3W5OA

Crystal structure of human dna ligase iv
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
596
structure length
577
Chain Sequence
QTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEELDILIVGGYWGKGSGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords DNA ligase 4
total genus 174
structure length 577
sequence length 596
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2013-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w5oA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w5oA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w5oA02
2IHEA 1VQFA 3M7NA 5D1OA 1EIYB 4P74A 4LNQA 4BBSH 4DR6Q 3BA9A 4JI2L 4A3LH 3ICEA 1XPOA 1TXYA 5BR8L 4Y52H 1EIFA 2RCNA 3RLFA 4GNXA 1I6HH 1B04A 3BA8A 3ULPA 1Q8KA 1PH1A 3HOVH 3CC7A 5FJ8G 4EX5A 4L5TA 5GAGC 4IOCA 1QZHA 1E22A 4DV1L 5C3EH 1Q1EA 4R4OA 1YITA 4LF5L 1L1OC 4R4IA 1YJ9A 5JJKA 1WCMH 1L0WA 4B3SL 2UUAQ 2UXBL 2DGYA 1NE3A 2VUMH 1NJIC 1NMGA 4JCVE 1K8AC 1K8GA 3HOZH 1P8LA 3CCQA 2ZTCA 1NY4A 4X6AH 3DLLA 2HVSA 2MFIA 3STBD 4DR4L 4XIGS 2DUDA 5M5YH 2HT1A 1JJCB 3B6YA 4DR5L 5GROA 4LFAQ 1YJNA 3CCSA 3U58A 4K0KQ 3I2ZA 2YTVA 2Z6KC 5C44G 4WJ4A 2WB1E 1W3SA 2UU9L 3S17H 5JEAG 2F3IA 1VQ9A 3KYHC 1PH4A 4C3IH 4LUOA 2VQFQ 3PO3G 4JBJA 5IYDG 1X3EA 4FDBA 2PMZE 4KHPL 5IYCH 3KF8B 4OWWB 1G291 1S3OA 2L15A 1C7YA 4A93G 4C2MH 1Y1VH 1QVGA 1S72A 3OTOQ 2I5MX 3AQQA 2HIXA 3GDEA 4NXNL 2VQEL 1B7YB 1IBMQ 4NXMQ 3GTQH 1VQ6A 3ULLA 3E0EA 2N8NA 2WAQG 3W5OA 3VDYA 2E5LQ 2JA5G 3E9HA 5M3FH 2UXBQ 4LH6A 1EQRA 1E3PA 1HJPA 1UE5A 2IHFA 3KJPA 1CSQA 4AQYL 1KC8C 1N36L 3CMEA 3K8AA 3I4NH 4A3LG 3KDFB 3M9BA 3U4ZA 2OTLA 2PNHA 1Z47A 3I7FA 4GS3A 4X62Q 2ZTEA 3D31A 5C0XG 2XTIA 2YV5A 4HJ7A 4HJ9A 3L7ZC 1MJEA 2H5XA 4RG1A 5BR8Q 1VS0A 4C3JH 3A74A 4A3IH 4DAYB 4LFCQ 5AJ3L 2R93G 2AWNA 4QIWE 4UCRA 1VQNA 2JA6G 2A1AA 4OONA 4UP7A 4DAMA 3HOZG 4A3CH 2KBNA 4NPSA 1N8RC 4A3BG 3JC66 1VQ8A 2NZOA 1IBLQ 1L1OB 3L2PA 2VS1A 4LF9L 4LW1A 1Y14B 4LFAL 4JI5L 2NVQH 1BKBA 4JI2Q 1LM0A 1RL2A 4OWXB 3J81j 2AMCB 2F4VL 3G4SA 5IYCG 1V1QA 4IPGA 1KIXA 5IYBG 2N3SA 3UDGA 5IY0A 3W1GA 3T1HL 3S1RH 3HOUG 1JJGA 3KLWA 3LGJA 2UUAL 2JQOA 4JYAQ 3CC2A 1G6PA 1B8AA 4BBSG 3BABA 3I4MH 3J80i 3TS2A 1K0RA 1UEBA 1X6OA 1H95A 4NXML 3CCUA 3UDXA 4UCOA 4R4CA 2MO0A 3CF5A 3PCOB 4L5SA 4JI3L 3U4VA 5C0XJ 4GOPB 2I0QA 1NTGA 2CKZB 4DR5Q 3GTPH 2RHQB 4YY3L 2B63G 1WCMG 4POGA 3ZJYC 1J5EQ 1HR0Q 2JEAI 4YCUA 3CP0A 2BH8A 4DV5Q 3CW2C 2BA1A 1X54A 2K75A 4A3IG 1VQLA 4QJFA 2NVTH 3GTJH 3CCVA 4A3KG 2K5HA 1WI5A 3PUVA 1XNRL 1VQGA 4DR3Q 4JV5L 4CC5A 4DPGA 1K9MC 2HHHQ 1Q81C 2JE6I 4DR7Q 4JYAL 4DR4Q 4A3EG 1CKNB 2YU9H 1PHJA 1N33L 3HKZG 4JI6Q 4PZ8A 4LF7L 4BY1G 2QEXA 3M4QA 2C35B 1WOCA 3JAMi 4YHHL 1XMOL 1VQCA 1OXXK 1OXTA 1UE1A 1YNXA 2ALYB 2GVAA 4PMWA 3PIPA 4UY8C 1P16A 2K14A 1T9HA 1BBWA 4YWMA 3RZOH 1IBKQ 1VQ7A 4JI4Q 1HNZQ 4E6NA 1FJGQ 4JBKA 1B70B 3K0XA 2ZM6Q 5LMUL 4OXPA 4DV3L 1ASZA 2PI2E 1HR0W 5C0XI 2HIVA 3CCEA 4DV5L 3S1QH 3ERSX 3HOYG 1N34L 3ER0A 4X64Q 1E24A 2D0OA 4DV6Q 2I5HA 3I56A 4TQUS 4X66Q 3T1YQ 2OQ0A 3PIOA 4DR1L 4AYBE 2XGTA 1AE2A 5E7NA 2ZJQA 1N9WA 3CCJA 4LF9Q 1L2FA 1SFOH 4LF5Q 2ZJPA 4P73A 2PI2A 2D62A 1YJWA 2E2IH 4AIMA 5GAEC 4GLXA 1HNXQ 4JI0L 4A3CG 1PH9A 1XDNA 3CPWA 1HZAA 1XNQQ 1FVIA 3F2DA 2N49A 4YWLA 4HJ5A 3K81C 3RTXA 1IZ6A 3STBC 2NVYH 4MNOA 3CCMA 5LMUQ 2UXDL 1YVCA 2KHIA 3PGZA 3NBYB 1I3QH 2IX0A 3RN5A 3L0OA 4UPAA 1OXSC 5GADC 4DV1Q 3PO2H 3BAAA 5IP9G 1QVCA 3S24A 5C44H 3S14H 5LMNL 1X65A 3GTGH 1WYDA 1SLJA 4DKAC 4GNXC 3AFQA 2Q2IA 2MQHA 4YHHQ 2ZJRA 1LUZA 2QGQA 1X56A 3K7AH 4C3HH 3S16H 1AE3A 4DR6L 4HTOA 4DK3C 3PUWA 5J3BA 2FXQA 3M4PA 4HTPA 1V43A 3NBHB 4R1JA 3TQYA 4DR2Q 3TEHB 4DV3Q 4A3FG 2I5LX 2E2HH 1Q46A 1GKHA 2KHJA 3W1BA 1D8LA 4B3ML 4KLKA 3QWUA 5M3FG 1OTCA 1TWCH 4BY7H 2NZHA 4HJAA 3HOVG 1A62A 3GO5A 4KHPQ 1Z9FA 2YTYA 4DUYL 4A3MH 1SE8A 5C3EG 2UXDQ 2EXDA 1DGSA 3F8TA 4BBRG 4R4TA 2R92G 2BA0A 3I4OA 4B3MQ 3PN1A 4YWKA 2NN6I 4JOIC 2ASBA 5FPOA 4K0KL 1Y1WH 3K7UC 3OYYA 2UUCQ 4UP8A 4LFCL 1VQEA 4A76A 3NC0B 1TWGH 4LH7A 4JOIA 3SGIA 1I94L 1SROA 4AYBG 2VNUD 1SMXA 3HOWG 3HOXH 4JG2A 2JA8H 2B3GA 2R6GA 2JA7H 1RIPA 4WJ3M 4JI1Q 1VQAA 1VQIA 2JA6H 4IFDG 3JSNA 4L5RC 2MNAA 1VQPA 4LF6Q 3AEVA 4X62L 3F1ZA 1PFSA 1S40A 2BH2A 5IWAL 4A3BH 2CCZA 4OX9Q 4LUZA 4B3RQ 5IYDH 3JSLA 4X66L 4QGUA 3T1YL 4LWCA 3H15A 3H3VI 4HIDA 3PO2G 4OWTB 4BA2I 5FLXc 4UFZA 2VQEQ 3PUZA 4POFA 4IPHA 2VW9A 1A0IA 4DV4Q 1IBML 1PVOA 3T1HQ 3OTOL 4JBMA 4JI7Q 1TWAH 3EIVA 4IOAA 2N78A 3RR5A 2RF4A 4TVAB 1JE5A 1XJVA 4NB3A 3CD6A 4OX9L 4JBWA 2IY5B 2AKWB 2K4KA 5IYBH 1HNZL 4KHZA 1QVFA 1IXRA 4X65L 2JA5H 1JT8A 1VQJA 4JI8Q 1U0LA 4JI0Q 4EQ5A 2K5VA 4DK6C 4YCWA 2KENA 5ELNA 5C4JH 3HKSA 4GNXB 2R7ZG 4GKJL 1A63A 1I5FA 5IT9c 1X3GA 3UE1A 4A3DH 1HH2P 2F52A 3BZCA 4X65Q 1IL2A 2A8VA 1JMCA 3M3YH 1QUQB 4Y7NH 4PZ7A 4DR1Q 2GN5A 4YCVA 3UDIA 3VNNA 4GKKL 2ID0A 1Q86C 2VY3A 1A8VA 3F2CA 4ME3A 3PSIA 1Q12A 2Q2HA 1E7ZA 3K80C 3TY9A 4ALPA 3CCRA 4IJHA 1Y1WG 1KD1C 1CKNA 3TRZA 3CPFA 1UE6A 3RN2A 3NBZB 1V9PA 3ULJA 1VQ5A 3OW2A 3HOWH 4A3KH 1XMQL 4AH6A 2VL6A 1K3RA 4A75A 1CKMA 4QY7A 3G6EA 3D0FA 2VZAA 4MZ9A 4BA1I 2Q2TA 3J81c 1UWVA 1M1KC 1VQBA 1CUKA 3UQ8A 1EYGA 1WJJA 1EWIA 3EBEA 1QUQA 1E1TA 2OCEA 1XMOQ 5C4XG 4DRFA 5D1OB 4DV2L 4BXXH 1W2BA 2Y0SG 1IBKL 4GKJQ 2A19A 4DUYQ 3FHWA 4B3RL 1LYLA 3H0GG 1SN8A 2HQLA 3I55A 1Q7YC 1HNXL 4GLAC 2ZTDA 2ATWA 5JJLA 5IE8A 3GTMH 4JV5Q 4OO1I 1TWHH 3E9IA 1Y1VG 3FP9A 3FKIH 1YHQA 1VQ4A 3IRBA 4JI6L 1L1OA 1Q1BA 2MO1A 4LF7Q 1GO3E 2E8GA 3S1MH 2HVRA 3HKZE 1HZBA 4X64L 4YY3Q 4DV6L 4A3MG 1FL0A 2R7ZH 3HOYH 3CCLA 5IP7H 4CC6A 1TWFH 4B3TL 4UCVA 5M3MG 4LF8L 1XNRQ 5FJ8H 3RLOA 4IPCA 2V1CC 1FJGL 2K52A 1K83H 3S2DH 1HZ9A 3TY5A 2GVBA 2CFMA 4GN4B 3HFZB 3KJOA 3HOXG 2ZM6L 2E2JH 5H1SE 5GAHC 2JA7G 3CAMA 1N32Q 1CKOA 4EFBA 4A3JG 2YTXA 3BZKA 3KOJA 4DV0L 4DV7Q 4L5QA 4MTNA 4O0AA 4HIOA 5JJIA 1I50H 3A0JA 4O2DA 3H3VH 1G51A 3GTKH 2IT1A 1MIUA 2UXCQ 1KXLA 4NXNQ 4PG3A 4GOPA 1PV4A 3BJUA 5M5WH 4UCUA 4EFEA 1ASYA 1IYJB 1YEZA 1OXVA 4H02A 4A4IA 5LMNQ 1J6QA 1TAEA 4OO1G 3TS0A 2UU9Q 4JC0A 2HVQA 5C4XH 2WP8J 4A3GG 1SR3A 2VQFL 4DR3L 1IBLL 3KF6B 5FLMG 1EOVA 1JJ2A 3CC4A 1U5KA 2UUCL 1XK5A 2IX1A 3H0GH 2QA4A 4DV2Q 1PH5A 2D0PA 1I94Q 1GD7A 2JEBI 1PH6A 4IFDI 1YZ6A 4QL5A 3M85A 3HOUH 2WB1G 1J5EL 3Q8DA 1KQSA 5AJ3Q 1HR0L 3S2HH 1C0AA 1PH3A 1XPUA 4DV7L 2UUBL 3I4MG 5HGQA 4HJ8A 3UE0A 3I4NG 3GJXB 4GOPC 1PYBA 1LTLA 1SRUA 1JB7A 3GTLH 5IP7G 3JAMc 3CMAA 2ES2A 4QQBX 3CXCA 1HNWQ 1KAWA 2R7FA 4GLVB 3NELA 3PUXA 1VQDA 5GQOA 1KRTA 3WWVA 4B3TQ 1PA6A 2B63H 1VQMA 1K73C 2R92H 1QZGA 4HIMA 3TREA 4LF4Q 2F4VQ 2R93H 2LXJA 1CSPA 2CQOA 3KFUA 3M4OH 4P72A 1N32L 4P75A 1NMFA 1KHIA 1NBWA 4GN5A 5IWAQ 2LSSA 1D7QA 3KDFA 4LF6L 2VUMG 1X55A 2LXKA 2OQKA 1EUJA 3DM3A 3NENA 4DNIA 3F2BA 2CWPA 1R9TH 1X9NA 2EQSA 4J15A 4P71A 4BXXG 3AYHB 3G48A 1AH9A 4IPDA 2Z6KA 1PYSB 2K5NA 4A3EH 2WAQE 2UUBQ 5JEAJ 1PH7A 4IO9A 3A5ZB 4LF8Q 4BY1H 1HZCA 1MJCA 4GN3B 1YIJA 1FGUA 1N34Q 2HHHL 4JI5Q 1KRSA 1MKHA 4DR7L 5FLMH 4LFBQ 2Q2UA 2WFWA 3PO3H 2Y0SE 3J80c 1YI2A 4RMFA 2Z0SA 4UCSA 3NEMA 4DV0Q 3PF5A 4A3FH 3TY8A 4IJLA 3GD7A 1XMQQ 3GTOH 3S1NH 1YHAA 3CQZH 2B29A 4KI0A 3RNUA 4BY7G 5M3MH 4AQYQ 2PQAA 3RLNA 2VUGA 4DUZQ 5FPRA 4BBRH 4DV4L 1TA8A 2YYZA 5LMNW 1EQQA 2JK8A 4JI3Q 1YBYA 3PF4A 4GKKQ 5DISC 1E1OA 3PV0A 4A3JH 3EN2A 2AWOA 5D1PA 3U50C 4B3SQ 1XPRA 1N33Q 5HY6A 1BBUA 4UCTA 1GVPA 3J81i 3MEFA 4JI1L 2JA8G 5EAYA 1VQKA 2KCMA 3J7A5 1KL9A 1M90C 1O7IA 3KF6A 1OXUA 2CWAA 5ELOA 1EFWA 1WFQA 4A3DG 4UP9A 4A3GH 1XNQL 4IFDJ 3BU2A 4EEQA 1UE7A 3AFPA 1VQHA 2KCTA 3J7ZC 2R7DA 3G71A 1YHBA 4DR2L 1Q82C 2JJQA 2RHSB 1C9OA 2JA9A 4DUZL 2AHOB 1PH8A 1XTDA 2OWOA 1VQOA 1HNWL 2OTJA 4LUVA 5IP9H 5M5XH 3S15H 4A93H 4PZ6A 3PUYA 1BVSA 4HIKA 3MXNB 4JI8L 2NN6G 2EIFA 1PH2A 4R4QA 4JI4L 3UDFA 3GB8B 2K50A 2PQAB 2E5LL 5DLQE 4XTCS 1GM5A 5K36G 4LF4L 4LFBL 1S68A 4APVA 3RZDH 1VCIA 1N36Q 2NVXH 2UXCL 3FKIG 1X3FA 3A5UA 4JI7L
chains in the Genus database with same CATH superfamily
4UUGA 1DM0B 5D1OA 3KBGA 1EIYB 4LNQA 3BA9A 4DR6Q 4MTKA 4JI2L 4HN2A 3OIPA 1I4XA 1G2SA 4Y52H 2RCNA 5A35A 1B04A 1PDQA 1Q8KA 3W3AA 1SE3A 5FJ8G 1RCVD 4L5TA 4IOCA 1QZHA 1L1OC 5JJKA 4DAAA 1WCMH 5KNDA 5DM63 2K33A 1NE3A 4XYLB 4GZYC 1NJIC 1EZ1A 4QIWB 1OBGA 2YL2A 3R5XA 2ZTCA 1NY4A 5JPNC 1LABA 3I90A 4XIGS 4M8AA 4DR5L 1YJNA 3U58A 3DEOA 2YTVA 1AN8A 2TMPA 1EUCB 2UU9L 2Y4RA 3RD4A 4ME5A 3PO3G 1DYQA 1A3VA 1X32A 1V1OA 2PW5A 4OWWB 4WJWA 4KTAA 4K8IA 3OW7A 2PZUA 3T56B 1S72A 2ZT9C 3OTOQ 2I5MX 2WIIB 1ICWA 2VQEL 4DU9A 5M5WB 1I2KA 4M9UA 2N8NA 2WAQG 1C4QA 4RHRA 1CSQA 1RKNA 1G6ZA 3CMEA 1PTOH 1B6RA 4X3UA 3KAKA 2YZMA 2PNHA 3I7FA 4BWGB 5C0XG 3E6ZX 2E2HB 1TS4A 3V4SA 2H5XA 5DM73 1KLUD 5IYZF 5C4HA 2F1MA 1STBA 5D3IB 1JC7A 5AJ3L 4QIWE 4UCRA 2MPMA 1I1KA 4TUYF 2RCFA 5CORA 4NPSA 1LT3D 3VA5A 3J7YW 3JC66 3SNOA 2FINB 5I5UA 4JI2Q 1LM0A 4OWXB 3TMEA 4MHEA 3R8BA 3G4SA 5IYCG 2X0SA 5CV8A 1DJRD 3VYTA 5IY0A 1JJGA 1GXDC 4KY7A 3K5NA 3CC2A 1ET6A 1B8AA 1I50B 3EJIA 5A2QL 5JJZA 4O7RA 4V190 2MJ8A 3UDXA 5ELBA 4R4CA 4AYBB 2MO0A 1BDOA 5D65A 2I0QA 3QR8A 4DR5Q 4I65A 3MZ5A 1CQIB 1U4LA 4POGA 4Z9CB 1HR0Q 2AQ3B 4YCUA 5CA0F 1B50A 4O83A 4DV5Q 1B2TA 2BA1A 3T51B 2NVTH 2B2TC 3CCVA 4A3KG 2ZXRA 2E2JB 1RDPD 4DK1A 4CJ1B 1HQRD 1Q90A 4DR7Q 1Q81C 2JE6I 4DR4Q 3U9TA 3OUUA 1PHJA 2HCCA 3M4QA 2C35B 3HZXA 1WOCA 4YHHL 1MSHA 1OXTA 2E2IB 4DLKA 3EQLC 1P16A 2K14A 5M9OA 1BBWA 2R93B 5BYAA 1IBKQ 1HCZA 4E6NA 1FJGQ 5KYIA 5LMUL 4H7BA 1B4OA 5AFWA 1HR0W 2XN9C 2IX3A 3HOZB 2CHBD 2F0FA 4X64Q 1E24A 2D0OA 2YYAA 3J81E 3LQSA 3NWTA 1T36A 1W6JA 3KALA 5K5PA 3QIAA 2EJ3A 4AYBE 3RV3A 4O4IF 1SFOH 1E0BA 2E74C 4IZ8A 1A48A 5C4JB 1YJWA 4C3JB 2LY7A 3D4DA 4GLXA 1HNXQ 1PH9A 1XNQQ 1HZAA 3F2DA 2B2VC 4PV1C 3BVZA 2GPSA 3VYUA 5I9PA 2N88A 1I4HA 2UXDL 1YVCA 3PGZA 1I3QH 1WD0A 2EY6A 1QVCA 3S24A 4LMQD 5K3WA 2MQHA 1ENFA 3BG5A 4ZQIA 4ZQ3A 1AE3A 4DR6L 5D14A 4BS9A 3K57A 5DNFA 2HDLA 5J3BA 1PX2A 2QCPX 5IGCA 3T9BA 5BPHA 3ZYYX 1CI3M 5D3DA 2E2HH 3DWAA 3W1BA 4B3ML 4MV7A 1TWCH 1ENCA 3SK8A 2NZHA 4BY7H 3HOVG 4QMGA 1PMRA 2DNEA 2YTYA 4A3MH 3BVMA 2IWHA 2EXDA 3MC0B 1PFBA 1EY5A 3FKIB 4NW2A 2R92G 5BWUA 2BA0A 4YWKA 2NN6I 3OYYA 1VQEA 4A76A 1TWGB 4C3JG 3NC0B 2DY8A 5CM0A 4AYBG 1SMXA 2B3GA 1RIPA 4WJ3M 1VQAA 5EGTA 2WINB 4U68A 5IIFA 2PZWA 1VQPA 2EJFC 3BZDB 4X62L 1LTGD 1PFSA 1S40A 2BH2A 4R8NA 4A3BH 3UYYA 4FFRA 5C4ZA 3H15A 5FLXc 4PMBA 3PUZA 3FPUB 4POFA 5C3WA 1A0IA 2VW9A 2VQEQ 1PVOA 1F2YA 1LTTD 2OXPA 2JYOA 1GSHA 3RR5A 2B8GA 5HURA 1PRTC 1K8OA 3M4YA 2IY5B 4KHZA 1QVFA 1A2UA 2R7ZB 5EKKA 1JT8A 2LMCB 1I7NA 4JI0Q 4EQ5A 2F0VA 3ITPA 5JPMC 1A63A 2R7ZG 1KAAA 3GTMB 2F52A 4HAEA 1F77A 4A3EB 1ENAA 1JMCA 3K5HA 3VNNA 4DAVA 3CU7A 1DOKA 2ID0A 1ZYRC 2NUCA 1Q86C 2Q2HA 2F0PA 1SBBB 1Z7TA 4F88A 3NQTA 4O7ZA 5FOBB 2NZ1D 