4EEQA

Crystal structure of e. faecalis dna ligase with inhibitor
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
publication title Design, Synthesis and Activity Evaluation of Potent NAD+ DNA Ligase Inhibitors as Potential Antibacterial Agents.
rcsb
source organism Enterococcus faecalis
total genus 108
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4eeqA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4eeqA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4eeqA02
5LMUB 4K0KB 2VQFB 2UXDB 4DV2B 3GJXB 4DR4B 3BA8A 4LH6A 4KHPB 4DV3B 1J5EB 1XK5A 1TAEA 4GKKB 5BR8B 1IBKB 2Q2TA 2OWOA 1TA8A 3NC0B 4E6NA 2CFMA 2HIXA 1N36B 2UXBB 2UUAB 2HVRA 1FJGB 3VNNA 4DV7B 3T1HB 4UCUA 4OX9B 3NBZB 4YHHB 3NBYB 2VUGA 4LF5B 1N34B 4JI7B 1XMQB 3KYHC 1IBMB 3RTXA 1CKMA 3SGIA 4GKJB 4DUYB 1I94B 1HNZB 4B3SB 4B3RB 3PN1A 4DR1B 4DR3B 2ZM6B 1FVIA 4JI1B 4JI8B 3BA9A 4DV4B 4PZ8A 3S24A 3UQ8A 5D1OA 4UCRA 3TY9A 4DV6B 4AQYB 4UCTA 4DV0B 4EFBA 1CKNA 3RR5A 2HVQA 4DV5B 4NXNB 2HVSA 2UUBB 1XMOB 1HNWB 1HR0B 4LF8B 2E5LB 4YY3B 4LF9B 4PZ7A 4LF4B 4DR5B 3W5OA 2F4VB 4JV5B 4LH7A 1VS0A 1HNXB 2UXCB 3W1GA 2Q2UA 2HIVA 4DUZB 3QWUA 3W1BA 4EEQA 4X66B 4X65B 4LFCB 5D1OB 4GLXA 4EFEA 1DGSA 1XNQB 4PZ6A 1CKNB 5FPRA 4EQ5A 3BABA 4CC5A 3T1YB 3OTOB 4LFAB 4TOIA 3JSNA 5DISC 4JI6B 1P16A 4B3TB 4DRFA 4UFZA 4NXMB 4LFBB 4UCVA 2UUCB 1P8LA 3BAAA 5LMNB 4LF7B 3JSLA 4JI0B 1S68A 1N33B 1XNRB 4DR6B 4JI4B 1V9PA 3L2PA 5FPOA 3TY8A 1X9NA 1IBLB 1B04A 4JYAB 4CC6A 4DR2B 4DR7B 1XDNA 5IWAB 4JI2B 2HHHB 1ZAUA 1CKOA 2UU9B 4X62B 4X64B 4UCOA 4DV1B 3TY5A 3GDEA 2VQEB 3GB8B 4LF6B 1A0IA 5D1PA 4JI3B 4JI5B 4UCSA 1N32B 4B3MB
chains in the Genus database with same CATH superfamily
2OT5A 5KFJA 1DK1A 4DR4B 2YYAA 4FFMA 3TXQA 2Y0SA 1E79G 5IE9A 2GV9A 4GT1A 1XK5A 2HHFA 3GLKA 2C2EA 1IBMH 5D5PA 5KHGA 4J9YB 1TA8A 2ITCC 2VA2A 4X1KA 2Y4TA 3CJHA 5GTIZ 4YHHB 1HNXH 2GUZB 2Y0PA 1Q43A 3CP1A 2ABJA 2ZINA 5K1PA 1AUXA 5KFNA 1WCMA 1V55B 3RTXA 5CR5A 1VQKV 1OWTA 4YR2A 1GLVA 3BFRA 2B5UA 1KMIZ 2WLKA 3ML0A 5IYCG 1FXVA 1YVWA 1Y1VA 2HGSA 2WE6A 5EIBD 4PHZA 3D8CA 1KECA 2BE3A 2W8LA 4QJFA 3RYHA 1JDEA 4JZ2A 2VOBA 4YY3H 4O2BB 4ECTA 1AJQA 2LFSA 2QEXV 4LP8A 4AQYB 3KCYA 5E79Z 4L1KA 1M9NA 5BXZA 3T9BA 4RUAA 4DV0B 1SC5B 4UVCA 1RK6A 3ABMC 5EDWA 2NNUA 1SYXB 2E5LB 1WPXA 4EGQA 4O3RA 1TGOA 2DW4A 4J9RA 3DAAA 3HR0A 1NR1A 1NH2B 1TWHA 2QKAA 4IT5A 3RFCA 4LH7A 3UT5A 4K8ZA 2E3CA 3M8AA 2CDYA 2PVPA 1WB8A 3S3WA 4EEQA 1Q86W 5KG0A 4RUCA 3T1YH 3PW2A 3K79A 4RNMA 4LR3A 3AK1A 1GGOA 5JVDF 4FLZA 3P3PA 5L1LA 1V55C 4A3BG 1W0KG 1JMKC 1SEIA 4JF3A 4DR3O 1PV0A 5BPHA 1SQQH 3AG3B 2W9CA 4GKKH 1P16A 1YF2A 3WFVA 4DR6H 1W93A 5BWVA 1NI8A 1JJOA 2C2RA 2JEXA 4ECWA 4FM1A 3QNEA 4LFBB 3HKZE 5KFUA 1AN7A 4PA4A 2EJ7A 3HB9A 5LMNB 3JD2A 1HW7A 4QW9A 1KP3A 1M7JA 3STLC 2W7OA 1N33B 5BMVB 3P30A 3B09A 5FPOA 5KKNB 4LF9O 1L8DA 1RFYA 4FM2A 1AVMA 3J80N 3HKDB 2MCTA 2YC0A 4NXMO 2P5OA 4F6RB 1K9MW 4IR9A 3M99B 2UXDH 4LNUA 5EBMC 1TVKB 1B3QA 1IOVA 4JI3B 5FD5A 2UXBH 3CEIA 5IP7G 4JYAO 2IJJA 3ETJA 3WWIA 3RYIB 1AJNA 1KC7A 2ODTX 2OYQA 3AG1B 1LUVA 3RYFA 3CS5A 3RJ0A 4NB5A 3L70H 2ADQB 3MWDA 2QK4A 5EBWC 2J6UA 3APOA 2VQFO 3K5OA 3TCUA 2W6PA 2Q9LA 2VUGA 1MSWD 1VF6A 2PGGA 3RGZA 4DRXA 3L75H 2CK3G 1WAZA 1J5EO 2NVYA 3WG7C 2HVJC 1UFIA 3CHXA 3EXAA 5KA6A 1FJGO 2WWWA 3PW0A 3VOUA 5KFOA 1OCOC 3CSXA 5J2TA 2UVWA 3MHHC 3ZMVA 5KA5A 2EJ0A 2UUBH 4HQ6A 4HNVA 2W7PA 3TY9A 5KUMA 1SA0A 3A2FA 3QTCA 1K92A 3LMLA 4APMA 1GSHA 4DV6B 4RB3C 2A0LA 4GUNA 4LF4H 5C5JA 1HNZO 1VF7A 3JASA 1YTFD 2ADPA 2AW9A 4PDMA 2ZM6O 4DUZH 1HNWB 3FDSA 4IL6Z 3R5HA 3CC2V 5LL6Y 2H8PC 3SYOA 4X65H 5JVDB 2V4RA 2UXNA 4J9PA 3FB8C 3FKSG 1HNXB 3T54A 3H9VA 3GIPA 1DLBA 3QWUA 4MV3A 1P84F 2CH7B 4MTFA 1ZQ7A 2Z0AA 2BQRA 3CB2A 4X66B 1EFRG 3JD1A 5C3EG 4X1YA 1DGSA 4RB2C 4RNOA 5LBQA 3W7TA 4I9WA 4GCZA 5CB4F 2XAHA 4FMTA 3D36A 5JH7A 4YBZB 1AB3A 3OE7G 4YAKB 3STZC 4ABMA 2PUSA 1OCZC 1P8LA 4HAMA 5J9PC 2CQYA 1S68A 4ZHQA 4YR0A 3H3VH 2HKOA 4F4ZA 4X8AA 5I5WA 2HHHB 2OIEA 4QW8A 4HNTA 2F95B 3OR6C 5KFLA 3RVZA 1WLEA 4LF7O 4X64B 4I7HA 4M7EA 5DMXA 5I5XA 2ZGIA 1WA8A 1DF5A 1RM1C 5I5TA 4JI5B 1M6VA 5DQIA 3ASNC 1XOUA 5L9XA 3BG5A 4C2MA 4DV7H 2E74B 3CVZA 3E35A 5KT3A 1IXMA 4GKKB 2CW8A 4L87A 2VUMA 4I4TA 2N04A 4OGQB 5LHGA 2HIXA 2BQUA 1RSOB 4A3LG 4FLXA 2R93A 4UCUA 1I08A 4ZOLA 1F7YA 4DR3H 3JRWA 4O4HA 2JK5C 1XMQB 2CE4A 4DV4H 3V4SA 4YJ2B 3Q8QB 3UYYA 4YP3A 3ZEDA 1ZUQA 2WLLA 1W0JG 4DR1B 3ABLB 4Q8FA 4DR7O 2AU0A 2OLSA 2R8HA 5C8YA 1ZTEA 3HO8A 4LF9H 1VARA 1XL6A 3TETA 4IRCA 5IYZA 4X1IA 3WB1A 4NXMH 1Y76A 3RB3A 5L1IA 4CH6A 4IYHA 5LA6A 1H2LA 2HVSA 2YU9A 1GTOA 2X5RA 1ZWIC 1JQ0A 2JA5G 2IMWP 1EKPA 2KG7A 1IYEA 3JRXA 5CA0A 3MDSA 3K0GA 2GLTA 3QG5A 4I50F 4UUGA 2AGPA 2R86A 3T9CA 4QPJA 5CB4B 5IJ0A 2WTFA 1FKAO 4MS2A 2XCLA 5KFWA 3DC6A 5EWGA 4RB0A 4MT8A 3QO7A 1XNQB 1J95A 1WN7A 5FNVA 2YS7A 2W9AA 1Y1WA 3E22B 1M56C 4AYBA 2UXCO 4EQ5A 4QE7A 3U55A 1K5QA 1CPYA 2E75B 2RDJA 1PL0A 4F6EA 4GZRB 1YDXA 5LYJF 1N0NA 2VS0A 4IIJA 2ZR3A 4I5SA 3SPGA 2BCCH 4JUZA 2B1IA 1JIHA 2QA4V 4W4KA 3ZX6A 5IWAH 2YIDA 2UU9H 3KCXA 2CKZB 1K33A 4JI6O 1Y74A 4X88A 5KG4A 1XEQA 2RN9A 4BWAA 1N32H 4B3MH 1RK5A 3GTLA 5CM0A 1EZJA 4DV2H 1M5IA 3GTGA 3CE2A 3OM3B 1SZTA 5KFCA 1CP9A 3QZ7A 2RDCA 1WCMG 4C5BA 3AG4C 2HR3A 2EIJB 3ZHQA 4O4IF 4TM5A 2PMZA 5CE8A 4J9NA 4MTOA 3M7MX 1SESA 4DR2O 4JI2O 1W2BU 3TEKA 3JZIA 1Y1VG 3LNNA 4O3QA 3TJTA 2I87A 2Q2TA 2V59A 4DL4A 3P32A 4EYIB 4A3MG 3M9OB 4TUYF 3PW4A 3S3XA 4FFLA 5KFIA 4J9OA 1KKDA 1NS1A 3OUUA 2BOBC 3OUZA 3CX5F 4MTEA 5JJNB 5BWUA 2W57A 2P0AA 1CEZA 1SRYA 2DE0X 2Q7HA 1IBKO 4QWCA 3RVYA 1N33O 3M9NB 1YXBA 4FU0A 1IVSA 1K4CC 3PN1A 4O4JF 3T1HO 1RJQA 4OX9O 4O82A 2PYJA 3EYYA 5L1KA 4LF5O 3LNMB 4O86A 4DYLA 1BQZA 4U6PA 3V6JA 3UQ8A 1SZXA 4MV8A 3OAAG 4O7RA 4PV1B 1YCIA 5L3GA 5BZBA 2FE3A 3VBBA 4I9QA 3KALA 3OEEG 1QLEC 4PI0A 1NQTA 3RB4A 1EZVH 4P2ZA 1R9TA 4EB6B 3OR7C 2YS8A 4I7ZB 3J81W 1GN4A 4ED7A 3HXLA 3J81N 3CPWU 4Q43A 2JA7A 3J7AK 1IURA 2X7RB 2CTRA 4LF8O 5LYJB 3G6YA 1O9HA 3R65A 2DJVA 5HFLA 4Y8VB 2YUAA 2PTMA 4QIWA 4R8UA 3Q4HA 3N6RA 4ETSA 2OCHA 2KKWA 2FK2A 3CRQA 2P4VA 4PA9A 1NVPB 2CNUA 1Y4MA 4DRFA 5JCOA 5JQWA 2DWEC 2ZKOA 1OCCB 4UFZA 4NXMB 1OBDA 3CRAA 5GONA 4DR7H 1OCRC 1CQIB 4J11A 1ZX3A 4XYLB 1JXLA 2RGVA 2M05A 3AG2C 2C35B 2WDTA 4BW5A 5KFPA 4O4IB 2QTSA 3TGUH 3QO5A 4ZIBA 4JYAB 3JCZA 5ITZA 2QWQB 3KHHA 1BGYH 5LOVA 3GVMA 4FBUA 4DR4H 4P9PA 2Q8VA 2XASA 5KFEA 3SJAC 2EZPA 3RB0A 1XNRO 1UPGA 2EJ2A 4O2AF 2UVUA 4A3EG 2ETNA 4UCSA 2XIGA 3AW8A 4TUYB 4IGGA 2VQFB 5F9LA 3SDLA 2YZNA 2QR4A 1I7FA 3VQXA 2X0SA 4LH6A 5HV6A 3ZMUA 1JPXA 4YHHH 3JZ6A 5LXTA 1J5EB 3G67A 4RAIA 1S03G 2JA8G 2WAMA 3DTFA 4LF6O 4R7CA 1Y67A 1FJGB 2QWNB 4MW8A 3UO2A 3SI8A 1GH6A 2H94A 4A93G 4WFFA 3ZRVA 2ALZA 2ZXWC 1IX9A 4GC7A 3UCSC 3A0HZ 2FMLA 4DV3O 4U7NA 4DK1A 5BR8O 5C44G 2R92G 5JQGB 5DG7A 1GM9A 4DO2A 3T5LA 1HNZB 1EKVA 3WWHA 4FFRA 3ASOC 4AQYH 4Q0YA 2ZM6B 4JV2A 4DV0H 3K5MA 1N34O 1TUBB 2EINC 2W6ZA 5EZYA 4XX0B 1A32A 3H1KH 1R3LC 2E5LH 4UCRA 2ZE5A 2QB5A 3R5XA 2R9RB 1KC8W 2LFRA 5KFFA 1CKNA 3RV4A 4TT3G 4JI1O 1KB9F 2EIKC 3HKEA 3T4ZA 3KHGA 4R8CA 5B1AC 5B66Z 1MZEA 4JI2H 1WH2A 5CA1A 1V54B 2XOKG 3SJQC 4TV9A 2CAZC 2GHYA 2R85A 4O7ZA 3N2GB 5FL7G 2R82A 3IAYA 3CCVV 5D1OB 2QDOA 4Z2WA 5TISZ 5KFHA 2F4VO 4KUMA 4LFBH 5LMNH 3RBDA 3FYIB 5DISC 1IBKH 1NZ6A 4X20A 1N33H 3CRMA 2DOSA 1QQCA 2GTSA 1U96A 2I80A 4FFBB 3TXSA 2ZE6A 3A0RA 4OX9H 1F4MA 2ZDQA 5KLVH 4LF7B 1FXKB 4O7SA 4LWSB 5JVLA 3G6VA 3GV8B 3N8DA 1SF9A 2Q7EA 3OTOO 1VQPV 4LFAO 4TV8F 1K5SA 1MZFA 2JA6A 2JJ2G 5F2VO 3MR6A 2NVXA 2I8CA 2CZGA 4JI3H 3CMEV 5KFVA 4FPPA 3FMAA 4J0MA 4QWEA 2W6OA 1I50A 1CKOA 2FLPA 3WO0A 2JA5A 3GDEA 3ABUA 5KG7A 1PPJH 4DL7A 4JZGA 4JI0O 3R66A 1O9GA 4JI4O 4Q44A 5FD6A 4PDLA 5JWPA 4ASUG 1M93A 3AK2A 1ET0A 2P90A 2HP8A 2QTOA 4EKWA 4F4XA 3MJFA 1SQXH 3GTKA 4O2BA 3MR5A 5KX5F 1VQ7V 2ZDIA 3HOXG 3ICXA 2X6AA 1TWGA 3N2KB 4NVPA 1URFA 3FYEB 5KT6A 4QNHB 4CE5A 1I94B 4IR1A 1N36O 1A3GA 3SR2C 3ABMB 4BAYA 4DV6H 1ENVA 