4EEQA

Crystal structure of e. faecalis dna ligase with inhibitor
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
b'PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Design, Synthesis and Activity Evaluation of Potent NAD+ DNA Ligase Inhibitors as Potential Antibacterial Agents.
rcsb
source organism Enterococcus faecalis
molecule tags Ligase/ligase inhibitor
total genus 108
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4eeqA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4eeqA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4eeqA02
4YHHB 4JYAB 5DISC 4JI0B 4DUZB 4LF9B 1S68A 2HVQA 1HNWB 1XMQB 2HVSA 1XNQB 4DR1B 4LF6B 4AQYB 4B3MB 4B3TB 3SGIA 2VUGA 4CC6A 4X66B 4K0KB 4LFCB 2Q2TA 5FPOA 4B3RB 4UFZA 2HHHB 1J5EB 4LF4B 5LMUB 4JI5B 4YY3B 4UCTA 3W5OA 3W1BA 2HVRA 5D1OA 1VS0A 1TA8A 4DR3B 3JSLA 1CKMA 2HIVA 4DV4B 4JI2B 4KHPB 1XMOB 3TY9A 3JSNA 4DV0B 1HR0B 1P8LA 4UCRA 2UUCB 5IWAB 4DRFA 2UUBB 4LH7A 4LFBB 1XDNA 1N36B 3OTOB 3L2PA 1N33B 4EEQA 3UQ8A 2UU9B 3GJXB 3TY5A 4E6NA 1X9NA 1A0IA 1CKNA 2HIXA 3W1GA 1V9PA 4DV2B 4DV5B 4OX9B 4DR4B 4DUYB 1TAEA 1ZAUA 4B3SB 4DR7B 2VQFB 4JI7B 4PZ8A 3RR5A 4EFEA 4LF8B 4CC5A 2E5LB 2UUAB 4PZ6A 2OWOA 3T1YB 4UCVA 4TOIA 1HNXB 5D1PA 4GKKB 4DV6B 2F4VB 4JI1B 4JI8B 4JI6B 5LMNB 3TY8A 3S24A 2ZM6B 1B04A 2VQEB 4X62B 3BA8A 4X64B 4LF7B 1FVIA 3NC0B 4LH6A 1FJGB 4GKJB 4LFAB 3KYHC 3BA9A 1CKOA 4JI3B 1IBKB 4PZ7A 3RTXA 1XK5A 1HNZB 2UXBB 4DV1B 3NBZB 1CKNB 1XNRB 1IBMB 2UXDB 4DR2B 2CFMA 2Q2UA 1DGSA 3PN1A 5D1OB 4GLXA 3VNNA 1I94B 4LF5B 4UCOA 1IBLB 3QWUA 4JV5B 4UCSA 3T1HB 5BR8B 3NBYB 3GB8B 4X65B 4DR6B 3BABA 3GDEA 4NXMB 4EQ5A 5FPRA 1N34B 4DR5B 4UCUA 4JI4B 4NXNB 2UXCB 1P16A 1N32B 4DV3B 3BAAA 4EFBA 4DV7B
chains in the Genus database with same CATH superfamily
3ASOB 2GSMB 3KCXA 3UM7A 3CSWA 2HVQA 3RBDA 4MVQA 4A5UB 4XDKA 3G8CA 3W7SA 1N4CA 1NQTA 5FR9A 1G2WA 5A2QN 1QHTA 1JA8A 2DZDA 5BWXA 4ED3A 5L3FA 3V4ZA 5JCOC 1R3JC 2ITDC 2VUGA 3F7YC 4DUYH 4DO2A 5JCOA 1BCCH 5EC1C 3G6BA 3K5OA 2B63A 4W4LA 2EINB 2R87A 4TQRA 1AP5A 1AUXA 2BQ3A 2IP4A 4Z1VA 4Q8FA 4J0MA 1A3GA 2RGVA 1IBLO 2EILB 2UVUA 3OT7A 4A3GG 3H1LH 3UZBA 3WG7C 4A3IG 4X64O 2O03A 4EBDA 4JAVA 1N36B 1XDNA 1B06A 1JR9A 3VMMA 2R72A 4DV5H 2WPDG 2YXHA 4GKJO 3C3SA 3AK3A 2XTAA 1AB3A 1CKNA 3W7XA 2EIYA 3FB6C 5IYZA 2PY5A 4DV1O 4RZRA 3STZC 2UUAB 2GV9A 4UCVA 2PI4A 3GIKA 1YXBA 2PYLA 5I5YA 4GKKB 2X6CA 4I50B 5D5QA 1Q7YW 4O4JB 4HNTA 3G6XA 1RK6A 3N41B 4UV9A 1PL4A 3U9TA 2M6YA 3U0ZA 4TV8B 1KYOF 3ETJA 2YZGA 3HB3B 4TM5A 5KT6A 2P90A 1I5XA 2YIBA 1IURA 1WN7A 3KAJA 2JA6G 1CPYA 1OCOB 5LOVB 4I55F 4YR3A 2A0LA 4DRXB 4YJ2A 2ADPA 2UXCO 5LGTA 4QW8A 4FFLA 2B5UA 2H8PC 3CQZA 4O2AF 2Q2UA 1Y1WG 3AG4B 1EYZA 4O3OA 4ED7A 4RZQA 1Q3EA 2P7TC 4XDLA 5KFFA 2ODMA 4UVCA 4JV5B 4DLKA 3RW0A 1SS3A 2F95B 4F4LA 1Q86W 2WLLA 3ICXA 4FJCC 2GPSA 3E8GA 3PVXA 2A79B 2LW7A 3JD1A 4JV1A 1SERA 5L3CA 1NKDA 2QM8A 4F6RA 2YS6A 1LNQA 2JEUA 1OCZC 3UT5A 3N42B 3JZIA 4BWSC 5GTHZ 1Y66A 3J80N 1AI5A 5JVLA 1WSCA 3L9DA 2R93G 2Q4PA 2Y0SA 5KFXA 2KSDA 1WJZA 1N36H 4ECXA 5K3WA 1I7FA 2Z02A 4TUYB 2E3CA 2ZM6O 3QF7A 4GLWA 2W8KA 3CRAA 4CMDA 4PI2A 3OTOO 2W9BA 3K59A 3W7UA 4AYBA 2Y0IA 5IJ9A 3CCSV 3SYQA 2Q2TA 2RDIA 3OUUA 3MHHC 2UUAH 3Q8RB 2UXBO 4GKKH 2W8LA 3BVOA 2DWDC 2HR3A 4J7JA 2M05A 4GC7A 4APMA 5EWFA 1HR0B 1VF6C 3GTGA 3NXSA 2CNUA 5LMNO 1YVWA 2J6UA 1VF6A 2RMKB 2BOBC 1BMFG 2H94A 4U7NA 1V55C 4MW8A 5LGNA 4RU9A 3FKSG 1X4TA 1E4GT 4EFEA 1KMIZ 3OD4A 4PELA 4X9QA 1S76D 4JV5H 1B6SA 3T5KA 1KEEA 2FMAA 1R73A 2VA2A 4FVMA 4ZIBA 5E25A 3WO0A 4PV1B 1LUWA 3RYHB 4LF6O 1XQ8A 5JH7A 4IT5A 2VQEB 4UB8Z 4NZOA 4O4HA 3R5HA 1JVMA 2DAAA 1Q81W 4FE2A 5IYBO 2IH1C 4A3CG 2QTSA 4TQSA 2CK3G 1CKOA 4R8UB 3R5FA 2UXDH 1GGOA 3IC7A 5B1BC 3U9SA 1W0KG 1YJWV 1CKNB 4FZ1A 2WLHA 1JQ0A 5KFZA 1YTFD 4MTOA 5KFBA 4GLXA 1PPJH 2E2HA 1PNMA 2P22C 3ZCCA 1O9GA 4ASUG 3C90A 1KU9A 4J11A 2UUBO 5DG8A 3RFRA 1NR7A 3RYCA 3GTJA 3A0HZ 2R8IA 2JA6A 3H1KH 5EC2C 1O9HA 2X7RB 3GDEA 3TW7A 4ZOLA 1J5EO 4I50F 4DL6A 1GM7A 4H44B 4O4JF 1IYDA 2V4QA 4M0JA 3ZHSA 3JARA 4I0XB 4JTCB 1Y1WA 4TV8F 4YJ2B 4FS2A 4YHHB 4DV4O 4EYHB 5C8YB 5GONA 3BEHA 5FNVB 4XBFA 2EJ7A 1GYFA 3BFRA 1VBHA 2I87A 2R70A 4J10A 4A3EG 2ZE8A 5LOVF 2UUCO 1J95A 1P84F 2R7MA 4RO2A 4M9UA 3PJSK 4B3TB 2R8HA 4IGGA 2HKOA 3E8HA 4K0KB 5DN6G 2JGDA 1BGWA 1DV1A 4JTDB 4DV2O 2BCCH 4YY3B 3P3NA 4DR4O 1GN4A 1H2GA 2OIEA 5EYPA 2EJ3A 3CX5F 3ZRVA 5DGBA 2R7ZG 1UNNC 4A93G 2A7WA 1XMOB 3RT3C 1PNLA 2CNVA 1VQKV 3AW8A 4BIZA 1ORQC 1FS0G 5IYBG 2CAZC 2UU9B 1Z2NX 5KLVH 4JXUA 1GK9A 3IG0A 1XL4A 4P30A 4WFEA 4WFAV 1U97A 2CTRA 5KUKA 4TUYF 1HNXH 4MSWC 3K79A 1ZAUA 3K03A 1F7YA 2EIKB 2RJZA 1JKJB 2HDKA 2HJWA 5L3GA 3BACA 3GTOA 3GIIA 2ZDHA 3CXHF 1GSAA 5BMVA 1XI1A 2HEPA 3WFVA 3E5NA 1O75A 4C2MA 2F4VB 3JZFA 4ECRA 2IH3C 3G8DA 3CSXA 1QR9A 2W6JG 1NVPB 1W96A 4O7SA 2QF7A 5E1AC 2GUZA 1G1XB 3ABUA 4X1KB 3OUZA 3O9OA 5LL6b 2RNBA 4ZBMA 3B77A 1ZLZA 4FM1A 5J2UA 1Z5VA 2FP4B 2FPIB 3RBEA 3T99A 1HNZB 4DL3A 2JA8G 3QTCA 3T4DA 2OIGA 1XNRB 2ZE6A 3L75H 4HNAB 3T4ZA 3A0BZ 3V6JA 2ALZA 4JI0O 4DV0O 4WBNB 5C44G 1AVMA 4MS2A 1I94B 1IYEA 3VNNA 1DIKA 1A9XA 4B3TH 2W9CA 1NBMG 3S3XA 3FAVB 3RYFB 1THZA 1VP7A 1B3QA 2FTKA 4AI8A 1JIHA 4K0KH 5KG6A 3RYIA 4N23A 4O4IB 4O3PA 2OCCB 1W2BU 3SJAC 4YY3H 5IY5B 5I5XA 3CB2A 1X59A 3MR5A 2JIZG 3GIQA 4IIJA 1N34B 4O7WA 2QM4A 1IVSA 1XOUA 4MTGA 5I5WA 3WB0A 1FYJA 2C22A 3ZBHA 3D36A 3ZHUA 3JATA 1YDXA 1RM1C 5DGIA 2IU3A 4Q43A 1SF9A 4WFBV 5JWPA 4KP4A 4JI2O 1S68A 2CZGA 2HFEC 4DV6O 2XC9A 3LNMB 3JALB 1XMQB 3KHRA 1ZL8B 3HR0A 3LDCA 2UU9H 1K8AW 2NVXA 2CH7B 4QGPA 5KA6A 3WB1A 5HNEA 3AG2C 1KJ8A 1ROPA 4O7LA 3ZHRA 2NU6B 1PP9H 3MD0A 1FXKB 4X66B 1ZSPA 1TUBB 4XDJA 5DG9A 1Y74B 2GBOA 2DPIA 4QWCA 4MTXA 2JDIG 3UKMA 4G28B 3MFIA 1PV0A 3W1BA 4JASA 4DR7O 2PN1A 4FFNA 2F4VH 2ZJTA 1JX9A 2P67A 2EIMC 4C5CA 1WNSA 2ZNJA 3E22B 5IWAH 3HKDB 5D5PA 3WNZA 4NTXA 2PZSA 4UCRA 5KHGA 5GONB 3R5XA 4DL7A 3GVMA 3ZRXA 3AK1A 4YJ2F 1FJGO 1HNZH 4WFHA 2QTOA 3U55A 5BWTA 5C8YF 4F4WA 4B3SH 5FNVF 1XNRH 1A0IA 4D6TH 3OGCC 2X6AA 5IJ0A 1IBKO 5CN0A 1YI2V 2JGDB 2IW5A 4ECYA 2VQFB 3SPGA 2FK1A 1I94H 2R7ZA 4JZGA 4RWUA 5CM0A 4P2ZA 2J9GA 2OWOA 2QB5A 2AU0A 3GTMA 1WP7A 3OR7C 3OAAG 2OH2A 1TWGA 3VBBA 1QCEA 3SJCC 2Q7HA 3B2EE 3S24A 4X64B 2JJ1G 2Q6AA 3LSUA 1N34H 1S5LZ 1XILA 1M1KW 2JEIA 1Q6HA 1SZXA 4GKJB 3ABMB 1MA1A 2ATKC 1QLEC 4IHJB 5LMUO 3K3PA 3NUAA 5KT5A 3E8BA 4J7KA 1FXHA 4DV1B 3B8NA 3ETGA 2V1DA 2YI9A 1KJJA 1XMQH 5ITZA 1H8EG 3MR6A 1US6A 4WF9V 3CEIA 4DUZO 3CCJV 1WRVA 4PWQA 3TETA 3EPIA 1EZJA 4X88A 3BCCH 2W6QA 1NVPD 4LMYA 5C1PA 4X66H 2ZR3A 3SYOA 3T54A 5KFUA 4DR1O 2VWKA 5BR8B 3T9EA 4LBEC 2PF4E 4GC6A 3IGAC 4LCUC 4J80A 1Q5OA 2R6FA 5JQGA 2C35B 4X1IA 4J9LA 5I5SA 4FIPC 1VQ5V 2UXCB 3KHHA 3JAKB 5CB4B 1MZEA 3OSNA 5DQIA 3VPBA 3LSQA 1ENVA 5DISC 5CR5A 4KHPO 2WDTA 1XNQH 1DF5A 5F9NA 4JI1O 1VQ6V 5EIBD 2R86A 4LSAA 4U6PA 4ECVA 4PA9A 3M99B 2Q5ZA 5FLXW 3L4KA 1EKPA 4EEYA 1Y1VG 4CC6A 3G80A 1ULZA 2JA5A 2Q68A 1MMMA 1AI6A 2VQFH 4HAMA 1BHBA 4WBNF 4FPPA 1JXLA 2F66C 5BWVA 4X20B 5LA6B 1XHZA 5D1OA 2B63G 1IBMO 1BE3H 5BWWA 4CZZA 4LF8O 1GSHA 5K1PA 3EFFK 2E5LO 3CYOA 2WA4A 4O4IF 3CPWU 3CMEV 2XCAA 1VEWA 3KHLA 2R8JA 1M57C 1PNKA 3RB4A 3TY9A 4X64H 4A3FG 1AJQA 4O3RA 3GIMA 3I55V 3CC7V 4GKJH 4TVIA 3I4MG 1RM1B 5J9PC 3NR7A 2M7WA 3UO3A 3CCQV 3OTOB 4LWSB 1GN6A 3RV4A 3GQCA 1L1FA 1VQ8V 4ZI7A 3RVYA 4DV1H 1W93A 4YAKB 2Q0OC 4QW9A 4PBCA 2ZE7A 2HIXA 2QKAA 1R6KA 3JASA 4TQDA 4QNHB 4NLGA 2AHYA 3OMNB 2K1EA 3ZMUA 4PA4A 2J6TA 5KX5B 1KJ9A 3T5LA 5BR8H 1KP3A 4YR0A 4LF5O 1GLVA 5JQWA 5LMNB 2OTLV 1R3LC 4NYKA 2PVPA 1B04A 2EIMB 3OFNG 3OR6C 3H4DA 3F8NA 1NH2D 1QBZA 3ABKC 4U3FH 2UXCH 1K5SA 1WH2A 1GO3E 3L4JA 2QSAA 2WB1E 2R85A 3CC4V 1GN2A 4XYMB 5KMGA 3LDEA 3N2GA 4ED2A 5B3SC 4B7EA 4NXNO 2Q73A 3RTXA 3T9CA 5C4XG 4IYIA 1LUVA 5KFYA 3CVZA 3CC2V 2JEGA 1RFYA 3R65A 2A9HA 2IMWP 1P4RA 2LO1A 2AQ4A 2COGA 4DR6H 2Z3YA 4FZ0A 3DC5A 1NTMH 3W7WA 1S0OA 5KFSA 2MW2B 5IT9W 5KG7A 3G6YA 4A3BG 1WR2A 3KHGA 4PHZA 4FLVA 4JZ2A 