1G91A 3CPFA 3NBZB 3RN2A 1VQ5A 1IW7D 3K0YA 2CH4W 4B08A 4A3KH 4GLWA 3K7AB 4IN3A 4A75A 3S16B 3MTSA 4TRDA 2Q2TA 1OO9B 3J81c 3R23A 1KABA 5CR5A 5C4XG 3IL8A 1QUQA 2A68D 5EKLA 1DV1A 4C3HG 3MJFA 2B2YC 3BACA 1JORA 4ZHQF 4BXXH 3NXWA 4GKJQ 1B53A 4B3RL 2NN6H 5CMDA 3H0GG 1ESRA 2M2LA 3I55A 4MV8A 2CQAA 2XD4A 1E2ZA 1E2VA 3G8DA 1TWHB 3QJYA 5BWRA 3SK6A 4KY6A 4JI6L 1KEEA 2ICEC 3D6WA 4P2CB 2E8GA 3C3LA 3HKZE 4DV6L 5I6YA 2FFKB 3R5HA 3TDQA 3TP5A 1F9SA 1TWFH 3H91A 4LF8L 2OLSA 5FJ8H 2EIYA 4IPCA 2V1CC 1KNAA 3S2DH 1K83H 3GP7A 2GVBA 3KJOA 5GAHC 2JA7G 1CKOA 1WTOA 4CKBA 2YTXA 3KOJA 4DV7Q 1GHKA 1QG7A 4O2DA 3H3VH 5I5SA 4QUCA 1G51A 3UZBA 1MIUA 2UXCQ 5CBEE 4NXNQ 4GOPA 3SK5A 1PV4A 3PFFA 3BJUA 4O4LF 5LMNQ 4A4IA 3TZDA 2F0MA 2I46A 4JC0A 3A54A 4B9WA 5CV4A 2VQFL 3QOLA 3RZOB 1WTQA 1HRJA 1IBLL 3CC4A 5FLMG 1CS0A 4RAUC 1SCUB 1XK5A 5JAVA 2EOTA 1EWHA 2QK4A 1H9SA 3D4WA 4IFDI 1Z2NX 4I7ZC 3HOUH 2R92B 1HR0L 3Q8DA 1KQSA 4Q4CA 1PH3A 3IFDA 1RHPA 2PZTA 5HGQA 4GOPC 1JB7A 5IP7G 5JVG3 3CMAA 2ENBA 4QQBX 1WTPA 1HNWQ 1KAWA 3MVVA 1VQDA 3PMFA 1HA5A 1LT4D 1PA6A 2B63H 2LXJA 1LT6D 4JXUA 3H0GB 3VYSA 1BCPB 1V1PA 1NBWA 2B39A 4GN5A 5IT9L 1F9PA 4N9PA 1QNKA 1YNNC 2QKIC 2LXKA 3NENA 1C48A 1R9TH 3KREA 1X9NA 1M0WA 1Y69U 3QFFA 2Z6KA 4WBNF 2WAQE 1F2MA 5HGTA 3NWSA 3S1RB 2ZXOA 1MJCA 2HHHL 2EYJA 1KRSA 1MKHA 4HCEA 1XTCD 4UCSA 3NEMA 1U4PA 1EZ8A 4O7TA 5BYBA 4A3FH 1EY8A 2F0OA 2B29A 5M3MH 1UUPA 4AQYQ 2VUGA 1EKFA 3O13A 4EQOA 3AU7A 4L1KA 3J81L 1TA8A 3HS0C 3S14B 1EQQA 1EIHA 1D5ZC 1YBYA 1SNMA 3PV0A 4A3JH 2AWOA 2A69D 4CBVA 2CVRA 1XPRA 4O7NA 5HY6A 3KK7A 4JI1L 4IUQA 1BXTA 1CK1A 1VQKA 3I3CA 4IFDH 1FNVA 3C1EA 3SEBA 5FLXL 1M90C 1HXYD 1J8IA 3M4OB 1MI2A 4OIJA 2VXWA 2NU7B 2O4XA 1ZKOA 3AFPA 4YJ3F 1GUGA 5LL6S 4O2BF 2L4NA 4KKTA 4FF3A 4WHXA 4DUZL 2OWOA 4S3SA 1HNWL 2OTJA 1XTDA 3JZIA 3WWJA 3Q2OA 1WVLA 3PUYA 1BVSA 3GTLB 4RKBA 2NN6G 1PH2A 3S1QB 1ULZA 4R4QA 2A69C 2K50A 3NTHA 2E5LL 4FF4A 1TWFB 1WTWA 1S68A 4APVA 3RZDH 1VCIA 3FKIG 2KCCA 1JCKB 2IHEA 3M7NA 2K7VA 1FNUA 4MV9A 4K5XA 1R4QB 2F0WA 3IFTA 4KD4A 1NAPA 2F3WA 2L55A 3RLFA 3VA7A 3ULPA 1I6HH 5BWXA 3HOVH 3CC7A 4DV1L 4LF5L 5C3EH 2ZDHA 5A2QE 1YJ9A 3S17B 2HCIA 4YAJB 2COJA 2VUMH 3OWFA 3NSWA 1NMGA 3HOZH 1K8GA 4EQPA 5C8YF 3QWNA 2MFIA 3STBD 4DR4L 1T5EA 2HT1A 4A3DH 3JZFA 4LFAQ 2Z6KC 1LTRD 2WB1E 4TM5A 5JEAG 1VQ9A 3AW8A 1X3EA 5HV6A 4KHPL 5IYCH 5I5XA 3ERQA 4A93G 1ILQA 1S3OA 1C7YA 1Y1VH 3OPOA 5C4XB 1QVGA 1D5MC 4J6HA 4NXNL 2HIXA 3NE5B 3GDEA 3GTQH 4HR7A 1B7YB 2IP4A 2H1EA 3FMCA 2K04A 1PFNA 4FP5D 4LH6A 2BCOA 4R9WA 1HJPA 2IHFA 4AQYL 4ZAIA 1I4QA 2OT2A 1XYIA 3OHXC 5EJWA 3G7LA 3JAML 4A3LG 3U4ZA 4GS3A 4RCNA 4IWXA 3D31A 5I5WA 2XTIA 2C9OA 1MHWC 2YV5A 5HBRB 1S4ZA 4HJ7A 3HG9A 1NSNS 4C3JH 3A74A 4DAYB 3K5MA 1EZ6A 1RD9D 2A1HA 2R93G 5CE8A 1RJTA 4OONA 4UP7A 4DAMA 4WRDA 2XVSA 4H44C 5FR9A 4XXEA 4FFMA 1N8RC 4A3BG 2NU6B 1ONLA 3ONAB 1STEA 3HEJA 3HBLA 4LFAL 1E2WA 3J81j 1DD2A 3JRXA 2AMCB 4IPGA 2R84A 2ZXPA 2VB2X 2N3SA 2BE5D 3FDTA 3LGJA 1G6PA 1DXMA 4BBSG 1XX8A 2JP1A 3I4MH 4N8X1 3TS2A 4FFNA 1X6OA 1H95A 5KEEA 3C46A 3CCUA 1H9JA 4UCOA 4FXGC 4MA0A 3NUCA 3CF5A 3H6MA 1VF7A 4JI3L 1L0YB 2CKZB 1FYCA 5M5XB 3S15B 4OELB 2JEAI 3KF8A 5C3EB 1BO0A 1X54A 2K75A 3FRPB 1TVXA 2X6GA 5CBAE 4A3IG 5CGKA 1VQLA 3M3YB 3DTGA 3GTJH 5JVDF 1WI5A 4WORA 2VUMB 4CC5A 1I4PA 1A2TA 2HHHQ 4JYAL 4O7SA 4A3EG 2HD3A 1DV2A 5EPKA 4O81A 4KMUC 4JI6Q 3DWQA 4YBZB 4QSHA 5E3FA 1KJJA 1JOKA 2L5TA 4DIMA 1JWMD 5ISRA 4KN7C 5I2XA 1VQ7A 3K0XA 4DV3L 4OXPA 2FPPB 2PI2E 4K14A 4MV6A 3S1QH 2RBMA 4ZKBB 5TSSA 3ER0A 2GA4B 1AUVA 2V4DA 2ZJQA 1SNOA 3CCJA 1LLRD 2PW7A 3PO2B 2ZJPA 3A8JE 4MN3A 4P73A 4O1NA 2G5DA 1PTOF 5GAEC 2KJXA 1AEXA 3P20A 3CPWA 5I6WA 2N49A 2KECA 5IGFA 3MWDA 3PQIA 2KVMA 2N55A 2B2YA 4LK1C 1LTSD 3NBYB 2IX0A 4G57A 4QF4A 3HOVB 4UPAA 3LWBA 1OXSC 4DV1Q 2NU8B 4HR7B 4LJZC 3S14H 4DGZA 1X65A 3GTGH 2J4XA 1SLJA 1GHJA 1ZXTA 1O80A 4YHHQ 5J22A 5M3MB 3RZDB 3MA2B 4EGVA 2ABJA 1HTLD 1K28A 2XWBB 4DK3C 4LAAA 1SMYC 1EQTA 2F0KA 3T16A 3TEHB 1S5DD 2Z8LA 1Q46A 1GKHA 2R61A 5CA1F 3VPDA 4KLKA 1WD1A 1WRVA 4HJAA 1Y8OB 2B8FA 3D6CA 4KHPQ 1S5FD 1SE8A 2CH4A 2KCNA 4DFAA 4BBRG 3F8TA 5KRUA 3PN1A 4PQXA 2A5HA 3CSWA 4JOIC 4IIJF 3K7UC 2UUCQ 1I94L 1SROA 3AX6A 2IPKD 1VKZA 3JSNA 4IFDG 2CNQA 2K5QA 2MNAA 4LF6Q 2SEBD 4C3IB 3UI2A 5IWAL 4OHJA 4OX9Q 5IYDH 4MV3A 2M9VA 4QGUA 4UFZA 3PO2G 4N8FA 4CDDC 1VBHA 4IPHA 4DV4Q 2YW2A 3T1HQ 1M4VA 4JI7Q 1TWAH 1SYEA 3EIVA 3I12A 1KBLA 2EYPA 4TVAB 3DF7A 2F3VA 4OX9L 4JBWA 2F0DA 5IYBH 3D3RA 4H0LC 2JN4A 2JA5H 4JI8Q 1QB5D 1U0LA 1X3QA 3VMMA 2K5VA 3K5LA 4TV8F 4CHTB 5ELNA 4GNXB 3HKSA 4GKJL 1EL0A 4J1MA 5C44B 5IT9c 1X3GA 3UE1A 4TKOB 1O78A 3DEPA 4RA8A 4Y7NH 3SE7A 4GKKL 1A8VA 3F2CA 3PSIA 3V4ZA 2HGXA 1Q12A 3QQMA 1KUTA 3K80C 4K5VA 1EY0A 4ALPA 3FPPA 1Y1WG 1KD1C 3TRZA 2CW0C 2KEDA 5BWTA 4HN7A 3ULJA 3OW2A 2BE5C 4AH6A 5H80A 2VL6A 1EYAA 2QEJC 5BN3A 4MZ9A 4BA1I 1CUKA 3ND8A 1WJJA 2OCEA 3TIGA 1O7YA 3QO2A 1CA5A 1O7LA 3R9RA 3OWEB 1IBKL 4IALA 2W6PA 3KLSX 2L9HA 3FHWA 4K2LA 1LYLA 2XRSD 1HFNA 2HQLA 1BCPF 1Q7YC 2NVQB 4GLAC 5CV7A 4KV6A 3HOUB 3HRZC 1BQQT 4OO1I 1TWHH 3E9IA 1C3OA 3FKIH 4HSPA 5FK9C 1YHQA 2NWGA 3IRBA 4LF7Q 1L1OA 1Q1BA 2Z9HA 3A8IE 3BDLA 1HZBA 4X64L 4YY3Q 3HOYH 2YWVA 5IP7H 2I87A 4B3TL 3TINA 4UCVA 4V0BA 1MGSA 1XNRQ 4OL7A 1AZPA 5CYUA 2K52A 2CFMA 3HFZB 5DISC 2W6NA 3JZ6A 3CAMA 1N32Q 4IUTA 2A6HD 1YNND 4X3KA 5M5YB 3Q23A 3I4NB 4O0AA 2B2UC 2PPBC 3I4MB 3R2IA 4PG3A 1MSGA 4O2AF 4UCUA 4EFEA 4EGJA 3URYA 4H02A 2EVBA 4CJ2C 4DAYA 5JEAH 1TAEA 4OO1G 2O2LD 2Q8TA 5LHY1 3C2PA 4C2MB 1SR3A 1V1PB 4DR3L 2WV6D 2J7ZA 4O82A 2YZNA 2AQ2B 1EOVA 2LKVA 3H94A 2FP4B 2D0PA 2P0AA 4K6DA 2KA7A 4ZUJA 4K6LA 1YZ6A 4QL5A 2WB1G 3S2HH 5I5VA 3I4MG 3E3XA 4HJ8A 3I4NG 1KTAA 3GJXB 1KTKA 1HPCA 3R3OA 5DEHA 3KAJA 2ES2A 4O4JF 3ND9A 3CXCA 2XWJB 5IGDA 1VMCA 3NELA 2B2WA 5ELFA 1SXTA 3WWVA 5NUCA 1K73C 2HGSA 4K5WA 1QZGA 2R93H 3TREA 1L0XB 2YS6A 5I5YA 4YJ2F 2PYKA 1PK8A 2R7KA 4P72A 3MXPA 1UNSA 1NMFA 3GTQB 1N32L 3G6JB 3SXHA 4BY7B 1S5CD 4FXDA 1EOTA 5FPOA 2NVXB 4DNIA 2W70A 1EUJA 3V05A 3F2BA 1IKMA 2F0QA 4J15A 2MP1A 5CAEB 2K5NA 4A3EH 2RA4A 2UUBQ 2O5JC 5IGGA 4LF8Q 2EYLA 4KN4C 2R86A 4GN3B 3VPCA 1YIJA 4JI5Q 3GTKB 4LFBQ 3VOTA 2Y0SE 3CRLC 4NP5A 1YI2A 4RMFA 2Z0SA 2F0TA 3RUZA 3TN2A 5C5LA 3TY8A 4IJLA 3GD7A 2PBZA 3GTOH 3CQZH 4KI0A 4DQNA 5ELDA 4ZYSA 4CMDA 3WOFA 4ZOLF 3W2DA 3BS1A 3N8DA 4DUZQ 4EGQA 5FPRA 1STYA 1EU3A 4H13C 4DV4L 3M7GA 3Q24A 2F0JA 1UC9A 1E1OA 4B9XA 2DJFC 2SOBA 5L37A 1DCZA 1GVPA 2Q8IB 4HNTA 3WO0A 2DZDA 2JA8G 4O7YA 3K59A 2KCMA 1LTBD 3VYRA 3T53B 3T99A 1IW7C 4G7ZC 2CWAA 5ELOA 1WFQA 4UP9A 4CDFC 1FNWA 1XNQL 3I72A 3GTJB 2IW3A 1VQHA 1EY7A 2KCTA 3J7ZC 4A3MB 2R7DA 4FFPA 1YNJC 1Q82C 1C9OA 1HUMA 2JA9A 4YIJA 3TP8A 1IYVA 1VQOA 4K6NA 2Q7DA 4CHIA 4LUVA 5M5XH 3S15H 4A93H 2O5IC 5KS8A 1EHIA 3HOWB 4HCSA 2YS7A 2EIFA 1TKWB 4KD3A 1UAPA 4M0JA 3WDNA 3GB8B 2PQAB 3RFCA 2Y0SB 3MFGA 1TIID 1JWSD 2NVXH 3S1MH 1X3FA 1VDZA 1H9KA 5KX5F 4P74A 1LTID 4A3LH 3ICEA 1XPOA 5BR8L 5BWVA 1EIFA 1EYDA 1IYEA 3BA8A 3EROA 4G7HC 4XYMB 4EX5A 3I8ZA 5GAGC 3S17H 1TS2A 4R4OA 1QE6A 2IJ0A 1YITA 1HA6A 2YRXA 1EKPA 3CRKC 5JQWA 1L0WA 2UUAQ 2BDOA 1H9RA 1SNDA 3P75A 5LL6X 5E1FA 1WTVA 4JCVE 1P8LA 3CCQA 2HVSA 4X6AH 2DUDA 2DWCA 4K0KQ 3B6YA 5BMVF 1AFPA 2RDFA 5C44G 1W3SA 3C1FA 2F3IA 3KYHC 1KJQA 4FDBA 3KF8B 1NCVA 2JA6B 5CB4F 4C2MH 2W6MA 1H9MA 2D5DA 4ZKCB 4HQ6A 3TW7A 3AQQA 5E25A 1PFMA 1IBMQ 2B2TA 2LFNA 3E0EA 3SK4A 5KKNB 2E5LQ 2UXBQ 1HTPA 5M3FH 3KJPA 1KC8C 4XYQA 3I4NH 3KDFB 1YNJD 2OTLA 1JDBB 4C1NK 2ZTEA 2JA5B 3LWEA 2EE1A 4HJ9A 3L7ZC 1MJEA 5ELCA 3K5IA 4OGQC 3I70A 1Z2PX 4IQZA 4LFCQ 1TS3A 1VQNA 2JA6G 2A1AA 4A3CH 2KBNA 4XQJA 4DAPA 1R4PB 3BYTB 1TS5A 2XIWA 2K32A 3MXNA 3U55A 5DAAA 1GJXA 2NZOA 1PRTB 1JB3A 2JA8B 3HT5A 4O42A 3OMCA 2K6AA 4LF9L 3J7AV 1Y14B 4CE5A 4A3FB 4X3TA 1SYFA 1BKBA 2NVQH 1RL2A 3BYYB 4KJNA 1G2WA 5JVLA 2CNUA 3FVQA 4KJOA 1R9TB 1A15A 1V1QA 1C30A 5K36H 5IYBG 1LV9A 4XQQA 3UDGA 2EJ2A 3W1GA 3S1RH 1B3AA 1KC7A 2UUAL 2JQOA 3T9AA 4YAKB 1DZ1A 2HHFB 3TP7A 2X5RA 4L6TB 3J80i 2MHVA 2B2VA 5IODA 3T7AA 2B63B 3N52A 1ET9A 4A3IB 3S2DB 3L9AX 1FD7D 4L8JA 5C5MA 1CT1D 1D6EC 1S5BD 3U4VA 4EQNA 4GOPB 5BPFA 5FO8B 1WCMG 1VMPA 3ZJYC 1J5EQ 4XQNA 1CQJB 5KNBA 4O4HF 4L63B 1E4EB 4QJFA 1XNRL 4JVZA 1VQGA 1IOVA 4JV5L 4HNVA 4DPGA 1MD2D 2L12A 3P1HA 2EYOA 3DTFA 3MHBA 1Y1WB 1JLLB 1LO5D 4DXGA 2YU9H 2FMMA 1N33L 3HKZG 4LF7L 4PZ8A 4MV4A 4BY1G 1RODA 3KBXA 1DOMA 1VQCA 1XMOL 3HOYB 2EDGA 1QNUA 1UE1A 3WOEA 1D2BA 3ORRA 5LOVF 1B9NA 3F2UA 2F0GA 1T9HA 2EXZA 4YWMA 2B2UA 3RZOH 1NNXA 5E4WC 4JI4Q 3D4RA 1EY6A 2IL8A 4JBKA 2ZM6Q 1ASZA 1VBGA 3ERSX 3HOYG 2RKSA 1N34L 3TP6A 3JRWA 2HUGA 3NBHA 5C0XH 2I5HA 2GLTA 5FO9B 1K83B 1GLVA 2EZVA 1ILPA 4TQUS 2ODTX 1JQYD 1AP0A 1STGA 1AE2A 2YZLA 1KJIA 1Q8IA 3ETHA 1N9WA 3OMGA 4LF9Q 2HJWA 4LF5Q 4A3GB 1DOLA 2PI2A 3NPPA 1ZEQX 2PN1A 2E75C 4AIMA 1XDNA 4ZCKA 1FVIA 4YWLA 4C5CA 3S9WA 1V8QA 2K01A 3STBC 1PZKD 3NP8A 3HGBA 2KHIA 3U0GA 1JDEA 3L0OA 4ZUIA 3TBIB 1GOZA 1TT2A 5GADC 3MWEA 3BAAA 4KHVA 3I73A 5IP9G 5C44H 3MAQA 1WYDA 2E2DC 4YB8B 4GNXC 1SNQA 3AFQA 4FU0A 3KUPA 4ZI7F 2ZJRA 3QOJA 3U9SA 1EKVA 1X56A 3K7AH 1SYBA 3S16H 4BY1B 4F7XA 5G3LD 3PUWA 4R1JA 3NBHB 4KKUA 1V43A 4DR2Q 2COIA 4XDXA 1TWAB 1SJED 5I60A 5E4XA 4DV3Q 4A3FG 2I80A 1D8LA 3T9CA 1JWUD 4ID6A 5M3FG 1OTCA 1Y8PB 5D8DA 3G8CA 1SYCA 1G2TA 3GO5A 4CDEC 2PO4A 4DUYL 4FF1A 5KYLA 1IYUA 5JVH3 2UXDQ 1DGSA 1Z6HA 2J0TD 2NB0A 4JPBW 3I4OA 2YU9B 2ASBA 4K0KL 1Y1WH 3DHQA 4PBCA 4JOIA 2NU9B 1EEID 1RF2D 2BDNA 3DXJC 3X3MA 3HOXH 4JG2A 1JOOA 2JA7H 4ILWA 4JI1Q 2JA6H 2W6ZA 3CKIB 2W71A 3T9FA 4O84A 3D8GA 3F1ZA 3KLRA 2DJGC 4B3RQ 4LWCA 3J80E 4I55F 1EYZA 3A7AB 1IBML 3OTOL 1A3GA 2HDKA 5J39A 4K2KA 2RF4A 3OUZA 4NB3A 1SEBD 4FFLA 4XYOA 5J2TF 1IXRA 3VR2A 4N9TA 4IUPA 2MGSA 1VQJA 4DK6C 4MV1A 2KENA 5C4JH 3GTGB 3E5SA 1RTNA 2GQRA 2Z1CA 3LULA 1D1IA 3BZCA 4X65Q 1BCPD 2A8VA 3M3YH 1FR3A 2OEOA 1LT5D 4DR1Q 4YCVA 3UDIA 2VY3A 1SE4A 1EU4A 1TWCB 3LP8A 3S1MB 1Y1VB 1W96A 1ZAUA 2KQ3A 3JAME 1UE6A 3OIQA 1V9PA 4HSVA 1F9RA 4UDUC 3HOWH 1XMQL 1QWYA 1PRTF 1K3RA 3R2TA 5C1OA 1PYWD 3G6EA 3D0FA 3DUZA 2V58A 1ML0D 1VQBA 2R7MA 3UQ8A 2RDGA 3VR5A 1K8MA 1E1TA 2HHFA 4NMZA 1PZJD 1STHA 5I4DA 4DRFA 4DV2L 1W2BA 2Y0SG 1G8ZD 2X6LA 4DUYQ 2NYZD 4RGMA 2FB9A 3X3NA 1HNXL 4ZLTF 2ZTDA 2ATWA 1CA6A 5IE8A 3GTMH 5M3FB 3TQTA 4ME6A 1Y1VG 2E76C 4Q0FA 2EY2A 2MO1A 1GO3E 4A3MG 2EJMA 3K6OA 2R7ZH 1CQFA 2DIKA 3CCLA 1JR0D 1GSAA 4CC6A 4HNUA 2CNVA 3RLOA 5T1GA 2COGA 2VB3X 1D1KA 4PNYA 1HZ9A 4GN4B 1K0SA 2ZM6L 2QB5A 5H1SE 1SFOB 2K05A 2PCFB 1BUVT 4DV0L 3BZKA 4L5QA 4MTNA 2NTSA 1I50H 1KDAA 1LTAD 3A0JA 3GTKH 2XSCA 1KXLA 3GV3A 1CZWA 3TZUA 3QB3A 1IYJB 1OXVA 3SE0A 1XXGA 1J6QA 4C3IG 2NVYB 2BOSA 2UU9Q 2Z6BA 5C4XH 2WP8J 3J80L 4A3GG 1DIKA 4NYEA 