4LH7A

Crystal structure of a liga inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
321
structure length
321
Chain Sequence
EQQPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
publication title Identification through structure-based methods of a bacterial NAD(+)-dependent DNA ligase inhibitor that avoids known resistance mutations.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 111
structure length 321
sequence length 321
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4lh7A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4lh7A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lh7A02
1P8LA 4LF7B 2VQFB 3RTXA 4X64B 4EEQA 3TY5A 3NBYB 3S24A 4DR1B 1N34B 3W5OA 3JSLA 4LF6B 4EFBA 4X62B 4LH6A 1A0IA 4JI0B 4DR5B 2HHHB 5D1OA 1XDNA 5BR8B 4LF8B 1XNQB 4TOIA 4DV7B 3T1HB 1HR0B 4GKJB 5D1OB 4AQYB 2HVQA 2UU9B 1P16A 1X9NA 2E5LB 4GKKB 1S68A 1HNXB 4YHHB 4NXNB 3T1YB 4DV5B 3BABA 1XMOB 5IWAB 4JI8B 1N36B 4JI6B 4DV3B 4EFEA 2UXCB 3NBZB 4LFCB 4DV4B 3W1GA 4JI7B 1B04A 1I94B 1CKMA 3BA8A 3PN1A 3OTOB 1XMQB 2F4VB 4YY3B 2UUCB 5D1PA 3BA9A 4E6NA 4UCRA 1CKOA 3GJXB 3GDEA 2OWOA 2HIVA 3KYHC 5FPRA 4JI1B 4LFAB 4CC6A 4JI2B 4PZ7A 4GLXA 4UCUA 4UCOA 1V9PA 4DR6B 4B3RB 5DISC 3W1BA 4JYAB 1FVIA 2HIXA 4UFZA 4B3TB 4DUYB 3VNNA 1IBKB 4DV2B 1TAEA 2HVSA 1HNZB 5FPOA 4JI5B 3GB8B 4DR7B 4JI3B 4LF9B 4EQ5A 1XK5A 3JSNA 4B3MB 2VUGA 1ZAUA 4LFBB 3L2PA 2Q2TA 4DRFA 4X66B 2VQEB 4DUZB 5LMNB 1J5EB 2UXDB 4DR2B 2HVRA 4JV5B 4KHPB 3QWUA 3UQ8A 3TY8A 4JI4B 4UCVA 3SGIA 1N32B 1IBMB 3RR5A 4X65B 1CKNA 1DGSA 4DV6B 3BAAA 1VS0A 4DV0B 4PZ8A 1CKNB 4DR4B 4K0KB 4PZ6A 2ZM6B 1HNWB 3TY9A 4OX9B 4DR3B 1FJGB 4LH7A 4CC5A 4UCTA 1XNRB 4B3SB 2Q2UA 1IBLB 2UXBB 4LF5B 4NXMB 2UUBB 2CFMA 4DV1B 4UCSA 2UUAB 1N33B 4LF4B 5LMUB 3NC0B 1TA8A
chains in the Genus database with same CATH superfamily
1KU9A 2E5LH 4RUEA 4HNVA 3RYHA 2R85A 4E4TA 5KMGA 4FZ0A 3RF2A 1U97A 2VQFO 4PELA 3JZFA 5KMGB 5L3BA 3ETJA 4J7JA 1NT2B 3JZIA 4O81A 3HBLA 5D1OA 5KT2A 4X62O 3DTFA 5C8YF 2D2CB 3MD0A 3E89A 4TOIA 3OUZA 1SQFA 2IJJA 2BTOA 3M99B 4AQYB 1M0TA 1OJHA 5D1OB 3JD0A 4BY7G 4ABMA 3U0ZA 3GWOA 3M7MX 1A48A 1S0OA 1DF4A 4TV9A 5I5XA 1K7DA 3T9EA 1UC9A 2Y0IA 1S68A 4PJ0Z 1FFXA 3QQMA 4TV9B 2DABA 3ZRWB 3EHBB 4PA4A 1OCZB 1FFXB 2Q8VA 1CE8A 3VPCA 3M9NB 2Y69B 4C5CA 3NUAA 2ZINA 3OEEG 4CMFA 4LSXA 3RAXA 3CX5F 4X9QA 3W7XA 4JI7B 1KJJA 5BWUA 2ALZA 2CKZB 2BR0A 4MVRA 3IAYA 1I94B 1G2WA 2FLLA 4UV9A 1AR4A 3BPZA 1GYFA 3PN1A 3QO7A 4EBDA 1HNWH 1BNCA 4LF9H 1I5XA 1JJ2U 1PV0A 3FB7C 3CMAV 1DK1A 3PZPA 4FLTA 1NBMG 4BY1G 4UFZA 4QW9A 2UXDH 2XCAA 1PPJH 4UVBA 4Q4CA 1Q6IA 5J2UB 1TWAA 5B1BB 2HVSA 2W6ZA 5DG8A 4YQWA 3C3TA 5B1OA 1R3IC 3FFQA 1FYJA 4NZNA 1N4CA 2R92A 3EXAA 4X89A 5BPHA 2JK5C 1WLEA 2HEPA 4J80A 3P30A 4QNHB 2NLJC 1KD1W 2YZGA 1BS3A 2HP8A 2A7WA 3CE2A 3PW0A 1FJGH 4O2AF 1R73A 1L2ZA 1IZ3A 4NZOA 3HO8A 3ZMTA 5BWXA 4J7ZA 1P84F 1HNXH 4UCVA 1KT8A 4DR2O 2W9CA 5EIBC 4MVZA 4ED1A 1NVPB 3U54A 3ZMSA 2DJVA 4K0KB 3H20A 3CEIA 2IM9A 3HKBA 1AJQA 2YS6A 4OX9B 2DWDC 2LQTA 2PZSA 2QF7A 1L0NH 4PDMA 1ZSPA 4NKGB 5L3FA 2RMKB 2R6FA 3KAJA 3WWIA 4QWDA 2XC9A 3K9AA 2LP7A 4KUMA 1MSWD 5F9LA 5LL6Y 2ATKC 3JATB 2QWOB 3M4IA 1S3JA 4Z2WA 5KT6A 2CW7A 2VPQA 2DWEC 5J2TB 3ZRSA 1K1QA 1K83A 5KFVA 4C2MA 4HQ6A 1SZTA 4J9ZB 4FFOA 2K1EA 2EIYA 3ABKC 4AHCA 3T4ZA 2Q4PA 2EILC 4O7ZA 4JV1A 3ASOB 3FYIB 4O4HF 4YAKB 3GV8B 1HR0B 3BQ2A 3UCSC 4ECQA 1XMQH 2WAQA 3KTMA 5D5PA 2PBZA 1NTZH 5KFPA 3RW0A 3WU2Z 4M7EA 3OGIB 2OTLV 5C5JA 5IY5B 1N48A 2VPSA 1YF2A 4Q44A 2Q6AA 4YIOA 3OUFA 3A0HZ 4J9KA 1VAJA 2R86A 1SC5B 5CA1B 4U7CA 2CTPA 2PI5A 4DV4O 1I2KA 4A3GG 4I4TF 2DE0X 3T9FA 2ZR2A 1QVFU 3CCRV 4YY3O 2CGOA 5KFKA 4TQSA 2V59A 4JYBA 1RFYA 4GX0A 1V9PA 3PW2A 2CGNA 5DISC 1B6RA 1K4CC 1PX2A 2DN9A 1Q90D 1FVIA 2VQDA 2R8IA 3ZRVA 2K9PA 2WDTA 2JA8G 1VQ4V 4ZI7F 1FXKC 2FB5A 2N04A 4G2KA 3AEIA 1QQCA 4XZ3B 1BGWA 3WG7C 1FFTB 2JA6G 2W57A 2C2RA 3ABUA 1JMKC 1BHAA 3H4BA 3K58A 3GWKC 3IFXA 3RB6A 5KFQA 3D36A 2XGQA 2A3QA 1I1LA 2QKCA 1OZ0A 3A2FA 4DV1H 3AG2C 1Q6UA 3MWMA 1S9FA 2DYSB 3OUSA 5DMXA 3RR5A 4A3BG 2VUMG 3K5OA 2W6NA 1KYOF 2R70A 4PZ8A 4MTDA 4PBCA 1HNWB 5KFIA 1Y14B 4JI0H 1TWCA 3JALA 5BWVA 4JPRA 2Y0PA 4KP4A 5H9CA 2VOBA 3FYEB 2V4QA 3JALB 1D2DA 2IBZH 1MNGA 3MDSA 3LP8A 2WLJA 3B4SA 4A3LG 4JYAH 5LMNO 4FBTA 2X6CA 4F6RA 1VKZA 1SCUB 3U11A 5EZYB 4RB3C 2P7TC 4CZZA 4F6RB 4FPPA 4CH4A 4BIUA 1IXMA 3BVOA 3V6JA 1S0NA 1KC7A 2W71A 4LC1A 5DAAA 1VF6A 4TUYA 1E4FT 3U55A 1PD3A 4F4YA 1M90W 2GTAA 5C1PA 1HNXB 4B3SO 1JLLB 4WFBV 3T1YB 3LNMB 1JXLA 1NQTA 5B3SC 1Q82W 2IMWP 5LGTA 1KJQA 4FFLA 1V54B 2ASDA 1XMOO 5CE8A 5DQHA 5IWAO 1MZFA 4LF6O 1M0WA 5L9XA 2QM8A 4RU9A 4J9OA 3V6HA 3G6BA 4NVPA 1QR8A 2EJ0A 3ZIAG 4FU0A 1THZA 2E2HA 4JI5H 2WLKA 3A0RA 3C90A 2JRIA 3OM3B 4R8CA 1OCRC 3GLKA 1SERA 4ED7A 4PZ7A 3N42B 1N8RW 5LP6C 2FK3A 3BRCA 4BAYA 5FR9A 1JR9A 3SR2C 2EZPA 1CP9A 3N6RA 4FVMA 2YRXA 2YSUB 5KFCA 4JI4H 5B1AC 1TAEA 4O7RA 4O86A 2Y4TA 1IBMH 1J95A 4Q20A 2HR3A 3FDSA 1W0KG 2L6LA 1MSDA 3GB8B 3TW7A 5KFBA 2LGWA 3R5XA 3JAKA 5KX5F 4UB6Z 3FKIG 3SYOA 1WAZA 3Q4HB 2JDIG 3L2PA 5H6RA 3JD1A 4DRFA 3JAKB 4A3MG 3ASNC 2R7ZA 4TQRA 2EIJB 1LUWA 4J9QA 3LSSA 4NLGA 1ORQC 2HVRA 5KFAA 2PY5A 2X0SA 2Q67A 3RBEA 4BWSC 5E1AC 4ZHQA 4DR6O 1BQZA 1M57C 1I1KA 5EOYA 2OIGA 1GSOA 4MSWC 4LF7H 1ZX3A 4J9NA 3TGUH 3ZMUA 4ZHQB 3MR6A 1JX4A 2ZNJA 4YR0A 4DR1H 4AILC 4MV6A 1UJWB 3A8TA 4B3SB 2ADQB 1V55C 3A0BZ 3K04A 2WLNA 2UUCH 2NVXA 5EWFA 4DV7H 2ASJA 1Y6XA 5C8YB 2OLSA 4EG0A 4ZIBA 1YTFB 3LNNA 2BE3A 2SCUB 1I50A 4LF6B 3MAQA 3L4KA 2UUAO 3F5WC 5EC1C 2EJ2A 4CH6A 5I60A 4I7HA 5LMUO 5JCOA 4X1IA 1SKVA 3ABLB 1LNQA 2AHYA 4X1IB 3ZHSA 4IR9A 1H2KA 2HHHB 4MTEA 2NVYA 3VA7A 1Y76B 1XDNA 3T1HB 2IH3C 3VMMA 3F8NA 2HVQA 4Q43A 1WPXA 4E2LA 4FLYA 5BR8O 4I50A 2Q73A 3BJYA 2X0LA 3MWEA 2DYRC 3K06A 4GX5A 3I55V 4FFPA 2FE3A 2EIKC 2HJFC 1KMIZ 3Q8QB 1BHBA 4DV5O 5LXTA 1RK5A 4MV9A 4BIZA 4JI8O 4G27B 4FFMA 4F4ZA 5LXTB 3FX7A 1OBDA 3ZMVA 5BWRA 4DW1A 2CE4A 4E6NA 1VQOV 4OPAA 1AR5A 2COJA 2HIVA 1OCOC 3T2MA 4CKCA 5I5SA 3JAMW 1WP7A 3AG4C 4DR6B 4J41A 2AHZA 2CW8A 4ICGA 3APOA 4JYAB 3I12A 2G38A 4GUNA 1NZ6A 2Q5ZA 5JH7F 3M8AA 4B3RO 2CNVA 2VS0A 2ODMA 4CH3A 4NXNO 3R5FA 1K1SA 1NH2B 4HAMA 4O2BB 1P7GA 1OBGA 3AK2A 1AI7A 1EN5A 3Q2OA 2DPIA 1YTFD 3HKZA 1FXHA 3PJSK 1SESA 4HNAA 4DV2O 3TXQA 1HNZO 3LSUA 2PYLA 1HWYA 2JJ2G 1VQ6V 1VF5B 1MG1A 4HNAB 1WCMG 1CEZA 4AYBA 3EPIA 3MFIA 3RWRD 4Z1MG 3PR5B 5EBWC 1M1KW 3X2QB 2WE6A 2FB9A 4WFAV 1JOYA 4A93G 2GUZB 4PWQA 1NR7A 1K9MW 2VQEO 3T4DA 3OR6C 4N23A 4JI2O 3HB9A 5L3DA 4A3JG 1Y74A 1Y67A 3CD6V 4DO2A 4MS2A 2M6YA 1Y74B 2E2IA 2L35A 1C3OA 1UPGA 4O4IA 5JQGA 3TIGA 3AX6A 2YWVA 5LP6F 3S3WA 2BQ3A 1F4MA 5JQGB 2ZM6O 2NR5A 2ZR3A 2JA5G 1K5SA 4JI1H 4BWAA 2QWQB 2BQUA 4DRXA 1Q86W 1N33O 2XIGA 1Y1WG 2YI8A 4DRXB 4HNUA 1M6VA 3LDEA 3TXSA 5KKNB 2A0LA 1BT8A 2M05A 1LR1A 4RB0A 2JGDA 1M9NA 4OPHA 4F4WA 1N56A 1XOUA 4U3JA 4JI7H 2JGDB 2BTQB 5KFWA 4FLWA 2FPIB 2FK1A 2IU0A 3LDCA 2DIKA 3J80W 2JEFA 4DR3O 1EUCB 1YIJV 4DL2A 1XEQA 4NXNB 2NNUA 4NXMO 5DQIA 4RQEA 1CPYA 1H2MA 1RJPA 5KAFZ 4BBRG 2RDJA 1EZVH 4MV8A 4X65H 2JEUA 4DIMA 2AGAA 1R3KC 1Z2GA 2Z3YA 2UUCB 1S77D 3RBDA 3B8NA 2PI4A 2P67A 2ODTX 4B7KA 2XTAA 4JI2B 4F4XA 2HGXA 1VMGA 2YUAA 4UCOA 1GN6A 1XHZA 2YZLA 1I6UA 3JARA 2E76B 3LWBA 4DAAA 3B2EE 4A2AA 2YIAA 4GX2A 2HIXA 3H1LH 4ECSA 2R9IA 3JARB 3C0FB 3U9SA 1VIBA 3VNNA 1IBKB 1CXZB 3ZHTA 1TVKA 1QLNA 3CSWA 5KFLA 4GC6A 1VF7A 4KFMA 1PP9H 2V9WA 3UO3A 1TVKB 1ZAUA 3OMNB 4K0KH 2V1DA 3D3IA 2CDYA 3KALA 2QKAA 4C7UA 1S5JA 3CCQV 3H1IH 4X66O 2ZDIC 3L75H 4X1KB 5DGHA 5IYBO 2EJ7A 4IIJB 1BXRA 4JV5O 4KHPO 3SYPA 4DV6B 4QE7A 3OFNG 3G67A 1Q81W 3CSXA 4PA3A 3P3NA 1EKFA 4R6ZA 1EKVA 2W7PA 4DR3B 1YJNV 1AJNA 4B7EA 5DLGA 3V4SA 4NXMB 3TIIA 5LA6F 5KT5A 1I7FA 4B3MO 3N2GA 1XNRO 4FM2A 2F95B 4JAAA 4X20A 2J6TA 2R72A 5JWPA 5A2QN 3N2GB 1M93A 4DUZO 2W0XA 4HYOA 4X20B 2C2DA 4EEQA 2GV9A 3CEBA 3NBYB 3W5OA 4FLUA 5BMVF 4QSHA 5EDWA 1AI6A 2W6QA 1B33N 4RAIA 2YICA 4J9SA 1O75A 3DTGA 4ETSA 4DR5B 