3CEBA

Crystal structure of a putative 4-amino-4-deoxychorismate lyase (hs_0128) from haemophilus somnus 129pt at 2.40 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
194
structure length
193
Chain Sequence
GMWQFPLFETILIEQGQAKNISYHQQRYEKSLLKFYPKMKLQPFDLAKIIAKHTALFTHREGLIRCRIDYNHHDYVLQCFPYQQKVYRTFKPVFCDHIDYSLFSDRTLLNNLLKQKEECDEIMIIRQGKVTDCSIGNLIFRQNNQWITPDKPLLEGTQRAKLLEQKKIIAREIFFEDLAQYEEIRLINAMNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-aminoacid Aminotransferase-Like PLP-Dependent Enzyme (YP_718332.1) from Haemophilus somnus 129PT at 2.40 A resolution
rcsb
molecule keywords D-aminoacid aminotransferase-like PLP-dependent enzyme
molecule tags Lyase
source organism Haemophilus somnus
total genus 47
structure length 193
sequence length 194
ec nomenclature
pdb deposition date 2008-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 3cebA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3cebA01
4K6NA 5CM0A 5BWUA 2HDKA 3WWIA 5I5SA 5I5YA 1A0GA 1EKVA 5BWRA 2ZGIA 4DAAA 3CSWA 2HHFA 2EJ2A 1EKPA 2ABJA 3WWJA 5I5XA 3WWHA 3UZBA 3DTFA 3UYYA 2EIYA 2DABA 1I1KA 1I2KA 3DTGA 5BWVA 4JXUA 4CE5A 4WHXA 1KTAA 5I5TA 2HGWA 1ET0A 4TM5A 1I1LA 5I5UA 5I60A 5CE8A 3LQSA 4PBCA 5HNEA 1KT8A 5I5VA 5FR9A 1DAAA 5DAAA 1I1MA 1IYDA 1G2WA 1I2LA 2DAAA 3JZ6A 2COIA 3QQMA 4DQNA 4CHIA 3UZOA 1A3GA 5I5WA 3U0GA 3CEBA 3SNOA 2Y4RA 5BWXA 1WRVA 4UUGA 5K3WA 5CR5A 1EKFA 5BWTA 3HT5A 4CMFA 2A1HA 1IYEA 2EJ3A 3DAAA 4CMDA 4TVIA 2COJA 2HG8A 2EJ0A 2HHFB 3LULA 5E25A 2COGA 4M0JA 5BWWA 2HGXA
chains in the Genus database with same CATH superfamily
4WBNF 1WR2A 1VS0A 5CM0A 5BWUA 3UQ8A 2R86A 4LH7A 4NYEA 3PFFA 5I5YA 5DGHA 3V4SA 5BPFA 1EHIA 2WYOA 5JVLA 2R85A 5BWRA 4DIMA 4EFEA 2ZGIA 3KYHC 4HR7A 4I50F 2HIXA 5LA6F 4NZMA 1EKPA 1FVIA 3BG5A 2R87A 3T9DA 3WWHA 1KJQA 2YS6A 5BYBA 3UYYA 4ZI7F 5KX5F 4RCNA 3K3PA 2ZDGA 4MV8A 1I2KA 4PZ6A 1JKJB 1OBGA 2I8CA 3PN1A 1I7NA 2Q7DA 