3W5OA

Crystal structure of human dna ligase iv
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
596
structure length
577
Chain Sequence
b'QTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEELDILIVGGYWGKGSGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 4
publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 174
structure length 577
sequence length 596
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2013-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w5oA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w5oA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w5oA02
2LXKA 4RMFA 3CCLA 3NBZB 3NC0B 2DUDA 1SROA 2VUMH 1UEBA 5HGQA 4TVAB 5K36G 4IFDI 3I2ZA 3H0GG 4IJHA 4LW1A 3CC2A 1IBLQ 1HNXL 1U5KA 2R7ZG 3EN2A 1RIPA 2BH2A 3STBD 1M1KC 1SR3A 3E0EA 4A3EG 1PH9A 1E1TA 4XIGS 4RG1A 2OQKA 1X55A 3PCOB 1YEZA 4J15A 4GLXA 4NXMQ 4BBSH 3GO5A 1EFWA 4DV6Q 2HQLA 2VQFL 2RF4A 1N32L 3S17H 1HNZQ 1E24A 1VQAA 3T1YQ 4DV0L 1X3FA 2YV5A 5D1OB 2CFMA 4H02A 4LFCQ 4GOPB 4JI4Q 1A8VA 5C4JH 4LFBL 5BR8Q 3F2DA 2R93H 4FDBA 1YIJA 4IPGA 3M4QA 2UXDQ 3GTGH 4B3MQ 1UE5A 4IPCA 1G51A 4HJ5A 4BY7H 3NELA 4P73A 1YNXA 4DR2Q 1XNQL 4QGUA 2B63G 1YHQA 3HOYH 1SFOH 1EYGA 2RCNA 4GS3A 2WB1G 3A74A 1XNRQ 1L1OA 3W1GA 1X54A 1N34Q 4JI8L 1OXSC 4DR5Q 3RTXA 2R7FA 1T9HA 2ZTEA 3HOXH 2IHEA 4HJ7A 4DV2Q 2K4KA 3M4PA 3Q8DA 1E7ZA 1WCMH 1KRTA 3PF5A 3S1MH 3FKIG 4X65L 4JBKA 3F8TA 2I0QA 1SMXA 2KCMA 4IOCA 2E2HH 2K52A 4QIWE 2JEBI 3J80c 1I50H 2OWOA 3CC4A 1PH6A 1CKMA 4JI2L 1VQ7A 4L5QA 1Q8KA 4R4IA 3OTOL 4LF9L 2LXJA 3WWVA 1S72A 1SLJA 3M4OH 1AH9A 2JA6H 3AQQA 4X64Q 4HIDA 1S68A 1J5EQ 3F2CA 3K81C 4DV1Q 4NXML 1VQGA 2CCZA 3A0JA 3CAMA 5M5XH 4DV6L 4DK3C 3CCMA 1L0WA 4JI1L 2ALYB 4BBSG 4JI0L 4WJ4A 3CCRA 4DUZL 1KIXA 1N33Q 2PI2A 3RNUA 4OONA 1Y1VH 4A3FH 4A93G 1Q81C 3M7NA 4LFCL 4PZ6A 3TRZA 3CP0A 4X62Q 2A8VA 3I4NG 5E7NA 3BA9A 1FJGQ 3VNNA 4A3IH 1Q82C 3GTQH 4C3JH 3PSIA 4LF4Q 5DLQE 4YCUA 1PHJA 1TWFH 5IE8A 5JJLA 2K14A 2B3GA 3U50C 4DR4Q 2R93G 4UCSA 3I4OA 4BY7G 2ZM6L 1XMOL 5LMUL 4JYAQ 1XPUA 5IY0A 5C0XG 4DV3Q 3HOZG 2CKZB 4EQ5A 3A5ZB 4KHPL 4LF7L 1KL9A 2QEXA 4K0KL 3PIOA 1VQLA 3UDFA 1VQ5A 5AJ3Q 4JCVE 4JV5L 2F4VL 2HVRA 3D0FA 3HOXG 4A75A 1NJIC 1FVIA 5EAYA 4R1JA 5M3MH 1NBWA 2N8NA 3ER0A 1HNXQ 1YJWA 4A3EH 3NENA 2D0OA 4BBRG 4DV4L 3I7FA 3K0XA 2RHQB 2YYZA 3RN2A 1Q7YC 3PO2G 1TA8A 1C9OA 1LTLA 1GD7A 2UUBL 3GJXB 1SN8A 1KHIA 2VQFQ 3PUVA 3PO3G 1N32Q 3KF6B 2PQAB 1CUKA 3RLFA 4IOAA 5GAEC 1EIFA 3NBHB 4GN3B 3HOVG 1HNWL 2F3IA 2L15A 4DV0Q 3JSLA 1G291 4HIMA 3J80i 4GN5A 4KLKA 4R4OA 4OWTB 1VQEA 1J6QA 2UUCL 3D31A 3G71A 1P16A 3CPWA 3MEFA 5IT9c 1Q46A 4R4QA 3DM3A 4BA2I 3AFPA 4HTPA 1XNQQ 1IXRA 1NY4A 1N9WA 1Y1VG 2D0PA 3L0OA 1ASYA 2HHHL 3KJOA 4JI3Q 4YCVA 4B3RL 1D7QA 1TAEA 2AMCB 4A3IG 4PMWA 3PUYA 4JI8Q 1PA6A 5C0XJ 2Q2IA 4LF5L 3GB8B 1SRUA 4BY1G 1GVPA 3G48A 1QVFA 1CSQA 4CC6A 3H3VI 2OTJA 4X65Q 3ERSX 4DNIA 1IBKL 1E1OA 3BA8A 2YU9H 1LYLA 3UDIA 5IYCH 3J7A5 2R7DA 4PZ7A 2MQHA 4UP8A 2K75A 3QWUA 2OTLA 4JI2Q 2IT1A 2Y0SE 2IHFA 3OTOQ 4LF9Q 2WFWA 1K73C 1VQCA 1CKOA 4GLVB 1XJVA 1EWIA 2NVQH 5M3MG 1Y14B 4QJFA 1YJ9A 3KFUA 3GTOH 3M9BA 4Y7NH 3CXCA 5J3BA 4P72A 2GVBA 4A3KH 2EXDA 3TQYA 4DR7L 4JI1Q 4A93H 1BVSA 2JEAI 4JI0Q 4DUZQ 1AE2A 2XGTA 5IYBG 3ICEA 3I4NH 4AH6A 2AWNA 5FLXc 4O2DA 2E2JH 4X66Q 2OCEA 1TWCH 2AWOA 3EBEA 1VQ9A 3CMAA 1VQDA 3GTLH 4IJLA 1X9NA 4R4CA 2BA0A 4YCWA 2NVYH 1YHAA 4IFDJ 2R92H 3I55A 3PGZA 2A19A 1W3SA 3PUZA 3JAMc 1VQFA 2WP8J 4P75A 3HOZH 5M5WH 4JI3L 2ZM6Q 5LMUQ 1XMOQ 2KHJA 2N78A 4AYBE 3HKZE 4KHPQ 1AE3A 5C4XH 4YWKA 2UXBL 2V1CC 3SGIA 2ZJPA 4LF7Q 3E9HA 3OW2A 1XPOA 1JB7A 4K0KQ 5D1OA 1PVOA 3TEHB 2K5HA 4GOPA 2ES2A 3J7ZC 2JE6I 4O0AA 4PZ8A 2F4VQ 4JV5Q 2VW9A 1TXYA 1XTDA 5ELNA 2E5LL 1B04A 4LUVA 4BBRH 4LF6L 4BXXG 3BZCA 4IO9A 3PO2H 4MTNA 3GTKH 2I5LX 5IYCG 4NPSA 4DV4Q 3I4MG 1X3GA 1NMGA 1L1OC 2UUBQ 3PO3H 3VDYA 4UCOA 1B8AA 4GOPC 3HOVH 4L5RC 4YHHQ 2K50A 4GNXB 1HZCA 4LUZA 3L7ZC 3U4ZA 1HNWQ 3H3VH 3UDGA 1G6PA 4JC0A 4C3HH 5LMNL 1YJNA 3W5OA 3CCUA 5LMNW 4A76A 2UUCQ 1HH2P 3KDFB 4TQUS 4A3KG 4A3BH 2PMZE 4HTOA 3K7AH 2I5HA 4POFA 4DR1Q 4P74A 1MJEA 1I94Q 4X66L 1NTGA 2MO1A 3GDEA 4L5TA 4ME3A 2HHHQ 4B3RQ 2A1AA 2BH8A 3OYYA 3RN5A 1EQQA 1ASZA 4DAYB 2VZAA 2UXCL 4BY1H 4KHZA 1UWVA 1KRSA 1JMCA 4LF5Q 1VQBA 3T1HL 1YVCA 3BABA 2R92G 1I6HH 1IYJB 1QZHA 4ALPA 1HR0L 1QVCA 1CSPA 5C3EG 4IPHA 1IBKQ 1VQNA 2AKWB 5C4XG 3PIPA 4XTCS 1QVGA 1PH2A 1BBUA 2ZJQA 3L2PA 3TY5A 4LFAL 3JAMi 5C44H 2NVTH 5JEAG 3TY9A 4APVA 3EIVA 2OQ0A 1Q86C 4PG3A 1MIUA 3KLWA 1QUQB 1E22A 1PH7A 3TY8A 4A3LH 3RR5A 4C2MH 4DR7Q 2Y0SG 3M3YH 5D1PA 1U0LA 3PF4A 5IYBH 2CWAA 4YHHL 4JBJA 1FL0A 2ASBA 4UPAA 1XDNA 1Y1WG 1CKNB 4GLAC 5HY6A 2KENA 2JA5H 2FXQA 1PH5A 1GO3E 1HZBA 4EX5A 3K80C 1PH3A 2B29A 4C3IH 1V9PA 1WJJA 1YITA 4DR1L 4DR6L 1S3OA 4WJ3M 4A3BG 1A63A 4A3GH 1UE7A 3JC66 1I94L 5IYDG 3FP9A 3CCEA 2BA1A 3CCQA 1VQPA 3S2HH 1FGUA 3BZKA 5GROA 2Q2UA 3GTPH 3STBC 2HIXA 4DKAC 5GADC 1K8GA 2UXBQ 2VNUD 5FJ8H 4GKKL 3S14H 4JI5L 3J81j 1MJCA 2HVSA 3MXNB 2JA9A 4BXXH 1WFQA 2YTYA 3KF8B 4JI7L 2E5LQ 4AYBG 3HKZG 4LF6Q 3FHWA 2R6GA 3CQZH 2JA8H 1N36L 3I4MH 1B7YB 2NN6G 5M3FH 4HIKA 2Z0SA 4DV7Q 4DR3Q 1K83H 2KBNA 3PV0A 2HIVA 1OXTA 3AYHB 5C44G 3JSNA 2RHSB 1H95A 2GVAA 3ZJYC 1M90C 2JQOA 1KXLA 1A0IA 2VL6A 4JI6Q 3CCSA 5JJKA 2ZTCA 3DLLA 4DUYL 3W1BA 1EQRA 5LMNQ 2EQSA 4LNQA 2Z6KA 1VQMA 1VQ6A 4A3LG 3UE0A 4JG2A 1KC8C 5FPRA 4EFEA 1X65A 1K9MC 2NN6I 2Q2TA 3PUWA 4OO1G 1PH8A 3CD6A 1VQJA 3TREA 4YY3Q 3RZDH 2YTXA 1QZGA 2K5VA 2JA5G 1X56A 3J81c 5DISC 2UXCQ 1WOCA 2N49A 1VCIA 4JBWA 4NXNL 2MO0A 1E3PA 5ELOA 1VQKA 3S1NH 1X6OA 3BAAA 3F1ZA 2Q2HA 3T1HQ 1IL2A 2ID0A 3TS2A 2Z6KC 2ATWA 3HOWG 5C3EH 4A3GG 4LH6A 3CC7A 1HR0Q 2F52A 3G4SA 4MNOA 2QGQA 4YWMA 3BU2A 1PH1A 1OXVA 2GN5A 2UUAL 1WYDA 4DRFA 4B3TL 2WAQE 5FJ8G 1IBML 4OO1I 4Y52H 1L1OB 2AHOB 1I5FA 2NZOA 1RL2A 1SE8A 4LFAQ 3U4VA 3ULPA 2HVQA 3NBYB 1HZAA 1W2BA 4R4TA 4LUOA 5IP9H 1K3RA 4A3MG 3TS0A 1TWAH 4B3SL 2JA8G 4DV7L 1LM0A 5IP7H 4DR3L 4KI0A 5M3FG 3S15H 4AQYL 1VQIA 1WI5A 1OXXK 1KD1C 4LF8L 1Q12A 1OTCA 4OX9L 2JA7H 4GKJL 1VS0A 1Z9FA 2D62A 3K8AA 1Y1WH 4MZ9A 1EOVA 1GM5A 4DV5L 4JI6L 2HT1A 1XMQL 5IWAL 3S1QH 5FLMG 4JOIA 3UE1A 1YBYA 2N3SA 3S24A 3S1RH 2IY5B 4A3JG 3AEVA 1B70B 2K5NA 2YTVA 5IYDH 1O7IA 4DR6Q 3S16H 1D8LA 1A62A 4UCTA 1PV4A 1EIYB 4JBMA 4YY3L 4UCVA 3A5UA 3M85A 5GAGC 4UY8C 3ULJA 3GD7A 3H15A 4GNXA 2NVXH 2VUMG 1P8LA 2I5MX 1IBLL 2JJQA 2VS1A 4GKKQ 3CMEA 1L2FA 2KHIA 4JOIC 2IX0A 2MFIA 2VQEQ 1K8AC 4JI5Q 4EEQA 3KDFA 2E2IH 4UFZA 2QA4A 1KAWA 1HR0W 4AIMA 2ZTDA 1JE5A 5GAHC 4JI7Q 4A3CH 4UCRA 5FPOA 1UE6A 5H1SE 3S2DH 1DGSA 2VY3A 3J81i 1N36Q 1PFSA 1HNZL 1JT8A 4P71A 1GKHA 3G6EA 1YZ6A 1PYBA 3T1YL 5JJIA 4OWWB 4GNXC 4GN4B 1JJGA 1KQSA 3HOUH 4EFBA 1NMFA 3AFQA 2WB1E 1UE1A 2E8GA 3CCVA 4JI4L 4A3DH 5BR8L 4BA1I 3E9IA 5IP9G 3CPFA 3CW2C 1N8RC 4B3ML 2UXDL 1I3QH 1HJPA 4DR2L 4X6AH 5IP7G 4DUYQ 3K7UC 3CCJA 2VUGA 3UDXA 3PN1A 2PNHA 2ZJRA 2NZHA 4LH7A 2C35B 2DGYA 1TWGH 1VQ8A 1N34L 1XNRL 1V43A 3HOYG 2JA7G 1PYSB 1XK5A 4DR5L 2XTIA 1X3EA 4CC5A 2LSSA 4DK6C 2JK8A 2UU9Q 4HIOA 3UQ8A 4DV2L 4IPDA 4A4IA 3H0GH 1QUQA 1VQ4A 1BBWA 3NEMA 4QL5A 5GQOA 3LGJA 4QY7A 2R7ZH 1XPRA 1NE3A 1OXUA 3IRBA 1WCMG 4HJAA 3HKSA 2PI2E 4NB3A 4NXNQ 1K0RA 3HOWH 3GTJH 1V1QA 3PUXA 3KF6A 2PQAA 4UCUA 5C0XI 1MKHA 1VQHA 2IX1A 2MNAA 3KJPA 1C0AA 1CKNA 4X64L 2UUAQ 1J5EL 2VQEL 4E6NA 4OWXB 4DV1L 1IBMQ 4B3TQ 2JA6G 4DPGA 4POGA 1PH4A 1IZ6A 3U58A 4A3MH 1R9TH 3F2BA 3CF5A 4DAMA 4LWCA 4A3CG 2KCTA 2CQOA 4LFBQ 5JEAJ 2B63H 4OXPA 3RLNA 4B3SQ 1JJCB 2H5XA 3KOJA 3HFZB 1Q1EA 4HJ8A 1VQOA 1N33L 2WAQG 1JJ2A 1TWHH 1S40A 4AQYQ 1BKBA 4X62L 4A3FG 2CWPA 4IFDG 3KYHC 1FJGL 4LF8Q 3RLOA 4UP9A 4OX9Q 4LF4L 3HOUG 4GKJQ 4YWLA 4A3DG 1C7YA 5FLMH 1Q1BA 4DR4L 1Z47A 1HZ9A 4DV5Q 1XMQQ 3RZOH 5IWAQ 1YHBA 4QQBX 1YI2A 1EUJA 3ULLA 5M5YH 4JYAL 3I56A 4UP7A 4A3JH 3FKIH 3GTMH 4DV3L 1LUZA 4HJ9A 2EIFA 3B6YA 4L5SA 3BJUA 5AJ3L 2UU9L
chains in the Genus database with same CATH superfamily
3NBZB 3CCLA 2NVTB 3WOFA 3I73A 1B9NA 4ME5A 4TVAB 4IFDI 3TINA 1A3TA 5IGCA 1DD2A 3EN2A 1QILA 3STBD 1M1KC 1SR3A 3E0EA 4A3EG 1WTOA 1E1TA 4RG1A 3BDLA 1YEZA 3H94A 3GO5A 1EFWA 3M3YB 4DV6Q 3DAAA 2RF4A 5C1OA 1ET6A 1HNZQ 1NNXA 1VQAA 4DV0L 4QUCA 1U4MA 3MXUA 3T9DA 3KREA 3T9EA 2KCNA 3S9WA 4C3IB 3T4AC 4GOPB 4JI4Q 3KLRA 2RDFA 1KT8A 2F0VA 3F2DA 1IW7C 1SYGA 3M4QA 3GTGH 1UE5A 2B2TA 2UXDQ 4DA2A 5LP6F 1H9RA 1YNXA 2N55A 4DR2Q 3S2HB 1YHQA 3RUZA 1SFOH 1STYA 3GTPB 1GUWA 2WB1G 1XNRQ 3S14B 3W1GA 1EYAA 3GLKA 4FFOA 2MGSA 3RTXA 4K8JA 2PQEA 2ZTEA 3I91A 3LULA 4HJ7A 3AU7A 4DV2Q 2GPSA 5ELCA 4IQZA 3M4PA 3Q8DA 1E7ZA 1WCMH 2JA8B 3CQZB 4X65L 3I90A 4JBKA 3I4MB 4C56C 3K5NA 2R7MA 3M7GA 5M3FB 5LL6X 4IOCA 3TP6A 4KJOA 1K83B 2JEBI 4QIWE 1EEID 5JJZA 1D5MC 3H6MA 1PH6A 1VQ7A 4CKEA 4L5QA 4Q4CA 1Q8KA 4LF9L 2EYJA 1JR0D 3A56A 3WWVA 3M4OH 1SLJA 3VYTA 4N9TA 4X64Q 4HIDA 3UYYA 2VB2X 4ULLA 4DV1Q 5EPKA 2XRQD 4L8JA 3J81E 2YZNA 1PRTD 5JVG3 4BBSG 3LWBA 2K01A 3CCRA 4DUZL 4CHTB 2PI2A 1Y8NB 3RZDB 2L4NA 4PZ6A 5D14A 1PMRA 1F9PA 3BA9A 5E7NA 2OLSA 1FJGQ 1BF4A 4LF4Q 3PSIA 2EYPA 4YCUA 1TWFH 5EJWA 4O7LA 2M9VA 4HCSA 2ZM6L 4BY7G 4JYAQ 2GPWA 1V1PB 4JPBW 1XPUA 5IY0A 4KHPL 3HOZG 1F9QA 4EQ5A 2SEBD 3A5ZB 5I6YA 2MUYA 1ZEQX 3S17B 1AP0A 1VQLA 2K7VA 1WTWA 4XT3B 2F0DA 2WACA 5M3MH 2N8NA 3NENA 1R4QB 4DV4L 3QJYA 2RHQB 3DM1A 1LTTD 1LTLA 1SE4A 1SN8A 2W6QA 4CDDC 1KHIA 4KD4A 1DOKA 2MP1A 3PUVA 2HDKA 1FGBD 2EDGA 4K5VA 3VPDA 1EIFA 3D3RA 3WDNA 4DV0Q 2XNAC 3J80i 4HIMA 4KLKA 2UUCL 1I7NA 3K58A 3D8GA 3MEFA 5IT9c 1PFMA 3SR1A 5C6AA 1EIHA 5FO8B 2ENBA 1ONLA 2IL8A 1IXRA 1ASYA 1EUCB 2X69A 4H0LC 4HN2A 2NU8B 1KLUD 4A3IG 1B9MA 1PA6A 1C3OA 3GB8B 4TUYF 1L0YB 1SRUA 4AYBB 4BY1G 1GVPA 2RA4A 5IGEA 2E2IB 1CSQA 5C5MA 4ODGA 5DAAA 4X65Q 1KABA 3BA8A 3J7A5 1HCZA 5IYCH 3H91A 5C3XA 2R7DA 2MQHA 3VA5A 2OTLA 5E3FA 1EKPA 3W3AA 2IT1A 5KS8A 2IHFA 4LF9Q 3E3XA 1EYZA 1EWIA 4RHRA 3MEHA 3JAML 4X3KA 3DF7A 1PZID 1YNJD 4R8NA 2GVBA 4I7ZC 4A3KH 2EXDA 4ZCKA 2QILA 1BOSA 2YL2A 2FB9A 4DUZQ 2XD4A 1ZKOA 3H0GB 3I4NH 4AH6A 4TM5A 3R5HA 2VQDA 3GTLH 4X66Q 3EBEA 2R7ZB 2PMZB 1VQ9A 5HBRB 4RHSA 2YZGA 1PRTF 4YCWA 5LYJF 2NVYH 2IP4A 1F2ZA 1YHAA 2R92H 3I55A 2A19A 5IGDA 4JI3L 2ZM6Q 1D6EC 3HKZE 4KHPQ 1A6XA 5BWVA 2W6NA 4F87A 3OW2A 5LL6S 5D1OA 1BBXC 3VR5A 4ABNA 2W6PA 4CHIA 3TDQA 3J7ZC 2JE6I 3P1HA 4WBNF 2R85A 2VW9A 1R9TB 4BBRH 3P20A 1STGA 4LF6L 3BZCA 3T51B 2C5CA 4MTNA 4DV4Q 4NPSA 3RMHA 1L1OC 4RWSC 3PO3H 3HZXA 1WRVA 1CHQD 4UCOA 1B8AA 4GOPC 3HOVH 4FU0A 3K57A 4L5RC 3BVZA 4GNXB 1CZWA 1JCKB 3L7ZC 5CA0F 3FKIB 3UDGA 1I4RA 2UUCQ 3W5OA 1SYFA 1EY8A 2CNUA 3HB9A 1A9XA 1HHVA 5ELFA 1HRJA 1MJEA 1I94Q 4IUTA 1BDOA 4ZAIA 3OYYA 2EJ0A 1EQQA 1Z2NX 5HGTA 4PBCA 1JMCA 3BABA 3T1HL 1YVCA 1CI3M 1I6HH 