4EEQA

Crystal structure of e. faecalis dna ligase with inhibitor
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis and Activity Evaluation of Potent NAD+ DNA Ligase Inhibitors as Potential Antibacterial Agents.
rcsb
source organism Enterococcus faecalis
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 108
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4eeqA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4eeqA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4eeqA02
3S24A 4JI0B 1XK5A 2HHHB 2VQFB 4DR5B 4JI3B 4CC5A 1P8LA 5FPOA 4PZ7A 4DV1B 3T1HB 1DGSA 2UUAB 4LF6B 4DV2B 3RTXA 1TAEA 2UUBB 4LH7A 3TY8A 2OWOA 3W5OA 3NBYB 4DR1B 4B3TB 4JI7B 3JSLA 1CKOA 3W1GA 5FPRA 2HVQA 4LFCB 4GKJB 3KYHC 5D1PA 4PZ6A 5IWAB 3OTOB 1HNXB 5LMUB 3PN1A 1IBLB 4JI5B 4EEQA 1V9PA 5D1OA 4DV4B 4DV3B 4DUYB 4LF4B 3BA8A 4DV0B 4DV7B 3RR5A 4JI1B 4EQ5A 1N32B 2Q2TA 3L2PA 4LH6A 3BABA 4LF8B 4JV5B 1XMOB 3GB8B 4UCSA 4UCUA 1TA8A 3NBZB 2HIVA 1CKMA 4UFZA 2UXDB 4X65B 4UCTA 4LFAB 1CKNB 4OX9B 1IBMB 1N33B 2VUGA 5D1OB 4UCOA 2E5LB 2UXCB 4X66B 4NXNB 3VNNA 4EFBA 1XNRB 4LFBB 4B3SB 1VS0A 3SGIA 4JYAB 1S68A 1XNQB 4YY3B 5BR8B 4DV5B 4LF7B 4YHHB 3QWUA 1HNWB 1N34B 2UUCB 4CC6A 2UXBB 4B3MB 4TOIA 1ZAUA 4LF9B 4JI6B 4NXMB 4LF5B 4DRFA 1A0IA 4GKKB 3T1YB 3NC0B 3BA9A 3GJXB 4PZ8A 2CFMA 1HR0B 4JI4B 4DUZB 4DR6B 5LMNB 1P16A 4UCRA 4DV6B 3UQ8A 1X9NA 4DR2B 3BAAA 4X64B 1N36B 1B04A 2HVRA 3GDEA 4DR3B 4GLXA 4B3RB 2HVSA 5DISC 1CKNA 4JI2B 1XMQB 1FJGB 2Q2UA 4KHPB 1XDNA 1I94B 2UU9B 4E6NA 3JSNA 2F4VB 4K0KB 1HNZB 3W1BA 1IBKB 4AQYB 3TY5A 2ZM6B 4DR4B 2VQEB 1FVIA 4JI8B 4EFEA 2HIXA 4DR7B 4X62B 1J5EB 3TY9A 4UCVA
chains in the Genus database with same CATH superfamily
2IJHA 4JZ2A 4ED2A 1J95A 5J2TA 3SE7A 2WSSG 4CC5A 4Z1VA 1TWGA 1WN7A 3RT3C 2ATLA 4DV1B 5C44G 1GTOA 2RF4A 1MZFA 3PW2A 4XDJA 4HYOA 5EIBC 2XIGA 5IYDG 5BWTA 2PUSA 2EIJC 2IMWP 3CPWU 1N33H 4GKJB 3ZX6A 1VBHA 2UXBO 3ZCCA 4C5AA 1L2ZA 4UVCA 2PYJA 4H44B 3TJTA 1VQPV 4CMDA 3HOXG 4MV9A 2DWDC 2VS0A 2XAGA 2KQXA 1YXBA 4FE2A 1VKZA 4DV3B 4FM0A 1OBDA 4WFHA 5KFAA 4FU0A 5BYAA 5GTHZ 2A0LA 2QKSA 4LFAO 4B3MH 3BQ1A 3KKYA 5KT6A 2YIAA 5CBHA 4FFRA 1Q7YW 4GC7A 5FNVA 5KMGA 1M90W 2JEXA 1RPOA 1AI6A 3RYHA 4DV4O 4LNUB 2A1HA 4NZOA 1ENVA 1G1XB 2CTPA 1A0GA 3KTMA 3QZ8A 2W9BB 2CH7B 5LP6F 4X1YB 5JH7F 4LF4H 2JJ2G 3E22B 2F93B 2ODTX 2ETNA 5KFDA 2CE4A 3LNMB 5A2QW 2IH1C 4U3FH 2OIGA 2QWNB 1K9MW 3N43B 4A3LG 1FJGH 2UUCB 3FB6C 1WJZA 3LDDA 1QCEA 2W8LA 4IGGA 4TOIA 3GIDA 4LCUC 2CAZC 3GJXB 2VUMG 4E4TA 4DRXA 1CQIB 3JAKA 5B1AC 4DUZB 2HGWA 4QWCA 1YHQV 4FM2A 1HR0O 2YZLA 4FFPA 5KFYA 1GM7A 2W9BA 4LNUA 3EXAA 2UXXA 4B3RB 4O7YA 2RGVA 2XAQA 3GTGA 1JA8A 1K97A 5IY5B 4RUEA 4ICGA 3FKIG 4QIWE 3BQ0A 4F50A 2ZM6O 2F4VB 3D8CA 3W7SA 4FPPA 1JJ2U 1KBHA 4X1KA 3T5HA 4J9LA 3K5OA 1NH2D 3MJFA 1IBLO 2Q7DA 3UYYA 3STLC 3DTUB 2ODMA 4ECTA 3E83A 4DR7B 2ABJA 3HO8A 1WP7A 3CRMA 2X7RB 3TK1A 3M9OB 2IJJA 4UCVA 3UZBA 3OHAA 4JI6H 3SDLA 3T4ZA 4U3JA 5E25A 5DGHA 4JZGA 4I5SA 4O2BF 4GC6A 3T1HB 4DYLA 4RZRA 4FFBA 3RTXA 4PI0A 2HEPA 2HP8A 4LH7A 1BS3A 5BWUA 2OCHA 3CD6V 3R5HA 2KSDA 4DLKA 1Q82W 4B3MO 4LFAH 4PZ6A 3RF2A 4JTAB 1EN4A 1JMKC 4CH3A 1AI4A 5J2TB 3G8CA 1N36O 5KKNB 3RB3A 4JI5B 1Y1VG 2B63G 2B5UA 2GSMB 1KUTA 4DUYB 3OT7A 1XMOO 1C30A 5KMGB 1N32B 4ME6A 3HKEA 4RB3C 1NTMH 2R93A 4J11A 5B1BB 2UXBH 1KP2A 4LF9H 3RVYA 2HHFA 1VQ8V 5JWPA 3CCQV 3T9DA 4LFAB 1IYDA 2COGA 2H3OA 2R7MA 4WBNA 4F4YA 4BY7G 3QTCA 2VUGA 4DK1A 4LF8H 2ZE7A 2UXDO 3E8BA 5F9LA 1JQ0A 4NXNB 4DV6H 4HNAA 4ECXA 2ZD9A 2DMXA 5BWXA 1MABG 1XMQH 5DAAA 4CS2A 4I55F 3JAWA 1SQPH 4K6NA 1XNQB 3Q4HA 4EEYA 4TWKA 2D3OW 1M9NA 1JFFA 3APOA 3F5TA 5IP7G 1T36A 5C8YA 5DM6V 1A9XA 3GV7B 5BPHA 2YSUB 3T54A 3HKCA 3JARB 3ZBHA 3VPCA 2ZM6H 2EIMC 4IL6Z 1E4EB 1O9GA 2XOKG 3UQ8A 4ECQA 1FJGO 4JYCA 1YZBA 4PI2A 1ZQ7A 4DR3B 1HP8A 1Y4MA 3ZHVA 1SS3A 3H1LH 3RN4A 4KUMA 1Y14B 1Q43A 4MVOA 5BR8H 1RFYA 2V4DA 2J6UA 1JCHA 3UT5B 3ASOC 2YIBD 4J41A 5K1XA 2VQEB 1WNSA 5HNEA 2N05A 3CQZA 3TCUA 4RU9A 3BRCA 5CMUA 2WAMA 3QZ7A 3TXSA 1E4EA 2ATKC 1KB9F 4QJFA 4IHJF 1BQ0A 1I50A 2X6BA 5L3BA 5KG5A 2AGPA 2ZR2A 2W7OA 4IHJA 3AK3A 1Y76A 1Z5WA 2UXNA 2F43G 5LP6A 4AQYO 3E35A 3PFFA 3ZHSA 4GCZA 1AP5A 2X5RA 4U7OA 4EKWA 4YJ2F 3JAWB 5KFQA 3JSLA 3HOVG 3BHPA 2CTRA 2Q73A 1NR7A 4X88A 4O2AA 1HNXB 1MZEA 2ZE6A 2BSKB 3PN1A 2BOCC 4B3SH 2R6FA 4FS1A 1YIJV 2VUMA 1NR1A 4UB6Z 5CA0A 4ED8A 4LF4B 2JDIG 2R7LA 1K3EA 3OMNB 4YAKB 1F4NA 3BABA 4AILC 1YJWV 1XMOB 4J9NA 4ETSA 4YQWA 4DUYO 2EIKC 3AW8A 2XAHA 4CH5A 2FJZA 3ZIAG 5C5JA 3ZHUA 4X65B 5LP6C 1M0WA 4HR7A 1E4GT 3H0GG 5KFSA 3GIJA 1V51A 2COJA 1H8HG 1XI1A 3H20A 5DGAA 2EIJB 2E74B 4C5BA 2OT5A 2R9IA 2LQTA 2CNUA 3H0GA 3JARA 2JA5G 4O7ZA 4MTOA 5IYZB 4CH6A 4J9PA 1PNMA 4DR6O 4JGSA 2W9CA 2XASA 3H9VA 1I3QA 4TQRA 2QR4A 5BR8B 4IIJF 4ZI7A 3ETEA 1IXBA 4A3IG 2R9RB 2CGOA 4O4HB 4F4ZA 4DR7O 1KMIZ 1ZWIC 4X66O 3RBZA 1OCCB 5C1PA 4HNAB 3STZC 1EUCB 4JYAH 1FFXA 1B6SA 4QWEA 3HOZG 3UZOA 3FYIB 2FLLA 3AK2A 4I9QA 2DAAA 4WBNB 4ZQIA 2X6AA 5LBQA 3HOYG 3ASNB 4KHPO 3OTOO 4DV5H 2R7NA 4ED3A 3CCRV 1B06A 5IYDO 2CZGA 1NTZH 5LA6A 2F95B 4K0KB 2UUAH 1I1MA 1SETA 2UVVA 1IBKB 2R82A 2PVPA 5KT7A 4FK5C 2BQ3A 1FFTB 4JI8B 5BMVF 1I08A 1IBLH 2LFRA 3U0ZA 4DL7A 1WB8A 2KG7B 2JA6G 1JJOA 5LMNO 3ZMTA 5KT5A 3A8TA 2CK3G 1VBGA 1ZETA 4FM1A 1XILA 4XBFA 1GH6A 1P8LA 4C2MA 4MTFA 3RGBA 5LHGA 5CE8A 2NN4A 2W6OA 2JEFA 4I9WA 3BY6A 5KX5F 1EHIA 3SJCC 1XHZA 3MR6A 4RUAA 3J80W 3TY8A 1HNZH 1N0JA 1I2LA 2JJ1G 3IAYA 1JR9A 4U3JB 1CXZB 4ECZA 4MV7A 1QU7A 1XREA 3CEBA 1OCRB 3OW2U 4NTXA 5JJNB 2Z0AA 3WU2Z 3OUSA 2PI4A 4YHHH 4H13B 4ZHQF 2ZDHA 1EBOA 3E86A 1SERA 1J5EH 5KUKA 4LC1A 1DK1A 2RQ6A 3VBBA 1X59A 1QVFU 5JJJB 2DWEC 1HWYA 3GTPA 4A3KG 2M6YA 4I4TF 4ED1A 2YRXA 5DLFA 1HR0H 5LXTB 3VPBA 3T7AA 2R93G 5FL7G 3DTGA 2WDTA 3KAJA 4J9KA 4J9YB 4XX0B 1HNWO 4XDLA 3TEKA 1FXKB 3CCMV 2VA3A 1AI5A 1COWG 4F4WA 4O3NA 3M9NB 4DRXB 5KG2A 3VQWA 1ZUQA 1T5EA 3SJAC 1XNRB 4LFBB 2BE3A 2QK4A 2W71A 5DECA 3AK1A 4FMTA 3ZRWA 1CQJB 5LGTA 1XL4A 1S9FA 5KHIA 2OIEA 1US6A 3Q8RB 3E22A 4I7HA 2R85A 5KFEA 3AG7A 4NXMB 1S0MA 2JGUA 3JD4A 3CMAV 3LMLA 3UO2A 5CBGA 5L3GA 2WB1A 1Y74A 2ADPA 4EGQA 4YJ2A 3AG1B 5H80A 1SZTA 3FB8C 5A9GA 3J7AU 4BXXG 3RYHB 2QM7A 5F2VO 5TISZ 4JI8O 4EG0A 4H33A 4ECSA 2Z04A 4GX0A 4J7JA 1I5YA 2HGXA 4B3SO 5B1NA 1SQFA 2YI8A 3LWBA 3BVOA 5JQGB 1XBLA 5I60A 5KG4A 3DGEA 3C0FB 3CS5A 3WFVA 1KP3A 2GQSA 5LA6F 2W9AA 2QSAA 4DR4B 2UUCO 1AUVA 1HNZO 2AU0A 1H2SB 2QGNA 1R6KA 3ABKB 4DL2A 2YEVB 2VA2A 1EZJA 1R3KC 5EC2C 2XUMA 3SR2C 5LMUH 3RWRD 2R92G 2Q0OC 2Q7HA 4O4JF 5FD5A 3ABLC 3IC7A 3OMIB 4JPRA 2Q69A 3EFFK 2HVKC 2CNQA 4TT3G 3Q1KA 2ZCEA 4W4LA 4ASUG 3UFXB 4Q8EA 2LP7A 1GSOA 5GTIZ 2KSWA 3FAVA 1FXHA 1P84F 2XNDG 1L0LH 4XYLB 5KFHA 4CKCA 3N2KB 1KTAA 3KXYT 5EBWC 1WA8A 3TIGA 1P49A 2UVUA 3H4DA 3QFFA 1PP9H 1MNGA 1MA1A 3ABUA 2PZSA 2UUAO 2JGDA 1W96A 3F5WC 4ECWA 4ECUA 1JXLA 2ASJA 4I55A 4I50F 5CBFA 1I2KA 2BQUA 1E79G 5IP9G 2ZT9B 3L2PA 4ZBMA 3K58A 2Q8VA 4MW3A 4JI6O 1BE3H 1Z5VA 4UCSA 1JIHA 2F66C 5FR9A 4NXNH 4TUYB 4IR9A 1N34H 1CKMA 4MT8A 3OTFA 5LMUO 4EYIB 3FD9A 1Q6HA 2C22A 1GKFA 1SQXH 3WB2A 3JATA 1B33N 3V6HA 4WFGA 1QLEB 2P5OA 1N33B 3BQ2A 3OUZA 3K59A 4J80A 4UCOA 3QO5A 2GTAA 2FK2A 4NR1A 4PDLA 3DC6A 3SI8A 3PR4A 3K06A 1ROPA 3OUUA 2RDJA 3T5KA 2DN9A 4RAZA 2YI9A 1N32H 3JCUZ 1F4MA 5LOVF 3K9SA 1ZSPA 5B1OA 4LFCO 4WD3A 3KHLA 4QPKA 4JI8H 3CJHB 2Q67A 3MR5A 5JQGA 1H2MA 4B3MB 2QWQB 2XGQA 4TQDA 3UO3A 2BTQA 4DV6B 2UUBH 3FB7C 4G27B 1GN4A 1VQ4V 1H2GA 2AGAA 5LYJF 1XHXA 2M7WA 4YJ2B 1IX9A 3GVMA 2Q7GA 1AJPA 4FBTA 4JI2B 1NU1H 2MCTA 1ET0A 4LSXA 4Q45A 4YIPA 2QYZA 4Q4DA 1XDNA 2UU9B 1UPGA 3SPGA 2FK1A 3MFIA 3N44B 3U0GA 3ZRVA 5BMVA 4AQYB 2ZM6B 4O4IA 2E2IA 3HKBB 2F4VO 4J9SA 5LGUA 4LF5O 3V4SA 1KUQA 4O81A 4YB8B 3VQYA 5J2UB 5GW7A 3MWDA 1YF2A 2HHHB 4I0XA 1TWCA 3OR6C 4O82A 5T14A 2DQ0A 2FLNA 3H1JH 2HJDA 4R8CA 4CS3A 4PDBA 2R7KA 4NVPA 3GTLA 5K2MA 4O84A 1UC8A 2O03A 3MWMA 4X1IA 2NUAB 3U54A 1FPOA 3T9CA 4O2AF 4YR3A 3IJ4A 3K5HA 