2R3ZA 4Y8VB 2F0IA 1JJ2A 3MXGA 1SNCA 4IWYA 2QA4A 4DV2Q 1PH5A 4I4TF 1I94Q 2L11A 2AQ1B 2JEBI 4A3JB 5EPLA 1ET0A 3M85A 4NZMA 4I50F 2I8CA 1PXUA 1J5EL 1QJOA 2MUYA 1XPUA 1STAA 3R5FA 3A8KE 4RWSC 1TY2A 4O7VA 1JOQA 1PYBA 1SRUA 3E0JA 3JAMc 5I5TA 4C1NI 2NVTB 2CZGA 2R7FA 5LYJF 4GLVB 2W6OA 4B3TQ 5LP6F 3SHLA 4Q5VA 3WWIA 2F4VQ 3IKJA 4LF4Q 2A68C 1CSPA 3KFUA 4P75A 5C6AA 1KHIA 2LSSA 3RUPA 1AZQA 1D7QA 3KDFA 3S1NH 3S1NB 1X55A 2OQKA 5EPJA 2TSSA 3DM3A 2V5AA 5D1OB 4BXXG 3G48A 2GQSA 4IPDA 1PYSB 5J1ZA 1W93A 2WACA 1HZCA 1FGUA 3N6RA 3BVGA 4RHSA 1BOSA 2Q2UA 5EZYF 3PO3H 4IHJF 2K5DA 4O86A 4FGRA 2Z04A 4DV0Q 3PF5A 4JK1C 4KY5A 4NDXA 3CQZB 5T1IA 3GTOB 1YHAA 3RNUA 3GTPB 4BY7G 4CGYB 5J2UF 2PQAA 2AUJD 5COYA 3UFXB 2A73B 2YYZA 3NTKA 3R93A 2JK8A 4JI3Q 4GKKQ 4A3DB 1BNCA 1F9QA 1PRTD 3T9EA 1IKLA 4B3SQ 1N33Q 4ZRZA 1SMYD 5KNCA 4UCTA 4DF7A 3MEFA 5EAYA 1Z2OX 1NR4A 5JH7F 1SAPA 3J7A5 2QW7A 4IUVA 3ETJA 1KL9A 3BDCA 3KF6A 1OXUA 1EFWA 4A3DG 1B9MA 2PNRC 4IFDJ 3BU2A 4E6IA 1I6HB 4EEQA 3PIO3 1GGOA 4EG0A 3G71A 4DR2L 3LWUA 3K58A 2AHOB 1PH8A 3EFXD 3MXNB 4RZQA 3UDFA 5DLQE 4XTCS 4C5BA 2HVRA 4LFBL 2UXCL 4OEMB 1N36Q 1F2LA 1WCMB 3P7JA 4PZ7A 3A5UA 1VQFA 4BBSH 2XRQD 1HUNA 1HQMC 1TXYA 3V2TA 1BBXC 4DN4M 2I07B 4CDCC 4GNXA 3Q1KA 4NZNA 1PH1A 1OBDA 2VQDA 5FO7B 4BBRB 4FVMA 1GUOA 3NHHA 2Z4IA 3MFYA 4C5AA 1E22A 2L0CA 1B1ZA 1Q1EA 4CKCA 4QCLA 4R4IA 4B3SL 1A0GA 2W6QA 2UXBL 2DGYA 3U9OA 3ORQA 1O7ZA 2J9GA 3GLKA 4XZ3B 2EYHA 4MIUA 5IGBA 1K8AC 1U9RA 1STNA 2A6ED 3Q6SA 3DLLA 2QDBA 5M5YH 1JJCB 5GROA 3BG3A 3CCSA 3I2ZA 5CV9A 5KGUA 4WJ4A 5DAUA 2K5WA 1E4EA 1KDBA 1A6XA 1PH4A 3EA6A 4LUOA 4C3IH 2VQFQ 4JBJA 1S5ED 4ABNA 5CC4A 5IYDG 2PMZE 1EWCA 4M1UB 1ICFB 2L1BA 1G291 2L15A 1JICA 5IOCA 1KJ8A 4NXMQ 4XT1B 1VQ6A 3ULLA 3W5OA 3VDYA 2JA5G 3E9HA 4QUFA 1EQRA 1E3PA 1I4RA 1U4RA 1UE5A 3L3OC 1N36L 2F0NA 2SDFA 1TR5A 3K8AA 4ULLA 5DGHA 3M9BA 4TSSA 3MXUA 1KT8A 1Z47A 4X62Q 2A74C 4HEDA 5DMXA 4RH6A 5CV5A 4RG1A 5BR8Q 2EJ0A 1VS0A 3CHBD 4A3IH 1SSOA 2FHTA 5CR3A 3J7AF 2AWNA 2YRWA 2DLNA 4DXFA 1KDCA 3HOZG 2V59A 2F0EA 4K8JA 1VQ8A 1IBLQ 3WNZA 1L1OB 3L2PA 3HOXB 2VS1A 4LW1A 2D2CC 2EYMA 4JI5L 5DGIA 2X69A 2RQXA 1DAAA 5EKIA 4Y7NB 2F4VL 3MWYW 1KIXA 3T1HL 1PTOD 1I1LA 3HOUG 3T9DA 3KLWA 1I4GA 3CEBA 3NK9A 1A3UA 4JYAQ 2EJGC 3BABA 4X3SA 4WFN3 3WO1A 1K0RA 1UEBA 2VR1A 4NXML 4A3KB 2FMCA 3AMUA 4IURA 3PCOB 4L5SA 1IL8A 5C0XJ 3WWHA 1NTGA 3GTPH 2RHQB 2C00A 1MBYA 4YY3L 2DN8A 2RSOA 2B63G 1H9SB 1SYGA 1QOHA 2BH8A 3CP0A 1CTMA 2SCUB 3CW2C 5BN5A 1EY4A 1JKJB 2K5HA 2EY1A 3PUVA 2RDHA 4DR3Q 1J9OA 1KNEA 1I3QB 2KOLA 1K9MC 4BBSB 5I47A 1CHQD 3A56A 1B6SA 3EVQA 1CKNB 4FO2A 2QEXA 3JAMi 1OXXK 3TEKA 5IGEA 1YNXA 3VR3A 4OO1H 2ALYB 2GVAA 1EQVA 4PMWA 5FNVF 3PIPA 4UY8C 3RMHA 1HNZQ 1CE8A 5FLXE 1B70B 1BF4A 4A3BB 5C0XI 2HIVA 4FNFA 1PLFA 3CCEA 4DV5L 5LA6F 2F4IA 1EIGA 3RV4A 3OSOA 4DV6Q 4OIKA 3I56A 4X66Q 3T1YQ 1AW7A 2OQ0A 1SE2A 3PIOA 4DR1L 2WYOA 3E5NA 2XGTA 5E7NA 4R8IA 1QILA 1L2FA 2OF1A 2F0HA 2NBFA 2SNSA 2D62A 2R85A 3LX0A 2E2IH 4A3CG 5BWWA 4JI0L 3IAYA 2G9HD 4HJ5A 2WAQB 3K81C 3RTXA 1KLGD 4F87A 2F0SA 1GUWA 1IZ6A 1FGBD 2NVYH 3H09A 4MNOA 3CCMA 5LMUQ 4FFOA 3RN5A 2HDMA 4RGOS 3PO2H 3MEHA 4A93B 2XCLA 1HHVA 2R82A 5LMNL 4FXKC 4DKAC 4CMFA 2Q2IA 3K3PA 1LUZA 5EBCA 2QGQA 3NTIA 4C3HH 4HTOA 4TV9F 3VR6A 2FXQA 3M4PA 4HTPA 2RVLA 2D9UA 3TQYA 3GIDA 1K3BC 3GQBA 3NUAA 2I5LX 2KHJA 3QWUA 4DA2A 3DM1A 4HMJA 1A62A 2VPQA 3LNNA 1Z9FA 1B44D 1WTHA 4JW0A 3VR4A 5C3EG 1Y8NB 4R4TA 2KEEA 4B3MQ 5GONF 4UP8A 4LFCL 4LH7A 1TWGH 2A6EC 2DNCA 3SGIA 1UC8A 2VNUD 3I4LA 4RFBA 3HOWG 2JA8H 1I6VC 2R6GA 1T5XD 2DAAA 1VQIA 1VF5C 4PMCA 4L5RC 4RCOA 3AEVA 3VPBA 1ZYRD 2CCZA 3JSLA 4LUZA 1BR9A 4X66L 3T1YL 3H3VI 4HIDA 4OWTB 4BA2I 3TY5A 1EFID 4DNTB 1I2LA 1X3PA 5CV6A 4CJ0B 5K2MA 4JBMA 4IOAA 1EUDB 1M6VA 2N78A 1XJVA 1JE5A 3T13A 3CD6A 1BNZA 2AKWB 2K4KA 4FF2A 1HNZL 4X65L 1B3QA 4FYDA 2FPIB 3K5OA 1PTOB 2A6HC 1EY9A 4ODGA 4YCWA 3PO3B 5F2DA 1JE4A 1I5FA 5HNEA 2K03A 3QG1A 3HKZB 1HH2P 1TU2B 1IL2A 1SDFA 1QUQB 2GN5A 1IHZA 2H4OA 1CHPD 4EVOA 2FPGB 2K28A 4ME3A 2M00A 2QF7A 1E7ZA 4J8QA 3TY9A 4XT3B 1AUXA 3CCRA 3DMUA 4IJHA 4ZK9B 1CKNA 4G7OC 1C8CA 1PTOC 2QILA 2G9DA 4C3HB 4XX0B 1CKMA 1XWEA 4QY7A 3FEWX 3V96A 2VZAA 2DY7A 1UWVA 1M1KC 2Z4HA 3NQIA 5JQGF 1EYGA 1EWIA 2PMZB 3EBEA 2EPBA 1F2ZA 1XMOQ 3DAAA 2GPWA 3TW6A 2A19A 2ZGIA 3BDOA 1SN8A 3Q22A 2Q8RE 5IT9E 5JJLA 4JV5Q 1M0TA 3FP9A 4IUNA 1VQ4A 5LXTF 2CW0D 4DK0A 1FL0A 2EYFA 1CZGA 5FKAC 1CFMA 3I91A 3UZOA 4NKLA 2EY5A 3HP3A 5ELEA 5M3MG 1GUTA 1SYDA 2YZGA 1EYCA 4MA5A 1FJGL 2AUKA 2WB1B 1WR2A 1RTOA 3HOXG 2E2JH 4EFBA 4A3JG 3DWPA 1D5XC 4HIOA 5JJIA 3NBIA 1IOWA 3TSSA 3HB9A 2IT1A 4O7LA 4U673 2DABA 2WKDA 1I7LA 4G4KA 4RKLA 5M5WH 1ASYA 1YEZA 4IUUA 3TS0A 2R7NA 3PIP3 2HVQA 2C5CA 4IZOA 3KF6B 1U5KA 1Q3LA 4C56C 2UUCL 2IX1A 3H0GH 1GD7A 1PH6A 2QDLA 4DNRB 1C0AA 5AJ3Q 1GUSA 1NR2A 3T4AC 1IYDA 4I7AA 1QCBD 4DV7L 2UUBL 3UE0A 1U4MA 1BXRA 2RSNA 4UAIA 1LTLA 3GTLH 3SVMA 3OOCA 4QB4A 1GUNA 2WKCA 2F0UA 5BN4A 3PUXA 5GQOA 1KRTA 1TQOA 1VQMA 1TY0A 2R92H 3A7LA 1HFGA 2SNMA 5I9OA 2Z02A 4HIMA 3H3VC 1SNPA 5I2YA 2HGWA 2CQOA 4UHVA 3M4OH 1II3A 2ZDGA 5IWAQ 1W6KA 4LF6L 2VUMG 3GV6A 5C1PA 2CWPA 2EQSA 4P71A 1AH9A 3AYHB 2PVPA 2R87A 1WTXA 2F0LA 5JEAJ 1DONA 1PH7A 4IO9A 3A5ZB 3TIIA 2HQEA 1SJHD 4BY1H 1N34Q 4DR7L 5FLMH 2WFWA 3J80c 4FE2A 1NUCA 3Q0AA 2XNAC 2ICIA 3KLSA 4Q4DA 3T54A 1XMQQ 5EQ0A 5KIXA 5G3LF 2ZDQA 2JXMB 1LACA 2R7LA 3RLNA 4KKSA 2B2WC 4O7WA 5C3XA 4KK7A 2KHSA 2K1BA 2NUAB 3S2HB 1I1MA 4NZOA 4BBRH 5LMNW 3A55A 3PF4A 1GSOA 2HG8A 3EN2A 2FJ2A 5D1PA 3U50C 1BBUA 4RGTA 3J81i 4TVIA 2JA7B 2F03A 1A9XA 3SR1A 1O7IA 2LS01 4RGNA 4A3GH 1M8AA 1UEAB 1UE7A 1YHBA 3U54A 2JJQA 2RHSB 4E4TA 4F8MA 1EEFD 1BCPC 2NTTA 2PQEA 5IP9H 4PZ6A 4HIKA 4JI8L 3SDZA 3HO8A 3AB9A 1ESFA 2KUMA 4JI4L 5EBDA 4HTHA 1CM9A 1CQVA 5JOBA 1KJ9A 1WTRA 1GM5A 4CKEA 4LF4L 1A3TA 2JSOA 5K36G 4MAMA 1PZID 2P5ZX 4HMIA 4JI7L
chains in the Genus database with same CATH topology
2IHEA 1VQFA 3M7NA 5D1OA 1EIYB 4P74A 4LNQA 4BBSH 4DR6Q 3BA9A 4JI2L 4A3LH 3ICEA 1XPOA 1TXYA 5BR8L 4Y52H 1EIFA 2RCNA 3RLFA 4GNXA 1I6HH 1B04A 3BA8A 3ULPA 1Q8KA 1PH1A 3HOVH 3CC7A 5FJ8G 4EX5A 4L5TA 5GAGC 4IOCA 1QZHA 1E22A 4DV1L 5C3EH 1Q1EA 4R4OA 1YITA 4LF5L 1L1OC 4R4IA 1YJ9A 5JJKA 1WCMH 1L0WA 4B3SL 2UUAQ 2UXBL 2DGYA 1NE3A 2VUMH 1NJIC 1NMGA 4JCVE 1K8AC 1K8GA 3HOZH 1P8LA 3CCQA 2ZTCA 1NY4A 4X6AH 3DLLA 2HVSA 2MFIA 3STBD 4DR4L 4XIGS 2DUDA 5M5YH 2HT1A 1JJCB 3B6YA 4DR5L 5GROA 4LFAQ 1YJNA 3CCSA 3U58A 4K0KQ 3I2ZA 2YTVA 2Z6KC 5C44G 4WJ4A 2WB1E 1W3SA 2UU9L 3S17H 5JEAG 2F3IA 1VQ9A 3KYHC 1PH4A 4C3IH 4LUOA 2VQFQ 3PO3G 4JBJA 5IYDG 1X3EA 4FDBA 2PMZE 4KHPL 5IYCH 3KF8B 4OWWB 1G291 1S3OA 2L15A 1C7YA 4A93G 4C2MH 1Y1VH 1QVGA 1S72A 3OTOQ 2I5MX 3AQQA 2HIXA 3GDEA 4NXNL 2VQEL 1B7YB 1IBMQ 4NXMQ 3GTQH 1VQ6A 3ULLA 3E0EA 2N8NA 2WAQG 3W5OA 3VDYA 2E5LQ 2JA5G 3E9HA 5M3FH 2UXBQ 4LH6A 1EQRA 1E3PA 1HJPA 1UE5A 2IHFA 3KJPA 1CSQA 4AQYL 1KC8C 1N36L 3CMEA 3K8AA 3I4NH 4A3LG 3KDFB 3M9BA 3U4ZA 2OTLA 2PNHA 1Z47A 3I7FA 4GS3A 4X62Q 2ZTEA 3D31A 5C0XG 2XTIA 2YV5A 4HJ7A 4HJ9A 3L7ZC 1MJEA 2H5XA 4RG1A 5BR8Q 1VS0A 4C3JH 3A74A 4A3IH 4DAYB 4LFCQ 5AJ3L 2R93G 2AWNA 4QIWE 4UCRA 1VQNA 2JA6G 2A1AA 4OONA 4UP7A 4DAMA 3HOZG 4A3CH 2KBNA 4NPSA 1N8RC 4A3BG 3JC66 1VQ8A 2NZOA 1IBLQ 1L1OB 3L2PA 2VS1A 4LF9L 4LW1A 1Y14B 4LFAL 4JI5L 2NVQH 1BKBA 4JI2Q 1LM0A 1RL2A 4OWXB 3J81j 2AMCB 2F4VL 3G4SA 5IYCG 1V1QA 4IPGA 1KIXA 5IYBG 2N3SA 3UDGA 5IY0A 3W1GA 3T1HL 3S1RH 3HOUG 1JJGA 3KLWA 3LGJA 2UUAL 2JQOA 4JYAQ 3CC2A 1G6PA 1B8AA 4BBSG 3BABA 3I4MH 3J80i 3TS2A 1K0RA 1UEBA 1X6OA 1H95A 4NXML 3CCUA 3UDXA 4UCOA 4R4CA 2MO0A 3CF5A 3PCOB 4L5SA 4JI3L 3U4VA 5C0XJ 4GOPB 2I0QA 1NTGA 2CKZB 4DR5Q 3GTPH 2RHQB 4YY3L 2B63G 1WCMG 4POGA 3ZJYC 1J5EQ 1HR0Q 2JEAI 4YCUA 3CP0A 2BH8A 4DV5Q 3CW2C 2BA1A 1X54A 2K75A 4A3IG 1VQLA 4QJFA 2NVTH 3GTJH 3CCVA 4A3KG 2K5HA 1WI5A 3PUVA 1XNRL 1VQGA 4DR3Q 4JV5L 4CC5A 4DPGA 1K9MC 2HHHQ 1Q81C 2JE6I 4DR7Q 4JYAL 4DR4Q 4A3EG 1CKNB 2YU9H 1PHJA 1N33L 3HKZG 4JI6Q 4PZ8A 4LF7L 4BY1G 2QEXA 3M4QA 2C35B 1WOCA 3JAMi 4YHHL 1XMOL 1VQCA 1OXXK 1OXTA 1UE1A 1YNXA 2ALYB 2GVAA 4PMWA 3PIPA 4UY8C 1P16A 2K14A 1T9HA 1BBWA 4YWMA 3RZOH 1IBKQ 1VQ7A 4JI4Q 1HNZQ 4E6NA 1FJGQ 4JBKA 1B70B 3K0XA 2ZM6Q 5LMUL 4OXPA 4DV3L 1ASZA 2PI2E 1HR0W 5C0XI 2HIVA 3CCEA 4DV5L 3S1QH 3ERSX 3HOYG 1N34L 3ER0A 4X64Q 1E24A 2D0OA 4DV6Q 2I5HA 3I56A 4TQUS 4X66Q 3T1YQ 2OQ0A 3PIOA 4DR1L 4AYBE 2XGTA 1AE2A 5E7NA 2ZJQA 1N9WA 3CCJA 4LF9Q 1L2FA 1SFOH 4LF5Q 2ZJPA 4P73A 2PI2A 2D62A 1YJWA 2E2IH 4AIMA 5GAEC 4GLXA 1HNXQ 4JI0L 4A3CG 1PH9A 1XDNA 3CPWA 1HZAA 1XNQQ 1FVIA 3F2DA 2N49A 4YWLA 4HJ5A 3K81C 3RTXA 1IZ6A 3STBC 2NVYH 4MNOA 3CCMA 5LMUQ 2UXDL 1YVCA 2KHIA 3PGZA 3NBYB 1I3QH 2IX0A 3RN5A 3L0OA 4UPAA 1OXSC 5GADC 4DV1Q 3PO2H 3BAAA 5IP9G 1QVCA 3S24A 5C44H 3S14H 5LMNL 1X65A 3GTGH 1WYDA 1SLJA 4DKAC 4GNXC 3AFQA 2Q2IA 2MQHA 4YHHQ 2ZJRA 1LUZA 2QGQA 1X56A 3K7AH 4C3HH 3S16H 1AE3A 4DR6L 4HTOA 4DK3C 3PUWA 5J3BA 2FXQA 3M4PA 4HTPA 1V43A 3NBHB 4R1JA 3TQYA 4DR2Q 3TEHB 4DV3Q 4A3FG 2I5LX 2E2HH 1Q46A 1GKHA 2KHJA 3W1BA 1D8LA 4B3ML 4KLKA 3QWUA 5M3FG 1OTCA 1TWCH 4BY7H 2NZHA 4HJAA 3HOVG 1A62A 3GO5A 4KHPQ 1Z9FA 2YTYA 4DUYL 4A3MH 1SE8A 5C3EG 2UXDQ 2EXDA 1DGSA 3F8TA 4BBRG 4R4TA 2R92G 2BA0A 3I4OA 4B3MQ 3PN1A 4YWKA 2NN6I 4JOIC 2ASBA 5FPOA 4K0KL 1Y1WH 3K7UC 3OYYA 2UUCQ 4UP8A 4LFCL 1VQEA 4A76A 3NC0B 1TWGH 4LH7A 4JOIA 3SGIA 1I94L 1SROA 4AYBG 2VNUD 1SMXA 3HOWG 3HOXH 4JG2A 2JA8H 2B3GA 2R6GA 2JA7H 1RIPA 4WJ3M 4JI1Q 1VQAA 1VQIA 2JA6H 4IFDG 3JSNA 4L5RC 2MNAA 1VQPA 4LF6Q 3AEVA 4X62L 3F1ZA 1PFSA 1S40A 2BH2A 5IWAL 4A3BH 2CCZA 4OX9Q 4LUZA 4B3RQ 5IYDH 3JSLA 4X66L 4QGUA 3T1YL 4LWCA 3H15A 3H3VI 4HIDA 3PO2G 4OWTB 4BA2I 5FLXc 4UFZA 2VQEQ 3PUZA 4POFA 4IPHA 2VW9A 1A0IA 4DV4Q 1IBML 1PVOA 3T1HQ 3OTOL 4JBMA 4JI7Q 1TWAH 3EIVA 4IOAA 2N78A 3RR5A 2RF4A 4TVAB 1JE5A 1XJVA 4NB3A 3CD6A 4OX9L 4JBWA 2IY5B 2AKWB 2K4KA 5IYBH 1HNZL 4KHZA 1QVFA 1IXRA 4X65L 2JA5H 1JT8A 1VQJA 4JI8Q 1U0LA 4JI0Q 4EQ5A 2K5VA 4DK6C 4YCWA 2KENA 5ELNA 5C4JH 3HKSA 4GNXB 2R7ZG 4GKJL 1A63A 1I5FA 5IT9c 1X3GA 3UE1A 4A3DH 1HH2P 2F52A 3BZCA 4X65Q 1IL2A 2A8VA 1JMCA 3M3YH 1QUQB 4Y7NH 4PZ7A 4DR1Q 2GN5A 4YCVA 3UDIA 3VNNA 4GKKL 2ID0A 1Q86C 2VY3A 1A8VA 3F2CA 4ME3A 3PSIA 1Q12A 2Q2HA 1E7ZA 3K80C 3TY9A 4ALPA 3CCRA 4IJHA 1Y1WG 1KD1C 1CKNA 3TRZA 3CPFA 1UE6A 3RN2A 3NBZB 1V9PA 3ULJA 1VQ5A 3OW2A 3HOWH 4A3KH 1XMQL 4AH6A 2VL6A 1K3RA 4A75A 1CKMA 4QY7A 3G6EA 3D0FA 2VZAA 4MZ9A 4BA1I 2Q2TA 3J81c 1UWVA 1M1KC 1VQBA 1CUKA 3UQ8A 1EYGA 1WJJA 1EWIA 3EBEA 1QUQA 1E1TA 2OCEA 1XMOQ 5C4XG 4DRFA 5D1OB 4DV2L 4BXXH 1W2BA 2Y0SG 1IBKL 4GKJQ 2A19A 4DUYQ 3FHWA 4B3RL 1LYLA 3H0GG 1SN8A 2HQLA 3I55A 1Q7YC 1HNXL 4GLAC 2ZTDA 2ATWA 5JJLA 5IE8A 3GTMH 4JV5Q 4OO1I 1TWHH 