3HT5A

Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
335
structure length
335
Chain Sequence
YHTDHMVSIDYAEGRGWHNARVIPYGPIELDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRADANAARLRSSARRLAIPELPDAVFIESLRQLIAVDKAWVPGAGGEEALYLRPFIFATEPGLGVRPATQYRYLLIASPAGAYFKGGIAPVSVWVSTEYVRACPGGTGAAKFGGNYAASLLAQAEAAENGCDQVVWLDAVERRYIEEMGGMNIFFVLGSGGSARLVTPELSGSLLPGITRDSLLQLAIDAGFAVEERRIDIDEWQKKAAAGEITEVFACGTAAVITPVARVRHGASEFRIADGQPGEVTMALRDTLTGIQRGTFADTHGWMARLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.9 A structure of the branched-chain amino-acid transaminase (IlvE) from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords branched-chain-amino-acid aminotransferase
total genus 103
structure length 335
sequence length 335
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 3ht5A02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3ht5A01
3CSWA 1I1MA 5BWTA 4DAAA 5BWVA 5I5WA 1G2WA 1EKVA 4CMDA 2COJA 1IYEA 4M0JA 2HHFA 1A0GA 4JXUA 1I2LA 2DAAA 2HG8A 5FR9A 1ET0A 4TVIA 1I2KA 5CR5A 4TM5A 2HGXA 3DAAA 5I5SA 3JZ6A 5CM0A 5I5XA 3DTGA 2EJ0A 2ABJA 3SNOA 3UZBA 5DAAA 4WHXA 5BWXA 1IYDA 1I1KA 1WRVA 4CE5A 2ZGIA 2EJ3A 1EKFA 2HGWA 2COIA 2Y4RA 5I5VA 4CMFA 1A3GA 2DABA 3WWIA 5BWRA 3QQMA 5I5TA 5HNEA 5BWUA 5I60A 4K6NA 2HHFB 5I5UA 2EIYA 3WWJA 3UZOA 3CEBA 4PBCA 5K3WA 3DTFA 3LQSA 1I1LA 1DAAA 3UYYA 3LULA 5E25A 2HDKA 4CHIA 1KT8A 4DQNA 2COGA 3HT5A 1KTAA 1EKPA 5I5YA 5BWWA 3WWHA 3U0GA 4UUGA 2EJ2A 5CE8A 2A1HA
chains in the Genus database with same CATH superfamily
4PZ6A 4TUYF 4XYLB 5I47A 2FP4B 5FPRA 3HB9A 3VA7A 2YWVA 4UCTA 4HNTA 2Q2TA 3T9DA 2FPIB 2GPWA 2HVQA 3PFFA 5J2TF 4IHJF 3ETHA 4FFMA 4O2BF 4GLXA 1CKOA 5DISC 3RFCA 4IZOA 1I2LA 1IOWA 1VKZA 2VPQA 2HVRA 4FFOA 2HG8A 2GPSA 1CQIB 4UCOA 1A0IA 3TEKA 2HGXA 1W96A 3RV4A 3DAAA 1GGOA 4ME6A 2YZLA 3HBLA 3TY9A 2FPPB 4RZQA 3JZIA 3TQTA 2R7KA 3T9AA 1WR2A 2ZDGA 2Q2UA 4CKBA 2ABJA 1TAEA 4CC5A 