2EJ0A

Crystal structure of t.th.hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
305
structure length
297
Chain Sequence
QIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEWVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase with Pyridoxamine 5'-phosphate
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Branched-chain amino acid aminotransferase
total genus 100
structure length 297
sequence length 305
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2ej0A02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2ej0A01
5BWRA 3UZOA 1I2KA 1KT8A 2HGWA 5I60A 5CR5A 5CE8A 2HDKA 2COIA 2EIYA 3LULA 3WWIA 4CHIA 2EJ0A 5I5YA 2DAAA 1EKVA 2HHFA 5HNEA 3LQSA 3U0GA 1EKFA 2HG8A 3SNOA 1ET0A 4K6NA 5BWVA 3QQMA 4PBCA 5E25A 3UZBA 2EJ2A 4JXUA 2COGA 2ZGIA 4CE5A 2COJA 1I1LA 5I5SA 3JZ6A 3HT5A 2HGXA 5BWTA 5BWUA 2EJ3A 1WRVA 4TVIA 1IYDA 5I5TA 1KTAA 5DAAA 5CM0A 4M0JA 1I1MA 4DAAA 1A3GA 5I5VA 4CMDA 3DAAA 5BWXA 5I5XA 3DTFA 2HHFB 5BWWA 2Y4RA 3DTGA 4DQNA 5K3WA 1I2LA 3CSWA 4TM5A 5I5WA 2ABJA 1IYEA 5FR9A 1EKPA 1I1KA 1A0GA 3UYYA 5I5UA 1DAAA 2DABA 1G2WA 4WHXA 3WWJA 2A1HA 3WWHA 4UUGA 3CEBA 4CMFA
chains in the Genus database with same CATH superfamily
1I2KA 1V9PA 3TIIA 1IOVA 2X0SA 1SCUB 2YZLA 2NU7B 4YBZB 4O82A 4ZHQF 2CNVA 4EGQA 4Y8VB 5C1OA 4CKBA 4GLWA 2R84A 2I8CA 3NBYB 2HIXA 2FB9A 5D1OB 3KAJA 2HHFA 5HNEA 4O7SA 3R5HA 4C5CA 4C5BA 4I55F 4O4IF 4XX0B 2HVRA 4EFEA 4YAJB 2W6ZA 2OWOA 3RUPA 2YRXA 1B04A 1ET0A 3QFFA 1JKJB 4FFNA 2Z02A 5CA1F 1CE8A 3Q2OA 2HJWA 3UZBA 2EJ2A 2QK4A 2W6QA 2NUAB 4RZQA 2HVQA 5D1PA 4O86A 3R5FA 1E4EA 4YJ3F 1KBLA 1ULZA 4O7TA 1CKMA 4PZ7A 2PVPA 3OUUA 3RTXA 1AUVA 4O4HF 3BA9A 3TY9A 4TVIA 2Q7DA 4EFBA 1KJJA 2R7MA 1KTAA 5DAAA 2W6MA 4WBNF 2W6NA 4I4TF 3TINA 5I5VA 3KALA 3MJFA 3L2PA 4DLKA 3DAAA 5BWXA 1GSOA 2R7LA 4FFLA 4LH6A 5I5XA 1A0IA 4O7WA 3MWDA 3VPCA 5JQWA 4MV9A 5K2MA 2PBZA 3DTGA 3K5HA 1Z2NX 3V4ZA 1CKNA 1VS0A 1OBDA 2VR1A 3CSWA 3U54A 3U9TA 3KAKA 4MA5A 1IYEA 3WO0A 5FR9A 3HBLA 1EKPA 1KJIA 3KREA 4IZOA 4O4LF 5GONF 2QB5A 1T36A 1Z2PX 1DV1A 4MV1A 4O83A 4WHXA 3WWJA 5C1PA 1IOWA 3V4SA 3TW7A 2X5RA 3T9FA 4O2BF 2XD4A 5BWRA 4HNUA 3JSLA 2NU9B 4XZ3B 2Q2UA 2J9GA 1E4EB 5LOVF 3DF7A 