3E9IA 1Y1VG 3FP9A 3FKIH 1YHQA 1VQ4A 3IRBA 4JI6L 1L1OA 1Q1BA 2MO1A 4LF7Q 1GO3E 2E8GA 3S1MH 2HVRA 3HKZE 1HZBA 4X64L 4YY3Q 4DV6L 4A3MG 1FL0A 2R7ZH 3HOYH 3CCLA 5IP7H 4CC6A 1TWFH 4B3TL 4UCVA 5M3MG 4LF8L 1XNRQ 5FJ8H 3RLOA 4IPCA 2V1CC 1FJGL 2K52A 1K83H 3S2DH 1HZ9A 3TY5A 2GVBA 2CFMA 4GN4B 3HFZB 3KJOA 3HOXG 2ZM6L 2E2JH 5H1SE 5GAHC 2JA7G 3CAMA 1N32Q 1CKOA 4EFBA 4A3JG 2YTXA 3BZKA 3KOJA 4DV0L 4DV7Q 4L5QA 4MTNA 4O0AA 4HIOA 5JJIA 1I50H 3A0JA 4O2DA 3H3VH 1G51A 3GTKH 2IT1A 1MIUA 2UXCQ 1KXLA 4NXNQ 4PG3A 4GOPA 1PV4A 3BJUA 5M5WH 4UCUA 4EFEA 1ASYA 1IYJB 1YEZA 1OXVA 4H02A 4A4IA 5LMNQ 1J6QA 1TAEA 4OO1G 3TS0A 2UU9Q 4JC0A 2HVQA 5C4XH 2WP8J 4A3GG 1SR3A 2VQFL 4DR3L 1IBLL 3KF6B 5FLMG 1EOVA 1JJ2A 3CC4A 1U5KA 2UUCL 1XK5A 2IX1A 3H0GH 2QA4A 4DV2Q 1PH5A 2D0PA 1I94Q 1GD7A 2JEBI 1PH6A 4IFDI 1YZ6A 4QL5A 3M85A 3HOUH 2WB1G 1J5EL 3Q8DA 1KQSA 5AJ3Q 1HR0L 3S2HH 1C0AA 1PH3A 1XPUA 4DV7L 2UUBL 3I4MG 5HGQA 4HJ8A 3UE0A 3I4NG 3GJXB 4GOPC 1PYBA 1LTLA 1SRUA 1JB7A 3GTLH 5IP7G 3JAMc 3CMAA 2ES2A 4QQBX 3CXCA 1HNWQ 1KAWA 2R7FA 4GLVB 3NELA 3PUXA 1VQDA 5GQOA 1KRTA 3WWVA 4B3TQ 1PA6A 2B63H 1VQMA 1K73C 2R92H 1QZGA 4HIMA 3TREA 4LF4Q 2F4VQ 2R93H 2LXJA 1CSPA 2CQOA 3KFUA 3M4OH 4P72A 1N32L 4P75A 1NMFA 1KHIA 1NBWA 4GN5A 5IWAQ 2LSSA 1D7QA 3KDFA 4LF6L 2VUMG 1X55A 2LXKA 2OQKA 1EUJA 3DM3A 3NENA 4DNIA 3F2BA 2CWPA 1R9TH 1X9NA 2EQSA 4J15A 4P71A 4BXXG 3AYHB 3G48A 1AH9A 4IPDA 2Z6KA 1PYSB 2K5NA 4A3EH 2WAQE 2UUBQ 5JEAJ 1PH7A 4IO9A 3A5ZB 4LF8Q 4BY1H 1HZCA 1MJCA 4GN3B 1YIJA 1FGUA 1N34Q 2HHHL 4JI5Q 1KRSA 1MKHA 4DR7L 5FLMH 4LFBQ 2Q2UA 2WFWA 3PO3H 2Y0SE 3J80c 1YI2A 4RMFA 2Z0SA 4UCSA 3NEMA 4DV0Q 3PF5A 4A3FH 3TY8A 4IJLA 3GD7A 1XMQQ 3GTOH 3S1NH 1YHAA 3CQZH 2B29A 4KI0A 3RNUA 4BY7G 5M3MH 4AQYQ 2PQAA 3RLNA 2VUGA 4DUZQ 5FPRA 4BBRH 4DV4L 1TA8A 2YYZA 5LMNW 1EQQA 2JK8A 4JI3Q 1YBYA 3PF4A 4GKKQ 5DISC 1E1OA 3PV0A 4A3JH 3EN2A 2AWOA 5D1PA 3U50C 4B3SQ 1XPRA 1N33Q 5HY6A 1BBUA 4UCTA 1GVPA 3J81i 3MEFA 4JI1L 2JA8G 5EAYA 1VQKA 2KCMA 3J7A5 1KL9A 1M90C 1O7IA 3KF6A 1OXUA 2CWAA 5ELOA 1EFWA 1WFQA 4A3DG 4UP9A 4A3GH 1XNQL 4IFDJ 3BU2A 4EEQA 1UE7A 3AFPA 1VQHA 2KCTA 3J7ZC 2R7DA 3G71A 1YHBA 4DR2L 1Q82C 2JJQA 2RHSB 1C9OA 2JA9A 4DUZL 2AHOB 1PH8A 1XTDA 2OWOA 1VQOA 1HNWL 2OTJA 4LUVA 5IP9H 5M5XH 3S15H 4A93H 4PZ6A 3PUYA 1BVSA 4HIKA 3MXNB 4JI8L 2NN6G 2EIFA 1PH2A 4R4QA 4JI4L 3UDFA 3GB8B 2K50A 2PQAB 2E5LL 5DLQE 4XTCS 1GM5A 5K36G 4LF4L 4LFBL 1S68A 4APVA 3RZDH 1VCIA 1N36Q 2NVXH 2UXCL 3FKIG 1X3FA 3A5UA 4JI7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHE A;  1VQF A;  3M7N A;  5D1O A;  1EIY B;  4P74 A;  4LNQ A;  4BBS H;  4DR6 Q;  3BA9 A;  4JI2 L;  4A3L H;  3ICE A;  1XPO A;  1TXY A;  5BR8 L;  4Y52 H;  1EIF A;  2RCN A;  3RLF A;  4GNX A;  1I6H H;  1B04 A;  3BA8 A;  3ULP A;  1Q8K A;  1PH1 A;  3HOV H;  3CC7 A;  5FJ8 G;  4EX5 A;  4L5T A;  5GAG C;  4IOC A;  1QZH A;  1E22 A;  4DV1 L;  5C3E H;  1Q1E A;  4R4O A;  1YIT A;  4LF5 L;  1L1O C;  4R4I A;  1YJ9 A;  5JJK A;  1WCM H;  1L0W A;  4B3S L;  2UUA Q;  2UXB L;  2DGY A;  1NE3 A;  2VUM H;  1NJI C;  1NMG A;  4JCV E;  1K8A C;  1K8G A;  3HOZ H;  1P8L A;  3CCQ A;  2ZTC A;  1NY4 A;  4X6A H;  3DLL A;  2HVS A;  2MFI A;  3STB D;  4DR4 L;  4XIG S;  2DUD A;  5M5Y H;  2HT1 A;  1JJC B;  3B6Y A;  4DR5 L;  5GRO A;  4LFA Q;  1YJN A;  3CCS A;  3U58 A;  4K0K Q;  3I2Z A;  2YTV A;  2Z6K C;  5C44 G;  4WJ4 A;  2WB1 E;  1W3S A;  2UU9 L;  3S17 H;  5JEA G;  2F3I A;  1VQ9 A;  3KYH C;  1PH4 A;  4C3I H;  4LUO A;  2VQF Q;  3PO3 G;  4JBJ A;  5IYD G;  1X3E A;  4FDB A;  2PMZ E;  4KHP L;  5IYC H;  3KF8 B;  4OWW B;  1G29 1;  1S3O A;  2L15 A;  1C7Y A;  4A93 G;  4C2M H;  1Y1V H;  1QVG A;  1S72 A;  3OTO Q;  2I5M X;  3AQQ A;  2HIX A;  3GDE A;  4NXN L;  2VQE L;  1B7Y B;  1IBM Q;  4NXM Q;  3GTQ H;  1VQ6 A;  3ULL A;  3E0E A;  2N8N A;  2WAQ G;  3W5O A;  3VDY A;  2E5L Q;  2JA5 G;  3E9H A;  5M3F H;  2UXB Q;  4LH6 A;  1EQR A;  1E3P A;  1HJP A;  1UE5 A;  2IHF A;  3KJP A;  1CSQ A;  4AQY L;  1KC8 C;  1N36 L;  3CME A;  3K8A A;  3I4N H;  4A3L G;  3KDF B;  3M9B A;  3U4Z A;  2OTL A;  2PNH A;  1Z47 A;  3I7F A;  4GS3 A;  4X62 Q;  2ZTE A;  3D31 A;  5C0X G;  2XTI A;  2YV5 A;  4HJ7 A;  4HJ9 A;  3L7Z C;  1MJE A;  2H5X A;  4RG1 A;  5BR8 Q;  1VS0 A;  4C3J H;  3A74 A;  4A3I H;  4DAY B;  4LFC Q;  5AJ3 L;  2R93 G;  2AWN A;  4QIW E;  4UCR A;  1VQN A;  2JA6 G;  2A1A A;  4OON A;  4UP7 A;  4DAM A;  3HOZ G;  4A3C H;  2KBN A;  4NPS A;  1N8R C;  4A3B G;  3JC6 6;  1VQ8 A;  2NZO A;  1IBL Q;  1L1O B;  3L2P A;  2VS1 A;  4LF9 L;  4LW1 A;  1Y14 B;  4LFA L;  4JI5 L;  2NVQ H;  1BKB A;  4JI2 Q;  1LM0 A;  1RL2 A;  4OWX B;  3J81 j;  2AMC B;  2F4V L;  3G4S A;  5IYC G;  1V1Q A;  4IPG A;  1KIX A;  5IYB G;  2N3S A;  3UDG A;  5IY0 A;  3W1G A;  3T1H L;  3S1R H;  3HOU G;  1JJG A;  3KLW A;  3LGJ A;  2UUA L;  2JQO A;  4JYA Q;  3CC2 A;  1G6P A;  1B8A A;  4BBS G;  3BAB A;  3I4M H;  3J80 i;  3TS2 A;  1K0R A;  1UEB A;  1X6O A;  1H95 A;  4NXM L;  3CCU A;  3UDX A;  4UCO A;  4R4C A;  2MO0 A;  3CF5 A;  3PCO B;  4L5S A;  4JI3 L;  3U4V A;  5C0X J;  4GOP B;  2I0Q A;  1NTG A;  2CKZ B;  4DR5 Q;  3GTP H;  2RHQ B;  4YY3 L;  2B63 G;  1WCM G;  4POG A;  3ZJY C;  1J5E Q;  1HR0 Q;  2JEA I;  4YCU A;  3CP0 A;  2BH8 A;  4DV5 Q;  3CW2 C;  2BA1 A;  1X54 A;  2K75 A;  4A3I G;  1VQL A;  4QJF A;  2NVT H;  3GTJ H;  3CCV A;  4A3K G;  2K5H A;  1WI5 A;  3PUV A;  1XNR L;  1VQG A;  4DR3 Q;  4JV5 L;  4CC5 A;  4DPG A;  1K9M C;  2HHH Q;  1Q81 C;  2JE6 I;  4DR7 Q;  4JYA L;  4DR4 Q;  4A3E G;  1CKN B;  2YU9 H;  1PHJ A;  1N33 L;  3HKZ G;  4JI6 Q;  4PZ8 A;  4LF7 L;  4BY1 G;  2QEX A;  3M4Q A;  2C35 B;  1WOC A;  3JAM i;  4YHH L;  1XMO L;  1VQC A;  1OXX K;  1OXT A;  1UE1 A;  1YNX A;  2ALY B;  2GVA A;  4PMW A;  3PIP A;  4UY8 C;  1P16 A;  2K14 A;  1T9H A;  1BBW A;  4YWM A;  3RZO H;  1IBK Q;  1VQ7 A;  4JI4 Q;  1HNZ Q;  4E6N A;  1FJG Q;  4JBK A;  1B70 B;  3K0X A;  2ZM6 Q;  5LMU L;  4OXP A;  4DV3 L;  1ASZ A;  2PI2 E;  1HR0 W;  5C0X I;  2HIV A;  3CCE A;  4DV5 L;  3S1Q H;  3ERS X;  3HOY G;  1N34 L;  3ER0 A;  4X64 Q;  1E24 A;  2D0O A;  4DV6 Q;  2I5H A;  3I56 A;  4TQU S;  4X66 Q;  3T1Y Q;  2OQ0 A;  3PIO A;  4DR1 L;  4AYB E;  2XGT A;  1AE2 A;  5E7N A;  2ZJQ A;  1N9W A;  3CCJ A;  4LF9 Q;  1L2F A;  1SFO H;  4LF5 Q;  2ZJP A;  4P73 A;  2PI2 A;  2D62 A;  1YJW A;  2E2I H;  4AIM A;  5GAE C;  4GLX A;  1HNX Q;  4JI0 L;  4A3C G;  1PH9 A;  1XDN A;  3CPW A;  1HZA A;  1XNQ Q;  1FVI A;  3F2D A;  2N49 A;  4YWL A;  4HJ5 A;  3K81 C;  3RTX A;  1IZ6 A;  3STB C;  2NVY H;  4MNO A;  3CCM A;  5LMU Q;  2UXD L;  1YVC A;  2KHI A;  3PGZ A;  3NBY B;  1I3Q H;  2IX0 A;  3RN5 A;  3L0O A;  4UPA A;  1OXS C;  5GAD C;  4DV1 Q;  3PO2 H;  3BAA A;  5IP9 G;  1QVC A;  3S24 A;  5C44 H;  3S14 H;  5LMN L;  1X65 A;  3GTG H;  1WYD A;  1SLJ A;  4DKA C;  4GNX C;  3AFQ A;  2Q2I A;  2MQH A;  4YHH Q;  2ZJR A;  1LUZ A;  2QGQ A;  1X56 A;  3K7A H;  4C3H H;  3S16 H;  1AE3 A;  4DR6 L;  4HTO A;  4DK3 C;  3PUW A;  5J3B A;  2FXQ A;  3M4P A;  4HTP A;  1V43 A;  3NBH B;  4R1J A;  3TQY A;  4DR2 Q;  3TEH B;  4DV3 Q;  4A3F G;  2I5L X;  2E2H H;  1Q46 A;  1GKH A;  2KHJ A;  3W1B A;  1D8L A;  4B3M L;  4KLK A;  3QWU A;  5M3F G;  1OTC A;  1TWC H;  4BY7 H;  2NZH A;  4HJA A;  3HOV G;  1A62 A;  3GO5 A;  4KHP Q;  1Z9F A;  2YTY A;  4DUY L;  4A3M H;  1SE8 A;  5C3E G;  2UXD Q;  2EXD A;  1DGS A;  3F8T A;  4BBR G;  4R4T A;  2R92 G;  2BA0 A;  3I4O A;  4B3M Q;  3PN1 A;  4YWK A;  2NN6 I;  4JOI C;  2ASB A;  5FPO A;  4K0K L;  1Y1W H;  3K7U C;  3OYY A;  2UUC Q;  4UP8 A;  4LFC L;  1VQE A;  4A76 A;  3NC0 B;  1TWG H;  4LH7 A;  4JOI A;  3SGI A;  1I94 L;  1SRO A;  4AYB G;  2VNU D;  1SMX A;  3HOW G;  3HOX H;  4JG2 A;  2JA8 H;  2B3G A;  2R6G A;  2JA7 H;  1RIP A;  4WJ3 M;  4JI1 Q;  1VQA A;  1VQI A;  2JA6 H;  4IFD G;  3JSN A;  4L5R C;  2MNA A;  1VQP A;  4LF6 Q;  3AEV A;  4X62 L;  3F1Z A;  1PFS A;  1S40 A;  2BH2 A;  5IWA L;  4A3B H;  2CCZ A;  4OX9 Q;  4LUZ A;  4B3R Q;  5IYD H;  3JSL A;  4X66 L;  4QGU A;  3T1Y L;  4LWC A;  3H15 A;  3H3V I;  4HID A;  3PO2 G;  4OWT B;  4BA2 I;  5FLX c;  4UFZ A;  2VQE Q;  3PUZ A;  4POF A;  4IPH A;  2VW9 A;  1A0I A;  4DV4 Q;  1IBM L;  1PVO A;  3T1H Q;  3OTO L;  4JBM A;  4JI7 Q;  1TWA H;  3EIV A;  4IOA A;  2N78 A;  3RR5 A;  2RF4 A;  4TVA B;  1JE5 A;  1XJV A;  4NB3 A;  3CD6 A;  4OX9 L;  4JBW A;  2IY5 B;  2AKW B;  2K4K A;  5IYB H;  1HNZ L;  4KHZ A;  1QVF A;  1IXR A;  4X65 L;  2JA5 H;  1JT8 A;  1VQJ A;  4JI8 Q;  1U0L A;  4JI0 Q;  4EQ5 A;  2K5V A;  4DK6 C;  4YCW A;  2KEN A;  5ELN A;  5C4J H;  3HKS A;  4GNX B;  2R7Z G;  4GKJ L;  1A63 A;  1I5F A;  5IT9 c;  1X3G A;  3UE1 A;  4A3D H;  1HH2 P;  2F52 A;  3BZC A;  4X65 Q;  1IL2 A;  2A8V A;  1JMC A;  3M3Y H;  1QUQ B;  4Y7N H;  4PZ7 A;  4DR1 Q;  2GN5 A;  4YCV A;  3UDI A;  3VNN A;  4GKK L;  2ID0 A;  1Q86 C;  2VY3 A;  1A8V A;  3F2C A;  4ME3 A;  3PSI A;  1Q12 A;  2Q2H A;  1E7Z A;  3K80 C;  3TY9 A;  4ALP A;  3CCR A;  4IJH A;  1Y1W G;  1KD1 C;  1CKN A;  3TRZ A;  3CPF A;  1UE6 A;  3RN2 A;  3NBZ B;  1V9P A;  3ULJ A;  1VQ5 A;  3OW2 A;  3HOW H;  4A3K H;  1XMQ L;  4AH6 A;  2VL6 A;  1K3R A;  4A75 A;  1CKM A;  4QY7 A;  3G6E A;  3D0F A;  2VZA A;  4MZ9 A;  4BA1 I;  2Q2T A;  3J81 c;  1UWV A;  1M1K C;  1VQB A;  1CUK A;  3UQ8 A;  1EYG A;  1WJJ A;  1EWI A;  3EBE A;  1QUQ A;  1E1T A;  2OCE A;  1XMO Q;  5C4X G;  4DRF A;  5D1O B;  4DV2 L;  4BXX H;  1W2B A;  2Y0S G;  1IBK L;  4GKJ Q;  2A19 A;  4DUY Q;  3FHW A;  4B3R L;  1LYL A;  3H0G G;  1SN8 A;  2HQL A;  3I55 A;  1Q7Y C;  1HNX L;  4GLA C;  2ZTD A;  2ATW A;  5JJL A;  5IE8 A;  3GTM H;  4JV5 Q;  4OO1 I;  1TWH H;  3E9I A;  1Y1V G;  3FP9 A;  3FKI H;  1YHQ A;  1VQ4 A;  3IRB A;  4JI6 L;  1L1O A;  1Q1B A;  2MO1 A;  4LF7 Q;  1GO3 E;  2E8G A;  3S1M H;  2HVR A;  3HKZ E;  1HZB A;  4X64 L;  4YY3 Q;  4DV6 L;  4A3M G;  1FL0 A;  2R7Z H;  3HOY H;  3CCL A;  5IP7 H;  4CC6 A;  1TWF H;  4B3T L;  4UCV A;  5M3M G;  4LF8 L;  1XNR Q;  5FJ8 H;  3RLO A;  4IPC A;  2V1C C;  1FJG L;  2K52 A;  1K83 H;  3S2D H;  1HZ9 A;  3TY5 A;  2GVB A;  2CFM A;  4GN4 B;  3HFZ B;  3KJO A;  3HOX G;  2ZM6 L;  2E2J H;  5H1S E;  5GAH C;  2JA7 G;  3CAM A;  1N32 Q;  1CKO A;  4EFB A;  4A3J G;  2YTX A;  3BZK A;  3KOJ A;  4DV0 L;  4DV7 Q;  4L5Q A;  4MTN A;  4O0A A;  4HIO A;  5JJI A;  1I50 H;  3A0J A;  4O2D A;  3H3V H;  1G51 A;  3GTK H;  2IT1 A;  1MIU A;  2UXC Q;  1KXL A;  4NXN Q;  4PG3 A;  4GOP A;  1PV4 A;  3BJU A;  5M5W H;  4UCU A;  4EFE A;  1ASY A;  1IYJ B;  1YEZ A;  1OXV A;  4H02 A;  4A4I A;  5LMN Q;  1J6Q A;  1TAE A;  4OO1 G;  3TS0 A;  2UU9 Q;  4JC0 A;  2HVQ A;  5C4X H;  2WP8 J;  4A3G