2Y4RA

Crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
270
structure length
270
Chain Sequence
LDWVDGRPAAELSVRDRGLAYGDGLFETLAVRAGTPRLLERHLARLEEGCRRLAIPLDTAALRQELLAFCAALGDGVAKLIVTRGEGLRGYAPPAEASPRRILSGSPRPAYPERHWQQGVRLFACRTRLAEQPLLAGLKHLNRLEQVLARAEWSDAGHAEGLMLDVHERVVEGVFSNLLLVLDGTLVAPDLRRCGVAGVMRAELLERAEGIGVPLAIRDVSMAELATADEVFLCNSQFGIWPVRALDEHVWPVGELTRKLQDQLRDDLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-AMINO-4-DEOXYCHORISMATE LYASE
publication title Pseudomonas Aeruginosa 4-Amino-4-Deoxychorismate Lyase: Spatial Conservation of an Active Site Tyrosine and Classification of Two Types of Enzyme.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 81
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 4.1.3.38: Aminodeoxychorismate lyase.
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2y4rA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2y4rA01
1I2KA 5BWUA 4JXUA 3SNOA 5I5TA 3CEBA 2HGWA 4TVIA 1DAAA 3UYYA 4DQNA 2ABJA 5CR5A 2EIYA 5I60A 1I1MA 1WRVA 1G2WA 3WWIA 1I1LA 5E25A 2HG8A 5BWRA 4CMDA 3WWJA 3LULA 1KT8A 5I5VA 1IYEA 2Y4RA 5BWWA 2ZGIA 3DTGA 3CSWA 1A3GA 4DAAA 3LQSA 5CE8A 3U0GA 4K6NA 1EKFA 5HNEA 1ET0A 1EKVA 2A1HA 1A0GA 3JZ6A 3DAAA 3QQMA 5I5SA 5BWTA 1IYDA 4WHXA 4TM5A 3HT5A 4PBCA 2EJ3A 1KTAA 5DAAA 4M0JA 1I1KA 2COJA 4CMFA 2HDKA 5CM0A 5K3WA 5I5YA 4UUGA 2HGXA 5I5XA 3UZOA 3UZBA 2COIA 5I5WA 1EKPA 5BWVA 2COGA 2EJ2A 2DABA 3DTFA 5FR9A 2DAAA 4CHIA 3WWHA 2HHFA 2EJ0A 5BWXA 1I2LA 5I5UA 4CE5A 2HHFB
chains in the Genus database with same CATH superfamily
4YB8B 4I50F 4IWYA 1DV1A 3CEBA 3TIGA 2I87A 1VKZA 5JQWA 1VS0A 2VUGA 3GIDA 4O7VA 2W6ZA 3SGIA 5D8DA 4DQNA 4NZNA 1A48A 5D1OA 3TW7A 1T36A 5JQGF 5CR5A 2I8CA 5FNVF 5I60A 1EYZA 3T9FA 4TUYF 3LP8A 3N6RA 5D1OB 3JZFA 4O7WA 4WBNF 4FFMA 2YZNA 3PN1A 1I1LA 2IP4A 2XD4A 2WYOA 2CZGA 4HQ6A 2FP4B 3R5XA 2W6OA 1FVIA 3JZIA 3WWJA 1GLVA 2DLNA 3GDEA 3BA9A 4ZHQF 2GQSA 