2Y4RA

Crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
270
structure length
270
Chain Sequence
b'LDWVDGRPAAELSVRDRGLAYGDGLFETLAVRAGTPRLLERHLARLEEGCRRLAIPLDTAALRQELLAFCAALGDGVAKLIVTRGEGLRGYAPPAEASPRRILSGSPRPAYPERHWQQGVRLFACRTRLAEQPLLAGLKHLNRLEQVLARAEWSDAGHAEGLMLDVHERVVEGVFSNLLLVLDGTLVAPDLRRCGVAGVMRAELLERAEGIGVPLAIRDVSMAELATADEVFLCNSQFGIWPVRALDEHVWPVGELTRKLQDQLRDDLDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-AMINO-4-DEOXYCHORISMATE LYASE
molecule tags Lyase
source organism Pseudomonas aeruginosa
publication title Pseudomonas Aeruginosa 4-Amino-4-Deoxychorismate Lyase: Spatial Conservation of an Active Site Tyrosine and Classification of Two Types of Enzyme.
pubmed doi rcsb
total genus 81
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 4.1.3.38: Aminodeoxychorismate lyase.
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2y4rA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2y4rA01
3CSWA 2ABJA 5I5SA 2HHFA 5I60A 2COGA 3HT5A 1I2KA 4UUGA 3UZBA 3UZOA 5CR5A 3LULA 5BWUA 3DTFA 4CHIA 4DAAA 4TM5A 2DABA 4CMDA 2HDKA 1IYDA 3SNOA 4CE5A 4DQNA 1WRVA 1A0GA 1G2WA 4CMFA 5I5WA 1I2LA 3WWHA 5CM0A 5I5VA 1ET0A 3JZ6A 2EJ0A 3WWJA 4M0JA 2ZGIA 1EKPA 2HGWA 1I1KA 5I5UA 5I5XA 3DTGA 5I5TA 5BWVA 4TVIA 3WWIA 4PBCA 1KTAA 3U0GA 2COJA 3UYYA 1EKVA 5CE8A 5DAAA 1DAAA 1IYEA 1EKFA 3LQSA 3CEBA 5BWXA 1A3GA 2EJ2A 4K6NA 2HGXA 2EIYA 3DAAA 5BWTA 5K3WA 4JXUA 5E25A 5FR9A 2DAAA 1KT8A 2HHFB 2A1HA 3QQMA 5I5YA 2COIA 1I1LA 2Y4RA 5BWRA 2HG8A 1I1MA 2EJ3A 5BWWA 4WHXA 5HNEA
chains in the Genus database with same CATH superfamily
4Q4DA 3CSWA 3HT5A 2V5AA 1I2KA 3VMMA 3UZBA 3T9BA 2R7MA 3E5NA 3LULA 1EHIA 4CHIA 2CNVA 3RUPA 4UFZA 2DABA 1IOWA 2R7KA 2VUGA 3PN1A 4YAKB 1DGSA 4EGJA 3SNOA 2GQSA 2YZNA 3JZFA 5HBRB 3TY5A 5KS8A 4TUYF 5BYAA 4FGRA 4TV9F 5I5VA 1Z2NX 1ET0A 3JZ6A 4ME6A 2HVRA 3KAKA 1CKMA 4LH6A 2PN1A 3W1BA 3DF7A 3W1GA 4PZ8A 3PFFA 2ZGIA 4EFBA 