G;  1SR3 A;  2VQF L;  4DR3 L;  1IBL L;  3KF6 B;  5FLM G;  1EOV A;  1JJ2 A;  3CC4 A;  1U5K A;  2UUC L;  1XK5 A;  2IX1 A;  3H0G H;  2QA4 A;  4DV2 Q;  1PH5 A;  2D0P A;  1I94 Q;  1GD7 A;  2JEB I;  1PH6 A;  4IFD I;  1YZ6 A;  4QL5 A;  3M85 A;  3HOU H;  2WB1 G;  1J5E L;  3Q8D A;  1KQS A;  5AJ3 Q;  1HR0 L;  3S2H H;  1C0A A;  1PH3 A;  1XPU A;  4DV7 L;  2UUB L;  3I4M G;  5HGQ A;  4HJ8 A;  3UE0 A;  3I4N G;  3GJX B;  4GOP C;  1PYB A;  1LTL A;  1SRU A;  1JB7 A;  3GTL H;  5IP7 G;  3JAM c;  3CMA A;  2ES2 A;  4QQB X;  3CXC A;  1HNW Q;  1KAW A;  2R7F A;  4GLV B;  3NEL A;  3PUX A;  1VQD A;  5GQO A;  1KRT A;  3WWV A;  4B3T Q;  1PA6 A;  2B63 H;  1VQM A;  1K73 C;  2R92 H;  1QZG A;  4HIM A;  3TRE A;  4LF4 Q;  2F4V Q;  2R93 H;  2LXJ A;  1CSP A;  2CQO A;  3KFU A;  3M4O H;  4P72 A;  1N32 L;  4P75 A;  1NMF A;  1KHI A;  1NBW A;  4GN5 A;  5IWA Q;  2LSS A;  1D7Q A;  3KDF A;  4LF6 L;  2VUM G;  1X55 A;  2LXK A;  2OQK A;  1EUJ A;  3DM3 A;  3NEN A;  4DNI A;  3F2B A;  2CWP A;  1R9T H;  1X9N A;  2EQS A;  4J15 A;  4P71 A;  4BXX G;  3AYH B;  3G48 A;  1AH9 A;  4IPD A;  2Z6K A;  1PYS B;  2K5N A;  4A3E H;  2WAQ E;  2UUB Q;  5JEA J;  1PH7 A;  4IO9 A;  3A5Z B;  4LF8 Q;  4BY1 H;  1HZC A;  1MJC A;  4GN3 B;  1YIJ A;  1FGU A;  1N34 Q;  2HHH L;  4JI5 Q;  1KRS A;  1MKH A;  4DR7 L;  5FLM H;  4LFB Q;  2Q2U A;  2WFW A;  3PO3 H;  2Y0S E;  3J80 c;  1YI2 A;  4RMF A;  2Z0S A;  4UCS A;  3NEM A;  4DV0 Q;  3PF5 A;  4A3F H;  3TY8 A;  4IJL A;  3GD7 A;  1XMQ Q;  3GTO H;  3S1N H;  1YHA A;  3CQZ H;  2B29 A;  4KI0 A;  3RNU A;  4BY7 G;  5M3M H;  4AQY Q;  2PQA A;  3RLN A;  2VUG A;  4DUZ Q;  5FPR A;  4BBR H;  4DV4 L;  1TA8 A;  2YYZ A;  5LMN W;  1EQQ A;  2JK8 A;  4JI3 Q;  1YBY A;  3PF4 A;  4GKK Q;  5DIS C;  1E1O A;  3PV0 A;  4A3J H;  3EN2 A;  2AWO A;  5D1P A;  3U50 C;  4B3S Q;  1XPR A;  1N33 Q;  5HY6 A;  1BBU A;  4UCT A;  1GVP A;  3J81 i;  3MEF A;  4JI1 L;  2JA8 G;  5EAY A;  1VQK A;  2KCM A;  3J7A 5;  1KL9 A;  1M90 C;  1O7I A;  3KF6 A;  1OXU A;  2CWA A;  5ELO A;  1EFW A;  1WFQ A;  4A3D G;  4UP9 A;  4A3G H;  1XNQ L;  4IFD J;  3BU2 A;  4EEQ A;  1UE7 A;  3AFP A;  1VQH A;  2KCT A;  3J7Z C;  2R7D A;  3G71 A;  1YHB A;  4DR2 L;  1Q82 C;  2JJQ A;  2RHS B;  1C9O A;  2JA9 A;  4DUZ L;  2AHO B;  1PH8 A;  1XTD A;  2OWO A;  1VQO A;  1HNW L;  2OTJ A;  4LUV A;  5IP9 H;  5M5X H;  3S15 H;  4A93 H;  4PZ6 A;  3PUY A;  1BVS A;  4HIK A;  3MXN B;  4JI8 L;  2NN6 G;  2EIF A;  1PH2 A;  4R4Q A;  4JI4 L;  3UDF A;  3GB8 B;  2K50 A;  2PQA B;  2E5L L;  5DLQ E;  4XTC S;  1GM5 A;  5K36 G;  4LF4 L;  4LFB L;  1S68 A;  4APV A;  3RZD H;  1VCI A;  1N36 Q;  2NVX H;  2UXC L;  3FKI G;  1X3F A;  3A5U A;  4JI7 L; 
#chains in the Genus database with same CATH topology
 4UUG A;  1DM0 B;  5D1O A;  3KBG A;  1EIY B;  4LNQ A;  3BA9 A;  4DR6 Q;  4MTK A;  4JI2 L;  4HN2 A;  3OIP A;  1I4X A;  1G2S A;  4Y52 H;  2RCN A;  5A35 A;  1B04 A;  1PDQ A;  1Q8K A;  3W3A A;  1SE3 A;  5FJ8 G;  1RCV D;  4L5T A;  4IOC A;  1QZH A;  1L1O C;  5JJK A;  4DAA A;  1WCM H;  5KND A;  5DM6 3;  2K33 A;  1NE3 A;  4XYL B;  4GZY C;  1NJI C;  1EZ1 A;  4QIW B;  1OBG A;  2YL2 A;  3R5X A;  2ZTC A;  1NY4 A;  5JPN C;  1LAB A;  3I90 A;  4XIG S;  4M8A A;  4DR5 L;  1YJN A;  3U58 A;  3DEO A;  2YTV A;  1AN8 A;  2TMP A;  1EUC B;  2UU9 L;  2Y4R A;  3RD4 A;  4ME5 A;  3PO3 G;  1DYQ A;  1A3V A;  1X32 A;  1V1O A;  2PW5 A;  4OWW B;  4WJW A;  4KTA A;  4K8I A;  3OW7 A;  2PZU A;  3T56 B;  1S72 A;  2ZT9 C;  3OTO Q;  2I5M X;  2WII B;  1ICW A;  2VQE L;  4DU9 A;  5M5W B;  1I2K A;  4M9U A;  2N8N A;  2WAQ G;  1C4Q A;  4RHR A;  1CSQ A;  1RKN A;  1G6Z A;  3CME A;  1PTO H;  1B6R A;  4X3U A;  3KAK A;  2YZM A;  2PNH A;  3I7F A;  4BWG B;  5C0X G;  3E6Z X;  2E2H B;  1TS4 A;  3V4S A;  2H5X A;  5DM7 3;  1KLU D;  5IYZ F;  5C4H A;  2F1M A;  1STB A;  5D3I B;  1JC7 A;  5AJ3 L;  4QIW E;  4UCR A;  2MPM A;  1I1K A;  4TUY F;  2RCF A;  5COR A;  4NPS A;  1LT3 D;  3VA5 A;  3J7Y W;  3JC6 6;  3SNO A;  2FIN B;  5I5U A;  4JI2 Q;  1LM0 A;  4OWX B;  3TME A;  4MHE A;  3R8B A;  3G4S A;  5IYC G;  2X0S A;  5CV8 A;  1DJR D;  3VYT A;  5IY0 A;  1JJG A;  1GXD C;  4KY7 A;  3K5N A;  3CC2 A;  1ET6 A;  1B8A A;  1I50 B;  3EJI A;  5A2Q L;  5JJZ A;  4O7R A;  4V19 0;  2MJ8 A;  3UDX A;  5ELB A;  4R4C A;  4AYB B;  2MO0 A;  1BDO A;  5D65 A;  2I0Q A;  3QR8 A;  4DR5 Q;  4I65 A;  3MZ5 A;  1CQI B;  1U4L A;  4POG A;  4Z9C B;  1HR0 Q;  2AQ3 B;  4YCU A;  5CA0 F;  1B50 A;  4O83 A;  4DV5 Q;  1B2T A;  2BA1 A;  3T51 B;  2NVT H;  2B2T C;  3CCV A;  4A3K G;  2ZXR A;  2E2J B;  1RDP D;  4DK1 A;  4CJ1 B;  1HQR D;  1Q90 A;  4DR7 Q;  1Q81 C;  2JE6 I;  4DR4 Q;  3U9T A;  3OUU A;  1PHJ A;  2HCC A;  3M4Q A;  2C35 B;  3HZX A;  1WOC A;  4YHH L;  1MSH A;  1OXT A;  2E2I B;  4DLK A;  3EQL C;  1P16 A;  2K14 A;  5M9O A;  1BBW A;  2R93 B;  5BYA A;  1IBK Q;  1HCZ A;  4E6N A;  1FJG Q;  5KYI A;  5LMU L;  4H7B A;  1B4O A;  5AFW A;  1HR0 W;  2XN9 C;  2IX3 A;  3HOZ B;  2CHB D;  2F0F A;  4X64 Q;  1E24 A;  2D0O A;  2YYA A;  3J81 E;  3LQS A;  3NWT A;  1T36 A;  1W6J A;  3KAL A;  5K5P A;  3QIA A;  2EJ3 A;  4AYB E;  3RV3 A;  4O4I F;  1SFO H;  1E0B A;  2E74 C;  4IZ8 A;  1A48 A;  5C4J B;  1YJW A;  4C3J B;  2LY7 A;  3D4D A;  4GLX A;  1HNX Q;  1PH9 A;  1XNQ Q;  1HZA A;  3F2D A;  2B2V C;  4PV1 C;  3BVZ A;  2GPS A;  3VYU A;  5I9P A;  2N88 A;  1I4H A;  2UXD L;  1YVC A;  3PGZ A;  1I3Q H;  1WD0 A;  2EY6 A;  1QVC A;  3S24 A;  4LMQ D;  5K3W A;  2MQH A;  1ENF A;  3BG5 A;  4ZQI A;  4ZQ3 A;  1AE3 A;  4DR6 L;  5D14 A;  4BS9 A;  3K57 A;  5DNF A;  2HDL A;  5J3B A;  1PX2 A;  2QCP X;  5IGC A;  3T9B A;  5BPH A;  3ZYY X;  1CI3 M;  5D3D A;  2E2H H;  3DWA A;  3W1B A;  4B3M L;  4MV7 A;  1TWC H;  1ENC A;  3SK8 A;  2NZH A;  4BY7 H;  3HOV G;  4QMG A;  1PMR A;  2DNE A;  2YTY A;  4A3M H;  3BVM A;  2IWH A;  2EXD A;  3MC0 B;  1PFB A;  1EY5 A;  3FKI B;  4NW2 A;  2R92 G;  5BWU A;  2BA0 A;  4YWK A;  2NN6 I;  3OYY A;  1VQE A;  4A76 A;  1TWG B;  4C3J G;  3NC0 B;  2DY8 A;  5CM0 A;  4AYB G;  1SMX A;  2B3G A;  1RIP A;  4WJ3 M;  1VQA A;  5EGT A;  2WIN B;  4U68 A;  5IIF A;  2PZW A;  1VQP A;  2EJF C;  3BZD B;  4X62 L;  1LTG D;  1PFS A;  1S40 A;  2BH2 A;  4R8N A;  4A3B H;  3UYY A;  4FFR A;  5C4Z A;  3H15 A;  5FLX c;  4PMB A;  3PUZ A;  3FPU B;  4POF A;  5C3W A;  1A0I A;  2VW9 A;  2VQE Q;  1PVO A;  1F2Y A;  1LTT D;  2OXP A;  2JYO A;  1GSH A;  3RR5 A;  2B8G A;  5HUR A;  1PRT C;  1K8O A;  3M4Y A;  2IY5 B;  4KHZ A;  1QVF A;  1A2U A;  2R7Z B;  5EKK A;  1JT8 A;  2LMC B;  1I7N A;  4JI0 Q;  4EQ5 A;  2F0V A;  3ITP A;  5JPM C;  1A63 A;  2R7Z G;  1KAA A;  3GTM B;  2F52 A;  4HAE A;  1F77 A;  4A3E B;  1ENA A;  1JMC A;  3K5H A;  3VNN A;  4DAV A;  3CU7 A;  1DOK A;  2ID0 A;  1ZYR C;  2NUC A;  1Q86 C;  2Q2H A;  2F0P A;  1SBB B;  1Z7T A;  4F88 A;  3NQT A;  4O7Z A;  5FOB B;  2NZ1 D;  1G91 A;  3CPF A;  3NBZ B;  3RN2 A;  1VQ5 A;  1IW7 D;  3K0Y A;  2CH4 W;  4B08 A;  4A3K H;  4GLW A;  3K7A B;  4IN3 A;  4A75 A;  3S16 B;  3MTS A;  4TRD A;  2Q2T A;  1OO9 B;  3J81 c;  3R23 A;  1KAB A;  5CR5 A;  5C4X G;  3IL8 A;  1QUQ A;  2A68 D;  5EKL A;  1DV1 A;  4C3H G;  3MJF A;  2B2Y C;  3BAC A;  1JOR A;  4ZHQ F;  4BXX H;  3NXW A;  4GKJ Q;  1B53 A;  4B3R L;  2NN6 H;  5CMD A;  3H0G G;  1ESR A;  2M2L A;  3I55 A;  4MV8 A;  2CQA A;  2XD4 A;  1E2Z A;  1E2V A;  3G8D A;  1TWH B;  3QJY A;  5BWR A;  3SK6 A;  4KY6 A;  4JI6 L;  1KEE A;  2ICE C;  3D6W A;  4P2C B;  2E8G A;  3C3L A;  3HKZ E;  4DV6 L;  5I6Y A;  2FFK B;  3R5H A;  3TDQ A;  3TP5 A;  1F9S A;  1TWF H;  3H91 A;  4LF8 L;  2OLS A;  5FJ8 H;  2EIY A;  4IPC A;  2V1C C;  1KNA A;  3S2D H;  1K83 H;  3GP7 A;  2GVB A;  3KJO A;  5GAH C;  2JA7 G;  1CKO A;  1WTO A;  4CKB A;  2YTX A;  3KOJ A;  4DV7 Q;  1GHK A;  1QG7 A;  4O2D A;  3H3V H;  5I5S A;  4QUC A;  1G51 A;  3UZB A;  1MIU A;  2UXC Q;  5CBE E;  4NXN Q;  4GOP A;  3SK5 A;  1PV4 A;  3PFF A;  3BJU A;  4O4L F;  5LMN Q;  4A4I A;  3TZD A;  2F0M A;  2I46 A;  4JC0 A;  3A54 A;  4B9W A;  5CV4 A;  2VQF L;  3QOL A;  3RZO B;  1WTQ A;  1HRJ A;  1IBL L;  3CC4 A;  5FLM G;  1CS0 A;  4RAU C;  1SCU B;  1XK5 A;  5JAV A;  2EOT A;  1EWH A;  2QK4 A;  1H9S A;  3D4W A;  4IFD I;  1Z2N X;  4I7Z C;  3HOU H;  2R92 B;  1HR0 L;  3Q8D A;  1KQS A;  4Q4C A;  1PH3 A;  3IFD A;  1RHP A;  2PZT A;  5HGQ A;  4GOP C;  1JB7 A;  5IP7 G;  5JVG 3;  3CMA A;  2ENB A;  4QQB X;  1WTP A;  1HNW Q;  1KAW A;  3MVV A;  1VQD A;  3PMF A;  1HA5 A;  1LT4 D;  1PA6 A;  2B63 H;  2LXJ A;  1LT6 D;  4JXU A;  3H0G B;  3VYS A;  1BCP B;  1V1P A;  1NBW A;  2B39 A;  4GN5 A;  5IT9 L;  1F9P A;  4N9P A;  1QNK A;  1YNN C;  2QKI C;  2LXK A;  3NEN A;  1C48 A;  1R9T H;  3KRE A;  1X9N A;  1M0W A;  1Y69 U;  3QFF A;  2Z6K A;  4WBN F;  2WAQ E;  1F2M A;  5HGT A;  3NWS A;  3S1R B;  2ZXO A;  1MJC A;  2HHH L;  2EYJ A;  1KRS A;  1MKH A;  4HCE A;  1XTC D;  4UCS A;  3NEM A;  1U4P A;  1EZ8 A;  4O7T A;  5BYB A;  4A3F H;  1EY8 A;  2F0O A;  2B29 A;  5M3M H;  1UUP A;  4AQY Q;  2VUG A;  1EKF A;  3O13 A;  4EQO A;  3AU7 A;  4L1K A;  3J81 L;  1TA8 A;  3HS0 C;  3S14 B;  1EQQ A;  1EIH A;  1D5Z C;  1YBY A;  1SNM A;  3PV0 A;  4A3J H;  2AWO A;  2A69 D;  4CBV A;  2CVR A;  1XPR A;  4O7N A;  5HY6 A;  3KK7 A;  4JI1 L;  4IUQ A;  1BXT A;  1CK1 A;  1VQK A;  3I3C A;  4IFD H;  1FNV A;  3C1E A;  3SEB A;  5FLX L;  1M90 C;  1HXY D;  1J8I A;  3M4O B;  1MI2 A;  4OIJ A;  2VXW A;  2NU7 B;  2O4X A;  1ZKO A;  3AFP A;  4YJ3 F;  1GUG A;  5LL6 S;  4O2B F;  2L4N A;  4KKT A;  4FF3 A;  4WHX A;  4DUZ L;  2OWO A;  4S3S A;  1HNW L;  2OTJ A;  1XTD A;  3JZI A;  3WWJ A;  3Q2O A;  1WVL A;  3PUY A;  1BVS A;  3GTL B;  4RKB A;  2NN6 G;  1PH2 A;  3S1Q B;  1ULZ A;  4R4Q A;  2A69 C;  2K50 A;  3NTH A;  2E5L L;  4FF4 A;  1TWF B;  1WTW A;  1S68 A;  4APV A;  3RZD H;  1VCI A;  3FKI G;  2KCC A;  1JCK B;  2IHE A;  3M7N A;  2K7V A;  1FNU A;  4MV9 A;  4K5X A;  1R4Q B;  2F0W A;  3IFT A;  4KD4 A;  1NAP A;  2F3W A;  2L55 A;  3RLF A;  3VA7 A;  3ULP A;  1I6H H;  5BWX A;  3HOV H;  3CC7 A;  4DV1 L;  4LF5 L;  5C3E H;  2ZDH A;  5A2Q E;  1YJ9 A;  3S17 B;  2HCI A;  4YAJ B;  2COJ A;  2VUM H;  3OWF A;  3NSW A;  1NMG A;  3HOZ H;  1K8G A;  4EQP A;  5C8Y F;  3QWN A;  2MFI A;  3STB D;  4DR4 L;  1T5E A;  2HT1 A;  4A3D H;  3JZF A;  4LFA Q;  2Z6K C;  1LTR D;  2WB1 E;  4TM5 A;  5JEA G;  1VQ9 A;  3AW8 A;  1X3E A;  5HV6 A;  4KHP L;  5IYC H;  5I5X A;  3ERQ A;  4A93 G;  1ILQ A;  1S3O A;  1C7Y A;  1Y1V H;  3OPO A;  5C4X B;  1QVG A;  1D5M C;  4J6H A;  4NXN L;  2HIX A;  3NE5 B;  3GDE A;  3GTQ H;  4HR7 A;  1B7Y B;  2IP4 A;  2H1E A;  3FMC A;  