2EJ0A

Crystal structure of t.th.hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
305
structure length
297
Chain Sequence
b'QIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEWVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Branched-chain amino acid aminotransferase
publication title Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase with Pyridoxamine 5'-phosphate
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 100
structure length 297
sequence length 305
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2ej0A02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2ej0A01
1I1MA 2HG8A 5BWXA 3WWJA 5CE8A 3DTGA 1I2LA 2DABA 2EJ2A 2HGXA 3SNOA 1IYDA 3CSWA 2COJA 3U0GA 4TM5A 1EKPA 5K3WA 2COIA 5BWVA 5BWWA 5E25A 3WWHA 1KTAA 2EJ3A 4TVIA 1G2WA 4PBCA 4CMFA 1I1KA 4UUGA 2COGA 5CR5A 1KT8A 4WHXA 1WRVA 5I5XA 5BWRA 3QQMA 2HDKA 3DAAA 4M0JA 5I60A 1I2KA 5I5WA 3DTFA 1A0GA 1ET0A 3LULA 3JZ6A 3LQSA 5DAAA 2EJ0A 5I5SA 5BWUA 4CHIA 2ZGIA 4K6NA 4DAAA 3WWIA 1IYEA 1A3GA 3UYYA 1DAAA 1EKVA 2Y4RA 5I5YA 5I5UA 3CEBA 5I5VA 3UZBA 5HNEA 5I5TA 2DAAA 2HHFA 4JXUA 4CE5A 5BWTA 2EIYA 4CMDA 1EKFA 1I1LA 2A1HA 2ABJA 4DQNA 5FR9A 3UZOA 5CM0A 3HT5A 2HGWA 2HHFB
chains in the Genus database with same CATH superfamily
4ME6A 4GLXA 1I1MA 4DLKA 5JQGF 3DTGA 4TUYF 1KJ8A 2VPQA 4CC5A 5BPFA 2V59A 4C5BA 1CKOA 4WBNF 3W1BA 2HGXA 3GB8B 2COJA 5K3WA 2HIXA 2W71A 5JH7F 2COIA 4O7WA 1T36A 1PK8A 2YZLA 2NU7B 1KTAA 3MJFA 4XX0B 3VMMA 4FFOA 2GQRA 1EZ1A 1KUTA 1EUCB 2W6MA 4EGQA 4EEQA 4LH6A 4O7RA 1GSOA 3AW8A 5D8DA 2YWVA 4O7VA 3NUAA 1VBGA 5D1PA 2COGA 2CNUA 1XK5A 5JQWA 1E4EB 1WRVA 5BWRA 3R5HA 5JVDF 4ZOLF 3QQMA 4O4HF 5LOVF 3T9BA 3MWEA 5DGIA 4TV8F 2GPSA 4FFPA 4M0JA 4Q4CA 1KEEA 2WYOA 4HQ6A 2GLTA 4UCOA 1KJJA 4YJ2F 2W6QA 4NZNA 3DTFA 4EQ5A 5C1OA 5KS8A 3PN1A 4YAKB 3LQSA 3TY9A 3V4SA 4YJ3F 2W6OA 2OLSA 1EHIA 5K2MA 3JZFA 3T7AA 5I5SA 3R23A 2R85A 4K6NA 3TQTA 5EZYF 4DRFA 1IYEA 3UYYA 2YS6A 1EUDB 1KBLA 1KJIA 5I5YA 4LH7A 5I5UA 5I5TA 2DAAA 1VS0A 3KAKA 5KX5F 2HVRA 1OBDA 2CNQA 1ZAUA 4IWYA 5BWTA 4MV9A 1KJQA 1XDNA 3JZIA 3JSLA 3WO0A 5FR9A 5KKNB 1C30A 5CM0A 2HGSA 3I12A 4O83A 5FPOA 3TW6A 2HGWA 3BACA 3VPBA 1Z2PX 2QK4A 3BABA 3TY8A 2ZDQA 