4O84A 5C1PA 5BWWA 3MWDA 4FU0A 3DTGA 3CSWA 1P16A 4DAAA 3U0GA 3K3PA 4PZ7A 1EKVA 2R86A 4HNTA 3R5HA 1A0GA 4MV3A 1EHIA 4Q4DA 2GQRA 4EFBA 4XZ3B 5BWTA 1V9PA 2PN1A 3N8DA 3R9RA 2R7LA 3PFFA 3TQTA 4RCNA 5LP6F 2W6NA 4EFEA 4TM5A 4EG0A 2HGSA 5J2UF 3JRWA 4HN2A 4LH6A 5DISC 5J2TF 3TY8A 3OUUA 2QB5A 4CKCA 1KUTA 1CKMA 4L1KA 3JSNA 4M0JA 2PVPA 2QF7A 3UQ8A 4HNUA 5JVDF 3KAJA 1SCUB 4CMFA 4NZMA 2ZDHA 1A0IA 3HO8A 3E5NA 4CKBA 2VQDA 5I5YA 4UUGA 3NBYB 2YWVA 4DRFA 3T9BA 5I5XA 4MV6A 3UZOA 2COIA 4PZ8A 3DF7A 2CNVA 5I47A 1EUCB 5LOVF 2DABA 3MJFA 4FE2A 2CNUA 5FR9A 2DAAA 2ZDQA 4ZOLF 3TW6A 3S24A 1C30A 4YAKB 1CKNA 3WNZA 1ULZA 1KC7A 2VR1A 1CKNB 4JXUA 1IOWA 5I5TA 1M6VA 1JKJB 2Q2TA 3UYYA 2HJWA 1CS0A 3I12A 1WR2A 5K2MA 1S68A 1I1MA 4M9UA 1WRVA 3G8DA 4O81A 2HVRA 1G2WA 4LH7A 4YBZB 3G8CA 4MV8A 4O86A 2YRXA 5BYBA 2SCUB 3W5OA 5E25A 3MWEA 4XYLB 1JDBB 5DGHA 2HG8A 4TV8F 4CMDA 3NUAA 1GSAA 2Q2UA 1VBHA 2R7NA 5I5VA 1M0TA 4GLXA 2VPQA 3AX6A 2Y4RA 3ORQA 3RR5A 2YW2A 3T99A 3V4SA 2HIXA 2OLSA 4CKEA 1A3GA 3LQSA 3T7AA 4GLWA 2FPIB 2Q7DA 4FFNA 4ME6A 2A1HA 4I55F 5FPRA 3R5FA 3DAAA 4MA0A 4I4TF 4YAJB 2NU8B 2R87A 1OBDA 1A9XA 2HIVA 5CA0F 2EJ3A 4O2BF 4O7ZA 4NYEA 5DMXA 3GLKA 4O7LA 3VMMA 3BAAA 1DV2A 3BABA 1W96A 3Q1KA 1I1KA 2ODTX 2HDKA 3RUPA 3ORRA 5CM0A 4MV7A 3TY9A 5K3WA 5LYJF 2R7MA 3AW8A 5IYZF 5BPFA 1ZAUA 1XK5A 3OUZA 1DGSA 2GLTA 4FFPA 3T9DA 3T54A 3KYHC 2YS6A 2PBZA 3GB8B 3SE7A 1E4EA 3DTFA 3TY5A 2HVQA 3WWHA 4EGQA 2HHFA 3QWUA 5H80A 1E4EB 1I2LA 1EUDB 5I5UA 3UFXB 2HHFB 2Z02A 4O4JF 1M0WA 1I2KA 5BWUA 4HR7A 1TA8A 4O83A 1P8LA 3R23A 5BPHA 2HGWA 2V59A 4TVIA 4O7TA 1DAAA 5KS8A 2ABJA 5HV6A 2W6PA 2GPSA 3ETJA 2C00A 1B04A 2XCLA 4FFOA 2HVSA 1B6RA 2NUAB 2FPGB 3HBLA 3HB9A 2V58A 4XX0B 4CC6A 2I80A 2YZMA 3V4ZA 2W6MA 1TAEA 3KALA 3KAKA 4XYMB 4ZI7F 4O2AF 1IYEA 4MAMA 3U9TA 4EGJA 1KEEA 2ZGIA 1XDNA 3TEKA 3TIIA 4FFLA 2QK4A 5HNEA 1ET0A 4C5AA 3RV3A 3JZ6A 1GSHA 4CC5A 5I5SA 4UCOA 1IYDA 2W71A 4YJ3F 1B6SA 3K5HA 4ZQIA 