2K04 A;  1PFN A;  4FP5 D;  4LH6 A;  2BCO A;  4R9W A;  1HJP A;  2IHF A;  4AQY L;  4ZAI A;  1I4Q A;  2OT2 A;  1XYI A;  3OHX C;  5EJW A;  3G7L A;  3JAM L;  4A3L G;  3U4Z A;  4GS3 A;  4RCN A;  4IWX A;  3D31 A;  5I5W A;  2XTI A;  2C9O A;  1MHW C;  2YV5 A;  5HBR B;  1S4Z A;  4HJ7 A;  3HG9 A;  1NSN S;  4C3J H;  3A74 A;  4DAY B;  3K5M A;  1EZ6 A;  1RD9 D;  2A1H A;  2R93 G;  5CE8 A;  1RJT A;  4OON A;  4UP7 A;  4DAM A;  4WRD A;  2XVS A;  4H44 C;  5FR9 A;  4XXE A;  4FFM A;  1N8R C;  4A3B G;  2NU6 B;  1ONL A;  3ONA B;  1STE A;  3HEJ A;  3HBL A;  4LFA L;  1E2W A;  3J81 j;  1DD2 A;  3JRX A;  2AMC B;  4IPG A;  2R84 A;  2ZXP A;  2VB2 X;  2N3S A;  2BE5 D;  3FDT A;  3LGJ A;  1G6P A;  1DXM A;  4BBS G;  1XX8 A;  2JP1 A;  3I4M H;  4N8X 1;  3TS2 A;  4FFN A;  1X6O A;  1H95 A;  5KEE A;  3C46 A;  3CCU A;  1H9J A;  4UCO A;  4FXG C;  4MA0 A;  3NUC A;  3CF5 A;  3H6M A;  1VF7 A;  4JI3 L;  1L0Y B;  2CKZ B;  1FYC A;  5M5X B;  3S15 B;  4OEL B;  2JEA I;  3KF8 A;  5C3E B;  1BO0 A;  1X54 A;  2K75 A;  3FRP B;  1TVX A;  2X6G A;  5CBA E;  4A3I G;  5CGK A;  1VQL A;  3M3Y B;  3DTG A;  3GTJ H;  5JVD F;  1WI5 A;  4WOR A;  2VUM B;  4CC5 A;  1I4P A;  1A2T A;  2HHH Q;  4JYA L;  4O7S A;  4A3E G;  2HD3 A;  1DV2 A;  5EPK A;  4O81 A;  4KMU C;  4JI6 Q;  3DWQ A;  4YBZ B;  4QSH A;  5E3F A;  1KJJ A;  1JOK A;  2L5T A;  4DIM A;  1JWM D;  5ISR A;  4KN7 C;  5I2X A;  1VQ7 A;  3K0X A;  4DV3 L;  4OXP A;  2FPP B;  2PI2 E;  4K14 A;  4MV6 A;  3S1Q H;  2RBM A;  4ZKB B;  5TSS A;  3ER0 A;  2GA4 B;  1AUV A;  2V4D A;  2ZJQ A;  1SNO A;  3CCJ A;  1LLR D;  2PW7 A;  3PO2 B;  2ZJP A;  3A8J E;  4MN3 A;  4P73 A;  4O1N A;  2G5D A;  1PTO F;  5GAE C;  2KJX A;  1AEX A;  3P20 A;  3CPW A;  5I6W A;  2N49 A;  2KEC A;  5IGF A;  3MWD A;  3PQI A;  2KVM A;  2N55 A;  2B2Y A;  4LK1 C;  1LTS D;  3NBY B;  2IX0 A;  4G57 A;  4QF4 A;  3HOV B;  4UPA A;  3LWB A;  1OXS C;  4DV1 Q;  2NU8 B;  4HR7 B;  4LJZ C;  3S14 H;  4DGZ A;  1X65 A;  3GTG H;  2J4X A;  1SLJ A;  1GHJ A;  1ZXT A;  1O80 A;  4YHH Q;  5J22 A;  5M3M B;  3RZD B;  3MA2 B;  4EGV A;  2ABJ A;  1HTL D;  1K28 A;  2XWB B;  4DK3 C;  4LAA A;  1SMY C;  1EQT A;  2F0K A;  3T16 A;  3TEH B;  1S5D D;  2Z8L A;  1Q46 A;  1GKH A;  2R61 A;  5CA1 F;  3VPD A;  4KLK A;  1WD1 A;  1WRV A;  4HJA A;  1Y8O B;  2B8F A;  3D6C A;  4KHP Q;  1S5F D;  1SE8 A;  2CH4 A;  2KCN A;  4DFA A;  4BBR G;  3F8T A;  5KRU A;  3PN1 A;  4PQX A;  2A5H A;  3CSW A;  4JOI C;  4IIJ F;  3K7U C;  2UUC Q;  1I94 L;  1SRO A;  3AX6 A;  2IPK D;  1VKZ A;  3JSN A;  4IFD G;  2CNQ A;  2K5Q A;  2MNA A;  4LF6 Q;  2SEB D;  4C3I B;  3UI2 A;  5IWA L;  4OHJ A;  4OX9 Q;  5IYD H;  4MV3 A;  2M9V A;  4QGU A;  4UFZ A;  3PO2 G;  4N8F A;  4CDD C;  1VBH A;  4IPH A;  4DV4 Q;  2YW2 A;  3T1H Q;  1M4V A;  4JI7 Q;  1TWA H;  1SYE A;  3EIV A;  3I12 A;  1KBL A;  2EYP A;  4TVA B;  3DF7 A;  2F3V A;  4OX9 L;  4JBW A;  2F0D A;  5IYB H;  3D3R A;  4H0L C;  2JN4 A;  2JA5 H;  4JI8 Q;  1QB5 D;  1U0L A;  1X3Q A;  3VMM A;  2K5V A;  3K5L A;  4TV8 F;  4CHT B;  5ELN A;  4GNX B;  3HKS A;  4GKJ L;  1EL0 A;  4J1M A;  5C44 B;  5IT9 c;  1X3G A;  3UE1 A;  4TKO B;  1O78 A;  3DEP A;  4RA8 A;  4Y7N H;  3SE7 A;  4GKK L;  1A8V A;  3F2C A;  3PSI A;  3V4Z A;  2HGX A;  1Q12 A;  3QQM A;  1KUT A;  3K80 C;  4K5V A;  1EY0 A;  4ALP A;  3FPP A;  1Y1W G;  1KD1 C;  3TRZ A;  2CW0 C;  2KED A;  5BWT A;  4HN7 A;  3ULJ A;  3OW2 A;  2BE5 C;  4AH6 A;  5H80 A;  2VL6 A;  1EYA A;  2QEJ C;  5BN3 A;  4MZ9 A;  4BA1 I;  1CUK A;  3ND8 A;  1WJJ A;  2OCE A;  3TIG A;  1O7Y A;  3QO2 A;  1CA5 A;  1O7L A;  3R9R A;  3OWE B;  1IBK L;  4IAL A;  2W6P A;  3KLS X;  2L9H A;  3FHW A;  4K2L A;  1LYL A;  2XRS D;  1HFN A;  2HQL A;  1BCP F;  1Q7Y C;  2NVQ B;  4GLA C;  5CV7 A;  4KV6 A;  3HOU B;  3HRZ C;  1BQQ T;  4OO1 I;  1TWH H;  3E9I A;  1C3O A;  3FKI H;  4HSP A;  5FK9 C;  1YHQ A;  2NWG A;  3IRB A;  4LF7 Q;  1L1O A;  1Q1B A;  2Z9H A;  3A8I E;  3BDL A;  1HZB A;  4X64 L;  4YY3 Q;  3HOY H;  2YWV A;  5IP7 H;  2I87 A;  4B3T L;  3TIN A;  4UCV A;  4V0B A;  1MGS A;  1XNR Q;  4OL7 A;  1AZP A;  5CYU A;  2K52 A;  2CFM A;  3HFZ B;  5DIS C;  2W6N A;  3JZ6 A;  3CAM A;  1N32 Q;  4IUT A;  2A6H D;  1YNN D;  4X3K A;  5M5Y B;  3Q23 A;  3I4N B;  4O0A A;  2B2U C;  2PPB C;  3I4M B;  3R2I A;  4PG3 A;  1MSG A;  4O2A F;  4UCU A;  4EFE A;  4EGJ A;  3URY A;  4H02 A;  2EVB A;  4CJ2 C;  4DAY A;  5JEA H;  1TAE A;  4OO1 G;  2O2L D;  2Q8T A;  5LHY 1;  3C2P A;  4C2M B;  1SR3 A;  1V1P B;  4DR3 L;  2WV6 D;  2J7Z A;  4O82 A;  2YZN A;  2AQ2 B;  1EOV A;  2LKV A;  3H94 A;  2FP4 B;  2D0P A;  2P0A A;  4K6D A;  2KA7 A;  4ZUJ A;  4K6L A;  1YZ6 A;  4QL5 A;  2WB1 G;  3S2H H;  5I5V A;  3I4M G;  3E3X A;  4HJ8 A;  3I4N G;  1KTA A;  3GJX B;  1KTK A;  1HPC A;  3R3O A;  5DEH A;  3KAJ A;  2ES2 A;  4O4J F;  3ND9 A;  3CXC A;  2XWJ B;  5IGD A;  1VMC A;  3NEL A;  2B2W A;  5ELF A;  1SXT A;  3WWV A;  5NUC A;  1K73 C;  2HGS A;  4K5W A;  1QZG A;  2R93 H;  3TRE A;  1L0X B;  2YS6 A;  5I5Y A;  4YJ2 F;  2PYK A;  1PK8 A;  2R7K A;  4P72 A;  3MXP A;  1UNS A;  1NMF A;  3GTQ B;  1N32 L;  3G6J B;  3SXH A;  4BY7 B;  1S5C D;  4FXD A;  1EOT A;  5FPO A;  2NVX B;  4DNI A;  2W70 A;  1EUJ A;  3V05 A;  3F2B A;  1IKM A;  2F0Q A;  4J15 A;  2MP1 A;  5CAE B;  2K5N A;  4A3E H;  2RA4 A;  2UUB Q;  2O5J C;  5IGG A;  4LF8 Q;  2EYL A;  4KN4 C;  2R86 A;  4GN3 B;  3VPC A;  1YIJ A;  4JI5 Q;  3GTK B;  4LFB Q;  3VOT A;  2Y0S E;  3CRL C;  4NP5 A;  1YI2 A;  4RMF A;  2Z0S A;  2F0T A;  3RUZ A;  3TN2 A;  5C5L A;  3TY8 A;  4IJL A;  3GD7 A;  2PBZ A;  3GTO H;  3CQZ H;  4KI0 A;  4DQN A;  5ELD A;  4ZYS A;  4CMD A;  3WOF A;  4ZOL F;  3W2D A;  3BS1 A;  3N8D A;  4DUZ Q;  4EGQ A;  5FPR A;  1STY A;  1EU3 A;  4H13 C;  4DV4 L;  3M7G A;  3Q24 A;  2F0J A;  1UC9 A;  1E1O A;  4B9X A;  2DJF C;  2SOB A;  5L37 A;  1DCZ A;  1GVP A;  2Q8I B;  4HNT A;  3WO0 A;  2DZD A;  2JA8 G;  4O7Y A;  3K59 A;  2KCM A;  1LTB D;  3VYR A;  3T53 B;  3T99 A;  1IW7 C;  4G7Z C;  2CWA A;  5ELO A;  1WFQ A;  4UP9 A;  4CDF C;  1FNW A;  1XNQ L;  3I72 A;  3GTJ B;  2IW3 A;  1VQH A;  1EY7 A;  2KCT A;  3J7Z C;  4A3M B;  2R7D A;  4FFP A;  1YNJ C;  1Q82 C;  1C9O A;  1HUM A;  2JA9 A;  4YIJ A;  3TP8 A;  1IYV A;  1VQO A;  4K6N A;  2Q7D A;  4CHI A;  4LUV A;  5M5X H;  3S15 H;  4A93 H;  2O5I C;  5KS8 A;  1EHI A;  3HOW B;  4HCS A;  2YS7 A;  2EIF A;  1TKW B;  4KD3 A;  1UAP A;  4M0J A;  3WDN A;  3GB8 B;  2PQA B;  3RFC A;  2Y0S B;  3MFG A;  1TII D;  1JWS D;  2NVX H;  3S1M H;  1X3F A;  1VDZ A;  1H9K A;  5KX5 F;  4P74 A;  1LTI D;  4A3L H;  3ICE A;  1XPO A;  5BR8 L;  5BWV A;  1EIF A;  1EYD A;  1IYE A;  3BA8 A;  3ERO A;  4G7H C;  4XYM B;  4EX5 A;  3I8Z A;  5GAG C;  3S17 H;  1TS2 A;  4R4O A;  1QE6 A;  2IJ0 A;  1YIT A;  1HA6 A;  2YRX A;  1EKP A;  3CRK C;  5JQW A;  1L0W A;  2UUA Q;  2BDO A;  1H9R A;  1SND A;  3P75 A;  5LL6 X;  5E1F A;  1WTV A;  4JCV E;  1P8L A;  3CCQ A;  2HVS A;  4X6A H;  2DUD A;  2DWC A;  4K0K Q;  3B6Y A;  5BMV F;  1AFP A;  2RDF A;  5C44 G;  1W3S A;  3C1F A;  2F3I A;  3KYH C;  1KJQ A;  4FDB A;  3KF8 B;  1NCV A;  2JA6 B;  5CB4 F;  4C2M H;  2W6M A;  1H9M A;  2D5D A;  4ZKC B;  4HQ6 A;  3TW7 A;  3AQQ A;  5E25 A;  1PFM A;  1IBM Q;  2B2T A;  2LFN A;  3E0E A;  3SK4 A;  5KKN B;  2E5L Q;  2UXB Q;  1HTP A;  5M3F H;  3KJP A;  1KC8 C;  4XYQ A;  3I4N H;  3KDF B;  1YNJ D;  2OTL A;  1JDB B;  4C1N K;  2ZTE A;  2JA5 B;  3LWE A;  2EE1 A;  4HJ9 A;  3L7Z C;  1MJE A;  5ELC A;  3K5I A;  4OGQ C;  3I70 A;  1Z2P X;  4IQZ A;  4LFC Q;  1TS3 A;  1VQN A;  2JA6 G;  2A1A A;  4A3C H;  2KBN A;  4XQJ A;  4DAP A;  1R4P B;  3BYT B;  1TS5 A;  2XIW A;  2K32 A;  3MXN A;  3U55 A;  5DAA A;  1GJX A;  2NZO A;  1PRT B;  1JB3 A;  2JA8 B;  3HT5 A;  4O42 A;  3OMC A;  2K6A A;  4LF9 L;  3J7A V;  1Y14 B;  4CE5 A;  4A3F B;  4X3T A;  1SYF A;  1BKB A;  2NVQ H;  1RL2 A;  3BYY B;  4KJN A;  1G2W A;  5JVL A;  2CNU A;  3FVQ A;  4KJO A;  1R9T B;  1A15 A;  1V1Q A;  1C30 A;  5K36 H;  5IYB G;  1LV9 A;  4XQQ A;  3UDG A;  2EJ2 A;  3W1G A;  3S1R H;  1B3A A;  1KC7 A;  2UUA L;  2JQO A;  3T9A A;  4YAK B;  1DZ1 A;  2HHF B;  3TP7 A;  2X5R A;  4L6T B;  3J80 i;  2MHV A;  2B2V A;  5IOD A;  3T7A A;  2B63 B;  3N52 A;  1ET9 A;  4A3I B;  3S2D B;  3L9A X;  1FD7 D;  4L8J A;  5C5M A;  1CT1 D;  1D6E C;  1S5B D;  3U4V A;  4EQN A;  4GOP B;  5BPF A;  5FO8 B;  1WCM G;  1VMP A;  3ZJY C;  1J5E Q;  4XQN A;  1CQJ B;  5KNB A;  4O4H F;  4L63 B;  1E4E B;  4QJF A;  1XNR L;  4JVZ A;  1VQG A;  1IOV A;  4JV5 L;  4HNV A;  4DPG A;  1MD2 D;  2L12 A;  3P1H A;  2EYO A;  3DTF A;  3MHB A;  1Y1W B;  1JLL B;  1LO5 D;  4DXG A;  2YU9 H;  2FMM A;  1N33 L;  3HKZ G;  4LF7 L;  4PZ8 A;  4MV4 A;  4BY1 G;  1ROD A;  3KBX A;  1DOM A;  1VQC A;  1XMO L;  3HOY B;  2EDG A;  1QNU A;  1UE1 A;  3WOE A;  1D2B A;  3ORR A;  5LOV F;  1B9N A;  3F2U A;  2F0G A;  1T9H A;  2EXZ A;  4YWM A;  2B2U A;  3RZO H;  1NNX A;  5E4W C;  4JI4 Q;  3D4R A;  1EY6 A;  2IL8 A;  4JBK A;  2ZM6 Q;  1ASZ A;  1VBG A;  3ERS X;  3HOY G;  2RKS A;  1N34 L;  3TP6 A;  3JRW A;  2HUG A;  3NBH A;  5C0X H;  2I5H A;  2GLT A;  5FO9 B;  1K83 B;  1GLV A;  2EZV A;  1ILP A;  4TQU S;  2ODT X;  1JQY D;  1AP0 A;  1STG A;  1AE2 A;  2YZL A;  1KJI A;  1Q8I A;  3ETH A;  1N9W A;  3OMG A;  4LF9 Q;  2HJW A;  4LF5 Q;  4A3G B;  1DOL A;  2PI2 A;  3NPP A;  1ZEQ X;  2PN1 A;  2E75 C;  4AIM A;  1XDN A;  4ZCK A;  1FVI A;  4YWL A;  4C5C A;  3S9W A;  1V8Q A;  2K01 A;  3STB C;  1PZK D;  3NP8 A;  3HGB A;  2KHI A;  3U0G A;  1JDE A;  3L0O A;  4ZUI A;  3TBI B;  1GOZ A;  1TT2 A;  5GAD C;  3MWE A;  3BAA A;  4KHV A;  3I73 A;  5IP9 G;  5C44 H;  3MAQ A;  1WYD A;  2E2D C;  4YB8 B;  4GNX C;  1SNQ A;  3AFQ A;  4FU0 A;  3KUP A;  4ZI7 F;  2ZJR A;  3QOJ A;  3U9S A;  1EKV A;  1X56 A;  3K7A H;  1SYB A;  3S16 H;  4BY1 B;  4F7X A;  5G3L D;  3PUW A;  4R1J A;  3NBH B;  4KKU A;  1V43 A;  4DR2 Q;  2COI A;  4XDX A;  1TWA B;  1SJE D;  5I60 A;  5E4X A;  4DV3 Q;  4A3F G;  2I80 A;  1D8L A;  3T9C A;  1JWU D;  4ID6 A;  5M3F G;  1OTC A;  1Y8P B;  5D8D A;  3G8C A;  1SYC A;  1G2T A;  3GO5 A;  4CDE C;  2PO4 A;  4DUY L;  4FF1 A;  5KYL A;  1IYU A;  5JVH 3;  2UXD Q;  1DGS A;  1Z6H A;  2J0T D;  2NB0 A;  4JPB W;  3I4O A;  2YU9 B;  2ASB A;  4K0K L;  1Y1W H;  3DHQ A;  4PBC A;  4JOI A;  2NU9 B;  1EEI D;  1RF2 D;  2BDN A;  3DXJ C;  3X3M A;  3HOX H;  4JG2 A;  1JOO A;  2JA7 H;  4ILW A;  4JI1 Q;  2JA6 H;  2W6Z A;  3CKI B;  2W71 A;  3T9F A;  4O84 A;  3D8G A;  3F1Z A;  3KLR A;  2DJG C;  4B3R Q;  4LWC A;  3J80 E;  4I55 F;  1EYZ A;  3A7A B;  1IBM L;  3OTO L;  1A3G A;  2HDK A;  5J39 