3W7TA 5LYJB 5IYZF 3UFXB 1XNQB 2JS5A 4MA0A 4DYLA 3ZX6A 1RJQA 2KKWA 1YXBA 4X1YA 3U10A 3G6EV 4MTGA 2GQSA 5KG3A 1X9NA 3CJHB 5KFYA 4JZGA 5KG6A 3OSNA 4RNNA 1Y4MA 4ZOLA 1S03G 4LWSA 3PW4A 1N36B 1VEWA 4ZOLB 1VQLV 4LWSB 4EGJA 2H94A 2W6IG 2XAQA 3E22B 4TV8F 3T9AA 1ROPA 4R50A 2P5OA 4DV3O 3ABKB 4PDBA 3MJFA 3OTOB 4IZOA 2GHYA 2BOCC 3CWBH 3GJXB 3KYHC 4JI1B 1PK8A 3D3QA 5CBFA 4GLXA 1Y66A 1P49A 3CCUV 1KKCA 3ZRWA 3JAMN 3RN4A 4WBNB 4O4JB 4U3FH 2YS7A 2FPPB 5JJNB 4QGPA 3UZOA 4O7WA 3R23A 2JA7G 1AROP 5KFRA 3ZMZA 4DUYB 1WH2A 2MK3A 2PUSA 4PA7A 5H80A 4O4LF 4JZ2A 1A9XA 1KQSU 5B66Z 5IYBG 3M9MB 2UXCO 5CBGA 4O7TA 1GN2A 5LGNA 4B3MB 4O7LA 1JA8A 3CCJV 3CP1A 4RNMA 4QWBA 2VA3A 3KZIZ 4DUZB 1ZTEA 1AI4A 2HGWA 5EBMC 1Z2PX 1SS3A 4DQNA 5KFXA 1J5EO 2F1MA 1V4YA 4WFEA 4IL6Z 5J2UA 1FXKA 2WPDG 1H2LA 4MW3A 5FLXW 4X65B 1CKNA 2GLTA 2LW7A 5IYCG 5CMUA 1FXKB 5CA0B 1CKNB 4FLZA 1GM9A 2LW1A 1JDBB 2F43G 1FKAO 3K08A 4DL7A 3IC9A 1BMFG 5E25A 2GPSA 5KFOA 4FE2A 1Q3EA 1E79G 3Q8RB 3ETHA 3E8BA 1Q5OA 3JAWA 4MVOA 4DR7O 3E35A 3F5TA 3TINA 2FYUH 3JAWB 3OMAB 2UUBO 4MVQA 3NC0B 2W70A 3AG2B 2VQFB 2ETNA 2R7NA 3CXHF 2FMAA 3EPGA 4NR1A 3T1YH 4LF4O 1GLVA 1TGOA 3N43B 1BZKA 1TUEB 4X62B 5LOVF 4YJ2A 1ZHSA 3H9VA 1SQVH 2LFRA 1KEEA 1XUQA 1KECA 3CRAA 1GRJA 4YJ2B 3GTJA 3OAAG 2COIA 5IYDG 1ZETA 2R93A 1G8MA 4BIOA 4DV0O 4ED2A 4HZ3A 5L3GA 4MA5A 4I5SA 5FLMG 4IWXA 1ENVA 2P0AA 2RCVA 3OW2U 4WCEV 2Q0AA 1VBGA 3G4SV 4JAVA 3JATA 2UU9O 1ULZA 3K3WA 2M7WA 4LBEC 2E5LO 1S5LZ 4UVAA 5J2TA 1H2SB 4EKWA 3KG2A 4YHHO 3SJQC 2KQXA 3M9OB 2R92G 2UXCB 3NBZB 5FNVA 4QIWA 3J81W 3CRRA 3N27A 4QWCA 4JTAB 3H01A 3SPJA 3RB4A 1B04A 5FNVB 1BQ0A 3SNOA 4U6PA 3SYCA 4MV3A 1CKMA 3CQZA 2OCCC 1N34O 1SQBH 1YDXA 3KCYA 5L1JA 1ZLZA 2QB5A 4J10A 4TM5A 5DGIA 3AW8A 4RUCA 4FS2A 3K0DA 3KCXA 1IYEA 4P9PA 2CAZC 4ECTA 4ECUA 3BEHA 1RPRA 5LMNH 5B3SB 4GKKO 5CA1A 2AGQA 1EM1A 2IP4A 3P32A 3HOVG 2FL4A 4MV1A 4K35A 4PI2A 3RYFA 3RIZA 1GN4A 1WJZA 1NS1A 2QA4V 4DR7B 4FLVA 3ABMC 3RVYA 3RYFB 4IT5A 4LF9O 1OCRB 1GSHA 1NVPD 2PMZE 2W9AA 3CHXA 1W96A 2KB1A 4YAJB 4FM9A 2PN1A 2LFSA 4B3SH 4ECXA 5BXZA 4DR2B 3H1KH 5J9PC 5C44G 4LFAO 5I47A 1IXBA 3L71H 1YSCA 5DM6V 3GIQA 4IHJF 2Y69C 4ECRA 4DL6A 3CC4V 5IWAH 1S0MA 4O3PA 4LF6H 4PD4F 5B1AB 3KHRA 4EBCA 5IT9W 1S10A 1NR1A 2CTQA 4DV0B 4B3TO 1EKPA 1XREA 3N6XA 2WLLA 4GCZA 4RAYA 3OSPA 4CMDA 3AYHB 1CQIB 4MTXA 2E3CA 3OEHG 4U7OA 1SA0A 2WLLB 2DPJA 1I0HA 3ZRXA 1JIHA 2HHHH 4I7ZB 2P6JA 3ASNB 4WFGA 4CS2A 4R7RA 3P3PA 1FJGO 2R8GA 2F66C 1SA0B 3T1HH 1Z2OX 4YP3A 1IX9A 4TQDA 4LFBO 5FD6A 1MZBA 1SETA 4NTWA 4X88A 5EC2C 1IOVA 2P4KA 4MTFA 3RTXA 2V4DA 1AVMA 1M57B 5KFJA 1N34B 1KJIA 1R6NA 5JVDF 4D6TH 4O83A 4I55B 2XNDG 2IW5A 1PL0A 2YZMA 3I5DA 3VQYA 1AB3A 2DW4A 3FKSG 1AUXA 3W7WA 4QWAA 5K2MA 2W6MA 1VQNV 3KXYT 1IVSA 5KFDA 5EK0A 4WF9V 4EGQA 4LF8O 2W8KA 1H2GA 4GKKB 2I8CA 3E8GA 2IA6A 2RQ6A 4W4LA 4DK1A 4JTDB 4DR6H 2RNBA 2RGRA 1EHIA 3HKCB 3VQWA 5EZYA 5IJ0A 1K33A 4DV4B 3W7SA 5GONF 4MV7A 2QSAA 1U96A 5IJ0B 5HBRB 4A3IG 2A1HA 4YY3B 2VRZA 1FD9A 1W59A 1A32A 1VQ9V 3ETDA 4LFAB 2JEJA 2X6AA 2Y0SE 3G80A 2RDCA 3E86A 3PW5A 4Q4DA 3T9BA 2DYRB 2AW9A 2UUAH 3R9RA 2EIKB 4B3TB 4PDLA 4QE9A 3E8HA 2YXYA 3OR7C 5KUMA 1GSAA 2NU8B 2O03A 3GB7C 5FPOA 3RGBA 5KS8A 4RO2A 1WNSA 2QWNB 4APMA 3RB3A 3LSQA 5GW7A 3O9OA 1B6SA 1R1BA 4LFBB 2OH2A 1OCOB 1GTOA 4QW8A 5EBLC 4JV0A 4BW9A 4YJ3A 4EEYA 3AG4B 2QJ1A 2DQ0A 5F2VO 2R9AA 4PI0A 3LULA 5JVLA 3JD2A 4YJ3B 4RZRA 3I56V 2DQ3A 5KG1A 4DV5H 3B8MA 1K34A 4FFRA 3HB3B 2UXXA 3UT5B 3STLC 4P2ZA 2CTRA 3K59A 2DZDA 1K5QA 3GIJA 3Q4HA 4RUAA 5CB4F 3H3VH 2IH1C 2ZIMA 4HBNA 1RSOA 4JI3O 3BFRA 4QPJA 3PW7A 5BY1A 4A3EG 3KHGA 3G6XA 3UM7A 3SPGA 1RSOB 1R3JC 4IRKA 5LMNB 1TUBB 3G71V 4DV1O 1AR1B 3WWJA 4MT8A 2QTSA 4NXNH 1ZWIC 3TQTA 3K57A 4A3FG 1BGYH 2C00A 3U9TA 4ME6A 2FMLA 5CAEB 4LH6A 4DL4A 3QTCA 4PDVA 3B09A 2ZE5A 1P7BA 2IJKA 4TV9F 4JI0O 5KA6A 2HDKA 1WPBA 4I9WA 2ADPA 2JGUA 5C8YA 3HKDA 4GKJO 1GH6A 4YIPA 2VQEH 4A3DG 1IBLO 1TWFA 3HKDB 3WNZA 4JI2H 1XMOB 1H8HG 4ZBMA 4YB8B 5IWAB 4O3SA 2JVDA 2RN9A 1WB8A 4JYYA 4J9YB 2EZOA 4ASUG 2C28A 3T5KA 4D7TA 1Y1VA 2R7ZG 2ZKOA 4X64O 1Y76A 3FMAA 1IBKH 5DGBA 3DTUB 2ZNIA 5BWWA 3AG1C 4FM1A 1W0JG 4UCRA 4TVIA 1FXVA 4C5BA 3FB6C 5KG0A 4CC6A 2WB1A 2AZ0A 3DGEA 1N33H 1R6KA 3GVMA 2I80A 5AG2A 5DLFA 1G4YB 2JJ1G 1QHTA 3OD4A 4JI6O 4DV6H 1SQXH 2XD4A 4JI3B 4EQ5A 1UC8A 4F4LA 1H8EG 3U0GA 4P9OA 1JKJB 4FBUA 1SF9A 4FM0A 4JI5O 4I0XA 1UNNC 5KT3A 4DR3H 3K9SA 5KFNA 2AZ2A 4I0XB 1VF6C 3PO3G 3QVNA 2CH7A 2YIDA 3UO2A 1EN6A 3NR7A 3H1HH 2XCPA 4NXMH 1KKDA 4O2AA 4QWEA 3T1CA 2CH7B 2W0FC 5IP9G 4O2BA 3TW6A 4O2AB 1SQGA 1G1XB 1DGSA 1F23A 4JI4O 2WLHA 2JEXA 3QZ8A 4GYCB 1IBMO 4K6NA 1RK6A 2ATLA 1DTOA 5I5WA 4CC5A 4DR4O 4DR5H 4DW0A 4XYMB 1IBLB 1KBLA 3B40A 2A06H 4NTYA 5L3EA 2CFMA 2GUZA 1XNQH 2UUAB 4UV8A 5J2TF 4DXWA 2YU9A 3F7VC 4QIWF 3VQVA 3STZC 1PNLA 5LMUB 2EJ3A 2V4RA 2HJDA 2JS3A 3JZ6A 5IDJA 4ECZA 1KUQA 5KFZA 1AP5A 4UXNA 3WB2A 4X64B 3RUPA 3TY5A 4Q45A 3RT3C 4LF7O 2ZDHA 1AN7A 4FGRA 1N36H 1N32O 3CS5A 4DR1O 3CB2A 1D5AA 5BR8B 3HT5A 3GQCA 4OXSA 3N41B 2YIBA 3N2KB 3OTOH 5D5QA 4QJFA 3K03A 1I08A 4O4HA 1P16A 4QJFB 4X66H 3TCUA 4O4HB 5CA1F 3BABA 4DV5B 5EYPA 2UXBO 4JI8B 4KHPH 3CXCU 4RZQA 1XI1A 2OIEA 5EYPB 4JI6B 2ZDGA 1Q43A 4XYLB 1JDEA 1GGOA 1R6TA 2A9HA 4DUYH 2BTQA 4RWUA 4LFCO 3GV7B 1E1RG 5JUMA 1WSCA 4EB6A 4MW8A 1AJPA 2W6PA 2IJHA 4JUZA 2YL2A 3HOUG 2LO1A 4I4TA 5FPRA 3ZJZA 2KSDA 1NH2D 4EB6B 2F4VO 3HXLA 4B3MH 3BQ1A 1XNRH 2X5RA 3SI8A 4JTCB 3ORQA 4I4TB 4Z1VA 4O7VA 1CQJB 4B3RB 1DAAA 4DUZH 2H8PC 3W1BA 2ZE7A 3W7UA 1B3QA 4XDLA 4M0JA 2B63G 2P22C 3CRCA 1RM1C 4CBCA 4DV2B 1Q8IA 1R3LC 1HNZB 1I5YA 1I2LA 2HHFA 3GV5B 4XBFA 1AILA 1XHXA 3RVZA 4ZI7A 1XBLA 1QLEC 5ITZB 2OYQA 2HHFB 1YEWA 3HOWG 5CA3A 4ZI7B 1L1FA 4ED6A 4GZRB 2Q2TA 4YR3A 5C93A 3SJBC 3EYYA 2VQEB 3OUUA 5CBHA 2HKOA 3HKEA 2Q7DA 3WWHA 1GMGA 1VQMV 5H2FZ 3WFVA 2I87A 3QWUA 3HKEB 1AUVA 5I5YA 5KG2A 5KFFA 1MOFA 1N32B 3E8FA 4K3AA 2V58A 4QIWE 1AI5A 3L70H 4MVSA 2VQFH 2YIBD 3BAAA 1GM7A 4FMTA 2R7MA 2R87A 4CE5A 2UVVA 1MMMA 3VPDA 1BSMA 2ZM6B 3APQA 4X62H 1QVGU 5HV6A 2DOSA 4J9MA 1NI8A 3OHAA 2UXBB 4O3QA 5HNEA 4UCSA 1N33B 5L1IA 3JD4A 3BACA 2B9ZA 4X1KA 2WAQE 2LGQA 3UKMA 5C4XG 1TA8A 4IIJA 3HOZG 2BCCH 3DAAA 2QR4A 4J9LA 1PKXA 2YRWA 3RV4A 1MZEA 3GILA 5C1OA 4F50A 3NGDA 3SJCC 1A0IA 2UXCH 1RJRA 2VR1A 2YC0A 4TUYF 5C3EG 4ZKIA 1H38A 4FFBA 3AK1A 4J7KA 3SYAA 3G8CA 3L9DA 4C5AA 4FFBB 3H0GA 2WSSG 4AQYO 1RYRA 1E1QG 3TQ1A 1J5EH 5IYCO 1T94A 4J9PA 3CCSV 4O3NA 2KG7B 3OTFA 1GM8A 3GTLA 2DWCA 3FB5C 3ICXA 4J11A 4BR6A 3RBZA 3Q8PB 3TJTA 2NUAB 5GTHZ 2KSWA 1RYSA 4MVMA 3TK1A 5LYJA 2R7LA 3MFHA 2R8JA 1FKAH 4JI7O 4W4KA 1VBHA 2Q68A 2ZJTA 1I94O 1EN4A 2E74B 4DR7H 3CRMA 2VA2A 3CJHA 2ITCC 3CMEV 2P4VA 3DSQA 1XL4A 2PTMA 5BZBA 4A5UB 2ZE8A 4P30A 3RYIA 4O84A 4IGGA 3CVZA 2FK2A 2GTSA 2ILMA 3CCMV 4DR2H 3E22A 4JYCA 3RYIB 4CS3A 3CRQA 5CR5A 4PV1B 3VBBA 1DV1A 2XCLA 5LL6b 2Q0OC 1M56C 5TISZ 3GIIA 5IYDO 4MAMA 2AU0A 3K5IA 4G28B 1X4TA 2OCCB 2EILB 4ZQIA 4DV0H 3QNEA 2QYZA 1OCCC 1VQ5V 4X66B 4E4EA 1Q7YW 3RFCA 4WBNA 4O4JA 5CN0A 5KX5B 2XAJA 3KREA 1EZ1A 3JASA 4JV5B 4KHPB 2R7KA 4ZHQF 2RDIA 2PGGA 2PF4E 4YHHH 2OTJV 2CQYA 5KFTA 1PL4A 1VQPV 3G8DA 3JASB 2R8KA 2GSMB 4JXUA 3QO8A 5A9GA 3RYHB 3HPLC 2WWWA 3KHHA 1NKDA 1N34H 1SQPH 1S0VA 3ABMB 1PM9A 1S5HC 1LUVA 2H3OA 3JD3A 1XNRB 4K0KO 1RP3B 2XASA 5EIBD 4OX9O 4TWKA 2ZXWC 5FJ8G 1GN3A 2Z04A 1MABG 4J9RA 3QZ7A 4TT3G 2YW2A 1OHHG 4GKKH 4HR7A 4EBEA 5KG7A 1B6QA 5CA0A 5DN6G 3DC6A 2VWJA 5K1XA 2FLPA 4DV4H 1S97A 2CUGA 3WG7B 4I50F 2GPWA 4AI8A 4A2BA 4YY3H 5I5UA 3IC7A 1HR0O 2BSKA 5DEDA 3KAKA 5F9NA 4LFAH 4LF5O 2BSKB 5LXTF 3KKYA 1DIKA 4ECWA 4RAZA 1IDSA 5KUKA 4WFHA 5K3WA 4ECYA 4DV3B 4KXRA 1WR2A 5KLVH 1I7LA 2MW2B 4DL3A 2QM4A 3T5HA 4B3TH 1GO3F 4GLWA 2QKSA 3R65A 2EINC 2BQRA 3R5HA 5KT7A 4HNTA 2EIMC 1BCCH 1CKOA 4XX0B 1M4UA 3K5NA 2YS8A 1EBOA 3H1JH 2UVRA 1GAXA 4LFBH 3J80N 4IAJA 4O2BF 1PNMA 2XOKG 2WA4A 5KFSA 5DQGA 2Q9LA 1S72V 5H6QA 5KAIZ 5LHIA 1KP3A 3ETGA 2W9CB 1YITV 5LHHA 3CCLV 5JH7A 2EBOA 