2Y4RA

Crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
270
structure length
270
Chain Sequence
LDWVDGRPAAELSVRDRGLAYGDGLFETLAVRAGTPRLLERHLARLEEGCRRLAIPLDTAALRQELLAFCAALGDGVAKLIVTRGEGLRGYAPPAEASPRRILSGSPRPAYPERHWQQGVRLFACRTRLAEQPLLAGLKHLNRLEQVLARAEWSDAGHAEGLMLDVHERVVEGVFSNLLLVLDGTLVAPDLRRCGVAGVMRAELLERAEGIGVPLAIRDVSMAELATADEVFLCNSQFGIWPVRALDEHVWPVGELTRKLQDQLRDDLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pseudomonas Aeruginosa 4-Amino-4-Deoxychorismate Lyase: Spatial Conservation of an Active Site Tyrosine and Classification of Two Types of Enzyme.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
molecule keywords 4-AMINO-4-DEOXYCHORISMATE LYASE
total genus 81
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 4.1.3.38: Aminodeoxychorismate lyase.
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2y4rA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2y4rA01
5I5SA 5CM0A 3CSWA 5I5UA 1I2LA 1IYDA 2COJA 4PBCA 5I60A 5BWXA 2DABA 5BWTA 1DAAA 3WWJA 2EJ0A 4JXUA 2DAAA 2EIYA 1I2KA 1EKFA 2HDKA 5BWWA 4K6NA 5BWRA 5I5VA 5K3WA 2HGXA 3LQSA 1A0GA 1KTAA 3CEBA 1IYEA 5I5WA 5I5TA 3DTGA 5DAAA 5HNEA 4TM5A 1A3GA 1ET0A 2EJ3A 4WHXA 4CMFA 1I1LA 3QQMA 3UYYA 2COIA 4M0JA 1G2WA 5E25A 3WWHA 5CR5A 3SNOA 4CE5A 2HHFA 4CHIA 1KT8A 3JZ6A 5FR9A 3WWIA 2A1HA 3DTFA 5I5YA 5CE8A 5BWUA 1EKVA 5I5XA 2COGA 3UZBA 1I1MA 5BWVA 3LULA 4TVIA 2ABJA 4CMDA 3U0GA 2HGWA 1I1KA 4UUGA 1WRVA 2EJ2A 4DAAA 2ZGIA 3DAAA 3HT5A 2HHFB 2HG8A 4DQNA 2Y4RA 3UZOA 1EKPA
chains in the Genus database with same CATH superfamily
5I5SA 5LYJF 3N8DA 3TQTA 1I7NA 3CSWA 1TAEA 4FE2A 5I5UA 2NUAB 3RTXA 1UC8A 1I2LA 2FB9A 2W6MA 4YJ3F 4ME6A 1XK5A 2R82A 1KJ8A 5JVDF 1XDNA 2R7NA 4UCOA 3WWJA 1IOWA 2DIKA 3NBZB 2Q2UA 1B04A 1B6SA 4JXUA 2NU6B 1X9NA 5DISC 4HNTA 3ORRA 1A0IA 1JDBB 3U9SA 4FFNA 3T54A 2HDKA 2J9GA 5BWRA 2IP4A 4C5CA 4CKCA 4DRFA 1EUCB 3CEBA 4MV1A 3RUPA 2R87A 3TINA 