1SQFA 2JS3A 3ETHA 3JD4A 5LGNA 1EN4A 2W71A 2DYSC 3Q8RB 1HNWH 5GW7A 1A9XA 4BXXG 5H5NA 1S5LZ 1TWCA 4DL5A 4DUYO 2AQ4A 4B3RO 1MG1A 5KHIA 2W6NA 3LDDA 1Y1WG 3ORRA 1KD1W 3T9EA 4RZQA 4J42A 4NR1A 3CMAV 4JI8O 1I7NA 4J9SA 1D5AA 3H4BA 2YIBD 3E8BA 2IJIA 2ASDA 1FAFA 3RUPA 4X66H 4TVIA 3HOYG 2C2DA 2WPDG 2GQRA 5HFMA 4HNAB 5CBGA 2UXCB 2JEIA 3B40A 2M6YA 2JGDB 3JAMW 3JCUZ 1OHHG 3CCUV 4DXWA 4NXNO 4FZ0A 1BHBA 3HKBB 3N43B 1Y6XA 3K3WA 4J41A 5BMVA 1Q81W 4EBEA 2R8IA 5L3DA 2XHBA 1B33N 4PZ6A 4DR5O 4ZI7A 4JYYA 4FE2A 3K5IA 1R3JC 3GIKA 1TVKA 2DQ3A 4JI6B 1WR2A 5IYBG 3T99A 4BIZA 3P3NA 2JJ1G 1M1KW 2R9IA 2F1MA 2GSMB 2JS5A 3RYIA 1Z2OX 2HHHH 2ZNIA 1VQ4V 2SCUB 4X64H 3BCCH 3U0ZA 3DC5A 3TY8A 3L4JA 4E4TA 5IYCO 1YEWA 4DR2B 4JI5H 4JI2B 4ED2A 4P30A 2OIGA 2UUCO 2R7NA 1K3EA 4UCOA 1RPRA 4FJCC 3CC4V 1JDBB 2L35A 2CTPA 3GTQA 1QR9A 5KX5B 1AP6A 5K3WA 1IBLO 3UZOA 2RMKB 4MTDA 3G71V 3H1IH 1RYRA 3ABTA 2UVVA 3GJXB 3IG0A 2PF4E 4UB8Z 3WG7B 2HHFB 1TUEB 2NR5A 3CCLV 4DV1O 1IBKB 2YRXA 1XMQH 2RDIA 2VQEO 3E86A 2WA3A 4X1KB 4XZ3B 5EWEA 4ED6A 2COGA 3GV5B 4RU9A 2Q4PA 1OCOB 3T1HB 3E8GA 4OX9B 2ATKC 3FFQA 2XC9A 4DR1H 4PDBA 4LF5B 2HG5C 3EVKA 3HOUG 4TSFG 2FLLA 3QZ8A 1ROPA 2YXHA 2HDKA 1OV9A 4O4LA 2ODMA 3HKZA 4LC1A 4J9MA 2RF4A 2AGAA 1EN6A 2XTAA 4BBSG 4DQNA 2YIBA 1I3QA 4FLUA 2JDIG 2JRIA 2YXYA 4GX1A 1XQ8A 2CH7A 3K58A 5DQGA 2JA7G 4U7OA 2XNDG 3RYHB 4QJFB 2EILB 1GN3A 4MVZA 4G28B 5JJEB 1PD3A 2O03A 3JATB 5J2TF 1H38A 3K0DA 1DIKA 4LF8B 2DWCA 3K59A 2X6BA 2M7WA 2XAGA 5D8DA 3FKIA 2OTLV 2VRZA 3UT5B 1XNQH 3W1GA 4KXRA 4UB6Z 3CCQV 2DPIA 1UC9A 2YS6A 3JAKB 4PA7A 1Q90D 2E76B 1OCZB 1R6KA 1VQ8V 3LSUA 4ED8A 1VQMV 1JVMA 3C90A 1GN6A 2R8JA 3JARB 3ABKC 5CBHA 4YR3A 2HG8A 3T9AA 1MSDA 1A0GA 2R92A 3L9DA 2V1DA 3PVXA 2J9GA 2ZT9B 4PELA 4ECVA 2EILC 3VQWA 2NU6B 2Q7DA 3KHRA 5B1NA 1S9FA 3KAJA 2HJWA 3G6XA 3I12A 5I5YA 3T7AA 3J7AU 5JH7F 1YIJV 4PWQA 3F7VC 1IXBA 1RM1B 1XNRB 3ASNB 3T2MA 3IJ4A 1Q7YW 1Z2NX 1RSOA 4B3TO 3L71H 4DUYH 1K7DA 1ZAUA 1AJPA 3ETDA 4EYHB 4JAVA 5BWXA 4NTXA 5BWRA 4YJ2A 3DTGA 2B9ZA 4H13B 3W7WA 3UFXB 4LF6B 3B8MA 2Z5UA 3RGXA 2ZCEA 3TW6A 3JYCA 5IT9W 3ZHRA 3BQ0A 2DMXA 4Q4DA 4DV3B 1B6SA 1ZL8B 4X62O 3GIJA 1F4NA 5BR8B 1M0WA 5L1JA 1Q6IA 4BIOA 4NTYA 2B63G 3ZS8C 1PL4A 3SJCC 3T9DA 2PYLA 1IZ3A 1VP7A 2Y0IA 2YI9A 2HVRA 5KMGB 2WB1E 4BBRG 1I2LA 4B3SO 1JX9A 3UKMA 4K0KO 4DRXB 1N34B 2ARHA 3KHLA 4I4TF 3AK3A 3I55V 1L0NH 4GKJB 2W6QA 2CTQA 1GRJA 3OUSA 1FVIA 4JI1B 3LQSA 1M4UA 3WNZA 5CB4A 4JI7O 3CCSV 2JVDA 1YZBA 3PO3G 4J9ZB 4BIUA 1N56A 3E89A 4TWKA 1NT2B 2ZD9A 3E22A 3O65A 4CS3A 1IOWA 4ED0A 1D5NA 2V9WA 2X6CA 1VQNV 5C8YF 4FGRA 1GKFA 4A3GG 2W0XA 1I2KA 1M56B 4CH5A 1IBLH 1OZ0A 3W5OA 4F50A 2F4VB 2ZQMA 4CKCA 2Q2UA 4GLWA 4R6ZA 5EIBC 2W0FC 5J2UF 1G6UA 2YEVB 2DQ0A 4DV1H 4BR6A 2O57A 1RPOA 1VF6C 1C3OA 4WF9V 3RB6A 1M0TA 4EG0A 2W9BB 4EFEA 2JA6G 1BMFG 3SYAA 1VQLV 4YAJB 1NVPD 3OMNB 1I94O 4JV5O 4F4LA 4GC6A 4WFEA 1SQVH 3OTOB 3KXYT 1T3NA 4LFAB 2IBZH 4FFNA 3U11A 4KP4A 2Y48A 5KFYA 2XAJA 1Q82W 3NXSA 1I7LA 3ZHTA 4U3FH 1BQ0A 1S77D 4JYAH 2BTQB 1GM7A 2P4KA 4PDRA 3JALA 3LUTB 4HYOA 2L6LA 4IHJA 3AG4B 4GYCB 2DYRC 4JI0B 4IIJF 4JI4B 4MVRA 3WB2A 3ZMSA 1FD9A 3OD4A 2QSAA 4KFMA 4MW3A 4DL3A 4ECSA 4CC6A 1H2SB 1X59A 3E8FA 1KT8A 5AG2A 5EC2C 4D7TA 2VQFH 4WBNA 4F4YA 3G80A 3TK1A 2PI4A 4FFKA 1J5EH 5DG8A 1WA8B 2GQSA 4EEYA 2Q73A 4XBFA 4XDJA 3OT7A 4YIPA 1FJGH 3H0GG 2WAQE 1WRVA 1OJHA 4RWUA 1A48A 4MAMA 5F9NA 3NR7A 2BSKB 3HKCB 1RJPA 3BEHA 4B7EA 3N40P 4D7SA 3D36C 1N36B 1EN5A 3TQ1A 3CCRV 4RZRA 1HNZH 5LMUO 2QJ1A 1R3IC 5FLXW 4PA6A 2ZM6H 1V51A 3RGBA 4R50A 3TQTA 2WLIA 1P4RA 4QWBA 4A3DG 4EB6A 2Y69C 3OGIB 1T94A 2R7ZA 2WLLB 1SETA 4DUYB 1E4FT 4B3RB 1XILA 3CRCA 1IDSA 3BHPA 1S0VA 3GWOA 1QLEB 1Q5OA 4JI8B 4C5CA 2FKXA 4TQRA 5C8YB 2R6FA 2CW7A 3OHAA 3MWEA 5LYJA 3R23A 4G2KA 4JGSA 5D5QA 4MA5A 1NKDA 4CKBA 1E1QG 1H8EG 2PI5A 1GSAA 3ZHVA 5FJ8G 2DIKA 4NXNB 1FFTB 5J2UB 4R7RA 4ED1A 3CYOA 4PZ7A 4EGJA 1AI6A 2COJA 4LBEC 4GX0A 4DR5B 1ZETA 3DXRB 2J6TA 4ECUA 3GTJA 1JKJB 3RWRD 4DV5O 3LDCA 1XMOO 1HR0O 1Z5WA 5L3CA 5LGUA 1WB7A 4YJ3A 1JR9A 1CE8A 5IYDG 5KFGA 2CGOA 4MV4A 1OCRB 2W6MA 4I50B 3RIZA 2GPWA 3AG2B 4QE9A 4LF7H 4M9UA 2WLHA 2XAQA 1R6NA 3JSNA 4I0XB 2FPPB 3Q2OA 1VQ6V 1EZ1A 4ICGA 2PBZA 2BR0A 4J80A 3ZRWB 4DK0A 1RP3B 4QIWF 2UVRA 1SQPH 1NU1H 1PP9H 2UUCB 4YB8B 1FFXA 5KG5A 1M90W 4JI7H 3CCJV 1W96A 2R8KA 1VAJA 1BS3A 1KU9A 2FL4A 2LQTA 1IBLB 3H1LH 2NLJC 2P7TC 3GIQA 2KSDA 5CBFA 5K1XA 4FLYA 3FB7C 2LO1A 1FYJA 3M4IA 4QIWE 3PR5B 4A3JG 3PO2G 4DV1B 1PNMA 4A2AA 3TY5A 2VQEB 3GB8B 1EKFA 1YJNV 3OGCC 1S5HC 5JQGA 4HBNA 2ZXWB 3T1CA 5H6QA 2D3OW 3HT5A 3LWBA 2EIMC 5CAEB 3MR2A 2FB5A 3ZRXA 1TUBA 3PJSK 1VF5B 1QBZA 2LGQA 4FVMA 1MZBA 1GSOA 1QHTA 3ASOB 1QCEA 2V7QG 2R72A 3RAQA 3TIGA 1I94H 2YIAA 1W59A 3MR3A 2EINB 5CN0A 5LXTF 5B1BC 2HLDG 4IZOA 4XYMB 2HFEC 1AR1B 4KHPO 3OSPA 4MTXA 2CGNA 4JPRA 4JXUA 4NTWA 2PZSA 3QVNA 4O7YA 3FKIG 1JCHA 3MFIA 4MV1A 2EIKB 3BA9A 3X2QC 4FZ1A 3G6EV 4RQFA 2OCCC 2NUAB 2WLNA 1FKAH 1IBMO 5T14A 5LP6A 2R8GA 5B1AB 5D1OA 4BWSC 2Q67A 1SQGA 1JJ2U 1S97A 2Q5ZA 3VQVA 1KEEA 2D2CB 4UCTA 3N6XA 1D2DA 2WA4A 2FJZA 2UXCH 4O4JB 4LSXA 5EZYF 2Q69A 4Z1VA 2Y4UA 3EPIA 3ZN1A 4ZKIA 1SS3A 4FFBA 4U7CA 5KFQA 2R9AA 2WSSG 4P9OA 3V6KA 1FXKA 2IU3A 4J7JA 4LWSA 5KG1A 2F93B 5BPFA 2DABA 2YWVA 1US6A 1PM9A 1L1FA 1Z2PX 2OH2A 2P06A 1BHAA 2B63A 4YY3O 5A2QW 2XCAA 4JI6H 3RV3A 4GKJO 5LMUH 5A2QN 3SE7A 1KP2A 5CA1F 4IRKA 1Z2GA 1WNSA 4H44B 5FPRA 4TV9F 5DQHA 1NH2D 1XBLA 4TOIA 3RT3C 4JYBA 4B3TB 5B5EZ 1P49A 1PK8A 1XUQA 4O83A 3SYPA 4DR2H 3L4KA 4BW9A 4QWAA 1BE3H 4J10A 3PFFA 4U3JB 3ZHUA 2A1HA 4CMFA 1I1LA 4I55F 3G6BA 1S0NA 1COWG 1GN2A 4KL1A 3N2KA 1XDNA 4FFOA 3K08A 2C00A 3M9MB 3FB5C 4TQDA 3RW0A 5KS8A 1R1BA 3CQZA 3ETGA 4X62B 4MV9A 2V4DA 2W70A 2CNVA 5KAIZ 4DR6O 1R6TA 1YSCA 4B3SB 2WYOA 2WLMA 1XHZA 1KJ8A 3D3IA 5L3EA 4K0KB 2K1EA 4JV0A 3T1HH 4PBCA 4MVOA 3G4SV 1QR8A 5LXTB 3I5DA 5A9GA 4LF5H 5KFXA 3OHBA 2VPSA 1QNMA 3VQYA 4O2AB 4G27B 3MAQA 1PX2A 2Y4RA 2P6JA 3MD0A 5JCOC 3U10A 2DYSB 2GUZA 2UXDO 3N42B 3K9AA 4JI7B 1JA8A 1X4TA 1KTAA 2CNQA 2NU7B 4O2BF 3RYCB 2EX3A 3FAVB 4FM9A 2YZMA 1AROP 2UXBO 2YI8A 2RCVA 1R3KC 1N4CA 2JGDA 1H2MA 4MVUA 5KHJA 3OTFA 4CKEA 3OSNA 3HKBA 4FK5C 4PZ8A 5EZYB 4QSHA 2QYZA 1G4YB 1BXRA 4MVMA 4LF8H 4XDKA 5I60A 2N74A 3H40A 1Z5VA 3JD0A 1JFFB 4FS1A 4ECZA 2CUGA 4OPAA 1K1QA 4WCEV 3DSQA 5KFMA 5H9CA 2FPGB 3CRRA 3NUAA 4O7LA 3JAWB 4AI8A 4A3FG 5EYPB 2FLNA 1XHXA 4ME6A 3H0GA 4CS2A 4JV5B 2E2IA 3ZIAG 5CA1B 2YXLA 4JAAA 2UXXA 1KBHA 2UUBO 1MMMA 1Q6HA 5CMUA 3UO3A 4HN2A 2Y0SE 3A8TA 4N21A 3Q1KA 2LW1A 3OEHG 1MABG 2ASJA 4PDVA 1K8AW 4LF4O 5C1PA 5KFKA 3BVOA 2A7WA 1E4EB 4DUZO 5IY5B 4KHPH 4FM0A 4C5AA 4AILC 5IP9G 4RUEA 4RQEA 1GYFA 1XNRH 4X65O 4I55B 5KX5A 2GPSA 2HGWA 2NU9B 1VMGA 4ZI7F 4K35A 3WO1A 5C93A 3R5FA 3W7UA 4MA0A 3JAMN 4LF6H 4QGPA 5KT4A 3RN4A 2V58A 3HKDA 1NBMG 5C4XG 2XAFA 1VQ9V 3T9FA 4MVQA 4F6RA 1I5XA 1VQOV 3SYCA 1NTMH 3KG2A 4O7NA 1G2WA 4DV3H 3PW7A 1UNNC 4TV8B 5BR8H 1CQJB 4UV9A 5H2FZ 3RF2A 2A06H 3C3TA 2IH3C 5LMUB 3L73H 1RYSA 2Z04A 2R7ZG 3VA7A 5IJ9B 3K06A 2E2HA 3IFXA 3R9RA 1N34H 1TAEA 1XI1A 1WP7A 3WU2Z 3EFFK 5BYAA 2Z3YA 4O3PA 1XDCA 3NC0B 4D6TH 1WP8A 5IY5C 3CC7V 2AGQA 3PW5A 2DAAA 4GKJH 3B2EE 3JATA 2K9PA 3W7XA 5LHHA 3T4DA 3B8NA 4JI1H 1VEWA 2W6JG 3SPHA 3ZRSA 5EBLC 4YQWA 4HYKA 3ETEA 3E5NA 3WWJA 3V6HA 1BZKA 3GIDA 2UUAO 2HJDA 4DV7O 2NN4A 4E2LA 3T5KA 2IW5A 3JAKA 2LP7A 3OMAB 5B3SB 3LP8A 4O4LF 4HZ3A 1F23A 5IYBO 2EJRA 3ZN0A 1PNLA 2A3QA 3CJHB 4N23A 4L8JA 4CMDA 4EBDA 2F4VH 4LMYA 4DV5B 2RQ6A 3VPDA 3JARA 1XMOB 2R7LA 2C22A 1HR0B 4DV4O 5I5SA 2KQXA 1BJTA 4WFGA 3B4SA 2ZIOA 5JVDA 3HOZG 5E25A 4GX5A 3VPBA 1EBOA 1P7GA 5BYBA 3TINA 1K4DC 2YDEA 2ZDIC 3ABKB 1FXHA 3JD3A 2HIVA 2NU8B 1VBGA 4H33A 4CBCA 1C30A 2ZR2A 3Q8SB 5I47A 3J80W 2IH1C 1MOFA 3OTOH 4LFAH 3H20A 2ZIMA 3DTUB 2YL2A 4K8XA 4ZI7B 4CZZA 4DIMA 2XUMA 3BABA 4CC5A 1KJQA 2JGUA 2H3OA 4FBTA 5HBRB 4J9QA 3KTMA 3IGAC 4UV8A 5DGHA 4JI0H 4JI4H 4LFCO 5B3SC 1N48A 2QKSA 2DPJA 2X0LA 2MK3A 