2DWCA 1A9XA 4MAMA 5I5TA 2I80A 5CA0F 4PBCA 1KTAA 3U0GA 2YRXA 3ORQA 3JSNA 4GLWA 1JDBB 4O7ZA 3TY8A 1TAEA 3TW6A 3T9AA 2DIKA 2FPIB 3BA8A 3G8DA 4O4JF 4IWXA 2OWOA 3TIIA 3KALA 3LQSA 4O84A 5CB4F 3VA7A 4FFOA 2ZDQA 1XDNA 3JRWA 2EJ2A 3T9FA 5D8DA 2HJWA 2YWVA 4WBNF 1AUVA 4EEQA 4I4TF 3WNZA 5JQGF 3RR5A 4JXUA 4YAJB 1EZ1A 4IZOA 3QQMA 5I5YA 3LP8A 2YZGA 3GIDA 1A48A 2Y4RA 1KUTA 5DGIA 1CQIB 2P0AA 3UFXB 4DLKA 3K5HA 4O82A 3T7AA 5D1OA 1I1MA 4O81A 3GJXB 4LH7A 4TV8F 4NYEA 1UC8A 2W6ZA 2QB5A 2WYOA 2R85A 2CFMA 4WHXA 1KJ8A 5HNEA 3KAJA 1FVIA 5KKNB 2COGA 5LYJF 4M9UA 1KBLA 4MV7A 4PZ6A 5C1OA 4DIMA 1DV1A 4DAAA 3T54A 4YBZB 2YYAA 2R7LA 1ZAUA 1B6SA 2ZDHA 1EUCB 1VBHA 4NZOA 4MV8A 3KYHC 4O2BF 3TINA 1S68A 1C30A 4DQNA 4IHJF 4O4HF 4O7NA 1G2WA 4CMFA 4MV4A 5JH7F 4FU0A 4Q4CA 4XYMB 1I2LA 3L2PA 1DIKA 4CC5A 4O2AF 3ETJA 4FFLA 3WWHA 2YRWA 5CM0A 3NC0B 3HBLA 2QK4A 3NBZB 4EGQA 5D1OB 1I7NA 4RCNA 3BACA 3GDEA 3TY9A 5J2UF 4PZ7A 1V9PA 4TVIA 3VPDA 3Q1KA 4O7WA 2FP4B 1JLLB 3HO8A 1M6VA 4RZQA 4ZOLF 3W5OA 1GSOA 4IWYA 4MV6A 1A0IA 2PVPA 5DAAA 4GLXA 5IYZF 1W96A 4NZMA 5LOVF 4NZNA 1M0TA 4YJ2F 4K6NA 1M0WA 4UCOA 5DISC 4MV3A 1IOVA 2W6OA 3U9SA 1KEEA 5JVDF 5BWTA 2C00A 5E25A 3U55A 2XD4A 1KT8A 3T9EA 2A1HA 2W6NA 3S24A 1VBGA 4Y8VB 1JKJB 3T99A 2PBZA 4O7VA 2DLNA 4CKCA 4CKEA 1KJIA 5H80A 3JSLA 3TQTA 1BNCA 4YB8B 2EJ3A 5BWWA 4FE2A 4FFNA 5JQWA 4I55F 2ABJA 2VQDA 4XZ3B 2HHFA 4IIJF 1P16A 2VPQA 4L1KA 4UUGA 1XK5A 2V59A 4EFEA 3BAAA 3UZOA 2W70A 5CR5A 3T9DA 3TIGA 5FNVF 2YS6A 1KJQA 4CKBA 4TM5A 1JDEA 3I12A 2R7NA 4O7YA 2Z04A 1I7LA 3N6RA 3NUAA 2HVQA 2HDKA 1CKNA 5K2MA 2GQRA 1IYDA 1WRVA 1A0GA 1EYZA 4FFRA 3R5FA 1Z2PX 1KJ9A 2I87A 5GONF 2HVSA 4ZQIA 3Q2OA 2X0SA 2GPSA 4O86A 4FFMA 4O4IF 2NU9B 4MV1A 2GLTA 4HQ6A 3U54A 1CQJB 1P8LA 3NBYB 5CA1F 2EJ0A 4HNUA 2CZGA 2HIVA 4M0JA 2HIXA 4O7TA 1BXRA 5I5UA 1W93A 5I5XA 2QF7A 3MWDA 5CAEB 1TA8A 2DZDA 5DMXA 4EG0A 2ZDGA 5BWVA 2X5RA 3WWIA 1DV2A 1GLVA 4HNTA 2R87A 2ODTX 4O83A 3UYYA 