4LH7A

Crystal structure of a liga inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
321
structure length
321
Chain Sequence
EQQPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification through structure-based methods of a bacterial NAD(+)-dependent DNA ligase inhibitor that avoids known resistance mutations.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 111
structure length 321
sequence length 321
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4lh7A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4lh7A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lh7A02
4LF8B 4JV5B 4DRFA 4X65B 4K0KB 3PN1A 1XMQB 4DR4B 4JI4B 4PZ7A 2VQFB 2HHHB 2UXCB 1IBKB 2UUAB 4GLXA 4JI2B 4TOIA 1FVIA 4LF9B 4DV0B 1X9NA 1CKNA 1J5EB 4UCRA 3W1BA 4EQ5A 1XNQB 1I94B 4DR1B 3QWUA 3T1HB 4X66B 4GKKB 4LFBB 3W5OA 4UCUA 4DUYB 4KHPB 4DV6B 4LF6B 2VUGA 1P8LA 4JYAB 4LFCB 4LF7B 2Q2TA 2E5LB 3JSNA 1V9PA 1VS0A 3TY5A 3SGIA 4DR3B 4UCOA 4CC6A 3NBYB 4UCVA 4DUZB 4JI7B 1TA8A 4JI5B 3RTXA 5BR8B 1HNWB 4EFBA 4B3MB 3W1GA 1DGSA 4DV7B 4DV3B 3L2PA 3VNNA 2UXDB 3GB8B 5LMNB 1XMOB 1A0IA 4B3TB 1TAEA 3BA8A 2HIXA 2F4VB 1IBMB 1CKNB 3UQ8A 1FJGB 2UXBB 1CKOA 2UUCB 4JI8B 4DV2B 4UCSA 4JI3B 3T1YB 3JSLA 5LMUB 1XNRB 2ZM6B 3NC0B 4DR5B 2UUBB 4JI0B 4DR2B 4B3RB 3BA9A 5D1OA 4DV4B 3KYHC 5IWAB 1IBLB 4B3SB 4PZ6A 1N32B 3GJXB 3NBZB 2HVSA 3OTOB 4GKJB 4DV1B 1HR0B 4UFZA 5D1PA 4EEQA 4X64B 4DV5B 4LH7A 1XK5A 1ZAUA 2VQEB 4LFAB 2OWOA 1HNZB 4JI1B 2HVRA 2CFMA 1HNXB 3RR5A 4PZ8A 3S24A 1CKMA 4EFEA 4DR6B 4NXNB 1N34B 3BAAA 2HIVA 3GDEA 1N33B 4YY3B 5DISC 2HVQA 4OX9B 2UU9B 4E6NA 1XDNA 4X62B 1S68A 3BABA 4JI6B 1P16A 4LF4B 5FPRA 2Q2UA 4CC5A 1N36B 4LF5B 4LH6A 4AQYB 1B04A 4YHHB 4NXMB 4DR7B 3TY8A 4UCTA 3TY9A 5D1OB 5FPOA
chains in the Genus database with same CATH superfamily
2JEUA 4DR3H 1KYOF 4I7ZB 4RUEA 3K79A 4K0KB 5JWPA 1D2DA 1I94H 4DK1A 2BCCH 1EN5A 3D8CA 3H1JH 4P30A 4DV0B 5J2TF 2YEVA 2BSKA 4I5SA 3TW6A 2M7WA 4YXWG 4K0KO 1H2SB 4E4TA 4KHPH 4YR0A 3MR2A 3PW2A 1QU7A 3EHBB 3PW7A 1EFRG 5DLGA 4XBFA 2ZDQA 5IYZA 2XTAA 3G4SV 2LFSA 3HR0A 3U0GA 1NS1A 4AQYH 5KHKA 5IJ0B 2VPQA 5JVDF 2P7TC 3QO5A 4HNUA 4ZQIA 4TV8F 1O75A 1DF5A 3S3WA 1JJ2U 4DRXB 3GIPA 2JS3A 4WFBV 3NBYB 2RJZA 1VMGA 3K0GA 1CXZB 3T5HA 1TA8A 5LYJF 3JRWA 2HHHH 4DV6O 1HNWB 2R7NA 4B3MB 3R5HA 3ORQA 4EGQA 3STZC 1OZ0A 2Q4PA 3HKBA 2AW9A 3A0HZ 1K34A 4RAZA 4BAYA 5LA6F 4O7SA 4X64H 3KHGA 4R8CA 5KHIA 3EXAA 4NTXA 1I50A 4AHCA 5KFIA 1WB7A 5LL6b 4B3MH 4DR2H 5KHHA 3JD0A 1KBLA 4AI8A 3QF7A 2YL2A 1F4MA 2ADQB 5EZYA 1YI2V 1S5LZ 3PW5A 4O3SA 4J9SA 3KTMA 5BWRA 1ZX3A 2W6MA 4DR2B 2JIZG 4B3RB 4DL7A 3KYHC 4ECUA 3DAAA 2UVWA 1KUQA 1O9HA 1NTMH 2V1DA 2W6IG 2FYUH 3N2GB 3ZRWB 5BYAA 2X0SA 1XHXA 4QWCA 5A2QW 2XGPA 2EIMC 5B5EZ 3E35A 4YB8B 4I4TA 2FLLA 4RWUA 4WBNF 2JEJA 2JGUA 1CQJB 2P0AA 3UKMA 1VF5B 2YIDA 3T9BA 4DIMA 5IDJA 2PVPA 2JA6G 2OIEA 4F4WA 4BY7G 1Y76A 3ML0A 1FXKA 3ZMUA 1IBKO 4X1KA 4O7YA 3SDLA 3TIIA 3S24A 5L1JA 2X0LA 1WB8A 5KFKA 4DV5O 1Z2PX 4DXWA 3WWJA 2QSAA 1FFXA 2VOBA 1AI7A 2Q2UA 1PL0A 2UU9O 2V59A 3DTGA 4X65H 2GV9A 3N2GA 3T54A 4JI4O 3AG7A 2RDJA 5IE9A 1TVKA 2CTPA 3JALB 3R66A 2COJA 4A3GG 2WLKA 4JV5B 4G27B 1VQ9V 4DR7O 5JJJB 4YR2A 2IW5A 3B40A 4TT3G 2R82A 3K5HA 5KG4A 4PZ7A 4TUYA 4FFKA 3H0GA 2R8KA 1OCRB 4RB2C 4JI2B 5CMUA 4ZI7F 4O81A 1JX4A 1OCRC 2IP4A 1F7YA 4IRCA 1N4CA 3HKZA 4HR7A 3QG5A 4XZ3B 4O4LB 1VQOV 1BE3H 3G6BA 1P7GA 1QLEB 2FPPB 4X62H 1GLVA 5KA6A 1XHZA 5JUMA 1SC5B 1BGWA 4BY1G 5KFEA 1QCEA 1GN6A 1PP9H 4RNMA 4GKKO 3BY6A 4JYYA 1GO3E 3CCLV 2EILB 4DUYB 4JI5O 1SQVH 3X2QB 4AYBE 3APQA 2HHFA 4LF7B 2HHFB 2P67A 3E8GA 3UT5A 2AGAA 4DQNA 3RYCB 4UCOA 1YSCA 4RB3C 2QR4A 4DO2A 4Z1MG 3DGEA 4JI5B 1H2GA 2EJ0A 1BGYH 1Q43A 2HJFC 1V54B 3JAWB 1SESA 2YDEA 2CAZC 2DYRC 3PJSK 2JA5G 4DV5H 4UV8A 2YCHA 1XMOB 3T5LA 2CTRA 1Q8IA 3JAMW 3FKSG 3ETHA 4MSWC 1RYSA 2W6QA 4YJ3B 3BJYA 4DL2A 4ED2A 4BXXG 3VQVA 3SYCA 2UUCB 2GTAA 1BSMA 3TXQA 3W7WA 2LGWA 2V9WA 4JI3B 4DV6H 3SR2C 4CS4A 3CSWA 4JYCA 3OHBA 1GK9A 1KECA 1K8AW 3CVZA 3LSUA 3JAMN 2I87A 5B1NA 2YRWA 4KP4A 3KALA 1N36H 3H4DA 2WLIA 4O2BA 1Z2GA 1AUXA 2R7ZA 4QWAA 3RUPA 4RZRA 3PR5B 1KMIZ 1VF7A 1SS3A 3KCXA 1M90W 4UVBA 5GONF 1S03G 1SERA 3CPWU 4I50B 1N0JA 2COGA 1KUTA 2PYJA 1HWYA 1HNXB 3R5FA 2Q0AA 3RR5A 2P22C 5J2UA 4EFEA 4DR6B 5EYPA 1H8EG 1FPOA 3TINA 3WB2A 1VQLV 1QR9A 3K04A 1B6SA 4MTDA 2ZXWB 1YITV 5I5UA 3D36A 1XDNA 3GV5B 3BABA 5JCOC 2XAHA 1YJNV 3M9OB 3MWDA 4DR6H 4QIWA 4NB5A 5H6QA 4O3RA 1HR0O 4R7CA 2HGXA 2ZDIA 4XYLB 2VQEH 1KJJA 1AR5A 2GDSA 3MDSA 2J6UA 3LULA 4O4IF 2PI5A 3OEEG 2YS7A 1B6QA 3JATB 4LFBH 4AYBA 1VARA 4ED6A 2YUAA 1AB3A 1OBGA 3GTMA 1B33N 3TXSA 2OT5A 3CJHA 4QIWF 1ZWIC 4RAYA 4OX9H 4J7ZA 4DR1B 1WA8A 1WH2A 5KFXA 5KFOA 1JCHA 2JJ2G 4R6ZA 2AXTZ 4LF4H 1UPGA 3IC7A 3PFFA 4MTXA 1BHAA 1YEWA 4L8JA 1Y66A 2W70A 2A79B 2WTFA 4HZ3A 4KXRA 2VUMA 2IH1C 2NVXA 5JQGA 4U6PA 5BPHA 5IWAH 2ZXWC 4UCVA 3U9SA 4PA3A 1XMQH 3ZIAG 2PN1A 4YJ3A 4ICGA 1IBKH 5CA1F 1Z5WA 4NZOA 5IYZB 1I6UA 1Q90D 2GPWA 4MA0A 5DMXA 2YIBD 5BMVB 5KFUA 3JAKA 1JMKC 1GN4A 4K3AA 3HT5A 3RB6A 2IH3C 5IJ9B 2QWOB 5B1BC 4YAJB 2CTQA 4BR6A 4LNUA 3UQ8A 2IJIA 2IJJA 2B9ZA 5L3FA 1WP8A 2FKLA 2RGRA 3K9SA 3UT5B 1N34H 4C2MA 3K08A 4PA9A 3JD4A 1XNRB 1S76D 3T7AA 3BPZA 5LGTA 3T2MA 4MV8A 4FJCC 1H2MA 1K73W 4C7UA 3J7AU 2ZIMA 3TQTA 1EUCB 1HNXO 2YZLA 4I55B 5KFMA 3ABKB 1ORQC 1S72V 4UFZA 4DR5H 1AILA 2WA3A 4X89A 2HR3A 5KFAA 3U11A 2V58A 4AILC 4EEQA 4QE7A 5KG6A 3F8NA 4F4LA 1ZAUA 5DQGA 4CZZA 2W9BB 2Q7EA 2UUAO 1JOYA 2JA6A 5B1AC 4J9NA 2AHZA 2C2RA 4J9ZB 4ZI7A 4PZ8A 3T9DA 1OWTA 3M7MX 1ZETA 4NXNB 1IXBA 3AK3A 4R8UB 3A0BZ 4KFMA 3JALA 4YY3B 1AI4A 1TVKB 5E1AC 1F4NA 3N40P 2GUZA 4J9KA 4JI7O 4LF7O 1IZ3A 3KHLA 4F6EA 3E22A 3FB8C 5T14A 2CQYA 4R50A 3V6KA 4LF5B 4Q20A 3I4MG 1LUVA 1AJQA 1QR8A 3C3SA 3RVYA 4O7LA 5B1AB 4YY3O 3LP8A 2R70A 5EIBD 5CAEB 4RCNA 3RFRA 3CMEV 1D5NA 4QWDA 4EB6A 3GWOA 4LF5H 3RWRD 5ITZB 4A3DG 2WWWA 1XBLA 5KFGA 3Q4HA 3SPCA 1G8MA 2P90A 4U3FH 1X9NA 3ORRA 3IGAC 1SFOA 2JA8G 4I4TB 4MAMA 1XMOH 2PI4A 3RW0A 3AG2C 3QWUA 1KBHA 4MVMA 2LP7A 1N56A 3D3QA 3HPLC 1IOWA 5C8YA 2R85A 2YWVA 3JZ6A 2YIAA 3P32A 5L3DA 5CA0B 4KHPB 2P4VA 5I47A 4U7OA 3G80A 4JGSA 1VQ8V 1FKAH 4DV0O 2WSSG 1V9PA 1NJIW 4B3SH 3FKIA 1I5YA 1DIKA 1A32A 4IR9A 1OCCB 4H37A 1JR9A 4EYIB 5LA6B 4TVIA 3MHHC 2Y48A 4KHPO 3EFFK 2RF4A 1BT8A 1P4RA 1DGSA 2PMZA 2DWDC 4LF7H 4WFAV 3APOA 3Q8QB 5BMVA 2ASLA 4NZMA 3SJQC 4I0XA 1K1SA 4UV9A 4CS3A 4B08A 2Y0SA 4QWBA 3BA8A 3ZRVA 4ED1A 1WNSA 3FB5C 4I9WA 1JJOA 3D36C 2VR1A 1FYJA 4CMFA 3RBEA 1AP5A 3CWBH 3A8TA 3HOUG 2ZM6B 5LP6C 5LYJA 2MCTA 2CNUA 3OUFA 1IBLB 3VA7A 3BQ2A 2GPSA 2VWKA 5IYBG 1H38A 1PNLA 5CBFA 2ADPA 3ASOC 3RJ0A 2LW7A 4O2AA 1GH6A 1E4EA 1X4TA 1HDJA 1W96A 2W6OA 1KKCA 3PR4A 2BSKB 2ALZA 1JPXA 1RJRA 4APMA 1EYZA 3LMLA 3E8HA 3BRCA 1M0TA 2R72A 4GLWA 4GKJO 2GQRA 4IAJA 4A3IG 3M8AA 3L70H 2HP8A 3I56V 4TV8B 2BOCC 3C0FB 3QZ8A 1FKAO 4CH6A 2OTLV 4NTYA 1G1XB 4OX9B 4FBUA 1K33A 1R1BA 2X6AA 5C1OA 1FAFA 1SYXB 3RT3C 4QSHA 4JI8O 5KFBA 1L8DA 5FR9A 2CNQA 3T9EA 3IN5A 3T9CA 4JTCB 5EBWC 4LF6H 2N05A 3OTOO 1US6A 4ASUG 3SE7A 5EC1C 2P06A 2YXLA 4DR4B 4MV1A 1IBKB 1UFIA 3FB6C 3CRRA 2GQSA 1CKNA 1MSDA 5KX5F 2BTOA 4F4XA 4X9QA 3W7SA 3QFFA 2HGSA 3TK1A 4TWKA 4DR4H 5H2FZ 2ARHA 4ECWA 2E74B 1PK8A 2M6YA 1XREA 4FLYA 5KMGA 3JAWA 5L3BA 5BXZA 1Z5VA 5E79Z 1W2BU 4FE2A 2WAMA 3ETQA 2OCCB 4FZ1A 1BHBA 1S10A 2VUGA 1JDBB 1P8LA 5CB4F 3CRCA 1GM8A 4O4JF 5KLVH 3BQ1A 3B2EE 2HJWA 3RN4A 4ZOLB 5K2MA 1I7FA 2ZR3A 1QHTA 1VKZA 1DLBA 4WFGA 4FLVA 2UUAH 4XDLA 2W8LA 3W1GA 4DV7B 4FFBB 2YYAA 2YS8A 1M9NA 5LXTB 5DGHA 2W8KA 1JDEA 2QDOA 2ZE5A 2R87A 1PD3A 1WCMA 4J9QA 1IYEA 4W4LA 2C00A 4B3TB 1UNNC 4IWXA 2HIXA 2IBKA 3ZN1A 2Q7GA 5IYDG 3CCRV 3JD3A 2UXBB 2ZKOA 1EZVH 4TUYB 1THZA 1P7BA 4WFHA 4Z1VA 4ZHQA 2EBOA 1EKVA 4O3QA 1GYFA 4B3TO 5DG9A 2Z5UA 4TQFA 4FFNA 2V4RA 1N33H 2UUBB 4IZOA 2ZDGA 4BW9A 3RYIB 3EVKA 2W9CA 2KG7B 5BWXA 1RM1B 1T36A 1M57B 4GKJB 4Q43A 3BVOA 2QK4A 2C28A 1H2KA 1K4CC 2R9AA 2Z04A 5BZBA 