1KTAA 4HN2A 2HGWA 3NBZB 3BAAA 1SCUB 1IOVA 2VQDA 5I5UA 2NUAB 3U54A 3ORQA 5CE8A 2DIKA 3KAKA 3LQSA 3TY8A 5C1OA 2YL2A 2YZNA 4O7SA 5HNEA 4Q4CA 1ULZA 3HB9A 1DAAA 1CQIB 3QFFA 1Z2OX 1E4EA 1T36A 2W6ZA 5GONF 4E6NA 3TIGA 2Z04A 1B04A 2COIA 1DV1A 4O7RA 3KALA 3TY9A 3VPBA 4DQNA 4EG0A 5JH7F 4Y8VB 2QF7A 4O86A 5BWXA 2R84A 5JQGF 1XK5A 4O81A 2W6OA 3R9RA 3JRXA 5BWTA 4O7TA 3KAJA 3RFCA 3TW6A 3G8DA 1KUTA 4UCSA 4TV8F 5KKNB 3DAAA 3MJFA 2YYAA 2OWOA 4IWYA 1ZAUA 2PBZA 1TAEA 5LP6F 5D1OA 5BYAA 5C1PA 5EZYF 2COGA 4IHJF 4FFOA 4K6NA 2VPQA 4HNVA 3T54A 4CC5A 1DV2A 3GIDA 4YAKB 2CZGA 3WNZA 3S24A 2YS7A 3TY5A 1A0GA 1EKVA 4CKEA 1KC7A 1E4EB 3ETJA 4PZ7A 1CKNB 4DAAA 3CSWA 1IOWA 4O4IF 4ZHQF 2HHFA 1C3OA 3QWUA 3VOTA 3TINA 3TEKA 2PN1A 3MWDA 2NU8B 3UZBA 1B6SA 3G8CA 2EIYA 2CNQA 4XZ3B 3GB8B 4LH6A 4MV1A 1I1KA 3RV3A 4IWXA 2CNVA 3GDEA 3DTGA 5BWVA 2FB9A 3NBYB 2HJWA 4ZQIA 2W6PA 1S68A 1M0TA 2W6NA 1I1LA 4MAMA 5K2MA 3VA7A 4NZNA 2W70A 1C30A 1VBHA 2P0AA 2CFMA 1BXRA 4O4JF 4O84A 4MV7A 1GSAA 5DAAA 3K5IA 1I2LA 2FP4B 3W1GA 2DAAA 2W6MA 2ODTX 3JZ6A 3R5FA 4PZ8A 4EQ5A 2PVPA 2QK4A 1A3GA 3U0GA 1GLVA 3AX6A 4XX0B 4O2BF 5HBRB 5JVDF 3OUZA 1EKFA 3Q2OA 4UCUA 1W96A 2VUGA 3AW8A 3T9AA 2HIVA 4YAJB 2OLSA 4NZOA 1EZ1A 3RTXA 3VPDA 2C00A 1EYZA 5I47A 2CNUA 3L2PA 4TVIA 2YZGA 1PX2A 2NU6B 2XD4A 3NUAA 3T99A 3TIIA 2ZDHA 1AUXA 3VNNA 5BPHA 1PK8A 5H80A 3LULA 5E25A 3R5HA 2Q2TA 4YB8B 4O82A 2HGXA 3RV4A 4O2AF 4TUYF 2J9GA 3OUUA 2HDKA 3MWEA 2XCLA 2ZDQA 3TW7A 2GQSA 4FGRA 3ETHA 2I87A 4UCVA 2R7LA 2YRWA 2V59A 4O7WA 3SE7A 3TQTA 3WWJA 2V58A 4HQ6A 5I5XA 2YW2A 4GLXA 3LWBA 2W6QA 4QSHA 4FFPA 3ORRA 2R7NA 3W1BA 5DGIA 3K5HA 4XYLB 2DABA 3RR5A 5IYZF 4C5AA 1EUCB 1BNCA 1KJ9A 5D8DA 2YWVA 5I5TA 3BA8A 1ET0A 2I80A 4Q4DA 5DISC 5KS8A 4MV4A 4C5BA 3GLKA 1P16A 1GSHA 4DRFA 2VR1A 1CQJB 2GPWA 4CKCA 4FFRA 2YRXA 4PBCA 3N6RA 4ME6A 1Z2NX 1KT8A 3E5NA 3U55A 1X9NA 5I5VA 5FR9A 2FPGB 1GGOA 3T9EA 1IYDA 1G2WA 3JSNA 1UC8A 4FU0A 3Q1KA 5LYJF 3BABA 