3JRWA 3AG3C 2HFEC 5JH7B 5BYBA 2QDOA 3HKBB 3RJ0A 2R8HA 3E2EA 4DL5A 3BY6A 5KFHA 3RAQA 4LF8H 4F6EA 2NU7B 3MR3A 1QNMA 5JJEB 1J5EB 1JVMA 2CK3G 2ZE6A 4K8ZA 2J6SA 2CZGA 2YZNA 3JCZA 3V6KA 2RGVA 4J42A 3TY8A 3ZHVA 3SGIA 1Z2NX 3FAVA 1HDJA 1ET0A 2R93G 3JCUZ 3FB8C 4O4IF 5JQGF 1VS0A 3FAVB 3WO0A 3IG0A 3OMIB 5DGAA 4PZ6A 1K97A 4LP8A 1M7JA 2HG8A 1G6UA 3MR5A 1RPOA 5B5EZ 2HVKC 2Q2UA 1HNWO 3L72H 2QWPB 1GKFA 2YDEA 3CCVV 1L8DA 4BW5A 5LP6A 2UUBB 4LF5B 3UZBA 3K0GA 1T3NA 5KG4A 2JA6A 1A3GA 2WB1E 1HW7A 3UYYA 5LP6B 4LF4B 5L1LA 2XAHA 2Y4UA 1OCZC 3H40A 1ZQ7A 5KFGA 2CTWA 2Q7GA 3AG7A 2UXDO 1UFIA 3VPBA 5DG7A 1XMOH 1F4NA 1EFRG 1KTAA 1VQ8V 5H5NA 2Z5UA 1T5EA 5L3CA 1D5NA 2IBKA 3GIDA 2VUMA 3WO1A 4WD3A 3J7AU 1GO3E 2DLNA 2UU9B 2C35B 2X6BA 4ED8A 2E5LB 1FS0G 3ORRA 2PYJA 4YHHB 4IYHA 3IGAC 2A79B 1WP8A 1HNXO 3T1YO 4EFEA 4I55A 1WB7A 4OGQB 1K92A 1YZBA 3QF7A 5B1BC 1IURA 3W1GA 3BG5A 2ZT9B 3LQSA 1E4EA 4O7YA 3KHLA 3QFFA 3CC7V 3K5MA 3PFFA 3Q1KA 1E4EB 1E4GT 2EX3A 3HKZE 2AGPA 1P4RA 5D1PA 5IJ9A 4O7NA 4IR1A 2W7OA 4JI3H 3K5LA 3RV3A 1V55B 4AYBE 1EYZA 3RFRA 5IJ9B 2Q7EA 3OT7A 1SQQH 4K8XA 2QEXV 3CCEV 3GTMA 2WLIA 2QE7G 4L8JA 3GTPA 3E5NA 1IYDA 3HKCA 1S76D 2WLIB 3TEKA 5HFLA 3QG5A 2YXHA 3S3XA 4DK0A 4PA9A 4JGSA 3K5HA 4LF9B 4YBZB 2FTKA 3AG1B 1K4DC 3ZHQA 1ZHQA 4Q8EA 2F93B 4UUGA 2C2EA 3LUTB 4FIPC 4GKJH 2XT9A 1XMQO 4IIJF 5I5VA 5KHHA 4H13B 4H37A 1IBLH 2UXDB 5FL7G 3VOTA 1N0NA 2EJRA 1Z5VA 2HG5C 5LHGA 5LMUH 3GIMA 1YCIA 4LNUA 3PR4A 1KB9F 2V5AA 1NJIW 4X64H 2YXLA 4LNUB 5KG5A 1XILA 4EYHB 4NTXA 1K3EA 3ASOC 2IU3A 3JYCA 1FJGB 1H2NA 2F23A 4NYKA 4LH7A 3E83A 3K3VA 2JEGA 2OT5A 4RB1A 3GIPA 5BR8H 2DMXA 4TUYB 2AGOA 3TETA 2WAMA 1K73W 3LMLA 3FKIA 4H44B 5LA6A 1P8LA 4CKEA 3ZS8C 5IY5C 1HP8A 3UT5A 5LA6B 5LYJF 1ZL8A 1PNKA 2IJIA 2UVWA 3SYQA 4JI8H 1ZL8B 5FLXN 4JI6H 3SPIA 2LJ2A 5BMVA 4TSFG 2XUMA 4JASA 4LF8B 1NTMH 1F51A 5BMVB 4MV4A 3OHBA 1QR9A 2HHHO 4MVUA 5IYZA 3T1HO 4ZOLF 4JV2A 3PO2G 1TUBA 1TWGA 5CM0A 5IYZB 1KC8W 4FJCC 3ABTA 4GX1A 1URFA 4B3RH 5KHIA 4JF3A 5EWEA 3T5LA 2COGA 4YR2A 2ZDQA 3JRXA 1I1MA 4FZ1A 2R82A 3I4NG 2NU6B 1DLBA 2Q69A 4DV2H 4TV8A 4Q6GA 1XMQB 1HNZH 3EVKA 5HFMA 2MCTA 2ARHA 4WBNF 4DR4H 4O4JF 3CC2V 1JFFA 4L87A 4TV8B 3GDEA 1KP2A 1M5IA 1WRVA 1N0JA 1JFFB 3HOYG 3N40P 4Q0YA 2FKLA 5K1PA 1BE3H 2DAAA 4IYIA 1EUDB 3I4MG 1Z5WA 3D36C 1VP7A 2W6OA 4IRCA 1OWTA 3T54A 3G6VA 1KJ9A 2DYSC 2EULA 4JYAO 3WB0A 2R9RB 1N32H 5EWGA 1XDCA 3J81N 1SFOA 4GC7A 2W8LA 3JSNA 4O4LA 3EFFK 2XHBA 2ZM6H 4RUFA 4ED0A 4FS1A 4O4LB 2Q7HA 1K8AW 4D7SA 1B06A 2ZCEA 5A2QW 1WN7A 2UXBH 5J2UF 3PVXA 5CA0F 3DF7A 3T99A 1JJOA 4LR3A 5KFEA 5KT4A 3D8CA 3OGCC 2NU9B 4RNOA 2W9BA 1VQ7V 4I9QA 2NN4A 1DV2A 1RM1B 2YI9A 4LSAA 1DF5A 2W9BB 2UVUA 2QGNA 4LFCH 4U7NA 1QLEB 1NTKH 3HOXG 2GBOA 5GTIZ 2FPGB 2F4VH 3ZEDA 2PMZA 4O3RA 5IE9A 4G3IA 4DV1B 2ASLA 5DG9A 4I50B 4CHIA 2AXTZ 3ETQA 1YJWV 4X8AA 4IWYA 1Y1VG 4WHXA 1WCMA 4GT1A 3SE7A 4H33A 3K3PA 1V54C 4YJ2F 2QWRB 3T9CA 3N44B 5IP7G 2B1IA 4EFBA 1VARA 4JI0B 3GTGA 2CNUA 5IT9N 3HR0A 1QBZA 2N05A 5LOVA 2XGPA 1JPXA 4RQFA 4GKJB 1JX9A 4FFNA 1SEIA 5I5TA 5L1KA 5LOVB 1W93A 3SPHA 2GQRA 2ZDIA 2JEIA 4BBSG 3LDDA 3RYCA 2X7RB 5FNVF 4PDRA 2YCHA 3RYCB 4NB5A 2JA5A 4NZMA 4LMYA 1I3QA 1W2BU 2WTFA 4BXXG 2WLMA 1XL6A 1O9GA 2Z0AA 3BA8A 1Y1WA 4O7SA 5D8DA 3N2KA 4EYIB 4XDKA 3BA9A 2Y48A 5KFUA 2HGSA 2OWOA 1FAFA 1KJ8A 2EIJC 4QPKA 2UUCO 3GTKA 4FFKA 4UCUA 4DV7O 4IRDA 1XQ8A 5LGUA 4JV5H 2O57A 4YXWG 3ZCCA 2ZGIA 2AQ4A 3AK3A 3IJ4A 2J9GA 2JIZG 2B63A 4JI5B 1IBKO 4TQFA 1XK5A 2GDSA 4O4IB 2Y4RA 4PHZA 2Y0SA 5JQWA 3L74H 2FLNA 1V51A 5KFMA 3B77A 2R84A 4AQYH 1KBHA 3SJAC 1BJTA 4FK5C 2XAGA 4UVCA 3GIKA 3UQ8A 4JI4B 2C22A 2P06A 3GTQA 1F7YA 1IBMB 1AP6A 1YHQV 2C2AA 2ZD9A 1GK9A 3ABLC 4IHJA 4ECVA 1M56B 2N74A 3ZN0A 5ITZA 5JCOC 3BHPA 3MR2A 3L73H 4DR4B 4IHJB 4DV6O 1VQKV 1US6A 2QK4A 3TY9A 1I94H 3OE7G 4HN2A 1OCCB 4U3JB 4N21A 1QU7A 5FD5A 3C3SA 1I7NA 1FPOA 3T5JA 4JAUA 5LBQA 3F7YC 4DLKA 4CS4A 4I55F 3CPWU 2B1GA 3RB0A 2E75B 3CYOA 4LF7B 5BPFA 3O65A 2HLDG 1TWHA 1JCHA 2VWKA 3SPCA 2BOBC 4DR1B 2D3OW 4O82A 3S24A 2J6UA 3WB1A 3Q8SB 3JSLA 4Y8VB 4DV3H 4Q8FA 1SZXA 2WA3A 4CH5A 5JVDA 1X59A 3ETEA 4M9UA 4DV7B 2OCHA 5JVDB 4DR5O 1SRYA 4FLXA 1IOWA 1R9TA 1NU1H 3DXRA 4R7CA 1XNQO 5E79Z 2ZXWB 3T9DA 4O3OA 3GTOA 2HVJC 3DXRB 3MHHC 3ZN1A 5KHKA 5EZYF 4H0LB 2PVPA 3V4ZA 2YYAA 3BCCH 5B1NA 5BWTA 2QTOA 1C30A 4LFCB 3N8DA 2ZQMA 3L4JA 3SDLA 1N36O 3BQ0A 3ZHRA 4KL1A 2UXNA 2XAFA 2F4VB 2B5UA 5GONA 2HJWA 1MA1A 4WFFA 1QCEA 2P90A 3OTOO 5GONB 3DC5A 4LCUC 1JQ0A 5JJJB 3RGXA 4OX9H 4A3CG 3X2QC 4UUJC 1KUTA 2ZIOA 2YEVA 4JI1O 2KG7A 3FD9A 1COWG 3VOUA 3K79A 4RCNA 2YEVB 1O9HA 2RJZA 4UB8Z 4NYEA 1Q6HA 1SYXB 1OV9A 2EINB 4PA6A 4DUYO 1EZJA 2FJZA 4B08A 3MWDA 2ABJA 2EIMB 1WA8A 2VUGA 3ZHUA 1CS0A 4YJ3F 2WYOA 1HR0H 1WA8B 4R8UA 2Z02A 3IN5A 1BL8A 3R66A 5KHJA 1YJ9V 5T14A 4RB2C 4R8UB 3THOA 4XDJA 4LF5H 2UUBH 1A0GA 3ZBHA 5BYAA 4J0MA 1ZUQA 3ML0A 1YI2V 2ITDC 4LF4H 1T36A 4HYKA 2W6JG 4ED3A 5DECA 2FP4B 3T7AA 3H0GG 3G6YA 3J7AK 4X65O 3AG3B 3NXSA 1YVWA 2FKXA 4CKBA 4MTOA 2CNQA 2JA7A 1L0LH 2QM7A 4UCTA 2V7QG 2RF4A 5CB4A 3RGZA 5KX5A 3MHSC 3H4DA 5KA5A 5KHGA 4X1YB 3QO5A 4L1KA 4A3KG 5CB4B 2UU9H 3VQXA
chains in the Genus database with same CATH topology
1KU9A 2E5LH 2XIGA 4NXNH 3RYHA 5KMGA 2Q7GA 1XMOH 2YI8A 4DRXB 3RF2A 3K57A 5KMGB 4LH6A 4RB0A 1NT2B 5D1OA 1T5EA 3QTCA 4JI7H 4U3JA 2BTQB 4FLWA 4TOIA 1SQFA 1M0TA 2BTOA 5D1OB 4AQYB 3J80W 1WPBA 3U0ZA 2UU9B 3M7MX 2JGUA 5C8YA 3HKDA 4TV9A 2E5LB 1S68A 2VQEH 2PYJA 1FFXA 4YHHB 4NXNB 3HKDB 4JI2H 4TV9B 1XMOB 5IWAB 2JVDA 1FFXB 4EFEA 2ZINA 4I55A 4LSXA 3QF7A 3W1GA 4JI7B 4D7TA 4X65H 3IAYA 1I94B 3FMAA 1GYFA 1IBKH 3BPZA 3PN1A 3K5MA 1E4GT 2ZNIA 2EX3A 2UUCB 5D1PA 4FM1A 4UCRA 5IJ9A 1HNWH 4JI3H 3K5LA 4LF9H 3RFRA 4CC6A 5IJ9B 4JI2B 2Q7EA 4K8XA 4UCOA 1XHZA 1I6UA 3JARA 4A2AA 4FLTA 3B2EE 4L8JA 1N33H 2YIAA 2HIXA 4UFZA 3HKCA 2UXDH 3JARB 3C0FB 3VNNA 3QG5A 5J2UB 1IBKB 2HVSA 4DK0A 1QHTA 1TVKA 4DV6H 3FFQA 4JI3B 4LF9B 4EQ5A 1VF7A 1ZHQA 2HEPA 1TVKB 1ZAUA 4FM0A 4K0KH 2F93B 3KALA 4GKJH 1FJGH 4DR3H 5KHHA 1S5JA 1L2ZA 1IBLH 2UXDB 4NXMH 4O2AA 1Z5VA 4X1KB 1HNXH 4UCVA 4O2BA 4IIJB 4O2AB 5LMUH 5EIBC 1SQGA 4LNUA 1DGSA 4DV6B 4X64H 2YXLA 3CSXA 4GYCB 4LNUB 4K0KB 3H20A 2IM9A 3HKBA 4OX9B 4DR3B 1FJGB 4LH7A 4CC5A 2PZSA 3K3VA 4DR5H 1IBLB 4RB1A 5BR8H 4NXMB 2CFMA 1XNQH 3KAJA 1I7FA 2UUAB 4TUYB 3N2GA 3LMLA 4FM2A 2F95B 4X20A 3VQVA 5LA6A 2R72A 5LMUB 3N2GB 1M93A 1P8LA 3ZS8C 3JATB 3M4IA 3WB2A 4X20B 3UT5A 4X64B 5LA6B 4EEQA 3TY5A 2CW7A 2GV9A 3NBYB 3W5OA 5J2TB 4FLUA 1AN7A 4JI8H 1N36H 4JI6H 4AHCA 1O75A 4ETSA 5BMVA 3CB2A 4DR5B 1D5AA 5LYJB 5BR8B 4LF8B 1XNQB 2JS5A 5BMVB 1HR0B 3N41B 2YIBA 3N2KB 3OTOH 5D5QA 1XMQH 5IYZA 2KKWA 4X1YA 4O4HA 3U10A 1P16A 1X9NA 5D5PA 1TUBA 4X66H 5IYZB 4O4HB 3BABA 4DV5B 4M7EA 5EYPA 4ZOLA 1S03G 4JI8B 4KHPH 4RZQA 1N36B 2VPSA 5KHIA 1XI1A 4B3RH 5EYPB 4JI6B 4ZOLB 3E22B 1Q43A 5CA1B 2P5OA 4PDBA 4DUYH 2BTQA 4DV2H 4TV8A 3OTOB 4Q6GA 1XMQB 1HNZH 2MCTA 4DR4H 4EB6A 1JFFA 4TV8B 3GJXB 3GDEA 3KYHC 1M5IA 4I4TA 5FPRA 4JI1B 3HXLA 4B3MH 4EB6B 1XNRH 1JFFB 4GLXA 3N40P 4Q0YA 5K1PA 1P49A 1V9PA 4I4TB 4B3RB 1Z5WA 4WBNB 5DISC 4DUZH 4O4JB 3W1BA 1FVIA 5JJNB 2P22C 2WDTA 4DUYB 4DV2B 1WH2A 3WB0A 1Q8IA 2PUSA 1HNZB 1N32H 1QQCA 1BGWA 1XHXA 4ZI7A 5ITZB 2OYQA 2W57A 3JSNA 4O4LA 4B3MB 1JMKC 1YEWA 4ZI7B 3K58A 2XHBA 2Q2TA 2ZM6H 3SJBC 3EYYA 4O4LB 2VQEB 4DUZB 2Q7HA 4D7SA 2ZCEA 3HKEA 5A2QW 1WN7A 2UXBH 1Z2PX 3DF7A 4DV1H 1JJOA 3A2FA 4LR3A 3HKEB 3QWUA 2F1MA 1N32B 3MWMA 5J2UA 4I9QA 3RR5A 5FLXW 4LSAA 2YI9A 3K5OA 4X65B 1CKNA 2VQFH 2YIBD 3BAAA 5CA0B 2R70A 4PZ8A 4MTDA 1CKNB 4LFCH 4FLZA 2ZM6B 1HNWB 4X62H 4JI0H 1Q3EA 2F4VH 3ZEDA 3JALA 1Q5OA 3JAWA 2UXBB 4DV1B 2VOBA 4UCSA 1N33B 3JALB 4I50B 3JAWB 3ETQA 4X1KA 3NC0B 1TA8A 4IIJA 2VQFB 4JYAH 3T1YH 1TGOA 3N43B 4F6RA 3N44B 3U11A 4EFBA 4X62B 3SJCC 5EZYB 4RB3C 1A0IA 4YJ2A 4F6RB 1ZHSA 2UXCH 4JI0B 4CH4A 5LOVA 4YJ2B 4FFBA 4GKJB 1SEIA 5LOVB 4TUYA 4FFBB 1E4FT 2Q0AA 1HNXB 3RYCA 3T1YB 3JATA 1J5EH 2YCHA 3OTFA 3RYCB 