4LH7A

Crystal structure of a liga inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
321
structure length
321
Chain Sequence
EQQPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Identification through structure-based methods of a bacterial NAD(+)-dependent DNA ligase inhibitor that avoids known resistance mutations.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase/ligase inhibitor
total genus 111
structure length 321
sequence length 321
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4lh7A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4lh7A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lh7A02
5D1OA 4UCRA 1DGSA 2UU9B 1HNWB 1IBKB 4DUZB 4LF5B 1TAEA 4LH6A 4DV4B 2Q2UA 2VQFB 1N36B 1VS0A 2VQEB 4PZ7A 2UXCB 3BA8A 4UCSA 3NBYB 1XMQB 1I94B 3GDEA 2HVQA 5DISC 4EQ5A 4B3SB 1B04A 4UCUA 3T1YB 3RTXA 1TA8A 1CKMA 4PZ8A 3RR5A 5IWAB 2UUAB 4UCOA 4LF7B 4LFAB 1HNZB 2HVRA 3GB8B 1CKNA 1P8LA 3L2PA 3KYHC 4DV7B 3BA9A 2HIVA 3GJXB 4DV0B 2UXDB 3NBZB 1V9PA 4LF8B 1XNRB 1N34B 2F4VB 4DV1B 2UUBB 4LFBB 1P16A 3NC0B 4B3TB 4X65B 3UQ8A 3W1GA 4E6NA 4JI5B 3JSLA 4TOIA 5LMUB 4DR1B 4EEQA 2E5LB 5FPOA 4K0KB 4KHPB 4DR5B 2HVSA 4DV5B 4DRFA 4UFZA 4X62B 4DR7B 4DUYB 2UUCB 4OX9B 4UCVA 1N32B 4LH7A 3SGIA 4DV6B 1HNXB 4DR3B 4DR4B 4DR6B 4JYAB 3W5OA 4LF6B 4JI0B 4LFCB 2HIXA 3OTOB 1FVIA 1S68A 5D1OB 1X9NA 2ZM6B 4UCTA 4DR2B 3TY9A 4PZ6A 1XNQB 4JI3B 4LF9B 3W1BA 4JI7B 3TY5A 2OWOA 1XK5A 4NXMB 4GKJB 1XDNA 5BR8B 1A0IA 4JI1B 1N33B 4X64B 4GLXA 4EFBA 4B3MB 4EFEA 5D1PA 4DV3B 4JV5B 1IBMB 1CKOA 4LF4B 4CC6A 4NXNB 3QWUA 2CFMA 1IBLB 4X66B 2HHHB 4DV2B 4YHHB 1HR0B 4JI2B 4JI8B 3BAAA 1J5EB 4GKKB 1ZAUA 1FJGB 2VUGA 3JSNA 5FPRA 1CKNB 4B3RB 2UXBB 3S24A 4AQYB 4CC5A 4JI4B 5LMNB 3PN1A 4YY3B 2Q2TA 1XMOB 3TY8A 3VNNA 3BABA 3T1HB 4JI6B
chains in the Genus database with same CATH superfamily
