2Y4RA

Crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
270
structure length
270
Chain Sequence
LDWVDGRPAAELSVRDRGLAYGDGLFETLAVRAGTPRLLERHLARLEEGCRRLAIPLDTAALRQELLAFCAALGDGVAKLIVTRGEGLRGYAPPAEASPRRILSGSPRPAYPERHWQQGVRLFACRTRLAEQPLLAGLKHLNRLEQVLARAEWSDAGHAEGLMLDVHERVVEGVFSNLLLVLDGTLVAPDLRRCGVAGVMRAELLERAEGIGVPLAIRDVSMAELATADEVFLCNSQFGIWPVRALDEHVWPVGELTRKLQDQLRDDLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pseudomonas Aeruginosa 4-Amino-4-Deoxychorismate Lyase: Spatial Conservation of an Active Site Tyrosine and Classification of Two Types of Enzyme.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
molecule keywords 4-AMINO-4-DEOXYCHORISMATE LYASE
total genus 81
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 4.1.3.38: Aminodeoxychorismate lyase.
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2y4rA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2y4rA01
2HHFB 4K6NA 4CMFA 2DABA 2HG8A 3JZ6A 3UZOA 5I5XA 3HT5A 1I1KA 5BWXA 2COIA 4DAAA 3LQSA 5BWUA 5BWTA 5BWVA 2ABJA 5E25A 1G2WA 2EJ3A 3U0GA 3DTFA 1A3GA 2COJA 1A0GA 3UYYA 5I5TA 1IYDA 2DAAA 4DQNA 1I1MA 2COGA 3WWHA 5CR5A 5BWWA 1KTAA 1EKFA 3DAAA 2HGWA 2Y4RA 1IYEA 3LULA 4M0JA 5DAAA 3UZBA 5I5WA 3SNOA 5I60A 4JXUA 2HHFA 5I5VA 4PBCA 3CSWA 4TM5A 5I5UA 1WRVA 2HDKA 2A1HA 3QQMA 5BWRA 1DAAA 1I2KA 4CE5A 5I5YA 2ZGIA 1ET0A 5HNEA 5I5SA 1KT8A 4CMDA 3CEBA 4TVIA 4UUGA 4WHXA 2EIYA 3WWJA 1EKPA 5FR9A 5CE8A 2EJ0A 5K3WA 3WWIA 1I2LA 3DTGA 1EKVA 4CHIA 2EJ2A 2HGXA 5CM0A 1I1LA
chains in the Genus database with same CATH superfamily
4K6NA 4FE2A 4MAMA 3RFCA 2XCLA 3UZOA 1KJ9A 3U55A 5I5XA 5KX5F 3T9BA 1GLVA 3TY9A 1I1KA 3Q1KA 5J2UF 5BWXA 3HO8A 1JDBB 3VPDA 4YB8B 4HR7A 5BYAA 4UFZA 3LQSA 5BWVA 3MWDA 1TAEA 1VS0A 2HVQA 3V4ZA 1A48A 1EYZA 3T9CA 3I12A 3W1GA 5E25A 1GSAA 1G2WA 3HBLA 1BNCA 5D1PA 2VPQA 3DTFA 3S24A 3KREA 1C30A 2VQDA 1EUCB 3T9EA 2V5AA 3R5HA 4DQNA 5CR5A 4FFOA 