4EEQA

Crystal structure of e. faecalis dna ligase with inhibitor
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Design, Synthesis and Activity Evaluation of Potent NAD+ DNA Ligase Inhibitors as Potential Antibacterial Agents.
rcsb
source organism Enterococcus faecalis
molecule tags Ligase/ligase inhibitor
total genus 108
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4eeqA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4eeqA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4eeqA02
2UXBB 4UCSA 2E5LB 5FPOA 4CC6A 4NXMB 1XNQB 2ZM6B 3BA9A 4UCTA 3BAAA 4B3RB 2UXCB 1XDNA 2UUAB 2HHHB 4JI5B 5D1OA 5D1OB 4UFZA 2UU9B 4X65B 1XMQB 1HNWB 1X9NA 3GDEA 3W1BA 1DGSA 3OTOB 1XMOB 4B3SB 5FPRA 5DISC 4LF7B 3TY8A 3KYHC 4JYAB 4GKKB 1P16A 3NC0B 1I94B 3GJXB 4UCUA 3RTXA 4B3MB 3W5OA 4JI3B 4NXNB 1HNXB 4LFBB 3VNNA 1N33B 1P8LA 5BR8B 4DV7B 3RR5A 2VUGA 4E6NA 4DV0B 3S24A 5D1PA 2HVRA 4DR7B 4JI2B 3PN1A 3BA8A 4OX9B 1ZAUA 3NBYB 4LF9B 3TY5A 4DR4B 4EQ5A 4JI1B 4LF6B 1J5EB 2UUBB 2OWOA 2F4VB 4JI7B 1HNZB 4X62B 4DUZB 2CFMA 2UXDB 4EFEA 1FVIA 3GB8B 3L2PA 4UCRA 3QWUA 1TAEA 4DUYB 1FJGB 4X66B 1S68A 4B3TB 1XNRB 1CKOA 1CKNB 3BABA 1XK5A 4DV4B 4PZ7A 2HVSA 1V9PA 4GKJB 3TY9A 4JI6B 4LF4B 4LFCB 2VQFB 1A0IA 1CKMA 4EEQA 4GLXA 2VQEB 3T1HB 4DR5B 4DV3B 4DR6B 4YHHB 4X64B 1TA8A 4DR2B 1CKNA 3SGIA 2Q2UA 2HIXA 5LMUB 2UUCB 3W1GA 3JSNA 2Q2TA 4JI8B 3JSLA 4DV5B 4YY3B 4CC5A 1N36B 5LMNB 4DRFA 4UCVA 4JI4B 2HIVA 3NBZB 4LH7A 4DR1B 4JI0B 4UCOA 4LF5B 2HVQA 4PZ6A 4DV1B 1N32B 4EFBA 3UQ8A 4LH6A 4DR3B 4JV5B 4TOIA 5IWAB 4K0KB 1VS0A 1IBMB 4PZ8A 1B04A 1IBLB 4LFAB 1HR0B 1IBKB 4DV2B 3T1YB 4DV6B 4LF8B 4AQYB 4KHPB 1N34B
chains in the Genus database with same CATH superfamily
3K03A 1ULZA 4JPRA 4I55A 3HOVG 4BIOA 1HNWH 5DG8A 4B3RB 5KFBA 3JD0A 5KLVH 2AHZA 5IP7G 4RUEA 1N4CA 1BSMA 5ITZA 2YZGA 5BY1A 4U7OA 2LP7A 5H5NA 4ED6A 1KJQA 1UJWB 4Q8EA 3K08A 2FK3A 2R82A 3GIIA 4ECRA 5KHJA 3AEIA 3DAAA 4YP3A 3RYFB 4O3PA 4DR6O 5CB4F 4D7SA 2DZDA 1KMIZ 3A2FA 3CMEV 3HB3B 3JASB 3KCYA 2ALZA 2Y69C 1QHTA 2JEUA 5JCOA 4DR4O 3I5DA 5LP6F 3HOXG 4GUNA 3JAKB 4P9PA 3E8FA 2LW7A 4LF9H 2VPQA 4JF3A 1GSAA 4JI1H 4I7HA 4JGSA 2W7OA 4XX0B 3ABLC 1AP5A 3Q1KA 4FFRA 3N6XA 4RB0A 1QVGU 2EIKC 2UXXA 5EYPA 5IWAO 1KKDA 5LL6b 3U11A 3K5HA 4DR4B 1J5EB 2YZNA 1NTMH 4RWUA 3FYIB 4LFCH 3CCSV 3FFQA 5KKNB 3QO8A 5EWEA 4WFAV 1JQ0A 4NTXA 5KG4A 1GM8A 4QPKA 4DV4B 2ZDHA 3L75H 1NH2D 2ITDC 2JA6G 2OLSA 1K5QA 5I5WA 3S3XA 4DR5B 3ZRVA 2YSUB 4G27B 1JOYA 5F9LA 4DV3B 3LDCA 4MW8A 4HNUA 3QZ7A 5JQWA 2XOKG 1I08A 2LFRA 4YJ3F 4IZOA 4JZ2A 4YJ2A 3SPIA 4YY3B 1CQIB 1ZTEA 3VQWA 4AQYO 4X89A 4NYEA 1S5HC 5LL6Y 3IGAC 1VBGA 5KFAA 2JA6A 4IHJB 4KHPH 2NLJC 4ZKIA 2P6JA 2FE3A 4JI8H 1KECA 3CB2A 1P7BA 4X1YB 1A48A 4R8CA 1KT8A 4B3RH 5B1AC 4AQYB 5C8YF 1N34B 2COGA 3CEIA 4I50B 5LP6C 3AK2A 5BWVA 1EFRG 5IJ9B 5HNEA 1SFOA 4FFOA 3WNZA 4OX9O 2JA7G 2KSDA 1PL4A 2A0LA 4LP8A 3A0BZ 2JIZG 3ETEA 4GT1A 2OTJV 2A7WA 3B8NA 1KP3A 2RJZA 2R72A 3ASNC 1W0KG 4JYAO 4GKKO 2AGAA 2FPPB 3U0ZA 2GQSA 5D1OA 3GTJA 2FB5A 3H1IH 5JVDF 2OTLV 3TCUA 2VQFO 1C3OA 2NUAB 5IYZA 3ZHQA 2C2RA 5KFLA 4BWSC 2JA7A 4LF7B 4J9ZB 3R9RA 3K3PA 4X64O 3N8DA 4O3QA 4JYAB 4GKKB 1XQ8A 1Q81W 2IJHA 1N0NA 3LSUA 3SNOA 5JJEB 4R6ZA 2XIGA 4FBTA 2QWOB 3TW6A 1FD9A 4RU9A 5DLGA 1OZ0A 2Y0SE 1J5EH 3SYQA 5FLXW 3KKYA 3Q4HB 5L3BA 4E6NA 4MVOA 1Y74A 4MVZA 1WH2A 4NZMA 2V5AA 5A9GA 1OCCB 1TUBB 1VQ8V 2BE3A 1OJHA 2PMZE 4DV4H 1CS0A 2GHYA 2W9CB 2J6UA 4RO2A 5DQIA 4OPAA 2W6OA 3G4SV 1I5YA 4UCRA 4DR5H 1MG1A 5IY5C 3BY6A 4LMYA 4DV3H 3RYIB 4PZ7A 2Q0AA 2AGQA 4PA3A 3CCEV 2EJ3A 1F4NA 1Q8IA 4FIPC 2CE4A 3FX7A 3TGUH 2YZMA 3MWDA 3NXSA 4EEQA 3E5NA 1TWFA 1K5SA 4YY3H 3K0GA 2WLLA 4A5UB 5KFIA 1WA8B 4Z1MG 1TA8A 3G8CA 1YTFD 3RN4A 2ZDIC 4Q20A 4O7SA 1TVKA 1SA0A 5E25A 1S77D 1DK1A 1BT8A 1HR0O 5L3EA 3RFCA 4TQRA 4DRFA 1M5IA 3RFRA 4IYIA 2JJ2G 3UT5A 2FJZA 4IR9A 3M9NB 2FYUH 2JEJA 1GMGA 1N34H 1XNQO 3K5IA 2WDTA 3ZEDA 5EDWA 4O4LF 4EB6A 4MS2A 3SJQC 3BACA 1K83A 1VS0A 2QB5A 1M4UA 1HR0B 3SPHA 4RUAA 1YI2V 3T5KA 1RJRA 3RW0A 3WU2Z 1NR7A 3MHHC 1Z2OX 4BXXG 4TM5A 2VA2A 3APOA 4UCSA 1S0NA 1WP8A 2YXHA 1XNQB 1KJJA 5KFCA 4EYIB 1Z5VA 2KB1A 1NU1H 2UVWA 1MSDA 3H1JH 1XDNA 2UUAB 4QGPA 5L1LA 1BL8A 3RV4A 3ZIAG 3JD4A 4LF7H 4WBNA 4ASUG 2XAGA 2XAQA 4JI6O 4O7NA 4U3JB 3OTOB 4QJFB 2QTSA 2RF4A 3CEBA 2ZJTA 3CRMA 3IJ4A 4YR0A 3TQ1A 4FM2A 2AQ4A 2WSSG 3RB0A 2VWJA 1BQ0A 3KYHC 5IYCG 2ARHA 2BTQA 1GTOA 2PZSA 2XTAA 1UPGA 2CK3G 2AZ0A 4DL2A 3E22B 3FB5C 4B3SH 2ZD9A 2ATKC 1IXMA 3AG3C 4AYBA 4DV7B 1S0OA 1YJNV 1SC5B 3KREA 1FJGO 5DGHA 1AR5A 1XDCA 3QZ8A 4O4HF 2HVRA 2BSKA 1UC8A 3FD9A 4LNUA 2JA5G 1M0TA 2Q7GA 4RZQA 1ZAUA 3TY5A 1EBOA 2ILMA 3ABMB 4XZ3B 2ODTX 2FMLA 1L0LH 5CA1A 4X62B 3L73H 3OT7A 2EJRA 2F66C 4PELA 4K35A 1FJGB 2DW4A 3J80N 3ETQA 4HN2A 3BCCH 1SQFA 2Z02A 1V9PA 2WAMA 2Y4TA 3C90A 3CS5A 5LMNO 4ZBMA 3GIDA 3FMAA 3N40P 4C2MA 3WO1A 2JA5A 4F6RA 3JALA 3FDSA 1N32O 3J7AK 2UXDH 5CBGA 4YHHB 4Q44A 4Q4DA 4PA4A 4QIWA 1AILA 1XHXA 3JSNA 4FBUA 2BTOA 4R8UB 4YAKB 1GM9A 1RK5A 1RSOA 2HLDG 4ECZA 5LMNB 4YQWA 2DLNA 1IVSA 1JJ2U 3T1HH 2HVQA 4PZ6A 4FMTA 4MTDA 4J10A 3ZHUA 1N32B 5BYBA 2JA8G 1MZEA 1Y1WG 1E79G 4MV4A 3N41B 4CKCA 1TUEB 4M9UA 2PBZA 1B3QA 1VKZA 2NU6B 1DAAA 2NU9B 2UUAH 1D2DA 5K3WA 5J2UB 1PKXA 3K79A 3WB0A 2QEXV 5FPOA 4ECYA 4A3CG 1BE3H 2YS6A 5KFGA 4FLVA 3BJYA 5A2QW 3GV7B 2FPIB 1XUQA 3SE7A 1Y1WA 2PUSA 3RYHB 5DAAA 3OTOH 3FB8C 3ZRWA 3UKMA 5KX5A 3T7AA 2Y69B 5JH7A 2R9IA 5LXTB 1GN2A 3CCJV 4WFHA 3ABTA 4FLXA 3OUSA 3PR4A 3FKIG 4BY1G 2EZOA 3MR6A 3W1BA 5BPFA 1VQNV 1GM7A 3KHRA 1LUVA 4NKGB 1NVPB 5KFVA 2B9ZA 2ADQB 5LYJB 4CZZA 1VF5B 4PWQA 3ABLB 1QQCA 3JZFA 2FLLA 3PO3G 2EIKB 4DV7H 3HKDB 5CA0B 1YZBA 4F4LA 1QVFU 4PBCA 4YJ2F 4RZRA 2ZDQA 3TETA 3CHXA 1RM1C 4FFBB 3J81N 2R7MA 3P32A 1BS3A 4EYHB 3RB3A 1HNXB 1N36O 2GUZA 3ORQA 3FKIA 4AILC 2CH7A 2GV9A 2CTRA 4X62H 2XC9A 4K3AA 4RNOA 1I0HA 2QM7A 2M6YA 3OFNG 3BQ0A 1FJGH 4MTEA 4AHCA 2R8IA 5KA5A 2UXNA 2ZE7A 1IBMO 1PNLA 5I5TA 3F8NA 4LF6B 5JCOC 1OHHG 3JD3A 2C2AA 3GB8B 4X8AA 4EFEA 5F9NA 1AN7A 4Q43A 4YHHH 2WB1E 3MWEA 5I5SA 1QR9A 4X1KB 2PF4E 2P90A 3SPCA 2Q7DA 1IOVA 2AU0A 3L9DA 5I60A 2GTSA 2YI9A 2CDYA 4DW0A 3T9CA 3IG0A 5C44G 5CB4B 5CR5A 4PJ0Z 3RVYA 3N2GA 5CA3A 3A0RA 5IYZF 3SYCA 2Q2TA 2W6IG 1IBLO 5B1AB 5DQGA 3H40A 3GIJA 5BXZA 2AZ2A 2R7LA 3LDEA 4IRDA 5LP6B 5LOVA 5HBRB 5LGNA 5T14A 4F6EA 5CM0A 2PN1A 1EUDB 4O4JA 1GRJA 3ZMVA 4YAJB 4B7KA 2OH2A 2L6LA 3ASNB 1PK8A 3ZJZA 2W7PA 1IBLB 3FAVA 2QR4A 4JI5O 2ZINA 4O4IA 4A3MG 4R50A 2WLIB 4PV1B 3STZC 2YU9A 4LWSA 3TQTA 2PYLA 1R6NA 4FE2A 3KZIZ 2LJ2A 2EJ0A 4I0XA 2HR3A 3BAAA 4PA9A 1VARA 3M9OB 3BHPA 1VQ6V 3G67A 4O7LA 4JI5B 4RB3C 1KD1W 4EGJA 4X65B 1CQJB 2YXYA 1JFFB 1NKDA 2RCVA 3ZHVA 4YJ3B 1I7FA 3B8MA 2VQEO 4AI8A 1HNXH 2ZKOA 1GSHA 2EINC 3IN5A 5H6RA 3HKCA 1SQXH 2KG7A 5J2TA 4IL6Z 5C4XG 3AG7A 4UCUA 1YF2A 2IH3C 4B3MB 3SPGA 3GWOA 4NXNB 3T9DA 4LFBB 5KS8A 4X20A 5LA6A 4DR1O 5IY5B 1XL4A 2GLTA 2LGWA 4LF6H 3OR7C 4TT3G 4D7TA 4X66O 5BWUA 4DV0B 2ZGIA 2R6FA 1T36A 4A3DG 1TWAA 4I7ZB 3L74H 5C8YB 2CZGA 5L9XA 1VQ5V 3AG1C 5EC1C 3TW7A 2IMWP 1G4YB 4JI7B 1ZHQA 2Q67A 2XGQA 4MTXA 3G8DA 3CWBH 1ZHSA 5FD5A 5B3SC 4QW8A 4X66B 1FFTB 2P5OA 4P30A 3FKSG 5DN6G 2ZM6O 4IWXA 2QWNB 2UXCO 3RT3C 5JVDB 4F4ZA 4WBNF 3LSQA 3OR6C 4PDRA 1GK9A 4MVUA 3JAMW 2BR0A 1S5LZ 3L72H 3H1HH 1TGOA 4H0LB 2ZE6A 1B6RA 4O83A 3Q8QB 5KFDA 1XBLA 2COIA 5C1PA 4Q45A 5BWXA 5J2UF 1KB9F 4JI4B 2HIVA 1PNKA 3SYOA 1R1BA 4EBEA 1VQ7V 2OIGA 2EIYA 3CQZA 2IU0A 2JVDA 3CVZA 3T5JA 1FYJA 4LH6A 4JI3O 1ZUQA 4ED3A 4TOIA 1KJ9A 4YR2A 1K8AW 3KXYT 4JYBA 3T1CA 3GTMA 1B04A 4YIPA 2XD4A 3VOTA 2K1EA 2LQTA 2P4VA 2R70A 4FJCC 3RYFA 4DV6B 1EHIA 1CKNB 3TIIA 3GIQA 4JUZA 2P4KA 4DL7A 2QWPB 4TQSA 2HGXA 1BMFG 3QG5A 1Y14B 2L35A 3JASA 3ZRSA 1OV9A 3JATA 4X65H 3K5MA 3OSPA 2YXLA 2FPGB 5KT6A 4F50A 1H2NA 3JAKA 5GONF 2IA6A 3ZMTA 2XHBA 3LNMB 5GTIZ 4E4TA 1M56C 4HQ6A 2CUGA 2LFSA 4J7ZA 5TISZ 1IURA 3KAJA 1Q7YW 2CKZB 3M9MB 4UUJC 1DV1A 3AG3B 5B1OA 1KBLA 5H2FZ 