5CR5A 3WNZA 2HDKA 2XCLA 4Q4DA 2DLNA 4NZNA 4EGJA 3LULA 3WWIA 1OBGA 4EEQA 3K5IA 2YS7A 2SCUB 3GJXB 4HNVA 5I5YA 1EKVA 3TW6A 3GDEA 4O7ZA 4EQ5A 2CZGA 3TQTA 1VBGA 1UC9A 5LP6F 5KS8A 2HG8A 5JVDF 2Z04A 2YS6A 2W70A 3TEKA 4M9UA 3T9BA 1KJ9A 3JRXA 1JDEA 5BWVA 2YZGA 3QQMA 4XYLB 5E25A 5I47A 4FFRA 2COJA 1I1LA 5I5SA 3ETJA 2YZMA 3HT5A 4TV8F 3T99A 5C8YF 1I7NA 3OUZA 4Q4CA 1I7LA 2V5AA 5JVLA 2OLSA 2I80A 3VNNA 2EJ3A 3ETHA 4NZMA 5IYZF 1IYDA 5I5TA 5H80A 4CKCA 4HN2A 5LA6F 4ME6A 2HGSA 2W6PA 3NC0B 3T54A 1ZAUA 4M0JA 2YL2A 1CKNB 1M6VA 2FP4B 3SGIA 3VPDA 4IWXA 2R85A 1DV2A 1FVIA 3JSNA 5KKNB 5J2TF 1BXRA 3MWEA 2ZDQA 1P8LA 2R82A 2YW2A 5BPHA 3VA7A 2ABJA 1S68A 4TUYF 1I1KA 1DAAA 2C00A 1XK5A 3U55A 2CNUA 5D8DA 3VPBA 4O7NA 5BYBA 4UCTA 4I50F 5HV6A 4YAKB 4ZQIA 3UZOA 1C3OA 3S24A 1EUDB 2YZNA 4LH7A 4E4TA 2Q2TA 5FNVF 1CS0A 2HGWA 5I60A 3BAAA 2COIA 1AUXA 3BACA 1KC7A 1EZ1A 2DWCA 3UQ8A 4C5AA 3W5OA 3E5NA 3NBZB 5D1OA 4UCSA 4CHIA 3SE7A 4IWYA 2DAAA 3BG5A 3GLKA 3WO1A 3LQSA 1TAEA 4TV9F 3LWBA 1EKFA 2GPWA 4NYEA 3RFCA 2W71A 3LP8A 3GIDA 5BYAA 4UCVA 4PBCA 2P0AA 3R5XA 5CB4F 2COGA 4CE5A 1KUTA 3I12A 2GQSA 4CC5A 2VQDA 3RV3A 2HGXA 5BWTA 3RV4A 5BWUA 3AW8A 4O81A 2CFMA 4O7RA 1WRVA 3TY5A 2GQRA 4FFMA 4EG0A 5JQGF 2FPPB 5DGHA 1DIKA 4O7LA 5JH7F 1EUCB 3N6RA 1B6RA 2HVSA 4GLXA 1M0WA 4DIMA 3ORQA 4O84A 1X9NA 2VPQA 2DIKA 2ZDGA 1CQJB 4DAAA 3Q1KA 2ZDHA 4CKEA 1XDNA 4FGRA 3TY8A 2HHFB 2V58A 4FFOA 4NZOA 4MV7A 4IHJF 3HO8A 2Y4RA 3T7AA 5EZYF 3T9CA 3G8CA 4DQNA 3VOTA 5DISC 3W1GA 3T9EA 4CC6A 4TM5A 4YB8B 2HIVA 5LXTF 5LYJF 3K3PA 1JLLB 3UYYA 5I5UA 3R23A 2DABA 4MV3A 2DZDA 4PZ6A 1G2WA 2A1HA 1VKZA 4DRFA 3HB9A 3QWUA 3WWHA 4UUGA 4O7YA 4RCNA 3CEBA 4CMFA 3ORRA 2R7NA 2FPIB 4FE2A 2ODTX 1W96A 2QF7A 1KT8A 4UFZA 1EYZA 1W93A 1B6SA 4IIJF 4O7VA 3UFXB 5CE8A 2R87A 3JZIA 5KX5F 3RR5A 3NUAA 1GGOA 3G8DA 4MV4A 2EIYA 1WR2A 4QSHA 3PN1A 3KYHC 2NU6B 3GB8B 2EJ0A 3JZFA 5DGIA 3U0GA 5FPOA 3R9RA 2FPGB 3AX6A 4FU0A 3W1BA 4HNTA 5BMVF 2I87A 1DGSA 5FPRA 3VMMA 1KEEA 3SNOA 4L1KA 4MV8A 4K6NA 4MAMA 1BNCA 2IP4A 3JRWA 4JXUA 2ZGIA 4O4JF 4UCRA 4YJ2F 3PFFA 3JZ6A 2R7KA 4HR7A 2GLTA 1KJQA 2NU8B 5CA0F 1GLVA 3BABA 5BPFA 1C30A 3TIGA 4UCOA 2PN1A 1GSHA 1PX2A 5DMXA 2YYAA 2YRWA 1JDBB 5CM0A 3T9AA 5J2UF 2W6OA 4FFPA 1I1MA 2GPSA 4HQ6A 1A3GA 4CMDA 1UC8A 3DTFA 1Z2OX 5BWWA 1GSAA 3U9SA 2VUGA 1A9XA 4MV6A 1A48A 1KJ8A 4MA0A 1EHIA 5K3WA 1I2LA 5I5WA 4PZ8A 2R86A 1M0TA 2CNQA 4O2AF 4ZOLF 5HBRB 1A0GA 1TA8A 1PK8A 4UCUA 2WYOA 4E6NA 1VBHA 5CAEB 4ZI7F 2YWVA 2V59A 1CKOA 4XYMB 3N8DA 1CQIB 1P16A 3BA8A 3T9DA