2ZNJA 4NZOA 4EBCA 1AI4A 1DV1A 1ZL8A 4JASA 3KAKA 4MVSA 1S5JA 3GTPA 2RJZA 3AG3C 5KMGA 4O3SA 1P7BA 3GILA 1QVFU 2PN1A 1I0HA 5DN6G 3OMIB 5KFAA 2XGPA 2EJ3A 2W9CB 3DF7A 1FPOA 3AG7A 2FP4B 1N36H 5JUMA 3G8DA 5IWAO 4B7KA 2UU9O 4KHPB 4YJ2F 3O9OA 2AZ0A 4ED3A 1EUCB 5DGIA 4WHXA 1QU7A 4Q4CA 5KFSA 4B08A 2Q0OC 4CHIA 2IJHA 3VNNA 2EZOA 1N32O 4B3MO 3BACA 4B3RH 2C2AA 4DV2O 2Q6AA 1LR1A 4CH3A 4LNUB 4JI8H 1CXZB 1IBMB 2BQ3A 3ZMTA 4ZHQF 3RFRA 5L3BA 4O4LB 4FLVA 5KT5A 3AG1C 4A5UB 2QE7G 3LULA 3N44B 2V4QA 2VA3A 2AHYA 1Y66A 3HB3B 2QWPB 3IC9A 1N0JA 1KUQA 5BWWA 4X9QA 1AI7A 1XREA 1DV2A 4TQFA 2YEVA 5KFZA 4NXNH 4HNUA 3RYFB 5IT9N 2ZE8A 4C7UA 1U97A 2BTOA 2LW7A 2W9BA 4J7ZA 4DW0A 4DR5H 1DTOA 4EFBA 5DM6V 3OUFA 4ECYA 3GTOA 2FPIB 4YY3B 3K3VA 5DLFA 3SPJA 5DAAA 2YCHA 4YIOA 3KKYA 5H6RA 3HPLC 2BTQA 4ZOLF 4OXSA 3U9TA 1H2NA 1UJWB 3H1JH 5J2TB 4UXNA 4O4HF 3W1BA 1ULZA 4O3OA 1S0MA 2WB1A 1GO3F 1SA0B 1I5YA 2IM9A 5I5VA 3V4ZA 4XDLA 1EHIA 3JASB 2UUCH 2DYRB 3D3QA 3T1YB 4FFPA 4NYKA 1B06A 3AX6A 1AR4A 2DN9A 4M0JA 5KFRA 5DGBA 1S72V 2ZE7A 5IYZF 2HGXA 5FR9A 2UUAH 4RCNA 3FX7A 5C1OA 1GO3E 2W8KA 2FKLA 1Q6UA 5LA6F 3T5HA 1T5EA 2F43G 5EK0A 2BSKA 3HKCA 3L72H 1SERA 4DR6B 3VMMA 2VQEH 2XT9A 1CS0A 2ZJTA 5CA0F 4X1YB 1X9NA 3RBEA 5BY1A 1B04A 2LJ2A 3ZMZA 3KREA 1JLLB 4E4EA 2N05A 3THOA 4BY1G 3GIMA 2DLNA 4IHJF 1O75A 3TIIA 3FB6C 2C28A 1NTZH 4BY7G 3F5TA 2AZ2A 5LL6b 5JH7B 4FLTA 1SKVA 1A0IA 2G38A 5IDJA 4NZMA 1EUDB 5DG9A 5FNVF 1EYZA 2ZDHA 2UXDB 4JV1A 3N27A 1UC8A 3QFFA 4WBNF 1KJIA 3GV7B 2Y69B 2IJKA 5E1AC 4ZHQB 4IAJA 2OWOA 3EPGA 4RNNA 2UXBB 2YICA 3F7YC 5KFBA 3I4MG 1YJWV 2QM8A 3NBZB 1GM8A 3NBYB 5J2UA 2ILMA 1DF4A 5BWTA 4DR4O 1B6QA 1KJ9A 5H80A 5DLGA 4AYBE 3MFHA 2HJFC 3JZFA 4W4LA 4LFCH 1XL4A 3E8HA 4DLKA 4PA3A 4ECRA 3SPIA 3DXRA 3VOTA 2JIZG 2QWRB 4MSWC 3ZCCA 4ECXA 3RBZA 4YHHO 1JOYA 1K73W 3BQ2A 4K3AA 1VIBA 2JEFA 4JTCB 2QGNA 4I4TB 1NTKH 2QM4A 3GB7C 1LNQA 4FIPC 2FK3A 3H1HH 4ZOLB 4JAUA 3RR5A 4I50A 2ATLA 2UUBB 4Q6GA 4O4HB 5KG2A 3ABLC 3PR4A 3PZPA 1LUWA 1R73A 1VKZA 1WJZA 4QPKA 1L0LH 4I0XA 5FLXN 2HVKC 1YTFB 1QVGU 2YZLA 3CSWA 1K34A 4O81A 3ZRWA 4LF4B 1EM1A 1TWFA 2WAQA 2R84A 2VQDA 3K5NA 4AQYO 2PMZE 5I5UA 5KT7A 4MV7A 1BT8A 4DUZB 1KQSU 5FLMG 4DV0O 2Q7GA 1KUTA 1GAXA 3UM7A 4LSAA 5JJJB 4X65B 2E5LO 4AHCA 5DEDA 5IYZB 4B3TH 4X1IB 3SYQA 4QWDA 2RNBA 2R70A 4UVBA 1WSCA 1Y76B 4TQSA 3LSSA 5LA6B 1AP5A 1ZHSA 3BQ1A 3BRCA 5LGTA 3N41B 2DZDA 2BOCC 2VR1A 4YJ3F 2KG7B 1BL8A 1F51A 5CA0B 2FMAA 4WFHA 1BSMA 1NJIW 4UVAA 5KT2A 3BAAA 4IWXA 3JALB 2YZGA 4IHJB 3H01A 1HP8A 3BPZA 5IJ0B 3E83A 3K3PA 4X62H 3ZBHA 3CEBA 3F8NA 3LDEA 1Q8IA 1ZHQA 2EULA 2EIMB 1OBGA 4O4IA 5L3FA 4B3SH 5FNVB 3W7SA 2P67A 4LFBO 4K0KH 4NLGA 3A0BZ 4WBNB 5LMNO 1YHQV 4O7TA 2FK1A 3OFNG 3OW2U 4NKGB 5KFDA 1YI2V 2QKCA 2A79B 1HDJA 3GQCA 4IIJB 4NYEA 1VQ5V 3VPCA 4O7WA 5B1BB 4O84A 1I6UA 4TUYA 3BA8A 3WB0A 4MTGA 5HNEA 1AR5A 2QWOB 4DAAA 3BJYA 5JQGF 4E6NA 3MHSC 2UUAB 1Y74B 4O3NA 4JI3O 4DV7B 1YJ9V 4ZQIA 3X2QB 2COIA 3GTMA 2EIJC 2OCCB 3CD6V 5GONF 4G3IA 4A2BA 4O4JA 1S0OA 3IN5A 4UUJC 2OTJV 1SCUB 2PY5A 3TW7A 4J7KA 2WLIB 1CKMA 3SGIA 1AI5A 1KJJA 1ORQC 5IYDO 3I4NG 2WLJA 3E2EA 3K57A 1THZA 4DR3B 1K1SA 5LOVF 2R7KA 4DV4B 2FYUH 4DW1A 4RB1A 2YRWA 2VWJA 5KUKA 1S76D 1YITV 4JV5H 2HVQA 3GWKC 2JEUA 5LP6F 3HOVG 4LF9B 2CTWA 4F4WA 2GTAA 2ASLA 4HR7A 3QO8A 4RO2A 5LHIA 4X89A 3HOWG 2IBKA 4Q20A 4DV6O 4Z1MG 4A3KG 4RAZA 3NGDA 4U3JA 4WD3A 2GBOA 3I56V 1HNWO 3N2GA 4YJ3B 4LFCB 2QF7A 4GLXA 3K5HA 4RAYA 1BCCH 2Q68A 3AEIA 3LSQA 1HNXO 3SNOA 2W6IG 2IU0A 1H8HG 2P22C 4JTDB 5KG3A 2F66C 5EC1C 1IYDA 2XD4A 2B1GA 1FS0G 1ZSPA 5KAFZ 4X66O 5KHHA 3CXHF 4WFAV 4JTAB 5DECA 1S3JA 1NR7A 2R7MA 2JEJA 2EIYA 4UCVA 1BNCA 2AHZA 1FFXB 3Q8PB 4DL6A 2IA6A 4H37A 1E1RG 1RJRA 4DL2A 1TWAA 1V9PA 4RUFA 1V4YA 4O2AA 3DGEA 4H0LB 3ZJZA 5IWAB 3QF7A 4R8UB 1OCCC 4PD4F 3Q4HB 2GDSA 3IC7A 4FLWA 2UU9B 2A9HA 1QLNA 2IP4A 3FD9A 1Y14B 3T5JA 1ZLZA 3RYCA 5K2MA 3FAVA 4A3CG 3U54A 4O7VA 1MA1A 4B3MB 1N32B 5CA3A 2R87A 1WPBA 3C0FB 1SFOA 1HWYA 4A3IG 3B77A 5GONB 4DV2B 2HHHO 1G1XB 2V5AA 2YSUB 3K04A 5DGAA 3SPCA 1T36A 4X64O 3T1YO 4ECQA 4PJ0Z 2CFMA 3UZBA 1JFFA 3K03A 1AUVA 2FB9A 4OPHA 2VWKA 1L2ZA 4JI5O 5ITZB 5KG6A 4FS2A 5LOVB 4NZNA 3KYHC 1PKXA 3APQA 4GX2A 4J9LA 4GKKO 3HBLA 3JAWA 2AGOA 1DAAA 3GIIA 5EYPA 4IYIA 4Q8EA 3BY6A 5KFTA 3CWBH 3QQMA 4DV5H 1JX4A 3G8CA 1XMOH 3CCMV 1XMQO 5LP6B 3S24A 4JYCA 3SJBC 1KBLA 1HR0H 3C3SA 2QM7A 1I1KA 1M57B 4CS4A 3RAXA 4PI2A 1SQBH 2F23A 4DR1O 4CH4A 3MWMA 4ZBMA 1E4EA 1S10A 3K5LA 2JEGA 2LGWA 2HEPA 5B1OA 1I1MA 4I55A 4WFBV 2XCPA 2ITDC 4HNAA 1VS0A 3KZIZ 1GK9A 3AYHB 4K6NA 2YW2A 5EWFA 1N8RW 2KB1A 4IRDA 2KSWA 2VUMG 2ZDGA 1G8MA 1BGWA 4Q45A 2Z02A 2R93G 3F5WC 1CKNB 3K9SA 3CXCU 5EOYA 1V54C 1MNGA 4MV6A 3HKEB 3ETQA 4TV8A 2FTKA 5KHKA 3CCEV 1B6RA 1H2KA 4YXWG 2XGQA 5LP6C 1K83A 3U0GA 1PNKA 3ORQA 1XNQO 1KYOF 5IJ9A 3H4DA 3ZHSA 1K97A 1M57C 1VBHA 3EHBB 2J6SA 4TV9B 3JSLA 1AILA 4J9KA 3L2PA 2DWDC 2EBOA 2VPQA 4IWYA 3U9SA 4DR7B 2Q0AA 2MW2B 4LCUC 1KKCA 1H2GA 1E4GT 1GMGA 2RGRA 5GTHZ 1FXKC 5BMVF 3L74H 4X20B 5D1PA 1Q3EA 2AXTZ
chains in the Genus database with same CATH topology
1FJGH 4TUYB 2VQFB 4DR4B 1I7FA 3VQXA 4YHHH 4LH6A 4KHPB 5LXTA 2GV9A 1J5EB 1XK5A 3HKCB 1IBMH 3N40P 5D5PA 5KHGA 1S03G 1TA8A 4B08A 4D7SA 4X1KA 1N36B 1FJGB 3VNNA 1HNZH 4B3RH 2QJ1A 4YHHB 1HNXH 5FLXW 1Q43A 2ZINA 2ZM6H 3RGBA 5K1PA 4CH3A 4LNUB 4JI8H 1IBMB 3RTXA 3RFRA 4DK1A 4O4LB 4FLVA 4EB6A 3N44B 5JQGB 1KMIZ 4DUYB 1E4FT 1HNZB 4B3RB 4AQYH 3BHPA 4Q0YA 2ZM6B 1Q5OA 4JI8B 4DV0H 4TQFA 2HGSA 2WE6A 3K5MA 4NXNH 5EIBD 5C8YB 1TUBB 4PHZA 5EZYA 2CW7A 3RYFB 3RYHA 5LYJA 2E5LH 4UCRA 4YY3H 2VOBA 2BTOA 4O2BB 5D5QA 4AQYB 4DR5H 1CKNA 4DV0B 4EFBA 4NXNB 5J2UB 4R7RA 1SYXB 2E5LB 4YY3B 3HKEA 4PZ7A 1TGOA 3K3VA 4DR5B 2YCHA 4LH7A 3UT5A 4JI2H 4K8ZA 2BTQA 2E3CA 1WH2A 5CA1A 5J2TB 4TV9A 3RWRD 2CAZC 3W1BA 4EEQA 3T1YH 3N2GB 3IAYA 1Z5WA 4LR3A 5D1OB 4YJ3A 1SA0B 4FLZA 2IM9A 1JMKC 1SEIA 3JASB 4LFBH 4I50B 3RIZA 2UUCH 3T1YB 5LMNH 4LF7H 3JSNA 4GKKH 5DISC 1IBKH 1P16A 4X20A 1N33H 4DR6H 1QQCA 2UUAH 1JJOA 4DK0A 4FM1A 4FFBB 4LFBB 2UUCB 1AN7A 4OX9H 5LMNB 4LF7B 1FFXA 1HW7A 1T5EA 4JI7H 3HKCA 2Q7EA 1N33B 1KU9A 5BMVB 4DR6B 2VQEH 5FPOA 2ZJTA 1L8DA 4X1YB 4FM2A 1IBLB 1X9NA 1B04A 3HKDB 4JI3H 2MCTA 5K1XA 3FMAA 3THOA 4FLYA 4J0MA 2P5OA 4F6RB 3M4IA 1CKOA 2UXDH 1O75A 4LNUA 4DV1B 4A2AA 3TY5A 3GDEA 2VQEB 3GB8B 5LL6b 1TVKB 5JH7B 4FLTA 1SKVA 1A0IA 1O9GA 5JQGA 4JI3B 4HBNA 5FD5A 5FD6A 2UXBH 1M93A 2UXDB 3RYIB 2OYQA 1TUBA 3RYFA 4IAJA 4ZHQB 4FVMA 2OWOA 1MZBA 3RJ0A 4O2BA 1QHTA 2UXBB 2R72A 3ICXA 1I94H 3N2KB 4NVPA 2YIAA 3NBZB 3K5OA 3NBYB 3RGZA 5J2UA 2VUGA 2PGGA 4DRXA 4LFCH 3CHXA 1I94B 2PZSA 3SR2C 4DV6H 1SQFA 5J2TA 3CSXA 3BA9A 2UUBH 1HNWH 1FKAH 5LP6A 4I4TB 5D1OA 4BWSC 3TY9A 1SA0A 1SQGA 3A2FA 2QM4A 3QTCA 3LMLA 4APMA 3VQVA 4DV6B 4RB3C 4LF4H 5KHIA 1VF7A 3JASA 4UCTA 4ZOLB 3RR5A 4I50A 3N6XA 2UXCH 4RZQA 4O4JB 2UUBB 4DUZH 4Q6GA 4O4HB 1HNWB 4LSXA 1D5AA 2YIBD 4X66H 4X65H 5JVDB 4LF4B 4HNAB 4FFBA 3K5NA 2R9AA 1HNXB 2UXCB 4MV7A 4DUZB 3QWUA 2Q7GA 3JAMW 2F93B 3HKBB 3N43B 4LSAA 3CB2A 5BMVA 4X66B 5JJJB 4X65B 1Z2PX 2XHBA 5A2QW 4AHCA 4JI6H 4X1YA 1DGSA 5IYZB 4RB2C 4B3TH 4X1IB 4PZ6A 2R70A 5LMUH 4ZI7A 1WNSA 5FPRA 5LA6B 1ZHSA 3BRCA 3N41B 4TOIA 1TVKA 5JH7A 4JI6B 4B3TB 1P49A 5CA0B 2PUSA 2F1MA 2JS5A 3RYIA 1P8LA 3BAAA 4BW9A 1Z2OX 3L4KA 4DR2H 2HHHH 3JALB 4U3JB 4IHJB 2ZNIA 3BPZA 5IJ0B 1S68A 4X62H 4ZHQA 4X64H 3F8NA 3U0ZA 3TY8A 3L4JA 1Q8IA 1ZHQA 4O4IA 1YEWA 3N2KA 4KL1A 5FNVB 4DR2B 4JI2B 1XDNA 2HHHB 4B3SH 4JI5H 4TQDA 4K0KH 2F95B 4WBNB 4X62B 4X64B 4UCOA 4I7HA 4M7EA 4MV9A 2V4DA 4IIJB 5KX5B 4JI5B 4B3SB 2WYOA 1XHZA 4MTDA 4K0KB 1I6UA 4DV7H 4TUYA 3T1HH 3GJXB 3IG0A 3BA8A 3WB0A 5LXTB 4LF5H 3CVZA 4GKKB 1IBKB 2CW8A 1XMQH 2VPSA 4I4TA 4E6NA 4X1KB 2HIXA 3VQYA 2UUAB 4O2AB 3MAQA 4FLXA 4DV7B 3T1HB 4UCUA 4OX9B 3FFQA 4ZOLA 3U10A 5JCOC 4A2BA 4DR1H 4O4JA 3N42B 4DR3H 4LF5B 4PDBA 4JI7B 1X4TA 4O4HA 1XMQB 2PY5A 4DV4H 4YJ2B 1CKMA 4O4LA 3SGIA 3RYCB 2EX3A 4FM9A 3ZEDA 