2Y0IA 4IGGA 2ZT9B 5FL7G 5KMGB 5CBFA 5BR8O 3T9AA 5KFRA 2C22A 4B3MH 4NXNH 3DSQA 1VF7A 3C0FB 4LFBH 4ICGA 1PX2A 4QIWF 1Y67A 5B66Z 3TY8A 4FFNA 4DR2O 5I5YA 1EKFA 2JEXA 3CJHB 3UO3A 3EXAA 4DV0H 2HGSA 3U0GA 3MFIA 4WD3A 3K5NA 4QE9A 4O4LB 4BAYA 2BOCC 1ZETA 2UVVA 5BR8B 2C2EA 4MA0A 2JK5C 5FD6A 4JI7H 1M0WA 2ASLA 3ASOC 3L4KA 1PL0A 4GX5A 2X0SA 1Q90D 2MW2B 1Q3EA 4X66H 2V4DA 1FFXB 4ZQIA 3HOWG 5DGIA 4YXWG 1P7GA 3T5HA 2HHFA 1YEWA 3ETJA 2VUMA 3Q8PB 4HYOA 2YIBD 2UXBO 5FNVF 1BGWA 5KG5A 2GSMB 1WR2A 1AR4A 4FFMA 3JRXA 3PW2A 5KG7A 2B5UA 3RAQA 4ED2A 3N2KA 5JH7F 3NGDA 4JI0O 4CHIA 3EFFK 2UUBH 3AG2C 1DV2A 2HHHO 2CNUA 2ZQMA 4JI4H 4DR6B 2B1IA 3CPWU 2YI8A 1M7JA 1XMQO 4QWBA 1Q82W 2WAQE 3X2QC 2ZNJA 2N74A 4M7EA 4ZI7A 1XMOO 3DXRA 5KG3A 2Z3YA 2OCCC 4Q6GA 4LH7A 4JI0B 4O3NA 1N56A 4UCOA 5EBLC 5LGUA 1AJNA 5H9CA 4DV6H 1I94O 3RBDA 4J41A 3FB6C 2IH1C 3NUAA 4WHXA 5L1IA 5LMUH 5IWAB 4I9WA 1F4MA 4O4HB 3OUZA 1ZL8A 3GB7C 2OIEA 4CE5A 3CMAV 1U97A 4PZ8A 3FB7C 5BPHA 2FMAA 4TV8A 3HKEB 1YJ9V 4CKEA 4TV9A 2YRWA 1G6UA 3DTGA 4QWEA 1H2SB 2HG5C 4DR7O 2CNQA 1H8HG 4IAJA 4Y8VB 1IZ3A 5HV6A 2YZLA 3EHBB 1H8EG 1I6UA 4IT5A 2ODMA 5JJNB 3SJBC 4GCZA 2VWKA 2E3CA 3OTFA 2DPIA 1HNZO 4JTAB 3GV8B 2WA3A 4BR6A 1RM1B 3RJ0A 5ITZB 5JJJB 3Q4HA 1RFYA 5KFTA 2XAFA 1MZBA 2QWQB 1W96A 1K33A 3GDEA 4D6TH 1GO3F 1DGSA 1Q6HA 3JAWA 4Z2WA 1M6VA 1URFA 2NN4A 4A3LG 2WLMA 5DGBA 1GGOA 4U6PA 1BHBA 5EWGA 2CGNA 4E4EA 1R6KA 5KA6A 1NVPD 1WNSA 1EN4A 3H3VH 4TQFA 1TWGA 1PD3A 1H2LA 5KFKA 4ZHQA 2YYAA 4O4JF 4GX1A 3KHHA 1WA8A 4HNAA 5AG2A 5D8DA 4CMFA 1UC9A 1KEEA 4LF4O 4ED8A 5JQGA 4P2ZA 1ZQ7A 2IBKA 3PN1A 3JCZA 4OX9B 3NBYB 2X6BA 3BRCA 5KFSA 1IBKO 4CS3A 3IC7A 1YHQV 1KUQA 3HKZE 5KG2A 2R7KA 2WLJA 4UVAA 4DR6H 3MR2A 3GIMA 4MV8A 5KHKA 3A0HZ 3BABA 3KAKA 1SCUB 4LF4B 5K1XA 4TUYA 2JEFA 2VQFB 4DR4H 3OSNA 1WRVA 1I5XA 1EZVH 3M7MX 4J9QA 2M7WA 2JS3A 4DRXA 2IW5A 1R3IC 4X64B 3ZRXA 4JI0H 1NT2B 1VBHA 2Q2UA 5KFWA 3OE7G 4K0KO 3W1GA 4WFGA 3CCQV 3JSLA 4QWCA 4YJ2B 3T1YO 5J2TF 2IJJA 5IWAH 2DQ3A 1GO3E 3ML0A 4JAAA 4JASA 2CNVA 2E5LO 3WB2A 1IX9A 1SYXB 4CMDA 5IJ0A 4PDBA 1KP2A 5LA6F 5B5EZ 3OW2U 3MFHA 3QQMA 4O2AA 3SR2C 4K0KB 3PZPA 4U3JA 1Y76A 4N21A 1BNCA 1OCRC 1I2KA 3T1YB 3U9SA 3RYCB 5L1KA 2E5LB 1Z5WA 4J7JA 1JDEA 1AB3A 4JV1A 2QJ1A 4UVBA 1WB8A 1G8MA 2EINB 3T9EA 1VQPV 2VOBA 4XBFA 5H80A 3H4DA 4J9OA 2F95B 5KHGA 4DUZO 4O7YA 4AQYH 3DTUB 5D1OB 3L4JA 3R5HA 2ZE5A 1XNRO 2A3QA 2W6NA 5L3CA 1X9NA 2CGOA 2EIJC 2YIBA 1OWTA 5LHIA 3DC5A 5IYZB 4TVIA 4F4WA 4F4XA 5KFEA 1OCOC 4A3BG 3AG1B 2ZIMA 2P7TC 5B1BC 3RTXA 4GX0A 3H1KH 4DV5O 2AW9A 4O7ZA 5KFXA 3Q8RB 4MW3A 4OX9H 3VOUA 5B3SB 4LF5O 1GN6A 4G3IA 4DL3A 2QA4V 1SEIA 3BG5A 5H6QA 3AK3A 4B3TO 3S24A 3GTKA 4GKKH 1Y74B 3GVMA 4JYAH 4NZOA 1DF5A 2CTQA 4JV2A 5CAEB 3E2EA 1P49A 4O86A 4EQ5A 4X1IA 3ABKC 4MVMA 5C5JA 1EN5A 3PR5B 2VQFH 2W71A 3UYYA 5L1JA 2EULA 3QWUA 2XCLA 1JX4A 4X64H 3WO0A 4B3TB 3TJTA 4J9YB 1K97A 4JI6B 4O7TA 3E86A 1YDXA 2I80A 1RK6A 3M4IA 2Q5ZA 5I5UA 4FFLA 3H20A 3BVOA 2YC0A 2N04A 1S3JA 2WLLB 3Q8SB 4OXSA 3W7WA 4O84A 3HOUG 3SGIA 2QYZA 1SA0B 5KUMA 1W59A 1ZX3A 2E74B 4LFAO 4YR3A 1X59A 3PJSK 1V4YA 4GZRB 1YSCA 5KG1A 2W9BA 3K3VA 4XYMB 5JUMA 4RCNA 2JGDA 4I55F 1XHZA 3UT5B 3CCRV 4KP4A 3T1YH 1OBDA 4NXMO 3D36A 1E1QG 2R8KA 4A2AA 3LP8A 3RB4A 2NU8B 2Y0PA 1NTZH 1KBHA 2YDEA 1Q6UA 1M56B 3B4SA 4LFAB 4RB1A 4FLUA 1SERA 4GYCB 2YS7A 3J80W 2R8JA 2LO1A 1U96A 2EBOA 4JI2O 4ECUA 4NXMB 3LULA 2RMKB 2Q0OC 3QO5A 3SYPA 1VF6A 2HJDA 4GX2A 4TWKA 1AUXA 4MV1A 1HR0H 4EGQA 2Q4PA 1AI6A 3QNEA 4IIJA 4WBNB 5FJ8G 2NNUA 1Z2PX 1FXKA 3W7TA 1B33N 2X0LA 3LSSA 1XNQH 4XDLA 5C93A 2EX3A 3R65A 3CSXA 3Q2OA 2AGPA 4ZIBA 4E2LA 2O03A 3ASOB 4HAMA 1XOUA 1KJIA 1P16A 4ZI7F 3L70H 4DYLA 3GJXB 2VS0A 2R9RB 2UUCO 2BTQB 5IYCO 1WB7A 1MZFA 1NZ6A 2CW7A 1YXBA 4RQFA 1AUVA 3VNNA 1V55C 3TIGA 1FKAO 4DAAA 1VQ4V 3K57A 1R6TA 2RDJA 3O9OA 4WFEA 4LNUB 4FS2A 5EZYA 5DM6V 1KYOF 3AG2B 4TV8F 1E4EB 4TV9F 4JI6H 1R3KC 3OHBA 2PYJA 4LF8O 3DTFA 5LP6A 1FXVA 3L2PA 2GPWA 4ECXA 3X2QB 4QWAA 4PA6A 4NYKA 4NTWA 5GONB 5B1NA 3ZHRA 1XEQA 2OCCB 2QWRB 2RGRA 1F23A 5CMUA 1A0IA 4F6RB 1JMKC 3JALB 4H44B 4J7KA 3V4ZA 5EK0A 3JRWA 3P3PA 2ZCEA 3HKBA 3OMAB 1QLNA 1JR9A 5KFJA 3J81W 4DR3O 5GW7A 3HO8A 3B40A 4ZOLA 3N44B 1AI5A 2NVYA 4A3GG 1D5NA 1RSOB 1N36B 4B08A 3NBZB 3OGCC 1YJWV 3I12A 4LFAH 2PTMA 2H94A 2IU3A 1WLEA 2MK3A 3JYCA 2C35B 2GDSA 1S0VA 2EILB 1JIHA 4ECVA 2EIMC 4ECQA 2DE0X 4DR3B 3S3WA 5KT3A 4EBCA 5HFMA 4ZHQF 3OD4A 1AI4A 1IBMB 4NXMH 2SCUB 3K9AA 1N33O 5IYBG 5EOYA 5LMNH 3CRAA 5KFFA 5JQGF 4JZGA 5EC2C 4NZNA 2C28A 3RF2A 2X7RB 5BMVA 1N32H 3P30A 4XYLB 4IRCA 5FNVB 3GIPA 2UVRA 2Q6AA 3BA9A 3G6EV 4C5AA 2X6CA 3CRRA 2F4VO 2BQRA 1FXHA 1BXRA 3ZRWB 3JD2A 5KX5B 5DECA 4BY7G 5JH7B 1J95A 3OMIB 1A0GA 3V6JA 2D2CB 2IM9A 4UFZA 1CP9A 2CQYA 4TUYF 4FVMA 4GKJO 5KG0A 3T99A 3H0GG 2HKOA 2V1DA 5DISC 2J6TA 5KFOA 4A93G 3F7VC 1M90W 1IYDA 1UNNC 1S76D 3WFVA 2QGNA 4I4TA 3OUUA 1PPJH 3LUTB 2NVXA 3BEHA 4O3OA 5GTHZ 1ROPA 3W5OA 4A3EG 3LDDA 2DWDC 1PV0A 2VPSA 2GUZB 1YTFB 1P8LA 5KT7A 1BHAA 4MA5A 3H0GA 2CH7B 3R66A 4QWDA 5K1PA 1S5JA 1KKCA 2WLKA 4O2AF 3T9BA 2DIKA 4J9KA 3PW5A 1JJOA 3PO2G 4O2BA 2DAAA 4DV2O 3JZ6A 2YEVB 1Q86W 4JV5O 1G2WA 3SI8A 2ASJA 2DPJA 3RBEA 1MSWD 3T4DA 5F2VO 1SQGA 5C1OA 2XUMA 2RQ6A 4MTFA 2YIDA 4PDMA 1FPOA 1P4RA 2JEIA 2R7ZG 4DV1O 2CAZC 1VAJA 4GLXA 2VQEB 4QW9A 1N36H 4F4YA 1H2KA 4L8JA 4P9OA 5LBQA 5IYBO 1CKNA 1R3LC 2JJ1G 3RIZA 1HNWO 4ABMA 4J9NA 2O57A 1VQKV 3GWKC 2V4RA 1OCRB 2DWEC 1COWG 3HB9A 4JXUA 4FU0A 4DR3H 2FL4A 2GQRA 3TXQA 2W6ZA 4DR1B 1IBMH 4J0MA 5E79Z 4DV1B 2E75B 5E1AC 2R7ZA 4EFBA 3SJAC 1AJPA 3JARB 4O4JB 5KUKA 2HEPA 1QLEC 1Y66A 3ZBHA 3K9SA 1RP3B 2BQUA 3FAVB 5DQHA 3RUPA 4O7WA 2JEGA 2V9WA 2R85A 2EIJB 4LWSB 5EBWC 4NLGA 3JZIA 4QNHB 4FLWA 4YBZB 4C7UA 4M0JA 4LF9O 2ZM6B 4UB6Z 1XREA 4JI1O 1K3EA 5K2MA 4C5CA 2UXCB 1ZSPA 1IBLH 1OCOB 2PY5A 3HT5A 3CSWA 5B1BB 1AROP 4BW9A 4IR1A 2A1HA 3D3QA 4MTOA 1T5EA 2A9HA 4LFCO 4GLWA 3UZOA 5KFYA 3O65A 3HXLA 3VBBA 1TWCA 4J9PA 4NR1A 2V7QG 2R7NA 5IT9N 2KG7B 5EIBD 1PNMA 4CH6A 5J2TB 5DEDA 4ED1A 4JI5H 2DMXA 1QCEA 1D5AA 4ECWA 2IP4A 1PM9A 3ABKB 5CA1F 4JI3B 1MOFA 1SQQH 2W6PA 1ET0A 1NR1A 4YIOA 3AYHB 5LA6B 4OPHA 4X20B 3ABUA 1RJQA 3R5XA 4MVRA 2WYOA 4J11A 3VQYA 2PVPA 3TINA 3F5WC 3SPJA 1Y4MA 4GC7A 2LGQA 3OEHG 4A3KG 3KG2A 3K58A 4J42A 3CXHF 1QNMA 2ZXWC 2OWOA 3K3WA 5D5PA 3MWMA 4KHPO 2XNDG 2VQEH 4J9MA 3THOA 1W0JG 1O75A 2P0AA 3CCLV 4JI8O 2VUMG 3HR0A 1MABG 4EG0A 2FLNA 5FLMG 2FLPA 1FAFA 3K5OA 4O4HA 4IIJF 3E35A 4DR1H 4DR2B 2RNBA 5EWFA 4ETSA 3JCUZ 3E8BA 2XAHA 2HIXA 4RNNA 4A3FG 3PFFA 4R7RA 4JI8B 1H38A 4AYBE 4I9QA 1S10A 2WPDG 4CC5A 4PHZA 1K9MW 2KQXA 2ZDGA 5KAIZ 4CKBA 5I5XA 3OM3B 2P22C 2VA3A 4IHJA 3T5LA 1LNQA 1EUCB 2Q68A 2F23A 2JRIA 4PD4F 4L87A 5KX5F 4R7CA 3CX5F 2CW8A 1BQZA 4X1YA 3VQVA 3CD6V 5LGTA 2ZM6H 2IJKA 1K1SA 1MNGA 2UXCH 1DLBA 4L1KA 5EZYF 5JWPA 2UXBB 3PW4A 4I50A 3E89A 1SZTA 5IJ9A 2P06A 4CC6A 3E8HA 3JATB 4FZ0A 1JDBB 5KT4A 2W8KA 4UCTA 3D36C 1ZLZA 1J5EO 3U10A 3VA7A 5BWRA 4EBDA 2HHHB 4Q8FA 1WAZA 4QIWE 3CRCA 4I5SA 2D3OW 4MAMA 2KKWA 2YICA 1LUWA 1AI7A 1XMQB 4DV4O 1V55B 2R84A 2WB1A 1XMOB 1F7YA 2JDIG 4JI3H 2ITCC 4CH4A 4DR5O 4GC6A 1S9FA 4DV3O 4FM9A 5BZBA 4ZOLF 1VF6C 3ETHA 1N0JA 1QU7A 1XL6A 2Q69A 2R8GA 1I94B 3ZHTA 4I55B 2XCPA 5C3EG 4UXNA 2EILC 1I1KA 3KTMA 4YY3O 1FXKC 1K34A 1YVWA 4CBCA 1I7LA 2Y4RA 4MV9A 3E83A 3F7YC 4H33A 2BQ3A 3W7XA 1T94A 4DR7B 2QKCA 1TUBA 1MMMA 1NJIW 2RGVA 4HYKA 3EPIA 3T9FA 2OYQA 1OBGA 4XDJA 2HVKC 3IC9A 2W9CA 3ETGA 2HHFB 1HNZB 5BMVF 5BR8H 1N34O 5D5QA 1FVIA 1EKPA 3J7AU 1VQMV 5CBHA 3RYIA 4U7CA 4DR2H 5LOVF 1AVMA 1WN7A 5BWWA 4K6NA 3TY9A 4WFBV 3N2KB 3W7SA 3RAXA 2W70A 1M57C 3N43B 1CKMA 2H3OA 2W6JG 1IDSA 2J6SA 3I56V 2E76B 1KU9A 2EIMB 2P67A 3V6HA 2DYRC 1XILA 1QBZA 3RYCA 2H8PC 3M99B 4JTCB 5EYPB 4FLYA 4O4IF 2XASA 4ZI7B 1LR1A 1IXBA 3DXRB 2GPSA 2VR1A 5KFZA 2R8HA 3G80A 1R3JC 4I4TF 4BBRG 3IFXA 1R73A 4LF7O 1SZXA 1WPXA 4DO2A 3GQCA 1WP7A 4DK0A 2E2HA 1SKVA 3GLKA 2UXBH 2QKAA 3RGBA 1C30A 5CE8A 1ZL8B 