1UC9A 4UCRA 2FPIB 3QQMA 4CHIA 2X5RA 3LP8A 3UZOA 5I5WA 3JRWA 3CEBA 2IP4A 3R5XA 3SNOA 4O4LF 2Y4RA 2X0SA 4E4TA 1WRVA 5D1OB 3T7AA 5K3WA 1XDNA 2HVSA 4RZQA 3GJXB 2YZLA 4DLKA 4MV3A 5FPRA 3T9CA 1IYEA 2EJ3A 5LXTF 2DWCA 1KJJA 2R7MA 1KJIA 1M0WA 3KREA 1A48A 4MA0A 2COJA 4XYMB 1CKOA 1P8LA 2EJ0A 2QB5A 4FFLA 2YZMA 1VBGA 2W71A 2HHFB 2NU7B 3BA9A 5FNVF 4M0JA 5BWWA 3JZFA 2V5AA 5CAEB 4I55F 3U9SA 4EGJA 2HVQA 1TA8A 3JSLA 4UCTA 4CKBA 3WWIA 5I5SA 4GLWA 1A0IA 5JQWA 2FPPB 3VMMA 2GPSA 1W93A 4IIJF 2NU9B 2Q2UA 3N8DA 4IZOA 3SGIA 1CS0A 1AUVA 2EJ2A 2ABJA 4M9UA 4O4HF 3NC0B 4C5CA 2DLNA 4MA5A 5D1PA 3DF7A 3DTFA 4EFBA 5J2UF 1GSOA 3T9BA 4L1KA 3T9FA 5CB4F 1KBLA 4EEQA 2SCUB 1B6RA 1JDEA 5CA1F 3R23A 4ZOLF 4O83A 1CKNA 3UFXB 1M6VA 1I7LA 2GLTA 4JXUA 4CE5A 1V9PA 4UCOA 1OBDA 4WHXA 2R82A 4YBZB 4TM5A 1CE8A 5DMXA 2HVRA 5I60A 4MV6A 3U9TA 5CA0F 4MV9A 3HBLA 3JZIA 4O7VA 4UFZA 5J2TF 3WO0A 1I1MA 4I4TF 4FFMA 1DIKA 4O7YA 4O7ZA 1DGSA 4FE2A 4FFNA 1A9XA 1Z2PX 3BACA 4HNTA 5C8YF 1KEEA 4O7LA 1KJ8A 2GQRA 2HGSA 4UUGA 3HO8A 1JLLB 3VPCA 4CC6A 5CR5A 3I12A 3V4ZA 2R7KA 5BMVF 3HT5A 5LOVF 1CKMA 1VKZA 4HNUA 4CMFA 2A1HA 5FPOA 5HV6A 1JDBB 4CMDA 2Z02A 3RUPA 4YJ2F 2HG8A 3WO1A 3W5OA 1EUDB 4O7NA 4EGQA 2DZDA 4YJ3F 4TV9F
chains in the Genus database with same CATH topology
4K6NA 3T54A 4CKBA 5CM0A 5BWUA 2HDKA 3WWIA 5I5SA 4GLWA 3PFFA 3TW7A 5I5YA 1A0GA 5DGHA 1EKVA 4CKEA 5BWRA 2ZGIA 4DAAA 3CSWA 3SGIA 2HHFA 4NZMA 2EJ2A 1EKPA 2ABJA 3WWJA 3TEKA 5I5XA 3T9DA 3WWHA 3UZBA 5BYBA 3DTFA 3UYYA 3T9BA 2EIYA 5DGIA 3T9FA 2DABA 1I1KA 4RCNA 4IWXA 1I2KA 3DTGA 5BWVA 4JXUA 4CE5A 2Q7DA 4WHXA 1KTAA 5I5TA 4HN2A 2HGWA 1ET0A 4Q4DA 4TM5A 1I1LA 5KS8A 5K2MA 5I5UA 4NZNA 5I60A 5CE8A 3LQSA 4CKCA 4PBCA 5HNEA 4Q4CA 1KT8A 5I5VA 5FR9A 1DAAA 3T9EA 5DAAA 1I1MA 1IYDA 1G2WA 1I2LA 1UC8A 2DAAA 1UC9A 2ODTX 3JZ6A 2COIA 3QQMA 4DQNA 4CHIA 3BACA 2X5RA 3UZOA 1A3GA 5I5WA 3U0GA 3CEBA 3SNOA 2Y4RA 5BWXA 1WRVA 4UUGA 3T7AA 5K3WA 5CR5A 1EKFA 5BWTA 