A;  4K2K A;  2RF4 A;  3OUZ A;  4NB3 A;  1SEB D;  4FFL A;  4XYO A;  5J2T F;  1IXR A;  3VR2 A;  4N9T A;  4IUP A;  2MGS A;  1VQJ A;  4DK6 C;  4MV1 A;  2KEN A;  5C4J H;  3GTG B;  3E5S A;  1RTN A;  2GQR A;  2Z1C A;  3LUL A;  1D1I A;  3BZC A;  4X65 Q;  1BCP D;  2A8V A;  3M3Y H;  1FR3 A;  2OEO A;  1LT5 D;  4DR1 Q;  4YCV A;  3UDI A;  2VY3 A;  1SE4 A;  1EU4 A;  1TWC B;  3LP8 A;  3S1M B;  1Y1V B;  1W96 A;  1ZAU A;  2KQ3 A;  3JAM E;  1UE6 A;  3OIQ A;  1V9P A;  4HSV A;  1F9R A;  4UDU C;  3HOW H;  1XMQ L;  1QWY A;  1PRT F;  1K3R A;  3R2T A;  5C1O A;  1PYW D;  3G6E A;  3D0F A;  3DUZ A;  2V58 A;  1ML0 D;  1VQB A;  2R7M A;  3UQ8 A;  2RDG A;  3VR5 A;  1K8M A;  1E1T A;  2HHF A;  4NMZ A;  1PZJ D;  1STH A;  5I4D A;  4DRF A;  4DV2 L;  1W2B A;  2Y0S G;  1G8Z D;  2X6L A;  4DUY Q;  2NYZ D;  4RGM A;  2FB9 A;  3X3N A;  1HNX L;  4ZLT F;  2ZTD A;  2ATW A;  1CA6 A;  5IE8 A;  3GTM H;  5M3F B;  3TQT A;  4ME6 A;  1Y1V G;  2E76 C;  4Q0F A;  2EY2 A;  2MO1 A;  1GO3 E;  4A3M G;  2EJM A;  3K6O A;  2R7Z H;  1CQF A;  2DIK A;  3CCL A;  1JR0 D;  1GSA A;  4CC6 A;  4HNU A;  2CNV A;  3RLO A;  5T1G A;  2COG A;  2VB3 X;  1D1K A;  4PNY A;  1HZ9 A;  4GN4 B;  1K0S A;  2ZM6 L;  2QB5 A;  5H1S E;  1SFO B;  2K05 A;  2PCF B;  1BUV T;  4DV0 L;  3BZK A;  4L5Q A;  4MTN A;  2NTS A;  1I50 H;  1KDA A;  1LTA D;  3A0J A;  3GTK H;  2XSC A;  1KXL A;  3GV3 A;  1CZW A;  3TZU A;  3QB3 A;  1IYJ B;  1OXV A;  3SE0 A;  1XXG A;  1J6Q A;  4C3I G;  2NVY B;  2BOS A;  2UU9 Q;  2Z6B A;  5C4X H;  2WP8 J;  3J80 L;  4A3G G;  1DIK A;  4NYE A;  2R3Z A;  4Y8V B;  2F0I A;  1JJ2 A;  3MXG A;  1SNC A;  4IWY A;  2QA4 A;  4DV2 Q;  1PH5 A;  4I4T F;  1I94 Q;  2L11 A;  2AQ1 B;  2JEB I;  4A3J B;  5EPL A;  1ET0 A;  3M85 A;  4NZM A;  4I50 F;  2I8C A;  1PXU A;  1J5E L;  1QJO A;  2MUY A;  1XPU A;  1STA A;  3R5F A;  3A8K E;  4RWS C;  1TY2 A;  4O7V A;  1JOQ A;  1PYB A;  1SRU A;  3E0J A;  3JAM c;  5I5T A;  4C1N I;  2NVT B;  2CZG A;  2R7F A;  5LYJ F;  4GLV B;  2W6O A;  4B3T Q;  5LP6 F;  3SHL A;  4Q5V A;  3WWI A;  2F4V Q;  3IKJ A;  4LF4 Q;  2A68 C;  1CSP A;  3KFU A;  4P75 A;  5C6A A;  1KHI A;  2LSS A;  3RUP A;  1AZQ A;  1D7Q A;  3KDF A;  3S1N H;  3S1N B;  1X55 A;  2OQK A;  5EPJ A;  2TSS A;  3DM3 A;  2V5A A;  5D1O B;  4BXX G;  3G48 A;  2GQS A;  4IPD A;  1PYS B;  5J1Z A;  1W93 A;  2WAC A;  1HZC A;  1FGU A;  3N6R A;  3BVG A;  4RHS A;  1BOS A;  2Q2U A;  5EZY F;  3PO3 H;  4IHJ F;  2K5D A;  4O86 A;  4FGR A;  2Z04 A;  4DV0 Q;  3PF5 A;  4JK1 C;  4KY5 A;  4NDX A;  3CQZ B;  5T1I A;  3GTO B;  1YHA A;  3RNU A;  3GTP B;  4BY7 G;  4CGY B;  5J2U F;  2PQA A;  2AUJ D;  5COY A;  3UFX B;  2A73 B;  2YYZ A;  3NTK A;  3R93 A;  2JK8 A;  4JI3 Q;  4GKK Q;  4A3D B;  1BNC A;  1F9Q A;  1PRT D;  3T9E A;  1IKL A;  4B3S Q;  1N33 Q;  4ZRZ A;  1SMY D;  5KNC A;  4UCT A;  4DF7 A;  3MEF A;  5EAY A;  1Z2O X;  1NR4 A;  5JH7 F;  1SAP A;  3J7A 5;  2QW7 A;  4IUV A;  3ETJ A;  1KL9 A;  3BDC A;  3KF6 A;  1OXU A;  1EFW A;  4A3D G;  1B9M A;  2PNR C;  4IFD J;  3BU2 A;  4E6I A;  1I6H B;  4EEQ A;  3PIO 3;  1GGO A;  4EG0 A;  3G71 A;  4DR2 L;  3LWU A;  3K58 A;  2AHO B;  1PH8 A;  3EFX D;  3MXN B;  4RZQ A;  3UDF A;  5DLQ E;  4XTC S;  4C5B A;  2HVR A;  4LFB L;  2UXC L;  4OEM B;  1N36 Q;  1F2L A;  1WCM B;  3P7J A;  4PZ7 A;  3A5U A;  1VQF A;  4BBS H;  2XRQ D;  1HUN A;  1HQM C;  1TXY A;  3V2T A;  1BBX C;  4DN4 M;  2I07 B;  4CDC C;  4GNX A;  3Q1K A;  4NZN A;  1PH1 A;  1OBD A;  2VQD A;  5FO7 B;  4BBR B;  4FVM A;  1GUO A;  3NHH A;  2Z4I A;  3MFY A;  4C5A A;  1E22 A;  2L0C A;  1B1Z A;  1Q1E A;  4CKC A;  4QCL A;  4R4I A;  4B3S L;  1A0G A;  2W6Q A;  2UXB L;  2DGY A;  3U9O A;  3ORQ A;  1O7Z A;  2J9G A;  3GLK A;  4XZ3 B;  2EYH A;  4MIU A;  5IGB A;  1K8A C;  1U9R A;  1STN A;  2A6E D;  3Q6S A;  3DLL A;  2QDB A;  5M5Y H;  1JJC B;  5GRO A;  3BG3 A;  3CCS A;  3I2Z A;  5CV9 A;  5KGU A;  4WJ4 A;  5DAU A;  2K5W A;  1E4E A;  1KDB A;  1A6X A;  1PH4 A;  3EA6 A;  4LUO A;  4C3I H;  2VQF Q;  4JBJ A;  1S5E D;  4ABN A;  5CC4 A;  5IYD G;  2PMZ E;  1EWC A;  4M1U B;  1ICF B;  2L1B A;  1G29 1;  2L15 A;  1JIC A;  5IOC A;  1KJ8 A;  4NXM Q;  4XT1 B;  1VQ6 A;  3ULL A;  3W5O A;  3VDY A;  2JA5 G;  3E9H A;  4QUF A;  1EQR A;  1E3P A;  1I4R A;  1U4R A;  1UE5 A;  3L3O C;  1N36 L;  2F0N A;  2SDF A;  1TR5 A;  3K8A A;  4ULL A;  5DGH A;  3M9B A;  4TSS A;  3MXU A;  1KT8 A;  1Z47 A;  4X62 Q;  2A74 C;  4HED A;  5DMX A;  4RH6 A;  5CV5 A;  4RG1 A;  5BR8 Q;  2EJ0 A;  1VS0 A;  3CHB D;  4A3I H;  1SSO A;  2FHT A;  5CR3 A;  3J7A F;  2AWN A;  2YRW A;  2DLN A;  4DXF A;  1KDC A;  3HOZ G;  2V59 A;  2F0E A;  4K8J A;  1VQ8 A;  1IBL Q;  3WNZ A;  1L1O B;  3L2P A;  3HOX B;  2VS1 A;  4LW1 A;  2D2C C;  2EYM A;  4JI5 L;  5DGI A;  2X69 A;  2RQX A;  1DAA A;  5EKI A;  4Y7N B;  2F4V L;  3MWY W;  1KIX A;  3T1H L;  1PTO D;  1I1L A;  3HOU G;  3T9D A;  3KLW A;  1I4G A;  3CEB A;  3NK9 A;  1A3U A;  4JYA Q;  2EJG C;  3BAB A;  4X3S A;  4WFN 3;  3WO1 A;  1K0R A;  1UEB A;  2VR1 A;  4NXM L;  4A3K B;  2FMC A;  3AMU A;  4IUR A;  3PCO B;  4L5S A;  1IL8 A;  5C0X J;  3WWH A;  1NTG A;  3GTP H;  2RHQ B;  2C00 A;  1MBY A;  4YY3 L;  2DN8 A;  2RSO A;  2B63 G;  1H9S B;  1SYG A;  1QOH A;  2BH8 A;  3CP0 A;  1CTM A;  2SCU B;  3CW2 C;  5BN5 A;  1EY4 A;  1JKJ B;  2K5H A;  2EY1 A;  3PUV A;  2RDH A;  4DR3 Q;  1J9O A;  1KNE A;  1I3Q B;  2KOL A;  1K9M C;  4BBS B;  5I47 A;  1CHQ D;  3A56 A;  1B6S A;  3EVQ A;  1CKN B;  4FO2 A;  2QEX A;  3JAM i;  1OXX K;  3TEK A;  5IGE A;  1YNX A;  3VR3 A;  4OO1 H;  2ALY B;  2GVA A;  1EQV A;  4PMW A;  5FNV F;  3PIP A;  4UY8 C;  3RMH A;  1HNZ Q;  1CE8 A;  5FLX E;  1B70 B;  1BF4 A;  4A3B B;  5C0X I;  2HIV A;  4FNF A;  1PLF A;  3CCE A;  4DV5 L;  5LA6 F;  2F4I A;  1EIG A;  3RV4 A;  3OSO A;  4DV6 Q;  4OIK A;  3I56 A;  4X66 Q;  3T1Y Q;  1AW7 A;  2OQ0 A;  1SE2 A;  3PIO A;  4DR1 L;  2WYO A;  3E5N A;  2XGT A;  5E7N A;  4R8I A;  1QIL A;  1L2F A;  2OF1 A;  2F0H A;  2NBF A;  2SNS A;  2D62 A;  2R85 A;  3LX0 A;  2E2I H;  4A3C G;  5BWW A;  4JI0 L;  3IAY A;  2G9H D;  4HJ5 A;  2WAQ B;  3K81 C;  3RTX A;  1KLG D;  4F87 A;  2F0S A;  1GUW A;  1IZ6 A;  1FGB D;  2NVY H;  3H09 A;  4MNO A;  3CCM A;  5LMU Q;  4FFO A;  3RN5 A;  2HDM A;  4RGO S;  3PO2 H;  3MEH A;  4A93 B;  2XCL A;  1HHV A;  2R82 A;  5LMN L;  4FXK C;  4DKA C;  4CMF A;  2Q2I A;  3K3P A;  1LUZ A;  5EBC A;  2QGQ A;  3NTI A;  4C3H H;  4HTO A;  4TV9 F;  3VR6 A;  2FXQ A;  3M4P A;  4HTP A;  2RVL A;  2D9U A;  3TQY A;  3GID A;  1K3B C;  3GQB A;  3NUA A;  2I5L X;  2KHJ A;  3QWU A;  4DA2 A;  3DM1 A;  4HMJ A;  1A62 A;  2VPQ A;  3LNN A;  1Z9F A;  1B44 D;  1WTH A;  4JW0 A;  3VR4 A;  5C3E G;  1Y8N B;  4R4T A;  2KEE A;  4B3M Q;  5GON F;  4UP8 A;  4LFC L;  4LH7 A;  1TWG H;  2A6E C;  2DNC A;  3SGI A;  1UC8 A;  2VNU D;  3I4L A;  4RFB A;  3HOW G;  2JA8 H;  1I6V C;  2R6G A;  1T5X D;  2DAA A;  1VQI A;  1VF5 C;  4PMC A;  4L5R C;  4RCO A;  3AEV A;  3VPB A;  1ZYR D;  2CCZ A;  3JSL A;  4LUZ A;  1BR9 A;  4X66 L;  3T1Y L;  3H3V I;  4HID A;  4OWT B;  4BA2 I;  3TY5 A;  1EFI D;  4DNT B;  1I2L A;  1X3P A;  5CV6 A;  4CJ0 B;  5K2M A;  4JBM A;  4IOA A;  1EUD B;  1M6V A;  2N78 A;  1XJV A;  1JE5 A;  3T13 A;  3CD6 A;  1BNZ A;  2AKW B;  2K4K A;  4FF2 A;  1HNZ L;  4X65 L;  1B3Q A;  4FYD A;  2FPI B;  3K5O A;  1PTO B;  2A6H C;  1EY9 A;  4ODG A;  4YCW A;  3PO3 B;  5F2D A;  1JE4 A;  1I5F A;  5HNE A;  2K03 A;  3QG1 A;  3HKZ B;  1HH2 P;  1TU2 B;  1IL2 A;  1SDF A;  1QUQ B;  2GN5 A;  1IHZ A;  2H4O A;  1CHP D;  4EVO A;  2FPG B;  2K28 A;  4ME3 A;  2M00 A;  2QF7 A;  1E7Z A;  4J8Q A;  3TY9 A;  4XT3 B;  1AUX A;  3CCR A;  3DMU A;  4IJH A;  4ZK9 B;  1CKN A;  4G7O C;  1C8C A;  1PTO C;  2QIL A;  2G9D A;  4C3H B;  4XX0 B;  1CKM A;  1XWE A;  4QY7 A;  3FEW X;  3V96 A;  2VZA A;  2DY7 A;  1UWV A;  1M1K C;  2Z4H A;  3NQI A;  5JQG F;  1EYG A;  1EWI A;  2PMZ B;  3EBE A;  2EPB A;  1F2Z A;  1XMO Q;  3DAA A;  2GPW A;  3TW6 A;  2A19 A;  2ZGI A;  3BDO A;  1SN8 A;  3Q22 A;  2Q8R E;  5IT9 E;  5JJL A;  4JV5 Q;  1M0T A;  3FP9 A;  4IUN A;  1VQ4 A;  5LXT F;  2CW0 D;  4DK0 A;  1FL0 A;  2EYF A;  1CZG A;  5FKA C;  1CFM A;  3I91 A;  3UZO A;  4NKL A;  2EY5 A;  3HP3 A;  5ELE A;  5M3M G;  1GUT A;  1SYD A;  2YZG A;  1EYC A;  4MA5 A;  1FJG L;  2AUK A;  2WB1 B;  1WR2 A;  1RTO A;  3HOX G;  2E2J H;  4EFB A;  4A3J G;  3DWP A;  1D5X C;  4HIO A;  5JJI A;  3NBI A;  1IOW A;  3TSS A;  3HB9 A;  2IT1 A;  4O7L A;  4U67 3;  2DAB A;  2WKD A;  1I7L A;  4G4K A;  4RKL A;  5M5W H;  1ASY A;  1YEZ A;  4IUU A;  3TS0 A;  2R7N A;  3PIP 3;  2HVQ A;  2C5C A;  4IZO A;  3KF6 B;  1U5K A;  1Q3L A;  4C56 C;  2UUC L;  2IX1 A;  3H0G H;  1GD7 A;  1PH6 A;  2QDL A;  4DNR B;  1C0A A;  5AJ3 Q;  1GUS A;  1NR2 A;  3T4A C;  1IYD A;  4I7A A;  1QCB D;  4DV7 L;  2UUB L;  3UE0 A;  1U4M A;  1BXR A;  2RSN A;  4UAI A;  1LTL A;  3GTL H;  3SVM A;  3OOC A;  4QB4 A;  1GUN A;  2WKC A;  2F0U A;  5BN4 A;  3PUX A;  5GQO A;  1KRT A;  1TQO A;  1VQM A;  1TY0 A;  2R92 H;  3A7L A;  1HFG A;  2SNM A;  5I9O A;  2Z02 A;  4HIM A;  3H3V C;  1SNP A;  5I2Y A;  2HGW A;  2CQO A;  4UHV A;  3M4O H;  1II3 A;  2ZDG A;  5IWA Q;  1W6K A;  4LF6 L;  2VUM G;  3GV6 A;  5C1P A;  2CWP A;  2EQS A;  4P71 A;  1AH9 A;  3AYH B;  2PVP A;  2R87 A;  1WTX A;  2F0L A;  5JEA J;  1DON A;  1PH7 A;  4IO9 A;  3A5Z B;  3TII A;  2HQE A;  1SJH D;  4BY1 H;  1N34 Q;  4DR7 L;  5FLM H;  2WFW A;  3J80 c;  4FE2 A;  1NUC A;  3Q0A A;  2XNA C;  2ICI A;  3KLS A;  4Q4D A;  3T54 A;  1XMQ Q;  5EQ0 A;  5KIX A;  5G3L F;  2ZDQ A;  2JXM B;  1LAC A;  2R7L A;  3RLN A;  4KKS A;  2B2W C;  4O7W A;  5C3X A;  4KK7 A;  2KHS A;  2K1B A;  2NUA B;  3S2H B;  1I1M A;  4NZO A;  4BBR H;  5LMN W;  3A55 A;  3PF4 A;  1GSO A;  2HG8 A;  3EN2 A;  2FJ2 A;  5D1P A;  3U50 C;  1BBU A;  4RGT A;  3J81 i;  4TVI A;  2JA7 B;  2F03 A;  1A9X A;  3SR1 A;  1O7I A;  2LS0 1;  4RGN A;  4A3G H;  1M8A A;  1UEA B;  1UE7 A;  1YHB A;  3U54 A;  2JJQ A;  2RHS B;  4E4T A;  4F8M A;  1EEF D;  1BCP C;  2NTT A;  2PQE A;  5IP9 H;  4PZ6 A;  4HIK A;  4JI8 L;  3SDZ A;  3HO8 A;  3AB9 A;  1ESF A;  2KUM A;  4JI4 L;  5EBD A;  4HTH A;  1CM9 A;  1CQV A;  5JOB A;  1KJ9 A;  1WTR A;  1GM5 A;  4CKE A;  4LF4 L;  1A3T A;  2JSO A;  5K36 G;  4MAM A;  1PZI D;  2P5Z X;  4HMI A;  4JI7 L; 
#chains in the Genus database with same CATH homology