3K57A 2YI8A 2YIBA 4DR1B 4DR3B 4FLUA 5KHJA 3OTFA 1XQ8A 4DV4B 3HKBA 3K58A 5EZYB 4PZ8A 4RB1A 5C8YA 3RYHB 4LF8H 2VWJA 5JJEB 4LF9H 1Z5VA 5IYZA 1JFFB 4X1IA 3WB1A 2O03A 4NXMH 3JATB 4CH6A 4JV5H 3DSQA 5LA6A 2HVQA 2HVSA 4LF8B 4LF9B 3K59A 3JAWB 5CA0A 5EYPB 1XHXA 3UT5B 4CS2A 4JV5B 1XNQH 3QG5A 3W1GA 5CA1B 4RAZA 2YXLA 4U3JA 3JAKB 5CB4B 5IJ0A 3N2GA 4YJ3B 4LFCB 4GLXA 4RAYA 4RB0A 1XNQB 1WN7A 5FNVA 3E22B 4EQ5A 3JARB 2P22C 4FM0A 4KHPH 2F66C 4AILC 1GYFA 5KHHA 4IIJA 1XNRH 4I55B 5KX5A 3VQWA 4UCVA 3KAJA 5IWAH 1FFXB 2UU9H 1XNRB 1V9PA 4LF6H 1Z2NX 1RSOA 4O2AA 4DUYH 4BWAA 1N32H 3HKDA 5IWAB 4B3MH 1ZAUA 3QF7A 4FLWA 2UU9B 4F6RA 4DV2H 1M5IA 4YJ2A 4DV3H 4LF6B 3RYCA 4TV8B 5BR8H 3RGXA 3RF2A 1N32B 2ZCEA 4B3MB 1WPBA 5LMUB 3M7MX 3C0FB 5IJ9B 5GONB 4DV2B 5IT9W 4DV3B 1N34H 3LNNA 1TAEA 1XI1A 2Q2TA 5BR8B 1M0WA 3ZS8C 3SJCC 3NC0B 2PYLA 2CFMA 2HVRA 2YI9A 1JFFA 5KMGB 4GKJH 3B2EE 1L2ZA 2VWKA 3JATA 5ITZB 4DRXB 5LOVB 1N34B 4JI1H 3KYHC 4MTEA 5JJNB 2W57A 2Q7HA 3JAWA 4GKJB 5EYPA 3PN1A 1FVIA 4JI1B 2PYJA 3EYYA 1M4UA 4DV5H 3JAKA 5CB4A 1XMOH 5LP6B 3S24A 1HR0H 3SJBC 3UQ8A 2JVDA 4L8JA 1NT2B 4CS4A 3E22A 4CS3A 4PI2A 2F4VH 4LMYA 2FE3A 4CH4A 4DV5B 2RQ6A 3MWMA 3JARA 3K5LA 1XMOB 4I9QA 3KALA 4PI0A 1HR0B 1BJTA 2HEPA 4EB6B 4I55A 3J81W 4CH5A 1IBLH 2ZIOA 5JVDA 3W5OA 2F4VB 4HNAA 3HXLA 1VS0A 2Q2UA 2HIVA 5EIBC 1G6UA 3J7AK 4DV1H 3J80W 3OTOH 4LFAH 3H20A 2KSWA 5LYJB 2ZIMA 1M0TA 1O9HA 4EFEA 1BGWA 4K8XA 2PTMA 4ZI7B 1CKNB 3BABA 4CC5A 4ETSA 2JGUA 3OTOB 3KXYT 5EOYA 2KKWA 4LFAB 3HKEB 3ETQA 4TV8A 4JI0H 3U11A 5KHKA 4JI4H 4DRFA 5JCOA 5LP6C 4UFZA 4NXMB 4JYAH 5IJ9A 5GONA 2BTQB 4DR7H 2ZNJA 3JALA 3JSLA 4TV9B 4IHJA 4JI0B 4GYCB 2RGVA 4JI4B 3L2PA 3WB2A 3KAKA 1S5JA 2WDTA 2RJZA 5KMGA 4O4IB 4JYAB 4ZIBA 4CC6A 1H2SB 4DR7B 5ITZA 2Q0AA 2VQFH 4D7TA 1E4GT 5LOVA 2RGRA 4DR4H 4WBNA 1J5EH 3SJAC 3DF7A 4X20B 5D1PA 1Q3EA 4UCSA 2XIGA 1N36H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU B;  4K0K B;  2VQF B;  2UXD B;  4DV2 B;  3GJX B;  4DR4 B;  3BA8 A;  4LH6 A;  4KHP B;  4DV3 B;  1J5E B;  1XK5 A;  1TAE A;  4GKK B;  5BR8 B;  1IBK B;  2Q2T A;  2OWO A;  1TA8 A;  3NC0 B;  4E6N A;  2CFM A;  2HIX A;  1N36 B;  2UXB B;  2UUA B;  2HVR A;  1FJG B;  3VNN A;  4DV7 B;  3T1H B;  4UCU A;  4OX9 B;  3NBZ B;  4YHH B;  3NBY B;  2VUG A;  4LF5 B;  1N34 B;  4JI7 B;  1XMQ B;  3KYH C;  1IBM B;  3RTX A;  1CKM A;  3SGI A;  4GKJ B;  4DUY B;  1I94 B;  1HNZ B;  4B3S B;  4B3R B;  3PN1 A;  4DR1 B;  4DR3 B;  2ZM6 B;  1FVI A;  4JI1 B;  4JI8 B;  3BA9 A;  4DV4 B;  4PZ8 A;  3S24 A;  3UQ8 A;  5D1O A;  4UCR A;  3TY9 A;  4DV6 B;  4AQY B;  4UCT A;  4DV0 B;  4EFB A;  1CKN A;  3RR5 A;  2HVQ A;  4DV5 B;  4NXN B;  2HVS A;  2UUB B;  1XMO B;  1HNW B;  1HR0 B;  4LF8 B;  2E5L B;  4YY3 B;  4LF9 B;  4PZ7 A;  4LF4 B;  4DR5 B;  3W5O A;  2F4V B;  4JV5 B;  4LH7 A;  1VS0 A;  1HNX B;  2UXC B;  3W1G A;  2Q2U A;  2HIV A;  4DUZ B;  3QWU A;  3W1B A;  4EEQ A;  4X66 B;  4X65 B;  4LFC B;  5D1O B;  4GLX A;  4EFE A;  1DGS A;  1XNQ B;  4PZ6 A;  1CKN B;  5FPR A;  4EQ5 A;  3BAB A;  4CC5 A;  3T1Y B;  3OTO B;  4LFA B;  4TOI A;  3JSN A;  5DIS C;  4JI6 B;  1P16 A;  4B3T B;  4DRF A;  4UFZ A;  4NXM B;  4LFB B;  4UCV A;  2UUC B;  1P8L A;  3BAA A;  5LMN B;  4LF7 B;  3JSL A;  4JI0 B;  1S68 A;  1N33 B;  1XNR B;  4DR6 B;  4JI4 B;  1V9P A;  3L2P A;  5FPO A;  3TY8 A;  1X9N A;  1IBL B;  1B04 A;  4JYA B;  4CC6 A;  4DR2 B;  4DR7 B;  1XDN A;  5IWA B;  4JI2 B;  2HHH B;  1ZAU A;  1CKO A;  2UU9 B;  4X62 B;  4X64 B;  4UCO A;  4DV1 B;  3TY5 A;  3GDE A;  2VQE B;  3GB8 B;  4LF6 B;  1A0I A;  5D1P A;  4JI3 B;  4JI5 B;  4UCS A;  1N32 B;  4B3M B; 
#chains in the Genus database with same CATH topology
 2OT5 A;  5KFJ A;  1DK1 A;  4DR4 B;  2YYA A;  4FFM A;  3TXQ A;  2Y0S A;  1E79 G;  5IE9 A;  2GV9 A;  4GT1 A;  1XK5 A;  2HHF A;  3GLK A;  2C2E A;  1IBM H;  5D5P A;  5KHG A;  4J9Y B;  1TA8 A;  2ITC C;  2VA2 A;  4X1K A;  2Y4T A;  3CJH A;  5GTI Z;  4YHH B;  1HNX H;  2GUZ B;  2Y0P A;  1Q43 A;  3CP1 A;  2ABJ A;  2ZIN A;  5K1P A;  1AUX A;  5KFN A;  1WCM A;  1V55 B;  3RTX A;  5CR5 A;  1VQK V;  1OWT A;  4YR2 A;  1GLV A;  3BFR A;  2B5U A;  1KMI Z;  2WLK A;  3ML0 A;  5IYC G;  1FXV A;  1YVW A;  1Y1V A;  2HGS A;  2WE6 A;  5EIB D;  4PHZ A;  3D8C A;  1KEC A;  2BE3 A;  2W8L A;  4QJF A;  3RYH A;  1JDE A;  4JZ2 A;  2VOB A;  4YY3 H;  4O2B B;  4ECT A;  1AJQ A;  2LFS A;  2QEX V;  4LP8 A;  4AQY B;  3KCY A;  5E79 Z;  4L1K A;  1M9N A;  5BXZ A;  3T9B A;  4RUA A;  4DV0 B;  1SC5 B;  4UVC A;  1RK6 A;  3ABM C;  5EDW A;  2NNU A;  1SYX B;  2E5L B;  1WPX A;  4EGQ A;  4O3R A;  1TGO A;  2DW4 A;  4J9R A;  3DAA A;  3HR0 A;  1NR1 A;  1NH2 B;  1TWH A;  2QKA A;  4IT5 A;  3RFC A;  4LH7 A;  3UT5 A;  4K8Z A;  2E3C A;  3M8A A;  2CDY A;  2PVP A;  1WB8 A;  3S3W A;  4EEQ A;  1Q86 W;  5KG0 A;  4RUC A;  3T1Y H;  3PW2 A;  3K79 A;  4RNM A;  4LR3 A;  3AK1 A;  1GGO A;  5JVD F;  4FLZ A;  3P3P A;  5L1L A;  1V55 C;  4A3B G;  1W0K G;  1JMK C;  1SEI A;  4JF3 A;  4DR3 O;  1PV0 A;  5BPH A;  1SQQ H;  3AG3 B;  2W9C A;  4GKK H;  1P16 A;  1YF2 A;  3WFV A;  4DR6 H;  1W93 A;  5BWV A;  1NI8 A;  1JJO A;  2C2R A;  2JEX A;  4ECW A;  4FM1 A;  3QNE A;  4LFB B;  3HKZ E;  5KFU A;  1AN7 A;  4PA4 A;  2EJ7 A;  3HB9 A;  5LMN B;  3JD2 A;  1HW7 A;  4QW9 A;  1KP3 A;  1M7J A;  3STL C;  2W7O A;  1N33 B;  5BMV B;  3P30 A;  3B09 A;  5FPO A;  5KKN B;  4LF9 O;  1L8D A;  1RFY A;  4FM2 A;  1AVM A;  3J80 N;  3HKD B;  2MCT A;  2YC0 A;  4NXM O;  2P5O A;  4F6R B;  1K9M W;  4IR9 A;  3M99 B;  2UXD H;  4LNU A;  5EBM C;  1TVK B;  1B3Q A;  1IOV A;  4JI3 B;  5FD5 A;  2UXB H;  3CEI A;  5IP7 G;  4JYA O;  2IJJ A;  3ETJ A;  3WWI A;  3RYI B;  1AJN A;  1KC7 A;  2ODT X;  2OYQ A;  3AG1 B;  1LUV A;  3RYF A;  3CS5 A;  3RJ0 A;  4NB5 A;  3L70 H;  2ADQ B;  3MWD A;  2QK4 A;  5EBW C;  2J6U A;  3APO A;  2VQF O;  3K5O A;  3TCU A;  2W6P A;  2Q9L A;  2VUG A;  1MSW D;  1VF6 A;  2PGG A;  3RGZ A;  4DRX A;  3L75 H;  2CK3 G;  1WAZ A;  1J5E O;  2NVY A;  3WG7 C;  2HVJ C;  1UFI A;  3CHX A;  3EXA A;  5KA6 A;  1FJG O;  2WWW A;  3PW0 A;  3VOU A;  5KFO A;  1OCO C;  3CSX A;  5J2T A;  2UVW A;  3MHH C;  3ZMV A;  5KA5 A;  2EJ0 A;  2UUB H;  4HQ6 A;  4HNV A;  2W7P A;  3TY9 A;  5KUM A;  1SA0 A;  3A2F A;  3QTC A;  1K92 A;  3LML A;  4APM A;  1GSH A;  4DV6 B;  4RB3 C;  2A0L A;  4GUN A;  4LF4 H;  5C5J A;  1HNZ O;  1VF7 A;  3JAS A;  1YTF D;  2ADP A;  2AW9 A;  4PDM A;  2ZM6 O;  4DUZ H;  1HNW B;  3FDS A;  4IL6 Z;  3R5H A;  3CC2 V;  5LL6 Y;  2H8P C;  3SYO A;  4X65 H;  5JVD B;  2V4R A;  2UXN A;  4J9P A;  3FB8 C;  3FKS G;  1HNX B;  3T54 A;  3H9V A;  3GIP A;  1DLB A;  3QWU A;  4MV3 A;  1P84 F;  2CH7 B;  4MTF A;  1ZQ7 A;  2Z0A A;  2BQR A;  3CB2 A;  4X66 B;  1EFR G;  3JD1 A;  5C3E G;  4X1Y A;  1DGS A;  4RB2 C;  4RNO A;  5LBQ A;  3W7T A;  4I9W A;  4GCZ A;  5CB4 F;  2XAH A;  4FMT A;  3D36 A;  5JH7 A;  4YBZ B;  1AB3 A;  3OE7 G;  4YAK B;  3STZ C;  4ABM A;  2PUS A;  1OCZ C;  1P8L A;  4HAM A;  5J9P C;  2CQY A;  1S68 A;  4ZHQ A;  4YR0 A;  3H3V H;  2HKO A;  4F4Z A;  4X8A A;  5I5W A;  2HHH B;  2OIE A;  4QW8 A;  4HNT A;  2F95 B;  3OR6 C;  5KFL A;  3RVZ A;  1WLE A;  4LF7 O;  4X64 B;  4I7H A;  4M7E A;  5DMX A;  5I5X A;  2ZGI A;  1WA8 A;  1DF5 A;  1RM1 C;  5I5T A;  4JI5 B;  1M6V A;  5DQI A;  3ASN C;  1XOU A;  5L9X A;  3BG5 A;  4C2M A;  4DV7 H;  2E74 B;  3CVZ A;  3E35 A;  5KT3 A;  1IXM A;  4GKK B;  2CW8 A;  4L87 A;  2VUM A;  4I4T A;  2N04 A;  4OGQ B;  5LHG A;  2HIX A;  2BQU A;  1RSO B;  4A3L G;  4FLX A;  2R93 A;  4UCU A;  1I08 A;  4ZOL A;  1F7Y A;  4DR3 H;  3JRW A;  4O4H A;  2JK5 C;  1XMQ B;  2CE4 A;  4DV4 H;  3V4S A;  4YJ2 B;  3Q8Q B;  3UYY A;  4YP3 A;  3ZED A;  1ZUQ A;  2WLL A;  1W0J G;  4DR1 B;  3ABL B;  4Q8F A;  4DR7 O;  2AU0 A;  2OLS A;  2R8H A;  5C8Y A;  1ZTE A;  3HO8 A;  4LF9 H;  1VAR A;  1XL6 A;  3TET A;  4IRC A;  5IYZ A;  4X1I A;  3WB1 A;  4NXM H;  1Y76 A;  