5JH7F 5K2MA 2YWVA 2ODTX 3DAAA 3OUUA 3WO0A 2Z04A 4O7RA 1KJJA 1IYEA 2P0AA 4M0JA 1KBLA 4UCTA 5BMVF 5D1OB 4C5BA 5I5WA 3TEKA 2FPGB 5J2TF 4O86A 3T9AA 5I60A 4JXUA 4PZ6A 2GLTA 2YW2A 3K3PA 4TM5A 5I5UA 1UC9A 5CAEB 2IP4A 5I47A 4DIMA 2A1HA 3NBYB 1KJIA 1PK8A 1I2KA 3OUZA 4EFEA 1JLLB 3RR5A 4MV7A 4Q4DA 1AUVA 4RCNA 5GONF 3CEBA 2HJWA 2YRXA 4MV9A 2EIYA 3WWJA 2PVPA 1EKPA 3K5IA 4ZOLF 5K3WA 4UCOA 3UQ8A 5DMXA 4FFLA 2R7KA 1EKVA 2EJ2A 3E5NA 1XK5A 4PZ7A 3QWUA 4XYMB 1FVIA 2I80A 1I1LA 4XYLB 3NC0B 1GSHA 2NU9B 4HNVA 4CMFA 3N8DA 2GPWA 3PN1A 3TY8A 3RTXA 4EGQA 5LXTF 4O2AF 4IZOA 3MJFA 2X5RA 2YYAA 2FB9A 4MV3A 1DV2A 3G8DA 4YJ2F 2EJ3A 4O4IF 4DRFA 1E4EB 2R84A 2COJA 4ZHQF 4MV8A 1A0GA 5JVLA 2Q2TA 4HNUA 1M0TA 5IYZF 4O7NA 3K5HA 1JKJB 2YS6A 3AX6A 2DLNA 3VPBA 4MV4A 3W5OA 5HV6A 2DWCA 1I1MA 2QF7A 3T7AA 2CNVA 2W6ZA 4O7TA 3WWHA 4NZNA 2ZDGA 4O81A 4ZI7F 4CC5A 3ORRA 4PZ8A 5BWWA 4WBNF 4GLXA 4IHJF 5D1OA 5CA0F 5KS8A 1ULZA 2Y4RA 4MV6A 4TV9F 4FGRA 4XX0B 4NZOA 3VMMA 4IWYA 3UZBA 1IOVA 1VBGA 2YS7A 4LH6A 4O7SA 4M9UA 1CQIB 1OBGA 4TUYF 4IIJF 4O4HF 4O82A 1I7LA 2FP4B 3GIDA 5JQGF 1BXRA 4PBCA 2CFMA 1CKNA 5BPHA 5C8YF 1VBHA 4O84A 2V59A 3BABA 3G8CA 1OBDA 3T54A 3QQMA 4UCVA 1UC8A 3R23A 4CKCA 1KJ8A 5JVDF 5C1OA 3VPCA 5JQWA 3BACA 2ZGIA 3TIGA 4YAKB 2YZNA 5HNEA 1CQJB 2GQSA 3L2PA 4O7YA 2I8CA 4TVIA 4EFBA 1B6SA 2R82A 2Q7DA 3V4SA 3PFFA 2W6OA 2W6NA 3U9SA 2I87A 4O4LF 5CE8A 1XDNA 2GQRA 3DTGA 3RV3A 1TA8A 3TIIA 4FFMA 4Q4CA 4MA0A 2HHFB 4YJ3F 2HVRA 2W71A 3TQTA 4EGJA 2CNUA 4EEQA 1DIKA 2DIKA 4FFPA 2HG8A 3JSLA 1M0WA 4C5CA 2HVSA 3Q2OA 3ORQA 3VOTA 1Z2PX 3HT5A 3GLKA 1PX2A 2J9GA 4XZ3B 3KALA 4YAJB 4DAAA 1M6VA 5BWUA 3UFXB 2YRWA 2YZMA 3SGIA 1CKMA 3WO1A 5LA6F 1B6RA 3BA8A 5FNVF 5FPRA 1EZ1A 3QFFA 2W70A 3T99A 1A3GA 3SE7A 4HN2A 5CA1F 4E6NA 2HIXA 4GLWA 2R7MA 3W1BA 1IYDA 3KAJA 3HB9A 4IWXA 2ZDHA 1EHIA 2NU7B 1I7NA 1S68A 1KC7A 5DGHA 2CNQA 1KJQA 1CE8A 1DV1A 1CS0A 2HGWA 2HIVA 4YBZB 5CB4F 4HQ6A 2OLSA 5DAAA 3BAAA 