2Y4RA

Crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
270
structure length
270
Chain Sequence
LDWVDGRPAAELSVRDRGLAYGDGLFETLAVRAGTPRLLERHLARLEEGCRRLAIPLDTAALRQELLAFCAALGDGVAKLIVTRGEGLRGYAPPAEASPRRILSGSPRPAYPERHWQQGVRLFACRTRLAEQPLLAGLKHLNRLEQVLARAEWSDAGHAEGLMLDVHERVVEGVFSNLLLVLDGTLVAPDLRRCGVAGVMRAELLERAEGIGVPLAIRDVSMAELATADEVFLCNSQFGIWPVRALDEHVWPVGELTRKLQDQLRDDLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pseudomonas Aeruginosa 4-Amino-4-Deoxychorismate Lyase: Spatial Conservation of an Active Site Tyrosine and Classification of Two Types of Enzyme.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
molecule keywords 4-AMINO-4-DEOXYCHORISMATE LYASE
total genus 81
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 4.1.3.38: Aminodeoxychorismate lyase.
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2y4rA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2y4rA01
4WHXA 1KTAA 5CE8A 1EKVA 1IYEA 2EJ3A 4CMFA 1I1LA 3WWHA 5I5WA 5BWRA 3JZ6A 4K6NA 5K3WA 5CR5A 2ZGIA 5I5XA 4M0JA 5BWWA 4UUGA 5I5VA 1EKFA 2Y4RA 2HGXA 2COGA 5CM0A 3CEBA 5I5SA 1EKPA 3WWIA 2HHFA 2ABJA 2COIA 3DTFA 3UZBA 3U0GA 3DAAA 1DAAA 3LULA 4CE5A 3UZOA 3CSWA 5FR9A 1G2WA 4DQNA 5BWXA 1I1KA 1IYDA 4DAAA 2DAAA 2HG8A 2HDKA 2DABA 5BWVA 5HNEA 5I5YA 2A1HA 2EIYA 2EJ2A 5I60A 5DAAA 5E25A 1ET0A 4PBCA 3QQMA 5I5UA 3UYYA 1A0GA 4TVIA 1I2LA 4CMDA 5I5TA 1I2KA 3WWJA 1I1MA 2HGWA 2EJ0A 5BWUA 3HT5A 3LQSA 4JXUA 5BWTA 1KT8A 3SNOA 4TM5A 4CHIA 1A3GA 1WRVA 2HHFB 3DTGA 2COJA
chains in the Genus database with same CATH superfamily
4WHXA 1KTAA 4O7WA 1A0IA 4DIMA 5BPHA 3R5XA 1JDBB 4FGRA 2EJ3A 1PX2A 4CMFA 3SE7A 2HGSA 1T36A 2W6NA 2HVRA 2FPGB 1A48A 3ORQA 3HBLA 1W96A 4ZI7F 3VA7A 5CR5A 2Z04A 2GQSA 4XYMB 5IYZF 1XDNA 5H80A 2I8CA 4O81A 2QF7A 4TV9F 2DLNA 4XZ3B 1BNCA 3JSLA 4FE2A 3WWIA 2ABJA 1PK8A 4C5BA 2FPIB 4O2BF 1B04A 3NC0B 3R9RA 1KJIA 4CE5A 2W6ZA 3UZOA 3CSWA 5KKNB 