3W5OA

Crystal structure of human dna ligase iv
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
596
structure length
577
Chain Sequence
QTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEELDILIVGGYWGKGSGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 4
publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 174
structure length 577
sequence length 596
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2013-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w5oA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w5oA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w5oA02
2RHSB 4R4QA 3GTGH 1WOCA 4DK3C 3S1NH 1VQ5A 4HTPA 2UU9Q 2K75A 2I5HA 2RCNA 1QUQB 4PZ7A 1TWHH 1Y1WG 2JEAI 4IFDG 4BBRH 4E6NA 2JA6H 1L2FA 3KDFA 4JI3Q 4L5TA 1AE2A 2EIFA 2WAQG 1FL0A 1XNRQ 1PA6A 5JJLA 1I94Q 4LFCL 1JJ2A 3F1ZA 4HJ8A 1QVFA 1MIUA 1R9TH 4A3LH 3J80c 1VQ8A 4GOPB 3J7ZC 3S1RH 3M4OH 4YCWA 4UP9A 4AH6A 4TVAB 3OTOQ 3CMAA 1VQAA 4O0AA 1Q12A 3GD7A 1WI5A 1QVGA 4DK6C 3HOWG 3I7FA 4IPGA 5IYCH 3S16H 1XNQL 3D0FA 1N9WA 3J81i 4DV2L 5IWAQ 4A3EH 2F4VL 2YU9H 4DR7Q 3G48A 5AJ3L 1VQEA 4O2DA 1VQGA 2PI2A 1J6QA 5GAGC 1O7IA 2Q2HA 1PV4A 4DR5Q 4HIOA 1J5EQ 2ZTEA 3M7NA 3A74A 5M3FG 1GVPA 1NY4A 1Q1EA 3CCRA 3CC2A 4A3IG 1CKMA 4OXPA 1X56A 5C4JH 1XK5A 3J7A5 1N33Q 4X62Q 4A4IA 3JAMi 3BA8A 1YHAA 1Z47A 4UCVA 2K4KA 3H0GH 3K0XA 1X3EA 1ASYA 3S2DH 4AIMA 1M1KC 5C0XJ 5ELNA 3GTOH 3STBD 1HZ9A 4X65Q 4BBRG 4GOPC 2AKWB 4JI2Q 2OTLA 2ASBA 2UU9L 2JA6G 3KF6A 2JQOA 2A1AA 2VUGA 1K8GA 1RIPA 1V1QA 1FGUA 1YJWA 3A0JA 4DV3Q 4JI3L 4A3LG 3I4NG 3TS2A 3UE0A 4X6AH 1A63A 1S3OA 3G6EA 4JI6L 4OWWB 3KF8B 1I50H 3EN2A 2E2IH 4DV6L 1I94L 1JMCA 1B8AA 2ZJQA 4H02A 4KI0A 4EFBA 5C0XG 2ES2A 2UXDL 1XPOA 3PO3H 2IT1A 3CCMA 3H3VI 1PH3A 3S1MH 2ZM6Q 4LH7A 2XGTA 3L0OA 4K0KQ 1PH4A 1C7YA 4C3IH 4A3EG 1X3FA 1L1OB 2NN6I 1V43A 4UCRA 2E2JH 2OTJA 1K8AC 5ELOA 3DM3A 3W1BA 2LXKA 4X64Q 4DV7Q 2K5VA 4JI8Q 3RLNA 2MO1A 5LMUL 5IE8A 3NBHB 1J5EL 2K52A 4PZ6A 1LM0A 1LYLA 1TWGH 3KYHC 1Y14B 4DR2Q 4B3SQ 4IPCA 3J80i 5M5XH 1S72A 4OX9Q 5GAHC 1VQBA 2IX0A 4QJFA 3GTKH 3H0GG 2CCZA 3RR5A 4LF7Q 2LSSA 1N33L 2EQSA 4UP7A 4UCOA 4X62L 3GTMH 4B3TQ 2CQOA 2CFMA 4YHHQ 1PH7A 1VQJA 4PG3A 3TEHB 3HKZG 2IY5B 2AMCB 4JI2L 1K83H 3CCEA 3BABA 1L1OA 5M5YH 4DV0L 4DV4Q 3I2ZA 1SMXA 5D1OA 1L1OC 5C4XH 4EX5A 3F2CA 4DV3L 4BXXH 1S68A 3PF5A 1GO3E 3S2HH 3NBYB 1QZGA 2MFIA 3UDFA 2KCMA 3PO3G 2KBNA 1HNWQ 3E0EA 4UCTA 1UE7A 3J81j 4KHPQ 1G51A 2KENA 4YY3Q 1Q86C 1ASZA 5HGQA 1IBKQ 4DKAC 4DR1Q 4BY1H 3BU2A 4P75A 5BR8Q 3CCSA 4ALPA 2Q2TA 3CCLA 4JBKA 3UDGA 2ZM6L 4LF4Q 1KIXA 4LH6A 4UFZA 3I55A 4NXNQ 4K0KL 4C2MH 1E24A 4NXMQ 4LFAL 1PH8A 3TREA 3OYYA 1MJEA 1VQ7A 3CPFA 2VQEQ 5H1SE 1YIJA 4EEQA 1A0IA 4XTCS 1VCIA 3PSIA 2V1CC 5EAYA 2Z6KA 3GTLH 4DV7L 4X64L 1FVIA 1YI2A 3M4QA 4JI8L 2Z6KC 3TRZA 3PIPA 1X6OA 3PUWA 2NVXH 1HH2P 4B3SL 1WFQA 1OXUA 2KHIA 4DR2L 5GROA 2Q2UA 4OX9L 2R93H 1EIFA 2VL6A 1A62A 1NMGA 3IRBA 1GKHA 4IPDA 4LNQA 5J3BA 3M3YH 4DRFA 1HZAA 3HFZB 1GD7A 1XPRA 4B3TL 4GN4B 2OQKA 3KJPA 5M3MH 5C3EH 2VQFQ 3OW2A 1YJ9A 3TY8A 1TWAH 1MJCA 1Q7YC 1KRSA 2QGQA 1VQ4A 5C4XG 4L5RC 1G6PA 4BXXG 4DV5Q 1PH5A 1U0LA 3MEFA 3H3VH 4KHZA 3GB8B 3A5UA 1XTDA 1KXLA 4GLXA 4GLVB 4X66Q 1Q81C 2AWOA 3CPWA 1XMQL 1W3SA 4BY1G 2RHQB 4AQYL 1VQMA 1HNWL 2GVAA 4KHPL 1EQRA 2B29A 2JK8A 2K5HA 3F8TA 3D31A 3KF6B 1KRTA 4YY3L 2HHHQ 1SE8A 4RG1A 3RZDH 1IBKL 3CC4A 4DR1L 1VQNA 1I3QH 5BR8L 4LF4L 4GLAC 2E8GA 2B63H 4JI7Q 3CCQA 1K9MC 3HOYH 4P74A 4EQ5A 3SGIA 4NXML 1CSQA 2VQEL 4DUZQ 3A5ZB 1AH9A 1PVOA 1OXTA 3KLWA 2NVTH 1XMOQ 1X9NA 4FDBA 2E2HH 4RMFA 2R93G 2JJQA 1YZ6A 4DR3Q 3UE1A 2UXCQ 2HQLA 2ZTDA 3PUXA 2F3IA 3PO2H 3T1YQ 4JBWA 5HY6A 1XDNA 4R4OA 4DR4Q 3GDEA 3CD6A 1MKHA 5M3MG 5C3EG 5LMNW 3WWVA 4JI1Q 2L15A 5IP9H 1EOVA 3FKIH 4BY7H 3GTPH 1AE3A 1B7YB 1WJJA 2N78A 4NPSA 3VDYA 3CCVA 4A3GH 1X3GA 2K5NA 2VQFL 4IO9A 4B3MQ 2ZJPA 2I5LX 4YCVA 1BBWA 3EIVA 1X55A 2VY3A 1XNRL 4DV5L 1PFSA 1HR0Q 4POGA 2NN6G 4Y52H 4LFBQ 1Q1BA 3PUYA 2PI2E 2HIVA 3FHWA 4X66L 1PH2A 5DISC 3PCOB 3RZOH 5IYCG 3OTOL 4XIGS 2F52A 2YV5A 3RLOA 3S15H 1GM5A 1UE1A 2B63G 4UP8A 1FJGQ 1TXYA 2XTIA 3HOYG 4JCVE 2HHHL 4JI5Q 4JYAQ 5D1OB 3L7ZC 4HIMA 4A3CH 1PH1A 5IWAL 5IYBH 4JI7L 4DR7L 5FPOA 3KJOA 2ATWA 4HJ5A 1KC8C 3G71A 4WJ4A 4DUZL 4JI4Q 3CP0A 1EWIA 3AFPA 4DR5L 1K73C 2CKZB 2BA0A 3EBEA 3ZJYC 5IP7H 3PUVA 3M85A 2JA9A 4LW1A 1XMOL 3PO2G 1VQDA 3BZCA 3VNNA 4IOCA 1EIYB 1BBUA 4AYBE 2LXJA 5JEAG 2FXQA 4PZ8A 4GNXB 4DR3L 3RTXA 4OO1I 3K7UC 2KCTA 3UDIA 3T1YL 1KD1C 3BZKA 5IP9G 4R4IA 3FKIG 5DLQE 1CUKA 1L0WA 4BA1I 3TQYA 4HJ7A 1IBMQ 1VQ9A 3BAAA 2UUBQ 2WB1E 4LUVA 4DR4L 4X65L 4LF5Q 3K80C 4LF9Q 1VQ6A 4YWMA 4A3GG 2UXCL 4JI1L 2NVQH 1IBLQ 1NTGA 4OWTB 4JV5L 2OQ0A 2JE6I 1N34Q 1X54A 4B3ML 5IYDH 1G291 4HJAA 4GKKQ 4GN5A 1HZBA 4PMWA 2HVQA 2N49A 1OTCA 4DPGA 4A3FH 3CW2C 4WJ3M 1HJPA 4DUYQ 3JSNA 1E3PA 4POFA 1QZHA 1HR0L 3Q8DA 2JA7H 2ZJRA 2DGYA 2YTYA 3U4VA 2JA8H 4LFBL 1XPUA 3STBC 1CKNB 1VQHA 4A3KH 4OONA 4C3JH 1JJGA 4P71A 3H15A 2Y0SE 4GNXA 4A3CG 1FJGL 3I4OA 5IYBG 1YITA 4GNXC 1B04A 2D0PA 1E22A 4JI5L 1M90C 1UEBA 4JYAL 1H95A 4CC5A 1E7ZA 5IP7G 1LTLA 3K81C 3NENA 3HOUH 4J15A 1T9HA 2Z0SA 5GQOA 1UWVA 4A3JH 1WCMH 2A19A 3ULPA 2I5MX 2N3SA 1TA8A 4JOIA 3HOXH 4R1JA 3JSLA 4LF7L 1TWFH 3TY9A 3AYHB 4JOIC 4P73A 1W2BA 4JI0Q 1Q8KA 1CKOA 2N8NA 3S24A 1S40A 4LF8Q 2QEXA 1PH9A 4GKJQ 4YHHL 3TY5A 1IBML 4Y7NH 1CKNA 1OXXK 2UUBL 3L2PA 2DUDA 4DAYB 4LF5L 3ER0A 4MTNA 5IYDG 1HZCA 3S14H 1IBLL 5C44H 3HKSA 3CMEA 4HIKA 1N34L 1HNXQ 4DV4L 4A3FG 2MNAA 3G4SA 1Q82C 2VW9A 2R7ZH 1NJIC 2R6GA 2JA7G 2HVRA 1KAWA 2WAQE 3LGJA 4A75A 2JA8G 1N8RC 5FLXc 4JBJA 3U50C 2RF4A 1V9PA 4DUYL 1JT8A 4A3KG 1YJNA 4LF6Q 4DR6Q 1VS0A 2HVSA 2MO0A 5E7NA 1K3RA 2WP8J 2B3GA 1KHIA 2Q2IA 1X65A 2YTVA 3BA9A 1YEZA 3M9BA 4UCSA 1PH6A 2BA1A 3UDXA 3CC7A 4NXNL 2BH2A 1NMFA 2HT1A 3W5OA 1QVCA 1SROA 3HOVG 1IZ6A 2R92H 3BJUA 1Q46A 2GN5A 3F2DA 2OWOA 3KFUA 4MNOA 4BBSH 1YHBA 4DV6Q 3PV0A 4GS3A 3HOUG 2AHOB 3B6YA 3I4NH 3S1QH 2VS1A 4A3JG 2UXDQ 1WCMG 4IFDI 4A3DH 1I5FA 3HOXG 3ERSX 2JEBI 4KLKA 4HTOA 4LUOA 3AFQA 1KQSA 3AEVA 4CC6A 3I4MH 3S17H 1SRUA 2JA5H 3CQZH 1PHJA 1N32Q 3RN5A 1I6HH 2NVYH 2BH8A 4LUZA 4JI0L 4B3RQ 3NELA 4LF8L 5LMNQ 4A76A 1EYGA 4GKJL 4IPHA 3ULLA 5C44G 1E1OA 4YWLA 3HOZH 1QUQA 1K0RA 5LMUQ 2K14A 1B70B 1C0AA 5FLMH 5JJIA 2IX1A 1OXVA 4QL5A 3CXCA 3E9IA 2R7ZG 3PN1A 4OWXB 3RN2A 2UUAQ 1HNXL 4DV1Q 2VUMH 1VQOA 1CSPA 5D1PA 1U5KA 3RLFA 1IXRA 1Y1VH 2EXDA 4JBMA 5IY0A 4A93H 2OCEA 4DNIA 3PUZA 4JG2A 4GOPA 1TAEA 2K50A 4DR6L 1D8LA 1YNXA 4L5QA 5IT9c 1EUJA 3CCJA 4DAMA 4QGUA 4UPAA 4LF6L 5JEAJ 5FJ8H 4TQUS 1VQCA 4ME3A 1SR3A 2NZHA 3PIOA 4DV0Q 2R92G 2IHFA 1BKBA 3DLLA 3F2BA 1D7QA 1VQPA 4BBSG 1YHQA 2UXBQ 2KHJA 3JC66 1XJVA 4OO1G 1YVCA 2GVBA 4MZ9A 3NC0B 1HR0W 4QQBX 1HNZQ 4BY7G 1E1TA 4HJ9A 4A3DG 2NZOA 2ZTCA 4JV5Q 1Z9FA 2E5LQ 2UUCQ 4UCUA 2CWPA 1JE5A 4LWCA 3I56A 2VNUD 1SFOH 3I4MG 2JA5G 1WYDA 1OXSC 1IL2A 3RNUA 2PMZE 3M4PA 4YCUA 3CAMA 1NBWA 3GO5A 3CF5A 5M5WH 4LFAQ 3T1HQ 1VQKA 3U4ZA 4A3MH 3HOZG 1N32L 2H5XA 5C0XI 1JB7A 4IJLA 5FLMG 2A8VA 1P16A 2CWAA 1UE5A 1SN8A 1RL2A 4B3RL 5LMNL 4L5SA 1VQIA 1N36Q 3ICEA 4GN3B 4BA2I 3K8AA 1C9OA 4AYBG 2IHEA 3AQQA 3TS0A 3HKZE 3GTQH 4A3BH 1EFWA 3GTJH 2VUMG 3NBZB 2VZAA 4QIWE 1EQQA 2PNHA 5FPRA 1LUZA 1IYJB 1Y1VG 2C35B 2UUAL 2MQHA 4DV1L 4A93G 3UQ8A 3ULJA 4R4CA 2WB1G 3MXNB 2PQAB 3HOVH 5JJKA 1YBYA 4QY7A 1KL9A 5FJ8G 1SLJA 3J81c 2QA4A 5K36G 3PF4A 3CCUA 4YWKA 1JJCB 3W1GA 2WFWA 1Y1WH 1UE6A 5GADC 2HIXA 1BVSA 1P8LA 4LFCQ 1DGSA 4P72A 1VQLA 4IJHA 4UY8C 2UXBL 5GAEC 4HIDA 4JI4L 3E9HA 1HNZL 1PYSB 1XMQQ 4AQYQ 4NB3A 2Y0SG 2E5LL 3JAMc 2UUCL 3U58A 4JI6Q 1TWCH 4R4TA 2YYZA 1XNQQ 2YTXA 4DV2Q 3GJXB 4A3MG 3HOWH 2R7FA 3KDFB 2F4VQ 2PQAA 3NEMA 2R7DA 4APVA 2AWNA 5AJ3Q 3T1HL 4EFEA 1A8VA 3FP9A 3K7AH 4LF9L 4A3BG 2ALYB 2I0QA 4C3HH 3PGZA 4IFDJ 1PYBA 2ID0A 1N36L 4JC0A 3QWUA 1NE3A 2D62A 3KOJA 2D0OA 4GKKL 5M3FH 4IOAA 1VQFA 4A3IH
chains in the Genus database with same CATH superfamily
4R4QA 1D2BA 1IYEA 2RDHA 1M0WA 3S1NH 2I5HA 4K2LA 2FJ2A 1BDOA 1Y1WG 4CHIA 1F2YA 4BBRH 2A73B 4E4TA 2DJGC 1B3QA 1B53A 5C5MA 4TSSA 1XNRQ 3DMUA 1Y8OB 3S17B 2QEJC 4PQXA 2A6EC 3CQZB 1I94Q 1QVFA 4A3LH 5I5TA 3I3CA 4CJ0B 3A8KE 5KGUA 4GOPB 1VQ8A 4YCWA 3M4OH 3CEBA 1K3BC 3GD7A 1WI5A 5C0XH 2N88A 3HOWG 5D3DA 2K5WA 3TW7A 3S16H 5IYCH 1R4PB 3D0FA 3J81i 2KVMA 1CQVA 3JAML 5IWAQ 3U9SA 4DR7Q 1PZKD 1EIHA 5AJ3L 4PMBA 5GAGC 1J6QA 1B9NA 4B08A 1J5EQ 3JRWA 4HTHA 1B1ZA 3FMCA 3M7NA 5M3FG 5LA6F 2NUAB 3TP8A 1JR0D 3CCRA 2NTSA 2MPMA 3CC2A 4V190 5JH7F 1XK5A 3K5MA 4ZUIA 5HV6A 3DTGA 4UCVA 1I7LA 3K0XA 5DAAA 1M1KC 1LTBD 5C0XJ 3GTOH 3STBD 4X65Q 3MWYW 2UU9L 2W6NA 1SFOB 3UI2A 3OPOA 3TS2A 3HT5A 1CFMA 3LNNA 3PIP3 2BDNA 3G6EA 1H9KA 2JSOA 3KF8B 1I50H 1I1MA 2E2IH 1HXYD 4H13C 1BCPD 4ZYSA 1XPOA 3PO3H 2KA7A 2IT1A 2RCFA 3S1MH 2X6LA 3M7GA 2XGTA 4RGTA 1C7YA 3GTQB 4C1NI 3T7AA 1X3FA 3R2TA 1F77A 2OTJA 4DV7Q 3W1BA 2YZMA 4DU9A 3P1HA 1GUWA 1ESFA 4NZNA 5EGTA 3K6OA 3D8GA 1WTPA 5K5PA 1LM0A 1TWGH 3J80i 1F2MA 1C4QA 1VQBA 4XT1B 1GSOA 1MHWC 2EQSA 4UP7A 4UCOA 2KCCA 4X62L 1EKVA 4EGJA 4F8MA 2CQOA 2WAQB 4ULLA 4O1NA 1TQOA 4PG3A 3EA6A 2BOSA 3HOUB 2IY5B 2WIIB 1AEXA 3M4YA 4NMZA 1L0XB 2SEBD 3LP8A 5D1OA 1L1OC 1C30A 1A9XA 4ZKBB 4RH6A 3S2HH 3TEKA 5E1FA 1QZGA 2L12A 3D6CA 4ID6A 1HQRD 3UDFA 2KCMA 1VBGA 5BWUA 3J81j 2KENA 1U4PA 1Q86C 5HGQA 1IBKQ 4DKAC 4DR1Q 3S14B 3BACA 1U9RA 3V4SA 3CCLA 1KAAA 2GQRA 2ZM6L 2NU7B 1KIXA 3I55A 4NXNQ 2R7ZB 1B6SA 3K3PA 4G4KA 3OYYA 2FP4B 1YIJA 2VPQA 4XTCS 2R87A 2Z6KA 4X64L 1LTRD 3VPBA 3S1NB 3M4QA 1ILPA 1A3GA 5BN4A 3PIPA 4NZOA 1X6OA 3PUWA 1EZ1A 1HH2P 2W70A 3KBXA 4BBRB 3K57A 5GROA 1ZXTA 2Q2UA 2R93H 3EROA 2R92B 4KY5A 3IL8A 4O7ZA 3I4NB 3OW2A 1YJ9A 5C4XG 4MV9A 1R4QB 3MEFA 3P20A 2RQXA 3H3VH 3ETJA 4KHZA 3S16B 1ZYRC 4GLXA 4GLVB 4X66Q 1Q81C 4XQQA 2XWBB 1W3SA 4AQYL 1HNWL 4PBCA 2B29A 4JI6L 4YY3L 3D31A 4HCSA 2Z8LA 1KRTA 1C8CA 4RG1A 3RZDH 1G6ZA 5IGFA 2R7LA 4LF4L 4GLAC 5CV8A 5KEEA 2VUMB 4K14A 2PMZB 3AU7A 3SGIA 4B9XA 2VQEL 2CZGA 4DNRB 3A5ZB 1AH9A 1LTAD 4KTAA 3T9DA 5LL6S 2NVTH 1Q8IA 2EYFA 3DM1A 1S5DD 2NTTA 1BF4A 3C1FA 3UE1A 1AW7A 2F3IA 4MTKA 4O83A 3MFYA 4QIWB 1XDNA 5CV5A 2GPSA 1Z7TA 2L15A 1I50B 4JI1Q 4JV5Q 2E2IB 1AE3A 4K6DA 2VQFL 2Z6BA 1C48A 2OEOA 4IO9A 3PO3B 3S1MB 3AX6A 1S4ZA 3DEOA 2XSCA 4DV5L 1HHVA 2L9HA 2E76C 5D14A 2NN6G 2EYJA 1Q1BA 4RHSA 2EDGA 3WNZA 5FKAC 1WTQA 3WWIA 5I2YA 1PH2A 5CM0A 3MXUA 3PCOB 5IYCG 2YV5A 5KNDA 3LX0A 3S15H 1GM5A 2F1MA 4UP8A 2XTIA 3HOYG 2CNUA 2HHHL 2O5JC 1TWGB 4JYAQ 1EUDB 4G7HC 5D1OB 4DAAA 1PH1A 1K0SA 4HJ5A 1KC8C 4DFAA 2COGA 4XXEA 3AFPA 1K73C 1A2TA 4LAAA 2CKZB 2BA0A 3EBEA 3HS0C 1XMOL 2PNRC 1VQDA 3BZCA 4IWYA 3NK9A 4AYBE 4K8JA 1DV2A 2KCTA 1KD1C 4BY7G 5IP9G 4R4IA 1FNUA 