3E9HA 1N34L 3Q23A 2WB1G 2JEAI 3JRXA 4FE2A 4Y7NB 1N36Q 1CZWA 4IN3A 1M6VA 4FGRA 2B2TA 2NB0A 1C48A 3GTOB 1A3UA 4BY7G 1CK1A 2IPKD 3I4OA 4DV3L 4G4KA 2KCNA 2EZVA 5FJ8H 4DR7Q 3K80C 1HXYD 1B8AA 4KKSA 3RN2A 5LYJF 5IP7H 1KEEA 2Q8TA 1SE3A 1EY5A 3S1QH 1NUCA 1SJED 1YJ9A 5ELBA 1RTOA 4YCVA 2HJWA 2XWBB 2GLTA 5C4HA 4TSSA 4DUZQ 4WORA 3BACA 4WHXA 1MHWC 2L9HA 1RCVD 3TP7A 4QUFA 4C3IB 3TDQA 3T53B 4EVOA 1MBYA 3PFFA 5KKNB 1B70B 3KAJA 2P5ZX 4XXEA 4J6HA 4LF4L 2DABA 1EY4A 1X54A 2QW7A 3SGIA 1CT1D 4A3KB 1CA6A 2XGTA 2YRXA 2RCNA 3UE0A 2JN4A 2F0HA 4UUGA 3MZ5A 1Q46A 4LF8L 4CKBA 5C4JH 2JA8G 1Z2NX 1GM5A 2B39A 2E8GA 4O7SA 1TXYA 1Y1VH 2NVQH 4JV5L 5C1PA 3H0GH 5CBAE 1M90C 1CFMA 2EYHA 3RZOB 4UHVA 2EJFC 2R92H 2W71A 1T5EA 1I1MA 1HJPA 3GO5A 2PMZB 2HUGA 4MIUA 2LFNA 3HOYH 2JA5B 1XX8A 1V43A 3KF6A 2NU9B 3R9RA 5JJLA 3BZCA 2KHJA 2QGQA 4LFBQ 4KV6A 2Q2IA 3S1NB 4KKUA 3SNOA 4DV4Q 4A4IA 5C44H 1L0YB 2K7VA 4O7ZA 3SVMA 4JK1C 1RHPA 5GONF 1KC7A 2NVYB 2QKIC 3FPPA 4QMGA 4NMZA 4X3UA 1ML0D 4POFA 1X32A 2NTSA 1G2TA 1QUQB 2VZAA 3NSWA 1SR3A 4P74A 2W70A 4UCUA 2JA9A 4JI1L 1XPRA 1CUKA 3WOEA 2ABJA 2FJ2A 4HIOA 3ER0A 5CV4A 4QY7A 2MHVA 2L0CA 3AX6A 3RR5A 4DN4M 5FLXc 3GTKH 3KALA 2B2WC 3PO2H 3GD7A 4A75A 2JA7H 2RHQB 1DJRD 4M9UA 1KDAA 2VUMB 2I46A 3NELA 1LTSD 1QNUA 1K0SA 4K8IA 3I2ZA 3ORRA 5CV7A 1ULZA 2K05A 1CQVA 1YEZA 1WCMH 5IP9H 4BBSG 2YYZA 2K5NA 1Y14B 3OUZA 4UCVA 1PRTB 3S1QB 1YVCA 4CGYB 4O7NA 5FO7B 4JI7Q 2XWJB 4MN3A 1PX2A 3WWVA 1SMXA 1XDNA 2KBNA 3P7JA 4G7OC 3TZUA 3FKIG 1W3SA 2R7DA 5HURA 5IGBA 1EHIA 2PW5A 4DV6Q 4GLAC 4HN7A 1EY0A 4IJLA 1JB3A 1IBML 2R85A 3M9BA 1IKMA 4O7RA 2RF4A 2A6EC 4OO1H 3DTFA 5HBRB 1E3PA 1YNND 3D6WA 4E6NA 3MXGA 3TP8A 4LUZA 4PMWA 5FLXE 5C4JB 4RG1A 4XIGS 1Y1VB 2NVQB 3DLLA 2R7ZH 1AN8A 1DM0B 3H0GB 4P2CB 2ZXPA 3BDLA 3F2UA 2QF7A 3OMCA 5FK9C 5FLMH 2R92B 3CCVA 3V96A 1CKNB 4XYMB 1ICFB 1GD7A 4K5WA 2XTIA 1CI3M 3H3VI 3HOYB 3BVZA 1KLGD 2SCUB 1QILA 5IODA 4WJ3M 2OXPA 2SEBD 1HZ9A 2UXBQ 2VQEL 2HDLA 2ZTEA 3CRLC 2PZWA 3KJPA 4RMFA 2QDBA 2BH8A 3S1MH 4C3HH 2MO0A 3RV4A 4DR2L 1XMQQ 5C44B 3CD6A 3VMMA 2V4DA 3H94A 1E1OA 4JI8L 2Y0SB 3OWEB 2PO4A 2CZGA 1NCVA 3A0JA 4YHHL 2JQOA 2YU9H 3RLFA 1J5EQ 2EJGC 2ATWA 2DN8A 3BDOA 3TQTA 4IPHA 2OTLA 4JOIC 4JBKA 4L5RC 1SNMA 1SN8A 1PZKD 1IZ6A 2R84A 1DGSA 4C1NI 3GTKB 1H9RA 2IW3A 3PO3H 3EVQA 2HGWA 2ZM6Q 1YHBA 3PO2B 2JA7B 1BDOA 2F0KA 3D0FA 4IPGA 3T9CA 4UFZA 5ISRA 3QR8A 1T36A 1PFMA 1SNCA 2E2IH 3KF8B 2ZTCA 4MV7A 4JVZA 5C4ZA 4A3BH 4L63B 1QZHA 3CCRA 1WCMB 1QUQA 4FFMA 3BYTB 3GTGH 3K7AH 3UDXA 4DV2L 4DNIA 3QFFA 4XDXA 4DV7Q 3J7AV 3S9WA 4IQZA 1PTOC 4ZRZA 2CWPA 4DUZL 1EL0A 1G51A 2WYOA 2WV6D 3F2DA 4DF7A 4TV8F 2F0NA 3G8CA 4XT3B 1XNQQ 4IZOA 3N8DA 2GPWA 2YYAA 1EY6A 1PK8A 1TWGH 1G8ZD 5COYA 3DM1A 3HOXH 1RTNA 1D5MC 4XX0B 3WNZA 2NZOA 1W93A 1STBA
chains in the Genus database with same CATH topology
4JCVE 3STBD 3NBHB 1YHAA 1FVIA 3U50C 5D1OB 3H3VH 2IX0A 4A3FG 1VCIA 2D0OA 3T1YQ 1XNRQ 5DISC 3KOJA 2H5XA 1OXXK 1VQJA 1N33L 2IT1A 2JK8A 2MQHA 1SROA 1JJCB 1TWAH 2WFWA 4AH6A 3KLWA 3NC0B 2C35B 1X3FA 5EAYA 1XTDA 3L7ZC 2VQEQ 4UCOA 2B29A 4DR1Q 3OW2A 4A3EG 1PH1A 4LF4Q 1KRSA 2PQAA 1L0WA 4B3TL 1UE7A 4JI2Q 2B63G 1TAEA 1IL2A 4IFDI 3L2PA 3U58A 1L1OB 4JYAQ 4TQUS 1UWVA 4DR2Q 4BXXG 4A3GG 1P16A 4LFCQ 5H1SE 5HY6A 1K3RA 2E2HH 5IE8A 3PN1A 4DK3C 4A3FH 4DV5L 3G48A 2WP8J 4JI8Q 3J81j 1QVFA 4P73A 3GTQH 5FPOA 4R4IA 4YCUA 3S17H 4JV5Q 2A1AA 3TY5A 5GAGC 4DR3Q 4LF5Q 2GVAA 4YHHQ 5LMNQ 3HKSA 4HJAA 2GN5A 4O0AA 2Y0SE 4YY3Q 4A3EH 3GTMH 3UQ8A 2IX1A 3AFQA 2B63H 1EQQA 4UP9A 1CKNA 3F8TA 3CCJA 1BBWA 3GB8B 4BXXH 2F4VQ 2UUCL 4A3GH 3OYYA 1HZBA 2PMZE 5IYDG 4KI0A 1PA6A 3M4OH 2UXCL 1X65A 3VNNA 3TS2A 4HIDA 4OX9L 1YNXA 4GOPA 4A3DG 4JBJA 4DR6Q 2UXDL 1KAWA 2DUDA 4NXML 1N9WA 3HOVG 3CC7A 2R6GA 1L2FA 4AQYL 4YWMA 4GLVB 4IOCA 3RLNA 2FXQA 1PV4A 4EQ5A 4QIWE 3K0XA 3CCMA 3KJOA 3BABA 1N32Q 4DUYQ 3F2CA 1I94L 1IBLL 4YCWA 2LSSA 1EWIA 1EFWA 3OTOQ 4UPAA 3GTPH 4B3MQ 4A3LG 5LMUL 1ASZA 1C9OA 2VS1A 3JC66 3TS0A 3BZKA 3CW2C 5GAEC 4DV2Q 1SLJA 5IYDH 1FJGQ 1H95A 1D8LA 4R4OA 4GKKL 3KDFB 4A3DH 2PNHA 1G6PA 3CCLA 3GTLH 4PG3A 1PVOA 2DGYA 3UE1A 2Q2TA 1XK5A 4NPSA 3PO3G 3PGZA 3HOVH 4B3RQ 2I5HA 3ZJYC 3CF5A 1HNZL 4JI3Q 4DV0L 1VS0A 2AWNA 3W1BA 4X62Q 2ALYB 1KRTA 4DAYB 1O7IA 4A3BG 3PUXA 1PH6A 3PF4A 4JI7L 4A3LH 2JA6G 5M3FG 3UDGA 4JG2A 4YWLA 1X9NA 4Y7NH 1YIJA 2ES2A 2EIFA 4POGA 3GTOH 5M5WH 2BA0A 1E7ZA 3CCQA 1XPOA 4A3IH 2MFIA 1Y1WG 3A5ZB 5GQOA 4JBKA 1N33Q 1KIXA 3Q8DA 4JI5Q 4DV6L 2VL6A 2Z6KA 1RL2A 1HZAA 1UEBA 3FHWA 3AQQA 3H15A 4B3SL 4A3KG 3RTXA 1EQRA 1N36L 1Q86C 4JI6L 4B3TQ 3G4SA 4OO1I 1HR0L 3W1GA 5GROA 1EOVA 2YV5A 2GVBA 4OWTB 1X6OA 1NMGA 2JA6H 1GVPA 3T1HQ 5BR8Q 3HKZE 4DR7L 5J3BA 5JEAJ 4LF6L 2VQFL 4C3IH 3ICEA 4KHPQ 1Z47A 3M4QA 3K81C 4DV5Q 3TY8A 2HVRA 4WJ4A 1K83H 4DAMA 3BAAA 3D31A 3PIOA 2JA8H 2HIVA 3PUWA 5C3EG 4GLXA 3PF5A 3KYHC 4A3KH 5C0XI 5JEAG 2JA5G 3KF6B 4P72A 5HGQA 1HNWQ 1EYGA 2RHSB 4OXPA 1PH8A 1U5KA 1K8GA 3MXNB 4UY8C 4AYBE 5D1OA 2UXBL 3CAMA 4LUVA 4QGUA 2JJQA 4HIMA 4GN4B 2UUCQ 2AHOB 1X3EA 2UXCQ 2E5LL 5M3MG 4JBMA 3RZOH 4OX9Q 4LFAL 1HZCA 4OWXB 4X66Q 1L1OC 1WFQA 1SE8A 2UXDQ 5IY0A 4NXMQ 2AMCB 2YTXA 4AQYQ 3F1ZA 5C3EH 1X55A 4CC6A 1AE2A 4UP7A 2K14A 1R9TH 1VQ5A 2JA5H 1L1OA 3W5OA 4JI0L 3HOWG 2HVQA 2EQSA 2ID0A 1I94Q 4PZ7A 3S16H 4QJFA 2KENA 5GAHC 3TQYA 1C0AA 1PH7A 5IYBG 5JJKA 1NMFA 5LMUQ 1YJNA 1J5EL 1S68A 2VUGA 1KHIA 1OTCA 1VQ7A 3S2HH 3HOUG 2WAQE 1I5FA 4UCTA 5M3MH 1UE5A 3I55A 3VDYA 4GKKQ 1XJVA 3S1NH 1VQBA 3BU2A 3NENA 4NB3A 1OXVA 1W2BA 1YITA 2YTYA 4FDBA 1VQLA 4MNOA 2A19A 1KL9A 4GN3B 4R1JA 5D1PA 1VQFA 4DV0Q 3CXCA 1PH2A 2NVYH 4APVA 3HOWH 5E7NA 1Q82C 4LFBL 3PIPA 1KXLA 4BY1G 1E22A 2JE6I 1JE5A 1T9HA 2K4KA 1PFSA 3B6YA 4IPDA 3TREA 1U0LA 1QVGA 3TEHB 1NBWA 4P75A 4LWCA 5IYBH 4DV4L 1N8RC 1Q81C 5C0XJ 3A5UA 3DM3A 3HOUH 4QL5A 3CMAA 4GOPC 2A8VA 4UCSA 3I56A 2BA1A 4JI4L 5IP7G 1IXRA 2PI2E 1D7QA 5AJ3L 1EIFA 2L15A 2R7FA 4HJ9A 4LF7L 4UCRA 1A63A 1TA8A 3E9HA 2VY3A 5C0XG 2WB1G 1XMOL 4DR5L 1N34L 1M1KC 2JEAI 4B3SQ 3RLOA 3M3YH 4IOAA 1N36Q 3CCSA 4L5QA 4JI6Q 1VQAA 3J7ZC 1LM0A 4BY1H 4DR4Q 3E9IA 2IY5B 4BY7G 1AH9A 1QVCA 2N49A 1VQCA 3I4OA 4DV3L 1LTLA 3KDFA 1I6HH 1XNQL 3K7UC 3CPWA 1CKMA 3PUVA 5FJ8H 4OONA 4DR7Q 2D62A 3K80C 4LF6Q 1VQ8A 1B8AA 3RN2A 4OWWB 5IP7H 2QEXA 2UUBL 1PH4A 4LF9L 3S1QH 1YJ9A 4IFDJ 4A3IG 4YCVA 2K52A 3PUYA 2HIXA 3ERSX 3S14H 1FL0A 4DUZQ 4HJ5A 4O2DA 1VQMA 1VQKA 4NXNL 3LGJA 2PI2A 1Y1VG 4PZ6A 1NY4A 3G71A 3RN5A 2LXKA 3PUZA 3CCUA 4EFEA 1V9PA 2UU9Q 4BY7H 2OQKA 4IFDG 3UDFA 1B70B 2Q2HA 3I4NH 2R92G 1G291 2HVSA 4LF4L 3I7FA 4JI2L 1X54A 3SGIA 1B7YB 3HOYG 4LFAQ 2Z6KC 2HQLA 1Q12A 2XGTA 2UUAL 2K50A 2RCNA 3UE0A 2ZJRA 1ASYA 4LFCL 4MTNA 1NJIC 1GKHA 1Q46A 3S24A 2HHHL 4LF8L 5C4JH 1FGUA 1J6QA 1GM5A 1CSPA 2E8GA 2K5HA 4HTPA 5LMNW 2IHFA 1TXYA 1Y1VH 4GN5A 4JI0Q 4EX5A 2NVQH 4JV5L 3H0GH 1M90C 3BA8A 5C4XG 3TY9A 4K0KL 4LH6A 4R4TA 4EEQA 1S3OA 1EIYB 2R92H 2VW9A 3ULJA 2ZJQA 3CP0A 5C44G 1HJPA 3GO5A 1NTGA 4UP8A 2NN6I 1YI2A 2Y0SG 3U4ZA 3HOYH 3J7A5 1Q8KA 4JC0A 4A93G 3JAMi 1V43A 2V1CC 1I3QH 3CPFA 3EBEA 3KF6A 1K8AC 5JJLA 3BZCA 4P71A 1OXUA 4DPGA 2KHJA 4JOIA 3F2BA 1K0RA 4ME3A 1LYLA 2QGQA 2LXJA 1SRUA 3M85A 2Q2IA 4R4CA 4A3JG 1S72A 4LFBQ 5M5XH 5C4XH 3GDEA 5K36G 4DV4Q 4A4IA 5IWAL 3CMEA 1KQSA 5C44H 4HJ8A 4X65L 4GNXB 2KHIA 4JI4Q 3PO2G 2JA7G 4GKJL 3E0EA 1OXTA 4B3ML 2NVTH 5AJ3Q 3PV0A 3CCEA 5GADC 4A93H 1AE3A 2CKZB 4BA1I 4LF7Q 1V1QA 4POFA 1FJGL 4L5TA 1XMOQ 1N34Q 4DR5Q 1PYBA 4IPCA 1XMQL 1QUQB 2VZAA 4P74A 1SR3A 1X56A 1PH3A 2F52A 4UCUA 1WCMG 2JA9A 4JI1L 4A3JH 1VQOA 1CUKA 4C3JH 5IP9G 1XPRA 1IBKL 4LNQA 1EUJA 4HIOA 4B3RL 3ER0A 3UDIA 4QY7A 4A3MG 3AEVA 1I50H 4QQBX 1IBLQ 