2VA3A 1N48A 5J2TB 3H3VH 1GMGA 2CDYA 4JI7O 1BXRA 3NGDA 4DV3B 3T9AA 4ECTA 3HKCA 5EOYA 5GTIZ 3K57A 4NB5A 1Q6UA 4RAIA 4O7TA 3FDSA 2W57A 2PMZE 3MR3A 2YEVA 3PW4A 1RSOA 2ZCEA 3TIGA 4Q6GA 5FD5A 5T14A 4QWAA 3H4BA 1WA8A 3OE7G 3RN4A 3OTOH 5DGAA 3CMAV 2IA6A 4IHJF 3ZN1A 2PGGA 2LW1A 5I47A 2ZR2A 2B1GA 1K73W 5KFAA 1MABG 4Q4DA 1BL8A 4J9YB 3HKEA 2BTQA 4LF4H 2P6JA 5KAIZ 3FYIB 2NUAB 4MA5A 1J5EB 1W0JG 2MK3A 2GQSA 3LNNA 5KFWA 2Q8VA 2Q0AA 1K33A 1JJOA 4Y8VB 1IOVA 4MTFA 1AP6A 5LMNH 1CKMA 2HIVA 4DV4B 4U3JA 4IZOA 3IN5A 3SYCA 2QM7A 2ZIMA 2W6PA 2FKLA 4TQFA 4JI6O 1S0VA 2UUCB 2HP8A 1E1QG 1JFFB 4UV8A 5CB4F 1Y1VA 1Y14B 1V51A 1N33B 2DYSB 5FL7G 2D2CB 4NZNA 3L73H 1OBGA 2Y0SE 3RAQA 4DV2B 3ORQA 4DR4B 2X5RA 2FPPB 4OPAA 2LFRA 4TOIA 3LP8A 1I1LA 4XZ3B 5L1IA 1VQLV 4QWBA 3PW7A 2DW4A 5LA6F 4JPRA 2E2IA 1WB8A 1LR1A 1P7GA 4RNMA 3AG1B 1CP9A 4DV3H 1R3IC 2ZDIC 2E75B 1WP8A 3APOA 1L8DA 2QJ1A 2N05A 1CQIB 5H9CA 1DAAA 3DTGA 1A32A 2ZDIA 2SCUB 4O3QA 3RF2A 3CCUV 4DV7O 1MNGA 1H2LA 4MV4A 3CCVV 1S9FA 5IYDG 1K92A 3DXRA 5JVDF 4QE9A 3FB8C 1L0LH 4E2LA 3K5IA 3BG5A 4JAUA 3ZHTA 5EZYB 2VQDA 3DC6A 5KX5F 4GUNA 2F93B 2KG7B 3TXQA 2QYZA 1CEZA 2HHHO 2W70A 4DR5B 4JI5O 4DV4H 4BXXG 3VA7A 4EB6A 1WAZA 3Q8QB 3D8CA 3P30A 3V6HA 1WLEA 2UUCH 4CS4A 4JI0B 5HFLA 2Y0PA 2RN9A 4ZKIA 2YS8A 1JX4A 2YCHA 1N33H 2ASLA 2XCLA 3FB5C 4I4TA 4YJ3F 4DW0A 4ETSA 2ZKOA 3Q4HB 1MZFA 1KP2A 4Q0YA 1IXMA 3ABLC 4I5SA 4DV2H 1FKAO 3A0RA 4DQNA 2NVYA 2OCHA 4LFCB 3SDLA 5C93A 2CKZB 2W9AA 1UC8A 2EZOA 3N44B 1BT8A 3K04A 4MV3A 3FX7A 5LXTB 5KA5A 4YBZB 1UFIA 4L1KA 1YHQV 2ABJA 4RNNA 2XGPA 3JAWA 4JI2B 2UVVA 2BSKB 5KFDA 4PDBA 3I4NG 2DJVA 4RB1A 2EZPA 2FMLA 1NU1H 4OPHA 4YIPA 2ZDGA 1ZETA 5J2TF 3HOWG 3ZRWA 3AG7A 2DWEC 2CUGA 1EKVA 2C2EA 2Y4UA 2HVJC 2ZXWB 3KCYA 4TV9A 5FLXN 3RJ0A 4J9OA 1DTOA 1KKDA 4ME6A 2HGSA 3AG3C 3QG5A 4RAZA 4DR7B 5BWUA 5LHIA 3QFFA 1ZUQA 5KFKA 2FJZA 2WLIA 2XHBA 1S5JA 2FK2A 2R9AA 1VF5B 2Q69A 2QWOB 1KB9F 4MVSA 4LNUA 1FD9A 4DR5H 4GX0A 2AGPA 1DLBA 1FJGB 1JDBB 1TWFA 1GKFA 3T5JA 3KYHC 4R8CA 2YXYA 4FGRA 4F4XA 4YAJB 4HN2A 3VQWA 1IBKB 4JI4O 4PZ7A 4JI0H 1PKXA 5LYJA 5IP7G 1G6UA 3GLKA 2YRXA 4Z1MG 1R6NA 4K8XA 3F7VC 4O2BA 3N2KA 3UZOA 3PN1A 4DYLA 2H3OA 3I12A 3HOVG 4DXWA 4LFCH 2L6LA 2UVWA 5BXZA 4AQYO 5CA1A 3AK2A 1SQQH 3TQTA 4KXRA 4FMTA 3BABA 2LGQA 3TK1A 3ASNC 5B1AC 2UVRA 5FPRA 3CP1A 4FM2A 3LULA 5KFMA 3U0GA 4RB2C 2CGNA 3WG7B 4JI2H 1ZTEA 4UUGA 3CJHA 4MAMA 4J7ZA 4MTDA 4DL4A 3BAAA 4DR3O 5DEDA 5IYZB 4MV8A 5CAEB 4DUZB 5KFLA 3GV7B 4PDMA 3C3TA 1FFTB 4RUCA 2HGXA 3K9SA 3M9OB 4DR1B 4WCEV 4O3SA 2NN4A 3HOZG 4Z2WA 4Q4CA 1G4YB 5LP6C 1VQPV 3H1IH 4YR2A 1BJTA 3GV5B 4DV5O 5IP9G 2AGQA 5IT9N 3BPZA 1K3EA 2YDEA 3R9RA 5LP6A 2HVRA 3L72H 1VS0A 3CRQA 1HR0H 1SQFA 5EZYF 3E2EA 4FU0A 4KHPB 2GPWA 3JSNA 1ET0A 5KT7A 3QZ8A 5FJ8G 3ZX6A 1BGYH 2PYJA 1FJGH 4IRDA 2RF4A 3ZIAG 2HHFA 3ETDA 4LH7A 3ETEA 4XX0B 3N40P 1KT8A 3BRCA 4FFPA 1IBKH 4QWEA 4ZHQA 4LFAO 1OCRC 2WLLB 4ECUA 5AG2A 2IBKA 4MV1A 2VS0A 5HV6A 4F6RB 2GHYA 1Q8IA 4LF8B 4L87A 2E5LB 4QJFA 3UT5B 5DLFA 2R7LA 5L3EA 2VQEH 1OCZB 4RUFA 2WYOA 2P4KA 2CE4A 4IWYA 1AILA 3JAWB 4K8ZA 1BS3A 5I5TA 1VQ7V 3BA8A 5LXTF 2IJKA 3DTFA 2R8GA 3WB2A 3ZRWB 4PA3A 4K6NA 4FM9A 2ZIOA 2W9BB 5K1XA 2R7KA 4JI3B 4A2BA 4DUZH 5IJ9B 1N32O 1JJ2U 1NI8A 4DK1A 3DTUB 5KT2A 4BBSG 2GTAA 2CW7A 4DR1H 2AHZA 2QWRB 3AG3B 4LF5B 3QWUA 1WCMG 1HP8A 3SPIA 4QSHA 1FXVA 2DYRC 4QIWF 1E4EA 2BTOA 2VOBA 1T3NA 3ZHVA 2NLJC 5F2VO 4HNVA 3MAQA 2W6NA 2ODTX 1Y76A 4NKGB 3O65A 3THOA 5CA0A 4FS1A 3H9VA 1AJNA 4NXNB 4YHHH 2NR5A 4KHPH 2ADQB 1JLLB 2FK3A 3PO2G 1S0MA 4GYCB 2UUAO 1VBGA 1ZQ7A 5KKNB 1V55B 5LYJB 2G38A 1BQ0A 3TQ1A 4GX5A 5K2MA 2JS5A 2WA3A 1SZTA 3TXSA 5JJJB 1T36A 4I7ZB 4O81A 1TWAA 5KFPA 2IM9A 3E89A 3VQYA 1A0GA 4CH3A 4PDLA 3G71V 2FE3A 3L71H 5F9LA 3VQXA 5JH7B 5CA1B 4BY7G 3W7TA 4O4HB 4LC1A 1MZBA 4LF8H 2E5LH 1JOYA 2JA5G 2YXLA 4PDVA 3TIIA 3D36C 1GO3F 5TISZ 3EHBB 1XMOH 1NS1A 1ZWIC 3K58A 1JPXA 2YUAA 2ARHA 3VOUA 1I2KA 1VARA 4R7CA 3N6RA 5EDWA 1Q43A 3HKBA 4GZRB 4P9PA 2YWVA 3MFHA 5B1BB 2ZDQA 2EIJC 4X62O 1SQXH 5D8DA 1ZHQA 1M93A 2V4RA 5KFRA 2AGAA 4EEQA 4O7NA 3RB6A 4JI3H 5BZBA 5IYZF 1K1SA 3H1JH 4GCZA 1Z2GA 3RYCB 3MWEA 1RJRA 1U96A 2QA4V 4FK5C 3GTQA 2YIBD 1TAEA 3LQSA 3KZIZ 2DE0X 1SA0A 4ZOLB 1NR1A 3TCUA 3EXAA 4ABMA 4CC5A 1H38A 2UXDO 4LF5H 4DR2O 4ED1A 2XAQA 1D5AA 3JARB 3WWHA 5EBMC 3ZEDA 4I9QA 1M56C 4JI6B 4JF3A 2UXXA 3GTKA 1SQPH 2HG5C 3T1HO 1SFOA 3EYYA 4RQEA 2X6BA 4N21A 4NXNH 1OCCC 4LH6A 3SJBC 3BA9A 4DK0A 3LDDA 3OUFA 3TGUH 1Y6XA 3OHBA 1OWTA 1KJQA 3C0FB 4I55A 4IL6Z 4RNOA 2Y4TA 3IJ4A 4G2KA 4FLUA 5BPFA 4U7CA 1GM9A 5EYPB 1RYSA 1K4DC 1IBLB 4CS3A 4CH5A 5FLMG 3RGBA 1KBLA 4BIUA 4UVBA 4NTWA 4X89A 3GB8B 4F50A 5JUMA 3ZMZA 4MV6A 4F4YA 5DG7A 5KFTA 5L1KA 1H2KA 3V6KA 2C2RA 2FB5A 3OMIB 4FFBA 2R92A 5KFEA 2F1MA 2Z0AA 3H0GG 4WD3A 1EZVH 3B8MA 3SJQC 4DV7B 3LMLA 1L2ZA 2J6SA 1UC9A 3JD0A 4CBCA 2CQYA 2XIGA 1TGOA 1WCMA 3B4SA 2EJRA 1ZHSA 5KHIA 1H2MA 2AW9A 3S3WA 2C28A 5BMVB 4R50A 3T1CA 4CHIA 1V54C 5C5JA 1RPRA 4MVUA 5IYCO 5LGUA 1SETA 4XYLB 4GX2A 1KKCA 1YZBA 2GUZB 2HHHB 3H1HH 5DECA 1EUDB 4RAYA 3J7AK 4JI5B 4OX9O 1Y76B 1NT2B 1H8HG 1VQ9V 1SQBH 4DL5A 1QLNA 5J2UB 3N43B 4JI6H 1HNXO 3WWJA 3HXLA 1P49A 2RDCA 1YF2A 2I80A 1T94A 4RUEA 1EN4A 3SNOA 2IBZH 4ECZA 4YB8B 4JTAB 3GIPA 5LBQA 4MVOA 1TVKA 4LF7O 4ICGA 2LJ2A 3L2PA 2W9CB 1QNMA 3ASOC 3FB7C 5LYJF 3SI8A 3GTLA 1IXBA 3RYIB 3JCZA 3HKZA 2JA7G 1V9PA 3AYHB 4BBRG 5H6QA 2Y4RA 4K3AA 1W59A 1IBLH 4IIJB 5EBLC 4PZ6A 2QWQB 4E4TA 1S5HC 3BQ0A 3V4SA 1YITV 5JH7F 4QIWE 1MG1A 1K5QA 3K0GA 4O4HF 5KG0A 3JATB 1Y4MA 2ZM6B 2EINC 3HKBB 4IWXA 1K4CC 1VQ4V 2IJHA 1S77D 3Q8PB 2W6MA 4RB3C 1I5YA 2JJ2G 5BYBA 5L1JA 1I1KA 4I7HA 4DV7H 1S03G 2CW8A 1D5NA 3ZMTA 2JGUA 1XK5A 2UXBB 1OJHA 3AG2B 1WPXA 2MCTA 4UB6Z 5DM6V 2FPGB 5JJNB 1QVFU 4JYAO 3FKIA 1SA0B 1YEWA 4LF9O 1IZ3A 3LUTB 1KC8W 3T9FA 3BQ2A 3D3QA 3STLC 5DMXA 1VF7A 3PZPA 2HHHH 2UU9O 4ZOLF 5IYCG 3M9MB 1M56B 2XOKG 3VPCA 4EQ5A 3PO3G 1AN7A 1K7DA 4JI4B 4X8AA 1P16A 1YSCA 3FYEB 1VQOV 2R82A 1MSWD 5GONF 4MVZA 4I50A 2BE3A 3ABTA 3K5LA 5H2FZ 4O4JA 1JDEA 5IJ0B 4O84A 4R7RA 4CMFA 1AROP 2WLJA 2A3QA 4LSXA 2C2AA 4TV8A 5KHKA 4EBEA 3GWOA 1OCOC 3JYCA 5IWAO 3E8FA 3P32A 5KFCA 4LF6B 4AQYB 4LFBO 5LOVA 3J81W 1WB7A 3GB7C 5H80A 3ZHQA 3QQMA 3AG4C 1B6QA 4JAAA 3HOXG 4J42A 4DAAA 3H0GA 4AILC 4BIOA 5A9GA 1K34A 4B3SO 4FFBB 1XNRO 2C2DA 4DR3B 3HPLC 4CH4A 3DAAA 1H2SB 3H20A 4BWAA 2ZM6H 1I94O 1QLEB 1IOWA 1XL6A 1KUQA 5ITZB 3RGZA 5IYDO 4J9NA 3QZ7A 5KFIA 4X1YA 1EN6A 2UUBB 3QO8A 1OV9A 3UQ8A 3Q2OA 2UXBH 2VPQA 3MHSC 2Y69C 4BW9A 4WFGA 4IYHA 1AJPA 4NTYA 2OYQA 2W7OA 3M4IA 4DV5B 1FPOA 5I5UA 3ORRA 5JQGB 4X1IB 5BMVF 1SEIA 2YSUB 3TINA 4TUYA 2CNQA 5D1PA 3RAXA 1XMQO 3E35A 1GAXA 1SQVH 3CRRA 3VPDA 3SYAA 4O7RA 2QKSA 4H33A 5KT4A 2GLTA 1XUQA 1NTKH 4Q44A 4JI4H 2VUMA 2R9IA 3TEKA 5J2UF 5KFHA 2JA7A 1TVKB 3MWMA 4F4ZA 4LFAB 1QU7A 4QPJA 2V59A 2XCPA 4WFFA 2GQRA 5DGHA 2Q9LA 2DMXA 1GRJA 2N04A 2KB1A 2WAQA 1EN5A 2HGWA 2CFMA 4O7VA 4LF6H 5D1OB 4AQYH 4AYBE 4FM0A 5C3EG 5IDJA 2ZINA 2ZT9B 3DSQA 3JD2A 1SQGA 3U11A 1XNQO 1SKVA 2LFSA 4UCSA 3NBYB 1UJWB 1M57B 1YIJV 2YIDA 2QKCA 4IIJF 4I9WA 3JRXA 2NU8B 3QO7A 4B3RO 2YW2A 3VOTA 3I5DA 4DR3H 4J9RA 4ZI7B 2VQFO 3TJTA 4HYOA 1N32B 1GM8A 2HJDA 4NZMA 2VR1A 3PW5A 3JASB 3RBZA 2W0FC 3RYHA 2WB1A 1RJPA 3BJYA 4CH6A 2UUBH 3UCSC 2X0SA 5KHHA 1KUTA 4TWKA 1KC7A 2JEFA 5DAAA 5BYAA 4D7SA 1KQSU 4R8UA 1J5EH 4O3NA 4MVRA 3CWBH 5FPOA 5KFVA 1KBHA 5BPHA 2W6ZA 4QE7A 4OXSA 1S10A 3ABKB 5CBFA 4RQFA 5BY1A 3FD9A 5KMGB 1YTFB 3N2GB 3T1YO 1G8MA 1HDJA 2EJ0A 4G3IA 2DQ3A 4DV0B 1RP3B 1XREA 1K1QA 5B3SB 1V4YA 4JI8O 2V9WA 3SPCA 2R84A 5L1LA 5BR8O 2ZNIA 2KQXA 3B40A 3OGIB 1M90W 4DRFA 4LFAH 2PMZA 1S72V 2WE6A 3MJFA 3GJXB 2WAMA 2WWWA 4CS2A 4DR4H 2EX3A 2Q7GA 1B6RA 4U7OA 4I0XA 2XT9A 1X9NA 1KECA 3A8TA 3KTMA 3W1GA 1S0NA 3VQVA 5GW7A 1Z2OX 5C8YA 5FNVA 3HBLA 3RR5A 3CCLV 1CE8A 1CQJB 5KG2A 2V58A 3HKCB 4DV6B 1QR8A 4HZ3A 3GV8B 2QWNB 2AGOA 2YEVB 1RSOB 3B09A 2YL2A 1I50A 3BQ1A 4X62B 1N56A 1WA8B 2FKXA 1EBOA 