3RB3 A;  5L1I A;  4CH6 A;  4IYH A;  5LA6 A;  1H2L A;  2HVS A;  2YU9 A;  1GTO A;  2X5R A;  1ZWI C;  1JQ0 A;  2JA5 G;  2IMW P;  1EKP A;  2KG7 A;  1IYE A;  3JRX A;  5CA0 A;  3MDS A;  3K0G A;  2GLT A;  3QG5 A;  4I50 F;  4UUG A;  2AGP A;  2R86 A;  3T9C A;  4QPJ A;  5CB4 B;  5IJ0 A;  2WTF A;  1FKA O;  4MS2 A;  2XCL A;  5KFW A;  3DC6 A;  5EWG A;  4RB0 A;  4MT8 A;  3QO7 A;  1XNQ B;  1J95 A;  1WN7 A;  5FNV A;  2YS7 A;  2W9A A;  1Y1W A;  3E22 B;  1M56 C;  4AYB A;  2UXC O;  4EQ5 A;  4QE7 A;  3U55 A;  1K5Q A;  1CPY A;  2E75 B;  2RDJ A;  1PL0 A;  4F6E A;  4GZR B;  1YDX A;  5LYJ F;  1N0N A;  2VS0 A;  4IIJ A;  2ZR3 A;  4I5S A;  3SPG A;  2BCC H;  4JUZ A;  2B1I A;  1JIH A;  2QA4 V;  4W4K A;  3ZX6 A;  5IWA H;  2YID A;  2UU9 H;  3KCX A;  2CKZ B;  1K33 A;  4JI6 O;  1Y74 A;  4X88 A;  5KG4 A;  1XEQ A;  2RN9 A;  4BWA A;  1N32 H;  4B3M H;  1RK5 A;  3GTL A;  5CM0 A;  1EZJ A;  4DV2 H;  1M5I A;  3GTG A;  3CE2 A;  3OM3 B;  1SZT A;  5KFC A;  1CP9 A;  3QZ7 A;  2RDC A;  1WCM G;  4C5B A;  3AG4 C;  2HR3 A;  2EIJ B;  3ZHQ A;  4O4I F;  4TM5 A;  2PMZ A;  5CE8 A;  4J9N A;  4MTO A;  3M7M X;  1SES A;  4DR2 O;  4JI2 O;  1W2B U;  3TEK A;  3JZI A;  1Y1V G;  3LNN A;  4O3Q A;  3TJT A;  2I87 A;  2Q2T A;  2V59 A;  4DL4 A;  3P32 A;  4EYI B;  4A3M G;  3M9O B;  4TUY F;  3PW4 A;  3S3X A;  4FFL A;  5KFI A;  4J9O A;  1KKD A;  1NS1 A;  3OUU A;  2BOB C;  3OUZ A;  3CX5 F;  4MTE A;  5JJN B;  5BWU A;  2W57 A;  2P0A A;  1CEZ A;  1SRY A;  2DE0 X;  2Q7H A;  1IBK O;  4QWC A;  3RVY A;  1N33 O;  3M9N B;  1YXB A;  4FU0 A;  1IVS A;  1K4C C;  3PN1 A;  4O4J F;  3T1H O;  1RJQ A;  4OX9 O;  4O82 A;  2PYJ A;  3EYY A;  5L1K A;  4LF5 O;  3LNM B;  4O86 A;  4DYL A;  1BQZ A;  4U6P A;  3V6J A;  3UQ8 A;  1SZX A;  4MV8 A;  3OAA G;  4O7R A;  4PV1 B;  1YCI A;  5L3G A;  5BZB A;  2FE3 A;  3VBB A;  4I9Q A;  3KAL A;  3OEE G;  1QLE C;  4PI0 A;  1NQT A;  3RB4 A;  1EZV H;  4P2Z A;  1R9T A;  4EB6 B;  3OR7 C;  2YS8 A;  4I7Z B;  3J81 W;  1GN4 A;  4ED7 A;  3HXL A;  3J81 N;  3CPW U;  4Q43 A;  2JA7 A;  3J7A K;  1IUR A;  2X7R B;  2CTR A;  4LF8 O;  5LYJ B;  3G6Y A;  1O9H A;  3R65 A;  2DJV A;  5HFL A;  4Y8V B;  2YUA A;  2PTM A;  4QIW A;  4R8U A;  3Q4H A;  3N6R A;  4ETS A;  2OCH A;  2KKW A;  2FK2 A;  3CRQ A;  2P4V A;  4PA9 A;  1NVP B;  2CNU A;  1Y4M A;  4DRF A;  5JCO A;  5JQW A;  2DWE C;  2ZKO A;  1OCC B;  4UFZ A;  4NXM B;  1OBD A;  3CRA A;  5GON A;  4DR7 H;  1OCR C;  1CQI B;  4J11 A;  1ZX3 A;  4XYL B;  1JXL A;  2RGV A;  2M05 A;  3AG2 C;  2C35 B;  2WDT A;  4BW5 A;  5KFP A;  4O4I B;  2QTS A;  3TGU H;  3QO5 A;  4ZIB A;  4JYA B;  3JCZ A;  5ITZ A;  2QWQ B;  3KHH A;  1BGY H;  5LOV A;  3GVM A;  4FBU A;  4DR4 H;  4P9P A;  2Q8V A;  2XAS A;  5KFE A;  3SJA C;  2EZP A;  3RB0 A;  1XNR O;  1UPG A;  2EJ2 A;  4O2A F;  2UVU A;  4A3E G;  2ETN A;  4UCS A;  2XIG A;  3AW8 A;  4TUY B;  4IGG A;  2VQF B;  5F9L A;  3SDL A;  2YZN A;  2QR4 A;  1I7F A;  3VQX A;  2X0S A;  4LH6 A;  5HV6 A;  3ZMU A;  1JPX A;  4YHH H;  3JZ6 A;  5LXT A;  1J5E B;  3G67 A;  4RAI A;  1S03 G;  2JA8 G;  2WAM A;  3DTF A;  4LF6 O;  4R7C A;  1Y67 A;  1FJG B;  2QWN B;  4MW8 A;  3UO2 A;  3SI8 A;  1GH6 A;  2H94 A;  4A93 G;  4WFF A;  3ZRV A;  2ALZ A;  2ZXW C;  1IX9 A;  4GC7 A;  3UCS C;  3A0H Z;  2FML A;  4DV3 O;  4U7N A;  4DK1 A;  5BR8 O;  5C44 G;  2R92 G;  5JQG B;  5DG7 A;  1GM9 A;  4DO2 A;  3T5L A;  1HNZ B;  1EKV A;  3WWH A;  4FFR A;  3ASO C;  4AQY H;  4Q0Y A;  2ZM6 B;  4JV2 A;  4DV0 H;  3K5M A;  1N34 O;  1TUB B;  2EIN C;  2W6Z A;  5EZY A;  4XX0 B;  1A32 A;  3H1K H;  1R3L C;  2E5L H;  4UCR A;  2ZE5 A;  2QB5 A;  3R5X A;  2R9R B;  1KC8 W;  2LFR A;  5KFF A;  1CKN A;  3RV4 A;  4TT3 G;  4JI1 O;  1KB9 F;  2EIK C;  3HKE A;  3T4Z A;  3KHG A;  4R8C A;  5B1A C;  5B66 Z;  1MZE A;  4JI2 H;  1WH2 A;  5CA1 A;  1V54 B;  2XOK G;  3SJQ C;  4TV9 A;  2CAZ C;  2GHY A;  2R85 A;  4O7Z A;  3N2G B;  5FL7 G;  2R82 A;  3IAY A;  3CCV V;  5D1O B;  2QDO A;  4Z2W A;  5TIS Z;  5KFH A;  2F4V O;  4KUM A;  4LFB H;  5LMN H;  3RBD A;  3FYI B;  5DIS C;  1IBK H;  1NZ6 A;  4X20 A;  1N33 H;  3CRM A;  2DOS A;  1QQC A;  2GTS A;  1U96 A;  2I80 A;  4FFB B;  3TXS A;  2ZE6 A;  3A0R A;  4OX9 H;  1F4M A;  2ZDQ A;  5KLV H;  4LF7 B;  1FXK B;  4O7S A;  4LWS B;  5JVL A;  3G6V A;  3GV8 B;  3N8D A;  1SF9 A;  2Q7E A;  3OTO O;  1VQP V;  4LFA O;  4TV8 F;  1K5S A;  1MZF A;  2JA6 A;  2JJ2 G;  5F2V O;  3MR6 A;  2NVX A;  2I8C A;  2CZG A;  4JI3 H;  3CME V;  5KFV A;  4FPP A;  3FMA A;  4J0M A;  4QWE A;  2W6O A;  1I50 A;  1CKO A;  2FLP A;  3WO0 A;  2JA5 A;  3GDE A;  3ABU A;  5KG7 A;  1PPJ H;  4DL7 A;  4JZG A;  4JI0 O;  3R66 A;  1O9G A;  4JI4 O;  4Q44 A;  5FD6 A;  4PDL A;  5JWP A;  4ASU G;  1M93 A;  3AK2 A;  1ET0 A;  2P90 A;  2HP8 A;  2QTO A;  4EKW A;  4F4X A;  3MJF A;  1SQX H;  3GTK A;  4O2B A;  3MR5 A;  5KX5 F;  1VQ7 V;  2ZDI A;  3HOX G;  3ICX A;  2X6A A;  1TWG A;  3N2K B;  4NVP A;  1URF A;  3FYE B;  5KT6 A;  4QNH B;  4CE5 A;  1I94 B;  4IR1 A;  1N36 O;  1A3G A;  3SR2 C;  3ABM B;  4BAY A;  4DV6 H;  1ENV A;  1SQF A;  2JS3 A;  3ETH A;  3JD4 A;  5LGN A;  1EN4 A;  2W71 A;  2DYS C;  3Q8R B;  1HNW H;  5GW7 A;  1A9X A;  4BXX G;  5H5N A;  1S5L Z;  1TWC A;  4DL5 A;  4DUY O;  2AQ4 A;  4B3R O;  1MG1 A;  5KHI A;  2W6N A;  3LDD A;  1Y1W G;  3ORR A;  1KD1 W;  3T9E A;  4RZQ A;  4J42 A;  4NR1 A;  3CMA V;  4JI8 O;  1I7N A;  4J9S A;  1D5A A;  3H4B A;  2YIB D;  3E8B A;  2IJI A;  2ASD A;  1FAF A;  3RUP A;  4X66 H;  4TVI A;  3HOY G;  2C2D A;  2WPD G;  2GQR A;  5HFM A;  4HNA B;  5CBG A;  2UXC B;  2JEI A;  3B40 A;  2M6Y A;  2JGD B;  3JAM W;  3JCU Z;  1OHH G;  3CCU V;  4DXW A;  4NXN O;  4FZ0 A;  1BHB A;  3HKB B;  3N43 B;  1Y6X A;  3K3W A;  4J41 A;  5BMV A;  1Q81 W;  4EBE A;  2R8I A;  5L3D A;  2XHB A;  1B33 N;  4PZ6 A;  4DR5 O;  4ZI7 A;  4JYY A;  4FE2 A;  3K5I A;  1R3J C;  3GIK A;  1TVK A;  2DQ3 A;  4JI6 B;  1WR2 A;  5IYB G;  3T99 A;  4BIZ A;  3P3N A;  2JJ1 G;  1M1K W;  2R9I A;  2F1M A;  2GSM B;  2JS5 A;  3RYI A;  1Z2O X;  2HHH H;  2ZNI A;  1VQ4 V;  2SCU B;  4X64 H;  3BCC H;  3U0Z A;  3DC5 A;  3TY8 A;  3L4J A;  4E4T A;  5IYC O;  1YEW A;  4DR2 B;  4JI5 H;  4JI2 B;  4ED2 A;  4P30 A;  2OIG A;  2UUC O;  2R7N A;  1K3E A;  4UCO A;  1RPR A;  4FJC C;  3CC4 V;  1JDB B;  2L35 A;  2CTP A;  3GTQ A;  1QR9 A;  5KX5 B;  1AP6 A;  5K3W A;  1IBL O;  3UZO A;  2RMK B;  4MTD A;  3G71 V;  3H1I H;  1RYR A;  3ABT A;  2UVV A;  3GJX B;  3IG0 A;  2PF4 E;  4UB8 Z;  3WG7 B;  2HHF B;  1TUE B;  2NR5 A;  3CCL V;  4DV1 O;  1IBK B;  2YRX A;  1XMQ H;  2RDI A;  2VQE O;  3E86 A;  2WA3 A;  4X1K B;  4XZ3 B;  5EWE A;  4ED6 A;  2COG A;  3GV5 B;  4RU9 A;  2Q4P A;  1OCO B;  3T1H B;  3E8G A;  4OX9 B;  2ATK C;  3FFQ A;  2XC9 A;  4DR1 H;  4PDB A;  4LF5 B;  2HG5 C;  3EVK A;  3HOU G;  4TSF G;  2FLL A;  3QZ8 A;  1ROP A;  2YXH A;  2HDK A;  1OV9 A;  4O4L A;  2ODM A;  3HKZ A;  4LC1 A;  4J9M A;  2RF4 A;  2AGA A;  1EN6 A;  2XTA A;  4BBS G;  4DQN A;  2YIB A;  1I3Q A;  4FLU A;  2JDI G;  2JRI A;  2YXY A;  4GX1 A;  1XQ8 A;  2CH7 A;  3K58 A;  5DQG A;  2JA7 G;  4U7O A;  2XND G;  3RYH B;  4QJF B;  2EIL B;  1GN3 A;  4MVZ A;  4G28 B;  5JJE B;  1PD3 A;  2O03 A;  3JAT B;  5J2T F;  1H38 A;  3K0D A;  1DIK A;  4LF8 B;  2DWC A;  3K59 A;  2X6B A;  2M7W A;  2XAG A;  5D8D A;  3FKI A;  2OTL V;  2VRZ A;  3UT5 B;  1XNQ H;  3W1G A;  4KXR A;  4UB6 Z;  3CCQ V;  2DPI A;  1UC9 A;  2YS6 A;  3JAK B;  4PA7 A;  1Q90 D;  2E76 B;  1OCZ B;  1R6K A;  1VQ8 V;  3LSU A;  4ED8 A;  1VQM V;  1JVM A;  3C90 A;  1GN6 A;  2R8J A;  3JAR B;  3ABK C;  5CBH A;  4YR3 A;  2HG8 A;  3T9A A;  1MSD A;  1A0G A;  2R92 A;  3L9D A;  2V1D A;  3PVX A;  2J9G A;  2ZT9 B;  4PEL A;  4ECV A;  2EIL C;  3VQW A;  2NU6 B;  2Q7D A;  3KHR A;  5B1N A;  1S9F A;  3KAJ A;  2HJW A;  3G6X A;  3I12 A;  5I5Y A;  3T7A A;  3J7A U;  5JH7 F;  1YIJ V;  4PWQ A;  3F7V C;  1IXB A;  1RM1 B;  