2ASBA 2K75A 3RR5A 4DV3Q 5FLXc 4HTOA 4ALPA 4H02A 1BKBA 1C7YA 3GTKH 1VQ9A 4BA2I 2QA4A 3PO2H 3GD7A 4A75A 2JA7H 2RHQB 3PCOB 2UUBQ 1VQEA 2B3GA 4LF9Q 1SFOH 1PHJA 3NELA 3ULLA 1KC8C 1OXSC 3ULPA 3I2ZA 1HNXL 4GS3A 1K9MC 4NXNQ 2N3SA 1YEZA 2CQOA 3JSLA 1VQDA 4X64L 1WCMH 1HNZQ 2N8NA 3NEMA 4JI5L 5IP9H 3J80c 2YYZA 2K5NA 1Y14B 2ZM6L 1PH9A 4BBSG 1X3GA 3PSIA 4OO1G 4A3MH 1VQNA 2VUMG 4UCVA 1B04A 1YVCA 2NN6G 4JI7Q 4CC5A 3WWVA 2YTVA 4LUOA 5DLQE 1UE6A 3CQZH 3I4MH 2F3IA 2AWOA 3BJUA 5FJ8G 1SMXA 1XDNA 2KBNA 2UUAQ 2R7ZG 3T1HL 1K73C 5ELNA 5BR8L 3FKIG 1W3SA 1JJGA 4IO9A 1LUZA 2R7DA 2PQAB 5FLMG 4KHPL 1P8LA 4LF8Q 4DV6Q 2HHHQ 1TWFH 4GLAC 4DV1L 2NZHA 3HKZG 4IJLA 1IBML 1MKHA 3M9BA 4DV7L 4BBSH 5JJIA 2RF4A 1WJJA 1VQPA 3HOZG 1E3PA 4K0KQ 4J15A 2VUMH 4L5SA 1HR0Q 1E24A 4X6AH 4E6NA 1Q1BA 3I4NG 4LUZA 4PMWA 1HNWL 2MNAA 3KFUA 2HT1A 3GJXB 4RG1A 4XIGS 2OTJA 3DLLA 2VQFQ 3CC4A 2R7ZH 1E1TA 3FKIH 2R93G 4AYBG 1WYDA 3JAMc 5FLMH 1IYJB 3CCVA 1CKNB 1GD7A 2JEBI 1PYSB 4XTCS 4X66L 2XTIA 2E2JH 3T1YL 1XNRL 3CC2A 1VQ6A 3J80i 3H3VI 3HOZH 1UE1A 1VQIA 1PH5A 4EFBA 3H0GG 5IWAQ 1YBYA 1YZ6A 4WJ3M 1NE3A 1HZ9A 4GOPB 2UXBQ 3J81c 4X65Q 2VQEL 3S15H 1BVSA 2ZTEA 4DR1L 2OQ0A 3KJPA 4GKJQ 4Y52H 3BA9A 5FPRA 4RMFA 1JB7A 2BH8A 2E5LQ 1JT8A 3S1MH 1YJWA 2CWAA 2R93H 4C3HH 2MO0A 4JYAL 4TVAB 4DR2L 1XMQQ 1JMCA 3U4VA 1XPUA 4LH7A 5IT9c 4HJ7A 3EN2A 3CD6A 2D0PA 4JI1Q 2WAQG 1A62A 1IBKQ 1YHQA 1A8VA 4JI8L 1E1OA 3M4PA 3RNUA 2NVXH 4DR3L 1Z9FA 3A0JA 2I5LX 5IYCG 4LF5L 1GO3E 2JQOA 4YHHL 5LMNL 2N78A 2YU9H 3RLFA 4DK6C 1J5EQ 1VQHA 2EXDA 4YY3L 2ATWA 3JSNA 1BBUA 1VQGA 3M7NA 1KD1C 5M5YH 2K5VA 3A74A 4A3CG 4IPHA 2OTLA 3FP9A 4JOIC 4BBRG 2KCTA 5ELOA 1RIPA 1JJ2A 4GNXC 1HNXQ 2I0QA 4L5RC 2F4VL 1SN8A 4DRFA 4X64Q 1IZ6A 1DGSA 3PO3H 2ZM6Q 1YHBA 4KHZA 3S2DH 4GNXA 4DR6L 3D0FA 1MJEA 4IPGA 1HR0W 2VNUD 4UFZA 2IHEA 3L0OA 5IYCH 2CCZA 3K8AA 3KF8B 2E2IH 2ZTCA 4KLKA 3J81i 1Q7YC 4DR4L 4A3BH 1MJCA 4JBWA 4YWKA 1QZHA 4DUYL 1TWCH 1CSQA 3CCRA 1N32L 3NBYB 2OWOA 1QUQA 3HOXG 5M3FH 1QZGA 4A3CH 2KCMA 3OTOL 3S1RH 3GTGH 3K7AH 3UDXA 4AIMA 2WB1E 1TWHH 1WI5A 1WOCA 4IJHA 4BBRH 2JA8G 2AKWB 4DV1Q 3AFPA 4HIKA 1VQ4A 4DV2L 1Y1WH 2MO1A 4DNIA 1IBMQ 4DV7Q 3IRBA 3EIVA 2CWPA 4R4QA 4C2MH 2ZTDA 1G51A 3MEFA 2ZJPA 4DUZL 3TRZA 3G6EA 4DKAC 3GTJH 3F2DA 2I5MX 1S40A 4JI3L 2CFMA 1Q1EA 1HH2P 3HFZB 1CKOA 2Q2UA 1XNQQ 3QWUA 4A76A 2UU9L 4X62L 4PZ8A 3STBC 1TWGH 2Z0SA 2BH2A 3HOXH 1A0IA 2OCEA 3AYHB 4MZ9A 3I4MG 3RZDH 3NBZB 2NZOA 1MIUA 4LW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCV E;  3STB D;  3NBH B;  1YHA A;  1FVI A;  3U50 C;  5D1O B;  3H3V H;  2IX0 A;  4A3F G;  1VCI A;  2D0O A;  3T1Y Q;  1XNR Q;  5DIS C;  3KOJ A;  2H5X A;  1OXX K;  1VQJ A;  1N33 L;  2IT1 A;  2JK8 A;  2MQH A;  1SRO A;  1JJC B;  1TWA H;  2WFW A;  4AH6 A;  3KLW A;  3NC0 B;  2C35 B;  1X3F A;  5EAY A;  1XTD A;  3L7Z C;  2VQE Q;  4UCO A;  2B29 A;  4DR1 Q;  3OW2 A;  4A3E G;  1PH1 A;  4LF4 Q;  1KRS A;  2PQA A;  1L0W A;  4B3T L;  1UE7 A;  4JI2 Q;  2B63 G;  1TAE A;  1IL2 A;  4IFD I;  3L2P A;  3U58 A;  1L1O B;  4JYA Q;  4TQU S;  1UWV A;  4DR2 Q;  4BXX G;  4A3G G;  1P16 A;  4LFC Q;  5H1S E;  5HY6 A;  1K3R A;  2E2H H;  5IE8 A;  3PN1 A;  4DK3 C;  4A3F H;  4DV5 L;  3G48 A;  2WP8 J;  4JI8 Q;  3J81 j;  1QVF A;  4P73 A;  3GTQ H;  5FPO A;  4R4I A;  4YCU A;  3S17 H;  4JV5 Q;  2A1A A;  3TY5 A;  5GAG C;  4DR3 Q;  4LF5 Q;  2GVA A;  4YHH Q;  5LMN Q;  3HKS A;  4HJA A;  2GN5 A;  4O0A A;  2Y0S E;  4YY3 Q;  4A3E H;  3GTM H;  3UQ8 A;  2IX1 A;  3AFQ A;  2B63 H;  1EQQ A;  4UP9 A;  1CKN A;  3F8T A;  3CCJ A;  1BBW A;  3GB8 B;  4BXX H;  2F4V Q;  2UUC L;  4A3G H;  3OYY A;  1HZB A;  2PMZ E;  5IYD G;  4KI0 A;  1PA6 A;  3M4O H;  2UXC L;  1X65 A;  3VNN A;  3TS2 A;  4HID A;  4OX9 L;  1YNX A;  4GOP A;  4A3D G;  4JBJ A;  4DR6 Q;  2UXD L;  1KAW A;  2DUD A;  4NXM L;  1N9W A;  3HOV G;  3CC7 A;  2R6G A;  1L2F A;  4AQY L;  4YWM A;  4GLV B;  4IOC A;  3RLN A;  2FXQ A;  1PV4 A;  4EQ5 A;  4QIW E;  3K0X A;  3CCM A;  3KJO A;  3BAB A;  1N32 Q;  4DUY Q;  3F2C A;  1I94 L;  1IBL L;  4YCW A;  2LSS A;  1EWI A;  1EFW A;  3OTO Q;  4UPA A;  3GTP H;  4B3M Q;  4A3L G;  5LMU L;  1ASZ A;  1C9O A;  2VS1 A;  3JC6 6;  3TS0 A;  3BZK A;  3CW2 C;  5GAE C;  4DV2 Q;  1SLJ A;  5IYD H;  1FJG Q;  1H95 A;  1D8L A;  4R4O A;  4GKK L;  3KDF B;  4A3D H;  2PNH A;  1G6P A;  3CCL A;  3GTL H;  4PG3 A;  1PVO A;  2DGY A;  3UE1 A;  2Q2T A;  1XK5 A;  4NPS A;  3PO3 G;  3PGZ A;  3HOV H;  4B3R Q;  2I5H A;  3ZJY C;  3CF5 A;  1HNZ L;  4JI3 Q;  4DV0 L;  1VS0 A;  2AWN A;  3W1B A;  4X62 Q;  2ALY B;  1KRT A;  4DAY B;  1O7I A;  4A3B G;  3PUX A;  1PH6 A;  3PF4 A;  4JI7 L;  4A3L H;  2JA6 G;  5M3F G;  3UDG A;  4JG2 A;  4YWL A;  1X9N A;  4Y7N H;  1YIJ A;  2ES2 A;  2EIF A;  4POG A;  3GTO H;  5M5W H;  2BA0 A;  1E7Z A;  3CCQ A;  1XPO A;  4A3I H;  2MFI A;  1Y1W G;  3A5Z B;  5GQO A;  4JBK A;  1N33 Q;  1KIX A;  3Q8D A;  4JI5 Q;  4DV6 L;  2VL6 A;  2Z6K A;  1RL2 A;  1HZA A;  1UEB A;  3FHW A;  3AQQ A;  3H15 A;  4B3S L;  4A3K G;  3RTX A;  1EQR A;  1N36 L;  1Q86 C;  4JI6 L;  4B3T Q;  3G4S A;  4OO1 I;  1HR0 L;  3W1G A;  5GRO A;  1EOV A;  2YV5 A;  2GVB A;  4OWT B;  1X6O A;  1NMG A;  2JA6 H;  1GVP A;  3T1H Q;  5BR8 Q;  3HKZ E;  4DR7 L;  5J3B A;  5JEA J;  4LF6 L;  2VQF L;  4C3I H;  3ICE A;  4KHP Q;  1Z47 A;  3M4Q A;  3K81 C;  4DV5 Q;  3TY8 A;  2HVR A;  4WJ4 A;  1K83 H;  4DAM A;  3BAA A;  3D31 A;  3PIO A;  2JA8 H;  2HIV A;  3PUW A;  5C3E G;  4GLX A;  3PF5 A;  3KYH C;  4A3K H;  5C0X I;  5JEA G;  2JA5 G;  3KF6 B;  4P72 A;  5HGQ A;  1HNW Q;  1EYG A;  2RHS B;  4OXP A;  1PH8 A;  1U5K A;  1K8G A;  3MXN B;  4UY8 C;  4AYB E;  5D1O A;  2UXB L;  3CAM A;  4LUV A;  4QGU A;  2JJQ A;  4HIM A;  4GN4 B;  2UUC Q;  2AHO B;  1X3E A;  2UXC Q;  2E5L L;  5M3M G;  4JBM A;  3RZO H;  4OX9 Q;  4LFA L;  1HZC A;  4OWX B;  4X66 Q;  1L1O C;  1WFQ A;  1SE8 A;  2UXD Q;  5IY0 A;  4NXM Q;  2AMC B;  2YTX A;  4AQY Q;  3F1Z A;  5C3E H;  1X55 A;  4CC6 A;  1AE2 A;  4UP7 A;  2K14 A;  1R9T H;  1VQ5 A;  2JA5 H;  1L1O A;  3W5O A;  4JI0 L;  3HOW G;  2HVQ A;  2EQS A;  2ID0 A;  1I94 Q;  4PZ7 A;  3S16 H;  4QJF A;  2KEN A;  5GAH C;  3TQY A;  1C0A A;  1PH7 A;  5IYB G;  5JJK A;  1NMF A;  5LMU Q;  1YJN A;  1J5E L;  1S68 A;  2VUG A;  1KHI A;  1OTC A;  1VQ7 A;  3S2H H;  3HOU G;  2WAQ E;  1I5F A;  4UCT A;  5M3M H;  1UE5 A;  3I55 A;  3VDY A;  4GKK Q;  1XJV A;  3S1N H;  1VQB A;  3BU2 A;  3NEN A;  4NB3 A;  1OXV A;  1W2B A;  1YIT A;  2YTY A;  4FDB A;  1VQL A;  4MNO A;  2A19 A;  1KL9 A;  4GN3 B;  4R1J A;  5D1P A;  1VQF A;  4DV0 Q;  3CXC A;  1PH2 A;  2NVY H;  4APV A;  3HOW H;  5E7N A;  1Q82 C;  4LFB L;  3PIP A;  1KXL A;  4BY1 G;  1E22 A;  2JE6 I;  1JE5 A;  1T9H A;  2K4K A;  1PFS A;  3B6Y A;  4IPD A;  3TRE A;  1U0L A;  1QVG A;  3TEH B;  1NBW A;  4P75 A;  4LWC A;  5IYB H;  4DV4 L;  1N8R C;  1Q81 C;  5C0X J;  3A5U A;  3DM3 A;  3HOU H;  4QL5 A;  3CMA A;  4GOP C;  2A8V A;  4UCS A;  3I56 A;  2BA1 A;  4JI4 L;  5IP7 G;  1IXR A;  2PI2 E;  1D7Q A;  5AJ3 L;  1EIF A;  2L15 A;  2R7F A;  4HJ9 A;  4LF7 L;  4UCR A;  1A63 A;  1TA8 A;  3E9H A;  2VY3 A;  5C0X G;  2WB1 G;  1XMO L;  4DR5 L;  1N34 L;  1M1K C;  2JEA I;  4B3S Q;  3RLO A;  3M3Y H;  4IOA A;  1N36 Q;  3CCS A;  4L5Q A;  4JI6 Q;  1VQA A;  3J7Z C;  1LM0 A;  4BY1 H;  4DR4 Q;  3E9I A;  2IY5 B;  4BY7 G;  1AH9 A;  1QVC A;  2N49 A;  1VQC A;  3I4O A;  4DV3 L;  1LTL A;  3KDF A;  1I6H H;  1XNQ L;  3K7U C;  3CPW A;  1CKM A;  3PUV A;  5FJ8 H;  4OON A;  4DR7 Q;  2D62 A;  3K80 C;  4LF6 Q;  1VQ8 A;  1B8A A;  3RN2 A;  4OWW B;  5IP7 H;  2QEX A;  2UUB