1IYJB 1EY6A 1UUPA 2K5WA 2A73B 1QVCA 4O7VA 5KGUA 4L1KA 3PIO3 4TV9F 5ELEA 1W93A 1EUDB 3JAMi 3TW6A 3T7AA 1S5FD 5JEAG 4HEDA 2Z04A 4PG3A 2R93B 1E22A 1SNOA 1PFBA 5IGGA 2WYOA 5I5XA 3OUZA 3TZUA 4NYEA 1U0LA 5BWWA 1SSOA 2L55A 1FL0A 2A68C 4UPAA 4GLAC 1H9MA 2FXQA 2N88A 5D8DA 1GO3E 1HZBA 3CRKC 2IW3A 2Z9HA 1YITA 2X6LA 1RTOA 4DR1L 4A3GH 1UE7A 4CE5A 1SYEA 3C2PA 4RGTA 5CB4F 3BZKA 1KBLA 5CV6A 4JI5L 2XIWA 5DM73 4FF2A 1MJCA 2YRXA 2HVSA 5M5XB 3TMEA 4BXXH 4Q4DA 3HKZG 4LF6Q 4R9WA 2R6GA 1N36L 4HIKA 1Y1VB 2ICEC 2KBNA 3OMCA 3GTQB 4C3JB 1H95A 3ZJYC 1CM9A 4EQOA 2WKDA 1QJOA 3HG9A 2L11A 1EQRA 2EQSA 4PNYA 2DJFC 1VQMA 3I3CA 4JG2A 1K3BC 1U9RA 1KC8C 1X65A 1KDBA 1IHZA 3TP7A 4DLKA 4Y8VB 4I65A 1PH8A 2L0CA 3TREA 4F7XA 4C5CA 1KDAA 1QZGA 1MSGA 2RDGA 1X56A 5DISC 2RSNA 4A3EB 2ZGIA 4JBWA 3S1NH 1UNSA 1VQKA 3TS2A 3T1HQ 2ATWA 1LV9A 2F52A 4RH6A 3NTHA 1GUTA 4X3SA 2SCUB 2GN5A 2UUAL 2J9GA 5BYBA 2WAQE 2RQXA 1E2ZA 2AHOB 1I5FA 1SE8A 2NZOA 3H09A 5I9OA 4IIJF 5E4WC 3OW7A 1TWAH 2JA8G 4DGZA 1F9RA 3KAKA 4DR3L 4KK7A 4RAUC 2WB1B 5M3FG 3S15H 4AQYL 2EXZA 1VQIA 1WI5A 1OXXK 4PV1C 4LF8L 5CMDA 1EZ1A 2JA7H 3VYUA 2IWHA 3LNNA 1EL0A 3K8AA 1Y1WH 2I80A 3VR6A 5IWAL 2PW7A 2SNMA 4JOIA 1KJJA 4N9PA 1B70B 2YTVA 4UDUC 1JOQA 1O7IA 3DTGA 1SE3A 5H80A 1H9SA 5BN5A 3M85A 1SMYD 3ULJA 2NVQB 3VMMA 3A7AB 3H15A 5I5SA 1PZKD 4JW0A 2DIKA 3CMEA 4JI5Q 1U4PA 4Y7NB 3KDFA 2ABJA 2QK4A 3UZBA 1DONA 1SNQA 2QA4A 2HHFA 4UFZA 1KAWA 4XYOA 1VF5C 2ZTDA 2KCCA 3VOTA 4A3CH 5FPOA 2NN6H 5ISRA 3NE5B 3S2DH 1DGSA 1N36Q 3BG3A 4TVIA 3CHBD 4P71A 5I2XA 3G6EA 4O7NA 1YZ6A 1GSAA 1JB3A 3EVQA 4GNXC 2EJ3A 1KQSA 3HOUH 1IYDA 1NMFA 3AFQA 3CCVA 2E8GA 2B2WA 2PCFB 5BR8L 4BA1I 4E4TA 5IP9G 4YBZB 1N8RC 1ZYRD 5M5WB 5CV4A 5C3EB 4DQNA 5C4XB 3CCJA 2VUGA 2J4XA 3PN1A 2DJGC 5EKLA 5KX5F 1WTHA 2NZHA 3HOYG 1XK5A 2B2UA 3PQIA 1V43A 1ET0A 1PYSB 3SNOA 1X3EA 1WD1A 3BDCA 2UU9Q 3LGJA 4CGYB 1OXUA 1AZQA 3GTKB 2PI2E 3MWDA 2V5AA 3GTJH 2F4IA 2PQAA 2A6ED 3VPCA 1C0AA 2UUAQ 5EPLA 1J5EL 2VQEL 4HMIA 3QOJA 2L12A 4A3MH 3CF5A 2OXPA 1HUMA 3K7AB 2CQOA 4O7SA 1LTAD 4CDEC 4OXPA 4UCVA 3T9CA 4QF4A 1N33L 1VQOA 2WAQG 4H13C 1S40A 4AQYQ 3HBLA 4X62L 1I4PA 5EPJA 4IFDG 4LF8Q 1CQVA 4YWLA 1GUOA 5C4HA 5D65A 5FLMH 3KF8A 3T53B 1HZ9A 3RZOH 4QQBX 5IWAQ 3SK6A 4RA8A 3I56A 2EIFA 3JZIA 3ETJA 5AJ3L 5KYLA 4YAKB 1VDZA 2VUMH 3WWIA 5HGQA 3H0GG 4IJHA 3CC2A 1K0SA 4K6LA 2R7ZG 4QIWB 1HNXL 3OHXC 4MIUA 4C2MB 2OQKA 1X55A 4GLXA 4BBSH 2F03A 4Z9CB 2VQFL 4C1NK 4PMCA 3E0JA 2WKCA 1E24A 1WR2A 1E2WA 4ILWA 2EYLA 3SE7A 2HUGA 4O7TA 2JA5B 1ESRA 5J39A 4LFCQ 1G91A 1KLGD 5KNBA 5C4ZA 3K5MA 3TSSA 5C4JH 2NU6B 1GUNA 2B39A 2QCPX 4ZRZA 5BR8Q 1YIJA 4TSSA 3E5SA 3K3PA 3Q24A 4M8AA 1G51A 4BY7H 1XNQL 5G3LD 3OPOA 5HV6A 3ITPA 3R3OA 4NP5A 1WTVA 4GS3A 1NR4A 3OOCA 1L1OA 1X54A 2F0KA 2F0NA 1BQQT 3DEOA 2R7FA 1HPCA 1T9HA 2IHEA 2K4KA 2P5ZX 1OBGA 1KRTA 5E4XA 3GV6A 3FKIG 3S1MH 4KY5A 3F8TA 4XX0B 2A74C 1SMXA 5COYA 2EYFA 1LT5D 2ZXOA 1I50H 1RHPA 3CC4A 4JI2L 1CKMA 4HMJA 3RV3A 4FNFA 2LXJA 2K32A 5FLXE 3KLSX 3K5IA 1J5EQ 3F2CA 4KHVA 2CCZA 3E6ZX 4DV6L 2NUAB 1E4EB 4ZUJA 4FE2A 4JI1L 4G7OC 2PW5A 2X6GA 5I47A 2K5DA 1N33Q 4A93G 1Q81C 3M7NA 1JC7A 1IW7D 1JOKA 3RD4A 4X62Q 2A8VA 4A3IH 1Q82C 1K8MA 5CR3A 5DLQE 2PO4A 2K14A 1BR9A 2R93G 4FF4A 4MV6A 4HNVA 2F0QA 4O4HF 4G7ZC 4DIMA 1CZGA 1CQFA 3MHBA 5AJ3Q 4FF3A 1KJQA 2HVRA 3D0FA 4RCOA 4A75A 5EAYA 1F2LA 1HNXQ 1F2YA 3J7AV 2D0OA 2EPBA 5JQGF 4MV4A 3PO2G 2YYZA 3RN2A 5KIXA 1GD7A 1W96A 2NU7B 4ZOLF 3G7LA 4ZQ3A 2VQFQ 4QSHA 2PQAB 5JVH3 3UI2A 1G291 5D3DA 3S1RB 3G71A 3CPWA 4GLWA 2FPGB 1TVXA 1J9OA 3MVVA 4BA2I 3AFPA 4HTPA 1XNQQ 1NY4A 1N9WA 1Y1VG 2HHHL 2NVXB 1TAEA 4B3RL 4M0JA 2SOBA 1D7QA 1Z2PX 3V05A 2Z6BA 4FXDA 1STHA 3LP8A 4C3JG 1EY7A 4MHEA 3G48A 1GJXA 2IPKD 4CC6A 2OTJA 2B2VA 5G3LF 1C8CA 1UC8A 3MWEA 3UDIA 1VMCA 4PZ7A 2K75A 3H3VC 4JI2Q 4A3DB 1G2WA 2WFWA 1K73C 4GLVB 4O42A 1PRTB 1W6JA 2RCFA 4ZHQF 2A69C 4C1NI 2FHTA 1SNMA 1STNA 1JDEA 4DR7L 3TQYA 4JI1Q 1NCVA 3GP7A 1BVSA 2AUJD 3V96A 3E5NA 2KUMA 3OMGA 1AE2A 2R87A 5JOBA 5FLXc 1KDCA 1I1KA 5D3IB 2E2JH 4ZK9B 1SE2A 1A3UA 1X9NA 4R4CA 2Z8LA 3PGZA 1W3SA 3QQMA 3J80L 2WP8J 2KA7A 2KHJA 2K33A 3TIIA 5FNVF 1AE3A 2UXBL 3SGIA 2ZJPA 3E9HA 1XPOA 4XQJA 3K5OA 1JB7A 1XXGA 1PVOA 3TEHB 3OIQA 5DGHA 3T13A 3IFDA 4BS9A 4O0AA 4FXGC 1I4XA 1TXYA 1PTOC 4EQPA 1RJTA 5ELNA 2NB0A 1I1LA 2D9UA 1DM0B 4RKLA 2EJFC 2KVMA 2ZT9C 3FEWX 1SNCA 3LWEA 2BOSA 5DMXA 3NTIA 3ONAB 4MV9A 3VDYA 5J1ZA 2R86A 2PYKA 4YHHQ 4YJ2F 3U4ZA 1SCUB 3HO8A 2EOTA 4C3HH 5LMNL 5LMNW 3AX6A 4A76A 3CRLC 4CJ0B 3SK5A 4TQUS 2AUKA 1QWYA 2X0SA 1ZAUA 4J6HA 4X66L 1WTQA 2MO1A 1UC9A 4UUGA 3PFFA 2HHHQ 3X3NA 2E76C 4B3RQ 2BH8A 1ASZA 4DAYB 3X3MA 2GQRA 3G8CA 5BWTA 1A15A 1QZHA 1RTNA 3U0GA 1CSPA 5C3EG 1NAPA 1VQNA 5C4XG 4FXKC 3PIPA 4J1MA 3SDZA 4K14A 3G8DA 3P7JA 1QVGA 4O7YA 3I4NB 3I4LA 3L2PA 3TY5A 2NVTH 3TY9A 2AQ3B 2O5IC 4APVA 3EIVA 2OQ0A 1Q86C 2K6AA 1QUQB 3QO2A 1ENAA 3ORRA 2NUCA 1PH7A 2CNVA 2NU9B 3TQTA 2BDOA 3HOYB 4RGMA 3RR5A 2PBZA 3R8BA 2H4OA 4DR7Q 4RCNA 3M3YH 5D1PA 4E6IA 3PF4A 4NZOA 5IYBH 2CWAA 4JBJA 3HOXB 2K05A 1YNNC 1XDNA 2AQ2B 3U9OA 1Z6HA 1H9KA 2NTTA 5HY6A 4O4LF 4BBRB 1VBGA 1FR3A 4C3IH 2E2HB 1EY0A 4DR6L 1I94L 1AUXA 3CCEA 1SJED 2BA1A 3PO3B 3S2HH 1FGUA 2UXBQ 3KBGA 3GTPH 3STBC 4UAIA 3HOVB 2VNUD 1LTBD 4GKKL 1SAPA 3S14H 2JN4A 4O86A 3MXNB 1QCBD 1ICFB 2WAQB 3NWSA 3CQZH 2JA8H 3I4MH 3NBIA 1B7YB 3MWYW 5M3FH 1TS5A 4DV7Q 1K83H 1B53A 5I5VA 4OEMB 4CBVA 1GGOA 3ETHA 5T1GA 2GVAA 1M90C 3JRWA 2K5QA 1KXLA 4JI6Q 5JJKA 2ZTCA 5KRUA 3W1BA 2F3VA 5LMNQ 2XVSA 2Z6KA 4LNQA 1VQ6A 2EVBA 1SYBA 1JLLB 2NN6I 5KNDA 3N6RA 3PUWA 1M0TA 1VQJA 1SJHD 3RZDH 2JA5G 3J81c 1JICA 3FDTA 1DZ1A 2ZXPA 1I2LA 1BNCA 1EU4A 2Q2HA 3BVGA 1HQRD 2B2YA 2GQSA 1M6VA 4O1NA 3CC7A 4LH6A 4LJZC 3G4SA 4MNOA 4DAAA 2OF1A 4YWMA 5IGBA 2Q8IB 4KN4C 5FJ8G 4B3TL 4V190 4Y52H 1RL2A 3U4VA 2CQAA 4LUOA 5IP9H 1PDQA 4B3SL 4IUVA 2YZLA 3KLSA 4HQ6A 2Z1CA 4IWYA 1M8AA 3SK4A 1KD1C 4R8IA 1Q12A 3FPPA 3V4ZA 3HS0C 2QEJC 1Z9FA 2FMCA 5ELBA 4BWGB 4MZ9A 1EOVA 1GM5A 4DV5L 2HT1A 5BN3A 4FFNA 3S1QH 4HAEA 3K59A 2LY7A 2DY7A 2YU9B 2I87A 2R84A 4XZ3B 5IYDH 1WTPA 1LT6D 4DR6Q 1XX8A 1EIYB 4JBMA 3BDOA 3NK9A 4UY8C 4EGQA 2COGA 4WORA 1P8LA 5IYZF 4CMDA 4FFPA 4O4IF 2JJQA 2VS1A 2Y4RA 4GKKQ 3GTOB 1K8AC 3CU7A 2E2IH 3QOLA 1FNVA 5J2UF 4ME6A 2BE5C 5GAHC 1BCPD 2RKSA 4A93B 4JK1C 1UE6A 3BZDB 5H1SE 3KUPA 4JVZA 5IIFA 4S3SA 4EGVA 3AMUA 4GN4B 1TWCB 4K8IA 1CTMA 4XYMB 1UE1A 1G6ZA 4HNUA 1LTGD 3E9IA 3CW2C 4K2KA 3K5HA 2WIIB 3KBXA 1VQ8A 3J7YW 2O2LD 3J80E 1N34L 4OO1H 3QFFA 2KHSA 4DR5L 1X32A 2XTIA 1SNPA 2LSSA 4DK6C 3VR3A 1SYCA 3H0GH 4G4KA 1O78A 2R7ZH 1XPRA 3PO2B 3IRBA 1C48A 1WCMG 3HKSA 4IUPA 3HOWH 3V4SA 3T56B 2KJXA 2Y0SB 1V1QA 2K1BA 3KF6A 3PUXA 4K2LA 5I6WA 1QB5D 3S15B 3CEBA 4I4TF 3NBHA 4UCUA 5I5WA 4FGRA 4M9UA 1CKNA 5BWUA 1YNJC 4B3TQ 2F0UA 4DPGA 4I55F 4POGA 2DNCA 4DAPA 3U58A 1R9TH 3F2BA 4A3BB 2QDBA 2F0LA 1TS4A 4LFBQ 4B3SQ 1JJCB 3KOJA 3HFZB 4HJ8A 3L3OC 5CE8A 3QWNA 1E0BA 5LA6F 4ZKCB 4KJNA 3Q23A 4A3DG 3HGBA 1C7YA 1TS2A 1Q1BA 4DR4L 1Z47A 4DV5Q 1CFMA 1K28A 1YHBA 1EUJA 4UP7A 4A3JH 3FKIH 2EJ2A 5CV7A 1JQYD 1STAA 4GZYC 4MN3A 1W6KA 2LXKA 4OL7A 2UU9L 3NC0B 5C44B 1SROA 1BNZA 1UEBA 5HURA 2ODTX 2SDFA 2FFKB 5BPHA 4C5BA 4DN4M 1LTID 4KTAA 3ORQA 4IURA 4FFMA 4NZNA 1PH9A 4XIGS 4NXMQ 1NR2A 2CH4A 2O5JC 1STEA 4RFBA 5EKKA 2HDMA 3HEJA 4HSPA 2M00A 1A0GA 2YV5A 5D1OB 4Q0FA 5CBEE 1DYQA 1A8VA 2EE1A 1B6RA 3CSWA 1BCPF 2R93H 4FDBA 4IPGA 2W6ZA 2V58A 2C00A 4IPCA 1HFGA 3GTJB 3NELA 4P73A 1T36A 3HRZC 3NSWA 4KD3A 2RCNA 4CJ1B 3A74A 1N34Q 2XSCA 4JI8L 2AQ1B 1OXSC 2F0JA 2A6HD 4DR5Q 2R82A 4KY6A 2XWBB 3T54A 3PF5A 3T9BA 2B2TC 1GHKA 2JXMB 3J80c 5BWXA 4DNRB 4R4IA 3VR2A 1G2SA 3OTOL 5JPNC 1S72A 1AH9A 2JA6H 1Y69U 2PNRC 3URYA 2QW7A 3RZOB 3K81C 4DFAA 1DV1A 3A0JA 5M5XH 2YS7A 5CORA 4DK3C 3CCMA 1L0WA 2ALYB 3JAME 5TSSA 4JI0L 4WJ4A 4A3FH 1NUCA 1Y1VH 4OONA 1TIID 4LFCL 3CP0A 2B8FA 3I4NG 3VNNA 3F2UA 3GTQH 4C3JH 2MJ8A 5IE8A 2OEOA 4DR4Q 4UCSA 3U50C 2CHBD 5A2QL 2IX3A 1XMOL 5LMUL 5C0XG 4O2BF 4LF7L 1KL9A 3ND8A 3I12A 4K0KL 3PIOA 5JVDF 3UDFA 1VQ5A 1UEAB 2CW0C 4PMBA 4JV5L 2F4VL 2HGSA 3HOXG 2WINB 1FVIA 1QE6A 4IZOA 4QCLA 2COIA 2OT2A 3DEPA 4IWXA 3ER0A 1YJWA 4A3EH 5IT9L 4BBRG 4UHVA 3KAJA 4TV8F 3I7FA 1TA8A 3GJXB 3PO3G 3KF6B 1Q90A 5C3WA 4IOAA 3NBHB 3HOVG 1HNWL 2F3IA 2L15A 4GN5A 4R4OA 4OWTB 1KNAA 3IL8A 3D31A 3S1MB 1KTKA 2PVPA 1EZ8A 1P16A 3S16B 4R4QA 1JWSD 3TIGA 3DM3A 1CA5A 3L0OA 4OHJA 4FYDA 4YCVA 2CH4W 4B08A 2AMCB 3C1FA 4PMWA 4JI8Q 2BCOA 5E1FA 4LF5L 2F0TA 1B4OA 1FNWA 5JAVA 1HA6A 1GSHA 3A8JE 3ERSX 4DNIA 1ICWA 1Y8PB 1E1OA 1LYLA 3ND9A 1TKWB 5LOVF 5CC4A 2R7NA 4ZQIA 3A54A 2Y0SE 3FMCA 4LK1C 3OTOQ 1ML0D 2NVQH 1VQCA 4O83A 1CS0A 4FFRA 3Q22A 3U9SA 1I3QB 1LO5D 1Y14B 1B3AA 1YJ9A 3KFUA 4CDCC 3M9BA 4Y7NH 1ESFA 3CXCA 5J3BA 2ICIA 4P72A 1TWGB 5FO9B 1EY5A 4N8X1 2RSOA 5C1PA 2ZDHA 3WO0A 4JI0Q 3TEKA 2DZDA 2XGTA 4CMFA 3I70A 3ICEA 2ZDGA 5EKIA 2AWNA 1GUGA 4O2DA 5LXTF 2OCEA 4ID6A 2AWOA 2F0WA 3CMAA 4IJLA 2IJ0A 2BA0A 3A8KE 1KNEA 4OELB 1IYUA 5DAUA 3JAMc 4FF1A 5CYUA 4P75A 3HOZH 5M5WH 4WFN3 1XMOQ 5LMUQ 2H1EA 4HR7A 2F1MA 3MXPA 3CKIB 4YWKA 2V1CC 5C4XH 4LF7Q 4IALA 4K0KQ 4O82A 1JKJB 2K5HA 4GOPA 2ES2A 4PZ8A 2F4VQ 4JV5Q 5KEEA 2R7LA 1RF2D 1B04A 3EROA 5CM0A 4BXXG 1L0XB 4IO9A 4HN7A 4QMGA 2B63B 1TR5A 2FMMA 3GTKH 3FVQA 5BMVF 1TWHB 3N52A 3OSOA 1TS3A 1X3GA 1NMGA 4OGQC 5K2MA 2P0AA 3MTSA 1H9SB 1J8IA 4DXGA 3MJFA 5I9PA 2K50A 1HNWQ 4LUZA 5M5YB 3GTMB 3H3VH 3OWEB 3NXWA 4KMUC 4JC0A 1YJNA 1OBDA 3KDFB 1WVLA 1WTXA 3Q2OA 2HHFB 4HTOA 3K7AH 2EYHA 2K28A 4POFA 2W71A 1U4RA 4P74A 2I46A 4MV8A 4L5TA 3GDEA 4ME3A 1V1OA 2PPBC 4MV7A 4MV1A 2A1AA 1KC7A 3RN5A 1I1MA 2MPMA 2VZAA 2UXCL 1ULZA 4RKBA 4BY1H 4KHZA 2A6EC 2KOLA 4LF5Q 4X3TA 1HR0L 1OO9B 3R2IA 1MBYA 2AKWB 1PTOD 4DK0A 1I4HA 2Z02A 1BBUA 2RDHA 3J7AF 4J8QA 4LFAL 3O13A 3QR8A 5IODA 1RDPD 4B9WA 3KLWA 1VBHA 3GTGB 1V1PA 1ENFA 2HCIA 5A35A 3TY8A 3FRPB 4DK1A 4KY7A 1SFOB 1PTOH 2NZ1D 2PZTA 4C2MH 2A1HA 2Y0SG 3NP8A 2JP1A 1DOLA 1LT4D 1MGSA 4YHHL 1EWHA 1S5CD 2ASBA 5I5YA 3TP5A 1Y1WG 3ERQA 1WCMB 1T5XD 1C4QA 3MFGA 2L1BA 2JA5H 5EGTA 2B8GA 1MI2A 2LS01 1KEEA 3K80C 2B29A 1RKNA 1WJJA 3MC0B 5I5TA 3TBIB 3R5FA 1S3OA 5EBCA 4A3BG 4WJ3M 1A63A 3U54A 3JC66 3SE0A 3FP9A 4XYLB 3CCQA 3M4OB 5L37A 1D5XC 4I7AA 4DKAC 5GADC 1TQOA 4XXEA 5FJ8H 2PZUA 3OUUA 5ELDA 3UZOA 4HCEA 4JI7L 3KF8B 4HTHA 2E75C 2NN6G 1CQIB 2Z0SA 1B50A 1LABA 4MA0A 1O7YA 2QDLA 1OXTA 1KTAA 5C44G 2Q7DA 3JSNA 1TWFB 1D2BA 3GIDA 2QF7A 2VL6A 2XRSD 1Q8IA 2F0FA 4ZKBB 4A3LG 3N8DA 3NQIA 1K9MC 5A2QE 2COJA 3C46A 2Q2TA 1NSNS 1PXUA 4YY3Q 4DXFA 4EVOA 4CKBA 5M3MB 2K5VA 4OIJA 2UXCQ 1WOCA 2N49A 4NXNL 3WWHA 5ELOA 1E3PA 2WV6D 3BAAA 3F1ZA 1IL2A 2ID0A 2VPQA 4JXUA 5C5LA 3WWJA 4H44C 1HR0Q 5I2YA 5IT9E 2W70A 3BU2A 1PH1A 