4EEQA

Crystal structure of e. faecalis dna ligase with inhibitor
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis and Activity Evaluation of Potent NAD+ DNA Ligase Inhibitors as Potential Antibacterial Agents.
rcsb
source organism Enterococcus faecalis
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 108
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4eeqA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4eeqA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4eeqA02
1TAEA 3JSLA 5D1OA 1CKNA 4LFCB 4B3SB 4X64B 1N34B 3L2PA 4CC5A 2E5LB 2ZM6B 4DV4B 4UFZA 4DV0B 3OTOB 1N32B 3GJXB 4E6NA 4JYAB 4UCVA 3W1GA 4OX9B 1CKMA 4DUZB 3NC0B 2HVSA 4JI4B 3S24A 1VS0A 4JV5B 5FPRA 4UCRA 1N33B 4PZ8A 1HNZB 1XNRB 4B3RB 1S68A 1IBMB 4DR4B 1V9PA 4LF6B 3RTXA 4UCSA 4DV7B 4LF4B 4NXMB 2UXDB 4EFBA 2VQEB 4JI5B 4YY3B 4X66B 4LF5B 3T1HB 1XNQB 5LMUB 1HNWB 3TY8A 2UUCB 5DISC 1XDNA 1IBKB 4JI6B 4JI7B 1I94B 4B3MB 4DR5B 3SGIA 2OWOA 1XMOB 2HVQA 3KYHC 1ZAUA 3T1YB 4DR7B 2CFMA 1DGSA 1CKNB 4GLXA 2HIXA 3UQ8A 4DV1B 2UUBB 4JI8B 4DR6B 5FPOA 4CC6A 3BA8A 4LFBB 3JSNA 3W5OA 2UXCB 4DRFA 2F4VB 4DR2B 5LMNB 4DV3B 4DV5B 2HVRA 4JI0B 5IWAB 1J5EB 2Q2TA 4AQYB 4LH6A 1P8LA 4EEQA 2UUAB 3RR5A 1FVIA 2HIVA 1XK5A 2VUGA 4NXNB 5BR8B 4JI2B 3BAAA 4EQ5A 4JI1B 1IBLB 1CKOA 5D1PA 4B3TB 4LF9B 4PZ7A 4DR3B 2VQFB 5D1OB 4KHPB 4LFAB 4TOIA 3BA9A 4PZ6A 4UCUA 4GKKB 4JI3B 4X65B 2UXBB 1B04A 1N36B 3GDEA 1P16A 1HR0B 1XMQB 4LF7B 4DR1B 4DV6B 4EFEA 4LF8B 3NBYB 1TA8A 2HHHB 4K0KB 4GKJB 3GB8B 3PN1A 4UCOA 2Q2UA 3TY9A 4X62B 1FJGB 1A0IA 3VNNA 3NBZB 3TY5A 3QWUA 4YHHB 3W1BA 4UCTA 4DV2B 1X9NA 4DUYB 3BABA 4LH7A 2UU9B 1HNXB
chains in the Genus database with same CATH superfamily
4R6ZA 1FD9A 5IWAH 1XL4A 3SPGA 4JI0H 3SJCC 3AEIA 3CCRV 3OTOB 1TWCA 3JAMW 1DAAA 4OX9B 3GV8B 4O4IB 4D7SA 1OCOC 4FFBB 4MA0A 4ECTA 4M7EA 2CK3G 4J9RA 3DC5A 5L1KA 4FLUA 3D36A 1N33B 5KHHA 1TWAA 5KFDA 3MWEA 5J2UA 4DV7B 2R86A 1OCOB 5KX5B 3PW2A 2E75B 5LP6F 5EWFA 4JI5O 3E35A 1KTAA 1S5HC 2Q0AA 4MV7A 3CCLV 4X66H 3EVKA 5IWAO 1Q5OA 1FXKA 3OHBA 2GV9A 4FS2A 3Q8QB 1K4CC 1KJIA 3LSQA 3N6RA 2RDIA 1FJGH 4UV8A 1SEIA 4GCZA 2IBZH 1DGSA 4EBCA 3K59A 4FFNA 5KAFZ 4DV4O 1VQPV 3VQXA 1Y1VG 3DTFA 4QSHA 4EKWA 2LO1A 2NNUA 4AYBA 2R93A 3R9RA 3KHHA 3APQA 2R8KA 3L71H 1WB8A 1J5EB 2BSKB 4DR7H 2Y4TA 1NR1A 2Q2TA 4JI1H 1OHHG 4DW1A 2HVKC 3CC7V 2AGOA 1W93A 4YR3A 1GN4A 2HIVA 5F9NA 3GIQA 3UT5A 3OD4A 2VUGA 5IYCG 2C2DA 2P90A 2UU9H 3SJQC 4CKEA 2YU9A 1E4GT 3G8DA 3E8HA 2ADPA 2W9BB 3VBBA 5DGBA 3CE2A 4LF9B 3CMAV 4YR0A 3CJHA 3RYIA 4C5CA 1WA8A 4HNAA 2M6YA 1XNQO 3AYHB 4PA3A 2XD4A 1TVKA 3T9AA 2ZKOA 2JK5C 5HV6A 1ROPA 1P16A 1GM7A 2Q73A 3GQCA 2FL4A 2PMZA 4DR1H 4LSAA 1NI8A 2VWJA 5KFPA 2AHZA 4DIMA 3G6XA 5DM6V 3PR5B 1RP3B 4MTOA 2XGPA 2QTSA 1R73A 3DGEA 5LGTA 5KFVA 3GB7C 2FK1A 4FK5C 4X64O 2Y4RA 1JLLB 2LW1A 4QIWE 1K33A 3TXSA 2N74A 1R6NA 3GIKA 3T1HO 4PHZA 1RPRA 4DV4B 2BOCC 4HAMA 1M0WA 4WFFA 1IYDA 1G8MA 2E2IA 2XOKG 3IC9A 3K3WA 1MOFA 4QE7A 4X64H 2XCLA 2E74B 2R72A 4PZ8A 2CGOA 4J7KA 4MT8A 4ZHQF 5KX5A 4LF6B 4ZOLA 4WBNB 4A2AA 4JI5B 3ZRWB 4NZNA 2Q7DA 3BRCA 3K04A 3TEKA 5DMXA 5GONB 3FAVA 1EYZA 4A2BA 1GTOA 5B1BB 4FFOA 3B2EE 4PA6A 5DISC 5KT5A 4NXMH 2AZ2A 3RB0A 3U0ZA 1Z5WA 2YC0A 4JXUA 2OWOA 3ZHVA 4IIJB 1XMOB 4DL2A 4FM0A 4MV8A 1SFOA 3ZMZA 2CTQA 3SJBC 3KHGA 3W7TA 3E8GA 1YI2V 3H3VH 1CKNB 2NVYA 3OTOO 4DV1B 2UUBB 1FXHA 1XBLA 1XHZA 5CAEB 4ED3A 4NTXA 1PD3A 3ETJA 1KBLA 2YEVB 5J2TA 2HHHO 2JGDB 4TV9A 2Z5UA 4U6PA 1IBLH 1WJZA 2WLIB 3T5LA 1SS3A 3N8DA 3IGAC 1QLNA 2B9ZA 2QSAA 1NTKH 3ASNB 4I55B 2R7MA 4XYMB 2W71A 5BR8B 5KFJA 1H38A 4O83A 1NZ6A 2P22C 1JPXA 4PDRA 2YRXA 2H94A 3OMIB 4BR6A 2Q9LA 1YDXA 4GX0A 4O2BA 1K3EA 4PZ7A 2R9AA 1N33H 4KHPB 2RNBA 3ZMSA 4I0XA 3I55V 3ORRA 2WLIA 5KHJA 3CCEV 2DAAA 4B3TH 1EUDB 3F8NA 2UXDO 3N44B 1JA8A 1XMQB 2ODTX 4F4WA 1IBMH 4ETSA 2AGPA 4BW5A 1PK8A 4UVCA 2R8IA 2FPGB 4J80A 1E4EB 2ZQMA 5KFCA 1JR9A 4JGSA 2ZXWB 5DLGA 2WLKA 1IYEA 1MA1A 2Z0AA 4PV1B 4PDBA 1GYFA 1ENVA 3WG7C 5KMGA 4DV5H 4OGQB 1KD1W 3OM3B 1MABG 3IC7A 1GM8A 2YI8A 3MD0A 4BBRG 1YXBA 4LFBH 1XDCA 3OW2U 4MAMA 3ABLB 2JA5A 4G28B 1D2DA 3M9OB 1XHXA 2VQDA 4X89A 3HKEA 2P5OA 4DV2O 3E22A 1CEZA 4O7LA 3RBEA 4O3NA 1CE8A 4WBNF 4JPRA 4DR3H 1G2WA 1KBHA 1BNCA 2R7LA 2KQXA 1NJIW 2YIBA 1T36A 3NC0B 4H13B 3IAYA 4MVRA 1VQNV 1VS0A 1EHIA 3VOUA 2XAQA 1K4DC 3DXRA 2W7PA 2R8HA 4BY7G 4B3RB 2Y0SE 1VIBA 5LOVB 5B1AC 4AHCA 4UXNA 4MA5A 2ODMA 1Y76A 4JI5H 2KB1A 3CHXA 3TXQA 2QWOB 3JCUZ 5KFOA 2ZDIA 3SYPA 1JJOA 1AI4A 1EFRG 2R85A 5LXTF 2JIZG 1ZQ7A 2WYOA 4B7EA 1SKVA 3JD2A 1NVPD 1KJQA 3EPIA 5BWRA 4MW8A 5I5TA 4DV1O 2UUBO 3HPLC 2F95B 1T5EA 4DR7B 1WN7A 3QG5A 4JI8B 1YEWA 1XMOO 4GKJO 5EZYF 1V4YA 5H2FZ 2OLSA 2R87A 4A3LG 4DRXB 2HVRA 3UFXB 4MTDA 2JEUA 4LFCH 1G1XB 3J81N 4TQRA 1TUEB 4BWAA 4RAZA 4EGJA 4FS1A 3UKMA 4ECYA 4NXNH 4DYLA 4JI1B 4AI8A 5JQGB 2R92G 1P49A 1COWG 4I0XB 4DR3B 1TWHA 4ME6A 4JI1O 1M56B 5JH7B 3Q8PB 2V1DA 3SYAA 4QWDA 2QGNA 4DLKA 1N48A 4JV0A 1BS3A 2Y69C 3GV7B 4X66O 1PNLA 4GKJH 4LF9H 5IYBO 2PGGA 3IJ4A 2VR1A 1E4EA 3T5HA 5LP6A 3PVXA 4DR2O 3KCYA 4MVZA 4JV1A 1OBGA 2W6QA 3RGZA 1H8EG 4F6RA 3RB6A 2E2HA 1AUVA 1A0IA 4J9NA 3VNNA 4TM5A 1HW7A 2OIEA 3W1BA 1DF4A 4PI2A 3T9BA 1M93A 1ZTEA 1PX2A 3LNNA 1J5EH 4RNNA 4UB8Z 5D1OA 1UPGA 2I8CA 2JEIA 3K5HA 5LP6B 4MSWC 4E2LA 4O7NA 5C3EG 5C44G 1M5IA 4TT3G 1OCRC 2LQTA 4JI2H 2YUAA 4UCVA 4DUZH 3CCMV 3VPCA 3CVZA 4HNTA 4YAKB 4YJ2B 3HOWG 2B1IA 1THZA 3RGBA 1EKPA 3QO7A 3WFVA 4Q6GA 3MR2A 4F4LA 4FZ0A 2QKAA 4I55F 5KG4A 4FLVA 2Q67A 2VA2A 5GTHZ 2IMWP 1PL0A 1F4MA 4NXMB 3FD9A 2Q4PA 1SETA 5DAAA 2ATLA 5KFHA 4WF9V 5HFMA 1I50A 1NS1A 2XHBA 2EJ7A 1J5EO 5BYAA 1XMQH 5K1PA 3N6XA 3BQ0A 3V6JA 5D5PA 4RAYA 2JJ1G 1XDNA 1BHAA 5JJJB 1EUCB 2BR0A 4TUYF 4DV2H 4B3MB 5K3WA 3KTMA 1R6KA 3J80W 5H6QA 5FLXN 4A3BG 4JI2O 3ASOC 4H37A 2AXTZ 1WH2A 3WB0A 4FFKA 2DWCA 3P3PA 2EIYA 4QWCA 3U54A 4TQDA 3TQTA 3PO2G 2NVXA 1EN5A 1I0HA 3LMLA 1JDBB 4ICGA 2QA4V 3DTUB 1HNXO 3CCVV 2C2RA 3L9DA 1MZBA 4QJFB 1M6VA 5EOYA 4I50F 1GH6A 5KFAA 5CBFA 2BQRA 4YJ3A 5BWTA 1URFA 4J9YB 2W9CA 2YW2A 1Z2NX 2EIJB 5LGNA 2R9RB 1XNRO 1CKOA 3H4DA 5DLFA 3K58A 2YXLA 5F2VO 5I5VA 1AP5A 4YIPA 3ASNC 3ABKB 1IBLO 5H6RA 4LFAH 5I5XA 2CH7B 1W0JG 2VQEH 3BG5A 4D7TA 2JA5G 5FNVA 4RAIA 3GDEA 1K97A 1HR0B 3M9MB 4MTEA 3K0GA 1I7NA 4MV9A 5DG7A 1TA8A 2EZPA 4PDMA 4LF7H 4N23A 2V4QA 3VOTA 4MW3A 4K0KB 2W6ZA 1WB7A 3H1JH 3F7VC 4FFMA 5IE9A 2CH7A 3K5MA 1VAJA 5CA0B 4F4YA 4ECXA 1S10A 4RZQA 1KEEA 4TUYB 3FAVB 1N34O 3Q8SB 3AW8A 4DUYB 3JASA 2ZM6B 2PI5A 3T9EA 2A9HA 2DYRB 2EJ2A 3MJFA 2XC9A 2IJHA 1N36O 2NU9B 1MZFA 1RYSA 2NUAB 2P7TC 1Q6IA 1Q82W 5EK0A 5IYDG 5IYBG 4HNAB 2ZNJA 5EBWC 1N34H 3V4SA 1HNZH 2OTLV 3LP8A 1SZTA 2A7WA 2FB5A 2HHFB 3G8CA 3AG7A 3B8NA 1EZVH 4LMYA 2FLLA 2J6SA 2J6UA 3A0HZ 3BEHA 3V6HA 5KFKA 3WWIA 3ASOB 2L35A 3SPIA 1H2MA 2QM4A 1U96A 2HGSA 3ABTA 4X62H 2Q68A 2VUMG 5DGIA 2AQ4A 5FR9A 1HNZO 4JI6B 1B06A 2ZNIA 3CP1A 4YJ2F 4GC6A 1KT8A 1AROP 4LF8H 5FLXW 2DE0X 3J80N 1PKXA 2W6MA 1S5JA 2D3OW 3H01A 2QYZA 2JGUA 2F4VB 1I2KA 4C5BA 3G6BA 2HVJC 3L4KA 4O4LB 5BZBA 3CEIA 4YP3A 3OE7G 5LHHA 3WWHA 1XREA 2VQEO 4U3FH 4O7ZA 2ZM6H 3H9VA 2CW8A 1XOUA 4WBNA 4EQ5A 4A3JG 5LYJB 3B8MA 2WA3A 2UVWA 2FPPB 4ZQIA 5ITZB 3CCJV 2F93B 1YJNV 3JALB 4BWSC 4PZ6A 2FP4B 4BXXG 4Q43A 4X20A 1Y66A 2KSWA 2DYSC 4CS2A 1JFFA 4R50A 3ETDA 4NTYA 4LCUC 3QO8A 1N0NA 2UXBB 4J9OA 3OUFA 1B04A 4WCEV 4WFHA 1K83A 4E4TA 4LF4O 2R8GA 4LF7B 2X7RB 3CXCU 3RVZA 5BXZA 3DSQA 4F50A 2FYUH 4X1KB 1JX9A 1R3LC 4K8ZA 1K5QA 3GB8B 4GX2A 2WE6A 1T3NA 3CXHF 1FXKB 5CBHA 3TY9A 1Y76B 3H20A 1KQSU 1R3JC 3TETA 1DIKA 4JV2A 3QWUA 4O4JF 3H0GG 3D3IA 4QPKA 4DUYH 5IY5B 4QWBA 3RJ0A 4LNUB 3FYIB 1SZXA 1SA0A 2ZE7A 2B63A 1V55B 2A06H 3CSWA 1IVSA 4LFCB 4MVMA 4FLXA 3VPBA 2EJRA 1DV1A 2RF4A 4RQEA 3FKIG 2X6BA 1S77D 2RGRA 1VMGA 4YR2A 2JS5A 2EZOA 4DR2H 1YZBA 4CMFA 4GC7A 2CQYA 3M8AA 4JV5B 1N33O 2PMZE 4WFAV 2HFEC 2QK4A 3UT5B 1VBHA 3SPHA 1IBMB 1V9PA 2DQ3A 1AR1B 4LF4B 1H2LA 4JZGA 1I1MA 4KUMA 