5C1PA 4NZOA 3QFFA 4MV7A 5D8DA 3UZBA 3U54A 4I50F 1I1KA 4C5CA 2R7LA 1EKFA 3T99A 5CA1F 1FVIA 1B04A 2FB9A 2R84A 1IOVA 3U9SA 4EFBA 4HR7A 1UC9A 4PZ7A 5JVLA 1OBDA 4L1KA 2CNVA 2FPGB 3S24A 5I5TA 3N6RA 4GLWA 5HNEA 4YAJB 2GLTA 3NBZB 3T7AA 3W1BA 3R23A 3WO1A 1EUCB 2HHFB 4IWXA 3MJFA 3UQ8A 4LH6A 5J2UF 1KEEA 4LH7A 4HQ6A 5FNVF 2R85A 1BXRA 1S68A 4C5AA 1DAAA 4O7RA 3LULA 3VPCA 3BA8A 3RUPA 3TW6A 5BYAA 3KALA 1KT8A 2CZGA 2COGA 5JVDF 1Z2OX 3HO8A 1GSOA 1EKPA 3OUUA 3WWHA 3PN1A 3NBYB 4Q4DA 2GQRA 2QK4A 1DV2A 1E4EB 1JLLB 1VBGA 5D1PA 3GIDA 1I1MA 5BWTA 4O4HF 4MA5A 3BACA 3K5IA 5C1OA 4DLKA 5KKNB 3MWDA 4EG0A 3NUAA 5D1OA 3WO0A 1EKVA 4CMDA 4MV6A 5CAEB 2W70A 4CKCA 1A0GA 4JXUA 2HGSA 2NU6B 3R5FA 3G8CA 4MV1A 2Z04A 2NU7B 4RCNA 1ET0A 5LXTF 2QB5A 4UCRA 4I55F 4FFNA 4FU0A 4MV4A 1VBHA 3GJXB 2PBZA 1KJJA 5I5SA 2W6PA 2YL2A 3K5HA 3VMMA 4ZOLF 4O86A 4YAKB 4ZI7F 2DZDA 3SNOA 2CFMA 3JRWA 5C8YF 3UFXB 3V4ZA 2GQSA 5EZYF 3W1GA 4IWYA 2CNUA 2XCLA 5KS8A 2W6QA 3GB8B 4CE5A 3LWBA 3VPDA 2EJ3A 2DIKA 4O7SA 5HV6A 2HGWA 2Y4RA 1Z2NX 5IYZF 5FPOA 4YBZB 3R5XA 2NUAB 2Q7DA 1SCUB 1A48A 3I12A 4NZNA 2X0SA 3TIGA 5BWUA 4HN2A 5LOVF 5I60A 5I5UA 3E5NA 3VOTA 2EIYA 3UZOA 4O7LA 1GSHA 1EZ1A 2R7MA 4EGJA 3U9TA 4Y8VB 3DTFA 3LQSA 4FFPA 1Z2PX 5K2MA 4XYMB 2YYAA 3BA9A 2R87A 3RR5A 3ORQA 1I7LA 4CHIA 1KJQA 2DWCA 1KUTA 4O84A 1B6RA 2V5AA 2ZDQA 4UCSA 2COIA 4O81A 5JQWA 4FFLA 1W93A 4O82A 5H80A 3KAKA 3CSWA 3GLKA 4O7YA 3JSNA 4MA0A 4Q4CA 4MV9A 4DAAA 2DLNA 5I5WA 1G2WA 5DMXA 2I8CA 2COJA 2R86A 5JH7F 4M0JA 3BAAA 4E4TA 4E6NA 5KX5F 2P0AA 2HJWA 2VQDA 2DAAA 3ETJA 5FR9A 2Z02A 4TVIA 3MWEA 2R82A 4C5BA 5BPFA 5CR5A 4TM5A 4HNUA 1PX2A 2HIVA 4FGRA 1KBLA 3JZFA 1CE8A 5BYBA 1T36A 2X5RA 3KAJA 5I5XA 3T9FA 3RV3A 3TY5A 4DRFA 3SGIA 3DTGA 2EJ0A 2W6NA 2R7NA 3NC0B 4TV9F 4WHXA 5DGIA 2WYOA 1TA8A 4M9UA 4NYEA 1C3OA 4I4TF 5I5VA 3U55A 3DF7A 4CMFA 1A3GA 3T9BA 4XZ3B 5BWRA 4UCUA 1VS0A 2YW2A 1KC7A 4WBNF 1DV1A 1M0TA 2W6OA 5DGHA 1X9NA 