1US6A 2QK4A 1GAXA 3P3NA 4TV8B 1IBKB 1YIJV 1EN6A 3G6YA 1L8DA 4TV9B 3I55V 5L3DA 2UU9O 1K92A 1ORQC 2HHHH 2Y4UA 4UV9A 5FLXN 2W0XA 3W7UA 4O2BF 4B3SO 3ORRA 1W2BU 1XMQH 3QVNA 1B6QA 1I7NA 3ZN1A 1GKFA 4W4LA 1XMOH 1GN3A 3VPBA 3ZN0A 1S97A 2PGGA 4A3JG 2UU9B 1A3GA 3PW0A 1V54C 3D3IA 4KFMA 2R86A 2RDIA 1I94H 3M8AA 3OMNB 3JAWB 4QJFA 4B3SB 1JCHA 3APQA 3BPZA 4NVPA 5KG6A 4CH3A 2QKSA 1EM1A 3AG4B 4IRKA 4WFFA 1HWYA 4DR7H 3WWJA 3E22A 1W93A 3EVKA 2UXDO 3R23A 3RR5A 3DF7A 4ZHQB 2VUGA 3ZMZA 4MV7A 1HNZH 2Q7HA 2YUAA 4U7NA 4RUCA 5D1PA 4HNAB 1KC8W 3QO7A 4X9QA 2V59A 1I50A 5JQGB 4C5BA 1H2GA 2Q73A 3GV5B 4PI0A 1SQBH 1S03G 3UCSC 3T1HO 3CRQA 1SRYA 4DUZB 2QM8A 5KFMA 2UXDB 2K9PA 4MSWC 3OUFA 1Q6IA 4LC1A 1XNRB 1GYFA 3DGEA 4N23A 5LHGA 3C3SA 2R93G 5I47A 5LHHA 3LWBA 4TUYB 5KHHA 2UUAO 3T1HB 2QM4A 2F1MA 4W4KA 4DRXB 1QLEB 3H1LH 2W8LA 2R92G 3R5FA 5KFNA 5IYDG 4LR3A 4JV0A 2DN9A 4R8UA 4JAVA 3MDSA 4DK1A 3OTOO 4DV5B 4HNVA 5I5VA 4LF4H 4O3RA 3CCUV 3E8GA 4JYCA 1NI8A 3AK1A 1NS1A 3ETDA 1JX9A 3CC7V 4LF5B 3I4NG 2R93A 5IDJA 1IBKH 3HPLC 4J9LA 2FK2A 5IJ0B 3ZX6A 2COJA 1DF4A 1L2ZA 1OCZC 3CCMV 4O2AB 4TQDA 4BWAA 3BQ2A 3GTPA 3WG7C 2F93B 3ZCCA 4Q4CA 5BYAA 2R92A 4FK5C 2WLNA 1Y76B 3GIKA 4DV7O 2Z5UA 2Q7EA 3B2EE 1CXZB 1ENVA 1WJZA 5IE9A 2QE7G 1I2LA 4J80A 3VPCA 5J2UA 4QSHA 1TVKB 3STLC 4UVCA 4O81A 1RYRA 1KJ8A 2Y48A 1R9TA 2UU9H 4HZ3A 4K0KH 4FM0A 3OAAG 1HDJA 3RYHA 2C00A 3H01A 4X62O 1THZA 1M1KW 2WLHA 5LXTA 3BQ1A 2X5RA 2DYSC 2W0FC 4EB6B 2E5LH 2QSAA 2HG8A 3CC4V 4FGRA 2LW1A 2WE6A 5DG9A 1E4EA 3RWRD 2ABJA 3H9VA 5LYJA 5FPRA 4CH5A 3MAQA 1GSOA 1AR1B 1UFIA 4YHHO 4MV6A 3HKDA 5CA0A 2XCAA 2W57A 3KHLA 2HGWA 3GTGA 3K04A 4PA7A 2ZXWB 5GONA 4FFBA 2WAQA 3CXCU 4EKWA 2J9GA 3SDLA 1VMGA 4IHJF 3TEKA 4O7RA 3N6RA 4J9SA 4DUYO 4HR7A 4CS2A 1BCCH 4DUZH 1Z2GA 1Y1VG 4CS4A 4JI2B 4KL1A 3K5LA 1TWHA 2A06H 3BA8A 4DXWA 3RVZA 1XNRH 2R9AA 3UFXB 4XDKA 5IYDO 5KHIA 5CN0A 4X1IB 4I50F 1NH2B 2MCTA 4FFKA 2B63G 4MTGA 1E1RG 4WF9V 3U54A 2C2DA 4ME6A 2FKLA 3HBLA 4DUYB 1CKOA 1XK5A 1S0MA 4DL5A 3SJCC 4DIMA 4X1KA 1S72V 1YCIA 4KXRA 1Y1VA 3OHAA 4DV5H 5A2QN 4LCUC 4BW5A 4ED0A 5DGAA 1L0NH 4A2BA 2BSKB 4LF5H 3PVXA 4PDVA 5KAFZ 2M05A 2X6AA 2B63A 4JTDB 5CB4A 4B3TH 3LQSA 2UUCB 4G28B 3EPGA 3T54A 5FNVA 3KALA 3H4BA 5CA1B 1G1XB 2W9BB 2Z0AA 3QFFA 2OCHA 2JGDB 4HNTA 2DQ0A 1QR8A 1NQTA 3VPDA 3K59A 3UQ8A 3CE2A 1A9XA 4JYYA 1HNXO 4RB2C 3UO2A 3N42B 2ZE8A 2WA4A 5EBMC 4ECTA 2BOBC 1ZWIC 4LF8B 4FZ1A 2WLIA 2XAJA 4FPPA 1MA1A 4OGQB 4Z1VA 3KCXA 1X4TA 2AGOA 3V4SA 4O7VA 4QE7A 3OEEG 1GN4A 4LF6O 1EZJA 2YL2A 1BJTA 2XGPA 1GLVA 3IAYA 1Y6XA 2QF7A 3U9TA 1O9HA 2XT9A 4IIJB 3HKZA 3K06A 1L1FA 2ZNIA 4A3IG 3N27A 1RJPA 1FXKB 3JD1A 4BIZA 1JFFA 1B6SA 3G6BA 4FM1A 2F43G 2Q8VA 3HOYG 1A32A 1VQOV 1I1LA 4YJ3A 3VMMA 1E4FT 2EJ7A 1F51A 1HW7A 2Y0SA 5KFUA 1JLLB 2ZR2A 2YEVA 2HP8A 2I8CA 4UV8A 4DL4A 2I87A 2IBZH 3V6KA 1RPOA 4QPJA 3RGXA 1FS0G 3UM7A 4FLTA 1JKJB 4JI2H 1Q5OA 2HVJC 1K1QA 4LSXA 2PMZA 5HFLA 3CP1A 1K73W 1N33B 2DABA 4DW1A 4YB8B 4O3SA 3T4ZA 3A8TA 2ASDA 1KUTA 1Z2NX 2CTWA 4J9RA 3VQXA 1CPYA 1SF9A 4UB8Z 3MR5A 1M57B 5C8YA 2FK1A 5EZYB 4Q0YA 4DUYH 3GTQA 2YRXA 4X88A 1CEZA 2IJIA 4PDLA 2DYRB 3ZMSA 2F4VB 4EEYA 2YS8A 3FYEB 1EYZA 3GILA 1XI1A 2ZDIA 3PW7A 4LSAA 1H2MA 2HDKA 1WCMG 1P84F 5J9PC 2PI4A 4UUGA 3G6XA 1S68A 3CCVV 1I3QA 3JARA 3ZS8C 4H37A 4HBNA 4GKJB 5JVLA 1DTOA 3OGIB 2DOSA 2UUCH 3EYYA 4H13B 2Z04A 5JVDA 1OCCC 2WTFA 4MT8A 1SESA 3LNNA 4IYHA 2ADPA 2PI5A 1FKAH 2ZR3A 3HKBB 4X65O 3KHGA 1EZ1A 2HJWA 4ZOLB 3AW8A 1VQLV 1I1MA 3AG4C 3T2MA 2YWVA 5IP9G 3RB6A 1NTKH 3DC6A 1WCMA 4NTYA 3WB1A 2W6QA 2W6MA 4B7EA 4RAIA 2YCHA 5BWTA 4K8XA 4LF8H 2HFEC 3AX6A 4APMA 1JPXA 2Q9LA 1V51A 4B3MO 1GH6A 4NXNO 1YITV 4LFBO 3C3TA 1NBMG 3RBZA 4RAZA 2VRZA 1HP8A 4DV2B 4K8ZA 2G38A 2V4QA 4JV5B 1V54B 4DV0O 2W9AA 3G6VA 3N2GB 5BMVB 3GTLA 3QF7A 2QTOA 5KFQA 1SQVH 3G71V 2E2IA 3F5TA 1N8RW 5LOVB 1VP7A 2QDOA 4JI7O 3WWHA 4WCEV 1N48A 1B06A 1M93A 1PP9H 1Q43A 5EIBC 1KC7A 2NR5A 5DLFA 1WPBA 4PI2A 2JGUA 4U3FH 3K0DA 1HNWB 2FB9A 3CYOA 1SS3A 2FTKA 4FS1A 5KMGA 2FKXA 3CC2V 5DG7A 4NB5A 4O4IB 3UZBA 2NU7B 1N33H 1VQ9V 1BGYH 4I4TB 3CJHA 3NC0B 2JS5A 3JAMN 1JA8A 3U55A 4TSFG 4I0XB 1E4GT 2UUBO 5KFHA 3ZMUA 1K4CC 3MR3A 4G2KA 3HOZG 4O4LA 4JI4O 4MV3A 3TXSA 1CE8A 5DMXA 2F4VH 2UVUA 2AHYA 2RN9A 3TK1A 4KUMA 1K7DA 1BZKA 1T3NA 3ZHSA 3BFRA 1FFXA 2HJFC 4BIUA 2RDCA 2DJVA 4LF9B 4JI1B 4LBEC 4O2BB 4GKJH 2UUBB 5KT5A 1RYSA 5L3FA 1IOWA 3HKCB 2YW2A 2AXTZ 4DV6O 3QTCA 2CFMA 2CTPA 3D8CA 4FFPA 4RAYA 1TAEA 5LMUO 2GTAA 1JXLA 2GBOA 2A79B 2HVSA 1AP6A 2OT5A 2EZPA 2V58A 1IYEA 4LFCB 1AJQA 5LXTF 1KTAA 5IT9W 2EJ2A 4DQNA 2B1GA 3I4MG 3RV3A 3RGZA 5KFPA 3MJFA 3ABMC 1OCZB 3MHSC 2N05A 3WG7B 1WSCA 2ETNA 3WWIA 5LMUB 3NR7A 4MVSA 1SETA 4DLKA 5LYJF 4DL6A 5KT2A 1KQSU 4ECSA 4UCVA 5CA0F 4ED7A 2WWWA 3SYAA 1VIBA 3GTOA 4JAUA 1M9NA 4DV2H 2YIAA 2ZIOA 1VEWA 1K4DC 4JV5H 4RQEA 5FR9A 4IWYA 3B09A 1DIKA 4RUFA 1EKVA 4B3RO 1RPRA 2ATLA 4FLZA 3LMLA 4RNMA 3B77A 2BCCH 3L71H 5L3GA 2DWCA 4O82A 2R87A 4MVQA 1SQPH 2FP4B 2VQDA 3HKEA 1O9GA 2DYSB 1JVMA 3MD0A 4BBSG 4KHPB 3ICXA 2KSWA 4DV1H
chains in the Genus database with same CATH topology
3J80W 2HHHH 2PYLA 4NXMB 4I55A 1XMQH 1HNWH 3BAAA 4B3RB 1XMOH 1HR0H 3BHPA 4JI5B 4IIJA 2PGGA 5ITZA 4WBNB 4RB3C 1Z2PX 2UU9B 4X65B 1JFFB 1I94H 1XNQH 3JAWB 2EX3A 4B3SB 3CSXA 4YJ3B 1I7FA 5KHJA 3RYFB 4ZIBA 3BPZA 4NVPA 2O03A 1HNXH 4CH3A 3HKCA 4D7SA 5J2TA 1KMIZ 3A2FA 1P16A 3JASB 3GJXB 4UCUA 1QHTA 2BTQB 5JCOA 4B3MB 4DR7H 3E22A 4NXNB 2CW7A 4LFBB 4X20A 5LA6A 3VNNA 3JAKB 4LF9H 3RR5A 3DF7A 4ZHQB 4JI1H 2VUGA 4LF6H 3K57A 4I7HA 4MV7A 1HNZH 4D7TA 2Q7HA 4DV0B 5D1PA 4HNAB 3N6XA 4RB0A 4LNUB 5C8YB 5EZYA 5JQGB 5EYPA 5LL6b 4PI0A 1S03G 3U11A 4DR4B 1J5EB 4JI6H 2PYJA 4JI7B 4LFCH 1ZHQA 4DUZB 3FFQA 5LP6A 2UXDB 3L2PA 1ZHSA 5FD5A 5GONB 4X66B 1XNRB 2RGRA 1GYFA 2P5OA 4DV4B 4TUYB 5KHHA 1A0IA 5JVDB 4F6RB 1JMKC 3JALB 3T1HB 4DR5B 2QM4A 2F1MA 4DV3B 3JAMW 4DRXB 2ZCEA 3HKBA 1TGOA 3J81W 4ZOLA 3N44B 4LR3A 4DK1A 4DV5B 4YJ2A 4LF4H 4YY3B 1N36B 4B08A 3NBZB 4JI4B 3VQWA 2HIVA 4LF5B 4LFAH 2PTMA 1IBKH 4IHJB 4KHPH 5IJ0B 2JVDA 3CVZA 4LH6A 4DR3B 2FE3A 1L2ZA 4TOIA 4BWAA 4O2AB 4TQDA 3KXYT 4JI8H 3CB2A 2F93B 4X1YB 1IBMB 4NXMH 1B04A 5LMNH 5EOYA 4B3RH 3RYFA 2R70A 4DV6B 2Q7EA 4AQYB 1CKNB 3B2EE 1N34B 4I50B 5LP6C 5J2UA 3RF2A 1TVKB 5BMVA 5IJ9B 1N32H 3QG5A 3JASA 5FNVB 3JATA 2UU9H 4X65H 3BA9A 3K5MA 4K0KH 4FM0A 2YXLA 3RYHA 2RJZA 2R72A 3JAKA 5KX5B 2XHBA 5JH7B 5LXTA 3U0ZA 5D1OA 2IM9A 3KAJA 4UFZA 4EB6B 2E5LH 4FVMA 5KMGB 2WE6A 4B3MH 3RWRD 4NXNH 3DSQA 5IYZA 1VF7A 5LYJA 3C0FB 5FPRA 5DISC 4CH5A 4LF7B 4BWSC 4LFBH 3MAQA 3TY8A 3HKDA 5CA0A 4I4TA 2W57A 4JYAB 4GKKB 1XQ8A 4DV0H 5JJEB 2HGSA 5GONA 4FFBA 3W5OA 2XIGA 2VPSA 3K5NA 4O4LB 1P8LA 5BR8B 1J5EH 5FLXW 4CS2A 5FD6A 4E6NA 4JI7H 4DUZH 5K1PA 1S5JA 1M0WA 3L4KA 1WH2A 4CS4A 4JI2B 4KL1A 3K5LA 1TUBB 1Q3EA 3BA8A 4X66H 1XNRH 2R9AA 1JJOA 1FFXB 2V4DA 4DV4H 4O2BA 5KHIA 4X1IB 1YEWA 2MCTA 2YIBD 4UCRA 1BGWA 4DR5H 4LMYA 4DUYB 4DV3H 1CKOA 1SQGA 3RYIB 1XK5A 4PZ7A 2Q0AA 3SJCC 2RQ6A 4X1KA 3N2KA 1Q8IA 4DV5H 4EEQA 2UUBH 2CAZC 4GLXA 2VQEB 4YY3H 1N36H 4JI4H 4DR6B 4A2BA 4L8JA 1TA8A 1CKNA 4LF5H 2YI8A 3RIZA 5CB4A 1TVKA 1SA0A 4B3TH 2UUCB 2ZNJA 4M7EA 4ZI7A 5FNVA 4DR3H 4DRFA 3KALA 4Q6GA 1M5IA 5CA1B 4LH7A 4DR1B 3RFRA 4JI0B 1IBMH 4UCOA 4J0MA 4DV1B 3UT5A 4DV6H 4EFBA 3SJAC 1N34H 3JARB 4O4JB 2WDTA 3ZEDA 3K59A 3UQ8A 2HEPA 4EB6A 5LMUH 5IWAB 4O4HB 4RB2C 1VS0A 1M4UA 3N42B 4PZ8A 1HR0B 4TV8A 3HKEB 4LF8B 1Z2OX 4TV9A 1G6UA 1H2SB 4UCSA 1X4TA 4IAJA 1I6UA 4FLWA 1XNQB 5JJNB 2ZM6B 3SJBC 1Z5VA 2VWKA 2E3CA 2UXCB 3OTFA 1BJTA 1XDNA 1IBLH 2PY5A 2UUAB 3IAYA 1O9HA 4IIJB 4LF7H 3RJ0A 4BW9A 4WBNA 5ITZB 5JJJB 2ZNIA 1MZBA 1JFFA 4FM1A 1T5EA 3GDEA 4U3JB 3JAWA 1DGSA 3OTOB 4YJ3A 2ZJTA 3HXLA 1E4FT 4FM2A 1HW7A 5EIBD 4CH6A 5J2TB 4JI5H 2VWJA 3KYHC 1D5AA 2BTQA 1WNSA 2PZSA 3RGXA 4FLTA 4JI3B 4JI2H 3E22B 1Q5OA 4TQFA 4LSXA 4X20B 5LA6B 4B3SH 2WYOA 1N33B 4DV7B 3VQYA 4ZHQA 1Z2NX 4HNAA 2HVRA 3VQXA 4LNUA 5C8YA 4Q0YA 5EZYB 