2VQEB 4JI4H 4NLGA 3WNZA 4QWAA 5DG9A 3OSPA 3FDSA 3KALA 2FLNA 3H1LH 1HP8A 2OH2A 2F4VO 4O4IF 4RB2C 2WDTA 5JH7A 2NLJC 2ZDHA 1MMMA 2HVQA 3UO2A 1MG1A 5JQGF 4WD3A 5CMUA 2WLNA 4I5SA 4APMA 3A8TA 2UUCH 4GLXA 3ABMB 1K1QA 1VP7A 5DEDA 3ZHSA 4DR6H 4CMDA 2WLJA 4FFLA 2GTAA 5LMNB 4DV3B 1L0LH 1Y14B 2V4RA 2O57A 2QJ1A 1VBGA 1GO3F 4UVBA 4J9KA 1AJPA 5L1LA 2HR3A 3ETQA 2PI4A 1FVIA 4R8UB 5KFNA 5LOVF 3PZPA 3L4JA 2AGAA 3EHBB 3V4ZA 3BQ1A 3BAAA 3RYFA 4I4TA 5D1PA 2W57A 1UC8A 4JI6O 5KG5A 4LF5H 4MV6A 2RMKB 2ZCEA 2IU0A 4I9WA 4X1YB 4QE9A 2K1EA 5IJ0B 4ECVA 2G38A 1M9NA 3ZIAG 1K9MW 4CS3A 3PJSK 2XAFA 1KKDA 2FLPA 4J41A 1KUQA 4J9LA 5F9LA 4R8UA 1AJQA 4U3JA 3NBYB 2DOSA 3Q2OA 1M56C 4YXWG 3H1IH 4YIOA 1AI5A 2XTAA 3R66A 1RJRA 1YIJV 1HNWH 1OCZC 3JAWA 3JYCA 1ZHQA 4YQWA 3LQSA 5TISZ 5KS8A 3NUAA 3SR2C 3HKDB 3ZHQA 1IBKO 1W96A 1AI7A 2P0AA 3TW7A 2R93G 1NTMH 4A3KG 1N34B 3H40A 5T14A 4LC1A 4KXRA 1CQJB 4O4HA 5A2QW 1N8RW 5BYBA 4L1KA 4JYAB 3VQVA 4JZ2A 4X65H 3G4SV 2YSUB 3FB5C 1IBMO 5KT3A 3J81W 4JUZA 1VF6C 1L0NH 4MTFA 1JXLA 4YAJB 1Y74A 1XNRB 3HKDA 3VQWA 4CH6A 1S0VA 2NU6B 5DGHA 4ED7A 2FKLA 2C22A 1VQ7V 2ABJA 5CA1F 2RJZA 1FFXA 4FFPA 2F23A 3TJTA 1VKZA 4I50B 2DQ0A 3JCZA 3QF7A 5BWVA 3U55A 4CKBA 3ABKC 3IN5A 3EPGA 1T94A 1NBMG 4FLYA 4IYIA 2GPWA 2W8KA 2EIKC 4DR6B 1DTOA 4O3PA 4BW9A 5KFFA 3W7UA 2CTWA 4LFCO 5KFXA 3BJYA 2HP8A 3G6VA 3JATA 4A3CG 3JRXA 2B5UA 5KG0A 3LDEA 5H5NA 3KKYA 4LH6A 4Q0YA 3X2QB 4EEQA 1SQFA 2Q5ZA 3CRAA 4R8CA 3T5KA 1P4RA 1LNQA 1SQVH 3JD3A 5EYPB 4I4TB 3ZRWA 1K34A 2QB5A 4CH5A 5A2QN 2OT5A 3E22B 4ABMA 2JA7G 1JQ0A 2XNDG 1EKFA 4C5AA 3KG2A 2MCTA 5B1BC 3B77A 1RM1C 3U11A 1VQMV 3U0GA 2X0SA 4W4LA 3R23A 1BGYH 4MV1A 3WG7B 3A0BZ 2JRIA 3AX6A 3CS5A 2UXBO 2QKCA 4U3JB 5K2MA 2IBKA 2YYAA 1O9GA 5L9XA 4NXMO 3U10A 4GKKO 4GX1A 3MR6A 2F43G 2LGWA 4ZHQB 4Q44A 2ITCC 3RBZA 4LWSA 1P7BA 5KT4A 4X9QA 1FFTB 4UV9A 4MVUA 4XDLA 2J9GA 4YY3H 4HYKA 3C3SA 1AI6A 1S0OA 2Q0OC 2X0LA 2BQ3A 3OUUA 4CS4A 4KFMA 3BHPA 2J6TA 2VS0A 2PTMA 3L74H 3W7WA 4OPAA 3FMAA 1I94O 5KFZA 2R82A 1WRVA 4RNMA 2JEJA 4JASA 3ZHTA 1D5AA 3CYOA 4JI0O 5KUKA 3N42B 2GQSA 1KJJA 2AHYA 3PW7A 1N4CA 1S5LZ 3CC2V 4YY3O 2E5LB 2CUGA 5J2TF 1UC9A 4BAYA 5LA6F 4P9OA 3RN4A 3M9NB 4JYAH 3GJXB 4X62O 5B3SC 4I9QA 5KFIA 1CKMA 1BQZA 1C30A 4JI4B 5L1JA 2KSDA 3HB3B 5LXTB 1ET0A 4EBDA 3E83A 1C3OA 1HNZB 3ZBHA 1JDEA 2QKSA 4DR4H 1WCMG 1IOWA 3HKBB 4PDLA 4U7OA 1BJTA 5IYCO 4G3IA 1YHQV 3I4NG 1I6UA 2Y48A 4Q4DA 2WAQE 2D2CB 3RYHB 5LHIA 4AILC 1FS0G 3P3NA 5L3CA 1NH2D 3AK2A 5LYJA 1W59A 4DR3O 3ZMTA 1VQ8V 1M4UA 1B6SA 4JI7H 3NGDA 2EINC 3JASB 2F1MA 2YIBD 1H8HG 3SYOA 2HIXA 3FKSG 2DZDA 3QZ7A 3JZFA 2XT9A 4DQNA 3ZRSA 4LFBB 2YS6A 4K0KO 3HO8A 3GTOA 4DW0A 4DRFA 3EFFK 2RN9A 5CBGA 3N2GB 4D6TH 4NZOA 1Y1WA 5KA6A 3RB3A 3K5LA 1HR0O 1QBZA 3L72H 1U97A 4GX5A 2FKXA 1NQTA 3H4BA 2AGQA 3A2FA 4DR7O 5KG2A 4NXNB 4XX0B 4JI3H 4O3QA 4DL3A 3OHAA 1KJ8A 4HYOA 3RW0A 1S72V 1IBLB 4B3RO 4O4HF 4B3TB 4J7JA 4JI7O 2LP7A 3JD4A 4G27B 1H2SB 3T4ZA 1OBDA 2HG5C 1FXVA 3BA9A 1Z2OX 1Q90D 4IAJA 5AG2A 2ETNA 3VQYA 1MZEA 3CSXA 2W6NA 2ZE5A 5C8YB 3TQ1A 3O9OA 5EIBD 4A3GG 3RFRA 1BMFG 3GTKA 1CXZB 1JX4A 4JI3O 4ECWA 2BE3A 2DPJA 1QQCA 1KECA 2XCAA 5JJNB 1LR1A 2R70A 3MWDA 2GQRA 4ECQA 4X1IB 2ARHA 1Q7YW 3ML0A 3PW0A 3TK1A 2UVUA 4RZRA 4UVAA 4OXSA 2Y4UA 2COGA 2YDEA 3K3VA 2XUMA 3LWBA 2NU8B 2JS3A 5KG7A 2ZXWC 3SYCA 1IBKH 4DR5O 3QQMA 4DV2B 3BABA 2UU9B 1HNXB 3FB6C 4IRCA 2W6IG 1S0MA 3GTMA 4ZKIA 2LFSA 1B6QA 2JA6A 3LDCA 2N04A 2R7ZG 4KL1A 5BR8H 1ZWIC 2YRWA 2XCPA 5KUMA 4O4JA 4BIUA 5B1AB 4C2MA 3N2KB 1S0NA 3V6KA 1VF5B 1XI1A 4J10A 3GWOA 3GIPA 2HGXA 2JA7A 4DK1A 3DAAA 4I4TF 1QU7A 1WP7A 2UXDB 3K3PA 5I5WA 1SERA 4YB8B 5DQGA 2Y0SA 2KG7A 2XGQA 1R3KC 2WLLA 2A79B 2W0XA 3RYFB 3TY8A 4IR9A 5FNVB 4O4JB 2DIKA 4JI7B 4BBSG 3PFFA 4B3TO 2Q8VA 4ECZA 4DL4A 2QDOA 4B08A 2PBZA 1XMOH 1HR0H 3FFQA 5BR8O 4ZOLF 3GTPA 3JD0A 5A9GA 2CFMA 1OCRB 2W9BA 4FIPC 3UQ8A 4RUFA 3GIIA 2DWEC 4FGRA 4B3SO 2ZR2A 3C0FB 4DR2B 4DO2A 4JAUA 1O9HA 5LA6A 1RSOB 4JAAA 5CA0A 4Y8VB 1R6TA 4B7KA 4O82A 4G2KA 4ECUA 4LFBO 1P8LA 2VWKA 2AW9A 3CRQA 4Q45A 1A3GA 2FMAA 1GAXA 5IDJA 1R3IC 4I7HA 2YZNA 3UZOA 1YJWV 4ZI7B 3STLC 3H1KH 2HEPA 4TV8A 2YZMA 5DQIA 1PV0A 4LFAB 4RUEA 4O2BB 5KFMA 3J7AK 1OCCB 4O4LF 1TUBB 1DLBA 5EDWA 3KCXA 2DWDC 4X1IA 3WU2Z 1GKFA 1IOVA 2COJA 3FB7C 5CA1A 5JCOC 3LNMB 3T9FA 4GKJB 5IP7G 4UCOA 5LYJF 4U7NA 1NT2B 4X62B 2BCCH 4EBEA 4EEYA 4LR3A 1E1QG 5EBMC 5BWWA 2YCHA 3OGCC 4W4KA 2LFRA 4IWYA 1TWGA 1Y1WG 3AK3A 1HNXH 4QIWF 2NU7B 2BTQB 3TW6A 4O2AF 4IRKA 2CKZB 4AQYH 3RT3C 4TWKA 1RFYA 5CA1B 3L75H 4B3SB 1QVFU 3SDLA 4CC5A 3CX5F 2C2EA 4DV0B 2WPDG 3K0DA 4JI8O 1S3JA 4Z2WA 1VQ9V 1P84F 4X1YA 3KZIZ 3RBDA 2R6FA 3Q8RB 5LP6C 3PO3G 4NVPA 4UUGA 1AN7A 1MSWD 2IW5A 4NKGB 2OTJV 2C2AA 5JVDB 1VF7A 3S3XA 4Q4CA 1S68A 3MAQA 5DECA 5KFGA 2B1GA 4IHJB 3B40A 4LBEC 3ZN0A 5FD5A 1ZETA 1FYJA 3K5IA 3HOYG 5ITZA 3RAXA 1XNQB 5J2TB 1KJ9A 3T2MA 2YS7A 3OAAG 5JCOA 3N43B 3S3WA 2DW4A 3JAWB 1M1KW 1JVMA 4LF9O 1I2LA 4X88A 4I55A 3BVOA 1VQKV 1NVPB 3SYQA 3RYCB 2BOBC 4J42A 4BIZA 4O84A 3RGXA 4IHJA 2XASA 4PD4F 4JF3A 5L3FA 4EYIB 1F4NA 4M0JA 4YHHH 4O7TA 4O3RA 5LA6B 3JSNA 1VQ5V 3K06A 1UJWB 2QEXV 2IJIA 4O4HB 4O86A 5GONA 5IWAB 2ASDA 2UU9O 1YITV 3HKZA 4HNUA 1MNGA 4MVSA 2EILC 3ZN1A 1GO3E 1XNRH 1QCEA 4IIJA 1DF5A 1Y74B 3K08A 4PI0A 1YVWA 5LL6Y 3B4SA 1IX9A 1SRYA 5EZYA 1TGOA 4R7RA 4DV4H 5H80A 3RFCA 4NB5A 5EBLC 4J9QA 2LW7A 5E79Z 4UCUA 1XMQO 4JI3B 2OCCC 2V4DA 3MHSC 4I50A 3MR3A 2UUAO 1FXKC 4K0KH 2Q7GA 4DL7A 5KKNB 2GHYA 1WAZA 5L1IA 2GUZA 2YI9A 3OTFA 2HHHB 4KHPO 3WO1A 3CWBH 3OR7C 2R92A 4ZBMA 2R9IA 2Y69B 1D5NA 1JOYA 4O7YA 1XEQA 2FTKA 2KKWA 4K35A 4OX9O 1FJGB 2MK3A 1FJGO 5IYZF 3T1YO 3H1HH 2N05A 2EIMB 2DYRC 4DXWA 3OEEG 2AZ0A 1K5SA 3RTXA 1A48A 3Q1KA 1CS0A 1GSHA 1Y67A 5KFBA 5LMUO 1BXRA 2W9AA 4A3EG 2NR5A 4LP8A 2OYQA 1OCCC 1CP9A 2IA6A 3W1GA 2IU3A 2RQ6A 4ED8A 1Q6UA 2LGQA 4DUZB 5C8YF 1AVMA 4FE2A 4O7VA 3K9AA 4BIOA 2ZIOA 2A1HA 1AR5A 4WHXA 3P32A 3ETGA 4YJ2A 1M57B 1RPOA 4U7CA 4UCSA 4A3IG 2Z02A 4PA7A 4MS2A 1BZKA 4FZ1A 5CB4B 2EJ3A 5KFEA 4LF5B 3T1HB 5EWGA 4LF6O 1WSCA 2YZLA 2V7QG 2HKOA 2EBOA 4FM2A 2FMLA 4DV7H 2YICA 1IXMA 3STZC 2ILMA 1PNMA 1G4YB 4ECSA 2DJVA 4KP4A 2VA3A 1Q3EA 3GTLA 4RO2A 5J2UF 4B3MH 1I7FA 1ZAUA 1US6A 1ZHSA 5IP9G 4RNOA 1Q86W 1G6UA 3E8BA 5BY1A 3KAKA 3JD1A 2YXHA 4JI6H 5C93A 1B3QA 3ZJZA 2QF7A 5GTIZ 5CB4A 4DAAA 1WLEA 4ZI7F 1B33N 4Q8FA 4CH4A 2VPQA 2ALZA 3WO0A 3CRCA 3JAKA 4JI0B 1WNSA 3UO3A 2UXCO 5E1AC 2PVPA 3AG1B 3MFHA 1RM1B 2YZGA 1CQIB 2P06A 2ASJA 4JYCA 2QE7G 4YJ3B 3I4MG 4ED0A 2C35B 4XBFA 5KG1A 2F66C 5IYDO 3N40P 3H0GA 4JTDB 4FFRA 4KHPH 2QWPB 2UUCO 3T54A 2UXDH 4GKKB 3OUSA 3ICXA 2CDYA 5KFTA 4UB6Z 4DV0O 5KT2A 5C1PA 2GUZB 2YXYA 1BE3H 3ABMC 1RJPA 3MFIA 3T1CA 1ZUQA 4EFEA 4J9MA 5IJ9A 2YL2A 2WTFA 1Q81W 5FD6A 3ABLC 5FJ8G 3PW5A 2XAGA 3RV3A 2ASLA 1QLEB 5GW7A 1BT8A 3FB8C 4PA9A 4IYHA 1P7GA 2PYJA 4HQ6A 2V58A 3F5WC 2WWWA 2QWRB 3CCQV 3VMMA 1JIHA 3HKZE 4B3SH 2IJJA 3N2GA 4CBCA 2YIDA 4RB0A 5C1OA 2WLHA 3OR6C 3C90A 1E1RG 4LH7A 4YBZB 2ZD9A 5B3SB 3JSLA 3PR4A 1ZX3A 5LMNH 4RU9A 4F4ZA 2CTRA 3SNOA 4PDVA 4JV5H 3BFRA 3L2PA 4AYBE 4JI8H 4DL6A 1M57C 2GLTA 3ZX6A 2PF4E 3I5DA 1V55C 2Y0PA 4X65O 1I1KA 1J95A 2FPIB 4XDKA 3N41B 1GM9A 3DXRB 1A9XA 2W6PA 3RB4A 5L3BA 4LFAO 4P2ZA 3I56V 5BWUA 1AJNA 5LOVA 3PW4A 2QWQB 3TIIA 5EYPA 4FMTA 4ED2A 4DV6H 4DUZO 3W7SA 2V5AA 1S97A 2BQUA 1GSAA 1RK6A 2PN1A 1YTFB 4DR5H 4O7WA 4L8JA 3CB2A 4IWXA 4AQYO 3BPZA 1SQQH 2VUMA 5LMUB 3M7MX 1XL6A 4QJFA 4E4EA 4GLWA 3KHRA 1M7JA 2CTPA 1SQXH 1KC7A 3I12A 4EGQA 3CRRA 1QR8A 4O3OA 2EJ0A 3T1YB 1BQ0A 2QTOA 4JYAO 1TVKB 4K6NA 1TUBA 1TWFA 5KLVH 5CM0A 2RCVA 5IT9W 3BA8A 3O65A 4EB6B 4F4XA 4PA4A 4DV5O 1YJ9V 4DR1O 2SCUB 3P30A 4J9PA 3N2KA 3CMEV 4O2AA 1B6RA 4MVQA 2UUAB 3RR5A 1L2ZA 2HJWA 1XK5A 2UXXA 1PL4A 3ZCCA 4FLZA 4C7UA 1AB3A 2WB1E 1I5YA 4HBNA 4CZZA 3WB1A 2CNQA 4EB6A 4TV9F 4GKKH 3QZ8A 3LSUA 1IZ3A 3VPDA 2ZIMA 1VQ4V 4RB3C 4JYYA 1KP2A 4NTWA 4XDJA 1H2NA 3HB9A 4X20B 2W6OA 4LSXA 3ZMVA 2EIKB 4O2AB 