4K6NA 1EYZA 3RTXA 2W6ZA 3R9RA 5CB4F 2I80A 4O7VA 1CQJB 3CEBA 4PBCA 5K3WA 1I1LA 3OUZA 4FFRA 4O83A 4UFZA 2QF7A 4MAMA 4O4LF 3T9EA 5CA0F 2HDKA 3WNZA 2OLSA 4CC6A 3AX6A 2YS6A 2YRWA 2CNQA 2OWOA 4FE2A 2YZMA 5BPHA 4DQNA 4O4IF 2YRXA 3HT5A 1KTAA 1PK8A 2PN1A 4NZMA 3TY8A 1JDEA 4XX0B 4ZQIA 3U0GA 3ORRA 3T54A 5CE8A 2VR1A 4O7TA 1CKNA 3KREA 3Q2OA 4DIMA 2J9GA 4O4JF 3SE7A 1DIKA 4YJ3F 5BWVA 2W6MA 2YS7A 3L2PA 4EQ5A 5BMVF 4MV8A 3VNNA 3R5HA 4EGQA 1IYEA 3V4SA 5JQGF 2HHFA 1UC8A 3JRXA 3GDEA 4CKEA 5GONF 3T9CA 4HNVA 4O7ZA 2PVPA 1I7NA 1ZAUA 1I2KA 1C30A 1A9XA 2SCUB 5LP6F 1BNCA 3JZ6A 5CM0A 4PZ8A 5LYJF 1GSAA 4TV8F 3KYHC 2NU9B 4O7WA 2I87A 2HIXA 4YJ2F 5D1OB 3TINA 1AUXA 1XK5A 1GLVA 4IIJF 5DAAA 3G8DA 5BWXA 1JDBB 1IYDA 1WRVA 1CS0A 4O2AF 1E4EA 2YZGA 2ZGIA 3TIIA 2V58A 2HVSA 1CKMA 1DGSA 3LP8A 1V9PA 2VUGA 2W71A 2DABA 3WWIA 5LA6F 3Q1KA 1EHIA 3QQMA 5HBRB 3VPBA 4EFEA 1P16A 4YB8B 4ZHQF 3BABA 3JSLA 4MV3A 1XDNA 2XD4A 2YZNA 3WWJA 3TW7A 1M0WA 3AW8A 1B6SA 2ZDHA 2IP4A 3BG5A 4UCVA 3N8DA 2NU8B 3W5OA 1OBGA 2C00A 1M6VA 4EEQA 1JKJB 2ODTX 2V59A 3UYYA 1KJ9A 5E25A 4O7NA 3K3PA 1EUDB 1CKNB 1ULZA 1AUVA 1P8LA 1KJIA 5I5YA 1KJ8A 5BWWA 3QWUA 4QSHA 4UUGA 2EJ2A 2A1HA
chains in the Genus database with same CATH topology
4Q4DA 5I47A 3CSWA 4Q4CA 1I1MA 5BWTA 3BACA 3T9DA 4DAAA 5BWVA 5I5WA 1G2WA 3PFFA 1EKVA 4CMDA 2COJA 1IYEA 4CKCA 4M0JA 2HHFA 1UC8A 4CKEA 1A0GA 4JXUA 3T9CA 1I2LA 2DAAA 2HG8A 5FR9A 4RCNA 1ZAUA 1ET0A 4TVIA 2QB5A 1I2KA 5CR5A 4TM5A 3TEKA 2HGXA 3DAAA 5BYBA 5I5SA 2X5RA 3JZ6A 5CM0A 5I5XA 3T9FA 3T9AA 3SGIA 3DTGA 2EJ0A 4CKBA 2ABJA 4NZOA 3SNOA 3UZBA 5DAAA 4WHXA 5BWXA 1IYDA 1I1KA 4IWYA 1WRVA 5DGIA 5KS8A 4CE5A 3VPDA 2ZGIA 2EJ3A 1EKFA 3T99A 2HGWA 2COIA 2Y4RA 5I5VA 3T54A 4CMFA 1A3GA 1UC9A 2Q7DA 2DABA 3WWIA 5BWRA 3QQMA 4NZNA 5I5TA 4GLWA 5HNEA 5BWUA 3T7AA 4HN2A 5I60A 5DGHA 4K6NA 2HHFB 5I5UA 4IWXA 2EIYA 3WWJA 3TW7A 3UZOA 3CEBA 4PBCA 5K3WA 3DTFA 3LQSA 1I1LA 5K2MA 2ODTX 1DAAA 3UYYA 