1EFID 2PZTA 3TBIB 1Z2PX 3S2HB 1PK8A 5CC4A 1EWHA 3GQBA 2NZ1D 4YWMA 4RWSC 1VQ6A 2BDOA 4OWTB 5COYA 3WOEA 1G291 5I9PA 1STGA 2A6HC 5A35A 4O7RA 1HJPA 4POFA 1QZHA 2JA7H 1VDZA 3QQMA 3U4VA 2KUMA 4IUPA 5BN3A 2K01A 5I4DA 4P71A 5I5UA 2Y0SE 4O4HF 4WFN3 5IYBG 5JQWA 1A48A 2D0PA 1E22A 4HN7A 4JI5L 1UEBA 1SJED 1KJ9A 4CJ2C 5C3XA 2R93B 4K6NA 3GTGB 2F0SA 3D3RA 1DXMA 2F0OA 3Q23A 3E5NA 1PRTD 1O7YA 1IW7C 1T9HA 3TDQA 4C56C 1NR2A 1WCMH 2A19A 3ULPA 2I5MX 3OOCA 3L9AX 1XXGA 3HOXH 3C3LA 4LF7L 2QDBA 1GUNA 1U4MA 2NBFA 3PIO3 4YHHL 4FGRA 5JVLA 4F87A 1IBML 2R3ZA 2WKCA 1H9MA 2DUDA 5EJWA 3ER0A 1HZCA 3MTSA 3T9EA 1IBLL 1N34L 2B2UA 1LV9A 2HCIA 4DV4L 2MGSA 2MNAA 3RZDB 2NU9B 3T99A 2HVRA 1YNNC 2FHTA 5FLXc 4FXGC 2RF4A 1JT8A 4A3KG 4BS9A 4DR6Q 2R7NA 2HVSA 5JOBA 2W71A 1GLVA 2AUKA 3DWQA 1K3RA 1I4QA 2EY6A 2Q2IA 3D4DA 1YEZA 2CH4W 3N6RA 2NVTB 5BWRA 3CC7A 3W5OA 5I6WA 3SDZA 1LT4D 3KFUA 4BBSH 2AHOB 3K5HA 4IFDI 1RKNA 1WD0A 2PVPA 4X3SA 2B2YA 1KTKA 4FFOA 4LUOA 3AFQA 1KQSA 3I4MH 2FPGB 4K2KA 5C5LA 1I6HH 2NVYH 4JI0L 3KLSX 4KJOA 2BE5D 2F0KA 1TVXA 2CH4A 1QUQA 2COIA 5FLMH 5C4HA 4PV1C 2AQ2B 4O7TA 4RKBA 2N55A 2UUAQ 1HNXL 3RD4A 4DLKA 2Y4RA 1QOHA 1CHPD 4O42A 3RLFA 1Y1VH 2EXDA 2A5HA 1TAEA 1DM0B 2L4NA 4LF6L 3CCJA 1GUGA 4DAMA 5JEAJ 1TU2B 1ONLA 4TQUS 1VQCA 3QR8A 3IFTA 3PIOA 4M9UA 4FE2A 4O7YA 1XWEA 1FNVA 3JC66 2C5CA 2GVBA 2RBMA 1E1TA 3K0YA 4A3DG 4UCUA 3I56A 4I65A 1G8ZD 2AUJD 2JA5G 2KECA 1IL2A 1S5FD 4FFPA 3R8BA 3CF5A 2L11A 3E6ZX 4A3MH 2H5XA 1GUSA 5C0XI 3OHXC 1Z2OX 2JA7B 5LMNL 4L5SA 1VQIA 3MZ5A 1N36Q 4GN3B 5BPFA 2A68C 3K8AA 5BWTA 4R8NA 3TS0A 2IHEA 1DD2A 3HKZE 3NBZB 2F0TA 3GTJH 2Z4IA 1LUZA 4QB4A 4C2MB 5D8DA 3SE0A 2EJMA 1PZJD 4R4CA 2WB1G 1T36A 2PQAB 2KHSA 1HCZA 1YBYA 3V96A 1KL9A 1LT3D 5FJ8G 5HGTA 2WACA 1XYIA 3Q24A 3PF4A 2NVXB 3W1GA 1W6JA 4F7XA 1E4EA 1Y1WH 1EZ6A 1WCMB 2HIXA 1P8LA 5IT9L 4LFCQ 1WTXA 2R85A 3HOXB 4O7SA 4IJHA 4R9WA 2UXBL 2LFNA 4XQJA 3BG5A 3ONAB 1S5CD 1D1KA 4UAIA 4HIDA 1V1PA 1QJOA 1U4LA 4AQYQ 4NB3A 3SHLA 4JI6Q 5H80A 4R4TA 5KNCA 4G7OC 1KNAA 3HOWH 2F0QA 2QILA 2EXZA 2R7DA 5JPMC 1DOMA 3T1HL 4EGQA 1A8VA 5DMXA 5CGKA 4HR7A 5LP6F 2D62A 4YJ3F 5M3FH 4QUFA 1EU4A 2RHSB 2I07B 1Z2NX 1WOCA 3Q2OA 1M0TA 1VQ5A 2C9OA 5A2QE 4BBSB 3MXGA 1QUQB 2YWVA 4LK1C 3NUCA 2JEAI 3K59A 4IHJF 4L5TA 1AE2A 2K5DA 2NU6B 1FL0A 3R3OA 3PO2B 5EPJA 1PA6A 3V4ZA 5JJLA 1MIUA 1I6HB 4TV9F 1PRTF 3J81E 3T4AC 3S1RH 4UP9A 3CMAA 2DIKA 4K6LA 3VR3A 1I6VC 4L1KA 4ZLTF 1HQMC 1PYWD 2F4VL 2YU9H 3HEJA 5CMDA 4MV3A 2PI2A 1J9OA 1O7IA 2Q2HA 1PV4A 3TIGA 4HIOA 4I55F 2ZTEA 1NY4A 2PW7A 1LACA 4KD3A 2X69A 3G8CA 3D4RA 3JAMi 2WV6D 2K4KA 2NU8B 3C46A 3S2DH 1IYUA 3T9CA 1HZ9A 2QB5A 4ABNA 2ASBA 2AKWB 4JI2Q 2JA6G 1STEA 1TY0A 2FINB 1RIPA 3I4LA 1K8OA 4JI3L 5J2UF 1HPCA 3UE0A 2EE1A 4O7VA 3EN2A 1JMCA 1B8AA 1D6EC 2CVRA 4A3MB 2ZJQA 1H9JA 5C4ZA 1PTOC 1EUCB 4WHXA 4L6TB 4Q4DA 3CCMA 4Q4CA 3H3VI 3DF7A 1RJTA 1O80A 1OBGA 3NTHA 4K0KQ 1DAAA 4IZOA 1E4EB 2AQ3B 3GTJB 3RV4A 1L1OB 4MAMA 4A3FB 1BR9A 1V43A 3OWEB 3SK4A 2E2JH 2ZXRA 1G91A 5ELOA 4JI8Q 3RLNA 3JZ6A 5LMUL 1V1PB 5DM73 5IE8A 4PZ6A 4C3JB 4ZQ3A 1LYLA 1Y14B 5M5XH 2IX0A 3H0GG 2CCZA 3KF8A 4LF7Q 1Y1WB 1N33L 3TIIA 4O86A 1T5XD 2V59A 1ILQA 3VOTA 3E3XA 2CFMA 4YHHQ 5KKNB 2W6PA 3A8IE 2DABA 1EY6A 5FO7B 2AMCB 2QDLA 2K32A 1WVLA 1PFMA 4HR7B 4F88A 5JVG3 4DV0L 5C1PA 4DV4Q 5C4XH 1TWFB 3TP6A 4DV3L 1S68A 3HOWB 4C5AA 1D1IA 3GV3A 3Q22A 1SYCA 2GLTA 2RSNA 5C8YF 4XYOA 4FF2A 2IW3A 4O2AF 4C3IG 1HA5A 4OL7A 4XDXA 3BU2A 4P75A 3CCSA 2Q2TA 1EIGA 1K8MA 4KMUC 3VMMA 1E24A 1TS5A 4NXMQ 1G2WA 3TREA 5E3FA 4I7ZC 1STHA 5M3FB 1A0IA 4EQOA 2DLNA 2B39A 1A2UA 2V1CC 4KJNA 5EAYA 4UDUC 1EEFD 1FVIA 1AFPA 3TRZA 4DQNA 4TKOB 3FPUB 4JVZA 4CKBA 4YB8B 4B3SL 2KHIA 1OXUA 3KLRA 4DR2L 1EYCA 3RFCA 4OX9L 3CSWA 2VL6A 4IPDA 3W2DA 3QOLA 4LNQA 3KAJA 1HTPA 1KUTA 5I6YA 4B3TL 5DEHA 1PRTB 2ENBA 4FFLA 3S1RB 3A55A 1VQ4A 2F0VA 3OSOA 4BXXG 4NKLA 1QB5D 1U0LA 3GB8B 1SMYC 1CT1D 5F2DA 4DK0A 1QNUA 1XTDA 3KUPA 3A5UA 3J7AV 2AWOA 3NTIA 3CPWA 2NN6H 2YU9B 1XX8A 4BY1G 1DOLA 1VQMA 3HOZB 2GVAA 2KEDA 4KHPL 3GV6A 2K5HA 3K5LA 4FFMA 1SE8A 1BBXC 3WWJA 5BR8L 4KD4A 2A69D 1K9MC 3HOYH 4O4LF 4RZQA 3GLKA 1X3QA 2R7KA 4A93B 1PVOA 3EQLC 2XRSD 3KLWA 4NW2A 4DAYA 1PLFA 1YNJC 2E2HH 2ZTDA 3PUXA 2F0GA 3T1YQ 4JBWA 5HY6A 4R4OA 3KREA 4ODGA 4DR4Q 1O7LA 1B2TA 3CD6A 5C3EG 2YS7A 1QILA 1JICA 5IP9H 4BY7H 1EOVA 5ELEA 1B7YB 2N78A 1OO9B 3I90A 4NPSA 4UUGA 4QCLA 1X3GA 1RODA 3R23A 4YCVA 1ET9A 5J1ZA 3A8JE 1PFSA 5M5WB 1HR0Q 4WBNF 4Y52H 4XYQA 2L5TA 2HIVA 2PI2E 2E2JB 5DM63 4QMGA 2Q8TA 2TMPA 3RLOA 4A3BB 1D5MC 1FJGQ 2B63G 2LMCB 1GHKA 3DXJC 5M5XB 3L7ZC 4DN4M 1JQYD 4OIKA 3X3NA 5IYBH 3MFGA 4JI7L 5FPOA 3HOVB 3G71A 4WJ4A 4DUZL 3CP0A 2JA9A 2ZXPA 4LW1A 4IOCA 4ZOLF 2PO4A 4DR3L 3K7UC 4DAPA 4BA1I 3FKIG 1EQTA 1L0WA 5C4XB 3RUPA 3TQYA 3BAAA 2UUBQ 4LUVA 1ET6A 3K80C 2UXCL 2NVQH 1LTID 5D3IB 1KC7A 1X54A 4B3ML 3OUUA 4PMWA 2HVQA 2B2WC 2N49A 1H9SB 2A6ED 3CW2C 4WJ3M 2TSSA 2ZDHA 1HUNA 3Q8DA 2ZJRA 2DGYA 4LFBL 2D9UA 2DZDA 2F0DA 3HBLA 4KKTA 1XPUA 5CV4A 2EJFC 4A3KH 4OONA 2XWJB 2XN9C 3H09A 4GNXC 1UC9A 1M90C 2D5DA 4CC5A 5IOCA 2HGXA 2MHVA 5JQGF 5BPHA 3NENA 2W6MA 1UWVA 1E2VA 3T13A 2Z04A 4YJ2F 4JOIC 4P73A 1Q8KA 3S24A 4OHJA 3QG1A 4LF8Q 4GKJQ 3TY5A 1MSGA 4Y7NH 4HMJA 3M4OB 1KDBA 1CTMA 5CYUA 4DAYB 4LF5L 3SXHA 4MTNA 1GOZA 3NBIA 3GP7A 3NQTA 3CMEA 5I5YA 1Q82C 4FXDA 2VW9A 1TKWB 2XVSA 5A2QL 2WAQE 1JWUD 3LGJA 3S9WA 3OIQA 3HOYB 4JBJA 4DUYL 2QKIC 1YJNA 5EZYF 4DXFA 4YBZB 4DAVA 2WP8J 1NNXA 2B3GA 3TP7A 3BA9A 1U4RA 3VYSA 1MGSA 3UDXA 5JAVA 1WTRA 1SROA 5KS8A 4ZCKA 1B4OA 4NYEA 1DONA 2GN5A 3NE5B 1YHBA 3HOUG 3PV0A 4GS3A 3S1QH 3GTOB 4I50F 2VS1A 4A3JG 4BY7B 2H4OA 4A3DH 1I5FA 3ERSX 2JEBI 3OW7A 1UNSA 4KLKA 3QIAA 3AEVA 1J8IA 2JA5H 4WJWA 2E74C 4CGYB 4KKUA 3RN5A 2BH8A 4B3RQ 2EYMA 2I46A 2PN1A 4CMFA 5C44G 3MWEA 4YWLA 1GHJA 5LMUQ 2K14A 1MSHA 1B70B 1C0AA 1JCKB 3WO1A 2IX1A 3CXCA 2R7ZG 2B2TC 2EYHA 4DK1A 5K2MA 1S5ED 4DV1Q 1VQOA 1GSAA 5I47A 3LULA 3OIPA 4G7ZC 1IXRA 2EY1A 5LHY1 4JBMA 5CB4F 1PTOH 4M8AA 3PUZA 1D8LA 1YNXA 1EUJA 3LWUA 5FLXL 5FJ8H 4ME3A 1G2SA 1STYA 2F4IA 3TZUA 4DV0Q 2IHFA 5DAUA 2R92G 2YS6A 3R9RA 2ZGIA 1YHQA 2B2VA 5FO8B 1XJVA 4OO1G 4MZ9A 2L55A 5CBEE 4QQBX 3NC0B 1HNZQ 1UAPA 1TY2A 5KYIA 5IGCA 4MA5A 2E5LQ 2UUCQ 3WOFA 2CWPA 1JE5A 4LWCA 5FK9C 1KJJA 2VNUD 2NVQB 2CNQA 1ENFA 3UYYA 2CW0C 2PMZE 1GXDC 4YCUA 3CAMA 3R5HA 4ME6A 3Q1KA 2HJWA 1CHQD 4S3SA 3G7LA 1N32L 2W6QA 1JB7A 3SK8A 4CDEC 1P16A 2CWAA 2A8VA 5HURA 2J9GA 3NP8A 2R84A 3DUZA 4AYBG 3AQQA 1EFWA 2VUMG 4A3KB 3ERQA 4OEMB 1PMRA 4QIWE 3AB9A 1C3OA 1ZYRD 2MQHA 2EJGC 3QJYA 3ULJA 2SNMA 4IUVA 1SE4A 2EOTA 3J81c 2X0SA 2QA4A 2F0LA 3DEPA 1Z6HA 3CCUA 5CA0F 1JJCB 1BVSA 4EQNA 2EYLA 4CDDC 1VQLA 5LOVF 3KALA 2DY7A 2XRQD 5GAEC 2LKVA 2PPBC 2DY8A 3JZIA 2Y0SG 3NBHA 3NSWA 4PMCA 1EY8A 1TWCH 2O4XA 3BYYB 4N8X1 2W6ZA 1SAPA 3GJXB 3KDFB 3DTFA 2PQAA 4APVA 2AWNA 5AJ3Q 4EFEA 3K7AH 4LF9L 4NZMA 1EEID 1NE3A 3CU7A 3KOJA 3OMCA 1M6VA 5CV9A 1CK1A 5C1OA 3PMFA 1O7ZA 1DOKA 3Q6SA 5AFWA 3NPPA 2UU9Q 2RCNA 2X6GA 1TWHH 3S1QB 4ZK9B 1RTOA 1KLUD 4E6NA 4A3DB 2JA6H 1L2FA 1PX2A 2EIFA 4C5CA 2M00A 4O4JF 1IYDA 3A7LA 1R9TH 3J80c 3IKJA 1SCUB 3J7ZC 1X3PA 3DLLA 3VR5A 4H0LC 4AH6A 4JPBW 4IUUA 3I7FA 3U9OA 5DNFA 3I12A 1AZQA 1XNQL 1UEAB 1N9WA 4DV2L 1Y8NB 1CQFA 3D6WA 5CE8A 1A3UA 4C3HG 1VQEA 4O2DA 5I2XA 2WB1B 3JAME 1SYBA 3NWSA 1GVPA 3S15B 1Q1EA 1IYVA 4A3IG 3U54A 5C4JH 2A6HD 2DNEA 5CV6A 4X62Q 4A4IA 1IHZA 3RV3A 3J7AF 3H0GH 1AP0A 1BXRA 2SCUB 5JJZA 4CKCA 2YZGA 3KF6A 2JQOA 3R5FA 2A1AA 5EKIA 2VUGA 1K8GA 4O7WA 4U673 1Q3LA 2O2LD 1DJRD 4KK7A 1A63A 4OWWB 4WORA 1EL0A 1RCVD 4DV6L 1SE3A 2F0WA 1I94L 4KI0A 1PFBA 2ES2A 1JE4A 2R86A 1IW7D 1PH3A 2ZM6Q 4Y8VB 3L0OA 5CORA 4C3IH 4A3EG 2R82A 2FFKB 2NN6I 1Q90A 4C5BA 2EVBA 3FPPA 4FU0A 1CZGA 2LXKA 1LTGD 4X64Q 1AUVA 2K5VA 1QE6A 3K5OA 3NBHB 1J5EL 2SOBA 2YZNA 4LJZC 4JXUA 4IPCA 1S72A 1F2ZA 5GAHC 4XX0B 2B8FA 1YNND 3RR5A 2LSSA 3HRZC 5KYLA 3SK6A 3GTMH 1PH7A 3BDOA 2P0AA 2YW2A 3TEHB 1KLGD 1DYQA 1O78A 3HKZG 3LWEA 1A0GA 2HHFB 3CCEA 1SNPA 5ELCA 1L1OA 5M5YH 3BABA 3I2ZA 2PCFB 2B2WA 3MVVA 2FPPB 1A3TA 4BXXH 1GO3E 5FO9B 4K8IA 1WTHA 4O2BF 1KJ8A 1HNWQ 3E0EA 1NUCA 4HSVA 2EYPA 3HP3A 4QSHA 4MV8A 4YY3Q 2JN4A 1ASZA 2K7VA 3NXWA 4BY1H 3QB3A 4LF4Q 5CR5A 4LH6A 4UFZA 3UDGA 4RFBA 1SYFA 4X3KA 2EYOA 2KJXA 4RGNA 4FF1A 2KQ3A 1VQ7A 3QOJA 5CV7A 2VQEQ 4EEQA 5IYZF 1SEBD 1BQQT 1LT5D 3PSIA 4FVMA 1BNCA 3UFXB 4DV7L 1YI2A 2QK4A 5I5SA 1A3VA 2Z6KC 1EY4A 1JC7A 2ICEC 1SSOA 4K5XA 1TWHB 1B6RA 1WFQA 3VYRA 4YIJA 3LQSA 1A62A 1GKHA 3M3YH 2X5RA 1HZAA 1RTNA 3HFZB 4DF7A 1GD7A 5IGEA 4J8QA 1D5ZC 2ODTX 2LS01 5C3EH 3KJPA 2VQFQ 5EBCA 4DIMA 3QO2A 1TWAH 1MJCA 1G6PA 5KIXA 4DV5Q 5T1GA 3I4MB 5EKKA 3TINA 1EYZA 3GIDA 2NVYB 1ZAUA 1CA5A 4OIJA 1XMQL 2Q7DA 2F0JA 5BWVA 4FO2A 4EGVA 1KABA 1EQRA 3KF6B 2JK8A 3CRKC 3CC4A 2HHHQ 2MUYA 3VPDA 1IBKL 1VQNA 4DR1L 2YRXA 1V1OA 3T53B 5JVH3 2B63H 1KDCA 3CCQA 4P74A 1I7NA 1Y1VB 1MI2A 3J7YW 3H0GB 1DZ1A 1OXTA 2A68D 1XMOQ 5EKLA 3F2UA 2DWCA 3IAYA 1STNA 1KBLA 4FDBA 1LTTD 1YZ6A 2HQLA 2SDFA 5I5WA 1RF2D 5T1IA 3GDEA 1MKHA 5M3MG 5LMNW 3WWVA 3FKIH 3T9BA 1WJJA 3CCVA 1CI3M 2PW5A 2ZJPA 2I5LX 1OBDA 1BBWA 1GUOA 1X55A 2VY3A 2HDLA 1JLLB 4I4TF 2COJA 3K5IA 4C3IB 5BWXA 3PFFA 4V0BA 1CM9A 3PUYA 4X66L 2I80A 1BUVT 3FHWA 5DISC 4JK1C 3OTOL 1FNWA 2RSOA 5FNVF 2SNSA 1TXYA 2QW7A 2RDFA 4JCVE 3FEWX 4JI5Q 5FR9A 3JZFA 4JW0A 1ET0A 2GA4B 4ILWA 2IL8A 3J80E 2ZDQA 3U0GA 4NDXA 4XZ3B 4IUNA 4DR5L 5KNBA 3PO2G 1EIYB 5JEAG 2H1EA 2IP4A 1LLRD 4PZ8A 4IZ8A 4GNXB 3DAAA 1HFGA 4KHVA 3BZKA 1FGBD 5DLQE 4HJ7A 1IBMQ 1VQ9A 1F9QA 3NWTA 4CMDA 3E0JA 4YAJB 4A3GG 4LF9Q 4C1NK 4JI1L 4JV5L 1IBLQ 1NTGA 2OQ0A 2JE6I 1N34Q 1CQJB 2DN8A 1VMCA 2ABJA 2GQSA 4HJAA 4GN5A 1CA6A 1SNOA 2RA4A 4DPGA 2GPWA 4Q5VA 3JSNA 4TV8F 1EZ8A 2YTYA 5E4WC 4HN2A 3A56A 3STBC 1CKNB 1NR4A 4A3CG 1MBYA 4KY6A 5TSSA 4FFNA 3I4OA 2EJ2A 4JYAL 1CE8A 1H95A 1E7ZA 1LABA 5I9OA 1TS2A 4DGZA 5BYBA 5JVDF 1EY0A 3M3YB 5I5XA 3VYUA 5IP7G 1BCPC 1LTLA 3HOUH 4J15A 2Z0SA 5KRUA 5C3EB 4A3JH 3MXPA 1V8QA 1TA8A 1I4XA 1H9SA 2KEEA 2RVLA 3JSLA 1SJHD 3AYHB 4JI0Q 1D5XC 4DA2A 4E6IA 2XNAC 3NHHA 4IUQA 5IYDG 1E2WA 2HUGA 4M1UB 3S14H 5C44H 1SNMA 3HKSA 4HIKA 1HNXQ 1HTLD 3VA7A 1UC8A 5IGBA 4A3FG 2R7ZH 1NJIC 2R6GA 1KAWA 4A75A 2JA8G 2B63B 1JOOA 3U50C 1V9PA 3BYTB 4C3JG 1PTOD 1VS0A 4LF6Q 2FMMA 3A54A 1KJQA 1FYCA 2MO0A 1B50A 2Q8RE 2VXWA 2IX3A 1T5EA 2BA1A 5DGIA 2HT1A 1NMFA 2K28A 1ULZA 1QVCA 2R92H 1JDEA 1Q46A 1SNQA 4CDFC 3ND8A 4MNOA 4DV6Q 3S2DB 3ETHA 4OO1H 3BZDB 3B6YA 3I4NH 1TR5A 1ML0D 1KTAA 3FKIB 3HB9A 4XQNA 5I60A 3V05A 2B2YC 4IN3A 3EJIA 2G9DA 1RDPD 2F0EA 2FPIB 1GGOA 4LUZA 1DIKA 1F2LA 1TS3A 4R8IA 1HA6A 5LMNQ 4IPHA 3ULLA 1EOTA 1K0RA 3FVQA 2K04A 3MA2B 2XCLA 2V4DA 3PN1A 5G3LF 3RN2A 2VUMH 4CKEA 1BO0A 