chains in the Genus database with same CATH topology
5BWRA 3UZOA 1I2KA 2ODTX 1KT8A 2HGWA 5I60A 5CR5A 5CE8A 2HDKA 2COIA 3BACA 4Q4DA 4CKBA 4GLWA 2EIYA 4NZNA 3LULA 3WWIA 4CHIA 4IWYA 2EJ0A 5I5YA 2DAAA 1EKVA 2HHFA 5DGIA 5HNEA 3LQSA 3U0GA 1UC9A 5KS8A 1EKFA 2HG8A 3SNOA 1ET0A 3TEKA 3T9BA 4K6NA 5BWVA 3QQMA 5BYAA 4PBCA 5E25A 5I47A 3UZBA 2EJ2A 4JXUA 2COGA 2ZGIA 4CE5A 2COJA 1I1LA 5I5SA 3PFFA 3JZ6A 3HT5A 2HGXA 3T99A 5BWTA 4Q4CA 5BWUA 2EJ3A 1WRVA 4NZMA 4TVIA 2Q7DA 5DGHA 1IYDA 5I5TA 4CKCA 4HN2A 1KTAA 5DAAA 3T54A 1ZAUA 5CM0A 4M0JA 3T9AA 3SGIA 3VPDA 1I1MA 4DAAA 1A3GA 5I5VA 4CMDA 4CKEA 3DAAA 5BWXA 1UC8A 4IWXA 5I5XA 3DTFA 2HHFB 4NZOA 5BWWA 2Y4RA 5K2MA 3DTGA 3T7AA 3T9CA 4DQNA 5K3WA 3T9EA 1I2LA 3CSWA 4TM5A 5I5WA 2ABJA 1IYEA 5FR9A 1EKPA 1I1KA 1A0GA 3UYYA 5I5UA 1DAAA 2DABA 2QB5A 1G2WA 4WHXA 3WWJA 2A1HA 3TW7A 3WWHA 2X5RA 4UUGA 3T9FA 4RCNA 3CEBA 4CMFA 5BYBA 3T9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BWR A;  3UZO A;  1I2K A;  1KT8 A;  2HGW A;  5I60 A;  5CR5 A;  5CE8 A;  2HDK A;  2COI A;  2EIY A;  3LUL A;  3WWI A;  4CHI A;  2EJ0 A;  5I5Y A;  2DAA A;  1EKV A;  2HHF A;  5HNE A;  3LQS A;  3U0G A;  1EKF A;  2HG8 A;  3SNO A;  1ET0 A;  4K6N A;  5BWV A;  3QQM A;  4PBC A;  5E25 A;  3UZB A;  2EJ2 A;  4JXU A;  2COG A;  2ZGI A;  4CE5 A;  2COJ A;  1I1L A;  5I5S A;  3JZ6 A;  3HT5 A;  2HGX A;  5BWT A;  5BWU A;  2EJ3 A;  1WRV A;  4TVI A;  1IYD A;  5I5T A;  1KTA A;  5DAA A;  5CM0 A;  4M0J A;  1I1M A;  4DAA A;  1A3G A;  5I5V A;  4CMD A;  3DAA A;  5BWX A;  5I5X A;  3DTF A;  2HHF B;  5BWW A;  2Y4R A;  3DTG A;  4DQN A;  5K3W A;  1I2L A;  3CSW A;  4TM5 A;  5I5W A;  2ABJ A;  1IYE A;  5FR9 A;  1EKP A;  1I1K A;  1A0G A;  3UYY A;  5I5U A;  1DAA A;  2DAB A;  1G2W A;  4WHX A;  3WWJ A;  2A1H A;  3WWH A;  4UUG A;  3CEB A;  4CMF A; 
#chains in the Genus database with same CATH topology