4J10A 5LYJB 4HNTA 4UCRA 3TW7A 3ZBHA 1Y1WA 2JA8G 1BHBA 3RFRA 2EX3A 4ZOLA 5B3SB 1OCRC 4YIPA 5LHIA 3W7SA 5KT5A 4A3KG 2Q67A 3V6HA 3K06A 4DV3O 5F9LA 2UXCB 2C2DA 3BA8A 4X20A 5BPFA 5D8DA 4TV9B 4UB8Z 5EYPB 1GMGA 2FMLA 5IYCO 1SS3A 3EPGA 3KG2A 3UKMA 1XMOO 4RZRA 1EZ1A 4IRKA 1WR2A 3FB7C 3ZHUA 2FB9A 2ILMA 3VQYA 3Q8PB 5LA6A 4DV7B 4LSAA 2Q8VA 1GM8A 2Q7EA 1TWAA 2EIYA 1HDJA 2XCAA 3OSPA 3N42B 2YI9A 4B3TH 2YXYA 3O9OA 3Q4HB 2YS7A 1DF5A 3CJHA 2AGPA 4DXWA 5JVDA 1V51A 1M57C 2FKLA 2DWEC 3UT5B 4RUEA 5IJ0B 1TUBB 2EJ0A 2UUCH 2R93A 3KHGA 2UVWA 4A3EG 5BYBA 5KFUA 2ATKC 3ZRWB 5JCOC 1W0KG 5JJNB 4OX9B 3HKEB 4YAKB 5C1PA 1N32B 4JYAH 1XHZA 3SGIA 2X5RA 1RJRA 2FK2A 2QGNA 4DR6B 1BSMA 5C44G 1FD9A 4O86A 5D1OB 3TY9A 3GV5B 4BIOA 4IGGA 1BMFG 3ORRA 4HNVA 5BMVB 3IGAC 3QNEA 3GTQA 4DV1O 2ZJTA 3CSXA 1RSOA 4X65O 4CS3A 1T5EA 2VPSA 2LGQA 2E2HA 2JEJA 3CCQV 4U7OA 2C2RA 4NTXA 1V54B 2QJ1A 1NI8A 2FB5A 4ZI7B 4EFEA 3N43B 5KUKA 1FKAO 4ETSA 4CC6A 1J5EH 1IDSA 1AJNA 3R65A 5DECA 1S3JA 4AQYH 2RMKB 2Q7GA 5DG8A 2YUAA 2Z0AA 2AGAA 2VUGA 4HYKA 4O4JA 2RNBA 5BWVA 3T1HH 2KKWA 2Q7HA 4JI4O 4QPJA 1UJWB 1JDBB 1FXVA 1H2MA 3I55V 4LF5H 3OT7A 1VMGA 3AG7A 3ML0A 1XUQA 4X89A 4MTFA 3CRQA 4PBCA 2LW7A 2P22C 3RF2A 4YR2A 5CB4F 4JTAB 4ECZA 3ABKB 4DUZB 3MR6A 1ROPA 1RPOA 2DJVA 5KFQA 4B3SH 4PWQA 2DN9A 3DF7A 4R6ZA 4CH4A 4DO2A 5DG7A 3DC6A 3GDEA 1QU7A 4O7TA 2ZDIC 4KHPH 4LWSB 1SZTA 3BQ0A 4EBDA 3SYAA 2ODTX 1JCHA 1YXBA 4E4TA 1DV1A 4I7ZB 3T4DA 4ME6A 3ZCCA 4TQRA 5EWFA 4MTDA 4JGSA 2ZE5A 1B6QA 1KKDA 1Y74A 3G8DA 4FZ1A 4PA4A 3VA7A 1M56B 3FMAA 1YZBA 3CWBH 1I1LA 4ABMA 2VPQA 2OCCB 2XNDG 4LF8H 1AI6A 1N4CA 4TWKA 4DV4O 1H2SB 4O7LA 2QKSA 3OGIB 3UM7A 2XIGA 4IRCA 3A8TA 2Q5ZA 5JH7F 3LSQA 3CS5A 2W70A 1BQZA 3T1YO 4MVSA 3H1LH 5BZBA 5LHGA 4KHPB 2NU6B 4PI2A 1WRVA 3OFNG 3N2KB 5CB4A 1T3NA 4N23A 4K6NA 1S0NA 4UXNA 1BZKA 1NQTA 4O4HF 2P90A 3KAKA 4J9LA 1BQ0A 3WU2Z 2OIGA 1NBMG 1F7YA 1S0MA 1HNXO 1MZEA 2Q6AA 4JI7H 2R7NA 4IHJF 3CRCA 4DV0O 1BHAA 4LSXA 4JI1H 4ZOLB 4X64H 4JI3O 4A3FG 4Y8VB 1XDNA 2QKAA 2YRWA 1PKXA 1PNKA 4BWAA 2F95B 1S76D 4GLXA 4X20B 2XC9A 1WB8A 1KU9A 4ED2A 4IT5A 5HFLA 4JV5B 2W9BB 1Q7YW 2ZR2A 5IDJA 4JI8H 1FXKA 5E1AC 1Y66A 1FJGH 1AVMA 4JV0A 2JEGA 4DV2B 1YTFB 2I80A 5JH7A 3GIDA 4U3JA 4PELA 1PL0A 2HJFC 3J80N 2R8JA 2R8HA 4IZOA 4LF9O 4UB6Z 5LMNO 5EC1C 1AR1B 1VAJA 3R5HA 3L70H 4YY3O 2KSDA 2R8KA 2Y4TA 1K7DA 5KX5F 1D5NA 2PYLA 2W6PA 4IYHA 3FYEB 5JVDB 3P3PA 4YJ3F 3AK3A 2JJ2G 3CRRA 