L;  1PH4 A;  4LF9 L;  3S1Q H;  1YJ9 A;  4IFD J;  4A3I G;  4YCV A;  2K52 A;  3PUY A;  2HIX A;  3ERS X;  3S14 H;  1FL0 A;  4DUZ Q;  4HJ5 A;  4O2D A;  1VQM A;  1VQK A;  4NXN L;  3LGJ A;  2PI2 A;  1Y1V G;  4PZ6 A;  1NY4 A;  3G71 A;  3RN5 A;  2LXK A;  3PUZ A;  3CCU A;  4EFE A;  1V9P A;  2UU9 Q;  4BY7 H;  2OQK A;  4IFD G;  3UDF A;  1B70 B;  2Q2H A;  3I4N H;  2R92 G;  1G29 1;  2HVS A;  4LF4 L;  3I7F A;  4JI2 L;  1X54 A;  3SGI A;  1B7Y B;  3HOY G;  4LFA Q;  2Z6K C;  2HQL A;  1Q12 A;  2XGT A;  2UUA L;  2K50 A;  2RCN A;  3UE0 A;  2ZJR A;  1ASY A;  4LFC L;  4MTN A;  1NJI C;  1GKH A;  1Q46 A;  3S24 A;  2HHH L;  4LF8 L;  5C4J H;  1FGU A;  1J6Q A;  1GM5 A;  1CSP A;  2E8G A;  2K5H A;  4HTP A;  5LMN W;  2IHF A;  1TXY A;  1Y1V H;  4GN5 A;  4JI0 Q;  4EX5 A;  2NVQ H;  4JV5 L;  3H0G H;  1M90 C;  3BA8 A;  5C4X G;  3TY9 A;  4K0K L;  4LH6 A;  4R4T A;  4EEQ A;  1S3O A;  1EIY B;  2R92 H;  2VW9 A;  3ULJ A;  2ZJQ A;  3CP0 A;  5C44 G;  1HJP A;  3GO5 A;  1NTG A;  4UP8 A;  2NN6 I;  1YI2 A;  2Y0S G;  3U4Z A;  3HOY H;  3J7A 5;  1Q8K A;  4JC0 A;  4A93 G;  3JAM i;  1V43 A;  2V1C C;  1I3Q H;  3CPF A;  3EBE A;  3KF6 A;  1K8A C;  5JJL A;  3BZC A;  4P71 A;  1OXU A;  4DPG A;  2KHJ A;  4JOI A;  3F2B A;  1K0R A;  4ME3 A;  1LYL A;  2QGQ A;  2LXJ A;  1SRU A;  3M85 A;  2Q2I A;  4R4C A;  4A3J G;  1S72 A;  4LFB Q;  5M5X H;  5C4X H;  3GDE A;  5K36 G;  4DV4 Q;  4A4I A;  5IWA L;  3CME A;  1KQS A;  5C44 H;  4HJ8 A;  4X65 L;  4GNX B;  2KHI A;  4JI4 Q;  3PO2 G;  2JA7 G;  4GKJ L;  3E0E A;  1OXT A;  4B3M L;  2NVT H;  5AJ3 Q;  3PV0 A;  3CCE A;  5GAD C;  4A93 H;  1AE3 A;  2CKZ B;  4BA1 I;  4LF7 Q;  1V1Q A;  4POF A;  1FJG L;  4L5T A;  1XMO Q;  1N34 Q;  4DR5 Q;  1PYB A;  4IPC A;  1XMQ L;  1QUQ B;  2VZA A;  4P74 A;  1SR3 A;  1X56 A;  1PH3 A;  2F52 A;  4UCU A;  1WCM G;  2JA9 A;  4JI1 L;  4A3J H;  1VQO A;  1CUK A;  4C3J H;  5IP9 G;  1XPR A;  1IBK L;  4LNQ A;  1EUJ A;  4HIO A;  4B3R L;  3ER0 A;  3UDI A;  4QY7 A;  4A3M G;  3AEV A;  1I50 H;  4QQB X;  1IBL Q;  2ASB A;  2K75 A;  3RR5 A;  4DV3 Q;  5FLX c;  4HTO A;  4ALP A;  4H02 A;  1BKB A;  1C7Y A;  3GTK H;  1VQ9 A;  4BA2 I;  2QA4 A;  3PO2 H;  3GD7 A;  4A75 A;  2JA7 H;  2RHQ B;  3PCO B;  2UUB Q;  1VQE A;  2B3G A;  4LF9 Q;  1SFO H;  1PHJ A;  3NEL A;  3ULL A;  1KC8 C;  1OXS C;  3ULP A;  3I2Z A;  1HNX L;  4GS3 A;  1K9M C;  4NXN Q;  2N3S A;  1YEZ A;  2CQO A;  3JSL A;  1VQD A;  4X64 L;  1WCM H;  1HNZ Q;  2N8N A;  3NEM A;  4JI5 L;  5IP9 H;  3J80 c;  2YYZ A;  2K5N A;  1Y14 B;  2ZM6 L;  1PH9 A;  4BBS G;  1X3G A;  3PSI A;  4OO1 G;  4A3M H;  1VQN A;  2VUM G;  4UCV A;  1B04 A;  1YVC A;  2NN6 G;  4JI7 Q;  4CC5 A;  3WWV A;  2YTV A;  4LUO A;  5DLQ E;  1UE6 A;  3CQZ H;  3I4M H;  2F3I A;  2AWO A;  3BJU A;  5FJ8 G;  1SMX A;  1XDN A;  2KBN A;  2UUA Q;  2R7Z G;  3T1H L;  1K73 C;  5ELN A;  5BR8 L;  3FKI G;  1W3S A;  1JJG A;  4IO9 A;  1LUZ A;  2R7D A;  2PQA B;  5FLM G;  4KHP L;  1P8L A;  4LF8 Q;  4DV6 Q;  2HHH Q;  1TWF H;  4GLA C;  4DV1 L;  2NZH A;  3HKZ G;  4IJL A;  1IBM L;  1MKH A;  3M9B A;  4DV7 L;  4BBS H;  5JJI A;  2RF4 A;  1WJJ A;  1VQP A;  3HOZ G;  1E3P A;  4K0K Q;  4J15 A;  2VUM H;  4L5S A;  1HR0 Q;  1E24 A;  4X6A H;  4E6N A;  1Q1B A;  3I4N G;  4LUZ A;  4PMW A;  1HNW L;  2MNA A;  3KFU A;  2HT1 A;  3GJX B;  4RG1 A;  4XIG S;  2OTJ A;  3DLL A;  2VQF Q;  3CC4 A;  2R7Z H;  1E1T A;  3FKI H;  2R93 G;  4AYB G;  1WYD A;  3JAM c;  5FLM H;  1IYJ B;  3CCV A;  1CKN B;  1GD7 A;  2JEB I;  1PYS B;  4XTC S;  4X66 L;  2XTI A;  2E2J H;  3T1Y L;  1XNR L;  3CC2 A;  1VQ6 A;  3J80 i;  3H3V I;  3HOZ H;  1UE1 A;  1VQI A;  1PH5 A;  4EFB A;  3H0G G;  5IWA Q;  1YBY A;  1YZ6 A;  4WJ3 M;  1NE3 A;  1HZ9 A;  4GOP B;  2UXB Q;  3J81 c;  4X65 Q;  2VQE L;  3S15 H;  1BVS A;  2ZTE A;  4DR1 L;  2OQ0 A;  3KJP A;  4GKJ Q;  4Y52 H;  3BA9 A;  5FPR A;  4RMF A;  1JB7 A;  2BH8 A;  2E5L Q;  1JT8 A;  3S1M H;  1YJW A;  2CWA A;  2R93 H;  4C3H H;  2MO0 A;  4JYA L;  4TVA B;  4DR2 L;  1XMQ Q;  1JMC A;  3U4V A;  1XPU A;  4LH7 A;  5IT9 c;  4HJ7 A;  3EN2 A;  3CD6 A;  2D0P A;  4JI1 Q;  2WAQ G;  1A62 A;  1IBK Q;  1YHQ A;  1A8V A;  4JI8 L;  1E1O A;  3M4P A;  3RNU A;  2NVX H;  4DR3 L;  1Z9F A;  3A0J A;  2I5L X;  5IYC G;  4LF5 L;  1GO3 E;  2JQO A;  4YHH L;  5LMN L;  2N78 A;  2YU9 H;  3RLF A;  4DK6 C;  1J5E Q;  1VQH A;  2EXD A;  4YY3 L;  2ATW A;  3JSN A;  1BBU A;  1VQG A;  3M7N A;  1KD1 C;  5M5Y H;  2K5V A;  3A74 A;  4A3C G;  4IPH A;  2OTL A;  3FP9 A;  4JOI C;  4BBR G;  2KCT A;  5ELO A;  1RIP A;  1JJ2 A;  4GNX C;  1HNX Q;  2I0Q A;  4L5R C;  2F4V L;  1SN8 A;  4DRF A;  4X64 Q;  1IZ6 A;  1DGS A;  3PO3 H;  2ZM6 Q;  1YHB A;  4KHZ A;  3S2D H;  4GNX A;  4DR6 L;  3D0F A;  1MJE A;  4IPG A;  1HR0 W;  2VNU D;  4UFZ A;  2IHE A;  3L0O A;  5IYC H;  2CCZ A;  3K8A A;  3KF8 B;  2E2I H;  2ZTC A;  4KLK A;  3J81 i;  1Q7Y C;  4DR4 L;  4A3B H;  1MJC A;  4JBW A;  4YWK A;  1QZH A;  4DUY L;  1TWC H;  1CSQ A;  3CCR A;  1N32 L;  3NBY B;  2OWO A;  1QUQ A;  3HOX G;  5M3F H;  1QZG A;  4A3C H;  2KCM A;  3OTO L;  3S1R H;  3GTG H;  3K7A H;  3UDX A;  4AIM A;  2WB1 E;  1TWH H;  1WI5 A;  1WOC A;  4IJH A;  4BBR H;  2JA8 G;  2AKW B;  4DV1 Q;  3AFP A;  4HIK A;  1VQ4 A;  4DV2 L;  1Y1W H;  2MO1 A;  4DNI A;  1IBM Q;  4DV7 Q;  3IRB A;  3EIV A;  2CWP A;  4R4Q A;  4C2M H;  2ZTD A;  1G51 A;  3MEF A;  2ZJP A;  4DUZ L;  3TRZ A;  3G6E A;  4DKA C;  3GTJ H;  3F2D A;  2I5M X;  1S40 A;  4JI3 L;  2CFM A;  1Q1E A;  1HH2 P;  3HFZ B;  1CKO A;  2Q2U A;  1XNQ Q;  3QWU A;  4A76 A;  2UU9 L;  4X62 L;  4PZ8 A;  3STB C;  1TWG H;  2Z0S A;  2BH2 A;  3HOX H;  1A0I A;  2OCE A;  3AYH B;  4MZ9 A;  3I4M G;  3RZD H;  3NBZ B;  2NZO A;  1MIU A;  4LW1 A; 
#chains in the Genus database with same CATH topology
 4CKC A;  4A3E B;  2F0W A;  1FVI A;  4U68 A;  1PRT D;  4RGM A;  1EEI D;  1EYZ A;  5DIS C;  1AEX A;  3NE5 B;  3KOJ A;  2CQA A;  4FNF A;  2PPB C;  1OXX K;  5EKL A;  2IT1 A;  1SRO A;  2R7Z B;  1K3B C;  4A3G B;  1X3F A;  4MHE A;  2E2D C;  4O7Y A;  4UCO A;  1D1I A;  1KRS A;  1UE7 A;  2HD3 A;  4IUT A;  4JI2 Q;  4EQP A;  1JWM D;  4IFD I;  1EKV A;  1ET6 A;  4BS9 A;  4PV1 C;  4ZKC B;  1L1O B;  4TQU S;  1UWV A;  4BXX G;  4ME5 A;  3MWD A;  5J39 A;  3RFC A;  5KX5 F;  2N88 A;  5HY6 A;  1K3R A;  5I5U A;  2L1B A;  3PN1 A;  4DV5 L;  1HQR D;  3J81 j;  1B1Z A;  3I72 A;  1QVF A;  3GTQ H;  2QB5 A;  2EOT A;  1PTO F;  4YCU A;  1BO0 A;  3TY5 A;  1WRV A;  1W6K A;  3BVG A;  3S1M B;  4CMD A;  4LF5 Q;  1EZ8 A;  4I55 F;  3OUU A;  4C3H B;  5LMN Q;  4KN4 C;  3T56 B;  3HB9 A;  1HTP A;  1DV1 A;  2HHF B;  1CKN A;  5D8D A;  1AW7 A;  1SYG A;  1V1P B;  2DY7 A;  2UUC L;  3VPD A;  4KI0 A;  3M4O H;  2YU9 B;  3IFT A;  4OX9 L;  1YNX A;  2UXD L;  1LT3 D;  4HQ6 A;  1N9W A;  2R6G A;  3HBL A;  3RLN A;  1PV4 A;  3T7A A;  4EQ5 A;  4QIW E;  5BWU A;  3RUP A;  4YCW A;  3QJY A;  3PO3 B;  3OTO Q;  1Q8I A;  1EQV A;  4UDU C;  4B3M Q;  4A3L G;  1ASZ A;  1KDB A;  1SLJ A;  4V0B A;  5IYD H;  3C1F A;  2E2I B;  1M4V A;  1U4M A;  1H95 A;  3TW7 A;  2FPI B;  4GKK L;  2BOS A;  3KDF B;  4A3B B;  1G6P A;  2K5D A;  1PVO A;  2DGY A;  5C5M A;  1ENF A;  1LTA D;  2NBF A;  3HOV H;  3GTG B;  3K7A B;  5E25 A;  3CF5 A;  2K6A A;  5BWR A;  3SE0 A;  1EZ6 A;  5CR3 A;  2ALY B;  5BPF A;  1K83 B;  3IFD A;  5FO8 B;  1IYE A;  5TSS A;  4DAA A;  4ME6 A;  1BF4 A;  3E3X A;  4JI7 L;  1LTR D;  3E0J A;  3V4S A;  2F0S A;  5IGE A;  3UDG A;  3LWU A;  4JG2 A;  3A8J E;  3E6Z X;  4YWL A;  3J7A F;  3MWY W;  4C3I G;  1B4O A;  1E7Z A;  3CCQ A;  2L55 A;  1HPC A;  