 1I2K A;  1V9P A;  3TII A;  1IOV A;  2X0S A;  1SCU B;  2YZL A;  2NU7 B;  4YBZ B;  4O82 A;  4ZHQ F;  2CNV A;  4EGQ A;  4Y8V B;  5C1O A;  4CKB A;  4GLW A;  2R84 A;  2I8C A;  3NBY B;  2HIX A;  2FB9 A;  5D1O B;  3KAJ A;  2HHF A;  5HNE A;  4O7S A;  3R5H A;  4C5C A;  4C5B A;  4I55 F;  4O4I F;  4XX0 B;  2HVR A;  4EFE A;  4YAJ B;  2W6Z A;  2OWO A;  3RUP A;  2YRX A;  1B04 A;  1ET0 A;  3QFF A;  1JKJ B;  4FFN A;  2Z02 A;  5CA1 F;  1CE8 A;  3Q2O A;  2HJW A;  3UZB A;  2EJ2 A;  2QK4 A;  2W6Q A;  2NUA B;  4RZQ A;  2HVQ A;  5D1P A;  4O86 A;  3R5F A;  1E4E A;  4YJ3 F;  1KBL A;  1ULZ A;  4O7T A;  1CKM A;  4PZ7 A;  2PVP A;  3OUU A;  3RTX A;  1AUV A;  4O4H F;  3BA9 A;  3TY9 A;  4TVI A;  2Q7D A;  4EFB A;  1KJJ A;  2R7M A;  1KTA A;  5DAA A;  2W6M A;  4WBN F;  2W6N A;  4I4T F;  3TIN A;  5I5V A;  3KAL A;  3MJF A;  3L2P A;  4DLK A;  3DAA A;  5BWX A;  1GSO A;  2R7L A;  4FFL A;  4LH6 A;  5I5X A;  1A0I A;  4O7W A;  3MWD A;  3VPC A;  5JQW A;  4MV9 A;  5K2M A;  2PBZ A;  3DTG A;  3K5H A;  1Z2N X;  3V4Z A;  1CKN A;  1VS0 A;  1OBD A;  2VR1 A;  3CSW A;  3U54 A;  3U9T A;  3KAK A;  4MA5 A;  1IYE A;  3WO0 A;  5FR9 A;  3HBL A;  1EKP A;  1KJI A;  3KRE A;  4IZO A;  4O4L F;  5GON F;  2QB5 A;  1T36 A;  1Z2P X;  1DV1 A;  4MV1 A;  4O83 A;  4WHX A;  3WWJ A;  5C1P A;  1IOW A;  3V4S A;  3TW7 A;  2X5R A;  3T9F A;  4O2B F;  2XD4 A;  5BWR A;  4HNU A;  3JSL A;  2NU9 B;  4XZ3 B;  2Q2U A;  2J9G A;  1E4E B;  5LOV F;  3DF7 A;  5CR5 A;  3WNZ A;  2HDK A;  2XCL A;  4Q4D A;  2DLN A;  4NZN A;  4EGJ A;  3LUL A;  3WWI A;  1OBG A;  4EEQ A;  3K5I A;  2YS7 A;  2SCU B;  3GJX B;  4HNV A;  5I5Y A;  1EKV A;  3TW6 A;  3GDE A;  4O7Z A;  4EQ5 A;  2CZG A;  3TQT A;  1VBG A;  1UC9 A;  5LP6 F;  5KS8 A;  2HG8 A;  5JVD F;  2Z04 A;  2YS6 A;  2W70 A;  3TEK A;  4M9U A;  3T9B A;  1KJ9 A;  3JRX A;  1JDE A;  5BWV A;  2YZG A;  3QQM A;  4XYL B;  5E25 A;  5I47 A;  4FFR A;  2COJ A;  1I1L A;  5I5S A;  3ETJ A;  2YZM A;  3HT5 A;  4TV8 F;  3T99 A;  5C8Y F;  1I7N A;  3OUZ A;  4Q4C A;  1I7L A;  2V5A A;  5JVL A;  2OLS A;  2I80 A;  3VNN A;  2EJ3 A;  3ETH A;  4NZM A;  5IYZ F;  1IYD A;  5I5T A;  5H80 A;  4CKC A;  4HN2 A;  5LA6 F;  4ME6 A;  2HGS A;  2W6P A;  