1C3OA 1P8LA 3T9CA 1GGOA 2Q2UA 3BA9A 3ORRA 3HO8A 4FFPA 2QK4A 4DQNA 5BWXA 3VOTA 3TY8A 4O4JF 1IYDA 4YBZB 3V4ZA 4NZOA 3GDEA 2NUAB 2W6PA 4TUYF 5HNEA 2EJ2A 4YAKB 4PZ7A 5I60A 4DRFA 3NBYB 3VPDA 1OBGA 1CKNB 2W6OA 1I2LA 3LWBA 2CZGA 1BXRA 2YL2A 2ZDQA 4CKEA 4UCVA 4UCUA 5BPFA 3R5FA 2Q2TA 1V9PA 3U54A 1GSAA 1S68A 2C00A 2CNVA 3HT5A 1TAEA 5J2TF 4O86A 3VPCA 1IOVA 3VPBA 1EZ1A 2X0SA 4UCSA 4TM5A 2R86A 3TQTA 2VUGA 4HNUA 3W1GA 2HHFB 4E4TA 5JVDF 3WO1A 2R82A 4GLWA 2YZMA 2COJA 4FU0A 2HVSA 1KJ8A 5HBRB 2FB9A 3S24A 3RR5A 5BMVF 1ZAUA 2CFMA 1M0WA 5I5WA 4ME6A 3WO0A 3I12A 2R85A 5BWRA 3VMMA 2WYOA 1IOWA 4Q4DA 4O83A 1GSHA 3JZ6A 2YW2A 2FPPB 4LH6A 5DMXA 5I5XA 4M0JA 3N8DA 5D8DA 1AUVA 5CB4F 1KUTA 3RTXA 4FFNA 2HGXA 2ZDHA 4UFZA 5CM0A 5FNVF 3CEBA 1TA8A 1X9NA 5EZYF 2R7MA 2R7NA 3SGIA 1Z2PX 2YYAA 4CC6A 3DTFA 4O7VA 4PZ6A 3OUZA 4EGJA 3LULA 1P16A 4O82A 4IWYA 2YS7A 4M9UA 2PBZA 5D1OB 1ULZA 1KEEA 3R5HA 3GIDA 3N6RA 3TY9A 2W71A 4XYLB 2W6QA 5I47A 4DAAA 1I7LA 2V59A 3GJXB 2PN1A 1CQJB 3JSNA 5BWVA 2DWCA 2EIYA 5LP6F 4MV7A 1AUXA 3TIGA 2HVQA 3QQMA 2GLTA 4HR7A 5LOVF 4EG0A 2HJWA 4HQ6A 2VPQA 1DV1A 1CKMA 1VBHA 5KX5F 3KREA 4UCRA 3ETJA 2YZNA 2Q7DA 2HGWA 4NYEA 3TW7A 4PZ8A 2EJ0A 3PFFA 3TIIA 3BAAA 3BG5A 4GLXA 4LH7A 4O84A 4NZMA 4DLKA 5DGIA 2W70A 4EQ5A 4CC5A 2OLSA 3L2PA 2R7KA 3JRXA 2SCUB 4ZOLF 4IZOA 3JRWA 3RV3A 5I5UA 3TEKA 2IP4A 3U9TA 1EUDB 1EKVA 5DGHA 5C8YF 3G8CA 5CAEB 3WWHA 5LXTF 1Z2OX 3T9EA 1B6SA 4O7LA 3KALA 2J9GA 2GPSA 1M6VA 4IIJF 4L1KA 4MV8A 1EYZA 1CQIB 3K3PA 3T9DA 4UUGA 5I5VA 1KC7A 4I4TF 2Y4RA 2NU8B 3TW6A 4YJ2F 4MV9A 5JQWA 1M0TA 4XX0B 4C5CA 2HHFA 2COIA 3HB9A 4ZQIA 1CS0A 3G8DA 3Q1KA 3T54A 3U0GA 3W5OA 3DAAA 1DAAA 4O7YA 4YJ3F 1CKNA 4FFOA 3JZFA 3GB8B 2YRWA 2YRXA 2ZDGA 4O2AF 2R84A 1SCUB 1W93A 4NZNA 3WNZA 1WR2A 2I80A 4EGQA 2YZGA 1G2WA 1GSOA 1XK5A 2P0AA 2QB5A 3KYHC 4RZQA 4MA5A 4QSHA 1I1KA 2HIVA 2DAAA 5CA0F 1DIKA 1OBDA 2HG8A 2DABA 2Z02A 3AX6A 4O4LF 5LYJF 1C30A 3LP8A 5I5YA 3UQ8A 