3KF8 A;  1TWG B;  1N33 Q;  1CQJ B;  1KJ9 A;  3TN2 A;  4DV6 L;  2EYJ A;  2B8F A;  3GQB A;  4MV8 A;  3AQQ A;  4B3S L;  4A3K G;  5IT9 L;  5T1I A;  4OGQ C;  4B3T Q;  1KJQ A;  3W1G A;  1F9S A;  5C3W A;  2ODT X;  1NMG A;  2JA6 H;  1KBL A;  2KJX A;  3R5X A;  1CHP D;  3WWH A;  4N8X 1;  1WTR A;  3QWN A;  2AQ2 B;  4Q0F A;  4B9X A;  3CEB A;  4DAM A;  1UAP A;  1SXT A;  1CHQ D;  3NXW A;  5JEA G;  2JA5 G;  3KLS X;  5HGQ A;  2W6O A;  2O5J C;  1SSO A;  4RGN A;  3DEO A;  3GTQ B;  1CA5 A;  2UXB L;  3K5L A;  4X3K A;  3H09 A;  2Z8L A;  5M3M G;  2X0S A;  5I5Y A;  4NKL A;  3OPO A;  1HZC A;  4X66 Q;  1SMY C;  4KD4 A;  5IYZ F;  1O7Z A;  1HCZ A;  5IY0 A;  4M0J A;  2KVM A;  2AMC B;  5E4W C;  1X55 A;  4TUY F;  2K14 A;  5C1O A;  3D4W A;  1L1O A;  1XXG A;  2EJ0 A;  3M4O B;  3S16 H;  4ZOL F;  2KEN A;  4FO2 A;  1CTM A;  1SE2 A;  2YL2 A;  1PH7 A;  1NMF A;  1J5E L;  2F0Q A;  1OTC A;  3AMU A;  3S2H H;  1K8M A;  3ND8 A;  1UE5 A;  1STH A;  2SNM A;  3BU2 A;  1OXV A;  2HHF A;  5LA6 F;  1VQF A;  4DV0 Q;  1PH2 A;  1JE4 A;  2PYK A;  3VYS A;  5E7N A;  4XT1 B;  1T9H A;  2XD4 A;  4Y8V B;  3TRE A;  1U0L A;  4P75 A;  4LWC A;  1MI2 A;  5BWT A;  3MXU A;  5CV6 A;  4KN7 C;  3HOV B;  3PMF A;  1G91 A;  3K5N A;  1U4L A;  1I2K A;  4GOP C;  4UCS A;  2F0T A;  4RZQ A;  1TY2 A;  1J9O A;  3PIO 3;  5K3W A;  5IP7 G;  1IXR A;  1ROD A;  2ZDQ A;  5AJ3 L;  1WVL A;  1WTX A;  4L6T B;  2I07 B;  3CHB D;  4HJ9 A;  1S5C D;  1XMO L;  2VY3 A;  3SHL A;  1JOR A;  1GOZ A;  4FF1 A;  3J7Z C;  1LM0 A;  1Y69 U;  4DR4 Q;  4O7W A;  2IY5 B;  1QVC A;  5I60 A;  1VQC A;  1ICW A;  3KDF A;  1XNQ L;  1I6H H;  3K7U C;  5CR5 A;  1SCU B;  4R9W A;  2D62 A;  4LF6 Q;  1VQ8 A;  4OWW B;  2UUB L;  3ONA B;  3RMH A;  5BWV A;  4IFD J;  1EFI D;  4A3I G;  2A1H A;  2K52 A;  2HIX A;  1ESR A;  3K5O A;  1OO9 B;  1UEA B;  2B2Y A;  1FL0 A;  2EIY A;  4HN2 A;  4HJ5 A;  2JA6 B;  4O2B F;  2B2U A;  2EDG A;  1HRJ A;  2PI2 A;  1Y1V G;  2G5D A;  4EFE A;  4FFN A;  1F77 A;  3I4N H;  5BMV F;  2R92 G;  1DXM A;  3VR5 A;  5IGG A;  4JI2 L;  1JDE A;  1S5F D;  1A3G A;  4ODG A;  3HOY G;  2Z6K C;  2HQL A;  1Q12 A;  2X6G A;  2C5C A;  2K50 A;  2ZJR A;  2X6L A;  4O81 A;  5DM7 3;  2V5A A;  3PIP 3;  2M9V A;  1V1O A;  1J6Q A;  1FGU A;  2XRS D;  5CV9 A;  4HTP A;  5LMN W;  3NBZ B;  2IX3 A;  1C4Q A;  1O80 A;  2MGS A;  3I8Z A;  4EX5 A;  4A93 B;  5CMD A;  1G2S A;  4H0L C;  2KED A;  4OEL B;  3DF7 A;  4MA5 A;  1SYD A;  2ZDG A;  4YAK B;  1QOH A;  5DEH A;  5C44 G;  2ZJQ A;  2D9U A;  2Y0S G;  3OIP A;  3U4Z A;  2FPG B;  5I4D A;  1I50 B;  3S16 B;  3KRE A;  3EBE A;  3IKJ A;  3NHH A;  3LNN A;  1OXU A;  2QCP X;  1DYQ A;  3S2H B;  4ME3 A;  1LYL A;  3BAB A;  4HMI A;  1SRU A;  4MA0 A;  1S72 A;  3VR4 A;  4RKB A;  5LHY 1;  4ZKB B;  5IWA L;  3CME A;  2CVR A;  4KTA A;  2G9H D;  4OEM B;  1BNZ A;  4JI4 Q;  3PO2 G;  5I9P A;  2JA7 G;  4GKJ L;  3E0E A;  1OXT A;  4B3M L;  2CKZ B;  4DU9 A;  1HA5 A;  1W96 A;  4CMF A;  4LF7 Q;  1V1Q A;  2KA7 A;  4DR5 Q;  1PYB A;  2RDH A;  4RFB A;  1TKW B;  1X56 A;  3A56 A;  1WCM G;  3TY8 A;  1BCP B;  4A3J H;  4C3J H;  4N8F A;  5IP9 G;  1IBK L;  4LNQ A;  1EUJ A;  3UDI A;  1A0G A;  2K75 A;  4KY5 A;  1A48 A;  4ALP A;  2WKC A;  3V4Z A;  2HCC A;  2B3G A;  2VPQ A;  4LF9 Q;  4MV9 A;  1PHJ A;  3ULL A;  2MJ8 A;  1GUW A;  1HNX L;  4GS3 A;  4NDX A;  1UUP A;  4NXN Q;  3JSL A;  3K3P A;  1IW7 D;  1HNZ Q;  3VR6 A;  5IIF A;  4O42 A;  4OO1 G;  3TY9 A;  1QE6 A;  3AW8 A;  1VMC A;  4A3M H;  1VQN A;  2KEC A;  1B04 A;  1SBB B;  3D4D A;  3BYY B;  4CC5 A;  2W6Q A;  4LUO A;  5DLQ E;  3I4M H;  2AWO A;  2UUA Q;  2R7Z G;  1EOT A;  4DQN A;  1JJG A;  4IO9 A;  1LUZ A;  1II3 A;  2PQA B;  3R2T A;  5FLM G;  3I4N B;  1P8L A;  2HHH Q;  3HKZ G;  3K57 A;  4RGO S;  2ZXR A;  2H1E A;  1AFP A;  4K0K Q;  2VUM H;  2NUA B;  2DAA A;  1LV9 A;  1ET9 A;  3R8B A;  4ZUI A;  3SE7 A;  3VA7 A;  5CV8 A;  2DZD A;  2NTT A;  2F3W A;  2X5R A;  2HT1 A;  3GJX B;  1XWE A;  5EKK A;  4IWY A;  2OTJ A;  2YZL A;  3U0G A;  4XYQ A;  4QCL A;  3WDN A;  5JOB A;  2JEB I;  1PYS B;  4X66 L;  2E2J H;  3T1Y L;  1NAP A;  1F9R A;  3MC0 B;  1NE3 A;  5JVL A;  4X65 Q;  3S15 H;  4DR1 L;  2OQ0 A;  4Y52 H;  3BA9 A;  1JB7 A;  1EYC A;  2VB3 X;  1JT8 A;  2FP4 B;  3MHB A;  1YJW A;  4FF3 A;  1JLL B;  3UFX B;  4RH6 A;  3G7L A;  4TVA B;  1HA6 A;  1XPU A;  4LH7 A;  1STN A;  5IT9 c;  1VF7 A;  5DAU A;  1I6V C;  3VR2 A;  1A62 A;  1FR3 A;  5JH7 F;  3JAM L;  3ORQ A;  4DR3 L;  1Z9F A;  1GXD C;  1GLV A;  1TU2 B;  4G7Z C;  5J2U F;  4HSP A;  1VQG A;  5M5Y H;  4A3J B;  4C3J B;  3GTJ B;  1B9N A;  3NTK A;  4K6N A;  1LTG D;  4X64 Q;  5G3L D;  3MA2 B;  1SYE A;  1PLF A;  4GZY C;  1A2T A;  4DR6 L;  2Z4H A;  3NUA A;  2VNU D;  3KUP A;  3L0O A;  5IYC H;  1JDB B;  2CCZ A;  1EY8 A;  4KLK A;  1IL8 A;  4DR4 L;  4IUN A;  4YWK A;  3E5S A;  1N32 L;  5KNB A;  4DUY L;  1CSQ A;  5M3F H;  3HOX G;  1QZG A;  3S1R H;  1YNJ D;  1BCP D;  3N52 A;  3MTS A;  2WB1 E;  1TWH H;  3A8K E;  1F9P A;  4BBR H;  3CU7 A;  4A3M B;  4ILW A;  3UZO A;  4DV1 Q;  4HIK A;  1Y1W H;  3IAY A;  1WD0 A;  1GSA A;  5IT9 E;  3I4M B;  3EIV A;  4C2M H;  3TRZ A;  2ZJP A;  1ENC A;  4NW2 A;  2K03 A;  1DZ1 A;  2KHS A;  1S40 A;  1KNE A;  4CJ2 C;  5DMX A;  4E4T A;  1HH2 P;  4C1N K;  4PZ8 A;  5JQW A;  1PRT C;  5I5X A;  4MZ9 A;  3RZD H;  1BNC A;  1MIU A;  3TIG A;  2F0V A;  3NBH B;  3X3M A;  5KIX A;  2YRW A;  3DAA A;  2IX0 A;  3K5I A;  1VCI A;  2D0O A;  1XNR Q;  2A6H C;  4O7T A;  2E76 C;  1L0X B;  2KCC A;  4AH6 A;  2WFW A;  1T5X D;  3NC0 B;  3J7Y W;  1DOK A;  1B53 A;  3DWP A;  2PQA A;  1L0W A;  4L8J A;  2E2J B;  5BN3 A;  1IL2 A;  1TAE A;  2HGS A;  4O4J F;  4HMJ A;  1I4X A;  3U58 A;  3JZ6 A;  1OBD A;  4JYA Q;  1GUG A;  1P16 A;  4LFC Q;  1TS4 A;  5H1S E;  4YBZ B;  2E2H H;  2CNQ A;  1KAB A;  4KKT A;  5EBC A;  4DK3 C;  4DK0 A;  4A3F H;  3S15 B;  3G48 A;  2WP8 J;  1IOV A;  4P73 A;  5FOB B;  1CS0 A;  4DK1 A;  4DNR B;  5GAG C;  3LP8 A;  2GVA A;  1C3O A;  4AYB B;  1HQM C;  4YY3 Q;  4A3E H;  1JIC A;  5K2M A;  4CJ0 B;  1STG A;  3KLS A;  3J80 L;  3AFQ A;  2B63 H;  5KYI A;  3SDZ A;  1IYU A;  3GID A;  1PRT F;  4PBC A;  5EZY F;  1BBW A;  4O2A F;  4MTK A;  2F4V Q;  4A3G H;  3OYY A;  3U9T A;  3T16 A;  5IYD G;  1PA6 A;  5DM6 3;  4EGQ A;  4JXU A;  2F0D A;  2AQ3 B;  2KUM A;  2Z04 A;  5M5Y B;  2DUD A;  3HOV G;  3CC7 A;  4AQY L;  3P1H A;  4GLV B;  5KGU A;  4IOC A;  1PTO H;  1ILQ A;  4MV6 A;  5KYL A;  2FHT A;  1D1K A;  3QOJ A;  2WAQ B;  1EWI A;  2F3V A;  3L9A X;  5LMU L;  1C9O A;  3TS0 A;  5GAE C;  1KLU D;  1FJG Q;  4M8A A;  3TII A;  4TRD A;  1U4R A;  1SDF A;  3SXH A;  4A3D H;  3GTL H;  4PG3 A;  2Q2T A;  3PGZ A;  5M3F B;  4B3R Q;  3S1R B;  4RHS A;  1UC9 A;  1HNZ L;  1ILP A;  3SEB A;  3A54 A;  1TWH B;  4BBR B;  4JI3 Q;  3K5H A;  4C5A A;  1VS0 A;  2AWN A;  1S4Z A;  2B2V A;  1EY7 A;  5FKA C;  4X62 Q;  1Y1W B;  2YZM A;  1KRT A;  3LUL A;  2RSN A;  2IL8 A;  4FVM A;  4DAY B;  3VYU A;  1BXR A;  2PNR C;  3PUX A;  1GSH A;  5BWX A;  2R87 A;  4C2M B;  5EBD A;  2JA6 G;  1TT2 A;  2EJ2 A;  2ES2 A;  1X9N A;  1S5E D;  3I4L A;  5LL6 S;  3J81 L;  1LTB D;  4POG A;  5M5W H;  1XPO A;  2MFI A;  3R93 A;  2TMP A;  3A8I E;  3SK4 A;  1SNQ A;  2WIN B;  4JI5 Q;  3P20 A;  1RL2 A;  3RZD B;  1EUD B;  3FHW A;  3BDC A;  1I1K A;  1N36 L;  1Q86 C;  3G4S A;  1CQI B;  4K8J A;  2RDF A;  1EOV A;  3GV3 A;  2GVB A;  4OWT B;  1XYI A;  3RD4 A;  3FDT A;  3T1H Q;  4FFL A;  5BR8 Q;  3QOL A;  1F2L A;  4DR7 L;  1KDC A;  5J3B A;  2MUY A;  4TKO B;  3ICE A;  1PZI D;  1Z47 A;  