4DO2A 3Q8PB 5LL6Y 1N8RW 4DW0A 5FD6A 5BWRA 4O2BB 1K5SA 4Q44A 5BWVA 4B7KA 5CA1F 3ZHRA 4EEQA 4A3FG 3IGAC 2ZDIA 2PGGA 4O7LA 4JV5O 4TV9F 2V4QA 5D1OA 3LSSA 4O4HF 3WNZA 4DV0B 4ED7A 4WF9V 5I47A 3PW0A 4FVMA 1BT8A 2UUBO 4LH6A 2ZXWC 3K9AA 3FX7A 3VOUA 1S5LZ 2QWRB 2YS8A 4FLTA 4BWSC 2ZINA 1ULZA 5J2TF 1N33O 3GTQA 1XUQA 2Q68A 2WPDG 3I56V 5KFLA 3HB9A 4DV2O 3BFRA 4BW5A 5LL6b 2RDCA 3EPIA 1Q6UA 2CUGA 3CVZA 5KFRA 4J7ZA 2ITCC 1Q8IA 1UFIA 1GAXA 2DQ3A 5C3EG 3K3PA 1CP9A 2O57A 2W6JG 3N2GB 2AW9A 5CB4A 4O7VA 1V55B 1R6TA 4KHPH 1K1QA 4JI2H 2UXBB 4GKJO 3RYFB 4BIUA 4FS2A 4RCNA 3LSQA 2WYOA 3M9MB 3NC0B 4A3DG 1N34O 4Z1MG 2WLIA 4DR6B 1GLVA 2HG5C 1P16A 4CMFA 5EZYA 1IYEA 3FKSG 1N36B 3THOA 2W6QA 2YXYA 3E2EA 2Y69B 1WR2A 2XD4A 3FB5C 4YY3H 3T99A 4YBZB 2EIYA 4XDKA 3OUFA 1HNZB 4I0XB 2YS6A 5CAEB 3HT5A 2QM4A 3JD0A 4FFLA 3ETQA 1PM9A 2W9CB 2W6ZA 3T1YO 5EYPB 2W6IG 4RUFA 5HFMA 1I94H 4JAVA 3RYIB 2FKXA 1XK5A 2JEJA 1RPRA 5LMNH 3JATB 2VQFB 4TV8F 4LF6O 3HKDB 4A3CG 2JEIA 1ZHSA 5JVDB 1VQ9V 1IXMA 3K03A 1I1LA 2V59A 1TVKB 4O7NA 4MTGA 3GWKC 2MW2B 3W1GA 1IBMH 4OX9H 3G71V 5DQIA 4R7CA 1H2NA 3T2MA 5CN0A 2A06H 5L3EA 4MTEA 4YR0A 2Y4TA 2DZDA 1AROP 2GHYA 1RK5A 5KFGA 3ABTA 4G3IA 3KHRA 2DLNA 4Q43A 3K0DA 4AQYH 4FBUA 1D2DA 1ZX3A 2Q2TA 4X20A 1I1KA 1I7LA 1S10A 2HG8A 3ML0A 4JV5B 1E4FT 5DQGA 1WA8B 3ASOB 3V4ZA 4PDVA 1G2WA 2B1IA 4O4LF 2AGOA 4BWAA 2B1GA 2A79B 5FJ8G 3CC7V 4N21A 4PD4F 4OX9B 2Y0SA 5I5SA 1K83A 5D8DA 4YAJB 2C2AA 1FKAH 3CC2V 1OZ0A 1Y1WA 3C3TA 3GQCA 3K79A 3U9SA 3VQVA 1OWTA 4DV7H 3ZN1A 1P7GA 5EBMC 5BPFA 4YY3B 3RV4A 5IYBG 2YCHA 2AXTZ 2QWPB 1N34B 5E79Z 4HNVA 4X20B 1K73W 1OCZC 2OCCB 2Y48A 4IRCA 1PV0A 4JI6B 4DK0A 4YHHO 4R6ZA 5DN6G 1PNKA 2FPIB 1RJRA 2ZNIA 1L0NH 2W8KA 2VWKA 1NH2B 1DAAA 5KFUA 1K34A 1D5NA 2DABA 5B3SB 1MZBA 3RBEA 3G80A 1GK9A 1Y74B 3VOTA 1S5JA 5IE9A 3OSPA 3DC5A 3K0GA 5IJ0A 1J5EO 3OE7G 1MSWD 3CHXA 4ED6A 3AG2C 5JVDA 3B8MA 1GN6A 3D36C 3J80N 3FMAA 3H1HH 1ZTEA 4YXWG 2EJ3A 3RB4A 1NBMG 2IJKA 1VQ5V 1L8DA 4LR3A 5CM0A 4JAAA 1K92A 1RJQA 2CTWA 2K1EA 1OCRC 2Q4PA 4PDRA 5K1PA 4E2LA 1S03G 1RSOB 4KXRA 3CC4V 4JI0B 1UNNC 2C2EA 4F4LA 1DLBA 3B09A 1E1QG 4BAYA 2J9GA 4CKEA 4LF6B 2YL2A 1EZVH 3ZHQA 2YZGA 4MV4A 5HV6A 4DV4H 3W5OA 3CE2A 2FPPB 2WLMA 2LW7A 3NBYB 3CB2A 4LP8A 3K5NA 2V9WA 2L6LA 2P4VA 3NXSA 1WPXA 3G67A 5LMUB 1W0KG 1W2BU 2BOBC 3M8AA 2NNUA 5LHIA 1KC8W 4QWBA 2ADQB 2EILC 2YICA 4GX5A 4M7EA 5KFTA 3RR5A 5KG7A 5DG9A 3RFCA 3QVNA 4K8ZA 4LF8B 3GB8B 4DV7O 4FJCC 1K8AW 3FFQA 2HGSA 2GTSA 2HVJC 2ZE8A 1G4YB 3UM7A 3QO8A 2YW2A 3KHGA 3CXCU 5D5PA 5B5EZ 2L35A 2AHYA 2UUCH 1XNQH 1M57C 3JASB 1VF6A 3K3WA 1AJNA 2JA5A 2VRZA 2UXCB 4CE5A 2FMLA 3E8FA 2FLPA 4DV0H 1XMQO 1FYJA 2EJ2A 4DL6A 2NU8B 5BZBA 1JPXA 1R3JC 4J0MA 1HNXH 4A3GG 4K0KO 5EWFA 4DL4A 1R3LC 4FFKA 4JV2A 1SZXA 4YJ3B 1A48A 1HNWB 2JEGA 2X6CA 4UV9A 4B3RH 3SYAA 3T9AA 3PVXA 4ZHQA 3E8GA 3GV8B 3WB1A 2Z3YA 3R5FA 3TQTA 4J42A 3L9DA 2R8IA 1VMGA 4U7NA 1FD9A 5LMNB 2UXCH 4FM9A 4O2BA 2EILB 1LUVA 4K35A 2R8GA 4B3RO 1RM1C 2J6SA 5JJEB 3SYCA 4O86A 1HDJA 2E5LO 5IWAO 1FFXB 3OGCC 1Z2NX 3JAKB 2Q5ZA 2XCPA 5DISC 1M56C 4PHZA 1CKNA 1NQTA 1XMQB 1EZ1A 4RAIA 1BQZA 1SQQH 1CEZA 3C90A 4DV0O 3EYYA 5KFKA 3K5MA 2P7TC 4ECRA 3W1BA 4DQNA 5CA1B 3OGIB 5L3FA 3N40P 5J2UA 4NXMH 3QQMA 3T1HH 5KHJA 3U10A 4EFEA 4DR3H 2XAJA 2HIXA 3TY9A 2UVWA 2CH7A 4TV8A 2Y69C 1Y66A 2K9PA 2EINC 2GUZB 1GM8A 1DF4A 1QNMA 1L1FA 4JV0A 4OPHA 4IT5A 1S76D 5LA6B 3TW6A 2ARHA 2WAQE 1NS1A 3ABMC 5FNVB 3DF7A 3GTOA 3CCSV 2UUAB 1JDBB 2JEUA 4E4EA 3I4MG 4JI1H 5KS8A 1B6QA 4JI7B 4Q20A 2R8JA 4MVUA 1KYOF 3QO7A 5GONB 3OTOB 1RJPA 4NYEA 4CS4A 4HYKA 4TVIA 1S0OA 3P3NA 3AG4C 3SPJA 5JCOA 1JVMA 4L1KA 1Z2PX 1SRYA 1SA0A 5KFJA 4I50A 2YRWA 4TV9A 5KAFZ 2P4KA 4TSFG 3PO2G 2XAFA 3BEHA 4ZI7B 2HR3A 3GTJA 4UFZA 4AHCA 1Y76B 4WBNF 2ZJTA 1NT2B 1IDSA 2WLNA 4F4XA 2VPSA 1M1KW 5DG7A 2ASDA 2NU6B 4A93G 1G6UA 2DOSA 4O3OA 2EIMB 4NTYA 3RJ0A 3R65A 3E5NA 1N32O 5BWWA 4J9MA 2ZKOA 4TUYA 3MHSC 2DYSC 3K5IA 1PL4A 3K04A 1MOFA 3MD0A 2NU7B 4X65O 1Y67A 1H8EG 3CYOA 4JI5H 1SEIA 5L1JA 1OV9A 4FZ1A 1Q6IA 3ORQA 1H2LA 4DL5A 2PF4E 3U9TA 2ITDC 4EYHB 5C8YF 1VP7A 4GZRB 3BA9A 1P7BA 2IW5A 5IT9N 4HN2A 1TGOA 4LWSA 2Q9LA 4I55B 3DXRB 2BSKA 5LOVB 3G6BA 3OMAB 4RB0A 4R50A 5KX5B 4P2ZA 4O7TA 1SQVH 4FZ0A 3KREA 4DV5O 1GYFA 3GWOA 3T4DA 1B04A 5IYBO 4Q4CA 2ZDGA 4XZ3B 2HVSA 4X62O 4JYBA 4NTWA 1AR1B 2FYUH 4NYKA 1T3NA 3N2KA 3GIPA 3HOWG 2R8HA 1WCMG 1QHTA 1JFFB 5H2FZ 2IBKA 2JA7G 4O83A 3W7WA 3RGXA 3RBDA 3IN5A 2JA6A 4DV2H 3ZJZA 2JA8G 1OJHA 5LXTF 4X89A 4X62B 2UU9H 5LOVA 3EHBB 3DXRA 3FYEB 4OPAA 1KKDA 3GILA 5E1AC 2XGPA 2VQEH 4UXNA 3ZN0A 1OCOC 4PZ7A 5KFNA 4FGRA 1A3GA 2WA3A 3P3PA 4DR1O 4B3TO 1Z2OX 4PELA 2BR0A 2Y4RA 2UUBB 1P4RA 1R9TA 1YDXA 2EX3A 3APQA 1XDCA 3IFXA 1SCUB 4UV8A 3MFHA 4GYCB 5FPRA 4MV3A 3KYHC 2F1MA 3RYCB 1EN5A 4WFFA 5KFMA 4MVZA 5F9NA 4TM5A 3JALB 1AVMA 2H94A 3UCSC 4NLGA 4DR1H 4R7RA 4B3TH 1XNRH 3I4NG 1I7NA 1YCIA 4PV1B 5EZYF 4LF6H 3JZ6A 1GO3E 5BXZA 4I4TA 1NJIW 3ETHA 1QLEC 1SC5B 3CRRA 4FFBB 3FDSA 1KJJA 2I8CA 3F8NA 5KFOA 1KJ8A 4TV9B 3A0RA 1CKNB 4ZOLF 1O75A 4GX1A 2QTOA 2GPSA 4ED0A 4APMA 5C93A 3QG5A 2C28A 4FLZA 3R5XA 1VS0A 4X9QA 4QE9A 4C7UA 5C1OA 2UU9O 3OSNA 3GIMA 4IZOA 2PN1A 4X1KB 5IWAH 2YIBA 4O4IF 1K7DA 4HNTA 4Q8FA 3WB0A 4G28B 4IWYA 2CKZB 2VPQA 4ZIBA 2QJ1A 3L75H 4EB6A 4O4JB 4YJ3A 2XTAA 4YIOA 1AB3A 2PMZA 3LDCA 2QDOA 5L3DA 5BY1A 1RK6A 1QR8A 4PWQA 1IBKH 3RV3A 1FXKC 3SPHA 3WWJA 5K3WA 4A3BG 2HVRA 2A7WA 2KKWA 3GDEA 4GLXA 3WWHA 1BMFG 3G6EV 1U97A 1GN2A 1M0TA 5CR5A 1ZL8B 2Q2UA 3NGDA 4MVMA 2YU9A 2LGQA 2R86A 4MAMA 2P6JA 1EKPA 5IY5C 4WFBV 3BACA 5EOYA 2DYRC 4C5CA 2R87A 4A5UB 4DR2O 3NR7A 4X1YA 5FLMG 3P30A 4ZKIA 4QWAA 1PX2A 4FFNA 5CB4F 3RB0A 3TGUH 4RWUA 4FFOA 3L70H 3A2FA 2ZIOA 4F6EA 1V55C 2XCLA 2WA4A 4O4JA 3U55A 4EBEA 2PYLA 5L9XA 3IC9A 4W4KA 1TWHA 1WSCA 4RUCA 4GX2A 3MAQA 2OWOA 4DAAA 1GMGA 3KZIZ 3C3SA 2VWJA 1N4CA 2CDYA 1JOYA 4LF9O 1NZ6A 2B63A 2FL4A 2WAQA 1AI7A 3OR7C 2R70A 3R66A 4JI1O 5KLVH 2YZMA 2W0FC 1F51A 4UVAA 1H2KA 3CRAA 4HAMA 5DQHA 1XL6A 4DV4B 2ZXWB 1DTOA 3ORRA 1BHBA 5JQWA 1AR5A 2N74A 2V7QG 5H9CA 1JX4A 3VQXA 4BW9A 4FLUA 5KFWA 5A2QN 1CPYA 1UC9A 5J9PC 3CCEV 5IYZA 4GKJH 2AHZA 2RNBA 3ABLB 4J7KA 3SNOA 5I5VA 1IBMB 2IU3A 1VQNV 3S3XA 3V6JA 2X0LA 2ALZA 4X66B 3E89A 4DXWA 3V6KA 2H8PC 3MHHC 1KEEA 4UB8Z 4O3QA 4J9RA 3SGIA 4AYBE 1HW7A 1U96A 4MVSA 5KUMA 4MA0A 4DV5B 4LF7B 1Q5OA 4XYMB 1GSAA 1IOWA 1W59A 5DGBA 3ZHTA 3I55V 4MVQA 1SQBH 3ZEDA 3AEIA 3R9RA 2UVRA 3F7YC 4QIWF 5EC1C 5CA0B 1YJ9V 2OYQA 3PZPA 2PBZA 5EDWA 4PZ8A 2RDIA 4UUJC 1MMMA 1RSOA 3CRCA 3EVKA 3JAMN 1UJWB 2DPJA 2HDKA 1PKXA 5KT3A 3M4IA 2P22C 3ETDA 1YEWA 1AN7A 1SFOA 2YXHA 4HBNA 2XC9A 4UVBA 1N48A 4MTDA 2DPIA 2W6PA 5GONF 5LP6B 2ZNJA 4IHJB 2VR1A 3OAAG 5C4XG 2HJWA 1JX9A 4DV1O 1OCZB 5DEDA 3JALA 4EGJA 3PW4A 1RM1B 2R84A 3RVZA 2YS7A 1EKVA 3X2QB 3RYCA 3UKMA 4IRDA 2NLJC 2Q0AA 3LULA 3T9EA 1AP6A 4MS2A 3HKZA 1X4TA 4M0JA 4DL3A 3AX6A 3Q2OA 3PW7A 1VQ6V 2R72A 5I5TA 3L71H 2E5LH 3L74H 5L3CA 3H01A 4UUGA 5FLXN 3LP8A 2GPWA 4R8UB 2R8KA 3HXLA 5KFPA 2A3QA 3SYOA 3M99B 3J7AK 1FS0G 1KECA 1JLLB 1K4DC 4H37A 4KL1A 3T5JA 4MTXA 4BY1G 3DSQA 4RO2A 1NKDA 4O7SA 3GV5B 3JD1A 5EYPA 3CXHF 3AG1C 3KAKA 2ASLA 4QWDA 3ETGA 3OD4A 3M7MX 4LFBH 5C8YB 4P9OA 3L73H 4DV3O 1DV2A 4LBEC 2FE3A 1Q90D 3NBZB 2HIVA 1IBMO 4RNOA 4DR5H 4CKBA 5H6RA 4ZOLA 5KA5A 2EBOA 2WLJA 4CH4A 4M9UA 4I50B 1SA0B 1YSCA 2GDSA 3ZMZA 1KKCA 4IIJB 2EJ7A 4JI0H 2EIKB 5D5QA 4LFCH 4OGQB 4PA7A 5KFVA 3TQ1A 1LNQA 1Q81W 3LUTB 3U11A 4LWSB 3CP1A 3W7TA 4DR5O 5GONA 3SYQA 4YY3O 3ZMVA 4B3SB 4DUYH 3RW0A 2MK3A 3H1KH 2OCCC 4JYAB 1S68A 2Y0SE 3H4BA 2FTKA 2UXDH 3O9OA 1EM1A 2IA6A 4F6RA 3GIIA 4LMYA 1S0VA 3N27A 3HKEB 3JD3A 2AZ0A 4PDMA 2QKAA 4JF3A 1BL8A 1YTFD 1R6NA 3HKDA 2PI5A 2GUZA 2HLDG 4TV8B 1NVPD 3ZRSA 3RYIA 4UCRA 5LGNA 3JYCA 4QSHA 3LDEA 3JZIA 3ABKC 3Q8SB 3AG2B 3CCVV 3CMEV 2YIDA 2PMZE 5LYJA 5AG2A 1IBKO 2AGQA 4JXUA 1PNLA 4Z2WA 2HHHO 2NVYA 3FKIA 4A3MG 5KFIA 4QNHB 1I94B 1H38A 1JDEA 4HQ6A 1VARA 1TUBA 5DMXA 