3NC0 B;  3T54 A;  1ZAU A;  4M0J A;  2YL2 A;  1CKN B;  1M6V A;  2FP4 B;  3SGI A;  3VPD A;  4IWX A;  2R85 A;  1DV2 A;  1FVI A;  3JSN A;  5KKN B;  5J2T F;  1BXR A;  3MWE A;  2ZDQ A;  1P8L A;  2R82 A;  2YW2 A;  5BPH A;  3VA7 A;  2ABJ A;  1S68 A;  4TUY F;  1I1K A;  1DAA A;  2C00 A;  1XK5 A;  3U55 A;  2CNU A;  5D8D A;  3VPB A;  4O7N A;  5BYB A;  4UCT A;  4I50 F;  5HV6 A;  4YAK B;  4ZQI A;  3UZO A;  1C3O A;  3S24 A;  1EUD B;  2YZN A;  4LH7 A;  4E4T A;  2Q2T A;  5FNV F;  1CS0 A;  2HGW A;  5I60 A;  3BAA A;  2COI A;  1AUX A;  3BAC A;  1KC7 A;  1EZ1 A;  2DWC A;  3UQ8 A;  4C5A A;  3W5O A;  3E5N A;  3NBZ B;  5D1O A;  4UCS A;  4CHI A;  3SE7 A;  4IWY A;  2DAA A;  3BG5 A;  3GLK A;  3WO1 A;  3LQS A;  1TAE A;  4TV9 F;  3LWB A;  1EKF A;  2GPW A;  4NYE A;  3RFC A;  2W71 A;  3LP8 A;  3GID A;  5BYA A;  4UCV A;  4PBC A;  2P0A A;  3R5X A;  5CB4 F;  2COG A;  4CE5 A;  1KUT A;  3I12 A;  2GQS A;  4CC5 A;  2VQD A;  3RV3 A;  2HGX A;  5BWT A;  3RV4 A;  5BWU A;  3AW8 A;  4O81 A;  2CFM A;  4O7R A;  1WRV A;  3TY5 A;  2GQR A;  4FFM A;  4EG0 A;  5JQG F;  2FPP B;  5DGH A;  1DIK A;  4O7L A;  5JH7 F;  1EUC B;  3N6R A;  1B6R A;  2HVS A;  4GLX A;  1M0W A;  4DIM A;  3ORQ A;  4O84 A;  1X9N A;  2VPQ A;  2DIK A;  2ZDG A;  1CQJ B;  4DAA A;  3Q1K A;  2ZDH A;  4CKE A;  1XDN A;  4FGR A;  3TY8 A;  2HHF B;  2V58 A;  4FFO A;  4NZO A;  4MV7 A;  4IHJ F;  3HO8 A;  2Y4R A;  3T7A A;  5EZY F;  3T9C A;  3G8C A;  4DQN A;  3VOT A;  5DIS C;  3W1G A;  3T9E A;  4CC6 A;  4TM5 A;  4YB8 B;  2HIV A;  5LXT F;  5LYJ F;  3K3P A;  1JLL B;  3UYY A;  5I5U A;  3R23 A;  2DAB A;  4MV3 A;  2DZD A;  4PZ6 A;  1G2W A;  2A1H A;  1VKZ A;  4DRF A;  3HB9 A;  3QWU A;  3WWH A;  4UUG A;  4O7Y A;  4RCN A;  3CEB A;  4CMF A;  3ORR A;  2R7N A;  2FPI B;  4FE2 A;  2ODT X;  1W96 A;  2QF7 A;  1KT8 A;  4UFZ A;  1EYZ A;  1W93 A;  1B6S A;  4IIJ F;  4O7V A;  3UFX B;  5CE8 A;  2R87 A;  3JZI A;  5KX5 F;  3RR5 A;  3NUA A;  1GGO A;  3G8D A;  4MV4 A;  2EIY A;  1WR2 A;  4QSH A;  3PN1 A;  3KYH C;  2NU6 B;  3GB8 B;  2EJ0 A;  3JZF A;  5DGI A;  3U0G A;  5FPO A;  3R9R A;  2FPG B;  3AX6 A;  4FU0 A;  3W1B A;  4HNT A;  5BMV F;  2I87 A;  1DGS A;  5FPR A;  3VMM