3W5OA

Crystal structure of human dna ligase iv
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
596
structure length
577
Chain Sequence
QTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEELDILIVGGYWGKGSGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords DNA ligase 4
total genus 174
structure length 577
sequence length 596
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2013-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w5oA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w5oA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w5oA02
3I4NH 2JK8A 4NXMQ 4DR1Q 5FJ8H 4WJ4A 4LH6A 5IYDG 3CC7A 4A3BG 1NBWA 5D1OB 2K5VA 4JI6Q 4JBKA 3KOJA 1AE3A 2ASBA 2VUMH 2HHHL 4O0AA 1JJGA 5D1OA 3ZJYC 3PIPA 2QA4A 3RLFA 4LFCQ 1CKNA 1VQJA 1OTCA 2F3IA 1I94Q 5ELNA 1Q8KA 4JBJA 4JBWA 2JEBI 1EFWA 4QY7A 2VQEQ 1XNRQ 1HNWQ 1CKNB 4PZ6A 1PH3A 4DR6L 5EAYA 1KAWA 3D0FA 4JYAL 1PVOA 1A63A 1EOVA 4LUVA 2OWOA 1FJGQ 4DK6C 5LMUQ 1TWCH 4OWXB 2UUAQ 5DLQE 4QQBX 1NMGA 1ASZA 1A8VA 1MIUA 1VQ4A 2JA5H 1U0LA 1E7ZA 3GTKH 1W2BA 1VQGA 1X6OA 3EIVA 3G6EA 1FVIA 1V1QA 2CWPA 3TY8A 2KHJA 3U4VA 2MO0A 2IHEA 3PGZA 4LF7Q 5FLXc 4JI3L 1DGSA 4PMWA 1L1OB 1Y1WG 3HFZB 4DV6Q 1YJ9A 1FGUA 1KQSA 2YTXA 3UDFA 3HOXH 1YEZA 2PMZE 3JC66 4A93H 2JA9A 2KCTA 1NE3A 4L5QA 4DR5Q 5IP9G 2E5LQ 1PH2A 1UE6A 5IYBH 2YTYA 4X65L 4JI5Q 2YYZA 2WB1G 3EN2A 5C44G 2I0QA 1X3EA 4DV1L 4DRFA 2AKWB 1IBKL 1IBLQ 4JI0Q 4P71A 4IFDG 2NZHA 2JE6I 4DPGA 1T9HA 3NELA 1Q86C 1KC8C 1PA6A 2HVQA 2K4KA 3K0XA 4LW1A 4A3DG 4LF9Q 1C0AA 2ATWA 3CP0A 2F4VQ 1MKHA 4C3JH 1XMQQ 3S1NH 1JMCA 2R92G 4E6NA 1KHIA 2CQOA 4UCSA 4EEQA 1YHBA 2UU9Q 3F2CA 4KHZA 1NTGA 3BZKA 3G4SA 1LTLA 4UCUA 2BH2A 3NBZB 3UE0A 2AHOB 5LMNQ 4UY8C 4JI8Q 1UWVA 3HKSA 2A19A 4LFBQ 1GVPA 1WYDA 3TRZA 3J80c 2L15A 3I4OA 4QL5A 3W1BA 4UP9A 2N8NA 3WWVA 3M4OH 5JJLA 3BA8A 1G291 2ID0A 1IZ6A 3BU2A 1TWFH 1Q82C 2OQ0A 4BBSG 4DAMA 4A3MH 3BAAA 3BA9A 1HZCA 4DUYL 2AWOA 1L2FA 1NY4A 5IYCH 1I5FA 2ZJPA 4DV0Q 3CCMA 2CWAA 2UUAL 4HTPA 4OX9L 2LSSA 4X64Q 5HY6A 4X62L 3CCJA 4X6AH 3K7AH 1YJWA 1PH1A 4LF4Q 3TY9A 4HIDA 3KF6A 2UUCQ 3NENA 2ALYB 4YHHQ 4AYBG 4DV2L 5FJ8G 1EQQA 1N33Q 3TQYA 1LYLA 5IT9c 4A3IG 5LMNW 1X3GA 4DV6L 1J5EQ 1N36Q 5ELOA 2ZTCA 5IYDH 3JAMc 3U50C 3GTGH 4DR5L 4LNQA 2KENA 4NXML 1JT8A 1XPOA 4DK3C 2Q2TA 4A76A 2UXDQ 3G71A 2JA5G 1VQDA 1IBKQ 2ZM6L 1PYSB 1Y1VH 2R6GA 5M5XH 2HHHQ 5JJIA 1WCMH 4DAYB 1B7YB 3E9HA 4HJAA 3HOWG 4DV5Q 4A4IA 4IPGA 3A5UA 2WP8J 4NXNL 3DLLA 4BY1G 2B63G 2GVAA 1S68A 4P73A 2K5NA 1VQ7A 2ZJQA 4JI7Q 3VDYA 3J7ZC 1S3OA 4LF5L 4DR6Q 2VUGA 4KI0A 3K8AA 1C7YA 4TQUS 3TY5A 2Y0SG 1YHQA 3K7UC 2E8GA 3H0GG 3TEHB 2JA7H 2K75A 4AH6A 3HKZG 2B63H 1HJPA 2KCMA 2AWNA 3E9IA 5LMNL 2HVRA 1G6PA 4C2MH 2UXCL 1WI5A 4YCUA 4NB3A 5IP7G 4YY3Q 5D1PA 4OWTB 4A3GH 3STBC 1PH6A 3NEMA 4A3JH 1XJVA 1S40A 3PUWA 3GO5A 5IP9H 3KYHC 1BVSA 3KJOA 5M5WH 4EX5A 2K52A 1FL0A 4DR3L 2MNAA 1PHJA 3KDFB 2ES2A 2JA6H 4BY7G 4A3LH 3U58A 3M4PA 3CAMA 4P72A 5GADC 4AQYQ 5GAGC 4DV4L 3AEVA 4GN3B 1GO3E 4A75A 1PH9A 2RCNA 3UDXA 4X65Q 3J81i 1WFQA 4JI5L 2ZJRA 4A3DH 3M3YH 4DV1Q 1AE2A 2MQHA 1EIFA 4RMFA 4BY7H 1OXUA 1C9OA 2PI2E 2R92H 1XMOQ 2UUBL 4XIGS 1N32L 2UXBL 1U5KA 1KRSA 1P8LA 3L0OA 4LF8Q 4DV2Q 1QUQA 3W5OA 3FKIH 2YV5A 4R4OA 1N36L 5C3EH 3BZCA 4HJ9A 3LGJA 2Y0SE 5IY0A 4X66L 1CUKA 5IYCG 3PN1A 1BKBA 2PNHA 2E2HH 3HKZE 2I5HA 2UU9L 2VZAA 1WOCA 4L5TA 3QWUA 3K80C 3AQQA 2ZM6Q 2BH8A 5C4XH 1JB7A 5M3MG 3H15A 2NVQH 4C3HH 2N49A 1VQ9A 4UCOA 1IYJB 4PZ8A 2BA0A 1UE7A 5E7NA 4OO1I 4IPDA 1VQMA 3CF5A 1VQBA 4K0KQ 1VQ6A 3I55A 1I6HH 4JI7L 1SMXA 4IPHA 1CSQA 4PG3A 2EQSA 1YNXA 1YBYA 4A3FG 3ICEA 2DGYA 4B3SL 2CFMA 2MO1A 3F2DA 3J81c 4UP8A 3A74A 2K5HA 1I94L 1EWIA 3CCVA 3J7A5 5C0XI 4JCVE 4X64L 4P74A 1Q12A 3EBEA 4X62Q 3OTOL 2VUMG 4JYAQ 1UE5A 3E0EA 1K8GA 3CCQA 2VY3A 4DUZQ 3AYHB 2B29A 3CMAA 1TXYA 4UP7A 2HQLA 4IO9A 3S1RH 2NVTH 4UCTA 4LF6L 3S1MH 4HJ5A 3S15H 1TWGH 2QEXA 4JBMA 1JJ2A 3ER0A 4MNOA 4DV4Q 1HR0Q 1VQNA 3CCLA 3TS2A 4A93G 2HVSA 2MFIA 4PZ7A 3CC4A 4DV7Q 3RTXA 4LF7L 4GKJQ 4DNIA 4LH7A 1E1TA 3S14H 1E24A 1CKMA 2N78A 4IPCA 4QIWE 3PV0A 1N34Q 4L5RC 1QVCA 4IOAA 4P75A 3J81j 3RLOA 1EIYB 2IX1A 3M4QA 3RLNA 4TVAB 3GTOH 4JI4Q 4DV5L 5FPRA 1PH7A 4NXNQ 4A3CH 2IHFA 1S72A 5JEAJ 4JI6L 1BBWA 5J3BA 1TA8A 4HIMA 4C3IH 4LF5Q 1WCMG 2I5MX 3RR5A 2ZTEA 3M9BA 4DV3Q 4LF9L 3CPFA 4GS3A 2F4VL 1X54A 1I50H 1OXVA 4LFCL 1VQPA 4A3CG 1XK5A 3L7ZC 1KL9A 2K14A 4JG2A 5GQOA 2UXCQ 3F1ZA 1YIJA 2VL6A 1M1KC 4YY3L 1L0WA 4BBRH 3I4MG 1PV4A 4APVA 4YWKA 1AH9A 2D62A 1FJGL 3D31A 3PUZA 3PSIA 5C3EG 4HIOA 1YHAA 2AMCB 5C44H 4HJ7A 3AFQA 4JI8L 4DR3Q 3NBYB 1HZBA 1Q46A 4LFBL 2YTVA 4R4CA 4Y52H 3GTLH 3I4MH 1HZAA 4YWMA 4BXXH 5C0XJ 4IFDJ 1X9NA 4LFAQ 3PUVA 2Z0SA 1ASYA 1K73C 3PO2G 2WB1E 2HIVA 3PO3G 4WJ3M 4DR7Q 4UCRA 1EYGA 4OO1G 3CCUA 3HOUG 1A62A 3CW2C 3CCSA 2E5LL 3CXCA 2XTIA 1G51A 5M3FH 1SFOH 2E2JH 2VS1A 5C4JH 4Y7NH 1IBML 1OXSC 3HOVH 4IFDI 3PO3H 3HOZG 3GTPH 2OTJA 1H95A 2I5LX 3MEFA 1B04A 1EUJA 4A3MG 1OXTA 2JQOA 1P16A 1E22A 1IL2A 3PF4A 4UPAA 3CPWA 3I4NG 4UFZA 4JI1L 5HGQA 2JA8H 3BJUA 1K8AC 1XMQL 4GOPB 1KRTA 5IE8A 4A3KH 1N8RC 1QVFA 3I56A 1GD7A 3NC0B 2NN6I 1NMFA 2R93H 1O7IA 4DR1L 2CKZB 4IJHA 1GM5A 3GB8B 2B3GA 3T1YQ 1VQHA 1VQAA 4K0KL 2QGQA 2R7DA 5GAHC 3RNUA 5DISC 4JI0L 3GDEA 2XGTA 3G48A 4IJLA 4MTNA 5M3MH 3TS0A 3MXNB 3ULJA 2R93G 4B3SQ 2JJQA 1PFSA 4GOPA 1MJEA 4R4TA 4JI2Q 4GKKL 3CCRA 4R1JA 3HOYH 2VNUD 1V9PA 2VQFL 1HNWL 2WAQG 1KD1C 1B8AA 3PF5A 5M5YH 3H3VH 3KJPA 3KF6B 4BY1H 3S24A 1VQ5A 3M7NA 1RL2A 4DR2Q 1KIXA 1Y1VG 4GN4B 3CD6A 2UUCL 1VQEA 4LFAL 3GTMH 3H0GH 4J15A 2JA7G 3HOWH 2YU9H 4GKJL 2Z6KA 5K36G 4QJFA 4JI3Q 1N34L 4JV5L 4BA2I 4FDBA 4A3JG 1SLJA 4DUYQ 1OXXK 4AQYL 3PCOB 4GNXA 3F8TA 4A3GG 3W1GA 1UE1A 1E3PA 1YZ6A 2NZOA 2BA1A 4DV0L 1X3FA 3RN2A 4XTCS 3A5ZB 5AJ3L 4JI4L 4A3LG 3ULLA 2R7FA 1Y1WH 4KLKA 1SR3A 3FP9A 3H3VI 2Q2IA 3JAMi 3CMEA 5BR8L 2PQAA 3KDFA 4LF4L 3B6YA 4BXXG 2A8VA 1NJIC 4GNXC 1Q81C 2WAQE 4CC6A 4BA1I 2LXJA 1HH2P 4DV3L 4POGA 2KBNA 3PUYA 1CSPA 4DR4L 4QGUA 1VQCA 3HOUH 2Q2HA 1KXLA 5JEAG 1HNXQ 1XNQL 1YI2A 1GKHA 1TWHH 1Y14B 4OWWB 2DUDA 4B3RQ 4JOIA 5GROA 2EIFA 1MJCA 3T1YL 5IWAQ 3T1HQ 1QUQB 3KFUA 3VNNA 4L5SA 4MZ9A 2IX0A 4RG1A 2RHSB 4OXPA 3U4ZA 1VQLA 4GLVB 4UCVA 4LUZA 4GN5A 4ME3A 3ERSX 1XDNA 1VQFA 2OCEA 4HJ8A 1JE5A 4GKKQ 4HIKA 1PH5A 4POFA 2WFWA 3FHWA 2GN5A 2PI2A 4GNXB 3HOZH 3UDIA 5H1SE 3RZOH 1L1OC 1XPRA 4A3EG 3GTQH 5C0XG 2Q2UA 1YVCA 4A3IH 1IBMQ 3PUXA 2OQKA 3UDGA 2PQAB 3OTOQ 1VCIA 2VQEL 1XNRL 4H02A 1Z47A 1Z9FA 1X55A 4A3KG 4B3TL 2HIXA 1SRUA 1XMOL 2UUBQ 1N32Q 1Q1BA 2UXBQ 2D0OA 3ULPA 2RF4A 4A3EH 3F2BA 3I7FA 1TWAH 3RN5A 1J6QA 1I3QH 3S1QH 4YHHL 1K9MC 3KLWA 4YCWA 4KHPQ 1V43A 1B70B 1J5EL 3UQ8A 1LUZA 2R7ZH 1K3RA 1A0IA 1BBUA 4EQ5A 2NN6G 4X66Q 2V1CC 4DV7L 5AJ3Q 5FLMG 2JA8G 5IYBG 4DKAC 1D8LA 3GJXB 3M85A 2RHQB 4R4QA 4LF6Q 2GVBA 3BABA 4B3ML 1HNZQ 5BR8Q 1VQIA 4JC0A 2CCZA 2R7ZG 4GLXA 1SE8A 3HOYG 1YITA 1PH4A 1LM0A 3GTJH 4YCVA 1K83H 2Z6KC 5FLMH 4LUOA 2KHIA 3PIOA 1IXRA 1VQKA 3OYYA 4JI2L 1XPUA 4EFEA 1HNXL 3HOXG 2E2IH 1XNQQ 3RZDH 3KF8B 4AIMA 1YJNA 2A1AA 1QZGA 2IY5B 1Q1EA 2VQFQ 1EQRA 3A0JA 3IRBA 5GAEC 5IP7H 2NVYH 3STBD 1Q7YC 1HZ9A 4LWCA 3S2DH 2JEAI 4EFBA 4IOCA 2LXKA 1X65A 1M90C 1QZHA 2HT1A 2ZTDA 2JA6G 4DR2L 4AYBE 4CC5A 4KHPL 1PYBA 4DUZL 3FKIG 2H5XA 3Q8DA 1HR0W 4GOPC 5FPOA 1N9WA 1UEBA 5LMUL 3JSNA 3SGIA 4BBRG 2N3SA 2IT1A 4JV5Q 1VQ8A 2C35B 1R9TH 2UXDL 1K0RA 4JOIC 1VQOA 5JJKA 3HOVG 2K50A 1RIPA 3NBHB 4DR7L 3JSLA 1WJJA 3CCEA 1VS0A 4O2DA 4B3TQ 1E1OA 1SROA 4NPSA 2OTLA 3CQZH 3K81C 1XTDA 1SN8A 3OW2A 3S2HH 4LF8L 2EXDA 4OX9Q 1TAEA 3UE1A 3L2PA 4BBSH 1D7QA 4ALPA 3J80i 3PO2H 3S16H 2D0PA 4R4IA 2F52A 1PH8A 4DR4Q 4GLAC 5C4XG 2FXQA 1IBLL 2NVXH 1L1OA 1HR0L 1X56A 3AFPA 4OONA 4YWLA 3S17H 4HTOA 1W3SA 3DM3A 4JI1Q 1CKOA 3TREA 5M3FG 3CC2A 4B3RL 1N33L 3GD7A 5IWAL 3T1HL 1JJCB 3I2ZA 4A3BH 1QVGA 4B3MQ 1HNZL 2VW9A 4A3FH
chains in the Genus database with same CATH superfamily
3WWJA 1LTID 4FXKC 4DR1Q 2YYAA 5IYDG 4A3BG 1NBWA 4HMIA 2NZ1D 1IW7C 4IALA 4PMCA 2ASBA 3R9RA 4O0AA 5I47A 1JJGA 2QA4A 2OEOA 3RLFA 1VQJA 2EJMA 1XX8A 1I94Q 1Q8KA 4JBWA 2YW2A 4NZOA 4QY7A 3T53B 1PTOH 4DR6L 2EY5A 3SNOA 5EAYA 3T9BA 3BACA 2EJ2A 2HJWA 5I9PA 1FJGQ 1BDOA 4K6LA 1WVLA 2EZVA 2UUAQ 1XWEA 4MV8A 3U9SA 1SNOA 2A5HA 3X3MA 1E7ZA 3IAYA 2IL8A 3GTKH 1LTAD 1VQGA 2COIA 1V1QA 2KHJA 3PGZA 4CDCC 4JI3L 4DAVA 1NUCA 3HFZB 3E5SA 2ABJA 2PMZE 3JC66 4DR5Q 3VR3A 1NE3A 4CKBA 1CFMA 1I4XA 1UE6A 4X65L 1IKLA 1O80A 2WB1G 4FO2A 4MIUA 4CJ2C 5C44G 4FFOA 2AKWB 2D2CC 1IBLQ 1KBLA 2NZHA 3S2HB 2AQ1B 2LMCB 1Q86C 2K4KA 1W96A 2DY8A 2KEEA 2FPGB 4C3JH 1XMQQ 2CQOA 4UCSA 5EPLA 4EEQA 1JWUD 2NYZD 2UU9Q 4KHZA 3JRXA 1BCPC 3G4SA 3S15B 2BH2A 4RFBA 5E1FA 2AHOB 4UY8C 2VB2X 3KAKA 2A19A 3UYYA 1DV2A 4L63B 4IURA 2A74C 4FF1A 1EQVA 3K57A 3MWEA 3WWVA 3M4OH 2N8NA 2HDKA 2V5AA 4WRDA 3HS0C 3BZDB 2ID0A 1IZ6A 3BU2A 1TWFH 4A3MH 3BAAA 3BA9A 3GTOB 1OBDA 4MHEA 2C5CA 2XRSD 3SDZA 4BY7B 3CCMA 1TKWB 4HTPA 2OXPA 4OX9L 4X64Q 4X6AH 3QOLA 3K7AH 1YJWA 1PH1A 2M2LA 1WRVA 3NENA 4DV2L 4LF6Q 5LMNW 4DV6L 1I7LA 1FD7D 3MXNA 3X3NA 2EIYA 4QF4A 4EQPA 4LNQA 1JT8A 3QJYA 1R9TB 3OPOA 2A68D 4A76A 5KKNB 3G71A 2K32A 1IHZA 5I4DA 1IBKQ 5KYLA 3MZ5A 4C1NI 5FO8B 4DAYB 2KEDA 4Q4DA 4NKLA 3C1EA 4IPGA 3DLLA 3GIDA 2F0MA 1S5DD 2GVAA 2XVSA 4I7ZC 2KA7A 4JI7Q 5IGDA 5BWVA 4LF5L 4MA5A 4DR6Q 4MV6A 4ZAIA 3H0GG 2K75A 3HKZG 3QR8A 1KNAA 3O13A 2HVRA 1ET6A 1G6PA 1KJJA 1EY0A 3S1MB 3STBC 2XN9C 2I87A 1H9JA 5M5WH 1CQJB 4DR3L 2ES2A 2MNAA 1PHJA 1UC8A 4AQYQ 5GADC 4YJ2F 4DV4L 1TS4A 2E74C 5NUCA 4X65Q 3T99A 2WYOA 3MC0B 1OXUA 3J80L 1C9OA 2PI2E 4XIGS 1A3TA 1U5KA 5KNBA 1I4RA 5LL6X 5KNCA 3P1HA 3FKIH 1GJXA 4O4JF 1N36L 2F0NA 4O82A 1Q3LA 2Y0SE 3TBIB 1WTQA 3BVZA 2KCNA 2UU9L 1SE3A 3TZDA 1ZYRD 1WOCA 4L5TA 5IGBA 1KLUD 3GTGB 1SNPA 2ZM6Q 4UUGA 1JB7A 4LMQD 5M3MG 1VQ9A 1E4EA 4OO1I 4UCOA 2DWCA 1RKNA 4RHSA 3VOTA 3J7AF 4A93B 4K0KQ 3RV4A 5CV6A 3OUZA 2F3VA 2YZGA 4HNVA 4A3FG 2K04A 3TIIA 2DGYA 1LTTD 2R86A 1GSAA 5JVLA 1T5XD 5CV8A 4FFNA 4UP8A 4KN4C 3K5MA 1H9SB 2FMCA 2K5HA 2QW7A 1I94L 4GZYC 4X64L 3V4SA 1Q12A 3EBEA 2BE5D 5C4JB 2VUMG 1KC7A 1UE5A 3CCQA 1NSNS 2VY3A 1IL8A 4H7BA 2Y4RA 3C1FA 4IO9A 3S1RH 2NVTH 4LF6L 4KKTA 5DEHA 3S15H 2QEXA 4JBMA 3HBLA 4MNOA 4KMUC 4A93G 4QIWB 4PZ7A 1FYCA 4DV7Q 4GKJQ 1C48A 1CKMA 4IPCA 3PV0A 5LOVF 1EY5A 4P75A 3MXPA 5FLXE 3J81j 4ODGA 2I46A 1TWFB 2Z1CA 4NW2A 1B4OA 2CNQA 2KHSA 1PH7A 2IHFA 4JI6L 1BBWA 2FHTA 1TA8A 4LF5Q 1WCMG 3RR5A 4M8AA 4OGQC 1A3UA 2F0JA 3DUZA 4FXDA 1BF4A 2AUJD 2R82A 4FNFA 1AH9A 2D62A 3PUZA 4HIOA 1VKZA 1I4HA 4YB8B 3K0YA 4DR3Q 3H0GB 3CHBD 4AYBB 3BG5A 4N9TA 5C0XJ 4LFAQ 3PUVA 1U9RA 2HIVA 4UCRA 4DR7Q 2QEJC 1M0WA 2WACA 4KD4A 1U4LA 3CXCA 5M3FH 1G2TA 3V2TA 3IFTA 