1IYEA 1UC9A 4IHJF 4O7ZA 1WR2A 3DTGA 3JSLA 3VPCA 3LWBA 1DIKA 1FVIA 3N6RA 4CMFA 3JRWA 1JDEA 2QB5A 4C5BA 3R5XA 4CC6A 4RZQA 2COIA 4UCUA 2YZNA 5CAEB 3S24A 4EFBA 4O4LF 3ETJA 4O7LA 3SNOA 4CE5A 3TIIA 1EYZA 1KT8A 3JZ6A 1VKZA 3GJXB 1KJIA 4YJ2F 2A1HA 5LA6F 4HNUA 1JLLB 3MWEA 5CE8A 5H80A 4RCNA 1EKVA 3UFXB 3W5OA 4MV3A 2FPGB 4DIMA 1M6VA 4C5AA 1KJQA 1I1MA 3R5HA 3TW7A 5LXTF 3HBLA 4O83A 3VNNA 3U0GA 2PN1A 5BYAA 3BAAA 4I4TF 3K5HA 2GPWA 4Q4DA 2CZGA 1GSHA 2R84A 3U54A 3TW6A 4MV9A 4CC5A 4ZI7F 2ZGIA 4IIJF 3DAAA 4LH6A 2HHFB 3QWUA 4FFPA 3UQ8A 5HV6A 1CE8A 4MA5A 1EKPA 4DLKA 5D1PA 5EZYF 2YZMA 2GPSA 4MAMA 2CFMA 1CKOA 4PZ7A 3SGIA 2YYAA 2HVQA 3T9AA 5KS8A 4EG0A 1DGSA 3R5FA 4UCRA 1V9PA 3V4ZA 2Z02A 5DGIA 4TV9F 2DAAA 1IOVA 1A48A 2EIYA 3VMMA 3R9RA 3Q2OA 4UCTA 2HGXA 1S68A 4M9UA 1GSOA 3T9BA 1A0GA 3R23A 2VQDA 5I5WA 4O4IF 5HNEA 1OBGA 1PX2A 2YZLA 3T99A 5LP6F 3TY5A 2Q7DA 3QQMA 4XYLB 2W6ZA 3WWHA 5JVLA 3T9DA 4UCVA 3BA8A 1BXRA 5CR5A 2HHFA 3DF7A 3NC0B 3T9CA 5DMXA 4O84A 3SE7A 5BWUA 2WYOA 2CNQA 1VS0A 4O4HF 2HVRA 3AX6A 1P8LA 4UFZA 3V4SA 4TVIA 2W6QA 2YS6A 3KAKA 3OUUA 2VR1A 3NUAA 5JQGF 1C30A 4ZHQF 1WRVA 3PFFA 4O7SA 3G8CA 1KEEA 3PN1A 4O7YA 3TY9A 3GB8B 4DAAA 1W93A 1KC7A 3TY8A 5HBRB 3MJFA 2OLSA 3HT5A 2NU8B 3VPDA 1P16A 5BMVF 2HG8A 5CA0F 5K2MA 4NYEA 1ET0A 5KKNB 2V5AA 4O2AF 2W71A 3GLKA 1IYDA 2COJA 4PBCA 3KAJA 1AUVA 2FPIB 2YW2A 4L1KA 3I12A 2XD4A 3Q1KA 2EJ0A 4GLWA 1PK8A 1A9XA 2Z04A 3QFFA 1EZ1A 4IWXA 2I87A 3KREA 4O81A 5CB4F 2P0AA 4I50F 3RR5A 4TV8F 1I2KA 1W96A 4IWYA 1EKFA 3ETHA 5BWWA 3ORQA 5K3WA 2PVPA 3BACA 1KTAA 4FGRA 2YRXA 5I5TA 3BA9A 1KJ9A 3E5NA 3T9EA 1M0TA 4TM5A 3GIDA 2HJWA 2FPPB 2W6OA 5JQWA 3U55A 4WHXA 1I1LA 2NU9B 1VBHA 3UYYA 2ZDGA 5FPOA 2R85A 1AUXA 2YL2A 2PBZA 3BG5A 2CNVA 2VUGA 4HR7A 4O7RA 1BNCA 2NU7B 2QK4A 5C1OA 4IZOA 5BPHA 2ODTX 2R7LA 2SCUB 4O86A 2I80A 4Y8VB 1SCUB 4Q4CA 3JZFA 1EHIA 5FPRA 5I5XA 2YS7A 4MA0A 4NZNA 2HVSA 5D1OB 2COGA 3K3PA 3UZBA 4E4TA 5I47A 3LULA 