3T9EA 3LULA 5E25A 2HDKA 5BYAA 4CHIA 1KT8A 4DQNA 2COGA 3HT5A 1KTAA 1EKPA 5I5YA 4NZMA 5BWWA 3WWHA 3U0GA 3T9BA 4UUGA 2EJ2A 5CE8A 2A1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSW A;  1I1M A;  5BWT A;  4DAA A;  5BWV A;  5I5W A;  1G2W A;  1EKV A;  4CMD A;  2COJ A;  1IYE A;  4M0J A;  2HHF A;  1A0G A;  4JXU A;  1I2L A;  2DAA A;  2HG8 A;  5FR9 A;  1ET0 A;  4TVI A;  1I2K A;  5CR5 A;  4TM5 A;  2HGX A;  3DAA A;  5I5S A;  3JZ6 A;  5CM0 A;  5I5X A;  3DTG A;  2EJ0 A;  2ABJ A;  3SNO A;  3UZB A;  5DAA A;  4WHX A;  5BWX A;  1IYD A;  1I1K A;  1WRV A;  4CE5 A;  2ZGI A;  2EJ3 A;  1EKF A;  2HGW A;  2COI A;  2Y4R A;  5I5V A;  4CMF A;  1A3G A;  2DAB A;  3WWI A;  5BWR A;  3QQM A;  5I5T A;  5HNE A;  5BWU A;  5I60 A;  4K6N A;  2HHF B;  5I5U A;  2EIY A;  3WWJ A;  3UZO A;  3CEB A;  4PBC A;  5K3W A;  3DTF A;  3LQS A;  1I1L A;  1DAA A;  3UYY A;  3LUL A;  5E25 A;  2HDK A;  4CHI A;  1KT8 A;  4DQN A;  2COG A;  3HT5 A;  1KTA A;  1EKP A;  5I5Y A;  5BWW A;  3WWH A;  3U0G A;  4UUG A;  2EJ2 A;  5CE8 A;  2A1H A; 
#chains in the Genus database with same CATH topology
 4PZ6 A;  4TUY F;  4XYL B;  5I47 A;  2FP4 B;  5FPR A;  3HB9 A;  3VA7 A;  2YWV A;  4UCT A;  4HNT A;  2Q2T A;  3T9D A;  2FPI B;  2GPW A;  2HVQ A;  3PFF A;  5J2T F;  4IHJ F;  3ETH A;  4FFM A;  4O2B F;  4GLX A;  1CKO A;  5DIS C;  3RFC A;  4IZO A;  1I2L A;  1IOW A;  1VKZ A;  2VPQ A;  2HVR A;  4FFO A;  2HG8 A;  2GPS A;  1CQI B;  4UCO A;  1A0I A;  3TEK A;  2HGX A;  1W96 A;  3RV4 A;  3DAA A;  1GGO A;  4ME6 A;  2YZL A;  3HBL A;  3TY9 A;  2FPP B;  4RZQ A;  3JZI A;  3TQT A;  2R7K A;  3T9A A;  1WR2 A;  2ZDG A;  2Q2U A;  4CKB A;  2ABJ A;  1TAE A;  4CC5 A;  5C1P A;  4NZO A;  3QFF A;  4MV7 A;  5D8D A;  3UZB A;  3U54 A;  4I50 F;  1I1K A;  4C5C A;  2R7L A;  1EKF A;  3T99 A;  5CA1 F;  1FVI A;  1B04 A;  2FB9 A;  2R84 A;  1IOV A;  3U9S A;  4EFB A;  4HR7 A;  1UC9 A;  4PZ7 A;  5JVL A;  