5BYAA 4IFDI 3HOZG 3GTPH 2I5LX 1LTGD 1G8ZD 1TS3A 3I90A 4O84A 1KTKA 3S2DB 1A9XA 4HSPA 3BJUA 1TWHB 4GOPB 4A3KH 1QVFA 3I56A 3FEWX 5BWTA 2B8GA 2NN6I 1NMFA 3QG1A 2MPMA 3J80E 3T7AA 1Z6HA 3T1YQ 4K0KL 1VQHA 5GAHC 3RNUA 5DISC 2XGTA 3G48A 3ULJA 4XQQA 1PFSA 1CS0A 2XCLA 3E3XA 4K8JA 4R4TA 4EG0A 3VA5A 3ZYYX 3FKIB 1EZ1A 3KLSX 1KD1C 5C3EB 4FGRA 4HN7A 3NP8A 1GLVA 4GLWA 1MBYA 3H3VH 4FFRA 5CB4F 3H3VC 1ZKOA 4C3IG 1PTOC 4A3EB 1RL2A 3K6OA 5KRUA 3NK9A 4XQNA 1Y1VG 3CD6A 2UUCL 5LXTF 2JA7G 1AW7A 4A3FB 2YU9H 1SE4A 3HOWH 4GKJL 3I4NB 1LT5D 1QWYA 4JV5L 3RUPA 2B2YC 4AQYL 2L9HA 3W1GA 5J22A 5A2QE 2RBMA 4IZOA 4XTCS 3A5ZB 5AJ3L 2AUKA 4A3LG 2F0EA 2YL2A 3VPCA 4O83A 3DWAA 2EJ0A 3JAMi 3CMEA 5BR8L 3KBGA 4BXXG 5T1GA 1EYZA 4GNXC 2F0OA 1GOZA 2F0UA 5CV7A 2BDNA 2N55A 1CSPA 2NU6B 3T16A 3T9CA 3PFFA 1BNCA 5DM63 2JA8B 4DAAA 4JW0A 2PNRC 3J81E 2EIFA 5K5PA 5IGEA 4DAYA 3KFUA 4NDXA 2Y0SB 4MZ9A 4RG1A 1VQLA 1HUMA 1LT4D 5LYJF 2XRQD 4GN5A 5IGCA 3ERSX 1IYEA 1XDNA 3I12A 1OBGA 4HIKA 1CM9A 5ELFA 3LULA 3NTHA 4C3HG 1ESFA 2GN5A 5DM73 4GNXB 4XYLB 3RZOH 2W71A 1XPRA 5C0XG 2F1MA 2X0SA 3UDGA 5M5YB 4H02A 1SCUB 1X55A 3PO2B 3SXHA 2IY5B 1SRUA 2UXBQ 1N32Q 1KDAA 4K2LA 3RN5A 4J6HA 3DHQA 4YHHL 2A68C 4YCWA 1STAA 3S17B 1ESRA 2R7ZH 2YRXA 1A0IA 3A56A 2V1CC 3A8KE 5E4XA 4DV7L 1F2YA 5FLMG 1STNA 5IYBG 5D14A 3T54A 3TEKA 1SYCA 2EVBA 3BABA 2Z04A 2VQDA 1PFMA 2R7ZG 5BWXA 4GLXA 2EDGA 5FLMH 3PIOA 1VQKA 4EFEA 2KHIA 1XPUA 1XNQQ 2J4XA 3HOXG 3ETJA 3RZDH 5CYUA 2F0LA 2HDLA 2O5IC 1DONA 1Q1EA 2R3ZA 5M9OA 3GTPB 4DA2A 1X3QA 1B6SA 3R23A 2QCPX 3NUCA 1HZ9A 5KS8A 1PFNA 3S2DH 3HRZC 2A6EC 3BYYB 4O7RA 1M90C 3T56B 1CZGA 3D3RA 4CC5A 4DUZL 3FKIG 2H5XA 4GOPC 5I2XA 2PBZA 1EUDB 4JV5Q 1R9TH 5J2UF 4FVMA 5M3MB 2EJ3A 2L55A 1Y1VB 5JJKA 4DR7L 1RIPA 3JSLA 3H91A 4L1KA 3L3OC 3D6CA 5JEAH 2OTLA 2R7KA 3OW2A 1WTOA 4G7ZC 2EXDA 1ONLA 3QOJA 1TAEA 3UE1A 1I1KA 1D7QA 4ALPA 1CHPD 4PQXA 3U0GA 1ILPA 2JA7B 1SSOA 3AFPA 4KKUA 3DM3A 3C3LA 1JORA 1EZ8A 4DXFA 1JJCB 4DK1A 2F0VA 2VW9A 4A3FH 3HOWB 1EYCA 3I4NH 3BDCA 4WJ4A 1D5MC 5BWUA 1KTAA 1ET9A 3MTSA 3CC7A 5ISRA 4O7VA 5D1OB 4JI6Q 3R8BA 2VUMH 1Y1WB 2BE5C 5CV9A 3ZJYC 4M1UB 5KEEA 1EEFD 5BYBA 1CKNA 1NCVA 1SJED 2L4NA 2DZDA 2JEBI 1CKNB 1A63A 4TVIA 2WKCA 1EOVA 2NN6H 3MEHA 2DIKA 4C1NK 2M9VA 5LMUQ 1TWCH 2COJA 1NMGA 4MAMA 1E2VA 1A8VA 3K5IA 2CZGA 2RDHA 4DN4M 2JA5H 2QK4A 3TW7A 3G6EA 3SEBA 1STEA 4O7WA 4U673 4LF7Q 1GSHA 2NU7B 2L11A 4K14A 1Y1WG 1L1OB 4ZQ3A 2XWJB 1FGUA 1I6VC 4A93H 4L5QA 5IP9G 1PH2A 1CZWA 4TKOB 2YTYA 3CRKC 4JI5Q 2YYZA 3RZOB 3EN2A 1X3EA 1F77A 4DV1L 2R7LA 4DNTB 4DPGA 1PA6A 2HVQA 1T9HA 2B2TA 1QNUA 3NELA 3KLSA 4ME6A 3K0XA 3RUZA 1C0AA 4LF9Q 1FNVA 4WJWA 1SNDA 5D65A 2F4VQ 3QO2A 4QB4A 3QFFA 1S5CD 1LTRD 3S1NH 3BDLA 2F4IA 1RTNA 1KHIA 3BS1A 1C30A 3M7GA 1NTGA 3DF7A 1JOQA 1LTLA 2C9OA 2TMPA 3NBZB 1SDFA 1PYWD 3UE0A 5LMNQ 3NQTA 4JI8Q 1UWVA 5COYA 1B53A 5M5WB 1SNMA 1HTPA 2LS01 3W1BA 4UP9A 2H4OA 5JJLA 2F3WA 4RA8A 3AMUA 1Q82C 1GUTA 4DAMA 1HZCA 4DUYL 3M3YB 2QDBA 1T36A 5CR5A 1NY4A 3OW7A 2UUAL 2IW3A 1STYA 1EEID 5I5TA 5HY6A 5CV4A 4OEMB 5EGTA 1WD0A 4LF4Q 1TIID 3KF6A 4EQNA 2UUCQ 4YHHQ 3OIQA 4AYBG 5FJ8G 2J9GA 2HGSA 1EFID 5I5XA 2ZTCA 3DXJC 5H80A 1I2LA 4DR5L 5DGIA 2ZDQA 5CGKA 1F9PA 5KIXA 1XPOA 3M4YA 2NVQB 4DK3C 2Q2TA 1I7NA 4I65A 1G2WA 1PYSB 1SAPA 1Y1VH 2R6GA 5M5XH 1B7YB 4IUUA 4HJAA 3HOWG 4DV5Q 1NR2A 4A4IA 1PRTC 1YNNC 2WP8J 4NXNL 3K58A 1S68A 2ZJQA 2I80A 5CBAE 2HQEA 3OOCA 1PTOD 1GHKA 5M3FB 2F0QA 3DWPA 2VUGA 4KI0A 3K8AA 4PBCA 1C7YA 4Y7NB 3TY5A 4EGQA 2BOSA 4IUVA 3K7UC 2JA7H 3TEHB 1JWSD 3WNZA 3I73A 3DEPA 5ELCA 2NB0A 4C2MH 4YCUA 4YY3Q 4YAKB 3PQIA 2EYHA 4HTHA 2HCIA 1S40A 1D1KA 4A3JH 2RSOA 1XJVA 2KECA 1CA5A 3ONAB 1HA6A 4JVZA 4O7ZA 2R93B 2R87A 1DD2A 3M4PA 5LHY1 5GAGC 4HAEA 4GN3B 3AEVA 1TVXA 2X69A 3UDXA 3J81i 4JI5L 4A3DH 4DV1Q 3TP7A 3J7YW 2R92H 2UXBL 1N32L 3ND8A 1P8LA 3L0OA 4DV2Q 5IODA 2EJGC 2JYOA 2YV5A 2HHFA 1STHA 5C3EH 5IY0A 3NHHA 5CR3A 2W6OA 2A69C 1GUOA 2E2HH 1JKJB 3NXWA 3NSWA 3K80C 3AQQA 1JWMD 2MHVA 2N49A 3TIGA 1B9NA 1IYJB 1JB3A 1X3PA 1UE7A 2BA0A 4IPDA 1VQBA 5C0XH 4IIJF 2ZXPA 3A8JE 1G91A 4UAIA 1XTCD 3GQBA 2IJ0A 1SMXA 4JI7L 2EQSA 1YNXA 3F2UA 2CFMA 1HFGA 5BMVF 2YS7A 2LY7A 3R93A 1CQIB 3J7A5 5C0XI 4KHVA 2NU8B 4P74A 1WTXA 3OTOL 3E0EA 4HSVA 1K8GA 3HOVB 5CAEB 4DUZQ 1DYQA 3AYHB 4UP7A 2HQLA 4HJ5A 2Z4IA 1F9SA 4FFLA 5FOBB 4V0BA 2ZGIA 4DV4Q 1HR0Q 1VQNA 1I1LA 1S4ZA 3CC4A 4LF7L 3NUAA 3NPPA 1JQYD 1E1TA 1E24A 4QIWE 1YNJC 2R84A 1D5XC 3M4QA 1HQMC 2L5TA 2YWVA 4DV5L 2ZDHA 4NXNQ 1A3VA 1W6KA 3KREA 1SEBD 5JJZA 5J3BA 3OWFA 1LT6D 3RMHA 4ME5A 3M9BA 3TZUA 4ZK9B 4DV3Q 4LF9L 3CPFA 3KAJA 4GS3A 2F4VL 4RHRA 1PLFA 1PZJD 1I50H 2E76C 3MFYA 4LFCL 2SEBD 2K14A 4YY3L 2EYJA 5BN3A 1A0GA 1PV4A 1U4PA 4YWKA 3PSIA 2AMCB 3AFQA 4X3KA 1RTOA 4JI8L 1HZBA 2P0AA 3NBYB 5C6AA 4R4CA 4Y52H 4IFDJ 1X9NA 4K5XA 1K73C 2WB1E 3T4AC 4V190 4OO1G 1I2KA 1ENCA 2EXZA 1A62A 5C1OA 4IUTA 3T51B 3CCSA 1J9OA 3NWSA 2KCCA 1V8QA 2XTIA 2E5LL 1SFOH 2E2JH 1L0XB 4Y7NH 1IBML 4TV9F 1D1IA 1U4RA 1JICA 2X6LA 3MEFA 1B04A 4OO1H 3N52A 3J7AV 1OXTA 3E0JA 1BO0A 3PF4A 5DNFA 5JPMC 3HGBA 2NBFA 3R2TA 5HGQA 2JA8H 1TWGB 2ICEC 1KRTA 2PMZB 1VMPA 4I7AA 4RZQA 3DM1A 2R93H 1A3GA 3P75A 3D8GA 4CDEC 1VF7A 1GM5A 4G7OC 1HUNA 1E2WA 5J39A 2F0GA 1VMCA 2WKDA 3JAML 4A3DB 4MTNA 5M3MH 4IJLA 3TS0A 3SE7A 2R93G 4K6DA 2JJQA 1UC9A 1AEXA 2RDFA 4XYQA 4GKKL 4KJNA 1K0SA 2K01A 3C2PA 3HOYH 3QB3A 1AN8A 4OELB 1V9PA 1JOKA 1HNWL 4ZKBB 4O7LA 1ET0A 2XD4A 3NWTA 5M5YH 5ELDA 4O86A 2R85A 2E2HB 2C00A 4BY1H 4NZNA 2HG8A 3M7NA 3G7LA 2K5DA 3LNNA 5KNDA 1PMRA 1DM0B 1VQEA 4C3HB 4LFAL 4J15A 5C3XA 2K33A 1D5ZC 1EY7A 1EKPA 2A1HA 4BA2I 4FDBA 1G2SA 1SLJA 4DUYQ 1A15A 2ENBA 4GNXA 4A3GG 5CMDA 2BA1A 1X3FA 1E0BA 5L37A 4G4KA 3I70A 3WDNA 1Y1WH 1DXMA 4HQ6A 4DXGA 5JQWA 4WFN3 4LF4L 2A8VA 1Q81C 4DV3L 4POGA 1BCPD 2IP4A 1VQCA 5C3WA 3KF8A 4Q0FA 1MSHA 2KUMA 3PIP3 2L12A 1Y14B 4IWXA 2XSCA 4WBNF 3T1YL 1PZID 3OIPA 1HRJA 3VNNA 4Q5VA 2IX0A 3U4ZA 3R5XA 4O81A 2Z6BA 1JE5A 1MHWC 1SE2A 2SCUB 4XT1B 5JVDF 2WFWA 1HFNA 1H9RA 1YVCA 2JXMB 3NBIA 1IBMQ 2F0IA 1HQRD 2QILA 2XWBB 3OTOQ 2VQEL 5KGUA 1Z47A 1Z9FA 2HIXA 2B8FA 4F8MA 1XMOL 3FRPB 1EY4A 3I7FA 3JAME 1I3QH 3S1QH 4KHPQ 3DTGA 1V43A 1B70B 1LUZA 4X66Q 4EQ5A 1SNQA 1H9MA 1Z2PX 3A7LA 2K05A 5AJ3Q 3GJXB 3G8CA 3I4MB 4G57A 4R4QA 2SNMA 4B3ML 1HNZQ 1M4VA 5BR8Q 4IFDH 5CE8A 5HV6A 4EVOA 1KABA 1CI3M 1LM0A 4YCVA 4LUOA 2EY6A 2VR1A 4YAJB 2YRWA 1QZGA 3ORQA 1EOTA 4K5VA 5JVG3 1EQRA 3VYRA 4DFAA 1Q7YC 3STBD 3WWHA 1PTOF 2JEAI 5IOCA 4RGOS 2EOTA 2CVRA 5I5UA 4F87A 2ZTDA 2HGWA 2MP1A 2EYFA 1TY2A 3HZXA 5J2TF 1IYVA 1SYGA 3JZFA 4BBRG 4NMZA 2NTTA 4HR7B 1VQ8A 2E2DC 2RQXA 3QWNA 1EKFA 3FPUB 1HPCA 1TT2A 1WJJA 3CCEA 2YZMA 4O2DA 4B08A 3FMCA 4YBZB 3K81C 1KDCA 1SYEA 1XTDA 3Q0AA 5IIFA 3S2HH 1RF2D 3L2PA 3S16H 3LWBA 3TDQA 4R4IA 1HCZA 2P5ZX 4L6TB 4FFPA 2FXQA 2F0PA 4C3JB 1HR0L 3DAAA 1GUGA 4C5AA 3CC2A 3ETHA 1BNZA 1N33L 3GD7A 3I2ZA 2PZUA 3DMUA 4A3GB 1KJIA 2A6HD 1DOLA 5FR9A 2V59A 2YS6A 2GLTA 2OLSA 2XNAC 3SE0A 2B2VC 4ZKCB 3U9TA 3KOJA 4RGNA 3TP8A 1AE3A 2HDMA 3T9FA 2HHHL 1K83B 5D1OA 2B39A 2O5JC 4MV3A 3LX0A 3AB9A 4Z9CB 1A6XA 4LFCQ 3Q2OA 1BOSA 1SBBB 2F3IA 3ERQA 3AX6A 5ELNA 4JBJA 2J0TD 1SMYD 2NVYB 4TV8F 2VQEQ 1HNWQ 4JYAL 4H0LC 1KAWA 1QG7A 3D0FA 4KJOA 4RWSC 2OWOA 4K6NA 1KJ8A 3MXUA 4DK6C 4OWXB 2B2WA 5DLQE 1RDPD 1RJTA 1ASZA 2NU9B 1MIUA 1VQ4A 5C4ZA 3EJIA 2PCFB 2IX3A 2K03A 1W2BA 3EIVA 1X6OA 5JAVA 5JH7F 2CWPA 4MTKA 3TY8A 3I4LA 3K5HA 1H9KA 1QNKA 2NUCA 2HHFB 1YJ9A 1KT8A 2YTXA 3UDFA 1YEZA 2KCTA 1B9MA 2E5LQ 4KTAA 1A48A 5IYBH 1RCVD 1GGOA 2CW0C 4DRFA 1M6VA 1I4QA 4P71A 1BCPB 4QUCA 5JPNC 4YIJA 1GUNA 4ZOLF 4ZRZA 2ATWA 3CP0A 1MKHA 3NBHA 4E6NA 3MVVA 4ZCKA 4O4IF 1FNUA 3DWQA 2FINB 3WO0A 1YHBA 3F2CA 2D5DA 4KKSA 1II3A 2H1EA 3HKSA 3WOEA 2FB9A 1Q90A 1WYDA 3MJFA 3J80c 2L15A 3I4OA 4CHIA 5I6WA 2NWGA 4BWGB 5IGFA 2L1BA 5DGHA 4BBSG 3HT5A 2QF7A 1F9RA 3K5OA 2E2IB 1L2FA 5K36H 1ICFB 5IYCH 2ZJPA 2K28A 2RKSA 2R92B 1BQQT 4OIJA 1Q8IA 2WIIB 5I6YA 3T9DA 3CCJA 2W6NA 2W70A 2DAAA 3TY9A 4HIDA 1KJQA 3R5FA 5HURA 1Y8NB 2ALYB 3EVQA 2QKIC 1N33Q 2CH4A 4KHPL 5IT9c 1Y8OB 2PO4A 4A3IG 1X3GA 5IYDH 1JCKB 5ELOA 4JPBW 1AZPA 5LP6F 3UZOA 1MGSA 5K3WA 3GTGH 5HBRB 1QE6A 2KENA 1D6EC 2PZWA 2UXDQ 4OL7A 2JA5G 3GTLB 2EYLA 2FPPB 3HB9A 3JZIA 2HHHQ 5JJIA 2DY7A 3E9HA 1KDBA 4DAPA 3A5UA 2HD3A 4BY1G 4MV7A 4P73A 2K5NA 5D8DA 3VDYA 3J7ZC 1S3OA 1SFOB 2E2JB 4TQUS 5CV5A 1YHQA 2E8GA 2R61A 1EZ6A 2KQ3A 5C5LA 4AH6A 3E9IA 2KCMA 1PFBA 2AWNA 5LMNL 1WI5A 5CC4A 5IP7G 2NVTB 4FU0A 5D1PA 4OWTB 4KY6A 4A3GH 1PH6A 4JXUA 3IKJA 3NEMA 3PUWA 2IWHA 2F0DA 3I72A 4M9UA 5JVH3 1BVSA 3KJOA 5C4HA 4EX5A 1FL0A 2JA6H 4A3LH 3EA6A 4S3SA 1J8IA 4HEDA 3U58A 1PXUA 1GO3E 1JDBB 4A75A 2RCNA 1SXTA 1K8MA 1WFQA 2PZTA 2ZJRA 3NE5B 2DNCA 5ELEA 1EY6A 1EIFA 4RMFA 1JE4A 4O7YA 2AQ3B 5CBEE 4X3UA 1XMOQ 1KRSA 1F2LA 1WTHA 3E5NA 5EKIA 3K7AB 4O4HF 3BZCA 4C56C 5E25A 2RA4A 4CMDA 4X66L 4OIKA 3SK5A 1M8AA 3PN1A 1CT1D 2PNHA 1EWHA 2O2LD 2IPKD 4MN3A 5A2QL 3QWUA 1RHPA 2KVMA 2BH8A 1LACA 2I8CA 4C3HH 5GONF 1C4QA 4ABNA 4Q4CA 3CF5A 5I5SA 4DF7A 1DZ1A 1VQ6A 3I55A 1ENFA 1CSQA 2E75C 2TSSA 1YBYA 1WTRA 3U55A 3SVMA 3GLKA 2MO1A 1F9QA 3J81c 3A74A 1EWIA 2EYOA 3LQSA 1ULZA 4JCVE 3FVQA 4JYAQ 1V1OA 4N9PA 2Z9HA 2B29A 1VBGA 1TXYA 2B2TC 1AUXA 3S1MH 3BG3A 3A7AB 3VMMA 3ER0A 2HVSA 3NQIA 3CCLA 1CQFA 2MFIA 4O42A 3RTXA 3JZ6A 1W93A 3VA7A 5IT9L 1XXGA 2UXDL 2N78A 4QSHA 1QVCA 3K3PA 1O7LA 4DNRB 3RLOA 2IX1A 1DAAA 1PRTF 3W3AA 1WR2A 5FPRA 2DJGC 3SK8A 5D3IB 4I4TF 5EKKA 3LWEA 2A6ED 2HGXA 1GUSA 2I5MX 1BBXC 4A3IB 1OXVA 4F88A 3H6MA 1VQPA 3TSSA 1KL9A 5BPHA 5F2DA 5GQOA 4HR7A 3F1ZA 4BY1B 1L0WA 4IZ8A 1EY8A 1JOOA 3I4MG 3Q24A 3KBXA 3D31A 2A73B 5C3EG 1LO5D 4HJ7A 1EU4A 1Q46A 3D6WA 3CRLC 1Y8PB 3GTLH 3I4MH 4YWMA 3V4ZA 1UAPA 4IQZA 2Z0SA 3TW6A 1AFPA 1ENAA 2ODTX 1EYGA 3CCUA 3HOUG 3CW2C 1PRTB 3MHBA 2B2YA 1G51A 2VS1A 3RV3A 5C4JH 1OXSC 2Q8IB 2WV6D 1H95A 4O4LF 2A6HC 4DLKA 3I4NG 2CNVA 4CDFC 4JI1L 1BXTA 3LWUA 1K8AC 2DJFC 2RCFA 1N8RC 3UFXB 1T5EA 1O7IA 2BDOA 3S14B 4IJHA 4ZYSA 3N8DA 1UEAB 3GB8B 4K8IA 2B3GA 1VQAA 5EJWA 2QGQA 5BN5A 2R7DA 4KN7C 1SMYC 4LJZC 3U54A 1EYAA 1LABA 1S5ED 4GOPA 4RKBA 4NYEA 1TU2B 3CCRA 1KEEA 4HCSA 2B2UA 1EIGA 4CHTB 4QMGA 3S16B 5I2YA 1TS2A 3KJPA 5FLXL 3S24A 1GHJA 3HEJA 3WO1A 1I3QB 3TN2A 1JC7A 3QQMA 1ZXTA 4DR2Q 5EBCA 1KIXA 4XX0B 2PN1A 1I4PA 3H94A 3E6ZX 3MXGA 4B9XA 4DK0A 3NC0B 3PCOB 1YZ6A 3ITPA 2NZOA 1W6JA 3ULLA 1SR3A 3W2DA 1PZKD 5DMXA 2Q2IA 2PQAA 5CA0F 1NJIC 1SYBA 4CC6A 2VXWA 3RZDB 1ZAUA 4KK7A 1I1MA 1PX2A 1PK8A 4DR4L 2Q2HA 5JEAG 1HNXQ 5EBDA 3P20A 4QUFA 1YI2A 1GKHA 1TWHH 2DUDA 4CJ1B 4JOIA 2FP4B 3OUUA 5IWAQ 3T1HQ 2G9DA 1HA5A 4KY7A 4L5SA 3DEOA 4IUQA 2QDLA 2RHSB 4OXPA 4DQNA 2AQ2B 4GLVB 1KNEA 1VQFA 2OCEA 4HJ8A 1ZYRC 4GKKQ 