1W96A 4WRDA 3HZXA 1U5KA 4TRDA 2OCEA 2K50A 3QWNA 4DR6L 2HGSA 4UPAA 2RKSA 2KCNA 3TZDA 1F9SA 1SYEA 4CJ1B 1BKBA 1NSNS 3BVGA 4FFRA 3FDTA 3SVMA 2UXBQ 2ZTCA 1Z9FA 2F0IA 3HGBA 1IKLA 4XYLB 4HCEA 1WYDA 4O4IF 1KDAA 3RNUA 3ZYYX 3BG3A 3GO5A 5BMVF 2OF1A 2IWHA 3T1HQ 3U4ZA 4RCNA 3HOZG 2I87A 2V5AA 1UE5A 1SN8A 1RL2A 4QUCA 3R5XA 3ICEA 3CHBD 3VR6A 3BVMA 2JYOA 2VZAA 5FOBB 2DAAA 2Z02A 3OWFA 4KN4C 1IYJB 1SMYD 3WDNA 2UUAL 2NWGA 1KJIA 5FPRA 4A93G 2WKDA 4UHVA 5JJKA 1SLJA 4N8FA 3CRLC 5K36G 2KOLA 1SYGA 4YWKA 4RCOA 4Z9CB 1UE6A 4A3JB 4H7BA 2G9HD 2VR1A 4P72A 4UY8C 2F3VA 1M8AA 4JI4L 1QCBD 1I4PA 1PYSB 1XMQQ 1I2KA 5J39A 3T9AA 5IT9E 3SR1A 1YNJD 3JAMc 3U58A 1RD9D 2NUCA 2M2LA 2C00A 2EPBA 2F3WA 5C44B 2R7FA 3TMEA 2F4VQ 5J2TF 4I7AA 5D65A 4A3BG 4C3HH 3FRPB 4MN3A 3RMHA 4Q0FA 1PYBA 1N36L 3QWUA 4O7NA 5HBRB 3T54A 2JXMB 1EY9A 2D0OA 4GKKL 1KEEA 2ZXOA 1EQVA 1JDBB 3O13A 3KLSA 2PZUA 4A3IH 3HOVG 1DCZA 3GTGH 2HDMA 4TVIA 4DK3C 4HTPA 1PDQA 4GZYC 2K75A 4PZ7A 3UZBA 4IFDG 2E2HB 2L0CA 3KDFA 4JI3Q 2F0NA 2WAQG 3J81L 1EYAA 1CS0A 4EG0A 1NCVA 1WRVA 1SNCA 4LFCL 1JJ2A 3F1ZA 4HJ8A 2R7MA 3ND9A 4TM5A 4L8JA 1TT2A 2I0QA 4TVAB 3OTOQ 1VQAA 4O0AA 1Q12A 1QVGA 2HGWA 1F9RA 4YAKB 4HAEA 4DK6C 3URYA 3W3AA 2P5ZX 2XIWA 4IPGA 1RHPA 3ORRA 1TS4A 4AYBB 1SYDA 4P2CB 4A3EH 3G48A 1K28A 1VQGA 2Q8IB 5EQ0A 3V2TA 2J0TD 4DR5Q 1A6XA 1SXTA 3A74A 2LY7A 1PRTC 1FD7D 3T16A 1CKMA 1EWCA 1X56A 4OXPA 3J7A5 3I72A 1N33Q 3T56B 3BA8A 1YHAA 1Z47A 1PTOF 1X3EA 1ESRA 1ASYA 2K03A 4AIMA 3C2PA 3H6MA 5ELNA 1AN8A 4BBRG 4GOPC 3N52A 2OTLA 2MJ8A 3HG9A 1V1QA 1FGUA 1YJWA 3A0JA 2HCCA 4DV3Q 4A3LG 2Y0SB 3I4NG 5GONF 5IIFA 2W6OA 3R2IA 4X6AH 1S3OA 1I1KA 1PZID 3DWPA 4EFBA 4H02A 5C0XG 2UXDL 2EJ0A 3BVZA 1JOQA 3JRXA 3K58A 5CR3A 4O82A 4LH7A 3J80L 1Y8PB 1PH4A 2CHBD 5E4XA 4IWXA 4KKSA 4UCRA 3VPCA 2NB0A 1EY7A 4RA8A 1K8AC 3X3MA 2I8CA 3DM3A 4MV6A 4MV1A 1XTCD 2MO1A 2K6AA 1SDFA 2K52A 4B3SQ 3KYHC 2AQ1B 2JP1A 4DR2Q 1CQIB 1TIID 1VF5C 4OX9Q 3HO8A 4QJFA 3GTKH 4X3TA 1CZWA 1HFNA 4B3TQ 2OLSA 3VA5A 2F0HA 2BE5C 1VQJA 2DNCA 1NAPA 4JI2L 1B3AA 2J7ZA 4PNYA 3CKIB 1K83H 1SMXA 1A15A 1STBA 5DGHA 4EX5A 3F2CA 3NBYB 3PF5A 3WWHA 2WINB 2MFIA 3PO3G 1BCPF 2KBNA 4Y7NB 4OELB 1SE2A 1UE7A 4UCTA 3D4WA 1G51A 1PFNA 4KHPQ 1ICFB 4C3HB 5BR8Q 4ZKCB 4ALPA 4JBKA 5I5VA 2DJFC 3TN2A 4K0KL 1ZEQX 4C2MH 4LFAL 1PH8A 2EJ3A 1MJEA 3CPFA 5H1SE 4QF4A 5C6AA 4A3IB 2Z1CA 2FB9A 4GLWA 1VCIA 3T51B 3Q0AA 2ICIA 3GTLH 2HHFA 4IURA 4JI8L 1KT8A 2NVXH 2M9VA 3G8DA 2EY2A 2PZWA 4HSPA 1EIFA 1NMGA 3IRBA 4EVOA 4DRFA 5J3BA 2CQAA 4ZUJA 4O84A 5E25A 1XPRA 4O81A 4GN4B 1HUMA 3H94A 4IIJF 2OQKA 2PYKA 5M3MH 4TUYF 4DXGA 1Q7YC 1KRSA 2QGQA 4HEDA 4L5RC 1PH5A 1QNKA 2JA5B 3SEBA 4U68A 1KXLA 1I2LA 3RUZA 1G2TA 4XT3B 4NP5A 5EPKA 4A3EB 2IJ0A 2RHQB 1EY5A 3F8TA 3TQTA 2CW0D 1EU3A 3DWAA 1I3QH 4HQ6A 2E8GA 4JI7Q 5IGDA 4EQ5A 4NXML 1IOVA 1EKPA 1CSQA 4DUZQ 5CAEB 3I73A 1PTOB 3MHBA 3G6JB 2O5IC 1X9NA 1KNEA 4RMFA 1BXTA 4RKLA 2R93G 2JJQA 4DR3Q 3SNOA 3EVQA 3HKZB 3PO2H 1SBBB 5JEAH 5LL6X 3VR4A 2EIYA 2F0MA 2UXCQ 3L3OC 3ORQA 3GTPH 2E2DC 2RDGA 3VDYA 4ZAIA 4A3GH 3MAQA 2K5NA 4B3MQ 4ME5A 2OXPA 2HD3A 2QCPX 3EIVA 1UUPA 1XNRL 1X32A 4POGA 4LFBQ 1IL8A 1VKZA 3RZOH 4XIGS 2F52A 1H9RA 1UE1A 3C1EA 2K5QA 3BDLA 5M9OA 4ZI7F 4HIMA 4A3CH 5IWAL 3GTKB 1ENCA 4DR7L 2F0UA 3KJOA 2ATWA 5ELFA 1WTWA 4JI4Q 1EWIA 3ZJYC 3M85A 5IP7H 3PUVA 2EZVA 1I4GA 1PXUA 2D2CC 3VNNA 1BBUA 2LXJA 4ZQIA 2FXQA 1K83B 5JPNC 3RTXA 4HNVA 1WD1A 2G5DA 4B9WA 3AMUA 4OO1I 4MV4A 3UDIA 3T1YL 4LMQD 4K5WA 1IKMA 1CUKA 2WB1E 4FF4A 4DR4L 1JB3A 4X65L 2K1BA 4LF5Q 1BCPB 1I1LA 3R93A 1MD2D 3BS1A 1ICWA 1TWCB 5IYDH 2FMCA 3AW8A 4GKKQ 4J1MA 1HZBA 1OTCA 2YZLA 4A3FH 2ZDGA 2K05A 4DUYQ 5LYJF 1E3PA 3U55A 3I70A 1HR0L 3NUAA 2JA8H 4IUTA 3K7AB 1E2ZA 1VQHA 3GTLB 4CE5A 4C3JH 1JJGA 1SNDA 5BYAA 3H15A 4GNXA 5LXTF 1FJGL 1YITA 2F03A 2WYOA 1B04A 3T9FA 1VF7A 3N8DA 2K33A 3UZOA 2VB2X 3QFFA 4IQZA 3K5NA 4O7LA 3K81C 4MHEA 5GQOA 5M3MB 3OMGA 4KY7A 5J22A 2JA6B 2N3SA 3PQIA 1JWMD 2ZT9C 4JOIA 3U9TA 5K3WA 4R1JA 1ZKOA 1TWFH 3TY9A 1W2BA 1VMPA 1CKOA 2N8NA 1S40A 3MXNA 2QEXA 1WR2A 1PH9A 1R9TB 1BOSA 1CKNA 1OXXK 2UUBL 1LTSD 3L2PA 2EY5A 5ISRA 1WTVA 3VYTA 4FYDA 5G3LD 3G4SA 4FP5D 2A74C 1I3QB 2JA7G 2VQDA 3TSSA 3DHQA 1N8RC 1QG7A 1EHIA 2Z9HA 4J6HA 3SK5A 5E7NA 4RAUC 2YTVA 4KN7C 1KHIA 1X65A 3M9BA 4UCSA 1W6KA 1PH6A 2BH2A 1ENAA 4NXNL 5C4JB 4HNUA 1IZ6A 1M4VA 3H3VC 3BJUA 3F2DA 2OWOA 1II3A 4HNTA 1VBHA 3P7JA 1WCMG 2HQEA 4K5VA 2UXDQ 1JOKA 2IPKD 3GTPB 3HOXG 2HG8A 3VR2A 4HTOA 3P75A 4A3GB 1STAA 4CC6A 3S17H 1SRUA 4OGQC 5IGGA 3CQZH 5BN5A 2XD4A 1PHJA 3I8ZA 1N32Q 4BWGB 3NELA 4LF8L 1EYGA 4A76A 4GKJL 4HMIA 3HOZH 1E1OA 2A1HA 3SE7A 3KAKA 2B2TA 5CBAE 5JJIA 1OXVA 3RZOB 4QL5A 3E9IA 2Z4HA 1WTOA 2HDKA 1QWYA 1LO5D 4OWXB 1AUXA 2VB3X 4CHTB 4CDCC 4MIUA 5IODA 3A7AB 1CSPA 5D1PA 1JWSD 5BWWA 4M0JA 3H91A 3ITPA 5IY0A 4A93H 3OUZA 5KX5F 1GSHA 4X3UA 4DNIA 4JG2A 3KK7A 1I4HA 4GOPA 4L5QA 5IT9c 4FF3A 3LWBA 4QGUA 1S5BD 4KV6A 1GUTA 2CNVA 1SR3A 1Y69U 2NZHA 5K36H 2E75C 3NTKA 4N9TA 3F2BA 1D7QA 1VQPA 4BBSG 2KHJA 1YVCA 5FLXE 3GTMB 1HR0W 1LT6D 2B2VC 4HJ9A 2F0PA 2NZOA 2NYZD 2L1BA 4RGOS 1SFOH 3I4MG 3WO0A 1OXSC 4EQPA 3MEHA 5M5YB 3M4PA 3KBGA 1NBWA 2A69C 4LFAQ 5M5WH 2J4XA 2PQEA 2PBZA 1VQKA 4H44C 4FNFA 2QF7A 4IJLA 4N9PA 5FLMG 4B3RL 3TY8A 5CA1F 4BA2I 2B8GA 2JA8B 3I91A 1BNZA 1C9OA 4A3BH 3GTQH 4BY1B 1E0BA 1EQQA 2PNHA 4RGMA 3MJFA 1Y1VG 2C35B 3NQIA 4DV1L 2YYAA 3UQ8A 5ELDA 3MXNB 3HOVH 4QY7A 1F9PA 2R61A 2BCOA 3MWDA 1IOWA 3E5SA 1AZPA 2WFWA 4G57A 4L63B 4RHRA 4IFDH 5GADC 2YL2A 4FXKC 4XYMB 2V58A 1DGSA 5L37A 5EBDA 4ZRZA 3EFXD 2F0FA 3TW6A 3E9HA 1I4RA 4IALA 1HNZL 5HNEA 4DNTB 5NUCA 5ELBA 2E5LL 2UUCL 4CBVA 1TWAB 3BDCA 2YRWA 1B44D 5C3WA 2YYZA 5EPLA 1XNQQ 1JKJB 2YTXA 4DV2Q 4A3MG 4MA0A 3NEMA 1B9MA 2OT2A 1EYDA 1EKFA 1W93A 3FP9A 2ALYB 3MC0B 1L0YB 2MP1A 3PGZA 4IFDJ 1GJXA 2ID0A 3IFDA 3TP5A 4JC0A 1JORA 1HRJA 2B2UC 1FR3A 1DV1A 4MV7A 4IOAA 4ZHQF 1VQFA
chains in the Genus database with same CATH topology
2RHSB 4R4QA 3GTGH 1WOCA 4DK3C 3S1NH 1VQ5A 4HTPA 2UU9Q 2K75A 2I5HA 2RCNA 1QUQB 4PZ7A 1TWHH 1Y1WG 2JEAI 4IFDG 4BBRH 4E6NA 2JA6H 1L2FA 3KDFA 4JI3Q 4L5TA 1AE2A 2EIFA 2WAQG 1FL0A 1XNRQ 1PA6A 5JJLA 1I94Q 4LFCL 1JJ2A 3F1ZA 4HJ8A 1QVFA 1MIUA 1R9TH 4A3LH 3J80c 1VQ8A 4GOPB 3J7ZC 3S1RH 3M4OH 4YCWA 4UP9A 4AH6A 4TVAB 3OTOQ 3CMAA 1VQAA 4O0AA 1Q12A 3GD7A 1WI5A 1QVGA 4DK6C 3HOWG 3I7FA 4IPGA 5IYCH 3S16H 1XNQL 3D0FA 1N9WA 3J81i 4DV2L 5IWAQ 4A3EH 2F4VL 2YU9H 4DR7Q 3G48A 5AJ3L 1VQEA 4O2DA 1VQGA 2PI2A 1J6QA 5GAGC 1O7IA 2Q2HA 1PV4A 4DR5Q 4HIOA 1J5EQ 2ZTEA 3M7NA 3A74A 5M3FG 1GVPA 1NY4A 1Q1EA 3CCRA 3CC2A 4A3IG 1CKMA 4OXPA 1X56A 5C4JH 1XK5A 3J7A5 1N33Q 4X62Q 4A4IA 3JAMi 3BA8A 1YHAA 1Z47A 4UCVA 2K4KA 3H0GH 3K0XA 1X3EA 1ASYA 3S2DH 4AIMA 1M1KC 5C0XJ 5ELNA 3GTOH 3STBD 1HZ9A 4X65Q 4BBRG 4GOPC 2AKWB 4JI2Q 2OTLA 2ASBA 2UU9L 2JA6G 3KF6A 2JQOA 2A1AA 2VUGA 1K8GA 1RIPA 1V1QA 1FGUA 1YJWA 3A0JA 4DV3Q 4JI3L 4A3LG 3I4NG 3TS2A 3UE0A 4X6AH 1A63A 1S3OA 3G6EA 4JI6L 4OWWB 3KF8B 1I50H 3EN2A 2E2IH 4DV6L 1I94L 1JMCA 1B8AA 2ZJQA 4H02A 4KI0A 4EFBA 5C0XG 2ES2A 2UXDL 1XPOA 3PO3H 2IT1A 3CCMA 3H3VI 1PH3A 3S1MH 2ZM6Q 4LH7A 2XGTA 3L0OA 4K0KQ 1PH4A 1C7YA 4C3IH 4A3EG 1X3FA 1L1OB 2NN6I 1V43A 4UCRA 2E2JH 2OTJA 1K8AC 5ELOA 3DM3A 3W1BA 2LXKA 4X64Q 4DV7Q 2K5VA 4JI8Q 3RLNA 2MO1A 5LMUL 5IE8A 3NBHB 1J5EL 2K52A 4PZ6A 1LM0A 1LYLA 1TWGH 3KYHC 1Y14B 4DR2Q 4B3SQ 4IPCA 3J80i 5M5XH 1S72A 4OX9Q 5GAHC 1VQBA 2IX0A 4QJFA 3GTKH 3H0GG 2CCZA 3RR5A 4LF7Q 2LSSA 1N33L 2EQSA 4UP7A 4UCOA 4X62L 3GTMH 4B3TQ 2CQOA 2CFMA 4YHHQ 1PH7A 1VQJA 4PG3A 3TEHB 3HKZG 2IY5B 2AMCB 4JI2L 1K83H 3CCEA 3BABA 1L1OA 5M5YH 4DV0L 4DV4Q 3I2ZA 1SMXA 5D1OA 1L1OC 5C4XH 4EX5A 3F2CA 4DV3L 4BXXH 1S68A 3PF5A 1GO3E 3S2HH 3NBYB 1QZGA 2MFIA 3UDFA 2KCMA 3PO3G 2KBNA 1HNWQ 3E0EA 4UCTA 1UE7A 3J81j 4KHPQ 1G51A 2KENA 4YY3Q 1Q86C 1ASZA 5HGQA 1IBKQ 4DKAC 4DR1Q 4BY1H 3BU2A 4P75A 5BR8Q 3CCSA 4ALPA 2Q2TA 3CCLA 4JBKA 3UDGA 2ZM6L 4LF4Q 1KIXA 4LH6A 4UFZA 3I55A 4NXNQ 4K0KL 4C2MH 1E24A 4NXMQ 4LFAL 1PH8A 3TREA 3OYYA 1MJEA 1VQ7A 3CPFA 2VQEQ 5H1SE 1YIJA 4EEQA 1A0IA 4XTCS 1VCIA 3PSIA 2V1CC 5EAYA 2Z6KA 3GTLH 4DV7L 4X64L 1FVIA 1YI2A 3M4QA 4JI8L 2Z6KC 3TRZA 3PIPA 1X6OA 3PUWA 2NVXH 1HH2P 4B3SL 1WFQA 1OXUA 2KHIA 4DR2L 5GROA 2Q2UA 4OX9L 2R93H 1EIFA 2VL6A 1A62A 1NMGA 3IRBA 1GKHA 4IPDA 4LNQA 5J3BA 3M3YH 4DRFA 1HZAA 3HFZB 1GD7A 1XPRA 4B3TL 4GN4B 2OQKA 3KJPA 5M3MH 5C3EH 2VQFQ 3OW2A 1YJ9A 3TY8A 1TWAH 1MJCA 1Q7YC 1KRSA 2QGQA 1VQ4A 5C4XG 4L5RC 1G6PA 4BXXG 4DV5Q 1PH5A 1U0LA 3MEFA 3H3VH 4KHZA 3GB8B 3A5UA 1XTDA 1KXLA 4GLXA 4GLVB 4X66Q 1Q81C 2AWOA 3CPWA 1XMQL 1W3SA 4BY1G 2RHQB 4AQYL 1VQMA 1HNWL 2GVAA 4KHPL 1EQRA 2B29A 2JK8A 2K5HA 3F8TA 3D31A 3KF6B 1KRTA 4YY3L 2HHHQ 1SE8A 4RG1A 3RZDH 1IBKL 3CC4A 4DR1L 1VQNA 1I3QH 5BR8L 4LF4L 4GLAC 2E8GA 2B63H 4JI7Q 3CCQA 1K9MC 3HOYH 4P74A 4EQ5A 3SGIA 4NXML 1CSQA 2VQEL 4DUZQ 3A5ZB 1AH9A 1PVOA 1OXTA 3KLWA 2NVTH 1XMOQ 1X9NA 4FDBA 2E2HH 4RMFA 2R93G 2JJQA 1YZ6A 4DR3Q 3UE1A 2UXCQ 2HQLA 2ZTDA 3PUXA 2F3IA 3PO2H 3T1YQ 4JBWA 5HY6A 1XDNA 4R4OA 4DR4Q 3GDEA 3CD6A 1MKHA 5M3MG 5C3EG 5LMNW 3WWVA 4JI1Q 2L15A 5IP9H 1EOVA 3FKIH 4BY7H 3GTPH 1AE3A 1B7YB 1WJJA 2N78A 4NPSA 3VDYA 3CCVA 4A3GH 1X3GA 2K5NA 2VQFL 4IO9A 4B3MQ 2ZJPA 2I5LX 4YCVA 1BBWA 3EIVA 1X55A 2VY3A 1XNRL 4DV5L 1PFSA 1HR0Q 4POGA 2NN6G 4Y52H 4LFBQ 1Q1BA 3PUYA 2PI2E 2HIVA 3FHWA 4X66L 1PH2A 5DISC 3PCOB 3RZOH 5IYCG 3OTOL 4XIGS 2F52A 2YV5A 3RLOA 3S15H 1GM5A 1UE1A 2B63G 4UP8A 1FJGQ 1TXYA 2XTIA 3HOYG 4JCVE 2HHHL 4JI5Q 4JYAQ 5D1OB 3L7ZC 4HIMA 4A3CH 1PH1A 5IWAL 5IYBH 4JI7L 4DR7L 5FPOA 3KJOA 2ATWA 4HJ5A 1KC8C 3G71A 4WJ4A 4DUZL 4JI4Q 3CP0A 1EWIA 3AFPA 4DR5L 1K73C 2CKZB 2BA0A 3EBEA 3ZJYC 5IP7H 3PUVA 3M85A 2JA9A 4LW1A 1XMOL 3PO2G 1VQDA 3BZCA 3VNNA 4IOCA 1EIYB 1BBUA 4AYBE 2LXJA 5JEAG 2FXQA 4PZ8A 4GNXB 4DR3L 3RTXA 4OO1I 3K7UC 2KCTA 3UDIA 3T1YL 1KD1C 3BZKA 5IP9G 4R4IA 3FKIG 5DLQE 1CUKA 1L0WA 4BA1I 3TQYA 4HJ7A 1IBMQ 1VQ9A 3BAAA 2UUBQ 2WB1E 4LUVA 4DR4L 4X65L 4LF5Q 3K80C 4LF9Q 1VQ6A 4YWMA 4A3GG 2UXCL 4JI1L 2NVQH 1IBLQ 1NTGA 4OWTB 4JV5L 2OQ0A 2JE6I 1N34Q 1X54A 4B3ML 5IYDH 1G291 4HJAA 4GKKQ 4GN5A 1HZBA 4PMWA 2HVQA 2N49A 1OTCA 4DPGA 4A3FH 3CW2C 4WJ3M 1HJPA 4DUYQ 3JSNA 1E3PA 4POFA 1QZHA 1HR0L 3Q8DA 2JA7H 2ZJRA 2DGYA 2YTYA 3U4VA 2JA8H 4LFBL 1XPUA 3STBC 1CKNB 1VQHA 4A3KH 4OONA 4C3JH 1JJGA 4P71A 3H15A 2Y0SE 4GNXA 4A3CG 1FJGL 3I4OA 5IYBG 1YITA 4GNXC 1B04A 2D0PA 1E22A 4JI5L 1M90C 1UEBA 4JYAL 1H95A 4CC5A 1E7ZA 5IP7G 1LTLA 3K81C 3NENA 3HOUH 4J15A 1T9HA 2Z0SA 5GQOA 1UWVA 4A3JH 1WCMH 2A19A 3ULPA 2I5MX 2N3SA 1TA8A 4JOIA 3HOXH 4R1JA 3JSLA 4LF7L 1TWFH 3TY9A 3AYHB 4JOIC 4P73A 1W2BA 4JI0Q 1Q8KA 1CKOA 2N8NA 3S24A 1S40A 4LF8Q 2QEXA 1PH9A 4GKJQ 4YHHL 3TY5A 1IBML 4Y7NH 1CKNA 1OXXK 