4EEQA

Crystal structure of e. faecalis dna ligase with inhibitor
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Design, Synthesis and Activity Evaluation of Potent NAD+ DNA Ligase Inhibitors as Potential Antibacterial Agents.
rcsb
source organism Enterococcus faecalis
molecule tags Ligase/ligase inhibitor
total genus 108
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4eeqA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4eeqA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4eeqA02
4DV3B 4UCSA 1I94B 4LF8B 5DISC 3JSNA 4X64B 4CC5A 1P8LA 1TAEA 4EQ5A 4UCOA 3BABA 4DRFA 1N36B 1HR0B 1A0IA 3S24A 1XNQB 4JYAB 1XNRB 3BA9A 1CKOA 2HIVA 2VUGA 1X9NA 4DR5B 5D1OB 4LF6B 2HHHB 5IWAB 2Q2TA 4GLXA 3RR5A 5D1OA 5LMNB 1CKMA 1VS0A 4DV5B 4JI8B 1FJGB 1N32B 3TY8A 3BA8A 4UCVA 4JI6B 1IBKB 4DR4B 4CC6A 4TOIA 3PN1A 3L2PA 3SGIA 3TY9A 3GJXB 4LH7A 4DV7B 2UUAB 1ZAUA 2HIXA 3NC0B 1P16A 4NXMB 3JSLA 4X65B 5LMUB 4PZ7A 4LFBB 2CFMA 1XK5A 2UUBB 4LFCB 4JI1B 1HNWB 4AQYB 2UU9B 3VNNA 4DUZB 1J5EB 4DV2B 3RTXA 3W5OA 4DR6B 3TY5A 4DR1B 3QWUA 4EEQA 4YY3B 4PZ6A 4JI2B 5BR8B 4DV6B 3UQ8A 4DR7B 4UCTA 4JI7B 4DR2B 2E5LB 4UCUA 4UCRA 1N33B 4KHPB 3T1HB 4LF7B 4B3TB 1HNZB 4B3SB 4LF4B 4UFZA 4EFBA 4JI3B 2HVSA 4DV1B 2UXDB 1S68A 2Q2UA 1IBLB 1V9PA 4LH6A 1XMQB 1N34B 4EFEA 2OWOA 3GDEA 3GB8B 1FVIA 3NBZB 2VQFB 1TA8A 3W1BA 1XMOB 2ZM6B 3NBYB 1HNXB 2F4VB 2UXBB 4DUYB 2HVQA 5D1PA 4DR3B 4DV4B 4DV0B 4LFAB 5FPRA 4NXNB 2UXCB 4LF9B 4GKKB 4X62B 4JI4B 1XDNA 1CKNB 3T1YB 4K0KB 1IBMB 4E6NA 2HVRA 4YHHB 4B3RB 1CKNA 3OTOB 2UUCB 1B04A 4B3MB 4GKJB 4JI5B 3BAAA 4JI0B 4PZ8A 4JV5B 2VQEB 4OX9B 4X66B 4LF5B 5FPOA 3KYHC 3W1GA 1DGSA
chains in the Genus database with same CATH superfamily
5HV6A 1NI8A 2UXDH 1DTOA 2YRWA 2JA7G 3MHSC 1AI6A 2KSDA 2COIA 3B2EE 3L74H 5EC2C 4O7SA 3CCQV 1LR1A 1V54B 1I3QA 4XX0B 2FLPA 4FM1A 2CTRA 2ZM6H 3L4KA 2FYUH 5D8DA 1Y76B 3CYOA 3KCXA 4ZOLB 2YZLA 5D1OB 4BAYA 2Q0OC 3RBZA 2Q2TA 4BWSC 4BR6A 4YP3A 4PHZA 5KFVA 1EKVA 2RGRA 3TY8A 5HFLA 1AILA 4A3KG 4U6PA 3RB0A 3RV3A 2QB5A 1KJJA 1SA0A 1IBMH 4LFCO 3H1JH 4G27B 3FB7C 3ZS8C 3GJXB 4LF6H 4LH7A 4FFMA 2HGWA 1ZAUA 4R7CA 2AXTZ 4K35A 2E75B 4FM0A 4A3IG 1JDEA 4JI8O 3CB2A 4JI1B 1JXLA 3T5HA 2AGOA 5H6QA 1WNSA 1NTMH 4W4KA 3KALA 3H0GG 1BL8A 3QTCA 1AP6A 3SJAC 2PI5A 4L87A 2I87A 5DQGA 3QWUA 2EJ0A 1S10A 3BVOA 2R93A 1E4FT 2PTMA 1B06A 2CE4A 1MMMA 2J6SA 1ROPA 1EZ1A 4MSWC 4NTYA 3RYIB 4Q20A 1HNZB 2EX3A 4LWSB 5JQGF 4FFBB 4C5CA 4HNUA 4IHJA 1JJ2U 3ETGA 2QYZA 4Q6GA 1DF4A 1XMOO 1VQ4V 5LGTA 4FLZA 4JI6H 3GTPA 2ZIOA 4O4JA 4JTCB 3N2KA 4LC1A 5B1AB 1N34B 3KAKA 2HJFC 5FD6A 2ETNA 3SNOA 4DL5A 3HKCB 3DC5A 3W1BA 3LMLA 1ULZA 1TUEB 4KHPO 1HNXB 3K5NA 1KB9F 1W0JG 4NXMH 2HVQA 1BQ0A 3OD4A 5D1PA 5I60A 3ZMTA 1P49A 5JH7A 2B63A 4O7TA 4RNOA 3K0DA 3STLC 3OHAA 4ZQIA 4DV2H 5EZYB 4X62B 1DF5A 1CKNB 4O4IF 2HVRA 1OCZB 1O9HA 3OSNA 3E8HA 3KZIZ 1W2BU 2WLIB 5CAEB 2A06H 1XOUA 2B5UA 4R8UB 1IURA 4J9ZB 4MV9A 2ZDIC 5K1XA 4LF4H 4MTEA 4U7NA 4RZRA 4FK5C 4LF8B 5DAAA 2LQTA 3AK1A 5LGUA 4QIWE 3GIKA 4RU9A 1EN6A 1JFFB 4YHHO 1TWFA 1OCCC 3JD2A 3TGUH 1KJ8A 4FFNA 4APMA 2YRXA 1RJQA 2ADQB 4LNUB 4YJ2A 3GTJA 4ZIBA 1Q5OA 2W6OA 4OX9O 2DLNA 1SZXA 2HIVA 3I56V 2ZGIA 4Z2WA 3ZN1A 2EJ2A 2UXCH 4LF9H 2CTPA 1C30A 1KEEA 1K83A 2DQ0A 3CPWU 3PFFA 1QU7A 1JDBB 3OR7C 1T36A 4K0KH 1Q6HA 3PN1A 1QLEC 1HNWO 3TW6A 4TUYB 5KAIZ 5KX5A 2EZPA 3MFIA 2WAQA 2Z04A 4XDJA 5KFYA 1RJRA 5LMUB 4O4HB 4I5SA 4JYBA 4A3DG 2XCPA 3SPIA 4JI2O 2F23A 3AG2B 2Y0SA 5IE9A 3WB2A 3P30A 3RT3C 3K5LA 4DV6O 2YS6A 3CCLV 3RTXA 1OCOC 2LW1A 4BY7G 4X88A 2QWQB 1K1QA 5KFJA 4WFEA 4IWXA 1Z5WA 4O3PA 2JS5A 4WBNB 5IT9N 5BMVF 1XNQH 2C2RA 2EINB 2UUBO 2P67A 1VQ8V 5BWUA 1J5EO 4LF7B 4DR5H 4B3TB 3J80W 5I5XA 4UVAA 3RUPA 1IYDA 4O4LB 1PD3A 3VMMA 5DGAA 3MWEA 1BT8A 4GX0A 3ZHRA 4LH6A 4HN2A 3IN5A 2HKOA 2ZNIA 4RQEA 3CCEV 2E5LH 2DPJA 3FYIB 5KG5A 4ECSA 4TWKA 2ITCC 4IRKA 1FKAH 4I7ZB 3GTKA 3N6XA 4DL3A 3AG7A 2A7WA 1S9FA 1JOYA 3G6EV 4GKKB 2PI4A 2CTQA 2EIKB 1TGOA 2R92A 2NLJC 1GM9A 3QO5A 5KHGA 1NU1H 4E6NA 3OMNB 3PW4A 2UXBO 5CA0F 1KC7A 2Q5ZA 2R8JA 4CMDA 2W8KA 2JEXA 3T4ZA 4FFPA 2VPSA 2X6CA 1DGSA 2IP4A 3VQVA 5KG7A 4C2MA 3G6VA 4YR0A 4D7SA 2OTJV 5DGBA 2V59A 2DPIA 4DO2A 2HHHO 2QK4A 1RYRA 4RZQA 1BE3H 1I7LA 2K9PA 1K4DC 2FPIB 3S24A 3R9RA 4CE5A 1AJQA 3KHHA 3A8TA 4X66O 1WN7A 3N41B 1I0HA 4JI6O 4QSHA 4RCNA 1ZETA 4A3JG 2WLHA 5IWAB 3U54A 1EHIA 5I5YA 1LUVA 2CUGA 2WB1E 2BTOA 3E83A 5C3EG 4ZHQA 5KFAA 3BJYA 4LSAA 5JQGB 1M6VA 3PR4A 2GUZA 4R8CA 5K1PA 1Y4MA 3DC6A 2M6YA 1W59A 2V7QG 2KSWA 3AG1C 4FJCC 1FYJA 2PN1A 3WB1A 3T99A 3ZBHA 1PL4A 5LL6Y 3R5XA 2Y69B 3U9SA 2YU9A 3K59A 1K8AW 3VNNA 4DUZB 5CBHA 4Z1VA 2YC0A 2UVVA 4DR1B 4FLUA 2VA3A 1I7FA 4LF4O 2EIMB 4PDMA 3I55V 3RBDA 3NXSA 2GLTA 5KT6A 4PDLA 2PZSA 4DR7B 2ASLA 1BNCA 3BHPA 4F6EA 4FS2A 5DG9A 4ECRA 2JGDB 1FPOA 3L72H 4O4IB 3KHGA 1NVPD 3ABMC 1AR5A 4MV6A 3E5NA 4ZI7F 1RK6A 4J41A 4O3SA 1COWG 2HJWA 2J6TA 3EVKA 4CKEA 4J42A 5LYJF 2ZXWB 3ZHTA 2W0XA 2W6PA 1XMQB 2WYOA 4C5AA 5J2UF 2XAHA 3B77A 1BMFG 5KHHA 1A32A 4JI7O 3JRWA 1DV1A 3SJQC 4F4YA 4A3LG 3UT5B 4UB6Z 2UXCO 4MV7A 1Q8IA 4DL7A 4CBCA 2X6AA 4CS3A 4K0KO 1JLLB 2Q7GA 4JI1H 1UPGA 1IBLO 4MS2A 4NKGB 2O03A 1FXKB 1ZSPA 2PMZE 3KHRA 1GO3E 3L73H 3ETEA 1EN4A 3T1YB 2EJ7A 3CXHF 3LNMB 5KMGB 2XCAA 4PA6A 1QVGU 4FM9A 1WH2A 1K7DA 2ITDC 4PI2A 2HLDG 2E2IA 2W7OA 1S5HC 1PK8A 1S5JA 4DV4O 1NTKH 2AZ0A 4O7LA 4I9QA 1I50A 1HNZH 1Z2GA 2BTQA 2DWCA 1R1BA 4H33A 4UCSA 5KFEA 5KG2A 4B3RO 4DAAA 5KFQA 4DR5O 1N34H 4IIJF 5GONA 1RSOA 2LFSA 4B3MO 2RDCA 5B3SB 4BIUA 1VMGA 5LXTF 1M1KW 4J9OA 1HNXH 5CB4F 1YI2V 3DTGA 1OZ0A 3D36A 1O75A 1BQZA 4LF6B 1WR2A 2DYRC 5BMVB 4QPKA 1I94O 5EWGA 2YL2A 1XHZA 5B1NA 1CKMA 4O7YA 3G67A 1WPXA 1FJGB 4P2ZA 4I0XB 4QNHB 2PYJA 4O83A 3EFFK 4X62H 1FKAO 3MR5A 2ILMA 5EC1C 2QM8A 4QIWF 3DSQA 2YZNA 3CEBA 4JZ2A 1ENVA 3I5DA 4O2AA 5KFTA 5IY5C 2GSMB 1XK5A 3QF7A 4DW0A 2W6JG 3QVNA 4K8XA 5BR8O 4AQYB 3ICXA 1BHAA 3K5MA 4MV8A 4LF8H 3UZOA 5KFUA 2W9CB 3GV8B 2YIBA 3LULA 4N21A 1JR9A 1SZTA 4PD4F 5LHGA 3K58A 3SDLA 1GM8A 1BHBA 3O9OA 1NR7A 2YEVA 3K3PA 3OUUA 4GUNA 3RGBA 5FLMG 3K79A 5CA0B 3GIMA 4F4ZA 4B3SB 3CJHA 3R5FA 3TINA 1BJTA 4DL2A 2YZMA 2Q2UA 1MA1A 4IWYA 1NH2D 5BWVA 1AJPA 4I4TF 1K5SA 1M0WA 4A3CG 1ORQC 2VRZA 5CE8A 1RFYA 4QPJA 1FVIA 1V4YA 2O57A 2ZR3A 4MTOA 1THZA 1N56A 4QWDA 5LMUH 4O82A 5FJ8G 1Q3EA 4DR3B 4RUAA 2W6NA 4LFAB 5FPRA 1IXBA 3ABKB 1I6UA 1NVPB 2YIBD 5KFWA 4PA3A 1WLEA 1CS0A 4EB6A 1M93A 4WFHA 4JI0B 3BAAA 4JXUA 4R6ZA 2W6ZA 4LF7H 3GTMA 2RQ6A 1Q82W 4LF5B 5DEDA 1NJIW 3JATB 4RWUA 4ASUG 1WCMA 2DQ3A 5EWEA 3A0HZ 4EYIB 4IT5A 2MW2B 3U0GA 1A0IA 1I5XA 2R6FA 3JARA 3STZC 1EUCB 3QO7A 4PA4A 5LP6A 2VQEO 4TQRA 2IU3A 1XNRB 2MK3A 1CE8A 1Y74B 1AI5A 4O84A 5B1OA 5C8YF 3G8CA 4WFGA 1M5IA 2YWVA 4BXXG 1N32B 3CRMA 4GKKH 2UXXA 4ZI7B 1SESA 5IT9W 3TCUA 5DQIA 3L2PA 2LFRA 5J2UB 1YZBA 2F95B 2Z02A 3ZMSA 1MSWD 1S77D 1OJHA 2IM9A 2EZOA 3TJTA 2E2HA 1G1XB 2V4RA 1VQ6V 2UU9B 2OCCB 5LA6F 4L8JA 2R9RB 1JCHA 3OSPA 4D6TH 2WB1A 3HKEB 2XC9A 3K9AA 4H13B 4MTXA 2D2CB 1E4EB 2R7LA 4Q8FA 1HNZO 3K06A 3OFNG 2DABA 2EULA 5I47A 4J9MA 4DR2B 1ZL8A 2E5LB 5H5NA 3DAAA 3T1HB 2W9BB 3RB4A 5EK0A 1WAZA 2V4QA 4JYCA 5IWAH 3FYEB 4ECQA 2VQDA 5LL6b 3HOYG 1GK9A 1S68A 1HNXO 5JJNB 4YY3O 2YI9A 3B8MA 4FZ1A 2WLLB 3RB6A 5E25A 4LMYA 2OWOA 3F7YC 5ITZA 4RB2C 4XBFA 2QM7A 3EXAA 2N04A 2V1DA 3DGEA 3AYHB 1PNKA 3NGDA 1VQ9V 4IIJB 4X62O 2RJZA 3H3VH 1PL0A 2HHFA 1XDCA 5LXTB 3Q2OA 1PPJH 5CB4B 4DUZH 3OGIB 4NXNB 4QW8A 2RMKB 4OXSA 3ZRSA 1VIBA 1XBLA 1UJWB 1EKFA 3ZRWA 4P9PA 4J7JA 4DR1H 4E2LA 3KAJA 1SKVA 5C44G 3N43B 1S3JA 3E35A 4WFAV 3U9TA 4E4TA 3GIIA 2UUCB 3LDCA 4IR9A 4DR7H 4NVPA 1FD9A 4DUYO 5DGHA 4R50A 1M4UA 2EJRA 1IYEA 3HOZG 3LSUA 3MHHC 1GKFA 3MJFA 2JJ1G 2BSKB 1UNNC 1XMQH 3JSNA 4UV9A 1DV2A 2PMZA 1Q6IA 1E4GT 2GQRA 5L1LA 4G3IA 4XZ3B 2FP4B 3B8NA 1OCCB 4U7CA 2R7ZG 3IAYA 2R70A 4ECTA 3B09A 4E4EA 1UC9A 1MG1A 3RR5A 2X7RB 5L3BA 1H38A 3FB5C 5KA5A 2K1EA 2FPPB 1VEWA 2YEVB 3TIGA 1E1QG 3LUTB 3FX7A 