2ZDHA 3BABA 5BYBA 1Z2PX 2ZDQA 4TUYF 5C8YF 4CMDA 3JZIA 4ZOLF 3W1GA 1GLVA 1OBDA 4CKBA 3HO8A 1CKNA 5D8DA 2C00A 4EGQA 1CS0A 4I55F 2YZGA 5KX5F 4XYMB 1GGOA 2GQRA 2YRWA 2YWVA 2HIXA 2V59A 2VPQA 3JRXA 1CQJB 4MV7A 1KBLA 5D1OA 3OUZA 3KYHC 4DQNA 5IYZF 3RFCA 3HB9A 4O7NA 1E4EA 3W1BA 5CM0A 3NBYB 4PZ8A 4O7VA 3JSNA 2GQSA 2DZDA 4QSHA 4O7WA 1JKJB 5I60A 2R86A 5J2TF 3K5IA 3KALA 4PZ6A 4FFLA 1GSAA 2W6PA 1I7LA 2CNUA 4WBNF 5BWXA 2DABA 5BWTA 1DAAA 2HIVA 3G8DA 4O4JF 3WO0A 5J2UF 4NZOA 5DGHA 3WNZA 3T9FA 4GLXA 4FFRA 5LOVF 4FFOA 2Q2TA 4K6NA 4YAKB 5I5VA 4CKEA 3MWDA 3LQSA 4XZ3B 3LP8A 4UCSA 1CQIB 1ULZA 4HNVA 5DAAA 1CKNB 1A3GA 2XCLA 1KJJA 5CA1F 2EJ3A 1C3OA 4FFMA 2W70A 2HGSA 5BPFA 4M0JA 1G2WA 5E25A 4MV6A 2R7MA 4YB8B 4XX0B 4MV8A 1DV2A 4O2BF 4CHIA 5FR9A 2FP4B 3TEKA 1TA8A 2GLTA 3WWIA 2W6NA 3DTFA 5I5YA 1E4EB 4EQ5A 3VA7A 2I8CA 4O82A 3RV3A 1CKMA 3T7AA 4MV4A 4O7TA 3AW8A 3TIGA 1B6RA 2R7KA 1Z2NX 2DLNA 3VPBA 4YBZB 5BWVA 2ABJA 2DWCA 1EUDB 5JH7F 4EFEA 1M0WA 2HGWA 1Z2OX 5GONF 3GDEA 1I1KA 2OWOA 4HQ6A 4UUGA 2V58A 4E6NA 5C1PA 1VBGA 2QF7A 3L2PA 2EJ2A 4EEQA 2X5RA 4HN2A 3VOTA 4ZQIA 5FNVF 1T36A 3RV4A 4NZMA 1KUTA 2X0SA 3U9TA 4LH7A 3WO1A 1DV1A 4YAJB 2Y4RA 4EGJA 3UZOA 1ZAUA 4FU0A
chains in the Genus database with same CATH topology
5I5SA 5CM0A 3CSWA 5I5UA 1UC8A 1I2LA 1IYDA 2COJA 4PBCA 3SGIA 5I60A 3T9AA 5KS8A 5BWXA 2DABA 5BWTA 1DAAA 3WWJA 2EJ0A 4GLWA 4JXUA 5DGIA 4NZOA 2DAAA 5DGHA 4IWXA 3T9FA 2EIYA 1I2KA 4IWYA 1EKFA 3T54A 2HDKA 5BWWA 4K6NA 5BWRA 5I5VA 5K3WA 4CKEA 2HGXA 4CKCA 3LQSA 3BACA 3T9BA 1A0GA 1KTAA 3CEBA 1IYEA 1UC9A 5I5WA 5I5TA 3DTGA 3T9EA 5DAAA 5HNEA 4TM5A 1A3GA 1ET0A 2EJ3A 3T99A 4WHXA 4CMFA 2QB5A 2Q7DA 1I1LA 3QQMA 3UYYA 2COIA 4M0JA 1G2WA 5E25A 3WWHA 3T9DA 5CR5A 3SNOA 4CE5A 2HHFA 4CHIA 1KT8A 3JZ6A 5FR9A 3TEKA 3WWIA 2ODTX 2A1HA 3DTFA 5I5YA 3T9CA 4Q4CA 5CE8A 4RCNA 5BWUA 1EKVA 5I5XA 3T7AA 4NZNA 2COGA 3UZBA 1I1MA 5BWVA 3TW7A 5I47A 3LULA 4TVIA 2ABJA 5BYBA 4CMDA 