5J2TA 1H2SB 2UXCB 3NBZB 3ICXA 5FNVA 4LMYA 3J81W 1M0WA 2KSWA 1B04A 5FNVB 5LYJA 4NVPA 1CKMA 1O9GA 3BA8A 1FKAH 3N2KA 3BA9A 4JI5H 2ZJTA 2HGSA 4DR7H 2OWOA 4PZ7A 3DSQA 4UCUA 3N42B 2PTMA 5LP6C 3BRCA 3RYIA 2CAZC 3SR2C 3CVZA 1XQ8A 5LMNH 4DR2H 3E22A 4JV5H 3RYIB 4CS3A 4FVMA 5CA1A 4JI4H 1TAEA 5LL6b 1IBMH 4PI2A 3RYFA 3RIZA 4JI5B 3GB8B 4DR7B 1X4TA 4FLVA 4TQFA 3JAKA 1XK5A 3RYFB 4DV0H 4O4IB 3L2PA 4PHZA 4DRFA 3JAKB 4X66B 4AQYH 4WBNA 3CHXA 4O4JA 3SJAC 1BJTA 4FM9A 4B3SH 5KX5B 4DR2B 3JASA 4JV5B 4KHPB 2HVRA 2PGGA 3UQ8A 2PY5A 4JI4B 4YHHH 3JASB 4BWSC 4ZHQA 1IBMB 5IWAH 4LF6H 5EOYA 4LF7H 3RYHB 4IHJA 5IT9W 4ZHQB 2ZNJA 5ITZA 5JCOC 4DV0B 3BHPA 4DR1H 1N34H 4DR4B 4AILC 4IHJB 3N6XA 4RAYA 3TY9A 1I94H 2E3CA 1SA0A 4U3JB 1XNRB 4B3SB 2HHHH 2UUCH 4R7RA 5EIBD 4CS2A 5FD5A 4DV7H 2F66C 1SA0B 3T1HH 1Z2OX 5C8YB 4TQDA 5FD6A 1MZBA 4ZIBA 3LNNA 4CS4A 3L4KA 4LF6B 3MAQA 4LF7B 4GKKH 3RTXA 2V4DA 4CH6A 4I7HA 2VWKA 5JCOA 4X1IA 4DR1B 1SKVA 5CA0A 1N34B 3S24A 3WB1A 3JSLA 2VWJA 5K1XA 4I55B 4DV3H 4X1IB 4MTEA 4CH5A 5JVDA 2HHHB 4DV4H 1XDNA 3VQYA 4DV7B 3T1HB 5JVDB 3F8NA 4A2BA 2HVQA 3KXYT 4FLXA 4FLYA 4YY3H 4I50A 4GKKB 3KAKA 4LFAH 2FE3A 5KHKA 2RQ6A 4DK1A 4RAZA 4DR6H 2RGRA 1KMIZ 4DV3B 3HKCB 3VQWA 5LXTA 4MV9A 5EZYA 5IJ0A 4LFCB 4DV4B 3L4JA 2QM4A 4MV7A 4B3TH 5LXTB 5IJ0B 4KL1A 2F4VB 5GONA 4YY3B 4E6NA 1CKOA 1M4UA 3K5NA 2HIVA 5GONB 4OX9H 4LFAB 3RGXA 5JJJB 3JAMW 4LFBH 4IAJA 4DR6B 2ZIOA 2CW8A 2UUAH 4JYAB 1O9HA 2RJZA 4B3TB 4CH3A 2O03A 4O2BB 5FPOA 5JH7A 3RGBA 1WNSA 1SYXB 4APMA 4HNAA 4B08A 5JH7B 2PYLA 2VUGA 3HKBB 3RJ0A 4HNAB 4LFBB 2WYOA 4LF8H 3RWRD 1HR0H 2WE6A 4BW9A 5JJEB 1J5EB 4YJ3A 5KHJA 4K8ZA 4RB2C 2QJ1A 2R9AA 4PI0A 3THOA 4LF5H 2UUBH 2RGVA 4YJ3B 3TY8A 3SGIA 1Z2NX 4J0MA 4DV5H 4LF4H 3UT5B 1VS0A 3IG0A 3K59A 3J7AK 4PZ6A 4O4IA 5JQGA 1G6UA 4UCTA 2Q2UA 5JQGB 2ZIMA 4HBNA 4LF5B 5CB4A 1L8DA 5LP6A 1RSOA 2UUBB 3RGZA 5KX5A 4JI1H 5KHGA 4X1YB 1HW7A 4BWAA 5CB4B 5LP6B 2UU9H 4LF4B 3VQXA 5LMNB 1TUBB 4DRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8L A;  4LF7 B;  2VQF B;  3RTX A;  4X64 B;  4EEQ A;  3TY5 A;  3NBY B;  3S24 A;  4DR1 B;  1N34 B;  3W5O A;  3JSL A;  4LF6 B;  4EFB A;  4X62 B;  4LH6 A;  1A0I A;  4JI0 B;  4DR5 B;  2HHH B;  5D1O A;  1XDN A;  5BR8 B;  4LF8 B;  1XNQ B;  4TOI A;  4DV7 B;  3T1H B;  1HR0 B;  4GKJ B;  5D1O B;  4AQY B;  2HVQ A;  2UU9 B;  1P16 A;  1X9N A;  2E5L B;  4GKK B;  1S68 A;  1HNX B;  4YHH B;  4NXN B;  3T1Y B;  4DV5 B;  3BAB A;  1XMO B;  5IWA B;  4JI8 B;  1N36 B;  4JI6 B;  4DV3 B;  4EFE A;  2UXC B;  3NBZ B;  4LFC B;  4DV4 B;  3W1G A;  4JI7 B;  1B04 A;  1I94 B;  1CKM A;  3BA8 A;  3PN1 A;  3OTO B;  1XMQ B;  2F4V B;  4YY3 B;  2UUC B;  5D1P A;  3BA9 A;  4E6N A;  4UCR A;  1CKO A;  3GJX B;  3GDE A;  2OWO A;  2HIV A;  3KYH C;  5FPR A;  4JI1 B;  4LFA B;  4CC6 A;  4JI2 B;  4PZ7 A;  4GLX A;  4UCU A;  4UCO A;  1V9P A;  4DR6 B;  4B3R B;  5DIS C;  3W1B A;  4JYA B;  1FVI A;  2HIX A;  4UFZ A;  4B3T B;  4DUY B;  3VNN A;  1IBK B;  4DV2 B;  1TAE A;  2HVS A;  1HNZ B;  5FPO A;  4JI5 B;  3GB8 B;  4DR7 B;  4JI3 B;  4LF9 B;  4EQ5 A;  1XK5 A;  3JSN A;  4B3M B;  2VUG A;  1ZAU A;  4LFB B;  3L2P A;  2Q2T A;  4DRF A;  4X66 B;  2VQE B;  4DUZ B;  5LMN B;  1J5E B;  2UXD B;  4DR2 B;  2HVR A;  4JV5 B;  4KHP B;  3QWU A;  3UQ8 A;  3TY8 A;  4JI4 B;  4UCV A;  3SGI A;  1N32 B;  1IBM B;  3RR5 A;  4X65 B;  1CKN A;  1DGS A;  4DV6 B;  3BAA A;  1VS0 A;  4DV0 B;  4PZ8 A;  1CKN B;  4DR4 B;  4K0K B;  4PZ6 A;  2ZM6 B;  1HNW B;  3TY9 A;  4OX9 B;  4DR3 B;  1FJG B;  4LH7 A;  4CC5 A;  4UCT A;  1XNR B;  4B3S B;  2Q2U A;  1IBL B;  2UXB B;  4LF5 B;  4NXM B;  2UUB B;  2CFM A;  4DV1 B;  4UCS A;  2UUA B;  1N33 B;  4LF4 B;  5LMU B;  3NC0 B;  1TA8 A; 
#chains in the Genus database with same CATH topology
 1KU9 A;  2E5L H;  4RUE A;  4HNV A;  3RYH A;  2R85 A;  4E4T A;  5KMG A;  4FZ0 A;  3RF2 A;  1U97 A;  2VQF O;  4PEL A;  3JZF A;  5KMG B;  5L3B A;  3ETJ A;  4J7J A;  1NT2 B;  3JZI A;  4O81 A;  3HBL A;  5D1O A;  5KT2 A;  4X62 O;  3DTF A;  5C8Y F;  2D2C B;  3MD0 A;  3E89 A;  4TOI A;  3OUZ A;  1SQF A;  2IJJ A;  2BTO A;  3M99 B;  4AQY B;  1M0T A;  1OJH A;  5D1O B;  3JD0 A;  4BY7 G;  4ABM A;  3U0Z A;  3GWO A;  3M7M X;  1A48 A;  1S0O A;  1DF4 A;  4TV9 A;  5I5X A;  1K7D A;  3T9E A;  1UC9 A;  2Y0I A;  1S68 A;  4PJ0 Z;  1FFX A;  3QQM A;  4TV9 B;  2DAB A;  3ZRW B;  3EHB B;  4PA4 A;  1OCZ B;  1FFX B;  2Q8V A;  1CE8 A;  3VPC A;  3M9N B;  2Y69 B;  4C5C A;  3NUA A;  2ZIN A;  3OEE G;  4CMF A;  4LSX A;  3RAX A;  3CX5 F;  4X9Q A;  3W7X A;  4JI7 B;  1KJJ A;  5BWU A;  2ALZ A;  2CKZ B;  2BR0 A;  4MVR A;  3IAY A;  1I94 B;  1G2W A;  2FLL A;  4UV9 A;  1AR4 A;  3BPZ A;  1GYF A;  3PN1 A;  3QO7 A;  4EBD A;  1HNW H;  1BNC A;  4LF9 H;  1I5X A;  1JJ2 U;  1PV0 A;  3FB7 C;  3CMA V;  1DK1 A;  3PZP A;  4FLT A;  1NBM G;  4BY1 G;  4UFZ A;  4QW9 A;  2UXD H;  2XCA A;  1PPJ H;  4UVB A;  4Q4C A;  1Q6I A;  5J2U B;  1TWA A;  5B1B B;  2HVS A;  2W6Z A;  5DG8 A;  4YQW A;  3C3T A;  5B1O A;  1R3I C;  3FFQ A;  1FYJ A;  4NZN A;  1N4C A;  2R92 A;  3EXA A;  4X89 A;  5BPH A;  2JK5 C;  1WLE A;  2HEP A;  4J80 A;  3P30 A;  4QNH B;  2NLJ C;  1KD1 W;  2YZG A;  1BS3 A;  2HP8 A;  2A7W A;  3CE2 A;  3PW0 A;  1FJG H;  4O2A F;  1R73 A;  1L2Z A;  1IZ3 A;  4NZO A;  3HO8 A;  3ZMT A;  5BWX A;  4J7Z A;  1P84 F;  1HNX H;  4UCV A;  1KT8 A;  4DR2 O;  2W9C A;  5EIB C;  4MVZ A;  4ED1 A;  1NVP B;  3U54 A;  3ZMS A;  2DJV A;  4K0K B;  3H20 A;  3CEI A;  2IM9 A;  3HKB A;  1AJQ A;  2YS6 A;  4OX9 B;  2DWD C;  2LQT A;  2PZS A;  2QF7 A;  1L0N H;  4PDM A;  1ZSP A;  4NKG B;  5L3F A;  2RMK B;  2R6F A;  3KAJ A;  3WWI A;  4QWD A;  2XC9 A;  3K9A A;  2LP7 A;  4KUM A;  1MSW D;  5F9L A;  5LL6 Y;  2ATK C;  3JAT B;  2QWO B;  3M4I A;  1S3J A;  4Z2W A;  5KT6 A;  2CW7 A;  2VPQ A;  2DWE C;  5J2T B;  3ZRS A;  1K1Q A;  1K83 A;  5KFV A;  4C2M A;  4HQ6 A;  1SZT A;  4J9Z B;  4FFO A;  2K1E A;  2EIY A;  3ABK C;  4AHC A;  3T4Z A;  2Q4P A;  2EIL C;  4O7Z A;  4JV1 A;  3ASO B;  3FYI B;  4O4H F;  4YAK B;  3GV8 B;  1HR0 B;  3BQ2 A;  3UCS C;  4ECQ A;  1XMQ H;  2WAQ A;  3KTM A;  5D5P A;  2PBZ A;  1NTZ H;  5KFP A;  3RW0 A;  3WU2 Z;  4M7E A;  3OGI B;  2OTL V;  5C5J A;  5IY5 B;  1N48 A;  2VPS A;  1YF2 A;  4Q44 A;  2Q6A A;  4YIO A;  3OUF A;  3A0H Z;  4J9K A;  1VAJ A;  2R86 A;  1SC5 B;  5CA1 B;  4U7C A;  2CTP A;  2PI5 A;  4DV4 O;  1I2K A;  4A3G G;  4I4T F;  2DE0 X;  3T9F A;  2ZR2 A;  1QVF U;  3CCR V;  4YY3 O;  2CGO A;  5KFK A;  4TQS A;  2V59 A;  4JYB A;  1RFY A;  4GX0 A;  1V9P A;  3PW2 A;  2CGN A;  5DIS C;  1B6R A;  1K4C C;  1PX2 A;  2DN9 A;  1Q90 D;  1FVI A;  2VQD A;  2R8I A;  3ZRV A;  2K9P A;  2WDT A;  2JA8 G;  1VQ4 V;  4ZI7 F;  1FXK C;  2FB5 A;  2N04 A;  4G2K A;  3AEI A;  1QQC A;  4XZ3 B;  1BGW A;  3WG7 C;  1FFT B;  2JA6 G;  2W57 A;  2C2R A;  3ABU A;  1JMK C;  1BHA A;  3H4B A;  3K58 A;  3GWK C;  3IFX A;  3RB6 A;  5KFQ A;  3D36 A;  2XGQ A;  2A3Q A;  1I1L A;  2QKC A;  1OZ0 A;  3A2F A;  4DV1 H;  3AG2 C;  1Q6U A;  3MWM A;  1S9F A;  2DYS B;  3OUS A;  5DMX A;  3RR5 A;  4A3B G;  2VUM G;  3K5O A;  2W6N A;  1KYO F;  2R70 A;  4PZ8 A;  4MTD A;  4PBC A;  1HNW B;  5KFI A;  1Y14 B;  4JI0 H;  1TWC A;  3JAL A;  5BWV A;  4JPR A;  2Y0P A;  4KP4 A;  5H9C A;  2VOB A;  3FYE B;  2V4Q A;  3JAL B;  1D2D A;  2IBZ H;  1MNG A;  3MDS A;  3LP8 A;  2WLJ A;  3B4S A;  4A3L G;  4JYA H;  5LMN O;  4FBT A;  2X6C A;  4F6R A;  1VKZ A;  1SCU B;  3U11 A;  5EZY B;  4RB3 C;  2P7T C;  4CZZ A;  4F6R B;  4FPP A;  4CH4 A;  4BIU A;  1IXM A;  3BVO A;  3V6J A;  1S0N A;  1KC7 A;  2W71 A;  4LC1 A;  5DAA A;  1VF6 A;  4TUY A;  1E4F T;  3U55 A;  1PD3 A;  4F4Y A;  1M90 W;  2GTA A;  5C1P A;  1HNX B;  4B3S O;  1JLL B;  4WFB V;  3T1Y B;  3LNM B;  1JXL A;  1NQT A;  5B3S C;  1Q82 W;  2IMW P;  5LGT A;  1KJQ A;  4FFL A;  1V54 B;  2ASD A;  1XMO O;  5CE8 A;  5DQH A;  5IWA O;  1MZF A;  4LF6 O;  1M0W A;  5L9X A;  2QM8 