3HT5A 4CMFA 3T9AA 3T9CA 2A1HA 1IYEA 4NZOA 2EJ3A 3DAAA 3VPDA 4CMDA 5I47A 4TVIA 2COJA 3T99A 4IWYA 2HG8A 1ZAUA 5BYAA 2EJ0A 2QB5A 2HHFB 3LULA 5E25A 2COGA 4M0JA 5BWWA 2HGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K6N A;  5CM0 A;  5BWU A;  2HDK A;  3WWI A;  5I5S A;  5I5Y A;  1A0G A;  1EKV A;  5BWR A;  2ZGI A;  4DAA A;  3CSW A;  2HHF A;  2EJ2 A;  1EKP A;  2ABJ A;  3WWJ A;  5I5X A;  3WWH A;  3UZB A;  3DTF A;  3UYY A;  2EIY A;  2DAB A;  1I1K A;  1I2K A;  3DTG A;  5BWV A;  4JXU A;  4CE5 A;  4WHX A;  1KTA A;  5I5T A;  2HGW A;  1ET0 A;  4TM5 A;  1I1L A;  5I5U A;  5I60 A;  5CE8 A;  3LQS A;  4PBC A;  5HNE A;  1KT8 A;  5I5V A;  5FR9 A;  1DAA A;  5DAA A;  1I1M A;  1IYD A;  1G2W A;  1I2L A;  2DAA A;  3JZ6 A;  2COI A;  3QQM A;  4DQN A;  4CHI A;  3UZO A;  1A3G A;  5I5W A;  3U0G A;  3CEB A;  3SNO A;  2Y4R A;  5BWX A;  1WRV A;  4UUG A;  5K3W A;  5CR5 A;  1EKF A;  5BWT A;  3HT5 A;  4CMF A;  2A1H A;  1IYE A;  2EJ3 A;  3DAA A;  4CMD A;  4TVI A;  2COJ A;  2HG8 A;  2EJ0 A;  2HHF B;  3LUL A;  5E25 A;  2COG A;  4M0J A;  5BWW A;  2HGX A; 
#chains in the Genus database with same CATH topology
 4WBN F;  1WR2 A;  1VS0 A;  5CM0 A;  5BWU A;  3UQ8 A;  2R86 A;  4LH7 A;  4NYE A;  3PFF A;  5I5Y A;  5DGH A;  3V4S A;  5BPF A;  1EHI A;  2WYO A;  5JVL A;  2R85 A;  5BWR A;  4DIM A;  4EFE A;  2ZGI A;  3KYH C;  4HR7 A;  4I50 F;  2HIX A;  5LA6 F;  4NZM A;  1EKP A;  1FVI A;  3BG5 A;  2R87 A;  3T9D A;  3WWH A;  1KJQ A;  2YS6 A;  5BYB A;  3UYY A;  4ZI7 F;  5KX5 F;  4RCN A;  3K3P A;  2ZDG A;  4MV8 A;  1I2K A;  4PZ6 A;  1JKJ B;  1OBG A;  2I8C A;  3PN1 A;  1I7N A;  2Q7D A;  1KTA A;  4HN2 A;  2HGW A;  3NBZ B;  3BAA A;  1SCU B;  1IOV A;  2VQD A;  5I5U A;  2NUA B;  3U54 A;  3ORQ A;  5CE8 A;  2DIK A;  3KAK A;  3LQS A;  3TY8 A;  5C1O A;  2YL2 A;  2YZN A;  4O7S A;  5HNE A;  4Q4C A;  1ULZ A;  3HB9 A;  1DAA A;  1CQI B;  3QFF A;  1Z2O X;  1E4E A;  1T36 A;  