3U0GA 2HGWA 1I1KA 5BYAA 4UUGA 1WRVA 3PFFA 4CKBA 4Q4DA 2EJ2A 2X5RA 4HN2A 4DAAA 2ZGIA 4NZMA 3DAAA 3HT5A 2HHFB 3VPDA 2HG8A 4DQNA 2Y4RA 3UZOA 5K2MA 1ZAUA 1EKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I5S A;  5CM0 A;  3CSW A;  5I5U A;  1I2L A;  1IYD A;  2COJ A;  4PBC A;  5I60 A;  5BWX A;  2DAB A;  5BWT A;  1DAA A;  3WWJ A;  2EJ0 A;  4JXU A;  2DAA A;  2EIY A;  1I2K A;  1EKF A;  2HDK A;  5BWW A;  4K6N A;  5BWR A;  5I5V A;  5K3W A;  2HGX A;  3LQS A;  1A0G A;  1KTA A;  3CEB A;  1IYE A;  5I5W A;  5I5T A;  3DTG A;  5DAA A;  5HNE A;  4TM5 A;  1A3G A;  1ET0 A;  2EJ3 A;  4WHX A;  4CMF A;  1I1L A;  3QQM A;  3UYY A;  2COI A;  4M0J A;  1G2W A;  5E25 A;  3WWH A;  5CR5 A;  3SNO A;  4CE5 A;  2HHF A;  4CHI A;  1KT8 A;  3JZ6 A;  5FR9 A;  3WWI A;  2A1H A;  3DTF A;  5I5Y A;  5CE8 A;  5BWU A;  1EKV A;  5I5X A;  2COG A;  3UZB A;  1I1M A;  5BWV A;  3LUL A;  4TVI A;  2ABJ A;  4CMD A;  3U0G A;  2HGW A;  1I1K A;  4UUG A;  1WRV A;  2EJ2 A;  4DAA A;  2ZGI A;  3DAA A;  3HT5 A;  2HHF B;  2HG8 A;  4DQN A;  2Y4R A;  3UZO A;  1EKP A; 
#chains in the Genus database with same CATH topology
 5I5S A;  5LYJ F;  3N8D A;  3TQT A;  1I7N A;  3CSW A;  1TAE A;  4FE2 A;  5I5U A;  2NUA B;  3RTX A;  1UC8 A;  1I2L A;  2FB9 A;  2W6M A;  4YJ3 F;  4ME6 A;  1XK5 A;  2R82 A;  1KJ8 A;  5JVD F;  1XDN A;  2R7N A;  4UCO A;  3WWJ A;  1IOW A;  2DIK A;  3NBZ B;  2Q2U A;  1B04 A;  1B6S A;  4JXU A;  2NU6 B;  1X9N A;  5DIS C;  4HNT A;  3ORR A;  1A0I A;  1JDB B;  3U9S A;  4FFN A;  3T54 A;  2HDK A;  2J9G A;  5BWR A;  2IP4 A;  4C5C A;  4CKC A;  4DRF A;  1EUC B;  3CEB A;  4MV1 A;  3RUP A;  2R87 A;  3TIN A;  1IYE A;  1UC9 A;  4IHJ F;  4O7Z A;  1WR2 A;  3DTG A;  3JSL A;  3VPC A;  3LWB A;  1DIK A;  1FVI A;  3N6R A;  4CMF A;  3JRW A;  1JDE A;  2QB5 A;  4C5B A;  3R5X A;  4CC6 A;  4RZQ A;  2COI A;  4UCU A;  2YZN A;  5CAE B;  3S24 A;  4EFB A;  4O4L F;  3ETJ A;  4O7L A;  