1IBKB 1VF6A 3SR2C 4F4WA 3T1YH 4TOIA 4X89A 3VQWA 3BEHA 1H8EG 1AUVA 4I4TB 1VQLV 1QLEB 3WG7C 2H3OA 1UFIA 1WRVA 4EGQA 2CFMA 2QF7A 1OCRC 2XAFA 2PUSA 3Q8PB 5CA3A 1Z2OX 2CNQA 4HZ3A 2Q7EA 1F4NA 4OPHA 4DR4O 2Q9LA 4RUEA 4DRXB 1WA8A 3WB0A 4H0LB 2CAZC 4LF7O 1B3QA 4B3TO 1OCOB 4PZ6A 2YCHA 5BYBA 1URFA 5E79Z 3GVMA 3X2QC 1GAXA 4IAJA 4X65O 3ETHA 4QJFA 4I50A 4FVMA 1SCUB 1K4CC 1AR1B 2R87A 4GX1A 2RDJA 5KFCA 1U97A 3KHLA 3V6JA 2V4DA 4UUJC 4UFZA 2FTKA 1FJGH 1NZ6A 4BBSG 3HKBB 3RAQA 3JAMN 4YQWA 5KG1A 2P06A 2CK3G 2HEPA 2ABJA 5KUMA 4CZZA 4MVOA 2BQUA 1GSAA 1VQMV 2NVYA 1F7YA 3OW2U 1QBZA 5KFKA 4TQFA 1M57C 2CZGA 3C3SA 2DN9A 2P5OA 5H80A 3U55A 5JWPA 2F4VB 5KFOA 4TV8A 1D2DA 1QNMA 3GB7C 5B1BC 4EG0A 1KD1W 5KFRA 4A5UB 3OTFA 5BZBA 2R84A 2JS3A 4AQYH 1XUQA 4HQ6A 3ASNC 3F5TA 4JZGA 1P7BA 4JV1A 1I2KA 5C8YB 2AHYA 1AN7A 2HDKA 4IYIA 4X1IB 1GMGA 4UUGA 3CXCU 3CRRA 4KUMA 2JEUA 4M0JA 3EPGA 1YTFB 4JAAA 2WLJA 4IHJF 3RYHA 2KQXA 5KHIA 1KU9A 2VPQA 4PZ8A 3THOA 4O4JF 4QW9A 3GILA 3CQZA 4B3SH 2GTSA 1W96A 2L6LA 3QZ7A 3Q4HA 3WWJA 4CC5A 5LA6B 4EQ5A 3D36C 5JH7F 4CH6A 1VQ7V 4ZKIA 1VP7A 4O81A 3T9AA 1D5AA 4FGRA 1NTZH 1XL6A 5BPFA 5I5VA 1SQBH 4DW1A 2JGUA 3N2GA 1QCEA 2VA2A 4LP8A 4JUZA 1VQ5V 3GQCA 4DR3H 4RB3C 3BQ2A 5C93A 4LFAH 4CS2A 1VQKV 2Q69A 2COGA 1J95A 1GH6A 2DW4A 4X8AA 1CP9A 4DUZO 1GYFA 4DV7B 2UUAB 4A2BA 2I8CA 4FFLA 4JI0H 3M9MB 1JJOA 3AG1B 4RAYA 4RUFA 4YJ3A 1PV0A 4LF5H 2C2EA 2W6MA 1S0MA 3JZFA 4TM5A 1R6KA 4DR7O 1E1RG 4YJ2F 1TWGA 3JASA 2QE7G 2F66C 2QWOB 2CKZB 1TVKA 5BWWA 5L3CA 4UCTA 3UCSC 1XNRH 4UVCA 4LFBO 2HGSA 1SQQH 4EBEA 4BY1G 4I9WA 3H01A 3JCZA 5F9LA 3T2MA 2OLSA 1KECA 2FMLA 5JCOA 5LOVA 2CNVA 3ZN0A 4EFBA 2UVUA 5IYCG 4DV1B 2A79B 3ABMB 5I5UA 5KX5F 2G38A 1N32H 3JAKB 3G8DA 3APQA 2QKCA 3RYFB 2YI8A 1AUXA 1YJ9V 2DMXA 5TISZ 1FFXA 2VQFB 2NN4A 3SPJA 3HR0A 4PDRA 1P84F 4EBCA 3D3IA 4FBUA 2JJ2G 3FB8C 2UXDO 4XYMB 1GN4A 2M7WA 5EYPB 4DV0B 3N44B 3KREA 2UU9H 5IYBO 5L3EA 1SETA 2DJVA 4NZOA 2V9WA 4JV2A 3APOA 4X1YA 4F6RA 1CQJB 5I5TA 3ZCCA 3GWKC 3ZMZA 2ZM6O 1IXMA 2C2AA 3OTOB 3RYCA 1N48A 2P6JA 3GWOA 1Y1VG 4PJ0Z 1O9GA 4DR2H 2HJDA 3SYCA 5F2VO 3TETA 2IW5A 4GZRB 3T1HH 2YIDA 5IJ0A 2NNUA 2BQ3A 4PA9A 3J81W 2IA6A 3CS5A 1JX4A 4DV3B 2OT5A 5LP6C 1F23A 1KKDA 1IBMO 3OAAG 2ZJTA 2GPSA 3LWBA 5KFDA 1WB7A 4LF6O 5DG7A 3P32A 1N36B 4ICGA 1EM1A 3W7WA 3I4MG 3SJBC 3UM7A 2IJHA 3OHBA 3BA9A 1A48A 2GPWA 1CEZA 3U10A 3JD3A 2YW2A 3J7AK 4TT3G 3HXLA 3T7AA 2WA4A 3JAWA 3CSWA 4GX5A 4NXNH 1K92A 4JI8B 2GDSA 1AROP 2NUAB 1SA0B 2QKSA 2W9AA 5L3DA 1VBGA 4ED7A 4MVZA 3V6KA 2W7PA 2E74B 4AQYO 2CGOA 2HG8A 2JA7A 5KFLA 2WA3A 1QVFU 2UUCH 3IC7A 2PGGA 5BWXA 2N05A 3NR7A 4CH3A 5KFFA 3MD0A 4J80A 5KFNA 4DXWA 2QGNA 5KT4A 5K3WA 5FD5A 3ETDA 4I55A 1YF2A 2FKXA 5IY5B 4ED2A 1MSDA 1EZVH 3IG0A 4J9NA 2QEXV 1PKXA 3TY5A 1QLNA 2YUAA 5CBFA 2YS8A 3CX5F 1HW7A 4GT1A 4ECYA 4RUCA 4M9UA 1Y6XA 4NXMO 4HNAA 4ZHQF 4O86A 5F9NA 2Y0PA 1N33B 5CA1A 3PVXA 4KHPB 3E89A 4ED3A 4IHJB 4DV2O 5FLXN 2GTAA 2F43G 2Q7HA 3CCMV 3CHXA 4O4JB 3R23A 4X9QA 3N2KB 1TWCA 5JQWA 1ZHQA 5C4XG 4FLTA 5BXZA 3CEIA 1IBKH 3H0GA 4RNNA 5CM0A 1IDSA 4DR3O 2OCHA 3GDEA 4DK0A 5IYZA 4UVBA 4LFAO 3CRQA 4U3JA 1XREA 5BY1A 1BCCH 4JV0A 5JH7B 1K1SA 1VBHA 4PA7A 2ZD9A 4JF3A 3C90A 1JIHA 2QDOA 3BRCA 4P30A 1K73W 1GLVA 4YB8B 2KG7A 1AP5A 4JI0O 2F1MA 3K57A 2YIAA 4JI4B 2XNDG 3F5WC 3OE7G 1GSOA 1KJ9A 4G28B 3W7UA 3FMAA 4EGJA 2WTFA 3AEIA 1YEWA 1JPXA 4YHHB 5KAFZ 4TV9A 1Q7YW 1SYXB 5KFIA 4YIPA 5GTHZ 2WE6A 5EOYA 3JD1A 3PO2G 3N40P 3L70H 4OX9B 1RK5A 1AI7A 4LF9O 2IMWP 1S97A 2Q4PA 3GTLA 1K9MW 1XNRO 4PBCA 3JRXA 3S3XA 3UZBA 3QFFA 4QE9A 1P8LA 2RNBA 5E1AC 2HGXA 1MZFA 4UCOA 1XEQA 2RCVA 4YJ2B 5B5EZ 5B66Z 4JV5H 1HR0B 4ECUA 2A0LA 2HVKC 1N32O 3K5HA 2F4VH 4XYLB 2VUGA 3VQXA 1VF6C 4NB5A 4ED0A 2WAMA 3AG3C 5LMNB 1EBOA 1VS0A 3SJCC 4IR1A 3JALA 4QWEA 2CW7A 4C5BA 4JYAH 3IC9A 5KX5B 5IP7G 1XNQO 2FB5A 3ZIAG 3R5HA 3RGXA 2UU9O 3J7AU 2XAQA 3AG4C 1VF7A 2RN9A 2AGQA 1EKPA 2Y0IA 1EZJA 4MVUA 2UUBB 5GONF 3JAMW 4FLWA 1J5EB 2PBZA 3L75H 2E3CA 1LUWA 4MAMA 2E5LO 4JTDB 5EBLC 4CH4A 2MCTA 2DYSC 3K5OA 2VUMG 3BPZA 1BXRA 5KG6A 3T9EA 5J2TA 3G6BA 1IZ3A 3GTGA 4IRCA 3FAVA 4DYLA 3P3NA 5KA6A 2Z0AA 4X20A 4LBEC 4PWQA 4FLXA 3JZIA 1WP7A 1S0VA 3MR6A 4J9SA 1RPOA 2W8LA 4O2AF 3QO8A 4M7EA 2NVXA 2EIYA 4AI8A 1C3OA 1TA8A 5IYCO 4DV7H 4IGGA 2UUAH 5BWRA 2UXBB 1VF5B 4NLGA 5T14A 3JD4A 2CQYA 2ARHA 2JA5G 5HBRB 1R3KC 3R66A 4ME6A 3EYYA 5EBMC 4TQSA 1Q43A 4YR3A 3FDSA 3T5JA 3ZHQA 2JRIA 1S72V 2M05A 3S3WA 2AQ4A 2Q67A 2X5RA 1NS1A 1G8MA 2NU7B 1KUQA 3JAWB 4GKJB 2JEFA 4JI5B 3H9VA 1T3NA 4MA5A 2DZDA 2JVDA 1K97A 4X1KA 4X66B 4I7HA 3BCCH 2ZDHA 4N23A 2Q73A 4ECVA 1F4MA 5DLFA 4DV1H 3AX6A 3L9DA 3PW7A 2ZINA 3LDEA 5JVDA 1P4RA 4NTXA 5DGIA 4YXWG 1IOVA 2BQRA 3ZHVA 5JVDF 5KFZA 3PR5B 5KS8A 2VQFH 2QR4A 2UXNA 4FU0A 1S0OA 3AW8A 2GQSA 1P7GA 1R3LC 4O3OA 5KFBA 4HAMA 4HYOA 3QNEA 3HBLA 4EEYA 2YXYA 1X9NA 4QWCA 4A3MG 1MOFA 1Y76A 3MR3A 4ZOLA 4DV0H 4ZHQB 5D1OA 2ASDA 3LDDA 3GIQA 1V55C 3G6XA 4MV1A 4UCVA 2GUZB 3RFRA 2AGPA 2EIJC 2W6QA 2FJZA 4DL4A 3U11A 4CC6A 3JZ6A 2FMAA 1FXHA 2QWNB 3OTOH 2ZXWC 4WCEV 3KTMA 1TUBA 3ZJZA 3NC0B 1P16A 2P0AA 2NU8B 4U7OA 2LGWA 3L71H 4MVRA 3WG7B 3KG2A 1GN6A 3SYPA 4OPAA 3T4DA 4LSXA 4J9PA 5LP6F 4DV3H 1OCRB 1XL4A 3ZHSA 2A3QA 3GLKA 3CD6V 1N36H 5JCOC 3PJSK 1PM9A 1GSHA 2B63G 4JI7B 2R7NA 4TVIA 4JI1O 3X2QB 3HOWG 1FFTB 3RYIA 5KFGA 3JCUZ 4CS4A 4TV9B 4ECWA 2XD4A 2V5AA 4JI8H 5L1KA 3N27A 2F4VO 1IBLB 3WO1A 1Z2PX 1SFOA 4B08A 4O3QA 3E8FA 3VPBA 3GV7B 2J9GA 4EFEA 3SPGA 2YYAA 1KYOF 3VOTA 2C00A 3HKCA 3NBYB 3VA7A 2LW7A 1G6UA 1M57B 4Z1MG 4DV4B 3RJ0A 4MW8A 2CNUA 5B1BB 2P7TC 3K0GA 3MWDA 5KFXA 1N34O 3KXYT 4KL1A 5EZYA 1XDNA 1Y14B 1XMOH 2CH7A 1VQNV 3ASNB 4B3RB 4FFKA 4EYHB 1CKNA 3VOUA 4B3MB 2EBOA 3JALB 1AR4A 1N33H 3DTFA 2BTQB 1RP3B 2WLIA 5IYBG 4KHPH 1FAFA 5C1OA 4O2BA 4R8UA 1I94B 4FPPA 5KHJA 3ZMUA 2DOSA 5GONB 1RSOB 2QM4A 3QQMA 2Z3YA 4O7ZA 1JFFA 4ED8A 2AW9A 4NZMA 4BIZA 3WO0A 1JMKC 2X0LA 2JEGA 3FKSG 1G4YB 3LSSA 1L0LH 1RM1C 4YBZB 4A3EG 3DXRA 3UFXB 3RF2A 1KUTA 5D5QA 3H40A 4UXNA 3IFXA 4LF8O 2YZGA 1NH2B 3NUAA 1EYZA 5BWTA 3HB9A 1SS3A 4JI4H 3O65A 2R9AA 4QWAA 2FK2A 3ZMVA 1ZQ7A 4YHHH 3PW0A 3OUSA 3SGIA 3TY9A 2ZE8A 2ZNJA 4O2AB 2W57A 3TQ1A 5FL7G 4TUYA 4O7WA 1GN2A 3JSLA 4AYBE 1JA8A 4OX9H 1GO3F 2ZQMA 4O4HA 5JUMA 1WPBA 3T9DA 4RAZA 3ETQA 2R72A 3TXQA 1M56C 4FIPC 2R82A 3E22A 4J11A 4OGQB 4FMTA 3CCSV 5CN0A 1S76D 2XAJA 1HR0H 3FD9A 4DV1O 2R8KA 3UQ8A 2QSAA 5LMUO 4P9OA 4WBNA 3RBEA 4MW3A 5L9XA 4ECZA 3CJHB 5FNVA 2RGVA 3H20A 2XIGA 3RVYA 5C5JA 3VQYA 2YSUB 1E79G 3K3WA 3CSXA 2JEIA 5LMNH 2VQFO 3BQ1A 3HKDA 2R7KA 1WP8A 1YSCA 4O4LA 1N0JA 3PZPA 2ATKC 5KLVH 5EIBD 4BIOA 4ED6A 3GB8B 3NBZB 1QHTA 2HFEC 1D5NA 3RWRD 4RB0A 2LP7A 1EN5A 2JA5A 1HP8A 5JVDB 3Q1KA 3F8NA 2XTAA 5A2QN 2JA6G 4Q44A 2UUBH 3OMIB 3HKZE 1J5EH 5CR5A 3A0BZ 1YXBA 3TXSA 4F4LA 2XUMA 3OTOO 3HB3B 4FS1A 4I50F 3F7VC 3SYAA 1YITV 3RW0A 1YDXA 4MT8A 4EB6B 1BGYH 2ODMA 4FFRA 4QE7A 4K8ZA 3JD0A 3TIIA 4DV3O 1VQOV 5KFMA 1BS3A 3MWMA 4JV5B 2VQEB 3T9CA 1OWTA 2EILC 3ABUA 3BFRA 1DK1A 3K08A 3KYHC 2Q6AA 2ZE5A 1N36O 4GKKO 1JVMA 1TUBB 4DQNA 2IU0A 1W0KG 4TV8F 4F4XA 1KJQA 3JARB 3TK1A 2VWKA 2OCCC 1BSMA 3BABA 5LP6B 2H94A 3ASOC 3T5LA 1T94A 3E86A 4JYAB 5IP9G 2AHZA 3ORQA 2ZIMA 2UXBH 3KKYA 3G80A 2BOCC 3H1IH 1JX9A 2HP8A 2PVPA 1L2ZA 1KQSU 1GRJA 2JK5C 2IH1C 4GLXA 4FLVA 1AB3A 4DV5B 5KHKA 3Q8SB 3IJ4A 1WJZA 3EPIA 4IYHA 2WPDG 3M9NB 1YCIA 4IL6Z 1PX2A 1SRYA 5JQGA 3E8GA 4MV3A 2H8PC 3CRAA 2HHHH 1GM7A 4Q8EA 4GKJH 4JI5H 4GCZA 2HIXA 5IWAO 2D3OW 1OV9A 1IVSA 1K3EA 4X66H 3ZRVA 1PNMA 2UVWA 4FLYA 1K5QA 3ABLC 1SQVH 2R85A 3W5OA 4DR6B 2WLNA 1N33O 1KJIA 2ODTX 1B33N 4YY3B 2VR1A 3L4JA 2FLNA 5GW7A 2JEJA 5KT3A 1ZL8B 3SI8A 4O3NA 5HNEA 4YAKB 2IJIA 4QGPA 1S5LZ 1OBGA 2CH7B 1H2SB 2JGDA 3K04A 4O4IA 3ZEDA 4JI3B 2HVSA 1ZUQA 4DR1O 4XDLA 4K6NA 1R3JC 3GIPA 3SE7A 5FR9A 4W4LA 5ITZB 4YR2A 1QR9A 2FLLA 1RJPA 4YJ3F 3CVZA 4O2BB 3RN4A 3CCVV 3QG5A 5LBQA 2W70A 3ETJA 3UT5A 4JI4O 2HHFB 4DUYB 1NQTA 3MDSA 3V4ZA 1XMQO 3ZRWB 