5KHIA 1ZHQA 4IHJA 2LO1A 3EXAA 3RV3A 2OCCC 3ZHSA 5LOVA 2IH3C 4GLWA 2H3OA 3OSNA 3QZ8A 2CE4A 2CNVA 4GKKO 4AI8A 1TA8A 1M5IA 2UUAB 4JAVA 4KP4A 2Y4RA 2CW7A 3D3QA 4UCOA 5CA1F 3ABLC 3K5MA 1RJPA 2VOBA 4NR1A 5CBGA 1EKVA 3P32A 4O2AF 5I5YA 2WLLA 1PK8A 4HZ3A 4QIWE 3RGZA 1RSOB 5D5QA 1N34H 4QGPA 2PF4E 3AG1B 1EZVH 4NKGB 4UVAA 3C90A 2HVJC 3LDCA 2YRXA 5FL7G 3BACA 3Q8QB 3J7AK 2RGRA 3JAMW 5IJ9A 2VA3A 1GSAA 1MNGA 2WE6A 2SCUB 4MW3A 5JWPA 1WNSA 3ASNB 5LBQA 2FLPA 4J80A 4YJ3A 1BGWA 4O4JB 1JQ0A 2FE3A 4MVQA 4EBCA 4NZOA 2WLIA 1I7LA 4NZNA 3IJ4A 2AHZA 3SJAC 5IYCG 2V4DA 2GSMB 4JI0B 4F4WA 5DG9A 5BR8H 1I2LA 2Z5UA 2DLNA 2PGGA 2AGQA 4U7NA 1Q5OA 2ATLA 4B3TO 5CA1A 3EHBB 4XZ3B 1L2ZA 4GX0A 2W6OA 3GTGA 3G8CA 3T1CA 1CP9A 4OXSA 4HNUA 2XAJA 4O2AA 1K1QA 3OUUA 3J81N 3W7UA 3MAQA 3FKIA 1DIKA 1KT8A 4O4IF 3UYYA 4TUYF 1US6A 4LF4B 3SE7A 1YI2V 1C3OA 4O7ZA 2UUCO 3ZMTA 2JA7G 2DOSA 4B3RH 3T9FA 4U3FH 3ETGA 3OMAB 1Q86W 1A0GA 4JYAO 1Y74B 1I7NA 3RYFA 1JPXA 1IYDA 4QWDA 2CK3G 1D5AA 2ALZA 1JX4A 3PN1A 4UUGA 1PM9A 4F4YA 1XL6A 2LFSA 3APOA 3WNZA 4FGRA 1KYOF 4FJCC 1EZJA 3I5DA 1JDEA 2YDEA 4R8UA 2UU9B 3GV7B 2GBOA 2LGWA 3HOZG 1N36H 1DGSA 3W7XA 1WLEA 2R7ZA 1FAFA 2XGQA 2V59A 5DN6G 1VQ4V 5DQIA 2F4VH 2QWQB 4HN2A 4ECXA 4F4LA 4CKCA 1XMQB 2P4KA 5CB4B 2VUMA 5H6QA 2W7PA 4MA0A 1J5EO 3HOWG 1M93A 3CCJV 4YR3A 2O57A 3K5OA 3U54A 1HNZH 3SPGA 4AQYO 2JEIA 5KAFZ 4FFPA 4LFAB 4O4IA 3ASNC 1SZXA 1LR1A 2R6FA 2HDKA 1JJOA 1SC5B 4LF5O 1SERA 2EILB 4TV9F 3CC2V 1JIHA 2UXDB 2Y0IA 2A0LA 3AG3B 4OPAA 3B4SA 4JI5H 3VQVA 1K1SA 2FPPB 2F4VB 4L87A 1GK9A 3W1GA 4EQ5A 4B3SO 2DIKA 5KFLA 3UQ8A 2ARHA 1NVPD 1FXKB 2EJRA 2W6MA 2HGXA 2Q0OC 2N04A 4BIUA 4O3NA 1RJQA 5JH7B 2B9ZA 1TWHA 4KHPO 5EZYF 4DR7B 1I7FA 1G6UA 5KHKA 2DAAA 4C5CA 2AHYA 3T5LA 4DR3B 2BTOA 1OCCB 4J9RA 1S68A 3PO2G 1OHHG 1CQIB 3JRWA 4RNOA 4LF8O 1JXLA 2V4RA 1GKFA 4J41A 3AYHB 3CB2A 4IHJB 3T9AA 3F7YC 4QE9A 4PDVA 4NB5A 1UFIA 2BTQB 3LSUA 4BAYA 5LOVB 4PD4F 4B3MB 4PI0A 4EYHB 4X66H 4DL3A 2ABJA 1NU1H 1WCMG 4PA9A 4MTOA 2ZKOA 4TV9A 2QKCA 2PI5A 4JV5O 5B1BC 2PMZA 2OYQA 5KFRA 2UXBH 4W4LA 2Y0PA 4QW9A 4JI4H 4LR3A 1HR0B 4O3PA 3WB2A 1EYZA 3BG5A 4GX2A 4MVOA 2WLLB 1S5HC 