1PH5A 3T13A 4UHVA 1BR9A 3FHWA 2PI2A 3HOZH 3Q6SA 2RSNA 1QILA 3I91A 1IOWA 3MWDA 5TSSA 3UZBA 4FF4A 4LK1C 4FE2A 1BXRA 2EPBA 4A3IH 3H09A 3PUXA 2PQAB 1XNRL 2WB1B 3HG9A 1C8CA 4A3KG 4B3TL 5K36G 2UUBQ 3OSOA 4FF2A 1Q1BA 2D0OA 3F2BA 4BBRB 1TWAH 5CORA 1H9SA 1K9MC 3MAQA 1GSOA 4NZMA 2G9HD 3VR6A 1J5EL 3UQ8A 4L8JA 1K3RA 1L0YB 2MGSA 2NN6G 2M00A 2JA8G 1QJOA 4DKAC 5T1IA 3M85A 1YNND 2W6PA 4C5BA 4EGJA 2GVBA 1VQIA 4JC0A 4O7TA 1YITA 3URYA 4KY5A 3GTJH 1K83H 1IXRA 2CQAA 3OYYA 4C3JG 4MV9A 3TINA 2E2IH 5E3FA 4EGVA 1V1PB 3PO3B 1O7ZA 1I4GA 2NVYH 2GQSA 2QB5A 1LT3D 3EROA 2OF1A 2Q7DA 4EFBA 3MA2B 4CDDC 2OT2A 5J1ZA 1LTSD 1QZHA 2HT1A 4J1MA 1RD9D 2K6AA 4DR2L 4AYBE 3HO8A 4CE5A 1PYBA 3Q8DA 2JA5B 1N9WA 1PDQA 1UEBA 3L9AX 4IN3A 3SGIA 2N3SA 3NTIA 2IT1A 5I9OA 2C35B 2L0CA 4JOIC 2NUAB 5KYIA 4FFMA 4ZHQF 3TQTA 2EYPA 3HOVG 2EYMA 2K50A 1IKMA 1WCMB 5KX5F 2DN8A 1DOMA 3C46A 2N88A 1SROA 2RDGA 1SN8A 1IOVA 4LF8L 3Q23A 2Q8RE 1EHIA 3PO2H 4DR4Q 2D0PA 3S9WA 1R4PB 4FF3A 1VF5C 1IBLL 3TP5A 3G6JB 1X56A 1Z2NX 4OONA 3TMEA 4HTOA 3TREA 2PPBC 4JI1Q 1CKOA 3OMCA 3UI2A 5IWAL 3T1HL 2B2VA 4B3MQ 1STBA 1FR3A 1HNZL 1EWCA 3KALA 4R8NA 4TRDA 2JK8A 4NXMQ 5FJ8H 4LH6A 2JA6B 4E4TA 4TSSA 1QB5D 3KUPA 2K5VA 4JBKA 5D3DA 3P7JA 5DAUA 3VYSA 2Z02A 3PIPA 5EQ0A 1KJ9A 2SDFA 5FO7B 1OTCA 3R5HA 1EFWA 1XNRQ 1PH3A 4PZ6A 2PW5A 2CHBD 1PVOA 2F0FA 5EKLA 4WORA 4LUVA 1MI2A 2EJFC 3U9OA 4PV1C 2COGA 4QQBX 4ILWA 3A8IE 4FXGC 2ZXRA 4FP5D 3Q1KA 1U0LA 1YNJD 1Z2OX 1FVIA 3D4RA 1TS5A 1DIKA 3U4VA 2MO0A 2IHEA 5FLXc 1DGSA 4PMWA 4DV6Q 1KQSA 3HOXH 2GPWA 2JA9A 1KUTA 3WOFA 5M5XB 2I0QA 2VB3X 4PMBA 1EYDA 3GTQB 1ICWA 1IBKL 3BYTB 3OHXC 4JI0Q 4IFDG 2JE6I 1KC8C 1CQVA 4BBSB 3G8DA 5IT9E 4LW1A 4A3DG 2K5QA 2KOLA 3V96A 1CTMA 5LL6S 1JMCA 1B1ZA 1TWAB 2R92G 3I8ZA 4HNUA 1RODA 2FJ2A 4IWYA 4C2MB 3BZKA 1K8OA 5A35A 4UCUA 4CJ0B 4A3JB 5DAAA 3AW8A 4LFBQ 1GVPA 1HXYD 3TRZA 4CGYB 4QL5A 2VUMB 3BA8A 1G291 1EKVA 1Z7TA 2OQ0A 4FYDA 2AWOA 4O2BF 5C1PA 3VR5A 1I5FA 1F2ZA 4DV0Q 2CWAA 4N8X1 1NAPA 2LSSA 4O1NA 5CM0A 4X62L 2WINB 1TWCB 4TM5A 1EQQA 2DLNA 3TQYA 1LYLA 1J5EQ 1N36Q 2Z4HA 4ID6A 3VPDA 3JAMc 5ELBA 3U50C 3CSWA 4NXML 2B2UC 1JR0D 1VQDA 2ZM6L 5FO9B 4Y8VB 1WCMH 2JSOA 3GV3A 4ZUJA 4XQJA 1FGBD 3CQZB 3ORRA 2B63G 1HTLD 1VQ7A 4OHJA 4R8IA 4I55F 3S1NB 5IYZF 3N6RA 4DIMA 2SOBA 2Y0SG 5E4WC 3DTFA 2W6ZA 2B63H 1HJPA 2R7MA 2UXCL 4NB3A 3A54A 3D4DA 2O4XA 1G6ZA 1LTBD 3K59A 3RFCA 2EY2A 3GO5A 5IP9H 3KYHC 1B50A 2K52A 4HCEA 3KDFB 4BY7G 2FPIB 1R4QB 3CAMA 4P72A 2V58A 3R2IA 1O7YA 1PH9A 4DU9A 1V1PA 4A3MB 3M3YH 1AE2A 2MQHA 4RGTA 4BY7H 2K7VA 5JQGF 2UUBL 1WTVA 1FNWA 5I5VA 4LF8Q 1QUQA 3W5OA 5LA6F 4R4OA 3KK7A 4HJ9A 3LGJA 2NTSA 1CUKA 5IYCG 1BKBA 2PVPA 3HKZE 2I5HA 1E2ZA 4O7NA 2VZAA 4XYMB 3GTKB 4K2KA 5HNEA 2W6QA 3SK4A 5C4XH 1GUWA 1HHVA 3H15A 4F7XA 2NVQH 2VPQA 3GTMB 4PZ8A 5E7NA 1DV1A 1VQMA 3J81L 5BWWA 4C5CA 1E4EB 1I6HH 4IPHA 4PG3A 4X3TA 2DABA 4K5WA 2X5RA 3ICEA 3VYTA 4B3SL 3HKZB 3T9EA 3F2DA 2CH4W 3T9AA 3PMFA 4MV1A 3CCVA 4XYOA 1IW7D 2F0HA 4X62Q 5G3LF 1X32A 1EY9A 1ZEQX 3HOUB 3ND9A 3CMAA 3SHLA 4UCTA 4H13C 3VPBA 4DGZA 1TWGH 1JJ2A 4ZUIA 3OWEB 2ZT9C 2W6MA 3TS2A 4XDXA 2J7ZA 4EQOA 4I50F 3QIAA 4DNIA 2ZXOA 4LH7A 3S14H 1N34Q 2GPSA 4L5RC 4IOAA 2LFNA 1TR5A 1EIYB 3RLNA 2Z8LA 4TVAB 3TP6A 1EL0A 3GTOH 4JI4Q 4A3CH 1S72A 5EPKA 5JEAJ 3VYUA 4QCLA 1TQOA 5JOBA 4HIMA 1CHQD 4C3IH 2ZTEA 1BUVT 1O78A 3GV6A 1X54A 3HP3A 3A55A 4A3CG 1XK5A 5I60A 1WD1A 3AU7A 3L7ZC 3GP7A 4JG2A 5IGGA 1YIJA 1BCPF 4IUPA 1STGA 2VL6A 1M1KC 4BBRH 2UXCQ 5K2MA 2G5DA 3I3CA 4APVA 1FJGL 4RAUC 1SNCA 1YHAA 1B2TA 5C44H 4LFBL 2YTVA 1K28A 1HZAA 4BXXH 1MD2D 3NTKA 5FK9C 1ASYA 4H44C 3PO2G 3PO3G 4WJ3M 4XT3B 2KJXA 2D9UA 5BN4A 3GTJB 2HUGA 4RGMA 1LV9A 2XIWA 1EIHA 2F0TA 3K5LA 4ZLTF 3LP8A 3HOVH 1EU3A 3PO3H 1VDZA 1EUJA 4A3MG 1IL2A 1IYUA 1P16A 1E22A 2JQOA 3S1RB 2B63B 1M0TA 4UPAA 3CPWA 4N8FA 4BS9A 4UFZA 3BVGA 2EE1A 4X3SA 2BCOA 2Q8TA 3KLRA 2EY1A 1XMQL 5IE8A 3RD4A 3SK6A 1GD7A 4HMJA 4M0JA 3FPPA 4IUNA 1ML0D 4DR1L 4CBVA 2CKZB 1JDEA 1K3BC 4JI0L 3GDEA 1ILQA 1D2BA 2JN4A 4KV6A 3FDTA 3MXNB 4B3SQ 5C8YF 3HOZB 1MJEA 3K5NA 3MWYW 4JI2Q 5G3LD 4R1JA 1EQTA 1VBHA 2VNUD 1SYDA 2VQFL 2RVLA 1DOKA 1KAAA 1I50B 2WAQG 2PW7A 1B8AA 1PRTD 4RH6A 3PF5A 1U4MA 1S5FD 3KF6B 4HNTA 1SYFA 4R9WA 5HGTA 2NVXB 1VQ5A 3S1QB 4RCNA 1TY0A 1EUCB 5BWRA 1C3OA 4GN4B 5C4XB 4A3BB 4LAAA 1GXDC 3H0GH 3GTMH 1DJRD 2Z6KA 1QOHA 4JK1C 4QJFA 4JI3Q 2CW0D 4HN2A 1AP0A 1N34L 2K1BA 3Q22A 2SNSA 4A3JG 1OXXK 2F03A 1I6HB 3F8TA 1WTPA 1UE1A 5FKAC 1E3PA 4DV0L 3CEBA 3RN2A 4ZI7F 1AZQA 3R3OA 4JI4L 3SR1A 2R7FA 3VR4A 4KLKA 3H3VI 3FP9A 1AUVA 2WAQB 1B44D 1UNSA 4XXEA 3KDFA 4PNYA 5EPJA 3B6YA 3JRWA 2WAQE 3BDOA 4BA1I 1DCZA 1HH2P 2HCCA 2LXJA 2KBNA 3IL8A 3PUYA 4U68A 1PTOB 4QGUA 3HOUH 1KXLA 1LLRD 1XNQL 3PIO3 4OWWB 1CA6A 5CA1F 4A3KB 4B3RQ 5GROA 2DNEA 1MJCA 1QUQB 4XZ3B 2FMMA 4NP5A 2X6GA 1XYIA 4UCVA 2A69D 4LUZA 2GA4B 4ME3A 3EQLC 2I07B 1UUPA 1A2TA 2YZLA 4RCOA 5AFWA 1Y69U 4POFA 3UDIA 4WHXA 5H1SE 1L1OC 4MV4A 4C3IB 4A3EG 3GTQH 3HOYB 5FNVF 2Q2UA 1IYDA 2OQKA 2PQEA 1VCIA 4B9WA 1S5BD 4CKCA 1CK1A 3ULPA 3WWIA 2ICIA 2RF4A 1QCBD 4A3EH 4MA0A 1J6QA 2GQRA 1SJHD 3BVMA 3KLWA 4ULLA 4CMFA 5I5WA 1A2UA 2FFKB 4ZQIA 4YJ3F 1BBUA 5C44B 2YU9B 1WTWA 2JP1A 1D8LA 2RHQB 2CCZA 5BPFA 1SE8A 3HOYG 3M4OB 4TUYF 4UDUC 1PH4A 4P2CB 2Z6KC 1NR4A 4JI2L 2CNUA 2K5WA 2R7NA 1HNXL 3KF8B 4AIMA 1YJNA 2A1AA 2VQFQ 1B3AA 3A0JA 3IRBA 5GAEC 5IP7H 4CKEA 4LWCA 2YZNA 4IOCA 1B3QA 2LXKA 3D4WA 1X65A 1JLLB 2JA6G 1CE8A 3CKIB 1HR0W 5FPOA 4O7SA 1F2MA 5LMUL 4O2AF 4E6IA 3JSNA 5EZYF 3OMGA 2B2WC 2V4DA 3MFGA 4IHJF 5I5YA 1KLGD 1K0RA 2LKVA 1MSGA 3HOXB 1VQOA 2F0KA 3NBHB 3V05A 4J8QA 1VS0A 4B3TQ 1E1OA 2MJ8A 4NPSA 2PYKA 3CQZH 4KD3A 1B6RA 4OX9Q 4BBSH 3CU7A 3J80i 4RKLA 2OTJA 2F0WA 2F52A 3EFXD 4GLAC 1OO9B 1PH8A 5C4XG 1NNXA 2NVXH 3VR2A 1L1OA 2F0SA 4G7HC 4YWLA 3S17H 1W3SA 5M3FG 4B3RL 3IFDA 2R7ZB 5C5MA 4A3BH 2MUYA 1QVGA 2ZDGA
chains in the Genus database with same CATH topology
3I4NH 2JK8A 4NXMQ 4DR1Q 5FJ8H 4WJ4A 4LH6A 5IYDG 3CC7A 4A3BG 1NBWA 5D1OB 2K5VA 4JI6Q 4JBKA 3KOJA 1AE3A 2ASBA 2VUMH 2HHHL 4O0AA 1JJGA 5D1OA 3ZJYC 3PIPA 2QA4A 3RLFA 4LFCQ 1CKNA 1VQJA 1OTCA 2F3IA 1I94Q 5ELNA 1Q8KA 4JBJA 4JBWA 2JEBI 1EFWA 4QY7A 2VQEQ 1XNRQ 1HNWQ 1CKNB 4PZ6A 1PH3A 4DR6L 5EAYA 1KAWA 3D0FA 4JYAL 1PVOA 1A63A 1EOVA 4LUVA 2OWOA 1FJGQ 4DK6C 5LMUQ 1TWCH 4OWXB 2UUAQ 5DLQE 4QQBX 1NMGA 1ASZA 1A8VA 1MIUA 1VQ4A 2JA5H 1U0LA 1E7ZA 3GTKH 1W2BA 1VQGA 1X6OA 3EIVA 3G6EA 1FVIA 1V1QA 2CWPA 3TY8A 2KHJA 3U4VA 2MO0A 2IHEA 3PGZA 4LF7Q 5FLXc 4JI3L 1DGSA 4PMWA 1L1OB 1Y1WG 3HFZB 4DV6Q 1YJ9A 1FGUA 1KQSA 2YTXA 3UDFA 3HOXH 1YEZA 2PMZE 3JC66 4A93H 2JA9A 2KCTA 1NE3A 4L5QA 4DR5Q 5IP9G 2E5LQ 1PH2A 1UE6A 5IYBH 2YTYA 4X65L 4JI5Q 2YYZA 2WB1G 3EN2A 5C44G 2I0QA 1X3EA 4DV1L 4DRFA 2AKWB 1IBKL 1IBLQ 4JI0Q 4P71A 4IFDG 2NZHA 2JE6I 4DPGA 1T9HA 3NELA 1Q86C 1KC8C 1PA6A 2HVQA 2K4KA 3K0XA 4LW1A 4A3DG 4LF9Q 1C0AA 2ATWA 3CP0A 2F4VQ 1MKHA 4C3JH 1XMQQ 3S1NH 1JMCA 2R92G 4E6NA 1KHIA 2CQOA 4UCSA 4EEQA 1YHBA 2UU9Q 3F2CA 4KHZA 1NTGA 3BZKA 3G4SA 1LTLA 4UCUA 2BH2A 3NBZB 3UE0A 2AHOB 5LMNQ 4UY8C 4JI8Q 1UWVA 3HKSA 2A19A 4LFBQ 1GVPA 1WYDA 3TRZA 3J80c 2L15A 3I4OA 4QL5A 3W1BA 4UP9A 2N8NA 3WWVA 3M4OH 5JJLA 3BA8A 1G291 2ID0A 1IZ6A 3BU2A 1TWFH 1Q82C 2OQ0A 4BBSG 4DAMA 4A3MH 3BAAA 3BA9A 1HZCA 4DUYL 2AWOA 1L2FA 1NY4A 5IYCH 1I5FA 2ZJPA 4DV0Q 3CCMA 2CWAA 2UUAL 4HTPA 4OX9L 2LSSA 4X64Q 5HY6A 4X62L 3CCJA 4X6AH 3K7AH 1YJWA 1PH1A 4LF4Q 3TY9A 4HIDA 3KF6A 2UUCQ 3NENA 2ALYB 4YHHQ 4AYBG 4DV2L 5FJ8G 1EQQA 1N33Q 3TQYA 1LYLA 5IT9c 4A3IG 5LMNW 1X3GA 4DV6L 1J5EQ 1N36Q 5ELOA 2ZTCA 5IYDH 3JAMc 3U50C 3GTGH 4DR5L 4LNQA 2KENA 4NXML 1JT8A 1XPOA 4DK3C 2Q2TA 4A76A 2UXDQ 3G71A 2JA5G 1VQDA 1IBKQ 2ZM6L 1PYSB 1Y1VH 2R6GA 5M5XH 2HHHQ 5JJIA 1WCMH 4DAYB 1B7YB 3E9HA 4HJAA 3HOWG 4DV5Q 4A4IA 4IPGA 3A5UA 2WP8J 4NXNL 3DLLA 4BY1G 2B63G 2GVAA 1S68A 4P73A 2K5NA 1VQ7A 2ZJQA 4JI7Q 3VDYA 3J7ZC 1S3OA 4LF5L 4DR6Q 2VUGA 4KI0A 3K8AA 1C7YA 4TQUS 3TY5A 2Y0SG 1YHQA 3K7UC 2E8GA 3H0GG 3TEHB 2JA7H 2K75A 4AH6A 3HKZG 2B63H 1HJPA 2KCMA 2AWNA 3E9IA 5LMNL 2HVRA 1G6PA 4C2MH 2UXCL 1WI5A 4YCUA 4NB3A 5IP7G 4YY3Q 5D1PA 4OWTB 4A3GH 3STBC 1PH6A 3NEMA 4A3JH 1XJVA 1S40A 3PUWA 3GO5A 5IP9H 3KYHC 1BVSA 3KJOA 5M5WH 4EX5A 2K52A 1FL0A 4DR3L 2MNAA 1PHJA 3KDFB 2ES2A 2JA6H 4BY7G 4A3LH 3U58A 3M4PA 3CAMA 4P72A 5GADC 4AQYQ 5GAGC 4DV4L 3AEVA 4GN3B 1GO3E 4A75A 1PH9A 2RCNA 3UDXA 4X65Q 3J81i 1WFQA 4JI5L 2ZJRA 4A3DH 3M3YH 4DV1Q 1AE2A 2MQHA 1EIFA 4RMFA 4BY7H 1OXUA 1C9OA 2PI2E 2R92H 1XMOQ 2UUBL 4XIGS 1N32L 2UXBL 1U5KA 1KRSA 1P8LA 3L0OA 4LF8Q 4DV2Q 1QUQA 3W5OA 3FKIH 2YV5A 4R4OA 1N36L 5C3EH 3BZCA 4HJ9A 3LGJA 2Y0SE 5IY0A 4X66L 1CUKA 5IYCG 3PN1A 1BKBA 2PNHA 2E2HH 3HKZE 2I5HA 2UU9L 2VZAA 1WOCA 4L5TA 3QWUA 3K80C 3AQQA 2ZM6Q 2BH8A 5C4XH 1JB7A 5M3MG 3H15A 2NVQH 4C3HH 2N49A 1VQ9A 4UCOA 1IYJB 4PZ8A 2BA0A 1UE7A 5E7NA 4OO1I 4IPDA 1VQMA 3CF5A 1VQBA 4K0KQ 1VQ6A 3I55A 1I6HH 4JI7L 1SMXA 4IPHA 1CSQA 4PG3A 2EQSA 1YNXA 1YBYA 4A3FG 3ICEA 2DGYA 4B3SL 2CFMA 2MO1A 3F2DA 3J81c 4UP8A 3A74A 2K5HA 1I94L 1EWIA 3CCVA 3J7A5 5C0XI 4JCVE 4X64L 4P74A 1Q12A 3EBEA 4X62Q 3OTOL 2VUMG 4JYAQ 1UE5A 3E0EA 1K8GA 3CCQA 2VY3A 4DUZQ 3AYHB 2B29A 3CMAA 1TXYA 4UP7A 2HQLA 4IO9A 3S1RH 2NVTH 4UCTA 4LF6L 3S1MH 4HJ5A 3S15H 1TWGH 2QEXA 4JBMA 1JJ2A 3ER0A 4MNOA 4DV4Q 1HR0Q 1VQNA 3CCLA 3TS2A 4A93G 2HVSA 2MFIA 4PZ7A 3CC4A 4DV7Q 3RTXA 4LF7L 4GKJQ 4DNIA 4LH7A 1E1TA 3S14H 1E24A 1CKMA 2N78A 4IPCA 4QIWE 3PV0A 1N34Q 4L5RC 1QVCA 4IOAA 4P75A 3J81j 3RLOA 1EIYB 2IX1A 3M4QA 3RLNA 4TVAB 3GTOH 4JI4Q 4DV5L 5FPRA 1PH7A 4NXNQ 4A3CH 2IHFA 1S72A 5JEAJ 4JI6L 1BBWA 5J3BA 1TA8A 4HIMA 4C3IH 4LF5Q 1WCMG 2I5MX 3RR5A 2ZTEA 3M9BA 4DV3Q 4LF9L 3CPFA 4GS3A 2F4VL 1X54A 1I50H 1OXVA 4LFCL 1VQPA 4A3CG 1XK5A 3L7ZC 1KL9A 2K14A 4JG2A 5GQOA 2UXCQ 3F1ZA 1YIJA 2VL6A 1M1KC 4YY3L 1L0WA 4BBRH 3I4MG 1PV4A 4APVA 4YWKA 1AH9A 2D62A 1FJGL 3D31A 3PUZA 3PSIA 5C3EG 4HIOA 1YHAA 2AMCB 5C44H 4HJ7A 3AFQA 4JI8L 4DR3Q 3NBYB 1HZBA 1Q46A 4LFBL 2YTVA 4R4CA 4Y52H 3GTLH 3I4MH 1HZAA 4YWMA 4BXXH 5C0XJ 4IFDJ 1X9NA 4LFAQ 3PUVA 2Z0SA 1ASYA 1K73C 3PO2G 2WB1E 2HIVA 3PO3G 4WJ3M 4DR7Q 4UCRA 1EYGA 4OO1G 3CCUA 3HOUG 1A62A 3CW2C 3CCSA 2E5LL 3CXCA 2XTIA 1G51A 5M3FH 1SFOH 2E2JH 2VS1A 5C4JH 4Y7NH 1IBML 1OXSC 3HOVH 4IFDI 3PO3H 3HOZG 3GTPH 2OTJA 1H95A 2I5LX 3MEFA 1B04A 1EUJA 4A3MG 1OXTA 2JQOA 1P16A 1E22A 1IL2A 3PF4A 4UPAA 3CPWA 3I4NG 4UFZA 4JI1L 5HGQA 2JA8H 3BJUA 1K8AC 1XMQL 4GOPB 1KRTA 5IE8A 4A3KH 1N8RC 1QVFA 3I56A 1GD7A 3NC0B 2NN6I 1NMFA 2R93H 1O7IA 4DR1L 2CKZB 4IJHA 1GM5A 3GB8B 2B3GA 3T1YQ 1VQHA 1VQAA 4K0KL 2QGQA 2R7DA 5GAHC 3RNUA 5DISC 4JI0L 3GDEA 2XGTA 3G48A 4IJLA 4MTNA 5M3MH 3TS0A 3MXNB 3ULJA 2R93G 4B3SQ 2JJQA 1PFSA 4GOPA 1MJEA 4R4TA 4JI2Q 4GKKL 