1M6VA 3U9TA 1AUVA 2HG8A 3T54A 5BWXA 1A9XA 3VPCA 1M0TA 4CKEA 2FPIB 3UQ8A 4FFMA 4CKBA 2VUGA 4E6NA 3N6RA 1TA8A 1W96A 2W6NA 4C5CA 1AUXA 1IYDA 4NZMA 3K3PA 4EGJA 1EKPA 3VA7A 5DISC 5GONF 4MA0A 2Q2TA 5BWWA 1IOWA 1PX2A 2FP4B 3TINA 2EJ3A 2YZMA 2Q7DA 4TVIA 1DV2A 2YZNA 4FE2A 1BNCA 1I1KA 2R86A 4HNVA 3R9RA 4UCSA 5CR5A 3R5FA 3GLKA 2ZDHA 4M9UA 3V4ZA 1JKJB 3LWBA 2Z02A 3RR5A 3K5IA 4O4IF 1S68A 1FVIA 4IHJF 1KC7A 1I7LA 3HO8A 1V9PA 1I2KA 2YS7A 5BPHA 5CA1F 3GIDA 5CB4F 1ET0A 3LULA 3QWUA 5DAAA 3GDEA 1A0IA 1B6RA 1VBHA 1DIKA 2EJ0A 3N8DA 3TIIA 5IYZF 4MV6A 2W6ZA 4O4JF 5BWUA 1UC8A 2ZGIA 2FPPB 1CKNB 2GPWA 4QSHA 1A3GA 4TV9F 3R5XA 4HR7A 4UCTA 4FFRA 2Z04A 1GSAA 1EKVA 2Y4RA 5HV6A 3UZBA 4FU0A 3WO1A 3G8DA 2HHFA 1BXRA 4JXUA 3AX6A 2EIYA 3W5OA 4MV3A 1TAEA 2PN1A 2A1HA 3HB9A 5LXTF 4O7LA 3BA8A 1JDBB 2YL2A 2YYAA 5HBRB 1DV1A 2C00A 4CC6A 2VQDA 3BAAA 2R87A 4L1KA 4YAJB 1Z2OX 5D1OB 3SGIA 3RFCA 4FFNA 2CFMA 5LP6F 3OUUA 3WWJA 5CE8A 4MAMA 3ORRA 2YRXA 4O4LF 2DABA 1IOVA 3TIGA 2R7LA 4XYMB 2XCLA 3SNOA 3NBYB 3CSWA 3U0GA 5J2TF 1CQJB 2R7NA 2VR1A 5LYJF 1UC9A 1W93A 4O84A 5BYBA 2I80A 4XZ3B 2YW2A 4EFBA 4HNUA 5BWVA 5J2UF 5JVLA 3K5HA 2CNVA 5C1PA 3W1GA 1OBGA 1EYZA 2V5AA 2I8CA 5FPRA 1E4EA 4HNTA 2X5RA 4HN2A 2QB5A 5I47A 3RV3A 3HBLA 2FB9A 4O7YA 4E4TA 1G2WA 3T99A 3OUZA 4RCNA 4ZQIA 4UUGA 3DF7A 4WHXA 3NBZB 5C8YF 1ULZA 5I5XA 2YZGA 4O86A 2SCUB 3ETJA 3RUPA 4Q4DA 4Y8VB 1GLVA 2HVSA 3DAAA 4RZQA 3UFXB 1P16A 2CZGA 5I60A 1VKZA 2V58A 1A0GA 2R84A 4MV1A 3JZ6A 5H80A 4O7ZA 3LP8A 1P8LA 1JDEA 4O7SA 4CHIA 4UCUA 3TW7A 2DZDA 4MV7A 1B04A 1CS0A 3TY5A 5BYAA 1M0WA 1DAAA 2XD4A 3CEBA 4MV4A 3S24A 4FFLA 1X9NA 2W6PA 4IWXA 1I1LA 3NC0B 4GLWA 2ABJA 4EG0A 4DQNA 3UZOA 1C3OA 2R7MA 4I55F 4MV8A 4XYLB 2W70A 1GSHA 4O81A 5FNVF 3KREA 1JLLB 4CKCA 3G8CA 4EFEA 2NU9B 1Z2NX 1I7NA 1GGOA 3TEKA 4DIMA 2R82A 1I2LA 2IP4A 3BA9A 2NU6B 4UCRA 4I50F 2X0SA 1KJ9A 4PZ6A 2EJ2A 5CAEB 3QFFA 3U54A 4TM5A 2GQSA 5DGHA 4NZOA 3ETHA 2DLNA 5CA0F 2QF7A 4MA5A 5E25A 4O7TA 3MWDA 3WWHA 4IZOA 3JRXA 4PZ8A 1SCUB 3PFFA 4YBZB 3E5NA 3VNNA 2HJWA 3U55A 3VPDA 4PBCA 3JRWA 1WR2A 3T9EA 2I87A 4CMFA 4O2BF 3Q1KA 1KT8A 2ODTX 4C5AA 1CE8A 2DWCA 2NUAB 4UFZA 4I4TF 3T9CA 2HDKA 2PVPA 3KALA 2DIKA 2HIVA 1CQIB 2ZDGA 5I5WA 