5BPHA 4O7SA 3G6EV 3SE7A 3AG4C 5L3GA 1SESA 2ZT9B 4DV6B 4LF8B 5JVDA 3A0RA 3ZRXA 2WLMA 3F7YC 3G80A 3PN1A 1E4FT 1SCUB 4ECRA 1I94H 2DYSB 3RYHA 3K5NA 2R8JA 1R1BA 3AG4B 3Q4HA 1QVGU 5B66Z 2M7WA 2ZE8A 3ORQA 4RCNA 5LHGA 4YHHB 5JJEB 1SC5B 2NN4A 4IT5A 4UCTA 3MWMA 3ZMUA 2GPSA 3SPJA 2ZDIC 1V54B 4IL6Z 3QO5A 1GLVA 4ZI7A 4EYHB 2IP4A 2JA6G 3OGIB 3GLKA 4RUCA 1N32B 3R5HA 2OIGA 3E5NA 4O2BF 5BMVF 5KHKA 1V54C 4ASUG 5EWEA 3S24A 5IYZB 1L1FA 3KAJA 5FPRA 1WPXA 2JVDA 4UCRA 4TUYA 2JGDA 1Y6XA 2RGVA 1K1SA 4DR4B 5CR5A 1BCCH 2B63G 4NXNO 1VEWA 3BCCH 1SF9A 2JA8G 2FE3A 1EN4A 4FM1A 1NH2B 3K57A 5KFYA 1GMGA 5LMUH 5DGAA 4FVMA 1XNQH 3K03A 5EZYB 3AG2C 2GTSA 4FLWA 1K7DA 5KAIZ 2R84A 4JV5O 1IURA 1EZJA 1PP9H 4WFBV 3T1YH 1GGOA 1NTZH 3KYHC 1L8DA 2BTQA 3GTJA 3CQZA 3ABUA 2X6CA 2H3OA 3AG2B 1FKAO 1S76D 3AG3C 3TINA 2ZR3A 3DC6A 4IZOA 3AG1C 2EIJC 1X59A 1VARA 3KHLA 5LXTA 3CCUV 1VQOV 5KT7A 5E25A 1JFFB 1BL8A 2UUAH 2W9CB 4CH3A 2K9PA 4IR1A 4P30A 1UFIA 1OCZB 4JI2B 1JJ2U 2QM7A 3D36C 1LUVA 4B3MO 3T9CA 4M9UA 2ZGIA 1RYRA 5B1OA 5EC2C 4RUAA 4JI4O 4XZ3B 1KUTA 4JTAB 1BGWA 4QWEA 4O3SA 4HZ3A 5IJ0A 3HKCA 4DL5A 4RB1A 4P9PA 4GYCB 1ULZA 2W6JG 2A3QA 4LNUA 1F7YA 4CE5A 2FK2A 1PPJH 4RQFA 1QLEC 4GZRB 1SA0B 5I5SA 1OWTA 1O75A 2YWVA 4QW8A 2VQFO 1HDJA 3ZRVA 5JWPA 5KFUA 4CKCA 2WLLB 1Y1VA 3Q4HB 3LDDA 2PUSA 4WFEA 1HWYA 4FLTA 3JZIA 4A93G 1Q8IA 2YEVA 2BTOA 5BPFA 3OSNA 3TCUA 4TV9B 3UCSC 3DTGA 2W70A 2E5LH 1YF2A 2WA4A 2ZINA 3RAQA 1R9TA 2PZSA 3R5XA 2JEFA 1GN2A 2YS8A 2Z3YA 3OMAB 2E76B 3BY6A 4RWUA 4R7CA 3CPWU 3D3QA 2JDIG 3CRMA 2HJFC 2XAHA 4ED1A 3LSSA 4JYBA 2Z04A 1N56A 3SJAC 5CB4F 2Q69A 4FU0A 3IG0A 1N32H 3OT7A 4H33A 2ADQB 2RDJA 5IYZA 1QR9A 2CW7A 4J7ZA 3CEBA 2HG8A 3WWJA 2R7ZA 5KFRA 4FBTA 3ZEDA 4MTGA 4PBCA 1KP3A 4J9SA 1EZ1A 1MSDA 3G71V 4DRXA 2H8PC 1S9FA 1WR2A 2OCHA 3X2QC 4PWQA 4H44B 2DN9A 4J0MA 4TQFA 4HN2A 1BSMA 5LBQA 3ETHA 4X66B 3DF7A 3K9SA 3KXYT 5KMGB 1HNWB 2EINB 3CCSV 2HGWA 1Q43A 3UZBA 1DV2A 4PELA 4L87A 2UXBH 4DR5B 5I60A 4DR6O 5KHGA 4H0LB 5C4XG 4YJ3F 2LJ2A 2IH3C 2JEGA 3QFFA 2P67A 2WSSG 3HKEB 2EILB 1M0TA 3T5JA 1I5XA 5D8DA 3RWRD 4IGGA 1NU1H 2ZM6O 1OV9A 2CNVA 4DUYO 5I5UA 2DMXA 1Z2PX 3C3TA 4GT1A 1LUWA 5DN6G 2P4VA 4B3RH 2Y0IA 3R65A 2Q7EA 2KG7B 5DG8A 1V51A 2OCCB 1OZ0A 2GDSA 5D1OB 2IM9A 4TOIA 5D5QA 3ZS8C 2MW2B 4A3DG 2E3CA 5EIBC 1ZL8B 3R5FA 1PNKA 1GSOA 1WP8A 3TIGA 3ETEA 2W8LA 4MTXA 1KC8W 4DR4O 3MR5A 4GUNA 4A3FG 1RSOA 2BSKA 4QGPA 3CC4V 3GV5B 1AUXA 1QHTA 3E89A 5HNEA 2WAQA 3GIJA 5B1NA 2P6JA 4UUJC 3GILA 3TY5A 1S03G 4CHIA 4A3MG 3GVMA 2PY5A 1Y4MA 3OTOH 3JZ6A 3HR0A 5L3EA 3BACA 1X9NA 3OMNB 1A32A 1ZL8A 3RYCA 2CZGA 1RK5A 1TAEA 3CJHB 3RYIB 1GK9A 1HNWO 4DV6O 1CKNA 3THOA 2R7NA 5KHIA 3AK1A 3TGUH 2ZDQA 2R7KA 4UFZA 1ORQC 4Z1VA 1I7LA 1X4TA 2M05A 1N0JA 2JJ2G 4BY1G 4WFGA 1DK1A 3RF2A 2C28A 3J7AU 1JMKC 1GRJA 1UNNC 5FNVF 1VQ6V 5BWXA 2EX3A 2VOBA 4F6EA 3GWKC 1H2KA 4NZMA 4TVIA 4OX9H 5IJ9B 3FYEB 4FM9A 3BQ2A 4YY3B 2E5LO 1GN6A 3K5OA 3JATB 4F6RB 5LL6b 2QR4A 1I08A 2V9WA 4NR1A 1I94B 3QNEA 5JVDF 3SPCA 1F51A 3KREA 2IH1C 1IXBA 1ZLZA 2QWNB 4QPJA 4A5UB 2HLDG 3EXAA 4TSFG 4NYEA 4HNVA 4J9ZB 2X6AA 3ZHUA 4CC6A 5I5YA 3M4IA 3HOXG 2VPSA 5DQHA 4TV8F 3CD6V 3G6YA 4DV3H 2UXCH 1FFXB 2GBOA 4DV5B 3FX7A 1W2BU 3F5TA 3AG3B 5H9CA 4AQYB 1KMIZ 3QVNA 1EM1A 5J9PC 4QIWA 4ZOLB 5KFQA 2COIA 2A0LA 3APOA 2Q7HA 5JVLA 4ZIBA 1PM9A 3W7XA 3OEHG 2CE4A 4LWSB 4J11A 3OFNG 5BMVA 2YIAA 2VQFB 5KFSA 4Q20A 4I7ZB 2W7OA 2ZE6A 5CA0F 3T9DA 1KB9F 1E79G 5K1XA 4X65B 4LF6H 2ZJTA 2GSMB 1WPBA 1BHBA 3SI8A 4FJCC 4XYLB 2XAJA 3N27A 1JCHA 1FKAH 1N36H 3LULA 1XQ8A 4JAVA 4OPHA 2CNUA 2EIMC 5IT9N 1SQPH 2HDKA 2X5RA 1SQBH 1EBOA 3E86A 2L6LA 3HXLA 2P4KA 2HHFA 1I1LA 5BMVB 3T1HH 1NR7A 3E2EA 4EG0A 1H2GA 1VF6A 2W0FC 5KA5A 3HOUG 3L70H 1AP6A 5KT6A 3GTGA 1CPYA 3MDSA 3OUZA 2DPIA 4MVOA 3MHHC 3B09A 5KG6A 3E8FA 2UVRA 4K8XA 4LF7O 4Q8EA 2PYLA 5I47A 4X64B 1XUQA 3QTCA 1KKCA 4NYKA 4K3AA 4X8AA 5IY5C 3UM7A 5GONF 3L73H 4JTCB 1K8AW 4E6NA 3RUPA 1AR4A 5CA3A 1YCIA 5C5JA 3HOVG 2HVSA 1K73W 1XILA 5LGUA 5FL7G 1FPOA 2V59A 5HFLA 2RDCA 4O4IA 1FAFA 4FFBA 1KU9A 3NR7A 1I3QA 1Z2GA 2UVVA 4N21A 1Z5VA 2DABA 1JKJB 3K79A 3VA7A 2O03A 5JQGA 4HR7A 2VRZA 1N32O 3U9SA 4EFBA 1IDSA 1WCMA 5EC1C 2VQFH 5CN0A 2UXNA 4FPPA 3U9TA 2UUCB 5B5EZ 4FBUA 1EKVA 4LF4H 5FLMG 1IBKB 4TQSA 2Q6AA 3JALA 3SGIA 3LUTB 1M90W 2ZDGA 4YHHO 1GN3A 5KFLA 1Q6HA 4DK0A 3HKCB 5JUMA 1QNMA 2CGNA 1YSCA 5CE8A 2I87A 3HKBA 5FPOA 3RVYA 4QW9A 3W5OA 2QM8A 2UXCB 1RJQA 2EULA 4MV3A 4O7RA 2ATKC 4X1KA 4LF8O 1ZSPA 3T4DA 2FK3A 3GIDA 1F23A 1K92A 3IFXA 5JH7F 3JARA 3D8CA 4DV0H 3GTQA 3WB2A 4IRDA 4O81A 5JQWA 1YTFD 5L3DA 4IHJF 3EYYA 2FJZA 3G67A 4QNHB 2ITDC 3UYYA 5KX5F 2AU0A 3HOZG 3ZHRA 1AILA 5KG3A 1OJHA 3HT5A 2CAZC 1SYXB 2XIGA 2HHHH 4TV8B 1W0KG 2IJKA 4LF5O 2C00A 1A0GA 3JARB 1EN6A 1WA8B 3NXSA 4IIJF 2WAMA 1N36B 4Z1MG 4ZHQA 3FKIA 4MV4A 4DV7O 4DR1B 2HJDA 4DV3O 3RIZA 5LMNO 1SQGA 3GIMA 3T99A 3JAKB 1KYOF 2DLNA 3M99B 3JAMN 2F4VH 2Q2UA 4ED6A 3RV4A 2WB1A 3T7AA 3NBZB 4DV1H 2UUBH 1VQLV 2JEXA 3JRWA 4O4LA 5C8YA 4PJ0Z 2I80A 5KFWA 2FB9A 3HBLA 1NKDA 5J2UB 5HBRB
chains in the Genus database with same CATH topology
5IWAH 4JI0H 4ZI7A 3SJCC 3OTOB 1N32B 4KL1A 3JAMW 5BR8H 5KHKA 4OX9B 4O4IB 4D7SA 4FFBB 4O4JA 4M7EA 4HNAB 3N2KB 3S24A 5IYZB 2ZNJA 1N34H 4FLUA 3KAJA 1HNZH 5FPRA 4UCRA 2JVDA 5KHHA 1XI1A 1N33B 4TUYA 2RGVA 5J2UA 4DR4B 4DK1A 4LMYA 4DV7B 2UXDB 5KX5B 2FE3A 2QM4A 2Q0AA 4MV7A 4FM1A 3K57A 2HGSA 4X66H 5LMUH 4X62H 4FVMA 1XNQH 1Q5OA 3RYFB 3TY8A 5EZYB 4FLWA 2GV9A 5FNVB 4O4JB 4JI6B 4JI7B 2ZNIA 4B08A 3T1YH 1XMOH 3KYHC 1HR0H 1FJGH 3FFQA 1L8DA 2BTQA 1SEIA 4LF8H 2CFMA 5FLXW 1DGSA 3UQ8A 3K59A 3VQXA 1S5JA 3C0FB 2JGUA 2F4VB 4DR2B 5LXTA 1O9HA 5LA6A 5CA0A 3L4KA 1J5EB 4DR7H 4O4LB 1JFFB 2Q2TA 4JI1H 1P8LA 2VWKA 2UUAH 4CH3A 2HIVA 3UT5A 2ZM6H 2VUGA 2UU9H 2CW8A 4JI2B 4I7HA 1E4GT 4ZI7B 4EQ5A 4WBNA 5LYJB 4LF9B 2HEPA 3RYIA 4TV8A 5ITZB 2F93B 4LFAB 4O2BB 3JALB 4BWSC 4PZ6A 4X20A 4HNAA 2KSWA 1BGWA 3J7AK 4CS2A 1JFFA 5IJ0A 1TVKA 3HKCA 2UXBB 4RB1A 4GYCB 1B04A 1TUBB 4LNUA 1P16A 1SA0B 4DR1H 1O75A 4LF7B 4LSAA 2VWJA 4X1IA 5CA1A 3DSQA 5JCOC 4X1KB 4K8ZA 4GKJB 3GB8B 2PUSA 4UCOA 2WE6A 4FLTA 3TY9A 1NT2B 1Q8IA 2BTOA 4X62B 3H20A 4LR3A 4TV9B 2YCHA 3QWUA 2E5LH 2ZINA 2PZSA 4DUYH 3RJ0A 1HNXH 4LNUB 2BTQB 1SA0A 4AQYH 4LFCB 4FLXA 5CA1B 4B3SB 4CC5A 4PHZA 3SJAC 4DV4B 4DV0B 3IG0A 1N32H 1M0WA 2RGRA 2JS5A 4X1YA 4DR2H 5IYZA 5LP6C 2CW7A 4NVPA 1AN7A 3ZEDA 4JV5B 5JVDB 4X64H 2R72A 1VF7A 4PZ8A 3UT5B 4DRXA 1S68A 3MAQA 1IBMB 5KX5A 1V9PA 4IHJB 4LF6B 4ZOLA 4WBNB 4LF4B 5FD5A 4J0MA 4TQFA 4A2AA 2VQEB 4JI4H 4JI5B 5ITZA 4X66B 3BRCA 3DF7A 1XNQB 5GONB 5J2TB 3KXYT 5KMGB 1HNWB 5JCOA 3KALA 4A2BA 1Q43A 3N43B 3B2EE 4NXMH 5DISC 4RB2C 3JAWB 5JH7A 2WDTA 3U0ZA 1Z5WA 2UXBH 4DR5B 2OWOA 4IIJB 1XMOB 2HVQA 5KHGA 4FM0A 4I55A 3SJBC 3RYCB 4APMA 3RGXA 4IHJA 2UUCH 1CKNB 4GLXA 4DV1B 2UUBB 3HKEB 4YHHH 1XHZA 4DR6H 5LA6B 3JSNA 1M0TA 4O4HB 5GONA 5J2TA 5LMNB 3RWRD 4DV3B 4TV9A 5IWAB 1IBLH 2QJ1A 1Z2PX 1XNRH 4B3RH 4IIJA 3ETQA 1FVIA 4I55B 4PI0A 3L4JA 2Q7EA 5BR8B 3BAAA 2P22C 3RYFA 4I4TA 5D1PA 2W57A 5EZYA 1TGOA 4O2BA 4LF5H 4PZ7A 4R7RA 4DV4H 2R9AA 5D1OB 4KHPB 2ZCEA 4X1YB 2IM9A 1N33H 4TOIA 5D5QA 5IJ0B 4UCUA 4JI3B 2V4DA 3ZS8C 4I50A 4K0KH 2E3CA 2Q7GA 4CS3A 5KHJA 4B3TH 5EIBC 3F8NA 3N44B 1XMQB 1IBMH 4ETSA 2YI9A 3OTFA 4U3JA 3NBYB 2HHHB 1RSOA 4PDBA 1GYFA 5KMGA 1QHTA 2KKWA 4DV5H 1FJGB 1HNWH 3TY5A 2YI8A 1S03G 3JAWA 1ZHQA 4LFBH 2PY5A 3OTOH 3SR2C 1X9NA 3HKDB 3RTXA 3RYCA 1XHXA 1TAEA 3RYIB 1CKNA 3THOA 3HKEA 5KHIA 2P5OA 1N34B 3E22A 2OYQA 2ZM6B 4DR3H 4UFZA 4O4HA 5A2QW 1X4TA 4JYAB 3W1GA 2RQ6A 3VQVA 2YIBA 4X65H 3NC0B 4DUZB 3IAYA 3RF2A 1VS0A 3J81W 1JMKC 2ZIOA 1XNRB 3HKDA 4B3RB 2EX3A 2VOBA 4YJ2A 3VQWA 5LOVB 4CH6A 4AHCA 4OX9H 4UCSA 5IJ9B 4JI5H 4FM9A 3CHXA 4YY3B 2RJZA 3K5OA 5CB4B 4LF5B 3T1HB 1FFXA 3JATB 1JJOA 4F6RB 5LL6b 2WYOA 4I50B 4FM2A 3QF7A 4DV7H 1SKVA 1I94B 1Q3EA 4B3MH 1I7FA 1ZAUA 1ZHSA 4FLYA 2F95B 1T5EA 4DR7B 1G6UA 1WN7A 3QG5A 3KAKA 4JI8B 4DR6B 1YEWA 