1CXZB 3G67A 4ASUG 3UFXB 4MA5A 2FK1A 3RBEA 4J9MA 5L3CA 5EZYA 4JI1O 4A3CG 3Q4HA 3RYHA 4X64O 2VQFH 5A9GA 4MV7A 1NS1A 5IJ9B 3GIIA 1Y6XA 4HBNA 3FX7A 1SQGA 2QWRB 4C2MA 2VQEB 4FZ0A 3SJBC 4Z1VA 2WLHA 4X1KA 1I94B 3CMEV 2EILC 5J2UF 4YJ3B 3AG3C 4JI8O 3SNOA 3TETA 3H1IH 2W8KA 4JUZA 1R73A 1FJGO 3ZRWA 4FS2A 2BQRA 2CGNA 2Z02A 2FKXA 3FB8C 2QE7G 3OM3B 5DLGA 1KUQA 1FXKC 1MG1A 2J6TA 1P7GA 2RN9A 5DGAA 5KFFA 4RUFA 4A3DG 5GTHZ 4WBNF 2K9PA 4JYYA 2ZNIA 1G1XB 3KYHC 2NU9B 5DLFA 2G38A 2Y69B 3JASA 4GYCB 2B1IA 2IJJA 3NXSA 1P4RA 3B77A 3STZC 5CA1B 1GM9A 4ED3A 2COJA 2DQ0A 2QR4A 1KC7A 1B3QA 2EIMB 3CC4V 4DL6A 1DTOA 4O2AB 2ZDQA 3RFCA 2E5LH 1OCCC 1AROP 5KFTA 4I9QA 1IX9A 2CGOA 2CZGA 4DR5H 2B5UA 1F51A 4AHCA 1QR9A 2DYSB 3T4ZA 4ECQA 3ASOB 3PR5B 2V5AA 1KB9F 4XX0B 2QWPB 3ZN1A 1HNXH 3JD2A 3RYFB 2Y0SA 4R7RA 1NTKH 2LFRA 4DUYB 3WG7B 2JA6G 4DV6B 1THZA 4JI3H 2ZE8A 5J2UA 1AP5A 4BY7G 4R8UB 4ED1A 1DLBA 3VOTA 4LFCB 1EHIA 4AYBA 3RBZA 1COWG 5FLXW 3G6VA 1N34O 1AUXA 4GKJB 4JXUA 3CE2A 4DW1A 1KP3A 3MR5A 1EUDB 4WBNA 5KFCA 2D2CB 4EB6A 4JASA 5KA5A 1B6RA 5LGUA 4J7KA 4BBSG 4N21A 2QWNB 3RB0A 4LWSA 3HT5A 1IURA 1K83A 2Q68A 1EN6A 2C35B 4ZOLF 5KHHA 2DABA 4RU9A 1M0TA 3PW7A 2KG7A 4O4IB 4YB8B 4YY3H 1M57B 2FPGB 1S72V 3K58A 3STLC 3E86A 3JATB 1EUCB 3WFVA 3E2EA 1Z2NX 1EKFA 5BYAA 4GUNA 3Q8SB 1RP3B 5BR8O 2FLLA 4QNHB 4FM9A 1WAZA 2Q4PA 2UXCH 1IVSA 5BY1A 2L35A 2D3OW 2ZINA 1S5LZ 4PDBA 2Y69C 4FFKA 2YYAA 2HVQA 2EIMC 2J6SA 3TXQA 5IYZF 2A1HA 4B3RO 1HW7A 3LULA 1RK6A 4O7SA 3GTKA 1ZX3A 1ULZA 2DYSC 4DV7H 4P2ZA 2WAQA 1VQOV 4LC1A 2ADPA 3ASOC 3JYCA 1GRJA 2W6JG 4GCZA 5C5JA 5EIBC 4RZQA 1PNLA 2RGVA 3W7TA 4FFNA 4O7YA 3WG7C 1XI1A 4QWAA 1I5XA 1AJPA 1N36O 2F1MA 4WF9V 2HVKC 5L3BA 1XNRB 4CBCA 4ICGA 3RW0A 2HG8A 1Q90D 4E6NA 2F4VO 3SPHA 4M9UA 2Q7DA 3PW2A 2W9BA 2R7MA 5LMUB 4DR1B 3K3WA 1VKZA 4FE2A 1GN3A 4H13B 2E76B 2PY5A 3K5IA 1S9FA 4OX9H 1N32H 2CTRA 2YIBA 1K92A 1MZBA 5J9PC 1KEEA 1MMMA 3JD3A 3G4SV 1HNZO 4DR6H 2VWKA 3N2GA 2EZPA 4LNUA 3CVZA 1Q8IA 2GLTA 2W6IG 4DIMA 4JTCB 5KFNA 3R9RA 5EZYB 3R66A 3QO7A 3RYHB 1X9NA 5IYZA 5A2QN 4NTWA 1MA1A 2A7WA 1AR4A 4K3AA 2H94A 3JAMN 3KXYT 2OWOA 2ZQMA 3GTOA 1QR8A 4O4JF 