5JQGA 1M0TA 2KSWA 3PN1A 4DUYH 2Q7GA 4OX9B 1ZAUA 3NBYB 4RZQA 3TY5A 3K58A 3BRCA 2OWOA 2F4VB 4CS3A 5D5PA 3MWMA 1XI1A 5CA1A 4X62B 4LSAA 2VQEH 2F66C 3THOA 1FJGB 1O75A 4DR6H 1S68A 5KHKA 3BABA 3ETQA 3JARA 1SQFA 3ZS8C 1V9PA 4HBNA 4GKJB 3FMAA 4LF4B 3KAKA 3N40P 2UUCH 5K1XA 3EYYA 4TUYA 3K5OA 4O4HA 2VQFB 5JVDA 4F6RA 4DR4H 3JALA 3LNNA 3M7MX 3J7AK 2UXDH 4YHHB 4DRXA 4X64B 4DR1H 1FKAH 4JI0H 4DR2B 1NT2B 3HKBB 4ETSA 2Q2UA 4ZOLB 2HIXA 3W1GA 1XHXA 3JSNA 2BTOA 4JI8B 4R7RA 3JSLA 4I9QA 4YJ2B 3WB1A 1RSOA 4CC5A 5IWAH 5LMNB 4PHZA 3T1HH 2HVQA 2YCHA 4PZ6A 4MTDA 2P22C 4IHJA 3WB2A 4K8XA 4LF8H 1SYXB 1N32B 4APMA 5IJ0A 4PDBA 3N41B 4O2AA 3SR2C 4K0KB 4X1YA 3VQVA 4U3JA 2ZM6H 4RAZA 4DV2B 4K8ZA 2UXCH 3T1YB 4JV5B 3RYCB 2UUAH 2UXBB 4I50A 5J2UB 3WB0A 5IJ9A 3N2GB 5BMVB 1Z5WA 5FPOA 2E5LB 4CC6A 3QF7A 2QJ1A 4FLVA 3JATB 5A2QW 4UCTA 2VOBA 3U10A 2PUSA 3RYHB 5LOVB 3OTOH 2F95B 5KHGA 5KX5A 5JH7A 1M93A 1Q43A 5EIBC 2HHHB 4AQYH 5LXTB 5D1OB 3L4JA 4FLXA 1WPBA 2KKWA 4PI2A 2JGUA 1XMQB 1HNWB 1X9NA 3W1BA 2YIBA 1XMOB 5KMGA 4JI3H 4CH4A 5IYZB 4O4IB 5LYJB 1QQCA 4FM9A 1N33H 4DV7H 3HKDB 5CA0B 4I4TB 3NC0B 2JS5A 1I94B 4I55B 2ZIMA 3CHXA 3RTXA 4FFBB 1E4GT 1HNXB 4OX9H 4O4LA 4MV9A 4AILC 1SEIA 2F4VH 2GV9A 3S24A 4X62H 4JYAH 4DR7B 4GKKH 3ICXA 1TUBA 1FJGH 4MTEA 4AHCA 2RGVA 1FFXA 4LF9B 1P49A 2OYQA 4EQ5A 4JI1B 4O2BB 4X1IA 4LF6B 2UUBB 3F8NA 5JCOC 4GKJH 3HKCB 1HNZB 5BR8H 2VQFH 3QTCA 2CFMA 4EFEA 5D5QA 1FVIA 3GB8B 4RAYA 1AN7A 3QWUA 1TAEA 4YHHH 4X64H 3RYIA 4B3TB 4DR2H 2HVSA 1WN7A 4X1KB 3TY9A 4JI6B 3N2KB 3M4IA 4LFCB 3N43B 3H20A 5IT9W 1CKMA 1KU9A 3RGZA 2YI9A 3IG0A 3RYCA 3SGIA 5EYPB 5CB4B 1SA0B 3N2GA 5LMUB 4FLYA 2Q2TA 4ZI7B 4UCVA 5LP6B 3K3VA 5LOVA 4DK0A 1XHZA 1SKVA 3UT5B 4DV2H 2YIAA 2ZIOA 3T1YH 4JV5H 2UXBH 4O4JA 4A2AA 3RGBA 4FLZA 3LMLA 1IBLB 4LFAB 4TV8B 3HKEA 1IBKB 1O9GA 4FLUA 2ZINA 4RB1A 2CW8A 4O4IA 1L8DA 4KHPB 4TV9B 4GYCB 4DV1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB B;  4UCS A;  2E5L B;  5FPO A;  4CC6 A;  4NXM B;  1XNQ B;  2ZM6 B;  3BA9 A;  4UCT A;  3BAA A;  4B3R B;  2UXC B;  1XDN A;  2UUA B;  2HHH B;  4JI5 B;  5D1O A;  5D1O B;  4UFZ A;  2UU9 B;  4X65 B;  1XMQ B;  1HNW B;  1X9N A;  3GDE A;  3W1B A;  1DGS A;  3OTO B;  1XMO B;  4B3S B;  5FPR A;  5DIS C;  4LF7 B;  3TY8 A;  3KYH C;  4JYA B;  4GKK B;  1P16 A;  3NC0 B;  1I94 B;  3GJX B;  4UCU A;  3RTX A;  4B3M B;  3W5O A;  4JI3 B;  4NXN B;  1HNX B;  4LFB B;  3VNN A;  1N33 B;  1P8L A;  5BR8 B;  4DV7 B;  3RR5 A;  2VUG A;  4E6N A;  4DV0 B;  3S24 A;  5D1P A;  2HVR A;  4DR7 B;  4JI2 B;  3PN1 A;  3BA8 A;  4OX9 B;  1ZAU A;  3NBY B;  4LF9 B;  3TY5 A;  4DR4 B;  4EQ5 A;  4JI1 B;  4LF6 B;  1J5E B;  2UUB B;  2OWO A;  2F4V B;  4JI7 B;  1HNZ B;  4X62 B;  4DUZ B;  2CFM A;  2UXD B;  4EFE A;  1FVI A;  3GB8 B;  3L2P A;  4UCR A;  3QWU A;  1TAE A;  4DUY B;  1FJG B;  4X66 B;  1S68 A;  4B3T B;  1XNR B;  1CKO A;  1CKN B;  3BAB A;  1XK5 A;  4DV4 B;  4PZ7 A;  2HVS A;  1V9P A;  4GKJ B;  3TY9 A;  4JI6 B;  4LF4 B;  4LFC B;  2VQF B;  1A0I A;  1CKM A;  4EEQ A;  4GLX A;  2VQE B;  3T1H B;  4DR5 B;  4DV3 B;  4DR6 B;  4YHH B;  4X64 B;  1TA8 A;  4DR2 B;  1CKN A;  3SGI A;  2Q2U A;  2HIX A;  5LMU B;  2UUC B;  3W1G A;  3JSN A;  2Q2T A;  4JI8 B;  3JSL A;  4DV5 B;  4YY3 B;  4CC5 A;  1N36 B;  5LMN B;  4DRF A;  4UCV A;  4JI4 B;  2HIV A;  3NBZ B;  4LH7 A;  4DR1 B;  4JI0 B;  4UCO A;  4LF5 B;  2HVQ A;  4PZ6 A;  4DV1 B;  1N32 B;  4EFB A;  3UQ8 A;  4LH6 A;  4DR3 B;  4JV5 B;  4TOI A;  5IWA B;  4K0K B;  1VS0 A;  1IBM B;  4PZ8 A;  1B04 A;  1IBL B;  4LFA B;  1HR0 B;  1IBK B;  4DV2 B;  3T1Y B;  4DV6 B;  4LF8 B;  4AQY B;  4KHP B;  1N34 B; 
#chains in the Genus database with same CATH topology
 3K03 A;  1ULZ A;  4JPR A;  4I55 A;  3HOV G;  4BIO A;  1HNW H;  5DG8 A;  4B3R B;  5KFB A;  3JD0 A;  5KLV H;  2AHZ A;  5IP7 G;  4RUE A;  1N4C A;  1BSM A;  5ITZ A;  2YZG A;  5BY1 A;  4U7O A;  2LP7 A;  5H5N A;  4ED6 A;  1KJQ A;  1UJW B;  4Q8E A;  3K08 A;  2FK3 A;  2R82 A;  3GII A;  4ECR A;  5KHJ A;  3AEI A;  3DAA A;  4YP3 A;  3RYF B;  4O3P A;  4DR6 O;  5CB4 F;  4D7S A;  2DZD A;  1KMI Z;  3A2F A;  3CME V;  3HB3 B;  3JAS B;  3KCY A;  2ALZ A;  2Y69 C;  1QHT A;  2JEU A;  5JCO A;  4DR4 O;  3I5D A;  5LP6 F;  3HOX G;  4GUN A;  3JAK B;  4P9P A;  3E8F A;  2LW7 A;  4LF9 H;  2VPQ A;  4JF3 A;  1GSA A;  4JI1 H;  4I7H A;  4JGS A;  2W7O A;  4XX0 B;  3ABL C;  1AP5 A;  3Q1K A;  4FFR A;  3N6X A;  4RB0 A;  1QVG U;  2EIK C;  2UXX A;  5EYP A;  5IWA O;  1KKD A;  5LL6 b;  3U11 A;  3K5H A;  4DR4 B;  1J5E B;  2YZN A;  1NTM H;  4RWU A;  3FYI B;  4LFC H;  3CCS V;  3FFQ A;  5KKN B;  3QO8 A;  5EWE A;  4WFA V;  1JQ0 A;  4NTX A;  5KG4 A;  1GM8 A;  4QPK A;  4DV4 B;  2ZDH A;  3L75 H;  1NH2 D;  2ITD C;  2JA6 G;  2OLS A;  1K5Q A;  5I5W A;  3S3X A;  4DR5 B;  3ZRV A;  2YSU B;  4G27 B;  1JOY A;  5F9L A;  4DV3 B;  3LDC A;  4MW8 A;  4HNU A;  3QZ7 A;  5JQW A;  2XOK G;  1I08 A;  2LFR A;  4YJ3 F;  4IZO A;  4JZ2 A;  4YJ2 A;  3SPI A;  4YY3 B;  1CQI B;  1ZTE A;  3VQW A;  4AQY O;  4X89 A;  4NYE A;  1S5H C;  5LL6 Y;  3IGA C;  1VBG A;  5KFA A;  2JA6 A;  4IHJ B;  4KHP H;  2NLJ C;  4ZKI A;  2P6J A;  2FE3 A;  4JI8 H;  1KEC A;  3CB2 A;  1P7B A;  4X1Y B;  1A48 A;  4R8C A;  1KT8 A;  4B3R H;  5B1A C;  4AQY B;  5C8Y F;  1N34 B;  2COG A;  3CEI A;  4I50 B;  5LP6 C;  3AK2 A;  5BWV A;  1EFR G;  5IJ9 B;  5HNE A;  1SFO A;  4FFO A;  3WNZ A;  4OX9 O;  2JA7 G;  2KSD A;  1PL4 A;  2A0L A;  4LP8 A;  3A0B Z;  2JIZ G;  3ETE A;  4GT1 A;  2OTJ V;  2A7W A;  3B8N A;  1KP3 A;  2RJZ A;  2R72 A;  3ASN C;  1W0K G;  4JYA O;  4GKK O;  2AGA A;  2FPP B;  3U0Z A;  2GQS A;  5D1O A;  3GTJ A;  2FB5 A;  3H1I H;  5JVD F;  2OTL V;  3TCU A;  2VQF O;  1C3O A;  2NUA B;  5IYZ A;  3ZHQ A;  2C2R A;  5KFL A;  4BWS C;  2JA7 A;  4LF7 B;  4J9Z B;  3R9R A;  3K3P A;  4X64 O;  3N8D A;  4O3Q A;  4JYA B;  4GKK B;  1XQ8 A;  1Q81 W;  2IJH A;  1N0N A;  3LSU A;  3SNO A;  5JJE B;  4R6Z A;  2XIG A;  4FBT A;  2QWO B;  3TW6 A;  1FD9 A;  4RU9 A;  5DLG A;  1OZ0 A;  2Y0S E;  1J5E H;  3SYQ A;  5FLX W;  3KKY A;  3Q4H B;  5L3B A;  4E6N A;  4MVO A;  1Y74 A;  4MVZ A;  1WH2 A;  4NZM A;  2V5A A;  5A9G A;  1OCC B;  1TUB B;  1VQ8 V;  2BE3 A;  1OJH A;  2PMZ E;  4DV4 H;  1CS0 A;  2GHY A;  2W9C B;  2J6U A;  4RO2 A;  5DQI A;  4OPA A;  2W6O A;  3G4S V;  1I5Y A;  4UCR A;  4DR5 H;  1MG1 A;  5IY5 C;  3BY6 A;  4LMY A;  4DV3 H;  3RYI B;  4PZ7 A;  2Q0A A;  2AGQ A;  4PA3 A;  3CCE V;  2EJ3 A;  1F4N A;  1Q8I A;  4FIP C;  2CE4 A;  3FX7 A;  3TGU H;  2YZM A;  3MWD A;  3NXS A;  4EEQ A;  3E5N A;  1TWF A;  1K5S A;  4YY3 H;  3K0G A;  2WLL A;  4A5U B;  5KFI A;  1WA8 B;  4Z1M G;  1TA8 A;  3G8C A;  1YTF D;  3RN4 A;  2ZDI C;  4Q20 A;  4O7S A;  1TVK A;  1SA0 A;  5E25 A;  1S77 D;  1DK1 A;  1BT8 A;  1HR0 O;  5L3E A;  3RFC A;  4TQR A;  4DRF A;  1M5I A;  3RFR A;  4IYI A;  2JJ2 G;  3UT5 A;  2FJZ A;  4IR9 A;  3M9N B;  2FYU H;  2JEJ A;  1GMG A;  1N34 H;  1XNQ O;  3K5I A;  2WDT A;  3ZED A;  5EDW A;  4O4L F;  4EB6 A;  4MS2 A;  3SJQ C;  3BAC A;  1K83 A;  1VS0 A;  2QB5 A;  1M4U A;  1HR0 B;  3SPH A;  4RUA A;  1YI2 V;  3T5K A;  1RJR A;  3RW0 A;  3WU2 Z;  1NR7 A;  3MHH C;  1Z2O X;  4BXX G;  4TM5 A;  2VA2 A;  3APO A;  4UCS A;  1S0N A;  1WP8 A;  2YXH A;  1XNQ B;  1KJJ A;  5KFC A;  4EYI B;  1Z5V A;  2KB1 A;  1NU1 H;  2UVW A;  1MSD A;  3H1J H;  1XDN A;  2UUA B;  4QGP A;  5L1L A;  1BL8 A;  3RV4 A;  3ZIA G;  3JD4 A;  4LF7 H;  4WBN A;  4ASU G;  2XAG A;  2XAQ A;  4JI6 O;  4O7N A;  4U3J B;  3OTO B;  4QJF B;  2QTS A;  2RF4 A;  3CEB A;  2ZJT A;  3CRM A;  3IJ4 A;  4YR0 A;  3TQ1 A;  4FM2 A;  2AQ4 A;  2WSS G;  3RB0 A;  2VWJ A;  1BQ0 A;  3KYH C;  5IYC G;  2ARH A;  2BTQ A;  1GTO A;  2PZS A;  2XTA A;  1UPG A;  2CK3 G;  2AZ0 A;  4DL2 A;  3E22 B;  3FB5 C;  4B3S H;  2ZD9 A;  2ATK C;  1IXM A;  3AG3 C;  4AYB A;  4DV7 B;  1S0O A;  1YJN V;  1SC5 B;  3KRE A;  1FJG O;  5DGH A;  1AR5 A;  