3HT5A

Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
335
structure length
335
Chain Sequence
b'YHTDHMVSIDYAEGRGWHNARVIPYGPIELDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRADANAARLRSSARRLAIPELPDAVFIESLRQLIAVDKAWVPGAGGEEALYLRPFIFATEPGLGVRPATQYRYLLIASPAGAYFKGGIAPVSVWVSTEYVRACPGGTGAAKFGGNYAASLLAQAEAAENGCDQVVWLDAVERRYIEEMGGMNIFFVLGSGGSARLVTPELSGSLLPGITRDSLLQLAIDAGFAVEERRIDIDEWQKKAAAGEITEVFACGTAAVITPVARVRHGASEFRIADGQPGEVTMALRDTLTGIQRGTFADTHGWMARLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords branched-chain-amino-acid aminotransferase
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title The 1.9 A structure of the branched-chain amino-acid transaminase (IlvE) from Mycobacterium tuberculosis.
pubmed doi rcsb
total genus 103
structure length 335
sequence length 335
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 3ht5A02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3ht5A01
2HDKA 2HGXA 1EKVA 5BWRA 1WRVA 2Y4RA 3HT5A 5I5UA 5I60A 3SNOA 3WWJA 4CE5A 3QQMA 2COIA 4TM5A 5HNEA 2EIYA 5CE8A 3DAAA 2HHFB 1ET0A 4M0JA 1IYDA 2ZGIA 3UZOA 4K6NA 3UYYA 1KT8A 3DTFA 5I5WA 1I2KA 4CMFA 3WWHA 5FR9A 4CHIA 2EJ0A 3UZBA 1I1MA 5CM0A 2COGA 3JZ6A 4WHXA 4TVIA 4DAAA 1I2LA 4JXUA 5BWXA 5BWUA 1I1LA 5BWTA 1IYEA 2HGWA 5I5VA 2HHFA 2ABJA 5BWVA 5K3WA 2DABA 1KTAA 5CR5A 3CSWA 5BWWA 3CEBA 3DTGA 1A0GA 4PBCA 3WWIA 2A1HA 5I5TA 4CMDA 3LQSA 5I5SA 2EJ3A 1A3GA 1G2WA 2DAAA 3U0GA 2HG8A 5I5YA 2EJ2A 1EKPA 1DAAA 2COJA 1I1KA 4DQNA 5DAAA 1EKFA 5I5XA 5E25A 3LULA 4UUGA
chains in the Genus database with same CATH superfamily
3W5OA 4EEQA 3W1BA 5BWRA 2QB5A 3QFFA 2Z04A 1P16A 1WRVA 3UQ8A 2Y4RA 4HQ6A 4ME6A 2Q2UA 1EYZA 2P0AA 1KJJA 2YW2A 5I60A 4CE5A 2R7LA 3GIDA 3V4ZA 5LA6F 1XDNA 3NBYB 3JRWA 3T9AA 5JQGF 2YL2A 3TINA 2HHFB 3W1GA 2YS6A 1ET0A 5BYAA 4M0JA 5CA0F 4MA0A 4XYLB 1CQJB 4UCRA 4MV3A 4YBZB 4EQ5A 4ZHQF 4EGQA 3WWHA 4O2BF 1KJ9A 2EJ0A 3UZBA 