2YZGA 4WHXA 3JRXA 3JSLA 1BXRA 4C5CA 2X5RA 1CQJB 3VPDA 5HBRB 1VBGA 4O7RA 3BA8A 4EQ5A 5DAAA 5BMVF 3RV4A 1CKOA 2CFMA 4RZQA 4PZ6A 3RFCA 1EZ1A 4UCRA 4O7YA 3TINA 4UCUA 2CNQA 4Q4CA 5KX5F 4DIMA 3WO1A 4FFRA 5CA1F 1EKPA 2DIKA 5JVLA 2COGA 2EJ2A 1GSOA 2W6QA 5JH7F 2DWCA 2YYAA 4E4TA 4CE5A 5LXTF 1DIKA 3U9SA 2R82A 3RTXA 3SNOA 2X0SA 1I7LA 4O7NA 3K5IA 4UCVA 5CAEB 5KKNB 1W93A 1Z2OX 2NU6B 2R7KA 3VA7A 2FPPB 4QSHA 4Y8VB 3NC0B 4HNVA 5C1OA 2EIYA 1KJQA 3T9EA 5BYAA 1UC8A 1CE8A 3KREA 1Z2PX 2DZDA 4FGRA 1BNCA 1GGOA 4IWXA 4O82A 2YL2A 1KBLA 3WWIA 1IOVA 1OBGA 2R85A 3W1BA 5BWRA 2GPWA 2OWOA 1I7NA 3LULA 1KT8A 1JLLB 4MV1A 1KJIA 4YJ2F 3BG5A 1AUVA 5CB4F 2YRWA 4IHJF 1KJJA 1CQIB 4UCSA 4MA5A 5CE8A 4O4IF 4K6NA 3ETHA 5EZYF 2NU9B 1EKFA 4O4HF 2YS7A 2Z04A 5DGIA 5C8YF 3VOTA 5D1PA 2ZDGA 3QQMA 3NBZB 4UFZA 3T9AA 2FB9A 3LWBA 1X9NA 3GJXB 1UC9A 3T9CA 3HT5A 4PBCA 2NU7B 1C3OA 4NZOA 1JDEA 3U54A 3WO0A 3L2PA 1KTAA 5FPOA 2R84A 1KJ8A 4C5BA 4MV4A 1AUXA 4MV9A 4O4LF 2COJA 3VPCA 4E6NA 3QFFA 4DLKA 4TV9F 1KJ9A 5GONF 4UCTA 3VNNA 2HGXA 3BACA 3Q2OA 4IIJF 3UZBA 5I5WA 5BWVA 4IZOA 2W70A 1PK8A 1Z2NX 2V5AA 4EEQA 4CHIA 1PX2A 2P0AA 3U55A 2YZLA 2EJ0A 5BWXA 4O7SA 5LA6F 3VPBA 3W1GA 2J9GA
chains in the Genus database with same CATH topology
1I2KA 4IWYA 5BWUA 4JXUA 3SNOA 5I5TA 3CEBA 2HGWA 4TVIA 1DAAA 3SGIA 3UYYA 5KS8A 4DQNA 2ABJA 4NZNA 3TW7A 5CR5A 2EIYA 5I60A 5K2MA 3T9FA 3T9EA 5BYAA 1I1MA 1UC8A 1WRVA 1G2WA 4IWXA 3WWIA 1I1LA 5BYBA 5E25A 5DGHA 2HG8A 5BWRA 4CMDA 3WWJA 3LULA 1KT8A 5I5VA 1IYEA 2Y4RA 5BWWA 3T99A 2ZGIA 3DTGA 3CSWA 4CKEA 3TEKA 1A3GA 4DAAA 3LQSA 5CE8A 3U0GA 4K6NA 3T7AA 4GLWA 2Q7DA 1EKFA 5HNEA 1ET0A 1EKVA 2A1HA 1A0GA 5DGIA 3JZ6A 4Q4DA 3DAAA 3QQMA 5I5SA 5BWTA 1IYDA 3T9AA 3PFFA 4RCNA 4WHXA 4TM5A 1UC9A 3T9CA 2X5RA 3HT5A 4PBCA 4HN2A 2EJ3A 3VPDA 4NZOA 2QB5A 4CKCA 1KTAA 5DAAA 4M0JA 1I1KA 2COJA 4CMFA 2ODTX 2HDKA 4NZMA 5CM0A 5K3WA 4Q4CA 4CKBA 1ZAUA 5I5YA 4UUGA 2HGXA 3BACA 3T9BA 