2A1HA 4O7SA 2NU9B 3R23A 4UCOA 5DAAA 1EHIA 4HNTA 2XCLA 2YS6A 4PBCA 1JDEA 2NU7B 3Q2OA 4FFLA 4FFMA 4TVIA 3TINA 1VBGA 5I5TA 1Z2NX 3KAJA 3QFFA 5LA6F 1I2KA 3QWUA 2HIXA 4WBNF 5DISC 5JQGF 4YB8B 4CKCA 3T99A 3K5HA 4MV1A 4I55F 5J2UF 4EFBA 5BWTA 1CKOA 2PVPA 3SNOA 4RCNA 3JZIA 1EUCB 2DIKA 5FPRA 1B6RA 3NUAA 5JH7F 2V58A 4TV8F 2FP4B 1UC9A 1I1LA 3DTGA 1DV2A 2CNQA 5D1PA 5CE8A 3MWEA 4IWXA 4Q4CA 1IYEA 2W6MA 4MV3A 4O7TA 4EEQA 5KS8A 3W1BA 4C5AA 2DZDA 2X5RA 4MA0A 5JVLA 3K5IA 5BYAA 3RFCA 4K6NA 3RUPA 3OUUA 2NU6B 5K3WA 2ZGIA 5BWWA 4MV6A 5C1OA 1EKFA 5HV6A 2COGA 2YWVA 4O7RA 5I5SA 1VKZA 1JLLB 1EKPA 2I87A 3U55A 4O4HF 4FFRA 4Y8VB 3UZBA 1KJQA 1UC8A 3V4SA 4HNVA 3NBZB 2YZLA 3TY5A 3T9FA 3E5NA 3U9SA 3BACA 1KBLA 5GONF 1E4EB 5C1PA 5FR9A 3BA8A 4IHJF 4HN2A 5D1OA 2VR1A 2GPWA 2ODTX 4EFEA 3PN1A 1KJJA 2V5AA 2HDKA 5BYBA 4I50F 3VNNA 1VS0A 1FVIA 3T9AA 3GLKA 5E25A 1ET0A 1E4EA 3MWDA 3UYYA 1A0GA 4O7NA 4CMDA 3KAKA 4UCTA 3ETHA 5CA1F 2XD4A 3MJFA 3DF7A 4CKBA 1A9XA 1GLVA 3WWJA 2R7LA 4MAMA 2CNUA 1DGSA 1I1MA 2GQRA 4E6NA 3RV4A 5BWUA 4YAJB 4ZHQF 3LQSA 4JXUA 4O7ZA 1KJ9A 4MV4A 1JKJB 3T7AA 3UFXB 1KT8A 5K2MA 4CHIA 2VQDA 1A3GA 1WRVA 3BABA 1I7NA 2R87A 5FPOA 3T9BA 4O4IF 3AW8A 2OWOA 1CE8A
chains in the Genus database with same CATH topology
4WHXA 1KTAA 5CE8A 1EKVA 4IWXA 4Q4CA 1IYEA 2EJ3A 5DGHA 4CMFA 1ZAUA 1I1LA 3WWHA 5I5WA 5BWRA 5KS8A 3T9EA 2X5RA 4Q4DA 3JZ6A 5BYAA 4K6NA 5K3WA 5CR5A 2ZGIA 5I5XA 4M0JA 5BWWA 3T9DA 4UUGA 5I5VA 1EKFA 2Y4RA 2HGXA 2COGA 5CM0A 3CEBA 5I5SA 1EKPA 3SGIA 3WWIA 2HHFA 2ABJA 2COIA 3DTFA 3UZBA 3T54A 3U0GA 3DAAA 1DAAA 1UC8A 3LULA 4CE5A 3UZOA 3CSWA 3T9FA 4IWYA 3BACA 3T9CA 4NZNA 5FR9A 4HN2A 1G2WA 2QB5A 4DQNA 5BWXA 2ODTX 1I1KA 1IYDA 5I47A 4DAAA 2DAAA 4NZOA 2HG8A 2HDKA 2DABA 5BYBA 5BWVA 5HNEA 5I5YA 2A1HA 2EIYA 2EJ2A 5I60A 3T9AA 5DAAA 5E25A 1ET0A 4PBCA 3QQMA 5I5UA 3UYYA 3VPDA 1A0GA 4TVIA 1I2LA 4CMDA 5I5TA 4CKEA 1I2KA 4CKBA 4CKCA 3T99A 2Q7DA 3WWJA 1I1MA 2HGWA 