4JAUA 3ABMB 3JZFA 5B66Z 3L72H 1I7FA 3OFNG 2GBOA 4WFEA 1DIKA 1NTKH 4JI5O 4EBCA 4FLYA 4NXMO 4N23A 4DV1H 4MV1A 5KT4A 1HNWH 2LO1A 4L8JA 5EZYB 2RN9A 3ZMUA 3LQSA 2XCAA 4TQFA 4MW8A 2R9AA 5ITZB 3B40A 3OEEG 2VOBA 5DLGA 3ZMSA 4ZHQB 1I5XA 2KB1A 2OTJV 1DF5A 1XNRO 4JI7O 4JV5H 2EZOA 1TAEA 2YC0A 1YITV 3A0BZ 3SJBC 2UXCO 3HR0A 5L1LA 3N2GA 3B77A 5IYCO 1IOVA 2G38A 1BNCA 2I80A 2J6TA 3GTKA 2RCVA 2BQRA 2V4RA 3B2EE 4BBSG 1VQ7V 1N0NA 3KCXA 3P32A 1IBLB 3JASA 1EN6A 3TXQA 1ZLZA 5JCOC 2ZR3A 3DTFA 3K3VA 4JI7H 5CA1A 4WCEV 4DV7B 3G4SV 4PA3A 2JIZG 1RYRA 2GV9A 5KG0A 3ASNC 1Q86W 1JKJB 2R7ZA 1VIBA 1S77D 1KT8A 1TWFA 4UCUA 1PK8A 1TA8A 2COIA 5JH7B 2CW8A 3HBLA 1QR9A 1FKAO 1SF9A 4IWXA 5HFLA 4LF7O 4YP3A 3H1IH 5KG3A 4I7ZB 1WLEA 1CS0A 5D1OB 1G8MA 3B8NA 4PA9A 2PY5A 2E5LB 3SPIA 2CNVA 3H3VH 1R1BA 2PTMA 4L87A 2VQEO 1WP8A 1HNXO 3D3QA 4ZI7F 5DGIA 2XHBA 3WG7B 1C3OA 1M4UA 1BGWA 1SKVA 4QPJA 3GIQA 1EFRG 3OTOH 2AQ4A 3NUAA 2YWVA 5JUMA 2CQYA 1WPBA 3CJHA 4IYIA 2Y0PA 1S5HC 1ZAUA 3OM3B 4RAYA 4PJ0Z 3BPZA 1A0IA 2FK3A 5KHHA 1IZ3A 4AYBA 2P06A 4JI4B 4O3SA 4X66H 2HHHH 2ZIMA 3GIKA 1I0HA 2E2HA 1S0NA 3J81W 4D7TA 4ECVA 3CSXA 4X8AA 3RUPA 1KU9A 4DR2B 3BAAA 1T94A 2FB5A 2ILMA 1SQGA 4X65H 1BZKA 2LGWA 4NZNA 2W6MA 1MSDA 4J9OA 4WHXA 4KHPB 4MVRA 1GO3F 2QF7A 1VQLV 5IJ0B 2VQDA 1XOUA 2NU9B 3SJQC 1S97A 1VQKV 4F6RB 2CTQA 3JCZA 4LF8O 3WWIA 2R92A 1M5IA 3T9FA 5KT2A 2JK5C 4JTCB 1Y1WG 3KALA 1AILA 1FXVA 1XQ8A 5EBLC 3WG7C 2QTSA 2OLSA 1YI2V 3CSWA 1DV1A 1THZA 4DR5B 2M05A 5KA6A 4DV6O 3L4KA 5FPOA 5IJ9A 5KG1A 2JGDB 2JVDA 1V54B 2EULA 3VPDA 4QE7A 3RAXA 4JI4O 4PA4A 1K1SA 2BTOA 1M93A 4K3AA 3HKZE 3X2QC 2RJZA 4LFCB 1W93A 5D1PA 4RQFA 2DIKA 4FFMA 4TUYF 4JI3O 1AUXA 2WLHA 1Y1VA 4YJ3F 1M7JA 3JRXA 2LJ2A 4X62H 4DR4O 2JS3A 4JI2O 5JVDF 1WCMA 3BA8A 4JYYA 2FKLA 3CCUV 1N56A 2W6NA 4YR2A 1IURA 5CA0F 5L1KA 4LF4O 1WH2A 1QVGU 2YUAA 4FLVA 5KFFA 3T1CA 3ICXA 1M56B 3MWEA 4DIMA 2C35B 4R8UA 1GN3A 1VAJA 1OBGA 3T9BA 3S3WA 4LF5H 3EPGA 2IH3C 2HKOA 4IR1A 4O4LA 2AZ2A 2IBZH 2SCUB 2HJFC 1GM9A 3B4SA 3I12A 4LF7H 4ABMA 3K08A 4Y8VB 4PA6A 5H6QA 2JRIA 2Q6AA 1R73A 3T5LA 5KG6A 2Y4UA 3F7VC 4EFBA 5EK0A 2W7PA 1V54C 4O4LB 2A9HA 4U6PA 5I5WA 1TVKA 3QF7A 4YHHB 2LW1A 4KFMA 1OCCC 4J10A 4CC6A 4NB5A 3T1HO 2WWWA 1E1RG 1F7YA 3FAVB 3VMMA 4DRFA 3CCJV 4GKKB 3T1YB 1GSHA 4K8XA 1BJTA 2CFMA 1HR0B 4B08A 3PR5B 4B7EA 4BR6A 4HZ3A 3I5DA 5KFCA 2ZE5A 1KC7A 5FNVF 2LFSA 2QM8A 5I5YA 4GUNA 4MV6A 2IJIA 1KJ9A 2YDEA 5JVLA 1KQSU 2WLLA 1O9HA 1FJGB 1NI8A 5J2UF 1BCCH 4E6NA 1Q3EA 1BGYH 2RMKB 2FPGB 2V1DA 3T1YH 5HBRB 2IM9A 2YXLA 5LXTA 4AI8A 3Q8QB 1KJIA 1QLNA 1OHHG 4CBCA 3MDSA 2WLIB 3G6YA 2OH2A 1OCOB 2DJVA 1QQCA 4O7RA 1R3IC 3VA7A 5EWEA 1BSMA 4U7CA 3MR3A 5H5NA 1XMOH 3CWBH 1EUDB 4X64H 5JH7A 3TETA 3AG3C 2F4VH 2W70A 5CA3A 1URFA 3G8DA 4QW8A 3BG5A 2OTLV 2ZQMA 5CB4B 2RGRA 3BJYA 3ZRWB 2CGNA 1KD1W 2E75B 4BIZA 1CKOA 3WO1A 4GLWA 1FAFA 1ZHQA 5JQGF 4DR7H 1W0JG 5BYBA 4NZMA 3J81N 3GTMA 2EJRA 1TWAA 1M57B 1EKFA 4QW9A 1SESA 2HFEC 2E76B 2ZDIC 5IDJA 1FXKA 4JI1B 4EQ5A 4DR4H 3CEIA 2IP4A 1YTFB 4JI3H 4DR6H 1K5QA 4TQSA 3RFRA 5IYZF 2DWCA 2VQFH 3N6XA 5B1AB 4GKKH 2QKCA 2FP4B 2C00A 3G6VA 1VF6C 3AG3B 4DR2H 1MG1A 4QGPA 4RQEA 1SYXB 4CHIA 1V4YA 2DE0X 2D2CB 3W7UA 2VQFO 4K0KH 3HB3B 1VQOV 3JAMW 1EYZA 3RYFA 3BCCH 4DV3H 2QWOB 2GQRA 4X1IB 3HPLC 4CZZA 1I94O 4LFBO 2WB1E 5KFBA 4MSWC 1BXRA 3IG0A 1F23A 2EZPA 4O4HA 4DUZO 1N36H 1ZL8A 2V5AA 4LF5B 1D5AA 4A2AA 2P0AA 4A2BA 4P9PA 1KJQA 3GB7C 3KHHA 4QIWA 2ZGIA 5DG8A 2KG7A 3LNNA 5KHGA 4RB2C 1AR4A 3JD2A 4NKGB 2QA4V 1GRJA 4LSAA 2EJ0A 5IT9W 1S72V 3E8HA 4A3EG 2Y0IA 2YZNA 5BMVB 5IYCG 2NR5A 3CX5F 3K5LA 4G2KA 5EWGA 4EB6B 5FLXW 3JSNA 4JYAO 3PJSK 4JASA 2P90A 3SYPA 3TW7A 1YJNV 1QBZA 3W7XA 4FIPC 2QB5A 5ITZA 4MA5A 5B3SC 4O7WA 1FVIA 3OHBA 4X64O 1LR1A 2BTQB 3RAQA 4DW1A 2DYRB 1J5EB 4PBCA 3A0HZ 3AYHB 5LHHA 1Z2GA 4Q0YA 3O65A 2P67A 3R23A 3S24A 1WRVA 1NVPB 1S3JA 4JI3B 2B9ZA 3ZRXA 1TUBB 5L1IA 4A3JG 2F23A 1VQMV 3N41B 4ZOLB 4DR3O 1DGSA 2WE6A 4DV2B 2WLLB 3RB6A 2DW4A 5LYJB 4JUZA 3D36A 3JRWA 4I4TB 4DR1B 4B3TB 3GLKA 2WTFA 5I5UA 1XEQA 3PO3G 1PL0A 2HVQA 3DAAA 4O3PA 1YVWA 5IWAB 4H0LB 4BBRG 1VF5B 4J9QA 3HKBA 4IRKA 3QNEA 4O4IB 1V9PA 4FLWA 2NVXA 3LSUA 4Q6GA 2C2RA 2ZDQA 1AJQA 1IVSA 4IAJA 1WAZA 2W57A 4P30A 4EBDA 5KFZA 4OX9O 2QE7G 3UT5A 1BHAA 4O3RA 4RB1A 4RNMA 2JA7A 4ECYA 1K33A 4KP4A 5EIBD 4J9ZB 4FLXA 2UXDB 4UCTA 3SPCA 3N6RA 1KBLA 1B3QA 3ZS8C 5I5XA 1VF7A 3D3IA 1WB7A 4GKKO 2Q7EA 3VNNA 3KG2A 4O2AB 5BR8O 3OEHG 3TIIA 3RIZA 4IIJA 1ORQC 1Y6XA 5B1BC 1PD3A 3HKCB 2QEXV 4GT1A 3H40A 3QWUA 4D6TH 2X0SA 2DYSB 4D7SA 1XNQO 1RP3B 3N8DA 4LF9B 1RYSA 3N42B 2XT9A 3HOUG 5KAIZ 4RZQA 3Q4HB 4IYHA 4OXSA 4NXNO 3KCYA 1GGOA 1VEWA 2EINB 4QJFB 3L4JA 2YEVA 1X9NA 5KX5A 2FMAA 1LUWA 4X64B 5KHKA 2IU0A 5KFXA 2WLKA 2N04A 4JV1A 2R7ZG 2Z5UA 3G6XA 2C2DA 1B6RA 4MV8A 1CE8A 1K4CC 5IJ9B 2CW7A 3MR2A 4RNNA 2HHFB 2Z02A 1A32A 3ETJA 2JS5A 3TINA 2FB9A 2GLTA 3CCLV 1TUEB 2V58A 4BIOA 3K57A 3TY5A 4DUZH 3CRQA 3AG4B 4HNUA 4JI4H 3RGZA 1M6VA 4JI0O 2W0XA 4JTDB 1PPJH 3WO0A 2I87A 3PW5A 2BCCH 2E3CA 4WFAV 2YYAA 1I6UA
chains in the Genus database with same CATH topology
2R9AA 5ITZB 2ZCEA 5J2TA 2VOBA 4CC5A 4ZHQB 1WN7A 2KSWA 5LA6B 4DV1B 5FNVB 3DF7A 3N2KB 2UUAB 4JV5H 3KXYT 5EIBC 1TAEA 2XIGA 1P49A 4JI1H 3SJBC 4JI7B 2PUSA 3N2GA 2PZSA 1N33H 4GKJB 5GONB 3B2EE 3OTOB 1L2ZA 4CS4A 2PYJA 4I55A 5JCOA 1IBLB 3JASA 4MV9A 3K3VA 5JCOC 4JI7H 4DV3B 5CA1A 4FM0A 1Z2PX 4DV7B 1SA0A 4I50A 4TV9A 2GV9A 3L2PA 3K58A 1Z5VA 4UCSA 4UCUA 2F66C 1TA8A 4NXNH 4ZI7B 5JH7B 4TUYB 2CW8A 4B3MH 1N34H 1CKMA 3OTFA 4UFZA 4AHCA 2YIAA 2ZJTA 5FNVA 1NT2B 5KMGA 3RYHA 3JATA 3WB2A 2VPSA 2P5OA 1N33B 5D1OB 4LNUB 3K59A 4UCOA 2PY5A 2E5LB 1G6UA 2PTMA 3RJ0A 4X1YB 2XHBA 4LF4H 3E22B 2YI9A 2F93B 4TUYA 4RAZA 1M4UA 1BGWA 1N32H 1SKVA 5A2QW 3OTOH 3N43B 1FJGH 2UUCB 1WPBA 4JI5H 4JI8H 1SEIA 5JQGA 1ZAUA 4TOIA 4B3MB 4RAYA 2CAZC 3BPZA 1A0IA 5KHHA 3BA9A 3GJXB 4DRXA 3JAKA 1TGOA 4JI4B 4X66H 4DUZB 4I55B 2HHHH 2ZIMA 4TQDA 5LOVB 4DV6B 2BTQA 4FM2A 4D7TA 4RB0A 5KX5B 3J81W 2UUBH 3CSXA 1KU9A 4DR2B 3BAAA 1GYFA 1B04A 1SQGA 4LNUA 4X65H 1XHXA 4YJ2B 4B3RB 2RGVA 2HVSA 2Q7GA 3N2KA 4JI2B 4LSXA 2MCTA 4KHPB 1XDNA 2UU9B 1QHTA 1JFFB 2F4VB 3N44B 4X1KA 5IJ0B 5BMVA 3K5OA 4AQYB 4F6RB 3RGXA 2ZM6B 1M5IA 4O4IA 4DV2H 3HKBB 3KALA 4DR7B 1XQ8A 4X62B 2UU9H 5LOVA 3VQYA 4UCVA 5J2UB 4JI6H 4U3JA 2HHHB 4DR5B 2VQEH 3L4KA 5FPOA 5IJ9A 4PZ7A 2JVDA 3T1HB 4CS3A 4PDBA 4FFBA 1Z2OX 4NVPA 3RTXA 4PI0A 2HEPA 2UUBB 4LH7A 2BTOA 2EX3A 2O03A 1M93A 3MWMA 4X1IA 2RJZA 4GYCB 5FPRA 3KYHC 2F1MA 4LFCB 3RYCB 5D1PA 4PZ6A 3RF2A 4LFAH 5FD6A 1JMKC 4O2BB 4CH3A 5J2TB 3JALB 4JI5B 4EEQA 4X62H 2PGGA 4DR1H 5D1OA 4R7RA 4B3TH 4DUYB 1XNRH 3BA8A 4DV0B 4FVMA 5KMGB 1N32B 3HKEA 4RB3C 4LF6H 4LH6A 1WH2A 4FLVA 4FLTA 4BWSC 4I4TA 2ZINA 3ICXA 2UXBH 4LF9H 4FFBB 4LF5H 3F8NA 4O4LA 4TV9B 4LFAB 1CKNB 4WBNA 1O75A 5LL6b 3QTCA 2VUGA 4DK1A 4LF8H 4LF7H 3CVZA 4APMA 3QG5A 4NXNB 4DV6H 4HNAA 1Q8IA 4EFBA 4FLZA 4O4LB 1VS0A 1XMQH 4CS2A 3N2GB 1TVKA 3JAWA 5CB4A 1XNQB 3QF7A 4X1KB 4YHHB 5IWAH 4KHPH 2YIBA 1JFFA 3WB0A 4JI2H 5C8YA 4CC6A 2UXBB 4ZIBA 2QJ1A 3RYFB 4EB6A 4O4JB 2WYOA 4DRFA 4GKKB 4YJ3A 3T1YB 3NC0B 3HKCA 3JARB 4K8XA 1BJTA 2ZM6H 2CFMA 1HR0B 4B08A 1O9GA 4DR6B 1IBKH 1P16A 3UQ8A 5EZYA 1N36B 3THOA 2HVRA 2KKWA 3GDEA 4PI2A 4DR3B 4GLXA 1M0TA 1O9HA 1FJGB 2Q2UA 1Q43A 4YY3H 5BR8H 2V4DA 4E6NA 1Q3EA 3UT5B 1HNZB 3T1YH 5EOYA 2YIBD 2QM4A 2IM9A 5K1XA 2VQEB 1WNSA 2YXLA 5LXTA 4X1YA 3ETQA 3BRCA 5EYPB 1I94H 3RYIB 3A2FA 1QQCA 2ZIOA 1XK5A 5LMNH 3JATB 2VQFB 4O4JA 3HKDB 4IHJA 2PYLA 1Z5WA 5LP6A 1XMOH 1ZHSA 4X64H 5JVDB 5JH7A 2F4VH 3MAQA 2OWOA 1TVKB 3JAWB 5CB4B 2RGRA 3JSLA 2VWJA 1CKOA 3W1GA 3BHPA 1IBMH 1ZHQA 4OX9H 4O2AA 1HNXB 4DR7H 2R70A 3PN1A 4MTEA 4B3SH 5CA0A 4DV4B 4LF4B 4AQYH 4DR4H 4JI1B 4EQ5A 2Q2TA 4X20A 3BABA 4AILC 4JI3H 4DR6H 4JV5B 1XMOB 1E4FT 3VQXA 4ETSA 3RFRA 4BW9A 2VQFH 3N6XA 4GKKH 4FLUA 4BWAA 4CH5A 4X65B 5IYZA 5LP6C 1M0WA 1E4GT 4GKJH 4DR2H 4OX9B 3H20A 1XI1A 1IBMB 1SYXB 1FKAH 