1OBD A;  4L1K A;  2CNV A;  2FPG B;  3S24 A;  5I5T A;  3N6R A;  4GLW A;  5HNE A;  4YAJ B;  2GLT A;  3NBZ B;  3T7A A;  3W1B A;  3R23 A;  3WO1 A;  1EUC B;  2HHF B;  4IWX A;  3MJF A;  3UQ8 A;  4LH6 A;  5J2U F;  1KEE A;  4LH7 A;  4HQ6 A;  5FNV F;  2R85 A;  1BXR A;  1S68 A;  4C5A A;  1DAA A;  4O7R A;  3LUL A;  3VPC A;  3BA8 A;  3RUP A;  3TW6 A;  5BYA A;  3KAL A;  1KT8 A;  2CZG A;  2COG A;  5JVD F;  1Z2O X;  3HO8 A;  1GSO A;  1EKP A;  3OUU A;  3WWH A;  3PN1 A;  3NBY B;  4Q4D A;  2GQR A;  2QK4 A;  1DV2 A;  1E4E B;  1JLL B;  1VBG A;  5D1P A;  3GID A;  1I1M A;  5BWT A;  4O4H F;  4MA5 A;  3BAC A;  3K5I A;  5C1O A;  4DLK A;  5KKN B;  3MWD A;  4EG0 A;  3NUA A;  5D1O A;  3WO0 A;  1EKV A;  4CMD A;  4MV6 A;  5CAE B;  2W70 A;  4CKC A;  1A0G A;  4JXU A;  2HGS A;  2NU6 B;  3R5F A;  3G8C A;  4MV1 A;  2Z04 A;  2NU7 B;  4RCN A;  1ET0 A;  5LXT F;  2QB5 A;  4UCR A;  4I55 F;  4FFN A;  4FU0 A;  4MV4 A;  1VBH A;  3GJX B;  2PBZ A;  1KJJ A;  5I5S A;  2W6P A;  2YL2 A;  3K5H A;  3VMM A;  4ZOL F;  4O86 A;  4YAK B;  4ZI7 F;  2DZD A;  3SNO A;  2CFM A;  3JRW A;  5C8Y F;  3UFX B;  3V4Z A;  2GQS A;  5EZY F;  3W1G A;  4IWY A;  2CNU A;  2XCL A;  5KS8 A;  2W6Q A;  3GB8 B;  4CE5 A;  3LWB A;  3VPD A;  2EJ3 A;  2DIK A;  4O7S A;  5HV6 A;  2HGW A;  2Y4R A;  1Z2N X;  5IYZ F;  5FPO A;  4YBZ B;  3R5X A;  2NUA B;  2Q7D A;  1SCU B;  1A48 A;  3I12 A;  4NZN A;  2X0S A;  3TIG A;  5BWU A;  4HN2 A;  5LOV F;  5I60 A;  5I5U A;  3E5N A;  3VOT A;  2EIY A;  3UZO A;  4O7L A;  1GSH A;  1EZ1 A;  2R7M A;  4EGJ A;  3U9T A;  4Y8V B;  3DTF A;  3LQS A;  4FFP A;  1Z2P X;  5K2M A;  4XYM B;  2YYA A;  3BA9 A;  2R87 A;  3RR5 A;  3ORQ A;  1I7L A;  4CHI A;  1KJQ A;  2DWC A;  1KUT A;  4O84 A;  1B6R A;  2V5A A;  2ZDQ A;  4UCS A;  2COI A;  4O81 A;  5JQW A;  4FFL A;  1W93 A;  4O82 A;  5H80 A;  3KAK A;  3CSW A;  3GLK A;  4O7Y A;  3JSN A;  4MA0 A;  4Q4C A;  4MV9 A;  4DAA A;  