5KHGA 2WLHA 4J42A 2WB1E 5L1KA 4HNVA 4FU0A 2PBZA 5B3SC 5JCOA 3PW4A 3CSXA 2VQFH 2Q8VA 1M57C 3AEIA 2R7KA 1Y1WG 2A7WA 1ZSPA 5KAFZ 1S97A 2HIVA 1NH2B 3FD9A 5I5VA 1FXKC 2UU9B 3W7XA 1HNXH 3WG7C 1Y4MA 3IJ4A 4QGPA 4IRKA 2AU0A 4FM1A 1AVMA 5FPRA 3I5DA 2FLNA 4AQYB 1EHIA 3L71H 3RBDA 3UM7A 1BS3A 1N34O 4O86A 5CE8A 5IYDO 2DYSB 4YQWA 3VPBA 2VWJA 4O4HF 4U3JB 2CKZB 5KFQA 5FLXW 1K97A 1ET0A 3T5JA 4LFBO 4ETSA 3N6XA 3Q8PB 2BQUA 3G6EV 2VQFB 1V55C 3GIIA 1V55B 5DG8A 3CX5F 3CE2A 1GGOA 1R9TA 3O9OA 4UCRA 1ZHSA 3CCQV 3CCEV 1ZL8A 3OEHG 3Q8SB 3H1IH 3WO1A 4TM5A 4NXNO 4Q45A 4X8AA 4GKKB 2OTJV 3ZRWA 5EOYA 3N42B 1IBLO 5DGAA 2Q67A 3FB7C 1L1FA 4A3BG 4O4IB 3ZCCA 4CE5A 5K1PA 2VQDA 2JS5A 4G3IA 4DR7H 4EGJA 1BXRA 4JI6O 4N23A 4NR1A 4IHJB 4FS1A 1T3NA 1R3JC 4H0LB 5H6RA 1S0OA 1GAXA 5C8YB 2AGPA 3QTCA 3RYFB 5C44G 2WA4A 2UXDB 2Q5ZA 3AG4B 3N2KA 1PM9A 1Q3EA 2IJHA 2CGOA 4FK5C 4MW3A 1VQ7V 3RV3A 4LFAH 2N74A 5EDWA 4WCEV 3RV4A 5LP6F 2ZCEA 4PV1B 2VRZA 3CC2V 3FYEB 4JI8B 1LUWA 4DV2B 2QF7A 4EKWA 4OGQB 3JSLA 4JYBA 4JYAH 1N32O 4UVCA 3OUZA 1SF9A 2BTQA 1KJQA 2VUMG 2PMZE 4D6TH 4DV2H 4PA6A 3GJXB 3WO0A 2ZDIC 4O7VA 4JI1H 1CEZA 3QZ7A 4DV4H 3JRXA 4E2LA 3OSPA 1NTZH 4B3TH 2Y69C 4C5CA 2OWOA 1ZHQA 4PWQA 3N6RA 3CXCU 5ITZA 3U9TA 1WAZA 2I8CA 3HOYG 1TWAA 2AGOA 3BAAA 4B7EA 1M1KW 3OMAB 4X64O 3N27A 1N36O 4DR3O 4E6NA 1I3QA 2FJZA 1FJGO 4RU9A 1VIBA 4TUYF 5KG0A 5KFNA 3RYHA 3HKCA 4LWSA 1YTFB 3MWMA 1B04A 2CK3G 4PDLA 4DUYO 2R8GA 1AP6A 4EEYA 2EILC 4TV8A 1F51A 2EJ3A 2WLNA 5KFJA 5EWGA 4B3RO 4R7RA 1HP8A 3I12A 4X20B 3BCCH 2RCVA 1M56B 3ASNB 5K1XA 2UUAB 4M7EA 2NR5A 4LNUB 2W6JG 2QKAA 3BACA 3W1BA 4IIJB 1XNQB 2YXHA 1DAAA 4LF8O 3GVMA 3PW0A 1EUDB 1SQFA 4X66O 1CS0A 3RB0A 1ZUQA 5F2VO 4PD4F 4O3OA 4JI5H 4A3CG 2GHYA 4LCUC 3K3WA 4LFCB 2R86A 3T99A 3H0GG 5B66Z 2Q2TA 2WLLA 2OCHA 5DLFA 2F4VO 3HOVG 2F95B 2IM9A 3I4NG 4H33A 2D3OW 4DV3B 2FK2A 1BJTA 4A3KG 1CQIB 3CHXA 4DYLA 2FP4B 3JAKB 2ZGIA 3KG2A 1ZL8B 2IBZH 2PF4E 4IIJA 4JI3H 1CP9A 1QBZA 1AR1B 5JQGF 1OJHA 1DV1A 2ABJA 3K3VA 4UB8Z 5GONB 3FFQA 2QM4A 1TUBB 3VBBA 2XT9A 1XL6A 3RVZA 2B1GA 2WLLB 1KP3A 3M99B 4ZBMA 3T1YB 3K5IA 5JJEB 3V4ZA 5KFYA 2JRIA 4X65O 2UU9H 3GB7C 1NVPD 4JAUA 4ECQA 2WAQE 1R3LC 5JJNB 2YZGA 4I50F 5IYBO 2QB5A 2R84A 5CA3A 4O7TA 3E83A 4ECZA 1XQ8A 4HNAA 5KFWA 1R3IC 2RN9A 3AK1A 4GYCB 1DK1A 1D5AA 3O65A 1K92A 2B1IA 4X64B 1MNGA 5DGBA 5LL6Y 1NR1A 2GTSA 1EN6A 4Q6GA 4J41A 3LSSA 2XAFA 2J6SA 4RUAA 3FAVB 3UCSC 3CC7V 2CW8A 5KG1A 5EWEA 5D5PA 2C35B 5LGNA 2KSWA 1WCMG 4JPRA 3AG1B 2ZM6O 1A48A 1NKDA 2FK1A 3VMMA 4LF4B 4BIZA 3RYHB 1Q86W 4JV5H 2HFEC 3VQYA 1S5JA 4L87A 3ZMTA 5IT9W 1K9MW 1I1LA 1SRYA 4YJ2A 2NUAB 3DXRA 2KB1A 3TY9A 2F23A 3A0RA 5EYPB 1JFFB 2FL4A 3JD2A 4ED8A 1HNZH 2RMKB 3IC9A 1P84F 2W9BA 2EJ7A 3S3XA 1S3JA 1RK6A 5FNVA 4TV9F 3AK2A 2A0LA 3JASA 2X5RA 1VAJA 3CEBA 2DMXA 5BY1A 3BEHA 3JZFA 1E1RG 2V4QA 3MWEA 3SYQA 3G8CA 2O57A 4Y8VB 3J80W 2WLIB 4BIUA 4I55A 4FFBA 3RYFA 5EZYF 4TQRA 2NU6B 1WLEA 3ETGA 4O7WA 4JI8H 2UVUA 2H94A 1W0JG 4ME6A 2EJRA 4LF6B 4IR1A 3AW8A 2XCAA 1NBMG 2JA7G 3SYPA 2Z02A 2B5UA 2QM8A 5D5QA 3CCSV 3TY5A 4J10A 3HO8A 1RPRA 5CN0A 5C4XG 3H20A 4DR4O 1SQQH 3AG3C 1AJPA 4O2BF 4EFBA 2YC0A 3EYYA 1Y74B 1AN7A 1OCOB 3H9VA 2HKOA 2K1EA 2XGQA 2IU3A 2W6PA 3NXSA 4FMTA 3OD4A 2W6NA 2XC9A 1CKNB 1FJGB 4CS2A 1FFTB 2DZDA 1FS0G 1KU9A 4GX1A 4FM2A 1V54C 4GX5A 1UJWB 4IHJF 1RPOA 3K9AA 3H40A 1E79G 1VF6A 2UXXA 3OGCC 3RGBA 2A3QA 2JEFA 1IDSA 1W59A 4DUZH 3GWKC 3SJAC 4WD3A 4J9YB 2R9RB 1MSWD 1KP2A 3PO3G 3GIKA 1BZKA 4PDVA 1YJ9V 3CJHB 1Y67A 3R9RA 2JGDA 4MTGA 1JX9A 1N0NA 3KREA 4JI1B 5B1OA 3FAVA 3ETEA 1TUEB 3C3TA 3WB0A 1MZFA 3HKDA 1DF4A 3K59A 3T1YH 1GM9A 4P2ZA 5DG7A 3QO8A 4EG0A 3BG5A 2MW2B 2DIKA 1P16A 2UUCO 2YI8A 1S0MA 3DC5A 1XDCA 3L73H 5DGIA 1GN3A 5EBLC 3R65A 5KHJA 1GSHA 2KG7A 3RAXA 2W9CB 4QPKA 1SA0A 1H2NA 1MA1A 3E8FA 3ZMZA 5L9XA 5IYZF 4U7CA 2LGQA 2KQXA 3JARA 5JVDA 4X66H 3HKEB 5BR8H 2CE4A 3T4ZA 5LGUA 3AG2B 3RAQA 5CR5A 4GC6A 3SI8A 3G6YA 3LDDA 3OFNG 2LO1A 5A9GA 2IMWP 3ZHSA 2CH7B 4H13B 4FM0A 1I94B 3QVNA 5J2TB 2M05A 2XAQA 4PDMA 4JUZA 2Y0IA 4O7RA 2C22A 5J9PC 4B3SO 2E2IA 1L0LH 4LR3A 1OCZC 3FMAA 3FX7A 4DV6B 4BW5A 2FPIB 4DRXA 2ZM6H 2W71A 1GKFA 4UXNA 2QWQB 4JI7B 3GTKA 2Z0AA 3WG7B 1SQBH 2ZNIA 2QYZA 4X88A 3OW2U 2PUSA 4UB6Z 1OV9A 1RSOB 2QM7A 4M0JA 3VPCA 2OIGA 4QPJA 1WP7A 2V5AA 2DYSC 1A0IA 1K4DC 2XAGA 1KJ9A 2WB1A 1YVWA 1HNZO 3EPIA 5B1BB 4GC7A 3KHHA 3NGDA 2ATLA 4GX2A 5H5NA 3G8DA 4MV4A 4X20A 5BWVA 2R93G 2EZPA 3LNMB 2KKWA 3K58A 2A1HA 5LMUB 2CGNA 4YBZB 3STLC 3NC0B 3GV8B 4ECXA 3CRQA 2XHBA 2RGVA 4DV4B 4FLUA 4XDKA 1EM1A 1I7NA 4JI6H 4JI1O 4CH4A 4JI7H 3NBZB 2HVSA 3HOZG 3UZBA 5LP6B 2QJ1A 3HXLA 3T1CA 1WJZA 4X1IB 4K6NA 1DV2A 3RB4A 4JI3O 2DPIA 3JASB 2UXCO 2Y4RA 4ECYA 4X62O 2VQEB 1Y1WA 3G71V 4JF3A 3FKIG 3UYYA 3AG4C 2EIKC 4FLZA 5LXTF 2CTWA 1IX9A 2Y4TA 4FFMA 3B8NA 3WNZA 4PA7A 4I9QA 3GDEA 5DISC 2AGQA 2W57A 1JXLA 3JCUZ 1VQPV 4PELA 4WHXA 5C93A 3ASNC 4QE9A 1WRVA 4L1KA 3Q8RB 1PPJH 1FFXB 4O2AB 4DL4A 1COWG 2EIKB 2CW7A 4CMDA 4JI4H 3RB3A 4NXMB 4Q8FA 2AZ0A 4JI2H 2YI9A 5D1OB 3N44B 1IOVA 4DL6A 3JD1A 4MVUA 2DYRB 1SQGA 3FDSA 2IJKA 4JI4B 2EIYA 4NXMO 3SYAA 3SNOA 4DV7H 3FYIB 4NXNH 1J5EB 4CKEA 2FB9A 2VQFO 3L4KA 2QTSA 4Q4DA 2JEXA 1I0HA 1E4EB 3OMNB 4LFCH 4WFFA 2FE3A 4DV7O 5I5WA 3AYHB 3PZPA 3J7AK 2HLDG 1EBOA 1RP3B 2Z3YA 4IHJA 2LJ2A 3L9DA 4HQ6A 5KG3A 4CH3A 1S77D 1ZQ7A 1TUBA 2XOKG 5LHHA 4DUZB 4FIPC 4GCZA 5BR8B 4FM9A 4F6RA 1KEEA 3L2PA 5F9NA 2Q68A 3D3IA 2QKSA 2DJVA 3LUTB 4Z2WA 3NUAA 1YCIA 1FXVA 5J2TA 4DR2O 2CH7A 4TQDA 2OLSA 4DV4O 1PNMA 1TAEA 2UXDO 2DAAA 1XUQA 4N21A 5JH7B 3SPIA 4CHIA 4IYHA 4ECRA 1H8HG 3CCUV 4YAKB 2O03A 2OYQA 5JVDB 1A3GA 5DECA 3U54A 1HR0H 4PI0A 5IP9G 1SA0B 1P49A 2FK3A 4MTEA 5DQHA 5D1OA 2F43G 4EBCA 1XI1A 5KT2A 1N32B 1IVSA 1DTOA 3OTOB 3T9AA 5A2QN 3ZRXA 4Q0YA 3HKCB 4LWSB 3L75H 3OUUA 2JDIG 2ZT9B 1AR4A 5B3SB 1QQCA 4LFAO 4DV5B 1O9GA 4JASA 2D2CB 3RBZA 1VQMV 4RB0A 2NU9B 1RFYA 3HKDB 4K0KH 2B63G 3VOTA 4DAAA 3SJBC 4FFPA 3ZHQA 4I50A 3I55V 2COIA 4WF9V 4EYHB 2FMLA 2FKXA 2HVQA 2BE3A 1UC9A 1A9XA 3G67A 3ZRSA 2QGNA 3OMIB 1URFA 4GKKH 4H44B 4FZ0A 3KCYA 5DN6G 5CA0F 4IWYA 3GTGA 1CPYA 3E22B 1N36B 4X1IA 3CP1A 4O2BB 3P30A 4PBCA 5C1PA 4J9PA 5EBMC 4ECVA 1Q82W 3J81W 4UCTA 3H3VH 4YR3A 4LSAA 1U97A 1W93A 4M9UA 2HVKC 2X6BA 3GILA 1VF6C 2FPGB 4QWEA 4YIOA 1ZTEA 4K35A 3C90A 1MABG 3B77A 4ZOLF 1WPBA 3T1HO 3DF7A 4RUCA 1EKFA 1HNWH 4U7NA 3SPGA 3MR5A 1KQSU 3GIDA 3OR7C 3PVXA 2AHYA 5IJ9A 3M9NB 2Q69A 3T1HB 4X66B 3IG0A 3H1LH 1R6NA 3W7UA 5LP6A 2ODMA 5BR8O 3CCJV 1VQ5V 1YTFD 2Y0SE 4J0MA 2PGGA 2BTQB 4DLKA 3K0DA 5HV6A 3ZHTA 3V6HA 3CRMA 3G6XA 1ZLZA 1Z2NX 1SEIA 2R8HA 2HVJC 3ABKC 5HBRB 2UVRA 2B63A 4LP8A 1Q5OA 1IBLH 4A5UB 3SGIA 4CC6A 3HB3B 1XL4A 4LFCO 1NT2B 2RQ6A 2YW2A 5CM0A 1IBMH 1C30A 3AG3B 5LHIA 2WAQA 1JIHA 3MR6A 1J5EH 1E1QG 4A3FG 3GIMA 5LMNB 1R6TA 5KX5B 1XNRO 2VPSA 2R7LA 3OHAA 3ZMVA 1AUVA 1N48A 2R7ZG 2GLTA 2WYOA 1BNCA 5I5YA 3TW7A 3H01A 3VOUA 2VA2A 2GSMB 3JARB 1JVMA 1MMMA 5JQGB 3PO2G 4D7TA 2R93A 1LR1A 2ZD9A 5L1IA 1BCCH 4O7NA 1SETA 5KFCA 5J2UF 3ZHRA 4JV0A 5IYCG 1RYRA 1M4UA 1RM1C 4IL6Z 4EBEA 2F66C 3T4DA 2NNUA 4QIWE 2EJ2A 2XAJA 2YS6A 3CXHF 2EIJC 3GV7B 3ZHVA 4JV1A 1ULZA 2HVRA 4OPAA 1YJWV 5KFVA 3IAYA 4QNHB 3K5LA 3UO2A 3ZBHA 3N8DA 2UXCH 4KUMA 5CA1B 4MS2A 4RO2A 4U3JA 1XEQA 2ZINA 3THOA 5HFMA 5K3WA 1N33B 2FMAA 1KJIA 5C3EG 5KFTA 5DEDA 4JI0H 3TQ1A 4A3JG 4DL5A 3F5WC 2V7QG 2FLPA 1Q6IA 3SPHA 4HNAB 2BQ3A 1SCUB 4IT5A 1N33O 1TWFA 4YY3H 4WBNB 2EINB 2W6ZA 1E4GT 1H2LA 4LBEC 5BYBA 4DV0H 3RYIA 1M93A 2W7PA 2ILMA 1S0NA 5J2UB 4GT1A 1K3EA 3GTJA 3PN1A 5EZYB 1QVFU 1E4FT 3RIZA 2UXCB 2QWPB 4UUJC 4F4ZA 2ZIOA 5KS8A 3RGXA 4PDBA 1M6VA 4YJ2F 2ITCC 3CYOA 1KD1W 4BBRG 3U0ZA 4MTFA 4I0XB 1TGOA 4J9OA 4HN2A 2Q7HA 3HKBB 2DW4A 2YSUB 2UUCH 2ETNA 2I80A 2XCPA 4PA4A 2J6TA 2Q7DA 3L72H 4UUGA 4J7KA 2ZE6A 3BFRA 2P5OA 3AG1C 2AQ4A 2EIMB 4IGGA 4DR3B 5EIBC 1Q81W 1JQ0A 3LQSA 1IYDA 4KL1A 5KX5A 4QJFB 1VBHA 4XYMB 5LHGA 5BWWA 4O82A 1RSOA 3TJTA 1EN4A 1I94O 1VP7A 5IP7G 3K03A 4EBDA 