1XDC A;  3QZ8 A;  4O4H F;  2HVR A;  2BSK A;  1UC8 A;  3FD9 A;  4LNU A;  2JA5 G;  1M0T A;  2Q7G A;  4RZQ A;  1ZAU A;  3TY5 A;  1EBO A;  2ILM A;  3ABM B;  4XZ3 B;  2ODT X;  2FML A;  1L0L H;  5CA1 A;  4X62 B;  3L73 H;  3OT7 A;  2EJR A;  2F66 C;  4PEL A;  4K35 A;  1FJG B;  2DW4 A;  3J80 N;  3ETQ A;  4HN2 A;  3BCC H;  1SQF A;  2Z02 A;  1V9P A;  2WAM A;  2Y4T A;  3C90 A;  3CS5 A;  5LMN O;  4ZBM A;  3GID A;  3FMA A;  3N40 P;  4C2M A;  3WO1 A;  2JA5 A;  4F6R A;  3JAL A;  3FDS A;  1N32 O;  3J7A K;  2UXD H;  5CBG A;  4YHH B;  4Q44 A;  4Q4D A;  4PA4 A;  4QIW A;  1AIL A;  1XHX A;  3JSN A;  4FBU A;  2BTO A;  4R8U B;  4YAK B;  1GM9 A;  1RK5 A;  1RSO A;  2HLD G;  4ECZ A;  5LMN B;  4YQW A;  2DLN A;  1IVS A;  1JJ2 U;  3T1H H;  2HVQ A;  4PZ6 A;  4FMT A;  4MTD A;  4J10 A;  3ZHU A;  1N32 B;  5BYB A;  2JA8 G;  1MZE A;  1Y1W G;  1E79 G;  4MV4 A;  3N41 B;  4CKC A;  1TUE B;  4M9U A;  2PBZ A;  1B3Q A;  1VKZ A;  2NU6 B;  1DAA A;  2NU9 B;  2UUA H;  1D2D A;  5K3W A;  5J2U B;  1PKX A;  3K79 A;  3WB0 A;  2QEX V;  5FPO A;  4ECY A;  4A3C G;  1BE3 H;  2YS6 A;  5KFG A;  4FLV A;  3BJY A;  5A2Q W;  3GV7 B;  2FPI B;  1XUQ A;  3SE7 A;  1Y1W A;  2PUS A;  3RYH B;  5DAA A;  3OTO H;  3FB8 C;  3ZRW A;  3UKM A;  5KX5 A;  3T7A A;  2Y69 B;  5JH7 A;  2R9I A;  5LXT B;  1GN2 A;  3CCJ V;  4WFH A;  3ABT A;  4FLX A;  3OUS A;  3PR4 A;  3FKI G;  4BY1 G;  2EZO A;  3MR6 A;  3W1B A;  5BPF A;  1VQN V;  1GM7 A;  3KHR A;  1LUV A;  4NKG B;  1NVP B;  5KFV A;  2B9Z A;  2ADQ B;  5LYJ B;  4CZZ A;  1VF5 B;  4PWQ A;  3ABL B;  1QQC A;  3JZF A;  2FLL A;  3PO3 G;  2EIK B;  4DV7 H;  3HKD B;  5CA0 B;  1YZB A;  4F4L A;  1QVF U;  4PBC A;  4YJ2 F;  4RZR A;  2ZDQ A;  3TET A;  3CHX A;  1RM1 C;  4FFB B;  3J81 N;  2R7M A;  3P32 A;  1BS3 A;  4EYH B;  3RB3 A;  1HNX B;  1N36 O;  2GUZ A;  3ORQ A;  3FKI A;  4AIL C;  2CH7 A;  2GV9 A;  2CTR A;  4X62 H;  2XC9 A;  4K3A A;  4RNO A;  1I0H A;  2QM7 A;  2M6Y A;  3OFN G;  3BQ0 A;  1FJG H;  4MTE A;  4AHC A;  2R8I A;  5KA5 A;  2UXN A;  2ZE7 A;  1IBM O;  1PNL A;  5I5T A;  3F8N A;  4LF6 B;  5JCO C;  1OHH G;  3JD3 A;  2C2A A;  3GB8 B;  4X8A A;  4EFE A;  5F9N A;  1AN7 A;  4Q43 A;  4YHH H;  2WB1 E;  3MWE A;  5I5S A;  1QR9 A;  4X1K B;  2PF4 E;  2P90 A;  3SPC A;  2Q7D A;  1IOV A;  2AU0 A;  3L9D A;  5I60 A;  2GTS A;  2YI9 A;  2CDY A;  4DW0 A;  3T9C A;  3IG0 A;  5C44 G;  5CB4 B;  5CR5 A;  4PJ0 Z;  3RVY A;  3N2G A;  5CA3 A;  3A0R A;  5IYZ F;  3SYC A;  2Q2T A;  2W6I G;  1IBL O;  5B1A B;  5DQG A;  3H40 A;  3GIJ A;  5BXZ A;  2AZ2 A;  2R7L A;  3LDE A;  4IRD A;  5LP6 B;  5LOV A;  5HBR B;  5LGN A;  5T14 A;  4F6E A;  5CM0 A;  2PN1 A;  1EUD B;  4O4J A;  1GRJ A;  3ZMV A;  4YAJ B;  4B7K A;  2OH2 A;  2L6L A;  3ASN B;  1PK8 A;  3ZJZ A;  2W7P A;  1IBL B;  3FAV A;  2QR4 A;  4JI5 O;  2ZIN A;  4O4I A;  4A3M G;  4R50 A;  2WLI B;  4PV1 B;  3STZ C;  2YU9 A;  4LWS A;  3TQT A;  2PYL A;  1R6N A;  4FE2 A;  3KZI Z;  2LJ2 A;  2EJ0 A;  4I0X A;  2HR3 A;  3BAA A;  4PA9 A;  1VAR A;  3M9O B;  3BHP A;  1VQ6 V;  3G67 A;  4O7L A;  4JI5 B;  4RB3 C;  1KD1 W;  4EGJ A;  4X65 B;  1CQJ B;  2YXY A;  1JFF B;  1NKD A;  2RCV A;  3ZHV A;  4YJ3 B;  1I7F A;  3B8M A;  2VQE O;  4AI8 A;  1HNX H;  2ZKO A;  1GSH A;  2EIN C;  3IN5 A;  5H6R A;  3HKC A;  1SQX H;  2KG7 A;  5J2T A;  4IL6 Z;  5C4X G;  3AG7 A;  4UCU A;  1YF2 A;  2IH3 C;  4B3M B;  3SPG A;  3GWO A;  4NXN B;  3T9D A;  4LFB B;  5KS8 A;  4X20 A;  5LA6 A;  4DR1 O;  5IY5 B;  1XL4 A;  2GLT A;  2LGW A;  4LF6 H;  3OR7 C;  4TT3 G;  4D7T A;  4X66 O;  5BWU A;  4DV0 B;  2ZGI A;  2R6F A;  1T36 A;  4A3D G;  1TWA A;  4I7Z B;  3L74 H;  5C8Y B;  2CZG A;  5L9X A;  1VQ5 V;  3AG1 C;  5EC1 C;  3TW7 A;  2IMW P;  1G4Y B;  4JI7 B;  1ZHQ A;  2Q67 A;  2XGQ A;  4MTX A;  3G8D A;  3CWB H;  1ZHS A;  5FD5 A;  5B3S C;  4QW8 A;  4X66 B;  1FFT B;  2P5O A;  4P30 A;  3FKS G;  5DN6 G;  2ZM6 O;  4IWX A;  2QWN B;  2UXC O;  3RT3 C;  5JVD B;  4F4Z A;  4WBN F;  3LSQ A;  3OR6 C;  4PDR A;  1GK9 A;  4MVU A;  3JAM W;  2BR0 A;  1S5L Z;  3L72 H;  3H1H H;  1TGO A;  4H0L B;  2ZE6 A;  1B6R A;  4O83 A;  3Q8Q B;  5KFD A;  1XBL A;  2COI A;  5C1P A;  4Q45 A;  5BWX A;  5J2U F;  1KB9 F;  4JI4 B;  2HIV A;  1PNK A;  3SYO A;  1R1B A;  4EBE A;  1VQ7 V;  2OIG A;  2EIY A;  3CQZ A;  2IU0 A;  2JVD A;  3CVZ A;  3T5J A;  1FYJ A;  4LH6 A;  4JI3 O;  1ZUQ A;  4ED3 A;  4TOI A;  1KJ9 A;  4YR2 A;  1K8A W;  3KXY T;  4JYB A;  3T1C A;  3GTM A;  1B04 A;  4YIP A;  2XD4 A;  3VOT A;  2K1E A;  2LQT A;  2P4V A;  2R70 A;  4FJC C;  3RYF A;  4DV6 B;  1EHI A;  1CKN B;  3TII A;  3GIQ A;  4JUZ A;  2P4K A;  4DL7 A;  2QWP B;  4TQS A;  2HGX A;  1BMF G;  3QG5 A;  1Y14 B;  2L35 A;  3JAS A;  3ZRS A;  1OV9 A;  3JAT A;  4X65 H;  3K5M A;  3OSP A;  2YXL A;  2FPG B;  5KT6 A;  4F50 A;  1H2N A;  3JAK A;  5GON F;  2IA6 A;  3ZMT A;  2XHB A;  3LNM B;  5GTI Z;  4E4T A;  1M56 C;  4HQ6 A;  2CUG A;  2LFS A;  4J7Z A;  5TIS Z;  1IUR A;  3KAJ A;  1Q7Y W;  2CKZ B;  3M9M B;  4UUJ C;  1DV1 A;  3AG3 B;  5B1O A;  1KBL A;  5H2F Z;  2Y0I A;  4IGG A;  2ZT9 B;  5FL7 G;  5KMG B;  5CBF A;  5BR8 O;  3T9A A;  5KFR A;  2C22 A;  4B3M H;  4NXN H;  3DSQ A;  1VF7 A;  3C0F B;  4LFB H;  4ICG A;  1PX2 A;  4QIW F;  1Y67 A;  5B66 Z;  3TY8 A;  4FFN A;  4DR2 O;  5I5Y A;  1EKF A;  2JEX A;  3CJH B;  3UO3 A;  3EXA A;  4DV0 H;  2HGS A;  3U0G A;  3MFI A;  4WD3 A;  3K5N A;  4QE9 A;  4O4L B;  4BAY A;  2BOC C;  1ZET A;  2UVV A;  5BR8 B;  2C2E A;  4MA0 A;  2JK5 C;  5FD6 A;  4JI7 H;  1M0W A;  2ASL A;  3ASO C;  3L4K A;  1PL0 A;  4GX5 A;  2X0S A;  1Q90 D;  2MW2 B;  1Q3E A;  4X66 H;  2V4D A;  1FFX B;  4ZQI A;  3HOW G;  5DGI A;  4YXW G;  1P7G A;  3T5H A;  2HHF A;  1YEW A;  3ETJ A;  2VUM A;  3Q8P B;  4HYO A;  2YIB D;  2UXB O;  5FNV F;  1BGW A;  5KG5 A;  2GSM B;  1WR2 A;  1AR4 A;  4FFM A;  3JRX A;  3PW2 A;  5KG7 A;  2B5U A;  3RAQ A;  4ED2 A;  3N2K A;  5JH7 F;  3NGD A;  4JI0 O;  4CHI A;  3EFF K;  2UUB H;  3AG2 C;  1DV2 A;  2HHH O;  2CNU A;  2ZQM A;  4JI4 H;  4DR6 B;  2B1I A;  3CPW U;  2YI8 A;  1M7J A;  1XMQ O;  4QWB A;  1Q82 W;  2WAQ E;  3X2Q C;  2ZNJ A;  2N74 A;  4M7E A;  4ZI7 A;  1XMO O;  3DXR A;  5KG3 A;  2Z3Y A;  2OCC C;  4Q6G A;  4LH7 A;  4JI0 B;  4O3N A;  1N56 A;  4UCO A;  5EBL C;  5LGU A;  1AJN A;  5H9C A;  4DV6 H;  1I94 O;  3RBD A;  4J41 A;  3FB6 C;  2IH1 C;  3NUA A;  4WHX A;  5L1I A;  5LMU H;  5IWA B;  4I9W A;  1F4M A;  4O4H B;  3OUZ A;  1ZL8 A;  3GB7 C;  2OIE A;  4CE5 A;  3CMA V;  1U97 A;  4PZ8 A;  3FB7 C;  5BPH A;  2FMA A;  4TV8 A;  3HKE B;  1YJ9 V;  4CKE A;  4TV9 A;  2YRW A;  1G6U A;  3DTG A;  4QWE A;  1H2S B;  2HG5 C;  4DR7 O;  2CNQ A;  1H8H G;  4IAJ A;  4Y8V B;  1IZ3 A;  5HV6 A;  2YZL A;  3EHB B;  1H8E G;  1I6U A;  4IT5 A;  2ODM A;  5JJN B;  3SJB C;  4GCZ A;  2VWK A;  2E3C A;  3OTF A;  2DPI A;  1HNZ O;  4JTA B;  3GV8 B;  2WA3 A;  4BR6 A;  1RM1 B;  3RJ0 A;  5ITZ B;  5JJJ B;  3Q4H A;  1RFY A;  5KFT A;  2XAF A;  1MZB A;  2QWQ B;  1W96 A;  1K33 A;  3GDE A;  4D6T H;  1GO3 F;  1DGS A;  1Q6H A;  3JAW A;  4Z2W A;  1M6V A;  1URF A;  2NN4 A;  4A3L G;  2WLM A;  5DGB A;  1GGO A;  4U6P A;  1BHB A;  5EWG A;  2CGN A;  4E4E A;  1R6K A;  5KA6 A;  1NVP D;  1WNS A;  1EN4 A;  3H3V H;  4TQF A;  1TWG A;  1PD3 A;  1H2L A;  5KFK A;  4ZHQ A;  2YYA A;  4O4J F;  4GX1 A;  3KHH A;  1WA8 A;  4HNA A;  5AG2 A;  5D8D A;  4CMF A;  1UC9 A;  1KEE A;  4LF4 O;  4ED8 A;  5JQG A;  4P2Z A;  1ZQ7 A;  2IBK A;  3PN1 A;  3JCZ A;  4OX9 B;  3NBY B;  2X6B A;  3BRC A;  5KFS A;  1IBK O;  4CS3 A;  3IC7 A;  1YHQ V;  1KUQ A;  3HKZ E;  5KG2 A;  2R7K A;  2WLJ A;  4UVA A;  4DR6 H;  3MR2 A;  3GIM A;  4MV8 A;  5KHK A;  3A0H Z;  3BAB A;  3KAK A;  1SCU B;  4LF4 B;  5K1X A;  4TUY A;  2JEF A;  2VQF B;  4DR4 H;  3OSN A;  1WRV A;  1I5X A;  1EZV H;  3M7M X;  4J9Q A;  2M7W A;  2JS3 A;  4DRX A;  2IW5 A;  1R3I C;  4X64 B;  3ZRX A;  4JI0 H;  1NT2 B;  1VBH A;  