2HVQA 4ZHQF 3RTXA 2FPGB 2PBZA 1CKNA 4O82A 1A48A 3JSNA 4NYEA 3BG5A 2R7KA 1CKMA 4ZI7F 3SE7A 2J9GA 3U9SA 4DAAA 4O2AF 3WWIA 5LA6F 2NU8B 4IIJF 3T9AA 5DMXA 3T9FA 3L2PA 3GJXB 4FGRA 1DGSA 5I5VA 5HNEA 3T9DA 3WNZA 4CE5A 3RV4A 4CMDA 5D1OA 1EKFA 1B6SA 4O7NA 2P0AA 3VOTA 2OWOA 3KYHC 2YRWA 3ORQA 5BMVF 4PZ7A 3KAJA 4UCVA 4YB8B 3HT5A 2Q2UA 2HHFB 3Q2OA
chains in the Genus database with same CATH topology
3SGIA 4CKCA 1I1MA 2HG8A 3T54A 5BWXA 3WWJA 5CE8A 3TEKA 3DTGA 1I2LA 4CKEA 4CKBA 2DABA 2EJ2A 2HGXA 3SNOA 1IYDA 4NZMA 3CSWA 2COJA 3U0GA 4TM5A 1EKPA 5K3WA 1UC9A 5DGHA 2COIA 5BYBA 4NZOA 5BWVA 5BWWA 5E25A 3WWHA 1KTAA 2X5RA 4HN2A 2EJ3A 2QB5A 5I47A 2Q7DA 3PFFA 4TVIA 3VPDA 1G2WA 4PBCA 3T99A 3T9EA 4RCNA 4CMFA 1I1KA 4UUGA 2COGA 5CR5A 1KT8A 4WHXA 2ODTX 1WRVA 5I5XA 5BWRA 3QQMA 4Q4DA 3T9BA 5DGIA 3T9CA 2HDKA 3DAAA 4M0JA 5I60A 4Q4CA 1I2KA 5I5WA 4NZNA 3DTFA 1A0GA 1ET0A 3LULA 5KS8A 3JZ6A 3LQSA 5DAAA 5K2MA 2EJ0A 3T7AA 5I5SA 5BWUA 4CHIA 2ZGIA 4K6NA 1UC8A 4DAAA 3TW7A 3WWIA 1IYEA 1A3GA 3UYYA 5BYAA 3T9AA 1DAAA 3T9FA 1EKVA 2Y4RA 5I5YA 5I5UA 3CEBA 5I5VA 3UZBA 5HNEA 5I5TA 2DAAA 2HHFA 3T9DA 4JXUA 4CE5A 1ZAUA 4IWYA 4IWXA 5BWTA 2EIYA 4CMDA 1EKFA 1I1LA 4GLWA 2A1HA 2ABJA 4DQNA 5FR9A 3UZOA 5CM0A 3HT5A 2HGWA 2HHFB 3BACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1M A;  2HG8 A;  5BWX A;  3WWJ A;  5CE8 A;  3DTG A;  1I2L A;  2DAB A;  2EJ2 A;  2HGX A;  3SNO A;  1IYD A;  3CSW A;  2COJ A;  3U0G A;  4TM5 A;  1EKP A;  5K3W A;  2COI A;  5BWV A;  5BWW A;  5E25 A;  3WWH A;  1KTA A;  2EJ3 A;  4TVI A;  1G2W A;  4PBC A;  4CMF A;  1I1K A;  4UUG A;  2COG A;  5CR5 A;  1KT8 A;  4WHX A;  1WRV A;  5I5X A;  5BWR A;  3QQM A;  2HDK A;  3DAA A;  4M0J A;  5I60 A;  1I2K A;  5I5W A;  3DTF A;  1A0G A;  1ET0 A;  3LUL A;  3JZ6 A;  3LQS A;  5DAA A;  2EJ0 A;  5I5S A;  5BWU A;  4CHI A;  2ZGI A;  4K6N A;  4DAA A;  3WWI A;  1IYE A;  1A3G A;  3UYY A;  1DAA A;  1EKV A;  2Y4R A;  5I5Y A;  5I5U A;  3CEB A;  5I5V A;  3UZB A;  5HNE A;  5I5T A;  2DAA A;  2HHF A;  4JXU A;  4CE5 A;  5BWT A;  2EIY A;  4CMD A;  1EKF A;  1I1L A;  2A1H A;  2ABJ A;  4DQN A;  5FR9 A;  3UZO A;  5CM0 A;  3HT5 A;  2HGW A;  2HHF B; 
#chains in the Genus database with same CATH topology