5I5XA 3UZOA 3UZBA 2COIA 5I5WA 3T9DA 1EKPA 5BWVA 5I47A 3T54A 2COGA 2EJ2A 2DABA 3DTFA 5FR9A 2DAAA 4CHIA 3WWHA 2HHFA 2EJ0A 5BWXA 1I2LA 5I5UA 4CE5A 2HHFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2K A;  5BWU A;  4JXU A;  3SNO A;  5I5T A;  3CEB A;  2HGW A;  4TVI A;  1DAA A;  3UYY A;  4DQN A;  2ABJ A;  5CR5 A;  2EIY A;  5I60 A;  1I1M A;  1WRV A;  1G2W A;  3WWI A;  1I1L A;  5E25 A;  2HG8 A;  5BWR A;  4CMD A;  3WWJ A;  3LUL A;  1KT8 A;  5I5V A;  1IYE A;  2Y4R A;  5BWW A;  2ZGI A;  3DTG A;  3CSW A;  1A3G A;  4DAA A;  3LQS A;  5CE8 A;  3U0G A;  4K6N A;  1EKF A;  5HNE A;  1ET0 A;  1EKV A;  2A1H A;  1A0G A;  3JZ6 A;  3DAA A;  3QQM A;  5I5S A;  5BWT A;  1IYD A;  4WHX A;  4TM5 A;  3HT5 A;  4PBC A;  2EJ3 A;  1KTA A;  5DAA A;  4M0J A;  1I1K A;  2COJ A;  4CMF A;  2HDK A;  5CM0 A;  5K3W A;  5I5Y A;  4UUG A;  2HGX A;  5I5X A;  3UZO A;  3UZB A;  2COI A;  5I5W A;  1EKP A;  5BWV A;  2COG A;  2EJ2 A;  2DAB A;  3DTF A;  5FR9 A;  2DAA A;  4CHI A;  3WWH A;  2HHF A;  2EJ0 A;  5BWX A;  1I2L A;  5I5U A;  4CE5 A;  2HHF B; 
#chains in the Genus database with same CATH topology
 4YB8 B;  4I50 F;  4IWY A;  1DV1 A;  3CEB A;  3TIG A;  2I87 A;  1VKZ A;  5JQW A;  1VS0 A;  2VUG A;  3GID A;  4O7V A;  2W6Z A;  3SGI A;  5D8D A;  4DQN A;  4NZN A;  1A48 A;  5D1O A;  3TW7 A;  1T36 A;  5JQG F;  5CR5 A;  2I8C A;  5FNV F;  5I60 A;  1EYZ A;  3T9F A;  4TUY F;  3LP8 A;  3N6R A;  5D1O B;  3JZF A;  4O7W A;  4WBN F;  4FFM A;  2YZN A;  3PN1 A;  1I1L A;  2IP4 A;  2XD4 A;  2WYO A;  2CZG A;  4HQ6 A;  2FP4 B;  3R5X A;  2W6O A;  1FVI A;  3JZI A;  3WWJ A;  1GLV A;  2DLN A;  3GDE A;  3BA9 A;  4ZHQ F;  2GQS A;  4O84 A;  5C1P A;  5BWW A;  3MWD A;  4FU0 A;  3DTG A;  3CSW A;  1P16 A;  4DAA A;  3U0G A;  3K3P A;  4PZ7 A;  1EKV A;  2R86 A;  4HNT A;  3R5H A;  1A0G A;  4MV3 A;  1EHI A;  4Q4D A;  2GQR A;  4EFB A;  4XZ3 B;  5BWT A;  1V9P A;  2PN1 A;  3N8D A;  3R9R