2DZDA 3JSNA 4E4TA 2YL2A 3ETHA 5DGIA 2HHFA 3T9DA 2R7LA 4MV1A 4FFNA 5C1PA 3GDEA 2HDKA 2CZGA 1ZAUA 1B04A 1EUDB 4CE5A 2GPSA 5I5YA 4FU0A 3U9TA 1ET0A 4O7WA 3WNZA 2Z02A 5LYJF 2NU6B 5I5SA 1KT8A 3R9RA 4CMDA 3TY5A 3U54A 2X0SA 4UUGA 4O7ZA 4O83A 4ME6A 2QK4A 4DLKA 4L1KA 4I4TF 2YZLA 5HBRB 2NU8B 2C00A 1I2LA 3JRWA 5LP6F 1C3OA 4EQ5A 2HGXA 3VA7A 1Z2OX 1T36A 4LH7A 4C5AA 3LWBA 4CC6A 2DABA 3JZ6A 4UCRA 2QB5A 3JRXA 2WYOA 3NUAA 4CKEA 4FFRA 2COIA 4RZQA 5BWTA 1KEEA 3LP8A 3NBZB 4ZQIA 2ABJA 4MA5A 3VNNA 4UCSA 5BPFA 1DGSA 1CKNB 4NZMA 3U0GA 2VR1A 2W6QA 2R86A 3KYHC 4O7LA 3T9FA 1CKOA 3MWEA 3TW7A 3TW6A 5FPOA 1GGOA 3AW8A 3UYYA 2ZDQA 3GJXB 5BYBA 1A0IA 2FPPB 5I5TA 2DAAA 3GB8B 1AUXA 2COGA 1V9PA 5LOVF 4O2BF 3TINA 1P16A 2PN1A 1KTAA 2W6MA 3DF7A 1A9XA 1EKFA 1W93A 2YZGA 3N6RA 2OWOA 5KKNB 3R5XA 1W96A 4TV8F 3LULA 2W6PA 4UCUA 3ETJA 2HGSA 2PBZA 2R85A 5DISC 3SNOA 2XD4A 1SCUB 4O4JF 2SCUB 4EG0A 3R5FA 4NYEA 1E4EA 5I5VA 3CSWA 2Q2UA 1P8LA 3RV4A 1VKZA 2FPIB 1WRVA 3RUPA 5BWRA 3BG5A 1DAAA 2R87A 4I50F 2VUGA 3JZFA 1X9NA 1WR2A 4QSHA 5D8DA 3BA9A 4O7VA 4Y8VB 1IOWA 2NUAB 1GSOA 1KUTA 4WHXA 2R7NA 4I55F 5EZYF 3KAKA 4CKBA 5FR9A 3JZIA 2EJ0A 3WWIA 4HNTA 5H80A 1Z2NX 4CHIA 1JDEA 5CM0A 2V58A
chains in the Genus database with same CATH topology
2HHFB 4K6NA 4CMFA 2DABA 2HG8A 3JZ6A 3UZOA 2QB5A 5I5XA 4CKEA 3T9BA 3HT5A 1I1KA 5BWXA 3VPDA 5BYAA 2COIA 4DAAA 3LQSA 5BWUA 5BWTA 2X5RA 5BWVA 2ABJA 3SGIA 3T9CA 4NZMA 5E25A 1G2WA 2EJ3A 3U0GA 3DTFA 3T99A 1A3GA 2COJA 4HN2A 3T9FA 3TW7A 1A0GA 3UYYA 4GLWA 5BYBA 3T9EA 5I5TA 1IYDA 2DAAA 4DQNA 4IWXA 1I1MA 2COGA 3T7AA 3WWHA 4NZNA 5DGHA 5CR5A 5BWWA 5K2MA 2ODTX 1KTAA 1EKFA 3DAAA 5KS8A 2HGWA 2Y4RA 4NZOA 1IYEA 3LULA 4M0JA 4IWYA 5DAAA 3UZBA 5I5WA 3TEKA 3SNOA 3T9AA 5I60A 4JXUA 5DGIA 2HHFA 5I5VA 4PBCA 3CSWA 4TM5A 5I5UA 1UC9A 3T9DA 1WRVA 5I47A 2HDKA 3T54A 1ZAUA 2A1HA 3QQMA 5BWRA 1UC8A 4CKCA 1DAAA 1I2KA 4CE5A 5I5YA 3BACA 2ZGIA 1ET0A 5HNEA 4Q4DA 5I5SA 1KT8A 