3K81 C;  4WJ4 A;  1K83 H;  5I9O A;  2J9G A;  1Z7T A;  2BE5 D;  2JA8 H;  2HIV A;  1LTI D;  3K58 A;  3LWE A;  1RJT A;  1TII D;  4FFP A;  1EWH A;  4OHJ A;  2E2H B;  4IUU A;  2A68 D;  4NYE A;  4A3F B;  3MXN B;  3NBH A;  3MFG A;  4UY8 C;  2OLS A;  3FPU B;  3NK9 A;  2JJQ A;  2CH4 W;  4GN4 B;  2AHO B;  1X3E A;  2EJ3 A;  2UXC Q;  2W6M A;  4JBM A;  1BBX C;  4NZN A;  3OHX C;  4OWX B;  1L1O C;  5CYU A;  1WFQ A;  1RD9 D;  2B63 B;  4NXM Q;  4H13 C;  4DAP A;  4CC6 A;  4UP7 A;  3R23 A;  3HGB A;  2HVQ A;  2EQS A;  4ZAI A;  1I94 Q;  1KTA A;  4KMU C;  2R3Z A;  1C0A A;  3MAQ A;  2K01 A;  5LP6 F;  3JRW A;  5D3I B;  2A69 D;  1EKF A;  1MD2 D;  3OIQ A;  1SNP A;  4B08 A;  3VDY A;  2F1M A;  1PTO B;  3TIN A;  1VQB A;  1VF5 C;  2B2W A;  4RWS C;  4NB3 A;  4OIJ A;  3MWE A;  3HZX A;  2YTY A;  2DJF C;  2Z6B A;  2A19 A;  4R1J A;  5IGF A;  2G9D A;  3CXC A;  4APV A;  1Q82 C;  4LFB L;  4HNU A;  1E22 A;  3B6Y A;  2K4K A;  4NZO A;  4A3D B;  1B6R A;  1NBW A;  3GTL B;  1N8R C;  4DV4 L;  3VYR A;  4IWX A;  4ZQ3 A;  5C0X J;  3DM3 A;  4CHT B;  3WOF A;  1PMR A;  2AUJ D;  4DAV A;  2QDL A;  2R7F A;  3R3O A;  3U55 A;  1A63 A;  1TA8 A;  2E74 C;  1TS3 A;  2CH4 A;  5IOC A;  3RLO A;  3CCS A;  3EJI A;  4JI6 Q;  1VQA A;  5I5W A;  2FMC A;  1I4R A;  5M5W B;  3E9I A;  4HSV A;  1BQQ T;  3SK8 A;  1AH9 A;  1W6J A;  4WBN F;  2N49 A;  4F87 A;  1LTL A;  2ZGI A;  2Q8I B;  3C3L A;  2COG A;  2KQ3 A;  2QEX A;  3KK7 A;  3TP5 A;  2EY2 A;  2K28 A;  3S14 H;  4LK1 C;  1CM9 A;  4ZUJ A;  1I7L A;  4FFO A;  2R82 A;  4V19 0;  4DAY A;  5C0X H;  3ERO A;  1FNV A;  4HR7 B;  2OF1 A;  4PZ6 A;  5ELF A;  5A2Q L;  3G71 A;  1KJJ A;  1STY A;  2LXK A;  4F88 A;  2OQK A;  4IFD G;  3UDF A;  4FF2 A;  2Q2H A;  4O84 A;  1GHK A;  1MGS A;  2JA8 B;  4XYL B;  4RCO A;  1IYV A;  1B7Y B;  4LFA Q;  2IWH A;  2ENB A;  4LFC L;  4MTN A;  1NJI C;  3I12 A;  1GKH A;  1UNS A;  3PQI A;  2K5W A;  1JQY D;  1Y8P B;  2WAC A;  4JI0 Q;  2IHF A;  4GN5 A;  2GA4 B;  1PZJ D;  2W6P A;  2ICE C;  4FFR A;  2A73 B;  2VW9 A;  2RVL A;  1DD2 A;  3ULJ A;  2PN1 A;  4UP8 A;  1B2T A;  2HG8 A;  4JC0 A;  1JWS D;  3TP6 A;  2V1C C;  3JAM E;  1K8A C;  3QB3 A;  2C9O A;  3MXN A;  4P71 A;  2WII B;  4JOI A;  1K0R A;  1Z2P X;  4A3J G;  4C3J G;  3M85 A;  4R4C A;  5M5X H;  5C4X H;  4ZLT F;  3GDE A;  1SYC A;  1WTH A;  3HP3 A;  5K36 G;  5DGH A;  5LXT F;  3T13 A;  1KQS A;  4R8I A;  1E2Z A;  3H6M A;  4K6L A;  4GNX B;  3JZF A;  1IKL A;  2KHI A;  2AUK A;  2CW0 D;  2NVT H;  3PV0 A;  4A93 H;  3N6R A;  1FJG L;  4L5T A;  2QIL A;  1N34 Q;  1XMQ L;  2CNU A;  3QQM A;  4CDE C;  4B3R L;  4A3M G;  1I50 H;  1IBL Q;  2ASB A;  4DV3 Q;  2DIK A;  4HTO A;  1PTO D;  1TWF B;  4LJZ C;  4HAE A;  1C7Y A;  1LT5 D;  1VQ9 A;  2EY1 A;  3PCO B;  5CB4 F;  1VQE A;  1MSH A;  1IW7 C;  3T9F A;  4R8N A;  1SFO H;  3ULP A;  1K9M C;  2NUC A;  2N3S A;  4XYO A;  1VQD A;  3TME A;  1HUN A;  4ZK9 B;  2Q8R E;  4K5V A;  4JI5 L;  3NEM A;  5JPN C;  3J80 c;  2ZM6 L;  3PSI A;  2RSO A;  4WFN 3;  2VUM G;  1X3Q A;  3TBI B;  3NPP A;  3S14 B;  2EYF A;  3R5F A;  4C5C A;  3BG5 A;  4J1M A;  4G7H C;  1UE6 A;  3CQZ H;  4O83 A;  3BJU A;  5FJ8 G;  2R7M A;  5J22 A;  3T1H L;  1K73 C;  5ELN A;  1R4Q B;  5BR8 L;  5C5L A;  3Q2O A;  2I80 A;  4FXD A;  4LF8 Q;  5FNV F;  2B2T C;  2NZH A;  1BUV T;  1MKH A;  4DV7 L;  1A6X A;  1X3P A;  1VBH A;  1VQP A;  4L5S A;  3R5H A;  2EXZ A;  2F03 A;  1Q1B A;  2NN6 H;  3ERQ A;  2GQS A;  4O7L A;  5C8Y F;  2VQF Q;  1KUT A;  4HR7 A;  2L11 A;  2HDK A;  2BCO A;  4AYB G;  1WYD A;  3EA6 A;  1IYJ B;  5I47 A;  2NWG A;  5I5T A;  4O4I F;  2EYM A;  3TZD A;  4XTC S;  4K2K A;  3CC2 A;  3HOZ H;  1VQI A;  4IUQ A;  2F4I A;  5F2D A;  1PH5 A;  4EFB A;  3H0G G;  3J80 E;  1YBY A;  1H9J A;  4GOP B;  3J81 c;  2PZT A;  1XTC D;  5FPR A;  4HCE A;  2ZXO A;  4YJ2 F;  3H3V C;  4DGZ A;  3K6O A;  1KJI A;  5M5X B;  5C4X B;  2CWA A;  2R93 H;  2HQE A;  1JMC A;  3L3O C;  3M7G A;  4K14 A;  3G6J B;  1RDP D;  5I2X A;  3EN2 A;  2D0P A;  4JI1 Q;  2WAQ G;  1YHQ A;  1A8V A;  2VR1 A;  4WJW A;  3CRK C;  5CGK A;  3RNU A;  2NVX H;  1ZXT A;  2NVT B;  1EZ1 A;  2FMM A;  5BN4 A;  3MJF A;  2N55 A;  5IYC G;  2I5L X;  3D6C A;  4LF5 L;  1GO3 E;  5LMN L;  2N78 A;  2EXD A;  2SOB A;  3JSN A;  3M7N A;  2EYL A;  3T51 B;  1A3T A;  1JOO A;  1QCB D;  3FP9 A;  4BBR G;  2I0Q A;  5ELO A;  1RIP A;  2W6N A;  2YS7 A;  4MV1 A;  3NBI A;  4L1K A;  4QIW B;  3S2D H;  4GNX A;  4BWG B;  1NNX A;  2NYZ D;  1HR0 W;  1E2W A;  2Z9H A;  1SFO B;  5DNF A;  1YNJ C;  3AU7 A;  1BCP C;  4X3S A;  4EGJ A;  4XQJ A;  1MJC A;  4RKL A;  3KLR A;  3J81 E;  5KNC A;  2X69 A;  3BZD B;  3T4A C;  4A3C H;  4RCN A;  4XZ3 B;  1DOL A;  2B8G A;  2KCM A;  3OTO L;  3OWF A;  1GHJ A;  5EKI A;  4Q4D A;  3R2I A;  5DAA A;  1CE8 A;  2MO1 A;  1IBM Q;  3OW7 A;  1RKN A;  3CQZ B;  1M0T A;  3IRB A;  2ZTD A;  3MEF A;  3GTJ H;  2YS6 A;  4G57 A;  2XCL A;  2CFM A;  1Q1E A;  1FGB D;  3HFZ B;  3V2T A;  2Q2U A;  3U9O A;  1DON A;  1F2Z A;  3UYY A;  2OCE A;  5G3L F;  2IHE A;  2TSS A;  4LW1 A;  2HGX A;  1WTW A;  1F9Q A;  3STB D;  1HHV A;  4A3F G;  4H44 C;  4ULL A;  2H5X A;  1N33 L;  2K33 A;  2MQH A;  5BPH A;  2K1B A;  3KLW A;  1EYA A;  2F0L A;  1XTD A;  2VQE Q;  1I4Q A;  2B29 A;  4A3E G;  2JYO A;  1PH1 A;  3JZI A;  2M00 A;  4B3T L;  2MPM A;  2B63 G;  2ZDH A;  4FU0 A;  3L2P A;  3HOZ B;  3FVQ A;  3WWJ A;  5IGD A;  4DR2 Q;  3Q6S A;  4A3G G;  2LMC B;  5E3F A;  5IE8 A;  1A15 A;  1I1L A;  1YNN C;  4JI8 Q;  5FPO A;  4R4I A;  4HCS A;  3S17 H;  5I2Y A;  3VYT A;  1H9K A;  3I90 A;  2R93 B;  4YHH Q;  2EE1 A;  3HKS A;  4HJA A;  2Y0S E;  1GJX A;  1ESF A;  3D4R A;  4H7B A;  3RUZ A;  3GTM H;  3UQ8 A;  3K0Y A;  2IX1 A;  1DOM A;  3EQL C;  5DGI A;  1EY9 A;  3F8T A;  4OIK A;  4X3T A;  2NVX B;  2C00 A;  3HEJ A;  2E75 C;  2F0U A;  2QEJ C;  4C3H G;  1EEF D;  4O1N A;  4CHI A;  5EGT A;  2YZN A;  4RHR A;  1S5D D;  4GOP A;  4A3D G;  1E4E B;  1EU3 A;  4QB4 A;  4IUV A;  4ZYS A;  1IYD A;  1KAW A;  2F0I A;  1L2F A;  1SYF A;  4YWM A;  5LL6 X;  1ZKO A;  3CCM A;  3C2P A;  2CNV A;  3F2C A;  4C5B A;  1IBL L;  2JSO A;  3MXP A;  1EFW A;  1LAB A;  3S2D B;  2VS1 A;  2EY5 A;  1SND A;  3BZK A;  4DV2 Q;  4LAA A;  3W3A A;  1A3V A;  2B2V C;  3PO3 G;  5JVD F;  4B9W A;  3NQT A;  3LQS A;  3ZJY C;  1ET0 A;  1KNA A;  1C8C A;  4IHJ F;  4DV0 L;  3W1B A;  3O13 A;  3MVV A;  4A3B G;  1LTT D;  4JPB W;  1PH6 A;  3PF4 A;  4FF4 A;  3KBG A;  3ZYY X;  4CKE A;  1YIJ A;  2YZG A;  2BA0 A;  5D3D A;  4A3I H;  2I8C A;  1E2V A;  1SJH D;  4QUC A;  5A2Q E;  3Q8D A;  2NU8 B;  2VL6 A;  2Z6K A;  1WTP A;  2EPB A;  2PBZ A;  1GUS A;  1HZA A;  1R4P B;  3AB9 A;  3H15 A;  5I5S A;  1EQR A;  1H9S B;  3C1E A;  1DIK A;  5GRO A;  2L12 A;  1VBG A;  3HKZ E;  2BE5 C;  4LF6 L;  3MEH A;  1PXU A;  3TSS A;  2VQF L;  3M4Q A;  4KHP Q;  4DV5 Q;  3WO1 A;  2EYP A;  2HVR A;  1NR2 A;  2SDF A;  4O7V A;  2A68 C;  4GLX A;  3PF5 A;  3KYH C;  5M3M B;  5C0X I;  1TS2 A;  4KK7 A;  2XNA C;  1HNW Q;  1PH8 A;  1O7Y A;  1U5K A;  4KHV A;  1K8G A;  4TVI A;  3URY A;  1V8Q A;  3CAM A;  4QGU A;  1JOK A;  2O2L D;  2BDO A;  3S17 B;  4HIM A;  2UUC Q;  3U9S A;  2J4X A;  1PYW D;  1VMP A;  4I4T F;  1HFN A;  4FXG C;  4PNY A;  4OX9 Q;  1FNU A;  3GTM B;  1S5B D;  2UXD Q;  1SE8 A;  1EWC A;  2YTX A;  1KTK A;  5C3E H;  1AE2 A;  1SYB A;  1R9T H;  1QNK A;  1EIG A;  2VB2 X;  1VQ5 A;  5JAV A;  2A69 C;  2DNE A;  4PZ7 A;  2L4N A;  4QJF A;  5GAH C;  1O78 A;  5JJK A;  1YJN A;  2VUG A;  2M2L A;  1VQ7 A;  4N9P A;  5BN5 A;  3GLK A;  1I5F A;  3T9A