1SF9A 1W0JG 4Q20A 3ZHQA 4JI5O 4ECWA 1E79G 4DQNA 3BJYA 4X1KB 1ZETA 1JX9A 2FL4A 5C4XG 4TQFA 2C22A 2XGPA 4H0LB 5K1PA 4K35A 1E4FT 3FYIB 4B3MO 3MWMA 2XAGA 1CE8A 3K9SA 2GQRA 2F43G 2NVYA 4GX1A 4I50A 4JI2B 3UO2A 1FPOA 3G6BA 3BQ2A 3ABMB 3T9CA 2EIJB 2MK3A 5FPRA 5IYDG 2EJ7A 2ZDHA 3JASB 1Y67A 4D6TH 4BIZA 2PZSA 3LUTB 4DUZH 3ZHVA 3SPIA 3PVXA 4K8XA 1IOVA 4ECRA 4GC6A 4U7CA 3MWEA 3E8GA 5KHGA 2EINB 1AUVA 1PD3A 4PDLA 4FLYA 1Y1WG 4Q4DA 5KG2A 1KMIZ 3ETJA 4PZ7A 4MV4A 2OIEA 1YTFD 3G6EV 5DISC 4X66O 3SPCA 4FM2A 2W8LA 2YL2A 4FLUA 2W71A 3RGBA 5CAEB 4J9NA 1Z5VA 3D36A 2UXBO 5IWAB 5L1JA 3Q2OA 3FB6C 4J9KA 5J2UB 3FFQA 3UZBA 1U96A 2HG5C 3E8BA 3CSWA 3FAVB 4JPRA 2X7RB 2QA4V 4H33A 3L75H 2EIKB 3WWJA 1H38A 3HPLC 3NR7A 4FIPC 3VBBA 2OLSA 3WB1A 1UNNC 2WB1A 5KG3A 4XYLB 4PV1B 2VQFO 4WBNB 4MV6A 4JF3A 2DYRB 3H40A 3CCLV 3BEHA 4EB6B 1JLLB 4CH3A 2E2IA 2R9IA 2QF7A 3AEIA 3L4KA 3H20A 3JRXA 4EEQA 4FFMA 4WHXA 4O4LA 5KG4A 4FM0A 2KG7B 4O83A 4DRFA 2WWWA 4X62B 2R93G 4QPKA 2JDIG 2ZE7A 3HKBA 4ZHQA 2GHYA 1NTMH 1BT8A 2XCLA 5LHHA 4DR4B 1VQMV 4ECYA 3DSQA 3JARA 3HBLA 2DQ3A 3W5OA 5KS8A 1R3KC 2BE3A 1D2DA 1TWCA 2GDSA 1QCEA 1GM7A 1XNQB 2Q9LA 4J9ZB 1OBGA 5KUMA 3K0DA 3ABMC 4ZBMA 2EIJC 1K4DC 4O3QA 4JYCA 3L74H 3RN4A 3ABLB 3K08A 3HO8A 5H80A 1E1QG 4RWUA 4FFLA 3HOYG 2E5LO 1T36A 4JV5H 5BPHA 1TWFA 3TJTA 2LJ2A 4DK1A 4DR5O 3PZPA 3CPWU 4DV2H 5KFOA 2C2EA 4NXNB 2NU7B 2K1EA 3H01A 3VQWA 3E5NA 1VARA 1BJTA 2DW4A 3ZEDA 1SQQH 1L8DA 5CM0A 2EINC 2HHHB 4YAJB 4EGQA 5C1OA 1ZQ7A 3GIKA 2ZIOA 3ABTA 4XDKA 4FLXA 3GQCA 2VWJA 1T94A 1TWGA 4J9OA 4O7WA 4Z1MG 5LOVF 3RWRD 4MTXA 1GH6A 2QTOA 5H2FZ 5I5SA 4P9PA 5GTIZ 3JCUZ 1M4UA 4TSFG 1HNWB 3E89A 2VQDA 4UV9A 2EIKC 5KT4A 2XCPA 2WTFA 3JZIA 2DWCA 3GTPA 2PUSA 3ETDA 1NH2B 2P0AA 4HR7A 3T9BA 4Q0YA 1ZUQA 2UUAH 4TV8F 3L72H 4RNNA 2HHFA 1VEWA 3H1HH 2DYRC 4KL1A 4J9YB 3N2GB 4LNUB 2ZT9B 5K2MA 2UVUA 2R84A 4ZIBA 4MTEA 4WFEA 4AILC 3M9MB 5F2VO 2O03A 4MSWC 3CHXA 1ZWIC 5IYZB 5TISZ 2YW2A 5KG7A 3L2PA 2EJ2A 2ITCC 1Y1VA 2HJDA 3K5LA 4NLGA 3ZIAG 5KT6A 2WLKA 2XAQA 4ZKIA 4R7CA 2MW2B 4OGQB 2CKZB 1IXMA 4A2BA 2EULA 1YVWA 1GO3F 2ZE6A 2QWOB 5FD5A 2OH2A 3NBZB 2UXCO 2BTQA 4F50A 