3ORRA 4NZNA 2GPWA 1I1MA 1IOWA 1DIKA 3JZ6A 2FPGB 3MWEA 4HNTA 1KC7A 4WHXA 1I2LA 1EZ1A 3OUZA 4FFMA 2ZDQA 5C1PA 2HHFA 4TV8F 3R5HA 4NYEA 1PX2A 1UC8A 2R7MA 2FPPB 1ZAUA 2HIXA 2DZDA 4O4HF 1FVIA 1GSHA 3SE7A 1A0IA 2EJ3A 3BA8A 2W6MA 3TY8A 5LP6F 1G2WA 1E4EB 2YRWA 4LH7A 2DAAA 3PN1A 4Y8VB 1VS0A 2DWCA 3BG5A 3U0GA 3TW7A 5DISC 5I5YA 2EJ2A 2GLTA 1PK8A 3RV4A 3GB8B 2DIKA 3T9BA 4Q4DA 3RFCA 1CKOA 1W96A 4I4TF 4TV9F 3T9FA 2CZGA 2YRXA 3VPBA 3WO1A 4ZOLF 1JDBB 4UUGA 1P8LA 5EZYF 5C8YF 4QSHA 4O7YA 1KUTA 2Z02A 5CAEB 1GGOA 2PBZA 5KS8A 1UC9A 1XK5A 5KX5F 1BNCA 3HT5A 3BAAA 1B04A 2Q7DA 4CKEA 1CKNB 3JSLA 3SNOA 4EG0A 2HVQA 2W6QA 5D1PA 3RTXA 5DGHA 4YAKB 2COIA 4TM5A 3R5FA 5HV6A 2ODTX 2CNUA 4FFLA 3HO8A 4MV7A 3TIIA 1TAEA 3GLKA 1IYDA 3E5NA 3T99A 1T36A 4I55F 2V58A 3HB9A 4CKBA 3DTFA 5I5WA 2VQDA 4PZ7A 1C3OA 2X0SA 1I2KA 5FR9A 4CHIA 3T9DA 4XZ3B 5CM0A 3V4SA 2IP4A 3R9RA 4TVIA 5KKNB 1CKMA 1EUCB 4MV6A 3U9TA 3KAJA 2I80A 5I5VA 4FE2A 2ABJA 5BWVA 1DV1A 2HVRA 2R85A 2V59A 2NU8B 1KTAA 5CA1F 5J2TF 2GQRA 5BWWA 3DTGA 3BABA 3DF7A 5DGIA 5FNVF 1TA8A 3KYHC 2YZLA 5GONF 1I7LA 4MV8A 5J2UF 4CMDA 3LQSA 4IHJF 4O2AF 1M0WA 3GJXB 3T7AA 2OWOA 1KJIA 3ETJA 4XYMB 2VR1A 5BPHA 3KAKA 4C5AA 3TQTA 2DLNA 3TEKA 2HG8A 5JQWA 4MAMA 1EUDB 4O7LA 1EKPA 2COJA 3GDEA 4UCTA 3AW8A 4IWXA 4RCNA 1KEEA 4DQNA 5DAAA 3U9SA 1EKFA 3RUPA 3WNZA 2C00A 5E25A 4YB8B 4O82A 3S24A 1KBLA 4NZMA 3NBZB 1A48A 3VMMA 4O7ZA 3QWUA 2R84A 2HDKA 4CC5A 2YZGA 2V5AA 4EFBA 1EKVA 3LP8A 2CFMA 2NUAB 4O83A 4UCOA 3JRXA 2PVPA 4FU0A 4O7NA 2VPQA 3VNNA 3TY9A 5I5UA 2YS7A 5JVLA 3T9CA 3QQMA 4O4LF 2R7KA 3UFXB 4MA5A 1JKJB 2X5RA 3K5IA 5BYBA 4Q4CA 4M9UA 2VUGA 5C1OA 2EIYA 4HNVA 5CE8A 2OLSA 3NC0B 4LH6A 1B6RA 5JVDF 2I8CA 4O7RA 4DIMA 3SGIA 4UCVA 1AUVA 2NU9B 3UZOA 1KT8A 2HGSA 5FPRA 4CKCA 4CMFA 3VPCA 1JLLB 4PZ8A 1VBHA 1M6VA 5IYZF 3K3PA 4XX0B 1GLVA 1DV2A 3T54A 4DAAA 1DGSA 2YYAA 1OBDA 5FPOA 2HGWA 4ZQIA 5K3WA 5K2MA 2I87A 3N8DA 2ZDGA 5LYJF 2W6ZA 3CEBA 1A0GA 4PBCA 