4X66B 3JARA 4K0KH 5IYZB 3VQVA 4CH6A 3JAMW 4DV7H 3RYFA 4DV3H 3SGIA 4X1IB 1HW7A 4YY3B 5BR8B 4ZI7A 4DV5B 4LF7B 2YCHA 1Q5OA 1N34B 3IG0A 4X20B 4O4HA 4O4HB 3ZEDA 4JI6B 1N36H 4DK0A 4LF5B 1KMIZ 5CA0B 2OYQA 1D5AA 4A2AA 4HNAB 4JYAH 1FFXA 4PZ8A 4A2BA 2ZNIA 1RSOA 4I9QA 3M4IA 3LNNA 5KHGA 2P22C 2VWKA 4RB2C 4WBNB 1YEWA 4LSAA 1AN7A 5IT9W 1MZBA 4HBNA 1S5JA 5BMVB 4DV5H 5IJ0A 3CHXA 4MTDA 3K5LA 5JVDA 5LP6B 4EB6B 5FLXW 2ZNJA 4IHJB 3FMAA 3JSNA 5LA6A 2F95B 4K0KB 2UUAH 1IBKB 5ITZA 1L8DA 3JALA 4LR3A 1FVIA 4JI8B 1IBLH 2BTQB 3U0ZA 1J5EB 3RYCA 5K1PA 1JJOA 1S03G 4Q0YA 3S24A 2Q0AA 4JI0B 4FM1A 4JI3B 1X4TA 1P8LA 1TUBB 3RGBA 3N41B 2R72A 4ZOLB 2E5LH 1DGSA 2WE6A 4LF6B 3SJCC 4DV4H 4DV2B 1XHZA 3W5OA 3J80W 1HNZH 3TY8A 5LYJB 3IAYA 4U3JB 4I4TB 3NBYB 4DR1B 3CB2A 4B3TB 3HXLA 4MV7A 3K5NA 2HVQA 5JJNB 3J7AK 5IWAB 4YHHH 5LMUB 4KL1A 3HKBA 1J5EH 4O4IB 3DSQA 1V9PA 4FLWA 2RQ6A 5EYPA 3KAKA 4M7EA 5JJJB 4Q6GA 4LFBH 3M7MX 3RR5A 5C8YB 1HR0H 5LXTB 4IAJA 2W57A 4K8ZA 4LF8B 3GB8B 2FE3A 3FFQA 2WDTA 3UT5A 2HIVA 3NBZB 3KAJA 2HGSA 4DR5H 4RB1A 4ZOLA 4CH4A 5EIBD 4I50B 2UXDB 1SA0B 4FLXA 4JI0H 4UCTA 4IIJB 5D5PA 2UUCH 5D5QA 3ZS8C 1XNQH 1VF7A 4LFCH 3JASB 3U11A 2UXCB 4DRXB 2Q7EA 3VQWA 3VNNA 4DV0H 1T5EA 4O2AB 5GONA 3SJAC 4B3SB 1XNRB 4LFBB 4DUYH 3RIZA 4IIJA 4J0MA 1HNXH 4JYAB 1S68A 3HKCB 2UXDH 4YJ3B 3QWUA 4F6RA 4LMYA 1HNWB 4D7SA 3HKEB 5KHIA 4B3RH 3E22A 4LF9B 4I7HA 4ZHQA 4NXMB 3N42B 3WB1A 2JGUA 3HKDA 4RZQA 3LMLA 4TV8B 4YJ2A 5LMNB 2UXCH 4FM9A 4O2BA 3L4JA 3RYIA 4UCRA 3RYHB 1X9NA 5KX5A 5JJEB 4X64B 5KHKA 1FFXB 1Z2NX 3JAKB 5DISC 4PHZA 1CKNA 5LYJA 1SQFA 2YI8A 1XMQB 5IJ9B 2CW7A 5JQGB 3EYYA 1I94B 3K5MA 3C0FB 1TUBA 3W1BA 2JS5A 5CA1B 3N40P 5J2UA 3TY5A 3T1HH 4NXMH 1I7FA 3K57A 4DUZH 5KHJA 4DR4B 4JI4H 3RGZA 1H2SB 3U10A 4FLYA 4EFEA 4DV1H 4DR3H 2HIXA 3SR2C 1HNWH 4L8JA 5EZYB 5LMUH 3RWRD 3TY9A 2Q7HA 5FD5A 2E3CA 4TV8A 4TQFA 1I6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S24 A;  4JI0 B;  1XK5 A;  2HHH B;  2VQF B;  4DR5 B;  4JI3 B;  4CC5 A;  1P8L A;  5FPO A;  4PZ7 A;  4DV1 B;  3T1H B;  1DGS A;  2UUA B;  4LF6 B;  4DV2 B;  3RTX A;  1TAE A;  2UUB B;  4LH7 A;  3TY8 A;  2OWO A;  3W5O A;  3NBY B;  4DR1 B;  4B3T B;  4JI7 B;  3JSL A;  1CKO A;  3W1G A;  5FPR A;  2HVQ A;  4LFC B;  4GKJ B;  3KYH C;  5D1P A;  4PZ6 A;  5IWA B;  3OTO B;  1HNX B;  5LMU B;  3PN1 A;  1IBL B;  4JI5 B;  4EEQ A;  1V9P A;  5D1O A;  4DV4 B;  4DV3 B;  4DUY B;  4LF4 B;  3BA8 A;  4DV0 B;  4DV7 B;  3RR5 A;  4JI1 B;  4EQ5 A;  1N32 B;  2Q2T A;  3L2P A;  4LH6 A;  3BAB A;  4LF8 B;  4JV5 B;  1XMO B;  3GB8 B;  4UCS A;  4UCU A;  1TA8 A;  3NBZ B;  2HIV A;  1CKM A;  4UFZ A;  2UXD B;  4X65 B;  4UCT A;  4LFA B;  1CKN B;  4OX9 B;  1IBM B;  1N33 B;  2VUG A;  5D1O B;  4UCO A;  2E5L B;  2UXC B;  4X66 B;  4NXN B;  3VNN A;  4EFB A;  1XNR B;  4LFB B;  4B3S B;  1VS0 A;  3SGI A;  4JYA B;  1S68 A;  1XNQ B;  4YY3 B;  5BR8 B;  4DV5 B;  4LF7 B;  4YHH B;  3QWU A;  1HNW B;  1N34 B;  2UUC B;  4CC6 A;  2UXB B;  4B3M B;  4TOI A;  1ZAU A;  4LF9 B;  4JI6 B;  4NXM B;  4LF5 B;  4DRF A;  1A0I A;  4GKK B;  3T1Y B;  3NC0 B;  3BA9 A;  3GJX B;  4PZ8 A;  2CFM A;  1HR0 B;  4JI4 B;  4DUZ B;  4DR6 B;  5LMN B;  1P16 A;  4UCR A;  4DV6 B;  3UQ8 A;  1X9N A;  4DR2 B;  3BAA A;  4X64 B;  1N36 B;  1B04 A;  2HVR A;  3GDE A;  4DR3 B;  4GLX A;  4B3R B;  2HVS A;  5DIS C;  1CKN A;  4JI2 B;  1XMQ B;  1FJG B;  2Q2U A;  4KHP B;  1XDN A;  1I94 B;  2UU9 B;  4E6N A;  3JSN A;  2F4V B;  4K0K B;  1HNZ B;  3W1B A;  1IBK B;  4AQY B;  3TY5 A;  2ZM6 B;  4DR4 B;  2VQE B;  1FVI A;  4JI8 B;  4EFE A;  2HIX A;  4DR7 B;  4X62 B;  1J5E B;  3TY9 A;  4UCV A; 
#chains in the Genus database with same CATH topology
 2IJH A;  4JZ2 A;  4ED2 A;  1J95 A;  5J2T A;  3SE7 A;  2WSS G;  4CC5 A;  4Z1V A;  1TWG A;  1WN7 A;  3RT3 C;  2ATL A;  4DV1 B;  5C44 G;  1GTO A;  2RF4 A;  1MZF A;  3PW2 A;  4XDJ A;  4HYO A;  5EIB C;  2XIG A;  5IYD G;  5BWT A;  2PUS A;  2EIJ C;  2IMW P;  3CPW U;  1N33 H;  4GKJ B;  3ZX6 A;  1VBH A;  2UXB O;  3ZCC A;  4C5A A;  1L2Z A;  4UVC A;  2PYJ A;  4H44 B;  3TJT A;  1VQP V;  4CMD A;  3HOX G;  4MV9 A;  2DWD C;  2VS0 A;  2XAG A;  2KQX A;  1YXB A;  4FE2 A;  1VKZ A;  4DV3 B;  4FM0 A;  1OBD A;  4WFH A;  5KFA A;  4FU0 A;  5BYA A;  5GTH Z;  2A0L A;  2QKS A;  4LFA O;  4B3M H;  3BQ1 A;  3KKY A;  5KT6 A;  2YIA A;  5CBH A;  4FFR A;  1Q7Y W;  4GC7 A;  5FNV A;  5KMG A;  1M90 W;  2JEX A;  1RPO A;  1AI6 A;  3RYH A;  4DV4 O;  4LNU B;  2A1H A;  4NZO A;  1ENV A;  1G1X B;  2CTP A;  1A0G A;  3KTM A;  3QZ8 A;  2W9B B;  2CH7 B;  5LP6 F;  4X1Y B;  5JH7 F;  4LF4 H;  2JJ2 G;  3E22 B;  2F93 B;  2ODT X;  2ETN A;  5KFD A;  2CE4 A;  3LNM B;  5A2Q W;  2IH1 C;  4U3F H;  2OIG A;  2QWN B;  1K9M W;  3N43 B;  4A3L G;  1FJG H;  2UUC B;  3FB6 C;  1WJZ A;  3LDD A;  1QCE A;  2W8L A;  4IGG A;  4TOI A;  3GID A;  4LCU C;  2CAZ C;  3GJX B;  2VUM G;  4E4T A;  4DRX A;  1CQI B;  3JAK A;  5B1A C;  4DUZ B;  2HGW A;  4QWC A;  1YHQ V;  4FM2 A;  1HR0 O;  2YZL A;  4FFP A;  5KFY A;  1GM7 A;  2W9B A;  4LNU A;  3EXA A;  2UXX A;  4B3R B;  4O7Y A;  2RGV A;  2XAQ A;  3GTG A;  1JA8 A;  1K97 A;  5IY5 B;  4RUE A;  4ICG A;  3FKI G;  4QIW E;  3BQ0 A;  4F50 A;  2ZM6 O;  2F4V B;  3D8C A;  3W7S A;  4FPP A;  1JJ2 U;  1KBH A;  4X1K A;  3T5H A;  4J9L A;  3K5O A;  1NH2 D;  3MJF A;  1IBL O;  2Q7D A;  3UYY A;  3STL C;  3DTU B;  2ODM A;  4ECT A;  3E83 A;  4DR7 B;  2ABJ A;  3HO8 A;  1WP7 A;  3CRM A;  2X7R B;  3TK1 A;  3M9O B;  2IJJ A;  4UCV A;  3UZB A;  3OHA A;  4JI6 H;  3SDL A;  3T4Z A;  4U3J A;  5E25 A;  5DGH A;  4JZG A;  4I5S A;  4O2B F;  4GC6 A;  3T1H B;  4DYL A;  4RZR A;  4FFB A;  3RTX A;  4PI0 A;  2HEP A;  2HP8 A;  4LH7 A;  1BS3 A;  5BWU A;  2OCH A;  3CD6 V;  3R5H A;  2KSD A;  4DLK A;  1Q82 W;  4B3M O;  4LFA H;  4PZ6 A;  3RF2 A;  4JTA B;  1EN4 A;  1JMK C;  4CH3 A;  1AI4 A;  5J2T B;  3G8C A;  1N36 O;  5KKN B;  3RB3 A;  4JI5 B;  1Y1V G;  2B63 G;  2B5U A;  2GSM B;  1KUT A;  4DUY B;  3OT7 A;  1XMO O;  1C30 A;  5KMG B;  1N32 B;  4ME6 A;  3HKE A;  4RB3 C;  1NTM H;  2R93 A;  4J11 A;  5B1B B;  2UXB H;  1KP2 A;  4LF9 H;  3RVY A;  2HHF A;  1VQ8 V;  5JWP A;  3CCQ V;  3T9D A;  4LFA B;  1IYD A;  2COG A;  2H3O A;  2R7M A;  4WBN A;  4F4Y A;  4BY7 G;  3QTC A;  2VUG A;  4DK1 A;  4LF8 H;  2ZE7 A;  2UXD O;  3E8B A;  5F9L A;  1JQ0 A;  4NXN B;  4DV6 H;  4HNA A;  4ECX A;  2ZD9 A;  2DMX A;  5BWX A;  1MAB G;  1XMQ H;  5DAA A;  4CS2 A;  4I55 F;  3JAW A;  1SQP H;  4K6N A;  1XNQ B;  3Q4H A;  4EEY A;  4TWK A;  2D3O W;  1M9N A;  1JFF A;  3APO A;  3F5T A;  5IP7 G;  1T36 A;  5C8Y A;  5DM6 V;  1A9X A;  3GV7 B;  5BPH A;  2YSU B;  3T54 A;  3HKC A;  3JAR B;  3ZBH A;  3VPC A;  2ZM6 H;  2EIM C;  4IL6 Z;  1E4E B;  1O9G A;  2XOK G;  3UQ8 A;  4ECQ A;  1FJG O;  4JYC A;  1YZB A;  4PI2 A;  1ZQ7 A;  4DR3 B;  1HP8 A;  1Y4M A;  3ZHV A;  1SS3 A;  3H1L H;  3RN4 A;  4KUM A;  1Y14 B;  1Q43 A;  4MVO A;  5BR8 H;  1RFY A;  2V4D A;  2J6U A;  1JCH A;  3UT5 B;  3ASO C;  2YIB D;  4J41 A;  5K1X A;  2VQE B;  1WNS A;  5HNE A;  2N05 A;  3CQZ A;  3TCU A;  4RU9 A;  3BRC A;  5CMU A;  2WAM A;  3QZ7 A;  3TXS A;  1E4E A;  2ATK C;  1KB9 F;  4QJF A;  4IHJ F;  1BQ0 A;  1I50 A;  2X6B A;  5L3B A;  5KG5 A;  2AGP A;  2ZR2 A;  2W7O A;  4IHJ A;  3AK3 A;  1Y76 A;  1Z5W A;  2UXN A;  2F43 G;  5LP6 A;  4AQY O;  3E35 A;  3PFF A;  3ZHS A;  4GCZ A;  1AP5 A;  2X5R A;  4U7O A;  4EKW A;  4YJ2 F;  3JAW B;  5KFQ A;  3JSL A;  3HOV G;  3BHP A;  2CTR A;  2Q73 A;  1NR7 A;  4X88 A;  4O2A A;  1HNX B;  1MZE A;  2ZE6 A;  2BSK B;  3PN1 A;  2BOC C;  4B3S H;  2R6F A;  4FS1 A;  1YIJ V;  2VUM A;  1NR1 A;  4UB6 Z;  5CA0 A;  4ED8 A;  4LF4 B;  2JDI G;  2R7L A;  1K3E A;  3OMN B;  4YAK B;  1F4N A;  3BAB A;  4AIL C;  1YJW V;  1XMO B;  4J9N A;  4ETS A;  4YQW A;  4DUY O;  2EIK C;  3AW8 A;  2XAH A;  4CH5 A;  2FJZ A;  3ZIA G;  5C5J A;  3ZHU A;  4X65 B;  5LP6 C;  1M0W A;  4HR7 