3OM3B 5FLXN 4O2AF 3HKZE 2DLNA 2ITDC 4TSFG 3V6JA 3KZIZ 4OXSA 1IBMO 4UCSA 4DV1H 1PL4A 1PX2A 5HFLA 5HNEA 1JFFA 3MFIA 3GIJA 1AI5A 2HG5C 3GLKA 1OCCC 5IWAB 2WLJA 3Q1KA 4P9PA 3QNEA 4DR5O 1VBGA 4FFLA 4FS2A 4ECTA 3CCVV 1GSAA 5LMUH 1ROPA 1BMFG 1PNKA 1EZ1A 1KT8A 3ZMSA 4GUNA 2P6JA 4DK0A 4JXUA 4O83A 3GTLA 1SQXH 4F4YA 4OX9O 3HKEA 5EC2C 1HNZB 4RNNA 1AJNA 1Y6XA 1AI6A 3N41B 4X1KB 5IY5B 1B6RA 1I1MA 1ENVA 1Y76B 3L4JA 5LMUO 4A93G 4WBNA 5KFRA 5EK0A 4DUZO 2IA6A 5BWTA 1WN7A 3CEIA 1R73A 5C8YF 4LH6A 2ZQMA 4O3NA 1Q6UA 3MAQA 3K06A 1XMQO 4YIPA 1XMOO 1GRJA 2XNDG 4J9MA 1I2KA 2GBOA 3ZJZA 2ASJA 3WWHA 4X65B 3T5KA 5CA1A 3VPDA 2Q6AA 2C2DA 1XMQB 3K5NA 4RUFA 5KFHA 4I7HA 2QTOA 3K3PA 3CQZA 3LWBA 5KT4A 4LF8H 5BMVF 2JVDA 5KT3A 1NI8A 5KUKA 5KFLA 2IU0A 3N2KB 4JV2A 1J95A 3KAKA 2YXYA 4LFBB 1TWHA 1QVGU 2DWCA 2Y0PA 3NR7A 4JV5O 5KT6A 2DQ3A 3SYOA 4MVRA 5LA6A 1G2WA 1WPXA 3E8BA 3LDEA 2EIJB 4JI0O 4MTOA 1JKJB 5KUMA 1IXMA 3ABTA 3ZX6A 1NU1H 2PYLA 4O4IA 4DR6O 1I08A 3VNNA 1FJGH 5GW7A 3E89A 1M56C 5JH7F 5CBGA 2N04A 3R23A 1VQKV 1T94A 3LNNA 1IURA 4I4TF 5KT5A 3TETA 3T9FA 4NLGA 4J11A 5FLMG 1SZXA 4J9LA 2A06H 3IFXA 2XUMA 2XD4A 1KC7A 1FD9A 3LSQA 2DWEC 2SCUB 1KJ8A 1Y1VA 1KC8W 4X1YA 2YZMA 3E86A 4YJ3F 3ZS8C 2EZOA 2J9GA 2R8JA 3W7TA 2PY5A 3OSNA 1Y1VG 4DV2O 4TQSA 2WDTA 1YF2A 3HOWG 1N32H 4JYAO 5FNVB 1NH2D 5TISZ 4LC1A 2RNBA 5KFPA 5FNVF 4JZ2A 3MJFA 4O84A 1CKMA 4RQFA 4FGRA 1T5EA 2R9IA 3U55A 4NKGB 2UUBH 1B06A 1BL8A 3DXRB 2L35A 4BBSG 1BQZA 2C2AA 3MD0A 3ZEDA 5IYCO 1V51A 1N8RW 4CC5A 1GSOA 4LMYA 5KFZA 3JZIA 4B7KA 1G6UA 4IRDA 2BOBC 3MHSC 4D7SA 2R8IA 3GTOA 4ZIBA 4DR7B 5EWFA 4MVSA 3ABLB 4FVMA 4JAAA 4R8UA 4O4JA 4DRFA 2XIGA 4A2BA 5CB4B 4ZI7B 4A2AA 3DTFA 4PI2A 1KKDA 1FXHA 1PV0A 1HNWO 4MVZA 2ASDA 2HHHB 1KTAA 5GTIZ 4GLXA 3WU2Z 4LF9B 2QE7G 1Q7YW 4MV9A 2G38A 3J80N 1F23A 1MG1A 2V4DA 4O7ZA 2DPJA 2Y69B 2F4VH 4LF9H 5IWAO 2RDIA 2NN4A 4RQEA 2YRXA 1QNMA 3W5OA 4JZGA 5L3CA 3KAJA 5D8DA 4WFEA 1V4YA 4FLWA 2YICA 3EPGA 1G4YB 4MV3A 3ASOB 4ED3A 4LF4O 3K5OA 2W0XA 3CS5A 3TGUH 4JTAB 1VQ4V 1KB9F 3RTXA 2YU9A 4MV6A 3DSQA 2UVVA 1WSCA 4O3PA 2RDCA 1K5QA 4OPHA 5KMGB 4PDRA 3OTFA 4J7JA 3ZN0A 2UUBO 4MA5A 1C3OA 1WR2A 4XX0B 1JLLB 4HYKA 3T1HH 2XASA 1OBDA 2F4VB 1S0VA 4B3RH 3JATA 3L74H 1CKOA 2EINC 2WPDG 5KG7A 2DOSA 5DQIA 3WFVA 1OCOC 1S5HC 4GZRB 1B3QA 4IIJF 5KG5A 4MT8A 3DTUB 3ETJA 1CE8A 2QWNB 3LDCA 4DL3A 2F93B 2JK5C 5H9CA 2R92G 2BR0A 1MZBA 2UXDH 1GTOA 2UXNA 3B8MA 3ICXA 5FD5A 5LOVF 2JJ1G 1XK5A 2HGWA 1Q6HA 4LFAB 2OH2A 5LBQA 2LFRA 3UFXB 2YZNA 5I5SA 1Z2OX 2JEGA 4RB1A 2CDYA 2FB5A 1QLEC 4B3MO 2VS0A 5C5JA 1N34B 4NYKA 4O4HA 2W7OA 5JVLA 2JGDB 3V4SA 3P3PA 3VQWA 2VA3A 4NTWA 5IY5C 2LQTA 1RJQA 2QA4V 4Q44A 2HG8A 1EKPA 4A3MG 3ABMC 3CRAA 2MK3A 4HAMA 2HHHO 3SPJA 1K83A 4LF9O 2JA5A 3M4IA 3MFHA 3BQ0A 2K9PA 1K5SA 5KT7A 1VEWA 2CZGA 5FPOA 3CMAV 2E5LH 5LYJB 3OE7G 5KAIZ 1XNQO 1I7LA 4NXMH 1FVIA 3HB9A 3OT7A 2DE0X 3ABMB 4TOIA 4UVAA 2NU8B 3G6VA 1MZEA 4ED0A 5L1LA 3K5MA 1NR7A 2F1MA 5FD6A 2AZ2A 2R7MA 1SQPH 4ZKIA 3UZOA 5KA5A 2ZJTA 3M9MB 2OCCC 4FLTA 2UXBH 2ODTX 1JA8A 3H1KH 1M5IA 4J80A 2JA7A 4XDJA 3OUSA 3ABLC 4A3LG 1I5XA 4ZOLA 2Q9LA 5L3EA 3RYCA 1S9FA 3BHPA 5I5TA 2L6LA 3HOXG 3WB1A 2E76B 1BQ0A 2FTKA 2E5LB 5E25A 1NTKH 5FJ8G 4CKBA 2XCLA 3U10A 3F5TA 4J9RA 4K8ZA 4PHZA 5I5XA 5KG2A 5LMNO 4C5AA 2QKCA 3CC4V 2E3CA 1U96A 1I1KA 4MVQA 1TWGA 1Y14B 4QW9A 4QJFA 3T1YO 3QO7A 1Y74A 4BWSC 5IT9N 2PZSA 2LW1A 1R3KC 4O4LF 1NVPB 3JCZA 5DM6V 3B4SA 1YIJV 4JI2O 2ZE8A 4G28B 5CB4A 5F9LA 4MV7A 4GX0A 2ZE7A 2C2EA 1AROP 3E2EA 2WLMA 3OR6C 4B3SB 2ZDHA 1RJPA 1M0WA 2KSDA 2HEPA 4DV1B 1HR0B 4BIOA 4DV3H 4TV9B 1SZTA 3GQCA 4O4LA 1GO3F 1SKVA 4MW8A 1GMGA 2DN9A 2W0FC 5JQWA 4DV1O 4RNOA 1K7DA 4O4HB 4NYEA 2P4KA 3ABUA 3RGZA 2X6CA 1NZ6A 2CFMA 2W9AA 4A3EG 3R5XA 5KFDA 1NQTA 5KFFA 1A0GA 4ZHQF 1YXBA 1FXKB 2H3OA 3GIQA 1GM7A 3UO3A 1YHQV 1X59A 4DR1O 4YHHH 3A2FA 2QWRB 4E4EA 4FFRA 4LF5O 1XOUA 2X7RB 3RF2A 4JI6B 4DW0A 1I2LA 3P3NA 3CD6V 2HDKA 4YHHB 2BQRA 3H4BA 4YP3A 2CNVA 3TEKA 4JTDB 1R6KA 4LF8B 1VQ6V 4I55F 4MVOA 5AG2A 3HBLA 4CBCA 4YHHO 3KXYT 4DR1H 4P9OA 2EX3A 4HBNA 5GONA 1K1QA 1TWCA 2ATKC 5JH7A 4PJ0Z 4IYIA 3F7YC 3MR3A 1GN2A 3TIGA 3VQXA 1EZJA 2PTMA 3GTPA 4EQ5A 5LOVB 2R6FA 4LF6O 4G2KA 1UC8A 2ZR2A 4RAIA 3X2QC 4JAVA 4F6RB 3CB2A 3KHRA 2R92A 4DV3O 4UCUA 4JYAB 4AQYO 4FLXA 2E2HA 4ZHQB 3TCUA 3JSNA 4ED7A 1LNQA 1VS0A 4W4KA 3ZHUA 4CKCA 3B09A 1YZBA 5KKNB 5KFSA 5IJ0A 2Q0OC 4LSXA 4ABMA 3K57A 3JYCA 3OAAG 4HYOA 5BWUA 3GB8B 3OGIB 1WA8B 1MOFA 5LOVA 3SJCC 5LXTA 3CCMV 5BPFA 2Y4UA 4HNTA 1XNRH 4CH5A 2YEVB 1IBMB 2NVYA 1OHHG 1J5EO 3QQMA 2YIBA 3OTOH 5LMNH 4NZNA 5CBHA 3GTQA 1PKXA 4DR5B 5DAAA 1RK5A 4EB6B 4JI0B 4QW8A 5CA0A 3N43B 3BA9A 4PZ6A 4FBTA 1M7JA 4Q8EA 4BWAA 2HJDA 3KKYA 4K8XA 5H80A 4C5BA 2NU7B 4NVPA 3AX6A 5D1PA 2JEIA 2NLJC 2UXBO 2Q73A 1HW7A 2CUGA 5I60A 5GTHZ 1XILA 3RFCA 2WE6A 2GUZB 4LH7A 2DABA 2QEXV 2EULA 4GKJH 4FPPA 1L0NH 3Q4HB 2DQ0A 3E5NA 4ECSA 5L3GA 3WWIA 2A9HA 5FL7G 4O4JB 4F50A 3Q2OA 3DC6A 1YDXA 1XNQH 3J81N 4YJ2B 1VQNV 4X62B 2VQEO 1S68A 1W0KG 2E5LO 4TV9A 4RZQA 3F7VC 4Q4CA 1QLNA 4X1YB 4DUYH 2H8PC 1OCZB 3TY8A 4FFOA 3ETDA 4DW1A 2E75B 3H1HH 1L2ZA 2ZNJA
chains in the Genus database with same CATH topology
4X65B 4DR3H 5CA1A 2YXLA 1XMQB 4K0KB 4DR4B 3K5NA 1I94H 3JARA 5JVDA 4X66H 4DK1A 3HKEB 5BR8H 1IBKB 4DV0B 4I7HA 1CKNA 2BTOA 4LF8H 2HGSA 1H2SB 2JVDA 4FM0A 5J2TB 1I94B 4DR4H 4KHPH 3N2KB 4FLYA 5KMGA 3JAWA 3KAKA 4LFBB 1Z5VA 5IYZA 4AQYH 5KHKA 4LR3A 5IJ0B 3ETQA 5LA6A 3FMAA 4DV6B 2VUGA 4DRXA 1P8LA 2ZM6H 1O75A 3B2EE 4DRXB 2PYLA 3NBYB 2RJZA 4ZOLB 4JI7B 1I7FA 1TA8A 1QHTA 4O4IA 2ZNIA 4FLVA 1HNWB 2HHHH 2UUAH 4B3MB 3W1GA 2PUSA 4DV7B 3HKBA 4FFBB 5LXTB 3VNNA 1FJGH 4RAZA 4X64H 5KHIA 1A0IA 4B3TB 3LNNA 4AHCA 4B3MH 2HIXA 5LL6b 4DR2H 5KHHA 2Q7GA 2UXBB 3QF7A 4TUYB 4X20A 5EZYA 1GYFA 2KKWA 4ZHQA 3K58A 5LMUB 4TQFA 1N33H 3NC0B 2UUBB 4DR2B 4BW9A 4B3RB 3RYIB 2XHBA 2RGVA 4DV4B 4FLUA 3KYHC 4JI6H 4CH4A 4X1YA 3NBZB 2HVSA 4JI7H 1O9HA 4GKJB 5LP6B 2QJ1A 3ZS8C 3N2GB 3HXLA 2PY5A 1XHXA 4X1IB 5A2QW 2WDTA 4I4TA 2R9AA 3JASB 2JGUA 1N32H 5FNVB 5KHGA 2VQEB 5JCOA 4FLZA 3CSXA 4X1KA 2VQFH 3S24A 1CKMA 1T5EA 4I9QA 2HIVA 3GDEA 5DISC 2UUBH 2W57A 1Z2PX 2UU9B 1HNXH 3ZEDA 4FM1A 1FFXA 5FPRA 2Q2UA 4CC5A 2VOBA 1FFXB 4O2AB 4LMYA 4X65H 1G6UA 4AQYB 2CW7A 2GV9A 3N2GA 4D7SA 4JI4H 4ZIBA 4NXMB 4DR7B 1TVKA 4JI2H 2YI9A 3JALB 2VWJA 4FVMA 5D1OB 3N44B 4U3JB 5FLXW 4O4JA 4DRFA 4JV5B 2XIGA 4A2BA 5CB4B 4ZI7B 4A2AA 5JJJB 1SQGA 4ETSA 3N6XA 4PI2A 4JI4B 4PZ7A 4TUYA 2VQFB 2HHHB 4GLXA 4JI2B 4RB2C 4LF9B 4DV7H 4NXNH 1J5EB 3QG5A 3L4KA 4UCRA 1ZHSA 4O4LB 4MV9A 4X62H 2V4DA 4LFCH 4GKKB 2FE3A 2F4VH 4LF9H 5EOYA 1XHZA 3N42B 1BGWA 3W5OA 3J7AK 4O4IB 3KAJA 4DUYB 5K1PA 2JS5A 4DR7H 4FLWA 4IHJA 4LF7B 4CH3A 3UT5A 4IHJB 3K5OA 3RYCB 1TUBA 4UCOA 4RB3C 4DUZB 4JI5B 3RTXA 5BR8B 4FM9A 4F6RA 5C8YB 3DSQA 3QTCA 3RYFB 3L2PA 1Q43A 3JAWB 2UXDB 5KMGB 2CAZC 3OTFA 3N2KA 1Q3EA 4DV5H 2YCHA 5J2TA 1XMOB 4TQDA 3T1HH 1TAEA 4LFAH 3JAMW 1Q8IA 2F4VB 4YJ3B 4B3RH 5JH7B 2ZCEA 3JATA 3VQVA 1CKOA 2UUCB 4JI8B 2O03A 4DV2B 5JVDB 2OYQA 4JI3B 4DV6H 3SR2C 3JSLA 1HR0H 4PI0A 4JYAH 4CS4A 1SA0B 1P49A 4MTEA 2BTQA 5D1OA 3CVZA 1XI1A 4DV2H 1N32B 3GJXB 3OTOB 3KALA 1N36H 4O2BA 4Q0YA 2F93B 3HKCB 4JI1H 1MZBA 2UXDH 3ICXA 1QQCA 4DV4H 1KMIZ 4DV5B 1VF7A 5FD5A 1O9GA 1XK5A 4RB0A 4B3TH 4LFAB 1S03G 2OWOA 1ZHQA 3HKDB 4I50B 4K0KH 2PYJA 1HNXB 1Z2OX 5ITZA 2Q0AA 4RB1A 3RR5A 3SJBC 2P22C 5J2UA 4EFEA 4DR6B 5EYPA 4I50A 3BAAA 1N34B 4O4HA 3WB2A 2HVQA 4MTDA 4E6NA 3VQWA 1XDNA 4GKKH 3BABA 5JCOC 4DR6H 3RYHA 3E22B 3HKCA 1N36B 4X1IA 4O2BB 3MWMA 1B04A 3M4IA 3J81W 4UCTA 4LSAA 4TV8A 5FPOA 2E5LH 5LYJB 2VQEH 4R7RA 1WPBA 4X20B 3DF7A 4NXMH 5K1XA 1FVIA 2UUAB 4M7EA 1HNWH 4TOIA 4LFBH 3JATB 4LNUB 3K5MA 2F1MA 3W1BA 4IIJB 5IJ9A 5FD6A 1XNQB 4RAYA 4OX9H 4DR1B 3T1HB 4X66B 1WH2A 3IG0A 2ZJTA 5LP6A 4LF4H 1SQFA 4FLTA 2UXBH 4J0MA 2PGGA 1M5IA 1YEWA 2BTQB 4L8JA 4JI5H 4ZOLA 3RYCA 3BHPA 4LFCB 3WB1A 1SEIA 1Z2NX 2Q2TA 2E5LB 5JQGA 1Q5OA 5IWAH 1IBLH 3SGIA 