3CCRA 4R1JA 3HOYH 2VNUD 1V9PA 2VQFL 1HNWL 2WAQG 1KD1C 1B8AA 3PF5A 5M5YH 3H3VH 3KJPA 3KF6B 4BY1H 3S24A 1VQ5A 3M7NA 1RL2A 4DR2Q 1KIXA 1Y1VG 4GN4B 3CD6A 2UUCL 1VQEA 4LFAL 3GTMH 3H0GH 4J15A 2JA7G 3HOWH 2YU9H 4GKJL 2Z6KA 5K36G 4QJFA 4JI3Q 1N34L 4JV5L 4BA2I 4FDBA 4A3JG 1SLJA 4DUYQ 1OXXK 4AQYL 3PCOB 4GNXA 3F8TA 4A3GG 3W1GA 1UE1A 1E3PA 1YZ6A 2NZOA 2BA1A 4DV0L 1X3FA 3RN2A 4XTCS 3A5ZB 5AJ3L 4JI4L 4A3LG 3ULLA 2R7FA 1Y1WH 4KLKA 1SR3A 3FP9A 3H3VI 2Q2IA 3JAMi 3CMEA 5BR8L 2PQAA 3KDFA 4LF4L 3B6YA 4BXXG 2A8VA 1NJIC 4GNXC 1Q81C 2WAQE 4CC6A 4BA1I 2LXJA 1HH2P 4DV3L 4POGA 2KBNA 3PUYA 1CSPA 4DR4L 4QGUA 1VQCA 3HOUH 2Q2HA 1KXLA 5JEAG 1HNXQ 1XNQL 1YI2A 1GKHA 1TWHH 1Y14B 4OWWB 2DUDA 4B3RQ 4JOIA 5GROA 2EIFA 1MJCA 3T1YL 5IWAQ 3T1HQ 1QUQB 3KFUA 3VNNA 4L5SA 4MZ9A 2IX0A 4RG1A 2RHSB 4OXPA 3U4ZA 1VQLA 4GLVB 4UCVA 4LUZA 4GN5A 4ME3A 3ERSX 1XDNA 1VQFA 2OCEA 4HJ8A 1JE5A 4GKKQ 4HIKA 1PH5A 4POFA 2WFWA 3FHWA 2GN5A 2PI2A 4GNXB 3HOZH 3UDIA 5H1SE 3RZOH 1L1OC 1XPRA 4A3EG 3GTQH 5C0XG 2Q2UA 1YVCA 4A3IH 1IBMQ 3PUXA 2OQKA 3UDGA 2PQAB 3OTOQ 1VCIA 2VQEL 1XNRL 4H02A 1Z47A 1Z9FA 1X55A 4A3KG 4B3TL 2HIXA 1SRUA 1XMOL 2UUBQ 1N32Q 1Q1BA 2UXBQ 2D0OA 3ULPA 2RF4A 4A3EH 3F2BA 3I7FA 1TWAH 3RN5A 1J6QA 1I3QH 3S1QH 4YHHL 1K9MC 3KLWA 4YCWA 4KHPQ 1V43A 1B70B 1J5EL 3UQ8A 1LUZA 2R7ZH 1K3RA 1A0IA 1BBUA 4EQ5A 2NN6G 4X66Q 2V1CC 4DV7L 5AJ3Q 5FLMG 2JA8G 5IYBG 4DKAC 1D8LA 3GJXB 3M85A 2RHQB 4R4QA 4LF6Q 2GVBA 3BABA 4B3ML 1HNZQ 5BR8Q 1VQIA 4JC0A 2CCZA 2R7ZG 4GLXA 1SE8A 3HOYG 1YITA 1PH4A 1LM0A 3GTJH 4YCVA 1K83H 2Z6KC 5FLMH 4LUOA 2KHIA 3PIOA 1IXRA 1VQKA 3OYYA 4JI2L 1XPUA 4EFEA 1HNXL 3HOXG 2E2IH 1XNQQ 3RZDH 3KF8B 4AIMA 1YJNA 2A1AA 1QZGA 2IY5B 1Q1EA 2VQFQ 1EQRA 3A0JA 3IRBA 5GAEC 5IP7H 2NVYH 3STBD 1Q7YC 1HZ9A 4LWCA 3S2DH 2JEAI 4EFBA 4IOCA 2LXKA 1X65A 1M90C 1QZHA 2HT1A 2ZTDA 2JA6G 4DR2L 4AYBE 4CC5A 4KHPL 1PYBA 4DUZL 3FKIG 2H5XA 3Q8DA 1HR0W 4GOPC 5FPOA 1N9WA 1UEBA 5LMUL 3JSNA 3SGIA 4BBRG 2N3SA 2IT1A 4JV5Q 1VQ8A 2C35B 1R9TH 2UXDL 1K0RA 4JOIC 1VQOA 5JJKA 3HOVG 2K50A 1RIPA 3NBHB 4DR7L 3JSLA 1WJJA 3CCEA 1VS0A 4O2DA 4B3TQ 1E1OA 1SROA 4NPSA 2OTLA 3CQZH 3K81C 1XTDA 1SN8A 3OW2A 3S2HH 4LF8L 2EXDA 4OX9Q 1TAEA 3UE1A 3L2PA 4BBSH 1D7QA 4ALPA 3J80i 3PO2H 3S16H 2D0PA 4R4IA 2F52A 1PH8A 4DR4Q 4GLAC 5C4XG 2FXQA 1IBLL 2NVXH 1L1OA 1HR0L 1X56A 3AFPA 4OONA 4YWLA 3S17H 4HTOA 1W3SA 3DM3A 4JI1Q 1CKOA 3TREA 5M3FG 3CC2A 4B3RL 1N33L 3GD7A 5IWAL 3T1HL 1JJCB 3I2ZA 4A3BH 1QVGA 4B3MQ 1HNZL 2VW9A 4A3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N H;  2JK8 A;  4NXM Q;  4DR1 Q;  5FJ8 H;  4WJ4 A;  4LH6 A;  5IYD G;  3CC7 A;  4A3B G;  1NBW A;  5D1O B;  2K5V A;  4JI6 Q;  4JBK A;  3KOJ A;  1AE3 A;  2ASB A;  2VUM H;  2HHH L;  4O0A A;  1JJG A;  5D1O A;  3ZJY C;  3PIP A;  2QA4 A;  3RLF A;  4LFC Q;  1CKN A;  1VQJ A;  1OTC A;  2F3I A;  1I94 Q;  5ELN A;  1Q8K A;  4JBJ A;  4JBW A;  2JEB I;  1EFW A;  4QY7 A;  2VQE Q;  1XNR Q;  1HNW Q;  1CKN B;  4PZ6 A;  1PH3 A;  4DR6 L;  5EAY A;  1KAW A;  3D0F A;  4JYA L;  1PVO A;  1A63 A;  1EOV A;  4LUV A;  2OWO A;  1FJG Q;  4DK6 C;  5LMU Q;  1TWC H;  4OWX B;  2UUA Q;  5DLQ E;  4QQB X;  1NMG A;  1ASZ A;  1A8V A;  1MIU A;  1VQ4 A;  2JA5 H;  1U0L A;  1E7Z A;  3GTK H;  1W2B A;  1VQG A;  1X6O A;  3EIV A;  3G6E A;  1FVI A;  1V1Q A;  2CWP A;  3TY8 A;  2KHJ A;  3U4V A;  2MO0 A;  2IHE A;  3PGZ A;  4LF7 Q;  5FLX c;  4JI3 L;  1DGS A;  4PMW A;  1L1O B;  1Y1W G;  3HFZ B;  4DV6 Q;  1YJ9 A;  1FGU A;  1KQS A;  2YTX A;  3UDF A;  3HOX H;  1YEZ A;  2PMZ E;  3JC6 6;  4A93 H;  2JA9 A;  2KCT A;  1NE3 A;  4L5Q A;  4DR5 Q;  5IP9 G;  2E5L Q;  1PH2 A;  1UE6 A;  5IYB H;  2YTY A;  4X65 L;  4JI5 Q;  2YYZ A;  2WB1 G;  3EN2 A;  5C44 G;  2I0Q A;  1X3E A;  4DV1 L;  4DRF A;  2AKW B;  1IBK L;  1IBL Q;  4JI0 Q;  4P71 A;  4IFD G;  2NZH A;  2JE6 I;  4DPG A;  1T9H A;  3NEL A;  1Q86 C;  1KC8 C;  1PA6 A;  2HVQ A;  2K4K A;  3K0X A;  4LW1 A;  4A3D G;  4LF9 Q;  1C0A A;  2ATW A;  3CP0 A;  2F4V Q;  1MKH A;  4C3J H;  1XMQ Q;  3S1N H;  1JMC A;  2R92 G;  4E6N A;  1KHI A;  2CQO A;  4UCS A;  4EEQ A;  1YHB A;  2UU9 Q;  3F2C A;  4KHZ A;  1NTG A;  3BZK A;  3G4S A;  1LTL A;  4UCU A;  2BH2 A;  3NBZ B;  3UE0 A;  2AHO B;  5LMN Q;  4UY8 C;  4JI8 Q;  1UWV A;  3HKS A;  2A19 A;  4LFB Q;  1GVP A;  1WYD A;  3TRZ A;  3J80 c;  2L15 A;  3I4O A;  4QL5 A;  3W1B A;  4UP9 A;  2N8N A;  3WWV A;  3M4O H;  5JJL A;  3BA8 A;  1G29 1;  2ID0 A;  1IZ6 A;  3BU2 A;  1TWF H;  1Q82 C;  2OQ0 A;  4BBS G;  4DAM A;  4A3M H;  3BAA A;  3BA9 A;  1HZC A;  4DUY L;  2AWO A;  1L2F A;  1NY4 A;  5IYC H;  1I5F A;  2ZJP A;  4DV0 Q;  3CCM A;  2CWA A;  2UUA L;  4HTP A;  4OX9 L;  2LSS A;  4X64 Q;  5HY6 A;  4X62 L;  3CCJ A;  4X6A H;  3K7A H;  1YJW A;  1PH1 A;  4LF4 Q;  3TY9 A;  4HID A;  3KF6 A;  2UUC Q;  3NEN A;  2ALY B;  4YHH Q;  4AYB G;  4DV2 L;  5FJ8 G;  1EQQ A;  1N33 Q;  3TQY A;  1LYL A;  5IT9 c;  4A3I G;  5LMN W;  1X3G A;  4DV6 L;  1J5E Q;  1N36 Q;  5ELO A;  2ZTC A;  5IYD H;  3JAM c;  3U50 C;  3GTG H;  4DR5 L;  4LNQ A;  2KEN A;  4NXM L;  1JT8 A;  1XPO A;  4DK3 C;  2Q2T A;  4A76 A;  2UXD Q;  3G71 A;  2JA5 G;  1VQD A;  1IBK Q;  2ZM6 L;  1PYS B;  1Y1V H;  2R6G A;  5M5X H;  2HHH Q;  5JJI A;  1WCM H;  4DAY B;  1B7Y B;  3E9H A;  4HJA A;  3HOW G;  4DV5 Q;  4A4I A;  4IPG A;  3A5U A;  2WP8 J;  4NXN L;  3DLL A;  4BY1 G;  2B63 G;  2GVA A;  1S68 A;  4P73 A;  2K5N A;  1VQ7 A;  2ZJQ A;  4JI7 Q;  3VDY A;  3J7Z C;  1S3O A;  4LF5 L;  4DR6 Q;  2VUG A;  4KI0 A;  3K8A A;  1C7Y A;  4TQU S;  3TY5 A;  2Y0S G;  1YHQ A;  3K7U C;  2E8G A;  3H0G G;  3TEH B;  2JA7 H;  2K75 A;  4AH6 A;  3HKZ G;  2B63 H;  1HJP A;  2KCM A;  2AWN A;  3E9I A;  5LMN L;  2HVR A;  1G6P A;  4C2M H;  2UXC L;  1WI5 A;  4YCU A;  4NB3 A;  5IP7 G;  4YY3 Q;  5D1P A;  4OWT B;  4A3G H;  3STB C;  1PH6 A;  3NEM A;  4A3J H;  1XJV A;  1S40 A;  3PUW A;  3GO5 A;  5IP9 H;  3KYH C;  1BVS A;  3KJO A;  5M5W H;  4EX5 A;  2K52 A;  1FL0 A;  4DR3 L;  2MNA A;  1PHJ A;  3KDF B;  2ES2 A;  2JA6 H;  4BY7 G;  4A3L H;  3U58 A;  3M4P A;  3CAM A;  4P72 A;  5GAD C;  4AQY Q;  5GAG C;  4DV4 L;  3AEV A;  4GN3 B;  1GO3 E;  4A75 A;  1PH9 A;  2RCN A;  3UDX A;  4X65 Q;  3J81 i;  1WFQ A;  4JI5 L;  2ZJR A;  4A3D H;  3M3Y H;  4DV1 Q;  1AE2 A;  2MQH A;  1EIF A;  4RMF A;  4BY7 H;  1OXU A;  1C9O A;  2PI2 E;  2R92 H;  1XMO Q;  2UUB L;  4XIG S;  1N32 L;  2UXB L;  1U5K A;  1KRS A;  1P8L A;  3L0O A;  4LF8 Q;  4DV2 Q;  1QUQ A;  3W5O A;  3FKI H;  2YV5 A;  4R4O A;  1N36 L;  5C3E H;  3BZC A;  4HJ9 A;  3LGJ A;  2Y0S E;  5IY0 A;  4X66 L;  1CUK A;  5IYC G;  3PN1 A;  1BKB A;  2PNH A;  2E2H H;  3HKZ E;  2I5H A;  2UU9 L;  2VZA A;  1WOC A;  4L5T A;  3QWU A;  3K80 C;  3AQQ A;  2ZM6 Q;  2BH8 A;  5C4X H;  1JB7 A;  5M3M G;  3H15 A;  2NVQ H;  4C3H H;  2N49 A;  1VQ9 A;  4UCO A;  1IYJ B;  4PZ8 A;  2BA0 A;  1UE7 A;  5E7N A;  4OO1 I;  4IPD A;  1VQM A;  3CF5 A;  1VQB A;  4K0K Q;  1VQ6 A;  3I55 A;  1I6H H;  4JI7 L;  1SMX A;  4IPH A;  1CSQ A;  4PG3 A;  2EQS A;  1YNX A;  1YBY A;  4A3F G;  3ICE A;  2DGY A;  4B3S L;  2CFM A;  2MO1 A;  3F2D A;  3J81 c;  4UP8 A;  3A74 A;  2K5H A;  1I94 L;  1EWI A;  3CCV A;  3J7A 5;  5C0X I;  4JCV E;  4X64 L;  4P74 A;  1Q12 A;  3EBE A;  4X62 Q;  3OTO L;  2VUM G;  4JYA Q;  1UE5 A;  3E0E A;  1K8G A;  3CCQ A;  2VY3 A;  4DUZ Q;  3AYH B;  2B29 A;  3CMA A;  1TXY A;  4UP7 A;  2HQL A;  4IO9 A;  3S1R H;  2NVT H;  4UCT A;  4LF6 L;  3S1M H;  4HJ5 A;  3S15 H;  1TWG H;  2QEX A;  4JBM A;  1JJ2 A;  3ER0 A;  4MNO A;  4DV4 Q;  1HR0 Q;  1VQN A;  3CCL A;  3TS2 A;  4A93 G;  2HVS A;  2MFI A;  4PZ7 A;  3CC4 A;  4DV7 Q;  3RTX A;  4LF7 L;  4GKJ Q;  4DNI A;  4LH7 A;  1E1T A;  3S14 H;  1E24 A;  1CKM A;  2N78 A;  4IPC A;  4QIW E;  3PV0 A;  1N34 Q;  4L5R C;  1QVC A;  4IOA A;  4P75 A;  3J81 j;  3RLO A;  1EIY B;  2IX1 A;  3M4Q A;  3RLN A;  4TVA B;  3GTO H;  4JI4 Q;  4DV5 L;  5FPR A;  1PH7 A;  4NXN Q;  4A3C H;  2IHF A;  1S72 A;  5JEA J;  4JI6 L;  1BBW A;  5J3B A;  1TA8 A;  4HIM A;  4C3I H;  4LF5 Q;  1WCM G;  2I5M X;  3RR5 A;  2ZTE A;  3M9B A;  4DV3 Q;  4LF9 L;  3CPF A;  4GS3 A;  2F4V L;  1X54 A;  1I50 H;  1OXV A;  4LFC L;  1VQP A;  4A3C G;  1XK5 A;  3L7Z C;  1KL9 A;  2K14 A;  4JG2 A;  5GQO A;  2UXC Q;  3F1Z A;  1YIJ A;  2VL6 A;  1M1K C;  4YY3 L;  1L0W A;  4BBR H;  3I4M G;  1PV4 A;  4APV A;  4YWK A;  1AH9 A;  2D62 A;  1FJG L;  3D31 A;  3PUZ A;  3PSI A;  5C3E G;  4HIO A;  1YHA A;  2AMC B;  5C44 H;  4HJ7 A;  3AFQ A;  4JI8 L;  4DR3 Q;  3NBY B;  1HZB A;  1Q46 A;  4LFB L;  2YTV A;  4R4C A;  4Y52 H;  3GTL H;  3I4M H;  1HZA A;  4YWM A;  4BXX H;  5C0X J;  4IFD J;  1X9N A;  4LFA Q;  3PUV A;  2Z0S A;  1ASY A;  1K73 C;  3PO2 G;  2WB1 E;  2HIV A;  3PO3 G;  4WJ3 M;  4DR7 Q;  4UCR A;  1EYG A;  4OO1 G;  3CCU A;  3HOU G;  1A62 A;  3CW2 C;  3CCS A;  2E5L L;  3CXC A;  2XTI A;  1G51 A;  5M3F H;  1SFO H;  2E2J H;  2VS1 A;  5C4J H;  4Y7N H;  1IBM L;  1OXS C;  3HOV H;  4IFD I;  3PO3 H;  3HOZ G;  3GTP H;  2OTJ A;  1H95 A;  2I5L X;  3MEF A;  1B04 A;  1EUJ A;  4A3M G;  1OXT A;  2JQO A;  1P16 A;  1E22 A;  1IL2 A;  3PF4 A;  4UPA A;  3CPW A;  3I4N G;  4UFZ A;  4JI1 L;  5HGQ A;  2JA8 H;  3BJU A;  1K8A C;  1XMQ L;  4GOP B;  1KRT A;  5IE8 A;  4A3K H;  1N8R C;  1QVF A;  3I56 A;  1GD7 A;  3NC0 B;  2NN6 I;  1NMF A;  2R93 H;  1O7I A;  4DR1 L;  2CKZ B;  4IJH A;  1GM5 A;  3GB8 B;  2B3G A;  3T1Y Q;  1VQH A;  1VQA A;  4K0K L;  2QGQ A;  2R7D A;  5GAH C;  3RNU A;  5DIS C;  4JI0 L;  3GDE A;  2XGT A;  3G48 A;  4IJL A;  4MTN A;  5M3M H;  3TS0 A;  3MXN B;  3ULJ A;  2R93 G;  4B3S Q;  2JJQ A;  1PFS A;  4GOP A;  1MJE A;  4R4T A;  4JI2 Q;  4GKK L;  3CCR A;  4R1J A;  3HOY H;  2VNU D;  1V9P A;  2VQF L;  1HNW L;  2WAQ G;  1KD1 C;  1B8A A;  3PF5 A;  5M5Y H;  3H3V H;  3KJP A;  3KF6 B;  4BY1 H;  3S24 A;  1VQ5 A;  3M7N A;  1RL2 A;  4DR2 Q;  1KIX A;  1Y1V G;  4GN4 B;  3CD6 A;  2UUC L;  1VQE A;  4LFA L;  3GTM H;  3H0G H;  4J15 A;  2JA7 G;  3HOW H;  2YU9 H;  4GKJ L;  2Z6K A;  5K36 G;  4QJF A;  4JI3 Q;  1N34 L;  4JV5 L;  4BA2 I;  4FDB A;  4A3J G;  1SLJ A;  4DUY Q;  1OXX K;  4AQY L;  3PCO B;  4GNX A;  3F8T A;  4A3G G;  3W1G A;  1UE1 A;  1E3P A;  1YZ6 A;  2NZO A;  2BA1 A;  4DV0 L;  1X3F A;  3RN2 A;  4XTC S;  3A5Z B;  5AJ3 L;  4JI4 L;  4A3L G;  3ULL A;  2R7F A;  1Y1W H;  4KLK A;  1SR3 A;  3FP9 A;  3H3V I;  2Q2I A;  3JAM i;  3CME A;  5BR8 L;  2PQA A;  3KDF A;  4LF4 L;  3B6Y A;  4BXX G;  2A8V A;  1NJI C;  4GNX C;  1Q81 C;  2WAQ E;  4CC6 A;  4BA1 I;  2LXJ A;  1HH2 P;  4DV3 L;  4POG A;  2KBN A;  3PUY A;  1CSP A;  4DR4 L;  4QGU A;  1VQC A;  3HOU H;  2Q2H A;  1KXL A;  5JEA G;  1HNX Q;  1XNQ L;  1YI2 A;  1GKH A;  1TWH H;  1Y14 B;  4OWW B;  2DUD A;  4B3R Q;  4JOI A;  5GRO A;  2EIF A;  1MJC A;  3T1Y L;  5IWA Q;  3T1H Q;  1QUQ B;  3KFU A;  3VNN A;  4L5S A;  4MZ9 A;  2IX0 A;  4RG1 A;  2RHS B;  4OXP A;  3U4Z A;  1VQL A;  4GLV B;  4UCV A;  4LUZ A;  4GN5 A;  4ME3 A;  3ERS X;  1XDN A;  1VQF A;  2OCE A;  4HJ8 A;  1JE5 A;  4GKK Q;  4HIK A;  1PH5 A;  4POF A;  2WFW A;  3FHW A;  2GN5 A;  2PI2 A;  4GNX B;  3HOZ H;  3UDI A;  5H1S E;  3RZO H;  1L1O C;  1XPR A;  4A3E G;  3GTQ H;  5C0X G;  2Q2U A;  1YVC A;  4A3I H;  1IBM Q;  3PUX A;  2OQK A;  3UDG A;  2PQA B;  3OTO Q;  1VCI A;  2VQE L;  1XNR L;  4H02 A;  1Z47 A;  1Z9F A;  1X55 A;  4A3K G;  4B3T L;  2HIX A;  1SRU A;  1XMO L;  2UUB Q;  1N32 Q;  1Q1B A;  2UXB Q;  2D0O A;  3ULP A;  2RF4 A;  4A3E H;  3F2B A;  3I7F A;  1TWA H;  3RN5 A;  1J6Q A;  1I3Q H;  3S1Q H;  4YHH L;  1K9M C;  3KLW A;  4YCW A;  4KHP Q;  1V43 A;  1B70 B;  1J5E L;  3UQ8 A;  1LUZ A;  2R7Z H;  1K3R A;  1A0I A;  1BBU A;  4EQ5 A;  2NN6 G;  4X66 Q;  2V1C C;  4DV7 L;  5AJ3 Q;  5FLM G;  2JA8 G;  5IYB G;  4DKA C;  1D8L A;  3GJX B;  3M85 A;  2RHQ B;  4R4Q A;  4LF6 Q;  2GVB A;  3BAB A;  4B3M L;  1HNZ Q;  5BR8 Q;  1VQI A;  4JC0 A;  2CCZ A;  2R7Z G;  4GLX A;  1SE8 A;  3HOY G;  1YIT A;  1PH4 A;  1LM0 A;  3GTJ H;  4YCV A;  1K83 H;  2Z6K C;  5FLM H;  4LUO A;  2KHI A;  3PIO A;  1IXR A;  1VQK A;  3OYY A;  4JI2 L;  1XPU A;  4EFE A;  1HNX L;  3HOX G;  2E2I H;  1XNQ Q;  3RZD H;  3KF8 B;  4AIM A;  1YJN A;  2A1A A;  1QZG A;  2IY5 B;  1Q1E A;  2VQF Q;  1EQR A;  3A0J A;  3IRB A;  5GAE C;  5IP7 H;  2NVY H;  3STB D;  1Q7Y C;  1HZ9 A;  4LWC A;  3S2D H;  2JEA I;  4EFB A;  4IOC A;  2LXK A;  1X65 A;  1M90 C;  1QZH A;  2HT1 A;  2ZTD A;  2JA6 G;  4DR2 L;  4AYB E;  4CC5 A;  4KHP L;  1PYB A;  4DUZ L;  3FKI G;  2H5X A;  3Q8D A;  1HR0 W;  4GOP C;  5FPO A;  1N9W A;  1UEB A;  5LMU L;  3JSN A;  3SGI A;  4BBR G;  2N3S A;  2IT1 A;  4JV5 Q;  1VQ8 A;  2C35 B;  1R9T H;  2UXD L;  1K0R A;  4JOI C;  1VQO A;  5JJK A;  3HOV G;  2K50 A;  1RIP A;  3NBH B;  4DR7 L;  3JSL A;  1WJJ A;  3CCE A;  1VS0 A;  4O2D A;  4B3T Q;  1E1O A;  1SRO A;  4NPS A;  2OTL A;  3CQZ H;  3K81 C;  1XTD A;  1SN8 A;  3OW2 A;  3S2H H;  4LF8 L;  2EXD A;  4OX9 Q;  1TAE A;  3UE1 A;  3L2P A;  4BBS H;  1D7Q A;  4ALP A;  3J80 i;  3PO2 H;  3S16 H;  2D0P A;  4R4I A;  2F52 A;  1PH8 A;  4DR4 Q;  4GLA C;  5C4X G;  2FXQ A;  1IBL L;  2NVX H;  1L1O A;  1HR0 L;  1X56 A;  3AFP A;  4OON A;  4YWL A;  3S17 H;  4HTO A;  1W3S A;  3DM3 A;  4JI1 Q;  1CKO A;  3TRE A;  5M3F G;  3CC2 A;  4B3R L;  1N33 L;  3GD7 A;  5IWA L;  3T1H L;  1JJC B;  3I2Z A;  4A3B H;  1QVG A;  4B3M Q;  1HNZ L;  2VW9 A;  4A3F H; 
#chains in the Genus database with same CATH topology
 3WWJ A;  1LTI D;  4FXK C;  4DR1 Q;  2YYA A;  5IYD G;  4A3B G;  1NBW A;  4HMI A;  2NZ1 D;  1IW7 C;  4IAL A;  4PMC A;  2ASB A;  3R9R A;  4O0A A;  5I47 A;  1JJG A;  2QA4 A;  2OEO A;  3RLF A;  1VQJ A;  2EJM A;  1XX8 A;  1I94 Q;  1Q8K A;  4JBW A;  2YW2 A;  4NZO A;  4QY7 A;  3T53 B;  1PTO H;  4DR6 L;  2EY5 A;  3SNO A;  5EAY A;  3T9B A;  3BAC A;  2EJ2 A;  2HJW A;  5I9P A;  1FJG Q;  1BDO A;  4K6L A;  1WVL A;  2EZV A;  2UUA Q;  1XWE A;  4MV8 A;  3U9S A;  1SNO A;  2A5H A;  3X3M A;  1E7Z A;  3IAY A;  2IL8 A;  3GTK H;  1LTA D;  1VQG A;  2COI A;  1V1Q A;  2KHJ A;  3PGZ A;  4CDC C;  4JI3 L;  4DAV A;  1NUC A;  3HFZ B;  3E5S A;  2ABJ A;  2PMZ E;  3JC6 6;  4DR5 Q;  3VR3 A;  1NE3 A;  4CKB A;  1CFM A;  1I4X A;  1UE6 A;  4X65 L;  1IKL A;  1O80 A;  2WB1 G;  4FO2 A;  4MIU A;  4CJ2 C;  5C44 G;  4FFO A;  2AKW B;  2D2C C;  1IBL Q;  1KBL A;  2NZH A;  3S2H B;  2AQ1 B;  2LMC B;  1Q86 C;  2K4K A;  1W96 A;  2DY8 A;  2KEE A;  2FPG B;  4C3J H;  1XMQ Q;  2CQO A;  4UCS A;  5EPL A;  4EEQ A;  1JWU D;  2NYZ D;  2UU9 Q;  4KHZ A;  3JRX A;  1BCP C;  3G4S A;  3S15 B;  2BH2 A;  4RFB A;  5E1F A;  2AHO B;  4UY8 C;  2VB2 X;  3KAK A;  2A19 A;  3UYY A;  1DV2 A;  4L63 B;  4IUR A;  2A74 C;  4FF1 A;  1EQV A;  3K57 A;  3MWE A;  3WWV A;  3M4O H;  2N8N A;  2HDK A;  2V5A A;  4WRD A;  3HS0 C;  3BZD B;  2ID0 A;  1IZ6 A;  3BU2 A;  1TWF H;  4A3M H;  3BAA A;  3BA9 A;  3GTO B;  1OBD A;  4MHE A;  2C5C A;  2XRS D;  3SDZ A;  4BY7 B;  3CCM A;  1TKW B;  4HTP A;  2OXP A;  4OX9 L;  4X64 Q;  4X6A H;  3QOL A;  3K7A H;  1YJW A;  1PH1 A;  2M2L A;  1WRV A;  3NEN A;  4DV2 L;  4LF6 Q;  5LMN W;  4DV6 L;  1I7L A;  1FD7 D;  3MXN A;  3X3N A;  2EIY A;  4QF4 A;  4EQP A;  4LNQ A;  1JT8 A;  3QJY A;  1R9T B;  3OPO A;  2A68 D;  4A76 A;  5KKN B;  3G71 A;  2K32 A;  1IHZ A;  5I4D A;  1IBK Q;  5KYL A;  3MZ5 A;  4C1N I;  5FO8 B;  4DAY B;  2KED A;  4Q4D A;  4NKL A;  3C1E A;  4IPG A;  3DLL A;  3GID A;  2F0M A;  1S5D D;  2GVA A;  2XVS A;  4I7Z C;  2KA7 A;  4JI7 Q;  5IGD A;  5BWV A;  4LF5 L;  4MA5 A;  4DR6 Q;  4MV6 A;  4ZAI A;  3H0G G;  2K75 A;  3HKZ G;  3QR8 A;  1KNA A;  3O13 A;  2HVR A;  1ET6 A;  1G6P A;  1KJJ A;  1EY0 A;  3S1M B;  3STB C;  2XN9 C;  2I87 A;  1H9J A;  5M5W H;  1CQJ B;  4DR3 L;  2ES2 A;  2MNA A;  1PHJ A;  1UC8 A;  4AQY Q;  5GAD C;  4YJ2 F;  4DV4 L;  1TS4 A;  2E74 C;  5NUC A;  4X65 Q;  3T99 A;  2WYO A;  3MC0 B;  1OXU A;  3J80 L;  1C9O A;  2PI2 E;  4XIG S;  1A3T A;  1U5K A;  5KNB A;  1I4R A;  5LL6 X;  5KNC A;  3P1H A;  3FKI H;  1GJX A;  4O4J F;  1N36 L;  2F0N A;  4O82 A;  1Q3L A;  2Y0S E;  3TBI B;  1WTQ A;  3BVZ A;  2KCN A;  2UU9 L;  1SE3 A;  3TZD A;  1ZYR D;  1WOC A;  4L5T A;  5IGB A;  1KLU D;  3GTG B;  1SNP A;  2ZM6 Q;  4UUG A;  1JB7 A;  4LMQ D;  5M3M G;  1VQ9 A;  1E4E A;  4OO1 I;  4UCO A;  2DWC A;  1RKN A;  4RHS A;  3VOT A;  3J7A F;  4A93 B;  4K0K Q;  3RV4 A;  5CV6 A;  3OUZ A;  2F3V A;  2YZG A;  4HNV A;  4A3F G;  2K04 A;  3TII A;  2DGY A;  1LTT D;  2R86 A;  1GSA A;  5JVL A;  1T5X D;  5CV8 A;  4FFN A;  4UP8 A;  4KN4 C;  3K5M A;  1H9S B;  2FMC A;  2K5H A;  2QW7 A;  1I94 L;  4GZY C;  4X64 L;  3V4S A;  1Q12 A;  3EBE A;  2BE5 D;  5C4J B;  2VUM G;  1KC7 A;  1UE5 A;  3CCQ A;  1NSN S;  2VY3 A;  1IL8 A;  4H7B A;  2Y4R A;  3C1F A;  4IO9 A;  3S1R H;  2NVT H;  4LF6 L;  4KKT A;  5DEH A;  3S15 H;  2QEX A;  4JBM A;  3HBL A;  4MNO A;  4KMU C;  4A93 G;  4QIW B;  4PZ7 A;  1FYC A;  4DV7 Q;  4GKJ Q;  1C48 A;  1CKM A;  4IPC A;  3PV0 A;  5LOV F;  1EY5 A;  4P75 A;  3MXP A;  5FLX E;  3J81 j;  4ODG A;  2I46 A;  1TWF B;  2Z1C A;  4NW2 A;  1B4O A;  2CNQ A;  2KHS A;  1PH7 A;  2IHF A;  4JI6 L;  1BBW A;  2FHT A;  1TA8 A;  4LF5 Q;  1WCM G;  3RR5 A;  4M8A A;  4OGQ C;  1A3U A;  2F0J A;  3DUZ A;  4FXD A;  1BF4 A;  2AUJ D;  2R82 A;  4FNF A;  1AH9 A;  2D62 A;  3PUZ A;  4HIO A;  1VKZ A;  1I4H A;  4YB8 B;  3K0Y A;  4DR3 Q;  3H0G B;  3CHB D;  4AYB B;  3BG5 A;  4N9T A;  5C0X J;  4LFA Q;  3PUV A;  1U9R A;  2HIV A;  4UCR A;  4DR7 Q;  2QEJ C;  1M0W A;  2WAC A;  4KD4 A;  1U4L A;  3CXC A;  5M3F H;  1G2T A;  3V2T A;  3IFT A;  5BYA A;  4IFD I;  3HOZ G;  3GTP H;  2I5L X;  1LTG D;  1G8Z D;  1TS3 A;  3I90 A;  4O84 A;  1KTK A;  3S2D B;  1A9X A;  4HSP A;  3BJU A;  1TWH B;  4GOP B;  4A3K H;  1QVF A;  3I56 A;  3FEW X;  5BWT A;  2B8G A;  2NN6 I;  1NMF A;  3QG1 A;  2MPM A;  3J80 E;  3T7A A;  1Z6H A;  3T1Y Q;  4K0K L;  1VQH A;  5GAH C;  3RNU A;  5DIS C;  2XGT A;  3G48 A;  3ULJ A;  4XQQ A;  1PFS A;  1CS0 A;  2XCL A;  3E3X A;  4K8J A;  4R4T A;  4EG0 A;  3VA5 A;  3ZYY X;  3FKI B;  1EZ1 A;  3KLS X;  1KD1 C;  5C3E B;  4FGR A;  4HN7 A;  3NP8 A;  1GLV A;  4GLW A;  1MBY A;  3H3V H;  4FFR A;  5CB4 F;  3H3V C;  1ZKO A;  4C3I G;  1PTO C;  4A3E B;  1RL2 A;  3K6O A;  5KRU A;  3NK9 A;  4XQN A;  1Y1V G;  3CD6 A;  2UUC L;  5LXT F;  2JA7 G;  1AW7 A;  4A3F B;  2YU9 H;  1SE4 A;  3HOW H;  4GKJ L;  3I4N B;  1LT5 D;  1QWY A;  4JV5 L;  3RUP A;  2B2Y C;  4AQY L;  2L9H A;  3W1G A;  5J22 A;  5A2Q E;  2RBM A;  4IZO A;  4XTC S;  3A5Z B;  5AJ3 L;  2AUK A;  4A3L G;  2F0E A;  2YL2 A;  3VPC A;  4O83 A;  3DWA A;  2EJ0 A;  3JAM i;  3CME A;  5BR8 L;  3KBG A;  4BXX G;  5T1G A;  1EYZ A;  4GNX C;  2F0O A;  1GOZ A;  2F0U A;  5CV7 A;  2BDN A;  2N55 A;  1CSP A;  2NU6 B;  3T16 A;  3T9C A;  3PFF A;  1BNC A;  5DM6 3;  2JA8 B;  4DAA A;  4JW0 A;  2PNR C;  3J81 E;  2EIF A;  5K5P A;  5IGE A;  4DAY A;  3KFU A;  4NDX A;  2Y0S B;  4MZ9 A;  4RG1 A;  1VQL A;  1HUM A;  1LT4 D;  5LYJ F;  2XRQ D;  4GN5 A;  5IGC A;  3ERS X;  1IYE A;  1XDN A;  3I12 A;  1OBG A;  4HIK A;  1CM9 A;  5ELF A;  3LUL A;  3NTH A;  4C3H G;  1ESF A;  2GN5 A;  5DM7 3;  4GNX B;  4XYL B;  3RZO H;  2W71 A;  1XPR A;  5C0X G;  2F1M A;  2X0S A;  3UDG A;  5M5Y B;  4H02 A;  1SCU B;  1X55 A;  3PO2 B;  3SXH A;  2IY5 B;  1SRU A;  2UXB Q;  1N32 Q;  1KDA A;  4K2L A;  3RN5 A;  4J6H A;  3DHQ A;  4YHH L;  2A68 C;  4YCW A;  1STA A;  3S17 B;  1ESR A;  2R7Z H;  2YRX A;  1A0I A;  3A56 A;  2V1C C;  3A8K E;  5E4X A;  4DV7 L;  1F2Y A;  5FLM G;  1STN A;  5IYB G;  5D14 A;  3T54 A;  3TEK A;  1SYC A;  2EVB A;  3BAB A;  2Z04 A;  2VQD A;  1PFM A;  2R7Z G;  5BWX A;  4GLX A;  2EDG A;  5FLM H;  3PIO A;  1VQK A;  4EFE A;  2KHI A;  1XPU A;  1XNQ Q;  2J4X A;  3HOX G;  3ETJ A;  3RZD H;  5CYU A;  2F0L A;  2HDL A;  2O5I C;  1DON A;  1Q1E A;  2R3Z A;  5M9O A;  3GTP B;  4DA2 A;  1X3Q A;  1B6S A;  3R23 A;  2QCP X;  3NUC A;  1HZ9 A;  5KS8 A;  1PFN A;  3S2D H;  3HRZ C;  2A6E C;  3BYY B;  4O7R A;  1M90 C;  3T56 B;  1CZG A;  3D3R A;  4CC5 A;  4DUZ L;  3FKI G;  2H5X A;  4GOP C;  5I2X A;  2PBZ A;  1EUD B;  4JV5 Q;  1R9T H;  5J2U F;  4FVM A;  5M3M B;  2EJ3 A;  2L55 A;  1Y1V B;  5JJK A;  4DR7 L;  1RIP A;  3JSL A;  3H91 A;  4L1K A;  3L3O C;  3D6C A;  5JEA H;  2OTL A;  2R7K A;  3OW2 A;  1WTO A;  4G7Z C;  2EXD A;  1ONL A;  3QOJ A;  1TAE A;  3UE1 A;  1I1K A;  1D7Q A;  4ALP A;  1CHP D;  4PQX A;  3U0G A;  1ILP A;  2JA7 B;  1SSO A;  3AFP A;  4KKU A;  3DM3 A;  3C3L A;  1JOR A;  1EZ8 A;  4DXF A;  1JJC B;  4DK1 A;  2F0V A;  2VW9 A;  4A3F H;  3HOW B;  1EYC A;  3I4N H;  3BDC A;  4WJ4 A;  1D5M C;  5BWU A;  1KTA A;  1ET9 A;  3MTS A;  3CC7 A;  5ISR A;  4O7V A;  5D1O B;  4JI6 Q;  3R8B A;  2VUM H;  1Y1W B;  2BE5 C;  5CV9 A;  3ZJY C;  4M1U B;  5KEE A;  1EEF D;  5BYB A;  1CKN A;  1NCV A;  1SJE D;  2L4N A;  2DZD A;  2JEB I;  1CKN B;  1A63 A;  4TVI A;  2WKC A;  1EOV A;  2NN6 H;  3MEH A;  2DIK A;  4C1N K;  2M9V A;  5LMU Q;  1TWC H;  2COJ A;  1NMG A;  4MAM A;  1E2V A;  1A8V A;  3K5I A;  2CZG A;  2RDH A;  4DN4 M;  2JA5 H;  2QK4 A;  3TW7 A;  3G6E A;  3SEB A;  1STE A;  4O7W A;  4U67 3;  4LF7 Q;  1GSH A;  2NU7 B;  2L11 A;  4K14 A;  1Y1W G;  1L1O B;  4ZQ3 A;  2XWJ B;  1FGU A;  1I6V C;  4A93 H;  4L5Q A;  5IP9 G;  1PH2 A;  1CZW A;  4TKO B;  2YTY A;  