A;  1E4G T;  3H0G G;  5KFS A;  3GIJ A;  1V51 A;  2COJ A;  1H8H G;  1XI1 A;  3H20 A;  5DGA A;  2EIJ B;  2E74 B;  4C5B A;  2OT5 A;  2R9I A;  2LQT A;  2CNU A;  3H0G A;  3JAR A;  2JA5 G;  4O7Z A;  4MTO A;  5IYZ B;  4CH6 A;  4J9P A;  1PNM A;  4DR6 O;  4JGS A;  2W9C A;  2XAS A;  3H9V A;  1I3Q A;  4TQR A;  2QR4 A;  5BR8 B;  4IIJ F;  4ZI7 A;  3ETE A;  1IXB A;  4A3I G;  2R9R B;  2CGO A;  4O4H B;  4F4Z A;  4DR7 O;  1KMI Z;  1ZWI C;  4X66 O;  3RBZ A;  1OCC B;  5C1P A;  4HNA B;  3STZ C;  1EUC B;  4JYA H;  1FFX A;  1B6S A;  4QWE A;  3HOZ G;  3UZO A;  3FYI B;  2FLL A;  3AK2 A;  4I9Q A;  2DAA A;  4WBN B;  4ZQI A;  2X6A A;  5LBQ A;  3HOY G;  3ASN B;  4KHP O;  3OTO O;  4DV5 H;  2R7N A;  4ED3 A;  3CCR V;  1B06 A;  5IYD O;  2CZG A;  1NTZ H;  5LA6 A;  2F95 B;  4K0K B;  2UUA H;  1I1M A;  1SET A;  2UVV A;  1IBK B;  2R82 A;  2PVP A;  5KT7 A;  4FK5 C;  2BQ3 A;  1FFT B;  4JI8 B;  5BMV F;  1I08 A;  1IBL H;  2LFR A;  3U0Z A;  4DL7 A;  1WB8 A;  2KG7 B;  2JA6 G;  1JJO A;  5LMN O;  3ZMT A;  5KT5 A;  3A8T A;  2CK3 G;  1VBG A;  1ZET A;  4FM1 A;  1XIL A;  4XBF A;  1GH6 A;  1P8L A;  4C2M A;  4MTF A;  3RGB A;  5LHG A;  5CE8 A;  2NN4 A;  2W6O A;  2JEF A;  4I9W A;  3BY6 A;  5KX5 F;  1EHI A;  3SJC C;  1XHZ A;  3MR6 A;  4RUA A;  3J80 W;  3TY8 A;  1HNZ H;  1N0J A;  1I2L A;  2JJ1 G;  3IAY A;  1JR9 A;  4U3J B;  1CXZ B;  4ECZ A;  4MV7 A;  1QU7 A;  1XRE A;  3CEB A;  1OCR B;  3OW2 U;  4NTX A;  5JJN B;  2Z0A A;  3WU2 Z;  3OUS A;  2PI4 A;  4YHH H;  4H13 B;  4ZHQ F;  2ZDH A;  1EBO A;  3E86 A;  1SER A;  1J5E H;  5KUK A;  4LC1 A;  1DK1 A;  2RQ6 A;  3VBB A;  1X59 A;  1QVF U;  5JJJ B;  2DWE C;  1HWY A;  3GTP A;  4A3K G;  2M6Y A;  4I4T F;  4ED1 A;  2YRX A;  5DLF A;  1HR0 H;  5LXT B;  3VPB A;  3T7A A;  2R93 G;  5FL7 G;  3DTG A;  2WDT A;  3KAJ A;  4J9K A;  4J9Y B;  4XX0 B;  1HNW O;  4XDL A;  3TEK A;  1FXK B;  3CCM V;  2VA3 A;  1AI5 A;  1COW G;  4F4W A;  4O3N A;  3M9N B;  4DRX B;  5KG2 A;  3VQW A;  1ZUQ A;  1T5E A;  3SJA C;  1XNR B;  4LFB B;  2BE3 A;  2QK4 A;  2W71 A;  5DEC A;  3AK1 A;  4FMT A;  3ZRW A;  1CQJ B;  5LGT A;  1XL4 A;  1S9F A;  5KHI A;  2OIE A;  1US6 A;  3Q8R B;  3E22 A;  4I7H A;  2R85 A;  5KFE A;  3AG7 A;  4NXM B;  1S0M A;  2JGU A;  3JD4 A;  3CMA V;  3LML A;  3UO2 A;  5CBG A;  5L3G A;  2WB1 A;  1Y74 A;  2ADP A;  4EGQ A;  4YJ2 A;  3AG1 B;  5H80 A;  1SZT A;  3FB8 C;  5A9G A;  3J7A U;  4BXX G;  3RYH B;  2QM7 A;  5F2V O;  5TIS Z;  4JI8 O;  4EG0 A;  4H33 A;  4ECS A;  2Z04 A;  4GX0 A;  4J7J A;  1I5Y A;  2HGX A;  4B3S O;  5B1N A;  1SQF A;  2YI8 A;  3LWB A;  3BVO A;  5JQG B;  1XBL A;  5I60 A;  5KG4 A;  3DGE A;  3C0F B;  3CS5 A;  3WFV A;  1KP3 A;  2GQS A;  5LA6 F;  2W9A A;  2QSA A;  4DR4 B;  2UUC O;  1AUV A;  1HNZ O;  2AU0 A;  1H2S B;  2QGN A;  1R6K A;  3ABK B;  4DL2 A;  2YEV B;  2VA2 A;  1EZJ A;  1R3K C;  5EC2 C;  2XUM A;  3SR2 C;  5LMU H;  3RWR D;  2R92 G;  2Q0O C;  2Q7H A;  4O4J F;  5FD5 A;  3ABL C;  3IC7 A;  3OMI B;  4JPR A;  2Q69 A;  3EFF K;  2HVK C;  2CNQ A;  4TT3 G;  3Q1K A;  2ZCE A;  4W4L A;  4ASU G;  3UFX B;  4Q8E A;  2LP7 A;  1GSO A;  5GTI Z;  2KSW A;  3FAV A;  1FXH A;  1P84 F;  2XND G;  1L0L H;  4XYL B;  5KFH A;  4CKC A;  3N2K B;  1KTA A;  3KXY T;  5EBW C;  1WA8 A;  3TIG A;  1P49 A;  2UVU A;  3H4D A;  3QFF A;  1PP9 H;  1MNG A;  1MA1 A;  3ABU A;  2PZS A;  2UUA O;  2JGD A;  1W96 A;  3F5W C;  4ECW A;  4ECU A;  1JXL A;  2ASJ A;  4I55 A;  4I50 F;  5CBF A;  1I2K A;  2BQU A;  1E79 G;  5IP9 G;  2ZT9 B;  3L2P A;  4ZBM A;  3K58 A;  2Q8V A;  4MW3 A;  4JI6 O;  1BE3 H;  1Z5V A;  4UCS A;  1JIH A;  2F66 C;  5FR9 A;  4NXN H;  4TUY B;  4IR9 A;  1N34 H;  1CKM A;  4MT8 A;  3OTF A;  5LMU O;  4EYI B;  3FD9 A;  1Q6H A;  2C22 A;  1GKF A;  1SQX H;  3WB2 A;  3JAT A;  1B33 N;  3V6H A;  4WFG A;  1QLE B;  2P5O A;  1N33 B;  3BQ2 A;  3OUZ A;  3K59 A;  4J80 A;  4UCO A;  3QO5 A;  2GTA A;  2FK2 A;  4NR1 A;  4PDL A;  3DC6 A;  3SI8 A;  3PR4 A;  3K06 A;  1ROP A;  3OUU A;  2RDJ A;  3T5K A;  2DN9 A;  4RAZ A;  2YI9 A;  1N32 H;  3JCU Z;  1F4M A;  5LOV F;  3K9S A;  1ZSP A;  5B1O A;  4LFC O;  4WD3 A;  3KHL A;  4QPK A;  4JI8 H;  3CJH B;  2Q67 A;  3MR5 A;  5JQG A;  1H2M A;  4B3M B;  2QWQ B;  2XGQ A;  4TQD A;  3UO3 A;  2BTQ A;  4DV6 B;  2UUB H;  3FB7 C;  4G27 B;  1GN4 A;  1VQ4 V;  1H2G A;  2AGA A;  5LYJ F;  1XHX A;  2M7W A;  4YJ2 B;  1IX9 A;  3GVM A;  2Q7G A;  1AJP A;  4FBT A;  4JI2 B;  1NU1 H;  2MCT A;  1ET0 A;  4LSX A;  4Q45 A;  4YIP A;  2QYZ A;  4Q4D A;  1XDN A;  2UU9 B;  1UPG A;  3SPG A;  2FK1 A;  3MFI A;  3N44 B;  3U0G A;  3ZRV A;  5BMV A;  4AQY B;  2ZM6 B;  4O4I A;  2E2I A;  3HKB B;  2F4V O;  4J9S A;  5LGU A;  4LF5 O;  3V4S A;  1KUQ A;  4O81 A;  4YB8 B;  3VQY A;  5J2U B;  5GW7 A;  3MWD A;  1YF2 A;  2HHH B;  4I0X A;  1TWC A;  3OR6 C;  4O82 A;  5T14 A;  2DQ0 A;  2FLN A;  3H1J H;  2HJD A;  4R8C A;  4CS3 A;  4PDB A;  2R7K A;  4NVP A;  3GTL A;  5K2M A;  4O84 A;  1UC8 A;  2O03 A;  3MWM A;  4X1I A;  2NUA B;  3U54 A;  1FPO A;  3T9C A;  4O2A F;  4YR3 A;  3IJ4 A;  3K5H A;  4DO2 A;  3Q8P B;  5LL6 Y;  1N8R W;  4DW0 A;  5FD6 A;  5BWR A;  4O2B B;  1K5S A;  4Q44 A;  5BWV A;  4B7K A;  5CA1 F;  3ZHR A;  4EEQ A;  4A3F G;  3IGA C;  2ZDI A;  2PGG A;  4O7L A;  4JV5 O;  4TV9 F;  2V4Q A;  5D1O A;  3LSS A;  4O4H F;  3WNZ A;  4DV0 B;  4ED7 A;  4WF9 V;  5I47 A;  3PW0 A;  4FVM A;  1BT8 A;  2UUB O;  4LH6 A;  2ZXW C;  3K9A A;  3FX7 A;  3VOU A;  1S5L Z;  2QWR B;  2YS8 A;  4FLT A;  4BWS C;  2ZIN A;  1ULZ A;  5J2T F;  1N33 O;  3GTQ A;  1XUQ A;  2Q68 A;  2WPD G;  3I56 V;  5KFL A;  3HB9 A;  4DV2 O;  3BFR A;  4BW5 A;  5LL6 b;  2RDC A;  3EPI A;  1Q6U A;  2CUG A;  3CVZ A;  5KFR A;  4J7Z A;  2ITC C;  1Q8I A;  1UFI A;  1GAX A;  2DQ3 A;  5C3E G;  3K3P A;  1CP9 A;  2O57 A;  2W6J G;  3N2G B;  2AW9 A;  5CB4 A;  4O7V A;  1V55 B;  1R6T A;  4KHP H;  1K1Q A;  4JI2 H;  2UXB B;  4GKJ O;  3RYF B;  4BIU A;  4FS2 A;  4RCN A;  3LSQ A;  2WYO A;  3M9M B;  3NC0 B;  4A3D G;  1N34 O;  4Z1M G;  2WLI A;  4DR6 B;  1GLV A;  2HG5 C;  1P16 A;  4CMF A;  5EZY A;  1IYE A;  3FKS G;  1N36 B;  3THO A;  2W6Q A;  2YXY A;  3E2E A;  2Y69 B;  1WR2 A;  2XD4 A;  3FB5 C;  4YY3 H;  3T99 A;  4YBZ B;  2EIY A;  4XDK A;  3OUF A;  1HNZ B;  4I0X B;  2YS6 A;  5CAE B;  3HT5 A;  2QM4 A;  3JD0 A;  4FFL A;  3ETQ A;  1PM9 A;  2W9C B;  2W6Z A;  3T1Y O;  5EYP B;  2W6I G;  4RUF A;  5HFM A;  1I94 H;  4JAV A;  3RYI B;  2FKX A;  1XK5 A;  2JEJ A;  1RPR A;  5LMN H;  3JAT B;  2VQF B;  4TV8 F;  4LF6 O;  3HKD B;  4A3C G;  2JEI A;  1ZHS A;  5JVD B;  1VQ9 V;  1IXM A;  3K03 A;  1I1L A;  2V59 A;  1TVK B;  4O7N A;  4MTG A;  3GWK C;  2MW2 B;  3W1G A;  1IBM H;  4OX9 H;  3G71 V;  5DQI A;  4R7C A;  1H2N A;  3T2M A;  5CN0 A;  2A06 H;  5L3E A;  4MTE A;  4YR0 A;  2Y4T A;  2DZD A;  1ARO P;  2GHY A;  1RK5 A;  5KFG A;  3ABT A;  4G3I A;  3KHR A;  2DLN A;  4Q43 A;  3K0D A;  4AQY H;  4FBU A;  1D2D A;  1ZX3 A;  2Q2T A;  4X20 A;  1I1K A;  1I7L A;  1S10 A;  2HG8 A;  3ML0 A;  4JV5 B;  1E4F T;  5DQG A;  1WA8 B;  3ASO B;  3V4Z A;  4PDV A;  1G2W A;  2B1I A;  4O4L F;  2AGO A;  4BWA A;  2B1G A;  2A79 B;  5FJ8 G;  3CC7 V;  4N21 A;  4PD4 F;  4OX9 B;  2Y0S A;  5I5S A;  1K83 A;  5D8D A;  4YAJ B;  2C2A A;  1FKA H;  3CC2 V;  1OZ0 A;  1Y1W A;  3C3T A;  3GQC A;  3K79 A;  3U9S A;  3VQV A;  1OWT A;  4DV7 H;  3ZN1 A;  1P7G A;  5EBM C;  5BPF A;  4YY3 B;  3RV4 A;  5IYB G;  2YCH A;  2AXT Z;  2QWP B;  1N34 B;  5E79 Z;  4HNV A;  4X20 B;  1K73 W;  1OCZ C;  2OCC B;  2Y48 A;  4IRC A;  1PV0 A;  4JI6 B;  4DK0 A;  4YHH O;  4R6Z A;  5DN6 G;  1PNK A;  2FPI B;  1RJR A;  2ZNI A;  1L0N H;  2W8K A;  2VWK A;  1NH2 B;  1DAA A;  5KFU A;  1K34 A;  1D5N A;  2DAB A;  5B3S B;  1MZB A;  3RBE A;  3G80 A;  1GK9 A;  1Y74 B;  3VOT A;  1S5J A;  5IE9 A;  3OSP A;  3DC5 A;  3K0G A;  5IJ0 A;  1J5E O;  3OE7 G;  1MSW D;  3CHX A;  4ED6 A;  3AG2 C;  5JVD A;  3B8M