A;  4RU9 A;  4J9O A;  3V6H A;  3G6B A;  4NVP A;  1QR8 A;  2EJ0 A;  3ZIA G;  4FU0 A;  1THZ A;  2E2H A;  4JI5 H;  2WLK A;  3A0R A;  3C90 A;  2JRI A;  3OM3 B;  4R8C A;  1OCR C;  3GLK A;  1SER A;  4ED7 A;  4PZ7 A;  3N42 B;  1N8R W;  5LP6 C;  2FK3 A;  3BRC A;  4BAY A;  5FR9 A;  1JR9 A;  3SR2 C;  2EZP A;  1CP9 A;  3N6R A;  4FVM A;  2YRX A;  2YSU B;  5KFC A;  4JI4 H;  5B1A C;  1TAE A;  4O7R A;  4O86 A;  2Y4T A;  1IBM H;  1J95 A;  4Q20 A;  2HR3 A;  3FDS A;  1W0K G;  2L6L A;  1MSD A;  3GB8 B;  3TW7 A;  5KFB A;  2LGW A;  3R5X A;  3JAK A;  5KX5 F;  4UB6 Z;  3FKI G;  3SYO A;  1WAZ A;  3Q4H B;  2JDI G;  3L2P A;  5H6R A;  3JD1 A;  4DRF A;  3JAK B;  4A3M G;  3ASN C;  2R7Z A;  4TQR A;  2EIJ B;  1LUW A;  4J9Q A;  3LSS A;  4NLG A;  1ORQ C;  2HVR A;  5KFA A;  2PY5 A;  2X0S A;  2Q67 A;  3RBE A;  4BWS C;  5E1A C;  4ZHQ A;  4DR6 O;  1BQZ A;  1M57 C;  1I1K A;  5EOY A;  2OIG A;  1GSO A;  4MSW C;  4LF7 H;  1ZX3 A;  4J9N A;  3TGU H;  3ZMU A;  4ZHQ B;  3MR6 A;  1JX4 A;  2ZNJ A;  4YR0 A;  4DR1 H;  4AIL C;  4MV6 A;  1UJW B;  3A8T A;  4B3S B;  2ADQ B;  1V55 C;  3A0B Z;  3K04 A;  2WLN A;  2UUC H;  2NVX A;  5EWF A;  4DV7 H;  2ASJ A;  1Y6X A;  5C8Y B;  2OLS A;  4EG0 A;  4ZIB A;  1YTF B;  3LNN A;  2BE3 A;  2SCU B;  1I50 A;  4LF6 B;  3MAQ A;  3L4K A;  2UUA O;  3F5W C;  5EC1 C;  2EJ2 A;  4CH6 A;  5I60 A;  4I7H A;  5LMU O;  5JCO A;  4X1I A;  1SKV A;  3ABL B;  1LNQ A;  2AHY A;  4X1I B;  3ZHS A;  4IR9 A;  1H2K A;  2HHH B;  4MTE A;  2NVY A;  3VA7 A;  1Y76 B;  1XDN A;  3T1H B;  2IH3 C;  3VMM A;  3F8N A;  2HVQ A;  4Q43 A;  1WPX A;  4E2L A;  4FLY A;  5BR8 O;  4I50 A;  2Q73 A;  3BJY A;  2X0L A;  3MWE A;  2DYR C;  3K06 A;  4GX5 A;  3I55 V;  4FFP A;  2FE3 A;  2EIK C;  2HJF C;  1KMI Z;  3Q8Q B;  1BHB A;  4DV5 O;  5LXT A;  1RK5 A;  4MV9 A;  4BIZ A;  4JI8 O;  4G27 B;  4FFM A;  4F4Z A;  5LXT B;  3FX7 A;  1OBD A;  3ZMV A;  5BWR A;  4DW1 A;  2CE4 A;  4E6N A;  1VQO V;  4OPA A;  1AR5 A;  2COJ A;  2HIV A;  1OCO C;  3T2M A;  4CKC A;  5I5S A;  3JAM W;  1WP7 A;  3AG4 C;  4DR6 B;  4J41 A;  2AHZ A;  2CW8 A;  4ICG A;  3APO A;  4JYA B;  3I12 A;  2G38 A;  4GUN A;  1NZ6 A;  2Q5Z A;  5JH7 F;  3M8A A;  4B3R O;  2CNV A;  2VS0 A;  2ODM A;  4CH3 A;  4NXN O;  3R5F A;  1K1S A;  1NH2 B;  4HAM A;  4O2B B;  1P7G A;  1OBG A;  3AK2 A;  1AI7 A;  1EN5 A;  3Q2O A;  2DPI A;  1YTF D;  3HKZ A;  1FXH A;  3PJS K;  1SES A;  4HNA A;  4DV2 O;  3TXQ A;  1HNZ O;  3LSU A;  2PYL A;  1HWY A;  2JJ2 G;  1VQ6 V;  1VF5 B;  1MG1 A;  4HNA B;  1WCM G;  1CEZ A;  4AYB A;  3EPI A;  3MFI A;  3RWR D;  4Z1M G;  3PR5 B;  5EBW C;  1M1K W;  3X2Q B;  2WE6 A;  2FB9 A;  4WFA V;  1JOY A;  4A93 G;  2GUZ B;  4PWQ A;  1NR7 A;  1K9M W;  2VQE O;  3T4D A;  3OR6 C;  4N23 A;  4JI2 O;  3HB9 A;  5L3D A;  4A3J G;  1Y74 A;  1Y67 A;  3CD6 V;  4DO2 A;  4MS2 A;  2M6Y A;  1Y74 B;  2E2I A;  2L35 A;  1C3O A;  1UPG A;  4O4I A;  5JQG A;  3TIG A;  3AX6 A;  2YWV A;  5LP6 F;  3S3W A;  2BQ3 A;  1F4M A;  5JQG B;  2ZM6 O;  2NR5 A;  2ZR3 A;  2JA5 G;  1K5S A;  4JI1 H;  4BWA A;  2QWQ B;  2BQU A;  4DRX A;  1Q86 W;  1N33 O;  2XIG A;  1Y1W G;  2YI8 A;  4DRX B;  4HNU A;  1M6V A;  3LDE A;  3TXS A;  5KKN B;  2A0L A;  1BT8 A;  2M05 A;  1LR1 A;  4RB0 A;  2JGD A;  1M9N A;  4OPH A;  4F4W A;  1N56 A;  1XOU A;  4U3J A;  4JI7 H;  2JGD B;  2BTQ B;  5KFW A;  4FLW A;  2FPI B;  2FK1 A;  2IU0 A;  3LDC A;  2DIK A;  3J80 W;  2JEF A;  4DR3 O;  1EUC B;  1YIJ V;  4DL2 A;  1XEQ A;  4NXN B;  2NNU A;  4NXM O;  5DQI A;  4RQE A;  1CPY A;  1H2M A;  1RJP A;  5KAF Z;  4BBR G;  2RDJ A;  1EZV H;  4MV8 A;  4X65 H;  2JEU A;  4DIM A;  2AGA A;  1R3K C;  1Z2G A;  2Z3Y A;  2UUC B;  1S77 D;  3RBD A;  3B8N A;  2PI4 A;  2P67 A;  2ODT X;  4B7K A;  2XTA A;  4JI2 B;  4F4X A;  2HGX A;  1VMG A;  2YUA A;  4UCO A;  1GN6 A;  1XHZ A;  2YZL A;  1I6U A;  3JAR A;  2E76 B;  3LWB A;  4DAA A;  3B2E E;  4A2A A;  2YIA A;  4GX2 A;  2HIX A;  3H1L H;  4ECS A;  2R9I A;  3JAR B;  3C0F B;  3U9S A;  1VIB A;  3VNN A;  1IBK B;  1CXZ B;  3ZHT A;  1TVK A;  1QLN A;  3CSW A;  5KFL A;  4GC6 A;  1VF7 A;  4KFM A;  1PP9 H;  2V9W A;  3UO3 A;  1TVK B;  1ZAU A;  3OMN B;  4K0K H;  2V1D A;  3D3I A;  2CDY A;  3KAL A;  2QKA A;  4C7U A;  1S5J A;  3CCQ V;  3H1I H;  4X66 O;  2ZDI C;  3L75 H;  4X1K B;  5DGH A;  5IYB O;  2EJ7 A;  4IIJ B;  1BXR A;  4JV5 O;  4KHP O;  3SYP A;  4DV6 B;  4QE7 A;  3OFN G;  3G67 A;  1Q81 W;  3CSX A;  4PA3 A;  3P3N A;  1EKF A;  4R6Z A;  1EKV A;  2W7P A;  4DR3 B;  1YJN V;  1AJN A;  4B7E A;  5DLG A;  3V4S A;  4NXM B;  3TII A;  5LA6 F;  5KT5 A;  1I7F A;  4B3M O;  3N2G A;  1XNR O;  4FM2 A;  2F95 B;  4JAA A;  4X20 A;  2J6T A;  2R72 A;  5JWP A;  5A2Q N;  3N2G B;  1M93 A;  4DUZ O;  2W0X A;  4HYO A;  4X20 B;  2C2D A;  4EEQ A;  2GV9 A;  3CEB A;  3NBY B;  3W5O A;  4FLU A;  5BMV F;  4QSH A;  5EDW A;  1AI6 A;  2W6Q A;  1B33 N;  4RAI A;  2YIC A;  4J9S A;  1O75 A;  3DTG A;  4ETS A;  4DR5 B;  3W7T A;  5LYJ B;  5IYZ F;  3UFX B;  1XNQ B;  2JS5 A;  4MA0 A;  4DYL A;  3ZX6 A;  1RJQ A;  2KKW A;  1YXB A;  4X1Y A;  3U10 A;  3G6E V;  4MTG A;  2GQS A;  5KG3 A;  1X9N A;  3CJH B;  5KFY A;  4JZG A;  5KG6 A;  3OSN A;  4RNN A;  1Y4M A;  4ZOL A;  1S03 G;  4LWS A;  3PW4 A;  1N36 B;  1VEW A;  4ZOL B;  1VQL V;  4LWS B;  4EGJ A;  2H94 A;  2W6I G;  2XAQ A;  3E22 B;  4TV8 F;  3T9A A;  1ROP A;  4R50 A;  2P5O A;  4DV3 O;  3ABK B;  4PDB A;  3MJF A;  3OTO B;  4IZO A;  2GHY A;  2BOC C;  3CWB H;  3GJX B;  3KYH C;  4JI1 B;  1PK8 A;  3D3Q A;  5CBF A;  4GLX A;  1Y66 A;  1P49 A;  3CCU V;  1KKC A;  3ZRW A;  3JAM N;  3RN4 A;  4WBN B;  4O4J B;  4U3F H;  2YS7 A;  2FPP B;  5JJN B;  4QGP A;  3UZO A;  4O7W A;  3R23 A;  2JA7 G;  1ARO P;  5KFR A;  3ZMZ A;  4DUY B;  1WH2 A;  2MK3 A;  2PUS A;  4PA7 A;  5H80 A;  4O4L F;  4JZ2 A;  1A9X A;  1KQS U;  5B66 Z;  5IYB G;  3M9M B;  2UXC O;  5CBG A;  4O7T A;  1GN2 A;  5LGN A;  4B3M B;  4O7L A;  1JA8 A;  3CCJ V;  3CP1 A;  4RNM A;  4QWB A;  2VA3 A;  3KZI Z;  4DUZ B;  1ZTE A;  1AI4 A;  2HGW A;  5EBM C;  1Z2P X;  1SS3 A;  4DQN A;  5KFX A;  1J5E O;  2F1M A;  1V4Y A;  4WFE A;  4IL6 Z;  5J2U A;  1FXK A;  2WPD G;  1H2L A;  4MW3 A;  5FLX W;  4X65 B;  1CKN A;  2GLT A;  2LW7 A;  5IYC G;  5CMU A;  1FXK B;  5CA0 B;  1CKN B;  4FLZ A;  1GM9 A;  2LW1 A;  1JDB B;  2F43 G;  1FKA O;  3K08 A;  4DL7 A;  3IC9 A;  1BMF G;  5E25 A;  2GPS A;  5KFO A;  4FE2 A;  1Q3E A;  1E79 G;  3Q8R B;  3ETH A;  3E8B A;  1Q5O A;  3JAW A;  4MVO A;  4DR7 O;  3E35 A;  3F5T A;  3TIN A;  2FYU H;  3JAW B;  3OMA B;  2UUB O;  4MVQ A;  3NC0 B;  2W70 A;  3AG2 B;  2VQF B;  2ETN A;  2R7N A;  3CXH F;  2FMA A;  3EPG A;  4NR1 A;  3T1Y H;  4LF4 O;  1GLV A;  1TGO A;  3N43 B;  1BZK A;  1TUE B;  4X62 B;  5LOV F;  4YJ2 A;  1ZHS A;  3H9V A;  1SQV H;  2LFR A;  1KEE A;  1XUQ A;  1KEC A;  3CRA A;  1GRJ A;  4YJ2 B;  3GTJ A;  3OAA G;  2COI A;  5IYD G;  1ZET A;  2R93 A;  1G8M A;  4BIO A;  4DV0 O;  4ED2 A;  4HZ3 A;  5L3G A;  4MA5 A;  4I5S A;  5FLM G;  4IWX A;  1ENV A;  2P0A A;  2RCV A;  3OW2 U;  4WCE V;  2Q0A A;  1VBG A;  3G4S V;  4JAV A;  3JAT A;  2UU9 O;  1ULZ A;  3K3W A;  2M7W A;  4LBE C;  2E5L O;  1S5L Z;  4UVA A;  5J2T A;  1H2S B;  4EKW A;  3KG2 A;  4YHH O;  3SJQ C;  2KQX A;  3M9O B;  2R92 G;  2UXC B;  3NBZ B;  5FNV A;  4QIW A;  3J81 W;  3CRR A;  3N27 A;  4QWC A;  4JTA B;  3H01 A;  3SPJ A;  3RB4 A;  1B04 A;  5FNV B;  1BQ0 A;  3SNO A;  4U6P A;  3SYC A;  4MV3 A;  1CKM A;  3CQZ A;  2OCC C;  1N34 O;  1SQB H;  1YDX A;  3KCY A;  5L1J A;  1ZLZ A;  2QB5 A;  4J10 A;  4TM5 A;  5DGI A;  3AW8 A;  4RUC A;  4FS2 A;  3K0D A;  3KCX A;  1IYE A;  4P9P A;  2CAZ C;  4ECT A;  4ECU A;  3BEH A;  1RPR A;  5LMN H;  5B3S B;  4GKK O;  5CA1 A;  2AGQ A;  1EM1 A;  2IP4 A;  3P32 A;  3HOV G;  2FL4 A;  4MV1 A;  4K35 A;  4PI2 A;  3RYF A;  3RIZ A;  1GN4 A;  1WJZ A;  1NS1 A;  2QA4 V;  4DR7 B;  4FLV A;  3ABM C;  3RVY A;  3RYF B;  4IT5 A;  4LF9 O;  1OCR B;  1GSH A;  1NVP D;  2PMZ E;  2W9A A;  3CHX A;  1W96 A;  2KB1 A;  4YAJ B;  4FM9 A;  2PN1 A;  2LFS A;  4B3S H;  4ECX A;  5BXZ A;  4DR2 B;  3H1K H;  5J9P C;  5C44 G;  4LFA O;  5I47 A;  1IXB A;  3L71 H;  1YSC A;  5DM6 V;  3GIQ A;  4IHJ F;  2Y69 C;  4ECR A;  4DL6 A;  3CC4 V;  5IWA H;  1S0M A;  4O3P A;  4LF6 H;  4PD4 F;  5B1A B;  3KHR A;  4EBC A;  5IT9 W;  1S10 A;  1NR1 A;  2CTQ A;  4DV0 B;  4B3T O;  1EKP A;  1XRE A;  3N6X A;  2WLL A;  4GCZ A;  4RAY A;  3OSP A;  4CMD A;  3AYH B;  1CQI B;  4MTX A;  2E3C A;  3OEH G;  4U7O A;  1SA0 A;  2WLL B;  2DPJ A;  1I0H A;  3ZRX A;  1JIH A;  2HHH H;  4I7Z B;  2P6J A;  3ASN B;  4WFG A;  4CS2 A;  4R7R A;  3P3P A;  1FJG O;  2R8G A;  2F66 C;  1SA0 B;  3T1H H;  1Z2O X;  4YP3 A;  1IX9 A;  4TQD A;  4LFB O;  5FD6 A;  1MZB A;  1SET A;  4NTW A;  4X88 A;  5EC2 C;  1IOV A;  2P4K A;  4MTF A;  3RTX A;  2V4D A;  1AVM A;  1M57 B;  5KFJ A;  1N34 B;  1KJI A;  1R6N A;  5JVD F;  4D6T H;  4O83 A;  4I55 B;  2XND G;  2IW5 A;  1PL0 A;  2YZM A;  3I5D A;  3VQY A;  1AB3 A;  2DW4 A;  3FKS G;  1AUX A;  3W7W A;  4QWA A;  5K2M A;  2W6M A;  1VQN V;  3KXY T;  1IVS A;  5KFD A;  5EK0 A;  4WF9 V;  4EGQ A;  4LF8 O;  2W8K A;  1H2G A;  4GKK B;  2I8C A;  3E8G A;  2IA6 A;  2RQ6 A;  4W4L A;  4DK1 A;  4JTD B;  4DR6 H;  2RNB A;  2RGR A;  1EHI A;  3HKC B;  3VQW A;  5EZY A;  5IJ0 A;  1K33 A;  4DV4 B;  3W7S A;  5GON F;  4MV7 A;  2QSA A;  1U96 A;  5IJ0 B;  5HBR B;  4A3I G;  2A1H A;  4YY3 B;  2VRZ A;  1FD9 A;  1W59 A;  1A32 A;  1VQ9 V;  3ETD A;  4LFA B;  2JEJ A;  2X6A A;  2Y0S E;  3G80 A;  2RDC A;  3E86 A;  3PW5 A;  4Q4D A;  3T9B A;  2DYR B;  2AW9 A;  2UUA H;  3R9R A;  2EIK B;  4B3T B;  4PDL A;  4QE9 A;  3E8H A;  2YXY A;  3OR7 C;  5KUM A;  1GSA A;  2NU8 B;  2O03 A;  3GB7 C;  5FPO A;  3RGB A;  5KS8 A;  4RO2 A;  1WNS A;  2QWN B;  4APM A;  3RB3 A;  3LSQ A;  5GW7 A;  3O9O A;  1B6S A;  1R1B A;  4LFB B;  2OH2 A;  1OCO B;  1GTO A;  4QW8 A;  5EBL C;  4JV0 A;  4BW9 A;  4YJ3 A;  4EEY A;  3AG4 B;  2QJ1 A;  2DQ0 A;  5F2V O;  2R9A A;  4PI0 A;  3LUL A;  5JVL A;  3JD2 A;  4YJ3 B;  4RZR A;  3I56 V;  2DQ3 A;  5KG1 A;  4DV5 H;  3B8M A;  1K34 A;  4FFR A;  3HB3 B;  2UXX A;  3UT5 B;  3STL C;  4P2Z A;  2CTR A;  3K59 A;  2DZD A;  1K5Q A;  3GIJ A;  3Q4H A;  4RUA A;  5CB4 F;  3H3V H;  2IH1 C;  2ZIM A;  4HBN A;  1RSO A;  4JI3 O;  3BFR A;  4QPJ A;  3PW7 A;  5BY1 A;  4A3E G;  3KHG A;  3G6X A;  3UM7 A;  3SPG A;  1RSO B;  1R3J C;  4IRK A;  5LMN B;  1TUB B;  3G71 V;  4DV1 O;  1AR1 B;  3WWJ A;  4MT8 A;  2QTS A;  4NXN H;  1ZWI C;  3TQT A;  3K57 A;  4A3F G;  1BGY H;  2C00 A;  3U9T A;  4ME6 A;  2FML A;  5CAE B;  4LH6 A;  4DL4 A;  3QTC A;  4PDV A;  3B09 A;  2ZE5 A;  1P7B A;  2IJK A;  4TV9 F;  4JI0 O;  5KA6 A;  2HDK A;  1WPB A;  4I9W A;  2ADP A;  2JGU A;  5C8Y A;  3HKD A;  4GKJ O;  1GH6 A;  4YIP A;  2VQE H;  4A3D G;  1IBL O;  1TWF A;  3HKD B;  3WNZ A;  4JI2 H;  1XMO B;  1H8H G;  4ZBM A;  4YB8 B;  5IWA B;  4O3S A;  2JVD A;  2RN9 A;  1WB8 A;  4JYY A;  4J9Y B;  2EZO A;  4ASU G;  2C28 A;  3T5K A;  4D7T A;  1Y1V A;  2R7Z G;  2ZKO A;  4X64 O;  1Y76 A;  3FMA A;  1IBK H;  5DGB A;  3DTU B;  2ZNI A;  5BWW A;  3AG1 C;  4FM1 A;  1W0J G;  4UCR A;  4TVI A;  1FXV A;  4C5B A;  3FB6 C;  5KG0 A;  4CC6 A;  2WB1 A;  2AZ0 A;  3DGE A;  1N33 H;  1R6K A;  3GVM A;  2I80 A;  5AG2 A;  5DLF A;  1G4Y B;  2JJ1 G;  1QHT A;  3OD4 A;  4JI6 O;  4DV6 H;  1SQX H;  2XD4 A;  4JI3 B;  4EQ5 A;  1UC8 A;  4F4L A;  1H8E G;  3U0G A;  4P9O A;  1JKJ B;  4FBU A;  1SF9 A;  4FM0 A;  4JI5 O;  4I0X A;  1UNN C;  5KT3 A;  4DR3 H;  3K9S A;  5KFN A;  2AZ2 A;  4I0X B;  1VF6 C;  3PO3 G;  3QVN A;  2CH7 A;  2YID A;  3UO2 A;  1EN6 A;  3NR7 A;  3H1H H;  2XCP A;  4NXM H;  1KKD A;  4O2A A;  4QWE A;  3T1C A;  2CH7 B;  2W0F C;  5IP9 G;  4O2B A;  3TW6 A;  4O2A B;  1SQG A;  1G1X B;  1DGS A;  1F23 A;  4JI4 O;  2WLH A;  2JEX A;  3QZ8 A;  4GYC B;  1IBM O;  4K6N A;  1RK6 A;  2ATL A;  1DTO A;  5I5W A;  4CC5 A;  4DR4 O;  4DR5 H;  4DW0 A;  4XYM B;  1IBL B;  1KBL A;  3B40 A;  2A06 H;  4NTY A;  5L3E A;  2CFM A;  2GUZ A;  1XNQ H;  2UUA B;  4UV8 A;  5J2T F;  4DXW A;  2YU9 A;  3F7V C;  4QIW F;  3VQV A;  3STZ C;  1PNL A;  5LMU B;  2EJ3 A;  2V4R A;  2HJD A;  2JS3 A;  3JZ6 A;  5IDJ A;  4ECZ A;  1KUQ A;  5KFZ A;  1AP5 A;  4UXN A;  3WB2 A;  4X64 B;  3RUP A;  3TY5 A;  4Q45 A;  3RT3 C;  4LF7 O;  2ZDH A;  1AN7 A;  4FGR A;  1N36 H;  1N32 O;  3CS5 A;  4DR1 O;  3CB2 A;  1D5A A;  5BR8 B;  3HT5 A;  3GQC A;  4OXS A;  3N41 B;  2YIB A;  3N2K B;  3OTO H;  5D5Q A;  4QJF A;  3K03 A;  1I08 A;  4O4H A;  1P16 A;  4QJF B;  4X66 H;  3TCU A;  4O4H B;  5CA1 F;  3BAB A;  4DV5 B;  5EYP A;  2UXB O;  4JI8 B;  4KHP H;  3CXC U;  4RZQ A;  1XI1 A;  2OIE A;  5EYP B;  4JI6 B;  2ZDG A;  1Q43 A;  4XYL B;  1JDE A;  1GGO A;  1R6T A;  2A9H A;  4DUY H;  2BTQ A;  4RWU A;  4LFC O;  3GV7 B;  1E1R G;  5JUM A;  1WSC A;  4EB6 A;  4MW8 A;  1AJP A;  2W6P A;  2IJH A;  4JUZ A;  2YL2 A;  3HOU G;  2LO1 A;  4I4T A;  5FPR A;  3ZJZ A;  2KSD A;  1NH2 D;  4EB6 B;  2F4V O;  3HXL A;  4B3M H;  3BQ1 A;  1XNR H;  2X5R A;  3SI8 A;  4JTC B;  3ORQ A;  4I4T B;  4Z1V A;  4O7V A;  1CQJ B;  4B3R B;  1DAA A;  4DUZ H;  2H8P C;  3W1B A;  2ZE7 A;  3W7U A;  1B3Q A;  4XDL A;  4M0J A;  2B63 G;  2P22 C;  3CRC A;  1RM1 C;  4CBC A;  4DV2 B;  1Q8I A;  1R3L C;  1HNZ B;  1I5Y A;  1I2L A;  2HHF A;  3GV5 B;  4XBF A;  1AIL A;  1XHX A;  3RVZ A;  4ZI7 A;  1XBL A;  1QLE C;  5ITZ B;  2OYQ A;  2HHF B;  1YEW A;  3HOW G;  5CA3 A;  4ZI7 B;  1L1F A;  4ED6 A;  4GZR B;  2Q2T A;  4YR3 A;  5C93 A;  3SJB C;  3EYY A;  2VQE B;  3OUU A;  5CBH A;  2HKO A;  3HKE A;  2Q7D A;  3WWH A;  1GMG A;  1VQM V;  5H2F Z;  3WFV A;  2I87 A;  3QWU A;  3HKE B;  1AUV A;  5I5Y A;  5KG2 A;  5KFF A;  1MOF A;  1N32 B;  3E8F A;  4K3A A;  2V58 A;  4QIW E;  1AI5 A;  3L70 H;  4MVS A;  2VQF H;  2YIB D;  3BAA A;  1GM7 A;  4FMT A;  2R7M A;  2R87 A;  4CE5 A;  2UVV A;  1MMM A;  3VPD A;  1BSM A;  2ZM6 B;  3APQ A;  4X62 H;  1QVG U;  5HV6 A;  2DOS A;  4J9M A;  1NI8 A;  3OHA A;  2UXB B;  4O3Q A;  5HNE A;  4UCS A;  1N33 B;  5L1I A;  3JD4 A;  3BAC A;  2B9Z A;  4X1K A;  2WAQ E;  2LGQ A;  3UKM A;  5C4X G;  1TA8 A;  4IIJ A;  3HOZ G;  2BCC H;  3DAA A;  2QR4 A;  4J9L A;  1PKX A;  2YRW A;  3RV4 A;  1MZE A;  3GIL A;  5C1O A;  4F50 A;  3NGD A;  3SJC C;  1A0I A;  2UXC H;  1RJR A;  2VR1 A;  2YC0 A;  4TUY F;  5C3E G;  4ZKI A;  1H38 A;  4FFB A;  3AK1 A;  4J7K A;  3SYA A;  3G8C A;  3L9D A;  4C5A A;  4FFB B;  3H0G A;  2WSS G;  4AQY O;  1RYR A;  1E1Q G;  3TQ1 A;  1J5E H;  5IYC O;  1T94 A;  4J9P A;  3CCS V;  4O3N A;  2KG7 B;  3OTF A;  1GM8 A;  3GTL A;  2DWC A;  3FB5 C;  3ICX A;  4J11 A;  4BR6 A;  3RBZ A;  3Q8P B;  3TJT A;  2NUA B;  5GTH Z;  2KSW A;  1RYS A;  4MVM A;  3TK1 A;  5LYJ A;  2R7L A;  3MFH A;  2R8J A;  1FKA H;  4JI7 O;  4W4K A;  1VBH A;  2Q68 A;  2ZJT A;  1I94 O;  1EN4 A;  2E74 B;  4DR7 H;  3CRM A;  2VA2 A;  3CJH A;  2ITC C;  3CME V;  2P4V A;  3DSQ A;  1XL4 A;  2PTM A;  5BZB A;  4A5U B;  2ZE8 A;  4P30 A;  3RYI A;  4O84 A;  4IGG A;  3CVZ A;  2FK2 A;  2GTS A;  2ILM A;  3CCM V;  4DR2 H;  3E22 A;  4JYC A;  3RYI B;  4CS3 A;  3CRQ A;  5CR5 A;  4PV1 B;  3VBB A;  1DV1 A;  2XCL A;  5LL6 b;  2Q0O C;  1M56 C;  5TIS Z;  3GII A;  5IYD O;  4MAM A;  2AU0 A;  3K5I A;  4G28 B;  1X4T A;  2OCC B;  2EIL B;  4ZQI A;  4DV0 H;  3QNE A;  2QYZ A;  1OCC C;  1VQ5 V;  4X66 B;  4E4E A;  1Q7Y W;  3RFC A;  4WBN A;  4O4J A;  5CN0 A;  5KX5 B;  2XAJ A;  3KRE A;  1EZ1 A;  3JAS A;  4JV5 B;  4KHP B;  2R7K A;  4ZHQ F;  2RDI A;  2PGG A;  2PF4 E;  4YHH H;  2OTJ V;  2CQY A;  5KFT A;  1PL4 A;  1VQP V;  3G8D A;  3JAS B;  2R8K A;  2GSM B;  4JXU A;  3QO8 A;  5A9G A;  3RYH B;  3HPL C;  2WWW A;  3KHH A;  1NKD A;  1N34 H;  1SQP H;  1S0V A;  3ABM B;  1PM9 A;  1S5H C;  1LUV A;  2H3O A;  3JD3 A;  1XNR B;  4K0K O;  1RP3 B;  2XAS A;  5EIB