2UUBL 3L2PA 2DUDA 4DAYB 4LF5L 3ER0A 4MTNA 5IYDG 1HZCA 3S14H 1IBLL 5C44H 3HKSA 3CMEA 4HIKA 1N34L 1HNXQ 4DV4L 4A3FG 2MNAA 3G4SA 1Q82C 2VW9A 2R7ZH 1NJIC 2R6GA 2JA7G 2HVRA 1KAWA 2WAQE 3LGJA 4A75A 2JA8G 1N8RC 5FLXc 4JBJA 3U50C 2RF4A 1V9PA 4DUYL 1JT8A 4A3KG 1YJNA 4LF6Q 4DR6Q 1VS0A 2HVSA 2MO0A 5E7NA 1K3RA 2WP8J 2B3GA 1KHIA 2Q2IA 1X65A 2YTVA 3BA9A 1YEZA 3M9BA 4UCSA 1PH6A 2BA1A 3UDXA 3CC7A 4NXNL 2BH2A 1NMFA 2HT1A 3W5OA 1QVCA 1SROA 3HOVG 1IZ6A 2R92H 3BJUA 1Q46A 2GN5A 3F2DA 2OWOA 3KFUA 4MNOA 4BBSH 1YHBA 4DV6Q 3PV0A 4GS3A 3HOUG 2AHOB 3B6YA 3I4NH 3S1QH 2VS1A 4A3JG 2UXDQ 1WCMG 4IFDI 4A3DH 1I5FA 3HOXG 3ERSX 2JEBI 4KLKA 4HTOA 4LUOA 3AFQA 1KQSA 3AEVA 4CC6A 3I4MH 3S17H 1SRUA 2JA5H 3CQZH 1PHJA 1N32Q 3RN5A 1I6HH 2NVYH 2BH8A 4LUZA 4JI0L 4B3RQ 3NELA 4LF8L 5LMNQ 4A76A 1EYGA 4GKJL 4IPHA 3ULLA 5C44G 1E1OA 4YWLA 3HOZH 1QUQA 1K0RA 5LMUQ 2K14A 1B70B 1C0AA 5FLMH 5JJIA 2IX1A 1OXVA 4QL5A 3CXCA 3E9IA 2R7ZG 3PN1A 4OWXB 3RN2A 2UUAQ 1HNXL 4DV1Q 2VUMH 1VQOA 1CSPA 5D1PA 1U5KA 3RLFA 1IXRA 1Y1VH 2EXDA 4JBMA 5IY0A 4A93H 2OCEA 4DNIA 3PUZA 4JG2A 4GOPA 1TAEA 2K50A 4DR6L 1D8LA 1YNXA 4L5QA 5IT9c 1EUJA 3CCJA 4DAMA 4QGUA 4UPAA 4LF6L 5JEAJ 5FJ8H 4TQUS 1VQCA 4ME3A 1SR3A 2NZHA 3PIOA 4DV0Q 2R92G 2IHFA 1BKBA 3DLLA 3F2BA 1D7QA 1VQPA 4BBSG 1YHQA 2UXBQ 2KHJA 3JC66 1XJVA 4OO1G 1YVCA 2GVBA 4MZ9A 3NC0B 1HR0W 4QQBX 1HNZQ 4BY7G 1E1TA 4HJ9A 4A3DG 2NZOA 2ZTCA 4JV5Q 1Z9FA 2E5LQ 2UUCQ 4UCUA 2CWPA 1JE5A 4LWCA 3I56A 2VNUD 1SFOH 3I4MG 2JA5G 1WYDA 1OXSC 1IL2A 3RNUA 2PMZE 3M4PA 4YCUA 3CAMA 1NBWA 3GO5A 3CF5A 5M5WH 4LFAQ 3T1HQ 1VQKA 3U4ZA 4A3MH 3HOZG 1N32L 2H5XA 5C0XI 1JB7A 4IJLA 5FLMG 2A8VA 1P16A 2CWAA 1UE5A 1SN8A 1RL2A 4B3RL 5LMNL 4L5SA 1VQIA 1N36Q 3ICEA 4GN3B 4BA2I 3K8AA 1C9OA 4AYBG 2IHEA 3AQQA 3TS0A 3HKZE 3GTQH 4A3BH 1EFWA 3GTJH 2VUMG 3NBZB 2VZAA 4QIWE 1EQQA 2PNHA 5FPRA 1LUZA 1IYJB 1Y1VG 2C35B 2UUAL 2MQHA 4DV1L 4A93G 3UQ8A 3ULJA 4R4CA 2WB1G 3MXNB 2PQAB 3HOVH 5JJKA 1YBYA 4QY7A 1KL9A 5FJ8G 1SLJA 3J81c 2QA4A 5K36G 3PF4A 3CCUA 4YWKA 1JJCB 3W1GA 2WFWA 1Y1WH 1UE6A 5GADC 2HIXA 1BVSA 1P8LA 4LFCQ 1DGSA 4P72A 1VQLA 4IJHA 4UY8C 2UXBL 5GAEC 4HIDA 4JI4L 3E9HA 1HNZL 1PYSB 1XMQQ 4AQYQ 4NB3A 2Y0SG 2E5LL 3JAMc 2UUCL 3U58A 4JI6Q 1TWCH 4R4TA 2YYZA 1XNQQ 2YTXA 4DV2Q 3GJXB 4A3MG 3HOWH 2R7FA 3KDFB 2F4VQ 2PQAA 3NEMA 2R7DA 4APVA 2AWNA 5AJ3Q 3T1HL 4EFEA 1A8VA 3FP9A 3K7AH 4LF9L 4A3BG 2ALYB 2I0QA 4C3HH 3PGZA 4IFDJ 1PYBA 2ID0A 1N36L 4JC0A 3QWUA 1NE3A 2D62A 3KOJA 2D0OA 4GKKL 5M3FH 4IOAA 1VQFA 4A3IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHS B;  4R4Q A;  3GTG H;  1WOC A;  4DK3 C;  3S1N H;  1VQ5 A;  4HTP A;  2UU9 Q;  2K75 A;  2I5H A;  2RCN A;  1QUQ B;  4PZ7 A;  1TWH H;  1Y1W G;  2JEA I;  4IFD G;  4BBR H;  4E6N A;  2JA6 H;  1L2F A;  3KDF A;  4JI3 Q;  4L5T A;  1AE2 A;  2EIF A;  2WAQ G;  1FL0 A;  1XNR Q;  1PA6 A;  5JJL A;  1I94 Q;  4LFC L;  1JJ2 A;  3F1Z A;  4HJ8 A;  1QVF A;  1MIU A;  1R9T H;  4A3L H;  3J80 c;  1VQ8 A;  4GOP B;  3J7Z C;  3S1R H;  3M4O H;  4YCW A;  4UP9 A;  4AH6 A;  4TVA B;  3OTO Q;  3CMA A;  1VQA A;  4O0A A;  1Q12 A;  3GD7 A;  1WI5 A;  1QVG A;  4DK6 C;  3HOW G;  3I7F A;  4IPG A;  5IYC H;  3S16 H;  1XNQ L;  3D0F A;  1N9W A;  3J81 i;  4DV2 L;  5IWA Q;  4A3E H;  2F4V L;  2YU9 H;  4DR7 Q;  3G48 A;  5AJ3 L;  1VQE A;  4O2D A;  1VQG A;  2PI2 A;  1J6Q A;  5GAG C;  1O7I A;  2Q2H A;  1PV4 A;  4DR5 Q;  4HIO A;  1J5E Q;  2ZTE A;  3M7N A;  3A74 A;  5M3F G;  1GVP A;  1NY4 A;  1Q1E A;  3CCR A;  3CC2 A;  4A3I G;  1CKM A;  4OXP A;  1X56 A;  5C4J H;  1XK5 A;  3J7A 5;  1N33 Q;  4X62 Q;  4A4I A;  3JAM i;  3BA8 A;  1YHA A;  1Z47 A;  4UCV A;  2K4K A;  3H0G H;  3K0X A;  1X3E A;  1ASY A;  3S2D H;  4AIM A;  1M1K C;  5C0X J;  5ELN A;  3GTO H;  3STB D;  1HZ9 A;  4X65 Q;  4BBR G;  4GOP C;  2AKW B;  4JI2 Q;  2OTL A;  2ASB A;  2UU9 L;  2JA6 G;  3KF6 A;  2JQO A;  2A1A A;  2VUG A;  1K8G A;  1RIP A;  1V1Q A;  1FGU A;  1YJW A;  3A0J A;  4DV3 Q;  4JI3 L;  4A3L G;  3I4N G;  3TS2 A;  3UE0 A;  4X6A H;  1A63 A;  1S3O A;  3G6E A;  4JI6 L;  4OWW B;  3KF8 B;  1I50 H;  3EN2 A;  2E2I H;  4DV6 L;  1I94 L;  1JMC A;  1B8A A;  2ZJQ A;  4H02 A;  4KI0 A;  4EFB A;  5C0X G;  2ES2 A;  2UXD L;  1XPO A;  3PO3 H;  2IT1 A;  3CCM A;  3H3V I;  1PH3 A;  3S1M H;  2ZM6 Q;  4LH7 A;  2XGT A;  3L0O A;  4K0K Q;  1PH4 A;  1C7Y A;  4C3I H;  4A3E G;  1X3F A;  1L1O B;  2NN6 I;  1V43 A;  4UCR A;  2E2J H;  2OTJ A;  1K8A C;  5ELO A;  3DM3 A;  3W1B A;  2LXK A;  4X64 Q;  4DV7 Q;  2K5V A;  4JI8 Q;  3RLN A;  2MO1 A;  5LMU L;  5IE8 A;  3NBH B;  1J5E L;  2K52 A;  4PZ6 A;  1LM0 A;  1LYL A;  1TWG H;  3KYH C;  1Y14 B;  4DR2 Q;  4B3S Q;  4IPC A;  3J80 i;  5M5X H;  1S72 A;  4OX9 Q;  5GAH C;  1VQB A;  2IX0 A;  4QJF A;  3GTK H;  3H0G G;  2CCZ A;  3RR5 A;  4LF7 Q;  2LSS A;  1N33 L;  2EQS A;  4UP7 A;  4UCO A;  4X62 L;  3GTM H;  4B3T Q;  2CQO A;  2CFM A;  4YHH Q;  1PH7 A;  1VQJ A;  4PG3 A;  3TEH B;  3HKZ G;  2IY5 B;  2AMC B;  4JI2 L;  1K83 H;  3CCE A;  3BAB A;  1L1O A;  5M5Y H;  4DV0 L;  4DV4 Q;  3I2Z A;  1SMX A;  5D1O A;  1L1O C;  5C4X H;  4EX5 A;  3F2C A;  4DV3 L;  4BXX H;  1S68 A;  3PF5 A;  1GO3 E;  3S2H H;  3NBY B;  1QZG A;  2MFI A;  3UDF A;  2KCM A;  3PO3 G;  2KBN A;  1HNW Q;  3E0E A;  4UCT A;  1UE7 A;  3J81 j;  4KHP Q;  1G51 A;  2KEN A;  4YY3 Q;  1Q86 C;  1ASZ A;  5HGQ A;  1IBK Q;  4DKA C;  4DR1 Q;  4BY1 H;  3BU2 A;  4P75 A;  5BR8 Q;  3CCS A;  4ALP A;  2Q2T A;  3CCL A;  4JBK A;  3UDG A;  2ZM6 L;  4LF4 Q;  1KIX A;  4LH6 A;  4UFZ A;  3I55 A;  4NXN Q;  4K0K L;  4C2M H;  1E24 A;  4NXM Q;  4LFA L;  1PH8 A;  3TRE A;  3OYY A;  1MJE A;  1VQ7 A;  3CPF A;  2VQE Q;  5H1S E;  1YIJ A;  4EEQ A;  1A0I A;  4XTC S;  1VCI A;  3PSI A;  2V1C C;  5EAY A;  2Z6K A;  3GTL H;  4DV7 L;  4X64 L;  1FVI A;  1YI2 A;  3M4Q A;  4JI8 L;  2Z6K C;  3TRZ A;  3PIP A;  1X6O A;  3PUW A;  2NVX H;  1HH2 P;  4B3S L;  1WFQ A;  1OXU A;  2KHI A;  4DR2 L;  5GRO A;  2Q2U A;  4OX9 L;  2R93 H;  1EIF A;  2VL6 A;  1A62 A;  1NMG A;  3IRB A;  1GKH A;  4IPD A;  4LNQ A;  5J3B A;  3M3Y H;  4DRF A;  1HZA A;  3HFZ B;  1GD7 A;  1XPR A;  4B3T L;  4GN4 B;  2OQK A;  3KJP A;  5M3M H;  5C3E H;  2VQF Q;  3OW2 A;  1YJ9 A;  3TY8 A;  1TWA H;  1MJC A;  1Q7Y C;  1KRS A;  2QGQ A;  1VQ4 A;  5C4X G;  4L5R C;  1G6P A;  4BXX G;  4DV5 Q;  1PH5 A;  1U0L A;  3MEF A;  3H3V H;  4KHZ A;  3GB8 B;  3A5U A;  1XTD A;  1KXL A;  4GLX A;  4GLV B;  4X66 Q;  1Q81 C;  2AWO A;  3CPW A;  1XMQ L;  1W3S A;  4BY1 G;  2RHQ B;  4AQY L;  1VQM A;  1HNW L;  2GVA A;  4KHP L;  1EQR A;  2B29 A;  2JK8 A;  2K5H A;  3F8T A;  3D31 A;  3KF6 B;  1KRT A;  4YY3 L;  2HHH Q;  1SE8 A;  4RG1 A;  3RZD H;  1IBK L;  3CC4 A;  4DR1 L;  1VQN A;  1I3Q H;  5BR8 L;  4LF4 L;  4GLA C;  2E8G A;  2B63 H;  4JI7 Q;  3CCQ A;  1K9M C;  3HOY H;  4P74 A;  4EQ5 A;  3SGI A;  4NXM L;  1CSQ A;  2VQE L;  4DUZ Q;  3A5Z B;  1AH9 A;  1PVO A;  1OXT A;  3KLW A;  2NVT H;  1XMO Q;  1X9N A;  4FDB A;  2E2H H;  4RMF A;  2R93 G;  2JJQ A;  1YZ6 A;  4DR3 Q;  3UE1 A;  2UXC Q;  2HQL A;  2ZTD A;  3PUX A;  2F3I A;  3PO2 H;  3T1Y Q;  4JBW A;  5HY6 A;  1XDN A;  4R4O A;  4DR4 Q;  3GDE A;  3CD6 A;  1MKH A;  5M3M G;  5C3E G;  5LMN W;  3WWV A;  4JI1 Q;  2L15 A;  5IP9 H;  1EOV A;  3FKI H;  4BY7 H;  3GTP H;  1AE3 A;  1B7Y B;  1WJJ A;  2N78 A;  4NPS A;  3VDY A;  3CCV A;  4A3G H;  1X3G A;  2K5N A;  2VQF L;  4IO9 A;  4B3M Q;  2ZJP A;  2I5L X;  4YCV A;  1BBW A;  3EIV A;  1X55 A;  2VY3 A;  1XNR L;  4DV5 L;  1PFS A;  1HR0 Q;  4POG A;  2NN6 G;  4Y52 H;  4LFB Q;  1Q1B A;  3PUY A;  2PI2 E;  2HIV A;  3FHW A;  4X66 L;  1PH2 A;  5DIS C;  3PCO B;  3RZO H;  5IYC G;  3OTO L;  4XIG S;  2F52 A;  2YV5 A;  3RLO A;  3S15 H;  1GM5 A;  1UE1 A;  2B63 G;  4UP8 A;  1FJG Q;  1TXY A;  2XTI A;  3HOY G;  4JCV E;  2HHH L;  4JI5 Q;  4JYA Q;  5D1O B;  3L7Z C;  4HIM A;  4A3C H;  1PH1 A;  5IWA L;  5IYB H;  4JI7 L;  4DR7 L;  5FPO A;  3KJO A;  2ATW A;  4HJ5 A;  1KC8 C;  3G71 A;  4WJ4 A;  4DUZ L;  4JI4 Q;  3CP0 A;  1EWI A;  3AFP A;  4DR5 L;  1K73 C;  2CKZ B;  2BA0 A;  3EBE A;  3ZJY C;  5IP7 H;  3PUV A;  3M85 A;  2JA9 A;  4LW1 A;  1XMO L;  3PO2 G;  1VQD A;  3BZC A;  3VNN A;  4IOC A;  1EIY B;  1BBU A;  4AYB E;  2LXJ A;  5JEA G;  2FXQ A;  4PZ8 A;  4GNX B;  4DR3 L;  3RTX A;  4OO1 I;  3K7U C;  2KCT A;  3UDI A;  3T1Y L;  1KD1 C;  3BZK A;  5IP9 G;  4R4I A;  3FKI G;  5DLQ E;  1CUK A;  1L0W A;  4BA1 I;  3TQY A;  4HJ7 A;  1IBM Q;  1VQ9 A;  3BAA A;  2UUB Q;  2WB1 E;  4LUV A;  4DR4 L;  4X65 L;  4LF5 Q;  3K80 C;  4LF9 Q;  1VQ6 A;  4YWM A;  4A3G G;  2UXC L;  4JI1 L;  2NVQ H;  1IBL Q;  1NTG A;  4OWT B;  4JV5 L;  2OQ0 A;  2JE6 I;  1N34 Q;  1X54 A;  4B3M L;  5IYD H;  1G29 1;  4HJA A;  4GKK Q;  4GN5 A;  1HZB A;  4PMW A;  2HVQ A;  2N49 A;  1OTC A;  4DPG A;  4A3F H;  3CW2 C;  4WJ3 M;  1HJP A;  4DUY Q;  3JSN A;  1E3P A;  4POF A;  1QZH A;  1HR0 L;  3Q8D A;  2JA7 H;  2ZJR A;  2DGY A;  2YTY A;  3U4V A;  2JA8 H;  4LFB L;  1XPU A;  3STB C;  1CKN B;  1VQH A;  4A3K H;  4OON A;  4C3J H;  1JJG A;  4P71 A;  3H15 A;  2Y0S E;  4GNX A;  4A3C G;  1FJG L;  3I4O A;  5IYB G;  1YIT A;  4GNX C;  1B04 A;  2D0P A;  1E22 A;  4JI5 L;  1M90 C;  1UEB A;  4JYA L;  1H95 A;  4CC5 A;  1E7Z A;  5IP7 G;  1LTL A;  3K81 C;  3NEN A;  3HOU H;  4J15 A;  1T9H A;  2Z0S A;  5GQO A;  1UWV A;  4A3J H;  1WCM H;  2A19 A;  3ULP A;  2I5M X;  2N3S A;  1TA8 A;  4JOI A;  3HOX H;  4R1J A;  3JSL A;  4LF7 L;  1TWF H;  3TY9 A;  3AYH B;  4JOI C;  4P73 A;  1W2B A;  4JI0 Q;  1Q8K A;  1CKO A;  2N8N A;  3S24 A;  1S40 A;  4LF8 Q;  2QEX A;  1PH9 A;  4GKJ Q;  4YHH L;  3TY5 A;  1IBM L;  4Y7N H;  1CKN A;  1OXX K;  2UUB L;  3L2P A;  2DUD A;  4DAY B;  4LF5 L;  3ER0 A;  4MTN A;  5IYD G;  1HZC A;  3S14 H;  1IBL L;  5C44 H;  3HKS A;  3CME A;  4HIK A;  1N34 L;  1HNX Q;  4DV4 L;  4A3F G;  2MNA A;  3G4S A;  1Q82 C;  2VW9 A;  2R7Z H;  1NJI C;  2R6G A;  2JA7 G;  2HVR A;  1KAW A;  2WAQ E;  3LGJ A;  4A75 A;  2JA8 G;  1N8R C;  5FLX c;  4JBJ A;  3U50 C;  2RF4 A;  1V9P A;  4DUY L;  1JT8 A;  4A3K G;  1YJN A;  4LF6 Q;  4DR6 Q;  1VS0 A;  2HVS A;  2MO0 A;  5E7N A;  1K3R A;  2WP8 J;  2B3G A;  1KHI A;  2Q2I A;  1X65 A;  2YTV A;  3BA9 A;  1YEZ A;  3M9B A;  4UCS A;  1PH6 A;  2BA1 A;  3UDX A;  3CC7 A;  4NXN L;  2BH2 A;  1NMF A;  2HT1 A;  3W5O A;  1QVC A;  1SRO A;  3HOV G;  1IZ6 A;  2R92 H;  3BJU A;  1Q46 A;  2GN5 A;  3F2D A;  2OWO A;  3KFU A;  4MNO A;  4BBS H;  1YHB A;  4DV6 Q;  3PV0 A;  4GS3 A;  3HOU G;  2AHO B;  3B6Y A;  3I4N H;  3S1Q H;  2VS1 A;  4A3J G;  2UXD Q;  1WCM G;  4IFD I;  4A3D H;  1I5F A;  3HOX G;  3ERS X;  2JEB I;  4KLK A;  4HTO A;  4LUO A;  3AFQ A;  1KQS A;  