1EM1A 3HXLA 5BWRA 4Q44A 1WA8A 1QHTA 3SJCC 2DPIA 1TVKA 2F66C 4I50B 1IBMH 2HVSA 5EOYA 5KAIZ 4X88A 2YXLA 5IT9N 4CMFA 4JI0H 4EYIB 4ED6A 5CMUA 4OPHA 4XDLA 4DV7O 2LP7A 1S97A 5JUMA 1S03G 1TUEB 5KFZA 4TV8A 3G80A 1Z5WA 3OTOB 5B5EZ 2ZM6B 4UCTA 2FLNA 1VF6A 3RIZA 2YCHA 2DZDA 2R9AA 4O3RA 4NXMB 5B1AB 5I60A 3NUAA 2QB5A 2QM7A 4YR0A 1URFA 4LF4H 4EGJA 3K3VA 5KFPA 2XHBA 4L8JA 3N8DA 5D1PA 5KHJA 1IBMB 1KKCA 1BS3A 3OR6C 1CKOA 5KKNB 4OX9O 1WPBA 1N32O 3JD4A 2WAMA 1K97A 3JZ6A 3CCMV 5JVLA 4YHHB 3PW0A 2BCCH 4DR6O 1ZAUA 2BSKA 5HBRB 3RT3C 5FLXN 1QVFU 2ITDC 2UU9H 3RJ0A 1KP2A 3DTGA 3CYOA 4RUAA 3VNNA 5IY5B 3V4SA 1A9XA 4JI6B 1KJIA 1K34A 1C30A 1UC8A 1NZ6A 4RQFA 2DWDC 2AU0A 1IBKB 1Q81W 1XMQH 1A3GA 4LH6A 5JQWA 4O4LB 2YICA 3CP1A 4I0XA 5B66Z 4FM1A 3TINA 5KFKA 2GPSA 4QSHA 5KFGA 2Y4UA 2R7KA 2IM9A 2ZXWC 3U11A 3HKBB 4LFAH 4ZHQB 1AR5A 4RB0A 2XAHA 3JARB 5H5NA 4LF7B 3H3VH 2VA2A 5KT7A 1GSHA 1DF4A 2UXDH 2RCVA 5B1BB 4QWBA 5LGTA 2ZCEA 2XT9A 5DM6V 2NU8B 1SQXH 1MSDA 4DUZO 1L0LH 1VQ5V 3QO5A 2QM8A 2JK5C 2JA5A 2IMWP 4CS4A 3B09A 2W0FC 2UUBB 2AXTZ 4LFBB 3Q1KA 1F23A 5T14A 4K0KB 1NR7A 2WLJA 3DTFA 1R6NA 4RAYA 4DR7H 1WSCA 1SESA 4DV5B 2QK4A 5B1AC 4RCNA 1I0HA 4DR3H 1Q82W 3D3IA 3T5HA 4E4EA 4CKEA 4LH7A 3JATA 1OWTA 3ZMUA 4PA3A 3D36C 3OEEG 3TXSA 5FD6A 4CE5A 4PDMA 4DR2B 5KFBA 4FVMA 5CE8A 1AN7A 4NYEA 1XHXA 2HLDG 5JJJB 4XDJA 1YF2A 4B3MH 3A0HZ 5KT2A 4JYBA 1N33B 2LQTA 1R3IC 1FYJA 3BY6A 5IYDO 3UO3A 5EIBD 5IY5C 2HHFB 2R87A 4DV3B 1HR0H 1XREA 2XUMA 2YC0A 4FLVA 3FKIG 1CQJB 1IBLB 3ICXA 3A0RA 2IJKA 4DL4A 4JV1A 3JALA 2JEUA 3BHPA 2HHHO 1Y4MA 3HKZA 5E79Z 3FB5C 2XASA 3MHHC 2MCTA 3H4DA 3PO3G 2X6AA 1EBOA 1JKJB 4FK5C 4TQDA 3AX6A 5CA0F 2YS6A 5CBHA 3K5HA 2Q2TA 1XMOB 2V1DA 4MV9A 3TY8A 1CPYA 1I3QA 3KHHA 4DL7A 4PHZA 4X1IB 1K9MW 1DK1A 3MDSA 2Z3YA 4I9WA 4MV8A 3EYYA 2VQEH 1R3LC 4YIOA 3RYCA 4Z2WA 4FBTA 1BCCH 1WA8B 1I94H 5KFEA 2CUGA 5KFAA 3GIMA 1TVKB 2R7ZG 5DMXA 3R23A 1RK5A 2RDIA 1OBDA 3EPIA 4I55A 2NVXA 5DGIA 4DV2O 3WO1A 2XOKG 4A3BG 3AG4B 3QG5A 2R8GA 2NLJC 3BCCH 1B6SA 4ED8A 2QYZA 4ECTA 4DK0A 3K3PA 1ZLZA 3HKDA 1VQNV 4A93G 4TV8B 4DLKA 2JA6A 1I2KA 3RVYA 1NKDA 1MOFA 5KFJA 2A79B 3PJSK 3LDEA 