4JI6H 4BW9A 4CC6A 3M4IA 2VPSA 5CB4A 2UXCH 4CH4A 4DV3H 1FFXB 3JATA 3JAKA 4DRXB 4DV5B 4JI0B 2HVRA 4MTDA 1WNSA 4AQYB 4LFCH 1KMIZ 4LH6A 4Q0YA 4EEQA 1SQFA 4ZOLB 2Q7HA 4ZIBA 4BWAA 5EYPB 4I4TB 4RAZA 4YJ3B 4CH5A 4NXNH 3E22B 4JI1B 5JQGB 2F66C 2MCTA 1P49A 3N40P 5BMVA 4KHPH 2YIAA 4DR3B 2VQFB 5JH7B 3U11A 2UXDH 4GKKB 3ICXA 5K1XA 4X65B 4LF6H 2ZJTA 1WPBA 4GKJH 4LF9H 4U3JB 2PGGA 1FKAH 1O9GA 1N36H 1XQ8A 3U10A 4EFEA 4ZHQB 5IJ9A 5LP6A 5FD6A 3HXLA 3RGZA 4YY3H 5BMVB 3T1HH 4F6RA 2PYJA 1A0IA 3VNNA 4CS4A 4B3SH 3BHPA 3N2GA 4RB0A 1HW7A 3W1BA 2PTMA 3FMAA 4PI2A 4LH7A 1D5AA 1M93A 3N42B 3LNNA 4K8XA 1J5EH 3JSLA 5D1OA 5LMNH 2PYLA 5LP6B 4X64B 4JV5H 3L2PA 3QTCA 4JI8H 2E5LB 1M5IA 4JYAH 3GJXB 4E6NA 4JI2H 4UCVA 4DUZH 4I9QA 3N41B 1CKMA 2HVSA 3CVZA 4JI4B 4O4IA 4YJ2B 5LXTB 5LOVA 4FFBA 1KU9A 3RGBA 1HNZB 1Z5VA 4Q6GA 5EYPA 4DV6H 4FLVA 4DR4H 2O03A 4NXMB 5JQGA 3HKBB 4EFBA 4DR5H 1BJTA 1I6UA 4L8JA 3CB2A 2VQFH 3BPZA 2XHBA 3RYHB 4AILC 5LMUB 3M7MX 1XMQH 5K1PA 2UUCB 5LYJA 3N6XA 5D5PA 4RAYA 4LF4H 1XDNA 1IBKB 5JJJB 1M4UA 4DV2H 4B3MB 3JALA 3SGIA 4JI7H 3J80W 3T1YB 3JASB 1WH2A 2F1MA 4DK0A 1TVKB 3HKCB 2YIBD 1TUBA 3WB0A 2HIXA 3HKBA 5FPOA 5IT9W 3BA8A 4LFBB 3W5OA 4TQDA 2UXCB 4EB6B 4DRFA 3LMLA 4X1KA 3N2GB 1MZBA 3K5LA 3JARA 4DV0H 5EOYA 3N2KA 3WB2A 4O2AA 1L2ZA 4YJ3A 2UUAB 3RR5A 3A2FA 1XK5A 4NXNB 3EYYA 4JI3H 1Z2NX 4FLZA 1IBLB 1CKOA 3K58A 4B3TB 2YXLA 4HBNA 1H2SB 3WB1A 2UU9B 2CAZC 4EB6A 1SYXB 3BA9A 1Z2OX 2XIGA 4IAJA 4LFAH 4GKKH 2HHHH 4TV8B 3VQYA 2ZIMA 3CSXA 4RB3C 5C8YB 2VQEH 5EIBD 4D7TA 5FNVA 3JARB 3RFRA 4X20B 4LSXA 1N36B 3GDEA 4ZHQA 1HR0B 4O2AB 4MTEA 3MWMA 4MV9A 4DR1B 4DV6B 1QQCA 4LF8B 3RIZA 1TA8A 5JJNB 1SQGA 5JVDA 4LF7H 2R70A 4X1IB 3JAKB 4K0KB 3PN1A 1E4FT 1I94H 2F4VH 3RYHA 3K5NA 2Q2UA 3K3VA 3NBZB 4DV1H 3K5MA 2UUBH 5CA0B 4YHHB 4O4LA 5C8YA 5JJEB 4RZQA 1IBKH 4TUYB 4UCTA 4DV2B 4DUYB 3BABA 5J2UB 3JASA 1HNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAE A;  3JSL A;  5D1O A;  1CKN A;  4LFC B;  4B3S B;  4X64 B;  1N34 B;  3L2P A;  4CC5 A;  2E5L B;  2ZM6 B;  4DV4 B;  4UFZ A;  4DV0 B;  3OTO B;  1N32 B;  3GJX B;  4E6N A;  4JYA B;  4UCV A;  3W1G A;  4OX9 B;  1CKM A;  4DUZ B;  3NC0 B;  2HVS A;  4JI4 B;  3S24 A;  1VS0 A;  4JV5 B;  5FPR A;  4UCR A;  1N33 B;  4PZ8 A;  1HNZ B;  1XNR B;  4B3R B;  1S68 A;  1IBM B;  4DR4 B;  1V9P A;  4LF6 B;  3RTX A;  4UCS A;  4DV7 B;  4LF4 B;  4NXM B;  2UXD B;  4EFB A;  2VQE B;  4JI5 B;  4YY3 B;  4X66 B;  4LF5 B;  3T1H B;  1XNQ B;  5LMU B;  1HNW B;  3TY8 A;  2UUC B;  5DIS C;  1XDN A;  1IBK B;  4JI6 B;  4JI7 B;  1I94 B;  4B3M B;  4DR5 B;  3SGI A;  2OWO A;  1XMO B;  2HVQ A;  3KYH C;  1ZAU A;  3T1Y B;  4DR7 B;  2CFM A;  1DGS A;  1CKN B;  4GLX A;  2HIX A;  3UQ8 A;  4DV1 B;  2UUB B;  4JI8 B;  4DR6 B;  5FPO A;  4CC6 A;  3BA8 A;  4LFB B;  3JSN A;  3W5O A;  2UXC B;  4DRF A;  2F4V B;  4DR2 B;  5LMN B;  4DV3 B;  4DV5 B;  2HVR A;  4JI0 B;  5IWA B;  1J5E B;  2Q2T A;  4AQY B;  4LH6 A;  1P8L A;  4EEQ A;  2UUA B;  3RR5 A;  1FVI A;  2HIV A;  1XK5 A;  2VUG A;  4NXN B;  5BR8 B;  4JI2 B;  3BAA A;  4EQ5 A;  4JI1 B;  1IBL B;  1CKO A;  5D1P A;  4B3T B;  4LF9 B;  4PZ7 A;  4DR3 B;  2VQF B;  5D1O B;  4KHP B;  4LFA B;  4TOI A;  3BA9 A;  4PZ6 A;  4UCU A;  4GKK B;  4JI3 B;  4X65 B;  2UXB B;  1B04 A;  1N36 B;  3GDE A;  1P16 A;  1HR0 B;  1XMQ B;  4LF7 B;  4DR1 B;  4DV6 B;  4EFE A;  4LF8 B;  3NBY B;  1TA8 A;  2HHH B;  4K0K B;  4GKJ B;  3GB8 B;  3PN1 A;  4UCO A;  2Q2U A;  3TY9 A;  4X62 B;  1FJG B;  1A0I A;  3VNN A;  3NBZ B;  3TY5 A;  3QWU A;  4YHH B;  3W1B A;  4UCT A;  4DV2 B;  1X9N A;  4DUY B;  3BAB A;  4LH7 A;  2UU9 B;  1HNX B; 
#chains in the Genus database with same CATH topology
 4R6Z A;  1FD9 A;  5IWA H;  1XL4 A;  3SPG A;  4JI0 H;  3SJC C;  3AEI A;  3CCR V;  3OTO B;  1TWC A;  3JAM W;  1DAA A;  4OX9 B;  3GV8 B;  4O4I B;  4D7S A;  1OCO C;  4FFB B;  4MA0 A;  4ECT A;  4M7E A;  2CK3 G;  4J9R A;  3DC5 A;  5L1K A;  4FLU A;  3D36 A;  1N33 B;  5KHH A;  1TWA A;  5KFD A;  3MWE A;  5J2U A;  4DV7 B;  2R86 A;  1OCO B;  5KX5 B;  3PW2 A;  2E75 B;  5LP6 F;  5EWF A;  4JI5 O;  3E35 A;  1KTA A;  1S5H C;  2Q0A A;  4MV7 A;  3CCL V;  4X66 H;  3EVK A;  5IWA O;  1Q5O A;  1FXK A;  3OHB A;  2GV9 A;  4FS2 A;  3Q8Q B;  1K4C C;  1KJI A;  3LSQ A;  3N6R A;  2RDI A;  1FJG H;  4UV8 A;  1SEI A;  4GCZ A;  2IBZ H;  1DGS A;  4EBC A;  3K59 A;  4FFN A;  5KAF Z;  4DV4 O;  1VQP V;  3VQX A;  1Y1V G;  3DTF A;  4QSH A;  4EKW A;  2LO1 A;  2NNU A;  4AYB A;  2R93 A;  3R9R A;  3KHH A;  3APQ A;  2R8K A;  3L71 H;  1WB8 A;  1J5E B;  2BSK B;  4DR7 H;  2Y4T A;  1NR1 A;  2Q2T A;  4JI1 H;  1OHH G;  4DW1 A;  2HVK C;  3CC7 V;  2AGO A;  1W93 A;  4YR3 A;  1GN4 A;  2HIV A;  5F9N A;  3GIQ A;  3UT5 A;  3OD4 A;  2VUG A;  5IYC G;  2C2D A;  2P90 A;  2UU9 H;  3SJQ C;  4CKE A;  2YU9 A;  1E4G T;  3G8D A;  3E8H A;  2ADP A;  2W9B B;  3VBB A;  5DGB A;  3CE2 A;  4LF9 B;  3CMA V;  4YR0 A;  3CJH A;  3RYI A;  4C5C A;  1WA8 A;  4HNA A;  2M6Y A;  1XNQ O;  3AYH B;  4PA3 A;  2XD4 A;  1TVK A;  3T9A A;  2ZKO A;  2JK5 C;  5HV6 A;  1ROP A;  1P16 A;  1GM7 A;  2Q73 A;  3GQC A;  2FL4 A;  2PMZ A;  4DR1 H;  4LSA A;  1NI8 A;  2VWJ A;  5KFP A;  2AHZ A;  4DIM A;  3G6X A;  5DM6 V;  3PR5 B;  1RP3 B;  4MTO A;  2XGP A;  2QTS A;  1R73 A;  3DGE A;  5LGT A;  5KFV A;  3GB7 C;  2FK1 A;  4FK5 C;  4X64 O;  2Y4R A;  1JLL B;  2LW1 A;  4QIW E;  1K33 A;  3TXS A;  2N74 A;  1R6N A;  3GIK A;  3T1H O;  4PHZ A;  1RPR A;  4DV4 B;  2BOC C;  4HAM A;  1M0W A;  4WFF A;  1IYD A;  1G8M A;  2E2I A;  2XOK G;  3IC9 A;  3K3W A;  1MOF A;  4QE7 A;  4X64 H;  2XCL A;  2E74 B;  2R72 A;  4PZ8 A;  2CGO A;  4J7K A;  4MT8 A;  4ZHQ F;  5KX5 A;  4LF6 B;  4ZOL A;  4WBN B;  4A2A A;  4JI5 B;  3ZRW B;  4NZN A;  2Q7D A;  3BRC A;  3K04 A;  3TEK A;  5DMX A;  5GON B;  3FAV A;  1EYZ A;  4A2B A;  1GTO A;  5B1B B;  4FFO A;  3B2E E;  4PA6 A;  5DIS C;  5KT5 A;  4NXM H;  2AZ2 A;  3RB0 A;  3U0Z A;  1Z5W A;  2YC0 A;  4JXU A;  2OWO A;  3ZHV A;  4IIJ B;  1XMO B;  4DL2 A;  4FM0 A;  4MV8 A;  1SFO A;  3ZMZ A;  2CTQ A;  3SJB C;  3KHG A;  3W7T A;  3E8G A;  1YI2 V;  3H3V H;  1CKN B;  2NVY A;  3OTO O;  4DV1 B;  2UUB B;  1FXH A;  1XBL A;  1XHZ A;  5CAE B;  4ED3 A;  4NTX A;  1PD3 A;  3ETJ A;  1KBL A;  2YEV B;  5J2T A;  2HHH O;  2JGD B;  4TV9 A;  2Z5U A;  4U6P A;  1IBL H;  1WJZ A;  2WLI B;  3T5L A;  1SS3 A;  3N8D A;  3IGA C;  1QLN A;  2B9Z A;  2QSA A;  1NTK H;  3ASN B;  4I55 B;  2R7M A;  4XYM B;  2W71 A;  5BR8 B;  5KFJ A;  1H38 A;  4O83 A;  1NZ6 A;  2P22 C;  1JPX A;  4PDR A;  2YRX A;  2H94 A;  3OMI B;  4BR6 A;  2Q9L A;  1YDX A;  4GX0 A;  4O2B A;  1K3E A;  4PZ7 A;  2R9A A;  1N33 H;  4KHP B;  2RNB A;  3ZMS A;  4I0X A;  3I55 V;  3ORR A;  2WLI A;  5KHJ A;  3CCE V;  2DAA A;  4B3T H;  1EUD B;  3F8N A;  2UXD O;  3N44 B;  1JA8 A;  1XMQ B;  2ODT X;  4F4W A;  1IBM H;  4ETS A;  2AGP A;  4BW5 A;  1PK8 A;  4UVC A;  2R8I A;  2FPG B;  4J80 A;  1E4E B;  2ZQM A;  5KFC A;  1JR9 A;  4JGS A;  2ZXW B;  5DLG A;  2WLK A;  1IYE A;  1MA1 A;  2Z0A A;  4PV1 B;  4PDB A;  1GYF A;  1ENV A;  3WG7 C;  5KMG A;  4DV5 H;  4OGQ B;  1KD1 W;  3OM3 B;  1MAB G;  3IC7 A;  1GM8 A;  2YI8 A;  3MD0 A;  4BBR G;  1YXB A;  4LFB H;  1XDC A;  3OW2 U;  4MAM A;  3ABL B;  2JA5 A;  4G28 B;  1D2D A;  3M9O B;  1XHX A;  2VQD A;  4X89 A;  3HKE A;  2P5O A;  4DV2 O;  3E22 A;  1CEZ A;  4O7L A;  3RBE A;  4O3N A;  1CE8 A;  4WBN F;  4JPR A;  4DR3 H;  1G2W A;  1KBH A;  1BNC A;  2R7L A;  2KQX A;  1NJI W;  2YIB A;  1T36 A;  3NC0 B;  4H13 B;  3IAY A;  4MVR A;  1VQN V;  1VS0 A;  1EHI A;  3VOU A;  2XAQ A;  1K4D C;  3DXR A;  2W7P A;  2R8H A;  4BY7 G;  4B3R B;  2Y0S E;  1VIB A;  5LOV B;  5B1A C;  4AHC A;  4UXN A;  4MA5 A;  2ODM A;  1Y76 A;  4JI5 H;  2KB1 A;  3CHX A;  3TXQ A;  2QWO B;  3JCU Z;  5KFO A;  2ZDI A;  3SYP A;  1JJO A;  1AI4 A;  1EFR G;  2R85 A;  5LXT F;  2JIZ G;  1ZQ7 A;  2WYO A;  4B7E A;  1SKV