1OXVA 4O7RA 1AUVA 1STBA 1BXRA 2FPIB 3MXGA 4HSVA 4HR7B 4OO1I 5JEAH 1IBML 2YWVA 1L1OB 4LFAQ 3NBYB 2HVQA 3U55A 2E2DC 1HZAA 1W2BA 4R4TA 3DUZA 1K3RA 4A3MG 3LQSA 4EG0A 5KKNB 4DV7L 1EQVA 1PTOF 1AFPA 1OTCA 1DV2A 4JI6L 1XMQL 3NHHA 5FLMG 1JDBB 1LACA 3DXJC 2N3SA 3S24A 2IY5B 3S1RH 2F0GA 3AEVA 1KUTA 2K5NA 2FJ2A 1D8LA 1A62A 3AB9A 3A5UA 5GAGC 1CT1D 4GNXA 2NVXH 2VUMG 3DWQA 2I5MX 1IBLL 3T9AA 1TT2A 4EEQA 2KHIA 4JOIC 2IX0A 3G6JB 4YIJA 2W6OA 4A3KB 4JI7Q 1JE5A 1X3PA 5CV8A 2EYOA 1JT8A 1C30A 1PFSA 3P75A 1HUNA 3QB3A 3T1YL 1Q3LA 4CJ2C 3GTLB 5JJIA 3C1EA 4A3DH 2LKVA 5J22A 1JOOA 2NVYB 3T9FA 2R92B 3C3LA 2CZGA 2I8CA 4KN7C 4B3ML 2FINB 2M2LA 5KNCA 1GSOA 1HJPA 4X6AH 5IP7G 3GQBA 3K7UC 4WRDA 1D5ZC 2PNHA 2SNSA 1FD7D 5CGKA 2ZJRA 4LH7A 2C35B 2DGYA 1JWUD 4O4JF 5FKAC 4CC5A 4CDFC 3UQ8A 4HIOA 2F0OA 1GLVA 2B2WC 4Q5VA 1BBWA 3NEMA 4QL5A 5GQOA 2R61A 3MFYA 3D6CA 4NXNQ 4NB3A 3Q1KA 1K0RA 2DNEA 3KK7A 2J0TD 2KEDA 2B2UC 1MKHA 2TMPA 3KJPA 2BE5D 3IKJA 4OWXB 1AN8A 4K5XA 1WD0A 4DF7A 1IBMQ 3S1QB 1DXMA 1SXTA 1ILQA 1LLRD 4DAMA 3EQLC 4LWCA 2KCTA 5JEAJ 3VYRA 4HNTA 3RLNA 3K6OA 4IUNA 2R3ZA 1Q1EA 4U68A 1PZJD 1F2MA 4TKOB 3RLOA 4UP9A 3WNZA 2HJWA 4KKTA 1ET9A 3IAYA 2E74C 1I6HB 1XMQQ 1X3QA 2EY2A 1YI2A 2A68D 3BYYB 4DV3L 1PX2A 4HJ9A 3B6YA 3NQTA 1BUVT 1VKZA 1U4LA 3QIAA 4L5SA 1DOMA 5DM63 4RMFA 4CKCA 2DUDA 3JZFA 5K36G 2HQEA 3I2ZA 5JQWA 4LW1A 1IBLQ 4XYQA 1U5KA 2DAAA 4ZUIA 1RIPA 2BH2A 2XCLA 1BCPB 1BXTA 4RGNA 2G9DA 3PCOB 4J15A 2NTSA 4B9XA 1QNUA 2HQLA 1N32L 1EY9A 1IKLA 2JYOA 3S17H 4YAJB 1PRTC 4XT1B 3T1YQ 3DWPA 1O7LA 1X3FA 3DWAA 5I4DA 2Q8TA 2DY8A 2CFMA 4H02A 3WOEA 4RZQA 2TSSA 3SEBA 4LFBL 5K3WA 3HOWB 4A3GB 4B3MQ 1AEXA 4HJ5A 2B63G 5C0XH 4QGUA 3HOYH 2EY5A 1EYGA 5BWRA 1RD9D 3HOXH 4KV6A 2F0MA 4N8FA 3T16A 5T1IA 3SVMA 5HNEA 2I0QA 1HTPA 2A5HA 2KCMA 5EBDA 2E2HH 2K52A 5NUCA 2OWOA 2VR1A 2HCCA 1D1IA 2ZXRA 1D1KA 2ZDQA 2FP4B 3AQQA 1S68A 5IOCA 1TY0A 4NXML 1VQGA 4IUUA 4RGOS 3M4YA 1G8ZD 4A3JB 1SBBB 3CAMA 3W2DA 1LTSD 1RODA 1FNUA 1KIXA 2HGXA 3RNUA 2NYZD 4IFDH 3TRZA 2XN9C 5C8YF 4MA5A 1IKMA 5FO7B 3S1NB 3SHLA 1PHJA 3BS1A 5JJLA 5BPFA 2B3GA 4L63B 3D4WA 3I4OA 3ZYYX 2EY6A 4NDXA 2CVRA 1KJ8A 3MA2B 4DV3Q 2CKZB 3BVMA 1KJIA 2QEXA 4EQNA 1HFNA 1LT3D 1EHIA 4JCVE 4WJWA 3MAQA 4X3UA 3BG5A 1NJIC 4R1JA 1I6VC 1NBWA 1TWAB 2DN8A 3DHQA 3K0XA 1I2KA 2CNQA 1Q7YC 1T5EA 1C9OA 2UUBL 2JA7B 4DNTB 5CR5A 2C9OA 4L6TB 1Y1WB 1N32Q 1B3QA 1EEFD 1CUKA 3RLFA 5GAEC 4GN3B 2YW2A 3D4RA 1A2TA 1PK8A 3JSLA 2RVLA 1EKVA 1VQEA 1J6QA 1VF7A 1S5BD 2O4XA 4C3HG 4IHJF 2G5DA 1Q46A 1QNKA 1S4ZA 3HT5A 5EQ0A 2D0PA 4JI3Q 4YB8B 1EFID 3KJOA 2JA6B 5E25A 2K04A 3PUYA 5BYAA 4ZLTF 5C0XJ 2Q2IA 3NTKA 4YJ3F 4FO2A 1QVFA 4O7ZA 1GUSA 4WHXA 2CW0D 3H3VI 3S2DB 3R2TA 1IBKL 2KECA 3DTFA 2YU9H 5M9OA 3BYTB 4P2CB 4A3FB 3NUAA 4UP8A 3QWUA 3HOUB 1KJ9A 4NKLA 3R23A 5FLXL 2G9HD 5IGFA 2DLNA 2L9HA 1VMPA 4MV3A 1CKOA 1CK1A 1MD2D 1I4GA 1XJVA 1LTRD 5M3MG 4H7BA 4QJFA 1Z2OX 2MHVA 3GTOH 2F0HA 2B2VC 3A55A 4MAMA 1SYDA 3MZ5A 1B2TA 4TRDA 4A93H 2JEAI 3IFTA 5FR9A 1EZ6A 2DABA 4NW2A 1KAAA 1RCVD 5IYBG 2EYMA 1TWCH 1VQDA 1S5DD 4IFDJ 4C3IG 3PUZA 1VQFA 1HTLD 1I4QA 3K5LA 2L5TA 5J2TF 4AYBE 2N78A 1V8QA 3EJIA 2QB5A 5BN4A 1K8OA 1XWEA 3LX0A 1EOTA 4XQNA 1BCPC 1GXDC 1XTDA 4A3MB 2E5LL 4LUVA 2F3WA 5KYIA 2EZVA 4LMQD 4PQXA 3PO2H 3FPUB 5JH7F 2I5LX 5IYCG 3I4MG 2UUBQ 5AFWA 4XQQA 3TP8A 3R9RA 3BACA 4FVMA 1MHWC 5GONF 2HDLA 3RFCA 3EA6A 3DMUA 1HZCA 4IZ8A 1G6PA 1H9JA 3CCUA 1HH2P 4IUQA 3TN2A 4A3KG 4A3BH 2PMZE 4NMZA 1PLFA 2I5HA 4DR1Q 2BDNA 2VUMB 2I07B 1NTGA 3SXHA 4K5WA 5JPMC 1A48A 3U9TA 4O84A 1TU2B 1UWVA 1KRSA 3QG1A 1PFNA 1VQBA 1E4EA 2HGWA 2YS6A 2R92G 4BBSB 4ALPA 1I7LA 3Q0AA 5DNFA 5CAEB 2RBMA 4IPHA 1IBKQ 4XTCS 1B1ZA 1SDFA 1PH2A 1HXYD 2ZJQA 1IYVA 1O7ZA 2HD3A 5C44H 3HP3A 4EGJA 5C4JB 4LAAA 1SEBD 1MIUA 1EQTA 4K6DA 4BY7B 3VPBA 2V59A 3HOZB 2F0EA 4A3LH 1PYWD 3RUPA 4O81A 1EU3A 1ILPA 3JZ6A 2KQ3A 1HA5A 1A2UA 1BO0A 1CKNB 4FFLA 1R4PB 2KENA 1PH5A 3K0YA 4EX5A 1PH3A 1TY2A 1V9PA 3T99A 2K03A 3WO1A 1G2TA 1I50B 4XDXA 5IYDG 1VQPA 5GROA 2Q2UA 5FOBB 2HIXA 1K8GA 4FP5D 4QB4A 3J81j 5CA1F 5I5UA 2F0PA 3D4DA 2JA9A 2PN1A 1WFQA 2YTYA 3GV3A 2E5LQ 4AYBG 1EIGA 3FHWA 2YYAA 1AW7A 1MSHA 3UFXB 4DR3Q 4KKUA 3PV0A 4A3IB 2HIVA 3AYHB 5JVLA 2RHSB 4BY1B 3J81L 2JQOA 2VXWA 1B6SA 1A0IA 2DWCA 3CCSA 3RV4A 2Z4HA 3DLLA 1EWCA 5K5PA 4DUYL 4C5AA 3NPPA 5FPRA 3UE0A 2A6HC 4EFEA 5LHY1 4OO1G 3CD6A 2GLTA 3A8IE 2YTXA 5DEHA 1CHPD 4ZYSA 1VCIA 1AZPA 2MO0A 1SMYC 3OIPA 1X6OA 4U673 2R7KA 2Z6KC 3HOWG 1PTOB 5C3EH 4A3GG 1GHJA 3VA7A 2QGQA 1WYDA 3D6WA 1IOWA 4DRFA 1IL8A 3R5XA 5CV5A 2LMCB 3A7LA 3SK8A 3ULPA 2NBFA 5FK9C 1Y8OB 1GOZA 2Z4IA 3TS0A 2B2YC 1LM0A 5IP7H 4KI0A 2VB3X 4DAVA 1ZYRC 4GKJL 4OX9L 2A69D 5DGIA 1VS0A 1ENCA 3LWUA 2D62A 2YRWA 1B44D 2HG8A 4O2AF 1JWMD 4F88A 3NWTA 3UE1A 1YBYA 1S5ED 5CV9A 1DCZA 2EJGC 4A3JG 1WTRA 2W6MA 2EIYA 4M1UB 3S16H 1M4VA 3TW7A 4ZI7F 4UCTA 1PV4A 2EJMA 4YY3L 4G57A 1HQMC 4I50F 5I60A 3GD7A 3JRXA 3KALA 1L2FA 3I72A 2X5RA 2MFIA 1SNDA 2VQEQ 4G7HC 4DU9A 1HR0W 4AIMA 1A3GA 2LFNA 4UCRA 2VY3A 5CBAE 3J81i 2F0SA 1HNZL 1EYCA 3PIP3 1GKHA 3PMFA 4O7WA 1PYBA 2E2JB 2EY1A 4DAYA 4OWWB 1JJGA 4EFBA 5F2DA 2WB1E 4JI4L 3TZDA 2QKIC 4F8MA 1A3VA 5EZYF 1EKFA 2F0IA 1F77A 1EY4A 1QOHA 3CPFA 2UXDL 1I3QH 1JE4A 1Z7TA 4DR2L 2D5DA 4DUYQ 1E2VA 3UDXA 1DJRD 1F9SA 1XNRL 1TWGH 2JA7G 1M0WA 4K6NA 4KKSA 3OWFA 2JK8A 2XWJB 4DV2L 5K36H 4IPDA 1II3A 4A4IA 1QUQA 1VQ4A 4QY7A 4OIKA 1CE8A 1NE3A 1ZXTA 4HJAA 1JORA 2Q8RE 3L9AX 1IOVA 3VYSA 2KEEA 1UAPA 5C0XI 1VQHA 1FYCA 3V2TA 2IX1A 2MNAA 4X64L 1CQJB 2YZMA 4E6NA 1DIKA 4DV1L 2JA6G 1XYIA 4IN3A 1DAAA 4C3HB 1EYDA 1PH4A 1XTCD 1O80A 1IZ6A 2PZWA 4MTKA 2NWGA 4A3CG 1QG7A 1IYEA 2B63H 2V4DA 2H5XA 1JJ2A 1TWHH 2D2CC 1BKBA 3AW8A 4A3FG 2CWPA 4NZMA 3KYHC 1FJGL 4GKJQ 4OX9Q 3HOUG 4LF4L 3I8ZA 3MXNA 3EFXD 2J7ZA 3VR4A 4V0BA 3HKZB 3R93A 3ULLA 5M5YH 1CA6A 3GTMH 4JYAL 2FPPB 1YNND 2JSOA 1LUZA 3NUCA 3Q6SA 3BJUA 4QUFA 2GA4B
chains in the Genus database with same CATH topology
2LXKA 4RMFA 3CCLA 3NBZB 3NC0B 2DUDA 1SROA 2VUMH 1UEBA 5HGQA 4TVAB 5K36G 4IFDI 3I2ZA 3H0GG 4IJHA 4LW1A 3CC2A 1IBLQ 1HNXL 1U5KA 2R7ZG 3EN2A 1RIPA 2BH2A 3STBD 1M1KC 1SR3A 3E0EA 4A3EG 1PH9A 1E1TA 4XIGS 4RG1A 2OQKA 1X55A 3PCOB 1YEZA 4J15A 4GLXA 4NXMQ 4BBSH 3GO5A 1EFWA 4DV6Q 2HQLA 2VQFL 2RF4A 1N32L 3S17H 1HNZQ 1E24A 1VQAA 3T1YQ 4DV0L 1X3FA 2YV5A 5D1OB 2CFMA 4H02A 4LFCQ 4GOPB 4JI4Q 1A8VA 5C4JH 4LFBL 5BR8Q 3F2DA 2R93H 4FDBA 1YIJA 4IPGA 3M4QA 2UXDQ 3GTGH 4B3MQ 1UE5A 4IPCA 1G51A 4HJ5A 4BY7H 3NELA 4P73A 1YNXA 4DR2Q 1XNQL 4QGUA 2B63G 1YHQA 3HOYH 1SFOH 1EYGA 2RCNA 4GS3A 2WB1G 3A74A 1XNRQ 1L1OA 3W1GA 1X54A 1N34Q 4JI8L 1OXSC 4DR5Q 3RTXA 2R7FA 1T9HA 2ZTEA 3HOXH 2IHEA 4HJ7A 4DV2Q 2K4KA 3M4PA 3Q8DA 1E7ZA 1WCMH 1KRTA 3PF5A 3S1MH 3FKIG 4X65L 4JBKA 3F8TA 2I0QA 1SMXA 2KCMA 4IOCA 2E2HH 2K52A 4QIWE 2JEBI 3J80c 1I50H 2OWOA 3CC4A 1PH6A 1CKMA 4JI2L 1VQ7A 4L5QA 1Q8KA 4R4IA 3OTOL 4LF9L 2LXJA 3WWVA 1S72A 1SLJA 3M4OH 1AH9A 2JA6H 3AQQA 4X64Q 4HIDA 1S68A 1J5EQ 3F2CA 3K81C 4DV1Q 4NXML 1VQGA 2CCZA 3A0JA 3CAMA 5M5XH 4DV6L 4DK3C 3CCMA 1L0WA 4JI1L 2ALYB 4BBSG 4JI0L 4WJ4A 3CCRA 4DUZL 1KIXA 1N33Q 2PI2A 3RNUA 4OONA 1Y1VH 4A3FH 4A93G 1Q81C 3M7NA 4LFCL 4PZ6A 3TRZA 3CP0A 4X62Q 2A8VA 3I4NG 5E7NA 3BA9A 1FJGQ 3VNNA 4A3IH 1Q82C 3GTQH 4C3JH 3PSIA 4LF4Q 5DLQE 4YCUA 1PHJA 1TWFH 5IE8A 5JJLA 2K14A 2B3GA 3U50C 4DR4Q 2R93G 4UCSA 3I4OA 4BY7G 2ZM6L 1XMOL 5LMUL 4JYAQ 1XPUA 5IY0A 5C0XG 4DV3Q 3HOZG 2CKZB 4EQ5A 3A5ZB 4KHPL 4LF7L 1KL9A 2QEXA 4K0KL 3PIOA 1VQLA 3UDFA 1VQ5A 5AJ3Q 4JCVE 4JV5L 2F4VL 2HVRA 3D0FA 3HOXG 4A75A 1NJIC 1FVIA 5EAYA 4R1JA 5M3MH 1NBWA 2N8NA 3ER0A 1HNXQ 1YJWA 4A3EH 3NENA 2D0OA 4BBRG 4DV4L 3I7FA 3K0XA 2RHQB 2YYZA 3RN2A 1Q7YC 3PO2G 1TA8A 1C9OA 1LTLA 1GD7A 2UUBL 3GJXB 1SN8A 1KHIA 2VQFQ 3PUVA 3PO3G 1N32Q 3KF6B 2PQAB 1CUKA 3RLFA 4IOAA 5GAEC 1EIFA 3NBHB 4GN3B 3HOVG 1HNWL 2F3IA 2L15A 4DV0Q 3JSLA 1G291 4HIMA 3J80i 4GN5A 4KLKA 4R4OA 4OWTB 1VQEA 1J6QA 2UUCL 3D31A 3G71A 1P16A 3CPWA 3MEFA 5IT9c 1Q46A 4R4QA 3DM3A 4BA2I 3AFPA 4HTPA 1XNQQ 1IXRA 1NY4A 1N9WA 1Y1VG 2D0PA 3L0OA 1ASYA 2HHHL 3KJOA 4JI3Q 4YCVA 4B3RL 1D7QA 1TAEA 2AMCB 4A3IG 4PMWA 3PUYA 4JI8Q 1PA6A 5C0XJ 2Q2IA 4LF5L 3GB8B 1SRUA 4BY1G 1GVPA 3G48A 1QVFA 1CSQA 4CC6A 3H3VI 2OTJA 4X65Q 3ERSX 4DNIA 1IBKL 1E1OA 3BA8A 2YU9H 1LYLA 3UDIA 5IYCH 3J7A5 2R7DA 4PZ7A 2MQHA 4UP8A 2K75A 3QWUA 2OTLA 4JI2Q 2IT1A 2Y0SE 2IHFA 3OTOQ 4LF9Q 2WFWA 1K73C 1VQCA 1CKOA 4GLVB 1XJVA 1EWIA 2NVQH 5M3MG 1Y14B 4QJFA 1YJ9A 3KFUA 3GTOH 3M9BA 4Y7NH 3CXCA 5J3BA 4P72A 2GVBA 4A3KH 2EXDA 3TQYA 4DR7L 4JI1Q 4A93H 1BVSA 2JEAI 4JI0Q 4DUZQ 1AE2A 2XGTA 5IYBG 3ICEA 3I4NH 4AH6A 2AWNA 5FLXc 4O2DA 2E2JH 4X66Q 2OCEA 1TWCH 2AWOA 3EBEA 1VQ9A 3CMAA 1VQDA 3GTLH 4IJLA 1X9NA 4R4CA 2BA0A 4YCWA 2NVYH 1YHAA 4IFDJ 2R92H 3I55A 3PGZA 2A19A 1W3SA 3PUZA 3JAMc 1VQFA 2WP8J 4P75A 3HOZH 5M5WH 4JI3L 2ZM6Q 5LMUQ 1XMOQ 2KHJA 2N78A 4AYBE 3HKZE 4KHPQ 1AE3A 5C4XH 4YWKA 2UXBL 2V1CC 3SGIA 2ZJPA 4LF7Q 3E9HA 3OW2A 1XPOA 1JB7A 4K0KQ 5D1OA 1PVOA 3TEHB 2K5HA 4GOPA 2ES2A 3J7ZC 2JE6I 4O0AA 4PZ8A 2F4VQ 4JV5Q 2VW9A 1TXYA 1XTDA 5ELNA 2E5LL 1B04A 4LUVA 4BBRH 4LF6L 4BXXG 3BZCA 4IO9A 3PO2H 4MTNA 3GTKH 2I5LX 5IYCG 4NPSA 4DV4Q 3I4MG 1X3GA 1NMGA 1L1OC 2UUBQ 3PO3H 3VDYA 4UCOA 1B8AA 4GOPC 3HOVH 4L5RC 4YHHQ 2K50A 4GNXB 1HZCA 4LUZA 3L7ZC 3U4ZA 1HNWQ 3H3VH 3UDGA 1G6PA 4JC0A 4C3HH 5LMNL 1YJNA 3W5OA 3CCUA 5LMNW 4A76A 2UUCQ 1HH2P 3KDFB 4TQUS 4A3KG 4A3BH 2PMZE 4HTOA 3K7AH 2I5HA 4POFA 4DR1Q 4P74A 1MJEA 1I94Q 4X66L 1NTGA 2MO1A 3GDEA 4L5TA 4ME3A 2HHHQ 4B3RQ 2A1AA 2BH8A 3OYYA 3RN5A 1EQQA 1ASZA 4DAYB 2VZAA 2UXCL 4BY1H 4KHZA 1UWVA 1KRSA 1JMCA 4LF5Q 1VQBA 3T1HL 1YVCA 3BABA 2R92G 1I6HH 1IYJB 1QZHA 4ALPA 1HR0L 1QVCA 1CSPA 5C3EG 4IPHA 1IBKQ 1VQNA 2AKWB 5C4XG 3PIPA 4XTCS 1QVGA 1PH2A 1BBUA 2ZJQA 3L2PA 3TY5A 4LFAL 3JAMi 5C44H 2NVTH 5JEAG 3TY9A 4APVA 3EIVA 2OQ0A 1Q86C 4PG3A 1MIUA 3KLWA 1QUQB 1E22A 1PH7A 3TY8A 4A3LH 3RR5A 4C2MH 4DR7Q 2Y0SG 3M3YH 5D1PA 1U0LA 3PF4A 5IYBH 2CWAA 4YHHL 4JBJA 1FL0A 2ASBA 4UPAA 1XDNA 1Y1WG 1CKNB 4GLAC 5HY6A 2KENA 2JA5H 2FXQA 1PH5A 1GO3E 1HZBA 4EX5A 3K80C 1PH3A 2B29A 4C3IH 1V9PA 1WJJA 1YITA 4DR1L 4DR6L 1S3OA 4WJ3M 4A3BG 1A63A 4A3GH 1UE7A 3JC66 1I94L 5IYDG 3FP9A 3CCEA 2BA1A 3CCQA 1VQPA 3S2HH 1FGUA 3BZKA 5GROA 2Q2UA 3GTPH 3STBC 2HIXA 4DKAC 5GADC 1K8GA 2UXBQ 2VNUD 5FJ8H 4GKKL 3S14H 4JI5L 3J81j 1MJCA 2HVSA 3MXNB 2JA9A 4BXXH 1WFQA 2YTYA 3KF8B 4JI7L 2E5LQ 4AYBG 3HKZG 4LF6Q 3FHWA 2R6GA 3CQZH 2JA8H 1N36L 3I4MH 1B7YB 2NN6G 5M3FH 4HIKA 2Z0SA 4DV7Q 4DR3Q 1K83H 2KBNA 3PV0A 2HIVA 1OXTA 3AYHB 5C44G 3JSNA 2RHSB 1H95A 2GVAA 3ZJYC 1M90C 2JQOA 1KXLA 1A0IA 2VL6A 4JI6Q 3CCSA 5JJKA 2ZTCA 3DLLA 4DUYL 3W1BA 1EQRA 5LMNQ 2EQSA 4LNQA 2Z6KA 1VQMA 1VQ6A 4A3LG 3UE0A 4JG2A 1KC8C 