1XNR B;  3ASN B;  3T2M A;  3IJ4 A;  1Q7Y W;  1Z2N X;  1RSO A;  4B3T O;  3L71 H;  4DUY H;  1K7D A;  1ZAU A;  1AJP A;  3ETD A;  4EYH B;  4JAV A;  5BWX A;  4NTX A;  5BWR A;  4YJ2 A;  3DTG A;  2B9Z A;  4H13 B;  3W7W A;  3UFX B;  4LF6 B;  3B8M A;  2Z5U A;  3RGX A;  2ZCE A;  3TW6 A;  3JYC A;  5IT9 W;  3ZHR A;  3BQ0 A;  2DMX A;  4Q4D A;  4DV3 B;  1B6S A;  1ZL8 B;  4X62 O;  3GIJ A;  1F4N A;  5BR8 B;  1M0W A;  5L1J A;  1Q6I A;  4BIO A;  4NTY A;  2B63 G;  3ZS8 C;  1PL4 A;  3SJC C;  3T9D A;  2PYL A;  1IZ3 A;  1VP7 A;  2Y0I A;  2YI9 A;  2HVR A;  5KMG B;  2WB1 E;  4BBR G;  1I2L A;  4B3S O;  1JX9 A;  3UKM A;  4K0K O;  4DRX B;  1N34 B;  2ARH A;  3KHL A;  4I4T F;  3AK3 A;  3I55 V;  1L0N H;  4GKJ B;  2W6Q A;  2CTQ A;  1GRJ A;  3OUS A;  1FVI A;  4JI1 B;  3LQS A;  1M4U A;  3WNZ A;  5CB4 A;  4JI7 O;  3CCS V;  2JVD A;  1YZB A;  3PO3 G;  4J9Z B;  4BIU A;  1N56 A;  3E89 A;  4TWK A;  1NT2 B;  2ZD9 A;  3E22 A;  3O65 A;  4CS3 A;  1IOW A;  4ED0 A;  1D5N A;  2V9W A;  2X6C A;  1VQN V;  5C8Y F;  4FGR A;  1GKF A;  4A3G G;  2W0X A;  1I2K A;  1M56 B;  4CH5 A;  1IBL H;  1OZ0 A;  3W5O A;  4F50 A;  2F4V B;  2ZQM A;  4CKC A;  2Q2U A;  4GLW A;  4R6Z A;  5EIB C;  2W0F C;  5J2U F;  1G6U A;  2YEV B;  2DQ0 A;  4DV1 H;  4BR6 A;  2O57 A;  1RPO A;  1VF6 C;  1C3O A;  4WF9 V;  3RB6 A;  1M0T A;  4EG0 A;  2W9B B;  4EFE A;  2JA6 G;  1BMF G;  3SYA A;  1VQL V;  4YAJ B;  1NVP D;  3OMN B;  1I94 O;  4JV5 O;  4F4L A;  4GC6 A;  4WFE A;  1SQV H;  3OTO B;  3KXY T;  1T3N A;  4LFA B;  2IBZ H;  4FFN A;  3U11 A;  4KP4 A;  2Y48 A;  5KFY A;  2XAJ A;  1Q82 W;  3NXS A;  1I7L A;  3ZHT A;  4U3F H;  1BQ0 A;  1S77 D;  4JYA H;  2BTQ B;  1GM7 A;  2P4K A;  4PDR A;  3JAL A;  3LUT B;  4HYO A;  2L6L A;  4IHJ A;  3AG4 B;  4GYC B;  2DYR C;  4JI0 B;  4IIJ F;  4JI4 B;  4MVR A;  3WB2 A;  3ZMS A;  1FD9 A;  3OD4 A;  2QSA A;  4KFM A;  4MW3 A;  4DL3 A;  4ECS A;  4CC6 A;  1H2S B;  1X59 A;  3E8F A;  1KT8 A;  5AG2 A;  5EC2 C;  4D7T A;  2VQF H;  4WBN A;  4F4Y A;  3G80 A;  3TK1 A;  2PI4 A;  4FFK A;  1J5E H;  5DG8 A;  1WA8 B;  2GQS A;  4EEY A;  2Q73 A;  4XBF A;  4XDJ A;  3OT7 A;  4YIP A;  1FJG H;  3H0G G;  2WAQ E;  1WRV A;  1OJH A;  4RWU A;  1A48 A;  4MAM A;  5F9N A;  3NR7 A;  2BSK B;  3HKC B;  1RJP A;  3BEH A;  4B7E A;  3N40 P;  4D7S A;  3D36 C;  1N36 B;  1EN5 A;  3TQ1 A;  3CCR V;  4RZR A;  1HNZ H;  5LMU O;  2QJ1 A;  1R3I C;  5FLX W;  4PA6 A;  2ZM6 H;  1V51 A;  3RGB A;  4R50 A;  3TQT A;  2WLI A;  1P4R A;  4QWB A;  4A3D G;  4EB6 A;  2Y69 C;  3OGI B;  1T94 A;  2R7Z A;  2WLL B;  1SET A;  4DUY B;  1E4F T;  4B3R B;  1XIL A;  3CRC A;  1IDS A;  3BHP A;  1S0V A;  3GWO A;  1QLE B;  1Q5O A;  4JI8 B;  4C5C A;  2FKX A;  4TQR A;  5C8Y B;  2R6F A;  2CW7 A;  3OHA A;  3MWE A;  5LYJ A;  3R23 A;  4G2K A;  4JGS A;  5D5Q A;  4MA5 A;  1NKD A;  4CKB A;  1E1Q G;  1H8E G;  2PI5 A;  1GSA A;  3ZHV A;  5FJ8 G;  2DIK A;  4NXN B;  1FFT B;  5J2U B;  4R7R A;  4ED1 A;  3CYO A;  4PZ7 A;  4EGJ A;  1AI6 A;  2COJ A;  4LBE C;  4GX0 A;  4DR5 B;  1ZET A;  3DXR B;  2J6T A;  4ECU A;  3GTJ A;  1JKJ B;  3RWR D;  4DV5 O;  3LDC A;  1XMO O;  1HR0 O;  1Z5W A;  5L3C A;  5LGU A;  1WB7 A;  4YJ3 A;  1JR9 A;  1CE8 A;  5IYD G;  5KFG A;  2CGO A;  4MV4 A;  1OCR B;  2W6M A;  4I50 B;  3RIZ A;  2GPW A;  3AG2 B;  4QE9 A;  4LF7 H;  4M9U A;  2WLH A;  2XAQ A;  1R6N A;  3JSN A;  4I0X B;  2FPP B;  3Q2O A;  1VQ6 V;  1EZ1 A;  4ICG A;  2PBZ A;  2BR0 A;  4J80 A;  3ZRW B;  4DK0 A;  1RP3 B;  4QIW F;  2UVR A;  1SQP H;  1NU1 H;  1PP9 H;  2UUC B;  4YB8 B;  1FFX A;  5KG5 A;  1M90 W;  4JI7 H;  3CCJ V;  1W96 A;  2R8K A;  1VAJ A;  1BS3 A;  1KU9 A;  2FL4 A;  2LQT A;  1IBL B;  3H1L H;  2NLJ C;  2P7T C;  3GIQ A;  2KSD A;  5CBF A;  5K1X A;  4FLY A;  3FB7 C;  2LO1 A;  1FYJ A;  3M4I A;  4QIW E;  3PR5 B;  4A3J G;  3PO2 G;  4DV1 B;  1PNM A;  4A2A A;  3TY5 A;  2VQE B;  3GB8 B;  1EKF A;  1YJN V;  3OGC C;  1S5H C;  5JQG A;  4HBN A;  2ZXW B;  3T1C A;  5H6Q A;  2D3O W;  3HT5 A;  3LWB A;  2EIM C;  5CAE B;  3MR2 A;  2FB5 A;  3ZRX A;  1TUB A;  3PJS K;  1VF5 B;  1QBZ A;  2LGQ A;  4FVM A;  1MZB A;  1GSO A;  1QHT A;  3ASO B;  1QCE A;  2V7Q G;  2R72 A;  3RAQ A;  3TIG A;  1I94 H;  2YIA A;  1W59 A;  3MR3 A;  2EIN B;  5CN0 A;  5LXT F;  5B1B C;  2HLD G;  4IZO A;  4XYM B;  2HFE C;  1AR1 B;  4KHP O;  3OSP A;  4MTX A;  2CGN A;  4JPR A;  4JXU A;  4NTW A;  2PZS A;  3QVN A;  4O7Y A;  3FKI G;  1JCH A;  3MFI A;  4MV1 A;  2EIK B;  3BA9 A;  3X2Q C;  4FZ1 A;  3G6E V;  4RQF A;  2OCC C;  2NUA B;  2WLN A;  1FKA H;  1IBM O;  5T14 A;  5LP6 A;  2R8G A;  5B1A B;  5D1O A;  4BWS C;  2Q67 A;  1SQG A;  1JJ2 U;  1S97 A;  2Q5Z A;  3VQV A;  1KEE A;  2D2C B;  4UCT A;  3N6X A;  1D2D A;  2WA4 A;  2FJZ A;  2UXC H;  4O4J B;  4LSX A;  5EZY F;  2Q69 A;  4Z1V A;  2Y4U A;  3EPI A;  3ZN1 A;  4ZKI A;  1SS3 A;  4FFB A;  4U7C A;  5KFQ A;  2R9A A;  2WSS G;  4P9O A;  3V6K A;  1FXK A;  2IU3 A;  4J7J A;  4LWS A;  5KG1 A;  2F93 B;  5BPF A;  2DAB A;  2YWV A;  1US6 A;  1PM9 A;  1L1F A;  1Z2P X;  2OH2 A;  2P06 A;  1BHA A;  2B63 A;  4YY3 O;  5A2Q W;  2XCA A;  4JI6 H;  3RV3 A;  4GKJ O;  5LMU H;  5A2Q N;  3SE7 A;  1KP2 A;  5CA1 F;  4IRK A;  1Z2G A;  1WNS A;  4H44 B;  5FPR A;  4TV9 F;  5DQH A;  1NH2 D;  1XBL A;  4TOI A;  3RT3 C;  4JYB A;  4B3T B;  5B5E Z;  1P49 A;  1PK8 A;  1XUQ A;  4O83 A;  3SYP A;  4DR2 H;  3L4K A;  4BW9 A;  4QWA A;  1BE3 H;  4J10 A;  3PFF A;  4U3J B;  3ZHU A;  2A1H A;  4CMF A;  1I1L A;  4I55 F;  3G6B A;  1S0N A;  1COW G;  1GN2 A;  4KL1 A;  3N2K A;  1XDN A;  4FFO A;  3K08 A;  2C00 A;  3M9M B;  3FB5 C;  4TQD A;  3RW0 A;  5KS8 A;  1R1B A;  3CQZ A;  3ETG A;  4X62 B;  4MV9 A;  2V4D A;  2W70 A;  2CNV A;  5KAI Z;  4DR6 O;  1R6T A;  1YSC A;  4B3S B;  2WYO A;  2WLM A;  1XHZ A;  1KJ8 A;  3D3I A;  5L3E A;  4K0K B;  2K1E A;  4JV0 A;  3T1H H;  4PBC A;  4MVO A;  3G4S V;  1QR8 A;  5LXT B;  3I5D A;  5A9G A;  4LF5 H;  5KFX A;  3OHB A;  2VPS A;  1QNM A;  3VQY A;  4O2A B;  4G27 B;  3MAQ A;  1PX2 A;  2Y4R A;  2P6J A;  3MD0 A;  5JCO C;  3U10 A;  2DYS B;  2GUZ A;  2UXD O;  3N42 B;  3K9A A;  4JI7 B;  1JA8 A;  1X4T A;  1KTA A;  2CNQ A;  2NU7 B;  4O2B F;  3RYC B;  2EX3 A;  3FAV B;  4FM9 A;  2YZM A;  1ARO P;  2UXB O;  2YI8 A;  2RCV A;  1R3K C;  1N4C A;  2JGD A;  1H2M A;  4MVU A;  5KHJ A;  3OTF A;  4CKE A;  3OSN A;  3HKB A;  4FK5 C;  4PZ8 A;  5EZY B;  4QSH A;  2QYZ A;  1G4Y B;  1BXR A;  4MVM A;  4LF8 H;  4XDK A;  5I60 A;  2N74 A;  3H40 A;  1Z5V A;  3JD0 A;  1JFF B;  4FS1 A;  4ECZ A;  2CUG A;  4OPA A;  1K1Q A;  4WCE V;  3DSQ A;  5KFM A;  5H9C A;  2FPG B;  3CRR A;  3NUA A;  4O7L A;  3JAW B;  4AI8 A;  4A3F G;  5EYP B;  2FLN A;  1XHX A;  4ME6 A;  3H0G A;  4CS2 A;  4JV5 B;  2E2I A;  3ZIA G;  5CA1 B;  2YXL A;  4JAA A;  2UXX A;  1KBH A;  2UUB O;  1MMM A;  1Q6H A;  5CMU A;  3UO3 A;  4HN2 A;  2Y0S E;  3A8T A;  4N21 A;  3Q1K A;  2LW1 A;  3OEH G;  1MAB G;  2ASJ A;  4PDV A;  1K8A W;  4LF4 O;  5C1P A;  5KFK A;  3BVO A;  2A7W A;  1E4E B;  4DUZ O;  5IY5 B;  4KHP H;  4FM0 A;  4C5A A;  4AIL C;  5IP9 G;  4RUE A;  4RQE A;  1GYF A;  1XNR H;  4X65 O;  4I55 B;  5KX5 A;  2GPS A;  2HGW A;  2NU9 B;  1VMG A;  4ZI7 F;  4K35 A;  3WO1 A;  5C93 A;  3R5F A;  3W7U A;  4MA0 A;  3JAM N;  4LF6 H;  4QGP A;  5KT4 A;  3RN4 A;  2V58 A;  3HKD A;  1NBM G;  5C4X G;  2XAF A;  1VQ9 V;  3T9F A;  4MVQ A;  4F6R A;  1I5X A;  1VQO V;  3SYC A;  1NTM H;  3KG2 A;  4O7N A;  1G2W A;  4DV3 H;  3PW7 A;  1UNN C;  4TV8 B;  5BR8 H;  1CQJ B;  4UV9 A;  5H2F Z;  3RF2 A;  2A06 H;  3C3T A;  2IH3 C;  5LMU B;  3L73 H;  1RYS A;  2Z04 A;  2R7Z G;  3VA7 A;  5IJ9 B;  3K06 A;  2E2H A;  3IFX A;  3R9R A;  1N34 H;  1TAE A;  1XI1 A;  1WP7 A;  3WU2 Z;  3EFF K;  5BYA A;  2Z3Y A;  4O3P A;  1XDC A;  3NC0 B;  4D6T H;  1WP8 A;  5IY5 C;  3CC7 V;  2AGQ A;  3PW5 A;  2DAA A;  4GKJ H;  3B2E E;  3JAT A;  2K9P A;  3W7X A;  5LHH A;  3T4D