3CRK C;  4JI5 Q;  2YYZ A;  3RZO B;  3EN2 A;  1X3E A;  1F77 A;  4DV1 L;  2R7L A;  4DNT B;  4DPG A;  1PA6 A;  2HVQ A;  1T9H A;  2B2T A;  1QNU A;  3NEL A;  3KLS A;  4ME6 A;  3K0X A;  3RUZ A;  1C0A A;  4LF9 Q;  1FNV A;  4WJW A;  1SND A;  5D65 A;  2F4V Q;  3QO2 A;  4QB4 A;  3QFF A;  1S5C D;  1LTR D;  3S1N H;  3BDL A;  2F4I A;  1RTN A;  1KHI A;  3BS1 A;  1C30 A;  3M7G A;  1NTG A;  3DF7 A;  1JOQ A;  1LTL A;  2C9O A;  2TMP A;  3NBZ B;  1SDF A;  1PYW D;  3UE0 A;  5LMN Q;  3NQT A;  4JI8 Q;  1UWV A;  5COY A;  1B53 A;  5M5W B;  1SNM A;  1HTP A;  2LS0 1;  3W1B A;  4UP9 A;  2H4O A;  5JJL A;  2F3W A;  4RA8 A;  3AMU A;  1Q82 C;  1GUT A;  4DAM A;  1HZC A;  4DUY L;  3M3Y B;  2QDB A;  1T36 A;  5CR5 A;  1NY4 A;  3OW7 A;  2UUA L;  2IW3 A;  1STY A;  1EEI D;  5I5T A;  5HY6 A;  5CV4 A;  4OEM B;  5EGT A;  1WD0 A;  4LF4 Q;  1TII D;  3KF6 A;  4EQN A;  2UUC Q;  4YHH Q;  3OIQ A;  4AYB G;  5FJ8 G;  2J9G A;  2HGS A;  1EFI D;  5I5X A;  2ZTC A;  3DXJ C;  5H80 A;  1I2L A;  4DR5 L;  5DGI A;  2ZDQ A;  5CGK A;  1F9P A;  5KIX A;  1XPO A;  3M4Y A;  2NVQ B;  4DK3 C;  2Q2T A;  1I7N A;  4I65 A;  1G2W A;  1PYS B;  1SAP A;  1Y1V H;  2R6G A;  5M5X H;  1B7Y B;  4IUU A;  4HJA A;  3HOW G;  4DV5 Q;  1NR2 A;  4A4I A;  1PRT C;  1YNN C;  2WP8 J;  4NXN L;  3K58 A;  1S68 A;  2ZJQ A;  2I80 A;  5CBA E;  2HQE A;  3OOC A;  1PTO D;  1GHK A;  5M3F B;  2F0Q A;  3DWP A;  2VUG A;  4KI0 A;  3K8A A;  4PBC A;  1C7Y A;  4Y7N B;  3TY5 A;  4EGQ A;  2BOS A;  4IUV A;  3K7U C;  2JA7 H;  3TEH B;  1JWS D;  3WNZ A;  3I73 A;  3DEP A;  5ELC A;  2NB0 A;  4C2M H;  4YCU A;  4YY3 Q;  4YAK B;  3PQI A;  2EYH A;  4HTH A;  2HCI A;  1S40 A;  1D1K A;  4A3J H;  2RSO A;  1XJV A;  2KEC A;  1CA5 A;  3ONA B;  1HA6 A;  4JVZ A;  4O7Z A;  2R93 B;  2R87 A;  1DD2 A;  3M4P A;  5LHY 1;  5GAG C;  4HAE A;  4GN3 B;  3AEV A;  1TVX A;  2X69 A;  3UDX A;  3J81 i;  4JI5 L;  4A3D H;  4DV1 Q;  3TP7 A;  3J7Y W;  2R92 H;  2UXB L;  1N32 L;  3ND8 A;  1P8L A;  3L0O A;  4DV2 Q;  5IOD A;  2EJG C;  2JYO A;  2YV5 A;  2HHF A;  1STH A;  5C3E H;  5IY0 A;  3NHH A;  5CR3 A;  2W6O A;  2A69 C;  1GUO A;  2E2H H;  1JKJ B;  3NXW A;  3NSW A;  3K80 C;  3AQQ A;  1JWM D;  2MHV A;  2N49 A;  3TIG A;  1B9N A;  1IYJ B;  1JB3 A;  1X3P A;  1UE7 A;  2BA0 A;  4IPD A;  1VQB A;  5C0X H;  4IIJ F;  2ZXP A;  3A8J E;  1G91 A;  4UAI A;  1XTC D;  3GQB A;  2IJ0 A;  1SMX A;  4JI7 L;  2EQS A;  1YNX A;  3F2U A;  2CFM A;  1HFG A;  5BMV F;  2YS7 A;  2LY7 A;  3R93 A;  1CQI B;  3J7A 5;  5C0X I;  4KHV A;  2NU8 B;  4P74 A;  1WTX A;  3OTO L;  3E0E A;  4HSV A;  1K8G A;  3HOV B;  5CAE B;  4DUZ Q;  1DYQ A;  3AYH B;  4UP7 A;  2HQL A;  4HJ5 A;  2Z4I A;  1F9S A;  4FFL A;  5FOB B;  4V0B A;  2ZGI A;  4DV4 Q;  1HR0 Q;  1VQN A;  1I1L A;  1S4Z A;  3CC4 A;  4LF7 L;  3NUA A;  3NPP A;  1JQY D;  1E1T A;  1E24 A;  4QIW E;  1YNJ C;  2R84 A;  1D5X C;  3M4Q A;  1HQM C;  2L5T A;  2YWV A;  4DV5 L;  2ZDH A;  4NXN Q;  1A3V A;  1W6K A;  3KRE A;  1SEB D;  5JJZ A;  5J3B A;  3OWF A;  1LT6 D;  3RMH A;  4ME5 A;  3M9B A;  3TZU A;  4ZK9 B;  4DV3 Q;  4LF9 L;  3CPF A;  3KAJ A;  4GS3 A;  2F4V L;  4RHR A;  1PLF A;  1PZJ D;  1I50 H;  2E76 C;  3MFY A;  4LFC L;  2SEB D;  2K14 A;  4YY3 L;  2EYJ A;  5BN3 A;  1A0G A;  1PV4 A;  1U4P A;  4YWK A;  3PSI A;  2AMC B;  3AFQ A;  4X3K A;  1RTO A;  4JI8 L;  1HZB A;  2P0A A;  3NBY B;  5C6A A;  4R4C A;  4Y52 H;  4IFD J;  1X9N A;  4K5X A;  1K73 C;  2WB1 E;  3T4A C;  4V19 0;  4OO1 G;  1I2K A;  1ENC A;  2EXZ A;  1A62 A;  5C1O A;  4IUT A;  3T51 B;  3CCS A;  1J9O A;  3NWS A;  2KCC A;  1V8Q A;  2XTI A;  2E5L L;  1SFO H;  2E2J H;  1L0X B;  4Y7N H;  1IBM L;  4TV9 F;  1D1I A;  1U4R A;  1JIC A;  2X6L A;  3MEF A;  1B04 A;  4OO1 H;  3N52 A;  3J7A V;  1OXT A;  3E0J A;  1BO0 A;  3PF4 A;  5DNF A;  5JPM C;  3HGB A;  2NBF A;  3R2T A;  5HGQ A;  2JA8 H;  1TWG B;  2ICE C;  1KRT A;  2PMZ B;  1VMP A;  4I7A A;  4RZQ A;  3DM1 A;  2R93 H;  1A3G A;  3P75 A;  3D8G A;  4CDE C;  1VF7 A;  1GM5 A;  4G7O C;  1HUN A;  1E2W A;  5J39 A;  2F0G A;  1VMC A;  2WKD A;  3JAM L;  4A3D B;  4MTN A;  5M3M H;  4IJL A;  3TS0 A;  3SE7 A;  2R93 G;  4K6D A;  2JJQ A;  1UC9 A;  1AEX A;  2RDF A;  4XYQ A;  4GKK L;  4KJN A;  1K0S A;  2K01 A;  3C2P A;  3HOY H;  3QB3 A;  1AN8 A;  4OEL B;  1V9P A;  1JOK A;  1HNW L;  4ZKB B;  4O7L A;  1ET0 A;  2XD4 A;  3NWT A;  5M5Y H;  5ELD A;  4O86 A;  2R85 A;  2E2H B;  2C00 A;  4BY1 H;  4NZN A;  2HG8 A;  3M7N A;  3G7L A;  2K5D A;  3LNN A;  5KND A;  1PMR A;  1DM0 B;  1VQE A;  4C3H B;  4LFA L;  4J15 A;  5C3X A;  2K33 A;  1D5Z C;  1EY7 A;  1EKP A;  2A1H A;  4BA2 I;  4FDB A;  1G2S A;  1SLJ A;  4DUY Q;  1A15 A;  2ENB A;  4GNX A;  4A3G G;  5CMD A;  2BA1 A;  1X3F A;  1E0B A;  5L37 A;  4G4K A;  3I70 A;  3WDN A;  1Y1W H;  1DXM A;  4HQ6 A;  4DXG A;  5JQW A;  4WFN 3;  4LF4 L;  2A8V A;  1Q81 C;  4DV3 L;  4POG A;  1BCP D;  2IP4 A;  1VQC A;  5C3W A;  3KF8 A;  4Q0F A;  1MSH A;  2KUM A;  3PIP 3;  2L12 A;  1Y14 B;  4IWX A;  2XSC A;  4WBN F;  3T1Y L;  1PZI D;  3OIP A;  1HRJ A;  3VNN A;  4Q5V A;  2IX0 A;  3U4Z A;  3R5X A;  4O81 A;  2Z6B A;  1JE5 A;  1MHW C;  1SE2 A;  2SCU B;  4XT1 B;  5JVD F;  2WFW A;  1HFN A;  1H9R A;  1YVC A;  2JXM B;  3NBI A;  1IBM Q;  2F0I A;  1HQR D;  2QIL A;  2XWB B;  3OTO Q;  2VQE L;  5KGU A;  1Z47 A;  1Z9F A;  2HIX A;  2B8F A;  4F8M A;  1XMO L;  3FRP B;  1EY4 A;  3I7F A;  3JAM E;  1I3Q H;  3S1Q H;  4KHP Q;  3DTG A;  1V43 A;  1B70 B;  1LUZ A;  4X66 Q;  4EQ5 A;  1SNQ A;  1H9M A;  1Z2P X;  3A7L A;  2K05 A;  5AJ3 Q;  3GJX B;  3G8C A;  3I4M B;  4G57 A;  4R4Q A;  2SNM A;  4B3M L;  1HNZ Q;  1M4V A;  5BR8 Q;  4IFD H;  5CE8 A;  5HV6 A;  4EVO A;  1KAB A;  1CI3 M;  1LM0 A;  4YCV A;  4LUO A;  2EY6 A;  2VR1 A;  4YAJ B;  2YRW A;  1QZG A;  3ORQ A;  1EOT A;  4K5V A;  5JVG 3;  1EQR A;  3VYR A;  4DFA A;  1Q7Y C;  3STB D;  3WWH A;  1PTO F;  2JEA I;  5IOC A;  4RGO S;  2EOT A;  2CVR A;  5I5U A;  4F87 A;  2ZTD A;  2HGW A;  2MP1 A;  2EYF A;  1TY2 A;  3HZX A;  5J2T F;  1IYV A;  1SYG A;  3JZF A;  4BBR G;  4NMZ A;  2NTT A;  4HR7 B;  1VQ8 A;  2E2D C;  2RQX A;  3QWN A;  1EKF A;  3FPU B;  1HPC A;  1TT2 A;  1WJJ A;  3CCE A;  2YZM A;  4O2D A;  4B08 A;  3FMC A;  4YBZ B;  3K81 C;  1KDC A;  1SYE A;  1XTD A;  3Q0A A;  5IIF A;  3S2H H;  1RF2 D;  3L2P A;  3S16 H;  3LWB A;  3TDQ A;  4R4I A;  1HCZ A;  2P5Z X;  4L6T B;  4FFP A;  2FXQ A;  2F0P A;  4C3J B;  1HR0 L;  3DAA A;  1GUG A;  4C5A A;  3CC2 A;  3ETH A;  1BNZ A;  1N33 L;  3GD7 A;  3I2Z A;  2PZU A;  3DMU A;  4A3G B;  1KJI A;  2A6H D;  1DOL A;  5FR9 A;  2V59 A;  2YS6 A;  2GLT A;  2OLS A;  2XNA C;  3SE0 A;  2B2V C;  4ZKC B;  3U9T A;  3KOJ A;  4RGN A;  3TP8 A;  1AE3 A;  2HDM A;  3T9F A;  2HHH L;  1K83 B;  5D1O A;  2B39 A;  2O5J C;  4MV3 A;  3LX0 A;  3AB9 A;  4Z9C B;  1A6X A;  4LFC Q;  3Q2O A;  1BOS A;  1SBB B;  2F3I A;  3ERQ A;  3AX6 A;  5ELN A;  4JBJ A;  2J0T D;  1SMY D;  2NVY B;  4TV8 F;  2VQE Q;  1HNW Q;  4JYA L;  4H0L C;  1KAW A;  1QG7 A;  3D0F A;  4KJO A;  4RWS C;  2OWO A;  4K6N A;  1KJ8 A;  3MXU A;  4DK6 C;  4OWX B;  2B2W A;  5DLQ E;  1RDP D;  1RJT A;  1ASZ A;  2NU9 B;  1MIU A;  1VQ4 A;  5C4Z A;  3EJI A;  2PCF B;  2IX3 A;  2K03 A;  1W2B A;  3EIV A;  1X6O A;  5JAV A;  5JH7 F;  2CWP A;  4MTK A;  3TY8 A;  3I4L A;  3K5H A;  1H9K A;  1QNK A;  2NUC A;  2HHF B;  1YJ9 A;  1KT8 A;  2YTX A;  3UDF A;  1YEZ A;  2KCT A;  1B9M A;  2E5L Q;  4KTA A;  1A48 A;  5IYB H;  1RCV D;  1GGO A;  2CW0 C;  4DRF A;  1M6V A;  1I4Q A;  4P71 A;  1BCP B;  4QUC A;  5JPN C;  4YIJ A;  1GUN A;  4ZOL F;  4ZRZ A;  2ATW A;  3CP0 A;  1MKH A;  3NBH A;  4E6N A;  3MVV A;  4ZCK A;  4O4I F;  1FNU A;  3DWQ A;  2FIN B;  3WO0 A;  1YHB A;  3F2C A;  2D5D A;  4KKS A;  1II3 A;  2H1E A;  3HKS A;  3WOE A;  2FB9 A;  1Q90 A;  1WYD A;  3MJF A;  3J80 c;  2L15 A;  3I4O A;  4CHI A;  5I6W A;  2NWG A;  4BWG B;  5IGF A;  2L1B A;  5DGH A;  4BBS G;  3HT5 A;  2QF7 A;  1F9R A;  3K5O A;  2E2I B;  1L2F A;  5K36 H;  1ICF B;  5IYC H;  2ZJP A;  2K28 A;  2RKS A;  2R92 B;  1BQQ T;  4OIJ A;  1Q8I A;  2WII B;  5I6Y A;  3T9D A;  3CCJ A;  2W6N A;  2W70 A;  2DAA A;  3TY9 A;  4HID A;  1KJQ A;  3R5F A;  5HUR A;  1Y8N B;  2ALY B;  3EVQ A;  2QKI C;  1N33 Q;  2CH4 A;  4KHP L;  5IT9 c;  1Y8O B;  2PO4 A;  4A3I G;  1X3G A;  5IYD H;  1JCK B;  5ELO A;  4JPB W;  1AZP A;  5LP6 F;  3UZO A;  1MGS A;  5K3W A;  3GTG H;  5HBR B;  1QE6 A;  2KEN A;  1D6E C;  2PZW A;  2UXD Q;  4OL7 A;  2JA5 G;  3GTL B;  2EYL A;  2FPP B;  3HB9 A;  3JZI A;  2HHH Q;  5JJI A;  2DY7 A;  3E9H A;  1KDB A;  4DAP A;  3A5U A;  2HD3 A;  4BY1 G;  4MV7 A;  4P73 A;  2K5N A;  5D8D A;  3VDY A;  3J7Z C;  1S3O A;  1SFO B;  2E2J B;  4TQU S;  5CV5 A;  1YHQ A;  2E8G A;  2R61 A;  1EZ6 A;  2KQ3 A;  5C5L A;  4AH6 A;  3E9I A;  2KCM A;  1PFB A;  2AWN A;  5LMN L;  1WI5 A;  5CC4 A;  5IP7 G;  2NVT B;  4FU0 A;  5D1P A;  4OWT B;  4KY6 A;  4A3G H;  1PH6 A;  4JXU A;  3IKJ A;  3NEM A;  3PUW A;  2IWH A;  2F0D A;  3I72 A;  4M9U A;  5JVH 3;  1BVS A;  3KJO A;  5C4H A;  4EX5 A;  1FL0 A;  2JA6 H;  4A3L H;  3EA6 A;  4S3S A;  1J8I A;  4HED A;  3U58 A;  1PXU A;  1GO3 E;  1JDB B;  4A75 A;  2RCN A;  1SXT A;  1K8M A;  1WFQ A;  2PZT A;  2ZJR A;  3NE5 B;  2DNC A;  5ELE A;  1EY6 A;  1EIF A;  4RMF A;  1JE4 A;  4O7Y A;  2AQ3 B;  5CBE E;  4X3U A;  1XMO Q;  1KRS A;  1F2L A;  1WTH A;  3E5N A;  5EKI A;  3K7A B;  4O4H F;  3BZC A;  4C56 C;  5E25 A;  2RA4 A;  4CMD A;  4X66 L;  4OIK A;  3SK5 A;  1M8A A;  3PN1 A;  1CT1 D;  2PNH A;  1EWH A;  2O2L D;  2IPK D;  4MN3 A;  5A2Q L;  3QWU A;  1RHP A;  2KVM A;  2BH8 A;  1LAC A;  2I8C A;  4C3H H;  5GON F;  1C4Q A;  4ABN A;  4Q4C A;  3CF5 A;  5I5S A;  4DF7 A;  1DZ1 A;  1VQ6 A;  3I55 A;  1ENF A;  1CSQ A;  2E75 C;  2TSS A;  1YBY A;  1WTR A;  3U55 A;  3SVM A;  3GLK A;  2MO1 A;  1F9Q A;  3J81 c;  3A74 A;  1EWI A;  2EYO A;  3LQS A;  1ULZ A;  4JCV E;  3FVQ A;  4JYA Q;  1V1O A;  4N9P A;  2Z9H A;  2B29 A;  1VBG A;  1TXY A;  2B2T C;  1AUX A;  3S1M H;  3BG3 A;  3A7A B;  3VMM A;  3ER0 A;  2HVS A;  3NQI A;  3CCL A;  1CQF A;  2MFI A;  4O42 A;  3RTX A;  3JZ6 A;  1W93 A;  3VA7 A;  5IT9 L;  1XXG A;  2UXD L;  2N78 A;  4QSH A;  1QVC A;  3K3P A;  1O7L A;  4DNR B;  3RLO A;  2IX1 A;  1DAA A;  1PRT F;  3W3A A;  1WR2 A;  5FPR A;  2DJG C;  3SK8 A;  5D3I B;  4I4T F;  5EKK A;  3LWE A;  2A6E D;  2HGX A;  1GUS A;  2I5M X;  1BBX C;  4A3I B;  1OXV A;  4F88 A;  3H6M A;  1VQP A;  3TSS A;  1KL9 A;  5BPH A;  5F2D A;  5GQO A;  4HR7 A;  3F1Z A;  4BY1 B;  1L0W A;  4IZ8 A;  1EY8 A;  1JOO A;  3I4M G;  3Q24 A;  3KBX A;  3D31 A;  2A73 B;  5C3E