5FPRA 4EFEA 1X65A 1K9MC 2NN6I 2Q2TA 3PUWA 4OO1G 1PH8A 3CD6A 1VQJA 3TREA 4YY3Q 3RZDH 2YTXA 1QZGA 2K5VA 2JA5G 1X56A 3J81c 5DISC 2UXCQ 1WOCA 2N49A 1VCIA 4JBWA 4NXNL 2MO0A 1E3PA 5ELOA 1VQKA 3S1NH 1X6OA 3BAAA 3F1ZA 2Q2HA 3T1HQ 1IL2A 2ID0A 3TS2A 2Z6KC 2ATWA 3HOWG 5C3EH 4A3GG 4LH6A 3CC7A 1HR0Q 2F52A 3G4SA 4MNOA 2QGQA 4YWMA 3BU2A 1PH1A 1OXVA 2GN5A 2UUAL 1WYDA 4DRFA 4B3TL 2WAQE 5FJ8G 1IBML 4OO1I 4Y52H 1L1OB 2AHOB 1I5FA 2NZOA 1RL2A 1SE8A 4LFAQ 3U4VA 3ULPA 2HVQA 3NBYB 1HZAA 1W2BA 4R4TA 4LUOA 5IP9H 1K3RA 4A3MG 3TS0A 1TWAH 4B3SL 2JA8G 4DV7L 1LM0A 5IP7H 4DR3L 4KI0A 5M3FG 3S15H 4AQYL 1VQIA 1WI5A 1OXXK 1KD1C 4LF8L 1Q12A 1OTCA 4OX9L 2JA7H 4GKJL 1VS0A 1Z9FA 2D62A 3K8AA 1Y1WH 4MZ9A 1EOVA 1GM5A 4DV5L 4JI6L 2HT1A 1XMQL 5IWAL 3S1QH 5FLMG 4JOIA 3UE1A 1YBYA 2N3SA 3S24A 3S1RH 2IY5B 4A3JG 3AEVA 1B70B 2K5NA 2YTVA 5IYDH 1O7IA 4DR6Q 3S16H 1D8LA 1A62A 4UCTA 1PV4A 1EIYB 4JBMA 4YY3L 4UCVA 3A5UA 3M85A 5GAGC 4UY8C 3ULJA 3GD7A 3H15A 4GNXA 2NVXH 2VUMG 1P8LA 2I5MX 1IBLL 2JJQA 2VS1A 4GKKQ 3CMEA 1L2FA 2KHIA 4JOIC 2IX0A 2MFIA 2VQEQ 1K8AC 4JI5Q 4EEQA 3KDFA 2E2IH 4UFZA 2QA4A 1KAWA 1HR0W 4AIMA 2ZTDA 1JE5A 5GAHC 4JI7Q 4A3CH 4UCRA 5FPOA 1UE6A 5H1SE 3S2DH 1DGSA 2VY3A 3J81i 1N36Q 1PFSA 1HNZL 1JT8A 4P71A 1GKHA 3G6EA 1YZ6A 1PYBA 3T1YL 5JJIA 4OWWB 4GNXC 4GN4B 1JJGA 1KQSA 3HOUH 4EFBA 1NMFA 3AFQA 2WB1E 1UE1A 2E8GA 3CCVA 4JI4L 4A3DH 5BR8L 4BA1I 3E9IA 5IP9G 3CPFA 3CW2C 1N8RC 4B3ML 2UXDL 1I3QH 1HJPA 4DR2L 4X6AH 5IP7G 4DUYQ 3K7UC 3CCJA 2VUGA 3UDXA 3PN1A 2PNHA 2ZJRA 2NZHA 4LH7A 2C35B 2DGYA 1TWGH 1VQ8A 1N34L 1XNRL 1V43A 3HOYG 2JA7G 1PYSB 1XK5A 4DR5L 2XTIA 1X3EA 4CC5A 2LSSA 4DK6C 2JK8A 2UU9Q 4HIOA 3UQ8A 4DV2L 4IPDA 4A4IA 3H0GH 1QUQA 1VQ4A 1BBWA 3NEMA 4QL5A 5GQOA 3LGJA 4QY7A 2R7ZH 1XPRA 1NE3A 1OXUA 3IRBA 1WCMG 4HJAA 3HKSA 2PI2E 4NB3A 4NXNQ 1K0RA 3HOWH 3GTJH 1V1QA 3PUXA 3KF6A 2PQAA 4UCUA 5C0XI 1MKHA 1VQHA 2IX1A 2MNAA 3KJPA 1C0AA 1CKNA 4X64L 2UUAQ 1J5EL 2VQEL 4E6NA 4OWXB 4DV1L 1IBMQ 4B3TQ 2JA6G 4DPGA 4POGA 1PH4A 1IZ6A 3U58A 4A3MH 1R9TH 3F2BA 3CF5A 4DAMA 4LWCA 4A3CG 2KCTA 2CQOA 4LFBQ 5JEAJ 2B63H 4OXPA 3RLNA 4B3SQ 1JJCB 2H5XA 3KOJA 3HFZB 1Q1EA 4HJ8A 1VQOA 1N33L 2WAQG 1JJ2A 1TWHH 1S40A 4AQYQ 1BKBA 4X62L 4A3FG 2CWPA 4IFDG 3KYHC 1FJGL 4LF8Q 3RLOA 4UP9A 4OX9Q 4LF4L 3HOUG 4GKJQ 4YWLA 4A3DG 1C7YA 5FLMH 1Q1BA 4DR4L 1Z47A 1HZ9A 4DV5Q 1XMQQ 3RZOH 5IWAQ 1YHBA 4QQBX 1YI2A 1EUJA 3ULLA 5M5YH 4JYAL 3I56A 4UP7A 4A3JH 3FKIH 3GTMH 4DV3L 1LUZA 4HJ9A 2EIFA 3B6YA 4L5SA 3BJUA 5AJ3L 2UU9L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXK A;  4RMF A;  3CCL A;  3NBZ B;  3NC0 B;  2DUD A;  1SRO A;  2VUM H;  1UEB A;  5HGQ A;  4TVA B;  5K36 G;  4IFD I;  3I2Z A;  3H0G G;  4IJH A;  4LW1 A;  3CC2 A;  1IBL Q;  1HNX L;  1U5K A;  2R7Z G;  3EN2 A;  1RIP A;  2BH2 A;  3STB D;  1M1K C;  1SR3 A;  3E0E A;  4A3E G;  1PH9 A;  1E1T A;  4XIG S;  4RG1 A;  2OQK A;  1X55 A;  3PCO B;  1YEZ A;  4J15 A;  4GLX A;  4NXM Q;  4BBS H;  3GO5 A;  1EFW A;  4DV6 Q;  2HQL A;  2VQF L;  2RF4 A;  1N32 L;  3S17 H;  1HNZ Q;  1E24 A;  1VQA A;  3T1Y Q;  4DV0 L;  1X3F A;  2YV5 A;  5D1O B;  2CFM A;  4H02 A;  4LFC Q;  4GOP B;  4JI4 Q;  1A8V A;  5C4J H;  4LFB L;  5BR8 Q;  3F2D A;  2R93 H;  4FDB A;  1YIJ A;  4IPG A;  3M4Q A;  2UXD Q;  3GTG H;  4B3M Q;  1UE5 A;  4IPC A;  1G51 A;  4HJ5 A;  4BY7 H;  3NEL A;  4P73 A;  1YNX A;  4DR2 Q;  1XNQ L;  4QGU A;  2B63 G;  1YHQ A;  3HOY H;  1SFO H;  1EYG A;  2RCN A;  4GS3 A;  2WB1 G;  3A74 A;  1XNR Q;  1L1O A;  3W1G A;  1X54 A;  1N34 Q;  4JI8 L;  1OXS C;  4DR5 Q;  3RTX A;  2R7F A;  1T9H A;  2ZTE A;  3HOX H;  2IHE A;  4HJ7 A;  4DV2 Q;  2K4K A;  3M4P A;  3Q8D A;  1E7Z A;  1WCM H;  1KRT A;  3PF5 A;  3S1M H;  3FKI G;  4X65 L;  4JBK A;  3F8T A;  2I0Q A;  1SMX A;  2KCM A;  4IOC A;  2E2H H;  2K52 A;  4QIW E;  2JEB I;  3J80 c;  1I50 H;  2OWO A;  3CC4 A;  1PH6 A;  1CKM A;  4JI2 L;  1VQ7 A;  4L5Q A;  1Q8K A;  4R4I A;  3OTO L;  4LF9 L;  2LXJ A;  3WWV A;  1S72 A;  1SLJ A;  3M4O H;  1AH9 A;  2JA6 H;  3AQQ A;  4X64 Q;  4HID A;  1S68 A;  1J5E Q;  3F2C A;  3K81 C;  4DV1 Q;  4NXM L;  1VQG A;  2CCZ A;  3A0J A;  3CAM A;  5M5X H;  4DV6 L;  4DK3 C;  3CCM A;  1L0W A;  4JI1 L;  2ALY B;  4BBS G;  4JI0 L;  4WJ4 A;  3CCR A;  4DUZ L;  1KIX A;  1N33 Q;  2PI2 A;  3RNU A;  4OON A;  1Y1V H;  4A3F H;  4A93 G;  1Q81 C;  3M7N A;  4LFC L;  4PZ6 A;  3TRZ A;  3CP0 A;  4X62 Q;  2A8V A;  3I4N G;  5E7N A;  3BA9 A;  1FJG Q;  3VNN A;  4A3I H;  1Q82 C;  3GTQ H;  4C3J H;  3PSI A;  4LF4 Q;  5DLQ E;  4YCU A;  1PHJ A;  1TWF H;  5IE8 A;  5JJL A;  2K14 A;  2B3G A;  3U50 C;  4DR4 Q;  2R93 G;  4UCS A;  3I4O A;  4BY7 G;  2ZM6 L;  1XMO L;  5LMU L;  4JYA Q;  1XPU A;  5IY0 A;  5C0X G;  4DV3 Q;  3HOZ G;  2CKZ B;  4EQ5 A;  3A5Z B;  4KHP L;  4LF7 L;  1KL9 A;  2QEX A;  4K0K L;  3PIO A;  1VQL A;  3UDF A;  1VQ5 A;  5AJ3 Q;  4JCV E;  4JV5 L;  2F4V L;  2HVR A;  3D0F A;  3HOX G;  4A75 A;  1NJI C;  1FVI A;  5EAY A;  4R1J A;  5M3M H;  1NBW A;  2N8N A;  3ER0 A;  1HNX Q;  1YJW A;  4A3E H;  3NEN A;  2D0O A;  4BBR G;  4DV4 L;  3I7F A;  3K0X A;  2RHQ B;  2YYZ A;  3RN2 A;  1Q7Y C;  3PO2 G;  1TA8 A;  1C9O A;  1LTL A;  1GD7 A;  2UUB L;  3GJX B;  1SN8 A;  1KHI A;  2VQF Q;  3PUV A;  3PO3 G;  1N32 Q;  3KF6 B;  2PQA B;  1CUK A;  3RLF A;  4IOA A;  5GAE C;  1EIF A;  3NBH B;  4GN3 B;  3HOV G;  1HNW L;  2F3I A;  2L15 A;  4DV0 Q;  3JSL A;  1G29 1;  4HIM A;  3J80 i;  4GN5 A;  4KLK A;  4R4O A;  4OWT B;  1VQE A;  1J6Q A;  2UUC L;  3D31 A;  3G71 A;  1P16 A;  3CPW A;  3MEF A;  5IT9 c;  1Q46 A;  4R4Q A;  3DM3 A;  4BA2 I;  3AFP A;  4HTP A;  1XNQ Q;  1IXR A;  1NY4 A;  1N9W A;  1Y1V G;  2D0P A;  3L0O A;  1ASY A;  2HHH L;  3KJO A;  4JI3 Q;  4YCV A;  4B3R L;  1D7Q A;  1TAE A;  2AMC B;  4A3I G;  4PMW A;  3PUY A;  4JI8 Q;  1PA6 A;  5C0X J;  2Q2I A;  4LF5 L;  3GB8 B;  1SRU A;  4BY1 G;  1GVP A;  3G48 A;  1QVF A;  1CSQ A;  4CC6 A;  3H3V I;  2OTJ A;  4X65 Q;  3ERS X;  4DNI A;  1IBK L;  1E1O A;  3BA8 A;  2YU9 H;  1LYL A;  3UDI A;  5IYC H;  3J7A 5;  2R7D A;  4PZ7 A;  2MQH A;  4UP8 A;  2K75 A;  3QWU A;  2OTL A;  4JI2 Q;  2IT1 A;  2Y0S E;  2IHF A;  3OTO Q;  4LF9 Q;  2WFW A;  1K73 C;  1VQC A;  1CKO A;  4GLV B;  1XJV A;  1EWI A;  2NVQ H;  5M3M G;  1Y14 B;  4QJF A;  1YJ9 A;  3KFU A;  3GTO H;  3M9B A;  4Y7N H;  3CXC A;  5J3B A;  4P72 A;  2GVB A;  4A3K H;  2EXD A;  3TQY A;  4DR7 L;  4JI1 Q;  4A93 H;  1BVS A;  2JEA I;  4JI0 Q;  4DUZ Q;  1AE2 A;  2XGT A;  5IYB G;  3ICE A;  3I4N H;  4AH6 A;  2AWN A;  5FLX c;  4O2D A;  2E2J H;  4X66 Q;  2OCE A;  1TWC H;  2AWO A;  3EBE A;  1VQ9 A;  3CMA A;  1VQD A;  3GTL H;  4IJL A;  1X9N A;  4R4C A;  2BA0 A;  4YCW A;  2NVY H;  1YHA A;  4IFD J;  2R92 H;  3I55 A;  3PGZ A;  2A19 A;  1W3S A;  3PUZ A;  3JAM c;  1VQF A;  2WP8 J;  4P75 A;  3HOZ H;  5M5W H;  4JI3 L;  2ZM6 Q;  5LMU Q;  1XMO Q;  2KHJ A;  2N78 A;  4AYB E;  3HKZ E;  4KHP Q;  1AE3 A;  5C4X H;  4YWK A;  2UXB L;  2V1C C;  3SGI A;  2ZJP A;  4LF7 Q;  3E9H A;  3OW2 A;  1XPO A;  1JB7 A;  4K0K Q;  5D1O A;  1PVO A;  3TEH B;  2K5H A;  4GOP A;  2ES2 A;  3J7Z C;  2JE6 I;  4O0A A;  4PZ8 A;  2F4V Q;  4JV5 Q;  2VW9 A;  1TXY A;  1XTD A;  5ELN A;  2E5L L;  1B04 A;  4LUV A;  4BBR H;  4LF6 L;  4BXX G;  3BZC A;  4IO9 A;  3PO2 H;  4MTN A;  3GTK H;  2I5L X;  5IYC G;  4NPS A;  4DV4 Q;  3I4M G;  1X3G A;  1NMG A;  1L1O C;  2UUB Q;  3PO3 H;  3VDY A;  4UCO A;  1B8A A;  4GOP C;  3HOV H;  4L5R C;  4YHH Q;  2K50 A;  4GNX B;  1HZC A;  4LUZ A;  3L7Z C;  3U4Z A;  1HNW Q;  3H3V H;  3UDG A;  1G6P A;  4JC0 A;  4C3H H;  5LMN L;  1YJN A;  3W5O A;  3CCU A;  5LMN W;  4A76 A;  2UUC Q;  1HH2 P;  3KDF B;  4TQU S;  4A3K G;  4A3B H;  2PMZ E;  4HTO A;  3K7A H;  2I5H A;  4POF A;  4DR1 Q;  4P74 A;  1MJE A;  1I94 Q;  4X66 L;  1NTG A;  2MO1 A;  3GDE A;  4L5T A;  4ME3 A;  2HHH Q;  4B3R Q;  2A1A A;  2BH8 A;  3OYY A;  3RN5 A;  1EQQ A;  1ASZ A;  4DAY B;  2VZA A;  2UXC L;  4BY1 H;  4KHZ A;  1UWV A;  1KRS A;  1JMC A;  4LF5 Q;  1VQB A;  3T1H L;  1YVC A;  3BAB A;  2R92 G;  1I6H H;  1IYJ B;  1QZH A;  4ALP A;  1HR0 L;  1QVC A;  1CSP A;  5C3E G;  4IPH A;  1IBK Q;  1VQN A;  2AKW B;  5C4X G;  3PIP A;  4XTC S;  1QVG A;  1PH2 A;  1BBU A;  2ZJQ A;  3L2P A;  3TY5 A;  4LFA L;  3JAM i;  5C44 H;  2NVT H;  5JEA G;  3TY9 A;  4APV A;  3EIV A;  2OQ0 A;  1Q86 C;  4PG3 A;  1MIU A;  3KLW A;  1QUQ B;  1E22 A;  1PH7 A;  3TY8 A;  4A3L H;  3RR5 A;  4C2M H;  4DR7 Q;  2Y0S G;  3M3Y H;  5D1P A;  1U0L A;  3PF4 A;  5IYB H;  2CWA A;  4YHH L;  4JBJ A;  1FL0 A;  2ASB A;  4UPA A;  1XDN A;  1Y1W G;  1CKN B;  4GLA C;  5HY6 A;  2KEN A;  2JA5 H;  2FXQ A;  1PH5 A;  1GO3 E;  1HZB A;  4EX5 A;  3K80 C;  1PH3 A;  2B29 A;  4C3I H;  1V9P A;  1WJJ A;  1YIT A;  4DR1 L;  4DR6 L;  1S3O A;  4WJ3 M;  4A3B G;  1A63 A;  4A3G H;  1UE7 A;  3JC6 6;  1I94 L;  5IYD G;  3FP9 A;  3CCE A;  2BA1 A;  3CCQ A;  1VQP A;  3S2H H;  1FGU A;  3BZK A;  5GRO A;  2Q2U A;  3GTP H;  3STB C;  2HIX A;  4DKA C;  5GAD C;  1K8G A;  2UXB Q;  2VNU D;  5FJ8 H;  4GKK L;  3S14 H;  4JI5 L;  3J81 j;  1MJC A;  2HVS A;  3MXN B;  2JA9 A;  4BXX H;  1WFQ A;  2YTY A;  3KF8 B;  4JI7 L;  2E5L Q;  4AYB G;  3HKZ G;  4LF6 Q;  3FHW A;  2R6G A;  3CQZ H;  2JA8 H;  1N36 L;  3I4M H;  1B7Y B;  2NN6 G;  5M3F H;  4HIK A;  2Z0S A;  4DV7 Q;  4DR3 Q;  1K83 H;  2KBN A;  3PV0 A;  2HIV A;  1OXT A;  3AYH B;  5C44 G;  3JSN A;  2RHS B;  1H95 A;  2GVA A;  3ZJY C;  1M90 C;  2JQO A;  1KXL A;  1A0I A;  2VL6 A;  4JI6 Q;  3CCS A;  5JJK A;  2ZTC A;  3DLL A;  4DUY L;  3W1B A;  1EQR A;  5LMN Q;  2EQS A;  4LNQ A;  2Z6K A;  1VQM A;  1VQ6 A;  4A3L G;  3UE0 A;  4JG2 A;  1KC8 C;  5FPR A;  4EFE A;  1X65 A;  1K9M C;  2NN6 I;  2Q2T A;  3PUW A;  4OO1 G;  1PH8 A;  3CD6 A;  1VQJ A;  3TRE A;  4YY3 Q;  3RZD H;  2YTX A;  1QZG A;  2K5V A;  2JA5 G;  1X56 A;  3J81 c;  5DIS C;  2UXC Q;  1WOC A;  2N49 A;  1VCI A;  4JBW A;  4NXN L;  2MO0 A;  1E3P A;  5ELO A;  1VQK A;  3S1N H;  1X6O A;  3BAA A;  3F1Z A;  2Q2H A;  3T1H Q;  1IL2 A;  2ID0 A;  3TS2 A;  2Z6K C;  2ATW A;  3HOW G;  5C3E H;  4A3G G;  4LH6 A;  3CC7 A;  1HR0 Q;  2F52 A;  3G4S A;  4MNO A;  2QGQ A;  4YWM A;  3BU2 A;  1PH1 A;  1OXV A;  2GN5 A;  2UUA L;  1WYD A;  4DRF A;  4B3T L;  2WAQ E;  5FJ8 G;  1IBM L;  4OO1 I;  4Y52 H;  1L1O B;  2AHO B;  1I5F A;  2NZO A;  1RL2 A;  1SE8 A;  4LFA Q;  3U4V A;  3ULP A;  2HVQ A;  3NBY B;  1HZA A;  1W2B A;  4R4T A;  4LUO A;  5IP9 H;  1K3R A;  4A3M G;  3TS0 A;  1TWA H;  4B3S L;  2JA8 G;  4DV7 L;  1LM0 A;  5IP7 H;  4DR3 L;  4KI0 A;  5M3F G;  3S15 H;  4AQY L;  1VQI A;  1WI5 A;  1OXX K;  1KD1 C;  4LF8 L;  1Q12 A;  1OTC A;  4OX9 L;  2JA7 H;  4GKJ L;  1VS0 A;  1Z9F A;  2D62 A;  3K8A A;  1Y1W H;  4MZ9 A;  1EOV A;  1GM5 A;  4DV5 L;  4JI6 L;  2HT1 A;  1XMQ L;  5IWA L;  3S1Q H;  5FLM G;  4JOI A;  3UE1 A;  1YBY A;  2N3S A;  3S24 A;  3S1R H;  2IY5 B;  4A3J G;  3AEV A;  1B70 B;  2K5N A;  2YTV A;  5IYD H;  1O7I A;  4DR6 Q;  3S16 H;  1D8L A;  1A62 A;  4UCT A;  1PV4 A;  1EIY B;  4JBM A;  4YY3 L;  4UCV A;  3A5U A;  3M85 A;  5GAG C;  4UY8 C;  3ULJ A;  3GD7 A;  3H15 A;  4GNX A;  2NVX H;  2VUM G;  1P8L A;  2I5M X;  1IBL L;  2JJQ A;  2VS1 A;  4GKK Q;  3CME A;  1L2F A;  2KHI A;  4JOI C;  2IX0 A;  2MFI A;  2VQE Q;  1K8A C;  4JI5 Q;  4EEQ A;  3KDF A;  2E2I H;  4UFZ A;  2QA4 A;  1KAW A;  1HR0 W;  4AIM A;  2ZTD A;  1JE5 A;  5GAH C;  4JI7 Q;  4A3C H;  4UCR A;  5FPO A;  1UE6 A;  5H1S E;  3S2D H;  1DGS A;  2VY3 A;  3J81 i;  1N36 Q;  1PFS A;  1HNZ L;  1JT8 A;  4P71 A;  1GKH A;  3G6E A;  1YZ6 A;  1PYB A;  3T1Y L;  5JJI A;  4OWW B;  4GNX C;  4GN4 B;  1JJG A;  1KQS A;  3HOU H;  4EFB A;  1NMF A;  3AFQ A;  2WB1 E;  1UE1 A;  2E8G A;  3CCV A;  4JI4 L;  4A3D H;  5BR8 L;  4BA1 I;  3E9I A;  5IP9 G;  3CPF A;  3CW2 C;  1N8R C;  4B3M L;  2UXD L;  1I3Q H;  1HJP A;  4DR2 L;  4X6A H;  5IP7 G;  4DUY Q;  3K7U C;  3CCJ A;  2VUG A;  3UDX A;  3PN1 A;  2PNH A;  2ZJR A;  2NZH A;  4LH7 A;  2C35 B;  2DGY A;  1TWG H;  1VQ8 A;  1N34 L;  1XNR L;  1V43 A;  3HOY G;  2JA7 G;  1PYS B;  1XK5 A;  4DR5 L;  2XTI A;  1X3E A;  4CC5 A;  2LSS A;  4DK6 C;  2JK8 A;  2UU9 Q;  4HIO A;  3UQ8 A;  4DV2 L;  4IPD A;  4A4I A;  3H0G H;  1QUQ A;  1VQ4 A;  1BBW A;  3NEM A;  4QL5 A;  5GQO A;  3LGJ A;  4QY7 A;  2R7Z H;  1XPR A;  1NE3 A;  1OXU A;  3IRB A;  1WCM G;  4HJA A;  3HKS A;  2PI2 E;  4NB3 A;  4NXN Q;  1K0R A;  3HOW H;  3GTJ H;  1V1Q A;  3PUX A;  3KF6 A;  2PQA A;  4UCU A;  5C0X I;  1MKH A;  1VQH A;  2IX1 A;  2MNA A;  3KJP A;  1C0A A;  1CKN A;  4X64 L;  2UUA Q;  1J5E L;  2VQE L;  4E6N A;  4OWX B;  4DV1 L;  1IBM Q;  4B3T Q;  2JA6 G;  4DPG A;  4POG A;  1PH4 A;  1IZ6 A;  3U58 A;  4A3M H;  1R9T H;  3F2B A;  3CF5 A;  4DAM A;  4LWC A;  4A3C G;  2KCT A;  2CQO A;  4LFB Q;  5JEA J;  2B63 H;  4OXP A;  3RLN A;  4B3S Q;  1JJC B;  2H5X A;  3KOJ A;  3HFZ B;  1Q1E A;  4HJ8 A;  1VQO A;  1N33 L;  2WAQ G;  1JJ2 A;  1TWH H;  1S40 A;  4AQY Q;  1BKB A;  4X62 L;  4A3F G;  2CWP A;  4IFD G;  3KYH C;  1FJG L;  4LF8 Q;  3RLO A;  4UP9 A;  4OX9 Q;  4LF4 L;  3HOU G;  4GKJ Q;  4YWL A;  4A3D G;  1C7Y A;  5FLM H;  1Q1B A;  4DR4 L;  1Z47 A;  1HZ9 A;  4DV5 Q;  1XMQ Q;  3RZO H;  5IWA Q;  1YHB A;  4QQB X;  1YI2 A;  1EUJ A;  3ULL A;  5M5Y H;  4JYA L;  3I56 A;  4UP7 A;  4A3J H;  3FKI H;  3GTM H;  4DV3 L;  1LUZ A;  4HJ9 A;  2EIF A;  3B6Y A;  4L5S A;  3BJU A;  5AJ3 L;  2UU9 L; 
#chains in the Genus database with same CATH topology
 3NBZ B;  3CCL A;  2NVT B;  3WOF A;  3I73 A;  1B9N A;  4ME5 A;  4TVA B;  4IFD I;  3TIN A;  1A3T A;  5IGC A;  1DD2 A;  3EN2 A;  1QIL A;  3STB D;  1M1K C;  1SR3 A;  3E0E A;  4A3E G;  1WTO A;  1E1T A;  4RG1 A;  3BDL A;  1YEZ A;  3H94 A;  3GO5 A;  1EFW A;  3M3Y B;  4DV6 Q;  3DAA A;  2RF4 A;  5C1O A;  1ET6 A;  1HNZ Q;  1NNX A;  1VQA A;  4DV0 L;  4QUC A;  1U4M A;  3MXU A;  3T9D A;  3KRE A;  3T9E A;  2KCN A;  3S9W A;  4C3I B;  3T4A C;  4GOP B;  4JI4 Q;  3KLR A;  2RDF A;  1KT8 A;  2F0V A;  3F2D A;  1IW7 C;  1SYG A;  3M4Q A;  3GTG H;  1UE5 A;  2B2T A;  2UXD Q;  4DA2 A;  5LP6 F;  1H9R A;  1YNX A;  2N55 A;  4DR2 Q;  3S2H B;  1YHQ A;  3RUZ A;  1SFO H;  1STY A;  3GTP B;  1GUW A;  2WB1 G;  1XNR Q;  3S14 B;  3W1G A;  1EYA A;  3GLK A;  4FFO A;  2MGS A;  3RTX A;  4K8J A;  2PQE A;  2ZTE A;  3I91 A;  3LUL A;  4HJ7 A;  3AU7 A;  4DV2 Q;  2GPS A;  5ELC A;  4IQZ A;  3M4P A;  3Q8D A;  1E7Z A;  1WCM H;  2JA8 B;  3CQZ B;  4X65 L;  3I90 A;  4JBK A;  3I4M B;  4C56 C;  3K5N A;  2R7M A;  3M7G A;  5M3F B;  5LL6 X;  4IOC A;  3TP6 A;  4KJO A;  1K83 B;  2JEB I;  4QIW E;  1EEI D;  5JJZ A;  1D5M C;  3H6M A;  1PH6 A;  1VQ7 A;  4CKE A;  4L5Q A;  4Q4C A;  1Q8K A;  4LF9 L;  2EYJ A;  1JR0 D;  3A56 A;  3WWV A;  3M4O H;  1SLJ A;  3VYT A;  4N9T A;  4X64 Q;  4HID A;  3UYY A;  2VB2 X;  4ULL A;  4DV1 Q;  5EPK A;  2XRQ D;  4L8J A;  3J81 E;  2YZN A;  1PRT D;  5JVG 3;  4BBS G;  3LWB A;  2K01 A;  3CCR A;  4DUZ L;  4CHT B;  2PI2 A;  1Y8N B;  3RZD B;  2L4N A;  4PZ6 A;  5D14 A;  1PMR A;  1F9P A;  3BA9 A;  5E7N A;  2OLS A;  1FJG Q;  1BF4 A;  4LF4 Q;  3PSI A;  2EYP A;  4YCU A;  1TWF H;  5EJW A;  4O7L A;  2M9V A;  4HCS A;  2ZM6 L;  4BY7 G;  4JYA Q;  2GPW A;  1V1P B;  4JPB W;  1XPU A;  5IY0 A;  4KHP L;  3HOZ G;  1F9Q A;  4EQ5 A;  2SEB D;  3A5Z B;  5I6Y A;  2MUY A;  1ZEQ X;  3S17 B;  1AP0 A;  1VQL A;  2K7V A;  1WTW A;  4XT3 B;  2F0D A;  2WAC A;  5M3M H;  2N8N A;  3NEN A;  1R4Q B;  4DV4 L;  3QJY A;  2RHQ B;  3DM1 A;  1LTT D;  1LTL A;  1SE4 A;  1SN8 A;  2W6Q A;  4CDD C;  1KHI A;  4KD4 A;  1DOK A;  2MP1 A;  3PUV A;  2HDK A;  1FGB D;  2EDG A;  4K5V A;  3VPD A;  1EIF A;  3D3R A;  3WDN A;  4DV0 Q;  2XNA C;  3J80 i;  4HIM A;  4KLK A;  2UUC L;  1I7N A;  3K58 A;  3D8G A;  3MEF A;  5IT9 c;  1PFM A;  3SR1 A;  5C6A A;  1EIH A;  5FO8 B;  2ENB A;  1ONL A;  2IL8 A;  1IXR A;  1ASY A;  1EUC B;  2X69 A;  4H0L C;  4HN2 A;  2NU8 B;  1KLU D;  4A3I G;  1B9M A;  1PA6 A;  1C3O A;  3GB8 B;  4TUY F;  1L0Y B;  1SRU A;  4AYB B;  4BY1 G;  1GVP A;  2RA4 A;  5IGE A;  2E2I B;  1CSQ A;  5C5M A;  4ODG A;  5DAA A;  4X65 Q;  1KAB A;  3BA8 A;  3J7A 5;  1HCZ A;  5IYC H;  3H91 A;  5C3X A;  2R7D A;  2MQH A;  3VA5 A;  2OTL A;  5E3F A;  1EKP A;  3W3A A;  2IT1 A;  5KS8 A;  2IHF A;  4LF9 Q;  3E3X A;  1EYZ A;  1EWI A;  4RHR A;  3MEH A;  3JAM L;  4X3K A;  3DF7 A;  1PZI D;  1YNJ D;  4R8N A;  2GVB A;  4I7Z C;  4A3K H;  2EXD A;  4ZCK A;  2QIL A;  1BOS A;  2YL2 A;  2FB9 A;  4DUZ Q;  2XD4 A;  1ZKO A;  3H0G B;  3I4N H;  4AH6 A;  4TM5 A;  3R5H A;  2VQD A;  3GTL H;  4X66 Q;  3EBE A;  2R7Z B;  2PMZ B;  1VQ9 A;  5HBR B;  4RHS A;  2YZG A;  1PRT F;  4YCW A;  5LYJ F;  2NVY H;  2IP4 A;  1F2Z A;  1YHA A;  2R92 H;  3I55 A;  2A19 A;  5IGD A;  4JI3 L;  2ZM6 Q;  1D6E C;  3HKZ E;  4KHP Q;  1A6X A;  5BWV A;  2W6N A;  4F87 A;  3OW2 A;  5LL6 S;  5D1O A;  1BBX C;  3VR5 A;  4ABN A;  2W6P A;  4CHI A;  3TDQ A;  3J7Z C;  2JE6 I;  3P1H A;  4WBN F;  2R85 A;  2VW9 A;  1R9T B;  4BBR H;  3P20 A;  1STG A;  4LF6 L;  3BZC A;  3T51 B;  2C5C A;  4MTN A;  4DV4 Q;  4NPS A;  3RMH A;  1L1O C;  4RWS C;  3PO3 H;  3HZX A;  1WRV A;  1CHQ D;  4UCO A;  1B8A A;  4GOP C;  3HOV H;  4FU0 A;  3K57 A;  4L5R C;  3BVZ A;  4GNX B;  1CZW A;  1JCK B;  3L7Z C;  5CA0 F;  3FKI B;  3UDG A;  1I4R A;  2UUC Q;  3W5O A;  1SYF A;  1EY8 A;  2CNU A;  3HB9 A;  1A9X A;  1HHV A;  5ELF A;  1HRJ A;  1MJE A;  1I94 Q;  4IUT A;  1BDO A;  4ZAI A;  3OYY A;  2EJ0 A;  1EQQ A;  1Z2N X;  5HGT A;  4PBC A;  1JMC A;  3BAB A;  3T1H L;  1YVC A;  1CI3 M;  1I6H H;  1IYJ B;  1EY6 A;  1UUP A;  2K5W A;  2A73 B;  1QVC A;  4O7V A;  5KGU A;  4L1K A;  3PIO 3;  4TV9 F;  5ELE A;  1W93 A;  1EUD B;  3JAM i;  3TW6 A;  3T7A A;  1S5F D;  5JEA G;  4HED A;  2Z04 A;  4PG3 A;  2R93 B;  1E22 A;  1SNO A;  1PFB A;  5IGG A;  2WYO A;  5I5X A;  3OUZ A;  3TZU A;  4NYE A;  1U0L A;  5BWW A;  1SSO A;  2L55 A;  1FL0 A;  2A68 C;  4UPA A;  4GLA C;  1H9M A;  2FXQ A;  2N88 A;  5D8D A;  1GO3 E;  1HZB A;  3CRK C;  2IW3 A;  2Z9H A;  1YIT A;  2X6L A;  1RTO A;  4DR1 L;  4A3G H;  1UE7 A;  4CE5 A;  1SYE A;  3C2P A;  4RGT A;  5CB4 F;  3BZK A;  1KBL A;  5CV6 A;  4JI5 L;  2XIW A;  5DM7 3;  4FF2 A;  1MJC A;  2YRX A;  2HVS A;  5M5X B;  3TME A;  4BXX H;  4Q4D A;  3HKZ G;  4LF6 Q;  4R9W A;  2R6G A;  1N36 L;  4HIK A;  1Y1V B;  2ICE C;  2KBN A;  3OMC A;  3GTQ B;  4C3J B;  1H95 A;  3ZJY C;  1CM9 A;  4EQO A;  2WKD A;  1QJO A;  3HG9 A;  2L11 A;  1EQR A;  2EQS A;  4PNY A;  2DJF C;  1VQM A;  3I3C A;  4JG2 A;  1K3B C;  1U9R A;  1KC8 C;  1X65 A;  1KDB A;  1IHZ A;  3TP7 A;  4DLK A;  4Y8V B;  4I65 A;  1PH8 A;  2L0C A;  3TRE A;  4F7X A;  4C5C A;  1KDA A;  1QZG A;  1MSG A;  2RDG A;  1X56 A;  5DIS C;  2RSN A;  4A3E B;  2ZGI A;  4JBW A;  3S1N H;  1UNS A;  1VQK A;  3TS2 A;  3T1H Q;  2ATW A;  1LV9 A;  2F52 A;  4RH6 A;  3NTH A;  1GUT A;  4X3S A;  2SCU B;  2GN5 A;  2UUA L;  2J9G A;  5BYB A;  2WAQ E;  2RQX A;  1E2Z A;  2AHO B;  1I5F A;  1SE8 A;  2NZO A;  3H09 A;  5I9O A;  4IIJ F;  5E4W C;  3OW7 A;  1TWA H;  2JA8 G;  4DGZ A;  1F9R A;  3KAK A;  4DR3 L;  4KK7 A;  4RAU C;  2WB1 B;  5M3F G;  3S15 H;  4AQY L;  2EXZ A;  1VQI A;  1WI5 A;  1OXX K;  4PV1 C;  4LF8 L;  5CMD A;  1EZ1 A;  2JA7 H;  3VYU A;  2IWH A;  3LNN A;  1EL0 A;  3K8A A;  1Y1W H;  2I80 A;  3VR6 A;  5IWA L;  2PW7 A;  2SNM A;  4JOI A;  1KJJ A;  4N9P A;  1B70 B;  2YTV A;  4UDU C;  1JOQ A;  1O7I A;  3DTG A;  1SE3 A;  5H80 A;  1H9S A;  5BN5 A;  3M85 A;  1SMY D;  3ULJ A;  2NVQ B;  3VMM A;  3A7A B;  3H15 A;  5I5S A;  1PZK D;  4JW0 A;  2DIK A;  3CME A;  4JI5 Q;  1U4P A;  4Y7N B;  3KDF A;  2ABJ A;  2QK4 A;  3UZB A;  1DON A;  1SNQ A;  2QA4 A;  2HHF A;  4UFZ A;  1KAW A;  4XYO A;  1VF5 C;  2ZTD A;  2KCC A;  3VOT A;  4A3C H;  5FPO A;  2NN6 H;  5ISR A;  3NE5 B;  3S2D H;  1DGS A;  1N36 Q;  3BG3 A;  4TVI A;  3CHB D;  4P71 A;  5I2X A;  3G6E A;  4O7N A;  1YZ6 A;  1GSA A;  1JB3 A;  3EVQ A;  4GNX C;  2EJ3 A;  1KQS A;  3HOU H;  1IYD A;  1NMF A;  3AFQ A;  3CCV A;  2E8G A;  2B2W A;  2PCF B;  5BR8 L;  4BA1 I;  4E4T A;  5IP9 G;  4YBZ B;  1N8R C;  1ZYR D;  5M5W B;  5CV4 A;  5C3E B;  4DQN A;  5C4X B;  3CCJ A;  2VUG A;  2J4X A;  3PN1 A;  2DJG C;  5EKL A;  5KX5 F;  1WTH A;  2NZH A;  3HOY G;  1XK5 A;  2B2U A;  3PQI A;  1V43 A;  1ET0 A;  1PYS B;  3SNO A;  1X3E A;  1WD1 A;  3BDC A;  2UU9 Q;  3LGJ A;  4CGY B;  1OXU A;  1AZQ A;  3GTK B;  2PI2 E;  3MWD A;  2V5A A;  3GTJ H;  2F4I A;  2PQA A;  2A6E D;  3VPC A;  1C0A A;  2UUA Q;  5EPL A;  1J5E L;  2VQE L;  4HMI A;  3QOJ A;  2L12 A;  4A3M H;  3CF5 A;  2OXP A;  1HUM A;  3K7A B;  2CQO A;  4O7S A;  1LTA D;  4CDE C;  4OXP A;  4UCV A;  3T9C A;  4QF4 A;  1N33 L;  1VQO A;  2WAQ G;  4H13 C;  1S40 A;  4AQY Q;  3HBL A;  4X62 L;  1I4P A;  5EPJ A;  4IFD G;  4LF8 Q;  1CQV A;  4YWL A;  1GUO A;  5C4H A;  5D65 A;  5FLM H;  3KF8 A;  3T53 B;  1HZ9 A;  3RZO H;  4QQB X;  5IWA Q;  3SK6 A;  4RA8 A;  3I56 A;  2EIF A;  3JZI A;  3ETJ A;  5AJ3 L;  5KYL A;  4YAK B;  1VDZ A;  2VUM H;  3WWI A;  5HGQ A;  3H0G G;  4IJH A;  3CC2 A;  1K0S A;  4K6L A;  2R7Z G;  4QIW B;  1HNX L;  3OHX C;  4MIU A;  4C2M B;  2OQK A;  1X55 A;  4GLX A;  4BBS H;  2F03 A;  4Z9C B;  2VQF L;  4C1N K;  4PMC A;  3E0J A;  2WKC A;  1E24 A;  1WR2 A;  1E2W A;  4ILW A;  2EYL A;  3SE7 A;  2HUG A;  4O7T