3TW7A 2EJ0A 5BWUA 3PFFA 3HT5A 3LQSA 4JXUA 5BWTA 3T7AA 1KT8A 3SNOA 5K2MA 4RCNA 4TM5A 4NZMA 4CHIA 3TEKA 5DGIA 1A3GA 1WRVA 2HHFB 4GLWA 3T9BA 1UC9A 3DTGA 2COJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHX A;  1KTA A;  5CE8 A;  1EKV A;  1IYE A;  2EJ3 A;  4CMF A;  1I1L A;  3WWH A;  5I5W A;  5BWR A;  3JZ6 A;  4K6N A;  5K3W A;  5CR5 A;  2ZGI A;  5I5X A;  4M0J A;  5BWW A;  4UUG A;  5I5V A;  1EKF A;  2Y4R A;  2HGX A;  2COG A;  5CM0 A;  3CEB A;  5I5S A;  1EKP A;  3WWI A;  2HHF A;  2ABJ A;  2COI A;  3DTF A;  3UZB A;  3U0G A;  3DAA A;  1DAA A;  3LUL A;  4CE5 A;  3UZO A;  3CSW A;  5FR9 A;  1G2W A;  4DQN A;  5BWX A;  1I1K A;  1IYD A;  4DAA A;  2DAA A;  2HG8 A;  2HDK A;  2DAB A;  5BWV A;  5HNE A;  5I5Y A;  2A1H A;  2EIY A;  2EJ2 A;  5I60 A;  5DAA A;  5E25 A;  1ET0 A;  4PBC A;  3QQM A;  5I5U A;  3UYY A;  1A0G A;  4TVI A;  1I2L A;  4CMD A;  5I5T A;  1I2K A;  3WWJ A;  1I1M A;  2HGW A;  2EJ0 A;  5BWU A;  3HT5 A;  3LQS A;  4JXU A;  5BWT A;  1KT8 A;  3SNO A;  4TM5 A;  4CHI A;  1A3G A;  1WRV A;  2HHF B;  3DTG A;  2COJ A; 
#chains in the Genus database with same CATH topology
 4WHX A;  1KTA A;  4O7W A;  1A0I A;  4DIM A;  5BPH A;  3R5X A;  1JDB B;  4FGR A;  2EJ3 A;  1PX2 A;  4CMF A;  3SE7 A;  2HGS A;  1T36 A;  2W6N A;  2HVR A;  2FPG B;  1A48 A;  3ORQ A;  3HBL A;  1W96 A;  4ZI7 F;  3VA7 A;  5CR5 A;  2Z04 A;  2GQS A;  4XYM B;  5IYZ F;  1XDN A;  5H80 A;  2I8C A;  4O81 A;  2QF7 A;  4TV9 F;  2DLN A;  4XZ3 B;  1BNC A;  3JSL A;  4FE2 A;  3WWI A;  2ABJ A;  1PK8 A;  4C5B A;  2FPI B;  4O2B F;  1B04 A;  3NC0 B;  3R9R A;  1KJI A;  4CE5 A;  2W6Z A;  3UZO A;  3CSW A;  5KKN B;  1C3O A;  1P8L A;  3T9C A;  1GGO A;  2Q2U A;  3BA9 A;  3ORR A;  3HO8 A;  4FFP A;  2QK4 A;  4DQN A;  5BWX A;  3VOT A;  3TY8 A;  4O4J F;  1IYD A;  4YBZ B;  3V4Z A;  4NZO A;  3GDE A;  2NUA B;  2W6P A;  4TUY F;  5HNE A;  2EJ2 A;  4YAK B;  4PZ7 A;  5I60 A;  4DRF A;  