3AEV A;  4CC6 A;  3I4M H;  3S17 H;  1SRU A;  2JA5 H;  3CQZ H;  1PHJ A;  1N32 Q;  3RN5 A;  1I6H H;  2NVY H;  2BH8 A;  4LUZ A;  4JI0 L;  4B3R Q;  3NEL A;  4LF8 L;  5LMN Q;  4A76 A;  1EYG A;  4GKJ L;  4IPH A;  3ULL A;  5C44 G;  1E1O A;  4YWL A;  3HOZ H;  1QUQ A;  1K0R A;  5LMU Q;  2K14 A;  1B70 B;  1C0A A;  5FLM H;  5JJI A;  2IX1 A;  1OXV A;  4QL5 A;  3CXC A;  3E9I A;  2R7Z G;  3PN1 A;  4OWX B;  3RN2 A;  2UUA Q;  1HNX L;  4DV1 Q;  2VUM H;  1VQO A;  1CSP A;  5D1P A;  1U5K A;  3RLF A;  1IXR A;  1Y1V H;  2EXD A;  4JBM A;  5IY0 A;  4A93 H;  2OCE A;  4DNI A;  3PUZ A;  4JG2 A;  4GOP A;  1TAE A;  2K50 A;  4DR6 L;  1D8L A;  1YNX A;  4L5Q A;  5IT9 c;  1EUJ A;  3CCJ A;  4DAM A;  4QGU A;  4UPA A;  4LF6 L;  5JEA J;  5FJ8 H;  4TQU S;  1VQC A;  4ME3 A;  1SR3 A;  2NZH A;  3PIO A;  4DV0 Q;  2R92 G;  2IHF A;  1BKB A;  3DLL A;  3F2B A;  1D7Q A;  1VQP A;  4BBS G;  1YHQ A;  2UXB Q;  2KHJ A;  3JC6 6;  1XJV A;  4OO1 G;  1YVC A;  2GVB A;  4MZ9 A;  3NC0 B;  1HR0 W;  4QQB X;  1HNZ Q;  4BY7 G;  1E1T A;  4HJ9 A;  4A3D G;  2NZO A;  2ZTC A;  4JV5 Q;  1Z9F A;  2E5L Q;  2UUC Q;  4UCU A;  2CWP A;  1JE5 A;  4LWC A;  3I56 A;  2VNU D;  1SFO H;  3I4M G;  2JA5 G;  1WYD A;  1OXS C;  1IL2 A;  3RNU A;  2PMZ E;  3M4P A;  4YCU A;  3CAM A;  1NBW A;  3GO5 A;  3CF5 A;  5M5W H;  4LFA Q;  3T1H Q;  1VQK A;  3U4Z A;  4A3M H;  3HOZ G;  1N32 L;  2H5X A;  5C0X I;  1JB7 A;  4IJL A;  5FLM G;  2A8V A;  1P16 A;  2CWA A;  1UE5 A;  1SN8 A;  1RL2 A;  4B3R L;  5LMN L;  4L5S A;  1VQI A;  1N36 Q;  3ICE A;  4GN3 B;  4BA2 I;  3K8A A;  1C9O A;  4AYB G;  2IHE A;  3AQQ A;  3TS0 A;  3HKZ E;  3GTQ H;  4A3B H;  1EFW A;  3GTJ H;  2VUM G;  3NBZ B;  2VZA A;  4QIW E;  1EQQ A;  2PNH A;  5FPR A;  1LUZ A;  1IYJ B;  1Y1V G;  2C35 B;  2UUA L;  2MQH A;  4DV1 L;  4A93 G;  3UQ8 A;  3ULJ A;  4R4C A;  2WB1 G;  3MXN B;  2PQA B;  3HOV H;  5JJK A;  1YBY A;  4QY7 A;  1KL9 A;  5FJ8 G;  1SLJ A;  3J81 c;  2QA4 A;  5K36 G;  3PF4 A;  3CCU A;  4YWK A;  1JJC B;  3W1G A;  2WFW A;  1Y1W H;  1UE6 A;  5GAD C;  2HIX A;  1BVS A;  1P8L A;  4LFC Q;  1DGS A;  4P72 A;  1VQL A;  4IJH A;  4UY8 C;  2UXB L;  5GAE C;  4HID A;  4JI4 L;  3E9H A;  1HNZ L;  1PYS B;  1XMQ Q;  4AQY Q;  4NB3 A;  2Y0S G;  2E5L L;  3JAM c;  2UUC L;  3U58 A;  4JI6 Q;  1TWC H;  4R4T A;  2YYZ A;  1XNQ Q;  2YTX A;  4DV2 Q;  3GJX B;  4A3M G;  3HOW H;  2R7F A;  3KDF B;  2F4V Q;  2PQA A;  3NEM A;  2R7D A;  4APV A;  2AWN A;  5AJ3 Q;  3T1H L;  4EFE A;  1A8V A;  3FP9 A;  3K7A H;  4LF9 L;  4A3B G;  2ALY B;  2I0Q A;  4C3H H;  3PGZ A;  4IFD J;  1PYB A;  2ID0 A;  1N36 L;  4JC0 A;  3QWU A;  1NE3 A;  2D62 A;  3KOJ A;  2D0O A;  4GKK L;  5M3F H;  4IOA A;  1VQF A;  4A3I H; 
#chains in the Genus database with same CATH topology
 4R4Q A;  1D2B A;  1IYE A;  2RDH A;  1M0W A;  3S1N H;  2I5H A;  4K2L A;  2FJ2 A;  1BDO A;  1Y1W G;  4CHI A;  1F2Y A;  4BBR H;  2A73 B;  4E4T A;  2DJG C;  1B3Q A;  1B53 A;  5C5M A;  4TSS A;  1XNR Q;  3DMU A;  1Y8O B;  3S17 B;  2QEJ C;  4PQX A;  2A6E C;  3CQZ B;  1I94 Q;  1QVF A;  4A3L H;  5I5T A;  3I3C A;  4CJ0 B;  3A8K E;  5KGU A;  4GOP B;  1VQ8 A;  4YCW A;  3M4O H;  3CEB A;  1K3B C;  3GD7 A;  1WI5 A;  5C0X H;  2N88 A;  3HOW G;  5D3D A;  2K5W A;  3TW7 A;  3S16 H;  5IYC H;  1R4P B;  3D0F A;  3J81 i;  2KVM A;  1CQV A;  3JAM L;  5IWA Q;  3U9S A;  4DR7 Q;  1PZK D;  1EIH A;  5AJ3 L;  4PMB A;  5GAG C;  1J6Q A;  1B9N A;  4B08 A;  1J5E Q;  3JRW A;  4HTH A;  1B1Z A;  3FMC A;  3M7N A;  5M3F G;  5LA6 F;  2NUA B;  3TP8 A;  1JR0 D;  3CCR A;  2NTS A;  2MPM A;  3CC2 A;  4V19 0;  5JH7 F;  1XK5 A;  3K5M A;  4ZUI A;  5HV6 A;  3DTG A;  4UCV A;  1I7L A;  3K0X A;  5DAA A;  1M1K C;  1LTB D;  5C0X J;  3GTO H;  3STB D;  4X65 Q;  3MWY W;  2UU9 L;  2W6N A;  1SFO B;  3UI2 A;  3OPO A;  3TS2 A;  3HT5 A;  1CFM A;  3LNN A;  3PIP 3;  2BDN A;  3G6E A;  1H9K A;  2JSO A;  3KF8 B;  1I50 H;  1I1M A;  2E2I H;  1HXY D;  4H13 C;  1BCP D;  4ZYS A;  1XPO A;  3PO3 H;  2KA7 A;  2IT1 A;  2RCF A;  3S1M H;  2X6L A;  3M7G A;  2XGT A;  4RGT A;  1C7Y A;  3GTQ B;  4C1N I;  3T7A A;  1X3F A;  3R2T A;  1F77 A;  2OTJ A;  4DV7 Q;  3W1B A;  2YZM A;  4DU9 A;  3P1H A;  1GUW A;  1ESF A;  4NZN A;  5EGT A;  3K6O A;  3D8G A;  1WTP A;  5K5P A;  1LM0 A;  1TWG H;  3J80 i;  1F2M A;  1C4Q A;  1VQB A;  4XT1 B;  1GSO A;  1MHW C;  2EQS A;  4UP7 A;  4UCO A;  2KCC A;  4X62 L;  1EKV A;  4EGJ A;  4F8M A;  2CQO A;  2WAQ B;  4ULL A;  4O1N A;  1TQO A;  4PG3 A;  3EA6 A;  2BOS A;  3HOU B;  2IY5 B;  2WII B;  1AEX A;  3M4Y A;  4NMZ A;  1L0X B;  2SEB D;  3LP8 A;  5D1O A;  1L1O C;  1C30 A;  1A9X A;  4ZKB B;  4RH6 A;  3S2H H;  3TEK A;  5E1F A;  1QZG A;  2L12 A;  3D6C A;  4ID6 A;  1HQR D;  3UDF A;  2KCM A;  1VBG A;  5BWU A;  3J81 j;  2KEN A;  1U4P A;  1Q86 C;  5HGQ A;  1IBK Q;  4DKA C;  4DR1 Q;  3S14 B;  3BAC A;  1U9R A;  3V4S A;  3CCL A;  1KAA A;  2GQR A;  2ZM6 L;  2NU7 B;  1KIX A;  3I55 A;  4NXN Q;  2R7Z B;  1B6S A;  3K3P A;  4G4K A;  3OYY A;  2FP4 B;  1YIJ A;  2VPQ A;  4XTC S;  2R87 A;  2Z6K A;  4X64 L;  1LTR D;  3VPB A;  3S1N B;  3M4Q A;  1ILP A;  1A3G A;  5BN4 A;  3PIP A;  4NZO A;  1X6O A;  3PUW A;  1EZ1 A;  1HH2 P;  2W70 A;  3KBX A;  4BBR B;  3K57 A;  5GRO A;  1ZXT A;  2Q2U A;  2R93 H;  3ERO A;  2R92 B;  4KY5 A;  3IL8 A;  4O7Z A;  3I4N B;  3OW2 A;  1YJ9 A;  5C4X G;  4MV9 A;  1R4Q B;  3MEF A;  3P20 A;  2RQX A;  3H3V H;  3ETJ A;  4KHZ A;  3S16 B;  1ZYR C;  4GLX A;  4GLV B;  4X66 Q;  1Q81 C;  4XQQ A;  2XWB B;  1W3S A;  4AQY L;  1HNW L;  4PBC A;  2B29 A;  4JI6 L;  4YY3 L;  3D31 A;  4HCS A;  2Z8L A;  1KRT A;  1C8C A;  4RG1 A;  3RZD H;  1G6Z A;  5IGF A;  2R7L A;  4LF4 L;  4GLA C;  5CV8 A;  5KEE A;  2VUM B;  4K14 A;  2PMZ B;  3AU7 A;  3SGI A;  4B9X A;  2VQE L;  2CZG A;  4DNR B;  3A5Z B;  1AH9 A;  1LTA D;  4KTA A;  3T9D A;  5LL6 S;  2NVT H;  1Q8I A;  2EYF A;  3DM1 A;  1S5D D;  2NTT A;  1BF4 A;  3C1F A;  3UE1 A;  1AW7 A;  2F3I A;  4MTK A;  4O83 A;  3MFY A;  4QIW B;  1XDN A;  5CV5 A;  2GPS A;  1Z7T A;  2L15 A;  1I50 B;  4JI1 Q;  4JV5 Q;  2E2I B;  1AE3 A;  4K6D A;  2VQF L;  2Z6B A;  1C48 A;  2OEO A;  4IO9 A;  3PO3 B;  3S1M B;  3AX6 A;  1S4Z A;  3DEO A;  2XSC A;  4DV5 L;  1HHV A;  2L9H A;  2E76 C;  5D14 A;  2NN6 G;  2EYJ A;  1Q1B A;  4RHS A;  2EDG A;  3WNZ A;  5FKA C;  1WTQ A;  3WWI A;  5I2Y A;  1PH2 A;  5CM0 A;  3MXU A;  3PCO B;  5IYC G;  2YV5 A;  5KND A;  3LX0 A;  3S15 H;  1GM5 A;  2F1M A;  4UP8 A;  2XTI A;  3HOY G;  2CNU A;  2HHH L;  2O5J C;  1TWG B;  4JYA Q;  1EUD B;  4G7H C;  5D1O B;  4DAA A;  1PH1 A;  1K0S A;  4HJ5 A;  1KC8 C;  4DFA A;  2COG A;  4XXE A;  3AFP A;  1K73 C;  1A2T A;  4LAA A;  2CKZ B;  2BA0 A;  3EBE A;  3HS0 C;  1XMO L;  2PNR C;  1VQD A;  3BZC A;  4IWY A;  3NK9 A;  4AYB E;  4K8J A;  1DV2 A;  2KCT A;  1KD1 C;  4BY7 G;  5IP9 G;  4R4I A;  1FNU A;  1EFI D;  2PZT A;  3TBI B;  1Z2P X;  3S2H B;  1PK8 A;  5CC4 A;  1EWH A;  3GQB A;  2NZ1 D;  4YWM A;  4RWS C;  1VQ6 A;  2BDO A;  4OWT B;  5COY A;  3WOE A;  1G29 1;  5I9P A;  1STG A;  2A6H C;  5A35 A;  4O7R A;  1HJP A;  4POF A;  1QZH A;  2JA7 H;  1VDZ A;  3QQM A;  3U4V A;  2KUM A;  4IUP A;  5BN3 A;  2K01 A;  5I4D A;  4P71 A;  5I5U A;  2Y0S E;  4O4H F;  4WFN 3;  5IYB G;  5JQW A;  1A48 A;  2D0P A;  1E22 A;  4HN7 A;  4JI5 L;  1UEB A;  1SJE D;  1KJ9 A;  4CJ2 C;  5C3X A;  2R93 B;  4K6N A;  3GTG B;  2F0S A;  3D3R A;  1DXM A;  2F0O A;  3Q23 A;  3E5N A;  1PRT D;  1O7Y A;  1IW7 C;  1T9H A;  3TDQ A;  4C56 C;  1NR2 A;  1WCM H;  2A19 A;  3ULP A;  2I5M X;  3OOC A;  3L9A X;  1XXG A;  3HOX H;  3C3L A;  4LF7 L;  2QDB A;  1GUN A;  1U4M A;  2NBF A;  3PIO 3;  4YHH L;  4FGR A;  5JVL A;  4F87 A;  1IBM L;  2R3Z A;  2WKC A;  1H9M A;  2DUD A;  5EJW A;  3ER0 A;  1HZC A;  3MTS A;  3T9E A;  1IBL L;  1N34 L;  2B2U A;  1LV9 A;  2HCI A;  4DV4 L;  2MGS A;  2MNA A;  3RZD B;  2NU9 B;  3T99 A;  2HVR A;  1YNN C;  2FHT A;  5FLX c;  4FXG C;  2RF4 A;  1JT8 A;  4A3K G;  4BS9 A;  4DR6 Q;  2R7N A;  2HVS A;  5JOB A;  2W71 A;  1GLV A;  2AUK A;  3DWQ A;  1K3R A;  1I4Q A;  2EY6 A;  2Q2I A;  3D4D A;  1YEZ A;  2CH4 W;  3N6R A;  2NVT B;  5BWR A;  3CC7 A;  3W5O A;  5I6W A;  3SDZ A;  1LT4 D;  3KFU A;  4BBS H;  2AHO B;  3K5H A;  4IFD I;  1RKN A;  1WD0 A;  2PVP A;  4X3S A;  2B2Y A;  1KTK A;  4FFO A;  4LUO A;  3AFQ A;  1KQS A;  3I4M H;  2FPG B;  4K2K A;  5C5L A;  1I6H H;  2NVY H;  4JI0 L;  3KLS X;  4KJO A;  2BE5 D;  2F0K A;  1TVX A;  2CH4 A;  1QUQ A;  2COI A;  5FLM H;  5C4H A;  4PV1 C;  2AQ2 B;  4O7T A;  4RKB A;  2N55 A;  2UUA Q;  1HNX L;  3RD4 A;  4DLK A;  2Y4R A;  1QOH A;  1CHP D;  4O42 A;  3RLF A;  1Y1V H;  2EXD A;  2A5H A;  1TAE A;  1DM0 B;  2L4N A;  4LF6 L;  3CCJ A;  1GUG A;  4DAM A;  5JEA J;  1TU2 B;  1ONL A;  4TQU S;  1VQC A;  3QR8 A;  3IFT A;  3PIO A;  4M9U A;  4FE2 A;  4O7Y A;  1XWE A;  1FNV A;  3JC6 6;  2C5C A;  2GVB A;  2RBM A;  1E1T A;  3K0Y A;  4A3D G;  4UCU A;  3I56 A;  4I65 A;  1G8Z D;  2AUJ D;  2JA5 G;  2KEC A;  1IL2 A;  1S5F D;  4FFP A;  3R8B A;  3CF5 A;  2L11 A;  3E6Z X;  4A3M H;  2H5X A;  1GUS A;  5C0X I;  3OHX C;  1Z2O X;  2JA7 B;  5LMN L;  4L5S A;  1VQI A;  3MZ5 A;  1N36 Q;  4GN3 B;  5BPF A;  2A68 C;  3K8A A;  5BWT A;  4R8N A;  3TS0 A;  2IHE A;  1DD2 A;  3HKZ E;  3NBZ B;  2F0T A;  3GTJ H;  2Z4I A;  1LUZ A;  4QB4 A;  4C2M B;  5D8D A;  3SE0 A;  2EJM A;  1PZJ D;  4R4C A;  2WB1 G;  1T36 A;  2PQA B;  2KHS A;  1HCZ A;  1YBY A;  3V96 A;  1KL9 A;  1LT3 D;  5FJ8 G;  5HGT A;  2WAC A;  1XYI A;  3Q24 A;  3PF4 A;  2NVX B;  3W1G A;  1W6J A;  4F7X A;  1E4E A;  1Y1W H;  1EZ6 A;  1WCM B;  2HIX A;  1P8L A;  5IT9 L;  4LFC Q;  1WTX A;  2R85 A;  3HOX B;  4O7S A;  4IJH A;  4R9W A;  2UXB L;  2LFN A;  4XQJ A;  3BG5 A;  3ONA B;  1S5C D;  1D1K A;  4UAI A;  4HID A;  1V1P A;  1QJO A;  1U4L A;  4AQY Q;  4NB3 A;  3SHL A;  4JI6 Q;  5H80 A;  4R4T A;  5KNC A;  4G7O C;  1KNA A;  3HOW H;  2F0Q A;  2QIL A;  2EXZ A;  2R7D A;  5JPM C;  1DOM A;  3T1H L;  4EGQ A;  1A8V A;  5DMX A;  5CGK A;  4HR7 A;  5LP6 F;  2D62 A;  4YJ3 F;  5M3F H;  4QUF A;  1EU4 A;  2RHS B;  2I07 B;  1Z2N X;  1WOC A;  3Q2O A;  1M0T A;  1VQ5 A;  2C9O A;  5A2Q E;  4BBS B;  3MXG A;  1QUQ B;  2YWV A;  4LK1 C;  3NUC A;  2JEA I;  3K59 A;  4IHJ F;  4L5T A;  1AE2 A;  2K5D A;  2NU6 B;  1FL0 A;  3R3O A;  3PO2 B;  5EPJ A;  1PA6 A;  3V4Z A;  5JJL A;  1MIU A;  1I6H B;  4TV9 F;  1PRT F;  3J81 E;  3T4A C;  3S1R H;  4UP9 A;  3CMA A;  2DIK A;  4K6L A;  3VR3 A;  1I6V C;  4L1K A;  4ZLT F;  1HQM C;  1PYW D;  2F4V L;  2YU9 H;  3HEJ A;  5CMD A;  4MV3 A;  2PI2 A;  1J9O A;  1O7I A;  2Q2H A;  1PV4 A;  3TIG