1VS0A 1EKVA 3V4SA 1OBGA 4UCSA 1DAAA 3VOTA 3V4ZA 5HV6A 4UCTA 1EKFA 2CNQA 2Z02A 3ORRA 5BWXA 2HGSA 2R86A 2YS7A 5BPFA 3UQ8A 2GPWA 4HNVA 1Z2OX 2YL2A 2FPGB 5DGHA 3JZIA 1VKZA 2HGXA 1KC7A 2W71A 4XYLB 3MWEA 1EUDB 3AW8A 3TW7A 3BABA 2EIYA 4ZI7F 3G8CA 4MA5A 3VPBA 1ULZA 5K3WA 3BG5A 5FPRA 2R82A 5FR9A 2DAAA 2NU7B 3LWBA 3HB9A 2YZLA 5BYBA 4UCVA 2HG8A 3WO0A 3R5XA 1B6RA 4C5CA 2FB9A 1KJJA 1T36A 4UCRA 2Q2TA 3R23A 3SGIA 4FFPA 2I8CA 5I5SA 1E4EA 5I60A 3GLKA 4UCUA 4O7LA 5C1PA 4O7SA 2W6MA 4I50F 5BWUA 5LP6F 1C3OA 3DTFA 3QFFA 1X9NA 3GB8B 5FPOA 3AX6A 2OLSA 3RTXA 4CMDA 3K3PA 2VR1A 4E6NA 5LA6F 2W6QA 4C5BA 3KREA 4CE5A 2W6PA 5I47A 1GSAA 1B04A 1PX2A 5I5WA 2YW2A 4E4TA 4O4LF 2FPPB 3WO1A 2IP4A 3N8DA 3OUZA 2V58A 3T9CA 5C8YF 2Q7DA 3TEKA 4EQ5A 2YZMA 3WWJA 2CNUA 1EKPA 2HGWA 1I1KA 4YJ3F 3R5HA 4QSHA 2NU6B 3DTGA 4HN2A 2R84A 1GSHA 1GGOA 3U9TA 3ETHA 3RV4A 2COJA 4CC6A 4XX0B 5CE8A 3SE7A 5LXTF 4O7RA 4MA0A 1IYEA 1E4EB 3CEBA 3RFCA 1A3GA 1OBDA 1WR2A 3VPCA 2XCLA 5KX5F 5EZYF 1CKOA 1AUXA 5BPHA 1PK8A 4C5AA 3MJFA 3RV3A 1CS0A 5J2TF 3DAAA 1CKNB 2J9GA 4ZHQF 2NU8B 2Q2UA 3K5IA 2SCUB 3QWUA 2HHFB 4HR7A 1SCUB 2COIA 5D1PA 1I1LA 5BWRA 5JVLA 3JRXA 5BMVF 4DRFA 3VNNA 3BA9A 3OUUA 1UC9A 3R9RA 4MV9A 1CE8A 2NUAB
chains in the Genus database with same CATH topology
4Q4DA 3CSWA 2ABJA 5I5SA 2HHFA 5I60A 2COGA 3HT5A 1I2KA 4UUGA 3UZBA 3UZOA 3T9BA 5CR5A 3LULA 5BWUA 3T9DA 4CKBA 3DTFA 4CHIA 4DAAA 3T54A 4TM5A 2DABA 4CMDA 1ZAUA 2HDKA 5K2MA 4NZOA 1IYDA 3SNOA 4CE5A 5I47A 4DQNA 1WRVA 1A0GA 5KS8A 1G2WA 4CMFA 5I5WA 4Q4CA 5BYAA 1I2LA 3WWHA 5CM0A 5I5VA 1ET0A 3JZ6A 2EJ0A 2Q7DA 3TEKA 3WWJA 4M0JA 3PFFA 2ZGIA 1EKPA 2HGWA 1I1KA 5I5UA 5I5XA 4RCNA 3DTGA 3BACA 4HN2A 5I5TA 5BWVA 2X5RA 4TVIA 3WWIA 3VPDA 4PBCA 1KTAA 3U0GA 2ODTX 2COJA 4GLWA 3UYYA 1EKVA 4IWYA 5CE8A 3T9AA 5DAAA 1DAAA 1IYEA 4IWXA 4NZMA 1EKFA 3LQSA 3CEBA 5BWXA 1A3GA 4NZNA 2EJ2A 3T9FA 5DGHA 4K6NA 2HGXA 3TW7A 2EIYA 3DAAA 5BWTA 5K3WA 4JXUA 5E25A 5FR9A 