A;  3I55 A;  4GKK Q;  4GLW A;  1WR2 A;  1ZYR D;  4KY7 A;  4UAI A;  1AZQ A;  2PQE A;  5EJW A;  3NQI A;  4ZCK A;  1W2B A;  1YIT A;  3V05 A;  1VQL A;  4MNO A;  4GN3 B;  5D1P A;  2R7N A;  4Z9C B;  3HOW H;  4NZM A;  2AQ1 B;  2K04 A;  1PFS A;  4YAJ B;  3TEH B;  3I73 A;  5IYB H;  2KOL A;  3I3C A;  3ND9 A;  1E4E A;  4U67 3;  3HOU H;  4K5X A;  2XIW A;  2XN9 C;  2BA1 A;  4JI4 L;  2KEE A;  2PI2 E;  1A2U A;  3A55 A;  4LF7 L;  5I6W A;  2YW2 A;  1M1K C;  5C0X G;  4DR5 L;  4IOA A;  3M3Y H;  4B3S Q;  2V58 A;  4ABN A;  4YB8 B;  4L5Q A;  4CJ1 B;  4BY1 H;  4A3I B;  1PFB A;  2QK4 A;  5CA1 F;  3RV3 A;  2F0F A;  2RKS A;  3CPW A;  1CKM A;  3PUV A;  4OON A;  4MV3 A;  3DUZ A;  4E6I A;  5I6Y A;  5CM0 A;  1PH4 A;  4LF9 L;  1IHZ A;  2XRQ D;  1WTQ A;  3PUY A;  3ERS X;  3DTG A;  3CKI B;  4O2D A;  1VQM A;  1VQK A;  1BOS A;  4NXN L;  2Z4I A;  3LGJ A;  3RN5 A;  1NY4 A;  3NWT A;  3PUZ A;  3CCU A;  1CQF A;  4QF4 A;  1V9P A;  2UU9 Q;  4BY7 H;  2ZT9 C;  3GP7 A;  4DXF A;  2D5D A;  1G29 1;  3T54 A;  3I91 A;  2HVS A;  1B44 D;  3I7F A;  4QSH A;  3VPC A;  1BR9 A;  3OSO A;  5I5V A;  2UUA L;  1ASY A;  1H9S A;  3DMU A;  1I2L A;  4OL7 A;  5HV6 A;  1JCK B;  4K6D A;  3S24 A;  2HHH L;  3A7L A;  3BA8 A;  1CSP A;  2K5H A;  1D6E C;  5C4X G;  4K0K L;  4LH6 A;  4R4T A;  4EEQ A;  1Y8O B;  1S3O A;  1EU4 A;  1EIY B;  3VR3 A;  2WKD A;  2OEO A;  3CP0 A;  2PVP A;  1WTO A;  1NTG A;  5C3E B;  2NN6 I;  1YI2 A;  2NU6 B;  1R9T B;  1GUT A;  4IZ8 A;  1D2B A;  3HO8 A;  2NZ1 D;  1Q8K A;  2J7Z A;  1VDZ A;  5J1Z A;  3JAM i;  4A93 G;  3CPF A;  1I3Q H;  5T1G A;  4O86 A;  4KJO A;  4DPG A;  5CBE E;  2XVS A;  1D5Z C;  1PDQ A;  3F2B A;  2LXJ A;  2F0M A;  3E5N A;  2CW0 C;  5IGC A;  2EVB A;  5E4X A;  4HJ8 A;  4X65 L;  2R7K A;  1HUM A;  1OBG A;  3P75 A;  3HOW B;  5AJ3 Q;  3GV6 A;  3CCE A;  5GAD C;  5J2T F;  1AE3 A;  4BA1 I;  5H80 A;  2NU7 B;  1XMO Q;  5L37 A;  4IPC A;  3NUC A;  1PH3 A;  4EQO A;  2F52 A;  3HOU B;  1VQO A;  1C30 A;  2FPP B;  3C46 A;  2OT2 A;  2YWV A;  3AEV A;  4QQB X;  5EPL A;  4I50 F;  4N9T A;  1KAA A;  1EIH A;  1KJ8 A;  2RBM A;  5A35 A;  4H02 A;  1BKB A;  1AUX A;  4DNT B;  2PCF B;  4BA2 I;  2QA4 A;  3M3Y B;  4Q5V A;  2UUB Q;  1QG7 A;  3T9E A;  3DXJ C;  1EQT A;  4BY1 B;  2LKV A;  1KC8 C;  1OXS C;  5BYB A;  5KND A;  2CQO A;  4X64 L;  1LAC A;  2N8N A;  3T9B A;  3LX0 A;  1PH9 A;  3BVM A;  1X3G A;  4IUP A;  2O5I C;  2A6H D;  5JJZ A;  1STE A;  2NN6 G;  4XQQ A;  2HDM A;  3HKZ B;  3X3N A;  4DFA A;  2O4X A;  2WB1 B;  2YTV A;  2EYO A;  1IOW A;  2F3I A;  3ITP A;  3DWQ A;  5COR A;  4HNT A;  1TY0 A;  4BY7 B;  4KHP L;  1TWF H;  4DV1 L;  1QJO A;  1FD7 D;  1SNO A;  2J0T D;  4BBS H;  5JJI A;  3HOZ G;  1WJJ A;  4J15 A;  3D8G A;  1HR0 Q;  4EG0 A;  1E24 A;  4X6A H;  4IUR A;  3I4N G;  1HNW L;  5ELD A;  1M0W A;  2A6E D;  2MNA A;  3KFU A;  1B50 A;  2EJM A;  5CA0 F;  2A5H A;  3NP8 A;  2B2Y C;  3CC4 A;  1E1T A;  3FKI H;  2R93 G;  3TEK A;  3IL8 A;  2B2U C;  3JAM c;  2R86 A;  4WRD A;  4JW0 A;  4DIM A;  1XNR L;  4LMQ D;  1VQ6 A;  3J80 i;  1UE1 A;  5CAE B;  1SAP A;  1F2Y A;  1B9M A;  2DJG C;  5IWA Q;  4DXG A;  1YZ6 A;  1I3Q B;  4CDD C;  1BVS A;  3DEP A;  4I7A A;  4GKJ Q;  4PMC A;  4KD3 A;  1LT4 D;  1LLR D;  2LY7 A;  2F0P A;  2E5L Q;  1J8I A;  3WWI A;  5JVH 3;  1GUN A;  3VOT A;  3TW6 A;  3FRP B;  4JYA L;  3U4V A;  3Q0A A;  4HJ7 A;  3NTI A;  1IBK Q;  1A9X A;  2JXM B;  3M4P A;  3U54 A;  3KAK A;  4DK6 C;  1VQH A;  4YY3 L;  1GSO A;  4C56 C;  1BBU A;  4O4H F;  1KD1 C;  2K5V A;  3A74 A;  4A3C G;  1SEB D;  1JJ2 A;  1D5X C;  2KCT A;  2F4V L;  4GNX C;  1HNX Q;  4Q4C A;  3Q22 A;  4DRF A;  3HOX B;  4KHZ A;  5K5P A;  1MJE A;  1M8A A;  1DAA A;  1NR4 A;  4CDF C;  1I7N A;  4O4L F;  3K8A A;  1KT8 A;  2RDG A;  5LOV F;  3J81 i;  1Q7Y C;  4ID6 A;  4JBW A;  3SR1 A;  1BXT A;  1TWC H;  4K2L A;  3NBY B;  3HT5 A;  2OWO A;  2Y4R A;  5ELC A;  1K28 A;  4NP5 A;  4AIM A;  1WOC A;  1WI5 A;  4IJH A;  1TR5 A;  1EKP A;  2AKW B;  3AFP A;  1VQ4 A;  1E0B A;  5CE8 A;  2DLN A;  1B3A A;  2L5T A;  1WD1 A;  4R4Q A;  1U4P A;  5AFW A;  3G6E A;  4DKA C;  5D65 A;  2I5M X;  3K5M A;  3WO0 A;  4HNV A;  4JI3 L;  1JOQ A;  3QWU A;  1CKO A;  5FR9 A;  4A76 A;  2UU9 L;  4X62 L;  3STB C;  2K32 A;  4ZI7 F;  2XSC A;  2Z0S A;  2BH2 A;  1A0I A;  2RCF A;  3AYH B;  3I4M G;  4BBS B;  1F2M A;  2Q7D A;  3J7A 5;  4EQN A;  2FB9 A;  1RF2 D;  4JCV E;  1ZAU A;  4CBV A;  1ONL A;  1YHA A;  3U50 C;  5D1O B;  2SNS A;  2HCI A;  3H3V H;  2Z1C A;  3UI2 A;  3T1Y Q;  2JP1 A;  1VQJ A;  2JK8 A;  4MAM A;  1JJC B;  1TWA H;  4F7X A;  2I87 A;  3HS0 C;  2C35 B;  3FKI B;  4FYD A;  1DCZ A;  1Y8N B;  2FIN B;  3L7Z C;  5EAY A;  1LT6 D;  4FP5 D;  1B3Q A;  3A7A B;  3W2D A;  4DR1 Q;  2R61 A;  3OW2 A;  1DV2 A;  1ZEQ X;  4LF4 Q;  3HRZ C;  2RA4 A;  2DWC A;  2CHB D;  1GGO A;  5JQG F;  2LS0 1;  3Q24 A;  5EPJ A;  1GUO A;  5FLX L;  1H9M A;  1SE4 A;  1QWY A;  1NSN S;  3M4Y A;  1MSG A;  2V59 A;  1LO5 D;  4JV5 Q;  2A1A A;  3SK5 A;  4DR3 Q;  4KJN A;  1V1P A;  2R7L A;  2GN5 A;  4O0A A;  2K5Q A;  5JVG 3;  1EQQ A;  1UC8 A;  4UP9 A;  3CCJ A;  1AUV A;  3GB8 B;  1CZG A;  4BXX H;  5C6A A;  1HZB A;  2PMZ E;  2UXC L;  2IJ0 A;  1X65 A;  3VNN A;  3TS2 A;  4HID A;  3T99 A;  4JBJ A;  4DR6 Q;  2ICI A;  4FXK C;  4TM5 A;  4DLK A;  4NXM L;  4ZHQ F;  2GQR A;  1K8O A;  4TV9 F;  4M1U B;  2Z02 A;  2FXQ A;  2GPS A;  5HNE A;  2F0G A;  3K0X A;  5FO9 B;  3KJO A;  2F0O A;  5KRU A;  4ZQI A;  1N32 Q;  4DUY Q;  1I94 L;  4RA8 A;  2F0E A;  2LSS A;  2H4O A;  1PFN A;  3FEW X;  1HTL D;  2F0J A;  4HTH A;  3K59 A;  4UPA A;  3GTP H;  4YJ3 F;  3NTH A;  3JC6 6;  3CW2 C;  5KS8 A;  5HGT A;  1D8L A;  3MFY A;  4R4O A;  2PNH A;  3KBX A;  3CCL A;  2FFK B;  1XK5 A;  3OOC A;  1TWC B;  3UE1 A;  4I7Z C;  4NPS A;  3QO2 A;  1Z2O X;  4I65 A;  2PZU A;  3QIA A;  1TVX A;  2I5H A;  5ELE A;  1AP0 A;  5KEE A;  2VXW A;  1TS5 A;  5C3X A;  2COJ A;  2DNC A;  5EQ0 A;  1QB5 D;  5JPM C;  1O7I A;  4O82 A;  2VQD A;  3D3R A;  4A3L H;  5M3F G;  4RAU C;  4IIJ F;  3FMC A;  4Y7N H;  2EIF A;  3UZB A;  3DWA A;  3GTO H;  5EPK A;  1Y1W G;  3A5Z B;  3QG1 A;  5GQO A;  1KIX A;  5NUC A;  4KY6 A;  1UEB A;  4F8M A;  1EYD A;  3RTX A;  3BS1 A;  4JI6 L;  4IFD H;  3LWB A;  4OO1 I;  1HR0 L;  1Q90 A;  1U9R A;  2YV5 A;  1X6O A;  2MP1 A;  4RGT A;  1GVP A;  1TWA B;  3ETH A;  5JEA J;  1FYC A;  3NWS A;  4C3I H;  1O7L A;  1G2W A;  2PW7 A;  4PMB A;  3Q1K A;  3ETJ A;  3BAA A;  4EGV A;  3D31 A;  3PIO A;  3PUW A;  3HG9 A;  5C3E G;  1G6Z A;  3G8D A;  4S3S A;  1AZP A;  4A3K H;  1JWU D;  3KF6 B;  4P72 A;  1EYG A;  2RHS B;  4OXP A;  1I4P A;  4AYB E;  5D1O A;  3DHQ A;  5CV5 A;  4LUV A;  1HFG A;  1B6S A;  2E5L L;  2BDN A;  3RZO H;  3CSW A;  3SK6 A;  2IP4 A;  4LFA L;  4IAL A;  3VPB A;  4HED A;  2D2C C;  1JR0 D;  3VA5 A;  1TQO A;  4AQY Q;  3OMG A;  3F1Z A;  5JEA H;  2JA5 H;  3W5O A;  1SMY D;  4JI0 L;  3HOW G;  2ID0 A;  5K36 H;  1BCP F;  1JC7 A;  3TQY A;  1JKJ B;  5BWW A;  5IYB G;  3H91 A;  1ZYR C;  4PQX A;  5LMU Q;  1S68 A;  1EUC B;  1FNW A;  1KHI A;  3HOU G;  5BYA A;  2EY6 A;  4J8Q A;  2WAQ E;  3I70 A;  4UCT A;  4MV4 A;  5M3M H;  1XJV A;  3S1N H;  1Z6H A;  1VKZ A;  3NEN A;  2DY8 A;  3T9D A;  1I6H B;  4FDB A;  3GTP B;  2COI A;  1KL9 A;  3BG3 A;  5D14 A;  4DA2 A;  2NVY H;  2RQX A;  5CC4 A;  4YIJ A;  3PIP A;  4BY1 G;  2JE6 I;  1KXL A;  1JE5 A;  4IPD A;  1WTV A;  3EFX D;  1QVG A;  1I4H A;  1Q81 C;  3A5U A;  5E1F A;  4QL5 A;  3CMA A;  2A8V A;  2W6Z A;  3I56 A;  4XQN A;  1Q3L A;  5M9O A;  1D7Q A;  2P0A A;  