3WWIA 2W6NA 2A1HA 4MV9A 3JSNA 4WBNF 3ORQA 1BXRA 5D1OB 3Q1KA 4UCSA 4E4TA 4O7TA 4E6NA 2R82A 1EHIA 1KJ8A 5D1OA 3G8DA 2XCLA 5I47A 3JZIA 3TW6A 4FFPA 3U55A 2WYOA 4HN2A 5HBRB 4UCUA 1VKZA 4O7VA 1X9NA 1A9XA 3BACA 1CE8A 3RR5A 3LULA 3U54A 4GLXA 4YJ2F 1E4EA 3R5XA 3L2PA 2W6OA 2HGXA 2R86A 1W93A 1CS0A 2HJWA 3BA9A 4MV4A 3ETHA 5H80A 2XD4A 2QK4A 2W70A 1ULZA 3N6RA 4PZ6A 4O7WA 1I7NA 3R23A 4FFOA 3T9EA 4FFRA 3TY5A 2CNVA 3WWJA 1CQIB 3K5HA 2W71A 2J9GA 4O84A 5HNEA 3JZFA 5CB4F 1S68A 3DAAA 2NU7B 1C30A 2NU6B 2PN1A 3LWBA 5DMXA 4ZI7F 4CC6A 1CKNA 4EGJA 2ZGIA 1SCUB 3UYYA 4K6NA 5D8DA 2R7NA 3MWDA 1GSAA 4FGRA 4IIJF 2CNQA 4O4JF 1M0TA 2Q2TA 2GPSA 4EFEA 2COGA 4UFZA 1GSOA 4HR7A 4HNUA 3AX6A 4YAJB 3HBLA 4YJ3F 4MV1A 2YZMA 3KALA 4NZOA 4IWYA 4JXUA 5BWXA 5BWUA 3KREA 4O81A 4FFNA 3VA7A 1I1LA 1VBGA 3OUUA 5BWTA 1IYEA 1Z2NX 1Z2OX 1B6SA 3G8CA 5LXTF 5BMVF 2DABA 2FB9A 3Q2OA 2HVSA 2FP4B 4O4IF 5CR5A 1V9PA 3CSWA 3PFFA 1AUXA 4GLWA 5I5TA 2YZNA 2SCUB 4C5CA 4DLKA 4C5BA 5I5SA 1WR2A 1A3GA 3WO0A 4I50F 4RZQA 3NUAA 2HIVA 3RV3A 5JH7F 2GQSA 1JDEA 4L1KA 2R87A 4O86A 2QF7A 3TIGA 3MJFA 1KJQA 5BPFA 1DAAA 2W6PA 4O7SA 3VPDA 1I1KA 2FPIB 1OBGA 5I5XA 1Z2PX 3VOTA 2ZDHA 5LOVF 3I12A 2YWVA 4TUYF 4DRFA 4IZOA 1IOVA
chains in the Genus database with same CATH topology
2HDKA 2HGXA 1EKVA 5BWRA 2QB5A 5KS8A 1UC9A 1WRVA 2Y4RA 3HT5A 2Q7DA 4CKEA 5I5UA 3T9EA 5I60A 3SNOA 3WWJA 4CE5A 3T9CA 3QQMA 5DGHA 2COIA 4TM5A 2X5RA 5BYBA 5HNEA 4Q4CA 2ODTX 2EIYA 3T9AA 5CE8A 3DAAA 2HHFB 1ET0A 5BYAA 4M0JA 1IYDA 3SGIA 2ZGIA 3T99A 3UZOA 4K6NA 3UYYA 1KT8A 4CKBA 3DTFA 5I5WA 4CKCA 1I2KA 4CMFA 3WWHA 5FR9A 4CHIA 2EJ0A 3UZBA 3T9DA 4NZNA 1I1MA 5CM0A 2COGA 3JZ6A 4WHXA 4TVIA 4DAAA 3T54A 4NZOA 1I2LA 4IWYA 4JXUA 5BWXA 5BWUA 1I1LA 5BWTA 1IYEA 2HGWA 5I5VA 2HHFA 2ABJA 5BWVA 5K3WA 2DABA 5K2MA 1UC8A 1KTAA 5CR5A 3CSWA 3PFFA 5BWWA 3CEBA 3DTGA 1A0GA 4PBCA 3WWIA 1ZAUA 4GLWA 5DGIA 2A1HA 5I5TA 4CMDA 3LQSA 5I5SA 2EJ3A 1A3GA 3T7AA 1G2WA 