2Q2U A;  5KFW A;  3OE7 G;  4K0K O;  3W1G A;  4WFG A;  3CCQ V;  3JSL A;  4QWC A;  4YJ2 B;  3T1Y O;  5J2T F;  2IJJ A;  5IWA H;  2DQ3 A;  1GO3 E;  3ML0 A;  4JAA A;  4JAS A;  2CNV A;  2E5L O;  3WB2 A;  1IX9 A;  1SYX B;  4CMD A;  5IJ0 A;  4PDB A;  1KP2 A;  5LA6 F;  5B5E Z;  3OW2 U;  3MFH A;  3QQM A;  4O2A A;  3SR2 C;  4K0K B;  3PZP A;  4U3J A;  1Y76 A;  4N21 A;  1BNC A;  1OCR C;  1I2K A;  3T1Y B;  3U9S A;  3RYC B;  5L1K A;  2E5L B;  1Z5W A;  4J7J A;  1JDE A;  1AB3 A;  4JV1 A;  2QJ1 A;  4UVB A;  1WB8 A;  1G8M A;  2EIN B;  3T9E A;  1VQP V;  2VOB A;  4XBF A;  5H80 A;  3H4D A;  4J9O A;  2F95 B;  5KHG A;  4DUZ O;  4O7Y A;  4AQY H;  3DTU B;  5D1O B;  3L4J A;  3R5H A;  2ZE5 A;  1XNR O;  2A3Q A;  2W6N A;  5L3C A;  1X9N A;  2CGO A;  2EIJ C;  2YIB A;  1OWT A;  5LHI A;  3DC5 A;  5IYZ B;  4TVI A;  4F4W A;  4F4X A;  5KFE A;  1OCO C;  4A3B G;  3AG1 B;  2ZIM A;  2P7T C;  5B1B C;  3RTX A;  4GX0 A;  3H1K H;  4DV5 O;  2AW9 A;  4O7Z A;  5KFX A;  3Q8R B;  4MW3 A;  4OX9 H;  3VOU A;  5B3S B;  4LF5 O;  1GN6 A;  4G3I A;  4DL3 A;  2QA4 V;  1SEI A;  3BG5 A;  5H6Q A;  3AK3 A;  4B3T O;  3S24 A;  3GTK A;  4GKK H;  1Y74 B;  3GVM A;  4JYA H;  4NZO A;  1DF5 A;  2CTQ A;  4JV2 A;  5CAE B;  3E2E A;  1P49 A;  4O86 A;  4EQ5 A;  4X1I A;  3ABK C;  4MVM A;  5C5J A;  1EN5 A;  3PR5 B;  2VQF H;  2W71 A;  3UYY A;  5L1J A;  2EUL A;  3QWU A;  2XCL A;  1JX4 A;  4X64 H;  3WO0 A;  4B3T B;  3TJT A;  4J9Y B;  1K97 A;  4JI6 B;  4O7T A;  3E86 A;  1YDX A;  2I80 A;  1RK6 A;  3M4I A;  2Q5Z A;  5I5U A;  4FFL A;  3H20 A;  3BVO A;  2YC0 A;  2N04 A;  1S3J A;  2WLL B;  3Q8S B;  4OXS A;  3W7W A;  4O84 A;  3HOU G;  3SGI A;  2QYZ A;  1SA0 B;  5KUM A;  1W59 A;  1ZX3 A;  2E74 B;  4LFA O;  4YR3 A;  1X59 A;  3PJS K;  1V4Y A;  4GZR B;  1YSC A;  5KG1 A;  2W9B A;  3K3V A;  4XYM B;  5JUM A;  4RCN A;  2JGD A;  4I55 F;  1XHZ A;  3UT5 B;  3CCR V;  4KP4 A;  3T1Y H;  1OBD A;  4NXM O;  3D36 A;  1E1Q G;  2R8K A;  4A2A A;  3LP8 A;  3RB4 A;  2NU8 B;  2Y0P A;  1NTZ H;  1KBH A;  2YDE A;  1Q6U A;  1M56 B;  3B4S A;  4LFA B;  4RB1 A;  4FLU A;  1SER A;  4GYC B;  2YS7 A;  3J80 W;  2R8J A;  2LO1 A;  1U96 A;  2EBO A;  4JI2 O;  4ECU A;  4NXM B;  3LUL A;  2RMK B;  2Q0O C;  3QO5 A;  3SYP A;  1VF6 A;  2HJD A;  4GX2 A;  4TWK A;  1AUX A;  4MV1 A;  1HR0 H;  4EGQ A;  2Q4P A;  1AI6 A;  3QNE A;  4IIJ A;  4WBN B;  5FJ8 G;  2NNU A;  1Z2P X;  1FXK A;  3W7T A;  1B33 N;  2X0L A;  3LSS A;  1XNQ H;  4XDL A;  5C93 A;  2EX3 A;  3R65 A;  3CSX A;  3Q2O A;  2AGP A;  4ZIB A;  4E2L A;  2O03 A;  3ASO B;  4HAM A;  1XOU A;  1KJI A;  1P16 A;  4ZI7 F;  3L70 H;  4DYL A;  3GJX B;  2VS0 A;  2R9R B;  2UUC O;  2BTQ B;  5IYC O;  1WB7 A;  1MZF A;  1NZ6 A;  2CW7 A;  1YXB A;  4RQF A;  1AUV A;  3VNN A;  1V55 C;  3TIG A;  1FKA O;  4DAA A;  1VQ4 V;  3K57 A;  1R6T A;  2RDJ A;  3O9O A;  4WFE A;  4LNU B;  4FS2 A;  5EZY A;  5DM6 V;  1KYO F;  3AG2 B;  4TV8 F;  1E4E B;  4TV9 F;  4JI6 H;  1R3K C;  3OHB A;  2PYJ A;  4LF8 O;  3DTF A;  5LP6 A;  1FXV A;  3L2P A;  2GPW A;  4ECX A;  3X2Q B;  4QWA A;  4PA6 A;  4NYK A;  4NTW A;  5GON B;  5B1N A;  3ZHR A;  1XEQ A;  2OCC B;  2QWR B;  2RGR A;  1F23 A;  5CMU A;  1A0I A;  4F6R B;  1JMK C;  3JAL B;  4H44 B;  4J7K A;  3V4Z A;  5EK0 A;  3JRW A;  3P3P A;  2ZCE A;  3HKB A;  3OMA B;  1QLN A;  1JR9 A;  5KFJ A;  3J81 W;  4DR3 O;  5GW7 A;  3HO8 A;  3B40 A;  4ZOL A;  3N44 B;  1AI5 A;  2NVY A;  4A3G G;  1D5N A;  1RSO B;  1N36 B;  4B08 A;  3NBZ B;  3OGC C;  1YJW V;  3I12 A;  4LFA H;  2PTM A;  2H94 A;  2IU3 A;  1WLE A;  2MK3 A;  3JYC A;  2C35 B;  2GDS A;  1S0V A;  2EIL B;  1JIH A;  4ECV A;  2EIM C;  4ECQ A;  2DE0 X;  4DR3 B;  3S3W A;  5KT3 A;  4EBC A;  5HFM A;  4ZHQ F;  3OD4 A;  1AI4 A;  1IBM B;  4NXM H;  2SCU B;  3K9A A;  1N33 O;  5IYB G;  5EOY A;  5LMN H;  3CRA A;  5KFF A;  5JQG F;  4JZG A;  5EC2 C;  4NZN A;  2C28 A;  3RF2 A;  2X7R B;  5BMV A;  1N32 H;  3P30 A;  4XYL B;  4IRC A;  5FNV B;  3GIP A;  2UVR A;  2Q6A A;  3BA9 A;  3G6E V;  4C5A A;  2X6C A;  3CRR A;  2F4V O;  2BQR A;  1FXH A;  1BXR A;  3ZRW B;  3JD2 A;  5KX5 B;  5DEC A;  4BY7 G;  5JH7 B;  1J95 A;  3OMI B;  1A0G A;  3V6J A;  2D2C B;  2IM9 A;  4UFZ A;  1CP9 A;  2CQY A;  4TUY F;  4FVM A;  4GKJ O;  5KG0 A;  3T99 A;  3H0G G;  2HKO A;  2V1D A;  5DIS C;  2J6T A;  5KFO A;  4A93 G;  3F7V C;  1M90 W;  1IYD A;  1UNN C;  1S76 D;  3WFV A;  2QGN A;  4I4T A;  3OUU A;  1PPJ H;  3LUT B;  2NVX A;  3BEH A;  4O3O A;  5GTH Z;  1ROP A;  3W5O A;  4A3E G;  3LDD A;  2DWD C;  1PV0 A;  2VPS A;  2GUZ B;  1YTF B;  1P8L A;  5KT7 A;  1BHA A;  4MA5 A;  3H0G A;  2CH7 B;  3R66 A;  4QWD A;  5K1P A;  1S5J A;  1KKC A;  2WLK A;  4O2A F;  3T9B A;  2DIK A;  4J9K A;  3PW5 A;  1JJO A;  3PO2 G;  4O2B A;  2DAA A;  4DV2 O;  3JZ6 A;  2YEV B;  1Q86 W;  4JV5 O;  1G2W A;  3SI8 A;  2ASJ A;  2DPJ A;  3RBE A;  1MSW D;  3T4D A;  5F2V O;  1SQG A;  5C1O A;  2XUM A;  2RQ6 A;  4MTF A;  2YID A;  4PDM A;  1FPO A;  1P4R A;  2JEI A;  2R7Z G;  4DV1 O;  2CAZ C;  1VAJ A;  4GLX A;  2VQE B;  4QW9 A;  1N36 H;  4F4Y A;  1H2K A;  4L8J A;  4P9O A;  5LBQ A;  5IYB O;  1CKN A;  1R3L C;  2JJ1 G;  3RIZ A;  1HNW O;  4ABM A;  4J9N A;  2O57 A;  1VQK V;  3GWK C;  2V4R A;  1OCR B;  2DWE C;  1COW G;  3HB9 A;  4JXU A;  4FU0 A;  4DR3 H;  2FL4 A;  2GQR A;  3TXQ A;  2W6Z A;  4DR1 B;  1IBM H;  4J0M A;  5E79 Z;  4DV1 B;  2E75 B;  5E1A C;  2R7Z A;  4EFB A;  3SJA C;  1AJP A;  3JAR B;  4O4J B;  5KUK A;  2HEP A;  1QLE C;  1Y66 A;  3ZBH A;  3K9S A;  1RP3 B;  2BQU A;  3FAV B;  5DQH A;  3RUP A;  4O7W A;  2JEG A;  2V9W A;  2R85 A;  2EIJ B;  4LWS B;  5EBW C;  4NLG A;  3JZI A;  4QNH B;  4FLW A;  4YBZ B;  4C7U A;  4M0J A;  4LF9 O;  2ZM6 B;  4UB6 Z;  1XRE A;  4JI1 O;  1K3E A;  5K2M A;  4C5C A;  2UXC B;  1ZSP A;  1IBL H;  1OCO B;  2PY5 A;  3HT5 A;  3CSW A;  5B1B B;  1ARO P;  4BW9 A;  4IR1 A;  2A1H A;  3D3Q A;  4MTO A;  1T5E A;  2A9H A;  4LFC O;  4GLW A;  3UZO A;  5KFY A;  3O65 A;  3HXL A;  3VBB A;  1TWC A;  4J9P A;  4NR1 A;  2V7Q G;  2R7N A;  5IT9 N;  2KG7 B;  5EIB D;  1PNM A;  4CH6 A;  5J2T B;  5DED A;  4ED1 A;  4JI5 H;  2DMX A;  1QCE A;  1D5A A;  4ECW A;  2IP4 A;  1PM9 A;  3ABK B;  5CA1 F;  4JI3 B;  1MOF A;  1SQQ H;  2W6P A;  1ET0 A;  1NR1 A;  4YIO A;  3AYH B;  5LA6 B;  4OPH A;  4X20 B;  3ABU A;  1RJQ A;  3R5X A;  4MVR A;  2WYO A;  4J11 A;  3VQY A;  2PVP A;  3TIN A;  3F5W C;  3SPJ A;  1Y4M A;  4GC7 A;  2LGQ A;  3OEH G;  4A3K G;  3KG2 A;  3K58 A;  4J42 A;  3CXH F;  1QNM A;  2ZXW C;  2OWO A;  3K3W A;  5D5P A;  3MWM A;  4KHP O;  2XND G;  2VQE H;  4J9M A;  3THO A;  1W0J G;  1O75 A;  2P0A A;  3CCL V;  4JI8 O;  2VUM G;  3HR0 A;  1MAB G;  4EG0 A;  2FLN A;  5FLM G;  2FLP A;  1FAF A;  3K5O A;  4O4H A;  4IIJ F;  3E35 A;  4DR1 H;  4DR2 B;  2RNB A;  5EWF A;  4ETS A;  3JCU Z;  3E8B A;  2XAH A;  2HIX A;  4RNN A;  4A3F G;  3PFF A;  4R7R A;  4JI8 B;  1H38 A;  4AYB E;  4I9Q A;  1S10 A;  2WPD G;  4CC5 A;  4PHZ A;  1K9M W;  2KQX A;  2ZDG A;  5KAI Z;  4CKB A;  5I5X A;  3OM3 B;  2P22 C;  2VA3 A;  4IHJ A;  3T5L A;  1LNQ A;  1EUC B;  2Q68 A;  2F23 A;  2JRI A;  4PD4 F;  4L87 A;  5KX5 F;  4R7C A;  3CX5 F;  2CW8 A;  1BQZ A;  4X1Y A;  3VQV A;  3CD6 V;  5LGT A;  2ZM6 H;  2IJK A;  1K1S A;  1MNG A;  2UXC H;  1DLB A;  4L1K A;  5EZY F;  5JWP A;  2UXB B;  3PW4 A;  4I50 A;  3E89 A;  1SZT A;  5IJ9 A;  2P06 A;  4CC6 A;  3E8H A;  3JAT B;  4FZ0 A;  1JDB B;  5KT4 A;  2W8K A;  4UCT A;  3D36 C;  1ZLZ A;  1J5E O;  3U10 A;  3VA7 A;  5BWR A;  4EBD A;  2HHH B;  4Q8F A;  1WAZ A;  4QIW E;  3CRC A;  4I5S A;  2D3O W;  4MAM A;  2KKW A;  2YIC A;  1LUW A;  1AI7 A;  1XMQ B;  4DV4 O;  1V55 B;  2R84 A;  2WB1 A;  1XMO B;  1F7Y A;  2JDI G;  4JI3 H;  2ITC C;  4CH4 A;  4DR5 O;  4GC6 A;  1S9F A;  4DV3 O;  4FM9 A;  5BZB A;  4ZOL F;  1VF6 C;  3ETH A;  1N0J A;  1QU7 A;  1XL6 A;  2Q69 A;  2R8G A;  1I94 B;  3ZHT A;  4I55 B;  