4RCNA 4CMDA 3CEBA 4TVIA 4UUGA 4WHXA 2Q7DA 2EIYA 3WWJA 3PFFA 1EKPA 4CKBA 5FR9A 5CE8A 2EJ0A 5K3WA 3WWIA 1I2LA 3DTGA 1EKVA 4CHIA 2EJ2A 2HGXA 5CM0A 4Q4CA 1I1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHF B;  4K6N A;  4CMF A;  2DAB A;  2HG8 A;  3JZ6 A;  3UZO A;  5I5X A;  3HT5 A;  1I1K A;  5BWX A;  2COI A;  4DAA A;  3LQS A;  5BWU A;  5BWT A;  5BWV A;  2ABJ A;  5E25 A;  1G2W A;  2EJ3 A;  3U0G A;  3DTF A;  1A3G A;  2COJ A;  1A0G A;  3UYY A;  5I5T A;  1IYD A;  2DAA A;  4DQN A;  1I1M A;  2COG A;  3WWH A;  5CR5 A;  5BWW A;  1KTA A;  1EKF A;  3DAA A;  2HGW A;  2Y4R A;  1IYE A;  3LUL A;  4M0J A;  5DAA A;  3UZB A;  5I5W A;  3SNO A;  5I60 A;  4JXU A;  2HHF A;  5I5V A;  4PBC A;  3CSW A;  4TM5 A;  5I5U A;  1WRV A;  2HDK A;  2A1H A;  3QQM A;  5BWR A;  1DAA A;  1I2K A;  4CE5 A;  5I5Y A;  2ZGI A;  1ET0 A;  5HNE A;  5I5S A;  1KT8 A;  4CMD A;  3CEB A;  4TVI A;  4UUG A;  4WHX A;  2EIY A;  3WWJ A;  1EKP A;  5FR9 A;  5CE8 A;  2EJ0 A;  5K3W A;  3WWI A;  1I2L A;  3DTG A;  1EKV A;  4CHI A;  2EJ2 A;  2HGX A;  5CM0 A;  1I1L A; 
#chains in the Genus database with same CATH topology
 4K6N A;  4FE2 A;  4MAM A;  3RFC A;  2XCL A;  3UZO A;  1KJ9 A;  3U55 A;  5I5X A;  5KX5 F;  3T9B A;  1GLV A;  3TY9 A;  1I1K A;  3Q1K A;  5J2U F;  5BWX A;  3HO8 A;  1JDB B;  3VPD A;  4YB8 B;  4HR7 A;  5BYA A;  4UFZ A;  3LQS A;  5BWV A;  3MWD A;  1TAE A;  1VS0 A;  2HVQ A;  3V4Z A;  1A48 A;  1EYZ A;  3T9C A;  3I12 A;  3W1G A;  5E25 A;  1GSA A;  1G2W A;  3HBL A;  1BNC A;  5D1P A;  2VPQ A;  3DTF A;  3S24 A;  3KRE A;  1C30 A;  2VQD A;  1EUC B;  3T9E A;  2V5A A;  3R5H A;  4DQN A;  5CR5 A;  4FFO A;  5JH7 F;  5K2M A;  2YWV A;  2ODT X;  3DAA A;  3OUU A;  3WO0 A;  2Z04 A;  4O7R A;  1KJJ A;  1IYE A;  2P0A A;  4M0J A;  1KBL A;  4UCT A;  5BMV F;  5D1O B;  4C5B A;  5I5W A;  3TEK A;  2FPG B;  5J2T F;  4O86 A;  3T9A A;  5I60 A;  4JXU A;  4PZ6 A;  2GLT A;  2YW2 A;  