3SNO A;  4CE5 A;  3TII A;  1EYZ A;  1KT8 A;  3JZ6 A;  1VKZ A;  3GJX B;  1KJI A;  4YJ2 F;  2A1H A;  5LA6 F;  4HNU A;  1JLL B;  3MWE A;  5CE8 A;  5H80 A;  4RCN A;  1EKV A;  3UFX B;  3W5O A;  4MV3 A;  2FPG B;  4DIM A;  1M6V A;  4C5A A;  1KJQ A;  1I1M A;  3R5H A;  3TW7 A;  5LXT F;  3HBL A;  4O83 A;  3VNN A;  3U0G A;  2PN1 A;  5BYA A;  3BAA A;  4I4T F;  3K5H A;  2GPW A;  4Q4D A;  2CZG A;  1GSH A;  2R84 A;  3U54 A;  3TW6 A;  4MV9 A;  4CC5 A;  4ZI7 F;  2ZGI A;  4IIJ F;  3DAA A;  4LH6 A;  2HHF B;  3QWU A;  4FFP A;  3UQ8 A;  5HV6 A;  1CE8 A;  4MA5 A;  1EKP A;  4DLK A;  5D1P A;  5EZY F;  2YZM A;  2GPS A;  4MAM A;  2CFM A;  1CKO A;  4PZ7 A;  3SGI A;  2YYA A;  2HVQ A;  3T9A A;  5KS8 A;  4EG0 A;  1DGS A;  3R5F A;  4UCR A;  1V9P A;  3V4Z A;  2Z02 A;  5DGI A;  4TV9 F;  2DAA A;  1IOV A;  1A48 A;  2EIY A;  3VMM A;  3R9R A;  3Q2O A;  4UCT A;  2HGX A;  1S68 A;  4M9U A;  1GSO A;  3T9B A;  1A0G A;  3R23 A;  2VQD A;  5I5W A;  4O4I F;  5HNE A;  1OBG A;  1PX2 A;  2YZL A;  3T99 A;  5LP6 F;  3TY5 A;  2Q7D A;  3QQM A;  4XYL B;  2W6Z A;  3WWH A;  5JVL A;  3T9D A;  4UCV A;  3BA8 A;  1BXR A;  5CR5 A;  2HHF A;  3DF7 A;  3NC0 B;  3T9C A;  5DMX A;  4O84 A;  3SE7 A;  5BWU A;  2WYO A;  2CNQ A;  1VS0 A;  4O4H F;  2HVR A;  3AX6 A;  1P8L A;  4UFZ A;  3V4S A;  4TVI A;  2W6Q A;  2YS6 A;  3KAK A;  3OUU A;  2VR1 A;  3NUA A;  5JQG F;  1C30 A;  4ZHQ F;  1WRV A;  3PFF A;  4O7S A;  3G8C A;  1KEE A;  3PN1 A;  4O7Y A;  3TY9 A;  3GB8 B;  4DAA A;  1W93 A;  1KC7 A;  3TY8 A;  5HBR B;  3MJF A;  2OLS A;  3HT5 A;  2NU8 B;  3VPD A;  1P16 A;  5BMV F;  2HG8 A;  5CA0 F;  5K2M A;  4NYE A;  1ET0 A;  5KKN B;  2V5A A;  4O2A F;  2W71 A;  3GLK A;  1IYD A;  2COJ A;  4PBC A;  3KAJ A;  1AUV A;  2FPI B;  2YW2 A;  4L1K A;  3I12 A;  2XD4 A;  3Q1K A;  2EJ0 A;  4GLW A;  1PK8 A;  1A9X A;  2Z04 A;  3QFF A;  1EZ1 A;  4IWX A;  2I87 A;  3KRE A;  4O81 A;  5CB4 F;  2P0A A;  4I50 F;  