A;  3JD2 A;  1NVP D;  1KJQ A;  3EPI A;  5BWR A;  4MW8 A;  5I5T A;  4DV1 O;  2UUB O;  3HPL C;  2F95 B;  1T5E A;  4DR7 B;  1WN7 A;  3QG5 A;  4JI8 B;  1YEW A;  1XMO O;  4GKJ O;  5EZY F;  1V4Y A;  5H2F Z;  2OLS A;  2R87 A;  4A3L G;  4DRX B;  2HVR A;  3UFX B;  4MTD A;  2JEU A;  4LFC H;  1G1X B;  3J81 N;  4TQR A;  1TUE B;  4BWA A;  4RAZ A;  4EGJ A;  4FS1 A;  3UKM A;  4ECY A;  4NXN H;  4DYL A;  4JI1 B;  4AI8 A;  5JQG B;  2R92 G;  1P49 A;  1COW G;  4I0X B;  4DR3 B;  1TWH A;  4ME6 A;  4JI1 O;  1M56 B;  5JH7 B;  3Q8P B;  2V1D A;  3SYA A;  4QWD A;  2QGN A;  4DLK A;  1N48 A;  4JV0 A;  1BS3 A;  2Y69 C;  3GV7 B;  4X66 O;  1PNL A;  4GKJ H;  4LF9 H;  5IYB O;  2PGG A;  3IJ4 A;  2VR1 A;  1E4E A;  3T5H A;  5LP6 A;  3PVX A;  4DR2 O;  3KCY A;  4MVZ A;  4JV1 A;  1OBG A;  2W6Q A;  3RGZ A;  1H8E G;  4F6R A;  3RB6 A;  2E2H A;  1AUV A;  1A0I A;  4J9N A;  3VNN A;  4TM5 A;  1HW7 A;  2OIE A;  3W1B A;  1DF4 A;  4PI2 A;  3T9B A;  1M93 A;  1ZTE A;  1PX2 A;  3LNN A;  1J5E H;  4RNN A;  4UB8 Z;  5D1O A;  1UPG A;  2I8C A;  2JEI A;  3K5H A;  5LP6 B;  4MSW C;  4E2L A;  4O7N A;  5C3E G;  5C44 G;  1M5I A;  4TT3 G;  1OCR C;  2LQT A;  4JI2 H;  2YUA A;  4UCV A;  4DUZ H;  3CCM V;  3VPC A;  3CVZ A;  4HNT A;  4YAK B;  4YJ2 B;  3HOW G;  2B1I A;  1THZ A;  3RGB A;  1EKP A;  3QO7 A;  3WFV A;  4Q6G A;  3MR2 A;  4F4L A;  4FZ0 A;  2QKA A;  4I55 F;  5KG4 A;  4FLV A;  2Q67 A;  2VA2 A;  5GTH Z;  2IMW P;  1PL0 A;  1F4M A;  4NXM B;  3FD9 A;  2Q4P A;  1SET A;  5DAA A;  2ATL A;  5KFH A;  4WF9 V;  5HFM A;  1I50 A;  1NS1 A;  2XHB A;  2EJ7 A;  1J5E O;  5BYA A;  1XMQ H;  5K1P A;  3N6X A;  3BQ0 A;  3V6J A;  5D5P A;  4RAY A;  2JJ1 G;  1XDN A;  1BHA A;  5JJJ B;  1EUC B;  2BR0 A;  4TUY F;  4DV2 H;  4B3M B;  5K3W A;  3KTM A;  1R6K A;  3J80 W;  5H6Q A;  5FLX N;  4A3B G;  4JI2 O;  3ASO C;  4H37 A;  2AXT Z;  1WH2 A;  3WB0 A;  4FFK A;  2DWC A;  3P3P A;  2EIY A;  4QWC A;  3U54 A;  4TQD A;  3TQT A;  3PO2 G;  2NVX A;  1EN5 A;  1I0H A;  3LML A;  1JDB B;  4ICG A;  2QA4 V;  3DTU B;  1HNX O;  3CCV V;  2C2R A;  3L9D A;  1MZB A;  4QJF B;  1M6V A;  5EOY A;  4I50 F;  1GH6 A;  5KFA A;  5CBF A;  2BQR A;  4YJ3 A;  5BWT A;  1URF A;  4J9Y B;  2W9C A;  2YW2 A;  1Z2N X;  2EIJ B;  5LGN A;  2R9R B;  1XNR O;  1CKO A;  3H4D A;  5DLF A;  3K58 A;  2YXL A;  5F2V O;  5I5V A;  1AP5 A;  4YIP A;  3ASN C;  3ABK B;  1IBL O;  5H6R A;  4LFA H;  5I5X A;  2CH7 B;  1W0J G;  2VQE H;  3BG5 A;  4D7T A;  2JA5 G;  5FNV A;  4RAI A;  3GDE A;  1K97 A;  1HR0 B;  3M9M B;  4MTE A;  3K0G A;  1I7N A;  4MV9 A;  5DG7 A;  1TA8 A;  2EZP A;  4PDM A;  4LF7 H;  4N23 A;  2V4Q A;  3VOT A;  4MW3 A;  4K0K B;  2W6Z A;  1WB7 A;  3H1J H;  3F7V C;  4FFM A;  5IE9 A;  2CH7 A;  3K5M A;  1VAJ A;  5CA0 B;  4F4Y A;  4ECX A;  1S10 A;  4RZQ A;  1KEE A;  4TUY B;  3FAV B;  1N34 O;  3Q8S B;  3AW8 A;  4DUY B;  3JAS A;  2ZM6 B;  2PI5 A;  3T9E A;  2A9H A;  2DYR B;  2EJ2 A;  3MJF A;  2XC9 A;  2IJH A;  1N36 O;  2NU9 B;  1MZF A;  1RYS A;  2NUA B;  2P7T C;  1Q6I A;  1Q82 W;  5EK0 A;  5IYD G;  5IYB G;  4HNA B;  2ZNJ A;  5EBW C;  1N34 H;  3V4S A;  1HNZ H;  2OTL V;  3LP8 A;  1SZT A;  2A7W A;  2FB5 A;  2HHF B;  3G8C A;  3AG7 A;  3B8N A;  1EZV H;  4LMY A;  2FLL A;  2J6S A;  2J6U A;  3A0H Z;  3BEH A;  3V6H A;  5KFK A;  3WWI A;  3ASO B;  2L35 A;  3SPI A;  1H2M A;  2QM4 A;  1U96 A;  2HGS A;  3ABT A;  4X62 H;  2Q68 A;  2VUM G;  5DGI A;  2AQ4 A;  5FR9 A;  1HNZ O;  4JI6 B;  1B06 A;  2ZNI A;  3CP1 A;  4YJ2 F;  4GC6 A;  1KT8 A;  1ARO P;  4LF8 H;  5FLX W;  2DE0 X;  3J80 N;  1PKX A;  2W6M A;  1S5J A;  2D3O W;  3H01 A;  2QYZ A;  2JGU A;  2F4V B;  1I2K A;  4C5B A;  3G6B A;  2HVJ C;  3L4K A;  4O4L B;  5BZB A;  3CEI A;  4YP3 A;  3OE7 G;  5LHH A;  3WWH A;  1XRE A;  2VQE O;  4U3F H;  4O7Z A;  2ZM6 H;  3H9V A;  2CW8 A;  1XOU A;  4WBN A;  4EQ5 A;  4A3J G;  5LYJ B;  3B8M A;  2WA3 A;  2UVW A;  2FPP B;  4ZQI A;  5ITZ B;  3CCJ V;  2F93 B;  1YJN V;  3JAL B;  4BWS C;  4PZ6 A;  2FP4 B;  4BXX G;  4Q43 A;  4X20 A;  1Y66 A;  2KSW A;  2DYS C;  4CS2 A;  1JFF A;  4R50 A;  3ETD A;  4NTY A;  4LCU C;  3QO8 A;  1N0N A;  2UXB B;  4J9O A;  3OUF A;  1B04 A;  4WCE V;  4WFH A;  1K83 A;  4E4T A;  4LF4 O;  2R8G A;  4LF7 B;  2X7R B;  3CXC U;  3RVZ A;  5BXZ A;  3DSQ A;  4F50 A;  2FYU H;  4X1K B;  1JX9 A;  1R3L C;  4K8Z A;  1K5Q A;  3GB8 B;  4GX2 A;  2WE6 A;  1T3N A;  3CXH F;  1FXK B;  5CBH A;  3TY9 A;  1Y76 B;  3H20 A;  1KQS U;  1R3J C;  3TET A;  1DIK A;  4JV2 A;  3QWU A;  4O4J F;  3H0G G;  3D3I A;  4QPK A;  4DUY H;  5IY5 B;  4QWB A;  3RJ0 A;  4LNU B;  3FYI B;  1SZX A;  1SA0 A;  2ZE7 A;  2B63 A;  1V55 B;  2A06 H;  3CSW A;  1IVS A;  4LFC B;  4MVM A;  4FLX A;  3VPB A;  2EJR A;  1DV1 A;  2RF4 A;  4RQE A;  3FKI G;  2X6B A;  1S77 D;  2RGR A;  1VMG A;  4YR2 A;  2JS5 A;  2EZO A;  4DR2 H;  1YZB A;  4CMF A;  4GC7 A;  2CQY A;  3M8A A;  4JV5 B;  1N33 O;  2PMZ E;  4WFA V;  2HFE C;  2QK4 A;  3UT5 B;  1VBH A;  3SPH A;  1IBM B;  1V9P A;  2DQ3 A;  1AR1 B;  4LF4 B;  1H2L A;  4JZG A;  1I1M A;  4KUM A;  2VQE B;  4JI4 H;  4NLG A;  3WNZ A;  4QWA A;  5DG9 A;  3OSP A;  3FDS A;  3KAL A;  2FLN A;  3H1L H;  1HP8 A;  2OH2 A;  2F4V O;  4O4I F;  4RB2 C;  2WDT A;  5JH7 A;  2NLJ C;  2ZDH A;  1MMM A;  2HVQ A;  3UO2 A;  1MG1 A;  5JQG F;  4WD3 A;  5CMU A;  2WLN A;  4I5S A;  4APM A;  3A8T A;  2UUC H;  4GLX A;  3ABM B;  1K1Q A;  1VP7 A;  5DED A;  3ZHS A;  4DR6 H;  4CMD A;  2WLJ A;  4FFL A;  2GTA A;  5LMN B;  4DV3 B;  1L0L H;  1Y14 B;  2V4R A;  2O57 A;  2QJ1 A;  1VBG A;  1GO3 F;  4UVB A;  4J9K A;  1AJP A;  5L1L A;  2HR3 A;  3ETQ A;  2PI4 A;  1FVI A;  4R8U B;  5KFN A;  5LOV F;  3PZP A;  3L4J A;  2AGA A;  3EHB B;  3V4Z A;  3BQ1 A;  3BAA A;  3RYF A;  4I4T A;  5D1P A;  2W57 A;  1UC8 A;  4JI6 O;  5KG5 A;  4LF5 H;  4MV6 A;  2RMK B;  2ZCE A;  2IU0 A;  4I9W A;  4X1Y B;  4QE9 A;  2K1E A;  5IJ0 B;  4ECV A;  2G38 A;  1M9N A;  3ZIA G;  1K9M W;  4CS3 A;  3PJS K;  2XAF A;  1KKD A;  2FLP A;  4J41 A;  1KUQ A;  4J9L A;  5F9L A;  4R8U A;  1AJQ A;  4U3J A;  3NBY B;  2DOS A;  3Q2O A;  1M56 C;  4YXW G;  3H1I H;  4YIO A;  1AI5 A;  2XTA A;  3R66 A;  1RJR A;  1YIJ V;  1HNW H;  1OCZ C;  3JAW A;  3JYC A;  1ZHQ A;  4YQW A;  3LQS A;  5TIS Z;  5KS8 A;  3NUA A;  3SR2 C;  3HKD B;  3ZHQ A;  1IBK O;  1W96 A;  1AI7 A;  2P0A A;  3TW7 A;  2R93 G;  1NTM H;  4A3K G;  1N34 B;  3H40 A;  5T14 A;  4LC1 A;  4KXR A;  1CQJ B;  4O4H A;  5A2Q W;  1N8R W;  5BYB A;  4L1K A;  4JYA B;  3VQV A;  4JZ2 A;  4X65 H;  3G4S V;  2YSU B;  3FB5 C;  1IBM O;  5KT3 A;  3J81 W;  4JUZ A;  1VF6 C;  1L0N H;  4MTF A;  1JXL A;  4YAJ B;  1Y74 A;  1XNR B;  3HKD A;  3VQW A;  4CH6 A;  1S0V A;  2NU6 B;  5DGH A;  4ED7 A;  2FKL A;  2C22 A;  1VQ7 V;  2ABJ A;  5CA1 F;  2RJZ A;  1FFX A;  4FFP A;  2F23 A;  3TJT A;  1VKZ A;  4I50 B;  2DQ0 A;  3JCZ A;  3QF7 A;  5BWV A;  3U55 A;  4CKB A;  3ABK C;  3IN5 A;  3EPG A;  1T94 A;  1NBM G;  4FLY A;  4IYI A;  2GPW A;  2W8K A;  2EIK C;  4DR6 B;  1DTO A;  4O3P A;  4BW9 A;  5KFF A;  3W7U A;  2CTW A;  4LFC O;  5KFX A;  3BJY A;  2HP8 A;  3G6V A;  3JAT A;  4A3C G;  3JRX A;  2B5U A;  5KG0 A;  3LDE A;  5H5N A;  3KKY A;  4LH6 A;  4Q0Y A;  3X2Q B;  4EEQ A;  1SQF A;  2Q5Z A;  3CRA A;  4R8C A;  3T5K A;  1P4R A;  1LNQ A;  1SQV H;  3JD3 A;  5EYP B;  4I4T B;  3ZRW A;  1K34 A;  2QB5 A;  4CH5 A;  5A2Q N;  2OT5 A;  3E22 B;  4ABM A;  2JA7 G;  1JQ0 A;  2XND G;  1EKF A;  4C5A A;  3KG2 A;  2MCT A;  5B1B C;  3B77 A;  1RM1 C;  3U11 A;  1VQM V;  3U0G A;  2X0S A;  4W4L A;  3R23 A;  1BGY H;  4MV1 A;  3WG7 B;  3A0B Z;  2JRI A;  3AX6 A;  3CS5 A;  2UXB O;  2QKC A;  4U3J B;  5K2M A;  2IBK A;  2YYA A;  1O9G A;  5L9X A;  4NXM O;  3U10 A;  4GKK O;  4GX1 A;  3MR6 A;  2F43 G;  2LGW A;  4ZHQ B;  4Q44 A;  2ITC C;  3RBZ A;  4LWS A;  1P7B A;  5KT4 A;  4X9Q A;  1FFT B;  4UV9 A;  4MVU A;  4XDL A;  2J9G A;  4YY3 H;  4HYK A;  3C3S