3K3P A;  4TM5 A;  5I5U A;  1UC9 A;  5CAE B;  2IP4 A;  5I47 A;  4DIM A;  2A1H A;  3NBY B;  1KJI A;  1PK8 A;  1I2K A;  3OUZ A;  4EFE A;  1JLL B;  3RR5 A;  4MV7 A;  4Q4D A;  1AUV A;  4RCN A;  5GON F;  3CEB A;  2HJW A;  2YRX A;  4MV9 A;  2EIY A;  3WWJ A;  2PVP A;  1EKP A;  3K5I A;  4ZOL F;  5K3W A;  4UCO A;  3UQ8 A;  5DMX A;  4FFL A;  2R7K A;  1EKV A;  2EJ2 A;  3E5N A;  1XK5 A;  4PZ7 A;  3QWU A;  4XYM B;  1FVI A;  2I80 A;  1I1L A;  4XYL B;  3NC0 B;  1GSH A;  2NU9 B;  4HNV A;  4CMF A;  3N8D A;  2GPW A;  3PN1 A;  3TY8 A;  3RTX A;  4EGQ A;  5LXT F;  4O2A F;  4IZO A;  3MJF A;  2X5R A;  2YYA A;  2FB9 A;  4MV3 A;  1DV2 A;  3G8D A;  4YJ2 F;  2EJ3 A;  4O4I F;  4DRF A;  1E4E B;  2R84 A;  2COJ A;  4ZHQ F;  4MV8 A;  1A0G A;  5JVL A;  2Q2T A;  4HNU A;  1M0T A;  5IYZ F;  4O7N A;  3K5H A;  1JKJ B;  2YS6 A;  3AX6 A;  2DLN A;  3VPB A;  4MV4 A;  3W5O A;  5HV6 A;  2DWC A;  1I1M A;  2QF7 A;  3T7A A;  2CNV A;  2W6Z A;  4O7T A;  3WWH A;  4NZN A;  2ZDG A;  4O81 A;  4ZI7 F;  4CC5 A;  3ORR A;  4PZ8 A;  5BWW A;  4WBN F;  4GLX A;  4IHJ F;  5D1O A;  5CA0 F;  5KS8 A;  1ULZ A;  2Y4R A;  4MV6 A;  4TV9 F;  4FGR A;  4XX0 B;  4NZO A;  3VMM A;  4IWY A;  3UZB A;  1IOV A;  1VBG A;  2YS7 A;  4LH6 A;  4O7S A;  4M9U A;  1CQI B;  1OBG A;  4TUY F;  4IIJ F;  4O4H F;  4O82 A;  1I7L A;  2FP4 B;  3GID A;  5JQG F;  1BXR A;  4PBC A;  2CFM A;  1CKN A;  5BPH A;  5C8Y F;  1VBH A;  4O84 A;  2V59 A;  3BAB A;  3G8C A;  1OBD A;  3T54 A;  3QQM A;  4UCV A;  1UC8 A;  3R23 A;  4CKC A;  1KJ8 A;  5JVD F;  5C1O A;  3VPC A;  5JQW A;  3BAC A;  2ZGI A;  3TIG A;  4YAK B;  2YZN A;  5HNE A;  1CQJ B;  2GQS A;  3L2P A;  4O7Y A;  2I8C A;  4TVI A;  4EFB A;  1B6S A;  2R82 A;  2Q7D A;  3V4S A;  3PFF A;  2W6O A;  2W6N A;  3U9S A;  2I87 A;  4O4L F;  5CE8 A;  1XDN A;  2GQR A;  3DTG A;  3RV3 A;  1TA8 A;  3TII A;  4FFM A;  4Q4C A;  4MA0 A;  2HHF B;  4YJ3 F;  2HVR A;  2W71 A;  3TQT A;  