2XCP A;  5C3E G;  4UXN A;  2EIL C;  1I1K A;  3KTM A;  4YY3 O;  1FXK C;  1K34 A;  1YVW A;  4CBC A;  1I7L A;  2Y4R A;  4MV9 A;  3E83 A;  3F7Y C;  4H33 A;  2BQ3 A;  3W7X A;  1T94 A;  4DR7 B;  2QKC A;  1TUB A;  1MMM A;  1NJI W;  2RGV A;  4HYK A;  3EPI A;  3T9F A;  2OYQ A;  1OBG A;  4XDJ A;  2HVK C;  3IC9 A;  2W9C A;  3ETG A;  2HHF B;  1HNZ B;  5BMV F;  5BR8 H;  1N34 O;  5D5Q A;  1FVI A;  1EKP A;  3J7A U;  1VQM V;  5CBH A;  3RYI A;  4U7C A;  4DR2 H;  5LOV F;  1AVM A;  1WN7 A;  5BWW A;  4K6N A;  3TY9 A;  4WFB V;  3N2K B;  3W7S A;  3RAX A;  2W70 A;  1M57 C;  3N43 B;  1CKM A;  2H3O A;  2W6J G;  1IDS A;  2J6S A;  3I56 V;  2E76 B;  1KU9 A;  2EIM B;  2P67 A;  3V6H A;  2DYR C;  1XIL A;  1QBZ A;  3RYC A;  2H8P C;  3M99 B;  4JTC B;  5EYP B;  4FLY A;  4O4I F;  2XAS A;  4ZI7 B;  1LR1 A;  1IXB A;  3DXR B;  2GPS A;  2VR1 A;  5KFZ A;  2R8H A;  3G80 A;  1R3J C;  4I4T F;  4BBR G;  3IFX A;  1R73 A;  4LF7 O;  1SZX A;  1WPX A;  4DO2 A;  3GQC A;  1WP7 A;  4DK0 A;  2E2H A;  1SKV A;  3GLK A;  2UXB H;  2QKA A;  3RGB A;  1C30 A;  5CE8 A;  1ZL8 B;  1US6 A;  2QK4 A;  1GAX A;  3P3N A;  4TV8 B;  1IBK B;  1YIJ V;  1EN6 A;  3G6Y A;  1L8D A;  4TV9 B;  3I55 V;  5L3D A;  2UU9 O;  1K92 A;  1ORQ C;  2HHH H;  2Y4U A;  4UV9 A;  5FLX N;  2W0X A;  3W7U A;  4O2B F;  4B3S O;  3ORR A;  1W2B U;  1XMQ H;  3QVN A;  1B6Q A;  1I7N A;  3ZN1 A;  1GKF A;  4W4L A;  1XMO H;  1GN3 A;  3VPB A;  3ZN0 A;  1S97 A;  2PGG A;  4A3J G;  2UU9 B;  1A3G A;  3PW0 A;  1V54 C;  3D3I A;  4KFM A;  2R86 A;  2RDI A;  1I94 H;  3M8A A;  3OMN B;  3JAW B;  4QJF A;  4B3S B;  1JCH A;  3APQ A;  3BPZ A;  4NVP A;  5KG6 A;  4CH3 A;  2QKS A;  1EM1 A;  3AG4 B;  4IRK A;  4WFF A;  1HWY A;  4DR7 H;  3WWJ A;  3E22 A;  1W93 A;  3EVK A;  2UXD O;  3R23 A;  3RR5 A;  3DF7 A;  4ZHQ B;  2VUG A;  3ZMZ A;  4MV7 A;  1HNZ H;  2Q7H A;  2YUA A;  4U7N A;  4RUC A;  5D1P A;  4HNA B;  1KC8 W;  3QO7 A;  4X9Q A;  2V59 A;  1I50 A;  5JQG B;  4C5B A;  1H2G A;  2Q73 A;  3GV5 B;  4PI0 A;  1SQB H;  1S03 G;  3UCS C;  3T1H O;  3CRQ A;  1SRY A;  4DUZ B;  2QM8 A;  5KFM A;  2UXD B;  2K9P A;  4MSW C;  3OUF A;  1Q6I A;  4LC1 A;  1XNR B;  1GYF A;  3DGE A;  4N23 A;  5LHG A;  3C3S A;  2R93 G;  5I47 A;  5LHH A;  3LWB A;  4TUY B;  5KHH A;  2UUA O;  3T1H B;  2QM4 A;  2F1M A;  4W4K A;  4DRX B;  1QLE B;  3H1L H;  2W8L A;  2R92 G;  3R5F A;  5KFN A;  5IYD G;  4LR3 A;  4JV0 A;  2DN9 A;  4R8U A;  4JAV A;  3MDS A;  4DK1 A;  3OTO O;  4DV5 B;  4HNV A;  5I5V A;  4LF4 H;  4O3R A;  3CCU V;  3E8G A;  4JYC A;  1NI8 A;  3AK1 A;  1NS1 A;  3ETD A;  1JX9 A;  3CC7 V;  4LF5 B;  3I4N G;  2R93 A;  5IDJ A;  1IBK H;  3HPL C;  4J9L A;  2FK2 A;  5IJ0 B;  3ZX6 A;  2COJ A;  1DF4 A;  1L2Z A;  1OCZ C;  3CCM V;  4O2A B;  4TQD A;  4BWA A;  3BQ2 A;  3GTP A;  3WG7 C;  2F93 B;  3ZCC A;  4Q4C A;  5BYA A;  2R92 A;  4FK5 C;  2WLN A;  1Y76 B;  3GIK A;  4DV7 O;  2Z5U A;  2Q7E A;  3B2E E;  1CXZ B;  1ENV A;  1WJZ A;  5IE9 A;  2QE7 G;  1I2L A;  4J80 A;  3VPC A;  5J2U A;  4QSH A;  1TVK B;  3STL C;  4UVC A;  4O81 A;  1RYR A;  1KJ8 A;  2Y48 A;  1R9T A;  2UU9 H;  4HZ3 A;  4K0K H;  4FM0 A;  3OAA G;  1HDJ A;  3RYH A;  2C00 A;  3H01 A;  4X62 O;  1THZ A;  1M1K W;  2WLH A;  5LXT A;  3BQ1 A;  2X5R A;  2DYS C;  2W0F C;  4EB6 B;  2E5L H;  2QSA A;  2HG8 A;  3CC4 V;  4FGR A;  2LW1 A;  2WE6 A;  5DG9 A;  1E4E A;  3RWR D;  2ABJ A;  3H9V A;  5LYJ A;  5FPR A;  4CH5 A;  3MAQ A;  1GSO A;  1AR1 B;  1UFI A;  4YHH O;  4MV6 A;  3HKD A;  5CA0 A;  2XCA A;  2W57 A;  3KHL A;  2HGW A;  3GTG A;  3K04 A;  4PA7 A;  2ZXW B;  5GON A;  4FFB A;  2WAQ A;  3CXC U;  4EKW A;  2J9G A;  3SDL A;  1VMG A;  4IHJ F;  3TEK A;  4O7R A;  3N6R A;  4J9S A;  4DUY O;  4HR7 A;  4CS2 A;  1BCC H;  4DUZ H;  1Z2G A;  1Y1V G;  4CS4 A;  4JI2 B;  4KL1 A;  3K5L A;  1TWH A;  2A06 H;  3BA8 A;  4DXW A;  3RVZ A;  1XNR H;  2R9A A;  3UFX B;  4XDK A;  5IYD O;  5KHI A;  5CN0 A;  4X1I B;  4I50 F;  1NH2 B;  2MCT A;  4FFK A;  2B63 G;  4MTG A;  1E1R G;  4WF9 V;  3U54 A;  2C2D A;  4ME6 A;  2FKL A;  3HBL A;  4DUY B;  1CKO A;  1XK5 A;  1S0M A;  4DL5 A;  3SJC C;  4DIM A;  4X1K A;  1S72 V;  1YCI A;  4KXR A;  1Y1V A;  3OHA A;  4DV5 H;  5A2Q N;  4LCU C;  4BW5 A;  4ED0 A;  5DGA A;  1L0N H;  4A2B A;  2BSK B;  4LF5 H;  3PVX A;  4PDV A;  5KAF Z;  2M05 A;  2X6A A;  2B63 A;  4JTD B;  5CB4 A;  4B3T H;  3LQS A;  2UUC B;  4G28 B;  3EPG A;  3T54 A;  5FNV A;  3KAL A;  3H4B A;  5CA1 B;  1G1X B;  2W9B B;  2Z0A A;  3QFF A;  2OCH A;  2JGD B;  4HNT A;  2DQ0 A;  1QR8 A;  1NQT A;  3VPD A;  3K59 A;  3UQ8 A;  3CE2 A;  1A9X A;  4JYY A;  1HNX O;  4RB2 C;  3UO2 A;  3N42 B;  2ZE8 A;  2WA4 A;  5EBM C;  4ECT A;  2BOB C;  1ZWI C;  4LF8 B;  4FZ1 A;  2WLI A;  2XAJ A;  4FPP A;  1MA1 A;  4OGQ B;  4Z1V A;  3KCX A;  1X4T A;  2AGO A;  3V4S A;  4O7V A;  4QE7 A;  3OEE G;  1GN4 A;  4LF6 O;  1EZJ A;  2YL2 A;  1BJT A;  2XGP A;  1GLV A;  3IAY A;  1Y6X A;  2QF7 A;  3U9T A;  1O9H A;  2XT9 A;  4IIJ B;  3HKZ A;  3K06 A;  1L1F A;  2ZNI A;  4A3I G;  3N27 A;  1RJP A;  1FXK B;  3JD1 A;  4BIZ A;  1JFF A;  1B6S A;  3G6B A;  4FM1 A;  2F43 G;  2Q8V A;  3HOY G;  1A32 A;  1VQO V;  1I1L A;  4YJ3 A;  3VMM A;  1E4F T;  2EJ7 A;  1F51 A;  1HW7 A;  2Y0S A;  5KFU A;  1JLL B;  2ZR2 A;  2YEV A;  2HP8 A;  2I8C A;  4UV8 A;  4DL4 A;  2I87 A;  2IBZ H;  3V6K A;  1RPO A;  4QPJ A;  3RGX A;  1FS0 G;  3UM7 A;  4FLT A;  1JKJ B;  4JI2 H;  1Q5O A;  2HVJ C;  1K1Q A;  4LSX A;  2PMZ A;  5HFL A;  3CP1 A;  1K73 W;  1N33 B;  2DAB A;  4DW1 A;  4YB8 B;  4O3S A;  3T4Z A;  3A8T A;  2ASD A;  1KUT A;  1Z2N X;  2CTW A;  4J9R A;  3VQX A;  1CPY A;  1SF9 A;  4UB8 Z;  3MR5 A;  1M57 B;  5C8Y A;  2FK1 A;  5EZY B;  4Q0Y A;  4DUY H;  3GTQ A;  2YRX A;  4X88 A;  1CEZ A;  2IJI A;  4PDL A;  2DYR B;  3ZMS A;  2F4V B;  4EEY A;  2YS8 A;  3FYE B;  1EYZ A;  3GIL A;  1XI1 A;  2ZDI A;  3PW7 A;  4LSA A;  1H2M A;  2HDK A;  1WCM G;  1P84 F;  5J9P C;  2PI4 A;  4UUG A;  3G6X A;  1S68 A;  3CCV V;  1I3Q A;  3JAR A;  3ZS8 C;  4H37 A;  4HBN A;  4GKJ B;  5JVL A;  1DTO A;  3OGI B;  2DOS A;  2UUC H;  3EYY A;  4H13 B;  2Z04 A;  5JVD A;  1OCC C;  2WTF A;  4MT8 A;  1SES A;  3LNN A;  4IYH A;  2ADP A;  2PI5 A;  1FKA H;  2ZR3 A;  3HKB B;  4X65 O;  3KHG A;  1EZ1 A;  2HJW A;  4ZOL B;  3AW8 A;  1VQL V;  1I1M A;  3AG4 C;  3T2M A;  2YWV A;  5IP9 G;  3RB6 A;  1NTK H;  3DC6 A;  1WCM A;  4NTY A;  3WB1 A;  2W6Q A;  2W6M A;  4B7E A;  4RAI A;  2YCH A;  5BWT A;  4K8X A;  4LF8 H;  2HFE C;  3AX6 A;  4APM A;  1JPX A;  2Q9L A;  1V51 A;  4B3M O;  1GH6 A;  4NXN O;  1YIT V;  4LFB O;  3C3T A;  1NBM G;  3RBZ A;  4RAZ A;  2VRZ A;  1HP8 A;  4DV2 B;  4K8Z A;  2G38 A;  2V4Q A;  4JV5 B;  1V54 B;  4DV0 O;  2W9A A;  3G6V A;  3N2G B;  5BMV B;  3GTL A;  3QF7 A;  2QTO A;  5KFQ A;  1SQV H;  3G71 V;  2E2I A;  3F5T A;  1N8R W;  5LOV B;  1VP7 A;  2QDO A;  4JI7 O;  3WWH A;  4WCE V;  1N48 A;  1B06 A;  1M93 A;  1PP9 H;  1Q43 A;  5EIB C;  1KC7 A;  2NR5 A;  5DLF A;  1WPB A;  4PI2 A;  2JGU A;  4U3F H;  3K0D A;  1HNW B;  2FB9 A;  3CYO A;  1SS3 A;  2FTK A;  4FS1 A;  5KMG A;  2FKX A;  3CC2 V;  5DG7 A;  4NB5 A;  4O4I B;  3UZB A;  2NU7 B;  1N33 H;  1VQ9 V;  1BGY H;  4I4T B;  3CJH A;  3NC0 B;  2JS5 A;  3JAM N;  1JA8 A;  3U55 A;  4TSF G;  4I0X B;  1E4G T;  2UUB O;  5KFH A;  3ZMU A;  1K4C C;  3MR3 A;  4G2K A;  3HOZ G;  4O4L A;  4JI4 O;  4MV3 A;  3TXS A;  1CE8 A;  5DMX A;  2F4V H;  2UVU A;  2AHY A;  2RN9 A;  3TK1 A;  4KUM A;  1K7D A;  1BZK A;  1T3N A;  3ZHS A;  3BFR A;  1FFX A;  2HJF C;  4BIU A;  2RDC A;  2DJV A;  4LF9 B;  4JI1 B;  4LBE C;  4O2B B;  4GKJ H;  2UUB B;  5KT5 A;  1RYS A;  5L3F A;  1IOW A;  3HKC B;  2YW2 A;  2AXT Z;  4DV6 O;  3QTC A;  2CFM A;  2CTP A;  3D8C A;  4FFP A;  4RAY A;  1TAE A;  5LMU O;  2GTA A;  1JXL A;  2GBO A;  2A79 B;  2HVS A;  1AP6 A;  2OT5 A;  2EZP A;  2V58 A;  1IYE A;  4LFC B;  1AJQ A;  5LXT F;  1KTA A;  5IT9 W;  2EJ2 A;  4DQN A;  2B1G A;  3I4M G;  3RV3 A;  3RGZ A;  5KFP A;  3MJF A;  3ABM C;  1OCZ B;  3MHS C;  2N05 A;  3WG7 B;  1WSC A;  2ETN A;  3WWI A;  5LMU B;  3NR7 A;  4MVS A;  1SET A;  4DLK A;  5LYJ F;  4DL6 A;  5KT2 A;  1KQS U;  4ECS A;  4UCV A;  5CA0 F;  4ED7 A;  2WWW A;  3SYA A;  1VIB A;  3GTO A;  4JAU A;  1M9N A;  4DV2 H;  2YIA A;  2ZIO A;  1VEW A;  1K4D C;  4JV5 H;  4RQE A;  5FR9 A;  4IWY A;  3B09 A;  1DIK A;  4RUF A;  1EKV A;  4B3R O;  1RPR A;  2ATL A;  4FLZ A;  3LML A;  4RNM A;  3B77 A;  2BCC H;  3L71 H;  5L3G A;  2DWC A;  4O82 A;  2R87 A;  4MVQ A;  1SQP H;  2FP4 B;  2VQD A;  3HKE A;  1O9G A;  2DYS B;  1JVM A;  3MD0 A;  4BBS G;  4KHP B;  3ICX A;  2KSW A;  4DV1 H; 