 4ME6 A;  4GLX A;  1I1M A;  4DLK A;  5JQG F;  3DTG A;  4TUY F;  1KJ8 A;  2VPQ A;  4CC5 A;  5BPF A;  2V59 A;  4C5B A;  1CKO A;  4WBN F;  3W1B A;  2HGX A;  3GB8 B;  2COJ A;  5K3W A;  2HIX A;  2W71 A;  5JH7 F;  2COI A;  4O7W A;  1T36 A;  1PK8 A;  2YZL A;  2NU7 B;  1KTA A;  3MJF A;  4XX0 B;  3VMM A;  4FFO A;  2GQR A;  1EZ1 A;  1KUT A;  1EUC B;  2W6M A;  4EGQ A;  4EEQ A;  4LH6 A;  4O7R A;  1GSO A;  3AW8 A;  5D8D A;  2YWV A;  4O7V A;  3NUA A;  1VBG A;  5D1P A;  2COG A;  2CNU A;  1XK5 A;  5JQW A;  1E4E B;  1WRV A;  5BWR A;  3R5H A;  5JVD F;  4ZOL F;  3QQM A;  4O4H F;  5LOV F;  3T9B A;  3MWE A;  5DGI A;  4TV8 F;  2GPS A;  4FFP A;  4M0J A;  4Q4C A;  1KEE A;  2WYO A;  4HQ6 A;  2GLT A;  4UCO A;  1KJJ A;  4YJ2 F;  2W6Q A;  4NZN A;  3DTF A;  4EQ5 A;  5C1O A;  5KS8 A;  3PN1 A;  4YAK B;  3LQS A;  3TY9 A;  3V4S A;  4YJ3 F;  2W6O A;  2OLS A;  1EHI A;  5K2M A;  3JZF A;  3T7A A;  5I5S A;  3R23 A;  2R85 A;  4K6N A;  3TQT A;  5EZY F;  4DRF A;  1IYE A;  3UYY A;  2YS6 A;  1EUD B;  1KBL A;  1KJI A;  5I5Y A;  4LH7 A;  5I5U A;  5I5T A;  2DAA A;  1VS0 A;  3KAK A;  5KX5 F;  2HVR A;  1OBD A;  2CNQ A;  1ZAU A;  4IWY A;  5BWT A;  4MV9 A;  1KJQ A;  1XDN A;  3JZI A;  3JSL A;  3WO0 A;  5FR9 A;  5KKN B;  1C30 A;  5CM0 A;  2HGS A;  3I12 A;  4O83 A;  5FPO A;  3TW6 A;  2HGW A;  3BAC A;  3VPB A;  1Z2P X;  2QK4 A;  3BAB A;  3TY8 A;  2ZDQ A;  1M6V A;  3U9T A;  1AUV A;  2HG8 A;  3T54 A;  5BWX A;  1A9X A;  3VPC A;  1M0T A;  4CKE A;  2FPI B;  3UQ8 A;  4FFM A;  4CKB A;  2VUG A;  4E6N A;  3N6R A;  1TA8 A;  1W96 A;  2W6N A;  4C5C A;  1AUX A;  1IYD A;  4NZM A;  3K3P A;  4EGJ A;  1EKP A;  3VA7 A;  5DIS C;  5GON F;  4MA0 A;  2Q2T A;  5BWW A;  1IOW A;  1PX2 A;  2FP4 B;  3TIN A;  2EJ3 A;  2YZM A;  2Q7D A;  4TVI A;  1DV2 A;  2YZN A;  4FE2 A;  1BNC A;  1I1K A;  2R86 A;  4HNV A;  3R9R A;  4UCS A;  5CR5 A;  3R5F A;  3GLK A;  2ZDH A;  4M9U A;  3V4Z A;  1JKJ B;  3LWB A;  2Z02 A;  3RR5 A;  3K5I A;  4O4I F;  1S68 A;  1FVI A;  4IHJ F;  1KC7 A;  1I7L A;  3HO8 A;  1V9P A;  1I2K A;  2YS7 A;  5BPH A;  5CA1 F;  3GID A;  5CB4 F;  1ET0 A;  3LUL A;  3QWU A;  5DAA A;  3GDE A;  1A0I A;  1B6R A;  1VBH A;  1DIK