4EGJ A;  2CNU A;  4EEQ A;  1DIK A;  2DIK A;  4FFP A;  2HG8 A;  3JSL A;  1M0W A;  4C5C A;  2HVS A;  3Q2O A;  3ORQ A;  3VOT A;  1Z2P X;  3HT5 A;  3GLK A;  1PX2 A;  2J9G A;  4XZ3 B;  3KAL A;  4YAJ B;  4DAA A;  1M6V A;  5BWU A;  3UFX B;  2YRW A;  2YZM A;  3SGI A;  1CKM A;  3WO1 A;  5LA6 F;  1B6R A;  3BA8 A;  5FNV F;  5FPR A;  1EZ1 A;  3QFF A;  2W70 A;  3T99 A;  1A3G A;  3SE7 A;  4HN2 A;  5CA1 F;  4E6N A;  2HIX A;  4GLW A;  2R7M A;  3W1B A;  1IYD A;  3KAJ A;  3HB9 A;  4IWX A;  2ZDH A;  1EHI A;  2NU7 B;  1I7N A;  1S68 A;  1KC7 A;  5DGH A;  2CNQ A;  1KJQ A;  1CE8 A;  1DV1 A;  1CS0 A;  2HGW A;  2HIV A;  4YBZ B;  5CB4 F;  4HQ6 A;  2OLS A;  5DAA A;  3BAA A;  2DZD A;  3JSN A;  4E4T A;  2YL2 A;  3ETH A;  5DGI A;  2HHF A;  3T9D A;  2R7L A;  4MV1 A;  4FFN A;  5C1P A;  3GDE A;  2HDK A;  2CZG A;  1ZAU A;  1B04 A;  1EUD B;  4CE5 A;  2GPS A;  5I5Y A;  4FU0 A;  3U9T A;  1ET0 A;  4O7W A;  3WNZ A;  2Z02 A;  5LYJ F;  2NU6 B;  5I5S A;  1KT8 A;  3R9R A;  4CMD A;  3TY5 A;  3U54 A;  2X0S A;  4UUG A;  4O7Z A;  4O83 A;  4ME6 A;  2QK4 A;  4DLK A;  4L1K A;  4I4T F;  2YZL A;  5HBR B;  2NU8 B;  2C00 A;  1I2L A;  3JRW A;  5LP6 F;  1C3O A;  4EQ5 A;  2HGX A;  3VA7 A;  1Z2O X;  1T36 A;  4LH7 A;  4C5A A;  3LWB A;  4CC6 A;  2DAB A;  3JZ6 A;  4UCR A;  2QB5 A;  3JRX A;  2WYO A;  3NUA A;  4CKE A;  4FFR A;  2COI A;  4RZQ A;  5BWT A;  1KEE A;  3LP8 A;  3NBZ B;  4ZQI A;  2ABJ A;  4MA5 A;  3VNN A;  4UCS A;  5BPF A;  1DGS A;  1CKN B;  4NZM A;  3U0G A;  2VR1 A;  2W6Q A;  2R86 A;  3KYH C;  4O7L A;  3T9F A;  1CKO A;  3MWE A;  3TW7 A;  3TW6 A;  5FPO A;  1GGO A;  3AW8 A;  3UYY A;  2ZDQ A;  3GJX B;  5BYB A;  1A0I A;  2FPP B;  5I5T A;  2DAA A;  3GB8 B;  1AUX A;  2COG A;  1V9P A;  5LOV F;  4O2B F;  3TIN A;  1P16 A;  2PN1 A;  1KTA A;  2W6M A;  3DF7 A;  1A9X A;  1EKF A;  1W93 A;  2YZG A;  3N6R A;  2OWO A;  5KKN B;  3R5X A;  1W96 A;  4TV8 F;  3LUL A;  2W6P A;  