3NBY B;  3VPD A;  1OBG A;  1CKN B;  2W6O A;  1I2L A;  3LWB A;  2CZG A;  1BXR A;  2YL2 A;  2ZDQ A;  4CKE A;  4UCV A;  4UCU A;  5BPF A;  3R5F A;  2Q2T A;  1V9P A;  3U54 A;  1GSA A;  1S68 A;  2C00 A;  2CNV A;  3HT5 A;  1TAE A;  5J2T F;  4O86 A;  3VPC A;  1IOV A;  3VPB A;  1EZ1 A;  2X0S A;  4UCS A;  4TM5 A;  2R86 A;  3TQT A;  2VUG A;  4HNU A;  3W1G A;  2HHF B;  4E4T A;  5JVD F;  3WO1 A;  2R82 A;  4GLW A;  2YZM A;  2COJ A;  4FU0 A;  2HVS A;  1KJ8 A;  5HBR B;  2FB9 A;  3S24 A;  3RR5 A;  5BMV F;  1ZAU A;  2CFM A;  1M0W A;  5I5W A;  4ME6 A;  3WO0 A;  3I12 A;  2R85 A;  5BWR A;  3VMM A;  2WYO A;  1IOW A;  4Q4D A;  4O83 A;  1GSH A;  3JZ6 A;  2YW2 A;  2FPP B;  4LH6 A;  5DMX A;  5I5X A;  4M0J A;  3N8D A;  5D8D A;  1AUV A;  5CB4 F;  1KUT A;  3RTX A;  4FFN A;  2HGX A;  2ZDH A;  4UFZ A;  5CM0 A;  5FNV F;  3CEB A;  1TA8 A;  1X9N A;  5EZY F;  2R7M A;  2R7N A;  3SGI A;  1Z2P X;  2YYA A;  4CC6 A;  3DTF A;  4O7V A;  4PZ6 A;  3OUZ A;  4EGJ A;  3LUL A;  1P16 A;  4O82 A;  4IWY A;  2YS7 A;  4M9U A;  2PBZ A;  5D1O B;  1ULZ A;  1KEE A;  3R5H A;  3GID A;  3N6R A;  3TY9 A;  2W71 A;  4XYL B;  2W6Q A;  5I47 A;  4DAA A;  1I7L A;  2V59 A;  3GJX B;  2PN1 A;  1CQJ B;  3JSN A;  5BWV A;  2DWC A;  2EIY A;  5LP6 F;  4MV7 A;  1AUX A;  3TIG A;  2HVQ A;  3QQM A;  2GLT A;  4HR7 A;  5LOV F;  4EG0 A;  2HJW A;  4HQ6 A;  2VPQ A;  1DV1 A;  1CKM A;  1VBH A;  5KX5 F;  3KRE A;  4UCR A;  3ETJ A;  2YZN A;  2Q7D A;  2HGW A;  4NYE A;  3TW7 A;  4PZ8 A;  2EJ0 A;  3PFF A;  3TII A;  3BAA A;  3BG5 A;  4GLX A;  4LH7 A;  4O84 A;  4NZM A;  4DLK A;  5DGI A;  2W70 A;  4EQ5 A;  4CC5 A;  2OLS A;  3L2P A;  2R7K A;  3JRX A;  2SCU B;  4ZOL F;  4IZO A;  3JRW A;  3RV3 A;  5I5U A;  3TEK A;  2IP4 A;  3U9T A;  1EUD B;  1EKV A;  5DGH A;  5C8Y F;  3G8C A;  5CAE B;  3WWH A;  5LXT F;  1Z2O X;  3T9E A;  1B6S A;  4O7L A;  3KAL A;  2J9G A;  2GPS A;  1M6V A;  4IIJ F;  4L1K A;  4MV8 A;  