D;  4OX9 O;  4TWK A;  2ZXW C;  5FJ8 G;  1GN3 A;  2Z04 A;  1MAB G;  4J9R A;  3QZ7 A;  4TT3 G;  2YW2 A;  1OHH G;  4GKK H;  4HR7 A;  4EBE A;  5KG7 A;  1B6Q A;  5CA0 A;  5DN6 G;  3DC6 A;  2VWJ A;  5K1X A;  2FLP A;  4DV4 H;  1S97 A;  2CUG A;  3WG7 B;  4I50 F;  2GPW A;  4AI8 A;  4A2B A;  4YY3 H;  5I5U A;  3IC7 A;  1HR0 O;  2BSK A;  5DED A;  3KAK A;  5F9N A;  4LFA H;  4LF5 O;  2BSK B;  5LXT F;  3KKY A;  1DIK A;  4ECW A;  4RAZ A;  1IDS A;  5KUK A;  4WFH A;  5K3W A;  4ECY A;  4DV3 B;  4KXR A;  1WR2 A;  5KLV H;  1I7L A;  2MW2 B;  4DL3 A;  2QM4 A;  3T5H A;  4B3T H;  1GO3 F;  4GLW A;  2QKS A;  3R65 A;  2EIN C;  2BQR A;  3R5H A;  5KT7 A;  4HNT A;  2EIM C;  1BCC H;  1CKO A;  4XX0 B;  1M4U A;  3K5N A;  2YS8 A;  1EBO A;  3H1J H;  2UVR A;  1GAX A;  4LFB H;  3J80 N;  4IAJ A;  4O2B F;  1PNM A;  2XOK G;  2WA4 A;  5KFS A;  5DQG A;  2Q9L A;  1S72 V;  5H6Q A;  5KAI Z;  5LHI A;  1KP3 A;  3ETG A;  2W9C B;  1YIT V;  5LHH A;  3CCL V;  5JH7 A;  2EBO A;  3JRW A;  3AG3 C;  2HFE C;  5JH7 B;  5BYB A;  2QDO A;  3HKB B;  3RJ0 A;  2R8H A;  3E2E A;  4DL5 A;  3BY6 A;  5KFH A;  3RAQ A;  4LF8 H;  4F6E A;  2NU7 B;  3MR3 A;  1QNM A;  5JJE B;  1J5E B;  1JVM A;  2CK3 G;  2ZE6 A;  4K8Z A;  2J6S A;  2CZG A;  2YZN A;  3JCZ A;  3V6K A;  2RGV A;  4J42 A;  3TY8 A;  3ZHV A;  3SGI A;  1Z2N X;  3FAV A;  1HDJ A;  1ET0 A;  2R93 G;  3JCU Z;  3FB8 C;  4O4I F;  5JQG F;  1VS0 A;  3FAV B;  3WO0 A;  3IG0 A;  3OMI B;  5DGA A;  4PZ6 A;  1K97 A;  4LP8 A;  1M7J A;  2HG8 A;  1G6U A;  3MR5 A;  1RPO A;  5B5E Z;  2HVK C;  2Q2U A;  1HNW O;  3L72 H;  2QWP B;  1GKF A;  2YDE A;  3CCV V;  1L8D A;  4BW5 A;  5LP6 A;  2UUB B;  4LF5 B;  3UZB A;  3K0G A;  1T3N A;  5KG4 A;  2JA6 A;  1A3G A;  2WB1 E;  1HW7 A;  3UYY A;  5LP6 B;  4LF4 B;  5L1L A;  2XAH A;  2Y4U A;  1OCZ C;  3H40 A;  1ZQ7 A;  5KFG A;  2CTW A;  2Q7G A;  3AG7 A;  2UXD O;  1UFI A;  3VPB A;  5DG7 A;  1XMO H;  1F4N A;  1EFR G;  1KTA A;  1VQ8 V;  5H5N A;  2Z5U A;  1T5E A;  5L3C A;  1D5N A;  2IBK A;  3GID A;  2VUM A;  3WO1 A;  4WD3 A;  3J7A U;  1GO3 E;  2DLN A;  2UU9 B;  2C35 B;  2X6B A;  4ED8 A;  2E5L B;  1FS0 G;  3ORR A;  2PYJ A;  4YHH B;  4IYH A;  3IGA C;  2A79 B;  1WP8 A;  1HNX O;  3T1Y O;  4EFE A;  4I55 A;  1WB7 A;  4OGQ B;  1K92 A;  1YZB A;  3QF7 A;  5B1B C;  1IUR A;  3W1G A;  3BG5 A;  2ZT9 B;  3LQS A;  1E4E A;  4O7Y A;  3KHL A;  3QFF A;  3CC7 V;  3K5M A;  3PFF A;  3Q1K A;  1E4E B;  1E4G T;  2EX3 A;  3HKZ E;  2AGP A;  1P4R A;  5D1P A;  5IJ9 A;  4O7N A;  4IR1 A;  2W7O A;  4JI3 H;  3K5L A;  3RV3 A;  1V55 B;  4AYB E;  1EYZ A;  3RFR A;  5IJ9 B;  2Q7E A;  3OT7 A;  1SQQ H;  4K8X A;  2QEX V;  3CCE V;  3GTM A;  2WLI A;  2QE7 G;  4L8J A;  3GTP A;  3E5N A;  1IYD A;  3HKC A;  1S76 D;  2WLI B;  3TEK A;  5HFL A;  3QG5 A;  2YXH A;  3S3X A;  4DK0 A;  4PA9 A;  4JGS A;  3K5H A;  4LF9 B;  4YBZ B;  2FTK A;  3AG1 B;  1K4D C;  3ZHQ A;  1ZHQ A;  4Q8E A;  2F93 B;  4UUG A;  2C2E A;  3LUT B;  4FIP C;  4GKJ H;  2XT9 A;  1XMQ O;  4IIJ F;  5I5V A;  5KHH A;  4H13 B;  4H37 A;  1IBL H;  2UXD B;  5FL7 G;  3VOT A;  1N0N A;  2EJR A;  1Z5V A;  2HG5 C;  5LHG A;  5LMU H;  3GIM A;  1YCI A;  4LNU A;  3PR4 A;  1KB9 F;  2V5A A;  1NJI W;  4X64 H;  2YXL A;  4LNU B;  5KG5 A;  1XIL A;  4EYH B;  4NTX A;  1K3E A;  3ASO C;  2IU3 A;  3JYC A;  1FJG B;  1H2N A;  2F23 A;  4NYK A;  4LH7 A;  3E83 A;  3K3V A;  2JEG A;  2OT5 A;  4RB1 A;  3GIP A;  5BR8 H;  2DMX A;  4TUY B;  2AGO A;  3TET A;  2WAM A;  1K73 W;  3LML A;  3FKI A;  4H44 B;  5LA6 A;  1P8L A;  4CKE A;  3ZS8 C;  5IY5 C;  1HP8 A;  3UT5 A;  5LA6 B;  5LYJ F;  1ZL8 A;  1PNK A;  2IJI A;  2UVW A;  3SYQ A;  4JI8 H;  1ZL8 B;  5FLX N;  4JI6 H;  3SPI A;  2LJ2 A;  5BMV A;  4TSF G;  2XUM A;  4JAS A;  4LF8 B;  1NTM H;  1F51 A;  5BMV B;  4MV4 A;  3OHB A;  1QR9 A;  2HHH O;  4MVU A;  5IYZ A;  3T1H O;  4ZOL F;  4JV2 A;  3PO2 G;  1TUB A;  1TWG A;  5CM0 A;  5IYZ B;  1KC8 W;  4FJC C;  3ABT A;  4GX1 A;  1URF A;  4B3R H;  5KHI A;  4JF3 A;  5EWE A;  3T5L A;  2COG A;  4YR2 A;  2ZDQ A;  3JRX A;  1I1M A;  4FZ1 A;  2R82 A;  3I4N G;  2NU6 B;  1DLB A;  2Q69 A;  4DV2 H;  4TV8 A;  4Q6G A;  1XMQ B;  1HNZ H;  3EVK A;  5HFM A;  2MCT A;  2ARH A;  4WBN F;  4DR4 H;  4O4J F;  3CC2 V;  1JFF A;  4L87 A;  4TV8 B;  3GDE A;  1KP2 A;  1M5I A;  1WRV A;  1N0J A;  1JFF B;  3HOY G;  3N40 P;  4Q0Y A;  2FKL A;  5K1P A;  1BE3 H;  2DAA A;  4IYI A;  1EUD B;  3I4M G;  1Z5W A;  3D36 C;  1VP7 A;  2W6O A;  4IRC A;  1OWT A;  3T54 A;  3G6V A;  1KJ9 A;  2DYS C;  2EUL A;  4JYA O;  3WB0 A;  2R9R B;  1N32 H;  5EWG A;  1XDC A;  3J81 N;  1SFO A;  4GC7 A;  2W8L A;  3JSN A;  4O4L A;  3EFF K;  2XHB A;  2ZM6 H;  4RUF A;  4ED0 A;  4FS1 A;  4O4L B;  2Q7H A;  1K8A W;  4D7S A;  1B06 A;  2ZCE A;  5A2Q W;  1WN7 A;  2UXB H;  5J2U F;  3PVX A;  5CA0 F;  3DF7 A;  3T99 A;  1JJO A;  4LR3 A;  5KFE A;  5KT4 A;  3D8C A;  3OGC C;  2NU9 B;  4RNO A;  2W9B A;  1VQ7 V;  4I9Q A;  2NN4 A;  1DV2 A;  1RM1 B;  2YI9 A;  4LSA A;  1DF5 A;  2W9B B;  2UVU A;  2QGN A;  4LFC H;  4U7N A;  1QLE B;  1NTK H;  3HOX G;  2GBO A;  5GTI Z;  2FPG B;  2F4V H;  3ZED A;  2PMZ A;  4O3R A;  5IE9 A;  4G3I A;  4DV1 B;  2ASL A;  5DG9 A;  4I50 B;  4CHI A;  2AXT Z;  3ETQ A;  1YJW V;  4X8A A;  4IWY A;  1Y1V G;  4WHX A;  1WCM A;  4GT1 A;  3SE7 A;  4H33 A;  3K3P A;  1V54 C;  4YJ2 F;  2QWR B;  3T9C A;  3N44 B;  5IP7 G;  2B1I A;  4EFB A;  1VAR A;  4JI0 B;  3GTG A;  2CNU A;  5IT9 N;  3HR0 A;  1QBZ A;  2N05 A;  5LOV A;  2XGP A;  1JPX A;  4RQF A;  4GKJ B;  1JX9 A;  4FFN A;  1SEI A;  5I5T A;  5L1K A;  5LOV B;  1W93 A;  3SPH A;  2GQR A;  2ZDI A;  2JEI A;  4BBS G;  3LDD A;  3RYC A;  2X7R B;  5FNV F;  4PDR A;  2YCH A;  3RYC B;  4NB5 A;  2JA5 A;  4NZM A;  4LMY A;  1I3Q A;  1W2B U;  2WTF A;  4BXX G;  2WLM A;  1XL6 A;  1O9G A;  2Z0A A;  3BA8 A;  1Y1W A;  4O7S A;  5D8D A;  3N2K A;  4EYI B;  4XDK A;  3BA9 A;  2Y48 A;  5KFU A;  2HGS A;  2OWO A;  1FAF A;  1KJ8 A;  2EIJ C;  4QPK A;  2UUC O;  3GTK A;  4FFK A;  4UCU A;  4DV7 O;  4IRD A;  1XQ8 A;  5LGU A;  4JV5 H;  2O57 A;  4YXW G;  3ZCC A;  2ZGI A;  2AQ4 A;  3AK3 A;  3IJ4 A;  2J9G A;  2JIZ G;  2B63 A;  4JI5 B;  1IBK O;  4TQF A;  1XK5 A;  2GDS A;  4O4I B;  2Y4R A;  4PHZ A;  2Y0S A;  5JQW A;  3L74 H;  2FLN A;  1V51 A;  5KFM A;  3B77 A;  2R84 A;  4AQY H;  1KBH A;  3SJA C;  1BJT A;  4FK5 C;  2XAG A;  4UVC A;  3GIK A;  3UQ8 A;  4JI4 B;  2C22 A;  2P06 A;  3GTQ A;  1F7Y A;  1IBM B;  1AP6 A;  1YHQ V;  2C2A A;  2ZD9 A;  1GK9 A;  3ABL C;  4IHJ A;  4ECV A;  1M56 B;  2N74 A;  3ZN0 A;  5ITZ A;  5JCO C;  3BHP A;  3MR2 A;  3L73 H;  4DR4 B;  4IHJ B;  4DV6 O;  1VQK V;  1US6 A;  2QK4 A;  3TY9 A;  1I94 H;  3OE7 G;  4HN2 A;  1OCC B;  4U3J B;  4N21 A;  1QU7 A;  5FD5 A;  3C3S A;  1I7N A;  1FPO A;  3T5J A;  4JAU A;  5LBQ A;  3F7Y C;  4DLK A;  4CS4 A;  4I55 F;  3CPW U;  2B1G A;  3RB0 A;  2E75 B;  3CYO A;  4LF7 B;  5BPF A;  3O65 A;  2HLD G;  1TWH A;  1JCH A;  2VWK A;  3SPC A;  2BOB C;  4DR1 B;  2D3O W;  4O82 A;  3S24 A;  2J6U A;  3WB1 A;  3Q8S B;  3JSL A;  4Y8V B;  4DV3 H;  4Q8F A;  1SZX A;  2WA3 A;  4CH5 A;  5JVD A;  1X59 A;  3ETE A;  4M9U A;  4DV7 B;  2OCH A;  5JVD B;  4DR5 O;  1SRY A;  4FLX A;  1IOW A;  1R9T A;  1NU1 H;  3DXR A;  4R7C A;  1XNQ O;  5E79 Z;  2ZXW B;  3T9D A;  4O3O A;  3GTO A;  2HVJ C;  3DXR B;  3MHH C;  3ZN1 A;  5KHK A;  5EZY F;  4H0L B;  2PVP A;  3V4Z A;  2YYA A;  3BCC H;  5B1N A;  5BWT A;  2QTO A;  1C30 A;  4LFC B;  3N8D A;  2ZQM A;  3L4J A;  3SDL A;  1N36 O;  3BQ0 A;  3ZHR A;  4KL1 A;  2UXN A;  2XAF A;  2F4V B;  2B5U A;  5GON A;  2HJW A;  1MA1 A;  4WFF A;  1QCE A;  2P90 A;  3OTO O;  5GON B;  3DC5 A;  4LCU C;  1JQ0 A;  5JJJ B;  3RGX A;  4OX9 H;  4A3C G;  3X2Q C;  4UUJ C;  1KUT A;  2ZIO A;  2YEV A;  4JI1 O;  2KG7 A;  3FD9 A;  1COW G;  3VOU A;  3K79 A;  4RCN A;  2YEV B;  1O9H A;  2RJZ A;  4UB8 Z;  4NYE A;  1Q6H A;  1SYX B;  1OV9 A;  2EIN B;  4PA6 A;  4DUY O;  1EZJ A;  2FJZ A;  4B08 A;  3MWD A;  2ABJ A;  2EIM B;  1WA8 A;  2VUG A;  3ZHU A;  1CS0 A;  4YJ3 F;  2WYO A;  1HR0 H;  1WA8 B;  4R8U A;  2Z02 A;  3IN5 A;  1BL8 A;  3R66 A;  5KHJ A;  1YJ9 V;  5T14 A;  4RB2 C;  4R8U B;  3THO A;  4XDJ A;  4LF5 H;  2UUB H;  1A0G A;  3ZBH A;  5BYA A;  4J0M A;  1ZUQ A;  3ML0 A;  1YI2 V;  2ITD C;  4LF4 H;  1T36 A;  4HYK A;  2W6J G;  4ED3 A;  5DEC A;  2FP4 B;  3T7A A;  3H0G G;  3G6Y A;  3J7A K;  4X65 O;  3AG3 B;  3NXS A;  1YVW A;  2FKX A;  4CKB A;  4MTO A;  2CNQ A;  2JA7 A;  1L0L H;  2QM7 A;  4UCT A;  2V7Q G;  2RF4 A;  5CB4 A;  3RGZ A;  5KX5 A;  3MHS C;  3H4D A;  5KA5 A;  5KHG A;  4X1Y B;  3QO5 A;  4L1K A;  4A3K G;  5CB4 B;  2UU9 H;  3VQX A; 