A;  2JA5 B;  1ESR A;  5J39 A;  4LFC Q;  1G91 A;  1KLG D;  5KNB A;  5C4Z A;  3K5M A;  3TSS A;  5C4J H;  2NU6 B;  1GUN A;  2B39 A;  2QCP X;  4ZRZ A;  5BR8 Q;  1YIJ A;  4TSS A;  3E5S A;  3K3P A;  3Q24 A;  4M8A A;  1G51 A;  4BY7 H;  1XNQ L;  5G3L D;  3OPO A;  5HV6 A;  3ITP A;  3R3O A;  4NP5 A;  1WTV A;  4GS3 A;  1NR4 A;  3OOC A;  1L1O A;  1X54 A;  2F0K A;  2F0N A;  1BQQ T;  3DEO A;  2R7F A;  1HPC A;  1T9H A;  2IHE A;  2K4K A;  2P5Z X;  1OBG A;  1KRT A;  5E4X A;  3GV6 A;  3FKI G;  3S1M H;  4KY5 A;  3F8T A;  4XX0 B;  2A74 C;  1SMX A;  5COY A;  2EYF A;  1LT5 D;  2ZXO A;  1I50 H;  1RHP A;  3CC4 A;  4JI2 L;  1CKM A;  4HMJ A;  3RV3 A;  4FNF A;  2LXJ A;  2K32 A;  5FLX E;  3KLS X;  3K5I A;  1J5E Q;  3F2C A;  4KHV A;  2CCZ A;  3E6Z X;  4DV6 L;  2NUA B;  1E4E B;  4ZUJ A;  4FE2 A;  4JI1 L;  4G7O C;  2PW5 A;  2X6G A;  5I47 A;  2K5D A;  1N33 Q;  4A93 G;  1Q81 C;  3M7N A;  1JC7 A;  1IW7 D;  1JOK A;  3RD4 A;  4X62 Q;  2A8V A;  4A3I H;  1Q82 C;  1K8M A;  5CR3 A;  5DLQ E;  2PO4 A;  2K14 A;  1BR9 A;  2R93 G;  4FF4 A;  4MV6 A;  4HNV A;  2F0Q A;  4O4H F;  4G7Z C;  4DIM A;  1CZG A;  1CQF A;  3MHB A;  5AJ3 Q;  4FF3 A;  1KJQ A;  2HVR A;  3D0F A;  4RCO A;  4A75 A;  5EAY A;  1F2L A;  1HNX Q;  1F2Y A;  3J7A V;  2D0O A;  2EPB A;  5JQG F;  4MV4 A;  3PO2 G;  2YYZ A;  3RN2 A;  5KIX A;  1GD7 A;  1W96 A;  2NU7 B;  4ZOL F;  3G7L A;  4ZQ3 A;  2VQF Q;  4QSH A;  2PQA B;  5JVH 3;  3UI2 A;  1G29 1;  5D3D A;  3S1R B;  3G71 A;  3CPW A;  4GLW A;  2FPG B;  1TVX A;  1J9O A;  3MVV A;  4BA2 I;  3AFP A;  4HTP A;  1XNQ Q;  1NY4 A;  1N9W A;  1Y1V G;  2HHH L;  2NVX B;  1TAE A;  4B3R L;  4M0J A;  2SOB A;  1D7Q A;  1Z2P X;  3V05 A;  2Z6B A;  4FXD A;  1STH A;  3LP8 A;  4C3J G;  1EY7 A;  4MHE A;  3G48 A;  1GJX A;  2IPK D;  4CC6 A;  2OTJ A;  2B2V A;  5G3L F;  1C8C A;  1UC8 A;  3MWE A;  3UDI A;  1VMC A;  4PZ7 A;  2K75 A;  3H3V C;  4JI2 Q;  4A3D B;  1G2W A;  2WFW A;  1K73 C;  4GLV B;  4O42 A;  1PRT B;  1W6J A;  2RCF A;  4ZHQ F;  2A69 C;  4C1N I;  2FHT A;  1SNM A;  1STN A;  1JDE A;  4DR7 L;  3TQY A;  4JI1 Q;  1NCV A;  3GP7 A;  1BVS A;  2AUJ D;  3V96 A;  3E5N A;  2KUM A;  3OMG A;  1AE2 A;  2R87 A;  5JOB A;  5FLX c;  1KDC A;  1I1K A;  5D3I B;  2E2J H;  4ZK9 B;  1SE2 A;  1A3U A;  1X9N A;  4R4C A;  2Z8L A;  3PGZ A;  1W3S A;  3QQM A;  3J80 L;  2WP8 J;  2KA7 A;  2KHJ A;  2K33 A;  3TII A;  5FNV F;  1AE3 A;  2UXB L;  3SGI A;  2ZJP A;  3E9H A;  1XPO A;  4XQJ A;  3K5O A;  1JB7 A;  1XXG A;  1PVO A;  3TEH B;  3OIQ A;  5DGH A;  3T13 A;  3IFD A;  4BS9 A;  4O0A A;  4FXG C;  1I4X A;  1TXY A;  1PTO C;  4EQP A;  1RJT A;  5ELN A;  2NB0 A;  1I1L A;  2D9U A;  1DM0 B;  4RKL A;  2EJF C;  2KVM A;  2ZT9 C;  3FEW X;  1SNC A;  3LWE A;  2BOS A;  5DMX A;  3NTI A;  3ONA B;  4MV9 A;  3VDY A;  5J1Z A;  2R86 A;  2PYK A;  4YHH Q;  4YJ2 F;  3U4Z A;  1SCU B;  3HO8 A;  2EOT A;  4C3H H;  5LMN L;  5LMN W;  3AX6 A;  4A76 A;  3CRL C;  4CJ0 B;  3SK5 A;  4TQU S;  2AUK A;  1QWY A;  2X0S A;  1ZAU A;  4J6H A;  4X66 L;  1WTQ A;  2MO1 A;  1UC9 A;  4UUG A;  3PFF A;  2HHH Q;  3X3N A;  2E76 C;  4B3R Q;  2BH8 A;  1ASZ A;  4DAY B;  3X3M A;  2GQR A;  3G8C A;  5BWT A;  1A15 A;  1QZH A;  1RTN A;  3U0G A;  1CSP A;  5C3E G;  1NAP A;  1VQN A;  5C4X G;  4FXK C;  3PIP A;  4J1M A;  3SDZ A;  4K14 A;  3G8D A;  3P7J A;  1QVG A;  4O7Y A;  3I4N B;  3I4L A;  3L2P A;  3TY5 A;  2NVT H;  3TY9 A;  2AQ3 B;  2O5I C;  4APV A;  3EIV A;  2OQ0 A;  1Q86 C;  2K6A A;  1QUQ B;  3QO2 A;  1ENA A;  3ORR A;  2NUC A;  1PH7 A;  2CNV A;  2NU9 B;  3TQT A;  2BDO A;  3HOY B;  4RGM A;  3RR5 A;  2PBZ A;  3R8B A;  2H4O A;  4DR7 Q;  4RCN A;  3M3Y H;  5D1P A;  4E6I A;  3PF4 A;  4NZO A;  5IYB H;  2CWA A;  4JBJ A;  3HOX B;  2K05 A;  1YNN C;  1XDN A;  2AQ2 B;  3U9O A;  1Z6H A;  1H9K A;  2NTT A;  5HY6 A;  4O4L F;  4BBR B;  1VBG A;  1FR3 A;  4C3I H;  2E2H B;  1EY0 A;  4DR6 L;  1I94 L;  1AUX A;  3CCE A;  1SJE D;  2BA1 A;  3PO3 B;  3S2H H;  1FGU A;  2UXB Q;  3KBG A;  3GTP H;  3STB C;  4UAI A;  3HOV B;  2VNU D;  1LTB D;  4GKK L;  1SAP A;  3S14 H;  2JN4 A;  4O86 A;  3MXN B;  1QCB D;  1ICF B;  2WAQ B;  3NWS A;  3CQZ H;  2JA8 H;  3I4M H;  3NBI A;  1B7Y B;  3MWY W;  5M3F H;  1TS5 A;  4DV7 Q;  1K83 H;  1B53 A;  5I5V A;  4OEM B;  4CBV A;  1GGO A;  3ETH A;  5T1G A;  2GVA A;  1M90 C;  3JRW A;  2K5Q A;  1KXL A;  4JI6 Q;  5JJK A;  2ZTC A;  5KRU A;  3W1B A;  2F3V A;  5LMN Q;  2XVS A;  2Z6K A;  4LNQ A;  1VQ6 A;  2EVB A;  1SYB A;  1JLL B;  2NN6 I;  5KND A;  3N6R A;  3PUW A;  1M0T A;  1VQJ A;  1SJH D;  3RZD H;  2JA5 G;  3J81 c;  1JIC A;  3FDT A;  1DZ1 A;  2ZXP A;  1I2L A;  1BNC A;  1EU4 A;  2Q2H A;  3BVG A;  1HQR D;  2B2Y A;  2GQS A;  1M6V A;  4O1N A;  3CC7 A;  4LH6 A;  4LJZ C;  3G4S A;  4MNO A;  4DAA A;  2OF1 A;  4YWM A;  5IGB A;  2Q8I B;  4KN4 C;  5FJ8 G;  4B3T L;  4V19 0;  4Y52 H;  1RL2 A;  3U4V A;  2CQA A;  4LUO A;  5IP9 H;  1PDQ A;  4B3S L;  4IUV A;  2YZL A;  3KLS A;  4HQ6 A;  2Z1C A;  4IWY A;  1M8A A;  3SK4 A;  1KD1 C;  4R8I A;  1Q12 A;  3FPP A;  3V4Z A;  3HS0 C;  2QEJ C;  1Z9F A;  2FMC A;  5ELB A;  4BWG B;  4MZ9 A;  1EOV A;  1GM5 A;  4DV5 L;  2HT1 A;  5BN3 A;  4FFN A;  3S1Q H;  4HAE A;  3K59 A;  2LY7 A;  2DY7 A;  2YU9 B;  2I87 A;  2R84 A;  4XZ3 B;  5IYD H;  1WTP A;  1LT6 D;  4DR6 Q;  1XX8 A;  1EIY B;  4JBM A;  3BDO A;  3NK9 A;  4UY8 C;  4EGQ A;  2COG A;  4WOR A;  1P8L A;  5IYZ F;  4CMD A;  4FFP A;  4O4I F;  2JJQ A;  2VS1 A;  2Y4R A;  4GKK Q;  3GTO B;  1K8A C;  3CU7 A;  2E2I H;  3QOL A;  1FNV A;  5J2U F;  4ME6 A;  2BE5 C;  5GAH C;  1BCP D;  2RKS A;  4A93 B;  4JK1 C;  1UE6 A;  3BZD B;  5H1S E;  3KUP A;  4JVZ A;  5IIF A;  4S3S A;  4EGV A;  3AMU A;  4GN4 B;  1TWC B;  4K8I A;  1CTM A;  4XYM B;  1UE1 A;  1G6Z A;  4HNU A;  1LTG D;  3E9I A;  3CW2 C;  4K2K A;  3K5H A;  2WII B;  3KBX A;  1VQ8 A;  3J7Y W;  2O2L D;  3J80 E;  1N34 L;  4OO1 H;  3QFF A;  2KHS A;  4DR5 L;  1X32 A;  2XTI A;  1SNP A;  2LSS A;  4DK6 C;  3VR3 A;  1SYC A;  3H0G H;  4G4K A;  1O78 A;  2R7Z H;  1XPR A;  3PO2 B;  3IRB A;  1C48 A;  1WCM G;  3HKS A;  4IUP A;  3HOW H;  3V4S A;  3T56 B;  2KJX A;  2Y0S B;  1V1Q A;  2K1B A;  3KF6 A;  3PUX A;  4K2L A;  5I6W A;  1QB5 D;  3S15 B;  3CEB A;  4I4T F;  3NBH A;  4UCU A;  5I5W A;  4FGR A;  4M9U A;  1CKN A;  5BWU A;  1YNJ C;  4B3T Q;  2F0U A;  4DPG A;  4I55 F;  4POG A;  2DNC A;  4DAP A;  3U58 A;  1R9T H;  3F2B A;  4A3B B;  2QDB A;  2F0L A;  1TS4 A;  4LFB Q;  4B3S Q;  1JJC B;  3KOJ A;  3HFZ B;  4HJ8 A;  3L3O C;  5CE8 A;  3QWN A;  1E0B A;  5LA6 F;  4ZKC B;  4KJN A;  3Q23 A;  4A3D G;  3HGB A;  1C7Y A;  1TS2 A;  1Q1B A;  4DR4 L;  1Z47 A;  4DV5 Q;  1CFM A;  1K28 A;  1YHB A;  1EUJ A;  4UP7 A;  4A3J H;  3FKI H;  2EJ2 A;  5CV7 A;  1JQY D;  1STA A;  4GZY C;  4MN3 A;  1W6K A;  2LXK A;  4OL7 A;  2UU9 L;  3NC0 B;  5C44 B;  1SRO A;  1BNZ A;  1UEB A;  5HUR A;  2ODT X;  2SDF A;  2FFK B;  5BPH A;  4C5B A;  4DN4 M;  1LTI D;  4KTA A;  3ORQ A;  4IUR A;  4FFM A;  4NZN A;  1PH9 A;  4XIG S;  4NXM Q;  1NR2 A;  2CH4 A;  2O5J C;  1STE A;  4RFB A;  5EKK A;  2HDM A;  3HEJ A;  4HSP A;  2M00 A;  1A0G A;  2YV5 A;  5D1O B;  4Q0F A;  5CBE E;  1DYQ A;  1A8V A;  2EE1 A;  1B6R A;  3CSW A;  1BCP F;  2R93 H;  4FDB A;  4IPG A;  2W6Z A;  2V58 A;  2C00 A;  4IPC A;  1HFG A;  3GTJ B;  3NEL A;  4P73 A;  1T36 A;  3HRZ C;  3NSW A;  4KD3 A;  2RCN A;  4CJ1 B;  3A74 A;  1N34 Q;  2XSC A;  4JI8 L;  2AQ1 B;  1OXS C;  2F0J A;  2A6H D;  4DR5 Q;  2R82 A;  4KY6 A;  2XWB B;  3T54 A;  3PF5 A;  3T9B A;  2B2T C;  1GHK A;  2JXM B;  3J80 c;  5BWX A;  4DNR B;  4R4I A;  3VR2 A;  1G2S A;  3OTO L;  5JPN C;  1S72 A;  1AH9 A;  2JA6 H;  1Y69 U;  2PNR C;  3URY A;  2QW7 A;  3RZO B;  3K81 C;  4DFA A;  1DV1 A;  3A0J A;  5M5X H;  2YS7 A;  5COR A;  4DK3 C;  3CCM A;  1L0W A;  2ALY B;  3JAM E;  5TSS A;  4JI0 L;  4WJ4 A;  4A3F H;  1NUC A;  1Y1V H;  4OON A;  1TII D;  4LFC L;  3CP0 A;  2B8F A;  3I4N G;  3VNN A;  3F2U A;  3GTQ H;  4C3J H;  2MJ8 A;  5IE8 A;  2OEO A;  4DR4 Q;  4UCS A;  3U50 C;  2CHB D;  5A2Q L;  2IX3 A;  1XMO L;  5LMU L;  5C0X G;  4O2B F;  4LF7 L;  1KL9 A;  3ND8 A;  3I12 A;  4K0K L;  3PIO A;  5JVD F;  3UDF A;  1VQ5 A;  1UEA B;  2CW0 C;  4PMB A;  4JV5 L;  2F4V L;  2HGS A;  3HOX G;  2WIN B;  1FVI A;  1QE6 A;  4IZO A;  4QCL A;  2COI A;  2OT2 A;  3DEP A;  4IWX A;  3ER0 A;  1YJW A;  4A3E H;  5IT9 L;  4BBR G;  4UHV A;  3KAJ A;  4TV8 F;  3I7F A;  1TA8 A;  3GJX B;  3PO3 G;  3KF6 B;  1Q90 A;  5C3W A;  4IOA A;  3NBH B;  3HOV G;  1HNW L;  2F3I A;  2L15 A;  4GN5 A;  4R4O A;  4OWT B;  1KNA A;  3IL8 A;  3D31 A;  3S1M B;  1KTK A;  2PVP A;  1EZ8 A;  1P16 A;  3S16 B;  4R4Q A;  1JWS D;  3TIG A;  3DM3 A;  1CA5 A;  3L0O A;  4OHJ A;  4FYD A;  4YCV A;  2CH4 W;  4B08 A;  2AMC B;  3C1F A;  4PMW A;  4JI8 Q;  2BCO A;  5E1F A;  4LF5 L;  2F0T A;  1B4O A;  1FNW A;  5JAV A;  1HA6 A;  1GSH A;  3A8J E;  3ERS X;  4DNI A;  1ICW A;  1Y8P B;  1E1O A;  1LYL A;  3ND9 A;  1TKW B;  5LOV F;  5CC4 A;  2R7N A;  4ZQI A;  3A54 A;  2Y0S E;  3FMC A;  4LK1 C;  3OTO Q;  1ML0 D;  2NVQ H;  1VQC A;  4O83 A;  1CS0 A;  4FFR A;  3Q22 A;  3U9S A;  1I3Q B;  1LO5 D;  1Y14 B;  1B3A A;  1YJ9 A;  3KFU A;  4CDC C;  3M9B A;  4Y7N H;  1ESF A;  3CXC A;  5J3B A;  2ICI A;  4P72 A;  1TWG B;  5FO9 B;  1EY5 A;  4N8X 1;  2RSO A;  5C1P A;  2ZDH A;  3WO0 A;  4JI0 Q;  3TEK A;  2DZD A;  2XGT A;  4CMF A;  3I70 A;  3ICE A;  2ZDG A;  5EKI A;  2AWN A;  1GUG A;  4O2D A;  5LXT F;  2OCE A;  4ID6 A;  2AWO A;  2F0W A;  3CMA A;  4IJL A;  2IJ0 A;  2BA0 A;  3A8K E;  1KNE A;  4OEL B;  1IYU A;  5DAU A;  3JAM c;  4FF1 A;  5CYU A;  4P75 A;  3HOZ H;  5M5W H;  4WFN 3;  1XMO Q;  5LMU Q;  2H1E A;  4HR7 A;  2F1M A;  3MXP A;  3CKI B;  4YWK A;  2V1C C;  5C4X H;  4LF7 Q;  4IAL A;  4K0K Q;  4O82 A;  1JKJ B;  2K5H A;  4GOP A;  2ES2 A;  4PZ8 A;  2F4V Q;  4JV5 Q;  5KEE A;  2R7L A;  1RF2 D;  1B04 A;  3ERO A;  5CM0 A;  4BXX G;  1L0X B;  4IO9 A;  4HN7 A;  4QMG A;  2B63 B;  1TR5 A;  2FMM A;  3GTK H;  3FVQ A;  5BMV F;  1TWH B;  3N52 A;  3OSO A;  1TS3 A;  1X3G A;  1NMG A;  4OGQ C;  5K2M A;  2P0A A;  3MTS A;  1H9S B;  1J8I A;  4DXG A;  3MJF A;  5I9P A;  2K50 A;  1HNW Q;  4LUZ A;  5M5Y B;  3GTM B;  3H3V H;  3OWE B;  3NXW A;  4KMU C;  4JC0 A;  1YJN A;  1OBD A;  3KDF B;  1WVL A;  1WTX A;  3Q2O A;  2HHF B;  4HTO A;  3K7A H;  2EYH A;  2K28 A;  4POF A;  2W71 A;  1U4R A;  4P74 A;  2I46 A;  4MV8 A;  4L5T A;  3GDE A;  4ME3 A;  1V1O A;  2PPB C;  4MV7 A;  4MV1 A;  2A1A A;  1KC7 A;  3RN5 A;  1I1M A;  2MPM A;  2VZA A;  2UXC L;  1ULZ A;  4RKB A;  4BY1 H;  4KHZ A;  2A6E C;  2KOL