A;  3B8N A;  4JI1 H;  1VEW A;  2W6J G;  3SPH A;  3ZRS A;  5EBL C;  4YQW A;  4HYK A;  3ETE A;  3E5N A;  3WWJ A;  3V6H A;  1BZK A;  3GID A;  2UUA O;  2HJD A;  4DV7 O;  2NN4 A;  4E2L A;  3T5K A;  2IW5 A;  3JAK A;  2LP7 A;  3OMA B;  5B3S B;  3LP8 A;  4O4L F;  4HZ3 A;  1F23 A;  5IYB O;  2EJR A;  3ZN0 A;  1PNL A;  2A3Q A;  3CJH B;  4N23 A;  4L8J A;  4CMD A;  4EBD A;  2F4V H;  4LMY A;  4DV5 B;  2RQ6 A;  3VPD A;  3JAR A;  1XMO B;  2R7L A;  2C22 A;  1HR0 B;  4DV4 O;  5I5S A;  2KQX A;  1BJT A;  4WFG A;  3B4S A;  2ZIO A;  5JVD A;  3HOZ G;  5E25 A;  4GX5 A;  3VPB A;  1EBO A;  1P7G A;  5BYB A;  3TIN A;  1K4D C;  2YDE A;  2ZDI C;  3ABK B;  1FXH A;  3JD3 A;  2HIV A;  2NU8 B;  1VBG A;  4H33 A;  4CBC A;  1C30 A;  2ZR2 A;  3Q8S B;  5I47 A;  3J80 W;  2IH1 C;  1MOF A;  3OTO H;  4LFA H;  3H20 A;  2ZIM A;  3DTU B;  2YL2 A;  4K8X A;  4ZI7 B;  4CZZ A;  4DIM A;  2XUM A;  3BAB A;  4CC5 A;  1KJQ A;  2JGU A;  2H3O A;  4FBT A;  5HBR B;  4J9Q A;  3KTM A;  3IGA C;  4UV8 A;  5DGH A;  4JI0 H;  4JI4 H;  4LFC O;  5B3S C;  1N48 A;  2QKS A;  2DPJ A;  2X0L A;  2MK3 A;  2ZNJ A;  4NZO A;  4EBC A;  1AI4 A;  1DV1 A;  1ZL8 A;  4JAS A;  3KAK A;  4MVS A;  1S5J A;  3GTP A;  2RJZ A;  3AG3 C;  5KMG A;  4O3S A;  1P7B A;  3GIL A;  1QVF U;  2PN1 A;  1I0H A;  5DN6 G;  3OMI B;  5KFA A;  2XGP A;  2EJ3 A;  2W9C B;  3DF7 A;  1FPO A;  3AG7 A;  2FP4 B;  1N36 H;  5JUM A;  3G8D A;  5IWA O;  4B7K A;  2UU9 O;  4KHP B;  4YJ2 F;  3O9O A;  2AZ0 A;  4ED3 A;  1EUC B;  5DGI A;  4WHX A;  1QU7 A;  4Q4C A;  5KFS A;  4B08 A;  2Q0O C;  4CHI A;  2IJH A;  3VNN A;  2EZO A;  1N32 O;  4B3M O;  3BAC A;  4B3R H;  2C2A A;  4DV2 O;  2Q6A A;  1LR1 A;  4CH3 A;  4LNU B;  4JI8 H;  1CXZ B;  1IBM B;  2BQ3 A;  3ZMT A;  4ZHQ F;  3RFR A;  5L3B A;  4O4L B;  4FLV A;  5KT5 A;  3AG1 C;  4A5U B;  2QE7 G;  3LUL A;  3N44 B;  2V4Q A;  2VA3 A;  2AHY A;  1Y66 A;  3HB3 B;  2QWP B;  3IC9 A;  1N0J A;  1KUQ A;  5BWW A;  4X9Q A;  1AI7 A;  1XRE A;  1DV2 A;  4TQF A;  2YEV A;  5KFZ A;  4NXN H;  4HNU A;  3RYF B;  5IT9 N;  2ZE8 A;  4C7U A;  1U97 A;  2BTO A;  2LW7 A;  2W9B A;  4J7Z A;  4DW0 A;  4DR5 H;  1DTO A;  4EFB A;  5DM6 V;  3OUF A;  4ECY A;  3GTO A;  2FPI B;  4YY3 B;  3K3V A;  5DLF A;  3SPJ A;  5DAA A;  2YCH A;  4YIO A;  3KKY A;  5H6R A;  3HPL C;  2BTQ A;  4ZOL F;  4OXS A;  3U9T A;  1H2N A;  1UJW B;  3H1J H;  5J2T B;  4UXN A;  4O4H F;  3W1B A;  1ULZ A;  4O3O A;  1S0M A;  2WB1 A;  1GO3 F;  1SA0 B;  1I5Y A;  2IM9 A;  5I5V A;  3V4Z A;  4XDL A;  1EHI A;  3JAS B;  2UUC H;  2DYR B;  3D3Q A;  3T1Y B;  4FFP A;  4NYK A;  1B06 A;  3AX6 A;  1AR4 A;  2DN9 A;  4M0J A;  5KFR A;  5DGB A;  1S72 V;  2ZE7 A;  5IYZ F;  2HGX A;  5FR9 A;  2UUA H;  4RCN A;  3FX7 A;  5C1O A;  1GO3 E;  2W8K A;  2FKL A;  1Q6U A;  5LA6 F;  3T5H A;  1T5E A;  2F43 G;  5EK0 A;  2BSK A;  3HKC A;  3L72 H;  1SER A;  4DR6 B;  3VMM A;  2VQE H;  2XT9 A;  1CS0 A;  2ZJT A;  5CA0 F;  4X1Y B;  1X9N A;  3RBE A;  5BY1 A;  1B04 A;  2LJ2 A;  3ZMZ A;  3KRE A;  1JLL B;  4E4E A;  2N05 A;  3THO A;  4BY1 G;  3GIM A;  2DLN A;  4IHJ F;  1O75 A;  3TII A;  3FB6 C;  2C28 A;  1NTZ H;  4BY7 G;  3F5T A;  2AZ2 A;  5LL6 b;  5JH7 B;  4FLT A;  1SKV A;  1A0I A;  2G38 A;  5IDJ A;  4NZM A;  1EUD B;  5DG9 A;  5FNV F;  1EYZ A;  2ZDH A;  2UXD B;  4JV1 A;  3N27 A;  1UC8 A;  3QFF A;  4WBN F;  1KJI A;  3GV7 B;  2Y69 B;  2IJK A;  5E1A C;  4ZHQ B;  4IAJ A;  2OWO A;  3EPG A;  4RNN A;  2UXB B;  2YIC A;  3F7Y C;  5KFB A;  3I4M G;  1YJW V;  2QM8 A;  3NBZ B;  1GM8 A;  3NBY B;  5J2U A;  2ILM A;  1DF4 A;  5BWT A;  4DR4 O;  1B6Q A;  1KJ9 A;  5H80 A;  5DLG A;  4AYB E;  3MFH A;  2HJF C;  3JZF A;  4W4L A;  4LFC H;  1XL4 A;  3E8H A;  4DLK A;  4PA3 A;  4ECR A;  3SPI A;  3DXR A;  3VOT A;  2JIZ G;  2QWR B;  4MSW C;  3ZCC A;  4ECX A;  3RBZ A;  4YHH O;  1JOY A;  1K73 W;  3BQ2 A;  4K3A A;  1VIB A;  2JEF A;  4JTC B;  2QGN A;  4I4T B;  1NTK H;  2QM4 A;  3GB7 C;  1LNQ A;  4FIP C;  2FK3 A;  3H1H H;  4ZOL B;  4JAU A;  3RR5 A;  4I50 A;  2ATL A;  2UUB B;  4Q6G A;  4O4H B;  5KG2 A;  3ABL C;  3PR4 A;  3PZP A;  1LUW A;  1R73 A;  1VKZ A;  1WJZ A;  4QPK A;  1L0L H;  4I0X A;  5FLX N;  2HVK C;  1YTF B;  1QVG U;  2YZL A;  3CSW A;  1K34 A;  4O81 A;  3ZRW A;  4LF4 B;  1EM1 A;  1TWF A;  2WAQ A;  2R84 A;  2VQD A;  3K5N A;  4AQY O;  2PMZ E;  5I5U A;  5KT7 A;  4MV7 A;  1BT8 A;  4DUZ B;  1KQS U;  5FLM G;  4DV0 O;  2Q7G A;  1KUT A;  1GAX A;  3UM7 A;  4LSA A;  5JJJ B;  4X65 B;  2E5L O;  4AHC A;  5DED A;  5IYZ B;  4B3T H;  4X1I B;  3SYQ A;  4QWD A;  2RNB A;  2R70 A;  4UVB A;  1WSC A;  1Y76 B;  4TQS A;  3LSS A;  5LA6 B;  1AP5 A;  1ZHS A;  3BQ1 A;  3BRC A;  5LGT A;  3N41 B;  2DZD A;  2BOC C;  2VR1 A;  4YJ3 F;  2KG7 B;  1BL8 A;  1F51 A;  5CA0 B;  2FMA A;  4WFH A;  1BSM A;  1NJI W;  4UVA A;  5KT2 A;  3BAA A;  4IWX A;  3JAL B;  2YZG A;  4IHJ B;  3H01 A;  1HP8 A;  3BPZ A;  5IJ0 B;  3E83 A;  3K3P A;  4X62 H;  3ZBH A;  3CEB A;  3F8N A;  3LDE A;  1Q8I A;  1ZHQ A;  2EUL A;  2EIM B;  1OBG A;  4O4I A;  5L3F A;  4B3S H;  5FNV B;  3W7S A;  2P67 A;  4LFB O;  4K0K H;  4NLG A;  3A0B Z;  4WBN B;  5LMN O;  1YHQ V;  4O7T A;  2FK1 A;  3OFN G;  3OW2 U;  4NKG B;  5KFD A;  1YI2 V;  2QKC A;  2A79 B;  1HDJ A;  3GQC A;  4IIJ B;  4NYE A;  1VQ5 V;  3VPC A;  4O7W A;  5B1B B;  4O84 A;  1I6U A;  4TUY A;  3BA8 A;  3WB0 A;  4MTG A;  5HNE A;  1AR5 A;  2QWO B;  4DAA A;  3BJY A;  5JQG F;  4E6N A;  3MHS C;  2UUA B;  1Y74 B;  4O3N A;  4JI3 O;  4DV7 B;  1YJ9 V;  4ZQI A;  3X2Q B;  2COI A;  3GTM A;  2EIJ C;  2OCC B;  3CD6 V;  5GON F;  4G3I A;  4A2B A;  4O4J A;  1S0O A;  3IN5 A;  4UUJ C;  2OTJ V;  1SCU B;  2PY5 A;  3TW7 A;  4J7K A;  2WLI B;  1CKM A;  3SGI A;  1AI5 A;  1KJJ A;  1ORQ C;  5IYD O;  3I4N G;  2WLJ A;  3E2E A;  3K57 A;  1THZ A;  4DR3 B;  1K1S A;  5LOV F;  2R7K A;  4DV4 B;  2FYU H;  4DW1 A;  4RB1 A;  2YRW A;  2VWJ A;  5KUK A;  1S76 D;  1YIT V;  4JV5 H;  2HVQ A;  3GWK C;  2JEU A;  5LP6 F;  3HOV G;  4LF9 B;  2CTW A;  4F4W A;  2GTA A;  2ASL A;  4HR7 A;  3QO8 A;  4RO2 A;  5LHI A;  4X89 A;  3HOW G;  2IBK A;  4Q20 A;  4DV6 O;  4Z1M G;  4A3K G;  4RAZ A;  3NGD A;  4U3J A;  4WD3 A;  2GBO A;  3I56 V;  1HNW O;  3N2G A;  4YJ3 B;  4LFC B;  2QF7 A;  4GLX A;  3K5H A;  4RAY A;  1BCC H;  2Q68 A;  3AEI A;  3LSQ A;  1HNX O;  3SNO A;  2W6I G;  2IU0 A;  1H8H G;  2P22 C;  4JTD B;  5KG3 A;  2F66 C;  5EC1 C;  1IYD A;  2XD4 A;  2B1G A;  1FS0 G;  1ZSP A;  5KAF Z;  4X66 O;  5KHH A;  3CXH F;  4WFA V;  4JTA B;  5DEC A;  1S3J A;  1NR7 A;  2R7M A;  2JEJ A;  2EIY A;  4UCV A;  1BNC A;  2AHZ A;  1FFX B;  3Q8P B;  4DL6 A;  2IA6 A;  4H37 A;  1E1R G;  1RJR A;  4DL2 A;  1TWA A;  1V9P A;  4RUF A;  1V4Y A;  4O2A A;  3DGE A;  4H0L B;  3ZJZ A;  5IWA B;  3QF7 A;  4R8U B;  1OCC C;  4PD4 F;  3Q4H B;  2GDS A;  3IC7 A;  4FLW A;  2UU9 B;  2A9H A;  1QLN A;  2IP4 A;  3FD9 A;  1Y14 B;  3T5J A;  1ZLZ A;  3RYC A;  5K2M A;  3FAV A;  4A3C G;  3U54 A;  4O7V A;  1MA1 A;  4B3M B;  1N32 B;  5CA3 A;  2R87 A;  1WPB A;  3C0F B;  1SFO A;  1HWY A;  4A3I G;  3B77 A;  5GON B;  4DV2 B;  2HHH O;  1G1X B;  2V5A A;  2YSU B;  3K04 A;  5DGA A;  3SPC A;  1T36 A;  4X64 O;  3T1Y O;  4ECQ A;  4PJ0 Z;  2CFM A;  3UZB A;  1JFF A;  3K03 A;  1AUV A;  2FB9 A;  4OPH A;  2VWK A;  1L2Z A;  4JI5 O;  5ITZ B;  5KG6 A;  4FS2 A;  5LOV B;  4NZN A;  3KYH C;  1PKX A;  3APQ A;  4GX2 A;  4J9L A;  4GKK O;  3HBL A;  3JAW A;  2AGO A;  1DAA A;  3GII A;  5EYP A;  4IYI A;  4Q8E A;  3BY6 A;  5KFT A;  3CWB H;  3QQM A;  4DV5 H;  1JX4 A;  3G8C A;  1XMO H;  3CCM V;  1XMQ O;  5LP6 B;  3S24 A;  4JYC A;  3SJB C;  1KBL A;  1HR0 H;  3C3S A;  2QM7 A;  1I1K A;  1M57 B;  4CS4 A;  3RAX A;  4PI2 A;  1SQB H;  2F23 A;  4DR1 O;  4CH4 A;  3MWM A;  4ZBM A;  1E4E A;  1S10 A;  3K5L A;  2JEG A;  2LGW A;  2HEP A;  5B1O A;  1I1M A;  4I55 A;  4WFB V;  2XCP A;  2ITD C;  4HNA A;  1VS0 A;  3KZI Z;  1GK9 A;  3AYH B;  4K6N A;  2YW2 A;  5EWF A;  1N8R W;  2KB1 A;  4IRD A;  2KSW A;  2VUM G;  2ZDG A;  1G8M A;  1BGW A;  4Q45 A;  2Z02 A;  2R93 G;  3F5W C;  1CKN B;  3K9S A;  3CXC U;  5EOY A;  1V54 C;  1MNG A;  4MV6 A;  3HKE B;  3ETQ A;  4TV8 A;  2FTK A;  5KHK A;  3CCE V;  1B6R A;  1H2K A;  4YXW G;  2XGQ A;  5LP6 C;  1K83 A;  3U0G A;  1PNK A;  3ORQ A;  1XNQ O;  1KYO F;  5IJ9 A;  3H4D A;  3ZHS A;  1K97 A;  1M57 C;  1VBH A;  3EHB B;  2J6S A;  4TV9 B;  3JSL A;  1AIL A;  4J9K A;  3L2P A;  2DWD C;  2EBO A;  2VPQ A;  4IWY A;  3U9S A;  4DR7 B;  2Q0A A;  2MW2 B;  4LCU C;  1KKC A;  1H2G A;  1E4G T;  1GMG A;  2RGR A;  5GTH Z;  1FXK C;  5BMV F;  3L74 H;  4X20 B;  5D1P A;  1Q3E A;  2AXT Z; 