1XEQA 3M99B 4GZRB 2ZDGA 3J80W 5CA0A 1AJQA 4DV1B 2J9GA 4EEYA 4RO2A 4DYLA 4X65B 4BBRG 4MVMA 2WA3A 2COIA 4UVCA 5CR5A 3CCSV 2UXXA 4IWYA 3CCEV 2UUAO 5DGHA 1AB3A 4CKBA 4DUYH 5B1NA 3VOUA 4DV6H 1YHQV 1RYSA 3RAQA 2BSKB 2Y48A 5C8YF 1SA0A 4UCVA 4LFCH 1PP9H 1IOWA 3N6XA 1AILA 3T99A 4G28B 4LF6B 1CS0A 3VMMA 5KT3A 4MV3A 5KFWA 3DTUB 4GKJH 4DRXA 3AK1A 4HNAA 5H9CA 3OTOO 4PZ6A 1QQCA 3M9NB 3TCUA 1SFOA 3E35A 4FLZA 1X4TA 4X1YA 5DQHA 4I0XB 3SYPA 2UVVA 1M9NA 3O65A 3R5XA 3SYCA 4Q43A 3T9EA 1R9TA 5IP9G 3GTLA 2BR0A 4J7ZA 1IBMO 2X6CA 2B1GA 2GUZA 3TQ1A 4LBEC 1H2NA 1GN4A 5D5PA 1A48A 2GPWA 3T5KA 2R85A 3FAVA 5HFMA 1E4EA 4JI0O 3TEKA 2UXNA 2YXHA 4CC5A 4ED7A 3N40P 3H0GA 1QVGU 3OMNB 3AG4C 2V4QA 1KTAA 4G27B 5FNVF 2PMZE 3MWDA 3TK1A 4L1KA 1WB7A 2GV9A 2FYUH 3K79A 5C8YA 1P49A 3JD1A 3GV8B 2I8CA 2M6YA 2FP4B 4A5UB 2ASDA 3AG2B 2P5OA 3V6JA 1VF6C 4DV4B 4CH6A 4LF4O 5L9XA 3IG0A 1XOUA 3V6KA 1FFTB 4UCSA 5DEDA 4RAZA 3F8NA 3N6RA 3LP8A 3CX5F 2IBZH 1X59A 2L6LA 3T1YB 2AW9A 3RTXA 1PNMA 1ZL8A 1P7BA 3RR5A 2JGDB 1FS0G 4YJ2F 3E83A 3ZMSA 3S3WA 3FKSG 4O7VA 4JTDB 3M4IA 3GB8B 2R82A 2UU9O 2ODMA 2NNUA 1CKNA 4CMDA 3CCUV 1SQFA 5KMGA 4A2AA 3VPCA 2JEXA 1XNRH 2YZNA 3HOXG 4DV0B 2JEFA 4HYOA 4XBFA 3C3SA 2ZNJA 2JVDA 3B8MA 4CHIA 4IR1A 5LMUH 4DR1H 4FS1A 4KFMA 1OJHA 1XMQO 1VF7A 4QWEA 3NC0B 4MW8A 2UUBO 4ECVA 1KJQA 5FNVA 1XBLA 1MABG 2NN4A 3JALB 4F6EA 1VQKV 2BQ3A 2EBOA 3ABUA 3JAKA 2W9CA 3S3XA 4LFAO 3MJFA 1VF5B 4C5AA 4BXXG 1SEIA 1JOYA 4MTGA 4WFGA 3OUZA 2I87A 2BOCC 3KREA 3P3NA 1FVIA 2UXDO 3TIIA 2R92G 4I50F 4PA7A 3K59A 2JJ1G 3GVMA 5C3EG 3VQXA 2HEPA 4LF9B 3RYCB 3TY5A 2Y0SE 4YJ2A 2XD4A 3WWHA 4I4TA 2B63G 2JRIA 2FMAA 3BQ1A 5I5UA 3ZRSA 1VQ9V 4I55B 5JQGF 3UZOA 1N33O 1LUVA 3SDLA 3CXCU 3KKYA 4CS2A 2X0LA 4AYBE 1YIJV 4H37A 3B2EE 4JI2H 4O3OA 5CN0A 3CCVV 1M6VA 2V7QG 4DR7O 3HKDB 1I50A 3AG2C 4TM5A 1G2WA 2X6BA 3KHRA 1IBLO 1BL8A 4DR3O 3K0GA 4IL6Z 4CZZA 4GKKB 1ZSPA 1WP7A 4CH5A 3ETQA 1JFFA 1XDCA 3JAWA 4QJFB 1VP7A 3M9OB 3GIJA 2P4VA 1WH2A 2N74A 2CW8A 2YZGA 5KG1A 4R8CA 5CA0B 5I5WA 2JGUA 4DW0A 1OZ0A 5EDWA 3OTFA 5B1OA 1O75A 3OE7G 1GN2A 4ZQIA 4J7JA 1ENVA 1V4YA 3PFFA 5GW7A 5J2TF 1SQVH 2YI8A 3KHLA 3PW4A 