2DAAA 1KT8A 3T9EA 2HHFB 2A1HA 3QQMA 5I5YA 2COIA 1I1LA 2Y4RA 5BWRA 5DGIA 3T99A 5BYBA 3T7AA 2HG8A 4CKCA 4CKEA 1I1MA 2EJ3A 1UC8A 5BWWA 1UC9A 2QB5A 3SGIA 4WHXA 3T9CA 5HNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSW A;  2ABJ A;  5I5S A;  2HHF A;  5I60 A;  2COG A;  3HT5 A;  1I2K A;  4UUG A;  3UZB A;  3UZO A;  5CR5 A;  3LUL A;  5BWU A;  3DTF A;  4CHI A;  4DAA A;  4TM5 A;  2DAB A;  4CMD A;  2HDK A;  1IYD A;  3SNO A;  4CE5 A;  4DQN A;  1WRV A;  1A0G A;  1G2W A;  4CMF A;  5I5W A;  1I2L A;  3WWH A;  5CM0 A;  5I5V A;  1ET0 A;  3JZ6 A;  2EJ0 A;  3WWJ A;  4M0J A;  2ZGI A;  1EKP A;  2HGW A;  1I1K A;  5I5U A;  5I5X A;  3DTG A;  5I5T A;  5BWV A;  4TVI A;  3WWI A;  4PBC A;  1KTA A;  3U0G A;  2COJ A;  3UYY A;  1EKV A;  5CE8 A;  5DAA A;  1DAA A;  1IYE A;  1EKF A;  3LQS A;  3CEB A;  5BWX A;  1A3G A;  2EJ2 A;  4K6N A;  2HGX A;  2EIY A;  3DAA A;  5BWT A;  5K3W A;  4JXU A;  5E25 A;  5FR9 A;  2DAA A;  1KT8 A;  2HHF B;  2A1H A;  3QQM A;  5I5Y A;  2COI A;  1I1L A;  2Y4R A;  5BWR A;  2HG8 A;  1I1M A;  2EJ3 A;  5BWW A;  4WHX A;  5HNE A; 
#chains in the Genus database with same CATH topology
 4Q4D A;  3CSW A;  3HT5 A;  2V5A A;  1I2K A;  3VMM A;  3UZB A;  3T9B A;  2R7M A;  3E5N A;  3LUL A;  1EHI A;  4CHI A;  2CNV A;  3RUP A;  4UFZ A;  2DAB A;  1IOW A;  2R7K A;  2VUG A;  3PN1 A;  4YAK B;  1DGS A;  4EGJ A;  3SNO A;  2GQS A;  2YZN A;  3JZF A;  5HBR B;  3TY5 A;  5KS8 A;  4TUY F;  5BYA A;  4FGR A;  4TV9 F;  5I5V A;  1Z2N X;  1ET0 A;  3JZ6 A;  4ME6 A;  2HVR A;  3KAK A;  1CKM A;  4LH6 A;  2PN1 A;  3W1B A;  3DF7 A;  3W1G A;  4PZ8 A;  3PFF A;  2ZGI A;  4EFB A;  2DWC A;  1A9X A;  4MAM A;  5I5T A;  2I80 A;  5CA0 F;  4PBC A;  1KTA A;  3U0G A;  2YRX A;  3ORQ A;  3JSN A;  4GLW A;  1JDB B;  4O7Z A;  3TY8 A;  1TAE A;  3TW6 A;  3T9A A;  2DIK A;  2FPI B;  3BA8 A;  3G8D A;  4O4J F;  4IWX A;  2OWO A;  3TII A;  3KAL A;  3LQS A;  4O84 A;  5CB4 F;  