A;  1AI6 A;  1S0O A;  2Q0O C;  2X0L A;  2BQ3 A;  3OUU A;  4CS4 A;  4KFM A;  3BHP A;  2J6T A;  2VS0 A;  2PTM A;  3L74 H;  3W7W A;  4OPA A;  3FMA A;  1I94 O;  5KFZ A;  2R82 A;  1WRV A;  4RNM A;  2JEJ A;  4JAS A;  3ZHT A;  1D5A A;  3CYO A;  4JI0 O;  5KUK A;  3N42 B;  2GQS A;  1KJJ A;  2AHY A;  3PW7 A;  1N4C A;  1S5L Z;  3CC2 V;  4YY3 O;  2E5L B;  2CUG A;  5J2T F;  1UC9 A;  4BAY A;  5LA6 F;  4P9O A;  3RN4 A;  3M9N B;  4JYA H;  3GJX B;  4X62 O;  5B3S C;  4I9Q A;  5KFI A;  1CKM A;  1BQZ A;  1C30 A;  4JI4 B;  5L1J A;  2KSD A;  3HB3 B;  5LXT B;  1ET0 A;  4EBD A;  3E83 A;  1C3O A;  1HNZ B;  3ZBH A;  1JDE A;  2QKS A;  4DR4 H;  1WCM G;  1IOW A;  3HKB B;  4PDL A;  4U7O A;  1BJT A;  5IYC O;  4G3I A;  1YHQ V;  3I4N G;  1I6U A;  2Y48 A;  4Q4D A;  2WAQ E;  2D2C B;  3RYH B;  5LHI A;  4AIL C;  1FS0 G;  3P3N A;  5L3C A;  1NH2 D;  3AK2 A;  5LYJ A;  1W59 A;  4DR3 O;  3ZMT A;  1VQ8 V;  1M4U A;  1B6S A;  4JI7 H;  3NGD A;  2EIN C;  3JAS B;  2F1M A;  2YIB D;  1H8H G;  3SYO A;  2HIX A;  3FKS G;  2DZD A;  3QZ7 A;  3JZF A;  2XT9 A;  4DQN A;  3ZRS A;  4LFB B;  2YS6 A;  4K0K O;  3HO8 A;  3GTO A;  4DW0 A;  4DRF A;  3EFF K;  2RN9 A;  5CBG A;  3N2G B;  4D6T H;  4NZO A;  1Y1W A;  5KA6 A;  3RB3 A;  3K5L A;  1HR0 O;  1QBZ A;  3L72 H;  1U97 A;  4GX5 A;  2FKX A;  1NQT A;  3H4B A;  2AGQ A;  3A2F A;  4DR7 O;  5KG2 A;  4NXN B;  4XX0 B;  4JI3 H;  4O3Q A;  4DL3 A;  3OHA A;  1KJ8 A;  4HYO A;  3RW0 A;  1S72 V;  1IBL B;  4B3R O;  4O4H F;  4B3T B;  4J7J A;  4JI7 O;  2LP7 A;  3JD4 A;  4G27 B;  1H2S B;  3T4Z A;  1OBD A;  2HG5 C;  1FXV A;  3BA9 A;  1Z2O X;  1Q90 D;  4IAJ A;  5AG2 A;  2ETN A;  3VQY A;  1MZE A;  3CSX A;  2W6N A;  2ZE5 A;  5C8Y B;  3TQ1 A;  3O9O A;  5EIB D;  4A3G G;  3RFR A;  1BMF G;  3GTK A;  1CXZ B;  1JX4 A;  4JI3 O;  4ECW A;  2BE3 A;  2DPJ A;  1QQC A;  1KEC A;  2XCA A;  5JJN B;  1LR1 A;  2R70 A;  3MWD A;  2GQR A;  4ECQ A;  4X1I B;  2ARH A;  1Q7Y W;  3ML0 A;  3PW0 A;  3TK1 A;  2UVU A;  4RZR A;  4UVA A;  4OXS A;  2Y4U A;  2COG A;  2YDE A;  3K3V A;  2XUM A;  3LWB A;  2NU8 B;  2JS3 A;  5KG7 A;  2ZXW C;  3SYC A;  1IBK H;  4DR5 O;  3QQM A;  4DV2 B;  3BAB A;  2UU9 B;  1HNX B;  3FB6 C;  4IRC A;  2W6I G;  1S0M A;  3GTM A;  4ZKI A;  2LFS A;  1B6Q A;  2JA6 A;  3LDC A;  2N04 A;  2R7Z G;  4KL1 A;  5BR8 H;  1ZWI C;  2YRW A;  2XCP A;  5KUM A;  4O4J A;  4BIU A;  5B1A B;  4C2M A;  3N2K B;  1S0N A;  3V6K A;  1VF5 B;  1XI1 A;  4J10 A;  3GWO A;  3GIP A;  2HGX A;  2JA7 A;  4DK1 A;  3DAA A;  4I4T F;  1QU7 A;  1WP7 A;  2UXD B;  3K3P A;  5I5W A;  1SER A;  4YB8 B;  5DQG A;  2Y0S A;  2KG7 A;  2XGQ A;  1R3K C;  2WLL A;  2A79 B;  2W0X A;  3RYF B;  3TY8 A;  4IR9 A;  5FNV B;  4O4J B;  2DIK A;  4JI7 B;  4BBS G;  3PFF A;  4B3T O;  2Q8V A;  4ECZ A;  4DL4 A;  2QDO A;  4B08 A;  2PBZ A;  1XMO H;  1HR0 H;  3FFQ A;  5BR8 O;  4ZOL F;  3GTP A;  3JD0 A;  5A9G A;  2CFM A;  1OCR B;  2W9B A;  4FIP C;  3UQ8 A;  4RUF A;  3GII A;  2DWE C;  4FGR A;  4B3S O;  2ZR2 A;  3C0F B;  4DR2 B;  4DO2 A;  4JAU A;  1O9H A;  5LA6 A;  1RSO B;  4JAA A;  5CA0 A;  4Y8V B;  1R6T A;  4B7K A;  4O82 A;  4G2K A;  4ECU A;  4LFB O;  1P8L A;  2VWK A;  2AW9 A;  3CRQ A;  4Q45 A;  1A3G A;  2FMA A;  1GAX A;  5IDJ A;  1R3I C;  4I7H A;  2YZN A;  3UZO A;  1YJW V;  4ZI7 B;  3STL C;  3H1K H;  2HEP A;  4TV8 A;  2YZM A;  5DQI A;  1PV0 A;  4LFA B;  4RUE A;  4O2B B;  5KFM A;  3J7A K;  1OCC B;  4O4L F;  1TUB B;  1DLB A;  5EDW A;  3KCX A;  2DWD C;  4X1I A;  3WU2 Z;  1GKF A;  1IOV A;  2COJ A;  3FB7 C;  5CA1 A;  5JCO C;  3LNM B;  3T9F A;  4GKJ B;  5IP7 G;  4UCO A;  5LYJ F;  4U7N A;  1NT2 B;  4X62 B;  2BCC H;  4EBE A;  4EEY A;  4LR3 A;  1E1Q G;  5EBM C;  5BWW A;  2YCH A;  3OGC C;  4W4K A;  2LFR A;  4IWY A;  1TWG A;  1Y1W G;  3AK3 A;  1HNX H;  4QIW F;  2NU7 B;  2BTQ B;  3TW6 A;  4O2A F;  4IRK A;  2CKZ B;  4AQY H;  3RT3 C;  4TWK A;  1RFY A;  5CA1 B;  3L75 H;  4B3S B;  1QVF U;  3SDL A;  4CC5 A;  3CX5 F;  2C2E A;  4DV0 B;  2WPD G;  3K0D A;  4JI8 O;  1S3J A;  4Z2W A;  1VQ9 V;  1P84 F;  4X1Y A;  3KZI Z;  3RBD A;  2R6F A;  3Q8R B;  5LP6 C;  3PO3 G;  4NVP A;  4UUG A;  1AN7 A;  1MSW D;  2IW5 A;  4NKG B;  2OTJ V;  2C2A A;  5JVD B;  1VF7 A;  3S3X A;  4Q4C A;  1S68 A;  3MAQ A;  5DEC A;  5KFG A;  2B1G A;  4IHJ B;  3B40 A;  4LBE C;  3ZN0 A;  5FD5 A;  1ZET A;  1FYJ A;  3K5I A;  3HOY G;  5ITZ A;  3RAX A;  1XNQ B;  5J2T B;  1KJ9 A;  3T2M A;  2YS7 A;  3OAA G;  5JCO A;  3N43 B;  3S3W A;  2DW4 A;  3JAW B;  1M1K W;  1JVM A;  4LF9 O;  1I2L A;  4X88 A;  4I55 A;  3BVO A;  1VQK V;  1NVP B;  3SYQ A;  3RYC B;  2BOB C;  4J42 A;  4BIZ A;  4O84 A;  3RGX A;  4IHJ A;  2XAS A;  4PD4 F;  4JF3 A;  5L3F A;  4EYI B;  1F4N A;  4M0J A;  4YHH H;  4O7T A;  4O3R A;  5LA6 B;  3JSN A;  1VQ5 V;  3K06 A;  1UJW B;  2QEX V;  2IJI A;  4O4H B;  4O86 A;  5GON A;  5IWA B;  2ASD A;  2UU9 O;  1YIT V;  3HKZ A;  4HNU A;  1MNG A;  4MVS A;  2EIL C;  3ZN1 A;  1GO3 E;  1XNR H;  1QCE A;  4IIJ A;  1DF5 A;  1Y74 B;  3K08 A;  4PI0 A;  1YVW A;  5LL6 Y;  3B4S A;  1IX9 A;  1SRY A;  5EZY A;  1TGO A;  4R7R A;  4DV4 H;  5H80 A;  3RFC A;  4NB5 A;  5EBL C;  4J9Q A;  2LW7 A;  5E79 Z;  4UCU A;  1XMQ O;  4JI3 B;  2OCC C;  2V4D A;  3MHS C;  4I50 A;  3MR3 A;  2UUA O;  1FXK C;  4K0K H;  2Q7G A;  4DL7 A;  5KKN B;  2GHY A;  1WAZ A;  5L1I A;  2GUZ A;  2YI9 A;  3OTF A;  2HHH B;  4KHP O;  3WO1 A;  3CWB H;  3OR7 C;  2R92 A;  4ZBM A;  2R9I A;  2Y69 B;  1D5N A;  1JOY A;  4O7Y A;  1XEQ A;  2FTK A;  2KKW A;  4K35 A;  4OX9 O;  1FJG B;  2MK3 A;  1FJG O;  5IYZ F;  3T1Y O;  3H1H H;  2N05 A;  2EIM B;  2DYR C;  4DXW A;  3OEE G;  2AZ0 A;  1K5S A;  3RTX A;  1A48 A;  3Q1K A;  1CS0 A;  1GSH A;  1Y67 A;  5KFB A;  5LMU O;  1BXR A;  2W9A A;  4A3E G;  2NR5 A;  4LP8 A;  2OYQ A;  1OCC C;  1CP9 A;  2IA6 A;  3W1G A;  2IU3 A;  2RQ6 A;  4ED8 A;  1Q6U A;  2LGQ A;  4DUZ B;  5C8Y F;  1AVM A;  4FE2 A;  4O7V A;  3K9A A;  4BIO A;  2ZIO A;  2A1H A;  1AR5 A;  4WHX A;  3P32 A;  3ETG A;  4YJ2 A;  1M57 B;  1RPO A;  4U7C A;  4UCS A;  4A3I G;  2Z02 A;  4PA7 A;  4MS2 A;  1BZK A;  4FZ1 A;  5CB4 B;  2EJ3 A;  5KFE A;  4LF5 B;  3T1H B;  5EWG A;  4LF6 O;  1WSC A;  2YZL A;  2V7Q G;  2HKO A;  2EBO A;  4FM2 A;  2FML A;  4DV7 H;  2YIC A;  1IXM A;  3STZ C;  2ILM A;  1PNM A;  1G4Y B;  4ECS A;  2DJV A;  4KP4 A;  2VA3 A;  1Q3E A;  3GTL A;  4RO2 A;  5J2U F;  4B3M H;  1I7F A;  1ZAU A;  1US6 A;  1ZHS A;  5IP9 G;  4RNO A;  1Q86 W;  1G6U A;  3E8B A;  5BY1 A;  3KAK A;  3JD1 A;  2YXH A;  4JI6 H;  5C93 A;  1B3Q A;  3ZJZ A;  2QF7 A;  5GTI Z;  5CB4 A;  4DAA A;  1WLE A;  4ZI7 F;  1B33 N;  4Q8F A;  4CH4 A;  2VPQ A;  2ALZ A;  3WO0 A;  3CRC A;  3JAK A;  4JI0 B;  1WNS A;  3UO3 A;  2UXC O;  5E1A C;  2PVP A;  3AG1 B;  3MFH A;  1RM1 B;  2YZG A;  1CQI B;  2P06 A;  2ASJ A;  4JYC A;  2QE7 G;  4YJ3 B;  3I4M G;  4ED0 A;  2C35 B;  4XBF A;  5KG1 A;  2F66 C;  5IYD O;  3N40 P;  3H0G A;  4JTD B;  4FFR A;  4KHP H;  2QWP B;  2UUC O;  3T54 A;  2UXD H;  4GKK B;  3OUS A;  3ICX A;  2CDY A;  5KFT A;  4UB6 Z;  4DV0 O;  5KT2 A;  5C1P A;  2GUZ B;  2YXY A;  1BE3 H;  3ABM C;  1RJP A;  3MFI A;  3T1C A;  1ZUQ A;  4EFE A;  4J9M A;  5IJ9 A;  2YL2 A;  2WTF A;  1Q81 W;  5FD6 A;  3ABL C;  5FJ8 G;  3PW5 A;  2XAG A;  3RV3 A;  2ASL A;  1QLE B;  5GW7 A;  1BT8 A;  3FB8 C;  4PA9 A;  4IYH A;  1P7G A;  2PYJ A;  4HQ6 A;  2V58 A;  3F5W C;  2WWW A;  2QWR B;  3CCQ V;  3VMM A;  1JIH A;  3HKZ E;  4B3S H;  2IJJ A;  3N2G A;  4CBC A;  2YID A;  4RB0 A;  5C1O A;  2WLH A;  3OR6 C;  3C90 A;  1E1R G;  4LH7 A;  4YBZ B;  2ZD9 A;  5B3S B;  3JSL A;  3PR4 A;  1ZX3 A;  5LMN H;  4RU9 A;  4F4Z A;  2CTR A;  3SNO A;  4PDV A;  4JV5 H;  3BFR A;  3L2P A;  4AYB E;  4JI8 H;  4DL6 A;  1M57 C;  2GLT A;  3ZX6 A;  2PF4 E;  3I5D A;  1V55 C;  2Y0P A;  4X65 O;  1I1K A;  1J95 A;  2FPI B;  4XDK A;  3N41 B;  1GM9 A;  3DXR B;  1A9X A;  2W6P A;  3RB4 A;  