A;  4HIO A;  4I55 F;  2ZTE A;  1NY4 A;  2PW7 A;  1LAC A;  4KD3 A;  2X69 A;  3G8C A;  3D4R A;  3JAM i;  2WV6 D;  2K4K A;  2NU8 B;  3C46 A;  3S2D H;  1IYU A;  3T9C A;  1HZ9 A;  2QB5 A;  4ABN A;  2ASB A;  2AKW B;  4JI2 Q;  2JA6 G;  1STE A;  1TY0 A;  2FIN B;  1RIP A;  3I4L A;  1K8O A;  4JI3 L;  5J2U F;  1HPC A;  3UE0 A;  2EE1 A;  4O7V A;  3EN2 A;  1JMC A;  1B8A A;  1D6E C;  2CVR A;  4A3M B;  2ZJQ A;  1H9J A;  5C4Z A;  1PTO C;  1EUC B;  4WHX A;  4L6T B;  4Q4D A;  3CCM A;  4Q4C A;  3H3V I;  3DF7 A;  1RJT A;  1O80 A;  1OBG A;  3NTH A;  4K0K Q;  1DAA A;  4IZO A;  1E4E B;  2AQ3 B;  3GTJ B;  3RV4 A;  1L1O B;  4MAM A;  4A3F B;  1BR9 A;  1V43 A;  3OWE B;  3SK4 A;  2E2J H;  2ZXR A;  1G91 A;  5ELO A;  4JI8 Q;  3RLN A;  3JZ6 A;  5LMU L;  1V1P B;  5DM7 3;  5IE8 A;  4PZ6 A;  4C3J B;  4ZQ3 A;  1LYL A;  1Y14 B;  5M5X H;  2IX0 A;  3H0G G;  2CCZ A;  3KF8 A;  4LF7 Q;  1Y1W B;  1N33 L;  3TII A;  4O86 A;  1T5X D;  2V59 A;  1ILQ A;  3VOT A;  3E3X A;  2CFM A;  4YHH Q;  5KKN B;  2W6P A;  3A8I E;  2DAB A;  1EY6 A;  5FO7 B;  2AMC B;  2QDL A;  2K32 A;  1WVL A;  1PFM A;  4HR7 B;  4F88 A;  5JVG 3;  4DV0 L;  5C1P A;  4DV4 Q;  5C4X H;  1TWF B;  3TP6 A;  4DV3 L;  1S68 A;  3HOW B;  4C5A A;  1D1I A;  3GV3 A;  3Q22 A;  1SYC A;  2GLT A;  2RSN A;  5C8Y F;  4XYO A;  4FF2 A;  2IW3 A;  4O2A F;  4C3I G;  1HA5 A;  4OL7 A;  4XDX A;  3BU2 A;  4P75 A;  3CCS A;  2Q2T A;  1EIG A;  1K8M A;  4KMU C;  3VMM A;  1E24 A;  1TS5 A;  4NXM Q;  1G2W A;  3TRE A;  5E3F A;  4I7Z C;  1STH A;  5M3F B;  1A0I A;  4EQO A;  2DLN A;  2B39 A;  1A2U A;  2V1C C;  4KJN A;  5EAY A;  4UDU C;  1EEF D;  1FVI A;  1AFP A;  3TRZ A;  4DQN A;  4TKO B;  3FPU B;  4JVZ A;  4CKB A;  4YB8 B;  4B3S L;  2KHI A;  1OXU A;  3KLR A;  4DR2 L;  1EYC A;  3RFC A;  4OX9 L;  3CSW A;  2VL6 A;  4IPD A;  3W2D A;  3QOL A;  4LNQ A;  3KAJ A;  1HTP A;  1KUT A;  5I6Y A;  4B3T L;  5DEH A;  1PRT B;  2ENB A;  4FFL A;  3S1R B;  3A55 A;  1VQ4 A;  2F0V A;  3OSO A;  4BXX G;  4NKL A;  1QB5 D;  1U0L A;  3GB8 B;  1SMY C;  1CT1 D;  5F2D A;  4DK0 A;  1QNU A;  1XTD A;  3KUP A;  3A5U A;  3J7A V;  2AWO A;  3NTI A;  3CPW A;  2NN6 H;  2YU9 B;  1XX8 A;  4BY1 G;  1DOL A;  1VQM A;  3HOZ B;  2GVA A;  2KED A;  4KHP L;  3GV6 A;  2K5H A;  3K5L A;  4FFM A;  1SE8 A;  1BBX C;  3WWJ A;  5BR8 L;  4KD4 A;  2A69 D;  1K9M C;  3HOY H;  4O4L F;  4RZQ A;  3GLK A;  1X3Q A;  2R7K A;  4A93 B;  1PVO A;  3EQL C;  2XRS D;  3KLW A;  4NW2 A;  4DAY A;  1PLF A;  1YNJ C;  2E2H H;  2ZTD A;  3PUX A;  2F0G A;  3T1Y Q;  4JBW A;  5HY6 A;  4R4O A;  3KRE A;  4ODG A;  4DR4 Q;  1O7L A;  1B2T A;  3CD6 A;  5C3E G;  2YS7 A;  1QIL A;  1JIC A;  5IP9 H;  4BY7 H;  1EOV A;  5ELE A;  1B7Y B;  2N78 A;  1OO9 B;  3I90 A;  4NPS A;  4UUG A;  4QCL A;  1X3G A;  1ROD A;  3R23 A;  4YCV A;  1ET9 A;  5J1Z A;  3A8J E;  1PFS A;  5M5W B;  1HR0 Q;  4WBN F;  4Y52 H;  4XYQ A;  2L5T A;  2HIV A;  2PI2 E;  2E2J B;  5DM6 3;  4QMG A;  2Q8T A;  2TMP A;  3RLO A;  4A3B B;  1D5M C;  1FJG Q;  2B63 G;  2LMC B;  1GHK A;  3DXJ C;  5M5X B;  3L7Z C;  4DN4 M;  1JQY D;  4OIK A;  3X3N A;  5IYB H;  3MFG A;  4JI7 L;  5FPO A;  3HOV B;  3G71 A;  4WJ4 A;  4DUZ L;  3CP0 A;  2JA9 A;  2ZXP A;  4LW1 A;  4IOC A;  4ZOL F;  2PO4 A;  4DR3 L;  3K7U C;  4DAP A;  4BA1 I;  3FKI G;  1EQT A;  1L0W A;  5C4X B;  3RUP A;  3TQY A;  3BAA A;  2UUB Q;  4LUV A;  1ET6 A;  3K80 C;  2UXC L;  2NVQ H;  1LTI D;  5D3I B;  1KC7 A;  1X54 A;  4B3M L;  3OUU A;  4PMW A;  2HVQ A;  2B2W C;  2N49 A;  1H9S B;  2A6E D;  3CW2 C;  4WJ3 M;  2TSS A;  2ZDH A;  1HUN A;  3Q8D A;  2ZJR A;  2DGY A;  4LFB L;  2D9U A;  2DZD A;  2F0D A;  3HBL A;  4KKT A;  1XPU A;  5CV4 A;  2EJF C;  4A3K H;  4OON A;  2XWJ B;  2XN9 C;  3H09 A;  4GNX C;  1UC9 A;  1M90 C;  2D5D A;  4CC5 A;  5IOC A;  2HGX A;  2MHV A;  5JQG F;  5BPH A;  3NEN A;  2W6M A;  1UWV A;  1E2V A;  3T13 A;  2Z04 A;  4YJ2 F;  4JOI C;  4P73 A;  1Q8K A;  3S24 A;  4OHJ A;  3QG1 A;  4LF8 Q;  4GKJ Q;  3TY5 A;  1MSG A;  4Y7N H;  4HMJ A;  3M4O B;  1KDB A;  1CTM A;  5CYU A;  4DAY B;  4LF5 L;  3SXH A;  4MTN A;  1GOZ A;  3NBI A;  3GP7 A;  3NQT A;  3CME A;  5I5Y A;  1Q82 C;  4FXD A;  2VW9 A;  1TKW B;  2XVS A;  5A2Q L;  2WAQ E;  1JWU D;  3LGJ A;  3S9W A;  3OIQ A;  3HOY B;  4JBJ A;  4DUY L;  2QKI C;  1YJN A;  5EZY F;  4DXF A;  4YBZ B;  4DAV A;  2WP8 J;  1NNX A;  2B3G A;  3TP7 A;  3BA9 A;  1U4R A;  3VYS A;  1MGS A;  3UDX A;  5JAV A;  1WTR A;  1SRO A;  5KS8 A;  4ZCK A;  1B4O A;  4NYE A;  1DON A;  2GN5 A;  3NE5 B;  1YHB A;  3HOU G;  3PV0 A;  4GS3 A;  3S1Q H;  3GTO B;  4I50 F;  2VS1 A;  4A3J G;  4BY7 B;  2H4O A;  4A3D H;  1I5F A;  3ERS X;  2JEB I;  3OW7 A;  1UNS A;  4KLK A;  3QIA A;  3AEV A;  1J8I A;  2JA5 H;  4WJW A;  2E74 C;  4CGY B;  4KKU A;  3RN5 A;  2BH8 A;  4B3R Q;  2EYM A;  2I46 A;  2PN1 A;  4CMF A;  5C44 G;  3MWE A;  4YWL A;  1GHJ A;  5LMU Q;  2K14 A;  1MSH A;  1B70 B;  1C0A A;  1JCK B;  3WO1 A;  2IX1 A;  3CXC A;  2R7Z G;  2B2T C;  2EYH A;  4DK1 A;  5K2M A;  1S5E D;  4DV1 Q;  1VQO A;  1GSA A;  5I47 A;  3LUL A;  3OIP A;  4G7Z C;  1IXR A;  2EY1 A;  5LHY 1;  4JBM A;  5CB4 F;  1PTO H;  4M8A A;  3PUZ A;  1D8L A;  1YNX A;  1EUJ A;  3LWU A;  5FLX L;  5FJ8 H;  4ME3 A;  1G2S A;  1STY A;  2F4I A;  3TZU A;  4DV0 Q;  2IHF A;  5DAU A;  2R92 G;  2YS6 A;  3R9R A;  2ZGI A;  1YHQ A;  2B2V A;  5FO8 B;  1XJV A;  4OO1 G;  4MZ9 A;  2L55 A;  5CBE E;  4QQB X;  3NC0 B;  1HNZ Q;  1UAP A;  1TY2 A;  5KYI A;  5IGC A;  4MA5 A;  2E5L Q;  2UUC Q;  3WOF A;  2CWP A;  1JE5 A;  4LWC A;  5FK9 C;  1KJJ A;  2VNU D;  2NVQ B;  2CNQ A;  1ENF A;  3UYY A;  2CW0 C;  2PMZ E;  1GXD C;  4YCU A;  3CAM A;  3R5H A;  4ME6 A;  3Q1K A;  2HJW A;  1CHQ D;  4S3S A;  3G7L A;  1N32 L;  2W6Q A;  1JB7 A;  3SK8 A;  4CDE C;  1P16 A;  2CWA A;  2A8V A;  5HUR A;  2J9G A;  3NP8 A;  2R84 A;  3DUZ A;  4AYB G;  3AQQ A;  1EFW A;  2VUM G;  4A3K B;  3ERQ A;  4OEM B;  1PMR A;  4QIW E;  3AB9 A;  1C3O A;  1ZYR D;  2MQH A;  2EJG C;  3QJY A;  3ULJ A;  2SNM A;  4IUV A;  1SE4 A;  2EOT A;  3J81 c;  2X0S A;  2QA4 A;  2F0L A;  3DEP A;  1Z6H A;  3CCU A;  5CA0 F;  1JJC B;  1BVS A;  4EQN A;  2EYL A;  4CDD C;  1VQL A;  5LOV F;  3KAL A;  2DY7 A;  2XRQ D;  5GAE C;  2LKV A;  2PPB C;  2DY8 A;  3JZI A;  2Y0S G;  3NBH A;  3NSW A;  4PMC A;  1EY8 A;  1TWC H;  2O4X A;  3BYY B;  4N8X 1;  2W6Z A;  1SAP A;  3GJX B;  3KDF B;  3DTF A;  2PQA A;  4APV A;  2AWN A;  5AJ3 Q;  4EFE A;  3K7A H;  4LF9 L;  4NZM A;  1EEI D;  1NE3 A;  3CU7 A;  3KOJ A;  3OMC A;  1M6V A;  5CV9 A;  1CK1 A;  5C1O A;  3PMF A;  1O7Z A;  1DOK A;  3Q6S A;  5AFW A;  3NPP A;  2UU9 Q;  2RCN A;  2X6G A;  1TWH H;  3S1Q B;  4ZK9 B;  1RTO A;  1KLU D;  4E6N A;  4A3D B;  2JA6 H;  1L2F A;  1PX2 A;  2EIF A;  4C5C A;  2M00 A;  4O4J F;  1IYD A;  3A7L A;  1R9T H;  3J80 c;  3IKJ A;  1SCU B;  3J7Z C;  1X3P A;  3DLL A;  3VR5 A;  4H0L C;  4AH6 A;  4JPB W;  4IUU A;  3I7F A;  3U9O A;  5DNF A;  3I12 A;  1AZQ A;  1XNQ L;  1UEA B;  1N9W A;  4DV2 L;  1Y8N B;  1CQF A;  3D6W A;  5CE8 A;  1A3U A;  4C3H G;  1VQE A;  4O2D A;  5I2X A;  2WB1 B;  3JAM E;  1SYB A;  3NWS A;  1GVP A;  3S15 B;  1Q1E A;  1IYV A;  4A3I G;  3U54 A;  5C4J H;  2A6H D;  2DNE A;  5CV6 A;  4X62 Q;  4A4I A;  1IHZ A;  3RV3 A;  3J7A F;  3H0G H;  1AP0 A;  1BXR A;  2SCU B;  5JJZ A;  4CKC A;  2YZG A;  3KF6 A;  2JQO A;  3R5F A;  2A1A A;  5EKI A;  2VUG A;  1K8G A;  4O7W A;  4U67 3;  1Q3L A;  2O2L D;  1DJR D;  4KK7 A;  1A63 A;  4OWW B;  4WOR A;  1EL0 A;  1RCV D;  4DV6 L;  1SE3 A;  2F0W A;  1I94 L;  4KI0 A;  1PFB A;  2ES2 A;  1JE4 A;  2R86 A;  1IW7 D;  1PH3 A;  2ZM6 Q;  4Y8V B;  3L0O A;  5COR A;  4C3I H;  4A3E G;  2R82 A;  2FFK B;  2NN6 I;  1Q90 A;  4C5B A;  2EVB A;  3FPP A;  4FU0 A;  1CZG A;  2LXK A;  1LTG D;  4X64 Q;  1AUV A;  2K5V A;  1QE6 A;  3K5O A;  3NBH B;  1J5E L;  2SOB A;  2YZN A;  4LJZ C;  4JXU A;  4IPC A;  1S72 A;  1F2Z A;  5GAH C;  4XX0 B;  2B8F A;  1YNN D;  3RR5 A;  2LSS A;  3HRZ C;  5KYL A;  3SK6 A;  3GTM H;  1PH7 A;  3BDO A;  2P0A A;  2YW2 A;  3TEH B;  1KLG D;  1DYQ A;  1O78 A;  3HKZ G;  3LWE A;  1A0G A;  2HHF B;  3CCE A;  1SNP A;  5ELC A;  1L1O A;  5M5Y H;  3BAB A;  3I2Z A;  2PCF B;  2B2W A;  3MVV A;  2FPP B;  1A3T A;  4BXX H;  1GO3 E;  5FO9 B;  4K8I A;  1WTH A;  4O2B F;  1KJ8 A;  1HNW Q;  3E0E A;  1NUC A;  4HSV A;  2EYP A;  3HP3 A;  4QSH A;  4MV8 A;  4YY3 Q;  2JN4 A;  1ASZ A;  2K7V A;  3NXW A;  4BY1 H;  3QB3 A;  4LF4 Q;  5CR5 A;  4LH6 A;  4UFZ A;  3UDG A;  4RFB A;  1SYF A;  4X3K A;  2EYO A;  2KJX A;  4RGN A;  4FF1 A;  2KQ3 A;  1VQ7 A;  3QOJ A;  5CV7 A;  2VQE Q;  4EEQ A;  5IYZ F;  1SEB D;  1BQQ T;  1LT5 D;  3PSI A;  4FVM A;  1BNC A;  3UFX B;  4DV7 L;  1YI2 A;  2QK4 A;  5I5S A;  1A3V A;  2Z6K C;  1EY4 A;  1JC7 A;  2ICE C;  1SSO A;  4K5X A;  1TWH B;  1B6R A;  1WFQ A;  3VYR A;  4YIJ A;  3LQS A;  1A62 A;  1GKH A;  3M3Y H;  2X5R A;  1HZA A;  1RTN A;  3HFZ B;  4DF7 A;  1GD7 A;  5IGE A;  4J8Q A;  1D5Z C;  2ODT X;  2LS0 1;  5C3E H;  3KJP A;  2VQF Q;  5EBC A;  4DIM A;  3QO2 A;  1TWA H;  1MJC A;  1G6P A;  5KIX A;  4DV5 Q;  5T1G A;  3I4M B;  5EKK A;  3TIN A;  1EYZ A;  3GID A;  2NVY B;  1ZAU A;  1CA5 A;  4OIJ A;  1XMQ L;  2Q7D A;  2F0J A;  5BWV A;  4FO2 A;  4EGV A;  1KAB A;  1EQR A;  3KF6 B;  2JK8 A;  3CRK C;  3CC4 A;  2HHH Q;  2MUY A;  3VPD A;  1IBK L;  1VQN A;  4DR1 L;  2YRX A;  1V1O A;  3T53 B;  5JVH 3;  2B63 H;  1KDC A;  3CCQ A;  4P74 A;  1I7N A;  1Y1V B;  1MI2 A;  3J7Y W;  3H0G B;  1DZ1 A;  1OXT A;  2A68 D;  1XMO Q;  5EKL A;  3F2U A;  2DWC A;  3IAY A;  1STN A;  1KBL A;  4FDB A;  1LTT D;  1YZ6 A;  2HQL A;  2SDF A;  5I5W A;  1RF2 D;  5T1I A;  3GDE A;  1MKH A;  5M3M G;  5LMN W;  3WWV A;  3FKI H;  3T9B A;  1WJJ A;  3CCV A;  1CI3 M;  2PW5 A;  2ZJP A;  2I5L X;  1OBD A;  1BBW A;  1GUO A;  1X55 A;  2VY3 A;  2HDL A;  1JLL B;  4I4T F;  2COJ A;  3K5I A;  4C3I B;  5BWX A;  3PFF A;  4V0B A;  1CM9 A;  3PUY A;  4X66 L;  2I80 A;  1BUV T;  3FHW A;  5DIS C;  4JK1 C;  3OTO L;  1FNW A;  2RSO A;  5FNV F;  2SNS A;  1TXY A;  2QW7 A;  2RDF A;  4JCV E;  3FEW X;  4JI5 Q;  5FR9 A;  3JZF A;  4JW0 A;  1ET0 A;  2GA4 B;  4ILW A;  2IL8 A;  3J80 E;  2ZDQ A;  3U0G A;  4NDX A;  4XZ3 B;  4IUN A;  4DR5 L;  5KNB A;  3PO2 G;  1EIY B;  5JEA G;  2H1E A;  2IP4 A;  1LLR D;  4PZ8 A;  4IZ8 A;  4GNX B;  3DAA A;  1HFG A;  4KHV A;  3BZK A;  1FGB D;  5DLQ E;  4HJ7 A;  1IBM Q;  1VQ9 A;  1F9Q A;  3NWT A;  4CMD A;  3E0J A;  4YAJ B;  4A3G G;  4LF9 Q;  4C1N K;  4JI1 L;  4JV5 L;  1IBL Q;  1NTG A;  2OQ0 A;  2JE6 I;  1N34 Q;  1CQJ B;  2DN8 A;  1VMC A;  2ABJ A;  2GQS A;  4HJA A;  4GN5 