4HBNA 5DMXA 3DXRB 2C28A 1FXKA 2W0FC 4G2KA 2A9HA 2IJKA 1AI4A 2WSSG 2OTLV 5J9PC 5LOVF 3ABTA 1S0NA 2AZ2A 4A3FG 1SERA 1ZHSA 5KMGA 2WDTA 4JI7H 1VQPV 1H2LA 2AU0A 2IBZH 1GTOA 3C3TA 4JGSA 1HR0O 2QTOA 1ET0A 3W1GA 3K3VA 4RB1A 2R9IA 5DN6G 2R8GA 4FFOA 4H44B 5DISC 3OUZA 1IBLH 4X64B 3T1YO 1V54C 1YJWV 3H4DA 1I08A 2IBKA 4PDBA 3AK3A 4J9KA 3CC7V 2XT9A 1TWAA 5LMNO 2Q0AA 3B4SA 3GIDA 2OH2A 5I5SA 4MTDA 3E22B 4Y8VB 2X6BA 5KFPA 1ZX3A 4KP4A 3E8BA 4DV4H 5KG0A 3D8CA 2ATLA 5BMVA 2ASJA 5I5WA 3CC4V 3ORRA 3CCJV 1U96A 3AG3B 4I0XA 5FNVB 3WFVA 5KG3A 4DR4B 2PYLA 3CE2A 4B3RH 1Z5VA 3HKDB 4B3MH 1RPRA 1KC8W 4X65B 2R7ZA 3AG4B 5H2FZ 4MTFA 5IYDG 1FJGO 4LFCB 4GYCB 5IJ9A 5BPHA 3H1HH 2C2DA 1WA8B 1G2WA 1B6QA 1I94H 2GBOA 2SCUB 1L8DA 1KP2A 4YIOA 5K2MA 2W9CA 2B1GA 3E2EA 4QJFB 1ZWIC 2DYRB 2Y48A 4I50B 1UC8A 3GTOA 2DYSB 1L0NH 3RV4A 1JKJB 3CMEV 4UCUA 2FK1A 1EFRG 3SPHA 4AYBA 1F51A 3EHBB 1KT8A 1BGWA 1T5EA 5CA0A 1PNLA 5B1AC 1NBMG 2V58A 5BR8H 1X59A 1A3GA 4O3RA 3M8AA 3HT5A 3UKMA 3A2FA 3ML0A 4JASA 3IGAC 4I55F 4TV8B 3PO3G 1I1LA 3BY6A 1XMOB 5KFHA 3W7XA 4B3SO 3PW2A 2JA6A 2YXHA 1XILA 3FB6C 2FB9A 1WCMG 4MTGA 1XHXA 2A1HA 1Y67A 2Q68A 1OBDA 4GKJO 4JI5O 1OCZC 2ZT9B 1CPYA 4J9QA 1M9NA 4L1KA 1H2MA 5CA1F 2NU9B 3DTUB 2RDIA 1SQGA 3RYHB 1LNQA 3T9BA 1B6SA 4UV8A 4RQFA 4YAJB 4WFBV 1VKZA 4CKCA 5C1PA 2N74A 4J9YB 3DF7A 2ZE7A 1KBLA 1H8HG 3OM3B 3Q4HB 5FPOA 1KP3A 3GV5B 5IYZF 5JJJB 3HKZA 4IZOA 4JYYA 2VS0A 5LGNA 2PF4E 3JATA 1OHHG 3BACA 5GTIZ 2JDIG 3G4SV 5BYAA 2KKWA 4PDVA 4A3BG 4A3GG 3WU2Z 2XHBA 4BBRG 3N2GB 1V51A 3UO2A 4LF5O 1VARA 3TEKA 2DWEC 4JAVA 1X4TA 3W7SA 3V4SA 1I5YA 2R86A 5EIBC 1Y74A 4TV9F 4NTWA 2BOBC 3CC2V 5DG8A 1NR1A 3HPLC 4RNMA 4ZI7A 3QZ8A 1V55B 4JPRA 1DAAA 4H37A 3T5KA 4DL6A 2EIJB 5LYJA 1H2KA 2HR3A 4GC7A 4BW9A 3AG2C 4YJ3B 1GGOA 5J2UA 2ZDGA 5EWFA 1SC5B 4O7RA 5AG2A 2VQEH 4LFBB 1NKDA 2VWJA 4F50A 2R7MA 2LJ2A 1HNWB 4MA0A 3RAXA 3JASB 4HNTA 5HFMA 4HYKA 1JQ0A 4MVMA 2BR0A 5LHIA 3OMAB 2FPGB 5KKNB 3HKEA 1TVKB 3OGCC 1GN3A 3N6RA 2XGQA 4NYEA 4J9RA 4JI2B 1A0GA 1E4EA 2EINC 2C35B 4DV6B 2FL4A 5A2QW 2B9ZA 2QTSA 4Q4CA 2XOKG 5LOVB 3CCUV 3ZHUA 1HWYA 2XCLA 3CP1A 4KFMA 2W9BA 2DIKA 1RYSA 2UXDB 2FK3A 4DV5H 2WLKA 1Q86W 1B6RA 4Q43A 1NT2B 3I4NG 1S03G 3FKIG 2CDYA 2UVRA 5L3FA 1FFXB 4LR3A 1MZEA 1IOWA 2WLLA 3JYCA 4DR2O 2R8HA 2W71A 1FXVA 1Y1WG 2ZM6B 4ETSA 4EKWA 3T1HO 1SQXH 1R6NA 4TSFG 4PELA 1KTAA 2XAGA 4IIJA 1DIKA 2JIZG 4Q0YA 4K3AA 1WSCA 2NU6B 3OT7A 1Q6UA 2EIKC 3N42B 1DLBA 1N8RW 3CWBH 5DLGA 4F6RB 4X1YB 5LXTA 4TQDA 5J2TF 4DR6H 5CB4A 2JA8G 3CRCA 1TWHA 3D3QA 4RO2A 4WFFA 2CTWA 2COJA 3OR6C 4YY3H 1H2NA 3RYCB 1IBMB 3H1KH 2L35A 4D7TA 1M90W 3T1CA 4NZNA 4ED1A 5IJ0B 4NXNO 4QIWA 3HOXG 4JI3H 3N8DA 5CMUA 2ZDIA 2BSKA 3TW7A 2UUCO 2ZDQA 2DWDC 4A2AA 3CMAV 4BWAA 4KXRA 5IJ9B 3GIJA 2Z5UA 3OUFA 4DLKA 4DUYH 3KCYA 1Y1VA 2HHHB 1RM1B 4GLWA 4GX2A 2EJ3A 3C0FB 3BA8A 4PV1B 4FE2A 4JI6B 1R3IC 4DIMA 2RF4A 1L1FA 2P22C 3HOVG 3A0RA 1Q90D 2Y69C 3K9SA 3RVZA 4I4TA 4NXMB 3ZX6A 4I55B 4B7EA 4RAIA 4FM2A 1MABG 4DV2B 2Y4TA 1IBKO 3AK2A 2OIGA 2EIMC 4BW5A 2Y4RA 4X64H 1M56B 5DECA 4DRXA 4ZOLF 4J7KA 4HNAB 4CKBA 4NR1A 1HDJA 1M7JA 5IYDO 3MFHA 4J7ZA 2R93G 5L1JA 5CA1B 2IJJA 2KB1A 5H6RA 3G6YA 4NYKA 5KG4A 2ALZA 4UCRA 4J10A 3VPDA 3WWIA 1Y66A 1BZKA 4LF4B 2BE3A 2DAAA 2DE0X 1CXZB 3K5IA 3SYQA 3Q8RB 2YICA 4O7NA 1V9PA 4A93G 4XDKA 5IDJA 1IX9A 3HKBA 2WWWA 5IYZB 4DR4H 1US6A 3LSQA 4U3JB 5DQHA 3PW5A 4UB8Z 5EDWA 4ABMA 4CMFA 1SQFA 4B3TH 2HG5C 1AVMA 1XQ8A 2ZKOA 2PY5A 4HNVA 1R9TA 5KFSA 4X65H 3H1LH 1FXKC 1KBHA 4LFCH 2QWPB 2KG7B 3LNNA 1K34A 2UXCB 3Q8QB 5DM6V 4LF9B 3J80N 3GTQA 1R73A 3W7TA 5KT2A 4AHCA 4JV5O 3UO3A 4DK1A 5C8YA 4O7VA 1MZBA 3M99B 4LWSA 4FFBA 4K0KB 4Q45A 4X1IA 5L3GA 4U3FH 2P90A 2QKAA 4AILC 2IH3C 5JJEB 3I12A 5D5PA 1I2LA 5LHHA 3J81N 3TQTA 2R8IA 2WLMA 3SPCA 1N0NA 3OEEG 3RB3A 2B1IA 2EILB 4JYAO 4LCUC 5LYJB 4EBDA 3HOUG 2VOBA 2NR5A 2YDEA 4HR7A 3B40A 4GC6A 1TAEA 5B3SC 2Q8VA 4Q4DA 1Z2NX 3RIZA 1N4CA 1I1MA 3HO8A 4ECXA 4DRFA 5LA6A 2WAQE 3MR2A 1YVWA 3OEHG 1I1KA 4DV5O 5KT5A 1XNQB 4PI0A 1CKOA 2LO1A 2QJ1A 3WNZA 4J0MA 2F93B 1I7NA 5EZYF 3ASOB 5L1IA 4DR5B 3BQ0A 2Y0SE 4FZ0A 3P3PA 2XGPA 1CQIB 4CH5A 4WD3A 2I80A 2BCCH 1KKCA 3CCRV 2LGQA 1XI1A 3R65A 1FS0G 3T54A 3BG5A 3U0ZA 1K33A 4O2BF 1AJNA 2QWRB 1YTFD 2GV9A 4DR6O 1VAJA 2GHYA 4PZ7A 1QR8A 2HVJC 2XASA 4LNUA 4QWBA 1SEIA 4B7KA 2YXLA 3LP8A 3ABLB 1WB8A 1YHQV 2ADPA 3MAQA 2J6UA 4EEQA 3UYYA 1SF9A 2OIEA 4DV7O 5J2TB 5BR8B 2AGAA 4JI3O 2UUAO 3T9FA 4MV4A 5JVLA 2YS7A 1QQCA 3FAVB 3G71V 3M9OB 2OYQA 4MVQA 2X0SA 4MVSA 1KMIZ 4X20B 1PP9H 1R6TA 2ZCEA 4R7RA 2CW8A 3WWHA 1SQPH 5FLXW 3K03A 1Q81W 4C7UA 1YIJV 2ZR2A 2FKLA 4JTAB 5EBWC 4ZBMA 4TUYF 3FKIA 5KT7A 3JAKA 4IRDA 2P4KA 3VPCA 1YJNV 4JAUA 3M7MX 3LQSA 4O4HF 3SYOA 1Y1WA 3RYFA 2E76B 2VUMA 4FBTA 5H9CA 2CGNA 5KUKA 1H2GA 3M4IA 2P4VA 4LFBH 3V6HA 3H4BA 1HNWH 3ABKC 3VBBA 4WF9V 5EYPA 4WBNF 2C22A 2Y4UA 2FE3A 2QA4V 5FNVF 1ZLZA 1ZTEA 2W6IG 3FFQA 5A9GA 3RFCA 4JI2H 3RGZA 4J9LA 3ZRXA 2R92G 4DV6H 1M0TA 1A9XA 5CBGA 1B04A 4CHIA 1W93A 4O4LF 2Q7DA 4X1KB 1EUDB 4X64O 4DV0O 4WHXA 1MNGA 2ZE6A
chains in the Genus database with same CATH topology
3K3VA 4RB1A 3JATB 2UXDH 5DISC 1IBLH 4X64B 1P8LA 4PDBA 4UCOA 3B2EE 4YJ2B 4JV5H 1HR0B 1A0IA 3JARA 5LP6A 2Q0AA 4FM1A 1XNRB 2ZM6H 3L4KA 2F4VH 4ZOLB 4MTDA 2VUGA 3E22B 3VQXA 5D1OB 4DV4H 2Q2TA 4BWSC 1M5IA 5LMNB 1VS0A 4PHZA 5BMVA 2RGRA 3SJCC 1N32B 3TY8A 3JALA 4GKKH 2CW7A 4ZI7B 5IT9W 4JYAH 5FNVB 4DR4B 5KX5B 2PYLA 3L2PA 1SA0A 3RGXA 1IBMH 4B3RH 3ZS8C 3GJXB 4LF6H 4LH7A 5J2UB 1Z5VA 3HKDB 1VF7A 4B3MH 2F95B 1ZAUA 4X65B 4FM0A 2IM9A 2UUBB 3CB2A 4LFCB 4JI1B 4FLWA 2UU9B 4GYCB 3JAMW 4L8JA 1J5EB 5IJ9A 2E3CA 1WNSA 3KALA 1I94H 3HKEB 3QTCA 1L8DA 4CH4A 2MCTA 3SJAC 3K5OA 3QWUA 3BPZA 4I50B 1E4FT 2PTMA 5J2TA 4DR2B 2E5LB 4UCUA 3RYIB 3T1HB 1HNZB 2EX3A 4X20A 1BGWA 5IWAH 1T5EA 4FFBB 5CA0A 4FLXA 4IHJA 5LL6b 4Q6GA 1S68A 4FLZA 5BR8H 5JJNB 4JI6H 2YI9A 2ZIOA 4O4JA 3A2FA 3N2KA 3KAKA 1N34B 4M7EA 4LMYA 2OWOA 5FD6A 3HKCB 5ITZA 3W1BA 1TA8A 4TV8B 3LMLA 4RB2C 1XMOB 4DV7H 1HNXB 3K5NA 2UUAH 2UXBB 4IIJB 4NXMH 2RJZA 2HVQA 5D1PA 1P49A 5JH7A 5LXTB 3EYYA 5CB4B 4DUZH 1XHXA 4DV2H 1Q43A 4NXNB 5EZYB 4X62B 4DR1H 3KAJA 1SKVA 3N43B 1SQGA 1CKNB 2HVRA 1O9HA 3RYHB 3JAWB 2UUCB 4DR7H 4NVPA 4GKJB 4JI5B 1M4UA 3DF7A 2JVDA 4X1KA 4X66B 4I7HA 4MV9A 5FPOA 5K1XA 4LF4H 4MTEA 4DV1H 5JJJB 4LF8B 1XMQH 3JATA 2ZINA 3JSNA 5JVDA 1JFFB 1E4GT 4APMA 2KKWA 4LNUB 2VQFH 2XHBA 4YJ2A 4ZIBA 1Q5OA 3N2GB 3IAYA 2R70A 2HIVA 1X9NA 1X4TA 4ZOLA 4DV0H 5EIBC 3RR5A 4ZHQB 5D1OA 2UXCH 4LF9H 4UCVA 3RFRA 1IBKB 4ZI7A 3SR2C 3U11A 3T1YH 4CC6A 4TOIA 3PN1A 4K0KH 3VQWA 4TUYB 5KX5A 3OTOH 4I4TB 5LYJA 1TUBA 4BW9A 3NC0B 4YJ3B 1P16A 5J2UA 2VQEH 5LMUB 4O4HB 4LFBB 2CFMA 2VWJA 2PUSA 1HNWB 1Z2OX 3JASB 3WB2A 2Q7EA 3K5LA 4LSXA 3RTXA 4DV3H 4DRXB 3WB0A 3HKEA 1TVKB 2CAZC 4PZ6A 2YCHA 4JI2B 1Z5WA 1N36H 5JCOC 4DV6B 2JS5A 4WBNB 5A2QW 4IAJA 1XNQH 4I50A 4FVMA 4JI7B 5LOVB 4LF7B 4DR5H 2V4DA 4B3TB 3J80W 3RYIA 4UFZA 4O4LB 4TV9B 4CS4A 2UXDB 4DV5H 4JI8H 1FJGH 3HKBB 1NT2B 4LH6A 1IBLB 1Z2PX 4B08A 1S03G 2HEPA 2ZNIA 1FFXB 4LR3A 4EFEA 2E5LH 4TQFA 2ZM6B 3HKCA 2P5OA 3NBYB 2F4VB 4ETSA 4TV8A 1G6UA 4IIJA 4Q0YA 3OTFA 1FKAH 4DV4B 3RJ0A 4AQYH 3N42B 3N6XA 4F6RB 4X1YB 5LXTA 4TQDA 4DR6H 5CB4A 4GKKB 3KXYT 5C8YB 4KL1A 5EZYA 1XDNA 1AN7A 1TGOA 1XMOH 4X1IB 4YY3H 5KHGA 3RYCB 1IBMB 4E6NA 4B3RB 1CKNA 4D7TA 3RYHA 4B3MB 3JALB 5KHIA 1KU9A 4PZ8A 5IJ0B 1N33H 2BTQB 3THOA 2VPSA 4KHPH 4B3SH 4O2BA 4JI3H 1DGSA 1I94B 3VQVA 5KHJA 4CC5A 5GONB 2QM4A 5LA6B 4D7SA 4EQ5A 1JFFA 4CH6A 4RZQA 4A2AA 4BWAA 3S24A 1JMKC 5IJ9B 1D5AA 1WN7A 3N41B 2JGUA 3N2GA 4DUYH 3RF2A 5D5QA 2HHHB 5IWAB 4DR3H 4RB3C 4LFAH 4CS2A 2BTOA 3C0FB 3BA8A 4ZHQA 4JI6B 4JI4H 4LSAA 5JQGB 2R9AA 5K1PA 2P22C 4YHHH 2KSWA 3SGIA 3TY9A 1GYFA 2ZNJA 4O2AB 3WB1A 4DV7B 2W57A 4TUYA 2UUAB 4A2BA 4JI0H 4I4TA 4NXMB 3JSLA 1JJOA 4I55B 4RAYA 4OX9H 4YJ3A 4LF5H 4O4HA 3K59A 1WPBA 4RAZA 3VNNA 3ETQA 4DUZB 2R72A 4FM2A 4DV2B 3JASA 3E22A 4X64H 4DR1B 2F66C 