#chains in the Genus database with same CATH homology
 1KU9 A;  2E5L H;  2XIG A;  4NXN H;  3RYH A;  5KMG A;  2Q7G A;  1XMO H;  2YI8 A;  4DRX B;  3RF2 A;  3K57 A;  5KMG B;  4LH6 A;  4RB0 A;  1NT2 B;  5D1O A;  1T5E A;  3QTC A;  4JI7 H;  4U3J A;  2BTQ B;  4FLW A;  4TOI A;  1SQF A;  1M0T A;  2BTO A;  5D1O B;  4AQY B;  3J80 W;  1WPB A;  3U0Z A;  2UU9 B;  3M7M X;  2JGU A;  5C8Y A;  3HKD A;  4TV9 A;  2E5L B;  1S68 A;  2VQE H;  2PYJ A;  1FFX A;  4YHH B;  4NXN B;  3HKD B;  4JI2 H;  4TV9 B;  1XMO B;  5IWA B;  2JVD A;  1FFX B;  4EFE A;  2ZIN A;  4I55 A;  4LSX A;  3QF7 A;  3W1G A;  4JI7 B;  4D7T A;  4X65 H;  3IAY A;  1I94 B;  3FMA A;  1GYF A;  1IBK H;  3BPZ A;  3PN1 A;  3K5M A;  1E4G T;  2ZNI A;  2EX3 A;  2UUC B;  5D1P A;  4FM1 A;  4UCR A;  5IJ9 A;  1HNW H;  4JI3 H;  3K5L A;  4LF9 H;  3RFR A;  4CC6 A;  5IJ9 B;  4JI2 B;  2Q7E A;  4K8X A;  4UCO A;  1XHZ A;  1I6U A;  3JAR A;  4A2A A;  4FLT A;  3B2E E;  4L8J A;  1N33 H;  2YIA A;  2HIX A;  4UFZ A;  3HKC A;  2UXD H;  3JAR B;  3C0F B;  3VNN A;  3QG5 A;  5J2U B;  1IBK B;  2HVS A;  4DK0 A;  1QHT A;  1TVK A;  4DV6 H;  3FFQ A;  4JI3 B;  4LF9 B;  4EQ5 A;  1VF7 A;  1ZHQ A;  2HEP A;  1TVK B;  1ZAU A;  4FM0 A;  4K0K H;  2F93 B;  3KAL A;  4GKJ H;  1FJG H;  4DR3 H;  5KHH A;  1S5J A;  1L2Z A;  1IBL H;  2UXD B;  4NXM H;  4O2A A;  1Z5V A;  4X1K B;  1HNX H;  4UCV A;  4O2B A;  4IIJ B;  4O2A B;  5LMU H;  5EIB C;  1SQG A;  4LNU A;  1DGS A;  4DV6 B;  4X64 H;  2YXL A;  3CSX A;  4GYC B;  4LNU B;  4K0K B;  3H20 A;  2IM9 A;  3HKB A;  4OX9 B;  4DR3 B;  1FJG B;  4LH7 A;  4CC5 A;  2PZS A;  3K3V A;  4DR5 H;  1IBL B;  4RB1 A;  5BR8 H;  4NXM B;  2CFM A;  1XNQ H;  3KAJ A;  1I7F A;  2UUA B;  4TUY B;  3N2G A;  3LML A;  4FM2 A;  2F95 B;  4X20 A;  3VQV A;  5LA6 A;  2R72 A;  5LMU B;  3N2G B;  1M93 A;  1P8L A;  3ZS8 C;  3JAT B;  3M4I A;  3WB2 A;  4X20 B;  3UT5 A;  4X64 B;  5LA6 B;  4EEQ A;  3TY5 A;  2CW7 A;  2GV9 A;  3NBY B;  3W5O A;  5J2T B;  4FLU A;  1AN7 A;  4JI8 H;  1N36 H;  4JI6 H;  4AHC A;  1O75 A;  4ETS A;  5BMV A;  3CB2 A;  4DR5 B;  1D5A A;  5LYJ B;  5BR8 B;  4LF8 B;  1XNQ B;  2JS5 A;  5BMV B;  1HR0 B;  3N41 B;  2YIB A;  3N2K B;  3OTO H;  5D5Q A;  1XMQ H;  5IYZ A;  2KKW A;  4X1Y A;  4O4H A;  3U10 A;  1P16 A;  1X9N A;  5D5P A;  1TUB A;  4X66 H;  5IYZ B;  4O4H B;  3BAB A;  4DV5 B;  4M7E A;  5EYP A;  4ZOL A;  1S03 G;  4JI8 B;  4KHP H;  4RZQ A;  1N36 B;  2VPS A;  5KHI A;  1XI1 A;  4B3R H;  5EYP B;  4JI6 B;  4ZOL B;  3E22 B;  1Q43 A;  5CA1 B;  2P5O A;  4PDB A;  4DUY H;  2BTQ A;  4DV2 H;  4TV8 A;  3OTO B;  4Q6G A;  1XMQ B;  1HNZ H;  2MCT A;  4DR4 H;  4EB6 A;  1JFF A;  4TV8 B;  3GJX B;  3GDE A;  3KYH C;  1M5I A;  4I4T A;  5FPR A;  4JI1 B;  3HXL A;  4B3M H;  4EB6 B;  1XNR H;  1JFF B;  4GLX A;  3N40 P;  4Q0Y A;  5K1P A;  1P49 A;  1V9P A;  4I4T B;  4B3R B;  1Z5W A;  4WBN B;  5DIS C;  4DUZ H;  4O4J B;  3W1B A;  1FVI A;  5JJN B;  2P22 C;  2WDT A;  4DUY B;  4DV2 B;  1WH2 A;  3WB0 A;  1Q8I A;  2PUS A;  1HNZ B;  1N32 H;  1QQC A;  1BGW A;  1XHX A;  4ZI7 A;  5ITZ B;  2OYQ A;  2W57 A;  3JSN A;  4O4L A;  4B3M B;  1JMK C;  1YEW A;  4ZI7 B;  3K58 A;  2XHB A;  2Q2T A;  2ZM6 H;  3SJB C;  3EYY A;  4O4L B;  2VQE B;  4DUZ B;  2Q7H A;  4D7S A;  2ZCE A;  3HKE A;  5A2Q W;  1WN7 A;  2UXB H;  1Z2P X;  3DF7 A;  4DV1 H;  1JJO A;  3A2F A;  4LR3 A;  3HKE B;  3QWU A;  2F1M A;  1N32 B;  3MWM A;  5J2U A;  4I9Q A;  3RR5 A;  5FLX W;  4LSA A;  2YI9 A;  3K5O A;  4X65 B;  1CKN A;  2VQF H;  2YIB D;  3BAA A;  5CA0 B;  2R70 A;  4PZ8 A;  4MTD A;  1CKN B;  4LFC H;  4FLZ A;  2ZM6 B;  1HNW B;  4X62 H;  4JI0 H;  1Q3E A;  2F4V H;  3ZED A;  3JAL A;  1Q5O A;  3JAW A;  2UXB B;  4DV1 B;  2VOB A;  4UCS A;  1N33 B;  3JAL B;  4I50 B;  3JAW B;  3ETQ A;  4X1K A;  3NC0 B;  1TA8 A;  4IIJ A;  2VQF B;  4JYA H;  3T1Y H;  1TGO A;  3N43 B;  4F6R A;  3N44 B;  3U11 A;  4EFB A;  4X62 B;  3SJC C;  5EZY B;  4RB3 C;  1A0I A;  4YJ2 A;  4F6R B;  1ZHS A;  2UXC H;  4JI0 B;  4CH4 A;  5LOV A;  4YJ2 B;  4FFB A;  4GKJ B;  1SEI A;  5LOV B;  4TUY A;  4FFB B;  1E4F T;  2Q0A A;  1HNX B;  3RYC A;  3T1Y B;  3JAT A;  1J5E H;  2YCH A;  3OTF A;  3RYC B;  5J2T A;  1H2S B;  2UXC B;  3NBZ B;  3ICX A;  5FNV A;  4LMY A;  3J81 W;  1M0W A;  2KSW A;  1B04 A;  5FNV B;  5LYJ A;  4NVP A;  1CKM A;  1O9G A;  3BA8 A;  1FKA H;  3N2K A;  3BA9 A;  4JI5 H;  2ZJT A;  2HGS A;  4DR7 H;  2OWO A;  4PZ7 A;  3DSQ A;  4UCU A;  3N42 B;  2PTM A;  5LP6 C;  3BRC A;  3RYI A;  2CAZ C;  3SR2 C;  3CVZ A;  1XQ8 A;  5LMN H;  4DR2 H;  3E22 A;  4JV5 H;  3RYI B;  4CS3 A;  4FVM A;  5CA1 A;  4JI4 H;  1TAE A;  5LL6 b;  1IBM H;  4PI2 A;  3RYF A;  3RIZ A;  4JI5 B;  3GB8 B;  4DR7 B;  1X4T A;  4FLV A;  4TQF A;  3JAK A;  1XK5 A;  3RYF B;  4DV0 H;  4O4I B;  3L2P A;  4PHZ A;  4DRF A;  3JAK B;  4X66 B;  4AQY H;  4WBN A;  3CHX A;  4O4J A;  3SJA C;  1BJT A;  4FM9 A;  4B3S H;  5KX5 B;  4DR2 B;  3JAS A;  4JV5 B;  4KHP B;  2HVR A;  2PGG A;  3UQ8 A;  2PY5 A;  4JI4 B;  4YHH H;  3JAS B;  4BWS C;  4ZHQ A;  1IBM B;  5IWA H;  4LF6 H;  5EOY A;  4LF7 H;  3RYH B;  4IHJ A;  5IT9 W;  4ZHQ B;  2ZNJ A;  5ITZ A;  5JCO C;  4DV0 B;  3BHP A;  4DR1 H;  1N34 H;  4DR4 B;  4AIL C;  4IHJ B;  3N6X A;  4RAY A;  3TY9 A;  1I94 H;  2E3C A;  1SA0 A;  4U3J B;  1XNR B;  4B3S B;  2HHH H;  2UUC H;  4R7R A;  5EIB D;  4CS2 A;  5FD5 A;  4DV7 H;  2F66 C;  1SA0 B;  3T1H H;  1Z2O X;  5C8Y B;  4TQD A;  5FD6 A;  1MZB A;  4ZIB A;  3LNN A;  4CS4 A;  3L4K A;  4LF6 B;  3MAQ A;  4LF7 B;  4GKK H;  3RTX A;  2V4D A;  4CH6 A;  4I7H A;  2VWK A;  5JCO A;  4X1I A;  4DR1 B;  1SKV A;  5CA0 A;  1N34 B;  3S24 A;  3WB1 A;  3JSL A;  2VWJ A;  5K1X A;  4I55 B;  4DV3 H;  4X1I B;  4MTE A;  4CH5 A;  5JVD A;  2HHH B;  4DV4 H;  1XDN A;  3VQY A;  4DV7 B;  3T1H B;  5JVD B;  3F8N A;  4A2B A;  2HVQ A;  3KXY T;  4FLX A;  4FLY A;  4YY3 H;  4I50 A;  4GKK B;  3KAK A;  4LFA H;  2FE3 A;  5KHK A;  2RQ6 A;  4DK1 A;  4RAZ A;  4DR6 H;  2RGR A;  1KMI Z;  4DV3 B;  3HKC B;  3VQW A;  5LXT A;  4MV9 A;  5EZY A;  5IJ0 A;  4LFC B;  4DV4 B;  3L4J A;  2QM4 A;  4MV7 A;  4B3T H;  5LXT B;  5IJ0 B;  4KL1 A;  2F4V B;  5GON A;  4YY3 B;  4E6N A;  1CKO A;  1M4U A;  3K5N A;  2HIV A;  5GON B;  4OX9 H;  4LFA B;  3RGX A;  5JJJ B;  3JAM W;  4LFB H;  4IAJ A;  4DR6 B;  2ZIO A;  2CW8 A;  2UUA H;  4JYA B;  1O9H A;  2RJZ A;  4B3T B;  4CH3 A;  2O03 A;  4O2B B;  5FPO A;  5JH7 A;  3RGB A;  1WNS A;  1SYX B;  4APM A;  4HNA A;  4B08 A;  5JH7 B;  2PYL A;  2VUG A;  3HKB B;  3RJ0 A;  4HNA B;  4LFB B;  2WYO A;  4LF8 H;  3RWR D;  1HR0 H;  2WE6 A;  4BW9 A;  5JJE B;  1J5E B;  4YJ3 A;  5KHJ A;  4K8Z A;  4RB2 C;  2QJ1 A;  2R9A A;  4PI0 A;  3THO A;  4LF5 H;  2UUB H;  2RGV A;  4YJ3 B;  3TY8 A;  3SGI A;  1Z2N X;  4J0M A;  4DV5 H;  4LF4 H;  3UT5 B;  1VS0 A;  3IG0 A;  3K59 A;  3J7A K;  4PZ6 A;  4O4I A;  5JQG A;  1G6U A;  4UCT A;  2Q2U A;  5JQG B;  2ZIM A;  4HBN A;  4LF5 B;  5CB4 A;  1L8D A;  5LP6 A;  1RSO A;  2UUB B;  3RGZ A;  5KX5 A;  4JI1 H;  5KHG A;  4X1Y B;  1HW7 A;  4BWA A;  5CB4 B;  5LP6 B;  2UU9 H;  4LF4 B;  3VQX A;  5LMN B;  1TUB B;  4DRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...