3SR2C 4X65O 1EZ1A 4DR6O 4X1YB 1FVIA 2FB9A 1IDSA 1N32H 1I0HA 4ECWA 4NXMO 2DABA 4K35A 2QEXV 4YP3A 3HKEB 2BTQB 1I2LA 3H40A 3E83A 4MVMA 2HVKC 4FFRA 4B08A 2UXDB 2Y69B 4DR2B 1FFXA 3RWRD 5JJEB 1M7JA 4EYIB 1HNWO 3KXYT 3QNEA 3CRCA 4U3JB 1AUVA 3JD4A 5L3BA 3T1HB 3CEBA 4W4KA 5JQGF 4B3MO 2EIKC 1BZKA 3OUSA 2OLSA 3ZMVA 3U54A 1BHAA 2F43G 1HWYA 4LF4O 4DL2A 4DV0H 2XAJA 4ED8A 1PM9A 4AHCA 2BR0A 3TW6A 2YYAA 2QDOA 4C5AA 3OHAA 4X1KA 1WPBA 2FLLA 3SPHA 3BY6A 2VWJA 3CD6V 3EPGA 1F23A 4J9QA 4IR9A 1Z2PX 4HNAA 5LMUB 3KAKA 4QWDA 1Q90D 5EIBC 1F51A 4DUYO 3SPJA 4WBNA 1YJNV 3GILA 5EWGA 3E86A 3PW2A 4DV6H 1TA8A 4F6EA 3FAVA 2OCCC 4PJ0Z 4YXWG 3RYFA 5IE9A 4FLXA 5IY5C 4X62H 2WLMA 4CKCA 4O4IA 3ETQA 1M0TA 4LP8A 1EKFA 4O86A 4ZI7F 3A2FA 2HLDG 4GT1A 3DXRB 1C30A 4DIMA 1NJIW 4HYKA 2ATLA 3R66A 3ZS8C 3WWIA 4DR7H 4FFKA 3CHXA 2OT5A 4DR2H 3J81N 5HBRB 3CCRV 1BSMA 4OX9B 4DV3O 4PZ8A 2PI5A 3KALA 3JALA 3L70H 3HO8A 4C5BA 1ZL8A 1P7BA 4O4LA 1HNXB 3T1HH 4FLZA 2I8CA 1FXKC 2CH7A 4EB6B 1QQCA 3MDSA 4JI1B 2CGOA 3KG2A 1BNCA 1FXKA 3OSPA 1TUBA 1FAFA 2C00A 1B33N 1Y74A 2AXTZ 4LF7B 4ZQIA 4CKBA 4A2AA 3DF7A 1IX9A 4IAJA 4UVAA 4I4TB 4J9MA 1M5IA 2YRWA 1XHXA 1OZ0A 3ZRSA 3OM3B 1I6UA 2N74A 3E22A 3JRWA 3NBZB 5I5VA 1D2DA 3UYYA 3ABLB 3T2MA 3HKDA 5EBWC 1M4UA 3FMAA 1IBMB 5KFJA 3ML0A 1DGSA 2GDSA 2LP7A 5B66Z 4J41A 3K08A 4A3KG 3JD3A 3IFXA 2V5AA 4L8JA 3GTPA 3CCEV 3RB0A 3K3WA 4ECQA 4J9ZB 1N33O 3F5TA 5FD6A 3CCMV 3UFXB 5LMUH 1SC5B 1K97A 4B7KA 1A48A 1URFA 4JYCA 4MT8A 4WHXA 4TV9B 3JAMW 2R93A 3GWKC 2R92G 1Q6IA 3QVNA 1CXZB 2RCVA 4O83A 4E4EA 4JYAB 2VRZA 2NU9B 3M9NB 1L0NH 4LF9B 4FFOA 3ABMC 2OTJV 1FFXB 4JGSA 3T9BA 3G6EV 5CBGA 3RFCA 1C3OA 4IHJA 1N36O 2WLIB 1EM1A 4OX9H 1EUCB 4A3JG 3MR2A 4LNUB 1AR4A 4H0LB 4IRCA 1TWHA 4FLTA 4PA7A 5CA3A 2DPJA 3D3IA 2RDJA 2O57A 4JI1H 3JSLA 2WLKA 5KT3A 2ASDA 4MV7A 1XEQA 4ED6A 4GKKO 4LF7H 3DGEA 2EULA 1GSOA 4O2BB 2P5OA 2ZD9A 2FL4A 1EFRG 3J7AU 5IWAB 3N2KB 1DK1A 4NYEA 1MOFA 4EGJA 4MTEA 2B9ZA 4LFBB 5KS8A 1VMGA 1E1RG 2K9PA 2R7NA 2YU9A 2B1IA 4JUZA 3ETHA 2XASA 3JAKA 4UUJC 5CB4A 1GN3A 4DR5O 1IBMH 1I7LA 1M9NA 4B3SB 4JI7B 2QGNA 2PTMA 5EK0A 2PUSA 3X2QC 3I56V 2ILMA 1I7NA 3ASNB 3M7MX 5B1AB 1R1BA 3CJHB 2JS3A 1XBLA 4JV5O 2JRIA 3PR5B 2DLNA 4TT3G 4JV2A 2IJIA 4NVPA 1M0WA 4J9KA 1MSDA 1PL0A 1N0JA 1YCIA 4LFCO 3P3PA 2QE7G 4X20A 5LA6A 2JEJA 2UXNA 3G67A 2XNDG 4JYAH 3FFQA 4LR3A 4LF9H 1QVGU 3L74H 5C1OA 5KFOA 1I3QA 3HB9A 4EKWA 5EWEA 2KKWA 5E79Z 1PX2A 4YIOA 4JYBA 5KG1A 2ETNA 5LP6B 5A2QW 4LWSA 3HKZE 4O4LB 4UCOA 5CMUA 3FKIG 2W0XA 2JK5C 2KSWA 2FYUH 4MA0A 2XUMA 5JVDA 5KAFZ 3IAYA 2Q7EA 5KFGA 2XAFA 3K3VA 4H37A 3SE7A 3WO1A 2WSSG 2HHFB 3RGXA 5I60A 3UO2A 4UCUA 1EHIA 4ZHQB 2E76B 5KX5A 3QO5A 1VQNV 3F5WC 3T5HA 4PI0A 5H5NA 4EFBA 3M8AA 4HR7A 4NR1A 1OCRB 3K0DA 4I4TF 1HR0O 4LFBH 3K5MA 4FLWA 5KG5A 4JYYA 4QJFB 5KG4A 2EBOA 1RYRA 4O2AA 4FFMA 1XNQB 3Q1KA 1K9MW 2P4VA 3PFFA 2W71A 3PW0A 1TUEB 1NH2B 2YI8A 2LGWA 4BW5A 4YJ3A 4JI7H 4B3RB 4UFZA 3OW2U 1KJIA 1RJQA 2YC0A 2DOSA 4BY1G 1OHHG 2IU0A 4UCTA 3W5OA 1AI4A 3MWDA 2P0AA 1VQMV 1DV2A 1PD3A 4IR1A 4DW1A 2AZ2A 3WU2Z 1JMKC 3N8DA 3U10A 1Y67A 2HJFC 4HBNA 1JCHA 2Q7DA 4O7YA 2EJ2A 2VQEO 4TV9F 1H2NA 2A1HA 5KHJA 2W6IG 1E79G 5J2TA 1N8RW 4RCNA 1E4EB 3K9AA 4E6NA 3KKYA 5BWRA 2BOCC 2DYRB 4OGQB 3ZMSA 2FLNA 3AEIA 5CA0B 3T1YB 3ZJZA 4ED0A 2DQ0A 3RV3A 1SYXB 2ASJA 4JI8B 3JZ6A 4M7EA 4FBUA 2V4DA 3TY8A 1KD1W 1I1MA 1R3KC 2W7PA 5CE8A 3SYPA 2HG8A 5B1NA 4KUMA 3NC0B 1DF4A 4KFMA 1Q82W 2PBZA 1VAJA 3J80W 1GH6A 2VUMG 5KFQA 3HT5A 3EVKA 3G4SV 5DQGA 3BHPA 5CBHA 4O2BF 4CE5A 2YS7A 2ZQMA 1NZ6A 1CS0A 2BQUA 4PDRA 1OBDA 1S3JA 4YHHO 2DYSC 1SESA 2DN9A 1N0NA 2R9RB 4P9OA 1VKZA 1JFFA 5CA1F 1F4MA 2CTQA 4A3DG 2Y48A 1ZX3A 4MW3A 3X2QB 4B3RH 3R23A 1RK5A 4X65B 4B3TO 1K83A 4DR6B 2Z5UA 4O7ZA 4K0KO 4NXMB 4Q8EA 4PA6A 2YZNA 2EIJB 5B5EZ 2COJA 4YY3O 1HW7A 2EILC 2DWCA 3CS5A 3Q8SB 2NU7B 2L35A 5L9XA 4TSFG 1NTZH 4FLYA 1XMOO 3ZN0A 3AG1C 2QK4A 2W6OA 1HNWB 2HVSA 2A06H 4MV9A 3T9DA 4KL1A 2LQTA 3GIJA 4BAYA 4B3MB 4JV0A 1RPOA 2WAQE 3SGIA 4HNUA 4JI5H 5JVDB 4A3LG 4YQWA 5LP6F 3N6XA 4J9SA 4EBCA 4RUAA 5LHGA 3K5HA 4JI3O 4LF4B 1T5EA 2COIA 2XGQA 3T1YH 4O4LF 3OEHG 5H6RA 3APQA 4G27B 2E74B 4EGQA 1OCCB 4JI8H 2XD4A 3CRMA 3JAMN 3RVZA 1R6TA 2XAHA 1P8LA 4I55B 5EZYA 2F4VO 3GIDA 1FKAH 3PR4A 4R6ZA 2WTFA 3T7AA 1TWCA 4ZHQF 2KG7A 2P06A 2JVDA 4O82A 2ITCC 2YIAA 2ZE5A 4BR6A 2V7QG 4O2AB 1BQZA 3RUPA 3OMAB 3TY5A 3LWBA 5LL6Y 4DRXA 5L3DA 1M6VA 2GTSA 3CE2A 3K06A 4HQ6A 4YJ3B 3JCUZ 2RGRA 4DUYB 1HNZO 2X0LA 2RQ6A 1AI7A 2CTPA 1GTOA 4D7TA 4FBTA 5KUMA 1AR5A 3Q4HA 5B1OA 5HFMA 2YZLA 4X65H 5KFNA 1F4NA 2IJJA 4RB0A 5KG3A 3G6VA 2BQRA 1R9TA 4NXMH 3HOYG 2VPSA 3RB3A 2QWPB 4GX1A 4C7UA 1KTAA 1COWG 3HOUG 2FLPA 5LXTA 4Q45A 2DIKA 1VIBA 1SRYA 2XAGA 1PK8A 5LHHA 1N34O 2Z04A 3AX6A 1E4FT 3IC9A 4A3MG 2YZMA 5DQHA 1V54B 3H01A 2BSKA 1HNWH 3OTFA 4ECSA 2JEXA 4UXNA 5DLGA 2ZXWC 1YJ9V 2R8KA 1SCUB 4B3MH 4H13B 4PD4F 4EG0A 1I08A 2ZGIA 2YICA 2QR4A 1Z5WA 1AR1B 3K5NA 2F23A 4Q20A 3KREA 4CKEA 2CTWA 5CA0F 4X66O 2WLNA 4QIWA 1XDCA 4J9PA 4IRKA 3OEEG 3CXCU 3LSSA 2Q67A 3N27A 2AZ0A 4QPKA 3RIZA 1S97A 2D3OW 1UPGA 2NNUA
chains in the Genus database with same CATH topology
5LYJB 5DISC 2WDTA 1XNQH 2HVQA 4JI6H 4X1KA 2JS5A 5EIBD 1WPBA 4LSAA 5JJJB 1QHTA 5FLXW 2IM9A 3L4KA 3VQYA 5JCOC 4CH3A 2VWJA 2FE3A 2VUGA 3VQXA 4CC6A 4DUYH 5JH7B 2VQFH 5CA1B 5JCOA 4O4HB 4LF8H 1MZBA 2E5LH 2YXLA 3K5OA 4HNAA 5LMUB 2F66C 1Z2PX 3KAKA 4X20B 5EIBC 5LA6B 1XHZA 5D1OA 4WBNA 1XMOH 4DV6H 1TA8A 5K1PA 3K58A 3RYFA 4FLXA 4X62H 1Q43A 3TY9A 4J0MA 4X64H 2RGVA 3HKBA 4O4IA 3ETQA 1M0TA 4GKJH 3A2FA 1ZHQA 2O03A 1M93A 1XDNA 1N36B 3OTOB 4EEQA 4JI3H 4ZI7A 4DV5H 2R72A 4DV1H 3ZS8C 4DR7H 3RYCB 3CHXA 1CKNA 2HIXA 4DR2H 3JASA 4TQDA 4OX9B 5IYZA 2YIBD 2PY5A 1TAEA 4PZ8A 1SA0A 4ZOLB 3KALA 4LF5H 3JALA 4CC5A 2UUAB 2GV9A 4UCVA 4O4LA 1D5AA 1HNXB 5KX5B 2PYLA 4FLZA 3T1HH 3JARB 5BR8H 4EB6B 4GKKB 4I50B 5D5QA 1QQCA 3ZEDA 4I9QA 4JI1B 4O4JB 4JI6B 5LMNB 3N41B 1TUBA 1B04A 3EYYA 3U0ZA 4LF7B 4TV8B 4A2AA 3DF7A 3F8NA 4NXNH 4IAJA 4LH6A 2UXCH 4I4TB 1WH2A 2YIBA 3SJBC 3KAJA 3L4JA 1WN7A 3BA9A 1M5IA 4DK0A 1XHXA 5LOVB 5KMGA 3N2GA 1I6UA 4DRXB 4YJ2A 3RTXA 3E22A 3NBZB 3C0FB 3HKDA 4I55A 1M4UA 3FMAA 1IBMB 3CVZA 2Q2UA 1DGSA 4FLUA 5EYPB 4RZQA 1Q3EA 1IBLB 4CS3A 4JV5B 4CH5A 4L8JA 4DR6H 3RGBA 2F95B 3GB8B 5FD6A 3ICXA 5LMUH 5IT9W 4FFBA 4F6RA 4PHZA 4FLVA 3UT5A 3N42B 5J2TB 2F1MA 4BWSC 4TV9B 3JAMW 4DV3B 3HKCA 5EOYA 3K57A 1L2ZA 4DV7B 2W57A 3LMLA 4JYAB 1RSOA 2ZCEA 2XIGA 4Q6GA 5FD5A 4LF9B 1TGOA 1ZHSA 1N36H 3OTOH 1I7FA 1FFXB 5KHIA 4TUYB 2PGGA 2E3CA 3QF7A 5BMVB 4PI2A 4IHJA 3HKEA 2BTQA 4LF4H 3K59A 4OX9H 2Q2TA 5IJ9A 4LNUB 2HHHB 2UUAH 1J5EB 4RAYA 3J7AK 4FLTA 4JI5B 3LNNA 1NT2B 2Q0AA 4GKKH 1JJOA 4JI1H 5J2UB 3JSLA 1CKMA 3N43B 2HIVA 3HXLA 1P49A 4U3JA 4DV4B 4APMA 4MV7A 1HR0B 4LF7H 2ZIMA 4O2BB 4TQFA 2P5OA 2UUCB 4MTEA 5IWAB 3N2KB 1JFFB 1TVKA 4LFBB 3L2PA 1N33B 3JAKA 5CB4A 3RYIB 1IBMH 1V9PA 4DV2B 4DR4B 1X4TA 4B3SB 4JI7B 1E4GT 2PTMA 1KMIZ 4EFEA 2PUSA 1IBLH 4IIJB 4PZ6A 4JV5H 4TOIA 3M7MX 4FVMA 4ZIBA 3JATB 3RYHB 1XQ8A 5JH7A 2ZM6B 2VQEB 3HKBB 4NVPA 1M0WA 4O4HA 4RB3C 4X20A 5LA6A 4DV3H 4I7HA 4DV7H 1CKOA 1S03G 4JYAH 3FFQA 2CW8A 4LR3A 2UXDH 1L8DA 2JGUA 2QJ1A 1XK5A 2UXBB 4LF9H 1CKNB 3RF2A 2MCTA 5JJNB 2KKWA 1SA0B 1YEWA 5LP6B 5A2QW 4GLXA 4O4LB 2P22C 4UCOA 1O9GA 2KSWA 1KU9A 5JVDA 3RFRA 1VF7A 5EZYB 3RYCA 2Q7EA 3IAYA 2HHHH 3K3VA 1O9HA 3GDEA 4EQ5A 2F93B 3RGXA 4ZOLA 1AN7A 4DR5B 4UCUA 4JI4B 4DV4H 4ZHQB 5KX5A 1P16A 3JARA 4EB6A 4PI0A 4I50A 3K5LA 4EFBA 4YJ2B 4O4JA 4YHHB 5IJ0B 2UUCH 4R7RA 4CS4A 5C8YB 4JI0B 5FNVB 5GONA 1GYFA 4LSXA 4LFBH 4TV8A 3K5MA 2R70A 4FLWA 2YCHA 1N33H 5KHKA 4O2AA 4I4TA 1XNQB 4LF6B 4ETSA 4AQYB 4Q0YA 5LOVA 2YI8A 4B3TB 4DV2H 3J81W 4YJ3A 4K0KB 4LFCB 4JI7H 4B3RB 1BGWA 4UFZA 4YY3B 4AILC 3N44B 4UCTA 3W5OA 4FFBB 5EYPA 5LXTB 4DR3B 4CH4A 1H2SB 3H20A 4BWAA 2ZM6H 3JAWA 4JI2B 1XMOB 4PDBA 1JMKC 3U10A 5ITZB 4HBNA 3RGZA 4RB1A 4X1YA 2UUBB 2CAZC 5KHJA 3UQ8A 2UU9B 1Z2NX 5J2TA 4TV9A 2UXBH 4BW9A 3IG0A 3RJ0A 4E6NA 2OYQA 5LMNH 2HGSA 3M4IA 3QG5A 4DV5B 4RAZA 1HNXH 1ZAUA 5JQGB 4DR7B 4X1IB 2RJZA 1SEIA 5CA0B 4TUYA 3T1YB 5BMVA 5D1PA 1XI1A 2HEPA 1O75A 1SYXB 2F4VB 2XHBA 1S5JA 3CSXA 2R9AA 4JI8B 4M7EA 2V4DA 3TY8A 4LNUA 4X1KB 4DR5H 4JI4H 3NC0B 5LL6b 1FJGB 1TVKB 3MWMA 4LFAB 3KYHC 3J80W 4FM1A 5J2UA 1Z5VA 3VQWA 1IBKB 4PZ7A 3BHPA 4JI0H 5LYJA 1HNZB 1G6UA 3QTCA 1XNRB 4K8XA 4HNAB 2CFMA 4O2BA 3N2KA 3PN1A 5D1OB 4WBNB 4LF6H 1JFFA 3VNNA 1I94B 4AQYH 4FM0A 4B3TH 2ZINA 3DSQA 3RYFB 4K0KH 4LFCH 1SQGA 3U11A 1SKVA 4UCSA 4B3RH 3RYIA 3NBYB 5CA1A 4O4IB 4X65B 3SJAC 4DR6B 4YY3H 3BABA 3CB2A 4NXMB 5FPRA 4DR3H 4FM2A 4IIJA 1N34B 2QM4A 1HW7A 4ZI7B 4RB2C 4JI2H 1N32B 3WB0A 4MTDA 3BAAA 3JASB 3JATA 5IYZB 3RYHA 4DUZB 4CH6A 4FLYA 1S68A 2UUBH 1HNWB 5KHHA 3JALB 1XMQB 2HVSA 2UU9H 4MV9A 4KL1A 4DR1B 3WB1A 4B3MB 4D7SA 1J5EH 3SGIA 4X66B 4JI5H 5JVDB 1TUBB 5FPOA 3N6XA 5LP6C 4LF4B 1T5EA 1BJTA 3T1YH 3BPZA 3W1BA 2HVRA 5LP6A 1VS0A 2F4VH 2ZJTA 1HR0H 1SQFA 5KMGB 4JI8H 3N2GB 1WNSA 4KHPB 2ZNJA 3E22B 5IWAH 3JSNA 4DV0B 1P8LA 3HKDB 4I55B 5EZYA 5D5PA 2PZSA 2PYJA 4UCRA 5KHGA 1FKAH 5GONB 1FJGH 2ZNIA 4LFAH 4DRFA 4LH7A 2JVDA 2YIAA 2WE6A 4O2AB 3N40P 3BRCA 1IBKH 3TY5A 3GJXB 4CS2A 4ZHQA 1HNZH 4DR4H 2EX3A 4DRXA 2Q7GA 4B3SH 1X9NA 1XNRH 1A0IA 4YJ3B 3W1GA 3VQVA 5IJ0A 2RGRA 1Z2OX 5C8YA 4DUYB 5FNVA 2VQFB 3RR5A 1I94H 4F6RB 1Q8IA 4LF8B 2E5LB 3UT5B 2OWOA 2RQ6A 4D7TA 2VQEH 3HKCB 4X65H 4DV6B 2WYOA 3SJCC 4RB0A 2Q7HA 3JAWB 4K8ZA 3B2EE 3S24A 4NXMH 4X62B 3BA8A 2VPSA 4X64B 3SR2C 1N34H 4X1YB 3WB2A 1FVIA 4FM9A 1N32H 5LXTA 4GKJB 4IHJB 2ZIOA 1E4FT 5K1XA 3HKEB 2BTQB 4JI3B 4A2BA 4DUZH 5IJ9B 4DV1B 2YI9A 1HNWH 3OTFA 4B08A 4DK1A 5ITZA 1XMQH 2UXDB 4DR2B 1FFXA 2CW7A 3RWRD 5JJEB 4DR1H 4B3MH 4LF5B 3QWUA 4LMYA 3KXYT 4X66H 4U3JB 1Z5WA 3T1HB 2VWKA 5BR8B 2BTOA 2VOBA 3K5NA 1Q5OA 3MAQA 5JQGA 4X1IA 3THOA 5CA0A 4NXNB 4YHHH 2UXCB 4KHPH 3JAKB 5CB4B 3RIZA 4DV0H 4GYCB 4AHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH B;  4JYA B;  5DIS C;  4JI0 B;  4DUZ B;  4LF9 B;  1S68 A;  2HVQ A;  1HNW B;  1XMQ B;  2HVS A;  1XNQ B;  4DR1 B;  4LF6 B;  4AQY B;  4B3M B;  4B3T B;  3SGI A;  2VUG A;  4CC6 A;  4X66 B;  4K0K B;  4LFC B;  2Q2T A;  5FPO A;  4B3R B;  4UFZ A;  2HHH B;  1J5E B;  4LF4 B;  5LMU B;  4JI5 B;  4YY3 B;  4UCT A;  3W5O A;  3W1B A;  2HVR A;  5D1O A;  1VS0 A;  1TA8 A;  4DR3 B;  3JSL A;  1CKM A;  2HIV A;  4DV4 B;  4JI2 B;  4KHP B;  1XMO B;  3TY9 A;  3JSN A;  4DV0 B;  1HR0 B;  1P8L A;  4UCR A;  2UUC B;  5IWA B;  4DRF A;  2UUB B;  4LH7 A;  4LFB B;  1XDN A;  1N36 B;  3OTO B;  3L2P A;  1N33 B;  4EEQ A;  3UQ8 A;  2UU9 B;  3GJX B;  3TY5 A;  4E6N A;  1X9N A;  1A0I A;  1CKN A;  2HIX A;  3W1G A;  1V9P A;  4DV2 B;  4DV5 B;  4OX9 B;  4DR4 B;  4DUY B;  1TAE A;  1ZAU A;  4B3S B;  4DR7 B;  2VQF B;  4JI7 B;  4PZ8 A;  3RR5 A;  4EFE A;  4LF8 B;  4CC5 A;  2E5L B;  2UUA B;  4PZ6 A;  2OWO A;  3T1Y B;  4UCV A;  4TOI A;  1HNX B;  5D1P A;  4GKK B;  4DV6 B;  2F4V B;  4JI1 B;  4JI8 B;  4JI6 B;  5LMN B;  3TY8 A;  3S24 A;  2ZM6 B;  1B04 A;  2VQE B;  4X62 B;  3BA8 A;  4X64 B;  4LF7 B;  1FVI A;  3NC0 B;  4LH6 A;  1FJG B;  4GKJ B;  4LFA B;  3KYH C;  3BA9 A;  1CKO A;  4JI3 B;  1IBK B;  4PZ7 A;  3RTX A;  1XK5 A;  1HNZ B;  2UXB B;  4DV1 B;  3NBZ B;  1CKN B;  1XNR B;  1IBM B;  2UXD B;  4DR2 B;  2CFM A;  2Q2U A;  1DGS A;  3PN1 A;  5D1O B;  4GLX A;  3VNN A;  1I94 B;  4LF5 B;  4UCO A;  1IBL B;  3QWU A;  4JV5 B;  4UCS A;  3T1H B;  5BR8 B;  3NBY B;  3GB8 B;  4X65 B;  4DR6 B;  3BAB A;  3GDE A;  4NXM B;  4EQ5 A;  5FPR A;  1N34 B;  4DR5 B;  4UCU A;  4JI4 B;  4NXN B;  2UXC B;  1P16 A;  1N32 B;  4DV3 B;  3BAA A;  4EFB A;  4DV7 B; 
#chains in the Genus database with same CATH topology
 3ASO B;  2GSM B;  3KCX A;  3UM7 A;  3CSW A;  2HVQ A;  3RBD A;  4MVQ A;  4A5U B;  4XDK A;  3G8C A;  3W7S A;  1N4C A;  1NQT A;  5FR9 A;  1G2W A;  5A2Q N;  1QHT A;  1JA8 A;  2DZD A;  5BWX A;  4ED3 A;  5L3F A;  3V4Z A;  5JCO C;  1R3J C;  2ITD C;  2VUG A;  3F7Y C;  4DUY H;  4DO2 A;  5JCO A;  1BCC H;  5EC1 C;  3G6B A;  3K5O A;  2B63 A;  4W4L A;  2EIN B;  2R87 A;  4TQR A;  1AP5 A;  1AUX A;  2BQ3 A;  2IP4 A;  4Z1V A;  4Q8F A;  4J0M A;  1A3G A;  2RGV A;  1IBL O;  2EIL B;  2UVU A;  3OT7 A;  4A3G G;  3H1L H;  3UZB A;  3WG7 C;  4A3I G;  4X64 O;  2O03 A;  4EBD A;  4JAV A;  1N36 B;  1XDN A;  1B06 A;  1JR9 A;  3VMM A;  2R72 A;  4DV5 H;  2WPD G;  2YXH A;  4GKJ O;  3C3S A;  3AK3 A;  2XTA A;  1AB3 A;  1CKN A;  3W7X A;  2EIY A;  3FB6 C;  5IYZ A;  2PY5 A;  4DV1 O;  4RZR A;  3STZ C;  2UUA B;  2GV9 A;  4UCV A;  2PI4 A;  3GIK A;  1YXB A;  2PYL A;  5I5Y A;  4GKK B;  2X6C A;  4I50 B;  5D5Q A;  1Q7Y W;  4O4J B;  4HNT A;  3G6X A;  1RK6 A;  3N41 B;  4UV9 A;  1PL4 A;  3U9T A;  2M6Y A;  3U0Z A;  4TV8 B;  1KYO F;  3ETJ A;  2YZG A;  3HB3 B;  4TM5 A;  5KT6 A;  2P90 A;  1I5X A;  2YIB A;  1IUR A;  1WN7 A;  3KAJ A;  2JA6 G;  1CPY A;  1OCO B;  5LOV B;  4I55 F;  4YR3 A;  2A0L A;  4DRX B;  4YJ2 A;  2ADP A;  2UXC O;  5LGT A;  4QW8 A;  4FFL A;  2B5U A;  2H8P C;  3CQZ A;  4O2A F;  2Q2U A;  1Y1W G;  3AG4 B;  1EYZ A;  4O3O A;  4ED7 A;  4RZQ A;  1Q3E A;  2P7T C;  4XDL A;  5KFF A;  2ODM A;  4UVC A;  4JV5 B;  4DLK A;  3RW0 A;  1SS3 A;  2F95 B;  4F4L A;  1Q86 W;  2WLL A;  3ICX A;  4FJC C;  2GPS A;  3E8G A;  3PVX A;  2A79 B;  2LW7 A;  3JD1 A;  4JV1 A;  1SER A;  5L3C A;  1NKD A;  2QM8 A;  4F6R A;  2YS6 A;  1LNQ A;  2JEU A;  1OCZ C;  3UT5 A;  3N42 B;  3JZI A;  4BWS C;  5GTH Z;  1Y66 A;  3J80 N;  1AI5 A;  5JVL A;  1WSC A;  3L9D A;  2R93 G;  2Q4P A;  2Y0S A;  5KFX A;  2KSD A;  1WJZ A;  1N36 H;  4ECX A;  5K3W A;  1I7F A;  2Z02 A;  4TUY B;  2E3C A;  2ZM6 O;  3QF7 A;  4GLW A;  2W8K A;  3CRA A;  4CMD A;  4PI2 A;  3OTO O;  2W9B A;  3K59 A;  3W7U A;  4AYB A;  2Y0I A;  5IJ9 A;  3CCS V;  3SYQ A;  2Q2T A;  2RDI A;  3OUU A;  3MHH C;  2UUA H;  3Q8R B;  2UXB O;  4GKK H;  2W8L A;  3BVO A;  2DWD C;  2HR3 A;  4J7J A;  2M05 A;  4GC7 A;  4APM A;  5EWF A;  1HR0 B;  1VF6 C;  3GTG A;  3NXS A;  2CNU A;  5LMN O;  1YVW A;  2J6U A;  1VF6 A;  2RMK B;  2BOB C;  1BMF G;  2H94 A;  4U7N A;  1V55 C;  4MW8 A;  5LGN A;  4RU9 A;  3FKS G;  1X4T A;  1E4G T;  4EFE A;  1KMI Z;  3OD4 A;  4PEL A;  4X9Q A;  1S76 D;  4JV5 H;  1B6S A;  3T5K A;  1KEE A;  2FMA A;  1R73 A;  2VA2 A;  4FVM A;  4ZIB A;  5E25 A;  3WO0 A;  4PV1 B;  1LUW A;  3RYH B;  4LF6 O;  1XQ8 A;  5JH7 A;  4IT5 A;  2VQE B;  4UB8 Z;  4NZO A;  4O4H A;  3R5H A;  1JVM A;  2DAA A;  1Q81 W;  4FE2 A;  5IYB O;  2IH1 C;  4A3C G;  2QTS A;  4TQS A;  2CK3 G;  1CKO A;  4R8U B;  3R5F A;  2UXD H;  1GGO A;  3IC7 A;  5B1B C;  3U9S A;  1W0K G;  1YJW V;  1CKN B;  4FZ1 A;  2WLH A;  1JQ0 A;  5KFZ A;  1YTF D;  4MTO A;  5KFB A;  4GLX A;  1PPJ H;  2E2H A;  1PNM A;  2P22 C;  3ZCC A;  1O9G A;  4ASU G;  3C90 A;  1KU9 A;  4J11 A;  2UUB O;  5DG8 A;  3RFR A;  1NR7 A;  3RYC A;  3GTJ A;  3A0H Z;  2R8I A;  2JA6 A;  3H1K H;  5EC2 C;  1O9H A;  2X7R B;  3GDE A;  3TW7 A;  4ZOL A;  1J5E O;  4I50 F;  4DL6 A;  1GM7 A;  4H44 B;  4O4J F;  1IYD A;  2V4Q A;  4M0J A;  3ZHS A;  3JAR A;  4I0X B;  4JTC B;  1Y1W A;  4TV8 F;  4YJ2 B;  4FS2 A;  4YHH B;  4DV4 O;  4EYH B;  5C8Y B;  5GON A;  3BEH A;  5FNV B;  4XBF A;  2EJ7 A;  1GYF A;  3BFR A;  1VBH A;  2I87 A;  2R70 A;  4J10 A;  4A3E G;  2ZE8 A;  5LOV F;  2UUC O;  1J95 A;  1P84 F;  2R7M A;  4RO2 A;  4M9U A;  3PJS K;  4B3T B;  2R8H A;  4IGG A;  2HKO A;  3E8H A;  4K0K B;  5DN6 G;  2JGD A;  1BGW A;  1DV1 A;  4JTD B;  4DV2 O;  2BCC H;  4YY3 B;  3P3N A;  4DR4 O;  1GN4 A;  1H2G A;  2OIE A;  5EYP A;  2EJ3 A;  3CX5 F;  3ZRV A;  5DGB A;  2R7Z G;  1UNN C;  4A93 G;  2A7W A;  1XMO B;  3RT3 C;  1PNL A;  2CNV A;  1VQK V;  3AW8 A;  4BIZ A;  1ORQ C;  1FS0 G;  5IYB G;  2CAZ C;  2UU9 B;  1Z2N X;  5KLV H;  4JXU A;  1GK9 A;  3IG0 A;  1XL4 A;  4P30 A;  4WFE A;  4WFA V;  1U97 A;  2CTR A;  5KUK A;  4TUY F;  1HNX H;  4MSW C;  