A;  1GN6 A;  3D36 C;  3J80 N;  3FMA A;  3H1H H;  1ZTE A;  4YXW G;  2EJ3 A;  3RB4 A;  1NBM G;  2IJK A;  1VQ5 V;  1L8D A;  4LR3 A;  5CM0 A;  4JAA A;  1K92 A;  1RJQ A;  2CTW A;  2K1E A;  1OCR C;  2Q4P A;  4PDR A;  5K1P A;  4E2L A;  1S03 G;  1RSO B;  4KXR A;  3CC4 V;  4JI0 B;  1UNN C;  2C2E A;  4F4L A;  1DLB A;  3B09 A;  1E1Q G;  4BAY A;  2J9G A;  4CKE A;  4LF6 B;  2YL2 A;  1EZV H;  3ZHQ A;  2YZG A;  4MV4 A;  5HV6 A;  4DV4 H;  3W5O A;  3CE2 A;  2FPP B;  2WLM A;  2LW7 A;  3NBY B;  3CB2 A;  4LP8 A;  3K5N A;  2V9W A;  2L6L A;  2P4V A;  3NXS A;  1WPX A;  3G67 A;  5LMU B;  1W0K G;  1W2B U;  2BOB C;  3M8A A;  2NNU A;  5LHI A;  1KC8 W;  4QWB A;  2ADQ B;  2EIL C;  2YIC A;  4GX5 A;  4M7E A;  5KFT A;  3RR5 A;  5KG7 A;  5DG9 A;  3RFC A;  3QVN A;  4K8Z A;  4LF8 B;  3GB8 B;  4DV7 O;  4FJC C;  1K8A W;  3FFQ A;  2HGS A;  2GTS A;  2HVJ C;  2ZE8 A;  1G4Y B;  3UM7 A;  3QO8 A;  2YW2 A;  3KHG A;  3CXC U;  5D5P A;  5B5E Z;  2L35 A;  2AHY A;  2UUC H;  1XNQ H;  1M57 C;  3JAS B;  1VF6 A;  3K3W A;  1AJN A;  2JA5 A;  2VRZ A;  2UXC B;  4CE5 A;  2FML A;  3E8F A;  2FLP A;  4DV0 H;  1XMQ O;  1FYJ A;  2EJ2 A;  4DL6 A;  2NU8 B;  5BZB A;  1JPX A;  1R3J C;  4J0M A;  1HNX H;  4A3G G;  4K0K O;  5EWF A;  4DL4 A;  1R3L C;  4FFK A;  4JV2 A;  1SZX A;  4YJ3 B;  1A48 A;  1HNW B;  2JEG A;  2X6C A;  4UV9 A;  4B3R H;  3SYA A;  3T9A A;  3PVX A;  4ZHQ A;  3E8G A;  3GV8 B;  3WB1 A;  2Z3Y A;  3R5F A;  3TQT A;  4J42 A;  3L9D A;  2R8I A;  1VMG A;  4U7N A;  1FD9 A;  5LMN B;  2UXC H;  4FM9 A;  4O2B A;  2EIL B;  1LUV A;  4K35 A;  2R8G A;  4B3R O;  1RM1 C;  2J6S A;  5JJE B;  3SYC A;  4O86 A;  1HDJ A;  2E5L O;  5IWA O;  1FFX B;  3OGC C;  1Z2N X;  3JAK B;  2Q5Z A;  2XCP A;  5DIS C;  1M56 C;  4PHZ A;  1CKN A;  1NQT A;  1XMQ B;  1EZ1 A;  4RAI A;  1BQZ A;  1SQQ H;  1CEZ A;  3C90 A;  4DV0 O;  3EYY A;  5KFK A;  3K5M A;  2P7T C;  4ECR A;  3W1B A;  4DQN A;  5CA1 B;  3OGI B;  5L3F A;  3N40 P;  5J2U A;  4NXM H;  3QQM A;  3T1H H;  5KHJ A;  3U10 A;  4EFE A;  4DR3 H;  2XAJ A;  2HIX A;  3TY9 A;  2UVW A;  2CH7 A;  4TV8 A;  2Y69 C;  1Y66 A;  2K9P A;  2EIN C;  2GUZ B;  1GM8 A;  1DF4 A;  1QNM A;  1L1F A;  4JV0 A;  4OPH A;  4IT5 A;  1S76 D;  5LA6 B;  3TW6 A;  2ARH A;  2WAQ E;  1NS1 A;  3ABM C;  5FNV B;  3DF7 A;  3GTO A;  3CCS V;  2UUA B;  1JDB B;  2JEU A;  4E4E A;  3I4M G;  4JI1 H;  5KS8 A;  1B6Q A;  4JI7 B;  4Q20 A;  2R8J A;  4MVU A;  1KYO F;  3QO7 A;  5GON B;  3OTO B;  1RJP A;  4NYE A;  4CS4 A;  4HYK A;  4TVI A;  1S0O A;  3P3N A;  3AG4 C;  3SPJ A;  5JCO A;  1JVM A;  4L1K A;  1Z2P X;  1SRY A;  1SA0 A;  5KFJ A;  4I50 A;  2YRW A;  4TV9 A;  5KAF Z;  2P4K A;  4TSF G;  3PO2 G;  2XAF A;  3BEH A;  4ZI7 B;  2HR3 A;  3GTJ A;  4UFZ A;  4AHC A;  1Y76 B;  4WBN F;  2ZJT A;  1NT2 B;  1IDS A;  2WLN A;  4F4X A;  2VPS A;  1M1K W;  5DG7 A;  2ASD A;  2NU6 B;  4A93 G;  1G6U A;  2DOS A;  4O3O A;  2EIM B;  4NTY A;  3RJ0 A;  3R65 A;  3E5N A;  1N32 O;  5BWW A;  4J9M A;  2ZKO A;  4TUY A;  3MHS C;  2DYS C;  3K5I A;  1PL4 A;  3K04 A;  1MOF A;  3MD0 A;  2NU7 B;  4X65 O;  1Y67 A;  1H8E G;  3CYO A;  4JI5 H;  1SEI A;  5L1J A;  1OV9 A;  4FZ1 A;  1Q6I A;  3ORQ A;  1H2L A;  4DL5 A;  2PF4 E;  3U9T A;  2ITD C;  4EYH B;  5C8Y F;  1VP7 A;  4GZR B;  3BA9 A;  1P7B A;  2IW5 A;  5IT9 N;  4HN2 A;  1TGO A;  4LWS A;  2Q9L A;  4I55 B;  3DXR B;  2BSK A;  5LOV B;  3G6B A;  3OMA B;  4RB0 A;  4R50 A;  5KX5 B;  4P2Z A;  4O7T A;  1SQV H;  4FZ0 A;  3KRE A;  4DV5 O;  1GYF A;  3GWO A;  3T4D A;  1B04 A;  5IYB O;  4Q4C A;  2ZDG A;  4XZ3 B;  2HVS A;  4X62 O;  4JYB A;  4NTW A;  1AR1 B;  2FYU H;  4NYK A;  1T3N A;  3N2K A;  3GIP A;  3HOW G;  2R8H A;  1WCM G;  1QHT A;  1JFF B;  5H2F Z;  2IBK A;  2JA7 G;  4O83 A;  3W7W A;  3RGX A;  3RBD A;  3IN5 A;  2JA6 A;  4DV2 H;  3ZJZ A;  2JA8 G;  1OJH A;  5LXT F;  4X89 A;  4X62 B;  2UU9 H;  5LOV A;  3EHB B;  3DXR A;  3FYE B;  4OPA A;  1KKD A;  3GIL A;  5E1A C;  2XGP A;  2VQE H;  4UXN A;  3ZN0 A;  1OCO C;  4PZ7 A;  5KFN A;  4FGR A;  1A3G A;  2WA3 A;  3P3P A;  4DR1 O;  4B3T O;  1Z2O X;  4PEL A;  2BR0 A;  2Y4R A;  2UUB B;  1P4R A;  1R9T A;  1YDX A;  2EX3 A;  3APQ A;  1XDC A;  3IFX A;  1SCU B;  4UV8 A;  3MFH A;  4GYC B;  5FPR A;  4MV3 A;  3KYH C;  2F1M A;  3RYC B;  1EN5 A;  4WFF A;  5KFM A;  4MVZ A;  5F9N A;  4TM5 A;  3JAL B;  1AVM A;  2H94 A;  3UCS C;  4NLG A;  4DR1 H;  4R7R A;  4B3T H;  1XNR H;  3I4N G;  1I7N A;  1YCI A;  4PV1 B;  5EZY F;  4LF6 H;  3JZ6 A;  1GO3 E;  5BXZ A;  4I4T A;  1NJI W;  3ETH A;  1QLE C;  1SC5 B;  3CRR A;  4FFB B;  3FDS A;  1KJJ A;  2I8C A;  3F8N A;  5KFO A;  1KJ8 A;  4TV9 B;  3A0R A;  1CKN B;  4ZOL F;  1O75 A;  4GX1 A;  2QTO A;  2GPS A;  4ED0 A;  4APM A;  5C93 A;  3QG5 A;  2C28 A;  4FLZ A;  3R5X A;  1VS0 A;  4X9Q A;  4QE9 A;  4C7U A;  5C1O A;  2UU9 O;  3OSN A;  3GIM A;  4IZO A;  2PN1 A;  4X1K B;  5IWA H;  2YIB A;  4O4I F;  1K7D A;  4HNT A;  4Q8F A;  3WB0 A;  4G28 B;  4IWY A;  2CKZ B;  2VPQ A;  4ZIB A;  2QJ1 A;  3L75 H;  4EB6 A;  4O4J B;  4YJ3 A;  2XTA A;  4YIO A;  1AB3 A;  2PMZ A;  3LDC A;  2QDO A;  5L3D A;  5BY1 A;  1RK6 A;  1QR8 A;  4PWQ A;  1IBK H;  3RV3 A;  1FXK C;  3SPH A;  3WWJ A;  5K3W A;  4A3B G;  2HVR A;  2A7W A;  2KKW A;  3GDE A;  4GLX A;  3WWH A;  1BMF G;  3G6E V;  1U97 A;  1GN2 A;  1M0T A;  5CR5 A;  1ZL8 B;  2Q2U A;  3NGD A;  4MVM A;  2YU9 A;  2LGQ A;  2R86 A;  4MAM A;  2P6J A;  1EKP A;  5IY5 C;  4WFB V;  3BAC A;  5EOY A;  2DYR C;  4C5C A;  2R87 A;  4A5U B;  4DR2 O;  3NR7 A;  4X1Y A;  5FLM G;  3P30 A;  4ZKI A;  4QWA A;  1PX2 A;  4FFN A;  5CB4 F;  3RB0 A;  3TGU H;  4RWU A;  4FFO A;  3L70 H;  3A2F A;  2ZIO A;  4F6E A;  1V55 C;  2XCL A;  2WA4 A;  4O4J A;  3U55 A;  4EBE A;  2PYL A;  5L9X A;  3IC9 A;  4W4K A;  1TWH A;  1WSC A;  4RUC A;  4GX2 A;  3MAQ A;  2OWO A;  4DAA A;  1GMG A;  3KZI Z;  3C3S A;  2VWJ A;  1N4C A;  2CDY A;  1JOY A;  4LF9 O;  1NZ6 A;  2B63 A;  2FL4 A;  2WAQ A;  1AI7 A;  3OR7 C;  2R70 A;  3R66 A;  4JI1 O;  5KLV H;  2YZM A;  2W0F C;  1F51 A;  4UVA A;  1H2K A;  3CRA A;  4HAM A;  5DQH A;  1XL6 A;  4DV4 B;  2ZXW B;  1DTO A;  3ORR A;  1BHB A;  5JQW A;  1AR5 A;  2N74 A;  2V7Q G;  5H9C A;  1JX4 A;  3VQX A;  4BW9 A;  4FLU A;  5KFW A;  5A2Q N;  1CPY A;  1UC9 A;  5J9P C;  3CCE V;  5IYZ A;  4GKJ H;  2AHZ A;  2RNB A;  3ABL B;  4J7K A;  3SNO A;  5I5V A;  1IBM B;  2IU3 A;  1VQN V;  3S3X A;  3V6J A;  2X0L A;  2ALZ A;  4X66 B;  3E89 A;  4DXW A;  3V6K A;  2H8P C;  3MHH C;  1KEE A;  4UB8 Z;  4O3Q A;  4J9R A;  3SGI A;  4AYB E;  1HW7 A;  1U96 A;  4MVS A;  5KUM A;  4MA0 A;  4DV5 B;  4LF7 B;  1Q5O A;  4XYM B;  1GSA A;  1IOW A;  1W59 A;  5DGB A;  3ZHT A;  3I55 V;  4MVQ A;  1SQB H;  3ZED A;  3AEI A;  3R9R A;  2UVR A;  3F7Y C;  4QIW F;  5EC1 C;  5CA0 B;  1YJ9 V;  2OYQ A;  3PZP A;  2PBZ A;  5EDW A;  4PZ8 A;  2RDI A;  4UUJ C;  1MMM A;  1RSO A;  3CRC A;  3EVK A;  3JAM N;  1UJW B;  2DPJ A;  2HDK A;  1PKX A;  5KT3 A;  3M4I A;  2P22 C;  3ETD A;  1YEW A;  1AN7 A;  1SFO A;  2YXH A;  4HBN A;  2XC9 A;  4UVB A;  1N48 A;  4MTD A;  2DPI A;  2W6P A;  5GON F;  5LP6 B;  2ZNJ A;  4IHJ B;  2VR1 A;  3OAA G;  5C4X G;  2HJW A;  1JX9 A;  4DV1 O;  1OCZ B;  5DED A;  3JAL A;  4EGJ A;  3PW4 A;  1RM1 B;  2R84 A;  3RVZ A;  2YS7 A;  1EKV A;  3X2Q B;  3RYC A;  3UKM A;  4IRD A;  2NLJ C;  2Q0A A;  3LUL A;  3T9E A;  1AP6 A;  4MS2 A;  3HKZ A;  1X4T A;  4M0J A;  4DL3 A;  3AX6 A;  3Q2O A;  3PW7 A;  1VQ6 V;  2R72 A;  5I5T A;  3L71 H;  2E5L H;  3L74 H;  5L3C A;  3H01 A;  4UUG A;  5FLX N;  3LP8 A;  2GPW A;  4R8U B;  2R8K A;  3HXL A;  5KFP A;  2A3Q A;  3SYO A;  3M99 B;  3J7A K;  1FS0 G;  1KEC A;  1JLL B;  1K4D C;  4H37 A;  4KL1 A;  3T5J A;  4MTX A;  4BY1 G;  3DSQ A;  4RO2 A;  1NKD A;  4O7S A;  3GV5 B;  3JD1 A;  5EYP A;  3CXH F;  3AG1 C;  3KAK A;  2ASL A;  4QWD A;  3ETG A;  3OD4 A;  3M7M X;  4LFB H;  5C8Y B;  4P9O A;  3L73 H;  