A;  1CA6 A;  1SNO A;  2RA4 A;  4DPG A;  2GPW A;  4Q5V A;  3JSN A;  4TV8 F;  1EZ8 A;  2YTY A;  5E4W C;  4HN2 A;  3A56 A;  3STB C;  1CKN B;  1NR4 A;  4A3C G;  1MBY A;  4KY6 A;  5TSS A;  4FFN A;  3I4O A;  2EJ2 A;  4JYA L;  1CE8 A;  1H95 A;  1E7Z A;  1LAB A;  5I9O A;  1TS2 A;  4DGZ A;  5BYB A;  5JVD F;  1EY0 A;  3M3Y B;  5I5X A;  3VYU A;  5IP7 G;  1BCP C;  1LTL A;  3HOU H;  4J15 A;  2Z0S A;  5KRU A;  5C3E B;  4A3J H;  3MXP A;  1V8Q A;  1TA8 A;  1I4X A;  1H9S A;  2KEE A;  2RVL A;  3JSL A;  1SJH D;  3AYH B;  4JI0 Q;  1D5X C;  4DA2 A;  4E6I A;  2XNA C;  3NHH A;  4IUQ A;  5IYD G;  1E2W A;  2HUG A;  4M1U B;  3S14 H;  5C44 H;  1SNM A;  3HKS A;  4HIK A;  1HNX Q;  1HTL D;  3VA7 A;  1UC8 A;  5IGB A;  4A3F G;  2R7Z H;  1NJI C;  2R6G A;  1KAW A;  4A75 A;  2JA8 G;  2B63 B;  1JOO A;  3U50 C;  1V9P A;  3BYT B;  4C3J G;  1PTO D;  1VS0 A;  4LF6 Q;  2FMM A;  3A54 A;  1KJQ A;  1FYC A;  2MO0 A;  1B50 A;  2Q8R E;  2VXW A;  2IX3 A;  1T5E A;  2BA1 A;  5DGI A;  2HT1 A;  1NMF A;  2K28 A;  1ULZ A;  1QVC A;  2R92 H;  1JDE A;  1Q46 A;  1SNQ A;  4CDF C;  3ND8 A;  4MNO A;  4DV6 Q;  3S2D B;  3ETH A;  4OO1 H;  3BZD B;  3B6Y A;  3I4N H;  1TR5 A;  1ML0 D;  1KTA A;  3FKI B;  3HB9 A;  4XQN A;  5I60 A;  3V05 A;  2B2Y C;  4IN3 A;  3EJI A;  2G9D A;  1RDP D;  2F0E A;  2FPI B;  1GGO A;  4LUZ A;  1DIK A;  1F2L A;  1TS3 A;  4R8I A;  1HA6 A;  5LMN Q;  4IPH A;  3ULL A;  1EOT A;  1K0R A;  3FVQ A;  2K04 A;  3MA2 B;  2XCL A;  2V4D A;  3PN1 A;  5G3L F;  3RN2 A;  2VUM H;  4CKE A;  1BO0 A;  1W96 A;  4WRD A;  3HZX A;  1U5K A;  4TRD A;  2OCE A;  2K50 A;  3QWN A;  4DR6 L;  2HGS A;  4UPA A;  2RKS A;  2KCN A;  3TZD A;  1F9S A;  1SYE A;  4CJ1 B;  1BKB A;  1NSN S;  3BVG A;  4FFR A;  3FDT A;  3SVM A;  2UXB Q;  2ZTC A;  1Z9F A;  2F0I A;  3HGB A;  1IKL A;  4XYL B;  4HCE A;  1WYD A;  4O4I F;  1KDA A;  3RNU A;  3ZYY X;  3BG3 A;  3GO5 A;  5BMV F;  2OF1 A;  2IWH A;  3T1H Q;  3U4Z A;  4RCN A;  3HOZ G;  2I87 A;  2V5A A;  1UE5 A;  1SN8 A;  1RL2 A;  4QUC A;  3R5X A;  3ICE A;  3CHB D;  3VR6 A;  3BVM A;  2JYO A;  2VZA A;  5FOB B;  2DAA A;  2Z02 A;  3OWF A;  4KN4 C;  1IYJ B;  1SMY D;  3WDN A;  2UUA L;  2NWG A;  1KJI A;  5FPR A;  4A93 G;  2WKD A;  4UHV A;  5JJK A;  1SLJ A;  4N8F A;  3CRL C;  5K36 G;  2KOL A;  1SYG A;  4YWK A;  4RCO A;  4Z9C B;  1UE6 A;  4A3J B;  4H7B A;  2G9H D;  2VR1 A;  4P72 A;  4UY8 C;  2F3V A;  1M8A A;  4JI4 L;  1QCB D;  1I4P A;  1PYS B;  1XMQ Q;  1I2K A;  5J39 A;  3T9A A;  5IT9 E;  3SR1 A;  1YNJ D;  3JAM c;  3U58 A;  1RD9 D;  2NUC A;  2M2L A;  2C00 A;  2EPB A;  2F3W A;  5C44 B;  2R7F A;  3TME A;  2F4V Q;  5J2T F;  4I7A A;  5D65 A;  4A3B G;  4C3H H;  3FRP B;  4MN3 A;  3RMH A;  4Q0F A;  1PYB A;  1N36 L;  3QWU A;  4O7N A;  5HBR B;  3T54 A;  2JXM B;  1EY9 A;  2D0O A;  4GKK L;  1KEE A;  2ZXO A;  1EQV A;  1JDB B;  3O13 A;  3KLS A;  2PZU A;  4A3I H;  3HOV G;  1DCZ A;  3GTG H;  2HDM A;  4TVI A;  4DK3 C;  4HTP A;  1PDQ A;  4GZY C;  2K75 A;  4PZ7 A;  3UZB A;  4IFD G;  2E2H B;  2L0C A;  3KDF A;  4JI3 Q;  2F0N A;  2WAQ G;  3J81 L;  1EYA A;  1CS0 A;  4EG0 A;  1NCV A;  1WRV A;  1SNC A;  4LFC L;  1JJ2 A;  3F1Z A;  4HJ8 A;  2R7M A;  3ND9 A;  4TM5 A;  4L8J A;  1TT2 A;  2I0Q A;  4TVA B;  3OTO Q;  1VQA A;  4O0A A;  1Q12 A;  1QVG A;  2HGW A;  1F9R A;  4YAK B;  4HAE A;  4DK6 C;  3URY A;  3W3A A;  2P5Z X;  2XIW A;  4IPG A;  1RHP A;  3ORR A;  1TS4 A;  4AYB B;  1SYD A;  4P2C B;  4A3E H;  3G48 A;  1K28 A;  1VQG A;  2Q8I B;  5EQ0 A;  3V2T A;  2J0T D;  4DR5 Q;  1A6X A;  1SXT A;  3A74 A;  2LY7 A;  1PRT C;  1FD7 D;  3T16 A;  1CKM A;  1EWC A;  1X56 A;  4OXP A;  3J7A 5;  3I72 A;  1N33 Q;  3T56 B;  3BA8 A;  1YHA A;  1Z47 A;  1PTO F;  1X3E A;  1ESR A;  1ASY A;  2K03 A;  4AIM A;  3C2P A;  3H6M A;  5ELN A;  1AN8 A;  4BBR G;  4GOP C;  3N52 A;  2OTL A;  2MJ8 A;  3HG9 A;  1V1Q A;  1FGU A;  1YJW A;  3A0J A;  2HCC A;  4DV3 Q;  4A3L G;  2Y0S B;  3I4N G;  5GON F;  5IIF A;  2W6O A;  3R2I A;  4X6A H;  1S3O A;  1I1K A;  1PZI D;  3DWP A;  4EFB A;  4H02 A;  5C0X G;  2UXD L;  2EJ0 A;  3BVZ A;  1JOQ A;  3JRX A;  3K58 A;  5CR3 A;  4O82 A;  4LH7 A;  3J80 L;  1Y8P B;  1PH4 A;  2CHB D;  5E4X A;  4IWX A;  4KKS A;  4UCR A;  3VPC A;  2NB0 A;  1EY7 A;  4RA8 A;  1K8A C;  3X3M A;  2I8C A;  3DM3 A;  4MV6 A;  4MV1 A;  1XTC D;  2MO1 A;  2K6A A;  1SDF A;  2K52 A;  4B3S Q;  3KYH C;  2AQ1 B;  2JP1 A;  4DR2 Q;  1CQI B;  1TII D;  1VF5 C;  4OX9 Q;  3HO8 A;  4QJF A;  3GTK H;  4X3T A;  1CZW A;  1HFN A;  4B3T Q;  2OLS A;  3VA5 A;  2F0H A;  2BE5 C;  1VQJ A;  2DNC A;  1NAP A;  4JI2 L;  1B3A A;  2J7Z A;  4PNY A;  3CKI B;  1K83 H;  1SMX A;  1A15 A;  1STB A;  5DGH A;  4EX5 A;  3F2C A;  3NBY B;  3PF5 A;  3WWH A;  2WIN B;  2MFI A;  3PO3 G;  1BCP F;  2KBN A;  4Y7N B;  4OEL B;  1SE2 A;  1UE7 A;  4UCT A;  3D4W A;  1G51 A;  1PFN A;  4KHP Q;  1ICF B;  4C3H B;  5BR8 Q;  4ZKC B;  4ALP A;  4JBK A;  5I5V A;  2DJF C;  3TN2 A;  4K0K L;  1ZEQ X;  4C2M H;  4LFA L;  1PH8 A;  2EJ3 A;  1MJE A;  3CPF A;  5H1S E;  4QF4 A;  5C6A A;  4A3I B;  2Z1C A;  2FB9 A;  4GLW A;  1VCI A;  3T51 B;  3Q0A A;  2ICI A;  3GTL H;  2HHF A;  4IUR A;  4JI8 L;  1KT8 A;  2NVX H;  2M9V A;  3G8D A;  2EY2 A;  2PZW A;  4HSP A;  1EIF A;  1NMG A;  3IRB A;  4EVO A;  4DRF A;  5J3B A;  2CQA A;  4ZUJ A;  4O84 A;  5E25 A;  1XPR A;  4O81 A;  4GN4 B;  1HUM A;  3H94 A;  4IIJ F;  2OQK A;  2PYK A;  5M3M H;  4TUY F;  4DXG A;  1Q7Y C;  1KRS A;  2QGQ A;  4HED A;  4L5R C;  1PH5 A;  1QNK A;  2JA5 B;  3SEB A;  4U68 A;  1KXL A;  1I2L A;  3RUZ A;  1G2T A;  4XT3 B;  4NP5 A;  5EPK A;  4A3E B;  2IJ0 A;  2RHQ B;  1EY5 A;  3F8T A;  3TQT A;  2CW0 D;  1EU3 A;  3DWA A;  1I3Q H;  4HQ6 A;  2E8G A;  4JI7 Q;  5IGD A;  4EQ5 A;  4NXM L;  1IOV A;  1EKP A;  1CSQ A;  4DUZ Q;  5CAE B;  3I73 A;  1PTO B;  3MHB A;  3G6J B;  2O5I C;  1X9N A;  1KNE A;  4RMF A;  1BXT A;  4RKL A;  2R93 G;  2JJQ A;  4DR3 Q;  3SNO A;  3EVQ A;  3HKZ B;  3PO2 H;  1SBB B;  5JEA H;  5LL6 X;  3VR4 A;  2EIY A;  2F0M A;  2UXC Q;  3L3O C;  3ORQ A;  3GTP H;  2E2D C;  2RDG A;  3VDY A;  4ZAI A;  4A3G H;  3MAQ A;  2K5N A;  4B3M Q;  4ME5 A;  2OXP A;  2HD3 A;  2QCP X;  3EIV A;  1UUP A;  1XNR L;  1X32 A;  4POG A;  4LFB Q;  1IL8 A;  1VKZ A;  3RZO H;  4XIG S;  2F52 A;  1H9R A;  1UE1 A;  3C1E A;  2K5Q A;  3BDL A;  5M9O A;  4ZI7 F;  4HIM A;  4A3C H;  5IWA L;  3GTK B;  1ENC A;  4DR7 L;  2F0U A;  3KJO A;  2ATW A;  5ELF A;  1WTW A;  4JI4 Q;  1EWI A;  3ZJY C;  3M85 A;  5IP7 H;  3PUV A;  2EZV A;  1I4G A;  1PXU A;  2D2C C;  3VNN A;  1BBU A;  2LXJ A;  4ZQI A;  2FXQ A;  1K83 B;  5JPN C;  3RTX A;  4HNV A;  1WD1 A;  2G5D A;  4B9W A;  3AMU A;  4OO1 I;  4MV4 A;  3UDI A;  3T1Y L;  4LMQ D;  4K5W A;  1IKM A;  1CUK A;  2WB1 E;  4FF4 A;  4DR4 L;  1JB3 A;  4X65 L;  2K1B A;  4LF5 Q;  1BCP B;  1I1L A;  3R93 A;  1MD2 D;  3BS1 A;  1ICW A;  1TWC B;  5IYD H;  2FMC A;  3AW8 A;  4GKK Q;  4J1M A;  1HZB A;  1OTC A;  2YZL A;  4A3F H;  2ZDG A;  2K05 A;  4DUY Q;  5LYJ F;  1E3P A;  3U55 A;  3I70 A;  1HR0 L;  3NUA A;  2JA8 H;  4IUT A;  3K7A B;  1E2Z A;  1VQH A;  3GTL B;  4CE5 A;  4C3J H;  1JJG A;  1SND A;  5BYA A;  3H15 A;  4GNX A;  5LXT F;  1FJG L;  1YIT A;  2F03 A;  2WYO A;  1B04 A;  3T9F A;  1VF7 A;  3N8D A;  2K33 A;  3UZO A;  2VB2 X;  3QFF A;  4IQZ A;  3K5N A;  4O7L A;  3K81 C;  4MHE A;  5GQO A;  5M3M B;  3OMG A;  4KY7 A;  5J22 A;  2JA6 B;  2N3S A;  3PQI A;  1JWM D;  2ZT9 C;  4JOI A;  3U9T A;  5K3W A;  4R1J A;  1ZKO A;  1TWF H;  3TY9 A;  1W2B A;  1VMP A;  1CKO A;  2N8N A;  1S40 A;  3MXN A;  2QEX A;  1WR2 A;  1PH9 A;  1R9T B;  1BOS A;  1CKN A;  1OXX K;  2UUB L;  1LTS D;  3L2P A;  2EY5 A;  5ISR A;  1WTV A;  3VYT A;  4FYD A;  5G3L D;  3G4S A;  4FP5 D;  2A74 C;  1I3Q B;  2JA7 G;  2VQD A;  3TSS A;  3DHQ A;  1N8R C;  1QG7 A;  1EHI A;  2Z9H A;  4J6H A;  3SK5 A;  5E7N A;  4RAU C;  2YTV A;  4KN7 C;  1KHI A;  1X65 A;  3M9B A;  4UCS A;  1W6K A;  1PH6 A;  2BH2 A;  1ENA A;  4NXN L;  5C4J B;  4HNU A;  1IZ6 A;  1M4V A;  3H3V C;  3BJU A;  3F2D A;  2OWO A;  1II3 A;  4HNT A;  1VBH A;  3P7J A;  1WCM G;  2HQE A;  4K5V A;  2UXD Q;  1JOK A;  2IPK D;  3GTP B;  3HOX G;  2HG8 A;  3VR2 A;  4HTO A;  3P75 A;  4A3G B;  1STA A;  4CC6 A;  3S17 H;  1SRU A;  4OGQ C;  5IGG A;  3CQZ H;  5BN5 A;  2XD4 A;  1PHJ A;  3I8Z A;  1N32 Q;  4BWG B;  3NEL A;  4LF8 L;  1EYG A;  4A76 A;  4GKJ L;  4HMI A;  3HOZ H;  1E1O A;  2A1H A;  3SE7 A;  3KAK A;  2B2T A;  5CBA E;  5JJI A;  1OXV A;  3RZO B;  4QL5 A;  3E9I A;  2Z4H A;  1WTO A;  2HDK A;  1QWY A;  1LO5 D;  4OWX B;  1AUX A;  2VB3 X;  4CHT B;  4CDC C;  4MIU A;  5IOD A;  3A7A B;  1CSP A;  5D1P A;  1JWS D;  5BWW A;  4M0J A;  3H91 A;  3ITP A;  5IY0 A;  4A93 H;  3OUZ A;  5KX5 F;  1GSH A;  4X3U A;  4DNI A;  4JG2 A;  3KK7 A;  1I4H A;  4GOP A;  4L5Q A;  5IT9 c;  4FF3 A;  3LWB A;  4QGU A;  1S5B D;  4KV6 A;  1GUT A;  2CNV A;  1SR3 A;  1Y69 U;  2NZH A;  5K36 H;  2E75 C;  3NTK A;  4N9T A;  3F2B A;  1D7Q A;  1VQP A;  4BBS G;  2KHJ A;  1YVC A;  5FLX E;  3GTM B;  1HR0 W;  1LT6 D;  2B2V C;  4HJ9 A;  2F0P A;  2NZO A;  2NYZ D;  2L1B A;  4RGO S;  1SFO H;  3I4M G;  3WO0 A;  1OXS C;  4EQP A;  3MEH A;  5M5Y B;  3M4P A;  3KBG A;  1NBW A;  2A69 C;  4LFA Q;  5M5W H;  2J4X A;  2PQE A;  2PBZ A;  1VQK A;  4H44 C;  4FNF A;  2QF7 A;  4IJL A;  4N9P A;  5FLM G;  4B3R L;  3TY8 A;  5CA1 F;  4BA2 I;  2B8G A;  2JA8 B;  3I91 A;  1BNZ A;  1C9O A;  4A3B H;  3GTQ H;  4BY1 B;  1E0B A;  1EQQ A;  2PNH A;  4RGM A;  3MJF A;  1Y1V G;  2C35 B;  3NQI A;  4DV1 L;  2YYA A;  3UQ8 A;  5ELD A;  3MXN B;  3HOV H;  4QY7 A;  1F9P A;  2R61 A;  2BCO A;  3MWD A;  1IOW A;  3E5S A;  1AZP A;  2WFW A;  4G57 A;  4L63 B;  4RHR A;  4IFD H;  5GAD C;  2YL2 A;  4FXK C;  4XYM B;  2V58 A;  1DGS A;  5L37 A;  5EBD A;  4ZRZ A;  3EFX D;  2F0F A;  3TW6 A;  3E9H A;  1I4R A;  4IAL A;  1HNZ L;  5HNE A;  4DNT B;  5NUC A;  5ELB A;  2E5L L;  2UUC L;  4CBV A;  1TWA B;  3BDC A;  2YRW A;  1B44 D;  5C3W A;  2YYZ A;  5EPL A;  1XNQ Q;  1JKJ B;  2YTX A;  4DV2 Q;  4A3M G;  4MA0 A;  3NEM A;  1B9M A;  2OT2 A;  1EYD A;  1EKF A;  1W93 A;  3FP9 A;  2ALY B;  3MC0 B;  1L0Y B;  2MP1 A;  3PGZ A;  4IFD J;  1GJX A;  2ID0 A;  3IFD A;  3TP5 A;  4JC0 A;  1JOR A;  1HRJ A;  2B2U C;  1FR3 A;  1DV1 A;  4MV7 A;  4IOA A;  4ZHQ F;  1VQF A; 
#chains in the Genus database with same CATH homology