4CC6A 3U10A 4UCVA 1XMQH 2F95B 2IM9A 1NT2B 4YJ3A 2RQ6A 4PHZA 4K8ZA 1IBKH 1Z5WA 1I6UA 5IYZB 1IBMH 4DV3B 2E3CA 1BJTA 1J5EH 3CHXA 2YIBD 3JAKB 5BMVB 3JAKA 1JMKC 5LMNB 4IIJA 5IJ9B 5KX5B 4JI3H 4BWSC 2VPSA 2PZSA 4LNUA 3UQ8A 2WYOA 3K3VA 5GONB 3FFQA 2QM4A 1TUBB 2RGRA 3JARB 3UT5B 5JQGB 1N34H 3T1YB 5JJEB 4D7TA 5CB4A 1XNRB 3BPZA 4MV7A 2UU9H 4B3SB 5JJNB 2ZIMA 1M4UA 1M0WA 2HEPA 4DV1B 4I55B 2F66C 1HR0B 1XQ8A 4HNAA 4UFZA 4DR5H 4DV3H 4TV9B 3U11A 4O4LA 4AILC 4GYCB 4EEQA 1D5AA 1SKVA 4X64B 3F8NA 1ZAUA 4O4HB 4Q6GA 3RGZA 2Q7EA 2HVRA 2CFMA 3IAYA 3K5LA 2UXCH 5CA1B 4ZI7A 4PZ8A 2CW8A 3M7MX 4NXNB 5D5PA 4U3JA 2KSWA 2ZINA 3THOA 3JALA 1N33B 4YY3B 1TVKB 3A2FA 3N40P 4YHHH 4JI0H 3RF2A 4JI6B 4LF4B 3RYHB 3E22A 4JV5H 4HNAB 4LF5B 3VQYA 1S5JA 5IT9W 4YHHB 4WBNB 4YJ2A 4YY3H 2R70A 5EIBD 1E4GT 3RFRA 3TY9A 4DV0H 3RYIA 1M93A 4EB6A 5EYPB 1JFFB 4LF8B 5J2UB 4LF5H 3PN1A 5EZYB 3RWRD 5ITZB 1E4FT 3KXYT 4DR1H 3RIZA 1HNZH 2EX3A 2UXCB 4HBNA 5GONA 1X9NA 5JH7A 2ZIOA 3RGXA 5FNVA 4PDBA 3JASA 3VQXA 2PTMA 3U0ZA 4I4TB 4EQ5A 1XMOH 5LOVB 3QWUA 1TGOA 3J80W 4I55A 2Q7HA 3HKBB 4FFBA 3RYFA 5C8YA 4F6RB 3CB2A 2UUCH 4JI8H 2YIAA 4UCUA 5CA0B 4KHPB 4LF6B 4JYAB 1FKAH 4FLXA 4ZHQB 3JSNA 1V9PA 2P5OA 1VS0A 4B3SH 5D5QA 3TY5A 4DR3B 5EIBC 5LA6B 3H20A 5IJ0A 3EYYA 4EFBA 3K57A 4LSXA 1DGSA 4KL1A 1AN7A 5KX5A 4LF7H 3GB8B 5BMVA 1RSOA 5LOVA 3SJCC 5LXTA 4CS3A 4B08A 1XNRH 3BA8A 4CH5A 1IBMB 1CKNB 1FJGB 1WNSA 1JJOA 4CS2A 2YIBA 3OTOH 5LMNH 1KU9A 4UCSA 4FM2A 4DV1H 2ZM6B 5LP6C 4DR5B 1JFFA 5LYJA 4EB6B 4JI0B 2MCTA 5CA0A 3N43B 3BA9A 5IWAB 3RGBA 1IBLB 4PZ6A 2VWKA 4BWAA 4DUZH 3SJAC 4K8XA 3RJ0A 5LMUH 4O2AA 4NVPA 1X4TA 5D1PA 1HW7A 2WE6A 4LH7A 4GKJH 4DK0A 4APMA 3LMLA 3BRCA 3HKEA 1HNZB 4JI1B 1M0TA 2R72A 4IAJA 3N41B 4X1KB 4O4JB 3WB0A 3HKDA 3K59A 3L4JA 3T1YH 4TV8B 3C0FB 4CH6A 4OX9B 1XNQH 4YJ2B 4WBNA 4X62B 1S68A 1SYXB 4TV9A 1P16A 1WN7A 4RZQA 1L8DA 2YI8A 4LH6A 3MAQA 5KHJA 4X1YB 4DUYH 3TY8A 4LF6H 1L2ZA 1SA0A 2ZNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 B;  4JV5 B;  4DRF A;  4X65 B;  4K0K B;  3PN1 A;  1XMQ B;  4DR4 B;  4JI4 B;  4PZ7 A;  2VQF B;  2HHH B;  2UXC B;  1IBK B;  2UUA B;  4GLX A;  4JI2 B;  4TOI A;  1FVI A;  4LF9 B;  4DV0 B;  1X9N A;  1CKN A;  1J5E B;  4UCR A;  3W1B A;  4EQ5 A;  1XNQ B;  1I94 B;  4DR1 B;  3QWU A;  3T1H B;  4X66 B;  4GKK B;  4LFB B;  3W5O A;  4UCU A;  4DUY B;  4KHP B;  4DV6 B;  4LF6 B;  2VUG A;  1P8L A;  4JYA B;  4LFC B;  4LF7 B;  2Q2T A;  2E5L B;  3JSN A;  1V9P A;  1VS0 A;  3TY5 A;  3SGI A;  4DR3 B;  4UCO A;  4CC6 A;  3NBY B;  4UCV A;  4DUZ B;  4JI7 B;  1TA8 A;  4JI5 B;  3RTX A;  5BR8 B;  1HNW B;  4EFB A;  4B3M B;  3W1G A;  1DGS A;  4DV7 B;  4DV3 B;  3L2P A;  3VNN A;  2UXD B;  3GB8 B;  5LMN B;  1XMO B;  1A0I A;  4B3T B;  1TAE A;  3BA8 A;  2HIX A;  2F4V B;  1IBM B;  1CKN B;  3UQ8 A;  1FJG B;  2UXB B;  1CKO A;  2UUC B;  4JI8 B;  4DV2 B;  4UCS A;  4JI3 B;  3T1Y B;  3JSL A;  5LMU B;  1XNR B;  2ZM6 B;  3NC0 B;  4DR5 B;  2UUB B;  4JI0 B;  4DR2 B;  4B3R B;  3BA9 A;  5D1O A;  4DV4 B;  3KYH C;  5IWA B;  1IBL B;  4B3S B;  4PZ6 A;  1N32 B;  3GJX B;  3NBZ B;  2HVS A;  3OTO B;  4GKJ B;  4DV1 B;  1HR0 B;  4UFZ A;  5D1P A;  4EEQ A;  4X64 B;  4DV5 B;  4LH7 A;  1XK5 A;  1ZAU A;  2VQE B;  4LFA B;  2OWO A;  1HNZ B;  4JI1 B;  2HVR A;  2CFM A;  1HNX B;  3RR5 A;  4PZ8 A;  3S24 A;  1CKM A;  4EFE A;  4DR6 B;  4NXN B;  1N34 B;  3BAA A;  2HIV A;  3GDE A;  1N33 B;  4YY3 B;  5DIS C;  2HVQ A;  4OX9 B;  2UU9 B;  4E6N A;  1XDN A;  4X62 B;  1S68 A;  3BAB A;  4JI6 B;  1P16 A;  4LF4 B;  5FPR A;  2Q2U A;  4CC5 A;  1N36 B;  4LF5 B;  4LH6 A;  4AQY B;  1B04 A;  4YHH B;  4NXM B;  4DR7 B;  3TY8 A;  4UCT A;  3TY9 A;  5D1O B;  5FPO A; 
#chains in the Genus database with same CATH topology
 2JEU A;  4DR3 H;  1KYO F;  4I7Z B;  4RUE A;  3K79 A;  4K0K B;  5JWP A;  1D2D A;  1I94 H;  4DK1 A;  2BCC H;  1EN5 A;  3D8C A;  3H1J H;  4P30 A;  4DV0 B;  5J2T F;  2YEV A;  2BSK A;  4I5S A;  3TW6 A;  2M7W A;  4YXW G;  4K0K O;  1H2S B;  4E4T A;  4KHP H;  4YR0 A;  3MR2 A;  3PW2 A;  1QU7 A;  3EHB B;  3PW7 A;  1EFR G;  5DLG A;  4XBF A;  2ZDQ A;  5IYZ A;  2XTA A;  3G4S V;  2LFS A;  3HR0 A;  3U0G A;  1NS1 A;  4AQY H;  5KHK A;  5IJ0 B;  2VPQ A;  5JVD F;  2P7T C;  3QO5 A;  4HNU A;  4ZQI A;  4TV8 F;  1O75 A;  1DF5 A;  3S3W A;  1JJ2 U;  4DRX B;  3GIP A;  2JS3 A;  4WFB V;  3NBY B;  2RJZ A;  1VMG A;  3K0G A;  1CXZ B;  3T5H A;  1TA8 A;  5LYJ F;  3JRW A;  2HHH H;  4DV6 O;  1HNW B;  2R7N A;  4B3M B;  3R5H A;  3ORQ A;  4EGQ A;  3STZ C;  1OZ0 A;  2Q4P A;  3HKB A;  2AW9 A;  3A0H Z;  1K34 A;  4RAZ A;  4BAY A;  5LA6 F;  4O7S A;  4X64 H;  3KHG A;  4R8C A;  5KHI A;  3EXA A;  4NTX A;  1I50 A;  4AHC A;  5KFI A;  1WB7 A;  5LL6 b;  4B3M H;  4DR2 H;  5KHH A;  3JD0 A;  1KBL A;  4AI8 A;  3QF7 A;  2YL2 A;  1F4M A;  2ADQ B;  5EZY A;  1YI2 V;  1S5L Z;  3PW5 A;  4O3S A;  4J9S A;  3KTM A;  5BWR A;  1ZX3 A;  2W6M A;  4DR2 B;  2JIZ G;  4B3R B;  4DL7 A;  3KYH C;  4ECU A;  3DAA A;  2UVW A;  1KUQ A;  1O9H A;  1NTM H;  2V1D A;  2W6I G;  2FYU H;  3N2G B;  3ZRW B;  5BYA A;  2X0S A;  1XHX A;  4QWC A;  5A2Q W;  2XGP A;  2EIM C;  5B5E Z;  3E35 A;  4YB8 B;  4I4T A;  2FLL A;  4RWU A;  4WBN F;  2JEJ A;  2JGU A;  1CQJ B;  2P0A A;  3UKM A;  1VF5 B;  2YID A;  3T9B A;  4DIM A;  5IDJ A;  2PVP A;  2JA6 G;  2OIE A;  4F4W A;  4BY7 G;  1Y76 A;  3ML0 A;  1FXK A;  3ZMU A;  1IBK O;  4X1K A;  4O7Y A;  3SDL A;  3TII A;  3S24 A;  5L1J A;  2X0L A;  1WB8 A;  5KFK A;  4DV5 O;  1Z2P X;  4DXW A;  3WWJ A;  2QSA A;  1FFX A;  2VOB A;  1AI7 A;  2Q2U A;  1PL0 A;  2UU9 O;  2V59 A;  3DTG A;  4X65 H;  2GV9 A;  3N2G A;  3T54 A;  4JI4 O;  3AG7 A;  2RDJ A;  5IE9 A;  1TVK A;  2CTP A;  3JAL B;  3R66 A;  2COJ A;  4A3G G;  2WLK A;  4JV5 B;  4G27 B;  1VQ9 V;  4DR7 O;  5JJJ B;  4YR2 A;  2IW5 A;  3B40 A;  4TT3 G;  2R82 A;  3K5H A;  5KG4 A;  4PZ7 A;  4TUY A;  4FFK A;  3H0G A;  2R8K A;  1OCR B;  4RB2 C;  4JI2 B;  5CMU A;  4ZI7 F;  4O81 A;  1JX4 A;  1OCR C;  2IP4 A;  1F7Y A;  4IRC A;  1N4C A;  3HKZ A;  4HR7 A;  3QG5 A;  4XZ3 B;  4O4L B;  1VQO V;  1BE3 H;  3G6B A;  1P7G A;  1QLE B;  2FPP B;  4X62 H;  1GLV A;  5KA6 A;  1XHZ A;  5JUM A;  1SC5 B;  1BGW A;  4BY1 G;  5KFE A;  1QCE A;  1GN6 A;  1PP9 H;  4RNM A;  4GKK O;  3BY6 A;  4JYY A;  1GO3 E;  3CCL V;  2EIL B;  4DUY B;  4JI5 O;  1SQV H;  3X2Q B;  4AYB E;  3APQ A;  2HHF A;  4LF7 B;  2HHF B;  2P67 A;  3E8G A;  3UT5 A;  2AGA A;  4DQN A;  3RYC B;  4UCO A;  1YSC A;  4RB3 C;  2QR4 A;  4DO2 A;  4Z1M G;  3DGE A;  4JI5 B;  1H2G A;  2EJ0 A;  1BGY H;  1Q43 A;  2HJF C;  1V54 B;  3JAW B;  1SES A;  2YDE A;  2CAZ C;  2DYR C;  3PJS K;  2JA5 G;  4DV5 H;  4UV8 A;  2YCH A;  1XMO B;  3T5L A;  2CTR A;  1Q8I A;  3JAM W;  3FKS G;  3ETH A;  4MSW C;  1RYS A;  2W6Q A;  4YJ3 B;  3BJY A;  4DL2 A;  4ED2 A;  4BXX G;  3VQV A;  3SYC A;  2UUC B;  2GTA A;  1BSM A;  3TXQ A;  3W7W A;  2LGW A;  2V9W A;  4JI3 B;  4DV6 H;  3SR2 C;  4CS4 A;  3CSW A;  4JYC A;  3OHB A;  1GK9 A;  1KEC A;  1K8A W;  3CVZ A;  3LSU A;  3JAM N;  2I87 A;  5B1N A;  2YRW A;  4KP4 A;  3KAL A;  1N36 H;  3H4D A;  2WLI A;  4O2B A;  1Z2G A;  1AUX A;  2R7Z A;  4QWA A;  3RUP A;  4RZR A;  3PR5 B;  1KMI Z;  1VF7 A;  1SS3 A;  3KCX A;  1M90 W;  4UVB A;  5GON F;  1S03 G;  1SER A;  3CPW U;  4I50 B;  1N0J A;  2COG A;  1KUT A;  2PYJ A;  1HWY A;  1HNX B;  3R5F A;  2Q0A A;  3RR5 A;  2P22 C;  5J2U A;  4EFE A;  4DR6 B;  5EYP A;  1H8E G;  1FPO A;  3TIN A;  3WB2 A;  1VQL V;  1QR9 A;  3K04 A;  1B6S A;  4MTD A;  2ZXW B;  1YIT V;  5I5U A;  3D36 A;  1XDN A;  3GV5 B;  3BAB A;  5JCO C;  2XAH A;  1YJN V;  3M9O B;  3MWD A;  4DR6 H;  4QIW A;  4NB5 A;  5H6Q A;  4O3R A;  1HR0 O;  4R7C A;  2HGX A;  2ZDI A;  4XYL B;  2VQE H;  1KJJ A;  1AR5 A;  2GDS A;  3MDS A;  2J6U A;  3LUL A;  4O4I F;  2PI5 A;  3OEE G;  2YS7 A;  1B6Q A;  3JAT B;  4LFB H;  4AYB A;  1VAR A;  4ED6 A;  2YUA A;  1AB3 A;  1OBG A;  3GTM A;  1B33 N;  3TXS A;  2OT5 A;  3CJH A;  4QIW F;  1ZWI C;  4RAY A;  4OX9 H;  4J7Z A;  4DR1 B;  1WA8 A;  1WH2 A;  5KFX A;  5KFO A;  1JCH A;  2JJ2 G;  4R6Z A;  2AXT Z;  4LF4 H;  1UPG A;  3IC7 A;  3PFF A;  4MTX A;  1BHA A;  1YEW A;  4L8J A;  1Y66 A;  2W70 A;  2A79 B;  2WTF A;  4HZ3 A;  4KXR A;  2VUM A;  2IH1 C;  2NVX A;  5JQG A;  4U6P A;  5BPH A;  5IWA H;  2ZXW C;  4UCV A;  3U9S A;  4PA3 A;  1XMQ H;  3ZIA G;  2PN1 A;  4YJ3 A;  4ICG A;  1IBK H;  5CA1 F;  1Z5W A;  4NZO A;  5IYZ B;  1I6U A;  1Q90 D;  2GPW A;  4MA0 A;  5DMX A;  2YIB D;  5BMV B;  5KFU A;  3JAK A;  1JMK C;  1GN4 A;  4K3A A;  3HT5 A;  3RB6 A;  2IH3 C;  5IJ9 B;  2QWO B;  5B1B C;  4YAJ B;  2CTQ A;  4BR6 A;  4LNU A;  3UQ8 A;  2IJI A;  2IJJ A;  2B9Z A;  5L3F A;  1WP8 A;  2FKL A;  2RGR A;  3K9S A;  3UT5 B;  1N34 H;  4C2M A;  3K08 A;  4PA9 A;  3JD4 A;  1XNR B;  1S76 D;  3T7A A;  3BPZ A;  5LGT A;  3T2M A;  4MV8 A;  4FJC C;  1H2M A;  1K73 W;  4C7U A;  3J7A U;  2ZIM A;  3TQT A;  1EUC B;  1HNX O;  2YZL A;  4I55 B;  5KFM A;  3ABK B;  1ORQ C;  1S72 V;  4UFZ A;  4DR5 H;  1AIL A;  2WA3 A;  4X89 A;  2HR3 A;  5KFA A;  3U11 A;  2V58 A;  4AIL C;  4EEQ A;  4QE7 A;  5KG6 A;  3F8N A;  4F4L A;  1ZAU A;  5DQG A;  4CZZ A;  2W9B B;  2Q7E A;  2UUA O;  1JOY A;  2JA6 A;  5B1A C;  4J9N A;  2AHZ A;  2C2R A;  4J9Z B;  4ZI7 A;  4PZ8 A;  3T9D A;  1OWT A;  3M7M X;  1ZET A;  4NXN B;  1IXB A;  3AK3 A;  4R8U B;  3A0B Z;  4KFM A;  3JAL A;  4YY3 B;  1AI4 A;  1TVK B;  5E1A C;  1F4N A;  3N40 P;  2GUZ A;  4J9K A;  4JI7 O;  4LF7 O;  1IZ3 A;  3KHL A;  4F6E A;  3E22 A;  3FB8 C;  5T14 A;  2CQY A;  4R50 A;  3V6K A;  4LF5 B;  4Q20 A;  3I4M G;  1LUV A;  1AJQ A;  1QR8 A;  3C3S A;  3RVY A;  4O7L A;  5B1A B;  4YY3 O;  3LP8 A;  2R70 A;  5EIB D;  5CAE B;  4RCN A;  3RFR A;  3CME V;  1D5N A;  4QWD A;  4EB6 A;  3GWO A;  4LF5 H;  3RWR D;  5ITZ B;  4A3D G;  2WWW A;  1XBL A;  5KFG A;  3Q4H A;  3SPC A;  1G8M A;  2P90 A;  4U3F H;  1X9N A;  3ORR A;  3IGA C;  1SFO A;  2JA8 G;  4I4T B;  4MAM A;  1XMO H;  2PI4 A;  3RW0 A;  3AG2 C;  3QWU A;  1KBH A;  4MVM A;  2LP7 A;  1N56 A;  3D3Q A;  3HPL C;  1IOW A;  5C8Y A;  2R85 A;  2YWV A;  3JZ6 A;  2YIA A;  3P32 A;  5L3D A;  5CA0 B;  4KHP B;  2P4V A;  5I47 A;  4U7O A;  3G80 A;  4JGS A;  1VQ8 V;  1FKA H;  4DV0 O;  2WSS G;  1V9P A;  1NJI W;  4B3S H;  3FKI A;  1I5Y A;  1DIK A;  1A32 A;  4IR9 A;  1OCC B;  4H37 A;  1JR9 A;  4EYI B;  5LA6 B;  4TVI A;  3MHH C;  2Y48 A;  4KHP O;  3EFF K;  2RF4 A;  1BT8 A;  1P4R A;  1DGS A;  2PMZ A;  2DWD C;  4LF7 H;  4WFA V;  3APO A;  3Q8Q B;  5BMV A;  2ASL A;  4NZM A;  3SJQ C;  4I0X A;  1K1S A;  4UV9 A;  4CS3 A;  4B08 A;  2Y0S A;  4QWB A;  3BA8 A;  3ZRV A;  4ED1 A;  1WNS A;  3FB5 C;  4I9W A;  1JJO A;  3D36 C;  2VR1 A;  1FYJ A;  4CMF A;  3RBE A;  1AP5 A;  3CWB H;  3A8T A;  3HOU G;  2ZM6 B;  5LP6 C;  5LYJ A;  2MCT A;  2CNU A;  3OUF A;  1IBL B;  3VA7 A;  3BQ2 A;  2GPS A;  2VWK A;  5IYB G;  1H38 A;  1PNL A;  5CBF A;  2ADP A;  3ASO C;  3RJ0 A;  2LW7 A;  4O2A A;  1GH6 A;  1E4E A;  1X4T A;  1HDJ A;  1W96 A;  2W6O A;  1KKC A;  3PR4 A;  2BSK B;  2ALZ A;  1JPX A;  1RJR A;  4APM A;  1EYZ A;  3LML A;  3E8H A;  3BRC A;  1M0T A;  2R72 A;  4GLW A;  4GKJ O;  2GQR A;  4IAJ A;  4A3I G;  3M8A A;  3L70 H;  2HP8 A;  3I56 V;  4TV8 B;  2BOC C;  3C0F B;  3QZ8 A;  1FKA O;  4CH6 A;  2OTL V;  4NTY A;  1G1X B;  4OX9 B;  4FBU A;  1K33 A;  1R1B A;  2X6A A;  5C1O A;  1FAF A;  1SYX B;  3RT3 C;  4QSH A;  4JI8 O;  5KFB A;  1L8D A;  5FR9 A;  2CNQ A;  3T9E A;  3IN5 A;  3T9C A;  4JTC B;  5EBW C;  4LF6 H;  2N05 A;  3OTO O;  1US6 A;  4ASU G;  3SE7 A;  5EC1 C;  2P06 A;  2YXL A;  4DR4 B;  4MV1 A;  1IBK B;  1UFI A;  3FB6 C;  3CRR A;  2GQS A;  1CKN A;  1MSD A;  5KX5 F;  2BTO A;  4F4X A;  4X9Q A;  3W7S A;  3QFF A;  2HGS A;  3TK1 A;  4TWK A;  4DR4 H;  5H2F Z;  2ARH A;  4ECW A;  2E74 B;  1PK8 A;  2M6Y A;  1XRE A;  4FLY A;  5KMG A;  3JAW A;  5L3B A;  5BXZ A;  1Z5V A;  5E79 Z;  1W2B U;  4FE2 A;  2WAM A;  3ETQ A;  2OCC B;  4FZ1 A;  1BHB A;  1S10 A;  2VUG A;  1JDB B;  1P8L A;  5CB4 F;  3CRC A;  1GM8 A;  4O4J F;  5KLV H;  3BQ1 A;  3B2E E;  2HJW A;  3RN4 A;  4ZOL B;  5K2M A;  1I7F A;  2ZR3 A;  1QHT A;  1VKZ A;  1DLB A;  4WFG A;  4FLV A;  2UUA H;  4XDL A;  2W8L A;  3W1G A;  4DV7 B;  4FFB B;  2YYA A;  2YS8 A;  1M9N A;  5LXT B;  5DGH A;  2W8K A;  1JDE A;  2QDO A;  2ZE5 A;  2R87 A;  1PD3 A;  1WCM A;  4J9Q A;  1IYE A;  4W4L A;  2C00 A;  4B3T B;  1UNN C;  4IWX A;  2HIX A;  2IBK A;  3ZN1 A;  2Q7G A;  5IYD G;  3CCR V;  3JD3 A;  2UXB B;  2ZKO A;  1EZV H;  4TUY B;  1THZ A;  1P7B A;  4WFH A;  4Z1V A;  4ZHQ A;  2EBO A;  1EKV A;  4O3Q A;  1GYF A;  4B3T O;  5DG9 A;  2Z5U A;  4TQF A;  4FFN A;  2V4R A;  1N33 H;  2UUB B;  4IZO A;  2ZDG A;  4BW9 A;  3RYI B;  3EVK A;  2W9C A;  2KG7 B;  5BWX A;  1RM1 B;  1T36 A;  1M57 B;  4GKJ B;  4Q43 A;  3BVO A;  2QK4 A;  2C28 A;  1H2K A;  1K4C C;  2R9A A;  2Z04 A;  5BZB A;  5KHG A;  2WLH A;  4J42 A;  2WB1 E;  5L1K A;  4HNV A;  4FU0 A;  2PBZ A;  5B3S C;  5JCO A;  3PW4 A;  3CSX A;  2VQF H;  2Q8V A;  1M57 C;  3AEI A;  2R7K A;  1Y1W G;  2A7W A;  1ZSP A;  5KAF Z;  1S97 A;  2HIV A;  1NH2 B;  3FD9 A;  5I5V A;  1FXK C;  2UU9 B;  3W7X A;  1HNX H;  3WG7 C;  1Y4M A;  3IJ4 A;  4QGP A;  4IRK A;  2AU0 A;  4FM1 A;  1AVM A;  5FPR A;  3I5D A;  2FLN A;  4AQY B;  1EHI A;  3L71 H;  3RBD A;  3UM7 A;  1BS3 A;  1N34 O;  4O86 A;  5CE8 A;  5IYD O;  2DYS B;  4YQW A;  3VPB A;  2VWJ A;  4O4H F;  4U3J B;  2CKZ B;  5KFQ A;  5FLX W;  1K97 A;  1ET0 A;  3T5J A;  4LFB O;  4ETS A;  3N6X A;  3Q8P B;  2BQU A;  3G6E V;  2VQF B;  1V55 C;  3GII A;  1V55 B;  5DG8 A;  3CX5 F;  3CE2 A;  1GGO A;  1R9T A;  3O9O A;  4UCR A;  1ZHS A;  3CCQ V;  3CCE V;  1ZL8 A;  3OEH G;  3Q8S B;  3H1I H;  3WO1 A;  4TM5 A;  4NXN O;  4Q45 A;  4X8A A;  4GKK B;  2OTJ V;  3ZRW A;  5EOY A;  3N42 B;  1IBL O;  5DGA A;  2Q67 A;  3FB7 C;  1L1F A;  4A3B G;  4O4I B;  3ZCC A;  4CE5 A;  5K1P A;  2VQD A;  2JS5 A;  4G3I A;  4DR7 H;  4EGJ A;  1BXR A;  4JI6 O;  4N23 A;  4NR1 A;  4IHJ B;  4FS1 A;  1T3N A;  1R3J C;  4H0L B;  5H6R A;  1S0O A;  1GAX A;  5C8Y B;  2AGP A;  3QTC A;  3RYF B;  5C44 G;  2WA4 A;  2UXD B;  2Q5Z A;  3AG4 B;  3N2K A;  1PM9 A;  1Q3E A;  2IJH A;  2CGO A;  4FK5 C;  4MW3 A;  1VQ7 V;  3RV3 A;  4LFA H;  2N74 A;  5EDW A;  4WCE V;  3RV4 A;  5LP6 F;  2ZCE A;  4PV1 B;  2VRZ A;  3CC2 V;  3FYE B;  4JI8 B;  1LUW A;  4DV2 B;  2QF7 A;  4EKW A;  4OGQ B;  3JSL A;  4JYB A;  4JYA H;  1N32 O;  4UVC A;  3OUZ A;  1SF9 A;  2BTQ A;  1KJQ A;  2VUM G;  2PMZ E;  4D6T H;  4DV2 H;  4PA6 A;  3GJX B;  3WO0 A;  2ZDI C;  4O7V A;  4JI1 H;  1CEZ A;  3QZ7 A;  4DV4 H;  3JRX A;  4E2L A;  3OSP A;  1NTZ H;  4B3T H;  2Y69 C;  4C5C A;  2OWO A;  1ZHQ A;  4PWQ A;  3N6R A;  3CXC U;  5ITZ A;  3U9T A;  1WAZ A;  2I8C A;  3HOY G;  1TWA A;  2AGO A;  3BAA A;  4B7E A;  1M1K W;  3OMA B;  4X64 O;  3N27 A;  1N36 O;  4DR3 O;  4E6N A;  1I3Q A;  2FJZ A;  1FJG O;  4RU9 A;  1VIB A;  4TUY F;  5KG0 A;  5KFN A;  3RYH A;  3HKC A;  4LWS A;  1YTF B;  3MWM A;  1B04 A;  2CK3 G;  4PDL A;  4DUY O;  2R8G A;  1AP6 A;  4EEY A;  2EIL C;  4TV8 A;  1F51 A;  2EJ3 A;  2WLN A;  5KFJ A;  5EWG A;  4B3R O;  4R7R A;  1HP8 A;  3I12 A;  4X20 B;  3BCC H;  2RCV A;  1M56 B;  3ASN B;  5K1X A;  2UUA B;  4M7E A;  2NR5 A;  4LNU B;  2W6J G;  2QKA A;  3BAC A;  3W1B A;  4IIJ B;  1XNQ B;  2YXH A;  1DAA A;  4LF8 O;  3GVM A;  3PW0 A;  1EUD B;  1SQF A;  4X66 O;  1CS0 A;  3RB0 A;  1ZUQ A;  5F2V O;  4PD4 F;  4O3O A;  4JI5 H;  4A3C G;  2GHY A;  4LCU C;  3K3W A;  4LFC B;  2R86 A;  3T99 A;  3H0G G;  5B66 Z;  2Q2T A;  2WLL A;  2OCH A;  5DLF A;  2F4V O;  3HOV G;  2F95 B;  2IM9 A;  3I4N G;  4H33 A;  2D3O W;  4DV3 B;  2FK2 A;  1BJT A;  4A3K G;  1CQI B;  3CHX A;  4DYL A;  2FP4 B;  3JAK B;  2ZGI A;  3KG2 A;  1ZL8 B;  2IBZ H;  2PF4 E;  4IIJ A;  4JI3 H;  1CP9 A;  1QBZ A;  1AR1 B;  5JQG F;  1OJH A;  1DV1 A;  2ABJ A;  3K3V A;  4UB8 Z;  5GON B;  3FFQ A;  2QM4 A;  1TUB B;  3VBB A;  2XT9 A;  1XL6 A;  3RVZ A;  2B1G A;  2WLL B;  1KP3 A;  3M99 B;  4ZBM A;  3T1Y B;  3K5I A;  5JJE B;  3V4Z A;  5KFY A;  2JRI A;  4X65 O;  2UU9 H;  3GB7 C;  1NVP D;  4JAU A;  4ECQ A;  2WAQ E;  1R3L C;  5JJN B;  2YZG A;  4I50 F;  5IYB O;  2QB5 A;  2R84 A;  5CA3 A;  4O7T A;  3E83 A;  4ECZ A;  1XQ8 A;  4HNA A;  5KFW A;  1R3I C;  2RN9 A;  3AK1 A;  4GYC B;  1DK1 A;  1D5A A;  3O65 A;  1K92 A;  2B1I A;  4X64 B;  1MNG A;  5DGB A;  5LL6 Y;  1NR1 A;  2GTS A;  1EN6 A;  4Q6G A;  4J41 A;  3LSS A;  2XAF A;  2J6S A;  4RUA A;  3FAV B;  3UCS C;  3CC7 V;  2CW8 A;  5KG1 A;  5EWE A;  5D5P A;  2C35 B;  5LGN A;  2KSW A;  1WCM G;  4JPR A;  3AG1 B;  2ZM6 O;  1A48 A;  1NKD A;  2FK1 A;  3VMM A;  4LF4 B;  4BIZ A;  3RYH B;  1Q86 W;  4JV5 H;  2HFE C;  3VQY A;  1S5J A;  4L87 A;  3ZMT A;  5IT9 W;  1K9M W;  1I1L A;  1SRY A;  4YJ2 A;  2NUA B;  3DXR A;  2KB1 A;  3TY9 A;  2F23 A;  3A0R A;  5EYP B;  1JFF B;  2FL4 A;  3JD2 A;  4ED8 A;  1HNZ H;  2RMK B;  3IC9 A;  1P84 F;  2W9B A;  2EJ7 A;  3S3X A;  1S3J A;  1RK6 A;  5FNV A;  4TV9 F;  3AK2 A;  2A0L A;  3JAS A;  2X5R A;  1VAJ A;  3CEB A;  2DMX A;  5BY1 A;  3BEH A;  3JZF A;  1E1R G;  2V4Q A;  3MWE A;  3SYQ A;  3G8C A;  2O57 A;  4Y8V B;  3J80 W;  2WLI B;  4BIU A;  4I55 A;  4FFB A;  3RYF A;  5EZY F;  4TQR A;  2NU6 B;  1WLE A;  3ETG A;  4O7W A;  4JI8 H;  2UVU A;  2H94 A;  1W0J G;  4ME6 A;  2EJR A;  4LF6 B;  4IR1 A;  3AW8 A;  2XCA A;  1NBM G;  2JA7 G;  3SYP A;  2Z02 A;  2B5U A;  2QM8 A;  5D5Q A;  3CCS V;  3TY5 A;  4J10 A;  3HO8 A;  1RPR A;  5CN0 A;  5C4X G;  3H20 A;  4DR4 O;  1SQQ H;  3AG3 C;  1AJP A;  4O2B F;  4EFB A;  2YC0 A;  3EYY A;  1Y74 B;  1AN7 A;  1OCO B;  3H9V A;  2HKO A;  2K1E A;  2XGQ A;  2IU3 A;  2W6P A;  3NXS A;  4FMT A;  3OD4 A;  2W6N A;  2XC9 A;  1CKN B;  1FJG B;  4CS2 A;  1FFT B;  2DZD A;  1FS0 G;  1KU9 A;  4GX1 A;  4FM2 A;  1V54 C;  4GX5 A;  1UJW B;  4IHJ F;  1RPO A;  3K9A A;  3H40 A;  1E79 G;  1VF6 A;  2UXX A;  3OGC C;  3RGB A;  2A3Q A;  2JEF A;  1IDS A;  1W59 A;  4DUZ H;  3GWK C;  3SJA C;  4WD3 A;  4J9Y B;  2R9R B;  1MSW D;  1KP2 A;  3PO3 G;  3GIK A;  1BZK A;  4PDV A;  1YJ9 V;  3CJH B;  1Y67 A;  3R9R A;  2JGD A;  4MTG A;  1JX9 A;  1N0N A;  3KRE A;  4JI1 B;  5B1O A;  3FAV A;  3ETE A;  1TUE B;  3C3T A;  3WB0 A;  1MZF A;  3HKD A;  1DF4 A;  3K59 A;  3T1Y H;  1GM9 A;  4P2Z A;  5DG7 A;  3QO8 A;  4EG0 A;  3BG5 A;  2MW2 B;  2DIK A;  1P16 A;  2UUC O;  2YI8 A;  1S0M A;  3DC5 A;  1XDC A;  3L73 H;  5DGI A;  1GN3 A;  5EBL C;  3R65 A;  5KHJ A;  1GSH A;  2KG7 A;  3RAX A;  2W9C B;  4QPK A;  1SA0 A;  1H2N A;  1MA1 A;  3E8F A;  3ZMZ A;  5L9X A;  5IYZ F;  4U7C A;  2LGQ A;  2KQX A;  3JAR A;  5JVD A;  4X66 H;  3HKE B;  5BR8 H;  2CE4 A;  3T4Z A;  5LGU A;  3AG2 B;  3RAQ A;  5CR5 A;  4GC6 A;  3SI8 A;  3G6Y A;  3LDD A;  3OFN G;  2LO1 A;  5A9G A;  2IMW P;  3ZHS A;  2CH7 B;  4H13 B;  4FM0 A;  1I94 B;  3QVN A;  5J2T B;  2M05 A;  2XAQ A;  4PDM A;  4JUZ A;  2Y0I A;  4O7R A;  2C22 A;  5J9P C;  4B3S O;  2E2I A;  1L0L H;  4LR3 A;  1OCZ C;  3FMA A;  3FX7 A;  4DV6 B;  4BW5 A;  2FPI B;  4DRX A;  2ZM6 H;  2W71 A;  1GKF A;  4UXN A;  2QWQ B;  4JI7 B;  3GTK A;  2Z0A A;  3WG7 B;  1SQB H;  2ZNI A;  2QYZ A;  4X88 A;  3OW2 U;  2PUS A;  4UB6 Z;  1OV9 A;  1RSO B;  2QM7 A;  4M0J A;  3VPC A;  2OIG A;  4QPJ A;  1WP7 A;  2V5A A;  2DYS C;  1A0I A;  1K4D C;  2XAG A;  1KJ9 A;  2WB1 A;  1YVW A;  1HNZ O;  3EPI A;  5B1B B;  4GC7 A;  3KHH A;  3NGD A;  2ATL A;  4GX2 A;  5H5N A;  3G8D A;  4MV4 A;  4X20 A;  5BWV A;  2R93 G;  2EZP A;  3LNM B;  2KKW A;  3K58 A;  2A1H A;  5LMU B;  2CGN A;  4YBZ B;  3STL C;  3NC0 B;  3GV8 B;  4ECX A;  3CRQ A;  2XHB A;  2RGV A;  4DV4 B;  4FLU A;  4XDK A;  1EM1 A;  1I7N A;  4JI6 H;  4JI1 O;  4CH4 A;  4JI7 H;  3NBZ B;  2HVS A;  3HOZ G;  3UZB A;  5LP6 B;  2QJ1 A;  3HXL A;  3T1C A;  1WJZ A;  4X1I B;  4K6N A;  1DV2 A;  3RB4 A;  4JI3 O;  2DPI A;  3JAS B;  2UXC O;  2Y4R A;  4ECY A;  4X62 O;  2VQE B;  1Y1W A;  3G71 V;  4JF3 A;  3FKI G;  3UYY A;  3AG4 C;  2EIK C;  4FLZ A;  5LXT F;  2CTW A;  1IX9 A;  2Y4T A;  4FFM A;  3B8N A;  3WNZ A;  4PA7 A;  4I9Q A;  3GDE A;  5DIS C;  2AGQ A;  2W57 A;  1JXL A;  3JCU Z;  1VQP V;  4PEL A;  4WHX A;  5C93 A;  3ASN C;  4QE9 A;  1WRV A;  4L1K A;  3Q8R B;  1PPJ H;  1FFX B;  4O2A B;  4DL4 A;  1COW G;  2EIK B;  2CW7 A;  4CMD A;  4JI4 H;  3RB3 A;  4NXM B;  4Q8F A;  2AZ0 A;  4JI2 H;  2YI9 A;  5D1O B;  3N44 B;  1IOV A;  4DL6 A;  3JD1 A;  4MVU A;  2DYR B;  1SQG A;  3FDS A;  2IJK A;  4JI4 B;  2EIY A;  4NXM O;  3SYA A;  3SNO A;  4DV7 H;  3FYI B;  4NXN H;  1J5E B;  4CKE A;  2FB9 A;  2VQF O;  3L4K A;  2QTS A;  4Q4D A;  2JEX A;  1I0H A;  1E4E B;  3OMN B;  4LFC H;  4WFF A;  2FE3 A;  4DV7 O;  5I5W A;  3AYH B;  3PZP A;  3J7A K;  2HLD G;  1EBO A;  1RP3 B;  2Z3Y A;  4IHJ A;  2LJ2 A;  3L9D A;  4HQ6 A;  5KG3 A;  4CH3 A;  1S77 D;  1ZQ7 A;  1TUB A;  2XOK G;  5LHH A;  4DUZ B;  4FIP C;  4GCZ A;  5BR8 B;  4FM9 A;  4F6R A;  1KEE A;  3L2P A;  5F9N A;  2Q68 A;  3D3I A;  2QKS A;  2DJV A;  3LUT B;  4Z2W A;  3NUA A;  1YCI A;  1FXV A;  5J2T A;  4DR2 O;  2CH7 A;  4TQD A;  2OLS A;  4DV4 O;  1PNM A;  1TAE A;  2UXD O;  2DAA A;  1XUQ A;  4N21 A;  5JH7 B;  3SPI A;  4CHI A;  4IYH A;  4ECR A;  1H8H G;  3CCU V;  4YAK B;  2O03 A;  2OYQ A;  5JVD B;  1A3G A;  5DEC A;  3U54 A;  1HR0 H;  4PI0 A;  5IP9 G;  1SA0 B;  1P49 A;  2FK3 A;  4MTE A;  5DQH A;  5D1O A;  2F43 G;  4EBC A;  1XI1 A;  5KT2 A;  1N32 B;  1IVS A;  1DTO A;  3OTO B;  3T9A A;  5A2Q N;  3ZRX A;  4Q0Y A;  3HKC B;  4LWS B;  3L75 H;  3OUU A;  2JDI G;  2ZT9 B;  1AR4 A;  5B3S B;  1QQC A;  4LFA O;  4DV5 B;  1O9G A;  4JAS A;  2D2C B;  3RBZ A;  1VQM V;  4RB0 A;  2NU9 B;  1RFY A;  3HKD B;  4K0K H;  2B63 G;  3VOT A;  4DAA A;  3SJB C;  4FFP A;  3ZHQ A;  4I50 A;  3I55 V;  2COI A;  4WF9 V;  4EYH B;  2FML A;  2FKX A;  2HVQ A;  2BE3 A;  1UC9 A;  1A9X A;  3G67 A;  3ZRS A;  2QGN A;  3OMI B;  1URF A;  4GKK H;  4H44 B;  4FZ0 A;  3KCY A;  5DN6 G;  5CA0 F;  4IWY A;  3GTG A;  1CPY A;  3E22 B;  1N36 B;  4X1I A;  3CP1 A;  4O2B B;  3P30 A;  4PBC A;  5C1P A;  4J9P A;  5EBM C;  4ECV A;  1Q82 W;  3J81 W;  4UCT A;  3H3V H;  4YR3 A;  4LSA A;  1U97 A;  1W93 A;  4M9U A;  2HVK C;  2X6B A;  3GIL A;  1VF6 C;  2FPG B;  4QWE A;  4YIO A;  1ZTE A;  4K35 A;  3C90 A;  1MAB G;  3B77 A;  4ZOL F;  1WPB A;  3T1H O;  3DF7 A;  4RUC A;  1EKF A;  1HNW H;  4U7N A;  3SPG A;  3MR5 A;  1KQS U;  3GID A;  3OR7 C;  3PVX A;  2AHY A;  5IJ9 A;  3M9N B;  2Q69 A;  3T1H B;  4X66 B;  3IG0 A;  3H1L H;  1R6N A;  3W7U A;  5LP6 A;  2ODM A;  5BR8 O;  3CCJ V;  1VQ5 V;  1YTF D;  2Y0S E;  4J0M A;  2PGG A;  2BTQ B;  4DLK A;  3K0D A;  5HV6 A;  3ZHT A;  3V6H A;  3CRM A;  3G6X A;  1ZLZ A;  1Z2N X;  1SEI A;  2R8H A;  2HVJ C;  3ABK C;  5HBR B;  2UVR A;  2B63 A;  4LP8 A;  1Q5O A;  1IBL H;  4A5U B;  3SGI A;  4CC6 A;  3HB3 B;  1XL4 A;  4LFC O;  1NT2 B;  2RQ6 A;  2YW2 A;  5CM0 A;  1IBM H;  1C30 A;  3AG3 B;  5LHI A;  2WAQ A;  1JIH A;  3MR6 A;  1J5E H;  1E1Q G;  4A3F G;  3GIM A;  5LMN B;  1R6T A;  5KX5 B;  1XNR O;  2VPS A;  2R7L A;  3OHA A;  3ZMV A;  1AUV A;  1N48 A;  2R7Z G;  2GLT A;  2WYO A;  1BNC A;  5I5Y A;  3TW7 A;  3H01 A;  3VOU A;  2VA2 A;  2GSM B;  3JAR B;  1JVM A;  1MMM A;  5JQG B;  3PO2 G;  4D7T A;  2R93 A;  1LR1 A;  2ZD9 A;  5L1I A;  1BCC H;  4O7N A;  1SET A;  5KFC A;  5J2U F;  3ZHR A;  4JV0 A;  5IYC G;  1RYR A;  1M4U A;  1RM1 C;  4IL6 Z;  4EBE A;  2F66 C;  3T4D A;  2NNU A;  4QIW E;  2EJ2 A;  2XAJ A;  2YS6 A;  3CXH F;  2EIJ C;  3GV7 B;  3ZHV A;  4JV1 A;  1ULZ A;  2HVR A;  4OPA A;  1YJW V;  5KFV A;  3IAY A;  4QNH B;  3K5L A;  3UO2 A;  3ZBH A;  3N8D A;  2UXC H;  4KUM A;  5CA1 B;  4MS2 A;  4RO2 A;  4U3J A;  1XEQ A;  2ZIN A;  3THO A;  5HFM A;  5K3W A;  1N33 