4DV3 O;  1DV2 A;  4LBE C;  2FE3 A;  1Q90 D;  3NBZ B;  2HIV A;  1IBM O;  4RNO A;  4DR5 H;  4CKB A;  5H6R A;  4ZOL A;  5KA5 A;  2EBO A;  2WLJ A;  4CH4 A;  4M9U A;  4I50 B;  1SA0 B;  1YSC A;  2GDS A;  3ZMZ A;  1KKC A;  4IIJ B;  2EJ7 A;  4JI0 H;  2EIK B;  5D5Q A;  4LFC H;  4OGQ B;  4PA7 A;  5KFV A;  3TQ1 A;  1LNQ A;  1Q81 W;  3LUT B;  3U11 A;  4LWS B;  3CP1 A;  3W7T A;  4DR5 O;  5GON A;  3SYQ A;  4YY3 O;  3ZMV A;  4B3S B;  4DUY H;  3RW0 A;  2MK3 A;  3H1K H;  2OCC C;  4JYA B;  1S68 A;  2Y0S E;  3H4B A;  2FTK A;  2UXD H;  3O9O A;  1EM1 A;  2IA6 A;  4F6R A;  3GII A;  4LMY A;  1S0V A;  3N27 A;  3HKE B;  3JD3 A;  2AZ0 A;  4PDM A;  2QKA A;  4JF3 A;  1BL8 A;  1YTF D;  1R6N A;  3HKD A;  2PI5 A;  2GUZ A;  2HLD G;  4TV8 B;  1NVP D;  3ZRS A;  3RYI A;  4UCR A;  5LGN A;  3JYC A;  4QSH A;  3LDE A;  3JZI A;  3ABK C;  3Q8S B;  3AG2 B;  3CCV V;  3CME V;  2YID A;  2PMZ E;  5LYJ A;  5AG2 A;  1IBK O;  2AGQ A;  4JXU A;  1PNL A;  4Z2W A;  2HHH O;  2NVY A;  3FKI A;  4A3M G;  5KFI A;  4QNH B;  1I94 B;  1H38 A;  1JDE A;  4HQ6 A;  1VAR A;  1TUB A;  5DMX A;  4JAU A;  3ABM B;  3JZF A;  5B66 Z;  3L72 H;  1I7F A;  3OFN G;  2GBO A;  4WFE A;  1DIK A;  1NTK H;  4JI5 O;  4EBC A;  4FLY A;  4NXM O;  4N23 A;  4DV1 H;  4MV1 A;  5KT4 A;  1HNW H;  2LO1 A;  4L8J A;  5EZY B;  2RN9 A;  3ZMU A;  3LQS A;  2XCA A;  4TQF A;  4MW8 A;  2R9A A;  5ITZ B;  3B40 A;  3OEE G;  2VOB A;  5DLG A;  3ZMS A;  4ZHQ B;  1I5X A;  2KB1 A;  2OTJ V;  1DF5 A;  1XNR O;  4JI7 O;  4JV5 H;  2EZO A;  1TAE A;  2YC0 A;  1YIT V;  3A0B Z;  3SJB C;  2UXC O;  3HR0 A;  5L1L A;  3N2G A;  3B77 A;  5IYC O;  1IOV A;  2G38 A;  1BNC A;  2I80 A;  2J6T A;  3GTK A;  2RCV A;  2BQR A;  2V4R A;  3B2E E;  4BBS G;  1VQ7 V;  1N0N A;  3KCX A;  3P32 A;  1IBL B;  3JAS A;  1EN6 A;  3TXQ A;  1ZLZ A;  5JCO C;  2ZR3 A;  3DTF A;  3K3V A;  4JI7 H;  5CA1 A;  4WCE V;  4DV7 B;  3G4S V;  4PA3 A;  2JIZ G;  1RYR A;  2GV9 A;  5KG0 A;  3ASN C;  1Q86 W;  1JKJ B;  2R7Z A;  1VIB A;  1S77 D;  1KT8 A;  1TWF A;  4UCU A;  1PK8 A;  1TA8 A;  2COI A;  5JH7 B;  2CW8 A;  3HBL A;  1QR9 A;  1FKA O;  1SF9 A;  4IWX A;  5HFL A;  4LF7 O;  4YP3 A;  3H1I H;  5KG3 A;  4I7Z B;  1WLE A;  1CS0 A;  5D1O B;  1G8M A;  3B8N A;  4PA9 A;  2PY5 A;  2E5L B;  3SPI A;  2CNV A;  3H3V H;  1R1B A;  2PTM A;  4L87 A;  2VQE O;  1WP8 A;  1HNX O;  3D3Q A;  4ZI7 F;  5DGI A;  2XHB A;  3WG7 B;  1C3O A;  1M4U A;  1BGW A;  1SKV A;  4QPJ A;  3GIQ A;  1EFR G;  3OTO H;  2AQ4 A;  3NUA A;  2YWV A;  5JUM A;  2CQY A;  1WPB A;  3CJH A;  4IYI A;  2Y0P A;  1S5H C;  1ZAU A;  3OM3 B;  4RAY A;  4PJ0 Z;  3BPZ A;  1A0I A;  2FK3 A;  5KHH A;  1IZ3 A;  4AYB A;  2P06 A;  4JI4 B;  4O3S A;  4X66 H;  2HHH H;  2ZIM A;  3GIK A;  1I0H A;  2E2H A;  1S0N A;  3J81 W;  4D7T A;  4ECV A;  3CSX A;  4X8A A;  3RUP A;  1KU9 A;  4DR2 B;  3BAA A;  1T94 A;  2FB5 A;  2ILM A;  1SQG A;  4X65 H;  1BZK A;  2LGW A;  4NZN A;  2W6M A;  1MSD A;  4J9O A;  4WHX A;  4KHP B;  4MVR A;  1GO3 F;  2QF7 A;  1VQL V;  5IJ0 B;  2VQD A;  1XOU A;  2NU9 B;  3SJQ C;  1S97 A;  1VQK V;  4F6R B;  2CTQ A;  3JCZ A;  4LF8 O;  3WWI A;  2R92 A;  1M5I A;  3T9F A;  5KT2 A;  2JK5 C;  4JTC B;  1Y1W G;  3KAL A;  1AIL A;  1FXV A;  1XQ8 A;  5EBL C;  3WG7 C;  2QTS A;  2OLS A;  1YI2 V;  3CSW A;  1DV1 A;  1THZ A;  4DR5 B;  2M05 A;  5KA6 A;  4DV6 O;  3L4K A;  5FPO A;  5IJ9 A;  5KG1 A;  2JGD B;  2JVD A;  1V54 B;  2EUL A;  3VPD A;  4QE7 A;  3RAX A;  4JI4 O;  4PA4 A;  1K1S A;  2BTO A;  1M93 A;  4K3A A;  3HKZ E;  3X2Q C;  2RJZ A;  4LFC B;  1W93 A;  5D1P A;  4RQF A;  2DIK A;  4FFM A;  4TUY F;  4JI3 O;  1AUX A;  2WLH A;  1Y1V A;  4YJ3 F;  1M7J A;  3JRX A;  2LJ2 A;  4X62 H;  4DR4 O;  2JS3 A;  4JI2 O;  5JVD F;  1WCM A;  3BA8 A;  4JYY A;  2FKL A;  3CCU V;  1N56 A;  2W6N A;  4YR2 A;  1IUR A;  5CA0 F;  5L1K A;  4LF4 O;  1WH2 A;  1QVG U;  2YUA A;  4FLV A;  5KFF A;  3T1C A;  3ICX A;  1M56 B;  3MWE A;  4DIM A;  2C35 B;  4R8U A;  1GN3 A;  1VAJ A;  1OBG A;  3T9B A;  3S3W A;  4LF5 H;  3EPG A;  2IH3 C;  2HKO A;  4IR1 A;  4O4L A;  2AZ2 A;  2IBZ H;  2SCU B;  2HJF C;  1GM9 A;  3B4S A;  3I12 A;  4LF7 H;  4ABM A;  3K08 A;  4Y8V B;  4PA6 A;  5H6Q A;  2JRI A;  2Q6A A;  1R73 A;  3T5L A;  5KG6 A;  2Y4U A;  3F7V C;  4EFB A;  5EK0 A;  2W7P A;  1V54 C;  4O4L B;  2A9H A;  4U6P A;  5I5W A;  1TVK A;  3QF7 A;  4YHH B;  2LW1 A;  4KFM A;  1OCC C;  4J10 A;  4CC6 A;  4NB5 A;  3T1H O;  2WWW A;  1E1R G;  1F7Y A;  3FAV B;  3VMM A;  4DRF A;  3CCJ V;  4GKK B;  3T1Y B;  1GSH A;  4K8X A;  1BJT A;  2CFM A;  1HR0 B;  4B08 A;  3PR5 B;  4B7E A;  4BR6 A;  4HZ3 A;  3I5D A;  5KFC A;  2ZE5 A;  1KC7 A;  5FNV F;  2LFS A;  2QM8 A;  5I5Y A;  4GUN A;  4MV6 A;  2IJI A;  1KJ9 A;  2YDE A;  5JVL A;  1KQS U;  2WLL A;  1O9H A;  1FJG B;  1NI8 A;  5J2U F;  1BCC H;  4E6N A;  1Q3E A;  1BGY H;  2RMK B;  2FPG B;  2V1D A;  3T1Y H;  5HBR B;  2IM9 A;  2YXL A;  5LXT A;  4AI8 A;  3Q8Q B;  1KJI A;  1QLN A;  1OHH G;  4CBC A;  3MDS A;  2WLI B;  3G6Y A;  2OH2 A;  1OCO B;  2DJV A;  1QQC A;  4O7R A;  1R3I C;  3VA7 A;  5EWE A;  1BSM A;  4U7C A;  3MR3 A;  5H5N A;  1XMO H;  3CWB H;  1EUD B;  4X64 H;  5JH7 A;  3TET A;  3AG3 C;  2F4V H;  2W70 A;  5CA3 A;  1URF A;  3G8D A;  4QW8 A;  3BG5 A;  2OTL V;  2ZQM A;  5CB4 B;  2RGR A;  3BJY A;  3ZRW B;  2CGN A;  1KD1 W;  2E75 B;  4BIZ A;  1CKO A;  3WO1 A;  4GLW A;  1FAF A;  1ZHQ A;  5JQG F;  4DR7 H;  1W0J G;  5BYB A;  4NZM A;  3J81 N;  3GTM A;  2EJR A;  1TWA A;  1M57 B;  1EKF A;  4QW9 A;  1SES A;  2HFE C;  2E76 B;  2ZDI C;  5IDJ A;  1FXK A;  4JI1 B;  4EQ5 A;  4DR4 H;  3CEI A;  2IP4 A;  1YTF B;  4JI3 H;  4DR6 H;  1K5Q A;  4TQS A;  3RFR A;  5IYZ F;  2DWC A;  2VQF H;  3N6X A;  5B1A B;  4GKK H;  2QKC A;  2FP4 B;  2C00 A;  3G6V A;  1VF6 C;  3AG3 B;  4DR2 H;  1MG1 A;  4QGP A;  4RQE A;  1SYX B;  4CHI A;  1V4Y A;  2DE0 X;  2D2C B;  3W7U A;  2VQF O;  4K0K H;  3HB3 B;  1VQO V;  3JAM W;  1EYZ A;  3RYF A;  3BCC H;  4DV3 H;  2QWO B;  2GQR A;  4X1I B;  3HPL C;  4CZZ A;  1I94 O;  4LFB O;  2WB1 E;  5KFB A;  4MSW C;  1BXR A;  3IG0 A;  1F23 A;  2EZP A;  4O4H A;  4DUZ O;  1N36 H;  1ZL8 A;  2V5A A;  4LF5 B;  1D5A A;  4A2A A;  2P0A A;  4A2B A;  4P9P A;  1KJQ A;  3GB7 C;  3KHH A;  4QIW A;  2ZGI A;  5DG8 A;  2KG7 A;  3LNN A;  5KHG A;  4RB2 C;  1AR4 A;  3JD2 A;  4NKG B;  2QA4 V;  1GRJ A;  4LSA A;  2EJ0 A;  5IT9 W;  1S72 V;  3E8H A;  4A3E G;  2Y0I A;  2YZN A;  5BMV B;  5IYC G;  2NR5 A;  3CX5 F;  3K5L A;  4G2K A;  5EWG A;  4EB6 B;  5FLX W;  3JSN A;  4JYA O;  3PJS K;  4JAS A;  2P90 A;  3SYP A;  3TW7 A;  1YJN V;  1QBZ A;  3W7X A;  4FIP C;  2QB5 A;  5ITZ A;  4MA5 A;  5B3S C;  4O7W A;  1FVI A;  3OHB A;  4X64 O;  1LR1 A;  2BTQ B;  3RAQ A;  4DW1 A;  2DYR B;  1J5E B;  4PBC A;  3A0H Z;  3AYH B;  5LHH A;  1Z2G A;  4Q0Y A;  3O65 A;  2P67 A;  3R23 A;  3S24 A;  1WRV A;  1NVP B;  1S3J A;  4JI3 B;  2B9Z A;  3ZRX A;  1TUB B;  5L1I A;  4A3J G;  2F23 A;  1VQM V;  3N41 B;  4ZOL B;  4DR3 O;  1DGS A;  2WE6 A;  4DV2 B;  2WLL B;  3RB6 A;  2DW4 A;  5LYJ B;  4JUZ A;  3D36 A;  3JRW A;  4I4T B;  4DR1 B;  4B3T B;  3GLK A;  2WTF A;  5I5U A;  1XEQ A;  3PO3 G;  1PL0 A;  2HVQ A;  3DAA A;  4O3P A;  1YVW A;  5IWA B;  4H0L B;  4BBR G;  1VF5 B;  4J9Q A;  3HKB A;  4IRK A;  3QNE A;  4O4I B;  1V9P A;  4FLW A;  2NVX A;  3LSU A;  4Q6G A;  2C2R A;  2ZDQ A;  1AJQ A;  1IVS A;  4IAJ A;  1WAZ A;  2W57 A;  4P30 A;  4EBD A;  5KFZ A;  4OX9 O;  2QE7 G;  3UT5 A;  1BHA A;  4O3R A;  4RB1 A;  4RNM A;  2JA7 A;  4ECY A;  1K33 A;  4KP4 A;  5EIB D;  4J9Z B;  4FLX A;  2UXD B;  4UCT A;  3SPC A;  3N6R A;  1KBL A;  1B3Q A;  3ZS8 C;  5I5X A;  1VF7 A;  3D3I A;  1WB7 A;  4GKK O;  2Q7E A;  3VNN A;  3KG2 A;  4O2A B;  5BR8 O;  3OEH G;  3TII A;  3RIZ A;  4IIJ A;  1ORQ C;  1Y6X A;  5B1B C;  1PD3 A;  3HKC B;  2QEX V;  4GT1 A;  3H40 A;  3QWU A;  4D6T H;  2X0S A;  2DYS B;  4D7S A;  1XNQ O;  1RP3 B;  3N8D A;  4LF9 B;  1RYS A;  3N42 B;  2XT9 A;  3HOU G;  5KAI Z;  4RZQ A;  3Q4H B;  4IYH A;  4OXS A;  4NXN O;  3KCY A;  1GGO A;  1VEW A;  2EIN B;  4QJF B;  3L4J A;  2YEV A;  1X9N A;  5KX5 A;  2FMA A;  1LUW A;  4X64 B;  5KHK A;  2IU0 A;  5KFX A;  2WLK A;  2N04 A;  4JV1 A;  2R7Z G;  2Z5U A;  3G6X A;  2C2D A;  1B6R A;  4MV8 A;  1CE8 A;  1K4C C;  5IJ9 B;  2CW7 A;  3MR2 A;  4RNN A;  2HHF B;  2Z02 A;  1A32 A;  3ETJ A;  2JS5 A;  3TIN A;  2FB9 A;  2GLT A;  3CCL V;  1TUE B;  2V58 A;  4BIO A;  3K57 A;  3TY5 A;  4DUZ H;  3CRQ A;  3AG4 B;  4HNU A;  4JI4 H;  3RGZ A;  1M6V A;  4JI0 O;  2W0X A;  4JTD B;  1PPJ H;  3WO0 A;  2I87 A;  3PW5 A;  2BCC H;  2E3C A;  4WFA V;  2YYA A;  1I6U A; 