A;  2EJ0 A;  3N8D A;  3TII A;  5IYZ F;  4MV6 A;  2W6Z A;  4O4J F;  5BWU A;  1UC8 A;  2ZGI A;  2FPP B;  1CKN B;  2GPW A;  4QSH A;  1A3G A;  4TV9 F;  3R5X A;  4HR7 A;  4UCT A;  4FFR A;  2Z04 A;  1GSA A;  1EKV A;  2Y4R A;  5HV6 A;  3UZB A;  4FU0 A;  3WO1 A;  3G8D A;  2HHF A;  1BXR A;  4JXU A;  3AX6 A;  2EIY A;  3W5O A;  4MV3 A;  1TAE A;  2PN1 A;  2A1H A;  3HB9 A;  5LXT F;  4O7L A;  3BA8 A;  1JDB B;  2YL2 A;  2YYA A;  5HBR B;  1DV1 A;  2C00 A;  4CC6 A;  2VQD A;  3BAA A;  2R87 A;  4L1K A;  4YAJ B;  1Z2O X;  5D1O B;  3SGI A;  3RFC A;  4FFN A;  2CFM A;  5LP6 F;  3OUU A;  3WWJ A;  5CE8 A;  4MAM A;  3ORR A;  2YRX A;  4O4L F;  2DAB A;  1IOV A;  3TIG A;  2R7L A;  4XYM B;  2XCL A;  3SNO A;  3NBY B;  3CSW A;  3U0G A;  5J2T F;  1CQJ B;  2R7N A;  2VR1 A;  5LYJ F;  1UC9 A;  1W93 A;  4O84 A;  5BYB A;  2I80 A;  4XZ3 B;  2YW2 A;  4EFB A;  4HNU A;  5BWV A;  5J2U F;  5JVL A;  3K5H A;  2CNV A;  5C1P A;  3W1G A;  1OBG A;  1EYZ A;  2V5A A;  2I8C A;  5FPR A;  1E4E A;  4HNT A;  2X5R A;  4HN2 A;  2QB5 A;  5I47 A;  3RV3 A;  3HBL A;  2FB9 A;  4O7Y A;  4E4T A;  1G2W A;  3T99 A;  3OUZ A;  4RCN A;  4ZQI A;  4UUG A;  3DF7 A;  4WHX A;  3NBZ B;  5C8Y F;  1ULZ A;  5I5X A;  2YZG A;  4O86 A;  2SCU B;  3ETJ A;  3RUP A;  4Q4D A;  4Y8V B;  1GLV A;  2HVS A;  3DAA A;  4RZQ A;  3UFX B;  1P16 A;  2CZG A;  5I60 A;  1VKZ A;  2V58 A;  1A0G A;  2R84 A;  4MV1 A;  3JZ6 A;  5H80 A;  4O7Z A;  3LP8 A;  1P8L A;  1JDE A;  4O7S A;  4CHI A;  4UCU A;  3TW7 A;  2DZD A;  4MV7 A;  1B04 A;  1CS0 A;  3TY5 A;  5BYA A;  1M0W A;  1DAA A;  2XD4 A;  3CEB A;  4MV4 A;  3S24 A;  4FFL A;  1X9N A;  2W6P A;  4IWX A;  1I1L A;  3NC0 B;  4GLW A;  2ABJ A;  4EG0 A;  4DQN A;  3UZO A;  1C3O A;  2R7M A;  4I55 F;  4MV8 A;  4XYL B;  2W70 A;  1GSH A;  4O81 A;  5FNV F;  3KRE A;  1JLL B;  4CKC A;  3G8C A;  4EFE A;  2NU9 B;  1Z2N X;  1I7N A;  1GGO A;  3TEK A;  4DIM A;  2R82 A;  1I2L A;  2IP4 A;  3BA9 A;  2NU6 B;  4UCR A;  4I50 F;  2X0S A;  1KJ9 A;  4PZ6 A;  2EJ2 A;  5CAE B;  3QFF A;  3U54 A;  4TM5 A;  2GQS A;  5DGH A;  4NZO A;  3ETH A;  2DLN A;  5CA0 F;  2QF7 A;  4MA5 A;  5E25 A;  4O7T A;  3MWD A;  3WWH A;  4IZO A;  3JRX A;  4PZ8 A;  1SCU B;  