A;  2R7L A;  3PFF A;  3TQT A;  4RCN A;  5LP6 F;  2W6N A;  4EFE A;  4TM5 A;  4EG0 A;  2HGS A;  5J2U F;  3JRW A;  4HN2 A;  4LH6 A;  5DIS C;  5J2T F;  3TY8 A;  3OUU A;  2QB5 A;  4CKC A;  1KUT A;  1CKM A;  4L1K A;  3JSN A;  4M0J A;  2PVP A;  2QF7 A;  3UQ8 A;  4HNU A;  5JVD F;  3KAJ A;  1SCU B;  4CMF A;  4NZM A;  2ZDH A;  1A0I A;  3HO8 A;  3E5N A;  4CKB A;  2VQD A;  5I5Y A;  4UUG A;  3NBY B;  2YWV A;  4DRF A;  3T9B A;  5I5X A;  4MV6 A;  3UZO A;  2COI A;  4PZ8 A;  3DF7 A;  2CNV A;  5I47 A;  1EUC B;  5LOV F;  2DAB A;  3MJF A;  4FE2 A;  2CNU A;  5FR9 A;  2DAA A;  2ZDQ A;  4ZOL F;  3TW6 A;  3S24 A;  1C30 A;  4YAK B;  1CKN A;  3WNZ A;  1ULZ A;  1KC7 A;  2VR1 A;  1CKN B;  4JXU A;  1IOW A;  5I5T A;  1M6V A;  1JKJ B;  2Q2T A;  3UYY A;  2HJW A;  1CS0 A;  3I12 A;  1WR2 A;  5K2M A;  1S68 A;  1I1M A;  4M9U A;  1WRV A;  3G8D A;  4O81 A;  2HVR A;  1G2W A;  4LH7 A;  4YBZ B;  3G8C A;  4MV8 A;  4O86 A;  2YRX A;  5BYB A;  2SCU B;  3W5O A;  5E25 A;  3MWE A;  4XYL B;  1JDB B;  5DGH A;  2HG8 A;  4TV8 F;  4CMD A;  3NUA A;  1GSA A;  2Q2U A;  1VBH A;  2R7N A;  5I5V A;  1M0T A;  4GLX A;  2VPQ A;  3AX6 A;  2Y4R A;  3ORQ A;  3RR5 A;  2YW2 A;  3T99 A;  3V4S A;  2HIX A;  2OLS A;  4CKE A;  1A3G A;  3LQS A;  3T7A A;  4GLW A;  2FPI B;  2Q7D A;  4FFN A;  4ME6 A;  2A1H A;  4I55 F;  5FPR A;  3R5F A;  3DAA A;  4MA0 A;  4I4T F;  4YAJ B;  2NU8 B;  2R87 A;  1OBD A;  1A9X A;  2HIV A;  5CA0 F;  2EJ3 A;  4O2B F;  4O7Z A;  4NYE A;  5DMX A;  3GLK A;  4O7L A;  3VMM A;  3BAA A;  1DV2 A;  3BAB A;  1W96 A;  3Q1K A;  1I1K A;  2ODT X;  2HDK A;  3RUP A;  3ORR A;  5CM0 A;  4MV7 A;  3TY9 A;  5K3W A;  5LYJ F;  2R7M A;  3AW8 A;  5IYZ F;  5BPF A;  1ZAU A;  1XK5 A;  3OUZ A;  1DGS A;  2GLT A;  4FFP A;  3T9D A;  3T54 A;  3KYH C;  2YS6 A;  2PBZ A;  3GB8 B;  3SE7 A;  1E4E A;  3DTF A;  3TY5 A;  2HVQ A;  3WWH A;  4EGQ A;  2HHF A;  3QWU A;  5H80 A;  1E4E B;  1I2L A;  1EUD