2DLN A;  5I5W A;  1G2W A;  5DMX A;  2I8C A;  2COJ A;  2R86 A;  5JH7 F;  4M0J A;  3BAA A;  4E4T A;  4E6N A;  5KX5 F;  2P0A A;  2HJW A;  2VQD A;  2DAA A;  3ETJ A;  5FR9 A;  2Z02 A;  4TVI A;  3MWE A;  2R82 A;  4C5B A;  5BPF A;  5CR5 A;  4TM5 A;  4HNU A;  1PX2 A;  2HIV A;  4FGR A;  1KBL A;  3JZF A;  1CE8 A;  5BYB A;  1T36 A;  2X5R A;  3KAJ A;  5I5X A;  3T9F A;  3RV3 A;  3TY5 A;  4DRF A;  3SGI A;  3DTG A;  2EJ0 A;  2W6N A;  2R7N A;  3NC0 B;  4TV9 F;  4WHX A;  5DGI A;  2WYO A;  1TA8 A;  4M9U A;  4NYE A;  1C3O A;  4I4T F;  5I5V A;  3U55 A;  3DF7 A;  4CMF A;  1A3G A;  3T9B A;  4XZ3 B;  5BWR A;  4UCU A;  1VS0 A;  2YW2 A;  1KC7 A;  4WBN F;  1DV1 A;  1M0T A;  2W6O A;  5DGH A;  1X9N A;  4K6N A;  1EYZ A;  3RTX A;  2W6Z A;  3R9R A;  5CB4 F;  2I80 A;  4O7V A;  1CQJ B;  3CEB A;  4PBC A;  5K3W A;  1I1L A;  3OUZ A;  4FFR A;  4O83 A;  4UFZ A;  2QF7 A;  4MAM A;  4O4L F;  3T9E A;  5CA0 F;  2HDK A;  3WNZ A;  2OLS A;  4CC6 A;  3AX6 A;  2YS6 A;  2YRW A;  2CNQ A;  2OWO A;  4FE2 A;  2YZM A;  5BPH A;  4DQN A;  4O4I F;  2YRX A;  3HT5 A;  1KTA A;  1PK8 A;  2PN1 A;  4NZM A;  3TY8 A;  1JDE A;  4XX0 B;  4ZQI A;  3U0G A;  3ORR A;  3T54 A;  5CE8 A;  2VR1 A;  4O7T A;  1CKN A;  3KRE A;  3Q2O A;  4DIM A;  2J9G A;  4O4J F;  3SE7 A;  1DIK A;  4YJ3 F;  5BWV A;  2W6M A;  2YS7 A;  3L2P A;  4EQ5 A;  5BMV F;  4MV8 A;  3VNN A;  3R5H A;  4EGQ A;  1IYE A;  3V4S A;  5JQG F;  2HHF A;  1UC8 A;  3JRX A;  3GDE A;  4CKE A;  5GON F;  3T9C A;  4HNV A;  4O7Z A;  2PVP A;  1I7N A;  1ZAU A;  1I2K A;  1C30 A;  1A9X A;  2SCU B;  5LP6 F;  1BNC A;  3JZ6 A;  5CM0 A;  4PZ8 A;  5LYJ F;  1GSA A;  4TV8 F;  3KYH C;  2NU9 B;  4O7W A;  2I87 A;  2HIX A;  4YJ2 F;  5D1O B;  3TIN A;  1AUX A;  1XK5 A;  1GLV A;  4IIJ F;  5DAA A;  3G8D A;  5BWX A;  1JDB B;  1IYD A;  1WRV A;  1CS0 A;  4O2A F;  1E4E A;  2YZG A;  2ZGI A;  3TII A;  2V58 A;  2HVS A;  1CKM A;  1DGS A;  3LP8 A;  1V9P