2W6Z A;  5GON F;  4E6N A;  3TIG A;  2Z04 A;  1B04 A;  2COI A;  1DV1 A;  4O7R A;  3KAL A;  3TY9 A;  3VPB A;  4DQN A;  4EG0 A;  5JH7 F;  4Y8V B;  2QF7 A;  4O86 A;  5BWX A;  2R84 A;  5JQG F;  1XK5 A;  4O81 A;  2W6O A;  3R9R A;  3JRX A;  5BWT A;  4O7T A;  3KAJ A;  3RFC A;  3TW6 A;  3G8D A;  1KUT A;  4UCS A;  4TV8 F;  5KKN B;  3DAA A;  3MJF A;  2YYA A;  2OWO A;  4IWY A;  1ZAU A;  2PBZ A;  1TAE A;  5LP6 F;  5D1O A;  5BYA A;  5C1P A;  5EZY F;  2COG A;  4IHJ F;  4FFO A;  4K6N A;  2VPQ A;  4HNV A;  3T54 A;  4CC5 A;  1DV2 A;  3GID A;  4YAK B;  2CZG A;  3WNZ A;  3S24 A;  2YS7 A;  3TY5 A;  1A0G A;  1EKV A;  4CKE A;  1KC7 A;  1E4E B;  3ETJ A;  4PZ7 A;  1CKN B;  4DAA A;  3CSW A;  1IOW A;  4O4I F;  4ZHQ F;  2HHF A;  1C3O A;  3QWU A;  3VOT A;  3TIN A;  3TEK A;  2PN1 A;  3MWD A;  2NU8 B;  3UZB A;  1B6S A;  3G8C A;  2EIY A;  2CNQ A;  4XZ3 B;  3GB8 B;  4LH6 A;  4MV1 A;  1I1K A;  3RV3 A;  4IWX A;  2CNV A;  3GDE A;  3DTG A;  5BWV A;  2FB9 A;  3NBY B;  2HJW A;  4ZQI A;  2W6P A;  1S68 A;  1M0T A;  2W6N A;  1I1L A;  4MAM A;  5K2M A;  3VA7 A;  4NZN A;  2W70 A;  1C30 A;  1VBH A;  2P0A A;  2CFM A;  1BXR A;  4O4J F;  4O84 A;  4MV7 A;  1GSA A;  5DAA A;  3K5I A;  1I2L A;  2FP4 B;  3W1G A;  2DAA A;  2W6M A;  2ODT X;  3JZ6 A;  3R5F A;  4PZ8 A;  4EQ5 A;  2PVP A;  2QK4 A;  1A3G A;  3U0G A;  1GLV A;  3AX6 A;  4XX0 B;  4O2B F;  5HBR B;  5JVD F;  3OUZ A;  1EKF A;  3Q2O A;  4UCU A;  1W96 A;  2VUG A;  3AW8 A;  3T9A A;  2HIV A;  4YAJ B;  2OLS A;  4NZO A;  1EZ1 A;  3RTX A;  3VPD A;  2C00 A;  1EYZ A;  5I47 A;  2CNU A;  3L2P A;  4TVI A;  2YZG A;  1PX2 A;  2NU6 B;  2XD4 A;  3NUA A;  3T99 A;  3TII A;  2ZDH A;  1AUX A;  3VNN A;  5BPH A;  1PK8 A;  5H80 A;  3LUL A;  5E25 A;  3R5H A;  2Q2T A;  4YB8 B;  4O82 A;  2HGX A;  3RV4 A;  4O2A F;  4TUY F;  2J9G A;  3OUU A;  2HDK A;  3MWE A;  2XCL A;  2ZDQ A;  3TW7 A;  2GQS A;  4FGR A;  3ETH A;  2I87 A;  4UCV A;  