 2RHS B;  4R4Q A;  3GTG H;  1WOC A;  4DK3 C;  3S1N H;  1VQ5 A;  4HTP A;  2UU9 Q;  2K75 A;  2I5H A;  2RCN A;  1QUQ B;  4PZ7 A;  1TWH H;  1Y1W G;  2JEA I;  4IFD G;  4BBR H;  4E6N A;  2JA6 H;  1L2F A;  3KDF A;  4JI3 Q;  4L5T A;  1AE2 A;  2EIF A;  2WAQ G;  1FL0 A;  1XNR Q;  1PA6 A;  5JJL A;  1I94 Q;  4LFC L;  1JJ2 A;  3F1Z A;  4HJ8 A;  1QVF A;  1MIU A;  1R9T H;  4A3L H;  3J80 c;  1VQ8 A;  4GOP B;  3J7Z C;  3S1R H;  3M4O H;  4YCW A;  4UP9 A;  4AH6 A;  4TVA B;  3OTO Q;  3CMA A;  1VQA A;  4O0A A;  1Q12 A;  3GD7 A;  1WI5 A;  1QVG A;  4DK6 C;  3HOW G;  3I7F A;  4IPG A;  5IYC H;  3S16 H;  1XNQ L;  3D0F A;  1N9W A;  3J81 i;  4DV2 L;  5IWA Q;  4A3E H;  2F4V L;  2YU9 H;  4DR7 Q;  3G48 A;  5AJ3 L;  1VQE A;  4O2D A;  1VQG A;  2PI2 A;  1J6Q A;  5GAG C;  1O7I A;  2Q2H A;  1PV4 A;  4DR5 Q;  4HIO A;  1J5E Q;  2ZTE A;  3M7N A;  3A74 A;  5M3F G;  1GVP A;  1NY4 A;  1Q1E A;  3CCR A;  3CC2 A;  4A3I G;  1CKM A;  4OXP A;  1X56 A;  5C4J H;  1XK5 A;  3J7A 5;  1N33 Q;  4X62 Q;  4A4I A;  3JAM i;  3BA8 A;  1YHA A;  1Z47 A;  4UCV A;  2K4K A;  3H0G H;  3K0X A;  1X3E A;  1ASY A;  3S2D H;  4AIM A;  1M1K C;  5C0X J;  5ELN A;  3GTO H;  3STB D;  1HZ9 A;  4X65 Q;  4BBR G;  4GOP C;  2AKW B;  4JI2 Q;  2OTL A;  2ASB A;  2UU9 L;  2JA6 G;  3KF6 A;  2JQO A;  2A1A A;  2VUG A;  1K8G A;  1RIP A;  1V1Q A;  1FGU A;  1YJW A;  3A0J A;  4DV3 Q;  4JI3 L;  4A3L G;  3I4N G;  3TS2 A;  3UE0 A;  4X6A H;  1A63 A;  1S3O A;  3G6E A;  4JI6 L;  4OWW B;  3KF8 B;  1I50 H;  3EN2 A;  2E2I H;  4DV6 L;  1I94 L;  1JMC A;  1B8A A;  2ZJQ A;  4H02 A;  4KI0 A;  4EFB A;  5C0X G;  2ES2 A;  2UXD L;  1XPO A;  3PO3 H;  2IT1 A;  3CCM A;  3H3V I;  1PH3 A;  3S1M H;  2ZM6 Q;  4LH7 A;  2XGT A;  3L0O A;  4K0K Q;  1PH4 A;  1C7Y A;  4C3I H;  4A3E G;  1X3F A;  1L1O B;  2NN6 I;  1V43 A;  4UCR A;  2E2J H;  2OTJ A;  1K8A C;  5ELO A;  3DM3 A;  3W1B A;  2LXK A;  4X64 Q;  4DV7 Q;  2K5V A;  4JI8 Q;  3RLN A;  2MO1 A;  5LMU L;  5IE8 A;  3NBH B;  1J5E L;  2K52 A;  4PZ6 A;  1LM0 A;  1LYL A;  1TWG H;  3KYH C;  1Y14 B;  4DR2 Q;  4B3S Q;  4IPC A;  3J80 i;  5M5X H;  1S72 A;  4OX9 Q;  5GAH C;  1VQB A;  2IX0 A;  4QJF A;  3GTK H;  3H0G G;  2CCZ A;  3RR5 A;  4LF7 Q;  2LSS A;  1N33 L;  2EQS A;  4UP7 A;  4UCO A;  4X62 L;  3GTM H;  4B3T Q;  2CQO A;  2CFM A;  4YHH Q;  1PH7 A;  1VQJ A;  4PG3 A;  3TEH B;  3HKZ G;  2IY5 B;  2AMC B;  4JI2 L;  1K83 H;  3CCE A;  3BAB A;  1L1O A;  5M5Y H;  4DV0 L;  4DV4 Q;  3I2Z A;  1SMX A;  5D1O A;  1L1O C;  5C4X H;  4EX5 A;  3F2C A;  4DV3 L;  4BXX H;  1S68 A;  3PF5 A;  1GO3 E;  3S2H H;  3NBY B;  1QZG A;  2MFI A;  3UDF A;  2KCM A;  3PO3 G;  2KBN A;  1HNW Q;  3E0E A;  4UCT A;  1UE7 A;  3J81 j;  4KHP Q;  1G51 A;  2KEN A;  4YY3 Q;  1Q86 C;  1ASZ A;  5HGQ A;  1IBK Q;  4DKA C;  4DR1 Q;  4BY1 H;  3BU2 A;  4P75 A;  5BR8 Q;  3CCS A;  4ALP A;  2Q2T A;  3CCL A;  4JBK A;  3UDG A;  2ZM6 L;  4LF4 Q;  1KIX A;  4LH6 A;  4UFZ A;  3I55 A;  4NXN Q;  4K0K L;  4C2M H;  1E24 A;  4NXM Q;  4LFA L;  1PH8 A;  3TRE A;  3OYY A;  1MJE A;  1VQ7 A;  3CPF A;  2VQE Q;  5H1S E;  1YIJ A;  4EEQ A;  1A0I A;  4XTC S;  1VCI A;  3PSI A;  2V1C C;  5EAY A;  2Z6K A;  3GTL H;  4DV7 L;  4X64 L;  1FVI A;  1YI2 A;  3M4Q A;  4JI8 L;  2Z6K C;  3TRZ A;  3PIP A;  1X6O A;  3PUW A;  2NVX H;  1HH2 P;  4B3S L;  1WFQ A;  1OXU A;  2KHI A;  4DR2 L;  5GRO A;  2Q2U A;  4OX9 L;  2R93 H;  1EIF A;  2VL6 A;  1A62 A;  1NMG A;  3IRB A;  1GKH A;  4IPD A;  4LNQ A;  5J3B A;  3M3Y H;  4DRF A;  1HZA A;  3HFZ B;  1GD7 A;  1XPR A;  4B3T L;  4GN4 B;  2OQK A;  3KJP A;  5M3M H;  5C3E H;  2VQF Q;  3OW2 A;  1YJ9 A;  3TY8 A;  1TWA H;  1MJC A;  1Q7Y C;  1KRS A;  2QGQ A;  1VQ4 A;  5C4X G;  4L5R C;  1G6P A;  4BXX G;  4DV5 Q;  1PH5 A;  1U0L A;  3MEF A;  3H3V H;  4KHZ A;  3GB8 B;  3A5U A;  1XTD A;  1KXL A;  4GLX A;  4GLV B;  4X66 Q;  1Q81 C;  2AWO A;  3CPW A;  1XMQ L;  1W3S A;  4BY1 G;  2RHQ B;  4AQY L;  1VQM A;  1HNW L;  2GVA A;  4KHP L;  1EQR A;  2B29 A;  2JK8 A;  2K5H A;  3F8T A;  3D31 A;  3KF6 B;  1KRT A;  4YY3 L;  2HHH Q;  1SE8 A;  4RG1 A;  3RZD H;  1IBK L;  3CC4 A;  4DR1 L;  1VQN A;  1I3Q H;  5BR8 L;  4LF4 L;  4GLA C;  2E8G A;  2B63 H;  4JI7 Q;  3CCQ A;  1K9M C;  3HOY H;  4P74 A;  4EQ5 A;  3SGI A;  4NXM L;  1CSQ A;  2VQE L;  4DUZ Q;  3A5Z B;  1AH9 A;  1PVO A;  1OXT A;  3KLW A;  2NVT H;  1XMO Q;  1X9N A;  4FDB A;  2E2H H;  4RMF A;  2R93 G;  2JJQ A;  1YZ6 A;  4DR3 Q;  3UE1 A;  2UXC Q;  2HQL A;  2ZTD A;  3PUX A;  2F3I A;  3PO2 H;  3T1Y Q;  4JBW A;  5HY6 A;  1XDN A;  4R4O A;  4DR4 Q;  3GDE A;  3CD6 A;  1MKH A;  5M3M G;  5C3E G;  5LMN W;  3WWV A;  4JI1 Q;  2L15 A;  5IP9 H;  1EOV A;  3FKI H;  4BY7 H;  3GTP H;  1AE3 A;  1B7Y B;  1WJJ A;  2N78 A;  4NPS A;  3VDY A;  3CCV A;  4A3G H;  1X3G A;  2K5N A;  2VQF L;  4IO9 A;  4B3M Q;  2ZJP A;  2I5L X;  4YCV A;  1BBW A;  3EIV A;  1X55 A;  2VY3 A;  1XNR L;  4DV5 L;  1PFS A;  1HR0 Q;  4POG A;  2NN6 G;  4Y52 H;  4LFB Q;  1Q1B A;  3PUY A;  2PI2 E;  2HIV A;  3FHW A;  4X66 L;  1PH2 A;  5DIS C;  3PCO B;  3RZO H;  5IYC G;  3OTO L;  4XIG S;  2F52 A;  2YV5 A;  3RLO A;  3S15 H;  1GM5 A;  1UE1 A;  2B63 G;  4UP8 A;  1FJG Q;  1TXY A;  2XTI A;  3HOY G;  4JCV E;  2HHH L;  4JI5 Q;  4JYA Q;  5D1O B;  3L7Z C;  4HIM A;  4A3C H;  1PH1 A;  5IWA L;  5IYB H;  4JI7 L;  4DR7 L;  5FPO A;  3KJO A;  2ATW A;  4HJ5 A;  1KC8 C;  3G71 A;  4WJ4 A;  4DUZ L;  4JI4 Q;  3CP0 A;  1EWI A;  3AFP A;  4DR5 L;  1K73 C;  2CKZ B;  2BA0 A;  3EBE A;  3ZJY C;  5IP7 H;  3PUV A;  3M85 A;  2JA9 A;  4LW1 A;  1XMO L;  3PO2 G;  1VQD A;  3BZC A;  3VNN A;  4IOC A;  1EIY B;  1BBU A;  4AYB E;  2LXJ A;  5JEA G;  2FXQ A;  4PZ8 A;  4GNX B;  4DR3 L;  3RTX A;  4OO1 I;  3K7U C;  2KCT A;  3UDI A;  3T1Y L;  1KD1 C;  3BZK A;  5IP9 G;  4R4I A;  3FKI G;  5DLQ E;  1CUK A;  1L0W A;  4BA1 I;  3TQY A;  4HJ7 A;  1IBM Q;  1VQ9 A;  3BAA A;  2UUB Q;  2WB1 E;  4LUV A;  4DR4 L;  4X65 L;  4LF5 Q;  3K80 C;  4LF9 Q;  1VQ6 A;  4YWM A;  4A3G G;  2UXC L;  4JI1 L;  2NVQ H;  1IBL Q;  1NTG A;  4OWT B;  4JV5 L;  2OQ0 A;  2JE6 I;  1N34 Q;  1X54 A;  4B3M L;  5IYD H;  1G29 1;  4HJA A;  4GKK Q;  4GN5 A;  1HZB A;  4PMW A;  2HVQ A;  2N49 A;  1OTC A;  4DPG A;  4A3F H;  3CW2 C;  4WJ3 M;  1HJP A;  4DUY Q;  3JSN A;  1E3P A;  4POF A;  1QZH A;  1HR0 L;  3Q8D A;  2JA7 H;  2ZJR A;  2DGY A;  2YTY A;  3U4V A;  2JA8 H;  4LFB L;  1XPU A;  3STB C;  1CKN B;  1VQH A;  4A3K H;  4OON A;  4C3J H;  1JJG A;  4P71 A;  3H15 A;  2Y0S E;  4GNX A;  4A3C G;  1FJG L;  3I4O A;  5IYB G;  1YIT A;  4GNX C;  1B04 A;  2D0P A;  1E22 A;  4JI5 L;  1M90 C;  1UEB A;  4JYA L;  1H95 A;  4CC5 A;  1E7Z A;  5IP7 G;  1LTL A;  3K81 C;  3NEN A;  3HOU H;  4J15 A;  1T9H A;  2Z0S A;  5GQO A;  1UWV A;  4A3J H;  1WCM H;  2A19 A;  3ULP A;  2I5M X;  2N3S A;  1TA8 A;  4JOI A;  3HOX H;  4R1J A;  3JSL A;  4LF7 L;  1TWF H;  3TY9 A;  3AYH B;  4JOI C;  4P73 A;  1W2B A;  4JI0 Q;  1Q8K A;  1CKO A;  2N8N A;  3S24 A;  1S40 A;  4LF8 Q;  2QEX A;  1PH9 A;  4GKJ Q;  4YHH L;  3TY5 A;  1IBM L;  4Y7N H;  1CKN A;  1OXX K;  2UUB L;  3L2P A;  2DUD A;  4DAY B;  4LF5 L;  3ER0 A;  4MTN A;  5IYD G;  1HZC A;  3S14 H;  1IBL L;  5C44 H;  3HKS A;  3CME A;  4HIK A;  1N34 L;  1HNX Q;  4DV4 L;  4A3F G;  2MNA A;  3G4S A;  1Q82 C;  2VW9 A;  2R7Z H;  1NJI C;  2R6G A;  2JA7 G;  2HVR A;  1KAW A;  2WAQ E;  3LGJ A;  4A75 A;  2JA8 G;  1N8R C;  5FLX c;  4JBJ A;  3U50 C;  2RF4 A;  1V9P A;  4DUY L;  1JT8 A;  4A3K G;  1YJN A;  4LF6 Q;  4DR6 Q;  1VS0 A;  2HVS A;  2MO0 A;  5E7N A;  1K3R A;  2WP8 J;  2B3G A;  1KHI A;  2Q2I A;  1X65 A;  2YTV A;  3BA9 A;  1YEZ A;  3M9B A;  4UCS A;  1PH6 A;  2BA1 A;  3UDX A;  3CC7 A;  4NXN L;  2BH2 A;  1NMF A;  2HT1 A;  3W5O A;  1QVC A;  1SRO A;  3HOV G;  1IZ6 A;  2R92 H;  3BJU A;  1Q46 A;  2GN5 A;  3F2D A;  2OWO A;  3KFU A;  4MNO A;  4BBS H;  1YHB A;  4DV6 Q;  3PV0 A;  4GS3 A;  3HOU G;  2AHO B;  3B6Y A;  3I4N H;  3S1Q H;  2VS1 A;  4A3J G;  2UXD Q;  1WCM G;  4IFD I;  4A3D H;  1I5F A;  3HOX G;  3ERS X;  2JEB I;  4KLK A;  4HTO A;  4LUO A;  3AFQ A;  1KQS A;  3AEV A;  4CC6 A;  3I4M H;  3S17 H;  1SRU A;  2JA5 H;  3CQZ H;  1PHJ A;  1N32 Q;  3RN5 A;  1I6H H;  2NVY H;  2BH8 A;  4LUZ A;  4JI0 L;  4B3R Q;  3NEL A;  4LF8 L;  5LMN Q;  4A76 A;  1EYG A;  4GKJ L;  4IPH A;  3ULL A;  5C44 G;  1E1O A;  4YWL A;  3HOZ H;  1QUQ A;  1K0R A;  5LMU Q;  2K14 A;  1B70 B;  1C0A A;  5FLM H;  5JJI A;  2IX1 A;  1OXV A;  4QL5 A;  3CXC A;  3E9I A;  2R7Z G;  3PN1 A;  4OWX B;  3RN2 A;  2UUA Q;  1HNX L;  4DV1 Q;  2VUM H;  1VQO A;  1CSP A;  5D1P A;  1U5K A;  3RLF A;  1IXR A;  1Y1V H;  2EXD A;  4JBM A;  5IY0 A;  4A93 H;  2OCE A;  4DNI A;  3PUZ A;  4JG2 A;  4GOP A;  1TAE A;  2K50 A;  4DR6 L;  1D8L A;  1YNX A;  4L5Q A;  5IT9 c;  1EUJ A;  3CCJ A;  4DAM A;  4QGU A;  4UPA A;  4LF6 L;  5JEA J;  5FJ8 H;  4TQU S;  1VQC A;  4ME3 A;  1SR3 A;  2NZH A;  3PIO A;  4DV0 Q;  2R92 G;  2IHF A;  1BKB A;  3DLL A;  3F2B A;  1D7Q A;  1VQP A;  4BBS G;  1YHQ A;  2UXB Q;  2KHJ A;  3JC6 6;  1XJV A;  4OO1 G;  1YVC A;  2GVB A;  4MZ9 A;  3NC0 B;  1HR0 W;  4QQB X;  1HNZ Q;  4BY7 G;  1E1T A;  4HJ9 A;  4A3D G;  2NZO A;  2ZTC A;  4JV5 Q;  1Z9F A;  2E5L Q;  2UUC Q;  4UCU A;  2CWP A;  1JE5 A;  4LWC A;  3I56 A;  2VNU D;  1SFO H;  3I4M G;  2JA5 G;  1WYD A;  1OXS C;  1IL2 A;  3RNU A;  2PMZ E;  3M4P A;  4YCU A;  3CAM A;  1NBW A;  3GO5 A;  3CF5 A;  5M5W H;  4LFA Q;  3T1H Q;  1VQK A;  3U4Z A;  4A3M H;  3HOZ G;  1N32 L;  2H5X A;  5C0X I;  1JB7 A;  4IJL A;  5FLM G;  2A8V A;  1P16 A;  2CWA A;  1UE5 A;  1SN8 A;  1RL2 A;  4B3R L;  5LMN L;  4L5S A;  1VQI A;  1N36 Q;  3ICE A;  4GN3 B;  4BA2 I;  3K8A A;  1C9O A;  4AYB G;  2IHE A;  3AQQ A;  3TS0 A;  3HKZ E;  3GTQ H;  4A3B H;  1EFW A;  3GTJ H;  2VUM G;  3NBZ B;  2VZA A;  4QIW E;  1EQQ A;  2PNH A;  5FPR A;  1LUZ A;  1IYJ B;  1Y1V G;  2C35 B;  2UUA L;  2MQH A;  4DV1 L;  4A93 G;  3UQ8 A;  3ULJ A;  4R4C A;  2WB1 G;  3MXN B;  2PQA B;  3HOV H;  5JJK A;  1YBY A;  4QY7 A;  1KL9 A;  5FJ8 G;  1SLJ A;  3J81 c;  2QA4 A;  5K36 G;  3PF4 A;  3CCU A;  4YWK A;  1JJC B;  3W1G A;  2WFW A;  1Y1W H;  1UE6 A;  5GAD C;  2HIX A;  1BVS A;  1P8L A;  4LFC Q;  1DGS A;  4P72 A;  1VQL A;  4IJH A;  4UY8 C;  2UXB L;  5GAE C;  4HID A;  4JI4 L;  3E9H A;  1HNZ L;  1PYS B;  1XMQ Q;  4AQY Q;  4NB3 A;  2Y0S G;  2E5L L;  3JAM c;  2UUC L;  3U58 A;  4JI6 Q;  1TWC H;  4R4T A;  2YYZ A;  1XNQ Q;  2YTX A;  4DV2 Q;  3GJX B;  4A3M G;  3HOW H;  2R7F A;  3KDF B;  2F4V Q;  2PQA A;  3NEM A;  2R7D A;  4APV A;  2AWN A;  5AJ3 Q;  3T1H L;  4EFE A;  1A8V A;  3FP9 A;  3K7A H;  4LF9 L;  4A3B G;  2ALY B;  2I0Q A;  4C3H H;  3PGZ A;  4IFD J;  1PYB A;  2ID0 A;  1N36 L;  4JC0 A;  3QWU A;  1NE3 A;  2D62 A;  3KOJ A;  2D0O A;  4GKK L;  5M3F H;  4IOA A;  1VQF A;  4A3I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...