#chains in the Genus database with same CATH homology
 3J80 W;  2HHH H;  2PYL A;  4NXM B;  4I55 A;  1XMQ H;  1HNW H;  3BAA A;  4B3R B;  1XMO H;  1HR0 H;  3BHP A;  4JI5 B;  4IIJ A;  2PGG A;  5ITZ A;  4WBN B;  4RB3 C;  1Z2P X;  2UU9 B;  4X65 B;  1JFF B;  1I94 H;  1XNQ H;  3JAW B;  2EX3 A;  4B3S B;  3CSX A;  4YJ3 B;  1I7F A;  5KHJ A;  3RYF B;  4ZIB A;  3BPZ A;  4NVP A;  2O03 A;  1HNX H;  4CH3 A;  3HKC A;  4D7S A;  5J2T A;  1KMI Z;  3A2F A;  1P16 A;  3JAS B;  3GJX B;  4UCU A;  1QHT A;  2BTQ B;  5JCO A;  4B3M B;  4DR7 H;  3E22 A;  4NXN B;  2CW7 A;  4LFB B;  4X20 A;  5LA6 A;  3VNN A;  3JAK B;  4LF9 H;  3RR5 A;  3DF7 A;  4ZHQ B;  4JI1 H;  2VUG A;  4LF6 H;  3K57 A;  4I7H A;  4MV7 A;  1HNZ H;  4D7T A;  2Q7H A;  4DV0 B;  5D1P A;  4HNA B;  3N6X A;  4RB0 A;  4LNU B;  5C8Y B;  5EZY A;  5JQG B;  5EYP A;  5LL6 b;  4PI0 A;  1S03 G;  3U11 A;  4DR4 B;  1J5E B;  4JI6 H;  2PYJ A;  4JI7 B;  4LFC H;  1ZHQ A;  4DUZ B;  3FFQ A;  5LP6 A;  2UXD B;  3L2P A;  1ZHS A;  5FD5 A;  5GON B;  4X66 B;  1XNR B;  2RGR A;  1GYF A;  2P5O A;  4DV4 B;  4TUY B;  5KHH A;  1A0I A;  5JVD B;  4F6R B;  1JMK C;  3JAL B;  3T1H B;  4DR5 B;  2QM4 A;  2F1M A;  4DV3 B;  3JAM W;  4DRX B;  2ZCE A;  3HKB A;  1TGO A;  3J81 W;  4ZOL A;  3N44 B;  4LR3 A;  4DK1 A;  4DV5 B;  4YJ2 A;  4LF4 H;  4YY3 B;  1N36 B;  4B08 A;  3NBZ B;  4JI4 B;  3VQW A;  2HIV A;  4LF5 B;  4LFA H;  2PTM A;  1IBK H;  4IHJ B;  4KHP H;  5IJ0 B;  2JVD A;  3CVZ A;  4LH6 A;  4DR3 B;  2FE3 A;  1L2Z A;  4TOI A;  4BWA A;  4O2A B;  4TQD A;  3KXY T;  4JI8 H;  3CB2 A;  2F93 B;  4X1Y B;  1IBM B;  4NXM H;  1B04 A;  5LMN H;  5EOY A;  4B3R H;  3RYF A;  2R70 A;  4DV6 B;  2Q7E A;  4AQY B;  1CKN B;  3B2E E;  1N34 B;  4I50 B;  5LP6 C;  5J2U A;  3RF2 A;  1TVK B;  5BMV A;  5IJ9 B;  1N32 H;  3QG5 A;  3JAS A;  5FNV B;  3JAT A;  2UU9 H;  4X65 H;  3BA9 A;  3K5M A;  4K0K H;  4FM0 A;  2YXL A;  3RYH A;  2RJZ A;  2R72 A;  3JAK A;  5KX5 B;  2XHB A;  5JH7 B;  5LXT A;  3U0Z A;  5D1O A;  2IM9 A;  3KAJ A;  4UFZ A;  4EB6 B;  2E5L H;  4FVM A;  5KMG B;  2WE6 A;  4B3M H;  3RWR D;  4NXN H;  3DSQ A;  5IYZ A;  1VF7 A;  5LYJ A;  3C0F B;  5FPR A;  5DIS C;  4CH5 A;  4LF7 B;  4BWS C;  4LFB H;  3MAQ A;  3TY8 A;  3HKD A;  5CA0 A;  4I4T A;  2W57 A;  4JYA B;  4GKK B;  1XQ8 A;  4DV0 H;  5JJE B;  2HGS A;  5GON A;  4FFB A;  3W5O A;  2XIG A;  2VPS A;  3K5N A;  4O4L B;  1P8L A;  5BR8 B;  1J5E H;  5FLX W;  4CS2 A;  5FD6 A;  4E6N A;  4JI7 H;  4DUZ H;  5K1P A;  1S5J A;  1M0W A;  3L4K A;  1WH2 A;  4CS4 A;  4JI2 B;  4KL1 A;  3K5L A;  1TUB B;  1Q3E A;  3BA8 A;  4X66 H;  1XNR H;  2R9A A;  1JJO A;  1FFX B;  2V4D A;  4DV4 H;  4O2B A;  5KHI A;  4X1I B;  1YEW A;  2MCT A;  2YIB D;  4UCR A;  1BGW A;  4DR5 H;  4LMY A;  4DUY B;  4DV3 H;  1CKO A;  1SQG A;  3RYI B;  1XK5 A;  4PZ7 A;  2Q0A A;  3SJC C;  2RQ6 A;  4X1K A;  3N2K A;  1Q8I A;  4DV5 H;  4EEQ A;  2UUB H;  2CAZ C;  4GLX A;  2VQE B;  4YY3 H;  1N36 H;  4JI4 H;  4DR6 B;  4A2B A;  4L8J A;  1TA8 A;  1CKN A;  4LF5 H;  2YI8 A;  3RIZ A;  5CB4 A;  1TVK A;  1SA0 A;  4B3T H;  2UUC B;  2ZNJ A;  4M7E A;  4ZI7 A;  5FNV A;  4DR3 H;  4DRF A;  3KAL A;  4Q6G A;  1M5I A;  5CA1 B;  4LH7 A;  4DR1 B;  3RFR A;  4JI0 B;  1IBM H;  4UCO A;  4J0M A;  4DV1 B;  3UT5 A;  4DV6 H;  4EFB A;  3SJA C;  1N34 H;  3JAR B;  4O4J B;  2WDT A;  3ZED A;  3K59 A;  3UQ8 A;  2HEP A;  4EB6 A;  5LMU H;  5IWA B;  4O4H B;  4RB2 C;  1VS0 A;  1M4U A;  3N42 B;  4PZ8 A;  1HR0 B;  4TV8 A;  3HKE B;  4LF8 B;  1Z2O X;  4TV9 A;  1G6U A;  1H2S B;  4UCS A;  1X4T A;  4IAJ A;  1I6U A;  4FLW A;  1XNQ B;  5JJN B;  2ZM6 B;  3SJB C;  1Z5V A;  2VWK A;  2E3C A;  2UXC B;  3OTF A;  1BJT A;  1XDN A;  1IBL H;  2PY5 A;  2UUA B;  3IAY A;  1O9H A;  4IIJ B;  4LF7 H;  3RJ0 A;  4BW9 A;  4WBN A;  5ITZ B;  5JJJ B;  2ZNI A;  1MZB A;  1JFF A;  4FM1 A;  1T5E A;  3GDE A;  4U3J B;  3JAW A;  1DGS A;  3OTO B;  4YJ3 A;  2ZJT A;  3HXL A;  1E4F T;  4FM2 A;  1HW7 A;  5EIB D;  4CH6 A;  5J2T B;  4JI5 H;  2VWJ A;  3KYH C;  1D5A A;  2BTQ A;  1WNS A;  2PZS A;  3RGX A;  4FLT A;  4JI3 B;  4JI2 H;  3E22 B;  1Q5O A;  4TQF A;  4LSX A;  4X20 B;  5LA6 B;  4B3S H;  2WYO A;  1N33 B;  4DV7 B;  3VQY A;  4ZHQ A;  1Z2N X;  4HNA A;  2HVR A;  3VQX A;  4LNU A;  5C8Y A;  4Q0Y A;  5EZY B;  5JQG A;  1M0T A;  2KSW A;  3PN1 A;  4DUY H;  2Q7G A;  4OX9 B;  1ZAU A;  3NBY B;  4RZQ A;  3TY5 A;  3K58 A;  3BRC A;  2OWO A;  2F4V B;  4CS3 A;  5D5P A;  3MWM A;  1XI1 A;  5CA1 A;  4X62 B;  4LSA A;  2VQE H;  2F66 C;  3THO A;  1FJG B;  1O75 A;  4DR6 H;  1S68 A;  5KHK A;  3BAB A;  3ETQ A;  3JAR A;  1SQF A;  3ZS8 C;  1V9P A;  4HBN A;  4GKJ B;  3FMA A;  4LF4 B;  3KAK A;  3N40 P;  2UUC H;  5K1X A;  3EYY A;  4TUY A;  3K5O A;  4O4H A;  2VQF B;  5JVD A;  4F6R A;  4DR4 H;  3JAL A;  3LNN A;  3M7M X;  3J7A K;  2UXD H;  4YHH B;  4DRX A;  4X64 B;  4DR1 H;  1FKA H;  4JI0 H;  4DR2 B;  1NT2 B;  3HKB B;  4ETS A;  2Q2U A;  4ZOL B;  2HIX A;  3W1G A;  1XHX A;  3JSN A;  2BTO A;  4JI8 B;  4R7R A;  3JSL A;  4I9Q A;  4YJ2 B;  3WB1 A;  1RSO A;  4CC5 A;  5IWA H;  5LMN B;  4PHZ A;  3T1H H;  2HVQ A;  2YCH A;  4PZ6 A;  4MTD A;  2P22 C;  4IHJ A;  3WB2 A;  4K8X A;  4LF8 H;  1SYX B;  1N32 B;  4APM A;  5IJ0 A;  4PDB A;  3N41 B;  4O2A A;  3SR2 C;  4K0K B;  4X1Y A;  3VQV A;  4U3J A;  2ZM6 H;  4RAZ A;  4DV2 B;  4K8Z A;  2UXC H;  3T1Y B;  4JV5 B;  3RYC B;  2UUA H;  2UXB B;  4I50 A;  5J2U B;  3WB0 A;  5IJ9 A;  3N2G B;  5BMV B;  1Z5W A;  5FPO A;  2E5L B;  4CC6 A;  3QF7 A;  2QJ1 A;  4FLV A;  3JAT B;  5A2Q W;  4UCT A;  2VOB A;  3U10 A;  2PUS A;  3RYH B;  5LOV B;  3OTO H;  2F95 B;  5KHG A;  5KX5 A;  5JH7 A;  1M93 A;  1Q43 A;  5EIB C;  2HHH B;  4AQY H;  5LXT B;  5D1O B;  3L4J A;  4FLX A;  1WPB A;  2KKW A;  4PI2 A;  2JGU A;  1XMQ B;  1HNW B;  1X9N A;  3W1B A;  2YIB A;  1XMO B;  5KMG A;  4JI3 H;  4CH4 A;  5IYZ B;  4O4I B;  5LYJ B;  1QQC A;  4FM9 A;  1N33 H;  4DV7 H;  3HKD B;  5CA0 B;  4I4T B;  3NC0 B;  2JS5 A;  1I94 B;  4I55 B;  2ZIM A;  3CHX A;  3RTX A;  4FFB B;  1E4G T;  1HNX B;  4OX9 H;  4O4L A;  4MV9 A;  4AIL C;  1SEI A;  2F4V H;  2GV9 A;  3S24 A;  4X62 H;  4JYA H;  4DR7 B;  4GKK H;  3ICX A;  1TUB A;  1FJG H;  4MTE A;  4AHC A;  2RGV A;  1FFX A;  4LF9 B;  1P49 A;  2OYQ A;  4EQ5 A;  4JI1 B;  4O2B B;  4X1I A;  4LF6 B;  2UUB B;  3F8N A;  5JCO C;  4GKJ H;  3HKC B;  1HNZ B;  5BR8 H;  2VQF H;  3QTC A;  2CFM A;  4EFE A;  5D5Q A;  1FVI A;  3GB8 B;  4RAY A;  1AN7 A;  3QWU A;  1TAE A;  4YHH H;  4X64 H;  3RYI A;  4B3T B;  4DR2 H;  2HVS A;  1WN7 A;  4X1K B;  3TY9 A;  4JI6 B;  3N2K B;  3M4I A;  4LFC B;  3N43 B;  3H20 A;  5IT9 W;  1CKM A;  1KU9 A;  3RGZ A;  2YI9 A;  3IG0 A;  3RYC A;  3SGI A;  5EYP B;  5CB4 B;  1SA0 B;  3N2G A;  5LMU B;  4FLY A;  2Q2T A;  4ZI7 B;  4UCV A;  5LP6 B;  3K3V A;  5LOV A;  4DK0 A;  1XHZ A;  1SKV A;  3UT5 B;  4DV2 H;  2YIA A;  2ZIO A;  3T1Y H;  4JV5 H;  2UXB H;  4O4J A;  4A2A A;  3RGB A;  4FLZ A;  3LML A;  1IBL B;  4LFA B;  4TV8 B;  3HKE A;  1IBK B;  1O9G A;  4FLU A;  2ZIN A;  4RB1 A;  2CW8 A;  4O4I A;  1L8D A;  4KHP B;  4TV9 B;  4GYC B;  4DV1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...