2R7L A;  2YRW A;  2V59 A;  4O7W A;  3SE7 A;  3TQT A;  3WWJ A;  2V58 A;  4HQ6 A;  5I5X A;  2YW2 A;  4GLX A;  3LWB A;  2W6Q A;  4QSH A;  4FFP A;  3ORR A;  2R7N A;  3W1B A;  5DGI A;  3K5H A;  4XYL B;  2DAB A;  3RR5 A;  5IYZ F;  4C5A A;  1EUC B;  1BNC A;  1KJ9 A;  5D8D A;  2YWV A;  5I5T A;  3BA8 A;  1ET0 A;  2I80 A;  4Q4D A;  5DIS C;  5KS8 A;  4MV4 A;  4C5B A;  3GLK A;  1P16 A;  1GSH A;  4DRF A;  2VR1 A;  1CQJ B;  2GPW A;  4CKC A;  4FFR A;  2YRX A;  4PBC A;  3N6R A;  4ME6 A;  1Z2N X;  1KT8 A;  3E5N A;  3U55 A;  1X9N A;  5I5V A;  5FR9 A;  2FPG B;  1GGO A;  3T9E A;  1IYD A;  1G2W A;  3JSN A;  1UC8 A;  4FU0 A;  3Q1K A;  5LYJ F;  3BAB A;  1UC9 A;  4UCR A;  2FPI B;  3QQM A;  4CHI A;  2X5R A;  3LP8 A;  3UZO A;  5I5W A;  3JRW A;  3CEB A;  2IP4 A;  3R5X A;  3SNO A;  4O4L F;  2Y4R A;  2X0S A;  4E4T A;  1WRV A;  5D1O B;  3T7A A;  5K3W A;  1XDN A;  2HVS A;  4RZQ A;  3GJX B;  2YZL A;  4DLK A;  4MV3 A;  5FPR A;  3T9C A;  1IYE A;  2EJ3 A;  5LXT F;  2DWC A;  1KJJ A;  2R7M A;  1KJI A;  1M0W A;  3KRE A;  1A48 A;  4MA0 A;  2COJ A;  4XYM B;  1CKO A;  1P8L A;  2EJ0 A;  2QB5 A;  4FFL A;  2YZM A;  1VBG A;  2W71 A;  2HHF B;  2NU7 B;  3BA9 A;  5FNV F;  4M0J A;  5BWW A;  3JZF A;  2V5A A;  5CAE B;  4I55 F;  3U9S A;  4EGJ A;  2HVQ A;  1TA8 A;  3JSL A;  4UCT A;  4CKB A;  3WWI A;  5I5S A;  4GLW A;  1A0I A;  5JQW A;  2FPP B;  3VMM A;  2GPS A;  1W93 A;  4IIJ F;  2NU9 B;  2Q2U A;  3N8D A;  4IZO A;  3SGI A;  1CS0 A;  1AUV A;  2EJ2 A;  2ABJ A;  4M9U A;  4O4H F;  3NC0 B;  4C5C A;  2DLN A;  4MA5 A;  5D1P A;  3DF7 A;  3DTF A;  4EFB A;  5J2U F;  1GSO A;  3T9B A;  4L1K A;  3T9F A;  5CB4 F;  1KBL A;  4EEQ A;  2SCU B;  1B6R A;  1JDE A;  5CA1 F;  3R23 A;  4ZOL F;  4O83 A;  1CKN A;  3UFX B;  1M6V A;  1I7L A;  2GLT A;  4JXU A;  4CE5 A;  1V9P A;  4UCO A;  1OBD A;  4WHX A;  2R82 A;  4YBZ B;  4TM5 A;  1CE8 A;  5DMX A;  2HVR A;  5I60 A;  4MV6 A;  3U9T A;  5CA0 