G;  1LO5 D;  4HJ7 A;  1EU4 A;  1Q46 A;  3D6W A;  3CRL C;  1Y8P B;  3GTL H;  3I4M H;  4YWM A;  3V4Z A;  1UAP A;  4IQZ A;  2Z0S A;  3TW6 A;  1AFP A;  1ENA A;  2ODT X;  1EYG A;  3CCU A;  3HOU G;  3CW2 C;  1PRT B;  3MHB A;  2B2Y A;  1G51 A;  2VS1 A;  3RV3 A;  5C4J H;  1OXS C;  2Q8I B;  2WV6 D;  1H95 A;  4O4L F;  2A6H C;  4DLK A;  3I4N G;  2CNV A;  4CDF C;  4JI1 L;  1BXT A;  3LWU A;  1K8A C;  2DJF C;  2RCF A;  1N8R C;  3UFX B;  1T5E A;  1O7I A;  2BDO A;  3S14 B;  4IJH A;  4ZYS A;  3N8D A;  1UEA B;  3GB8 B;  4K8I A;  2B3G A;  1VQA A;  5EJW A;  2QGQ A;  5BN5 A;  2R7D A;  4KN7 C;  1SMY C;  4LJZ C;  3U54 A;  1EYA A;  1LAB A;  1S5E D;  4GOP A;  4RKB A;  4NYE A;  1TU2 B;  3CCR A;  1KEE A;  4HCS A;  2B2U A;  1EIG A;  4CHT B;  4QMG A;  3S16 B;  5I2Y A;  1TS2 A;  3KJP A;  5FLX L;  3S24 A;  1GHJ A;  3HEJ A;  3WO1 A;  1I3Q B;  3TN2 A;  1JC7 A;  3QQM A;  1ZXT A;  4DR2 Q;  5EBC A;  1KIX A;  4XX0 B;  2PN1 A;  1I4P A;  3H94 A;  3E6Z X;  3MXG A;  4B9X A;  4DK0 A;  3NC0 B;  3PCO B;  1YZ6 A;  3ITP A;  2NZO A;  1W6J A;  3ULL A;  1SR3 A;  3W2D A;  1PZK D;  5DMX A;  2Q2I A;  2PQA A;  5CA0 F;  1NJI C;  1SYB A;  4CC6 A;  2VXW A;  3RZD B;  1ZAU A;  4KK7 A;  1I1M A;  1PX2 A;  1PK8 A;  4DR4 L;  2Q2H A;  5JEA G;  1HNX Q;  5EBD A;  3P20 A;  4QUF A;  1YI2 A;  1GKH A;  1TWH H;  2DUD A;  4CJ1 B;  4JOI A;  2FP4 B;  3OUU A;  5IWA Q;  3T1H Q;  2G9D A;  1HA5 A;  4KY7 A;  4L5S A;  3DEO A;  4IUQ A;  2QDL A;  2RHS B;  4OXP A;  4DQN A;  2AQ2 B;  4GLV B;  1KNE A;  1VQF A;  2OCE A;  4HJ8 A;  1ZYR C;  4GKK Q;  1PH5 A;  3T13 A;  4UHV A;  1BR9 A;  3FHW A;  2PI2 A;  3HOZ H;  3Q6S A;  2RSN A;  1QIL A;  3I91 A;  1IOW A;  3MWD A;  5TSS A;  3UZB A;  4FF4 A;  4LK1 C;  4FE2 A;  1BXR A;  2EPB A;  4A3I H;  3H09 A;  3PUX A;  2PQA B;  1XNR L;  2WB1 B;  3HG9 A;  1C8C A;  4A3K G;  4B3T L;  5K36 G;  2UUB Q;  3OSO A;  4FF2 A;  1Q1B A;  2D0O A;  3F2B A;  4BBR B;  1TWA H;  5COR A;  1H9S A;  1K9M C;  3MAQ A;  1GSO A;  4NZM A;  2G9H D;  3VR6 A;  1J5E L;  3UQ8 A;  4L8J A;  1K3R A;  1L0Y B;  2MGS A;  2NN6 G;  2M00 A;  2JA8 G;  1QJO A;  4DKA C;  5T1I A;  3M85 A;  1YNN D;  2W6P A;  4C5B A;  4EGJ A;  2GVB A;  1VQI A;  4JC0 A;  4O7T A;  1YIT A;  3URY A;  4KY5 A;  3GTJ H;  1K83 H;  1IXR A;  2CQA A;  3OYY A;  4C3J G;  4MV9 A;  3TIN A;  2E2I H;  5E3F A;  4EGV A;  1V1P B;  3PO3 B;  1O7Z A;  1I4G A;  2NVY H;  2GQS A;  2QB5 A;  1LT3 D;  3ERO A;  2OF1 A;  2Q7D A;  4EFB A;  3MA2 B;  4CDD C;  2OT2 A;  5J1Z A;  1LTS D;  1QZH A;  2HT1 A;  4J1M A;  1RD9 D;  2K6A A;  4DR2 L;  4AYB E;  3HO8 A;  4CE5 A;  1PYB A;  3Q8D A;  2JA5 B;  1N9W A;  1PDQ A;  1UEB A;  3L9A X;  4IN3 A;  3SGI A;  2N3S A;  3NTI A;  2IT1 A;  5I9O A;  2C35 B;  2L0C A;  4JOI C;  2NUA B;  5KYI A;  4FFM A;  4ZHQ F;  3TQT A;  2EYP A;  3HOV G;  2EYM A;  2K50 A;  1IKM A;  1WCM B;  5KX5 F;  2DN8 A;  1DOM A;  3C46 A;  2N88 A;  1SRO A;  2RDG A;  1SN8 A;  1IOV A;  4LF8 L;  3Q23 A;  2Q8R E;  1EHI A;  3PO2 H;  4DR4 Q;  2D0P A;  3S9W A;  1R4P B;  4FF3 A;  1VF5 C;  1IBL L;  3TP5 A;  3G6J B;  1X56 A;  1Z2N X;  4OON A;  3TME A;  4HTO A;  3TRE A;  2PPB C;  4JI1 Q;  1CKO A;  3OMC A;  3UI2 A;  5IWA L;  3T1H L;  2B2V A;  4B3M Q;  1STB A;  1FR3 A;  1HNZ L;  1EWC A;  3KAL A;  4R8N A;  4TRD A;  2JK8 A;  4NXM Q;  5FJ8 H;  4LH6 A;  2JA6 B;  4E4T A;  4TSS A;  1QB5 D;  3KUP A;  2K5V A;  4JBK A;  5D3D A;  3P7J A;  5DAU A;  3VYS A;  2Z02 A;  3PIP A;  5EQ0 A;  1KJ9 A;  2SDF A;  5FO7 B;  1OTC A;  3R5H A;  1EFW A;  1XNR Q;  1PH3 A;  4PZ6 A;  2PW5 A;  2CHB D;  1PVO A;  2F0F A;  5EKL A;  4WOR A;  4LUV A;  1MI2 A;  2EJF C;  3U9O A;  4PV1 C;  2COG A;  4QQB X;  4ILW A;  3A8I E;  4FXG C;  2ZXR A;  4FP5 D;  3Q1K A;  1U0L A;  1YNJ D;  1Z2O X;  1FVI A;  3D4R A;  1TS5 A;  1DIK A;  3U4V A;  2MO0 A;  2IHE A;  5FLX c;  1DGS A;  4PMW A;  4DV6 Q;  1KQS A;  3HOX H;  2GPW A;  2JA9 A;  1KUT A;  3WOF A;  5M5X B;  2I0Q A;  2VB3 X;  4PMB A;  1EYD A;  3GTQ B;  1ICW A;  1IBK L;  3BYT B;  3OHX C;  4JI0 Q;  4IFD G;  2JE6 I;  1KC8 C;  1CQV A;  4BBS B;  3G8D A;  5IT9 E;  4LW1 A;  4A3D G;  2K5Q A;  2KOL A;  3V96 A;  1CTM A;  5LL6 S;  1JMC A;  1B1Z A;  1TWA B;  2R92 G;  3I8Z A;  4HNU A;  1ROD A;  2FJ2 A;  4IWY A;  4C2M B;  3BZK A;  1K8O A;  5A35 A;  4UCU A;  4CJ0 B;  4A3J B;  5DAA A;  3AW8 A;  4LFB Q;  1GVP A;  1HXY D;  3TRZ A;  4CGY B;  4QL5 A;  2VUM B;  3BA8 A;  1G29 1;  1EKV A;  1Z7T A;  2OQ0 A;  4FYD A;  2AWO A;  4O2B F;  5C1P A;  3VR5 A;  1I5F A;  1F2Z A;  4DV0 Q;  2CWA A;  4N8X 1;  1NAP A;  2LSS A;  4O1N A;  5CM0 A;  4X62 L;  2WIN B;  1TWC B;  4TM5 A;  1EQQ A;  2DLN A;  3TQY A;  1LYL A;  1J5E Q;  1N36 Q;  2Z4H A;  4ID6 A;  3VPD A;  3JAM c;  5ELB A;  3U50 C;  3CSW A;  4NXM L;  2B2U C;  1JR0 D;  1VQD A;  2ZM6 L;  5FO9 B;  4Y8V B;  1WCM H;  2JSO A;  3GV3 A;  4ZUJ A;  4XQJ A;  1FGB D;  3CQZ B;  3ORR A;  2B63 G;  1HTL D;  1VQ7 A;  4OHJ A;  4R8I A;  4I55 F;  3S1N B;  5IYZ F;  3N6R A;  4DIM A;  2SOB A;  2Y0S G;  5E4W C;  3DTF A;  2W6Z A;  2B63 H;  1HJP A;  2R7M A;  2UXC L;  4NB3 A;  3A54 A;  3D4D A;  2O4X A;  1G6Z A;  1LTB D;  3K59 A;  3RFC A;  2EY2 A;  3GO5 A;  5IP9 H;  3KYH C;  1B50 A;  2K52 A;  4HCE A;  3KDF B;  4BY7 G;  2FPI B;  1R4Q B;  3CAM A;  4P72 A;  2V58 A;  3R2I A;  1O7Y A;  1PH9 A;  4DU9 A;  1V1P A;  4A3M B;  3M3Y H;  1AE2 A;  2MQH A;  4RGT A;  4BY7 H;  2K7V A;  5JQG F;  2UUB L;  1WTV A;  1FNW A;  5I5V A;  4LF8 Q;  1QUQ A;  3W5O A;  5LA6 F;  4R4O A;  3KK7 A;  4HJ9 A;  3LGJ A;  2NTS A;  1CUK A;  5IYC G;  1BKB A;  2PVP A;  3HKZ E;  2I5H A;  1E2Z A;  4O7N A;  2VZA A;  4XYM B;  3GTK B;  4K2K A;  5HNE A;  2W6Q A;  3SK4 A;  5C4X H;  1GUW A;  1HHV A;  3H15 A;  4F7X A;  2NVQ H;  2VPQ A;  3GTM B;  4PZ8 A;  5E7N A;  1DV1 A;  1VQM A;  3J81 L;  5BWW A;  4C5C A;  1E4E B;  1I6H H;  4IPH A;  4PG3 A;  4X3T A;  2DAB A;  4K5W A;  2X5R A;  3ICE A;  3VYT A;  4B3S L;  3HKZ B;  3T9E A;  3F2D A;  2CH4 W;  3T9A A;  3PMF A;  4MV1 A;  3CCV A;  4XYO A;  1IW7 D;  2F0H A;  4X62 Q;  5G3L F;  1X32 A;  1EY9 A;  1ZEQ X;  3HOU B;  3ND9 A;  3CMA A;  3SHL A;  4UCT A;  4H13 C;  3VPB A;  4DGZ A;  1TWG H;  1JJ2 A;  4ZUI A;  3OWE B;  2ZT9 C;  2W6M A;  3TS2 A;  4XDX A;  2J7Z A;  4EQO A;  4I50 F;  3QIA A;  4DNI A;  2ZXO A;  4LH7 A;  3S14 H;  1N34 Q;  2GPS A;  4L5R C;  4IOA A;  2LFN A;  1TR5 A;  1EIY B;  3RLN A;  2Z8L A;  4TVA B;  3TP6 A;  1EL0 A;  3GTO H;  4JI4 Q;  4A3C H;  1S72 A;  5EPK A;  5JEA J;  3VYU A;  4QCL A;  1TQO A;  5JOB A;  4HIM A;  1CHQ D;  4C3I H;  2ZTE A;  1BUV T;  1O78 A;  3GV6 A;  1X54 A;  3HP3 A;  3A55 A;  4A3C G;  1XK5 A;  5I60 A;  1WD1 A;  3AU7 A;  3L7Z C;  3GP7 A;  4JG2 A;  5IGG A;  1YIJ A;  1BCP F;  4IUP A;  1STG A;  2VL6 A;  1M1K C;  4BBR H;  2UXC Q;  5K2M A;  2G5D A;  3I3C A;  4APV A;  1FJG L;  4RAU C;  1SNC A;  1YHA A;  1B2T A;  5C44 H;  4LFB L;  2YTV A;  1K28 A;  1HZA A;  4BXX H;  1MD2 D;  3NTK A;  5FK9 C;  1ASY A;  4H44 C;  3PO2 G;  3PO3 G;  4WJ3 M;  4XT3 B;  2KJX A;  2D9U A;  5BN4 A;  3GTJ B;  2HUG A;  4RGM A;  1LV9 A;  2XIW A;  1EIH A;  2F0T A;  3K5L A;  4ZLT F;  3LP8 A;  3HOV H;  1EU3 A;  3PO3 H;  1VDZ A;  1EUJ A;  4A3M G;  1IL2 A;  1IYU A;  1P16 A;  1E22 A;  2JQO A;  3S1R B;  2B63 B;  1M0T A;  4UPA A;  3CPW A;  4N8F A;  4BS9 A;  4UFZ A;  3BVG A;  2EE1 A;  4X3S A;  2BCO A;  2Q8T A;  3KLR A;  2EY1 A;  1XMQ L;  5IE8 A;  3RD4 A;  3SK6 A;  1GD7 A;  4HMJ A;  4M0J A;  3FPP A;  4IUN A;  1ML0 D;  4DR1 L;  4CBV A;  2CKZ B;  1JDE A;  1K3B C;  4JI0 L;  3GDE A;  1ILQ A;  1D2B A;  2JN4 A;  4KV6 A;  3FDT A;  3MXN B;  4B3S Q;  5C8Y F;  3HOZ B;  1MJE A;  3K5N A;  3MWY W;  4JI2 Q;  5G3L D;  4R1J A;  1EQT A;  1VBH A;  2VNU D;  1SYD A;  2VQF L;  2RVL A;  1DOK A;  1KAA A;  1I50 B;  2WAQ G;  2PW7 A;  1B8A A;  1PRT D;  4RH6 A;  3PF5 A;  1U4M A;  1S5F D;  3KF6 B;  4HNT A;  1SYF A;  4R9W A;  5HGT A;  2NVX B;  1VQ5 A;  3S1Q B;  4RCN A;  1TY0 A;  1EUC B;  5BWR A;  1C3O A;  4GN4 B;  5C4X B;  4A3B B;  4LAA A;  1GXD C;  3H0G H;  3GTM H;  1DJR D;  2Z6K A;  1QOH A;  4JK1 C;  4QJF A;  4JI3 Q;  2CW0 D;  4HN2 A;  1AP0 A;  1N34 L;  2K1B A;  3Q22 A;  2SNS A;  4A3J G;  1OXX K;  2F03 A;  1I6H B;  3F8T A;  1WTP A;  1UE1 A;  5FKA C;  1E3P A;  4DV0 L;  3CEB A;  3RN2 A;  4ZI7 F;  1AZQ A;  3R3O A;  4JI4 L;  3SR1 A;  2R7F A;  3VR4 A;  4KLK A;  3H3V I;  3FP9 A;  1AUV A;  2WAQ B;  1B44 D;  1UNS A;  4XXE A;  3KDF A;  4PNY A;  5EPJ A;  3B6Y A;  3JRW A;  2WAQ E;  3BDO A;  4BA1 I;  1DCZ A;  1HH2 P;  2HCC A;  2LXJ A;  2KBN A;  3IL8 A;  3PUY A;  4U68 A;  1PTO B;  4QGU A;  3HOU H;  1KXL A;  1LLR D;  1XNQ L;  3PIO 3;  4OWW B;  1CA6 A;  5CA1 F;  4A3K B;  4B3R Q;  5GRO A;  2DNE A;  1MJC A;  1QUQ B;  4XZ3 B;  2FMM A;  4NP5 A;  2X6G A;  1XYI A;  4UCV A;  2A69 D;  4LUZ A;  2GA4 B;  4ME3 A;  3EQL C;  2I07 B;  1UUP A;  1A2T A;  2YZL A;  4RCO A;  5AFW A;  1Y69 U;  4POF A;  3UDI A;  4WHX A;  5H1S E;  1L1O C;  4MV4 A;  4C3I B;  4A3E G;  3GTQ H;  3HOY B;  5FNV F;  2Q2U A;  1IYD A;  2OQK A;  2PQE A;  1VCI A;  4B9W A;  1S5B D;  4CKC A;  1CK1 A;  3ULP A;  3WWI A;  2ICI A;  2RF4 A;  1QCB D;  4A3E H;  4MA0 A;  1J6Q A;  2GQR A;  1SJH D;  3BVM A;  3KLW A;  4ULL A;  4CMF A;  5I5W A;  1A2U A;  2FFK B;  4ZQI A;  4YJ3 F;  1BBU A;  5C44 B;  2YU9 B;  1WTW A;  2JP1 A;  1D8L A;  2RHQ B;  2CCZ A;  5BPF A;  1SE8 A;  3HOY G;  3M4O B;  4TUY F;  4UDU C;  1PH4 A;  4P2C B;  2Z6K C;  1NR4 A;  4JI2 L;  2CNU A;  2K5W A;  2R7N A;  1HNX L;  3KF8 B;  4AIM A;  1YJN A;  2A1A A;  2VQF Q;  1B3A A;  3A0J A;  3IRB A;  5GAE C;  5IP7 H;  4CKE A;  4LWC A;  2YZN A;  4IOC A;  1B3Q A;  2LXK A;  3D4W A;  1X65 A;  1JLL B;  2JA6 G;  1CE8 A;  3CKI B;  1HR0 W;  5FPO A;  4O7S A;  1F2M A;  5LMU L;  4O2A F;  4E6I A;  3JSN A;  5EZY F;  3OMG A;  2B2W C;  2V4D A;  3MFG A;  4IHJ F;  5I5Y A;  1KLG D;  1K0R A;  2LKV A;  1MSG A;  3HOX B;  1VQO A;  2F0K A;  3NBH B;  3V05 A;  4J8Q A;  1VS0 A;  4B3T Q;  1E1O A;  2MJ8 A;  4NPS A;  2PYK A;  3CQZ H;  4KD3 A;  1B6R A;  4OX9 Q;  4BBS H;  3CU7 A;  3J80 i;  4RKL A;  2OTJ A;  2F0W A;  2F52 A;  3EFX D;  4GLA C;  1OO9 B;  1PH8 A;  5C4X G;  1NNX A;  2NVX H;  3VR2 A;  1L1O A;  2F0S A;  4G7H C;  4YWL A;  3S17 H;  1W3S A;  5M3F G;  4B3R L;  3IFD A;  2R7Z B;  5C5M A;  4A3B H;  2MUY A;  1QVG A;  2ZDG A; 
#chains in the Genus database with same CATH homology