B;  5I5U A;  3UFX B;  2HHF B;  2Z02 A;  4O4J F;  1M0W A;  1I2K A;  5BWU A;  4HR7 A;  1TA8 A;  4O83 A;  1P8L A;  3R23 A;  5BPH A;  2HGW A;  2V59 A;  4TVI A;  4O7T A;  1DAA A;  5KS8 A;  2ABJ A;  5HV6 A;  2W6P A;  2GPS A;  3ETJ A;  2C00 A;  1B04 A;  2XCL A;  4FFO A;  2HVS A;  1B6R A;  2NUA B;  2FPG B;  3HBL A;  3HB9 A;  2V58 A;  4XX0 B;  4CC6 A;  2I80 A;  2YZM A;  3V4Z A;  2W6M A;  1TAE A;  3KAL A;  3KAK A;  4XYM B;  4ZI7 F;  4O2A F;  1IYE A;  4MAM A;  3U9T A;  4EGJ A;  1KEE A;  2ZGI A;  1XDN A;  3TEK A;  3TII A;  4FFL A;  2QK4 A;  5HNE A;  1ET0 A;  4C5A A;  3RV3 A;  3JZ6 A;  1GSH A;  4CC5 A;  5I5S A;  4UCO A;  1IYD A;  2W71 A;  4YJ3 F;  1B6S A;  3K5H A;  4ZQI A;  2YZG A;  4WHX A;  3JRX A;  3JSL A;  1BXR A;  4C5C A;  2X5R A;  1CQJ B;  3VPD A;  5HBR B;  1VBG A;  4O7R A;  3BA8 A;  4EQ5 A;  5DAA A;  5BMV F;  3RV4 A;  1CKO A;  2CFM A;  4RZQ A;  4PZ6 A;  3RFC A;  1EZ1 A;  4UCR A;  4O7Y A;  3TIN A;  4UCU A;  2CNQ A;  4Q4C A;  5KX5 F;  4DIM A;  3WO1 A;  4FFR A;  5CA1 F;  1EKP A;  2DIK A;  5JVL A;  2COG A;  2EJ2 A;  1GSO A;  2W6Q A;  5JH7 F;  2DWC A;  2YYA A;  4E4T A;  4CE5 A;  5LXT F;  1DIK A;  3U9S A;  2R82 A;  3RTX A;  3SNO A;  2X0S A;  1I7L A;  4O7N A;  3K5I A;  4UCV A;  5CAE B;  5KKN B;  1W93 A;  1Z2O X;  2NU6 B;  2R7K A;  3VA7 A;  2FPP B;  4QSH A;  4Y8V B;  3NC0 B;  4HNV A;  5C1O A;  2EIY A;  1KJQ A;  3T9E A;  5BYA A;  1UC8 A;  1CE8 A;  3KRE A;  1Z2P X;  2DZD A;  4FGR A;  1BNC A;  1GGO A;  4IWX A;  4O82 A;  2YL2 A;  1KBL A;  3WWI A;  1IOV A;  1OBG A;  2R85 A;  3W1B A;  5BWR A;  2GPW A;  2OWO A;  1I7N A;  3LUL A;  1KT8 A;  1JLL B;  4MV1 A;  1KJI A;  4YJ2 F;  3BG5 A;  1AUV A;  5CB4 F;  2YRW A;  4IHJ F;  1KJJ A;  1CQI B;  4UCS A;  4MA5 A;  5CE8 A;  4O4I F;  4K6N A;  3ETH A;  5EZY F;  2NU9 B;  1EKF A;  4O4H F;  2YS7 A;  2Z04 A;  5DGI A;  5C8Y F;  3VOT A;  5D1P A;  2ZDG A;  3QQM A;  3NBZ B;  4UFZ A;  3T9A A;  