1EYZ A;  1CQI B;  3K3P A;  3T9D A;  4UUG A;  5I5V A;  1KC7 A;  4I4T F;  2Y4R A;  2NU8 B;  3TW6 A;  4YJ2 F;  4MV9 A;  5JQW A;  1M0T A;  4XX0 B;  4C5C A;  2HHF A;  2COI A;  3HB9 A;  4ZQI A;  1CS0 A;  3G8D A;  3Q1K A;  3T54 A;  3U0G A;  3W5O A;  3DAA A;  1DAA A;  4O7Y A;  4YJ3 F;  1CKN A;  4FFO A;  3JZF A;  3GB8 B;  2YRW A;  2YRX A;  2ZDG A;  4O2A F;  2R84 A;  1SCU B;  1W93 A;  4NZN A;  3WNZ A;  1WR2 A;  2I80 A;  4EGQ A;  2YZG A;  1G2W A;  1GSO A;  1XK5 A;  2P0A A;  2QB5 A;  3KYH C;  4RZQ A;  4MA5 A;  4QSH A;  1I1K A;  2HIV A;  2DAA A;  5CA0 F;  1DIK A;  1OBD A;  2HG8 A;  2DAB A;  2Z02 A;  3AX6 A;  4O4L F;  5LYJ F;  1C30 A;  3LP8 A;  5I5Y A;  3UQ8 A;  2A1H A;  4O7S A;  2NU9 B;  3R23 A;  4UCO A;  5DAA A;  1EHI A;  4HNT A;  2XCL A;  2YS6 A;  4PBC A;  1JDE A;  2NU7 B;  3Q2O A;  4FFL A;  4FFM A;  4TVI A;  3TIN A;  1VBG A;  5I5T A;  1Z2N X;  3KAJ A;  3QFF A;  5LA6 F;  1I2K A;  3QWU A;  2HIX A;  4WBN F;  5DIS C;  5JQG F;  4YB8 B;  4CKC A;  3T99 A;  3K5H A;  4MV1 A;  4I55 F;  5J2U F;  4EFB A;  5BWT A;  1CKO A;  2PVP A;  3SNO A;  4RCN A;  3JZI A;  1EUC B;  2DIK A;  5FPR A;  1B6R A;  3NUA A;  5JH7 F;  2V58 A;  4TV8 F;  2FP4 B;  1UC9 A;  1I1L A;  3DTG A;  1DV2 A;  2CNQ A;  5D1P A;  5CE8 A;  3MWE A;  4IWX A;  4Q4C A;  1IYE A;  2W6M A;  4MV3 A;  4O7T A;  4EEQ A;  5KS8 A;  3W1B A;  4C5A A;  2DZD A;  2X5R A;  4MA0 A;  5JVL A;  3K5I A;  5BYA A;  3RFC A;  4K6N A;  3RUP A;  3OUU A;  2NU6 B;  5K3W A;  2ZGI A;  5BWW A;  4MV6 A;  5C1O A;  1EKF A;  5HV6 A;  2COG A;  2YWV A;  4O7R A;  5I5S A;  1VKZ A;  1JLL B;  1EKP A;  2I87 A;  3U55 A;  4O4H F;  4FFR A;  4Y8V B;  3UZB A;  1KJQ A;  1UC8 A;  3V4S A;  4HNV A;  3NBZ B;  2YZL A;  3TY5 A;  3T9F A;  3E5N A;  3U9S A;  3BAC A;  1KBL A;  5GON F;  1E4E B;  5C1P A;  5FR9 A;  3BA8 A;  4IHJ F;  4HN2 A;  5D1O A;  2VR1 A;  2GPW A;  2ODT X;  4EFE A;  3PN1 A;  1KJJ A;  2V5A A;  2HDK A;  5BYB A;  