5L3B A;  4LFA O;  4P2Z A;  3I56 V;  5BWU A;  1AJN A;  5LOV A;  3PW4 A;  2QWQ B;  3TII A;  5EYP A;  4FMT A;  4ED2 A;  4DV6 H;  4DUZ O;  3W7S A;  2V5A A;  1S97 A;  2BQU A;  1GSA A;  1RK6 A;  2PN1 A;  1YTF B;  4DR5 H;  4O7W A;  4L8J A;  3CB2 A;  4IWX A;  4AQY O;  3BPZ A;  1SQQ H;  2VUM A;  5LMU B;  3M7M X;  1XL6 A;  4QJF A;  4E4E A;  4GLW A;  3KHR A;  1M7J A;  2CTP A;  1SQX H;  1KC7 A;  3I12 A;  4EGQ A;  3CRR A;  1QR8 A;  4O3O A;  2EJ0 A;  3T1Y B;  1BQ0 A;  2QTO A;  4JYA O;  1TVK B;  4K6N A;  1TUB A;  1TWF A;  5KLV H;  5CM0 A;  2RCV A;  5IT9 W;  3BA8 A;  3O65 A;  4EB6 B;  4F4X A;  4PA4 A;  4DV5 O;  1YJ9 V;  4DR1 O;  2SCU B;  3P30 A;  4J9P A;  3N2K A;  3CME V;  4O2A A;  1B6R A;  4MVQ A;  2UUA B;  3RR5 A;  1L2Z A;  2HJW A;  1XK5 A;  2UXX A;  1PL4 A;  3ZCC A;  4FLZ A;  4C7U A;  1AB3 A;  2WB1 E;  1I5Y A;  4HBN A;  4CZZ A;  3WB1 A;  2CNQ A;  4EB6 A;  4TV9 F;  4GKK H;  3QZ8 A;  3LSU A;  1IZ3 A;  3VPD A;  2ZIM A;  1VQ4 V;  4RB3 C;  4JYY A;  1KP2 A;  4NTW A;  4XDJ A;  1H2N A;  3HB9 A;  4X20 B;  2W6O A;  4LSX A;  3ZMV A;  2EIK B;  4O2A B;  5BPH A;  4O7S A;  3G6E V;  3SE7 A;  3AG4 C;  5L3G A;  1SES A;  2ZT9 B;  4DV6 B;  4LF8 B;  5JVD A;  3A0R A;  3ZRX A;  2WLM A;  3F7Y C;  3G80 A;  3PN1 A;  1E4F T;  1SCU B;  4ECR A;  1I94 H;  2DYS B;  3RYH A;  3K5N A;  2R8J A;  1R1B A;  3AG4 B;  3Q4H A;  1QVG U;  5B66 Z;  2M7W A;  2ZE8 A;  3ORQ A;  4RCN A;  5LHG A;  4YHH B;  5JJE B;  1SC5 B;  2NN4 A;  4IT5 A;  4UCT A;  3MWM A;  3ZMU A;  2GPS A;  3SPJ A;  2ZDI C;  1V54 B;  4IL6 Z;  3QO5 A;  1GLV A;  4ZI7 A;  4EYH B;  2IP4 A;  2JA6 G;  3OGI B;  3GLK A;  4RUC A;  1N32 B;  3R5H A;  2OIG A;  3E5N A;  4O2B F;  5BMV F;  5KHK A;  1V54 C;  4ASU G;  5EWE A;  3S24 A;  5IYZ B;  1L1F A;  3KAJ A;  5FPR A;  1WPX A;  2JVD A;  4UCR A;  4TUY A;  2JGD A;  1Y6X A;  2RGV A;  1K1S A;  4DR4 B;  5CR5 A;  1BCC H;  2B63 G;  4NXN O;  1VEW A;  3BCC H;  1SF9 A;  2JA8 G;  2FE3 A;  1EN4 A;  4FM1 A;  1NH2 B;  3K57 A;  5KFY A;  1GMG A;  5LMU H;  5DGA A;  4FVM A;  1XNQ H;  3K03 A;  5EZY B;  3AG2 C;  2GTS A;  4FLW A;  1K7D A;  5KAI Z;  2R84 A;  4JV5 O;  1IUR A;  1EZJ A;  1PP9 H;  4WFB V;  3T1Y H;  1GGO A;  1NTZ H;  3KYH C;  1L8D A;  2BTQ A;  3GTJ A;  3CQZ A;  3ABU A;  2X6C A;  2H3O A;  3AG2 B;  1FKA O;  1S76 D;  3AG3 C;  3TIN A;  2ZR3 A;  3DC6 A;  4IZO A;  3AG1 C;  2EIJ C;  1X59 A;  1VAR A;  3KHL A;  5LXT A;  3CCU V;  1VQO V;  5KT7 A;  5E25 A;  1JFF B;  1BL8 A;  2UUA H;  2W9C B;  4CH3 A;  2K9P A;  4IR1 A;  4P30 A;  1UFI A;  1OCZ B;  4JI2 B;  1JJ2 U;  2QM7 A;  3D36 C;  1LUV A;  4B3M O;  3T9C A;  4M9U A;  2ZGI A;  1RYR A;  5B1O A;  5EC2 C;  4RUA A;  4JI4 O;  4XZ3 B;  1KUT A;  4JTA B;  1BGW A;  4QWE A;  4O3S A;  4HZ3 A;  5IJ0 A;  3HKC A;  4DL5 A;  4RB1 A;  4P9P A;  4GYC B;  1ULZ A;  2W6J G;  2A3Q A;  4LNU A;  1F7Y A;  4CE5 A;  2FK2 A;  1PPJ H;  4RQF A;  1QLE C;  4GZR B;  1SA0 B;  5I5S A;  1OWT A;  1O75 A;  2YWV A;  4QW8 A;  2VQF O;  1HDJ A;  3ZRV A;  5JWP A;  5KFU A;  4CKC A;  2WLL B;  1Y1V A;  3Q4H B;  3LDD A;  2PUS A;  4WFE A;  1HWY A;  4FLT A;  3JZI A;  4A93 G;  1Q8I A;  2YEV A;  2BTO A;  5BPF A;  3OSN A;  3TCU A;  4TV9 B;  3UCS C;  3DTG A;  2W70 A;  2E5L H;  1YF2 A;  2WA4 A;  2ZIN A;  3RAQ A;  1R9T A;  2PZS A;  3R5X A;  2JEF A;  1GN2 A;  2YS8 A;  2Z3Y A;  3OMA B;  2E76 B;  3BY6 A;  4RWU A;  4R7C A;  3CPW U;  3D3Q A;  2JDI G;  3CRM A;  2HJF C;  2XAH A;  4ED1 A;  3LSS A;  4JYB A;  2Z04 A;  1N56 A;  3SJA C;  5CB4 F;  2Q69 A;  4FU0 A;  3IG0 A;  1N32 H;  3OT7 A;  4H33 A;  2ADQ B;  2RDJ A;  5IYZ A;  1QR9 A;  2CW7 A;  4J7Z A;  3CEB A;  2HG8 A;  3WWJ A;  2R7Z A;  5KFR A;  4FBT A;  3ZED A;  4MTG A;  4PBC A;  1KP3 A;  4J9S A;  1EZ1 A;  1MSD A;  3G71 V;  4DRX A;  2H8P C;  1S9F A;  1WR2 A;  2OCH A;  3X2Q C;  4PWQ A;  4H44 B;  2DN9 A;  4J0M A;  4TQF A;  4HN2 A;  1BSM A;  5LBQ A;  3ETH A;  4X66 B;  3DF7 A;  3K9S A;  3KXY T;  5KMG B;  1HNW B;  2EIN B;  3CCS V;  2HGW A;  1Q43 A;  3UZB A;  1DV2 A;  4PEL A;  4L87 A;  2UXB H;  4DR5 B;  5I60 A;  4DR6 O;  5KHG A;  4H0L B;  5C4X G;  4YJ3 F;  2LJ2 A;  2IH3 C;  2JEG A;  3QFF A;  2P67 A;  2WSS G;  3HKE B;  2EIL B;  1M0T A;  3T5J A;  1I5X A;  5D8D A;  3RWR D;  4IGG A;  1NU1 H;  2ZM6 O;  1OV9 A;  2CNV A;  4DUY O;  5I5U A;  2DMX A;  1Z2P X;  3C3T A;  4GT1 A;  1LUW A;  5DN6 G;  2P4V A;  4B3R H;  2Y0I A;  3R65 A;  2Q7E A;  2KG7 B;  5DG8 A;  1V51 A;  2OCC B;  1OZ0 A;  2GDS A;  5D1O B;  2IM9 A;  4TOI A;  5D5Q A;  3ZS8 C;  2MW2 B;  4A3D G;  2E3C A;  5EIB C;  1ZL8 B;  3R5F A;  1PNK A;  1GSO A;  1WP8 A;  3TIG A;  3ETE A;  2W8L A;  4MTX A;  1KC8 W;  4DR4 O;  3MR5 A;  4GUN A;  4A3F G;  1RSO A;  2BSK A;  4QGP A;  3CC4 V;  3GV5 B;  1AUX A;  1QHT A;  3E89 A;  5HNE A;  2WAQ A;  3GIJ A;  5B1N A;  2P6J A;  4UUJ C;  3GIL A;  3TY5 A;  1S03 G;  4CHI A;  4A3M G;  3GVM A;  2PY5 A;  1Y4M A;  3OTO H;  3JZ6 A;  3HR0 A;  5L3E A;  3BAC A;  1X9N A;  3OMN B;  1A32 A;  1ZL8 A;  3RYC A;  2CZG A;  1RK5 A;  1TAE A;  3CJH B;  3RYI B;  1GK9 A;  1HNW O;  4DV6 O;  1CKN A;  3THO A;  2R7N A;  5KHI A;  3AK1 A;  3TGU H;  2ZDQ A;  2R7K A;  4UFZ A;  1ORQ C;  4Z1V A;  1I7L A;  1X4T A;  2M05 A;  1N0J A;  2JJ2 G;  4BY1 G;  4WFG A;  1DK1 A;  3RF2 A;  2C28 A;  3J7A U;  1JMK C;  1GRJ A;  1UNN C;  5FNV F;  1VQ6 V;  5BWX A;  2EX3 A;  2VOB A;  4F6E A;  3GWK C;  1H2K A;  4NZM A;  4TVI A;  4OX9 H;  5IJ9 B;  3FYE B;  4FM9 A;  3BQ2 A;  4YY3 B;  2E5L O;  1GN6 A;  3K5O A;  3JAT B;  4F6R B;  5LL6 b;  2QR4 A;  1I08 A;  2V9W A;  4NR1 A;  1I94 B;  3QNE A;  5JVD F;  3SPC A;  1F51 A;  3KRE A;  2IH1 C;  1IXB A;  1ZLZ A;  2QWN B;  4QPJ A;  4A5U B;  2HLD G;  3EXA A;  4TSF G;  4NYE A;  4HNV A;  4J9Z B;  2X6A A;  3ZHU A;  4CC6 A;  5I5Y A;  3M4I A;  3HOX G;  2VPS A;  5DQH A;  4TV8 F;  3CD6 V;  3G6Y A;  4DV3 H;  2UXC H;  1FFX B;  2GBO A;  4DV5 B;  3FX7 A;  1W2B U;  3F5T A;  3AG3 B;  5H9C A;  4AQY B;  1KMI Z;  3QVN A;  1EM1 A;  5J9P C;  4QIW A;  4ZOL B;  5KFQ A;  2COI A;  2A0L A;  3APO A;  2Q7H A;  5JVL A;  4ZIB A;  1PM9 A;  3W7X A;  3OEH G;  2CE4 A;  4LWS B;  4J11 A;  3OFN G;  5BMV A;  2YIA A;  2VQF B;  5KFS A;  4Q20 A;  4I7Z B;  2W7O A;  2ZE6 A;  5CA0 F;  3T9D A;  1KB9 F;  1E79 G;  5K1X A;  4X65 B;  4LF6 H;  2ZJT A;  2GSM B;  1WPB A;  1BHB A;  3SI8 A;  4FJC C;  4XYL B;  2XAJ A;  3N27 A;  1JCH A;  1FKA H;  1N36 H;  3LUL A;  1XQ8 A;  4JAV A;  4OPH A;  2CNU A;  2EIM C;  5IT9 N;  1SQP H;  2HDK A;  2X5R A;  1SQB H;  1EBO A;  3E86 A;  2L6L A;  3HXL A;  2P4K A;  2HHF A;  1I1L A;  5BMV B;  3T1H H;  1NR7 A;  3E2E A;  4EG0 A;  1H2G A;  1VF6 A;  2W0F C;  5KA5 A;  3HOU G;  3L70 H;  1AP6 A;  5KT6 A;  3GTG A;  1CPY A;  3MDS A;  3OUZ A;  2DPI A;  4MVO A;  3MHH C;  3B09 A;  5KG6 A;  3E8F A;  2UVR A;  4K8X A;  4LF7 O;  4Q8E A;  2PYL A;  5I47 A;  4X64 B;  1XUQ A;  3QTC A;  1KKC A;  4NYK A;  4K3A A;  4X8A A;  5IY5 C;  3UM7 A;  5GON F;  3L73 H;  4JTC B;  1K8A W;  4E6N A;  3RUP A;  1AR4 A;  5CA3 A;  1YCI A;  5C5J A;  3HOV G;  2HVS A;  1K73 W;  1XIL A;  5LGU A;  5FL7 G;  1FPO A;  2V59 A;  5HFL A;  2RDC A;  4O4I A;  1FAF A;  4FFB A;  1KU9 A;  3NR7 A;  1I3Q A;  1Z2G A;  2UVV A;  4N21 A;  1Z5V A;  2DAB A;  1JKJ B;  3K79 A;  3VA7 A;  2O03 A;  5JQG A;  4HR7 A;  2VRZ A;  1N32 O;  3U9S A;  4EFB A;  1IDS A;  1WCM A;  5EC1 C;  2VQF H;  5CN0 A;  2UXN A;  4FPP A;  3U9T A;  2UUC B;  5B5E Z;  4FBU A;  1EKV A;  4LF4 H;  5FLM G;  1IBK B;  4TQS A;  2Q6A A;  3JAL A;  3SGI A;  3LUT B;  1M90 W;  2ZDG A;  4YHH O;  1GN3 A;  5KFL A;  1Q6H A;  4DK0 A;  3HKC B;  5JUM A;  1QNM A;  2CGN A;  1YSC A;  5CE8 A;  2I87 A;  3HKB A;  5FPO A;  3RVY A;  4QW9 A;  3W5O A;  2QM8 A;  2UXC B;  1RJQ A;  2EUL A;  4MV3 A;  4O7R A;  2ATK C;  4X1K A;  4LF8 O;  1ZSP A;  3T4D A;  2FK3 A;  3GID A;  1F23 A;  1K92 A;  3IFX A;  5JH7 F;  3JAR A;  3D8C A;  4DV0 H;  3GTQ A;  3WB2 A;  4IRD A;  4O81 A;  5JQW A;  1YTF D;  5L3D A;  4IHJ F;  3EYY A;  2FJZ A;  3G67 A;  4QNH B;  2ITD C;  3UYY A;  5KX5 F;  2AU0 A;  3HOZ G;  3ZHR A;  1AIL A;  5KG3 A;  1OJH A;  3HT5 A;  2CAZ C;  1SYX B;  2XIG A;  2HHH H;  4TV8 B;  1W0K G;  2IJK A;  4LF5 O;  2C00 A;  1A0G A;  3JAR B;  1EN6 A;  1WA8 B;  3NXS A;  4IIJ F;  2WAM A;  1N36 B;  4Z1M G;  4ZHQ A;  3FKI A;  4MV4 A;  4DV7 O;  4DR1 B;  2HJD A;  4DV3 O;  3RIZ A;  5LMN O;  1SQG A;  3GIM A;  3T99 A;  3JAK B;  1KYO F;  2DLN A;  3M99 B;  3JAM N;  2F4V H;  2Q2U A;  4ED6 A;  3RV4 A;  2WB1 A;  3T7A A;  3NBZ B;  4DV1 H;  2UUB H;  1VQL V;  2JEX A;  3JRW A;  4O4L A;  5C8Y A;  4PJ0 Z;  2I80 A;  5KFW A;  2FB9 A;  3HBL A;  1NKD A;  5J2U B;  5HBR B; 