4FLUA 4DRXA 1I7FA 4HNAB 1TVKA 1HR0H 3UQ8A 2PZSA 4UCTA 4DR7B 5CA1B 1XNRH 3BHPA 2HGSA 4WBNA 4O4IB 4UCRA 5FNVA 2RGVA 3H20A 2XIGA 3VQYA 5LOVA 5JCOA 4LF4B 4EFBA 3CSXA 4DV1B 5LMNH 3HKDA 1N32H 3JAKB 4O4LA 1V9PA 1XMQB 2WYOA 5EIBD 3HKBA 5IYZB 4DR4H 3RYFB 2YI8A 4U3JB 5KHHA 3GB8B 1FFXA 3NBZB 2VQFB 4B3TH 1SQFA 3UT5B 4MV7A 1QHTA 1Q8IA 3RWRD 1XQ8A 4RB0A 2PY5A 5JVDB 4X65H 3F8NA 4CS3A 3N44B 2Q7GA 5EYPB 4DV0B 2UUBH 2UU9H 4JI1H 3LNNA 1J5EH 4LFCH 2UXCB 4LF9B 2O03A 4F6RA 4X1YA 4AHCA 4DK1A 5C8YA 4EB6B 1MZBA 3T1YB 4K0KB 4FFBA 4X1IA 4K8ZA 5KMGB 3OTOB 3RYCA 4FM9A 1WH2A 4PI2A 4AILC 1O9GA 4DR2H 5JJEB 3MWMA 4JV5B 1S5JA 2VQEB 4I9QA 3T1HH 5D5PA 1HNZH 5IJ0A 3KYHC 2BTQA 3J81W 4DV3B 4UCSA 5LYJB 5LP6C 1TUBB 2VOBA 2ZJTA 1TAEA 1N34H 1Z2NX 3JARB 3RIZA 2VWKA 5GONA 1RSOA 3BABA 5LP6B 5LA6A 4DRFA 1N36B 3SJBC 1XNQB 4JYAB 3BA9A 4PI0A 1CKOA 1HNXH 2UXBH 2ZIMA 2QJ1A 4J0MA 2F93B 3U10A 1O75A 4DR5B 4LF6B 3J7AK 1L2ZA 3HXLA 5BMVB 4FLVA 4GLXA 3JAWA 4CH5A 1XHZA 1CKMA 4DV5B 4NXNH 5KHKA 4JI8B 1FJGB 2PYJA 4X62H 1XI1A 1SA0B 5JQGA 3U0ZA 3DSQA 2HHHH 2UUCH 2GV9A 2PGGA 4GKJH 4JI5H 4CH3A 2HIXA 4O2AA 4PZ7A 1XK5A 5FD5A 3QF7A 4X66H 4K8XA 4I55A 4FLYA 4LNUA 3ICXA 4AQYB 3K5MA 1SEIA 3W5OA 4DR6B 3IG0A 4LF8H 2YXLA 3TY5A 3MAQA 4EEQA 4YY3B 3L4JA 2YIBA 1HW7A 5J2TB 5BR8B 3K58A 4HNAA 1QQCA 3RGBA 2OYQA 1N33B 5CA1A 1KMIZ 4X20B 4KHPB 2ZCEA 5CA0B 1H2SB 2CW8A 4IHJB 4O4IA 3ZEDA 4B3SB 4R7RA 1BJTA 5FLXW 4JI3B 2HVSA 2Q7HA 3CHXA 2Q2UA 4O4JB 1ZHQA 3N2KB 4FLTA 3JAKA 1IBKH 1M0WA 5ITZB 3CVZA 3M7MX 4O2BB 3GDEA 4DK0A 5IYZA 1FVIA 3RYFA 3QG5A 4U3JA 3UT5A 5JH7B 5LMUH 4DUYB 3M4IA 4LFBH 1Q3EA 4DR3B 1HNWH 4LFAB 3BRCA 5FPRA 5EYPA 4HBNA 2F1MA 3K57A 2YIAA 4JI4B 2FE3A 1I6UA 3FMAA 2YIBD 3FFQA 1YEWA 4JI2H 3RGZA 4YHHB 4TV9A 1SYXB 4DV6H 4EB6A 1M0TA 1M93A 1B04A 1ZHSA 2WE6A 5KMGA 3BAAA 4JI0B 2WDTA 5EOYA 4X1KB 4JI7H 3N40P 4LF7H 4OX9B 2RQ6A 4LF5B 3W1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 B;  4UCS A;  1I94 B;  4LF8 B;  5DIS C;  3JSN A;  4X64 B;  4CC5 A;  1P8L A;  1TAE A;  4EQ5 A;  4UCO A;  3BAB A;  4DRF A;  1N36 B;  1HR0 B;  1A0I A;  3S24 A;  1XNQ B;  4JYA B;  1XNR B;  3BA9 A;  1CKO A;  2HIV A;  2VUG A;  1X9N A;  4DR5 B;  5D1O B;  4LF6 B;  2HHH B;  5IWA B;  2Q2T A;  4GLX A;  3RR5 A;  5D1O A;  5LMN B;  1CKM A;  1VS0 A;  4DV5 B;  4JI8 B;  1FJG B;  1N32 B;  3TY8 A;  3BA8 A;  4UCV A;  4JI6 B;  1IBK B;  4DR4 B;  4CC6 A;  4TOI A;  3PN1 A;  3L2P A;  3SGI A;  3TY9 A;  3GJX B;  4LH7 A;  4DV7 B;  2UUA B;  1ZAU A;  2HIX A;  3NC0 B;  1P16 A;  4NXM B;  3JSL A;  4X65 B;  5LMU B;  4PZ7 A;  4LFB B;  2CFM A;  1XK5 A;  2UUB B;  4LFC B;  4JI1 B;  1HNW B;  4AQY B;  2UU9 B;  3VNN A;  4DUZ B;  1J5E B;  4DV2 B;  3RTX A;  3W5O A;  4DR6 B;  3TY5 A;  4DR1 B;  3QWU A;  4EEQ A;  4YY3 B;  4PZ6 A;  4JI2 B;  5BR8 B;  4DV6 B;  3UQ8 A;  4DR7 B;  4UCT A;  4JI7 B;  4DR2 B;  2E5L B;  4UCU A;  4UCR A;  1N33 B;  4KHP B;  3T1H B;  4LF7 B;  4B3T B;  1HNZ B;  4B3S B;  4LF4 B;  4UFZ A;  4EFB A;  4JI3 B;  2HVS A;  4DV1 B;  2UXD B;  1S68 A;  2Q2U A;  1IBL B;  1V9P A;  4LH6 A;  1XMQ B;  1N34 B;  4EFE A;  2OWO A;  3GDE A;  3GB8 B;  1FVI A;  3NBZ B;  2VQF B;  1TA8 A;  3W1B A;  1XMO B;  2ZM6 B;  3NBY B;  1HNX B;  2F4V B;  2UXB B;  4DUY B;  2HVQ A;  5D1P A;  4DR3 B;  4DV4 B;  4DV0 B;  4LFA B;  5FPR A;  4NXN B;  2UXC B;  4LF9 B;  4GKK B;  4X62 B;  4JI4 B;  1XDN A;  1CKN B;  3T1Y B;  4K0K B;  1IBM B;  4E6N A;  2HVR A;  4YHH B;  4B3R B;  1CKN A;  3OTO B;  2UUC B;  1B04 A;  4B3M B;  4GKJ B;  4JI5 B;  3BAA A;  4JI0 B;  4PZ8 A;  4JV5 B;  2VQE B;  4OX9 B;  4X66 B;  4LF5 B;  5FPO A;  3KYH C;  3W1G A;  1DGS A; 
#chains in the Genus database with same CATH topology
 5HV6 A;  1NI8 A;  2UXD H;  1DTO A;  2YRW A;  2JA7 G;  3MHS C;  1AI6 A;  2KSD A;  2COI A;  3B2E E;  3L74 H;  5EC2 C;  4O7S A;  3CCQ V;  1LR1 A;  1V54 B;  1I3Q A;  4XX0 B;  2FLP A;  4FM1 A;  2CTR A;  2ZM6 H;  3L4K A;  2FYU H;  5D8D A;  1Y76 B;  3CYO A;  3KCX A;  4ZOL B;  2YZL A;  5D1O B;  4BAY A;  2Q0O C;  3RBZ A;  2Q2T A;  4BWS C;  4BR6 A;  4YP3 A;  4PHZ A;  5KFV A;  1EKV A;  2RGR A;  3TY8 A;  5HFL A;  1AIL A;  4A3K G;  4U6P A;  3RB0 A;  3RV3 A;  2QB5 A;  1KJJ A;  1SA0 A;  1IBM H;  4LFC O;  3H1J H;  4G27 B;  3FB7 C;  3ZS8 C;  3GJX B;  4LF6 H;  4LH7 A;  4FFM A;  2HGW A;  1ZAU A;  4R7C A;  2AXT Z;  4K35 A;  2E75 B;  4FM0 A;  4A3I G;  1JDE A;  4JI8 O;  3CB2 A;  4JI1 B;  1JXL A;  3T5H A;  2AGO A;  5H6Q A;  1WNS A;  1NTM H;  4W4K A;  3KAL A;  3H0G G;  1BL8 A;  3QTC A;  1AP6 A;  3SJA C;  2PI5 A;  4L87 A;  2I87 A;  5DQG A;  3QWU A;  2EJ0 A;  1S10 A;  3BVO A;  2R93 A;  1E4F T;  2PTM A;  1B06 A;  2CE4 A;  1MMM A;  2J6S A;  1ROP A;  1EZ1 A;  4MSW C;  4NTY A;  3RYI B;  4Q20 A;  1HNZ B;  2EX3 A;  4LWS B;  5JQG F;  4FFB B;  4C5C A;  4HNU A;  4IHJ A;  1JJ2 U;  3ETG A;  2QYZ A;  4Q6G A;  1DF4 A;  1XMO O;  1VQ4 V;  5LGT A;  4FLZ A;  4JI6 H;  3GTP A;  2ZIO A;  4O4J A;  4JTC B;  3N2K A;  4LC1 A;  5B1A B;  1N34 B;  3KAK A;  2HJF C;  5FD6 A;  2ETN A;  3SNO A;  4DL5 A;  3HKC B;  3DC5 A;  3W1B A;  3LML A;  1ULZ A;  1TUE B;  4KHP O;  1HNX B;  3K5N A;  1KB9 F;  1W0J G;  4NXM H;  2HVQ A;  1BQ0 A;  3OD4 A;  5D1P A;  5I60 A;  3ZMT A;  1P49 A;  5JH7 A;  2B63 A;  4O7T A;  4RNO A;  3K0D A;  3STL C;  3OHA A;  4ZQI A;  4DV2 H;  5EZY B;  4X62 B;  1DF5 A;  1CKN B;  4O4I F;  2HVR A;  1OCZ B;  1O9H A;  3OSN A;  3E8H A;  3KZI Z;  1W2B U;  2WLI B;  5CAE B;  2A06 H;  1XOU A;  2B5U A;  4R8U B;  1IUR A;  4J9Z B;  4MV9 A;  2ZDI C;  5K1X A;  4LF4 H;  4MTE A;  4U7N A;  4RZR A;  4FK5 C;  4LF8 B;  5DAA A;  2LQT A;  3AK1 A;  5LGU A;  4QIW E;  3GIK A;  4RU9 A;  1EN6 A;  1JFF B;  4YHH O;  1TWF A;  1OCC C;  3JD2 A;  3TGU H;  1KJ8 A;  4FFN A;  4APM A;  2YRX A;  1RJQ A;  2ADQ B;  4LNU B;  4YJ2 A;  3GTJ A;  4ZIB A;  1Q5O A;  2W6O A;  4OX9 O;  2DLN A;  1SZX A;  2HIV A;  3I56 V;  2ZGI A;  4Z2W A;  3ZN1 A;  2EJ2 A;  2UXC H;  4LF9 H;  2CTP A;  1C30 A;  1KEE A;  1K83 A;  2DQ0 A;  3CPW U;  3PFF A;  1QU7 A;  1JDB B;  3OR7 C;  1T36 A;  4K0K H;  1Q6H A;  3PN1 A;  1QLE C;  1HNW O;  3TW6 A;  4TUY B;  5KAI Z;  5KX5 A;  2EZP A;  3MFI A;  2WAQ A;  2Z04 A;  4XDJ A;  5KFY A;  1RJR A;  5LMU B;  4O4H B;  4I5S A;  4JYB A;  4A3D G;  2XCP A;  3SPI A;  4JI2 O;  2F23 A;  3AG2 B;  2Y0S A;  5IE9 A;  3WB2 A;  3P30 A;  3RT3 C;  3K5L A;  4DV6 O;  2YS6 A;  3CCL V;  3RTX A;  1OCO C;  2LW1 A;  4BY7 G;  4X88 A;  2QWQ B;  1K1Q A;  5KFJ A;  4WFE A;  4IWX A;  1Z5W A;  4O3P A;  2JS5 A;  4WBN B;  5IT9 N;  5BMV F;  1XNQ H;  2C2R A;  2EIN B;  2UUB O;  2P67 A;  1VQ8 V;  5BWU A;  1J5E O;  4LF7 B;  4DR5 H;  4B3T B;  3J80 W;  5I5X A;  4UVA A;  3RUP A;  1IYD A;  4O4L B;  1PD3 A;  3VMM A;  5DGA A;  3MWE A;  1BT8 A;  4GX0 A;  3ZHR A;  4LH6 A;  4HN2 A;  3IN5 A;  2HKO A;  2ZNI A;  4RQE A;  3CCE V;  2E5L H;  2DPJ A;  3FYI B;  5KG5 A;  4ECS A;  4TWK A;  2ITC C;  4IRK A;  1FKA H;  4I7Z B;  3GTK A;  3N6X A;  4DL3 A;  3AG7 A;  2A7W A;  1S9F A;  1JOY A;  3G6E V;  4GKK B;  2PI4 A;  2CTQ A;  2EIK B;  1TGO A;  2R92 A;  2NLJ C;  1GM9 A;  3QO5 A;  5KHG A;  1NU1 H;  4E6N A;  3OMN B;  3PW4 A;  2UXB O;  5CA0 F;  1KC7 A;  2Q5Z A;  2R8J A;  4CMD A;  2W8K A;  2JEX A;  3T4Z A;  4FFP A;  2VPS A;  2X6C A;  1DGS A;  2IP4 A;  3VQV A;  5KG7 A;  4C2M A;  3G6V A;  4YR0 A;  4D7S A;  2OTJ V;  5DGB A;  2V59 A;  2DPI A;  4DO2 A;  2HHH O;  2QK4 A;  1RYR A;  4RZQ A;  1BE3 H;  1I7L A;  2K9P A;  1K4D C;  2FPI B;  3S24 A;  3R9R A;  4CE5 A;  1AJQ A;  3KHH A;  3A8T A;  4X66 O;  1WN7 A;  3N41 B;  1I0H A;  4JI6 O;  4QSH A;  4RCN A;  1ZET A;  4A3J G;  2WLH A;  5IWA B;  3U54 A;  1EHI A;  5I5Y A;  1LUV A;  2CUG A;  2WB1 E;  2BTO A;  3E83 A;  5C3E G;  4ZHQ A;  5KFA A;  3BJY A;  4LSA A;  5JQG B;  1M6V A;  3PR4 A;  2GUZ A;  4R8C A;  5K1P A;  1Y4M A;  3DC6 A;  2M6Y A;  1W59 A;  2V7Q G;  2KSW A;  3AG1 C;  4FJC C;  1FYJ A;  2PN1 A;  3WB1 A;  