2DAAA 3TEKA 3U0GA 2HG8A 3TW7A 5I5YA 2EJ2A 5I47A 1EKPA 1DAAA 2COJA 3VPDA 4IWXA 4RCNA 1I1KA 4HN2A 4DQNA 5DAAA 1EKFA 5I5XA 5E25A 3T9BA 4Q4DA 3BACA 4NZMA 3T9FA 3LULA 4UUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDK A;  2HGX A;  1EKV A;  5BWR A;  1WRV A;  2Y4R A;  3HT5 A;  5I5U A;  5I60 A;  3SNO A;  3WWJ A;  4CE5 A;  3QQM A;  2COI A;  4TM5 A;  5HNE A;  2EIY A;  5CE8 A;  3DAA A;  2HHF B;  1ET0 A;  4M0J A;  1IYD A;  2ZGI A;  3UZO A;  4K6N A;  3UYY A;  1KT8 A;  3DTF A;  5I5W A;  1I2K A;  4CMF A;  3WWH A;  5FR9 A;  4CHI A;  2EJ0 A;  3UZB A;  1I1M A;  5CM0 A;  2COG A;  3JZ6 A;  4WHX A;  4TVI A;  4DAA A;  1I2L A;  4JXU A;  5BWX A;  5BWU A;  1I1L A;  5BWT A;  1IYE A;  2HGW A;  5I5V A;  2HHF A;  2ABJ A;  5BWV A;  5K3W A;  2DAB A;  1KTA A;  5CR5 A;  3CSW A;  5BWW A;  3CEB A;  3DTG A;  1A0G A;  4PBC A;  3WWI A;  2A1H A;  5I5T A;  4CMD A;  3LQS A;  5I5S A;  2EJ3 A;  1A3G A;  1G2W A;  2DAA A;  3U0G A;  2HG8 A;  5I5Y A;  2EJ2 A;  1EKP A;  1DAA A;  2COJ A;  1I1K A;  4DQN A;  5DAA A;  1EKF A;  5I5X A;  5E25 A;  3LUL A;  4UUG A; 
#chains in the Genus database with same CATH topology
 3W5O A;  4EEQ A;  3W1B A;  5BWR A;  2QB5 A;  3QFF A;  2Z04 A;  1P16 A;  1WRV A;  3UQ8 A;  2Y4R A;  4HQ6 A;  4ME6 A;  2Q2U A;  1EYZ A;  2P0A A;  1KJJ A;  2YW2 A;  5I60 A;  4CE5 A;  2R7L A;  3GID A;  3V4Z A;  5LA6 F;  1XDN A;  3NBY B;  3JRW A;  3T9A A;  5JQG F;  2YL2 A;  3TIN A;  2HHF B;  3W1G A;  2YS6 A;  1ET0 A;  5BYA A;  4M0J A;  5CA0 F;  4MA0 A;  4XYL B;  1CQJ B;  4UCR A;  4MV3 A;  4YBZ B;  4EQ5 A;  4ZHQ F;  4EGQ A;  3WWH A;  4O2B F;  1KJ9 A;  2EJ0 A;  3UZB A;  3ORR A;  4NZN A;  2GPW A;  1I1M A;  1IOW A;  1DIK A;  3JZ6 A;  2FPG B;  3MWE A;  4HNT A;  1KC7 A;  4WHX A;  1I2L A;  1EZ1 A;  3OUZ A;  4FFM A;  2ZDQ A;  5C1P A;  2HHF A;  4TV8 F;  3R5H A;  4NYE A;  1PX2 A;  1UC8 A;  2R7M A;  2FPP B;  1ZAU A;  2HIX A;  2DZD A;  4O4H F;  1FVI A;  