A;  1KEE A;  3SNO A;  4L1K A;  4MV8 A;  4K6N A;  4MAM A;  1BNC A;  2IP4 A;  3JRW A;  4JXU A;  2ZGI A;  4O4J F;  4UCR A;  4YJ2 F;  3PFF A;  3JZ6 A;  2R7K A;  4HR7 A;  2GLT A;  1KJQ A;  2NU8 B;  5CA0 F;  1GLV A;  3BAB A;  5BPF A;  1C30 A;  3TIG A;  4UCO A;  2PN1 A;  1GSH A;  1PX2 A;  5DMX A;  2YYA A;  2YRW A;  1JDB B;  5CM0 A;  3T9A A;  5J2U F;  2W6O A;  4FFP A;  1I1M A;  2GPS A;  4HQ6 A;  1A3G A;  4CMD A;  1UC8 A;  3DTF A;  1Z2O X;  5BWW A;  1GSA A;  3U9S A;  2VUG A;  1A9X A;  4MV6 A;  1A48 A;  1KJ8 A;  4MA0 A;  1EHI A;  5K3W A;  1I2L A;  5I5W A;  4PZ8 A;  2R86 A;  1M0T A;  2CNQ A;  4O2A F;  4ZOL F;  5HBR B;  1A0G A;  1TA8 A;  1PK8 A;  4UCU A;  2WYO A;  4E6N A;  1VBH A;  5CAE B;  4ZI7 F;  2YWV A;  2V59 A;  1CKO A;  4XYM B;  3N8D A;  1CQI B;  1P16 A;  3BA8 A;  3T9D A; 
#chains in the Genus database with same CATH homology
 5BWR A;  3UZO A;  1I2K A;  2ODT X;  1KT8 A;  2HGW A;  5I60 A;  5CR5 A;  5CE8 A;  2HDK A;  2COI A;  3BAC A;  4Q4D A;  4CKB A;  4GLW A;  2EIY A;  4NZN A;  3LUL A;  3WWI A;  4CHI A;  4IWY A;  2EJ0 A;  5I5Y A;  2DAA A;  1EKV A;  2HHF A;  5DGI A;  5HNE A;  3LQS A;  3U0G A;  1UC9 A;  5KS8 A;  1EKF A;  2HG8 A;  3SNO A;  1ET0 A;  3TEK A;  3T9B A;  4K6N A;  5BWV A;  3QQM A;  5BYA A;  4PBC A;  5E25 A;  5I47 A;  3UZB A;  2EJ2 A;  4JXU A;  2COG A;  2ZGI A;  4CE5 A;  2COJ A;  1I1L A;  5I5S A;  3PFF A;  3JZ6 A;  3HT5 A;  2HGX A;  3T99 A;  5BWT A;  4Q4C A;  5BWU A;  2EJ3 A;  1WRV A;  4NZM A;  4TVI A;  2Q7D A;  5DGH A;  1IYD A;  5I5T A;  4CKC A;  4HN2 A;  1KTA A;  5DAA A;  3T54 A;  1ZAU A;  5CM0 A;  4M0J A;  3T9A A;  3SGI A;  3VPD A;  1I1M A;  4DAA A;  1A3G A;  5I5V A;  4CMD A;  4CKE A;  3DAA A;  5BWX A;  1UC8 A;  4IWX A;  5I5X A;  3DTF A;  2HHF B;  4NZO A;  5BWW A;  2Y4R A;  5K2M A;  3DTG A;  3T7A A;  3T9C A;  4DQN A;  5K3W A;  3T9E A;  1I2L A;  3CSW A;  4TM5 A;  5I5W A;  2ABJ A;  1IYE A;  5FR9 A;  1EKP A;  1I1K A;  1A0G A;  3UYY A;  5I5U A;  1DAA A;  2DAB A;  2QB5 A;  1G2W A;  4WHX A;  3WWJ A;  2A1H A;  3TW7 A;  3WWH A;  2X5R A;  4UUG A;  3T9F A;  4RCN A;  3CEB A;  4CMF A;  5BYB A;  3T9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...