A;  4LF5 Q;  4X3T A;  1HR0 L;  1OO9 B;  3R2I A;  1MBY A;  2AKW B;  1PTO D;  4DK0 A;  1I4H A;  2Z02 A;  1BBU A;  2RDH A;  3J7A F;  4J8Q A;  4LFA L;  3O13 A;  3QR8 A;  5IOD A;  1RDP D;  4B9W A;  3KLW A;  1VBH A;  3GTG B;  1V1P A;  1ENF A;  2HCI A;  5A35 A;  3TY8 A;  3FRP B;  4DK1 A;  4KY7 A;  1SFO B;  1PTO H;  2NZ1 D;  2PZT A;  4C2M H;  2A1H A;  2Y0S G;  3NP8 A;  2JP1 A;  1DOL A;  1LT4 D;  1MGS A;  4YHH L;  1EWH A;  1S5C D;  2ASB A;  5I5Y A;  3TP5 A;  1Y1W G;  3ERQ A;  1WCM B;  1T5X D;  1C4Q A;  3MFG A;  2L1B A;  2JA5 H;  5EGT A;  2B8G A;  1MI2 A;  2LS0 1;  1KEE A;  3K80 C;  2B29 A;  1RKN A;  1WJJ A;  3MC0 B;  5I5T A;  3TBI B;  3R5F A;  1S3O A;  5EBC A;  4A3B G;  4WJ3 M;  1A63 A;  3U54 A;  3JC6 6;  3SE0 A;  3FP9 A;  4XYL B;  3CCQ A;  3M4O B;  5L37 A;  1D5X C;  4I7A A;  4DKA C;  5GAD C;  1TQO A;  4XXE A;  5FJ8 H;  2PZU A;  3OUU A;  5ELD A;  3UZO A;  4HCE A;  4JI7 L;  3KF8 B;  4HTH A;  2E75 C;  2NN6 G;  1CQI B;  2Z0S A;  1B50 A;  1LAB A;  4MA0 A;  1O7Y A;  2QDL A;  1OXT A;  1KTA A;  5C44 G;  2Q7D A;  3JSN A;  1TWF B;  1D2B A;  3GID A;  2QF7 A;  2VL6 A;  2XRS D;  1Q8I A;  2F0F A;  4ZKB B;  4A3L G;  3N8D A;  3NQI A;  1K9M C;  5A2Q E;  2COJ A;  3C46 A;  2Q2T A;  1NSN S;  1PXU A;  4YY3 Q;  4DXF A;  4EVO A;  4CKB A;  5M3M B;  2K5V A;  4OIJ A;  2UXC Q;  1WOC A;  2N49 A;  4NXN L;  3WWH A;  5ELO A;  1E3P A;  2WV6 D;  3BAA A;  3F1Z A;  1IL2 A;  2ID0 A;  2VPQ A;  4JXU A;  5C5L A;  3WWJ A;  4H44 C;  1HR0 Q;  5I2Y A;  5IT9 E;  2W70 A;  3BU2 A;  1PH1 A;  1OXV A;  4O7R A;  1AUV A;  1STB A;  1BXR A;  2FPI B;  3MXG A;  4HSV A;  4HR7 B;  4OO1 I;  5JEA H;  1IBM L;  2YWV A;  1L1O B;  4LFA Q;  3NBY B;  2HVQ A;  3U55 A;  2E2D C;  1HZA A;  1W2B A;  4R4T A;  3DUZ A;  1K3R A;  4A3M G;  3LQS A;  4EG0 A;  5KKN B;  4DV7 L;  1EQV A;  1PTO F;  1AFP A;  1OTC A;  1DV2 A;  4JI6 L;  1XMQ L;  3NHH A;  5FLM G;  1JDB B;  1LAC A;  3DXJ C;  2N3S A;  3S24 A;  2IY5 B;  3S1R H;  2F0G A;  3AEV A;  1KUT A;  2K5N A;  2FJ2 A;  1D8L A;  1A62 A;  3AB9 A;  3A5U A;  5GAG C;  1CT1 D;  4GNX A;  2NVX H;  2VUM G;  3DWQ A;  2I5M X;  1IBL L;  3T9A A;  1TT2 A;  4EEQ A;  2KHI A;  4JOI C;  2IX0 A;  3G6J B;  4YIJ A;  2W6O A;  4A3K B;  4JI7 Q;  1JE5 A;  1X3P A;  5CV8 A;  2EYO A;  1JT8 A;  1C30 A;  1PFS A;  3P75 A;  1HUN A;  3QB3 A;  3T1Y L;  1Q3L A;  4CJ2 C;  3GTL B;  5JJI A;  3C1E A;  4A3D H;  2LKV A;  5J22 A;  1JOO A;  2NVY B;  3T9F A;  2R92 B;  3C3L A;  2CZG A;  2I8C A;  4KN7 C;  4B3M L;  2FIN B;  2M2L A;  5KNC A;  1GSO A;  1HJP A;  4X6A H;  5IP7 G;  3GQB A;  3K7U C;  4WRD A;  1D5Z C;  2PNH A;  2SNS A;  1FD7 D;  5CGK A;  2ZJR A;  4LH7 A;  2C35 B;  2DGY A;  1JWU D;  4O4J F;  5FKA C;  4CC5 A;  4CDF C;  3UQ8 A;  4HIO A;  2F0O A;  1GLV A;  2B2W C;  4Q5V A;  1BBW A;  3NEM A;  4QL5 A;  5GQO A;  2R61 A;  3MFY A;  3D6C A;  4NXN Q;  4NB3 A;  3Q1K A;  1K0R A;  2DNE A;  3KK7 A;  2J0T D;  2KED A;  2B2U C;  1MKH A;  2TMP A;  3KJP A;  2BE5 D;  3IKJ A;  4OWX B;  1AN8 A;  4K5X A;  1WD0 A;  4DF7 A;  1IBM Q;  3S1Q B;  1DXM A;  1SXT A;  1ILQ A;  1LLR D;  4DAM A;  3EQL C;  4LWC A;  2KCT A;  5JEA J;  3VYR A;  4HNT A;  3RLN A;  3K6O A;  4IUN A;  2R3Z A;  1Q1E A;  4U68 A;  1PZJ D;  1F2M A;  4TKO B;  3RLO A;  4UP9 A;  3WNZ A;  2HJW A;  4KKT A;  1ET9 A;  3IAY A;  2E74 C;  1I6H B;  1XMQ Q;  1X3Q A;  2EY2 A;  1YI2 A;  2A68 D;  3BYY B;  4DV3 L;  1PX2 A;  4HJ9 A;  3B6Y A;  3NQT A;  1BUV T;  1VKZ A;  1U4L A;  3QIA A;  4L5S A;  1DOM A;  5DM6 3;  4RMF A;  4CKC A;  2DUD A;  3JZF A;  5K36 G;  2HQE A;  3I2Z A;  5JQW A;  4LW1 A;  1IBL Q;  4XYQ A;  1U5K A;  2DAA A;  4ZUI A;  1RIP A;  2BH2 A;  2XCL A;  1BCP B;  1BXT A;  4RGN A;  2G9D A;  3PCO B;  4J15 A;  2NTS A;  4B9X A;  1QNU A;  2HQL A;  1N32 L;  1EY9 A;  1IKL A;  2JYO A;  3S17 H;  4YAJ B;  1PRT C;  4XT1 B;  3T1Y Q;  3DWP A;  1O7L A;  1X3F A;  3DWA A;  5I4D A;  2Q8T A;  2DY8 A;  2CFM A;  4H02 A;  3WOE A;  4RZQ A;  2TSS A;  3SEB A;  4LFB L;  5K3W A;  3HOW B;  4A3G B;  4B3M Q;  1AEX A;  4HJ5 A;  2B63 G;  5C0X H;  4QGU A;  3HOY H;  2EY5 A;  1EYG A;  5BWR A;  1RD9 D;  3HOX H;  4KV6 A;  2F0M A;  4N8F A;  3T16 A;  5T1I A;  3SVM A;  5HNE A;  2I0Q A;  1HTP A;  2A5H A;  2KCM A;  5EBD A;  2E2H H;  2K52 A;  5NUC A;  2OWO A;  2VR1 A;  2HCC A;  1D1I A;  2ZXR A;  1D1K A;  2ZDQ A;  2FP4 B;  3AQQ A;  1S68 A;  5IOC A;  1TY0 A;  4NXM L;  1VQG A;  4IUU A;  4RGO S;  3M4Y A;  1G8Z D;  4A3J B;  1SBB B;  3CAM A;  3W2D A;  1LTS D;  1ROD A;  1FNU A;  1KIX A;  2HGX A;  3RNU A;  2NYZ D;  4IFD H;  3TRZ A;  2XN9 C;  5C8Y F;  4MA5 A;  1IKM A;  5FO7 B;  3S1N B;  3SHL A;  1PHJ A;  3BS1 A;  5JJL A;  5BPF A;  2B3G A;  4L63 B;  3D4W A;  3I4O A;  3ZYY X;  2EY6 A;  4NDX A;  2CVR A;  1KJ8 A;  3MA2 B;  4DV3 Q;  2CKZ B;  3BVM A;  1KJI A;  2QEX A;  4EQN A;  1HFN A;  1LT3 D;  1EHI A;  4JCV E;  4WJW A;  3MAQ A;  4X3U A;  3BG5 A;  1NJI C;  4R1J A;  1I6V C;  1NBW A;  1TWA B;  2DN8 A;  3DHQ A;  3K0X A;  1I2K A;  2CNQ A;  1Q7Y C;  1T5E A;  1C9O A;  2UUB L;  2JA7 B;  4DNT B;  5CR5 A;  2C9O A;  4L6T B;  1Y1W B;  1N32 Q;  1B3Q A;  1EEF D;  1CUK A;  3RLF A;  5GAE C;  4GN3 B;  2YW2 A;  3D4R A;  1A2T A;  1PK8 A;  3JSL A;  2RVL A;  1EKV A;  1VQE A;  1J6Q A;  1VF7 A;  1S5B D;  2O4X A;  4C3H G;  4IHJ F;  2G5D A;  1Q46 A;  1QNK A;  1S4Z A;  3HT5 A;  5EQ0 A;  2D0P A;  4JI3 Q;  4YB8 B;  1EFI D;  3KJO A;  2JA6 B;  5E25 A;  2K04 A;  3PUY A;  5BYA A;  4ZLT F;  5C0X J;  2Q2I A;  3NTK A;  4YJ3 F;  4FO2 A;  1QVF A;  4O7Z A;  1GUS A;  4WHX A;  2CW0 D;  3H3V I;  3S2D B;  3R2T A;  1IBK L;  2KEC A;  3DTF A;  2YU9 H;  5M9O A;  3BYT B;  4P2C B;  4A3F B;  3NUA A;  4UP8 A;  3QWU A;  3HOU B;  1KJ9 A;  4NKL A;  3R23 A;  5FLX L;  2G9H D;  5IGF A;  2DLN A;  2L9H A;  1VMP A;  4MV3 A;  1CKO A;  1CK1 A;  1MD2 D;  1I4G A;  1XJV A;  1LTR D;  5M3M G;  4H7B A;  4QJF A;  1Z2O X;  2MHV A;  3GTO H;  2F0H A;  2B2V C;  3A55 A;  4MAM A;  1SYD A;  3MZ5 A;  1B2T A;  4TRD A;  4A93 H;  2JEA I;  3IFT A;  5FR9 A;  1EZ6 A;  2DAB A;  4NW2 A;  1KAA A;  1RCV D;  5IYB G;  2EYM A;  1TWC H;  1VQD A;  1S5D D;  4IFD J;  4C3I G;  3PUZ A;  1VQF A;  1HTL D;  1I4Q A;  3K5L A;  2L5T A;  5J2T F;  4AYB E;  2N78 A;  1V8Q A;  3EJI A;  2QB5 A;  5BN4 A;  1K8O A;  1XWE A;  3LX0 A;  1EOT A;  4XQN A;  1BCP C;  1GXD C;  1XTD A;  4A3M B;  2E5L L;  4LUV A;  2F3W A;  5KYI A;  2EZV A;  4LMQ D;  4PQX A;  3PO2 H;  3FPU B;  5JH7 F;  2I5L X;  5IYC G;  3I4M G;  2UUB Q;  5AFW A;  4XQQ A;  3TP8 A;  3R9R A;  3BAC A;  4FVM A;  1MHW C;  5GON F;  2HDL A;  3RFC A;  3EA6 A;  3DMU A;  1HZC A;  4IZ8 A;  1G6P A;  1H9J A;  3CCU A;  1HH2 P;  4IUQ A;  3TN2 A;  4A3K G;  4A3B H;  2PMZ E;  4NMZ A;  1PLF A;  2I5H A;  4DR1 Q;  2BDN A;  2VUM B;  2I07 B;  1NTG A;  3SXH A;  4K5W A;  5JPM C;  1A48 A;  3U9T A;  4O84 A;  1TU2 B;  1UWV A;  1KRS A;  3QG1 A;  1PFN A;  1VQB A;  1E4E A;  2HGW A;  2YS6 A;  2R92 G;  4BBS B;  4ALP A;  1I7L A;  3Q0A A;  5DNF A;  5CAE B;  2RBM A;  4IPH A;  1IBK Q;  4XTC S;  1B1Z A;  1SDF A;  1PH2 A;  1HXY D;  2ZJQ A;  1IYV A;  1O7Z A;  2HD3 A;  5C44 H;  3HP3 A;  4EGJ A;  5C4J B;  4LAA A;  1SEB D;  1MIU A;  1EQT A;  4K6D A;  4BY7 B;  3VPB A;  2V59 A;  3HOZ B;  2F0E A;  4A3L H;  1PYW D;  3RUP A;  4O81 A;  1EU3 A;  1ILP A;  3JZ6 A;  2KQ3 A;  1HA5 A;  1A2U A;  1BO0 A;  1CKN B;  4FFL A;  1R4P B;  2KEN A;  1PH5 A;  3K0Y A;  4EX5 A;  1PH3 A;  1TY2 A;  1V9P A;  3T99 A;  2K03 A;  3WO1 A;  1G2T A;  1I50 B;  4XDX A;  5IYD G;  1VQP A;  5GRO A;  2Q2U A;  5FOB B;  2HIX A;  1K8G A;  4FP5 D;  4QB4 A;  3J81 j;  5CA1 F;  5I5U A;  2F0P A;  3D4D A;  2JA9 A;  2PN1 A;  1WFQ A;  2YTY A;  3GV3 A;  2E5L Q;  4AYB G;  1EIG A;  3FHW A;  2YYA A;  1AW7 A;  1MSH A;  3UFX B;  4DR3 Q;  4KKU A;  3PV0 A;  4A3I B;  2HIV A;  3AYH B;  5JVL A;  2RHS B;  4BY1 B;  3J81 L;  2JQO A;  2VXW A;  1B6S A;  1A0I A;  2DWC A;  3CCS A;  3RV4 A;  2Z4H A;  3DLL A;  1EWC A;  5K5P A;  4DUY L;  4C5A A;  3NPP A;  5FPR A;  3UE0 A;  2A6H C;  4EFE A;  5LHY 1;  4OO1 G;  3CD6 A;  2GLT A;  3A8I E;  2YTX A;  5DEH A;  1CHP D;  4ZYS A;  1VCI A;  1AZP A;  2MO0 A;  1SMY C;  3OIP A;  1X6O A;  4U67 3;  2R7K A;  2Z6K C;  3HOW G;  1PTO B;  5C3E H;  4A3G G;  1GHJ A;  3VA7 A;  2QGQ A;  1WYD A;  3D6W A;  1IOW A;  4DRF A;  1IL8 A;  3R5X A;  5CV5 A;  2LMC B;  3A7L A;  3SK8 A;  3ULP A;  2NBF A;  5FK9 C;  1Y8O B;  1GOZ A;  2Z4I A;  3TS0 A;  2B2Y C;  1LM0 A;  5IP7 H;  4KI0 A;  2VB3 X;  4DAV A;  1ZYR C;  4GKJ L;  4OX9 L;  2A69 D;  5DGI A;  1VS0 A;  1ENC A;  3LWU A;  2D62 A;  2YRW A;  1B44 D;  2HG8 A;  4O2A F;  1JWM D;  4F88 A;  3NWT A;  3UE1 A;  1YBY A;  1S5E D;  5CV9 A;  1DCZ A;  2EJG C;  4A3J G;  1WTR A;  2W6M A;  2EIY A;  4M1U B;  3S16 H;  1M4V A;  3TW7 A;  4ZI7 F;  4UCT A;  1PV4 A;  2EJM A;  4YY3 L;  4G57 A;  1HQM C;  4I50 F;  5I60 A;  3GD7 A;  3JRX A;  3KAL A;  1L2F A;  3I72 A;  2X5R A;  2MFI A;  1SND A;  2VQE Q;  4G7H C;  4DU9 A;  1HR0 W;  4AIM A;  1A3G A;  2LFN A;  4UCR A;  2VY3 A;  5CBA E;  3J81 i;  2F0S A;  1HNZ L;  1EYC A;  3PIP 3;  1GKH A;  3PMF A;  4O7W A;  1PYB A;  2E2J B;  2EY1 A;  4DAY A;  4OWW B;  1JJG A;  4EFB A;  5F2D A;  2WB1 E;  4JI4 L;  3TZD A;  2QKI C;  4F8M A;  1A3V A;  5EZY F;  1EKF A;  2F0I A;  1F77 A;  1EY4 A;  1QOH A;  3CPF A;  2UXD L;  1I3Q H;  1JE4 A;  1Z7T A;  4DR2 L;  2D5D A;  4DUY Q;  1E2V A;  3UDX A;  1DJR D;  1F9S A;  1XNR L;  1TWG H;  2JA7 G;  1M0W A;  4K6N A;  4KKS A;  3OWF A;  2JK8 A;  2XWJ B;  4DV2 L;  5K36 H;  4IPD A;  1II3 A;  4A4I A;  1QUQ A;  1VQ4 A;  4QY7 A;  4OIK A;  1CE8 A;  1NE3 A;  1ZXT A;  4HJA A;  1JOR A;  2Q8R E;  3L9A X;  1IOV A;  3VYS A;  2KEE A;  1UAP A;  5C0X I;  1VQH A;  1FYC A;  3V2T A;  2IX1 A;  2MNA A;  4X64 L;  1CQJ B;  2YZM A;  4E6N A;  1DIK A;  4DV1 L;  2JA6 G;  1XYI A;  4IN3 A;  1DAA A;  4C3H B;  1EYD A;  1PH4 A;  1XTC D;  1O80 A;  1IZ6 A;  2PZW A;  4MTK A;  2NWG A;  4A3C G;  1QG7 A;  1IYE A;  2B63 H;  2V4D A;  2H5X A;  1JJ2 A;  1TWH H;  2D2C C;  1BKB A;  3AW8 A;  4A3F G;  2CWP A;  4NZM A;  3KYH C;  1FJG L;  4GKJ Q;  4OX9 Q;  3HOU G;  4LF4 L;  3I8Z A;  3MXN A;  3EFX D;  2J7Z A;  3VR4 A;  4V0B A;  3HKZ B;  3R93 A;  3ULL A;  5M5Y H;  1CA6 A;  3GTM H;  4JYA L;  2FPP B;  1YNN D;  2JSO A;  1LUZ A;  3NUC A;  3Q6S A;  3BJU A;  4QUF A;  2GA4 B; 
#chains in the Genus database with same CATH homology