B;  2FMA A;  1KJI A;  5C3E G;  5KFT A;  5DED A;  4JI0 H;  3TQ1 A;  4A3J G;  4DL5 A;  3F5W C;  2V7Q G;  2FLP A;  1Q6I A;  3SPH A;  4HNA B;  2BQ3 A;  1SCU B;  4IT5 A;  1N33 O;  1TWF A;  4YY3 H;  4WBN B;  2EIN B;  2W6Z A;  1E4G T;  1H2L A;  4LBE C;  5BYB A;  4DV0 H;  3RYI A;  1M93 A;  2W7P A;  2ILM A;  1S0N A;  5J2U B;  4GT1 A;  1K3E A;  3GTJ A;  3PN1 A;  5EZY B;  1QVF U;  1E4F T;  3RIZ A;  2UXC B;  2QWP B;  4UUJ C;  4F4Z A;  2ZIO A;  5KS8 A;  3RGX A;  4PDB A;  1M6V A;  4YJ2 F;  2ITC C;  3CYO A;  1KD1 W;  4BBR G;  3U0Z A;  4MTF A;  4I0X B;  1TGO A;  4J9O A;  4HN2 A;  2Q7H A;  3HKB B;  2DW4 A;  2YSU B;  2UUC H;  2ETN A;  2I80 A;  2XCP A;  4PA4 A;  2J6T A;  2Q7D A;  3L72 H;  4UUG A;  4J7K A;  2ZE6 A;  3BFR A;  2P5O A;  3AG1 C;  2AQ4 A;  2EIM B;  4IGG A;  4DR3 B;  5EIB C;  1Q81 W;  1JQ0 A;  3LQS A;  1IYD A;  4KL1 A;  5KX5 A;  4QJF B;  1VBH A;  4XYM B;  5LHG A;  5BWW A;  4O82 A;  1RSO A;  3TJT A;  1EN4 A;  1I94 O;  1VP7 A;  5IP7 G;  3K03 A;  4EBD A;  3OM3 B;  5FLX N;  4O2A F;  3HKZ E;  2DLN A;  2ITD C;  4TSF G;  3V6J A;  3KZI Z;  4OXS A;  1IBM O;  4UCS A;  4DV1 H;  1PL4 A;  1PX2 A;  5HFL A;  5HNE A;  1JFF A;  3MFI A;  3GIJ A;  1AI5 A;  2HG5 C;  3GLK A;  1OCC C;  5IWA B;  2WLJ A;  3Q1K A;  4P9P A;  3QNE A;  4DR5 O;  1VBG A;  4FFL A;  4FS2 A;  4ECT A;  3CCV V;  1GSA A;  5LMU H;  1ROP A;  1BMF G;  1PNK A;  1EZ1 A;  1KT8 A;  3ZMS A;  4GUN A;  2P6J A;  4DK0 A;  4JXU A;  4O83 A;  3GTL A;  1SQX H;  4F4Y A;  4OX9 O;  3HKE A;  5EC2 C;  1HNZ B;  4RNN A;  1AJN A;  1Y6X A;  1AI6 A;  3N41 B;  4X1K B;  5IY5 B;  1B6R A;  1I1M A;  1ENV A;  1Y76 B;  3L4J A;  5LMU O;  4A93 G;  4WBN A;  5KFR A;  5EK0 A;  4DUZ O;  2IA6 A;  5BWT A;  1WN7 A;  3CEI A;  1R73 A;  5C8Y F;  4LH6 A;  2ZQM A;  4O3N A;  1Q6U A;  3MAQ A;  3K06 A;  1XMQ O;  4YIP A;  1XMO O;  1GRJ A;  2XND G;  4J9M A;  1I2K A;  2GBO A;  3ZJZ A;  2ASJ A;  3WWH A;  4X65 B;  3T5K A;  5CA1 A;  3VPD A;  2Q6A A;  2C2D A;  1XMQ B;  3K5N A;  4RUF A;  5KFH A;  4I7H A;  2QTO A;  3K3P A;  3CQZ A;  3LWB A;  5KT4 A;  4LF8 H;  5BMV F;  2JVD A;  5KT3 A;  1NI8 A;  5KUK A;  5KFL A;  2IU0 A;  3N2K B;  4JV2 A;  1J95 A;  3KAK A;  2YXY A;  4LFB B;  1TWH A;  1QVG U;  2DWC A;  2Y0P A;  3NR7 A;  4JV5 O;  5KT6 A;  2DQ3 A;  3SYO A;  4MVR A;  5LA6 A;  1G2W A;  1WPX A;  3E8B A;  3LDE A;  2EIJ B;  4JI0 O;  4MTO A;  1JKJ B;  5KUM A;  1IXM A;  3ABT A;  3ZX6 A;  1NU1 H;  2PYL A;  4O4I A;  4DR6 O;  1I08 A;  3VNN A;  1FJG H;  5GW7 A;  3E89 A;  1M56 C;  5JH7 F;  5CBG A;  2N04 A;  3R23 A;  1VQK V;  1T94 A;  3LNN A;  1IUR A;  4I4T F;  5KT5 A;  3TET A;  3T9F A;  4NLG A;  4J11 A;  5FLM G;  1SZX A;  4J9L A;  2A06 H;  3IFX A;  2XUM A;  2XD4 A;  1KC7 A;  1FD9 A;  3LSQ A;  2DWE C;  2SCU B;  1KJ8 A;  1Y1V A;  1KC8 W;  4X1Y A;  2YZM A;  3E86 A;  4YJ3 F;  3ZS8 C;  2EZO A;  2J9G A;  2R8J A;  3W7T A;  2PY5 A;  3OSN A;  1Y1V G;  4DV2 O;  4TQS A;  2WDT A;  1YF2 A;  3HOW G;  1N32 H;  4JYA O;  5FNV B;  1NH2 D;  5TIS Z;  4LC1 A;  2RNB A;  5KFP A;  5FNV F;  4JZ2 A;  3MJF A;  4O84 A;  1CKM A;  4RQF A;  4FGR A;  1T5E A;  2R9I A;  3U55 A;  4NKG B;  2UUB H;  1B06 A;  1BL8 A;  3DXR B;  2L35 A;  4BBS G;  1BQZ A;  2C2A A;  3MD0 A;  3ZED A;  5IYC O;  1V51 A;  1N8R W;  4CC5 A;  1GSO A;  4LMY A;  5KFZ A;  3JZI A;  4B7K A;  1G6U A;  4IRD A;  2BOB C;  3MHS C;  4D7S A;  2R8I A;  3GTO A;  4ZIB A;  4DR7 B;  5EWF A;  4MVS A;  3ABL B;  4FVM A;  4JAA A;  4R8U A;  4O4J A;  4DRF A;  2XIG A;  4A2B A;  5CB4 B;  4ZI7 B;  4A2A A;  3DTF A;  4PI2 A;  1KKD A;  1FXH A;  1PV0 A;  1HNW O;  4MVZ A;  2ASD A;  2HHH B;  1KTA A;  5GTI Z;  4GLX A;  3WU2 Z;  4LF9 B;  2QE7 G;  1Q7Y W;  4MV9 A;  2G38 A;  3J80 N;  1F23 A;  1MG1 A;  2V4D A;  4O7Z A;  2DPJ A;  2Y69 B;  2F4V H;  4LF9 H;  5IWA O;  2RDI A;  2NN4 A;  4RQE A;  2YRX A;  1QNM A;  3W5O A;  4JZG A;  5L3C A;  3KAJ A;  5D8D A;  4WFE A;  1V4Y A;  4FLW A;  2YIC A;  3EPG A;  1G4Y B;  4MV3 A;  3ASO B;  4ED3 A;  4LF4 O;  3K5O A;  2W0X A;  3CS5 A;  3TGU H;  4JTA B;  1VQ4 V;  1KB9 F;  3RTX A;  2YU9 A;  4MV6 A;  3DSQ A;  2UVV A;  1WSC A;  4O3P A;  2RDC A;  1K5Q A;  4OPH A;  5KMG B;  4PDR A;  3OTF A;  4J7J A;  3ZN0 A;  2UUB O;  4MA5 A;  1C3O A;  1WR2 A;  4XX0 B;  1JLL B;  4HYK A;  3T1H H;  2XAS A;  1OBD A;  2F4V B;  1S0V A;  4B3R H;  3JAT A;  3L74 H;  1CKO A;  2EIN C;  2WPD G;  5KG7 A;  2DOS A;  5DQI A;  3WFV A;  1OCO C;  1S5H C;  4GZR B;  1B3Q A;  4IIJ F;  5KG5 A;  4MT8 A;  3DTU B;  3ETJ A;  1CE8 A;  2QWN B;  3LDC A;  4DL3 A;  2F93 B;  2JK5 C;  5H9C A;  2R92 G;  2BR0 A;  1MZB A;  2UXD H;  1GTO A;  2UXN A;  3B8M A;  3ICX A;  5FD5 A;  5LOV F;  2JJ1 G;  1XK5 A;  2HGW A;  1Q6H A;  4LFA B;  2OH2 A;  5LBQ A;  2LFR A;  3UFX B;  2YZN A;  5I5S A;  1Z2O X;  2JEG A;  4RB1 A;  2CDY A;  2FB5 A;  1QLE C;  4B3M O;  2VS0 A;  5C5J A;  1N34 B;  4NYK A;  4O4H A;  2W7O A;  5JVL A;  2JGD B;  3V4S A;  3P3P A;  3VQW A;  2VA3 A;  4NTW A;  5IY5 C;  2LQT A;  1RJQ A;  2QA4 V;  4Q44 A;  2HG8 A;  1EKP A;  4A3M G;  3ABM C;  3CRA A;  2MK3 A;  4HAM A;  2HHH O;  3SPJ A;  1K83 A;  4LF9 O;  2JA5 A;  3M4I A;  3MFH A;  3BQ0 A;  2K9P A;  1K5S A;  5KT7 A;  1VEW A;  2CZG A;  5FPO A;  3CMA V;  2E5L H;  5LYJ B;  3OE7 G;  5KAI Z;  1XNQ O;  1I7L A;  4NXM H;  1FVI A;  3HB9 A;  3OT7 A;  2DE0 X;  3ABM B;  4TOI A;  4UVA A;  2NU8 B;  3G6V A;  1MZE A;  4ED0 A;  5L1L A;  3K5M A;  1NR7 A;  2F1M A;  5FD6 A;  2AZ2 A;  2R7M A;  1SQP H;  4ZKI A;  3UZO A;  5KA5 A;  2ZJT A;  3M9M B;  2OCC C;  4FLT A;  2UXB H;  2ODT X;  1JA8 A;  3H1K H;  1M5I A;  4J80 A;  2JA7 A;  4XDJ A;  3OUS A;  3ABL C;  4A3L G;  1I5X A;  4ZOL A;  2Q9L A;  5L3E A;  3RYC A;  1S9F A;  3BHP A;  5I5T A;  2L6L A;  3HOX G;  3WB1 A;  2E76 B;  1BQ0 A;  2FTK A;  2E5L B;  5E25 A;  1NTK H;  5FJ8 G;  4CKB A;  2XCL A;  3U10 A;  3F5T A;  4J9R A;  4K8Z A;  4PHZ A;  5I5X A;  5KG2 A;  5LMN O;  4C5A A;  2QKC A;  3CC4 V;  2E3C A;  1U96 A;  1I1K A;  4MVQ A;  1TWG A;  1Y14 B;  4QW9 A;  4QJF A;  3T1Y O;  3QO7 A;  1Y74 A;  4BWS C;  5IT9 N;  2PZS A;  2LW1 A;  1R3K C;  4O4L F;  1NVP B;  3JCZ A;  5DM6 V;  3B4S A;  1YIJ V;  4JI2 O;  2ZE8 A;  4G28 B;  5CB4 A;  5F9L A;  4MV7 A;  4GX0 A;  2ZE7 A;  2C2E A;  1ARO P;  3E2E A;  2WLM A;  3OR6 C;  4B3S B;  2ZDH A;  1RJP A;  1M0W A;  2KSD A;  2HEP A;  4DV1 B;  1HR0 B;  4BIO A;  4DV3 H;  4TV9 B;  1SZT A;  3GQC A;  4O4L A;  1GO3 F;  1SKV A;  4MW8 A;  1GMG A;  2DN9 A;  2W0F C;  5JQW A;  4DV1 O;  4RNO A;  1K7D A;  4O4H B;  4NYE A;  2P4K A;  3ABU A;  3RGZ A;  2X6C A;  1NZ6 A;  2CFM A;  2W9A A;  4A3E G;  3R5X A;  5KFD A;  1NQT A;  5KFF A;  1A0G A;  4ZHQ F;  1YXB A;  1FXK B;  2H3O A;  3GIQ A;  1GM7 A;  3UO3 A;  1YHQ V;  1X59 A;  4DR1 O;  4YHH H;  3A2F A;  2QWR B;  4E4E A;  4FFR A;  4LF5 O;  1XOU A;  2X7R B;  3RF2 A;  4JI6 B;  4DW0 A;  1I2L A;  3P3N A;  3CD6 V;  2HDK A;  4YHH B;  2BQR A;  3H4B A;  4YP3 A;  2CNV A;  3TEK A;  4JTD B;  1R6K A;  4LF8 B;  1VQ6 V;  4I55 F;  4MVO A;  5AG2 A;  3HBL A;  4CBC A;  4YHH O;  3KXY T;  4DR1 H;  4P9O A;  2EX3 A;  4HBN A;  5GON A;  1K1Q A;  1TWC A;  2ATK C;  5JH7 A;  4PJ0 Z;  4IYI A;  3F7Y C;  3MR3 A;  1GN2 A;  3TIG A;  3VQX A;  1EZJ A;  2PTM A;  3GTP A;  4EQ5 A;  5LOV B;  2R6F A;  4LF6 O;  4G2K A;  1UC8 A;  2ZR2 A;  4RAI A;  3X2Q C;  4JAV A;  4F6R B;  3CB2 A;  3KHR A;  2R92 A;  4DV3 O;  4UCU A;  4JYA B;  4AQY O;  4FLX A;  2E2H A;  4ZHQ B;  3TCU A;  3JSN A;  4ED7 A;  1LNQ A;  1VS0 A;  4W4K A;  3ZHU A;  4CKC A;  3B09 A;  1YZB A;  5KKN B;  5KFS A;  5IJ0 A;  2Q0O C;  4LSX A;  4ABM A;  3K57 A;  3JYC A;  3OAA G;  4HYO A;  5BWU A;  3GB8 B;  3OGI B;  1WA8 B;  1MOF A;  5LOV A;  3SJC C;  5LXT A;  3CCM V;  5BPF A;  2Y4U A;  4HNT A;  1XNR H;  4CH5 A;  2YEV B;  1IBM B;  2NVY A;  1OHH G;  1J5E O;  3QQM A;  2YIB A;  3OTO H;  5LMN H;  4NZN A;  5CBH A;  3GTQ A;  1PKX A;  4DR5 B;  5DAA A;  1RK5 A;  4EB6 B;  4JI0 B;  4QW8 A;  5CA0 A;  3N43 B;  3BA9 A;  4PZ6 A;  4FBT A;  1M7J A;  4Q8E A;  4BWA A;  2HJD A;  3KKY A;  4K8X A;  5H80 A;  4C5B A;  2NU7 B;  4NVP A;  3AX6 A;  5D1P A;  2JEI A;  2NLJ C;  2UXB O;  2Q73 A;  1HW7 A;  2CUG A;  5I60 A;  5GTH Z;  1XIL A;  3RFC A;  2WE6 A;  2GUZ B;  4LH7 A;  2DAB A;  2QEX V;  2EUL A;  4GKJ H;  4FPP A;  1L0N H;  3Q4H B;  2DQ0 A;  3E5N A;  4ECS A;  5L3G A;  3WWI A;  2A9H A;  5FL7 G;  4O4J B;  4F50 A;  3Q2O A;  3DC6 A;  1YDX A;  1XNQ H;  3J81 N;  4YJ2 B;  1VQN V;  4X62 B;  2VQE O;  1S68 A;  1W0K G;  2E5L O;  4TV9 A;  4RZQ A;  3F7V C;  4Q4C A;  1QLN A;  4X1Y B;  4DUY H;  2H8P C;  1OCZ B;  3TY8 A;  4FFO A;  3ETD A;  4DW1 A;  2E75 B;  3H1H H;  1L2Z A;  2ZNJ A; 