F;  4MV9 A;  3HBL A;  3JZI A;  4O7V A;  4UFZ A;  5J2T F;  3WO0 A;  1I1M A;  4I4T F;  4FFM A;  1DIK A;  4O7Y A;  4O7Z A;  1DGS A;  4FE2 A;  4FFN A;  1A9X A;  1Z2P X;  3BAC A;  4HNT A;  5C8Y F;  1KEE A;  4O7L A;  1KJ8 A;  2GQR A;  2HGS A;  4UUG A;  3HO8 A;  1JLL B;  3VPC A;  4CC6 A;  5CR5 A;  3I12 A;  3V4Z A;  2R7K A;  5BMV F;  3HT5 A;  5LOV F;  1CKM A;  1VKZ A;  4HNU A;  4CMF A;  2A1H A;  5FPO A;  5HV6 A;  1JDB B;  4CMD A;  2Z02 A;  3RUP A;  4YJ2 F;  2HG8 A;  3WO1 A;  3W5O A;  1EUD B;  4O7N A;  4EGQ A;  2DZD A;  4YJ3 F;  4TV9 F; 
#chains in the Genus database with same CATH homology
 4K6N A;  3T54 A;  4CKB A;  5CM0 A;  5BWU A;  2HDK A;  3WWI A;  5I5S A;  4GLW A;  3PFF A;  3TW7 A;  5I5Y A;  1A0G A;  5DGH A;  1EKV A;  4CKE A;  5BWR A;  2ZGI A;  4DAA A;  3CSW A;  3SGI A;  2HHF A;  4NZM A;  2EJ2 A;  1EKP A;  2ABJ A;  3WWJ A;  3TEK A;  5I5X A;  3T9D A;  3WWH A;  3UZB A;  5BYB A;  3DTF A;  3UYY A;  3T9B A;  2EIY A;  5DGI A;  3T9F A;  2DAB A;  1I1K A;  4RCN A;  4IWX A;  1I2K A;  3DTG A;  5BWV A;  4JXU A;  4CE5 A;  2Q7D A;  4WHX A;  1KTA A;  5I5T A;  4HN2 A;  2HGW A;  1ET0 A;  4Q4D A;  4TM5 A;  1I1L A;  5KS8 A;  5K2M A;  5I5U A;  4NZN A;  5I60 A;  5CE8 A;  3LQS A;  4CKC A;  4PBC A;  5HNE A;  4Q4C A;  1KT8 A;  5I5V A;  5FR9 A;  1DAA A;  3T9E A;  5DAA A;  1I1M A;  1IYD A;  1G2W A;  1I2L A;  1UC8 A;  2DAA A;  1UC9 A;  2ODT X;  3JZ6 A;  2COI A;  3QQM A;  4DQN A;  4CHI A;  3BAC A;  2X5R A;  3UZO A;  1A3G A;  5I5W A;  3U0G A;  3CEB A;  3SNO A;  2Y4R A;  5BWX A;  1WRV A;  4UUG A;  3T7A A;  5K3W A;  5CR5 A;  1EKF A;  5BWT A;  3HT5 A;  4CMF A;  3T9A A;  3T9C A;  2A1H A;  1IYE A;  4NZO A;  2EJ3 A;  3DAA A;  3VPD A;  4CMD A;  5I47 A;  4TVI A;  2COJ A;  3T99 A;  4IWY A;  2HG8 A;  1ZAU A;  5BYA A;  2EJ0 A;  2QB5 A;  2HHF B;  3LUL A;  5E25 A;  2COG A;  4M0J A;  5BWW A;  2HGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...