3K79 A;  1ZAU A;  3K03 A;  1F7Y A;  2EIK B;  2RJZ A;  1JKJ B;  2HDK A;  2HJW A;  5L3G A;  3BAC A;  3GTO A;  3GII A;  2ZDH A;  3CXH F;  1GSA A;  5BMV A;  1XI1 A;  2HEP A;  3WFV A;  3E5N A;  1O75 A;  4C2M A;  2F4V B;  3JZF A;  4ECR A;  2IH3 C;  3G8D A;  3CSX A;  1QR9 A;  2W6J G;  1NVP B;  1W96 A;  4O7S A;  2QF7 A;  5E1A C;  2GUZ A;  1G1X B;  3ABU A;  4X1K B;  3OUZ A;  3O9O A;  5LL6 b;  2RNB A;  4ZBM A;  3B77 A;  1ZLZ A;  4FM1 A;  5J2U A;  1Z5V A;  2FP4 B;  2FPI B;  3RBE A;  3T99 A;  1HNZ B;  4DL3 A;  2JA8 G;  3QTC A;  3T4D A;  2OIG A;  1XNR B;  2ZE6 A;  3L75 H;  4HNA B;  3T4Z A;  3A0B Z;  3V6J A;  2ALZ A;  4JI0 O;  4DV0 O;  4WBN B;  5C44 G;  1AVM A;  4MS2 A;  1I94 B;  1IYE A;  3VNN A;  1DIK A;  1A9X A;  4B3T H;  2W9C A;  1NBM G;  3S3X A;  3FAV B;  3RYF B;  1THZ A;  1VP7 A;  1B3Q A;  2FTK A;  4AI8 A;  1JIH A;  4K0K H;  5KG6 A;  3RYI A;  4N23 A;  4O4I B;  4O3P A;  2OCC B;  1W2B U;  3SJA C;  4YY3 H;  5IY5 B;  5I5X A;  3CB2 A;  1X59 A;  3MR5 A;  2JIZ G;  3GIQ A;  4IIJ A;  1N34 B;  4O7W A;  2QM4 A;  1IVS A;  1XOU A;  4MTG A;  5I5W A;  3WB0 A;  1FYJ A;  2C22 A;  3ZBH A;  3D36 A;  3ZHU A;  3JAT A;  1YDX A;  1RM1 C;  5DGI A;  2IU3 A;  4Q43 A;  1SF9 A;  4WFB V;  5JWP A;  4KP4 A;  4JI2 O;  1S68 A;  2CZG A;  2HFE C;  4DV6 O;  2XC9 A;  3LNM B;  3JAL B;  1XMQ B;  3KHR A;  1ZL8 B;  3HR0 A;  3LDC A;  2UU9 H;  1K8A W;  2NVX A;  2CH7 B;  4QGP A;  5KA6 A;  3WB1 A;  5HNE A;  3AG2 C;  1KJ8 A;  1ROP A;  4O7L A;  3ZHR A;  2NU6 B;  1PP9 H;  3MD0 A;  1FXK B;  4X66 B;  1ZSP A;  1TUB B;  4XDJ A;  5DG9 A;  1Y74 B;  2GBO A;  2DPI A;  4QWC A;  4MTX A;  2JDI G;  3UKM A;  4G28 B;  3MFI A;  1PV0 A;  3W1B A;  4JAS A;  4DR7 O;  2PN1 A;  4FFN A;  2F4V H;  2ZJT A;  1JX9 A;  2P67 A;  2EIM C;  4C5C A;  1WNS A;  2ZNJ A;  3E22 B;  5IWA H;  3HKD B;  5D5P A;  3WNZ A;  4NTX A;  2PZS A;  4UCR A;  5KHG A;  5GON B;  3R5X A;  4DL7 A;  3GVM A;  3ZRX A;  3AK1 A;  4YJ2 F;  1FJG O;  1HNZ H;  4WFH A;  2QTO A;  3U55 A;  5BWT A;  5C8Y F;  4F4W A;  4B3S H;  5FNV F;  1XNR H;  1A0I A;  4D6T H;  3OGC C;  2X6A A;  5IJ0 A;  1IBK O;  5CN0 A;  1YI2 V;  2JGD B;  2IW5 A;  4ECY A;  2VQF B;  3SPG A;  2FK1 A;  1I94 H;  2R7Z A;  4JZG A;  4RWU A;  5CM0 A;  4P2Z A;  2J9G A;  2OWO A;  2QB5 A;  2AU0 A;  3GTM A;  1WP7 A;  3OR7 C;  3OAA G;  2OH2 A;  1TWG A;  3VBB A;  1QCE A;  3SJC C;  2Q7H A;  3B2E E;  3S24 A;  4X64 B;  2JJ1 G;  2Q6A A;  3LSU A;  1N34 H;  1S5L Z;  1XIL A;  1M1K W;  2JEI A;  1Q6H A;  1SZX A;  4GKJ B;  3ABM B;  1MA1 A;  2ATK C;  1QLE C;  4IHJ B;  5LMU O;  3K3P A;  3NUA A;  5KT5 A;  3E8B A;  4J7K A;  1FXH A;  4DV1 B;  3B8N A;  3ETG A;  2V1D A;  2YI9 A;  1KJJ A;  1XMQ H;  5ITZ A;  1H8E G;  3MR6 A;  1US6 A;  4WF9 V;  3CEI A;  4DUZ O;  3CCJ V;  1WRV A;  4PWQ A;  3TET A;  3EPI A;  1EZJ A;  4X88 A;  3BCC H;  2W6Q A;  1NVP D;  4LMY A;  5C1P A;  4X66 H;  2ZR3 A;  3SYO A;  3T54 A;  5KFU A;  4DR1 O;  2VWK A;  5BR8 B;  3T9E A;  4LBE C;  2PF4 E;  4GC6 A;  3IGA C;  4LCU C;  4J80 A;  1Q5O A;  2R6F A;  5JQG A;  2C35 B;  4X1I A;  4J9L A;  5I5S A;  4FIP C;  1VQ5 V;  2UXC B;  3KHH A;  3JAK B;  5CB4 B;  1MZE A;  3OSN A;  5DQI A;  3VPB A;  3LSQ A;  1ENV A;  5DIS C;  5CR5 A;  4KHP O;  2WDT A;  1XNQ H;  1DF5 A;  5F9N A;  4JI1 O;  1VQ6 V;  5EIB D;  2R86 A;  4LSA A;  4U6P A;  4ECV A;  4PA9 A;  3M99 B;  2Q5Z A;  5FLX W;  3L4K A;  1EKP A;  4EEY A;  1Y1V G;  4CC6 A;  3G80 A;  1ULZ A;  2JA5 A;  2Q68 A;  1MMM A;  1AI6 A;  2VQF H;  4HAM A;  1BHB A;  4WBN F;  4FPP A;  1JXL A;  2F66 C;  5BWV A;  4X20 B;  5LA6 B;  1XHZ A;  5D1O A;  2B63 G;  1IBM O;  1BE3 H;  5BWW A;  4CZZ A;  4LF8 O;  1GSH A;  5K1P A;  3EFF K;  2E5L O;  3CYO A;  2WA4 A;  4O4I F;  3CPW U;  3CME V;  2XCA A;  1VEW A;  3KHL A;  2R8J A;  1M57 C;  1PNK A;  3RB4 A;  3TY9 A;  4X64 H;  4A3F G;  1AJQ A;  4O3R A;  3GIM A;  3I55 V;  3CC7 V;  4GKJ H;  4TVI A;  3I4M G;  1RM1 B;  5J9P C;  3NR7 A;  2M7W A;  3UO3 A;  3CCQ V;  3OTO B;  4LWS B;  1GN6 A;  3RV4 A;  3GQC A;  1L1F A;  1VQ8 V;  4ZI7 A;  3RVY A;  4DV1 H;  1W93 A;  4YAK B;  2Q0O C;  4QW9 A;  4PBC A;  2ZE7 A;  2HIX A;  2QKA A;  1R6K A;  3JAS A;  4TQD A;  4QNH B;  4NLG A;  2AHY A;  3OMN B;  2K1E A;  3ZMU A;  4PA4 A;  2J6T A;  5KX5 B;  1KJ9 A;  3T5L A;  5BR8 H;  1KP3 A;  4YR0 A;  4LF5 O;  1GLV A;  5JQW A;  5LMN B;  2OTL V;  1R3L C;  4NYK A;  2PVP A;  1B04 A;  2EIM B;  3OFN G;  3OR6 C;  3H4D A;  3F8N A;  1NH2 D;  1QBZ A;  3ABK C;  4U3F H;  2UXC H;  1K5S A;  1WH2 A;  1GO3 E;  3L4J A;  2QSA A;  2WB1 E;  2R85 A;  3CC4 V;  1GN2 A;  4XYM B;  5KMG A;  3LDE A;  3N2G A;  4ED2 A;  5B3S C;  4B7E A;  4NXN O;  2Q73 A;  3RTX A;  3T9C A;  5C4X G;  4IYI A;  1LUV A;  5KFY A;  3CVZ A;  3CC2 V;  2JEG A;  1RFY A;  3R65 A;  2A9H A;  2IMW P;  1P4R A;  2LO1 A;  2AQ4 A;  2COG A;  4DR6 H;  2Z3Y A;  4FZ0 A;  3DC5 A;  1NTM H;  3W7W A;  1S0O A;  5KFS A;  2MW2 B;  5IT9 W;  5KG7 A;  3G6Y A;  4A3B G;  1WR2 A;  3KHG A;  4PHZ A;  4FLV A;  4JZ2 A;  2VA3 A;  1N48 A;  5J2T B;  3H3V H;  1GMG A;  2CDY A;  4JI7 O;  1BXR A;  3NGD A;  4DV3 B;  3T9A A;  4ECT A;  3HKC A;  5EOY A;  5GTI Z;  3K57 A;  4NB5 A;  1Q6U A;  4RAI A;  4O7T A;  3FDS A;  2W57 A;  2PMZ E;  3MR3 A;  2YEV A;  3PW4 A;  1RSO A;  2ZCE A;  3TIG A;  4Q6G A;  5FD5 A;  5T14 A;  4QWA A;  3H4B A;  1WA8 A;  3OE7 G;  3RN4 A;  3OTO H;  5DGA A;  3CMA V;  2IA6 A;  4IHJ F;  3ZN1 A;  2PGG A;  2LW1 A;  5I47 A;  2ZR2 A;  2B1G A;  1K73 W;  5KFA A;  1MAB G;  4Q4D A;  1BL8 A;  4J9Y B;  3HKE A;  2BTQ A;  4LF4 H;  2P6J A;  5KAI Z;  3FYI B;  2NUA B;  4MA5 A;  1J5E B;  1W0J G;  2MK3 A;  2GQS A;  3LNN A;  5KFW A;  2Q8V A;  2Q0A A;  1K33 A;  1JJO A;  4Y8V B;  1IOV A;  4MTF A;  1AP6 A;  5LMN H;  1CKM A;  2HIV A;  4DV4 B;  4U3J A;  4IZO A;  3IN5 A;  3SYC A;  2QM7 A;  2ZIM A;  2W6P A;  2FKL A;  4TQF A;  4JI6 O;  1S0V A;  2UUC B;  2HP8 A;  1E1Q G;  1JFF B;  4UV8 A;  5CB4 F;  1Y1V A;  1Y14 B;  1V51 A;  1N33 B;  2DYS B;  5FL7 G;  2D2C B;  4NZN A;  3L73 H;  1OBG A;  2Y0S E;  3RAQ A;  4DV2 B;  3ORQ A;  4DR4 B;  2X5R A;  2FPP B;  4OPA A;  2LFR A;  4TOI A;  3LP8 A;  1I1L A;  4XZ3 B;  5L1I A;  1VQL V;  4QWB A;  3PW7 A;  2DW4 A;  5LA6 F;  4JPR A;  2E2I A;  1WB8 A;  1LR1 A;  1P7G A;  4RNM A;  3AG1 B;  1CP9 A;  4DV3 H;  1R3I C;  2ZDI C;  2E75 B;  1WP8 A;  3APO A;  1L8D A;  2QJ1 A;  2N05 A;  1CQI B;  5H9C A;  1DAA A;  3DTG A;  1A32 A;  2ZDI A;  2SCU B;  4O3Q A;  3RF2 A;  3CCU V;  4DV7 O;  1MNG A;  1H2L A;  4MV4 A;  3CCV V;  1S9F A;  5IYD G;  1K92 A;  3DXR A;  5JVD F;  4QE9 A;  3FB8 C;  1L0L H;  4E2L A;  3K5I A;  3BG5 A;  4JAU A;  3ZHT A;  5EZY B;  2VQD A;  3DC6 A;  5KX5 F;  4GUN A;  2F93 B;  2KG7 B;  3TXQ A;  2QYZ A;  1CEZ A;  2HHH O;  2W70 A;  4DR5 B;  4JI5 O;  4DV4 H;  4BXX G;  3VA7 A;  4EB6 A;  1WAZ A;  3Q8Q B;  3D8C A;  3P30 A;  3V6H A;  1WLE A;  2UUC H;  4CS4 A;  4JI0 B;  5HFL A;  2Y0P A;  2RN9 A;  4ZKI A;  2YS8 A;  1JX4 A;  2YCH A;  1N33 H;  2ASL A;  2XCL A;  3FB5 C;  4I4T A;  4YJ3 F;  4DW0 A;  4ETS A;  2ZKO A;  3Q4H B;  1MZF A;  1KP2 A;  4Q0Y A;  1IXM A;  3ABL C;  4I5S A;  4DV2 H;  1FKA O;  3A0R A;  4DQN A;  2NVY A;  2OCH A;  4LFC B;  3SDL A;  5C93 A;  2CKZ B;  2W9A A;  1UC8 A;  2EZO A;  3N44 B;  1BT8 A;  3K04 A;  4MV3 A;  3FX7 A;  5LXT B;  5KA5 A;  4YBZ B;  1UFI A;  4L1K A;  1YHQ V;  2ABJ A;  4RNN A;  2XGP A;  3JAW A;  4JI2 B;  2UVV A;  2BSK B;  5KFD A;  4PDB A;  3I4N G;  2DJV A;  4RB1 A;  2EZP A;  2FML A;  1NU1 H;  4OPH A;  4YIP A;  2ZDG A;  1ZET A;  5J2T F;  3HOW G;  3ZRW A;  3AG7 A;  2DWE C;  2CUG A;  1EKV A;  2C2E A;  2Y4U A;  2HVJ C;  2ZXW B;  3KCY A;  4TV9 A;  5FLX N;  3RJ0 A;  4J9O A;  1DTO A;  1KKD A;  4ME6 A;  2HGS A;  3AG3 C;  3QG5 A;  4RAZ A;  4DR7 B;  5BWU A;  5LHI A;  3QFF A;  1ZUQ A;  5KFK A;  2FJZ A;  2WLI A;  2XHB A;  1S5J A;  2FK2 A;  2R9A A;  1VF5 B;  2Q69 A;  2QWO B;  1KB9 F;  4MVS A;  4LNU