#chains in the Genus database with same CATH homology
 1FJG H;  4TUY B;  2VQF B;  4DR4 B;  1I7F A;  3VQX A;  4YHH H;  4LH6 A;  4KHP B;  5LXT A;  2GV9 A;  1J5E B;  1XK5 A;  3HKC B;  1IBM H;  3N40 P;  5D5P A;  5KHG A;  1S03 G;  1TA8 A;  4B08 A;  4D7S A;  4X1K A;  1N36 B;  1FJG B;  3VNN A;  1HNZ H;  4B3R H;  2QJ1 A;  4YHH B;  1HNX H;  5FLX W;  1Q43 A;  2ZIN A;  2ZM6 H;  3RGB A;  5K1P A;  4CH3 A;  4LNU B;  4JI8 H;  1IBM B;  3RTX A;  3RFR A;  4DK1 A;  4O4L B;  4FLV A;  4EB6 A;  3N44 B;  5JQG B;  1KMI Z;  4DUY B;  1E4F T;  1HNZ B;  4B3R B;  4AQY H;  3BHP A;  4Q0Y A;  2ZM6 B;  1Q5O A;  4JI8 B;  4DV0 H;  4TQF A;  2HGS A;  2WE6 A;  3K5M A;  4NXN H;  5EIB D;  5C8Y B;  1TUB B;  4PHZ A;  5EZY A;  2CW7 A;  3RYF B;  3RYH A;  5LYJ A;  2E5L H;  4UCR A;  4YY3 H;  2VOB A;  2BTO A;  4O2B B;  5D5Q A;  4AQY B;  4DR5 H;  1CKN A;  4DV0 B;  4EFB A;  4NXN B;  5J2U B;  4R7R A;  1SYX B;  2E5L B;  4YY3 B;  3HKE A;  4PZ7 A;  1TGO A;  3K3V A;  4DR5 B;  2YCH A;  4LH7 A;  3UT5 A;  4JI2 H;  4K8Z A;  2BTQ A;  2E3C A;  1WH2 A;  5CA1 A;  5J2T B;  4TV9 A;  3RWR D;  2CAZ C;  3W1B A;  4EEQ A;  3T1Y H;  3N2G B;  3IAY A;  1Z5W A;  4LR3 A;  5D1O B;  4YJ3 A;  1SA0 B;  4FLZ A;  2IM9 A;  1JMK C;  1SEI A;  3JAS B;  4LFB H;  4I50 B;  3RIZ A;  2UUC H;  3T1Y B;  5LMN H;  4LF7 H;  3JSN A;  4GKK H;  5DIS C;  1IBK H;  1P16 A;  4X20 A;  1N33 H;  4DR6 H;  1QQC A;  2UUA H;  1JJO A;  4DK0 A;  4FM1 A;  4FFB B;  4LFB B;  2UUC B;  1AN7 A;  4OX9 H;  5LMN B;  4LF7 B;  1FFX A;  1HW7 A;  1T5E A;  4JI7 H;  3HKC A;  2Q7E A;  1N33 B;  1KU9 A;  5BMV B;  4DR6 B;  2VQE H;  5FPO A;  2ZJT A;  1L8D A;  4X1Y B;  4FM2 A;  1IBL B;  1X9N A;  1B04 A;  3HKD B;  4JI3 H;  2MCT A;  5K1X A;  3FMA A;  3THO A;  4FLY A;  4J0M A;  2P5O A;  4F6R B;  3M4I A;  1CKO A;  2UXD H;  1O75 A;  4LNU A;  4DV1 B;  4A2A A;  3TY5 A;  3GDE A;  2VQE B;  3GB8 B;  5LL6 b;  1TVK B;  5JH7 B;  4FLT A;  1SKV A;  1A0I A;  1O9G A;  5JQG A;  4JI3 B;  4HBN A;  5FD5 A;  5FD6 A;  2UXB H;  1M93 A;  2UXD B;  3RYI B;  2OYQ A;  1TUB A;  3RYF A;  4IAJ A;  4ZHQ B;  4FVM A;  2OWO A;  1MZB A;  3RJ0 A;  4O2B A;  1QHT A;  2UXB B;  2R72 A;  3ICX A;  1I94 H;  3N2K B;  4NVP A;  2YIA A;  3NBZ B;  3K5O A;  3NBY B;  3RGZ A;  5J2U A;  2VUG A;  2PGG A;  4DRX A;  4LFC H;  3CHX A;  1I94 B;  2PZS A;  3SR2 C;  4DV6 H;  1SQF A;  5J2T A;  3CSX A;  3BA9 A;  2UUB H;  1HNW H;  1FKA H;  5LP6 A;  4I4T B;  5D1O A;  4BWS C;  3TY9 A;  1SA0 A;  1SQG A;  3A2F A;  2QM4 A;  3QTC A;  3LML A;  4APM A;  3VQV A;  4DV6 B;  4RB3 C;  4LF4 H;  5KHI A;  1VF7 A;  3JAS A;  4UCT A;  4ZOL B;  3RR5 A;  4I50 A;  3N6X A;  2UXC H;  4RZQ A;  4O4J B;  2UUB B;  4DUZ H;  4Q6G A;  4O4H B;  1HNW B;  4LSX A;  1D5A A;  2YIB D;  4X66 H;  4X65 H;  5JVD B;  4LF4 B;  4HNA B;  4FFB A;  3K5N A;  2R9A A;  1HNX B;  2UXC B;  4MV7 A;  4DUZ B;  3QWU A;  2Q7G A;  3JAM W;  2F93 B;  3HKB B;  3N43 B;  4LSA A;  3CB2 A;  5BMV A;  4X66 B;  5JJJ B;  4X65 B;  1Z2P X;  2XHB A;  5A2Q W;  4AHC A;  4JI6 H;  4X1Y A;  1DGS A;  5IYZ B;  4RB2 C;  4B3T H;  4X1I B;  4PZ6 A;  2R70 A;  5LMU H;  4ZI7 A;  1WNS A;  5FPR A;  5LA6 B;  1ZHS A;  3BRC A;  3N41 B;  4TOI A;  1TVK A;  5JH7 A;  4JI6 B;  4B3T B;  1P49 A;  5CA0 B;  2PUS A;  2F1M A;  2JS5 A;  3RYI A;  1P8L A;  3BAA A;  4BW9 A;  1Z2O X;  3L4K A;  4DR2 H;  2HHH H;  3JAL B;  4U3J B;  4IHJ B;  2ZNI A;  3BPZ A;  5IJ0 B;  1S68 A;  4X62 H;  4ZHQ A;  4X64 H;  3F8N A;  3U0Z A;  3TY8 A;  3L4J A;  1Q8I A;  1ZHQ A;  4O4I A;  1YEW A;  3N2K A;  4KL1 A;  5FNV B;  4DR2 B;  4JI2 B;  1XDN A;  2HHH B;  4B3S H;  4JI5 H;  4TQD A;  4K0K H;  2F95 B;  4WBN B;  4X62 B;  4X64 B;  4UCO A;  4I7H A;  4M7E A;  4MV9 A;  2V4D A;  4IIJ B;  5KX5 B;  4JI5 B;  4B3S B;  2WYO A;  1XHZ A;  4MTD A;  4K0K B;  1I6U A;  4DV7 H;  4TUY A;  3T1H H;  3GJX B;  3IG0 A;  3BA8 A;  3WB0 A;  5LXT B;  4LF5 H;  3CVZ A;  4GKK B;  1IBK B;  2CW8 A;  1XMQ H;  2VPS A;  4I4T A;  4E6N A;  4X1K B;  2HIX A;  3VQY A;  2UUA B;  4O2A B;  3MAQ A;  4FLX A;  4DV7 B;  3T1H B;  4UCU A;  4OX9 B;  3FFQ A;  4ZOL A;  3U10 A;  5JCO C;  4A2B A;  4DR1 H;  4O4J A;  3N42 B;  4DR3 H;  4LF5 B;  4PDB A;  4JI7 B;  1X4T A;  4O4H A;  1XMQ B;  2PY5 A;  4DV4 H;  4YJ2 B;  1CKM A;  4O4L A;  3SGI A;  3RYC B;  2EX3 A;  4FM9 A;  3ZED A;  3K57 A;  2YI8 A;  2YIB A;  4DR1 B;  4DR3 B;  4FLU A;  5KHJ A;  3OTF A;  1XQ8 A;  4DV4 B;  3HKB A;  3K58 A;  5EZY B;  4PZ8 A;  4RB1 A;  5C8Y A;  3RYH B;  4LF8 H;  2VWJ A;  5JJE B;  4LF9 H;  1Z5V A;  5IYZ A;  1JFF B;  4X1I A;  3WB1 A;  2O03 A;  4NXM H;  3JAT B;  4CH6 A;  4JV5 H;  3DSQ A;  5LA6 A;  2HVQ A;  2HVS A;  4LF8 B;  4LF9 B;  3K59 A;  3JAW B;  5CA0 A;  5EYP B;  1XHX A;  3UT5 B;  4CS2 A;  4JV5 B;  1XNQ H;  3QG5 A;  3W1G A;  5CA1 B;  4RAZ A;  2YXL A;  4U3J A;  3JAK B;  5CB4 B;  5IJ0 A;  3N2G A;  4YJ3 B;  4LFC B;  4GLX A;  4RAY A;  4RB0 A;  1XNQ B;  1WN7 A;  5FNV A;  3E22 B;  4EQ5 A;  3JAR B;  2P22 C;  4FM0 A;  4KHP H;  2F66 C;  4AIL C;  1GYF A;  5KHH A;  4IIJ A;  1XNR H;  4I55 B;  5KX5 A;  3VQW A;  4UCV A;  3KAJ A;  5IWA H;  1FFX B;  2UU9 H;  1XNR B;  1V9P A;  4LF6 H;  1Z2N X;  1RSO A;  4O2A A;  4DUY H;  4BWA A;  1N32 H;  3HKD A;  5IWA B;  4B3M H;  1ZAU A;  3QF7 A;  4FLW A;  2UU9 B;  4F6R A;  4DV2 H;  1M5I A;  4YJ2 A;  4DV3 H;  4LF6 B;  3RYC A;  4TV8 B;  5BR8 H;  3RGX A;  3RF2 A;  1N32 B;  2ZCE A;  4B3M B;  1WPB A;  5LMU B;  3M7M X;  3C0F B;  5IJ9 B;  5GON B;  4DV2 B;  5IT9 W;  4DV3 B;  1N34 H;  3LNN A;  1TAE A;  1XI1 A;  2Q2T A;  5BR8 B;  1M0W A;  3ZS8 C;  3SJC C;  3NC0 B;  2PYL A;  2CFM A;  2HVR A;  2YI9 A;  1JFF A;  5KMG B;  4GKJ H;  3B2E E;  1L2Z A;  2VWK A;  3JAT A;  5ITZ B;  4DRX B;  5LOV B;  1N34 B;  4JI1 H;  3KYH C;  4MTE A;  5JJN B;  2W57 A;  2Q7H A;  3JAW A;  4GKJ B;  5EYP A;  3PN1 A;  1FVI A;  4JI1 B;  2PYJ A;  3EYY A;  1M4U A;  4DV5 H;  3JAK A;  5CB4 A;  1XMO H;  5LP6 B;  3S24 A;  1HR0 H;  3SJB C;  3UQ8 A;  2JVD A;  4L8J A;  1NT2 B;  4CS4 A;  3E22 A;  4CS3 A;  4PI2 A;  2F4V H;  4LMY A;  2FE3 A;  4CH4 A;  4DV5 B;  2RQ6 A;  3MWM A;  3JAR A;  3K5L A;  1XMO B;  4I9Q A;  3KAL A;  4PI0 A;  1HR0 B;  1BJT A;  2HEP A;  4EB6 B;  4I55 A;  3J81 W;  4CH5 A;  1IBL H;  2ZIO A;  5JVD A;  3W5O A;  2F4V B;  4HNA A;  3HXL A;  1VS0 A;  2Q2U A;  2HIV A;  5EIB C;  1G6U A;  3J7A K;  4DV1 H;  3J80 W;  3OTO H;  4LFA H;  3H20 A;  2KSW A;  5LYJ B;  2ZIM A;  1M0T A;  1O9H A;  4EFE A;  1BGW A;  4K8X A;  2PTM A;  4ZI7 B;  1CKN B;  3BAB A;  4CC5 A;  4ETS A;  2JGU A;  3OTO B;  3KXY T;  5EOY A;  2KKW A;  4LFA B;  3HKE B;  3ETQ A;  4TV8 A;  4JI0 H;  3U11 A;  5KHK A;  4JI4 H;  4DRF A;  5JCO A;  5LP6 C;  4UFZ A;  4NXM B;  4JYA H;  5IJ9 A;  5GON A;  2BTQ B;  4DR7 H;  2ZNJ A;  3JAL A;  3JSL A;  4TV9 B;  4IHJ A;  4JI0 B;  4GYC B;  2RGV A;  4JI4 B;  3L2P A;  3WB2 A;  3KAK A;  1S5J A;  2WDT A;  2RJZ A;  5KMG A;  4O4I B;  4JYA B;  4ZIB A;  4CC6 A;  1H2S B;  4DR7 B;  5ITZ A;  2Q0A A;  2VQF H;  4D7T A;  1E4G T;  5LOV A;  2RGR A;  4DR4 H;  4WBN A;  1J5E H;  3SJA C;  3DF7 A;  4X20 B;  5D1P A;  1Q3E A;  4UCS A;  2XIG A;  1N36 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...