3PFF A;  4YBZ B;  3E5N A;  3VNN A;  2HJW A;  3U55 A;  3VPD A;  4PBC A;  3JRW A;  1WR2 A;  3T9E A;  2I87 A;  4CMF A;  4O2B F;  3Q1K A;  1KT8 A;  2ODT X;  4C5A A;  1CE8 A;  2DWC A;  2NUA B;  4UFZ A;  4I4T F;  3T9C A;  2HDK A;  2PVP A;  3KAL A;  2DIK A;  2HIV A;  1CQI B;  2ZDG A;  5I5W A;  2HVQ A;  4ZHQ F;  3RTX A;  2FPG B;  2PBZ A;  1CKN A;  4O82 A;  1A48 A;  3JSN A;  4NYE A;  3BG5 A;  2R7K A;  1CKM A;  4ZI7 F;  3SE7 A;  2J9G A;  3U9S A;  4DAA A;  4O2A F;  3WWI A;  5LA6 F;  2NU8 B;  4IIJ F;  3T9A A;  5DMX A;  3T9F A;  3L2P A;  3GJX B;  4FGR A;  1DGS A;  5I5V A;  5HNE A;  3T9D A;  3WNZ A;  4CE5 A;  3RV4 A;  4CMD A;  5D1O A;  1EKF A;  1B6S A;  4O7N A;  2P0A A;  3VOT A;  2OWO A;  3KYH C;  2YRW A;  3ORQ A;  5BMV F;  4PZ7 A;  3KAJ A;  4UCV A;  4YB8 B;  3HT5 A;  2Q2U A;  2HHF B;  3Q2O A; 
#chains in the Genus database with same CATH homology
 3SGI A;  4CKC A;  1I1M A;  2HG8 A;  3T54 A;  5BWX A;  3WWJ A;  5CE8 A;  3TEK A;  3DTG A;  1I2L A;  4CKE A;  4CKB A;  2DAB A;  2EJ2 A;  2HGX A;  3SNO A;  1IYD A;  4NZM A;  3CSW A;  2COJ A;  3U0G A;  4TM5 A;  1EKP A;  5K3W A;  1UC9 A;  5DGH A;  2COI A;  5BYB A;  4NZO A;  5BWV A;  5BWW A;  5E25 A;  3WWH A;  1KTA A;  2X5R A;  4HN2 A;  2EJ3 A;  2QB5 A;  5I47 A;  2Q7D A;  3PFF A;  4TVI A;  3VPD A;  1G2W A;  4PBC A;  3T99 A;  3T9E A;  4RCN A;  4CMF A;  1I1K A;  4UUG A;  2COG A;  5CR5 A;  1KT8 A;  4WHX A;  2ODT X;  1WRV A;  5I5X A;  5BWR A;  3QQM A;  4Q4D A;  3T9B A;  5DGI A;  3T9C A;  2HDK A;  3DAA A;  4M0J A;  5I60 A;  4Q4C A;  1I2K A;  5I5W A;  4NZN A;  3DTF A;  1A0G A;  1ET0 A;  3LUL A;  5KS8 A;  3JZ6 A;  3LQS A;  5DAA A;  5K2M A;  2EJ0 A;  3T7A A;  5I5S A;  5BWU A;  4CHI A;  2ZGI A;  4K6N A;  1UC8 A;  4DAA A;  3TW7 A;  3WWI A;  1IYE A;  1A3G A;  3UYY A;  5BYA A;  3T9A A;  1DAA A;  3T9F A;  1EKV A;  2Y4R A;  5I5Y A;  5I5U A;  3CEB A;  5I5V A;  3UZB A;  5HNE A;  5I5T A;  2DAA A;  2HHF A;  3T9D A;  4JXU A;  4CE5 A;  1ZAU A;  4IWY A;  4IWX A;  5BWT A;  2EIY A;  4CMD A;  1EKF A;  1I1L A;  4GLW A;  2A1H A;  2ABJ A;  4DQN A;  5FR9 A;  3UZO A;  5CM0 A;  3HT5 A;  2HGW A;  2HHF B;  3BAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...