A;  1FD9 A;  4DR5 H;  4GX0 A;  2AGP A;  1DLB A;  1FJG B;  1JDB B;  1TWF A;  1GKF A;  3T5J A;  3KYH C;  4R8C A;  2YXY A;  4FGR A;  4F4X A;  4YAJ B;  4HN2 A;  3VQW A;  1IBK B;  4JI4 O;  4PZ7 A;  4JI0 H;  1PKX A;  5LYJ A;  5IP7 G;  1G6U A;  3GLK A;  2YRX A;  4Z1M G;  1R6N A;  4K8X A;  3F7V C;  4O2B A;  3N2K A;  3UZO A;  3PN1 A;  4DYL A;  2H3O A;  3I12 A;  3HOV G;  4DXW A;  4LFC H;  2L6L A;  2UVW A;  5BXZ A;  4AQY O;  5CA1 A;  3AK2 A;  1SQQ H;  3TQT A;  4KXR A;  4FMT A;  3BAB A;  2LGQ A;  3TK1 A;  3ASN C;  5B1A C;  2UVR A;  5FPR A;  3CP1 A;  4FM2 A;  3LUL A;  5KFM A;  3U0G A;  4RB2 C;  2CGN A;  3WG7 B;  4JI2 H;  1ZTE A;  4UUG A;  3CJH A;  4MAM A;  4J7Z A;  4MTD A;  4DL4 A;  3BAA A;  4DR3 O;  5DED A;  5IYZ B;  4MV8 A;  5CAE B;  4DUZ B;  5KFL A;  3GV7 B;  4PDM A;  3C3T A;  1FFT B;  4RUC A;  2HGX A;  3K9S A;  3M9O B;  4DR1 B;  4WCE V;  4O3S A;  2NN4 A;  3HOZ G;  4Z2W A;  4Q4C A;  1G4Y B;  5LP6 C;  1VQP V;  3H1I H;  4YR2 A;  1BJT A;  3GV5 B;  4DV5 O;  5IP9 G;  2AGQ A;  5IT9 N;  3BPZ A;  1K3E A;  2YDE A;  3R9R A;  5LP6 A;  2HVR A;  3L72 H;  1VS0 A;  3CRQ A;  1HR0 H;  1SQF A;  5EZY F;  3E2E A;  4FU0 A;  4KHP B;  2GPW A;  3JSN A;  1ET0 A;  5KT7 A;  3QZ8 A;  5FJ8 G;  3ZX6 A;  1BGY H;  2PYJ A;  1FJG H;  4IRD A;  2RF4 A;  3ZIA G;  2HHF A;  3ETD A;  4LH7 A;  3ETE A;  4XX0 B;  3N40 P;  1KT8 A;  3BRC A;  4FFP A;  1IBK H;  4QWE A;  4ZHQ A;  4LFA O;  1OCR C;  2WLL B;  4ECU A;  5AG2 A;  2IBK A;  4MV1 A;  2VS0 A;  5HV6 A;  4F6R B;  2GHY A;  1Q8I A;  4LF8 B;  4L87 A;  2E5L B;  4QJF A;  3UT5 B;  5DLF A;  2R7L A;  5L3E A;  2VQE H;  1OCZ B;  4RUF A;  2WYO A;  2P4K A;  2CE4 A;  4IWY A;  1AIL A;  3JAW B;  4K8Z A;  1BS3 A;  5I5T A;  1VQ7 V;  3BA8 A;  5LXT F;  2IJK A;  3DTF A;  2R8G A;  3WB2 A;  3ZRW B;  4PA3 A;  4K6N A;  4FM9 A;  2ZIO A;  2W9B B;  5K1X A;  2R7K A;  4JI3 B;  4A2B A;  4DUZ H;  5IJ9 B;  1N32 O;  1JJ2 U;  1NI8 A;  4DK1 A;  3DTU B;  5KT2 A;  4BBS G;  2GTA A;  2CW7 A;  4DR1 H;  2AHZ A;  2QWR B;  3AG3 B;  4LF5 B;  3QWU A;  1WCM G;  1HP8 A;  3SPI A;  4QSH A;  1FXV A;  2DYR C;  4QIW F;  1E4E A;  2BTO A;  2VOB A;  1T3N A;  3ZHV A;  2NLJ C;  5F2V O;  4HNV A;  3MAQ A;  2W6N A;  2ODT X;  1Y76 A;  4NKG B;  3O65 A;  3THO A;  5CA0 A;  4FS1 A;  3H9V A;  1AJN A;  4NXN B;  4YHH H;  2NR5 A;  4KHP H;  2ADQ B;  1JLL B;  2FK3 A;  3PO2 G;  1S0M A;  4GYC B;  2UUA O;  1VBG A;  1ZQ7 A;  5KKN B;  1V55 B;  5LYJ B;  2G38 A;  1BQ0 A;  3TQ1 A;  4GX5 A;  5K2M A;  2JS5 A;  2WA3 A;  1SZT A;  3TXS A;  5JJJ B;  1T36 A;  4I7Z B;  4O81 A;  1TWA A;  5KFP A;  2IM9 A;  3E89 A;  3VQY A;  1A0G A;  4CH3 A;  4PDL A;  3G71 V;  2FE3 A;  3L71 H;  5F9L A;  3VQX A;  5JH7 B;  5CA1 B;  4BY7 G;  3W7T A;  4O4H B;  4LC1 A;  1MZB A;  4LF8 H;  2E5L H;  1JOY A;  2JA5 G;  2YXL A;  4PDV A;  3TII A;  3D36 C;  1GO3 F;  5TIS Z;  3EHB B;  1XMO H;  1NS1 A;  1ZWI C;  3K58 A;  1JPX A;  2YUA A;  2ARH A;  3VOU A;  1I2K A;  1VAR A;  4R7C A;  3N6R A;  5EDW A;  1Q43 A;  3HKB A;  4GZR B;  4P9P A;  2YWV A;  3MFH A;  5B1B B;  2ZDQ A;  2EIJ C;  4X62 O;  1SQX H;  5D8D A;  1ZHQ A;  1M93 A;  2V4R A;  5KFR A;  2AGA A;  4EEQ A;  4O7N A;  3RB6 A;  4JI3 H;  5BZB A;  5IYZ F;  1K1S A;  3H1J H;  4GCZ A;  1Z2G A;  3RYC B;  3MWE A;  1RJR A;  1U96 A;  2QA4 V;  4FK5 C;  3GTQ A;  2YIB D;  1TAE A;  3LQS A;  3KZI Z;  2DE0 X;  1SA0 A;  4ZOL B;  1NR1 A;  3TCU A;  3EXA A;  4ABM A;  4CC5 A;  1H38 A;  2UXD O;  4LF5 H;  4DR2 O;  4ED1 A;  2XAQ A;  1D5A A;  3JAR B;  3WWH A;  5EBM C;  3ZED A;  4I9Q A;  1M56 C;  4JI6 B;  4JF3 A;  2UXX A;  3GTK A;  1SQP H;  2HG5 C;  3T1H O;  1SFO A;  3EYY A;  4RQE A;  2X6B A;  4N21 A;  4NXN H;  1OCC C;  4LH6 A;  3SJB C;  3BA9 A;  4DK0 A;  3LDD A;  3OUF A;  3TGU H;  1Y6X A;  3OHB A;  1OWT A;  1KJQ A;  3C0F B;  4I55 A;  4IL6 Z;  4RNO A;  2Y4T A;  3IJ4 A;  4G2K A;  4FLU A;  5BPF A;  4U7C A;  1GM9 A;  5EYP B;  1RYS A;  1K4D C;  1IBL B;  4CS3 A;  4CH5 A;  5FLM G;  3RGB A;  1KBL A;  4BIU A;  4UVB A;  4NTW A;  4X89 A;  3GB8 B;  4F50 A;  5JUM A;  3ZMZ A;  4MV6 A;  4F4Y A;  5DG7 A;  5KFT A;  5L1K A;  1H2K A;  3V6K A;  2C2R A;  2FB5 A;  3OMI B;  4FFB A;  2R92 A;  5KFE A;  2F1M A;  2Z0A A;  3H0G G;  4WD3 A;  1EZV H;  3B8M A;  3SJQ C;  4DV7 B;  3LML A;  1L2Z A;  2J6S A;  1UC9 A;  3JD0 A;  4CBC A;  2CQY A;  2XIG A;  1TGO A;  1WCM A;  3B4S A;  2EJR A;  1ZHS A;  5KHI A;  1H2M A;  2AW9 A;  3S3W A;  2C28 A;  5BMV B;  4R50 A;  3T1C A;  4CHI A;  1V54 C;  5C5J A;  1RPR A;  4MVU A;  5IYC O;  5LGU A;  1SET A;  4XYL B;  4GX2 A;  1KKC A;  1YZB A;  2GUZ B;  2HHH B;  3H1H H;  5DEC A;  1EUD B;  4RAY A;  3J7A K;  4JI5 B;  4OX9 O;  1Y76 B;  1NT2 B;  1H8H G;  1VQ9 V;  1SQB H;  4DL5 A;  1QLN A;  5J2U B;  3N43 B;  4JI6 H;  1HNX O;  3WWJ A;  3HXL A;  1P49 A;  2RDC A;  1YF2 A;  2I80 A;  1T94 A;  4RUE A;  1EN4 A;  3SNO A;  2IBZ H;  4ECZ A;  4YB8 B;  4JTA B;  3GIP A;  5LBQ A;  4MVO A;  1TVK A;  4LF7 O;  4ICG A;  2LJ2 A;  3L2P A;  2W9C B;  1QNM A;  3ASO C;  3FB7 C;  5LYJ F;  3SI8 A;  3GTL A;  1IXB A;  3RYI B;  3JCZ A;  3HKZ A;  2JA7 G;  1V9P A;  3AYH B;  4BBR G;  5H6Q A;  2Y4R A;  4K3A A;  1W59 A;  1IBL H;  4IIJ B;  5EBL C;  4PZ6 A;  2QWQ B;  4E4T A;  1S5H C;  3BQ0 A;  3V4S A;  1YIT V;  5JH7 F;  4QIW E;  1MG1 A;  1K5Q A;  3K0G A;  4O4H F;  5KG0 A;  3JAT B;  1Y4M A;  2ZM6 B;  2EIN C;  3HKB B;  4IWX A;  1K4C C;  1VQ4 V;  2IJH A;  1S77 D;  3Q8P B;  2W6M A;  4RB3 C;  1I5Y A;  2JJ2 G;  5BYB A;  5L1J A;  1I1K A;  4I7H A;  4DV7 H;  1S03 G;  2CW8 A;  1D5N A;  3ZMT A;  2JGU A;  1XK5 A;  2UXB B;  1OJH A;  3AG2 B;  1WPX A;  2MCT A;  4UB6 Z;  5DM6 V;  2FPG B;  5JJN B;  1QVF U;  4JYA O;  3FKI A;  1SA0 B;  1YEW A;  4LF9 O;  1IZ3 A;  3LUT B;  1KC8 W;  3T9F A;  3BQ2 A;  3D3Q A;  3STL C;  5DMX A;  1VF7 A;  3PZP A;  2HHH H;  2UU9 O;  4ZOL F;  5IYC G;  3M9M B;  1M56 B;  2XOK G;  3VPC A;  4EQ5 A;  3PO3 G;  1AN7 A;  1K7D A;  4JI4 B;  4X8A A;  1P16 A;  1YSC A;  3FYE B;  1VQO V;  2R82 A;  1MSW D;  5GON F;  4MVZ A;  4I50 A;  2BE3 A;  3ABT A;  3K5L A;  5H2F Z;  4O4J A;  1JDE A;  5IJ0 B;  4O84 A;  4R7R A;  4CMF A;  1ARO P;  2WLJ A;  2A3Q A;  4LSX A;  2C2A A;  4TV8 A;  5KHK A;  4EBE A;  3GWO A;  1OCO C;  3JYC A;  5IWA O;  3E8F A;  3P32 A;  5KFC A;  4LF6 B;  4AQY B;  4LFB O;  5LOV A;  3J81 W;  1WB7 A;  3GB7 C;  5H80 A;  3ZHQ A;  3QQM A;  3AG4 C;  1B6Q A;  4JAA A;  3HOX G;  4J42 A;  4DAA A;  3H0G A;  4AIL C;  4BIO A;  5A9G A;  1K34 A;  4B3S O;  4FFB B;  1XNR O;  2C2D A;  4DR3 B;  3HPL C;  4CH4 A;  3DAA A;  1H2S B;  3H20 A;  4BWA A;  2ZM6 H;  1I94 O;  1QLE B;  1IOW A;  1XL6 A;  1KUQ A;  5ITZ B;  3RGZ A;  5IYD O;  4J9N A;  3QZ7 A;  5KFI A;  4X1Y A;  1EN6 A;  2UUB B;  3QO8 A;  1OV9 A;  3UQ8 A;  3Q2O A;  2UXB H;  2VPQ A;  3MHS C;  2Y69 C;  4BW9 A;  4WFG A;  4IYH A;  1AJP A;  4NTY A;  2OYQ A;  2W7O A;  3M4I A;  4DV5 B;  1FPO A;  5I5U A;  3ORR A;  5JQG B;  4X1I B;  5BMV F;  1SEI A;  2YSU B;  3TIN A;  4TUY A;  2CNQ A;  5D1P A;  3RAX A;  1XMQ O;  3E35 A;  1GAX A;  1SQV H;  3CRR A;  3VPD A;  3SYA A;  4O7R A;  2QKS A;  4H33 A;  5KT4 A;  2GLT A;  1XUQ A;  1NTK H;  4Q44 A;  4JI4 H;  2VUM A;  2R9I A;  3TEK A;  5J2U F;  5KFH A;  2JA7 A;  1TVK B;  3MWM A;  4F4Z A;  4LFA B;  1QU7 A;  4QPJ A;  2V59 A;  2XCP A;  4WFF A;  2GQR A;  5DGH A;  2Q9L A;  2DMX A;  1GRJ A;  2N04 A;  2KB1 A;  2WAQ A;  1EN5 A;  2HGW A;  2CFM A;  4O7V A;  4LF6 H;  5D1O B;  4AQY H;  4AYB E;  4FM0 A;  5C3E G;  5IDJ A;  2ZIN A;  2ZT9 B;  3DSQ A;  3JD2 A;  1SQG A;  3U11 A;  1XNQ O;  1SKV A;  2LFS A;  4UCS A;  3NBY B;  1UJW B;  1M57 B;  1YIJ V;  2YID A;  2QKC A;  4IIJ F;  4I9W A;  3JRX A;  2NU8 B;  3QO7 A;  4B3R O;  2YW2 A;  3VOT A;  3I5D A;  4DR3 H;  4J9R A;  4ZI7 B;  2VQF O;  3TJT A;  4HYO A;  1N32 B;  1GM8 A;  2HJD A;  4NZM A;  2VR1 A;  3PW5 A;  3JAS B;  3RBZ A;  2W0F C;  3RYH A;  2WB1 A;  1RJP A;  3BJY A;  4CH6 