#chains in the Genus database with same CATH homology
 4X65 B;  4DR3 H;  5CA1 A;  2YXL A;  1XMQ B;  4K0K B;  4DR4 B;  3K5N A;  1I94 H;  3JAR A;  5JVD A;  4X66 H;  4DK1 A;  3HKE B;  5BR8 H;  1IBK B;  4DV0 B;  4I7H A;  1CKN A;  2BTO A;  4LF8 H;  2HGS A;  1H2S B;  2JVD A;  4FM0 A;  5J2T B;  1I94 B;  4DR4 H;  4KHP H;  3N2K B;  4FLY A;  5KMG A;  3JAW A;  3KAK A;  4LFB B;  1Z5V A;  5IYZ A;  4AQY H;  5KHK A;  4LR3 A;  5IJ0 B;  3ETQ A;  5LA6 A;  3FMA A;  4DV6 B;  2VUG A;  4DRX A;  1P8L A;  2ZM6 H;  1O75 A;  3B2E E;  4DRX B;  2PYL A;  3NBY B;  2RJZ A;  4ZOL B;  4JI7 B;  1I7F A;  1TA8 A;  1QHT A;  4O4I A;  2ZNI A;  4FLV A;  1HNW B;  2HHH H;  2UUA H;  4B3M B;  3W1G A;  2PUS A;  4DV7 B;  3HKB A;  4FFB B;  5LXT B;  3VNN A;  1FJG H;  4RAZ A;  4X64 H;  5KHI A;  1A0I A;  4B3T B;  3LNN A;  4AHC A;  4B3M H;  2HIX A;  5LL6 b;  4DR2 H;  5KHH A;  2Q7G A;  2UXB B;  3QF7 A;  4TUY B;  4X20 A;  5EZY A;  1GYF A;  2KKW A;  4ZHQ A;  3K58 A;  5LMU B;  4TQF A;  1N33 H;  3NC0 B;  2UUB B;  4DR2 B;  4BW9 A;  4B3R B;  3RYI B;  2XHB A;  2RGV A;  4DV4 B;  4FLU A;  3KYH C;  4JI6 H;  4CH4 A;  4X1Y A;  3NBZ B;  2HVS A;  4JI7 H;  1O9H A;  4GKJ B;  5LP6 B;  2QJ1 A;  3ZS8 C;  3N2G B;  3HXL A;  2PY5 A;  1XHX A;  4X1I B;  5A2Q W;  2WDT A;  4I4T A;  2R9A A;  3JAS B;  2JGU A;  1N32 H;  5FNV B;  5KHG A;  2VQE B;  5JCO A;  4FLZ A;  3CSX A;  4X1K A;  2VQF H;  3S24 A;  1CKM A;  1T5E A;  4I9Q A;  2HIV A;  3GDE A;  5DIS C;  2UUB H;  2W57 A;  1Z2P X;  2UU9 B;  1HNX H;  3ZED A;  4FM1 A;  1FFX A;  5FPR A;  2Q2U A;  4CC5 A;  2VOB A;  1FFX B;  4O2A B;  4LMY A;  4X65 H;  1G6U A;  4AQY B;  2CW7 A;  2GV9 A;  3N2G A;  4D7S A;  4JI4 H;  4ZIB A;  4NXM B;  4DR7 B;  1TVK A;  4JI2 H;  2YI9 A;  3JAL B;  2VWJ A;  4FVM A;  5D1O B;  3N44 B;  4U3J B;  5FLX W;  4O4J A;  4DRF A;  4JV5 B;  2XIG A;  4A2B A;  5CB4 B;  4ZI7 B;  4A2A A;  5JJJ B;  1SQG A;  4ETS A;  3N6X A;  4PI2 A;  4JI4 B;  4PZ7 A;  4TUY A;  2VQF B;  2HHH B;  4GLX A;  4JI2 B;  4RB2 C;  4LF9 B;  4DV7 H;  4NXN H;  1J5E B;  3QG5 A;  3L4K A;  4UCR A;  1ZHS A;  4O4L B;  4MV9 A;  4X62 H;  2V4D A;  4LFC H;  4GKK B;  2FE3 A;  2F4V H;  4LF9 H;  5EOY A;  1XHZ A;  3N42 B;  1BGW A;  3W5O A;  3J7A K;  4O4I B;  3KAJ A;  4DUY B;  5K1P A;  2JS5 A;  4DR7 H;  4FLW A;  4IHJ A;  4LF7 B;  4CH3 A;  3UT5 A;  4IHJ B;  3K5O A;  3RYC B;  1TUB A;  4UCO A;  4RB3 C;  4DUZ B;  4JI5 B;  3RTX A;  5BR8 B;  4FM9 A;  4F6R A;  5C8Y B;  3DSQ A;  3QTC A;  3RYF B;  3L2P A;  1Q43 A;  3JAW B;  2UXD B;  5KMG B;  2CAZ C;  3OTF A;  3N2K A;  1Q3E A;  4DV5 H;  2YCH A;  5J2T A;  1XMO B;  4TQD A;  3T1H H;  1TAE A;  4LFA H;  3JAM W;  1Q8I A;  2F4V B;  4YJ3 B;  4B3R H;  5JH7 B;  2ZCE A;  3JAT A;  3VQV A;  1CKO A;  2UUC B;  4JI8 B;  2O03 A;  4DV2 B;  5JVD B;  2OYQ A;  4JI3 B;  4DV6 H;  3SR2 C;  3JSL A;  1HR0 H;  4PI0 A;  4JYA H;  4CS4 A;  1SA0 B;  1P49 A;  4MTE A;  2BTQ A;  5D1O A;  3CVZ A;  1XI1 A;  4DV2 H;  1N32 B;  3GJX B;  3OTO B;  3KAL A;  1N36 H;  4O2B A;  4Q0Y A;  2F93 B;  3HKC B;  4JI1 H;  1MZB A;  2UXD H;  3ICX A;  1QQC A;  4DV4 H;  1KMI Z;  4DV5 B;  1VF7 A;  5FD5 A;  1O9G A;  1XK5 A;  4RB0 A;  4B3T H;  4LFA B;  1S03 G;  2OWO A;  1ZHQ A;  3HKD B;  4I50 B;  4K0K H;  2PYJ A;  1HNX B;  1Z2O X;  5ITZ A;  2Q0A A;  4RB1 A;  3RR5 A;  3SJB C;  2P22 C;  5J2U A;  4EFE A;  4DR6 B;  5EYP A;  4I50 A;  3BAA A;  1N34 B;  4O4H A;  3WB2 A;  2HVQ A;  4MTD A;  4E6N A;  3VQW A;  1XDN A;  4GKK H;  3BAB A;  5JCO C;  4DR6 H;  3RYH A;  3E22 B;  3HKC A;  1N36 B;  4X1I A;  4O2B B;  3MWM A;  1B04 A;  3M4I A;  3J81 W;  4UCT A;  4LSA A;  4TV8 A;  5FPO A;  2E5L H;  5LYJ B;  2VQE H;  4R7R A;  1WPB A;  4X20 B;  3DF7 A;  4NXM H;  5K1X A;  1FVI A;  2UUA B;  4M7E A;  1HNW H;  4TOI A;  4LFB H;  3JAT B;  4LNU B;  3K5M A;  2F1M A;  3W1B A;  4IIJ B;  5IJ9 A;  5FD6 A;  1XNQ B;  4RAY A;  4OX9 H;  4DR1 B;  3T1H B;  4X66 B;  1WH2 A;  3IG0 A;  2ZJT A;  5LP6 A;  4LF4 H;  1SQF A;  4FLT A;  2UXB H;  4J0M A;  2PGG A;  1M5I A;  1YEW A;  2BTQ B;  4L8J A;  4JI5 H;  4ZOL A;  3RYC A;  3BHP A;  4LFC B;  3WB1 A;  1SEI A;  1Z2N X;  2Q2T A;  2E5L B;  5JQG A;  1Q5O A;  5IWA H;  1IBL H;  3SGI A;  4CC6 A;  3U10 A;  4UCV A;  1XMQ H;  2F95 B;  2IM9 A;  1NT2 B;  4YJ3 A;  2RQ6 A;  4PHZ A;  4K8Z A;  1IBK H;  1Z5W A;  1I6U A;  5IYZ B;  1IBM H;  4DV3 B;  2E3C A;  1BJT A;  1J5E H;  3CHX A;  2YIB D;  3JAK B;  5BMV B;  3JAK A;  1JMK C;  5LMN B;  4IIJ A;  5IJ9 B;  5KX5 B;  4JI3 H;  4BWS C;  2VPS A;  2PZS A;  4LNU A;  3UQ8 A;  2WYO A;  3K3V A;  5GON B;  3FFQ A;  2QM4 A;  1TUB B;  2RGR A;  3JAR B;  3UT5 B;  5JQG B;  1N34 H;  3T1Y B;  5JJE B;  4D7T A;  5CB4 A;  1XNR B;  3BPZ A;  4MV7 A;  2UU9 H;  4B3S B;  5JJN B;  2ZIM A;  1M4U A;  1M0W A;  2HEP A;  4DV1 B;  4I55 B;  2F66 C;  1HR0 B;  1XQ8 A;  4HNA A;  4UFZ A;  4DR5 H;  4DV3 H;  4TV9 B;  3U11 A;  4O4L A;  4AIL C;  4GYC B;  4EEQ A;  1D5A A;  1SKV A;  4X64 B;  3F8N A;  1ZAU A;  4O4H B;  4Q6G A;  3RGZ A;  2Q7E A;  2HVR A;  2CFM A;  3IAY A;  3K5L A;  2UXC H;  5CA1 B;  4ZI7 A;  4PZ8 A;  2CW8 A;  3M7M X;  4NXN B;  5D5P A;  4U3J A;  2KSW A;  2ZIN A;  3THO A;  3JAL A;  1N33 B;  4YY3 B;  1TVK B;  3A2F A;  3N40 P;  4YHH H;  4JI0 H;  3RF2 A;  4JI6 B;  4LF4 B;  3RYH B;  3E22 A;  4JV5 H;  4HNA B;  4LF5 B;  3VQY A;  1S5J A;  5IT9 W;  4YHH B;  4WBN B;  4YJ2 A;  4YY3 H;  2R70 A;  5EIB D;  1E4G T;  3RFR A;  3TY9 A;  4DV0 H;  3RYI A;  1M93 A;  4EB6 A;  5EYP B;  1JFF B;  4LF8 B;  5J2U B;  4LF5 H;  3PN1 A;  5EZY B;  3RWR D;  5ITZ B;  1E4F T;  3KXY T;  4DR1 H;  3RIZ A;  1HNZ H;  2EX3 A;  2UXC B;  4HBN A;  5GON A;  1X9N A;  5JH7 A;  2ZIO A;  3RGX A;  5FNV A;  4PDB A;  3JAS A;  3VQX A;  2PTM A;  3U0Z A;  4I4T B;  4EQ5 A;  1XMO H;  5LOV B;  3QWU A;  1TGO A;  3J80 W;  4I55 A;  2Q7H A;  3HKB B;  4FFB A;  3RYF A;  5C8Y A;  4F6R B;  3CB2 A;  2UUC H;  4JI8 H;  2YIA A;  4UCU A;  5CA0 B;  4KHP B;  4LF6 B;  4JYA B;  1FKA H;  4FLX A;  4ZHQ B;  3JSN A;  1V9P A;  2P5O A;  1VS0 A;  4B3S H;  5D5Q A;  3TY5 A;  4DR3 B;  5EIB C;  5LA6 B;  3H20 A;  5IJ0 A;  3EYY A;  4EFB A;  3K57 A;  4LSX A;  1DGS A;  4KL1 A;  1AN7 A;  5KX5 A;  4LF7 H;  3GB8 B;  5BMV A;  1RSO A;  5LOV A;  3SJC C;  5LXT A;  4CS3 A;  4B08 A;  1XNR H;  3BA8 A;  4CH5 A;  1IBM B;  1CKN B;  1FJG B;  1WNS A;  1JJO A;  4CS2 A;  2YIB A;  3OTO H;  5LMN H;  1KU9 A;  4UCS A;  4FM2 A;  4DV1 H;  2ZM6 B;  5LP6 C;  4DR5 B;  1JFF A;  5LYJ A;  4EB6 B;  4JI0 B;  2MCT A;  5CA0 A;  3N43 B;  3BA9 A;  5IWA B;  3RGB A;  1IBL B;  4PZ6 A;  2VWK A;  4BWA A;  4DUZ H;  3SJA C;  4K8X A;  3RJ0 A;  5LMU H;  4O2A A;  4NVP A;  1X4T A;  5D1P A;  1HW7 A;  2WE6 A;  4LH7 A;  4GKJ H;  4DK0 A;  4APM A;  3LML A;  3BRC A;  3HKE A;  1HNZ B;  4JI1 B;  1M0T A;  2R72 A;  4IAJ A;  3N41 B;  4X1K B;  4O4J B;  3WB0 A;  3HKD A;  3K59 A;  3L4J A;  3T1Y H;  4TV8 B;  3C0F B;  4CH6 A;  4OX9 B;  1XNQ H;  4YJ2 B;  4WBN A;  4X62 B;  1S68 A;  1SYX B;  4TV9 A;  1P16 A;  1WN7 A;  4RZQ A;  1L8D A;  2YI8 A;  4LH6 A;  3MAQ A;  5KHJ A;  4X1Y B;  4DUY H;  3TY8 A;  4LF6 H;  1L2Z A;  1SA0 A;  2ZNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...