3T99 A;  3ZBH A;  1PL4 A;  5LL6 Y;  3R5X A;  2Y69 B;  3U9S A;  2YU9 A;  3K59 A;  1K8A W;  3VNN A;  4DUZ B;  5CBH A;  4Z1V A;  2YC0 A;  2UVV A;  4DR1 B;  4FLU A;  2VA3 A;  1I7F A;  4LF4 O;  2EIM B;  4PDM A;  3I55 V;  3RBD A;  3NXS A;  2GLT A;  5KT6 A;  4PDL A;  2PZS A;  4DR7 B;  2ASL A;  1BNC A;  3BHP A;  4F6E A;  4FS2 A;  5DG9 A;  4ECR A;  2JGD B;  1FPO A;  3L72 H;  4O4I B;  3KHG A;  1NVP D;  3ABM C;  1AR5 A;  4MV6 A;  3E5N A;  4ZI7 F;  1RK6 A;  4J41 A;  4O3S A;  1COW G;  2HJW A;  2J6T A;  3EVK A;  4CKE A;  4J42 A;  5LYJ F;  2ZXW B;  3ZHT A;  2W0X A;  2W6P A;  1XMQ B;  2WYO A;  4C5A A;  5J2U F;  2XAH A;  3B77 A;  1BMF G;  5KHH A;  1A32 A;  4JI7 O;  3JRW A;  1DV1 A;  3SJQ C;  4F4Y A;  4A3L G;  3UT5 B;  4UB6 Z;  2UXC O;  4MV7 A;  1Q8I A;  4DL7 A;  4CBC A;  2X6A A;  4CS3 A;  4K0K O;  1JLL B;  2Q7G A;  4JI1 H;  1UPG A;  1IBL O;  4MS2 A;  4NKG B;  2O03 A;  1FXK B;  1ZSP A;  2PMZ E;  3KHR A;  1GO3 E;  3L73 H;  3ETE A;  1EN4 A;  3T1Y B;  2EJ7 A;  3CXH F;  3LNM B;  5KMG B;  2XCA A;  4PA6 A;  1QVG U;  4FM9 A;  1WH2 A;  1K7D A;  2ITD C;  4PI2 A;  2HLD G;  2E2I A;  2W7O A;  1S5H C;  1PK8 A;  1S5J A;  4DV4 O;  1NTK H;  2AZ0 A;  4O7L A;  4I9Q A;  1I50 A;  1HNZ H;  1Z2G A;  2BTQ A;  2DWC A;  1R1B A;  4H33 A;  4UCS A;  5KFE A;  5KG2 A;  4B3R O;  4DAA A;  5KFQ A;  4DR5 O;  1N34 H;  4IIJ F;  5GON A;  1RSO A;  2LFS A;  4B3M O;  2RDC A;  5B3S B;  4BIU A;  1VMG A;  5LXT F;  1M1K W;  4J9O A;  1HNX H;  5CB4 F;  1YI2 V;  3DTG A;  1OZ0 A;  3D36 A;  1O75 A;  1BQZ A;  4LF6 B;  1WR2 A;  2DYR C;  5BMV B;  4QPK A;  1I94 O;  5EWG A;  2YL2 A;  1XHZ A;  5B1N A;  1CKM A;  4O7Y A;  3G67 A;  1WPX A;  1FJG B;  4P2Z A;  4I0X B;  4QNH B;  2PYJ A;  4O83 A;  3EFF K;  4X62 H;  1FKA O;  3MR5 A;  2ILM A;  5EC1 C;  2QM8 A;  4QIW F;  3DSQ A;  2YZN A;  3CEB A;  4JZ2 A;  1ENV A;  3I5D A;  4O2A A;  5KFT A;  5IY5 C;  2GSM B;  1XK5 A;  3QF7 A;  4DW0 A;  2W6J G;  3QVN A;  4K8X A;  5BR8 O;  4AQY B;  3ICX A;  1BHA A;  3K5M A;  4MV8 A;  4LF8 H;  3UZO A;  5KFU A;  2W9C B;  3GV8 B;  2YIB A;  3LUL A;  4N21 A;  1JR9 A;  1SZT A;  4PD4 F;  5LHG A;  3K58 A;  3SDL A;  1GM8 A;  1BHB A;  3O9O A;  1NR7 A;  2YEV A;  3K3P A;  3OUU A;  4GUN A;  3RGB A;  5FLM G;  3K79 A;  5CA0 B;  3GIM A;  4F4Z A;  4B3S B;  3CJH A;  3R5F A;  3TIN A;  1BJT A;  4DL2 A;  2YZM A;  2Q2U A;  1MA1 A;  4IWY A;  1NH2 D;  5BWV A;  1AJP A;  4I4T F;  1K5S A;  1M0W A;  4A3C G;  1ORQ C;  2VRZ A;  5CE8 A;  1RFY A;  4QPJ A;  1FVI A;  1V4Y A;  2O57 A;  2ZR3 A;  4MTO A;  1THZ A;  1N56 A;  4QWD A;  5LMU H;  4O82 A;  5FJ8 G;  1Q3E A;  4DR3 B;  4RUA A;  2W6N A;  4LFA B;  5FPR A;  1IXB A;  3ABK B;  1I6U A;  1NVP B;  2YIB D;  5KFW A;  4PA3 A;  1WLE A;  1CS0 A;  4EB6 A;  1M93 A;  4WFH A;  4JI0 B;  3BAA A;  4JXU A;  4R6Z A;  2W6Z A;  4LF7 H;  3GTM A;  2RQ6 A;  1Q82 W;  4LF5 B;  5DED A;  1NJI W;  3JAT B;  4RWU A;  4ASU G;  1WCM A;  2DQ3 A;  5EWE A;  3A0H Z;  4EYI B;  4IT5 A;  2MW2 B;  3U0G A;  1A0I A;  1I5X A;  2R6F A;  3JAR A;  3STZ C;  1EUC B;  3QO7 A;  4PA4 A;  5LP6 A;  2VQE O;  4TQR A;  2IU3 A;  1XNR B;  2MK3 A;  1CE8 A;  1Y74 B;  1AI5 A;  4O84 A;  5B1O A;  5C8Y F;  3G8C A;  4WFG A;  1M5I A;  2YWV A;  4BXX G;  1N32 B;  3CRM A;  4GKK H;  2UXX A;  4ZI7 B;  1SES A;  5IT9 W;  3TCU A;  5DQI A;  3L2P A;  2LFR A;  5J2U B;  1YZB A;  2F95 B;  2Z02 A;  3ZMS A;  1MSW D;  1S77 D;  1OJH A;  2IM9 A;  2EZO A;  3TJT A;  2E2H A;  1G1X B;  2V4R A;  1VQ6 V;  2UU9 B;  2OCC B;  5LA6 F;  4L8J A;  2R9R B;  1JCH A;  3OSP A;  4D6T H;  2WB1 A;  3HKE B;  2XC9 A;  3K9A A;  4H13 B;  4MTX A;  2D2C B;  1E4E B;  2R7L A;  4Q8F A;  1HNZ O;  3K06 A;  3OFN G;  2DAB A;  2EUL A;  5I47 A;  4J9M A;  4DR2 B;  1ZL8 A;  2E5L B;  5H5N A;  3DAA A;  3T1H B;  2W9B B;  3RB4 A;  5EK0 A;  1WAZ A;  2V4Q A;  4JYC A;  5IWA H;  3FYE B;  4ECQ A;  2VQD A;  5LL6 b;  3HOY G;  1GK9 A;  1S68 A;  1HNX O;  5JJN B;  4YY3 O;  2YI9 A;  3B8M A;  4FZ1 A;  2WLL B;  3RB6 A;  5E25 A;  4LMY A;  2OWO A;  3F7Y C;  5ITZ A;  4RB2 C;  4XBF A;  2QM7 A;  3EXA A;  2N04 A;  2V1D A;  3DGE A;  3AYH B;  1PNK A;  3NGD A;  1VQ9 V;  4IIJ B;  4X62 O;  2RJZ A;  3H3V H;  1PL0 A;  2HHF A;  1XDC A;  5LXT B;  3Q2O A;  1PPJ H;  5CB4 B;  4DUZ H;  3OGI B;  4NXN B;  4QW8 A;  2RMK B;  4OXS A;  3ZRS A;  1VIB A;  1XBL A;  1UJW B;  1EKF A;  3ZRW A;  4P9P A;  4J7J A;  4DR1 H;  4E2L A;  3KAJ A;  1SKV A;  5C44 G;  3N43 B;  1S3J A;  3E35 A;  4WFA V;  3U9T A;  4E4T A;  3GII A;  2UUC B;  3LDC A;  4IR9 A;  4DR7 H;  4NVP A;  1FD9 A;  4DUY O;  5DGH A;  4R50 A;  1M4U A;  2EJR A;  1IYE A;  3HOZ G;  3LSU A;  3MHH C;  1GKF A;  3MJF A;  2JJ1 G;  2BSK B;  1UNN C;  1XMQ H;  3JSN A;  4UV9 A;  1DV2 A;  2PMZ A;  1Q6I A;  1E4G T;  2GQR A;  5L1L A;  4G3I A;  4XZ3 B;  2FP4 B;  3B8N A;  1OCC B;  4U7C A;  2R7Z G;  3IAY A;  2R70 A;  4ECT A;  3B09 A;  4E4E A;  1UC9 A;  1MG1 A;  3RR5 A;  2X7R B;  5L3B A;  1H38 A;  3FB5 C;  5KA5 A;  2K1E A;  2FPP B;  1VEW A;  2YEV B;  3TIG A;  1E1Q G;  3LUT B;  3FX7 A;  1IBK B;  1VF6 A;  3SR2 C;  4F4W A;  3T1Y H;  4TOI A;  4X89 A;  3VQW A;  3BEH A;  1H8E G;  1AUV A;  4I4T B;  1VQL V;  1QLE B;  3WG7 C;  2H3O A;  1UFI A;  1WRV A;  4EGQ A;  2CFM A;  2QF7 A;  1OCR C;  2XAF A;  2PUS A;  3Q8P B;  5CA3 A;  1Z2O X;  2CNQ A;  4HZ3 A;  2Q7E A;  1F4N A;  4OPH A;  4DR4 O;  2Q9L A;  4RUE A;  4DRX B;  1WA8 A;  3WB0 A;  4H0L B;  2CAZ C;  4LF7 O;  1B3Q A;  4B3T O;  1OCO B;  4PZ6 A;  2YCH A;  5BYB A;  1URF A;  5E79 Z;  3GVM A;  3X2Q C;  1GAX A;  4IAJ A;  4X65 O;  3ETH A;  4QJF A;  4I50 A;  4FVM A;  1SCU B;  1K4C C;  1AR1 B;  2R87 A;  4GX1 A;  2RDJ A;  5KFC A;  1U97 A;  3KHL A;  3V6J A;  2V4D A;  4UUJ C;  4UFZ A;  2FTK A;  1FJG H;  1NZ6 A;  4BBS G;  3HKB B;  3RAQ A;  3JAM N;  4YQW A;  5KG1 A;  2P06 A;  2CK3 G;  2HEP A;  2ABJ A;  5KUM A;  4CZZ A;  4MVO A;  2BQU A;  1GSA A;  1VQM V;  2NVY A;  1F7Y A;  3OW2 U;  1QBZ A;  5KFK A;  4TQF A;  1M57 C;  2CZG A;  3C3S A;  2DN9 A;  2P5O A;  5H80 A;  3U55 A;  5JWP A;  2F4V B;  5KFO A;  4TV8 A;  1D2D A;  1QNM A;  3GB7 C;  5B1B C;  4EG0 A;  1KD1 W;  5KFR A;  4A5U B;  3OTF A;  5BZB A;  2R84 A;  2JS3 A;  4AQY H;  1XUQ A;  4HQ6 A;  3ASN C;  3F5T A;  4JZG A;  1P7B A;  4JV1 A;  1I2K A;  5C8Y B;  2AHY A;  1AN7 A;  2HDK A;  4IYI A;  4X1I B;  1GMG A;  4UUG A;  3CXC U;  3CRR A;  4KUM A;  2JEU A;  4M0J A;  3EPG A;  1YTF B;  4JAA A;  2WLJ A;  4IHJ F;  3RYH A;  2KQX A;  5KHI A;  1KU9 A;  2VPQ A;  4PZ8 A;  3THO A;  4O4J F;  4QW9 A;  3GIL A;  3CQZ A;  4B3S H;  2GTS A;  1W96 A;  2L6L A;  3QZ7 A;  3Q4H A;  3WWJ A;  4CC5 A;  5LA6 B;  4EQ5 A;  3D36 C;  5JH7 F;  4CH6 A;  1VQ7 V;  4ZKI A;  1VP7 A;  4O81 A;  3T9A A;  1D5A A;  4FGR A;  1NTZ H;  1XL6 A;  5BPF A;  5I5V A;  1SQB H;  4DW1 A;  2JGU A;  3N2G A;  1QCE A;  2VA2 A;  4LP8 A;  4JUZ A;  1VQ5 V;  3GQC A;  4DR3 H;  4RB3 C;  3BQ2 A;  5C93 A;  4LFA H;  4CS2 A;  1VQK V;  2Q69 A;  2COG A;  1J95 A;  1GH6 A;  2DW4 A;  4X8A A;  1CP9 A;  4DUZ O;  1GYF A;  4DV7 B;  2UUA B;  4A2B A;  2I8C A;  4FFL A;  4JI0 H;  3M9M B;  1JJO A;  3AG1 B;  4RAY A;  4RUF A;  4YJ3 A;  1PV0 A;  4LF5 H;  2C2E A;  2W6M A;  1S0M A;  3JZF A;  4TM5 A;  1R6K A;  4DR7 O;  1E1R G;  4YJ2 F;  1TWG A;  3JAS A;  2QE7 G;  2F66 C;  2QWO B;  2CKZ B;  1TVK A;  5BWW A;  5L3C A;  4UCT A;  3UCS C;  1XNR H;  4UVC A;  4LFB O;  2HGS A;  1SQQ H;  4EBE A;  4BY1 G;  4I9W A;  3H01 A;  3JCZ A;  5F9L A;  3T2M A;  2OLS A;  1KEC A;  2FML A;  5JCO A;  5LOV A;  2CNV A;  3ZN0 A;  4EFB A;  2UVU A;  5IYC G;  4DV1 B;  2A79 B;  3ABM B;  5I5U A;  5KX5 F;  2G38 A;  1N32 H;  3JAK B;  3G8D A;  3APQ A;  2QKC A;  3RYF B;  2YI8 A;  1AUX A;  1YJ9 V;  2DMX A;  5TIS Z;  1FFX A;  2VQF B;  2NN4 A;  3SPJ A;  3HR0 A;  4PDR A;  1P84 F;  4EBC A;  3D3I A;  4FBU A;  2JJ2 G;  3FB8 C;  2UXD O;  4XYM B;  1GN4 A;  2M7W A;  5EYP B;  4DV0 B;  3N44 B;  