A;  2UUB H;  3UCS C;  2X0S A;  5KHH A;  1KUT A;  4TWK A;  1KC7 A;  2JEF A;  5DAA A;  5BYA A;  4D7S A;  1KQS U;  4R8U A;  1J5E H;  4O3N A;  4MVR A;  3CWB H;  5FPO A;  5KFV A;  1KBH A;  5BPH A;  2W6Z A;  4QE7 A;  4OXS A;  1S10 A;  3ABK B;  5CBF A;  4RQF A;  5BY1 A;  3FD9 A;  5KMG B;  1YTF B;  3N2G B;  3T1Y O;  1G8M A;  1HDJ A;  2EJ0 A;  4G3I A;  2DQ3 A;  4DV0 B;  1RP3 B;  1XRE A;  1K1Q A;  5B3S B;  1V4Y A;  4JI8 O;  2V9W A;  3SPC A;  2R84 A;  5L1L A;  5BR8 O;  2ZNI A;  2KQX A;  3B40 A;  3OGI B;  1M90 W;  4DRF A;  4LFA H;  2PMZ A;  1S72 V;  2WE6 A;  3MJF A;  3GJX B;  2WAM A;  2WWW A;  4CS2 A;  4DR4 H;  2EX3 A;  2Q7G A;  1B6R A;  4U7O A;  4I0X A;  2XT9 A;  1X9N A;  1KEC A;  3A8T A;  3KTM A;  3W1G A;  1S0N A;  3VQV A;  5GW7 A;  1Z2O X;  5C8Y A;  5FNV A;  3HBL A;  3RR5 A;  3CCL V;  1CE8 A;  1CQJ B;  5KG2 A;  2V58 A;  3HKC B;  4DV6 B;  1QR8 A;  4HZ3 A;  3GV8 B;  2QWN B;  2AGO A;  2YEV B;  1RSO B;  3B09 A;  2YL2 A;  1I50 A;  3BQ1 A;  4X62 B;  1N56 A;  1WA8 B;  2FKX A;  1EBO A;  3SR2 C;  4X65 O;  1EZ1 A;  4DR6 O;  4X1Y B;  1FVI A;  2FB9 A;  1IDS A;  1N32 H;  1I0H A;  4ECW A;  4NXM O;  2DAB A;  4K35 A;  2QEX V;  4YP3 A;  3HKE B;  2BTQ B;  1I2L A;  3H40 A;  3E83 A;  4MVM A;  2HVK C;  4FFR A;  4B08 A;  2UXD B;  2Y69 B;  4DR2 B;  1FFX A;  3RWR D;  5JJE B;  1M7J A;  4EYI B;  1HNW O;  3KXY T;  3QNE A;  3CRC A;  4U3J B;  1AUV A;  3JD4 A;  5L3B A;  3T1H B;  3CEB A;  4W4K A;  5JQG F;  4B3M O;  2EIK C;  1BZK A;  3OUS A;  2OLS A;  3ZMV A;  3U54 A;  1BHA A;  2F43 G;  1HWY A;  4LF4 O;  4DL2 A;  4DV0 H;  2XAJ A;  4ED8 A;  1PM9 A;  4AHC A;  2BR0 A;  3TW6 A;  2YYA A;  2QDO A;  4C5A A;  3OHA A;  4X1K A;  1WPB A;  2FLL A;  3SPH A;  3BY6 A;  2VWJ A;  3CD6 V;  3EPG A;  1F23 A;  4J9Q A;  4IR9 A;  1Z2P X;  4HNA A;  5LMU B;  3KAK A;  4QWD A;  1Q90 D;  5EIB C;  1F51 A;  4DUY O;  3SPJ A;  4WBN A;  1YJN V;  3GIL A;  5EWG A;  3E86 A;  3PW2 A;  4DV6 H;  1TA8 A;  4F6E A;  3FAV A;  2OCC C;  4PJ0 Z;  4YXW G;  3RYF A;  5IE9 A;  4FLX A;  5IY5 C;  4X62 H;  2WLM A;  4CKC A;  4O4I A;  3ETQ A;  1M0T A;  4LP8 A;  1EKF A;  4O86 A;  4ZI7 F;  3A2F A;  2HLD G;  4GT1 A;  3DXR B;  1C30 A;  4DIM A;  1NJI W;  4HYK A;  2ATL A;  3R66 A;  3ZS8 C;  3WWI A;  4DR7 H;  4FFK A;  3CHX A;  2OT5 A;  4DR2 H;  3J81 N;  5HBR B;  3CCR V;  1BSM A;  4OX9 B;  4DV3 O;  4PZ8 A;  2PI5 A;  3KAL A;  3JAL A;  3L70 H;  3HO8 A;  4C5B A;  1ZL8 A;  1P7B A;  4O4L A;  1HNX B;  3T1H H;  4FLZ A;  2I8C A;  1FXK C;  2CH7 A;  4EB6 B;  1QQC A;  3MDS A;  4JI1 B;  2CGO A;  3KG2 A;  1BNC A;  1FXK A;  3OSP A;  1TUB A;  1FAF A;  2C00 A;  1B33 N;  1Y74 A;  2AXT Z;  4LF7 B;  4ZQI A;  4CKB A;  4A2A A;  3DF7 A;  1IX9 A;  4IAJ A;  4UVA A;  4I4T B;  4J9M A;  1M5I A;  2YRW A;  1XHX A;  1OZ0 A;  3ZRS A;  3OM3 B;  1I6U A;  2N74 A;  3E22 A;  3JRW A;  3NBZ B;  5I5V A;  1D2D A;  3UYY A;  3ABL B;  3T2M A;  3HKD A;  5EBW C;  1M4U A;  3FMA A;  1IBM B;  5KFJ A;  3ML0 A;  1DGS A;  2GDS A;  2LP7 A;  5B66 Z;  4J41 A;  3K08 A;  4A3K G;  3JD3 A;  3IFX A;  2V5A A;  4L8J A;  3GTP A;  3CCE V;  3RB0 A;  3K3W A;  4ECQ A;  4J9Z B;  1N33 O;  3F5T A;  5FD6 A;  3CCM V;  3UFX B;  5LMU H;  1SC5 B;  1K97 A;  4B7K A;  1A48 A;  1URF A;  4JYC A;  4MT8 A;  4WHX A;  4TV9 B;  3JAM W;  2R93 A;  3GWK C;  2R92 G;  1Q6I A;  3QVN A;  1CXZ B;  2RCV A;  4O83 A;  4E4E A;  4JYA B;  2VRZ A;  2NU9 B;  3M9N B;  1L0N H;  4LF9 B;  4FFO A;  3ABM C;  2OTJ V;  1FFX B;  4JGS A;  3T9B A;  3G6E V;  5CBG A;  3RFC A;  1C3O A;  4IHJ A;  1N36 O;  2WLI B;  1EM1 A;  4OX9 H;  1EUC B;  4A3J G;  3MR2 A;  4LNU B;  1AR4 A;  4H0L B;  4IRC A;  1TWH A;  4FLT A;  4PA7 A;  5CA3 A;  2DPJ A;  3D3I A;  2RDJ A;  2O57 A;  4JI1 H;  3JSL A;  2WLK A;  5KT3 A;  2ASD A;  4MV7 A;  1XEQ A;  4ED6 A;  4GKK O;  4LF7 H;  3DGE A;  2EUL A;  1GSO A;  4O2B B;  2P5O A;  2ZD9 A;  2FL4 A;  1EFR G;  3J7A U;  5IWA B;  3N2K B;  1DK1 A;  4NYE A;  1MOF A;  4EGJ A;  4MTE A;  2B9Z A;  4LFB B;  5KS8 A;  1VMG A;  1E1R G;  2K9P A;  2R7N A;  2YU9 A;  2B1I A;  4JUZ A;  3ETH A;  2XAS A;  3JAK A;  4UUJ C;  5CB4 A;  1GN3 A;  4DR5 O;  1IBM H;  1I7L A;  1M9N A;  4B3S B;  4JI7 B;  2QGN A;  2PTM A;  5EK0 A;  2PUS A;  3X2Q C;  3I56 V;  2ILM A;  1I7N A;  3ASN B;  3M7M X;  5B1A B;  1R1B A;  3CJH B;  2JS3 A;  1XBL A;  4JV5 O;  2JRI A;  3PR5 B;  2DLN A;  4TT3 G;  4JV2 A;  2IJI A;  4NVP A;  1M0W A;  4J9K A;  1MSD A;  1PL0 A;  1N0J A;  1YCI A;  4LFC O;  3P3P A;  2QE7 G;  4X20 A;  5LA6 A;  2JEJ A;  2UXN A;  3G67 A;  2XND G;  4JYA H;  3FFQ A;  4LR3 A;  4LF9 H;  1QVG U;  3L74 H;  5C1O A;  5KFO A;  1I3Q A;  3HB9 A;  4EKW A;  5EWE A;  2KKW A;  5E79 Z;  1PX2 A;  4YIO A;  4JYB A;  5KG1 A;  2ETN A;  5LP6 B;  5A2Q W;  4LWS A;  3HKZ E;  4O4L B;  4UCO A;  5CMU A;  3FKI G;  2W0X A;  2JK5 C;  2KSW A;  2FYU H;  4MA0 A;  2XUM A;  5JVD A;  5KAF Z;  3IAY A;  2Q7E A;  5KFG A;  2XAF A;  3K3V A;  4H37 A;  3SE7 A;  3WO1 A;  2WSS G;  2HHF B;  3RGX A;  5I60 A;  3UO2 A;  4UCU A;  1EHI A;  4ZHQ B;  2E76 B;  5KX5 A;  3QO5 A;  1VQN V;  3F5W C;  3T5H A;  4PI0 A;  5H5N A;  4EFB A;  3M8A A;  4HR7 A;  4NR1 A;  1OCR B;  3K0D A;  4I4T F;  1HR0 O;  4LFB H;  3K5M A;  4FLW A;  5KG5 A;  4JYY A;  4QJF B;  5KG4 A;  2EBO A;  1RYR A;  4O2A A;  4FFM A;  1XNQ B;  3Q1K A;  1K9M W;  2P4V A;  3PFF A;  2W71 A;  3PW0 A;  1TUE B;  1NH2 B;  2YI8 A;  2LGW A;  4BW5 A;  4YJ3 A;  4JI7 H;  4B3R B;  4UFZ A;  3OW2 U;  1KJI A;  1RJQ A;  2YC0 A;  2DOS A;  4BY1 G;  1OHH G;  2IU0 A;  4UCT A;  3W5O A;  1AI4 A;  3MWD A;  2P0A A;  1VQM V;  1DV2 A;  1PD3 A;  4IR1 A;  4DW1 A;  2AZ2 A;  3WU2 Z;  1JMK C;  3N8D A;  3U10 A;  1Y67 A;  2HJF C;  4HBN A;  1JCH A;  2Q7D A;  4O7Y A;  2EJ2 A;  2VQE O;  4TV9 F;  1H2N A;  2A1H A;  5KHJ A;  2W6I G;  1E79 G;  5J2T A;  1N8R W;  4RCN A;  1E4E B;  3K9A A;  4E6N A;  3KKY A;  5BWR A;  2BOC C;  2DYR B;  4OGQ B;  3ZMS A;  2FLN A;  3AEI A;  5CA0 B;  3T1Y B;  3ZJZ A;  4ED0 A;  2DQ0 A;  3RV3 A;  1SYX B;  2ASJ A;  4JI8 B;  3JZ6 A;  4M7E A;  4FBU A;  2V4D A;  3TY8 A;  1KD1 W;  1I1M A;  1R3K C;  2W7P A;  5CE8 A;  3SYP A;  2HG8 A;  5B1N A;  4KUM A;  3NC0 B;  1DF4 A;  4KFM A;  1Q82 W;  2PBZ A;  1VAJ A;  3J80 W;  1GH6 A;  2VUM G;  5KFQ A;  3HT5 A;  3EVK A;  3G4S V;  5DQG A;  3BHP A;  5CBH A;  4O2B F;  4CE5 A;  2YS7 A;  2ZQM A;  1NZ6 A;  1CS0 A;  2BQU A;  4PDR A;  1OBD A;  1S3J A;  4YHH O;  2DYS C;  1SES A;  2DN9 A;  1N0N A;  2R9R B;  4P9O A;  1VKZ A;  1JFF A;  5CA1 F;  1F4M A;  2CTQ A;  4A3D G;  2Y48 A;  1ZX3 A;  4MW3 A;  3X2Q B;  4B3R H;  3R23 A;  1RK5 A;  4X65 B;  4B3T O;  1K83 A;  4DR6 B;  2Z5U A;  4O7Z A;  4K0K O;  4NXM B;  4Q8E A;  4PA6 A;  2YZN A;  2EIJ B;  5B5E Z;  2COJ A;  4YY3 O;  1HW7 A;  2EIL C;  2DWC A;  3CS5 A;  3Q8S B;  2NU7 B;  2L35 A;  5L9X A;  4TSF G;  1NTZ H;  4FLY A;  1XMO O;  3ZN0 A;  3AG1 C;  2QK4 A;  2W6O A;  1HNW B;  2HVS A;  2A06 H;  4MV9 A;  3T9D A;  4KL1 A;  2LQT A;  3GIJ A;  4BAY A;  4B3M B;  4JV0 A;  1RPO A;  2WAQ E;  3SGI A;  4HNU A;  4JI5 H;  5JVD B;  4A3L G;  4YQW A;  5LP6 F;  3N6X A;  4J9S A;  4EBC A;  4RUA A;  5LHG A;  3K5H A;  4JI3 O;  4LF4 B;  1T5E A;  2COI A;  2XGQ A;  3T1Y H;  4O4L F;  3OEH G;  5H6R A;  3APQ A;  4G27 B;  2E74 B;  4EGQ A;  1OCC B;  4JI8 H;  2XD4 A;  3CRM A;  3JAM N;  3RVZ A;  1R6T A;  2XAH A;  1P8L A;  4I55 B;  5EZY A;  2F4V O;  3GID A;  1FKA H;  3PR4 A;  4R6Z A;  2WTF A;  3T7A A;  1TWC A;  4ZHQ F;  2KG7 A;  2P06 A;  2JVD A;  4O82 A;  2ITC C;  2YIA A;  2ZE5 A;  4BR6 A;  2V7Q G;  4O2A B;  1BQZ A;  3RUP A;  3OMA B;  3TY5 A;  3LWB A;  5LL6 Y;  4DRX A;  5L3D A;  1M6V A;  2GTS A;  3CE2 A;  3K06 A;  4HQ6 A;  4YJ3 B;  3JCU Z;  2RGR A;  4DUY B;  1HNZ O;  2X0L A;  2RQ6 A;  1AI7 A;  2CTP A;  1GTO A;  4D7T A;  4FBT A;  5KUM A;  1AR5 A;  3Q4H A;  5B1O A;  5HFM A;  2YZL A;  4X65 H;  5KFN A;  1F4N A;  2IJJ A;  4RB0 A;  5KG3 A;  3G6V A;  2BQR A;  1R9T A;  4NXM H;  3HOY G;  2VPS A;  3RB3 A;  2QWP B;  4GX1 A;  4C7U A;  1KTA A;  1COW G;  3HOU G;  2FLP A;  5LXT A;  4Q45 A;  2DIK A;  1VIB A;  1SRY A;  2XAG A;  1PK8 A;  5LHH A;  1N34 O;  2Z04 A;  3AX6 A;  1E4F T;  3IC9 A;  4A3M G;  2YZM A;  5DQH A;  1V54 B;  3H01 A;  2BSK A;  1HNW H;  3OTF A;  4ECS A;  2JEX A;  4UXN A;  5DLG A;  2ZXW C;  1YJ9 V;  2R8K A;  1SCU B;  4B3M H;  4H13 B;  4PD4 F;  4EG0 A;  1I08 A;  2ZGI A;  2YIC A;  2QR4 A;  1Z5W A;  1AR1 B;  3K5N A;  2F23 A;  4Q20 A;  3KRE A;  4CKE A;  2CTW A;  5CA0 F;  4X66 O;  2WLN A;  4QIW A;  1XDC A;  4J9P A;  4IRK A;  3OEE G;  3CXC U;  3LSS A;  2Q67 A;  3N27 A;  2AZ0 A;  4QPK A;  3RIZ A;  1S97 A;  2D3O W;  1UPG A;  2NNU A; 