 2LXK A;  4RMF A;  3CCL A;  3NBZ B;  3NC0 B;  2DUD A;  1SRO A;  2VUM H;  1UEB A;  5HGQ A;  4TVA B;  5K36 G;  4IFD I;  3I2Z A;  3H0G G;  4IJH A;  4LW1 A;  3CC2 A;  1IBL Q;  1HNX L;  1U5K A;  2R7Z G;  3EN2 A;  1RIP A;  2BH2 A;  3STB D;  1M1K C;  1SR3 A;  3E0E A;  4A3E G;  1PH9 A;  1E1T A;  4XIG S;  4RG1 A;  2OQK A;  1X55 A;  3PCO B;  1YEZ A;  4J15 A;  4GLX A;  4NXM Q;  4BBS H;  3GO5 A;  1EFW A;  4DV6 Q;  2HQL A;  2VQF L;  2RF4 A;  1N32 L;  3S17 H;  1HNZ Q;  1E24 A;  1VQA A;  3T1Y Q;  4DV0 L;  1X3F A;  2YV5 A;  5D1O B;  2CFM A;  4H02 A;  4LFC Q;  4GOP B;  4JI4 Q;  1A8V A;  5C4J H;  4LFB L;  5BR8 Q;  3F2D A;  2R93 H;  4FDB A;  1YIJ A;  4IPG A;  3M4Q A;  2UXD Q;  3GTG H;  4B3M Q;  1UE5 A;  4IPC A;  1G51 A;  4HJ5 A;  4BY7 H;  3NEL A;  4P73 A;  1YNX A;  4DR2 Q;  1XNQ L;  4QGU A;  2B63 G;  1YHQ A;  3HOY H;  1SFO H;  1EYG A;  2RCN A;  4GS3 A;  2WB1 G;  3A74 A;  1XNR Q;  1L1O A;  3W1G A;  1X54 A;  1N34 Q;  4JI8 L;  1OXS C;  4DR5 Q;  3RTX A;  2R7F A;  1T9H A;  2ZTE A;  3HOX H;  2IHE A;  4HJ7 A;  4DV2 Q;  2K4K A;  3M4P A;  3Q8D A;  1E7Z A;  1WCM H;  1KRT A;  3PF5 A;  3S1M H;  3FKI G;  4X65 L;  4JBK A;  3F8T A;  2I0Q A;  1SMX A;  2KCM A;  4IOC A;  2E2H H;  2K52 A;  4QIW E;  2JEB I;  3J80 c;  1I50 H;  2OWO A;  3CC4 A;  1PH6 A;  1CKM A;  4JI2 L;  1VQ7 A;  4L5Q A;  1Q8K A;  4R4I A;  3OTO L;  4LF9 L;  2LXJ A;  3WWV A;  1S72 A;  1SLJ A;  3M4O H;  1AH9 A;  2JA6 H;  3AQQ A;  4X64 Q;  4HID A;  1S68 A;  1J5E Q;  3F2C A;  3K81 C;  4DV1 Q;  4NXM L;  1VQG A;  2CCZ A;  3A0J A;  3CAM A;  5M5X H;  4DV6 L;  4DK3 C;  3CCM A;  1L0W A;  4JI1 L;  2ALY B;  4BBS G;  4JI0 L;  4WJ4 A;  3CCR A;  4DUZ L;  1KIX A;  1N33 Q;  2PI2 A;  3RNU A;  4OON A;  1Y1V H;  4A3F H;  4A93 G;  1Q81 C;  3M7N A;  4LFC L;  4PZ6 A;  3TRZ A;  3CP0 A;  4X62 Q;  2A8V A;  3I4N G;  5E7N A;  3BA9 A;  1FJG Q;  3VNN A;  4A3I H;  1Q82 C;  3GTQ H;  4C3J H;  3PSI A;  4LF4 Q;  5DLQ E;  4YCU A;  1PHJ A;  1TWF H;  5IE8 A;  5JJL A;  2K14 A;  2B3G A;  3U50 C;  4DR4 Q;  2R93 G;  4UCS A;  3I4O A;  4BY7 G;  2ZM6 L;  1XMO L;  5LMU L;  4JYA Q;  1XPU A;  5IY0 A;  5C0X G;  4DV3 Q;  3HOZ G;  2CKZ B;  4EQ5 A;  3A5Z B;  4KHP L;  4LF7 L;  1KL9 A;  2QEX A;  4K0K L;  3PIO A;  1VQL A;  3UDF A;  1VQ5 A;  5AJ3 Q;  4JCV E;  4JV5 L;  2F4V L;  2HVR A;  3D0F A;  3HOX G;  4A75 A;  1NJI C;  1FVI A;  5EAY A;  4R1J A;  5M3M H;  1NBW A;  2N8N A;  3ER0 A;  1HNX Q;  1YJW A;  4A3E H;  3NEN A;  2D0O A;  4BBR G;  4DV4 L;  3I7F A;  3K0X A;  2RHQ B;  2YYZ A;  3RN2 A;  1Q7Y C;  3PO2 G;  1TA8 A;  1C9O A;  1LTL A;  1GD7 A;  2UUB L;  3GJX B;  1SN8 A;  1KHI A;  2VQF Q;  3PUV A;  3PO3 G;  1N32 Q;  3KF6 B;  2PQA B;  1CUK A;  3RLF A;  4IOA A;  5GAE C;  1EIF A;  3NBH B;  4GN3 B;  3HOV G;  1HNW L;  2F3I A;  2L15 A;  4DV0 Q;  3JSL A;  1G29 1;  4HIM A;  3J80 i;  4GN5 A;  4KLK A;  4R4O A;  4OWT B;  1VQE A;  1J6Q A;  2UUC L;  3D31 A;  3G71 A;  1P16 A;  3CPW A;  3MEF A;  5IT9 c;  1Q46 A;  4R4Q A;  3DM3 A;  4BA2 I;  3AFP A;  4HTP A;  1XNQ Q;  1IXR A;  1NY4 A;  1N9W A;  1Y1V G;  2D0P A;  3L0O A;  1ASY A;  2HHH L;  3KJO A;  4JI3 Q;  4YCV A;  4B3R L;  1D7Q A;  1TAE A;  2AMC B;  4A3I G;  4PMW A;  3PUY A;  4JI8 Q;  1PA6 A;  5C0X J;  2Q2I A;  4LF5 L;  3GB8 B;  1SRU A;  4BY1 G;  1GVP A;  3G48 A;  1QVF A;  1CSQ A;  4CC6 A;  3H3V I;  2OTJ A;  4X65 Q;  3ERS X;  4DNI A;  1IBK L;  1E1O A;  3BA8 A;  2YU9 H;  1LYL A;  3UDI A;  5IYC H;  3J7A 5;  2R7D A;  4PZ7 A;  2MQH A;  4UP8 A;  2K75 A;  3QWU A;  2OTL A;  4JI2 Q;  2IT1 A;  2Y0S E;  2IHF A;  3OTO Q;  4LF9 Q;  2WFW A;  1K73 C;  1VQC A;  1CKO A;  4GLV B;  1XJV A;  1EWI A;  2NVQ H;  5M3M G;  1Y14 B;  4QJF A;  1YJ9 A;  3KFU A;  3GTO H;  3M9B A;  4Y7N H;  3CXC A;  5J3B A;  4P72 A;  2GVB A;  4A3K H;  2EXD A;  3TQY A;  4DR7 L;  4JI1 Q;  4A93 H;  1BVS A;  2JEA I;  4JI0 Q;  4DUZ Q;  1AE2 A;  2XGT A;  5IYB G;  3ICE A;  3I4N H;  4AH6 A;  2AWN A;  5FLX c;  4O2D A;  2E2J H;  4X66 Q;  2OCE A;  1TWC H;  2AWO A;  3EBE A;  1VQ9 A;  3CMA A;  1VQD A;  3GTL H;  4IJL A;  1X9N A;  4R4C A;  2BA0 A;  4YCW A;  2NVY H;  1YHA A;  4IFD J;  2R92 H;  3I55 A;  3PGZ A;  2A19 A;  1W3S A;  3PUZ A;  3JAM c;  1VQF A;  2WP8 J;  4P75 A;  3HOZ H;  5M5W H;  4JI3 L;  2ZM6 Q;  5LMU Q;  1XMO Q;  2KHJ A;  2N78 A;  4AYB E;  3HKZ E;  4KHP Q;  1AE3 A;  5C4X H;  4YWK A;  2UXB L;  2V1C C;  3SGI A;  2ZJP A;  4LF7 Q;  3E9H A;  3OW2 A;  1XPO A;  1JB7 A;  4K0K Q;  5D1O A;  1PVO A;  3TEH B;  2K5H A;  4GOP A;  2ES2 A;  3J7Z C;  2JE6 I;  4O0A A;  4PZ8 A;  2F4V Q;  4JV5 Q;  2VW9 A;  1TXY A;  1XTD A;  5ELN A;  2E5L L;  1B04 A;  4LUV A;  4BBR H;  4LF6 L;  4BXX G;  3BZC A;  4IO9 A;  3PO2 H;  4MTN A;  3GTK H;  2I5L X;  5IYC G;  4NPS A;  4DV4 Q;  3I4M G;  1X3G A;  1NMG A;  1L1O C;  2UUB Q;  3PO3 H;  3VDY A;  4UCO A;  1B8A A;  4GOP C;  3HOV H;  4L5R C;  4YHH Q;  2K50 A;  4GNX B;  1HZC A;  4LUZ A;  3L7Z C;  3U4Z A;  1HNW Q;  3H3V H;  3UDG A;  1G6P A;  4JC0 A;  4C3H H;  5LMN L;  1YJN A;  3W5O A;  3CCU A;  5LMN W;  4A76 A;  2UUC Q;  1HH2 P;  3KDF B;  4TQU S;  4A3K G;  4A3B H;  2PMZ E;  4HTO A;  3K7A H;  2I5H A;  4POF A;  4DR1 Q;  4P74 A;  1MJE A;  1I94 Q;  4X66 L;  1NTG A;  2MO1 A;  3GDE A;  4L5T A;  4ME3 A;  2HHH Q;  4B3R Q;  2A1A A;  2BH8 A;  3OYY A;  3RN5 A;  1EQQ A;  1ASZ A;  4DAY B;  2VZA A;  2UXC L;  4BY1 H;  4KHZ A;  1UWV A;  1KRS A;  1JMC A;  4LF5 Q;  1VQB A;  3T1H L;  1YVC A;  3BAB A;  2R92 G;  1I6H H;  1IYJ B;  1QZH A;  4ALP A;  1HR0 L;  1QVC A;  1CSP A;  5C3E G;  4IPH A;  1IBK Q;  1VQN A;  2AKW B;  5C4X G;  3PIP A;  4XTC S;  1QVG A;  1PH2 A;  1BBU A;  2ZJQ A;  3L2P A;  3TY5 A;  4LFA L;  3JAM i;  5C44 H;  2NVT H;  5JEA G;  3TY9 A;  4APV A;  3EIV A;  2OQ0 A;  1Q86 C;  4PG3 A;  1MIU A;  3KLW A;  1QUQ B;  1E22 A;  1PH7 A;  3TY8 A;  4A3L H;  3RR5 A;  4C2M H;  4DR7 Q;  2Y0S G;  3M3Y H;  5D1P A;  1U0L A;  3PF4 A;  5IYB H;  2CWA A;  4YHH L;  4JBJ A;  1FL0 A;  2ASB A;  4UPA A;  1XDN A;  1Y1W G;  1CKN B;  4GLA C;  5HY6 A;  2KEN A;  2JA5 H;  2FXQ A;  1PH5 A;  1GO3 E;  1HZB A;  4EX5 A;  3K80 C;  1PH3 A;  2B29 A;  4C3I H;  1V9P A;  1WJJ A;  1YIT A;  4DR1 L;  4DR6 L;  1S3O A;  4WJ3 M;  4A3B G;  1A63 A;  4A3G H;  1UE7 A;  3JC6 6;  1I94 L;  5IYD G;  3FP9 A;  3CCE A;  2BA1 A;  3CCQ A;  1VQP A;  3S2H H;  1FGU A;  3BZK A;  5GRO A;  2Q2U A;  3GTP H;  3STB C;  2HIX A;  4DKA C;  5GAD C;  1K8G A;  2UXB Q;  2VNU D;  5FJ8 H;  4GKK L;  3S14 H;  4JI5 L;  3J81 j;  1MJC A;  2HVS A;  3MXN B;  2JA9 A;  4BXX H;  1WFQ A;  2YTY A;  3KF8 B;  4JI7 L;  2E5L Q;  4AYB G;  3HKZ G;  4LF6 Q;  3FHW A;  2R6G A;  3CQZ H;  2JA8 H;  1N36 L;  3I4M H;  1B7Y B;  2NN6 G;  5M3F H;  4HIK A;  2Z0S A;  4DV7 Q;  4DR3 Q;  1K83 H;  2KBN A;  3PV0 A;  2HIV A;  1OXT A;  3AYH B;  5C44 G;  3JSN A;  2RHS B;  1H95 A;  2GVA A;  3ZJY C;  1M90 C;  2JQO A;  1KXL A;  1A0I A;  2VL6 A;  4JI6 Q;  3CCS A;  5JJK A;  2ZTC A;  3DLL A;  4DUY L;  3W1B A;  1EQR A;  5LMN Q;  2EQS A;  4LNQ A;  2Z6K A;  1VQM A;  1VQ6 A;  4A3L G;  3UE0 A;  4JG2 A;  1KC8 C;  5FPR A;  4EFE A;  1X65 A;  1K9M C;  2NN6 I;  2Q2T A;  3PUW A;  4OO1 G;  1PH8 A;  3CD6 A;  1VQJ A;  3TRE A;  4YY3 Q;  3RZD H;  2YTX A;  1QZG A;  2K5V A;  2JA5 G;  1X56 A;  3J81 c;  5DIS C;  2UXC Q;  1WOC A;  2N49 A;  1VCI A;  4JBW A;  4NXN L;  2MO0 A;  1E3P A;  5ELO A;  1VQK A;  3S1N H;  1X6O A;  3BAA A;  3F1Z A;  2Q2H A;  3T1H Q;  1IL2 A;  2ID0 A;  3TS2 A;  2Z6K C;  2ATW A;  3HOW G;  5C3E H;  4A3G G;  4LH6 A;  3CC7 A;  1HR0 Q;  2F52 A;  3G4S A;  4MNO A;  2QGQ A;  4YWM A;  3BU2 A;  1PH1 A;  1OXV A;  2GN5 A;  2UUA L;  1WYD A;  4DRF A;  4B3T L;  2WAQ E;  5FJ8 G;  1IBM L;  4OO1 I;  4Y52 H;  1L1O B;  2AHO B;  1I5F A;  2NZO A;  1RL2 A;  1SE8 A;  4LFA Q;  3U4V A;  3ULP A;  2HVQ A;  3NBY B;  1HZA A;  1W2B A;  4R4T A;  4LUO A;  5IP9 H;  1K3R A;  4A3M G;  3TS0 A;  1TWA H;  4B3S L;  2JA8 G;  4DV7 L;  1LM0 A;  5IP7 H;  4DR3 L;  4KI0 A;  5M3F G;  3S15 H;  4AQY L;  1VQI A;  1WI5 A;  1OXX K;  1KD1 C;  4LF8 L;  1Q12 A;  1OTC A;  4OX9 L;  2JA7 H;  4GKJ L;  1VS0 A;  1Z9F A;  2D62 A;  3K8A A;  1Y1W H;  4MZ9 A;  1EOV A;  1GM5 A;  4DV5 L;  4JI6 L;  2HT1 A;  1XMQ L;  5IWA L;  3S1Q H;  5FLM G;  4JOI A;  3UE1 A;  1YBY A;  2N3S A;  3S24 A;  3S1R H;  2IY5 B;  4A3J G;  3AEV A;  1B70 B;  2K5N A;  2YTV A;  5IYD H;  1O7I A;  4DR6 Q;  3S16 H;  1D8L A;  1A62 A;  4UCT A;  1PV4 A;  1EIY B;  4JBM A;  4YY3 L;  4UCV A;  3A5U A;  3M85 A;  5GAG C;  4UY8 C;  3ULJ A;  3GD7 A;  3H15 A;  4GNX A;  2NVX H;  2VUM G;  1P8L A;  2I5M X;  1IBL L;  2JJQ A;  2VS1 A;  4GKK Q;  3CME A;  1L2F A;  2KHI A;  4JOI C;  2IX0 A;  2MFI A;  2VQE Q;  1K8A C;  4JI5 Q;  4EEQ A;  3KDF A;  2E2I H;  4UFZ A;  2QA4 A;  1KAW A;  1HR0 W;  4AIM A;  2ZTD A;  1JE5 A;  5GAH C;  4JI7 Q;  4A3C H;  4UCR A;  5FPO A;  1UE6 A;  5H1S E;  3S2D H;  1DGS A;  2VY3 A;  3J81 i;  1N36 Q;  1PFS A;  1HNZ L;  1JT8 A;  4P71 A;  1GKH A;  3G6E A;  1YZ6 A;  1PYB A;  3T1Y L;  5JJI A;  4OWW B;  4GNX C;  4GN4 B;  1JJG A;  1KQS A;  3HOU H;  4EFB A;  1NMF A;  3AFQ A;  2WB1 E;  1UE1 A;  2E8G A;  3CCV A;  4JI4 L;  4A3D H;  5BR8 L;  4BA1 I;  3E9I A;  5IP9 G;  3CPF A;  3CW2 C;  1N8R C;  4B3M L;  2UXD L;  1I3Q H;  1HJP A;  4DR2 L;  4X6A H;  5IP7 G;  4DUY Q;  3K7U C;  3CCJ A;  2VUG A;  3UDX A;  3PN1 A;  2PNH A;  2ZJR A;  2NZH A;  4LH7 A;  2C35 B;  2DGY A;  1TWG H;  1VQ8 A;  1N34 L;  1XNR L;  1V43 A;  3HOY G;  2JA7 G;  1PYS B;  1XK5 A;  4DR5 L;  2XTI A;  1X3E A;  4CC5 A;  2LSS A;  4DK6 C;  2JK8 A;  2UU9 Q;  4HIO A;  3UQ8 A;  4DV2 L;  4IPD A;  4A4I A;  3H0G H;  1QUQ A;  1VQ4 A;  1BBW A;  3NEM A;  4QL5 A;  5GQO A;  3LGJ A;  4QY7 A;  2R7Z H;  1XPR A;  1NE3 A;  1OXU A;  3IRB A;  1WCM G;  4HJA A;  3HKS A;  2PI2 E;  4NB3 A;  4NXN Q;  1K0R A;  3HOW H;  3GTJ H;  1V1Q A;  3PUX A;  3KF6 A;  2PQA A;  4UCU A;  5C0X I;  1MKH A;  1VQH A;  2IX1 A;  2MNA A;  3KJP A;  1C0A A;  1CKN A;  4X64 L;  2UUA Q;  1J5E L;  2VQE L;  4E6N A;  4OWX B;  4DV1 L;  1IBM Q;  4B3T Q;  2JA6 G;  4DPG A;  4POG A;  1PH4 A;  1IZ6 A;  3U58 A;  4A3M H;  1R9T H;  3F2B A;  3CF5 A;  4DAM A;  4LWC A;  4A3C G;  2KCT A;  2CQO A;  4LFB Q;  5JEA J;  2B63 H;  4OXP A;  3RLN A;  4B3S Q;  1JJC B;  2H5X A;  3KOJ A;  3HFZ B;  1Q1E A;  4HJ8 A;  1VQO A;  1N33 L;  2WAQ G;  1JJ2 A;  1TWH H;  1S40 A;  4AQY Q;  1BKB A;  4X62 L;  4A3F G;  2CWP A;  4IFD G;  3KYH C;  1FJG L;  4LF8 Q;  3RLO A;  4UP9 A;  4OX9 Q;  4LF4 L;  3HOU G;  4GKJ Q;  4YWL A;  4A3D G;  1C7Y A;  5FLM H;  1Q1B A;  4DR4 L;  1Z47 A;  1HZ9 A;  4DV5 Q;  1XMQ Q;  3RZO H;  5IWA Q;  1YHB A;  4QQB X;  1YI2 A;  1EUJ A;  3ULL A;  5M5Y H;  4JYA L;  3I56 A;  4UP7 A;  4A3J H;  3FKI H;  3GTM H;  4DV3 L;  1LUZ A;  4HJ9 A;  2EIF A;  3B6Y A;  4L5S A;  3BJU A;  5AJ3 L;  2UU9 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...