3VA7 A;  4FFO A;  2ZDQ A;  1XDN A;  3JRW A;  2EJ2 A;  3T9F A;  5D8D A;  2HJW A;  2YWV A;  4WBN F;  1AUV A;  4EEQ A;  4I4T F;  3WNZ A;  5JQG F;  3RR5 A;  4JXU A;  4YAJ B;  1EZ1 A;  4IZO A;  3QQM A;  5I5Y A;  3LP8 A;  2YZG A;  3GID A;  1A48 A;  2Y4R A;  1KUT A;  5DGI A;  1CQI B;  2P0A A;  3UFX B;  4DLK A;  3K5H A;  4O82 A;  3T7A A;  5D1O A;  1I1M A;  4O81 A;  3GJX B;  4LH7 A;  4TV8 F;  4NYE A;  1UC8 A;  2W6Z A;  2QB5 A;  2WYO A;  2R85 A;  2CFM A;  4WHX A;  1KJ8 A;  5HNE A;  3KAJ A;  1FVI A;  5KKN B;  2COG A;  5LYJ F;  4M9U A;  1KBL A;  4MV7 A;  4PZ6 A;  5C1O A;  4DIM A;  1DV1 A;  4DAA A;  3T54 A;  4YBZ B;  2YYA A;  2R7L A;  1ZAU A;  1B6S A;  2ZDH A;  1EUC B;  1VBH A;  4NZO A;  4MV8 A;  3KYH C;  4O2B F;  3TIN A;  1S68 A;  1C30 A;  4DQN A;  4IHJ F;  4O4H F;  4O7N A;  1G2W A;  4CMF A;  4MV4 A;  5JH7 F;  4FU0 A;  4Q4C A;  4XYM B;  1I2L A;  3L2P A;  1DIK A;  4CC5 A;  4O2A F;  3ETJ A;  4FFL A;  3WWH A;  2YRW A;  5CM0 A;  3NC0 B;  3HBL A;  2QK4 A;  3NBZ B;  4EGQ A;  5D1O B;  1I7N A;  4RCN A;  3BAC A;  3GDE A;  3TY9 A;  5J2U F;  4PZ7 A;  1V9P A;  4TVI A;  3VPD A;  3Q1K A;  4O7W A;  2FP4 B;  1JLL B;  3HO8 A;  1M6V A;  4RZQ A;  4ZOL F;  3W5O A;  1GSO A;  4IWY A;  4MV6 A;  1A0I A;  2PVP A;  5DAA A;  4GLX A;  5IYZ F;  1W96 A;  4NZM A;  5LOV F;  4NZN A;  1M0T A;  4YJ2 F;  4K6N A;  1M0W A;  4UCO A;  5DIS C;  4MV3 A;  1IOV A;  2W6O A;  3U9S A;  1KEE A;  5JVD F;  5BWT A;  2C00 A;  5E25 A;  3U55 A;  2XD4 A;  1KT8 A;  3T9E A;  2A1H A;  2W6N A;  3S24 A;  1VBG A;  4Y8V B;  1JKJ B;  3T99 A;  2PBZ A;  4O7V A;  2DLN A;  4CKC A;  4CKE A;  1KJI A;  5H80 A;  3JSL A;  3TQT A;  1BNC A;  4YB8 B;  2EJ3 A;  5BWW A;  4FE2 A;  4FFN A;  5JQW A;  4I55 F;  2ABJ A;  2VQD A;  4XZ3 B;  2HHF A;  4IIJ F;  1P16 A;  2VPQ A;  4L1K A;  4UUG A;  1XK5 A;  2V59 A;  4EFE A;  3BAA A;  3UZO A;  2W70 A;  5CR5 A;  3T9D A;  3TIG A;  5FNV F;  2YS6 A;  1KJQ A;  