#chains in the Genus database with same CATH homology
 2R9A A;  5ITZ B;  2ZCE A;  5J2T A;  2VOB A;  4CC5 A;  4ZHQ B;  1WN7 A;  2KSW A;  5LA6 B;  4DV1 B;  5FNV B;  3DF7 A;  3N2K B;  2UUA B;  4JV5 H;  3KXY T;  5EIB C;  1TAE A;  2XIG A;  1P49 A;  4JI1 H;  3SJB C;  4JI7 B;  2PUS A;  3N2G A;  2PZS A;  1N33 H;  4GKJ B;  5GON B;  3B2E E;  3OTO B;  1L2Z A;  4CS4 A;  2PYJ A;  4I55 A;  5JCO A;  1IBL B;  3JAS A;  4MV9 A;  3K3V A;  5JCO C;  4JI7 H;  4DV3 B;  5CA1 A;  4FM0 A;  1Z2P X;  4DV7 B;  1SA0 A;  4I50 A;  4TV9 A;  2GV9 A;  3L2P A;  3K58 A;  1Z5V A;  4UCS A;  4UCU A;  2F66 C;  1TA8 A;  4NXN H;  4ZI7 B;  5JH7 B;  4TUY B;  2CW8 A;  4B3M H;  1N34 H;  1CKM A;  3OTF A;  4UFZ A;  4AHC A;  2YIA A;  2ZJT A;  5FNV A;  1NT2 B;  5KMG A;  3RYH A;  3JAT A;  3WB2 A;  2VPS A;  2P5O A;  1N33 B;  5D1O B;  4LNU B;  3K59 A;  4UCO A;  2PY5 A;  2E5L B;  1G6U A;  2PTM A;  3RJ0 A;  4X1Y B;  2XHB A;  4LF4 H;  3E22 B;  2YI9 A;  2F93 B;  4TUY A;  4RAZ A;  1M4U A;  1BGW A;  1N32 H;  1SKV A;  5A2Q W;  3OTO H;  3N43 B;  1FJG H;  2UUC B;  1WPB A;  4JI5 H;  4JI8 H;  1SEI A;  5JQG A;  1ZAU A;  4TOI A;  4B3M B;  4RAY A;  2CAZ C;  3BPZ A;  1A0I A;  5KHH A;  3BA9 A;  3GJX B;  4DRX A;  3JAK A;  1TGO A;  4JI4 B;  4X66 H;  4DUZ B;  4I55 B;  2HHH H;  2ZIM A;  4TQD A;  5LOV B;  4DV6 B;  2BTQ A;  4FM2 A;  4D7T A;  4RB0 A;  5KX5 B;  3J81 W;  2UUB H;  3CSX A;  1KU9 A;  4DR2 B;  3BAA A;  1GYF A;  1B04 A;  1SQG A;  4LNU A;  4X65 H;  1XHX A;  4YJ2 B;  4B3R B;  2RGV A;  2HVS A;  2Q7G A;  3N2K A;  4JI2 B;  4LSX A;  2MCT A;  4KHP B;  1XDN A;  2UU9 B;  1QHT A;  1JFF B;  2F4V B;  3N44 B;  4X1K A;  5IJ0 B;  5BMV A;  3K5O A;  4AQY B;  4F6R B;  3RGX A;  2ZM6 B;  1M5I A;  4O4I A;  4DV2 H;  3HKB B;  3KAL A;  4DR7 B;  1XQ8 A;  4X62 B;  2UU9 H;  5LOV A;  3VQY A;  4UCV A;  5J2U B;  4JI6 H;  4U3J A;  2HHH B;  4DR5 B;  2VQE H;  3L4K A;  5FPO A;  5IJ9 A;  4PZ7 A;  2JVD A;  3T1H B;  4CS3 A;  4PDB A;  4FFB A;  1Z2O X;  4NVP A;  3RTX A;  4PI0 A;  2HEP A;  2UUB B;  4LH7 A;  2BTO A;  2EX3 A;  2O03 A;  1M93 A;  3MWM A;  4X1I A;  2RJZ A;  4GYC B;  5FPR A;  3KYH C;  2F1M A;  4LFC B;  3RYC B;  5D1P A;  4PZ6 A;  3RF2 A;  4LFA H;  5FD6 A;  1JMK C;  4O2B B;  4CH3 A;  5J2T B;  3JAL B;  4JI5 B;  4EEQ A;  4X62 H;  2PGG A;  4DR1 H;  5D1O A;  4R7R A;  4B3T H;  4DUY B;  1XNR H;  3BA8 A;  4DV0 B;  4FVM A;  5KMG B;  1N32 B;  3HKE A;  4RB3 C;  4LF6 H;  4LH6 A;  1WH2 A;  4FLV A;  4FLT A;  4BWS C;  4I4T A;  2ZIN A;  3ICX A;  2UXB H;  4LF9 H;  4FFB B;  4LF5 H;  3F8N A;  4O4L A;  4TV9 B;  4LFA B;  1CKN B;  4WBN A;  1O75 A;  5LL6 b;  3QTC A;  2VUG A;  4DK1 A;  4LF8 H;  4LF7 H;  3CVZ A;  4APM A;  3QG5 A;  4NXN B;  4DV6 H;  4HNA A;  1Q8I A;  4EFB A;  4FLZ A;  4O4L B;  1VS0 A;  1XMQ H;  4CS2 A;  3N2G B;  1TVK A;  3JAW A;  5CB4 A;  1XNQ B;  3QF7 A;  4X1K B;  4YHH B;  5IWA H;  4KHP H;  2YIB A;  1JFF A;  3WB0 A;  4JI2 H;  5C8Y A;  4CC6 A;  2UXB B;  4ZIB A;  2QJ1 A;  3RYF B;  4EB6 A;  4O4J B;  2WYO A;  4DRF A;  4GKK B;  4YJ3 A;  3T1Y B;  3NC0 B;  3HKC A;  3JAR B;  4K8X A;  1BJT A;  2ZM6 H;  2CFM A;  1HR0 B;  4B08 A;  1O9G A;  4DR6 B;  1IBK H;  1P16 A;  3UQ8 A;  5EZY A;  1N36 B;  3THO A;  2HVR A;  2KKW A;  3GDE A;  4PI2 A;  4DR3 B;  4GLX A;  1M0T A;  1O9H A;  1FJG B;  2Q2U A;  1Q43 A;  4YY3 H;  5BR8 H;  2V4D A;  4E6N A;  1Q3E A;  3UT5 B;  1HNZ B;  3T1Y H;  5EOY A;  2YIB D;  2QM4 A;  2IM9 A;  5K1X A;  2VQE B;  1WNS A;  2YXL A;  5LXT A;  4X1Y A;  3ETQ A;  3BRC A;  5EYP B;  1I94 H;  3RYI B;  3A2F A;  1QQC A;  2ZIO A;  1XK5 A;  5LMN H;  3JAT B;  2VQF B;  4O4J A;  3HKD B;  4IHJ A;  2PYL A;  1Z5W A;  5LP6 A;  1XMO H;  1ZHS A;  4X64 H;  5JVD B;  5JH7 A;  2F4V H;  3MAQ A;  2OWO A;  1TVK B;  3JAW B;  5CB4 B;  2RGR A;  3JSL A;  2VWJ A;  1CKO A;  3W1G A;  3BHP A;  1IBM H;  1ZHQ A;  4OX9 H;  4O2A A;  1HNX B;  4DR7 H;  2R70 A;  3PN1 A;  4MTE A;  4B3S H;  5CA0 A;  4DV4 B;  4LF4 B;  4AQY H;  4DR4 H;  4JI1 B;  4EQ5 A;  2Q2T A;  4X20 A;  3BAB A;  4AIL C;  4JI3 H;  4DR6 H;  4JV5 B;  1XMO B;  1E4F T;  3VQX A;  4ETS A;  3RFR A;  4BW9 A;  2VQF H;  3N6X A;  4GKK H;  4FLU A;  4BWA A;  4CH5 A;  4X65 B;  5IYZ A;  5LP6 C;  1M0W A;  1E4G T;  4GKJ H;  4DR2 H;  4OX9 B;  3H20 A;  1XI1 A;  1IBM B;  1SYX B;  1FKA H;  4X66 B;  3JAR A;  4K0K H;  5IYZ B;  3VQV A;  4CH6 A;  3JAM W;  4DV7 H;  3RYF A;  4DV3 H;  3SGI A;  4X1I B;  1HW7 A;  4YY3 B;  5BR8 B;  4ZI7 A;  4DV5 B;  4LF7 B;  2YCH A;  1Q5O A;  1N34 B;  3IG0 A;  4X20 B;  4O4H A;  4O4H B;  3ZED A;  4JI6 B;  1N36 H;  4DK0 A;  4LF5 B;  1KMI Z;  5CA0 B;  2OYQ A;  1D5A A;  4A2A A;  4HNA B;  4JYA H;  1FFX A;  4PZ8 A;  4A2B A;  2ZNI A;  1RSO A;  4I9Q A;  3M4I A;  3LNN A;  5KHG A;  2P22 C;  2VWK A;  4RB2 C;  4WBN B;  1YEW A;  4LSA A;  1AN7 A;  5IT9 W;  1MZB A;  4HBN A;  1S5J A;  5BMV B;  4DV5 H;  5IJ0 A;  3CHX A;  4MTD A;  3K5L A;  5JVD A;  5LP6 B;  4EB6 B;  5FLX W;  2ZNJ A;  4IHJ B;  3FMA A;  3JSN A;  5LA6 A;  2F95 B;  4K0K B;  2UUA H;  1IBK B;  5ITZ A;  1L8D A;  3JAL A;  4LR3 A;  1FVI A;  4JI8 B;  1IBL H;  2BTQ B;  3U0Z A;  1J5E B;  3RYC A;  5K1P A;  1JJO A;  1S03 G;  4Q0Y A;  3S24 A;  2Q0A A;  4JI0 B;  4FM1 A;  4JI3 B;  1X4T A;  1P8L A;  1TUB B;  3RGB A;  3N41 B;  2R72 A;  4ZOL B;  2E5L H;  1DGS A;  2WE6 A;  4LF6 B;  3SJC C;  4DV4 H;  4DV2 B;  1XHZ A;  3W5O A;  3J80 W;  1HNZ H;  3TY8 A;  5LYJ B;  3IAY A;  4U3J B;  4I4T B;  3NBY B;  4DR1 B;  3CB2 A;  4B3T B;  3HXL A;  4MV7 A;  3K5N A;  2HVQ A;  5JJN B;  3J7A K;  5IWA B;  4YHH H;  5LMU B;  4KL1 A;  3HKB A;  1J5E H;  4O4I B;  3DSQ A;  1V9P A;  4FLW A;  2RQ6 A;  5EYP A;  3KAK A;  4M7E A;  5JJJ B;  4Q6G A;  4LFB H;  3M7M X;  3RR5 A;  5C8Y B;  1HR0 H;  5LXT B;  4IAJ A;  2W57 A;  4K8Z A;  4LF8 B;  3GB8 B;  2FE3 A;  3FFQ A;  2WDT A;  3UT5 A;  2HIV A;  3NBZ B;  3KAJ A;  2HGS A;  4DR5 H;  4RB1 A;  4ZOL A;  4CH4 A;  5EIB D;  4I50 B;  2UXD B;  1SA0 B;  4FLX A;  4JI0 H;  4UCT A;  4IIJ B;  5D5P A;  2UUC H;  5D5Q A;  3ZS8 C;  1XNQ H;  1VF7 A;  4LFC H;  3JAS B;  3U11 A;  2UXC B;  4DRX B;  2Q7E A;  3VQW A;  3VNN A;  4DV0 H;  1T5E A;  4O2A B;  5GON A;  3SJA C;  4B3S B;  1XNR B;  4LFB B;  4DUY H;  3RIZ A;  4IIJ A;  4J0M A;  1HNX H;  4JYA B;  1S68 A;  3HKC B;  2UXD H;  4YJ3 B;  3QWU A;  4F6R A;  4LMY A;  1HNW B;  4D7S A;  3HKE B;  5KHI A;  4B3R H;  3E22 A;  4LF9 B;  4I7H A;  4ZHQ A;  4NXM B;  3N42 B;  3WB1 A;  2JGU A;  3HKD A;  4RZQ A;  3LML A;  4TV8 B;  4YJ2 A;  5LMN B;  2UXC H;  4FM9 A;  4O2B A;  3L4J A;  3RYI A;  4UCR A;  3RYH B;  1X9N A;  5KX5 A;  5JJE B;  4X64 B;  5KHK A;  1FFX B;  1Z2N X;  3JAK B;  5DIS C;  4PHZ A;  1CKN A;  5LYJ A;  1SQF A;  2YI8 A;  1XMQ B;  5IJ9 B;  2CW7 A;  5JQG B;  3EYY A;  1I94 B;  3K5M A;  3C0F B;  1TUB A;  3W1B A;  2JS5 A;  5CA1 B;  3N40 P;  5J2U A;  3TY5 A;  3T1H H;  4NXM H;  1I7F A;  3K57 A;  4DUZ H;  5KHJ A;  4DR4 B;  4JI4 H;  3RGZ A;  1H2S B;  3U10 A;  4FLY A;  4EFE A;  4DV1 H;  4DR3 H;  2HIX A;  3SR2 C;  1HNW H;  4L8J A;  5EZY B;  5LMU H;  3RWR D;  3TY9 A;  2Q7H A;  5FD5 A;  2E3C A;  4TV8 A;  4TQF A;  1I6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...