1GSH A;  3SE7 A;  1A0I A;  2EJ3 A;  3BA8 A;  2W6M A;  3TY8 A;  5LP6 F;  1G2W A;  1E4E B;  2YRW A;  4LH7 A;  2DAA A;  3PN1 A;  4Y8V B;  1VS0 A;  2DWC A;  3BG5 A;  3U0G A;  3TW7 A;  5DIS C;  5I5Y A;  2EJ2 A;  2GLT A;  1PK8 A;  3RV4 A;  3GB8 B;  2DIK A;  3T9B A;  4Q4D A;  3RFC A;  1CKO A;  1W96 A;  4I4T F;  4TV9 F;  3T9F A;  2CZG A;  2YRX A;  3VPB A;  3WO1 A;  4ZOL F;  1JDB B;  4UUG A;  1P8L A;  5EZY F;  5C8Y F;  4QSH A;  4O7Y A;  1KUT A;  2Z02 A;  5CAE B;  1GGO A;  2PBZ A;  5KS8 A;  1UC9 A;  1XK5 A;  5KX5 F;  1BNC A;  3HT5 A;  3BAA A;  1B04 A;  2Q7D A;  4CKE A;  1CKN B;  3JSL A;  3SNO A;  4EG0 A;  2HVQ A;  2W6Q A;  5D1P A;  3RTX A;  5DGH A;  4YAK B;  2COI A;  4TM5 A;  3R5F A;  5HV6 A;  2ODT X;  2CNU A;  4FFL A;  3HO8 A;  4MV7 A;  3TII A;  1TAE A;  3GLK A;  1IYD A;  3E5N A;  3T99 A;  1T36 A;  4I55 F;  2V58 A;  3HB9 A;  4CKB A;  3DTF A;  5I5W A;  2VQD A;  4PZ7 A;  1C3O A;  2X0S A;  1I2K A;  5FR9 A;  4CHI A;  3T9D A;  4XZ3 B;  5CM0 A;  3V4S A;  2IP4 A;  3R9R A;  4TVI A;  5KKN B;  1CKM A;  1EUC B;  4MV6 A;  3U9T A;  3KAJ A;  2I80 A;  5I5V A;  4FE2 A;  2ABJ A;  5BWV A;  1DV1 A;  2HVR A;  2R85 A;  2V59 A;  2NU8 B;  1KTA A;  5CA1 F;  5J2T F;  2GQR A;  5BWW A;  3DTG A;  3BAB A;  3DF7 A;  5DGI A;  5FNV F;  1TA8 A;  3KYH C;  2YZL A;  5GON F;  1I7L A;  4MV8 A;  5J2U F;  4CMD A;  3LQS A;  4IHJ F;  4O2A F;  1M0W A;  3GJX B;  3T7A A;  2OWO A;  1KJI A;  3ETJ A;  4XYM B;  2VR1 A;  5BPH A;  3KAK A;  4C5A A;  3TQT A;  2DLN A;  3TEK A;  2HG8 A;  5JQW A;  4MAM A;  1EUD B;  4O7L A;  1EKP A;  2COJ A;  3GDE A;  4UCT A;  3AW8 A;  4IWX A;  4RCN A;  1KEE A;  4DQN A;  5DAA A;  3U9S A;  1EKF A;  3RUP A;  3WNZ A;  2C00 A;  5E25 A;  4YB8 B;  4O82 A;  3S24 A;  1KBL A;  4NZM A;  3NBZ B;  1A48 A;  3VMM A;  4O7Z A;  3QWU A;  2R84 A;  2HDK A;  4CC5 A;  2YZG A;  2V5A A;  4EFB A;  1EKV A;  3LP8 A;  2CFM A;  2NUA B;  4O83 A;  4UCO A;  3JRX A;  2PVP