4CKB A;  4TM5 A;  1JDE A;  3I12 A;  2R7N A;  4O7Y A;  2Z04 A;  1I7L A;  3N6R A;  3NUA A;  2HVQ A;  2HDK A;  1CKN A;  5K2M A;  2GQR A;  1IYD A;  1WRV A;  1A0G A;  1EYZ A;  4FFR A;  3R5F A;  1Z2P X;  1KJ9 A;  2I87 A;  5GON F;  2HVS A;  4ZQI A;  3Q2O A;  2X0S A;  2GPS A;  4O86 A;  4FFM A;  4O4I F;  2NU9 B;  4MV1 A;  2GLT A;  4HQ6 A;  3U54 A;  1CQJ B;  1P8L A;  3NBY B;  5CA1 F;  2EJ0 A;  4HNU A;  2CZG A;  2HIV A;  4M0J A;  2HIX A;  4O7T A;  1BXR A;  5I5U A;  1W93 A;  5I5X A;  2QF7 A;  3MWD A;  5CAE B;  1TA8 A;  2DZD A;  5DMX A;  4EG0 A;  2ZDG A;  5BWV A;  2X5R A;  3WWI A;  1DV2 A;  1GLV A;  4HNT A;  2R87 A;  2ODT X;  4O83 A;  3UYY A;  1VS0 A;  1EKV A;  3V4S A;  1OBG A;  4UCS A;  1DAA A;  3VOT A;  3V4Z A;  5HV6 A;  4UCT A;  1EKF A;  2CNQ A;  2Z02 A;  3ORR A;  5BWX A;  2HGS A;  2R86 A;  2YS7 A;  5BPF A;  3UQ8 A;  2GPW A;  4HNV A;  1Z2O X;  2YL2 A;  2FPG B;  5DGH A;  3JZI A;  1VKZ A;  2HGX A;  1KC7 A;  2W71 A;  4XYL B;  3MWE A;  1EUD B;  3AW8 A;  3TW7 A;  3BAB A;  2EIY A;  4ZI7 F;  3G8C A;  4MA5 A;  3VPB A;  1ULZ A;  5K3W A;  3BG5 A;  5FPR A;  2R82 A;  5FR9 A;  2DAA A;  2NU7 B;  3LWB A;  3HB9 A;  2YZL A;  5BYB A;  4UCV A;  2HG8 A;  3WO0 A;  3R5X A;  1B6R A;  4C5C A;  2FB9 A;  1KJJ A;  1T36 A;  4UCR A;  2Q2T A;  3R23 A;  3SGI A;  4FFP A;  2I8C A;  5I5S A;  1E4E A;  5I60 A;  3GLK A;  4UCU A;  4O7L A;  5C1P A;  4O7S A;  2W6M A;  4I50 F;  5BWU A;  5LP6 F;  1C3O A;  3DTF A;  3QFF A;  1X9N A;  3GB8 B;  5FPO A;  3AX6 A;  2OLS A;  3RTX A;  4CMD A;  3K3P A;  2VR1 A;  4E6N A;  5LA6 F;  2W6Q A;  4C5B A;  3KRE A;  4CE5 A;  2W6P A;  5I47 A;  1GSA A;  1B04 A;  1PX2 A;  5I5W A;  2YW2 A;  4E4T A;  4O4L F;  2FPP B;  3WO1 A;  2IP4 A;  3N8D A;  3OUZ A;  2V58 A;  3T9C A;  5C8Y F;  2Q7D A;  3TEK A;  4EQ5 A;  2YZM A;  3WWJ A;  2CNU A;  1EKP A;  2HGW A;  1I1K A;  4YJ3 F;  3R5H A;  4QSH A;  2NU6 B;  3DTG A;  4HN2 A;  2R84 A;  1GSH A;  1GGO