3KRE A;  2UU9 H;  5IYB O;  5L3E A;  1SET A;  2DJV A;  4NZO A;  2V9W A;  4JV2 A;  3APO A;  4X1Y A;  4F6R A;  1CQJ B;  5I5T A;  3ZCC A;  3GWK C;  3ZMZ A;  2ZM6 O;  1IXM A;  2C2A A;  3OTO B;  3RYC A;  1N48 A;  2P6J A;  3GWO A;  1Y1V G;  4PJ0 Z;  1O9G A;  4DR2 H;  2HJD A;  3SYC A;  5F2V O;  3TET A;  2IW5 A;  4GZR B;  3T1H H;  2YID A;  5IJ0 A;  2NNU A;  2BQ3 A;  4PA9 A;  3J81 W;  2IA6 A;  3CS5 A;  1JX4 A;  4DV3 B;  2OT5 A;  5LP6 C;  1F23 A;  1KKD A;  1IBM O;  3OAA G;  2ZJT A;  2GPS A;  3LWB A;  5KFD A;  1WB7 A;  4LF6 O;  5DG7 A;  3P32 A;  1N36 B;  4ICG A;  1EM1 A;  3W7W A;  3I4M G;  3SJB C;  3UM7 A;  2IJH A;  3OHB A;  3BA9 A;  1A48 A;  2GPW A;  1CEZ A;  3U10 A;  3JD3 A;  2YW2 A;  3J7A K;  4TT3 G;  3HXL A;  3T7A A;  2WA4 A;  3JAW A;  3CSW A;  4GX5 A;  4NXN H;  1K92 A;  4JI8 B;  2GDS A;  1ARO P;  2NUA B;  1SA0 B;  2QKS A;  2W9A A;  5L3D A;  1VBG A;  4ED7 A;  4MVZ A;  3V6K A;  2W7P A;  2E74 B;  4AQY O;  2CGO A;  2HG8 A;  2JA7 A;  5KFL A;  2WA3 A;  1QVF U;  2UUC H;  3IC7 A;  2PGG A;  5BWX A;  2N05 A;  3NR7 A;  4CH3 A;  5KFF A;  3MD0 A;  4J80 A;  5KFN A;  4DXW A;  2QGN A;  5KT4 A;  5K3W A;  5FD5 A;  3ETD A;  4I55 A;  1YF2 A;  2FKX A;  5IY5 B;  4ED2 A;  1MSD A;  1EZV H;  3IG0 A;  4J9N A;  2QEX V;  1PKX A;  3TY5 A;  1QLN A;  2YUA A;  5CBF A;  2YS8 A;  3CX5 F;  1HW7 A;  4GT1 A;  4ECY A;  4RUC A;  4M9U A;  1Y6X A;  4NXM O;  4HNA A;  4ZHQ F;  4O86 A;  5F9N A;  2Y0P A;  1N33 B;  5CA1 A;  3PVX A;  4KHP B;  3E89 A;  4ED3 A;  4IHJ B;  4DV2 O;  5FLX N;  2GTA A;  2F43 G;  2Q7H A;  3CCM V;  3CHX A;  4O4J B;  3R23 A;  4X9Q A;  3N2K B;  1TWC A;  5JQW A;  1ZHQ A;  5C4X G;  4FLT A;  5BXZ A;  3CEI A;  1IBK H;  3H0G A;  4RNN A;  5CM0 A;  1IDS A;  4DR3 O;  2OCH A;  3GDE A;  4DK0 A;  5IYZ A;  4UVB A;  4LFA O;  3CRQ A;  4U3J A;  1XRE A;  5BY1 A;  1BCC H;  4JV0 A;  5JH7 B;  1K1S A;  1VBH A;  4PA7 A;  2ZD9 A;  4JF3 A;  3C90 A;  1JIH A;  2QDO A;  3BRC A;  4P30 A;  1K73 W;  1GLV A;  4YB8 B;  2KG7 A;  1AP5 A;  4JI0 O;  2F1M A;  3K57 A;  2YIA A;  4JI4 B;  2XND G;  3F5W C;  3OE7 G;  1GSO A;  1KJ9 A;  4G28 B;  3W7U A;  3FMA A;  4EGJ A;  2WTF A;  3AEI A;  1YEW A;  1JPX A;  4YHH B;  5KAF Z;  4TV9 A;  1Q7Y W;  1SYX B;  5KFI A;  4YIP A;  5GTH Z;  2WE6 A;  5EOY A;  3JD1 A;  3PO2 G;  3N40 P;  3L70 H;  4OX9 B;  1RK5 A;  1AI7 A;  4LF9 O;  2IMW P;  1S97 A;  2Q4P A;  3GTL A;  1K9M W;  1XNR O;  4PBC A;  3JRX A;  3S3X A;  3UZB A;  3QFF A;  4QE9 A;  1P8L A;  2RNB A;  5E1A C;  2HGX A;  1MZF A;  4UCO A;  1XEQ A;  2RCV A;  4YJ2 B;  5B5E Z;  5B66 Z;  4JV5 H;  1HR0 B;  4ECU A;  2A0L A;  2HVK C;  1N32 O;  3K5H A;  2F4V H;  4XYL B;  2VUG A;  3VQX A;  1VF6 C;  4NB5 A;  4ED0 A;  2WAM A;  3AG3 C;  5LMN B;  1EBO A;  1VS0 A;  3SJC C;  4IR1 A;  3JAL A;  4QWE A;  2CW7 A;  4C5B A;  4JYA H;  3IC9 A;  5KX5 B;  5IP7 G;  1XNQ O;  2FB5 A;  3ZIA G;  3R5H A;  3RGX A;  2UU9 O;  3J7A U;  2XAQ A;  3AG4 C;  1VF7 A;  2RN9 A;  2AGQ A;  1EKP A;  2Y0I A;  1EZJ A;  4MVU A;  2UUB B;  5GON F;  3JAM W;  4FLW A;  1J5E B;  2PBZ A;  3L75 H;  2E3C A;  1LUW A;  4MAM A;  2E5L O;  4JTD B;  5EBL C;  4CH4 A;  2MCT A;  2DYS C;  3K5O A;  2VUM G;  3BPZ A;  1BXR A;  5KG6 A;  3T9E A;  5J2T A;  3G6B A;  1IZ3 A;  3GTG A;  4IRC A;  3FAV A;  4DYL A;  3P3N A;  5KA6 A;  2Z0A A;  4X20 A;  4LBE C;  4PWQ A;  4FLX A;  3JZI A;  1WP7 A;  1S0V A;  3MR6 A;  4J9S A;  1RPO A;  2W8L A;  4O2A F;  3QO8 A;  4M7E A;  2NVX A;  2EIY A;  4AI8 A;  1C3O A;  1TA8 A;  5IYC O;  4DV7 H;  4IGG A;  2UUA H;  5BWR A;  2UXB B;  1VF5 B;  4NLG A;  5T14 A;  3JD4 A;  2CQY A;  2ARH A;  2JA5 G;  5HBR B;  1R3K C;  3R66 A;  4ME6 A;  3EYY A;  5EBM C;  4TQS A;  1Q43 A;  4YR3 A;  3FDS A;  3T5J A;  3ZHQ A;  2JRI A;  1S72 V;  2M05 A;  3S3W A;  2AQ4 A;  2Q67 A;  2X5R A;  1NS1 A;  1G8M A;  2NU7 B;  1KUQ A;  3JAW B;  4GKJ B;  2JEF A;  4JI5 B;  3H9V A;  1T3N A;  4MA5 A;  2DZD A;  2JVD A;  1K97 A;  4X1K A;  4X66 B;  4I7H A;  3BCC H;  2ZDH A;  4N23 A;  2Q73 A;  4ECV A;  1F4M A;  5DLF A;  4DV1 H;  3AX6 A;  3L9D A;  3PW7 A;  2ZIN A;  3LDE A;  5JVD A;  1P4R A;  4NTX A;  5DGI A;  4YXW G;  1IOV A;  2BQR A;  3ZHV A;  5JVD F;  5KFZ A;  3PR5 B;  5KS8 A;  2VQF H;  2QR4 A;  2UXN A;  4FU0 A;  1S0O A;  3AW8 A;  2GQS A;  1P7G A;  1R3L C;  4O3O A;  5KFB A;  4HAM A;  4HYO A;  3QNE A;  3HBL A;  4EEY A;  2YXY A;  1X9N A;  4QWC A;  4A3M G;  1MOF A;  1Y76 A;  3MR3 A;  4ZOL A;  4DV0 H;  4ZHQ B;  5D1O A;  2ASD A;  3LDD A;  3GIQ A;  1V55 C;  3G6X A;  4MV1 A;  4UCV A;  2GUZ B;  3RFR A;  2AGP A;  2EIJ C;  2W6Q A;  2FJZ A;  4DL4 A;  3U11 A;  4CC6 A;  3JZ6 A;  2FMA A;  1FXH A;  2QWN B;  3OTO H;  2ZXW C;  4WCE V;  3KTM A;  1TUB A;  3ZJZ A;  3NC0 B;  1P16 A;  2P0A A;  2NU8 B;  4U7O A;  2LGW A;  3L71 H;  4MVR A;  3WG7 B;  3KG2 A;  1GN6 A;  3SYP A;  4OPA A;  3T4D A;  4LSX A;  4J9P A;  5LP6 F;  4DV3 H;  1OCR B;  1XL4 A;  3ZHS A;  2A3Q A;  3GLK A;  3CD6 V;  1N36 H;  5JCO C;  3PJS K;  1PM9 A;  1GSH A;  2B63 G;  4JI7 B;  2R7N A;  4TVI A;  4JI1 O;  3X2Q B;  3HOW G;  1FFT B;  3RYI A;  5KFG A;  3JCU Z;  4CS4 A;  4TV9 B;  4ECW A;  2XD4 A;  2V5A A;  4JI8 H;  5L1K A;  3N27 A;  2F4V O;  1IBL B;  3WO1 A;  1Z2P X;  1SFO A;  4B08 A;  4O3Q A;  3E8F A;  3VPB A;  3GV7 B;  2J9G A;  4EFE A;  3SPG A;  2YYA A;  1KYO F;  3VOT A;  2C00 A;  3HKC A;  3NBY B;  3VA7 A;  2LW7 A;  1G6U A;  1M57 B;  4Z1M G;  4DV4 B;  3RJ0 A;  4MW8 A;  2CNU A;  5B1B B;  2P7T C;  3K0G A;  3MWD A;  5KFX A;  1N34 O;  3KXY T;  4KL1 A;  5EZY A;  1XDN A;  1Y14 B;  1XMO H;  2CH7 A;  1VQN V;  3ASN B;  4B3R B;  4FFK A;  4EYH B;  1CKN A;  3VOU A;  4B3M B;  2EBO A;  3JAL B;  1AR4 A;  1N33 H;  3DTF A;  2BTQ B;  1RP3 B;  2WLI A;  5IYB G;  4KHP H;  1FAF A;  5C1O A;  4O2B A;  4R8U A;  1I94 B;  4FPP A;  5KHJ A;  3ZMU A;  2DOS A;  5GON B;  1RSO B;  2QM4 A;  3QQM A;  2Z3Y A;  4O7Z A;  1JFF A;  4ED8 A;  2AW9 A;  4NZM A;  4BIZ A;  3WO0 A;  1JMK C;  2X0L A;  2JEG A;  3FKS G;  1G4Y B;  3LSS A;  1L0L H;  1RM1 C;  4YBZ B;  4A3E G;  3DXR A;  3UFX B;  3RF2 A;  1KUT A;  5D5Q A;  3H40 A;  4UXN A;  3IFX A;  4LF8 O;  2YZG A;  1NH2 B;  3NUA A;  1EYZ A;  5BWT A;  3HB9 A;  1SS3 A;  4JI4 H;  3O65 A;  2R9A A;  4QWA A;  2FK2 A;  3ZMV A;  1ZQ7 A;  4YHH H;  3PW0 A;  3OUS A;  3SGI A;  3TY9 A;  2ZE8 A;  2ZNJ A;  4O2A B;  2W57 A;  3TQ1 A;  5FL7 G;  4TUY A;  4O7W A;  1GN2 A;  3JSL A;  4AYB E;  1JA8 A;  4OX9 H;  1GO3 F;  2ZQM A;  4O4H A;  5JUM A;  1WPB A;  3T9D A;  4RAZ A;  3ETQ A;  2R72 A;  3TXQ A;  1M56 C;  4FIP C;  2R82 A;  3E22 A;  4J11 A;  4OGQ B;  4FMT A;  3CCS V;  5CN0 A;  1S76 D;  2XAJ A;  1HR0 H;  3FD9 A;  4DV1 O;  2R8K A;  3UQ8 A;  2QSA A;  5LMU O;  4P9O A;  4WBN A;  3RBE A;  4MW3 A;  5L9X A;  4ECZ A;  3CJH B;  5FNV A;  2RGV A;  3H20 A;  2XIG A;  3RVY A;  5C5J A;  3VQY A;  2YSU B;  1E79 G;  3K3W A;  3CSX A;  2JEI A;  5LMN H;  2VQF O;  3BQ1 A;  3HKD A;  2R7K A;  1WP8 A;  1YSC A;  4O4L A;  1N0J A;  3PZP A;  2ATK C;  5KLV H;  5EIB D;  4BIO A;  4ED6 A;  3GB8 B;  3NBZ B;  1QHT A;  2HFE C;  1D5N A;  3RWR D;  4RB0 A;  2LP7 A;  1EN5 A;  2JA5 A;  1HP8 A;  5JVD B;  3Q1K A;  3F8N A;  2XTA A;  5A2Q N;  2JA6 G;  4Q44 A;  2UUB H;  3OMI B;  3HKZ E;  1J5E H;  5CR5 A;  3A0B Z;  1YXB A;  3TXS A;  4F4L A;  2XUM A;  3OTO O;  3HB3 B;  4FS1 A;  4I50 F;  3F7V C;  3SYA A;  1YIT V;  3RW0 A;  1YDX A;  4MT8 A;  4EB6 B;  1BGY H;  2ODM A;  4FFR A;  4QE7 A;  4K8Z A;  3JD0 A;  3TII A;  4DV3 O;  1VQO V;  5KFM A;  1BS3 A;  3MWM A;  4JV5 B;  2VQE B;  3T9C A;  1OWT A;  2EIL C;  3ABU A;  3BFR A;  1DK1 A;  3K08 A;  3KYH C;  2Q6A A;  2ZE5 A;  1N36 O;  4GKK O;  1JVM A;  1TUB B;  4DQN A;  2IU0 A;  1W0K G;  4TV8 F;  4F4X A;  1KJQ A;  3JAR B;  3TK1 A;  2VWK A;  2OCC C;  1BSM A;  3BAB A;  5LP6 B;  2H94 A;  3ASO C;  3T5L A;  1T94 A;  3E86 A;  4JYA B;  5IP9 G;  2AHZ A;  3ORQ A;  2ZIM A;  2UXB H;  3KKY A;  3G80 A;  