 3I4N H;  2JK8 A;  4NXM Q;  4DR1 Q;  5FJ8 H;  4WJ4 A;  4LH6 A;  5IYD G;  3CC7 A;  4A3B G;  1NBW A;  5D1O B;  2K5V A;  4JI6 Q;  4JBK A;  3KOJ A;  1AE3 A;  2ASB A;  2VUM H;  2HHH L;  4O0A A;  1JJG A;  5D1O A;  3ZJY C;  3PIP A;  2QA4 A;  3RLF A;  4LFC Q;  1CKN A;  1VQJ A;  1OTC A;  2F3I A;  1I94 Q;  5ELN A;  1Q8K A;  4JBJ A;  4JBW A;  2JEB I;  1EFW A;  4QY7 A;  2VQE Q;  1XNR Q;  1HNW Q;  1CKN B;  4PZ6 A;  1PH3 A;  4DR6 L;  5EAY A;  1KAW A;  3D0F A;  4JYA L;  1PVO A;  1A63 A;  1EOV A;  4LUV A;  2OWO A;  1FJG Q;  4DK6 C;  5LMU Q;  1TWC H;  4OWX B;  2UUA Q;  5DLQ E;  4QQB X;  1NMG A;  1ASZ A;  1A8V A;  1MIU A;  1VQ4 A;  2JA5 H;  1U0L A;  1E7Z A;  3GTK H;  1W2B A;  1VQG A;  1X6O A;  3EIV A;  3G6E A;  1FVI A;  1V1Q A;  2CWP A;  3TY8 A;  2KHJ A;  3U4V A;  2MO0 A;  2IHE A;  3PGZ A;  4LF7 Q;  5FLX c;  4JI3 L;  1DGS A;  4PMW A;  1L1O B;  1Y1W G;  3HFZ B;  4DV6 Q;  1YJ9 A;  1FGU A;  1KQS A;  2YTX A;  3UDF A;  3HOX H;  1YEZ A;  2PMZ E;  3JC6 6;  4A93 H;  2JA9 A;  2KCT A;  1NE3 A;  4L5Q A;  4DR5 Q;  5IP9 G;  2E5L Q;  1PH2 A;  1UE6 A;  5IYB H;  2YTY A;  4X65 L;  4JI5 Q;  2YYZ A;  2WB1 G;  3EN2 A;  5C44 G;  2I0Q A;  1X3E A;  4DV1 L;  4DRF A;  2AKW B;  1IBK L;  1IBL Q;  4JI0 Q;  4P71 A;  4IFD G;  2NZH A;  2JE6 I;  4DPG A;  1T9H A;  3NEL A;  1Q86 C;  1KC8 C;  1PA6 A;  2HVQ A;  2K4K A;  3K0X A;  4LW1 A;  4A3D G;  4LF9 Q;  1C0A A;  2ATW A;  3CP0 A;  2F4V Q;  1MKH A;  4C3J H;  1XMQ Q;  3S1N H;  1JMC A;  2R92 G;  4E6N A;  1KHI A;  2CQO A;  4UCS A;  4EEQ A;  1YHB A;  2UU9 Q;  3F2C A;  4KHZ A;  1NTG A;  3BZK A;  3G4S A;  1LTL A;  4UCU A;  2BH2 A;  3NBZ B;  3UE0 A;  2AHO B;  5LMN Q;  4UY8 C;  4JI8 Q;  1UWV A;  3HKS A;  2A19 A;  4LFB Q;  1GVP A;  1WYD A;  3TRZ A;  3J80 c;  2L15 A;  3I4O A;  4QL5 A;  3W1B A;  4UP9 A;  2N8N A;  3WWV A;  3M4O H;  5JJL A;  3BA8 A;  1G29 1;  2ID0 A;  1IZ6 A;  3BU2 A;  1TWF H;  1Q82 C;  2OQ0 A;  4BBS G;  4DAM A;  4A3M H;  3BAA A;  3BA9 A;  1HZC A;  4DUY L;  2AWO A;  1L2F A;  1NY4 A;  5IYC H;  1I5F A;  2ZJP A;  4DV0 Q;  3CCM A;  2CWA A;  2UUA L;  4HTP A;  4OX9 L;  2LSS A;  4X64 Q;  5HY6 A;  4X62 L;  3CCJ A;  4X6A H;  3K7A H;  1YJW A;  1PH1 A;  4LF4 Q;  3TY9 A;  4HID A;  3KF6 A;  2UUC Q;  3NEN A;  2ALY B;  4YHH Q;  4AYB G;  4DV2 L;  5FJ8 G;  1EQQ A;  1N33 Q;  3TQY A;  1LYL A;  5IT9 c;  4A3I G;  5LMN W;  1X3G A;  4DV6 L;  1J5E Q;  1N36 Q;  5ELO A;  2ZTC A;  5IYD H;  3JAM c;  3U50 C;  3GTG H;  4DR5 L;  4LNQ A;  2KEN A;  4NXM L;  1JT8 A;  1XPO A;  4DK3 C;  2Q2T A;  4A76 A;  2UXD Q;  3G71 A;  2JA5 G;  1VQD A;  1IBK Q;  2ZM6 L;  1PYS B;  1Y1V H;  2R6G A;  5M5X H;  2HHH Q;  5JJI A;  1WCM H;  4DAY B;  1B7Y B;  3E9H A;  4HJA A;  3HOW G;  4DV5 Q;  4A4I A;  4IPG A;  3A5U A;  2WP8 J;  4NXN L;  3DLL A;  4BY1 G;  2B63 G;  2GVA A;  1S68 A;  4P73 A;  2K5N A;  1VQ7 A;  2ZJQ A;  4JI7 Q;  3VDY A;  3J7Z C;  1S3O A;  4LF5 L;  4DR6 Q;  2VUG A;  4KI0 A;  3K8A A;  1C7Y A;  4TQU S;  3TY5 A;  2Y0S G;  1YHQ A;  3K7U C;  2E8G A;  3H0G G;  3TEH B;  2JA7 H;  2K75 A;  4AH6 A;  3HKZ G;  2B63 H;  1HJP A;  2KCM A;  2AWN A;  3E9I A;  5LMN L;  2HVR A;  1G6P A;  4C2M H;  2UXC L;  1WI5 A;  4YCU A;  4NB3 A;  5IP7 G;  4YY3 Q;  5D1P A;  4OWT B;  4A3G H;  3STB C;  1PH6 A;  3NEM A;  4A3J H;  1XJV A;  1S40 A;  3PUW A;  3GO5 A;  5IP9 H;  3KYH C;  1BVS A;  3KJO A;  5M5W H;  4EX5 A;  2K52 A;  1FL0 A;  4DR3 L;  2MNA A;  1PHJ A;  3KDF B;  2ES2 A;  2JA6 H;  4BY7 G;  4A3L H;  3U58 A;  3M4P A;  3CAM A;  4P72 A;  5GAD C;  4AQY Q;  5GAG C;  4DV4 L;  3AEV A;  4GN3 B;  1GO3 E;  4A75 A;  1PH9 A;  2RCN A;  3UDX A;  4X65 Q;  3J81 i;  1WFQ A;  4JI5 L;  2ZJR A;  4A3D H;  3M3Y H;  4DV1 Q;  1AE2 A;  2MQH A;  1EIF A;  4RMF A;  4BY7 H;  1OXU A;  1C9O A;  2PI2 E;  2R92 H;  1XMO Q;  2UUB L;  4XIG S;  1N32 L;  2UXB L;  1U5K A;  1KRS A;  1P8L A;  3L0O A;  4LF8 Q;  4DV2 Q;  1QUQ A;  3W5O A;  3FKI H;  2YV5 A;  4R4O A;  1N36 L;  5C3E H;  3BZC A;  4HJ9 A;  3LGJ A;  2Y0S E;  5IY0 A;  4X66 L;  1CUK A;  5IYC G;  3PN1 A;  1BKB A;  2PNH A;  2E2H H;  3HKZ E;  2I5H A;  2UU9 L;  2VZA A;  1WOC A;  4L5T A;  3QWU A;  3K80 C;  3AQQ A;  2ZM6 Q;  2BH8 A;  5C4X H;  1JB7 A;  5M3M G;  3H15 A;  2NVQ H;  4C3H H;  2N49 A;  1VQ9 A;  4UCO A;  1IYJ B;  4PZ8 A;  2BA0 A;  1UE7 A;  5E7N A;  4OO1 I;  4IPD A;  1VQM A;  3CF5 A;  1VQB A;  4K0K Q;  1VQ6 A;  3I55 A;  1I6H H;  4JI7 L;  1SMX A;  4IPH A;  1CSQ A;  4PG3 A;  2EQS A;  1YNX A;  1YBY A;  4A3F G;  3ICE A;  2DGY A;  4B3S L;  2CFM A;  2MO1 A;  3F2D A;  3J81 c;  4UP8 A;  3A74 A;  2K5H A;  1I94 L;  1EWI A;  3CCV A;  3J7A 5;  5C0X I;  4JCV E;  4X64 L;  4P74 A;  1Q12 A;  3EBE A;  4X62 Q;  3OTO L;  2VUM G;  4JYA Q;  1UE5 A;  3E0E A;  1K8G A;  3CCQ A;  2VY3 A;  4DUZ Q;  3AYH B;  2B29 A;  3CMA A;  1TXY A;  4UP7 A;  2HQL A;  4IO9 A;  3S1R H;  2NVT H;  4UCT A;  4LF6 L;  3S1M H;  4HJ5 A;  3S15 H;  1TWG H;  2QEX A;  4JBM A;  1JJ2 A;  3ER0 A;  4MNO A;  4DV4 Q;  1HR0 Q;  1VQN A;  3CCL A;  3TS2 A;  4A93 G;  2HVS A;  2MFI A;  4PZ7 A;  3CC4 A;  4DV7 Q;  3RTX A;  4LF7 L;  4GKJ Q;  4DNI A;  4LH7 A;  1E1T A;  3S14 H;  1E24 A;  1CKM A;  2N78 A;  4IPC A;  4QIW E;  3PV0 A;  1N34 Q;  4L5R C;  1QVC A;  4IOA A;  4P75 A;  3J81 j;  3RLO A;  1EIY B;  2IX1 A;  3M4Q A;  3RLN A;  4TVA B;  3GTO H;  4JI4 Q;  4DV5 L;  5FPR A;  1PH7 A;  4NXN Q;  4A3C H;  2IHF A;  1S72 A;  5JEA J;  4JI6 L;  1BBW A;  5J3B A;  1TA8 A;  4HIM A;  4C3I H;  4LF5 Q;  1WCM G;  2I5M X;  3RR5 A;  2ZTE A;  3M9B A;  4DV3 Q;  4LF9 L;  3CPF A;  4GS3 A;  2F4V L;  1X54 A;  1I50 H;  1OXV A;  4LFC L;  1VQP A;  4A3C G;  1XK5 A;  3L7Z C;  1KL9 A;  2K14 A;  4JG2 A;  5GQO A;  2UXC Q;  3F1Z A;  1YIJ A;  2VL6 A;  1M1K C;  4YY3 L;  1L0W A;  4BBR H;  3I4M G;  1PV4 A;  4APV A;  4YWK A;  1AH9 A;  2D62 A;  1FJG L;  3D31 A;  3PUZ A;  3PSI A;  5C3E G;  4HIO A;  1YHA A;  2AMC B;  5C44 H;  4HJ7 A;  3AFQ A;  4JI8 L;  4DR3 Q;  3NBY B;  1HZB A;  1Q46 A;  4LFB L;  2YTV A;  4R4C A;  4Y52 H;  3GTL H;  3I4M H;  1HZA A;  4YWM A;  4BXX H;  5C0X J;  4IFD J;  1X9N A;  4LFA Q;  3PUV A;  2Z0S A;  1ASY A;  1K73 C;  3PO2 G;  2WB1 E;  2HIV A;  3PO3 G;  4WJ3 M;  4DR7 Q;  4UCR A;  1EYG A;  4OO1 G;  3CCU A;  3HOU G;  1A62 A;  3CW2 C;  3CCS A;  2E5L L;  3CXC A;  2XTI A;  1G51 A;  5M3F H;  1SFO H;  2E2J H;  2VS1 A;  5C4J H;  4Y7N H;  1IBM L;  1OXS C;  3HOV H;  4IFD I;  3PO3 H;  3HOZ G;  3GTP H;  2OTJ A;  1H95 A;  2I5L X;  3MEF A;  1B04 A;  1EUJ A;  4A3M G;  1OXT A;  2JQO A;  1P16 A;  1E22 A;  1IL2 A;  3PF4 A;  4UPA A;  3CPW A;  3I4N G;  4UFZ A;  4JI1 L;  5HGQ A;  2JA8 H;  3BJU A;  1K8A C;  1XMQ L;  4GOP B;  1KRT A;  5IE8 A;  4A3K H;  1N8R C;  1QVF A;  3I56 A;  1GD7 A;  3NC0 B;  2NN6 I;  1NMF A;  2R93 H;  1O7I A;  4DR1 L;  2CKZ B;  4IJH A;  1GM5 A;  3GB8 B;  2B3G A;  3T1Y Q;  1VQH A;  1VQA A;  4K0K L;  2QGQ A;  2R7D A;  5GAH C;  3RNU A;  5DIS C;  4JI0 L;  3GDE A;  2XGT A;  3G48 A;  4IJL A;  4MTN A;  5M3M H;  3TS0 A;  3MXN B;  3ULJ A;  2R93 G;  4B3S Q;  2JJQ A;  1PFS A;  4GOP A;  1MJE A;  4R4T A;  4JI2 Q;  4GKK L;  3CCR A;  4R1J A;  3HOY H;  2VNU D;  1V9P A;  2VQF L;  1HNW L;  2WAQ G;  1KD1 C;  1B8A A;  3PF5 A;  5M5Y H;  3H3V H;  3KJP A;  3KF6 B;  4BY1 H;  3S24 A;  1VQ5 A;  3M7N A;  1RL2 A;  4DR2 Q;  1KIX A;  1Y1V G;  4GN4 B;  3CD6 A;  2UUC L;  1VQE A;  4LFA L;  3GTM H;  3H0G H;  4J15 A;  2JA7 G;  3HOW H;  2YU9 H;  4GKJ L;  2Z6K A;  5K36 G;  4QJF A;  4JI3 Q;  1N34 L;  4JV5 L;  4BA2 I;  4FDB A;  4A3J G;  1SLJ A;  4DUY Q;  1OXX K;  4AQY L;  3PCO B;  4GNX A;  3F8T A;  4A3G G;  3W1G A;  1UE1 A;  1E3P A;  1YZ6 A;  2NZO A;  2BA1 A;  4DV0 L;  1X3F A;  3RN2 A;  4XTC S;  3A5Z B;  5AJ3 L;  4JI4 L;  4A3L G;  3ULL A;  2R7F A;  1Y1W H;  4KLK A;  1SR3 A;  3FP9 A;  3H3V I;  2Q2I A;  3JAM i;  3CME A;  5BR8 L;  2PQA A;  3KDF A;  4LF4 L;  3B6Y A;  4BXX G;  2A8V A;  1NJI C;  4GNX C;  1Q81 C;  2WAQ E;  4CC6 A;  4BA1 I;  2LXJ A;  1HH2 P;  4DV3 L;  4POG A;  2KBN A;  3PUY A;  1CSP A;  4DR4 L;  4QGU A;  1VQC A;  3HOU H;  2Q2H A;  1KXL A;  5JEA G;  1HNX Q;  1XNQ L;  1YI2 A;  1GKH A;  1TWH H;  1Y14 B;  4OWW B;  2DUD A;  4B3R Q;  4JOI A;  5GRO A;  2EIF A;  1MJC A;  3T1Y L;  5IWA Q;  3T1H Q;  1QUQ B;  3KFU A;  3VNN A;  4L5S A;  4MZ9 A;  2IX0 A;  4RG1 A;  2RHS B;  4OXP A;  3U4Z A;  1VQL A;  4GLV B;  4UCV A;  4LUZ A;  4GN5 A;  4ME3 A;  3ERS X;  1XDN A;  1VQF A;  2OCE A;  4HJ8 A;  1JE5 A;  4GKK Q;  4HIK A;  1PH5 A;  4POF A;  2WFW A;  3FHW A;  2GN5 A;  2PI2 A;  4GNX B;  3HOZ H;  3UDI A;  5H1S E;  3RZO H;  1L1O C;  1XPR A;  4A3E G;  3GTQ H;  5C0X G;  2Q2U A;  1YVC A;  4A3I H;  1IBM Q;  3PUX A;  2OQK A;  3UDG A;  2PQA B;  3OTO Q;  1VCI A;  2VQE L;  1XNR L;  4H02 A;  1Z47 A;  1Z9F A;  1X55 A;  4A3K G;  4B3T L;  2HIX A;  1SRU A;  1XMO L;  2UUB Q;  1N32 Q;  1Q1B A;  2UXB Q;  2D0O A;  3ULP A;  2RF4 A;  4A3E H;  3F2B A;  3I7F A;  1TWA H;  3RN5 A;  1J6Q A;  1I3Q H;  3S1Q H;  4YHH L;  1K9M C;  3KLW A;  4YCW A;  4KHP Q;  1V43 A;  1B70 B;  1J5E L;  3UQ8 A;  1LUZ A;  2R7Z H;  1K3R A;  1A0I A;  1BBU A;  4EQ5 A;  2NN6 G;  4X66 Q;  2V1C C;  4DV7 L;  5AJ3 Q;  5FLM G;  2JA8 G;  5IYB G;  4DKA C;  1D8L A;  3GJX B;  3M85 A;  2RHQ B;  4R4Q A;  4LF6 Q;  2GVB A;  3BAB A;  4B3M L;  1HNZ Q;  5BR8 Q;  1VQI A;  4JC0 A;  2CCZ A;  2R7Z G;  4GLX A;  1SE8 A;  3HOY G;  1YIT A;  1PH4 A;  1LM0 A;  3GTJ H;  4YCV A;  1K83 H;  2Z6K C;  5FLM H;  4LUO A;  2KHI A;  3PIO A;  1IXR A;  1VQK A;  3OYY A;  4JI2 L;  1XPU A;  4EFE A;  1HNX L;  3HOX G;  2E2I H;  1XNQ Q;  3RZD H;  3KF8 B;  4AIM A;  1YJN A;  2A1A A;  1QZG A;  2IY5 B;  1Q1E A;  2VQF Q;  1EQR A;  3A0J A;  3IRB A;  5GAE C;  5IP7 H;  2NVY H;  3STB D;  1Q7Y C;  1HZ9 A;  4LWC A;  3S2D H;  2JEA I;  4EFB A;  4IOC A;  2LXK A;  1X65 A;  1M90 C;  1QZH A;  2HT1 A;  2ZTD A;  2JA6 G;  4DR2 L;  4AYB E;  4CC5 A;  4KHP L;  1PYB A;  4DUZ L;  3FKI G;  2H5X A;  3Q8D A;  1HR0 W;  4GOP C;  5FPO A;  1N9W A;  1UEB A;  5LMU L;  3JSN A;  3SGI A;  4BBR G;  2N3S A;  2IT1 A;  4JV5 Q;  1VQ8 A;  2C35 B;  1R9T H;  2UXD L;  1K0R A;  4JOI C;  1VQO A;  5JJK A;  3HOV G;  2K50 A;  1RIP A;  3NBH B;  4DR7 L;  3JSL A;  1WJJ A;  3CCE A;  1VS0 A;  4O2D A;  4B3T Q;  1E1O A;  1SRO A;  4NPS A;  2OTL A;  3CQZ H;  3K81 C;  1XTD A;  1SN8 A;  3OW2 A;  3S2H H;  4LF8 L;  2EXD A;  4OX9 Q;  1TAE A;  3UE1 A;  3L2P A;  4BBS H;  1D7Q A;  4ALP A;  3J80 i;  3PO2 H;  3S16 H;  2D0P A;  4R4I A;  2F52 A;  1PH8 A;  4DR4 Q;  4GLA C;  5C4X G;  2FXQ A;  1IBL L;  2NVX H;  1L1O A;  1HR0 L;  1X56 A;  3AFP A;  4OON A;  4YWL A;  3S17 H;  4HTO A;  1W3S A;  3DM3 A;  4JI1 Q;  1CKO A;  3TRE A;  5M3F G;  3CC2 A;  4B3R L;  1N33 L;  3GD7 A;  5IWA L;  3T1H L;  1JJC B;  3I2Z A;  4A3B H;  1QVG A;  4B3M Q;  1HNZ L;  2VW9 A;  4A3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...