3RR5 A;  4TV8 F;  1I2K A;  1W96 A;  4IWY A;  1EKF A;  3ETH A;  5BWW A;  3ORQ A;  5K3W A;  2PVP A;  3BAC A;  1KTA A;  4FGR A;  2YRX A;  5I5T A;  3BA9 A;  1KJ9 A;  3E5N A;  3T9E A;  1M0T A;  4TM5 A;  3GID A;  2HJW A;  2FPP B;  2W6O A;  5JQW A;  3U55 A;  4WHX A;  1I1L A;  2NU9 B;  1VBH A;  3UYY A;  2ZDG A;  5FPO A;  2R85 A;  1AUX A;  2YL2 A;  2PBZ A;  3BG5 A;  2CNV A;  2VUG A;  4HR7 A;  4O7R A;  1BNC A;  2NU7 B;  2QK4 A;  5C1O A;  4IZO A;  5BPH A;  2ODT X;  2R7L A;  2SCU B;  4O86 A;  2I80 A;  4Y8V B;  1SCU B;  4Q4C A;  3JZF A;  1EHI A;  5FPR A;  5I5X A;  2YS7 A;  4MA0 A;  4NZN A;  2HVS A;  5D1O B;  2COG A;  3K3P A;  3UZB A;  4E4T A;  5I47 A;  3LUL A;  2ZDH A;  3BAB A;  5BYB A;  1Z2P X;  2ZDQ A;  4TUY F;  5C8Y F;  4CMD A;  3JZI A;  4ZOL F;  3W1G A;  1GLV A;  1OBD A;  4CKB A;  3HO8 A;  1CKN A;  5D8D A;  2C00 A;  4EGQ A;  1CS0 A;  4I55 F;  2YZG A;  5KX5 F;  4XYM B;  1GGO A;  2GQR A;  2YRW A;  2YWV A;  2HIX A;  2V59 A;  2VPQ A;  3JRX A;  1CQJ B;  4MV7 A;  1KBL A;  5D1O A;  3OUZ A;  3KYH C;  4DQN A;  5IYZ F;  3RFC A;  3HB9 A;  4O7N A;  1E4E A;  3W1B A;  5CM0 A;  3NBY B;  4PZ8 A;  4O7V A;  3JSN A;  2GQS A;  2DZD A;  4QSH A;  4O7W A;  1JKJ B;  5I60 A;  2R86 A;  5J2T F;  3K5I A;  3KAL A;  4PZ6 A;  4FFL A;  1GSA A;  2W6P A;  1I7L A;  2CNU A;  4WBN F;  5BWX A;  2DAB A;  5BWT A;  1DAA A;  2HIV A;  3G8D A;  4O4J F;  3WO0 A;  5J2U F;  4NZO A;  5DGH A;  3WNZ A;  3T9F A;  4GLX A;  4FFR A;  5LOV F;  4FFO A;  2Q2T A;  4K6N A;  4YAK B;  5I5V A;  4CKE A;  3MWD A;  3LQS A;  4XZ3 B;  3LP8 A;  4UCS A;  1CQI B;  1ULZ A;  4HNV A;  5DAA A;  1CKN B;  1A3G A;  2XCL A;  1KJJ A;  5CA1 F;  2EJ3 A;  1C3O A;  4FFM A;  2W70 A;  2HGS A;  5BPF A;  4M0J A;  1G2W A;  5E25 A;  4MV6 A;  2R7M A;  4YB8 B;  4XX0 B;  4MV8 A;  1DV2 A;  4O2B F;  4CHI A;  5FR9 A;  2FP4 B;  3TEK A;  1TA8 A;  2GLT A;  3WWI A;  2W6N A;  3DTF A;  5I5Y A;  1E4E B;  4EQ5 A;  