2BOC C;  3H1I H;  1JX9 A;  2HP8 A;  2PVP A;  1L2Z A;  1KQS U;  1GRJ A;  2JK5 C;  2IH1 C;  4GLX A;  4FLV A;  1AB3 A;  4DV5 B;  5KHK A;  3Q8S B;  3IJ4 A;  1WJZ A;  3EPI A;  4IYH A;  2WPD G;  3M9N B;  1YCI A;  4IL6 Z;  1PX2 A;  1SRY A;  5JQG A;  3E8G A;  4MV3 A;  2H8P C;  3CRA A;  2HHH H;  1GM7 A;  4Q8E A;  4GKJ H;  4JI5 H;  4GCZ A;  2HIX A;  5IWA O;  2D3O W;  1OV9 A;  1IVS A;  1K3E A;  4X66 H;  3ZRV A;  1PNM A;  2UVW A;  4FLY A;  1K5Q A;  3ABL C;  1SQV H;  2R85 A;  3W5O A;  4DR6 B;  2WLN A;  1N33 O;  1KJI A;  2ODT X;  1B33 N;  4YY3 B;  2VR1 A;  3L4J A;  2FLN A;  5GW7 A;  2JEJ A;  5KT3 A;  1ZL8 B;  3SI8 A;  4O3N A;  5HNE A;  4YAK B;  2IJI A;  4QGP A;  1S5L Z;  1OBG A;  2CH7 B;  1H2S B;  2JGD A;  3K04 A;  4O4I A;  3ZED A;  4JI3 B;  2HVS A;  1ZUQ A;  4DR1 O;  4XDL A;  4K6N A;  1R3J C;  3GIP A;  3SE7 A;  5FR9 A;  4W4L A;  5ITZ B;  4YR2 A;  1QR9 A;  2FLL A;  1RJP A;  4YJ3 F;  3CVZ A;  4O2B B;  3RN4 A;  3CCV V;  3QG5 A;  5LBQ A;  2W70 A;  3ETJ A;  3UT5 A;  4JI4 O;  2HHF B;  4DUY B;  1NQT A;  3MDS A;  3V4Z A;  1XMQ O;  3ZRW B;  4HBN A;  5DMX A;  3DXR B;  2C28 A;  1FXK A;  2W0F C;  4G2K A;  2A9H A;  2IJK A;  1AI4 A;  2WSS G;  2OTL V;  5J9P C;  5LOV F;  3ABT A;  1S0N A;  2AZ2 A;  4A3F G;  1SER A;  1ZHS A;  5KMG A;  2WDT A;  4JI7 H;  1VQP V;  1H2L A;  2AU0 A;  2IBZ H;  1GTO A;  3C3T A;  4JGS A;  1HR0 O;  2QTO A;  1ET0 A;  3W1G A;  3K3V A;  4RB1 A;  2R9I A;  5DN6 G;  2R8G A;  4FFO A;  4H44 B;  5DIS C;  3OUZ A;  1IBL H;  4X64 B;  3T1Y O;  1V54 C;  1YJW V;  3H4D A;  1I08 A;  2IBK A;  4PDB A;  3AK3 A;  4J9K A;  3CC7 V;  2XT9 A;  1TWA A;  5LMN O;  2Q0A A;  3B4S A;  3GID A;  2OH2 A;  5I5S A;  4MTD A;  3E22 B;  4Y8V B;  2X6B A;  5KFP A;  1ZX3 A;  4KP4 A;  3E8B A;  4DV4 H;  5KG0 A;  3D8C A;  2ATL A;  5BMV A;  2ASJ A;  5I5W A;  3CC4 V;  3ORR A;  3CCJ V;  1U96 A;  3AG3 B;  4I0X A;  5FNV B;  3WFV A;  5KG3 A;  4DR4 B;  2PYL A;  3CE2 A;  4B3R H;  1Z5V A;  3HKD B;  4B3M H;  1RPR A;  1KC8 W;  4X65 B;  2R7Z A;  3AG4 B;  5H2F Z;  4MTF A;  5IYD G;  1FJG O;  4LFC B;  4GYC B;  5IJ9 A;  5BPH A;  3H1H H;  2C2D A;  1WA8 B;  1G2W A;  1B6Q A;  1I94 H;  2GBO A;  2SCU B;  1L8D A;  1KP2 A;  4YIO A;  5K2M A;  2W9C A;  2B1G A;  3E2E A;  4QJF B;  1ZWI C;  2DYR B;  2Y48 A;  4I50 B;  1UC8 A;  3GTO A;  2DYS B;  1L0N H;  3RV4 A;  1JKJ B;  3CME V;  4UCU A;  2FK1 A;  1EFR G;  3SPH A;  4AYB A;  1F51 A;  3EHB B;  1KT8 A;  1BGW A;  1T5E A;  5CA0 A;  1PNL A;  5B1A C;  1NBM G;  2V58 A;  5BR8 H;  1X59 A;  1A3G A;  4O3R A;  3M8A A;  3HT5 A;  3UKM A;  3A2F A;  3ML0 A;  4JAS A;  3IGA C;  4I55 F;  4TV8 B;  3PO3 G;  1I1L A;  3BY6 A;  1XMO B;  5KFH A;  3W7X A;  4B3S O;  3PW2 A;  2JA6 A;  2YXH A;  1XIL A;  3FB6 C;  2FB9 A;  1WCM G;  4MTG A;  1XHX A;  2A1H A;  1Y67 A;  2Q68 A;  1OBD A;  4GKJ O;  4JI5 O;  1OCZ C;  2ZT9 B;  1CPY A;  4J9Q A;  1M9N A;  4L1K A;  1H2M A;  5CA1 F;  2NU9 B;  3DTU B;  2RDI A;  1SQG A;  3RYH B;  1LNQ A;  3T9B A;  1B6S A;  4UV8 A;  4RQF A;  4YAJ B;  4WFB V;  1VKZ A;  4CKC A;  5C1P A;  2N74 A;  4J9Y B;  3DF7 A;  2ZE7 A;  1KBL A;  1H8H G;  3OM3 B;  3Q4H B;  5FPO A;  1KP3 A;  3GV5 B;  5IYZ F;  5JJJ B;  3HKZ A;  4IZO A;  4JYY A;  2VS0 A;  5LGN A;  2PF4 E;  3JAT A;  1OHH G;  3BAC A;  5GTI Z;  2JDI G;  3G4S V;  5BYA A;  2KKW A;  4PDV A;  4A3B G;  4A3G G;  3WU2 Z;  2XHB A;  4BBR G;  3N2G B;  1V51 A;  3UO2 A;  4LF5 O;  1VAR A;  3TEK A;  2DWE C;  4JAV A;  1X4T A;  3W7S A;  3V4S A;  1I5Y A;  2R86 A;  5EIB C;  1Y74 A;  4TV9 F;  4NTW A;  2BOB C;  3CC2 V;  5DG8 A;  1NR1 A;  3HPL C;  4RNM A;  4ZI7 A;  3QZ8 A;  1V55 B;  4JPR A;  1DAA A;  4H37 A;  3T5K A;  4DL6 A;  2EIJ B;  5LYJ A;  1H2K A;  2HR3 A;  4GC7 A;  4BW9 A;  3AG2 C;  4YJ3 B;  1GGO A;  5J2U A;  2ZDG A;  5EWF A;  1SC5 B;  4O7R A;  5AG2 A;  2VQE H;  4LFB B;  1NKD A;  2VWJ A;  4F50 A;  2R7M A;  2LJ2 A;  1HNW B;  4MA0 A;  3RAX A;  3JAS B;  4HNT A;  5HFM A;  4HYK A;  1JQ0 A;  4MVM A;  2BR0 A;  5LHI A;  3OMA B;  2FPG B;  5KKN B;  3HKE A;  1TVK B;  3OGC C;  1GN3 A;  3N6R A;  2XGQ A;  4NYE A;  4J9R A;  4JI2 B;  1A0G A;  1E4E A;  2EIN C;  2C35 B;  4DV6 B;  2FL4 A;  5A2Q W;  2B9Z A;  2QTS A;  4Q4C A;  2XOK G;  5LOV B;  3CCU V;  3ZHU A;  1HWY A;  2XCL A;  3CP1 A;  4KFM A;  2W9B A;  2DIK A;  1RYS A;  2UXD B;  2FK3 A;  4DV5 H;  2WLK A;  1Q86 W;  1B6R A;  4Q43 A;  1NT2 B;  3I4N G;  1S03 G;  3FKI G;  2CDY A;  2UVR A;  5L3F A;  1FFX B;  4LR3 A;  1MZE A;  1IOW A;  2WLL A;  3JYC A;  4DR2 O;  2R8H A;  2W71 A;  1FXV A;  1Y1W G;  2ZM6 B;  4ETS A;  4EKW A;  3T1H O;  1SQX H;  1R6N A;  4TSF G;  4PEL A;  1KTA A;  2XAG A;  4IIJ A;  1DIK A;  2JIZ G;  4Q0Y A;  4K3A A;  1WSC A;  2NU6 B;  3OT7 A;  1Q6U A;  2EIK C;  3N42 B;  1DLB A;  1N8R W;  3CWB H;  5DLG A;  4F6R B;  4X1Y B;  5LXT A;  4TQD A;  5J2T F;  4DR6 H;  5CB4 A;  2JA8 G;  3CRC A;  1TWH A;  3D3Q A;  4RO2 A;  4WFF A;  2CTW A;  2COJ A;  3OR6 C;  4YY3 H;  1H2N A;  3RYC B;  1IBM B;  3H1K H;  2L35 A;  4D7T A;  1M90 W;  3T1C A;  4NZN A;  4ED1 A;  5IJ0 B;  4NXN O;  4QIW A;  3HOX G;  4JI3 H;  3N8D A;  5CMU A;  2ZDI A;  2BSK A;  3TW7 A;  2UUC O;  2ZDQ A;  2DWD C;  4A2A A;  3CMA V;  4BWA A;  4KXR A;  5IJ9 B;  3GIJ A;  2Z5U A;  3OUF A;  4DLK A;  4DUY H;  3KCY A;  1Y1V A;  2HHH B;  1RM1 B;  4GLW A;  4GX2 A;  2EJ3 A;  3C0F B;  3BA8 A;  4PV1 B;  4FE2 A;  4JI6 B;  1R3I C;  4DIM A;  2RF4 A;  1L1F A;  2P22 C;  3HOV G;  3A0R A;  1Q90 D;  2Y69 C;  3K9S A;  3RVZ A;  4I4T A;  4NXM B;  3ZX6 A;  4I55 B;  4B7E A;  4RAI A;  4FM2 A;  1MAB G;  4DV2 B;  2Y4T A;  1IBK O;  3AK2 A;  2OIG A;  2EIM C;  4BW5 A;  2Y4R A;  4X64 H;  1M56 B;  5DEC A;  4DRX A;  4ZOL F;  4J7K A;  4HNA B;  4CKB A;  4NR1 A;  1HDJ A;  1M7J A;  5IYD O;  3MFH A;  4J7Z A;  2R93 G;  5L1J A;  5CA1 B;  2IJJ A;  2KB1 A;  5H6R A;  3G6Y A;  4NYK A;  5KG4 A;  2ALZ A;  4UCR A;  4J10 A;  3VPD A;  3WWI A;  1Y66 A;  1BZK A;  4LF4 B;  2BE3 A;  2DAA A;  2DE0 X;  1CXZ B;  3K5I A;  3SYQ A;  3Q8R B;  2YIC A;  4O7N A;  1V9P A;  4A93 G;  4XDK A;  5IDJ A;  1IX9 A;  3HKB A;  2WWW A;  5IYZ B;  4DR4 H;  1US6 A;  3LSQ A;  4U3J B;  5DQH A;  3PW5 A;  4UB8 Z;  5EDW A;  4ABM A;  4CMF A;  1SQF A;  4B3T H;  2HG5 C;  1AVM A;  1XQ8 A;  2ZKO A;  2PY5 A;  4HNV A;  1R9T A;  5KFS A;  4X65 H;  3H1L H;  1FXK C;  1KBH A;  4LFC H;  2QWP B;  2KG7 B;  3LNN A;  1K34 A;  2UXC B;  3Q8Q B;  5DM6 V;  4LF9 B;  3J80 N;  3GTQ A;  1R73 A;  3W7T A;  5KT2 A;  4AHC A;  4JV5 O;  3UO3 A;  4DK1 A;  5C8Y A;  4O7V A;  1MZB A;  3M99 B;  4LWS A;  4FFB A;  4K0K B;  4Q45 A;  4X1I A;  5L3G A;  4U3F H;  2P90 A;  2QKA A;  4AIL C;  2IH3 C;  5JJE B;  3I12 A;  5D5P A;  1I2L A;  5LHH A;  3J81 N;  3TQT A;  2R8I A;  2WLM A;  3SPC A;  1N0N A;  3OEE G;  3RB3 A;  2B1I A;  2EIL B;  4JYA O;  4LCU C;  5LYJ B;  4EBD A;  3HOU G;  2VOB A;  2NR5 A;  2YDE A;  4HR7 A;  3B40 A;  4GC6 A;  1TAE A;  5B3S C;  2Q8V A;  4Q4D A;  1Z2N X;  3RIZ A;  1N4C A;  1I1M A;  3HO8 A;  4ECX A;  4DRF A;  5LA6 A;  2WAQ E;  3MR2 A;  1YVW A;  3OEH G;  1I1K A;  4DV5 O;  5KT5 A;  1XNQ B;  4PI0 A;  1CKO A;  2LO1 A;  2QJ1 A;  3WNZ A;  4J0M A;  2F93 B;  1I7N A;  5EZY F;  3ASO B;  5L1I A;  4DR5 B;  3BQ0 A;  2Y0S E;  4FZ0 A;  3P3P A;  2XGP A;  1CQI B;  4CH5 A;  4WD3 A;  2I80 A;  2BCC H;  1KKC A;  3CCR V;  2LGQ A;  1XI1 A;  3R65 A;  1FS0 G;  3T54 A;  3BG5 A;  3U0Z A;  1K33 A;  4O2B F;  1AJN A;  2QWR B;  1YTF D;  2GV9 A;  4DR6 O;  1VAJ A;  2GHY A;  4PZ7 A;  1QR8 A;  2HVJ C;  2XAS A;  4LNU A;  4QWB A;  1SEI A;  4B7K A;  2YXL A;  3LP8 A;  3ABL B;  1WB8 A;  1YHQ V;  2ADP A;  3MAQ A;  2J6U A;  4EEQ A;  3UYY A;  1SF9 A;  2OIE A;  4DV7 O;  5J2T B;  5BR8 B;  2AGA A;  4JI3 O;  2UUA O;  3T9F A;  4MV4 A;  5JVL A;  2YS7 A;  1QQC A;  3FAV B;  3G71 V;  3M9O B;  2OYQ A;  4MVQ A;  2X0S A;  4MVS A;  1KMI Z;  4X20 B;  1PP9 H;  1R6T A;  2ZCE A;  4R7R A;  2CW8 A;  3WWH A;  1SQP H;  5FLX W;  3K03 A;  1Q81 W;  4C7U A;  1YIJ V;  2ZR2 A;  2FKL A;  4JTA B;  5EBW C;  4ZBM A;  4TUY F;  3FKI A;  5KT7 A;  3JAK A;  4IRD A;  2P4K A;  3VPC A;  1YJN V;  4JAU A;  3M7M X;  3LQS A;  4O4H F;  3SYO A;  1Y1W A;  3RYF A;  2E76 B;  2VUM A;  4FBT A;  5H9C A;  2CGN A;  5KUK A;  1H2G A;  3M4I A;  2P4V A;  4LFB H;  3V6H A;  3H4B A;  1HNW H;  3ABK C;  3VBB A;  4WF9 V;  5EYP A;  4WBN F;  2C22 A;  2Y4U A;  2FE3 A;  2QA4 V;  5FNV F;  1ZLZ A;  1ZTE A;  2W6I G;  3FFQ A;  5A9G A;  3RFC A;  4JI2 H;  3RGZ A;  4J9L A;  3ZRX A;  2R92 G;  4DV6 H;  1M0T A;  1A9X A;  5CBG A;  1B04 A;  4CHI A;  1W93 A;  4O4L F;  2Q7D A;  4X1K B;  1EUD B;  4X64 O;  4DV0 O;  4WHX A;  1MNG A;  2ZE6 A; 