2FB9 A;  3LWB A;  1X9N A;  3GJX B;  1UC9 A;  3T9C A;  3HT5 A;  4PBC A;  2NU7 B;  1C3O A;  4NZO A;  1JDE A;  3U54 A;  3WO0 A;  3L2P A;  1KTA A;  5FPO A;  2R84 A;  1KJ8 A;  4C5B A;  4MV4 A;  1AUX A;  4MV9 A;  4O4L F;  2COJ A;  3VPC A;  4E6N A;  3QFF A;  4DLK A;  4TV9 F;  1KJ9 A;  5GON F;  4UCT A;  3VNN A;  2HGX A;  3BAC A;  3Q2O A;  4IIJ F;  3UZB A;  5I5W A;  5BWV A;  4IZO A;  2W70 A;  1PK8 A;  1Z2N X;  2V5A A;  4EEQ A;  4CHI A;  1PX2 A;  2P0A A;  3U55 A;  2YZL A;  2EJ0 A;  5BWX A;  4O7S A;  5LA6 F;  3VPB A;  3W1G A;  2J9G A; 
#chains in the Genus database with same CATH homology
 1I2K A;  4IWY A;  5BWU A;  4JXU A;  3SNO A;  5I5T A;  3CEB A;  2HGW A;  4TVI A;  1DAA A;  3SGI A;  3UYY A;  5KS8 A;  4DQN A;  2ABJ A;  4NZN A;  3TW7 A;  5CR5 A;  2EIY A;  5I60 A;  5K2M A;  3T9F A;  3T9E A;  5BYA A;  1I1M A;  1UC8 A;  1WRV A;  1G2W A;  4IWX A;  3WWI A;  1I1L A;  5BYB A;  5E25 A;  5DGH A;  2HG8 A;  5BWR A;  4CMD A;  3WWJ A;  3LUL A;  1KT8 A;  5I5V A;  1IYE A;  2Y4R A;  5BWW A;  3T99 A;  2ZGI A;  3DTG A;  3CSW A;  4CKE A;  3TEK A;  1A3G A;  4DAA A;  3LQS A;  5CE8 A;  3U0G A;  4K6N A;  3T7A A;  4GLW A;  2Q7D A;  1EKF A;  5HNE A;  1ET0 A;  1EKV A;  2A1H A;  1A0G A;  5DGI A;  3JZ6 A;  4Q4D A;  3DAA A;  3QQM A;  5I5S A;  5BWT A;  1IYD A;  3T9A A;  3PFF A;  4RCN A;  4WHX A;  4TM5 A;  1UC9 A;  3T9C A;  2X5R A;  3HT5 A;  4PBC A;  4HN2 A;  2EJ3 A;  3VPD A;  4NZO A;  2QB5 A;  4CKC A;  1KTA A;  5DAA A;  4M0J A;  1I1K A;  2COJ A;  4CMF A;  2ODT X;  2HDK A;  4NZM A;  5CM0 A;  5K3W A;  4Q4C A;  4CKB A;  1ZAU A;  5I5Y A;  4UUG A;  2HGX A;  3BAC A;  3T9B A;  5I5X A;  3UZO A;  3UZB A;  2COI A;  5I5W A;  3T9D A;  1EKP A;  5BWV A;  5I47 A;  3T54 A;  2COG A;  2EJ2 A;  2DAB A;  3DTF A;  5FR9 A;  2DAA A;  4CHI A;  3WWH A;  2HHF A;  2EJ0 A;  5BWX A;  1I2L A;  5I5U A;  4CE5 A;  2HHF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...