 2IHE A;  1VQF A;  3M7N A;  5D1O A;  1EIY B;  4P74 A;  4LNQ A;  4BBS H;  4DR6 Q;  3BA9 A;  4JI2 L;  4A3L H;  3ICE A;  1XPO A;  1TXY A;  5BR8 L;  4Y52 H;  1EIF A;  2RCN A;  3RLF A;  4GNX A;  1I6H H;  1B04 A;  3BA8 A;  3ULP A;  1Q8K A;  1PH1 A;  3HOV H;  3CC7 A;  5FJ8 G;  4EX5 A;  4L5T A;  5GAG C;  4IOC A;  1QZH A;  1E22 A;  4DV1 L;  5C3E H;  1Q1E A;  4R4O A;  1YIT A;  4LF5 L;  1L1O C;  4R4I A;  1YJ9 A;  5JJK A;  1WCM H;  1L0W A;  4B3S L;  2UUA Q;  2UXB L;  2DGY A;  1NE3 A;  2VUM H;  1NJI C;  1NMG A;  4JCV E;  1K8A C;  1K8G A;  3HOZ H;  1P8L A;  3CCQ A;  2ZTC A;  1NY4 A;  4X6A H;  3DLL A;  2HVS A;  2MFI A;  3STB D;  4DR4 L;  4XIG S;  2DUD A;  5M5Y H;  2HT1 A;  1JJC B;  3B6Y A;  4DR5 L;  5GRO A;  4LFA Q;  1YJN A;  3CCS A;  3U58 A;  4K0K Q;  3I2Z A;  2YTV A;  2Z6K C;  5C44 G;  4WJ4 A;  2WB1 E;  1W3S A;  2UU9 L;  3S17 H;  5JEA G;  2F3I A;  1VQ9 A;  3KYH C;  1PH4 A;  4C3I H;  4LUO A;  2VQF Q;  3PO3 G;  4JBJ A;  5IYD G;  1X3E A;  4FDB A;  2PMZ E;  4KHP L;  5IYC H;  3KF8 B;  4OWW B;  1G29 1;  1S3O A;  2L15 A;  1C7Y A;  4A93 G;  4C2M H;  1Y1V H;  1QVG A;  1S72 A;  3OTO Q;  2I5M X;  3AQQ A;  2HIX A;  3GDE A;  4NXN L;  2VQE L;  1B7Y B;  1IBM Q;  4NXM Q;  3GTQ H;  1VQ6 A;  3ULL A;  3E0E A;  2N8N A;  2WAQ G;  3W5O A;  3VDY A;  2E5L Q;  2JA5 G;  3E9H A;  5M3F H;  2UXB Q;  4LH6 A;  1EQR A;  1E3P A;  1HJP A;  1UE5 A;  2IHF A;  3KJP A;  1CSQ A;  4AQY L;  1KC8 C;  1N36 L;  3CME A;  3K8A A;  3I4N H;  4A3L G;  3KDF B;  3M9B A;  3U4Z A;  2OTL A;  2PNH A;  1Z47 A;  3I7F A;  4GS3 A;  4X62 Q;  2ZTE A;  3D31 A;  5C0X G;  2XTI A;  2YV5 A;  4HJ7 A;  4HJ9 A;  3L7Z C;  1MJE A;  2H5X A;  4RG1 A;  5BR8 Q;  1VS0 A;  4C3J H;  3A74 A;  4A3I H;  4DAY B;  4LFC Q;  5AJ3 L;  2R93 G;  2AWN A;  4QIW E;  4UCR A;  1VQN A;  2JA6 G;  2A1A A;  4OON A;  4UP7 A;  4DAM A;  3HOZ G;  4A3C H;  2KBN A;  4NPS A;  1N8R C;  4A3B G;  3JC6 6;  1VQ8 A;  2NZO A;  1IBL Q;  1L1O B;  3L2P A;  2VS1 A;  4LF9 L;  4LW1 A;  1Y14 B;  4LFA L;  4JI5 L;  2NVQ H;  1BKB A;  4JI2 Q;  1LM0 A;  1RL2 A;  4OWX B;  3J81 j;  2AMC B;  2F4V L;  3G4S A;  5IYC G;  1V1Q A;  4IPG A;  1KIX A;  5IYB G;  2N3S A;  3UDG A;  5IY0 A;  3W1G A;  3T1H L;  3S1R H;  3HOU G;  1JJG A;  3KLW A;  3LGJ A;  2UUA L;  2JQO A;  4JYA Q;  3CC2 A;  1G6P A;  1B8A A;  4BBS G;  3BAB A;  3I4M H;  3J80 i;  3TS2 A;  1K0R A;  1UEB A;  1X6O A;  1H95 A;  4NXM L;  3CCU A;  3UDX A;  4UCO A;  4R4C A;  2MO0 A;  3CF5 A;  3PCO B;  4L5S A;  4JI3 L;  3U4V A;  5C0X J;  4GOP B;  2I0Q A;  1NTG A;  2CKZ B;  4DR5 Q;  3GTP H;  2RHQ B;  4YY3 L;  2B63 G;  1WCM G;  4POG A;  3ZJY C;  1J5E Q;  1HR0 Q;  2JEA I;  4YCU A;  3CP0 A;  2BH8 A;  4DV5 Q;  3CW2 C;  2BA1 A;  1X54 A;  2K75 A;  4A3I G;  1VQL A;  4QJF A;  2NVT H;  3GTJ H;  3CCV A;  4A3K G;  2K5H A;  1WI5 A;  3PUV A;  1XNR L;  1VQG A;  4DR3 Q;  4JV5 L;  4CC5 A;  4DPG A;  1K9M C;  2HHH Q;  1Q81 C;  2JE6 I;  4DR7 Q;  4JYA L;  4DR4 Q;  4A3E G;  1CKN B;  2YU9 H;  1PHJ A;  1N33 L;  3HKZ G;  4JI6 Q;  4PZ8 A;  4LF7 L;  4BY1 G;  2QEX A;  3M4Q A;  2C35 B;  1WOC A;  3JAM i;  4YHH L;  1XMO L;  1VQC A;  1OXX K;  1OXT A;  1UE1 A;  1YNX A;  2ALY B;  2GVA A;  4PMW A;  3PIP A;  4UY8 C;  1P16 A;  2K14 A;  1T9H A;  1BBW A;  4YWM A;  3RZO H;  1IBK Q;  1VQ7 A;  4JI4 Q;  1HNZ Q;  4E6N A;  1FJG Q;  4JBK A;  1B70 B;  3K0X A;  2ZM6 Q;  5LMU L;  4OXP A;  4DV3 L;  1ASZ A;  2PI2 E;  1HR0 W;  5C0X I;  2HIV A;  3CCE A;  4DV5 L;  3S1Q H;  3ERS X;  3HOY G;  1N34 L;  3ER0 A;  4X64 Q;  1E24 A;  2D0O A;  4DV6 Q;  2I5H A;  3I56 A;  4TQU S;  4X66 Q;  3T1Y Q;  2OQ0 A;  3PIO A;  4DR1 L;  4AYB E;  2XGT A;  1AE2 A;  5E7N A;  2ZJQ A;  1N9W A;  3CCJ A;  4LF9 Q;  1L2F A;  1SFO H;  4LF5 Q;  2ZJP A;  4P73 A;  2PI2 A;  2D62 A;  1YJW A;  2E2I H;  4AIM A;  5GAE C;  4GLX A;  1HNX Q;  4JI0 L;  4A3C G;  1PH9 A;  1XDN A;  3CPW A;  1HZA A;  1XNQ Q;  1FVI A;  3F2D A;  2N49 A;  4YWL A;  4HJ5 A;  3K81 C;  3RTX A;  1IZ6 A;  3STB C;  2NVY H;  4MNO A;  3CCM A;  5LMU Q;  2UXD L;  1YVC A;  2KHI A;  3PGZ A;  3NBY B;  1I3Q H;  2IX0 A;  3RN5 A;  3L0O A;  4UPA A;  1OXS C;  5GAD C;  4DV1 Q;  3PO2 H;  3BAA A;  5IP9 G;  1QVC A;  3S24 A;  5C44 H;  3S14 H;  5LMN L;  1X65 A;  3GTG H;  1WYD A;  1SLJ A;  4DKA C;  4GNX C;  3AFQ A;  2Q2I A;  2MQH A;  4YHH Q;  2ZJR A;  1LUZ A;  2QGQ A;  1X56 A;  3K7A H;  4C3H H;  3S16 H;  1AE3 A;  4DR6 L;  4HTO A;  4DK3 C;  3PUW A;  5J3B A;  2FXQ A;  3M4P A;  4HTP A;  1V43 A;  3NBH B;  4R1J A;  3TQY A;  4DR2 Q;  3TEH B;  4DV3 Q;  4A3F G;  2I5L X;  2E2H H;  1Q46 A;  1GKH A;  2KHJ A;  3W1B A;  1D8L A;  4B3M L;  4KLK A;  3QWU A;  5M3F G;  1OTC A;  1TWC H;  4BY7 H;  2NZH A;  4HJA A;  3HOV G;  1A62 A;  3GO5 A;  4KHP Q;  1Z9F A;  2YTY A;  4DUY L;  4A3M H;  1SE8 A;  5C3E G;  2UXD Q;  2EXD A;  1DGS A;  3F8T A;  4BBR G;  4R4T A;  2R92 G;  2BA0 A;  3I4O A;  4B3M Q;  3PN1 A;  4YWK A;  2NN6 I;  4JOI C;  2ASB A;  5FPO A;  4K0K L;  1Y1W H;  3K7U C;  3OYY A;  2UUC Q;  4UP8 A;  4LFC L;  1VQE A;  4A76 A;  3NC0 B;  1TWG H;  4LH7 A;  4JOI A;  3SGI A;  1I94 L;  1SRO A;  4AYB G;  2VNU D;  1SMX A;  3HOW G;  3HOX H;  4JG2 A;  2JA8 H;  2B3G A;  2R6G A;  2JA7 H;  1RIP A;  4WJ3 M;  4JI1 Q;  1VQA A;  1VQI A;  2JA6 H;  4IFD G;  3JSN A;  4L5R C;  2MNA A;  1VQP A;  4LF6 Q;  3AEV A;  4X62 L;  3F1Z A;  1PFS A;  1S40 A;  2BH2 A;  5IWA L;  4A3B H;  2CCZ A;  4OX9 Q;  4LUZ A;  4B3R Q;  5IYD H;  3JSL A;  4X66 L;  4QGU A;  3T1Y L;  4LWC A;  3H15 A;  3H3V I;  4HID A;  3PO2 G;  4OWT B;  4BA2 I;  5FLX c;  4UFZ A;  2VQE Q;  3PUZ A;  4POF A;  4IPH A;  2VW9 A;  1A0I A;  4DV4 Q;  1IBM L;  1PVO A;  3T1H Q;  3OTO L;  4JBM A;  4JI7 Q;  1TWA H;  3EIV A;  4IOA A;  2N78 A;  3RR5 A;  2RF4 A;  4TVA B;  1JE5 A;  1XJV A;  4NB3 A;  3CD6 A;  4OX9 L;  4JBW A;  2IY5 B;  2AKW B;  2K4K A;  5IYB H;  1HNZ L;  4KHZ A;  1QVF A;  1IXR A;  4X65 L;  2JA5 H;  1JT8 A;  1VQJ A;  4JI8 Q;  1U0L A;  4JI0 Q;  4EQ5 A;  2K5V A;  4DK6 C;  4YCW A;  2KEN A;  5ELN A;  5C4J H;  3HKS A;  4GNX B;  2R7Z G;  4GKJ L;  1A63 A;  1I5F A;  5IT9 c;  1X3G A;  3UE1 A;  4A3D H;  1HH2 P;  2F52 A;  3BZC A;  4X65 Q;  1IL2 A;  2A8V A;  1JMC A;  3M3Y H;  1QUQ B;  4Y7N H;  4PZ7 A;  4DR1 Q;  2GN5 A;  4YCV A;  3UDI A;  3VNN A;  4GKK L;  2ID0 A;  1Q86 C;  2VY3 A;  1A8V A;  3F2C A;  4ME3 A;  3PSI A;  1Q12 A;  2Q2H A;  1E7Z A;  3K80 C;  3TY9 A;  4ALP A;  3CCR A;  4IJH A;  1Y1W G;  1KD1 C;  1CKN A;  3TRZ A;  3CPF A;  1UE6 A;  3RN2 A;  3NBZ B;  1V9P A;  3ULJ A;  1VQ5 A;  3OW2 A;  3HOW H;  4A3K H;  1XMQ L;  4AH6 A;  2VL6 A;  1K3R A;  4A75 A;  1CKM A;  4QY7 A;  3G6E A;  3D0F A;  2VZA A;  4MZ9 A;  4BA1 I;  2Q2T A;  3J81 c;  1UWV A;  1M1K C;  1VQB A;  1CUK A;  3UQ8 A;  1EYG A;  1WJJ A;  1EWI A;  3EBE A;  1QUQ A;  1E1T A;  2OCE A;  1XMO Q;  5C4X G;  4DRF A;  5D1O B;  4DV2 L;  4BXX H;  1W2B A;  2Y0S G;  1IBK L;  4GKJ Q;  2A19 A;  4DUY Q;  3FHW A;  4B3R L;  1LYL A;  3H0G G;  1SN8 A;  2HQL A;  3I55 A;  1Q7Y C;  1HNX L;  4GLA C;  2ZTD A;  2ATW A;  5JJL A;  5IE8 A;  3GTM H;  4JV5 Q;  4OO1 I;  1TWH H;  3E9I A;  1Y1V G;  3FP9 A;  3FKI H;  1YHQ A;  1VQ4 A;  3IRB A;  4JI6 L;  1L1O A;  1Q1B A;  2MO1 A;  4LF7 Q;  1GO3 E;  2E8G A;  3S1M H;  2HVR A;  3HKZ E;  1HZB A;  4X64 L;  4YY3 Q;  4DV6 L;  4A3M G;  1FL0 A;  2R7Z H;  3HOY H;  3CCL A;  5IP7 H;  4CC6 A;  1TWF H;  4B3T L;  4UCV A;  5M3M G;  4LF8 L;  1XNR Q;  5FJ8 H;  3RLO A;  4IPC A;  2V1C C;  1FJG L;  2K52 A;  1K83 H;  3S2D H;  1HZ9 A;  3TY5 A;  2GVB A;  2CFM A;  4GN4 B;  3HFZ B;  3KJO A;  3HOX G;  2ZM6 L;  2E2J H;  5H1S E;  5GAH C;  2JA7 G;  3CAM A;  1N32 Q;  1CKO A;  4EFB A;  4A3J G;  2YTX A;  3BZK A;  3KOJ A;  4DV0 L;  4DV7 Q;  4L5Q A;  4MTN A;  4O0A A;  4HIO A;  5JJI A;  1I50 H;  3A0J A;  4O2D A;  3H3V H;  1G51 A;  3GTK H;  2IT1 A;  1MIU A;  2UXC Q;  1KXL A;  4NXN Q;  4PG3 A;  4GOP A;  1PV4 A;  3BJU A;  5M5W H;  4UCU A;  4EFE A;  1ASY A;  1IYJ B;  1YEZ A;  1OXV A;  4H02 A;  4A4I A;  5LMN Q;  1J6Q A;  1TAE A;  4OO1 G;  3TS0 A;  2UU9 Q;  4JC0 A;  2HVQ A;  5C4X H;  2WP8 J;  4A3G G;  1SR3 A;  2VQF L;  4DR3 L;  1IBL L;  3KF6 B;  5FLM G;  1EOV A;  1JJ2 A;  3CC4 A;  1U5K A;  2UUC L;  1XK5 A;  2IX1 A;  3H0G H;  2QA4 A;  4DV2 Q;  1PH5 A;  2D0P A;  1I94 Q;  1GD7 A;  2JEB I;  1PH6 A;  4IFD I;  1YZ6 A;  4QL5 A;  3M85 A;  3HOU H;  2WB1 G;  1J5E L;  3Q8D A;  1KQS A;  5AJ3 Q;  1HR0 L;  3S2H H;  1C0A A;  1PH3 A;  1XPU A;  4DV7 L;  2UUB L;  3I4M G;  5HGQ A;  4HJ8 A;  3UE0 A;  3I4N G;  3GJX B;  4GOP C;  1PYB A;  1LTL A;  1SRU A;  1JB7 A;  3GTL H;  5IP7 G;  3JAM c;  3CMA A;  2ES2 A;  4QQB X;  3CXC A;  1HNW Q;  1KAW A;  2R7F A;  4GLV B;  3NEL A;  3PUX A;  1VQD A;  5GQO A;  1KRT A;  3WWV A;  4B3T Q;  1PA6 A;  2B63 H;  1VQM A;  1K73 C;  2R92 H;  1QZG A;  4HIM A;  3TRE A;  4LF4 Q;  2F4V Q;  2R93 H;  2LXJ A;  1CSP A;  2CQO A;  3KFU A;  3M4O H;  4P72 A;  1N32 L;  4P75 A;  1NMF A;  1KHI A;  1NBW A;  4GN5 A;  5IWA Q;  2LSS A;  1D7Q A;  3KDF A;  4LF6 L;  2VUM G;  1X55 A;  2LXK A;  2OQK A;  1EUJ A;  3DM3 A;  3NEN A;  4DNI A;  3F2B A;  2CWP A;  1R9T H;  1X9N A;  2EQS A;  4J15 A;  4P71 A;  4BXX G;  3AYH B;  3G48 A;  1AH9 A;  4IPD A;  2Z6K A;  1PYS B;  2K5N A;  4A3E H;  2WAQ E;  2UUB Q;  5JEA J;  1PH7 A;  4IO9 A;  3A5Z B;  4LF8 Q;  4BY1 H;  1HZC A;  1MJC A;  4GN3 B;  1YIJ A;  1FGU A;  1N34 Q;  2HHH L;  4JI5 Q;  1KRS A;  1MKH A;  4DR7 L;  5FLM H;  4LFB Q;  2Q2U A;  2WFW A;  3PO3 H;  2Y0S E;  3J80 c;  1YI2 A;  4RMF A;  2Z0S A;  4UCS A;  3NEM A;  4DV0 Q;  3PF5 A;  4A3F H;  3TY8 A;  4IJL A;  3GD7 A;  1XMQ Q;  3GTO H;  3S1N H;  1YHA A;  3CQZ H;  2B29 A;  4KI0 A;  3RNU A;  4BY7 G;  5M3M H;  4AQY Q;  2PQA A;  3RLN A;  2VUG A;  4DUZ Q;  5FPR A;  4BBR H;  4DV4 L;  1TA8 A;  2YYZ A;  5LMN W;  1EQQ A;  2JK8 A;  4JI3 Q;  1YBY A;  3PF4 A;  4GKK Q;  5DIS C;  1E1O A;  3PV0 A;  4A3J H;  3EN2 A;  2AWO A;  5D1P A;  3U50 C;  4B3S Q;  1XPR A;  1N33 Q;  5HY6 A;  1BBU A;  4UCT A;  1GVP A;  3J81 i;  3MEF A;  4JI1 L;  2JA8 G;  5EAY A;  1VQK A;  2KCM A;  3J7A 5;  1KL9 A;  1M90 C;  1O7I A;  3KF6 A;  1OXU A;  2CWA A;  5ELO A;  1EFW A;  1WFQ A;  4A3D G;  4UP9 A;  4A3G H;  1XNQ L;  4IFD J;  3BU2 A;  4EEQ A;  1UE7 A;  3AFP A;  1VQH A;  2KCT A;  3J7Z C;  2R7D A;  3G71 A;  1YHB A;  4DR2 L;  1Q82 C;  2JJQ A;  2RHS B;  1C9O A;  2JA9 A;  4DUZ L;  2AHO B;  1PH8 A;  1XTD A;  2OWO A;  1VQO A;  1HNW L;  2OTJ A;  4LUV A;  5IP9 H;  5M5X H;  3S15 H;  4A93 H;  4PZ6 A;  3PUY A;  1BVS A;  4HIK A;  3MXN B;  4JI8 L;  2NN6 G;  2EIF A;  1PH2 A;  4R4Q A;  4JI4 L;  3UDF A;  3GB8 B;  2K50 A;  2PQA B;  2E5L L;  5DLQ E;  4XTC S;  1GM5 A;  5K36 G;  4LF4 L;  4LFB L;  1S68 A;  4APV A;  3RZD H;  1VCI A;  1N36 Q;  2NVX H;  2UXC L;  3FKI G;  1X3F A;  3A5U A;  4JI7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...