#chains in the Genus database with same CATH homology
 3K3V A;  4RB1 A;  3JAT B;  2UXD H;  5DIS C;  1IBL H;  4X64 B;  1P8L A;  4PDB A;  4UCO A;  3B2E E;  4YJ2 B;  4JV5 H;  1HR0 B;  1A0I A;  3JAR A;  5LP6 A;  2Q0A A;  4FM1 A;  1XNR B;  2ZM6 H;  3L4K A;  2F4V H;  4ZOL B;  4MTD A;  2VUG A;  3E22 B;  3VQX A;  5D1O B;  4DV4 H;  2Q2T A;  4BWS C;  1M5I A;  5LMN B;  1VS0 A;  4PHZ A;  5BMV A;  2RGR A;  3SJC C;  1N32 B;  3TY8 A;  3JAL A;  4GKK H;  2CW7 A;  4ZI7 B;  5IT9 W;  4JYA H;  5FNV B;  4DR4 B;  5KX5 B;  2PYL A;  3L2P A;  1SA0 A;  3RGX A;  1IBM H;  4B3R H;  3ZS8 C;  3GJX B;  4LF6 H;  4LH7 A;  5J2U B;  1Z5V A;  3HKD B;  1VF7 A;  4B3M H;  2F95 B;  1ZAU A;  4X65 B;  4FM0 A;  2IM9 A;  2UUB B;  3CB2 A;  4LFC B;  4JI1 B;  4FLW A;  2UU9 B;  4GYC B;  3JAM W;  4L8J A;  1J5E B;  5IJ9 A;  2E3C A;  1WNS A;  3KAL A;  1I94 H;  3HKE B;  3QTC A;  1L8D A;  4CH4 A;  2MCT A;  3SJA C;  3K5O A;  3QWU A;  3BPZ A;  4I50 B;  1E4F T;  2PTM A;  5J2T A;  4DR2 B;  2E5L B;  4UCU A;  3RYI B;  3T1H B;  1HNZ B;  2EX3 A;  4X20 A;  1BGW A;  5IWA H;  1T5E A;  4FFB B;  5CA0 A;  4FLX A;  4IHJ A;  5LL6 b;  4Q6G A;  1S68 A;  4FLZ A;  5BR8 H;  5JJN B;  4JI6 H;  2YI9 A;  2ZIO A;  4O4J A;  3A2F A;  3N2K A;  3KAK A;  1N34 B;  4M7E A;  4LMY A;  2OWO A;  5FD6 A;  3HKC B;  5ITZ A;  3W1B A;  1TA8 A;  4TV8 B;  3LML A;  4RB2 C;  1XMO B;  4DV7 H;  1HNX B;  3K5N A;  2UUA H;  2UXB B;  4IIJ B;  4NXM H;  2RJZ A;  2HVQ A;  5D1P A;  1P49 A;  5JH7 A;  5LXT B;  3EYY A;  5CB4 B;  4DUZ H;  1XHX A;  4DV2 H;  1Q43 A;  4NXN B;  5EZY B;  4X62 B;  4DR1 H;  3KAJ A;  1SKV A;  3N43 B;  1SQG A;  1CKN B;  2HVR A;  1O9H A;  3RYH B;  3JAW B;  2UUC B;  4DR7 H;  4NVP A;  4GKJ B;  4JI5 B;  1M4U A;  3DF7 A;  2JVD A;  4X1K A;  4X66 B;  4I7H A;  4MV9 A;  5FPO A;  5K1X A;  4LF4 H;  4MTE A;  4DV1 H;  5JJJ B;  4LF8 B;  1XMQ H;  3JAT A;  2ZIN A;  3JSN A;  5JVD A;  1JFF B;  1E4G T;  4APM A;  2KKW A;  4LNU B;  2VQF H;  2XHB A;  4YJ2 A;  4ZIB A;  1Q5O A;  3N2G B;  3IAY A;  2R70 A;  2HIV A;  1X9N A;  1X4T A;  4ZOL A;  4DV0 H;  5EIB C;  3RR5 A;  4ZHQ B;  5D1O A;  2UXC H;  4LF9 H;  4UCV A;  3RFR A;  1IBK B;  4ZI7 A;  3SR2 C;  3U11 A;  3T1Y H;  4CC6 A;  4TOI A;  3PN1 A;  4K0K H;  3VQW A;  4TUY B;  5KX5 A;  3OTO H;  4I4T B;  5LYJ A;  1TUB A;  4BW9 A;  3NC0 B;  4YJ3 B;  1P16 A;  5J2U A;  2VQE H;  5LMU B;  4O4H B;  4LFB B;  2CFM A;  2VWJ A;  2PUS A;  1HNW B;  1Z2O X;  3JAS B;  3WB2 A;  2Q7E A;  3K5L A;  4LSX A;  3RTX A;  4DV3 H;  4DRX B;  3WB0 A;  3HKE A;  1TVK B;  2CAZ C;  4PZ6 A;  2YCH A;  4JI2 B;  1Z5W A;  1N36 H;  5JCO C;  4DV6 B;  2JS5 A;  4WBN B;  5A2Q W;  4IAJ A;  1XNQ H;  4I50 A;  4FVM A;  4JI7 B;  5LOV B;  4LF7 B;  4DR5 H;  2V4D A;  4B3T B;  3J80 W;  3RYI A;  4UFZ A;  4O4L B;  4TV9 B;  4CS4 A;  2UXD B;  4DV5 H;  4JI8 H;  1FJG H;  3HKB B;  1NT2 B;  4LH6 A;  1IBL B;  1Z2P X;  4B08 A;  1S03 G;  2HEP A;  2ZNI A;  1FFX B;  4LR3 A;  4EFE A;  2E5L H;  4TQF A;  2ZM6 B;  3HKC A;  2P5O A;  3NBY B;  2F4V B;  4ETS A;  4TV8 A;  1G6U A;  4IIJ A;  4Q0Y A;  3OTF A;  1FKA H;  4DV4 B;  3RJ0 A;  4AQY H;  3N42 B;  3N6X A;  4F6R B;  4X1Y B;  5LXT A;  4TQD A;  4DR6 H;  5CB4 A;  4GKK B;  3KXY T;  5C8Y B;  4KL1 A;  5EZY A;  1XDN A;  1AN7 A;  1TGO A;  1XMO H;  4X1I B;  4YY3 H;  5KHG A;  3RYC B;  1IBM B;  4E6N A;  4B3R B;  1CKN A;  4D7T A;  3RYH A;  4B3M B;  3JAL B;  5KHI A;  1KU9 A;  4PZ8 A;  5IJ0 B;  1N33 H;  2BTQ B;  3THO A;  2VPS A;  4KHP H;  4B3S H;  4O2B A;  4JI3 H;  1DGS A;  1I94 B;  3VQV A;  5KHJ A;  4CC5 A;  5GON B;  2QM4 A;  5LA6 B;  4D7S A;  4EQ5 A;  1JFF A;  4CH6 A;  4RZQ A;  4A2A A;  4BWA A;  3S24 A;  1JMK C;  5IJ9 B;  1D5A A;  1WN7 A;  3N41 B;  2JGU A;  3N2G A;  4DUY H;  3RF2 A;  5D5Q A;  2HHH B;  5IWA B;  4DR3 H;  4RB3 C;  4LFA H;  4CS2 A;  2BTO A;  3C0F B;  3BA8 A;  4ZHQ A;  4JI6 B;  4JI4 H;  4LSA A;  5JQG B;  2R9A A;  5K1P A;  2P22 C;  4YHH H;  2KSW A;  3SGI A;  3TY9 A;  1GYF A;  2ZNJ A;  4O2A B;  3WB1 A;  4DV7 B;  2W57 A;  4TUY A;  2UUA B;  4A2B A;  4JI0 H;  4I4T A;  4NXM B;  3JSL A;  1JJO A;  4I55 B;  4RAY A;  4OX9 H;  4YJ3 A;  4LF5 H;  4O4H A;  3K59 A;  1WPB A;  4RAZ A;  3VNN A;  3ETQ A;  4DUZ B;  2R72 A;  4FM2 A;  4DV2 B;  3JAS A;  3E22 A;  4X64 H;  4DR1 B;  2F66 C;  4FLU A;  4DRX A;  1I7F A;  4HNA B;  1TVK A;  1HR0 H;  3UQ8 A;  2PZS A;  4UCT A;  4DR7 B;  5CA1 B;  1XNR H;  3BHP A;  2HGS A;  4WBN A;  4O4I B;  4UCR A;  5FNV A;  2RGV A;  3H20 A;  2XIG A;  3VQY A;  5LOV A;  5JCO A;  4LF4 B;  4EFB A;  3CSX A;  4DV1 B;  5LMN H;  3HKD A;  1N32 H;  3JAK B;  4O4L A;  1V9P A;  1XMQ B;  2WYO A;  5EIB D;  3HKB A;  5IYZ B;  4DR4 H;  3RYF B;  2YI8 A;  4U3J B;  5KHH A;  3GB8 B;  1FFX A;  3NBZ B;  2VQF B;  4B3T H;  1SQF A;  3UT5 B;  4MV7 A;  1QHT A;  1Q8I A;  3RWR D;  1XQ8 A;  4RB0 A;  2PY5 A;  5JVD B;  4X65 H;  3F8N A;  4CS3 A;  3N44 B;  2Q7G A;  5EYP B;  4DV0 B;  2UUB H;  2UU9 H;  4JI1 H;  3LNN A;  1J5E H;  4LFC H;  2UXC B;  4LF9 B;  2O03 A;  4F6R A;  4X1Y A;  4AHC A;  4DK1 A;  5C8Y A;  4EB6 B;  1MZB A;  3T1Y B;  4K0K B;  4FFB A;  4X1I A;  4K8Z A;  5KMG B;  3OTO B;  3RYC A;  4FM9 A;  1WH2 A;  4PI2 A;  4AIL C;  1O9G A;  4DR2 H;  5JJE B;  3MWM A;  4JV5 B;  1S5J A;  2VQE B;  4I9Q A;  3T1H H;  5D5P A;  1HNZ H;  5IJ0 A;  3KYH C;  2BTQ A;  3J81 W;  4DV3 B;  4UCS A;  5LYJ B;  5LP6 C;  1TUB B;  2VOB A;  2ZJT A;  1TAE A;  1N34 H;  1Z2N X;  3JAR B;  3RIZ A;  2VWK A;  5GON A;  1RSO A;  3BAB A;  5LP6 B;  5LA6 A;  4DRF A;  1N36 B;  3SJB C;  1XNQ B;  4JYA B;  3BA9 A;  4PI0 A;  1CKO A;  1HNX H;  2UXB H;  2ZIM A;  2QJ1 A;  4J0M A;  2F93 B;  3U10 A;  1O75 A;  4DR5 B;  4LF6 B;  3J7A K;  1L2Z A;  3HXL A;  5BMV B;  4FLV A;  4GLX A;  3JAW A;  4CH5 A;  1XHZ A;  1CKM A;  4DV5 B;  4NXN H;  5KHK A;  4JI8 B;  1FJG B;  2PYJ A;  4X62 H;  1XI1 A;  1SA0 B;  5JQG A;  3U0Z A;  3DSQ A;  2HHH H;  2UUC H;  2GV9 A;  2PGG A;  4GKJ H;  4JI5 H;  4CH3 A;  2HIX A;  4O2A A;  4PZ7 A;  1XK5 A;  5FD5 A;  3QF7 A;  4X66 H;  4K8X A;  4I55 A;  4FLY A;  4LNU A;  3ICX A;  4AQY B;  3K5M A;  1SEI A;  3W5O A;  4DR6 B;  3IG0 A;  4LF8 H;  2YXL A;  3TY5 A;  3MAQ A;  4EEQ A;  4YY3 B;  3L4J A;  2YIB A;  1HW7 A;  5J2T B;  5BR8 B;  3K58 A;  4HNA A;  1QQC A;  3RGB A;  2OYQ A;  1N33 B;  5CA1 A;  1KMI Z;  4X20 B;  4KHP B;  2ZCE A;  5CA0 B;  1H2S B;  2CW8 A;  4IHJ B;  4O4I A;  3ZED A;  4B3S B;  4R7R A;  1BJT A;  5FLX W;  4JI3 B;  2HVS A;  2Q7H A;  3CHX A;  2Q2U A;  4O4J B;  1ZHQ A;  3N2K B;  4FLT A;  3JAK A;  1IBK H;  1M0W A;  5ITZ B;  3CVZ A;  3M7M X;  4O2B B;  3GDE A;  4DK0 A;  5IYZ A;  1FVI A;  3RYF A;  3QG5 A;  4U3J A;  3UT5 A;  5JH7 B;  5LMU H;  4DUY B;  3M4I A;  4LFB H;  1Q3E A;  4DR3 B;  1HNW H;  4LFA B;  3BRC A;  5FPR A;  5EYP A;  4HBN A;  2F1M A;  3K57 A;  2YIA A;  4JI4 B;  2FE3 A;  1I6U A;  3FMA A;  2YIB D;  3FFQ A;  1YEW A;  4JI2 H;  3RGZ A;  4YHH B;  4TV9 A;  1SYX B;  4DV6 H;  4EB6 A;  1M0T A;  1M93 A;  1B04 A;  1ZHS A;  2WE6 A;  5KMG A;  3BAA A;  4JI0 B;  2WDT A;  5EOY A;  4X1K B;  4JI7 H;  3N40 P;  4LF7 H;  4OX9 B;  2RQ6 A;  4LF5 B;  3W1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...