A;  2VUG A;  2W71 A;  2DAB A;  3WWI A;  5LA6 F;  3Q1K A;  1EHI A;  3QQM A;  5HBR B;  3VPB A;  4EFE A;  1P16 A;  4YB8 B;  4ZHQ F;  3BAB A;  3JSL A;  4MV3 A;  1XDN A;  2XD4 A;  2YZN A;  3WWJ A;  3TW7 A;  1M0W A;  3AW8 A;  1B6S A;  2ZDH A;  2IP4 A;  3BG5 A;  4UCV A;  3N8D A;  2NU8 B;  3W5O A;  1OBG A;  2C00 A;  1M6V A;  4EEQ A;  1JKJ B;  2ODT X;  2V59 A;  3UYY A;  1KJ9 A;  5E25 A;  4O7N A;  3K3P A;  1EUD B;  1CKN B;  1ULZ A;  1AUV A;  1P8L A;  1KJI A;  5I5Y A;  1KJ8 A;  5BWW A;  3QWU A;  4QSH A;  4UUG A;  2EJ2 A;  2A1H A; 
#chains in the Genus database with same CATH homology
 4Q4D A;  5I47 A;  3CSW A;  4Q4C A;  1I1M A;  5BWT A;  3BAC A;  3T9D A;  4DAA A;  5BWV A;  5I5W A;  1G2W A;  3PFF A;  1EKV A;  4CMD A;  2COJ A;  1IYE A;  4CKC A;  4M0J A;  2HHF A;  1UC8 A;  4CKE A;  1A0G A;  4JXU A;  3T9C A;  1I2L A;  2DAA A;  2HG8 A;  5FR9 A;  4RCN A;  1ZAU A;  1ET0 A;  4TVI A;  2QB5 A;  1I2K A;  5CR5 A;  4TM5 A;  3TEK A;  2HGX A;  3DAA A;  5BYB A;  5I5S A;  2X5R A;  3JZ6 A;  5CM0 A;  5I5X A;  3T9F A;  3T9A A;  3SGI A;  3DTG A;  2EJ0 A;  4CKB A;  2ABJ A;  4NZO A;  3SNO A;  3UZB A;  5DAA A;  4WHX A;  5BWX A;  1IYD A;  1I1K A;  4IWY A;  1WRV A;  5DGI A;  5KS8 A;  4CE5 A;  3VPD A;  2ZGI A;  2EJ3 A;  1EKF A;  3T99 A;  2HGW A;  2COI A;  2Y4R A;  5I5V A;  3T54 A;  4CMF A;  1A3G A;  1UC9 A;  2Q7D A;  2DAB A;  3WWI A;  5BWR A;  3QQM A;  4NZN A;  5I5T A;  4GLW A;  5HNE A;  5BWU A;  3T7A A;  4HN2 A;  5I60 A;  5DGH A;  4K6N A;  2HHF B;  5I5U A;  4IWX A;  2EIY A;  3WWJ A;  3TW7 A;  3UZO A;  3CEB A;  4PBC A;  5K3W A;  3DTF A;  3LQS A;  1I1L A;  5K2M A;  2ODT X;  1DAA A;  3UYY A;  3T9E A;  3LUL A;  5E25 A;  2HDK A;  5BYA A;  4CHI A;  1KT8 A;  4DQN A;  2COG A;  3HT5 A;  1KTA A;  1EKP A;  5I5Y A;  4NZM A;  5BWW A;  3WWH A;  3U0G A;  3T9B A;  4UUG A;  2EJ2 A;  5CE8 A;  2A1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...