A;  4FU0 A;  4O7N A;  2VPQ A;  3VNN A;  3TY9 A;  5I5U A;  2YS7 A;  5JVL A;  3T9C A;  3QQM A;  4O4L F;  2R7K A;  3UFX B;  4MA5 A;  1JKJ B;  2X5R A;  3K5I A;  5BYB A;  4Q4C A;  4M9U A;  2VUG A;  5C1O A;  2EIY A;  4HNV A;  5CE8 A;  2OLS A;  3NC0 B;  4LH6 A;  1B6R A;  5JVD F;  2I8C A;  4O7R A;  4DIM A;  3SGI A;  4UCV A;  1AUV A;  2NU9 B;  3UZO A;  1KT8 A;  2HGS A;  5FPR A;  4CKC A;  4CMF A;  3VPC A;  1JLL B;  4PZ8 A;  1VBH A;  1M6V A;  5IYZ F;  3K3P A;  4XX0 B;  1GLV A;  1DV2 A;  3T54 A;  4DAA A;  1DGS A;  2YYA A;  1OBD A;  5FPO A;  2HGW A;  4ZQI A;  5K3W A;  5K2M A;  2I87 A;  3N8D A;  2ZDG A;  5LYJ F;  2W6Z A;  3CEB A;  1A0G A;  4PBC A;  3WWI A;  2W6N A;  2A1H A;  4MV9 A;  3JSN A;  4WBN F;  3ORQ A;  1BXR A;  5D1O B;  3Q1K A;  4UCS A;  4E4T A;  4O7T A;  4E6N A;  2R82 A;  1EHI A;  1KJ8 A;  5D1O A;  3G8D A;  2XCL A;  5I47 A;  3JZI A;  3TW6 A;  4FFP A;  3U55 A;  2WYO A;  4HN2 A;  5HBR B;  4UCU A;  1VKZ A;  4O7V A;  1X9N A;  1A9X A;  3BAC A;  1CE8 A;  3RR5 A;  3LUL A;  3U54 A;  4GLX A;  4YJ2 F;  1E4E A;  3R5X A;  3L2P A;  2W6O A;  2HGX A;  2R86 A;  1W93 A;  1CS0 A;  2HJW A;  3BA9 A;  4MV4 A;  3ETH A;  5H80 A;  2XD4 A;  2QK4 A;  2W70 A;  1ULZ A;  3N6R A;  4PZ6 A;  4O7W A;  1I7N A;  3R23 A;  4FFO A;  3T9E A;  4FFR A;  3TY5 A;  2CNV A;  3WWJ A;  1CQI B;  3K5H A;  2W71 A;  2J9G A;  4O84 A;  5HNE A;  3JZF A;  5CB4 F;  1S68 A;  3DAA A;  2NU7 B;  1C30 A;  2NU6 B;  2PN1 A;  3LWB A;  5DMX A;  4ZI7 F;  4CC6 A;  1CKN A;  4EGJ A;  2ZGI A;  1SCU B;  3UYY A;  4K6N A;  5D8D A;  2R7N A;  3MWD A;  1GSA A;  4FGR A;  4IIJ F;  2CNQ A;  4O4J F;  1M0T A;  2Q2T A;  2GPS A;  4EFE A;  2COG A;  4UFZ A;  1GSO A;  4HR7 A;  4HNU A;  3AX6 A;  4YAJ B;  3HBL A;  4YJ3 F;  4MV1 A;  2YZM A;  3KAL A;  4NZO A;  4IWY A;  4JXU A;  5BWX A;  5BWU A;  3KRE A;  4O81 A;  4FFN A;  3VA7 A;  1I1L A;  1VBG A;  3OUU A;  5BWT A;  1IYE A;  1Z2N X;  1Z2O X;  1B6S