#chains in the Genus database with same CATH homology
 5IWA H;  4JI0 H;  4ZI7 A;  3SJC C;  3OTO B;  1N32 B;  4KL1 A;  3JAM W;  5BR8 H;  5KHK A;  4OX9 B;  4O4I B;  4D7S A;  4FFB B;  4O4J A;  4M7E A;  4HNA B;  3N2K B;  3S24 A;  5IYZ B;  2ZNJ A;  1N34 H;  4FLU A;  3KAJ A;  1HNZ H;  5FPR A;  4UCR A;  2JVD A;  5KHH A;  1XI1 A;  1N33 B;  4TUY A;  2RGV A;  5J2U A;  4DR4 B;  4DK1 A;  4LMY A;  4DV7 B;  2UXD B;  5KX5 B;  2FE3 A;  2QM4 A;  2Q0A A;  4MV7 A;  4FM1 A;  3K57 A;  2HGS A;  4X66 H;  5LMU H;  4X62 H;  4FVM A;  1XNQ H;  1Q5O A;  3RYF B;  3TY8 A;  5EZY B;  4FLW A;  2GV9 A;  5FNV B;  4O4J B;  4JI6 B;  4JI7 B;  2ZNI A;  4B08 A;  3T1Y H;  1XMO H;  3KYH C;  1HR0 H;  1FJG H;  3FFQ A;  1L8D A;  2BTQ A;  1SEI A;  4LF8 H;  2CFM A;  5FLX W;  1DGS A;  3UQ8 A;  3K59 A;  3VQX A;  1S5J A;  3C0F B;  2JGU A;  2F4V B;  4DR2 B;  5LXT A;  1O9H A;  5LA6 A;  5CA0 A;  3L4K A;  1J5E B;  4DR7 H;  4O4L B;  1JFF B;  2Q2T A;  4JI1 H;  1P8L A;  2VWK A;  2UUA H;  4CH3 A;  2HIV A;  3UT5 A;  2ZM6 H;  2VUG A;  2UU9 H;  2CW8 A;  4JI2 B;  4I7H A;  1E4G T;  4ZI7 B;  4EQ5 A;  4WBN A;  5LYJ B;  4LF9 B;  2HEP A;  3RYI A;  4TV8 A;  5ITZ B;  2F93 B;  4LFA B;  4O2B B;  3JAL B;  4BWS C;  4PZ6 A;  4X20 A;  4HNA A;  2KSW A;  1BGW A;  3J7A K;  4CS2 A;  1JFF A;  5IJ0 A;  1TVK A;  3HKC A;  2UXB B;  4RB1 A;  4GYC B;  1B04 A;  1TUB B;  4LNU A;  1P16 A;  1SA0 B;  4DR1 H;  1O75 A;  4LF7 B;  4LSA A;  2VWJ A;  4X1I A;  5CA1 A;  3DSQ A;  5JCO C;  4X1K B;  4K8Z A;  4GKJ B;  3GB8 B;  2PUS A;  4UCO A;  2WE6 A;  4FLT A;  3TY9 A;  1NT2 B;  1Q8I A;  2BTO A;  4X62 B;  3H20 A;  4LR3 A;  4TV9 B;  2YCH A;  3QWU A;  2E5L H;  2ZIN A;  2PZS A;  4DUY H;  3RJ0 A;  1HNX H;  4LNU B;  2BTQ B;  1SA0 A;  4AQY H;  4LFC B;  4FLX A;  5CA1 B;  4B3S B;  4CC5 A;  4PHZ A;  3SJA C;  4DV4 B;  4DV0 B;  3IG0 A;  1N32 H;  1M0W A;  2RGR A;  2JS5 A;  4X1Y A;  4DR2 H;  5IYZ A;  5LP6 C;  2CW7 A;  4NVP A;  1AN7 A;  3ZED A;  4JV5 B;  5JVD B;  4X64 H;  2R72 A;  1VF7 A;  4PZ8 A;  3UT5 B;  4DRX A;  1S68 A;  3MAQ A;  1IBM B;  5KX5 A;  1V9P A;  4IHJ B;  4LF6 B;  4ZOL A;  4WBN B;  4LF4 B;  5FD5 A;  4J0M A;  4TQF A;  4A2A A;  2VQE B;  4JI4 H;  4JI5 B;  5ITZ A;  4X66 B;  3BRC A;  3DF7 A;  1XNQ B;  5GON B;  5J2T B;  3KXY T;  5KMG B;  1HNW B;  5JCO A;  3KAL A;  4A2B A;  1Q43 A;  3N43 B;  3B2E E;  4NXM H;  5DIS C;  4RB2 C;  3JAW B;  5JH7 A;  2WDT A;  3U0Z A;  1Z5W A;  2UXB H;  4DR5 B;  2OWO A;  4IIJ B;  1XMO B;  2HVQ A;  5KHG A;  4FM0 A;  4I55 A;  3SJB C;  3RYC B;  4APM A;  3RGX A;  4IHJ A;  2UUC H;  1CKN B;  4GLX A;  4DV1 B;  2UUB B;  3HKE B;  4YHH H;  1XHZ A;  4DR6 H;  5LA6 B;  3JSN A;  1M0T A;  4O4H B;  5GON A;  5J2T A;  5LMN B;  3RWR D;  4DV3 B;  4TV9 A;  5IWA B;  1IBL H;  2QJ1 A;  1Z2P X;  1XNR H;  4B3R H;  4IIJ A;  3ETQ A;  1FVI A;  4I55 B;  4PI0 A;  3L4J A;  2Q7E A;  5BR8 B;  3BAA A;  2P22 C;  3RYF A;  4I4T A;  5D1P A;  2W57 A;  5EZY A;  1TGO A;  4O2B A;  4LF5 H;  4PZ7 A;  4R7R A;  4DV4 H;  2R9A A;  5D1O B;  4KHP B;  2ZCE A;  4X1Y B;  2IM9 A;  1N33 H;  4TOI A;  5D5Q A;  5IJ0 B;  4UCU A;  4JI3 B;  2V4D A;  3ZS8 C;  4I50 A;  4K0K H;  2E3C A;  2Q7G A;  4CS3 A;  5KHJ A;  4B3T H;  5EIB C;  3F8N A;  3N44 B;  1XMQ B;  1IBM H;  4ETS A;  2YI9 A;  3OTF A;  4U3J A;  3NBY B;  2HHH B;  1RSO A;  4PDB A;  1GYF A;  5KMG A;  1QHT A;  2KKW A;  4DV5 H;  1FJG B;  1HNW H;  3TY5 A;  2YI8 A;  1S03 G;  3JAW A;  1ZHQ A;  4LFB H;  2PY5 A;  3OTO H;  3SR2 C;  1X9N A;  3HKD B;  3RTX A;  3RYC A;  1XHX A;  1TAE A;  3RYI B;  1CKN A;  3THO A;  3HKE A;  5KHI A;  2P5O A;  1N34 B;  3E22 A;  2OYQ A;  2ZM6 B;  4DR3 H;  4UFZ A;  4O4H A;  5A2Q W;  1X4T A;  4JYA B;  3W1G A;  2RQ6 A;  3VQV A;  2YIB A;  4X65 H;  3NC0 B;  4DUZ B;  3IAY A;  3RF2 A;  1VS0 A;  3J81 W;  1JMK C;  2ZIO A;  1XNR B;  3HKD A;  4B3R B;  2EX3 A;  2VOB A;  4YJ2 A;  3VQW A;  5LOV B;  4CH6 A;  4AHC A;  4OX9 H;  4UCS A;  5IJ9 B;  4JI5 H;  4FM9 A;  3CHX A;  4YY3 B;  2RJZ A;  3K5O A;  5CB4 B;  4LF5 B;  3T1H B;  1FFX A;  3JAT B;  1JJO A;  4F6R B;  5LL6 b;  2WYO A;  4I50 B;  4FM2 A;  3QF7 A;  4DV7 H;  1SKV A;  1I94 B;  1Q3E A;  4B3M H;  1I7F A;  1ZAU A;  1ZHS A;  4FLY A;  2F95 B;  1T5E A;  4DR7 B;  1G6U A;  1WN7 A;  3QG5 A;  3KAK A;  4JI8 B;  4DR6 B;  1YEW A;  4JI6 H;  4BW9 A;  4CC6 A;  3M4I A;  2VPS A;  5CB4 A;  2UXC H;  4CH4 A;  4DV3 H;  1FFX B;  3JAT A;  3JAK A;  4DRX B;  4DV5 B;  4JI0 B;  2HVR A;  4MTD A;  1WNS A;  4AQY B;  4LFC H;  1KMI Z;  4LH6 A;  4Q0Y A;  4EEQ A;  1SQF A;  4ZOL B;  2Q7H A;  4ZIB A;  4BWA A;  5EYP B;  4I4T B;  4RAZ A;  4YJ3 B;  4CH5 A;  4NXN H;  3E22 B;  4JI1 B;  5JQG B;  2F66 C;  2MCT A;  1P49 A;  3N40 P;  5BMV A;  4KHP H;  2YIA A;  4DR3 B;  2VQF B;  5JH7 B;  3U11 A;  2UXD H;  4GKK B;  3ICX A;  5K1X A;  4X65 B;  4LF6 H;  2ZJT A;  1WPB A;  4GKJ H;  4LF9 H;  4U3J B;  2PGG A;  1FKA H;  1O9G A;  1N36 H;  1XQ8 A;  3U10 A;  4EFE A;  4ZHQ B;  5IJ9 A;  5LP6 A;  5FD6 A;  3HXL A;  3RGZ A;  4YY3 H;  5BMV B;  3T1H H;  4F6R A;  2PYJ A;  1A0I A;  3VNN A;  4CS4 A;  4B3S H;  3BHP A;  3N2G A;  4RB0 A;  1HW7 A;  3W1B A;  2PTM A;  3FMA A;  4PI2 A;  4LH7 A;  1D5A A;  1M93 A;  3N42 B;  3LNN A;  4K8X A;  1J5E H;  3JSL A;  5D1O A;  5LMN H;  2PYL A;  5LP6 B;  4X64 B;  4JV5 H;  3L2P A;  3QTC A;  4JI8 H;  2E5L B;  1M5I A;  4JYA H;  3GJX B;  4E6N A;  4JI2 H;  4UCV A;  4DUZ H;  4I9Q A;  3N41 B;  1CKM A;  2HVS A;  3CVZ A;  4JI4 B;  4O4I A;  4YJ2 B;  5LXT B;  5LOV A;  4FFB A;  1KU9 A;  3RGB A;  1HNZ B;  1Z5V A;  4Q6G A;  5EYP A;  4DV6 H;  4FLV A;  4DR4 H;  2O03 A;  4NXM B;  5JQG A;  3HKB B;  4EFB A;  4DR5 H;  1BJT A;  1I6U A;  4L8J A;  3CB2 A;  2VQF H;  3BPZ A;  2XHB A;  3RYH B;  4AIL C;  5LMU B;  3M7M X;  1XMQ H;  5K1P A;  2UUC B;  5LYJ A;  3N6X A;  5D5P A;  4RAY A;  4LF4 H;  1XDN A;  1IBK B;  5JJJ B;  1M4U A;  4DV2 H;  4B3M B;  3JAL A;  3SGI A;  4JI7 H;  3J80 W;  3T1Y B;  3JAS B;  1WH2 A;  2F1M A;  4DK0 A;  1TVK B;  3HKC B;  2YIB D;  1TUB A;  3WB0 A;  2HIX A;  3HKB A;  5FPO A;  5IT9 W;  3BA8 A;  4LFB B;  3W5O A;  4TQD A;  2UXC B;  4EB6 B;  4DRF A;  3LML A;  4X1K A;  3N2G B;  1MZB A;  3K5L A;  3JAR A;  4DV0 H;  5EOY A;  3N2K A;  3WB2 A;  4O2A A;  1L2Z A;  4YJ3 A;  2UUA B;  3RR5 A;  3A2F A;  1XK5 A;  4NXN B;  3EYY A;  4JI3 H;  1Z2N X;  4FLZ A;  1IBL B;  1CKO A;  3K58 A;  4B3T B;  2YXL A;  4HBN A;  1H2S B;  3WB1 A;  2UU9 B;  2CAZ C;  4EB6 A;  1SYX B;  3BA9 A;  1Z2O X;  2XIG A;  4IAJ A;  4LFA H;  4GKK H;  2HHH H;  4TV8 B;  3VQY A;  2ZIM A;  3CSX A;  4RB3 C;  5C8Y B;  2VQE H;  5EIB D;  4D7T A;  5FNV A;  3JAR B;  3RFR A;  4X20 B;  4LSX A;  1N36 B;  3GDE A;  4ZHQ A;  1HR0 B;  4O2A B;  4MTE A;  3MWM A;  4MV9 A;  4DR1 B;  4DV6 B;  1QQC A;  4LF8 B;  3RIZ A;  1TA8 A;  5JJN B;  1SQG A;  5JVD A;  4LF7 H;  2R70 A;  4X1I B;  3JAK B;  4K0K B;  3PN1 A;  1E4F T;  1I94 H;  2F4V H;  3RYH A;  3K5N A;  2Q2U A;  3K3V A;  3NBZ B;  4DV1 H;  3K5M A;  2UUB H;  5CA0 B;  4YHH B;  4O4L A;  5C8Y A;  5JJE B;  4RZQ A;  1IBK H;  4TUY B;  4UCT A;  4DV2 B;  4DUY B;  3BAB A;  5J2U B;  3JAS A;  1HNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...