2A74 C;  1EIF A;  1STA A;  1ENA A;  2L15 A;  4CDC C;  4CE5 A;  1I4G A;  4UCR A;  3E9H A;  1N34 L;  3Q23 A;  2WB1 G;  2JEA I;  3JRX A;  4FE2 A;  4Y7N B;  1N36 Q;  1CZW A;  4IN3 A;  1M6V A;  4FGR A;  2B2T A;  2NB0 A;  1C48 A;  3GTO B;  1A3U A;  4BY7 G;  1CK1 A;  2IPK D;  3I4O A;  4DV3 L;  4G4K A;  2KCN A;  2EZV A;  5FJ8 H;  4DR7 Q;  3K80 C;  1HXY D;  1B8A A;  4KKS A;  3RN2 A;  5LYJ F;  5IP7 H;  1KEE A;  2Q8T A;  1SE3 A;  1EY5 A;  3S1Q H;  1NUC A;  1SJE D;  1YJ9 A;  5ELB A;  1RTO A;  4YCV A;  2HJW A;  2XWB B;  2GLT A;  5C4H A;  4TSS A;  4DUZ Q;  4WOR A;  3BAC A;  4WHX A;  1MHW C;  2L9H A;  1RCV D;  3TP7 A;  4QUF A;  4C3I B;  3TDQ A;  3T53 B;  4EVO A;  1MBY A;  3PFF A;  5KKN B;  1B70 B;  3KAJ A;  2P5Z X;  4XXE A;  4J6H A;  4LF4 L;  2DAB A;  1EY4 A;  1X54 A;  2QW7 A;  3SGI A;  1CT1 D;  4A3K B;  1CA6 A;  2XGT A;  2YRX A;  2RCN A;  3UE0 A;  2JN4 A;  2F0H A;  4UUG A;  3MZ5 A;  1Q46 A;  4LF8 L;  4CKB A;  5C4J H;  2JA8 G;  1Z2N X;  1GM5 A;  2B39 A;  2E8G A;  4O7S A;  1TXY A;  1Y1V H;  2NVQ H;  4JV5 L;  5C1P A;  3H0G H;  5CBA E;  1M90 C;  1CFM A;  2EYH A;  3RZO B;  4UHV A;  2EJF C;  2R92 H;  2W71 A;  1T5E A;  1I1M A;  1HJP A;  3GO5 A;  2PMZ B;  2HUG A;  4MIU A;  2LFN A;  3HOY H;  2JA5 B;  1XX8 A;  1V43 A;  3KF6 A;  2NU9 B;  3R9R A;  5JJL A;  3BZC A;  2KHJ A;  2QGQ A;  4LFB Q;  4KV6 A;  2Q2I A;  3S1N B;  4KKU A;  3SNO A;  4DV4 Q;  4A4I A;  5C44 H;  1L0Y B;  2K7V A;  4O7Z A;  3SVM A;  4JK1 C;  1RHP A;  5GON F;  1KC7 A;  2NVY B;  2QKI C;  3FPP A;  4QMG A;  4NMZ A;  4X3U A;  1ML0 D;  4POF A;  1X32 A;  2NTS A;  1G2T A;  1QUQ B;  2VZA A;  3NSW A;  1SR3 A;  4P74 A;  2W70 A;  4UCU A;  2JA9 A;  4JI1 L;  1XPR A;  1CUK A;  3WOE A;  2ABJ A;  2FJ2 A;  4HIO A;  3ER0 A;  5CV4 A;  4QY7 A;  2MHV A;  2L0C A;  3AX6 A;  3RR5 A;  4DN4 M;  5FLX c;  3GTK H;  3KAL A;  2B2W C;  3PO2 H;  3GD7 A;  4A75 A;  2JA7 H;  2RHQ B;  1DJR D;  4M9U A;  1KDA A;  2VUM B;  2I46 A;  3NEL A;  1LTS D;  1QNU A;  1K0S A;  4K8I A;  3I2Z A;  3ORR A;  5CV7 A;  1ULZ A;  2K05 A;  1CQV A;  1YEZ A;  1WCM H;  5IP9 H;  4BBS G;  2YYZ A;  2K5N A;  1Y14 B;  3OUZ A;  4UCV A;  1PRT B;  3S1Q B;  1YVC A;  4CGY B;  4O7N A;  5FO7 B;  4JI7 Q;  2XWJ B;  4MN3 A;  1PX2 A;  3WWV A;  1SMX A;  1XDN A;  2KBN A;  3P7J A;  4G7O C;  3TZU A;  3FKI G;  1W3S A;  2R7D A;  5HUR A;  5IGB A;  1EHI A;  2PW5 A;  4DV6 Q;  4GLA C;  4HN7 A;  1EY0 A;  4IJL A;  1JB3 A;  1IBM L;  2R85 A;  3M9B A;  1IKM A;  4O7R A;  2RF4 A;  2A6E C;  4OO1 H;  3DTF A;  5HBR B;  1E3P A;  1YNN D;  3D6W A;  4E6N A;  3MXG A;  3TP8 A;  4LUZ A;  4PMW A;  5FLX E;  5C4J B;  4RG1 A;  4XIG S;  1Y1V B;  2NVQ B;  3DLL A;  2R7Z H;  1AN8 A;  1DM0 B;  3H0G B;  4P2C B;  2ZXP A;  3BDL A;  3F2U A;  2QF7 A;  3OMC A;  5FK9 C;  5FLM H;  2R92 B;  3CCV A;  3V96 A;  1CKN B;  4XYM B;  1ICF B;  1GD7 A;  4K5W A;  2XTI A;  1CI3 M;  3H3V I;  3HOY B;  3BVZ A;  1KLG D;  2SCU B;  1QIL A;  5IOD A;  4WJ3 M;  2OXP A;  2SEB D;  1HZ9 A;  2UXB Q;  2VQE L;  2HDL A;  2ZTE A;  3CRL C;  2PZW A;  3KJP A;  4RMF A;  2QDB A;  2BH8 A;  3S1M H;  4C3H H;  2MO0 A;  3RV4 A;  4DR2 L;  1XMQ Q;  5C44 B;  3CD6 A;  3VMM A;  2V4D A;  3H94 A;  1E1O A;  4JI8 L;  2Y0S B;  3OWE B;  2PO4 A;  2CZG A;  1NCV A;  3A0J A;  4YHH L;  2JQO A;  2YU9 H;  3RLF A;  1J5E Q;  2EJG C;  2ATW A;  2DN8 A;  3BDO A;  3TQT A;  4IPH A;  2OTL A;  4JOI C;  4JBK A;  4L5R C;  1SNM A;  1SN8 A;  1PZK D;  1IZ6 A;  2R84 A;  1DGS A;  4C1N I;  3GTK B;  1H9R A;  2IW3 A;  3PO3 H;  3EVQ A;  2HGW A;  2ZM6 Q;  1YHB A;  3PO2 B;  2JA7 B;  1BDO A;  2F0K A;  3D0F A;  4IPG A;  3T9C A;  4UFZ A;  5ISR A;  3QR8 A;  1T36 A;  1PFM A;  1SNC A;  2E2I H;  3KF8 B;  2ZTC A;  4MV7 A;  4JVZ A;  5C4Z A;  4A3B H;  4L63 B;  1QZH A;  3CCR A;  1WCM B;  1QUQ A;  4FFM A;  3BYT B;  3GTG H;  3K7A H;  3UDX A;  4DV2 L;  4DNI A;  3QFF A;  4XDX A;  4DV7 Q;  3J7A V;  3S9W A;  4IQZ A;  1PTO C;  4ZRZ A;  2CWP A;  4DUZ L;  1EL0 A;  1G51 A;  2WYO A;  2WV6 D;  3F2D A;  4DF7 A;  4TV8 F;  2F0N A;  3G8C A;  4XT3 B;  1XNQ Q;  4IZO A;  3N8D A;  2GPW A;  2YYA A;  1EY6 A;  1PK8 A;  1TWG H;  1G8Z D;  5COY A;  3DM1 A;  3HOX H;  1RTN A;  1D5M C;  4XX0 B;  3WNZ A;  2NZO A;  1W93 A;  1STB A; 
#chains in the Genus database with same CATH homology
 4JCV E;  3STB D;  3NBH B;  1YHA A;  1FVI A;  3U50 C;  5D1O B;  3H3V H;  2IX0 A;  4A3F G;  1VCI A;  2D0O A;  3T1Y Q;  1XNR Q;  5DIS C;  3KOJ A;  2H5X A;  1OXX K;  1VQJ A;  1N33 L;  2IT1 A;  2JK8 A;  2MQH A;  1SRO A;  1JJC B;  1TWA H;  2WFW A;  4AH6 A;  3KLW A;  3NC0 B;  2C35 B;  1X3F A;  5EAY A;  1XTD A;  3L7Z C;  2VQE Q;  4UCO A;  2B29 A;  4DR1 Q;  3OW2 A;  4A3E G;  1PH1 A;  4LF4 Q;  1KRS A;  2PQA A;  1L0W A;  4B3T L;  1UE7 A;  4JI2 Q;  2B63 G;  1TAE A;  1IL2 A;  4IFD I;  3L2P A;  3U58 A;  1L1O B;  4JYA Q;  4TQU S;  1UWV A;  4DR2 Q;  4BXX G;  4A3G G;  1P16 A;  4LFC Q;  5H1S E;  5HY6 A;  1K3R A;  2E2H H;  5IE8 A;  3PN1 A;  4DK3 C;  4A3F H;  4DV5 L;  3G48 A;  2WP8 J;  4JI8 Q;  3J81 j;  1QVF A;  4P73 A;  3GTQ H;  5FPO A;  4R4I A;  4YCU A;  3S17 H;  4JV5 Q;  2A1A A;  3TY5 A;  5GAG C;  4DR3 Q;  4LF5 Q;  2GVA A;  4YHH Q;  5LMN Q;  3HKS A;  4HJA A;  2GN5 A;  4O0A A;  2Y0S E;  4YY3 Q;  4A3E H;  3GTM H;  3UQ8 A;  2IX1 A;  3AFQ A;  2B63 H;  1EQQ A;  4UP9 A;  1CKN A;  3F8T A;  3CCJ A;  1BBW A;  3GB8 B;  4BXX H;  2F4V Q;  2UUC L;  4A3G H;  3OYY A;  1HZB A;  2PMZ E;  5IYD G;  4KI0 A;  1PA6 A;  3M4O H;  2UXC L;  1X65 A;  3VNN A;  3TS2 A;  4HID A;  4OX9 L;  1YNX A;  4GOP A;  4A3D G;  4JBJ A;  4DR6 Q;  2UXD L;  1KAW A;  2DUD A;  4NXM L;  1N9W A;  3HOV G;  3CC7 A;  2R6G A;  1L2F A;  4AQY L;  4YWM A;  4GLV B;  4IOC A;  3RLN A;  2FXQ A;  1PV4 A;  4EQ5 A;  4QIW E;  3K0X A;  3CCM A;  3KJO A;  3BAB A;  1N32 Q;  4DUY Q;  3F2C A;  1I94 L;  1IBL L;  4YCW A;  2LSS A;  1EWI A;  1EFW A;  3OTO Q;  4UPA A;  3GTP H;  4B3M Q;  4A3L G;  5LMU L;  1ASZ A;  1C9O A;  2VS1 A;  3JC6 6;  3TS0 A;  3BZK A;  3CW2 C;  5GAE C;  4DV2 Q;  1SLJ A;  5IYD H;  1FJG Q;  1H95 A;  1D8L A;  4R4O A;  4GKK L;  3KDF B;  4A3D H;  2PNH A;  1G6P A;  3CCL A;  3GTL H;  4PG3 A;  1PVO A;  2DGY A;  3UE1 A;  2Q2T A;  1XK5 A;  4NPS A;  3PO3 G;  3PGZ A;  3HOV H;  4B3R Q;  2I5H A;  3ZJY C;  3CF5 A;  1HNZ L;  4JI3 Q;  4DV0 L;  1VS0 A;  2AWN A;  3W1B A;  4X62 Q;  2ALY B;  1KRT A;  4DAY B;  1O7I A;  4A3B G;  3PUX A;  1PH6 A;  3PF4 A;  4JI7 L;  4A3L H;  2JA6 G;  5M3F G;  3UDG A;  4JG2 A;  4YWL A;  1X9N A;  4Y7N H;  1YIJ A;  2ES2 A;  2EIF A;  4POG A;  3GTO H;  5M5W H;  2BA0 A;  1E7Z A;  3CCQ A;  1XPO A;  4A3I H;  2MFI A;  1Y1W G;  3A5Z B;  5GQO A;  4JBK A;  1N33 Q;  1KIX A;  3Q8D A;  4JI5 Q;  4DV6 L;  2VL6 A;  2Z6K A;  1RL2 A;  1HZA A;  1UEB A;  3FHW A;  3AQQ A;  3H15 A;  4B3S L;  4A3K G;  3RTX A;  1EQR A;  1N36 L;  1Q86 C;  4JI6 L;  4B3T Q;  3G4S A;  4OO1 I;  1HR0 L;  3W1G A;  5GRO A;  1EOV A;  2YV5 A;  2GVB A;  4OWT B;  1X6O A;  1NMG A;  2JA6 H;  1GVP A;  3T1H Q;  5BR8 Q;  3HKZ E;  4DR7 L;  5J3B A;  5JEA J;  4LF6 L;  2VQF L;  4C3I H;  3ICE A;  4KHP Q;  1Z47 A;  3M4Q A;  3K81 C;  4DV5 Q;  3TY8 A;  2HVR A;  4WJ4 A;  1K83 H;  4DAM A;  3BAA A;  3D31 A;  3PIO A;  2JA8 H;  2HIV A;  3PUW A;  5C3E G;  4GLX A;  3PF5 A;  3KYH C;  4A3K H;  5C0X I;  5JEA G;  2JA5 G;  3KF6 B;  4P72 A;  5HGQ A;  1HNW Q;  1EYG A;  2RHS B;  4OXP A;  1PH8 A;  1U5K A;  1K8G A;  3MXN B;  4UY8 C;  4AYB E;  5D1O A;  2UXB L;  3CAM A;  4LUV A;  4QGU A;  2JJQ A;  4HIM A;  4GN4 B;  2UUC Q;  2AHO B;  1X3E A;  2UXC Q;  2E5L L;  5M3M G;  4JBM A;  