A;  3U9T A;  3ETH A;  3RV4 A;  2COJ A;  4CC6 A;  4XX0 B;  5CE8 A;  3SE7 A;  5LXT F;  4O7R A;  4MA0 A;  1IYE A;  1E4E B;  3CEB A;  3RFC A;  1A3G A;  1OBD A;  1WR2 A;  3VPC A;  2XCL A;  5KX5 F;  5EZY F;  1CKO A;  1AUX A;  5BPH A;  1PK8 A;  4C5A A;  3MJF A;  3RV3 A;  1CS0 A;  5J2T F;  3DAA A;  1CKN B;  2J9G A;  4ZHQ F;  2NU8 B;  2Q2U A;  3K5I A;  2SCU B;  3QWU A;  2HHF B;  4HR7 A;  1SCU B;  2COI A;  5D1P A;  1I1L A;  5BWR A;  5JVL A;  3JRX A;  5BMV F;  4DRF A;  3VNN A;  3BA9 A;  3OUU A;  1UC9 A;  3R9R A;  4MV9 A;  1CE8 A;  2NUA B; 
#chains in the Genus database with same CATH homology
 4Q4D A;  3CSW A;  2ABJ A;  5I5S A;  2HHF A;  5I60 A;  2COG A;  3HT5 A;  1I2K A;  4UUG A;  3UZB A;  3UZO A;  3T9B A;  5CR5 A;  3LUL A;  5BWU A;  3T9D A;  4CKB A;  3DTF A;  4CHI A;  4DAA A;  3T54 A;  4TM5 A;  2DAB A;  4CMD A;  1ZAU A;  2HDK A;  5K2M A;  4NZO A;  1IYD A;  3SNO A;  4CE5 A;  5I47 A;  4DQN A;  1WRV A;  1A0G A;  5KS8 A;  1G2W A;  4CMF A;  5I5W A;  4Q4C A;  5BYA A;  1I2L A;  3WWH A;  5CM0 A;  5I5V A;  1ET0 A;  3JZ6 A;  2EJ0 A;  2Q7D A;  3TEK A;  3WWJ A;  4M0J A;  3PFF A;  2ZGI A;  1EKP A;  2HGW A;  1I1K A;  5I5U A;  5I5X A;  4RCN A;  3DTG A;  3BAC A;  4HN2 A;  5I5T A;  5BWV A;  2X5R A;  4TVI A;  3WWI A;  3VPD A;  4PBC A;  1KTA A;  3U0G A;  2ODT X;  2COJ A;  4GLW A;  3UYY A;  1EKV A;  4IWY A;  5CE8 A;  3T9A A;  5DAA A;  1DAA A;  1IYE A;  4IWX A;  4NZM A;  1EKF A;  3LQS A;  3CEB A;  5BWX A;  1A3G A;  4NZN A;  2EJ2 A;  3T9F A;  5DGH A;  4K6N A;  2HGX A;  3TW7 A;  2EIY A;  3DAA A;  5BWT A;  5K3W A;  4JXU A;  5E25 A;  5FR9 A;  2DAA A;  1KT8 A;  3T9E A;  2HHF B;  2A1H A;  3QQM A;  5I5Y A;  2COI A;  1I1L A;  2Y4R A;  5BWR A;  5DGI A;  3T99 A;  5BYB A;  3T7A A;  2HG8 A;  4CKC A;  4CKE A;  1I1M A;  2EJ3 A;  1UC8 A;  5BWW A;  1UC9 A;  2QB5 A;  3SGI A;  4WHX A;  3T9C A;  5HNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...