#chains in the Genus database with same CATH homology
 5LYJ B;  5DIS C;  2WDT A;  1XNQ H;  2HVQ A;  4JI6 H;  4X1K A;  2JS5 A;  5EIB D;  1WPB A;  4LSA A;  5JJJ B;  1QHT A;  5FLX W;  2IM9 A;  3L4K A;  3VQY A;  5JCO C;  4CH3 A;  2VWJ A;  2FE3 A;  2VUG A;  3VQX A;  4CC6 A;  4DUY H;  5JH7 B;  2VQF H;  5CA1 B;  5JCO A;  4O4H B;  4LF8 H;  1MZB A;  2E5L H;  2YXL A;  3K5O A;  4HNA A;  5LMU B;  2F66 C;  1Z2P X;  3KAK A;  4X20 B;  5EIB C;  5LA6 B;  1XHZ A;  5D1O A;  4WBN A;  1XMO H;  4DV6 H;  1TA8 A;  5K1P A;  3K58 A;  3RYF A;  4FLX A;  4X62 H;  1Q43 A;  3TY9 A;  4J0M A;  4X64 H;  2RGV A;  3HKB A;  4O4I A;  3ETQ A;  1M0T A;  4GKJ H;  3A2F A;  1ZHQ A;  2O03 A;  1M93 A;  1XDN A;  1N36 B;  3OTO B;  4EEQ A;  4JI3 H;  4ZI7 A;  4DV5 H;  2R72 A;  4DV1 H;  3ZS8 C;  4DR7 H;  3RYC B;  3CHX A;  1CKN A;  2HIX A;  4DR2 H;  3JAS A;  4TQD A;  4OX9 B;  5IYZ A;  2YIB D;  2PY5 A;  1TAE A;  4PZ8 A;  1SA0 A;  4ZOL B;  3KAL A;  4LF5 H;  3JAL A;  4CC5 A;  2UUA B;  2GV9 A;  4UCV A;  4O4L A;  1D5A A;  1HNX B;  5KX5 B;  2PYL A;  4FLZ A;  3T1H H;  3JAR B;  5BR8 H;  4EB6 B;  4GKK B;  4I50 B;  5D5Q A;  1QQC A;  3ZED A;  4I9Q A;  4JI1 B;  4O4J B;  4JI6 B;  5LMN B;  3N41 B;  1TUB A;  1B04 A;  3EYY A;  3U0Z A;  4LF7 B;  4TV8 B;  4A2A A;  3DF7 A;  3F8N A;  4NXN H;  4IAJ A;  4LH6 A;  2UXC H;  4I4T B;  1WH2 A;  2YIB A;  3SJB C;  3KAJ A;  3L4J A;  1WN7 A;  3BA9 A;  1M5I A;  4DK0 A;  1XHX A;  5LOV B;  5KMG A;  3N2G A;  1I6U A;  4DRX B;  4YJ2 A;  3RTX A;  3E22 A;  3NBZ B;  3C0F B;  3HKD A;  4I55 A;  1M4U A;  3FMA A;  1IBM B;  3CVZ A;  2Q2U A;  1DGS A;  4FLU A;  5EYP B;  4RZQ A;  1Q3E A;  1IBL B;  4CS3 A;  4JV5 B;  4CH5 A;  4L8J A;  4DR6 H;  3RGB A;  2F95 B;  3GB8 B;  5FD6 A;  3ICX A;  5LMU H;  5IT9 W;  4FFB A;  4F6R A;  4PHZ A;  4FLV A;  3UT5 A;  3N42 B;  5J2T B;  2F1M A;  4BWS C;  4TV9 B;  3JAM W;  4DV3 B;  3HKC A;  5EOY A;  3K57 A;  1L2Z A;  4DV7 B;  2W57 A;  3LML A;  4JYA B;  1RSO A;  2ZCE A;  2XIG A;  4Q6G A;  5FD5 A;  4LF9 B;  1TGO A;  1ZHS A;  1N36 H;  3OTO H;  1I7F A;  1FFX B;  5KHI A;  4TUY B;  2PGG A;  2E3C A;  3QF7 A;  5BMV B;  4PI2 A;  4IHJ A;  3HKE A;  2BTQ A;  4LF4 H;  3K59 A;  4OX9 H;  2Q2T A;  5IJ9 A;  4LNU B;  2HHH B;  2UUA H;  1J5E B;  4RAY A;  3J7A K;  4FLT A;  4JI5 B;  3LNN A;  1NT2 B;  2Q0A A;  4GKK H;  1JJO A;  4JI1 H;  5J2U B;  3JSL A;  1CKM A;  3N43 B;  2HIV A;  3HXL A;  1P49 A;  4U3J A;  4DV4 B;  4APM A;  4MV7 A;  1HR0 B;  4LF7 H;  2ZIM A;  4O2B B;  4TQF A;  2P5O A;  2UUC B;  4MTE A;  5IWA B;  3N2K B;  1JFF B;  1TVK A;  4LFB B;  3L2P A;  1N33 B;  3JAK A;  5CB4 A;  3RYI B;  1IBM H;  1V9P A;  4DV2 B;  4DR4 B;  1X4T A;  4B3S B;  4JI7 B;  1E4G T;  2PTM A;  1KMI Z;  4EFE A;  2PUS A;  1IBL H;  4IIJ B;  4PZ6 A;  4JV5 H;  4TOI A;  3M7M X;  4FVM A;  4ZIB A;  3JAT B;  3RYH B;  1XQ8 A;  5JH7 A;  2ZM6 B;  2VQE B;  3HKB B;  4NVP A;  1M0W A;  4O4H A;  4RB3 C;  4X20 A;  5LA6 A;  4DV3 H;  4I7H A;  4DV7 H;  1CKO A;  1S03 G;  4JYA H;  3FFQ A;  2CW8 A;  4LR3 A;  2UXD H;  1L8D A;  2JGU A;  2QJ1 A;  1XK5 A;  2UXB B;  4LF9 H;  1CKN B;  3RF2 A;  2MCT A;  5JJN B;  2KKW A;  1SA0 B;  1YEW A;  5LP6 B;  5A2Q W;  4GLX A;  4O4L B;  2P22 C;  4UCO A;  1O9G A;  2KSW A;  1KU9 A;  5JVD A;  3RFR A;  1VF7 A;  5EZY B;  3RYC A;  2Q7E A;  3IAY A;  2HHH H;  3K3V A;  1O9H A;  3GDE A;  4EQ5 A;  2F93 B;  3RGX A;  4ZOL A;  1AN7 A;  4DR5 B;  4UCU A;  4JI4 B;  4DV4 H;  4ZHQ B;  5KX5 A;  1P16 A;  3JAR A;  4EB6 A;  4PI0 A;  4I50 A;  3K5L A;  4EFB A;  4YJ2 B;  4O4J A;  4YHH B;  5IJ0 B;  2UUC H;  4R7R A;  4CS4 A;  5C8Y B;  4JI0 B;  5FNV B;  5GON A;  1GYF A;  4LSX A;  4LFB H;  4TV8 A;  3K5M A;  2R70 A;  4FLW A;  2YCH A;  1N33 H;  5KHK A;  4O2A A;  4I4T A;  1XNQ B;  4LF6 B;  4ETS A;  4AQY B;  4Q0Y A;  5LOV A;  2YI8 A;  4B3T B;  4DV2 H;  3J81 W;  4YJ3 A;  4K0K B;  4LFC B;  4JI7 H;  4B3R B;  1BGW A;  4UFZ A;  4YY3 B;  4AIL C;  3N44 B;  4UCT A;  3W5O A;  4FFB B;  5EYP A;  5LXT B;  4DR3 B;  4CH4 A;  1H2S B;  3H20 A;  4BWA A;  2ZM6 H;  3JAW A;  4JI2 B;  1XMO B;  4PDB A;  1JMK C;  3U10 A;  5ITZ B;  4HBN A;  3RGZ A;  4RB1 A;  4X1Y A;  2UUB B;  2CAZ C;  5KHJ A;  3UQ8 A;  2UU9 B;  1Z2N X;  5J2T A;  4TV9 A;  2UXB H;  4BW9 A;  3IG0 A;  3RJ0 A;  4E6N A;  2OYQ A;  5LMN H;  2HGS A;  3M4I A;  3QG5 A;  4DV5 B;  4RAZ A;  1HNX H;  1ZAU A;  5JQG B;  4DR7 B;  4X1I B;  2RJZ A;  1SEI A;  5CA0 B;  4TUY A;  3T1Y B;  5BMV A;  5D1P A;  1XI1 A;  2HEP A;  1O75 A;  1SYX B;  2F4V B;  2XHB A;  1S5J A;  3CSX A;  2R9A A;  4JI8 B;  4M7E A;  2V4D A;  3TY8 A;  4LNU A;  4X1K B;  4DR5 H;  4JI4 H;  3NC0 B;  5LL6 b;  1FJG B;  1TVK B;  3MWM A;  4LFA B;  3KYH C;  3J80 W;  4FM1 A;  5J2U A;  1Z5V A;  3VQW A;  1IBK B;  4PZ7 A;  3BHP A;  4JI0 H;  5LYJ A;  1HNZ B;  1G6U A;  3QTC A;  1XNR B;  4K8X A;  4HNA B;  2CFM A;  4O2B A;  3N2K A;  3PN1 A;  5D1O B;  4WBN B;  4LF6 H;  1JFF A;  3VNN A;  1I94 B;  4AQY H;  4FM0 A;  4B3T H;  2ZIN A;  3DSQ A;  3RYF B;  4K0K H;  4LFC H;  1SQG A;  3U11 A;  1SKV A;  4UCS A;  4B3R H;  3RYI A;  3NBY B;  5CA1 A;  4O4I B;  4X65 B;  3SJA C;  4DR6 B;  4YY3 H;  3BAB A;  3CB2 A;  4NXM B;  5FPR A;  4DR3 H;  4FM2 A;  4IIJ A;  1N34 B;  2QM4 A;  1HW7 A;  4ZI7 B;  4RB2 C;  4JI2 H;  1N32 B;  3WB0 A;  4MTD A;  3BAA A;  3JAS B;  3JAT A;  5IYZ B;  3RYH A;  4DUZ B;  4CH6 A;  4FLY A;  1S68 A;  2UUB H;  1HNW B;  5KHH A;  3JAL B;  1XMQ B;  2HVS A;  2UU9 H;  4MV9 A;  4KL1 A;  4DR1 B;  3WB1 A;  4B3M B;  4D7S A;  1J5E H;  3SGI A;  4X66 B;  4JI5 H;  5JVD B;  1TUB B;  5FPO A;  3N6X A;  5LP6 C;  4LF4 B;  1T5E A;  1BJT A;  3T1Y H;  3BPZ A;  3W1B A;  2HVR A;  5LP6 A;  1VS0 A;  2F4V H;  2ZJT A;  1HR0 H;  1SQF A;  5KMG B;  4JI8 H;  3N2G B;  1WNS A;  4KHP B;  2ZNJ A;  3E22 B;  5IWA H;  3JSN A;  4DV0 B;  1P8L A;  3HKD B;  4I55 B;  5EZY A;  5D5P A;  2PZS A;  2PYJ A;  4UCR A;  5KHG A;  1FKA H;  5GON B;  1FJG H;  2ZNI A;  4LFA H;  4DRF A;  4LH7 A;  2JVD A;  2YIA A;  2WE6 A;  4O2A B;  3N40 P;  3BRC A;  1IBK H;  3TY5 A;  3GJX B;  4CS2 A;  4ZHQ A;  1HNZ H;  4DR4 H;  2EX3 A;  4DRX A;  2Q7G A;  4B3S H;  1X9N A;  1XNR H;  1A0I A;  4YJ3 B;  3W1G A;  3VQV A;  5IJ0 A;  2RGR A;  1Z2O X;  5C8Y A;  4DUY B;  5FNV A;  2VQF B;  3RR5 A;  1I94 H;  4F6R B;  1Q8I A;  4LF8 B;  2E5L B;  3UT5 B;  2OWO A;  2RQ6 A;  4D7T A;  2VQE H;  3HKC B;  4X65 H;  4DV6 B;  2WYO A;  3SJC C;  4RB0 A;  2Q7H A;  3JAW B;  4K8Z A;  3B2E E;  3S24 A;  4NXM H;  4X62 B;  3BA8 A;  2VPS A;  4X64 B;  3SR2 C;  1N34 H;  4X1Y B;  3WB2 A;  1FVI A;  4FM9 A;  1N32 H;  5LXT A;  4GKJ B;  4IHJ B;  2ZIO A;  1E4F T;  5K1X A;  3HKE B;  2BTQ B;  4JI3 B;  4A2B A;  4DUZ H;  5IJ9 B;  4DV1 B;  2YI9 A;  1HNW H;  3OTF A;  4B08 A;  4DK1 A;  5ITZ A;  1XMQ H;  2UXD B;  4DR2 B;  1FFX A;  2CW7 A;  3RWR D;  5JJE B;  4DR1 H;  4B3M H;  4LF5 B;  3QWU A;  4LMY A;  3KXY T;  4X66 H;  4U3J B;  1Z5W A;  3T1H B;  2VWK A;  5BR8 B;  2BTO A;  2VOB A;  3K5N A;  1Q5O A;  3MAQ A;  5JQG A;  4X1I A;  3THO A;  5CA0 A;  4NXN B;  4YHH H;  2UXC B;  4KHP H;  3JAK B;  5CB4 B;  3RIZ A;  4DV0 H;  4GYC B;  4AHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...