4I50 F;  3VNN A;  1VS0 A;  1FVI A;  3T9A A;  3GLK A;  5E25 A;  1ET0 A;  1E4E A;  3MWD A;  3UYY A;  1A0G A;  4O7N A;  4CMD A;  3KAK A;  4UCT A;  3ETH A;  5CA1 F;  2XD4 A;  3MJF A;  3DF7 A;  4CKB A;  1A9X A;  1GLV A;  3WWJ A;  2R7L A;  4MAM A;  2CNU A;  1DGS A;  1I1M A;  2GQR A;  4E6N A;  3RV4 A;  5BWU A;  4YAJ B;  4ZHQ F;  3LQS A;  4JXU A;  4O7Z A;  1KJ9 A;  4MV4 A;  1JKJ B;  3T7A A;  3UFX B;  1KT8 A;  5K2M A;  4CHI A;  2VQD A;  1A3G A;  1WRV A;  3BAB A;  1I7N A;  2R87 A;  5FPO A;  3T9B A;  4O4I F;  3AW8 A;  2OWO A;  1CE8 A; 
#chains in the Genus database with same CATH homology
 4WHX A;  1KTA A;  5CE8 A;  1EKV A;  4IWX A;  4Q4C A;  1IYE A;  2EJ3 A;  5DGH A;  4CMF A;  1ZAU A;  1I1L A;  3WWH A;  5I5W A;  5BWR A;  5KS8 A;  3T9E A;  2X5R A;  4Q4D A;  3JZ6 A;  5BYA A;  4K6N A;  5K3W A;  5CR5 A;  2ZGI A;  5I5X A;  4M0J A;  5BWW A;  3T9D A;  4UUG A;  5I5V A;  1EKF A;  2Y4R A;  2HGX A;  2COG A;  5CM0 A;  3CEB A;  5I5S A;  1EKP A;  3SGI A;  3WWI A;  2HHF A;  2ABJ A;  2COI A;  3DTF A;  3UZB A;  3T54 A;  3U0G A;  3DAA A;  1DAA A;  1UC8 A;  3LUL A;  4CE5 A;  3UZO A;  3CSW A;  3T9F A;  4IWY A;  3BAC A;  3T9C A;  4NZN A;  5FR9 A;  4HN2 A;  1G2W A;  2QB5 A;  4DQN A;  5BWX A;  2ODT X;  1I1K A;  1IYD A;  5I47 A;  4DAA A;  2DAA A;  4NZO A;  2HG8 A;  2HDK A;  2DAB A;  5BYB A;  5BWV A;  5HNE A;  5I5Y A;  2A1H A;  2EIY A;  2EJ2 A;  5I60 A;  3T9A A;  5DAA A;  5E25 A;  1ET0 A;  4PBC A;  3QQM A;  5I5U A;  3UYY A;  3VPD A;  1A0G A;  4TVI A;  1I2L A;  4CMD A;  5I5T A;  4CKE A;  1I2K A;  4CKB A;  4CKC A;  3T99 A;  2Q7D A;  3WWJ A;  1I1M A;  2HGW A;  3TW7 A;  2EJ0 A;  5BWU A;  3PFF A;  3HT5 A;  3LQS A;  4JXU A;  5BWT A;  3T7A A;  1KT8 A;  3SNO A;  5K2M A;  4RCN A;  4TM5 A;  4NZM A;  4CHI A;  3TEK A;  5DGI A;  1A3G A;  1WRV A;  2HHF B;  4GLW A;  3T9B A;  1UC9 A;  3DTG A;  2COJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...