4UCU A;  3ETJ A;  2HGS A;  2PBZ A;  2R85 A;  5DIS C;  3SNO A;  2XD4 A;  1SCU B;  4O4J F;  2SCU B;  4EG0 A;  3R5F A;  4NYE A;  1E4E A;  5I5V A;  3CSW A;  2Q2U A;  1P8L A;  3RV4 A;  1VKZ A;  2FPI B;  1WRV A;  3RUP A;  5BWR A;  3BG5 A;  1DAA A;  2R87 A;  4I50 F;  2VUG A;  3JZF A;  1X9N A;  1WR2 A;  4QSH A;  5D8D A;  3BA9 A;  4O7V A;  4Y8V B;  1IOW A;  2NUA B;  1GSO A;  1KUT A;  4WHX A;  2R7N A;  4I55 F;  5EZY F;  3KAK A;  4CKB A;  5FR9 A;  3JZI A;  2EJ0 A;  3WWI A;  4HNT A;  5H80 A;  1Z2N X;  4CHI A;  1JDE A;  5CM0 A;  2V58 A; 
#chains in the Genus database with same CATH homology
 2HHF B;  4K6N A;  4CMF A;  2DAB A;  2HG8 A;  3JZ6 A;  3UZO A;  2QB5 A;  5I5X A;  4CKE A;  3T9B A;  3HT5 A;  1I1K A;  5BWX A;  3VPD A;  5BYA A;  2COI A;  4DAA A;  3LQS A;  5BWU A;  5BWT A;  2X5R A;  5BWV A;  2ABJ A;  3SGI A;  3T9C A;  4NZM A;  5E25 A;  1G2W A;  2EJ3 A;  3U0G A;  3DTF A;  3T99 A;  1A3G A;  2COJ A;  4HN2 A;  3T9F A;  3TW7 A;  1A0G A;  3UYY A;  4GLW A;  5BYB A;  3T9E A;  5I5T A;  1IYD A;  2DAA A;  4DQN A;  4IWX A;  1I1M A;  2COG A;  3T7A A;  3WWH A;  4NZN A;  5DGH A;  5CR5 A;  5BWW A;  5K2M A;  2ODT X;  1KTA A;  1EKF A;  3DAA A;  5KS8 A;  2HGW A;  2Y4R A;  4NZO A;  1IYE A;  3LUL A;  4M0J A;  4IWY A;  5DAA A;  3UZB A;  5I5W A;  3TEK A;  3SNO A;  3T9A A;  5I60 A;  4JXU A;  5DGI A;  2HHF A;  5I5V A;  4PBC A;  3CSW A;  4TM5 A;  5I5U A;  1UC9 A;  3T9D A;  1WRV A;  5I47 A;  2HDK A;  3T54 A;  1ZAU A;  2A1H A;  3QQM A;  5BWR A;  1UC8 A;  4CKC A;  1DAA A;  1I2K A;  4CE5 A;  5I5Y A;  3BAC A;  2ZGI A;  1ET0 A;  5HNE A;  4Q4D A;  5I5S A;  1KT8 A;  4RCN A;  4CMD A;  3CEB A;  4TVI A;  4UUG A;  4WHX A;  2Q7D A;  2EIY A;  3WWJ A;  3PFF A;  1EKP A;  4CKB A;  5FR9 A;  5CE8 A;  2EJ0 A;  5K3W A;  3WWI A;  1I2L A;  3DTG A;  1EKV A;  4CHI A;  2EJ2 A;  2HGX A;  5CM0 A;  4Q4C A;  1I1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...