3VA7 A;  2I8C A;  4O82 A;  3RV3 A;  1CKM A;  3T7A A;  4MV4 A;  4O7T A;  3AW8 A;  3TIG A;  1B6R A;  2R7K A;  1Z2N X;  2DLN A;  3VPB A;  4YBZ B;  5BWV A;  2ABJ A;  2DWC A;  1EUD B;  5JH7 F;  4EFE A;  1M0W A;  2HGW A;  1Z2O X;  5GON F;  3GDE A;  1I1K A;  2OWO A;  4HQ6 A;  4UUG A;  2V58 A;  4E6N A;  5C1P A;  1VBG A;  2QF7 A;  3L2P A;  2EJ2 A;  4EEQ A;  2X5R A;  4HN2 A;  3VOT A;  4ZQI A;  5FNV F;  1T36 A;  3RV4 A;  4NZM A;  1KUT A;  2X0S A;  3U9T A;  4LH7 A;  3WO1 A;  1DV1 A;  4YAJ B;  2Y4R A;  4EGJ A;  3UZO A;  1ZAU A;  4FU0 A; 
#chains in the Genus database with same CATH homology
 5I5S A;  5CM0 A;  3CSW A;  5I5U A;  1UC8 A;  1I2L A;  1IYD A;  2COJ A;  4PBC A;  3SGI A;  5I60 A;  3T9A A;  5KS8 A;  5BWX A;  2DAB A;  5BWT A;  1DAA A;  3WWJ A;  2EJ0 A;  4GLW A;  4JXU A;  5DGI A;  4NZO A;  2DAA A;  5DGH A;  4IWX A;  3T9F A;  2EIY A;  1I2K A;  4IWY A;  1EKF A;  3T54 A;  2HDK A;  5BWW A;  4K6N A;  5BWR A;  5I5V A;  5K3W A;  4CKE A;  2HGX A;  4CKC A;  3LQS A;  3BAC A;  3T9B A;  1A0G A;  1KTA A;  3CEB A;  1IYE A;  1UC9 A;  5I5W A;  5I5T A;  3DTG A;  3T9E A;  5DAA A;  5HNE A;  4TM5 A;  1A3G A;  1ET0 A;  2EJ3 A;  3T99 A;  4WHX A;  4CMF A;  2QB5 A;  2Q7D A;  1I1L A;  3QQM A;  3UYY A;  2COI A;  4M0J A;  1G2W A;  5E25 A;  3WWH A;  3T9D A;  5CR5 A;  3SNO A;  4CE5 A;  2HHF A;  4CHI A;  1KT8 A;  3JZ6 A;  5FR9 A;  3TEK A;  3WWI A;  2ODT X;  2A1H A;  3DTF A;  5I5Y A;  3T9C A;  4Q4C A;  5CE8 A;  4RCN A;  5BWU A;  1EKV A;  5I5X A;  3T7A A;  4NZN A;  2COG A;  3UZB A;  1I1M A;  5BWV A;  3TW7 A;  5I47 A;  3LUL A;  4TVI A;  2ABJ A;  5BYB A;  4CMD A;  3U0G A;  2HGW A;  1I1K A;  5BYA A;  4UUG A;  1WRV A;  3PFF A;  4CKB A;  4Q4D A;  2EJ2 A;  2X5R A;  4HN2 A;  4DAA A;  2ZGI A;  4NZM A;  3DAA A;  3HT5 A;  2HHF B;  3VPD A;  2HG8 A;  4DQN A;  2Y4R A;  3UZO A;  5K2M A;  1ZAU A;  1EKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...