3RZO H;  4OX9 Q;  4LFA L;  1HZC A;  4OWX B;  4X66 Q;  1L1O C;  1WFQ A;  1SE8 A;  2UXD Q;  5IY0 A;  4NXM Q;  2AMC B;  2YTX A;  4AQY Q;  3F1Z A;  5C3E H;  1X55 A;  4CC6 A;  1AE2 A;  4UP7 A;  2K14 A;  1R9T H;  1VQ5 A;  2JA5 H;  1L1O A;  3W5O A;  4JI0 L;  3HOW G;  2HVQ A;  2EQS A;  2ID0 A;  1I94 Q;  4PZ7 A;  3S16 H;  4QJF A;  2KEN A;  5GAH C;  3TQY A;  1C0A A;  1PH7 A;  5IYB G;  5JJK A;  1NMF A;  5LMU Q;  1YJN A;  1J5E L;  1S68 A;  2VUG A;  1KHI A;  1OTC A;  1VQ7 A;  3S2H H;  3HOU G;  2WAQ E;  1I5F A;  4UCT A;  5M3M H;  1UE5 A;  3I55 A;  3VDY A;  4GKK Q;  1XJV A;  3S1N H;  1VQB A;  3BU2 A;  3NEN A;  4NB3 A;  1OXV A;  1W2B A;  1YIT A;  2YTY A;  4FDB A;  1VQL A;  4MNO A;  2A19 A;  1KL9 A;  4GN3 B;  4R1J A;  5D1P A;  1VQF A;  4DV0 Q;  3CXC A;  1PH2 A;  2NVY H;  4APV A;  3HOW H;  5E7N A;  1Q82 C;  4LFB L;  3PIP A;  1KXL A;  4BY1 G;  1E22 A;  2JE6 I;  1JE5 A;  1T9H A;  2K4K A;  1PFS A;  3B6Y A;  4IPD A;  3TRE A;  1U0L A;  1QVG A;  3TEH B;  1NBW A;  4P75 A;  4LWC A;  5IYB H;  4DV4 L;  1N8R C;  1Q81 C;  5C0X J;  3A5U A;  3DM3 A;  3HOU H;  4QL5 A;  3CMA A;  4GOP C;  2A8V A;  4UCS A;  3I56 A;  2BA1 A;  4JI4 L;  5IP7 G;  1IXR A;  2PI2 E;  1D7Q A;  5AJ3 L;  1EIF A;  2L15 A;  2R7F A;  4HJ9 A;  4LF7 L;  4UCR A;  1A63 A;  1TA8 A;  3E9H A;  2VY3 A;  5C0X G;  2WB1 G;  1XMO L;  4DR5 L;  1N34 L;  1M1K C;  2JEA I;  4B3S Q;  3RLO A;  3M3Y H;  4IOA A;  1N36 Q;  3CCS A;  4L5Q A;  4JI6 Q;  1VQA A;  3J7Z C;  1LM0 A;  4BY1 H;  4DR4 Q;  3E9I A;  2IY5 B;  4BY7 G;  1AH9 A;  1QVC A;  2N49 A;  1VQC A;  3I4O A;  4DV3 L;  1LTL A;  3KDF A;  1I6H H;  1XNQ L;  3K7U C;  3CPW A;  1CKM A;  3PUV A;  5FJ8 H;  4OON A;  4DR7 Q;  2D62 A;  3K80 C;  4LF6 Q;  1VQ8 A;  1B8A A;  3RN2 A;  4OWW B;  5IP7 H;  2QEX A;  2UUB L;  1PH4 A;  4LF9 L;  3S1Q H;  1YJ9 A;  4IFD J;  4A3I G;  4YCV A;  2K52 A;  3PUY A;  2HIX A;  3ERS X;  3S14 H;  1FL0 A;  4DUZ Q;  4HJ5 A;  4O2D A;  1VQM A;  1VQK A;  4NXN L;  3LGJ A;  2PI2 A;  1Y1V G;  4PZ6 A;  1NY4 A;  3G71 A;  3RN5 A;  2LXK A;  3PUZ A;  3CCU A;  4EFE A;  1V9P A;  2UU9 Q;  4BY7 H;  2OQK A;  4IFD G;  3UDF A;  1B70 B;  2Q2H A;  3I4N H;  2R92 G;  1G29 1;  2HVS A;  4LF4 L;  3I7F A;  4JI2 L;  1X54 A;  3SGI A;  1B7Y B;  3HOY G;  4LFA Q;  2Z6K C;  2HQL A;  1Q12 A;  2XGT A;  2UUA L;  2K50 A;  2RCN A;  3UE0 A;  2ZJR A;  1ASY A;  4LFC L;  4MTN A;  1NJI C;  1GKH A;  1Q46 A;  3S24 A;  2HHH L;  4LF8 L;  5C4J H;  1FGU A;  1J6Q A;  1GM5 A;  1CSP A;  2E8G A;  2K5H A;  4HTP A;  5LMN W;  2IHF A;  1TXY A;  1Y1V H;  4GN5 A;  4JI0 Q;  4EX5 A;  2NVQ H;  4JV5 L;  3H0G H;  1M90 C;  3BA8 A;  5C4X G;  3TY9 A;  4K0K L;  4LH6 A;  4R4T A;  4EEQ A;  1S3O A;  1EIY B;  2R92 H;  2VW9 A;  3ULJ A;  2ZJQ A;  3CP0 A;  5C44 G;  1HJP A;  3GO5 A;  1NTG A;  4UP8 A;  2NN6 I;  1YI2 A;  2Y0S G;  3U4Z A;  3HOY H;  3J7A 5;  1Q8K A;  4JC0 A;  4A93 G;  3JAM i;  1V43 A;  2V1C C;  1I3Q H;  3CPF A;  3EBE A;  3KF6 A;  1K8A C;  5JJL A;  3BZC A;  4P71 A;  1OXU A;  4DPG A;  2KHJ A;  4JOI A;  3F2B A;  1K0R A;  4ME3 A;  1LYL A;  2QGQ A;  2LXJ A;  1SRU A;  3M85 A;  2Q2I A;  4R4C A;  4A3J G;  1S72 A;  4LFB Q;  5M5X H;  5C4X H;  3GDE A;  5K36 G;  4DV4 Q;  4A4I A;  5IWA L;  3CME A;  1KQS A;  5C44 H;  4HJ8 A;  4X65 L;  4GNX B;  2KHI A;  4JI4 Q;  3PO2 G;  2JA7 G;  4GKJ L;  3E0E A;  1OXT A;  4B3M L;  2NVT H;  5AJ3 Q;  3PV0 A;  3CCE A;  5GAD C;  4A93 H;  1AE3 A;  2CKZ B;  4BA1 I;  4LF7 Q;  1V1Q A;  4POF A;  1FJG L;  4L5T A;  1XMO Q;  1N34 Q;  4DR5 Q;  1PYB A;  4IPC A;  1XMQ L;  1QUQ B;  2VZA A;  4P74 A;  1SR3 A;  1X56 A;  1PH3 A;  2F52 A;  4UCU A;  1WCM G;  2JA9 A;  4JI1 L;  4A3J H;  1VQO A;  1CUK A;  4C3J H;  5IP9 G;  1XPR A;  1IBK L;  4LNQ A;  1EUJ A;  4HIO A;  4B3R L;  3ER0 A;  3UDI A;  4QY7 A;  4A3M G;  3AEV A;  1I50 H;  4QQB X;  1IBL Q;  2ASB A;  2K75 A;  3RR5 A;  4DV3 Q;  5FLX c;  4HTO A;  4ALP A;  4H02 A;  1BKB A;  1C7Y A;  3GTK H;  1VQ9 A;  4BA2 I;  2QA4 A;  3PO2 H;  3GD7 A;  4A75 A;  2JA7 H;  2RHQ B;  3PCO B;  2UUB Q;  1VQE A;  2B3G A;  4LF9 Q;  1SFO H;  1PHJ A;  3NEL A;  3ULL A;  1KC8 C;  1OXS C;  3ULP A;  3I2Z A;  1HNX L;  4GS3 A;  1K9M C;  4NXN Q;  2N3S A;  1YEZ A;  2CQO A;  3JSL A;  1VQD A;  4X64 L;  1WCM H;  1HNZ Q;  2N8N A;  3NEM A;  4JI5 L;  5IP9 H;  3J80 c;  2YYZ A;  2K5N A;  1Y14 B;  2ZM6 L;  1PH9 A;  4BBS G;  1X3G A;  3PSI A;  4OO1 G;  4A3M H;  1VQN A;  2VUM G;  4UCV A;  1B04 A;  1YVC A;  2NN6 G;  4JI7 Q;  4CC5 A;  3WWV A;  2YTV A;  4LUO A;  5DLQ E;  1UE6 A;  3CQZ H;  3I4M H;  2F3I A;  2AWO A;  3BJU A;  5FJ8 G;  1SMX A;  1XDN A;  2KBN A;  2UUA Q;  2R7Z G;  3T1H L;  1K73 C;  5ELN A;  5BR8 L;  3FKI G;  1W3S A;  1JJG A;  4IO9 A;  1LUZ A;  2R7D A;  2PQA B;  5FLM G;  4KHP L;  1P8L A;  4LF8 Q;  4DV6 Q;  2HHH Q;  1TWF H;  4GLA C;  4DV1 L;  2NZH A;  3HKZ G;  4IJL A;  1IBM L;  1MKH A;  3M9B A;  4DV7 L;  4BBS H;  5JJI A;  2RF4 A;  1WJJ A;  1VQP A;  3HOZ G;  1E3P A;  4K0K Q;  4J15 A;  2VUM H;  4L5S A;  1HR0 Q;  1E24 A;  4X6A H;  4E6N A;  1Q1B A;  3I4N G;  4LUZ A;  4PMW A;  1HNW L;  2MNA A;  3KFU A;  2HT1 A;  3GJX B;  4RG1 A;  4XIG S;  2OTJ A;  3DLL A;  2VQF Q;  3CC4 A;  2R7Z H;  1E1T A;  3FKI H;  2R93 G;  4AYB G;  1WYD A;  3JAM c;  5FLM H;  1IYJ B;  3CCV A;  1CKN B;  1GD7 A;  2JEB I;  1PYS B;  4XTC S;  4X66 L;  2XTI A;  2E2J H;  3T1Y L;  1XNR L;  3CC2 A;  1VQ6 A;  3J80 i;  3H3V I;  3HOZ H;  1UE1 A;  1VQI A;  1PH5 A;  4EFB A;  3H0G G;  5IWA Q;  1YBY A;  1YZ6 A;  4WJ3 M;  1NE3 A;  1HZ9 A;  4GOP B;  2UXB Q;  3J81 c;  4X65 Q;  2VQE L;  3S15 H;  1BVS A;  2ZTE A;  4DR1 L;  2OQ0 A;  3KJP A;  4GKJ Q;  4Y52 H;  3BA9 A;  5FPR A;  4RMF A;  1JB7 A;  2BH8 A;  2E5L Q;  1JT8 A;  3S1M H;  1YJW A;  2CWA A;  2R93 H;  4C3H H;  2MO0 A;  4JYA L;  4TVA B;  4DR2 L;  1XMQ Q;  1JMC A;  3U4V A;  1XPU A;  4LH7 A;  5IT9 c;  4HJ7 A;  3EN2 A;  3CD6 A;  2D0P A;  4JI1 Q;  2WAQ G;  1A62 A;  1IBK Q;  1YHQ A;  1A8V A;  4JI8 L;  1E1O A;  3M4P A;  3RNU A;  2NVX H;  4DR3 L;  1Z9F A;  3A0J A;  2I5L X;  5IYC G;  4LF5 L;  1GO3 E;  2JQO A;  4YHH L;  5LMN L;  2N78 A;  2YU9 H;  3RLF A;  4DK6 C;  1J5E Q;  1VQH A;  2EXD A;  4YY3 L;  2ATW A;  3JSN A;  1BBU A;  1VQG A;  3M7N A;  1KD1 C;  5M5Y H;  2K5V A;  3A74 A;  4A3C G;  4IPH A;  2OTL A;  3FP9 A;  4JOI C;  4BBR G;  2KCT A;  5ELO A;  1RIP A;  1JJ2 A;  4GNX C;  1HNX Q;  2I0Q A;  4L5R C;  2F4V L;  1SN8 A;  4DRF A;  4X64 Q;  1IZ6 A;  1DGS A;  3PO3 H;  2ZM6 Q;  1YHB A;  4KHZ A;  3S2D H;  4GNX A;  4DR6 L;  3D0F A;  1MJE A;  4IPG A;  1HR0 W;  2VNU D;  4UFZ A;  2IHE A;  3L0O A;  5IYC H;  2CCZ A;  3K8A A;  3KF8 B;  2E2I H;  2ZTC A;  4KLK A;  3J81 i;  1Q7Y C;  4DR4 L;  4A3B H;  1MJC A;  4JBW A;  4YWK A;  1QZH A;  4DUY L;  1TWC H;  1CSQ A;  3CCR A;  1N32 L;  3NBY B;  2OWO A;  1QUQ A;  3HOX G;  5M3F H;  1QZG A;  4A3C H;  2KCM A;  3OTO L;  3S1R H;  3GTG H;  3K7A H;  3UDX A;  4AIM A;  2WB1 E;  1TWH H;  1WI5 A;  1WOC A;  4IJH A;  4BBR H;  2JA8 G;  2AKW B;  4DV1 Q;  3AFP A;  4HIK A;  1VQ4 A;  4DV2 L;  1Y1W H;  2MO1 A;  4DNI A;  1IBM Q;  4DV7 Q;  3IRB A;  3EIV A;  2CWP A;  4R4Q A;  4C2M H;  2ZTD A;  1G51 A;  3MEF A;  2ZJP A;  4DUZ L;  3TRZ A;  3G6E A;  4DKA C;  3GTJ H;  3F2D A;  2I5M X;  1S40 A;  4JI3 L;  2CFM A;  1Q1E A;  1HH2 P;  3HFZ B;  1CKO A;  2Q2U A;  1XNQ Q;  3QWU A;  4A76 A;  2UU9 L;  4X62 L;  4PZ8 A;  3STB C;  1TWG H;  2Z0S A;  2BH2 A;  3HOX H;  1A0I A;  2OCE A;  3AYH B;  4MZ9 A;  3I4M G;  3RZD H;  3NBZ B;  2NZO A;  1MIU A;  4LW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...