A;  3G8C A;  5LXT F;  5BMV F;  2DAB A;  2FB9 A;  3Q2O A;  2HVS A;  2FP4 B;  4O4I F;  5CR5 A;  1V9P A;  3CSW A;  3PFF A;  1AUX A;  4GLW A;  5I5T A;  2YZN A;  2SCU B;  4C5C A;  4DLK A;  4C5B A;  5I5S A;  1WR2 A;  1A3G A;  3WO0 A;  4I50 F;  4RZQ A;  3NUA A;  2HIV A;  3RV3 A;  5JH7 F;  2GQS A;  1JDE A;  4L1K A;  2R87 A;  4O86 A;  2QF7 A;  3TIG A;  3MJF A;  1KJQ A;  5BPF A;  1DAA A;  2W6P A;  4O7S A;  3VPD A;  1I1K A;  2FPI B;  1OBG A;  5I5X A;  1Z2P X;  3VOT A;  2ZDH A;  5LOV F;  3I12 A;  2YWV A;  4TUY F;  4DRF A;  4IZO A;  1IOV A; 
#chains in the Genus database with same CATH homology
 2HDK A;  2HGX A;  1EKV A;  5BWR A;  2QB5 A;  5KS8 A;  1UC9 A;  1WRV A;  2Y4R A;  3HT5 A;  2Q7D A;  4CKE A;  5I5U A;  3T9E A;  5I60 A;  3SNO A;  3WWJ A;  4CE5 A;  3T9C A;  3QQM A;  5DGH A;  2COI A;  4TM5 A;  2X5R A;  5BYB A;  5HNE A;  4Q4C A;  2ODT X;  2EIY A;  3T9A A;  5CE8 A;  3DAA A;  2HHF B;  1ET0 A;  5BYA A;  4M0J A;  1IYD A;  3SGI A;  2ZGI A;  3T99 A;  3UZO A;  4K6N A;  3UYY A;  1KT8 A;  4CKB A;  3DTF A;  5I5W A;  4CKC A;  1I2K A;  4CMF A;  3WWH A;  5FR9 A;  4CHI A;  2EJ0 A;  3UZB A;  3T9D A;  4NZN A;  1I1M A;  5CM0 A;  2COG A;  3JZ6 A;  4WHX A;  4TVI A;  4DAA A;  3T54 A;  4NZO A;  1I2L A;  4IWY A;  4JXU A;  5BWX A;  5BWU A;  1I1L A;  5BWT A;  1IYE A;  2HGW A;  5I5V A;  2HHF A;  2ABJ A;  5BWV A;  5K3W A;  2DAB A;  5K2M A;  1UC8 A;  1KTA A;  5CR5 A;  3CSW A;  3PFF A;  5BWW A;  3CEB A;  3DTG A;  1A0G A;  4PBC A;  3WWI A;  1ZAU A;  4GLW A;  5DGI A;  2A1H A;  5I5T A;  4CMD A;  3LQS A;  5I5S A;  2EJ3 A;  1A3G A;  3T7A A;  1G2W A;  2DAA A;  3TEK A;  3U0G A;  2HG8 A;  3TW7 A;  5I5Y A;  2EJ2 A;  5I47 A;  1EKP A;  1DAA A;  2COJ A;  3VPD A;  4IWX A;  4RCN A;  1I1K A;  4HN2 A;  4DQN A;  5DAA A;  1EKF A;  5I5X A;  5E25 A;  3T9B A;  4Q4D A;  3BAC A;  4NZM A;  3T9F A;  3LUL A;  4UUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...