3ZS8C 5IWAH 1KBHA 1HR0O 1KJJA 3QO8A 2ZR3A 4MV1A 2RDCA 3OUSA 1SA0B 3ZN0A 3K57A 2FPIB 4TVIA 1CKMA 1I08A 3MR2A 5L3DA 1DV2A 4PZ8A 1S5JA 4NTYA 3U9SA 1W2BU 2COGA 5JQGA 3OUFA 3KAJA 1K73W 3SYOA 2N05A 2X0SA 4O4LF 4DRXB 4HNAB 4IYIA 1H8HG 3N27A 1S77D 1W59A 2HR3A 2WPDG 4X1YB 4GC7A 4ZHQF 1SCUB 2CNQA 4FLTA 2PI4A 1NH2D 1F4NA 1BXRA 2VQEO 3VPDA 1V9PA 3CD6V 4C5BA 2YIBD 2Z04A 2WAQE 4RQEA 1I94O 1PX2A 2R8IA 4B3TB 2V9WA 2CAZC 2IJHA 2BOBC 2GTAA 3LNMB 5FPOA 3F5TA 4X62H 2GUZB 2R72A 1YITV 4O2BB 3N41B 3SYQA 3C0FB 1SRYA 1YDXA 1E4EB 5KFDA 4DR4H 4Q45A 4YXWG 2UUCB 3EFFK 5L3EA 5EBLC 3HOVG 3ZRVA 5J2TA 5B3SC 1BGYH 1XNQH 4P9OA 5GONF 1SKVA 1GTOA 3BFRA 4JYAB 5H6RA 3PW5A 3TGUH 4LF6O 4G2KA 1BNCA 5C8YB 5CBFA 3HKCB 3QFFA 2LW1A 2WLMA 3CRMA 3ETEA 3K04A 3CEBA 4QIWF 2CTPA 4QW8A 2Q73A 4EKWA 1GN6A 3RV4A 4RUCA 1JMKC 1Z2OX 4NXNH 2A06H 3BPZA 3LDDA 2HHHH 2XTAA 1ZL8B 4YQWA 4DUYO 2CFMA 3M8AA 5EWEA 4DV6O 4R50A 1MSWD 3BAAA 1J5EB 1IYEA 2H8PC 3H9VA 4LFCO 1CKNB 3V4ZA 5K3WA 4AQYB 3OAAG 3WB0A 5KMGB 2AQ4A 1UC9A 1N8RW 1G8MA 1AI4A 1W93A 4IIJF 3OR7C 1HNWH 4GKJO 3MR3A 3T1HB 3OEHG 5BWTA 4JAUA 3RB3A 4LF5B 1TAEA 1WPXA 2YIDA 4MT8A 3N44B 5FNVB 5GONA 1VS0A 5BWWA 3MD0A 1K33A 4JV2A 1VBHA 4J0MA 3JAKB 1JR9A 4B3SB 2W9CB 2JS3A 1QLNA 5KG6A 4DL5A 2AGOA 4X8AA 4ED0A 3CC7V 3T5JA 3CXHF 4O84A 4QIWA 5L3GA 4RB3C 5DGBA 4JZ2A 1M1KW 3SPJA 1VBGA 2RQ6A 3BRCA 2WLNA 3A2FA 2IU0A 1V54C 3CEIA 3ORQA 3JZFA 1P84F 4YJ2B 2R70A 1KC8W 4IRDA 4I4TB 4MS2A 1M7JA 3GJXB 4FFRA 1KJ9A 1NTZH 3P30A 1S10A 2WYOA 4FLWA 2ZIMA 2OCHA 1VQ7V 4LF8B 5KFIA 5EWGA 1Q6HA 4IIJA 1JVMA 1KJ8A 1L0NH 3G6XA 4BY1G 2IU3A 3K9AA 4UUJC 5JJEB 3CMAV 2WB1E 2YU9A 1J95A 1EN5A 1OCOB 1K3EA 1GAXA 1YJ9V 4I7HA 2W6QA 3OTOH 1JFFB 1K5SA 3JAWB 3ABKC 2ZM6H 2W7OA 1R6TA 3PR4A 1ET0A 1VIBA 3TIGA 3G6YA 2QM4A 4WFHA 4NXMH 4P30A 3U10A 4X1IA 2IP4A 1XQ8A 2ZXWB 1GSOA 3QVNA 5LA6B 4JI7B 3W1BA 3SI8A 5KFHA 2FTKA 1XNRO 2YZMA 3ZMZA 4TQSA 3OHBA 3G71V 1RYRA 4JI1B 3TQTA 1H2KA 4X64B 4O4HA 5LMUO 4DR1O 4QWCA 3L4JA 3CJHB 5LP6F 5EK0A 3OW2U 1W96A 1ORQC 4C7UA 5KLVH 2JA7A 4YHHH 3KTMA 1WN7A 1M56C 1YEWA 4GT1A 3QWUA 5JQGB 4Q4CA 3T2MA 4J11A 2YS8A 4FPPA 4JI8B 5DAAA 4RB2C 1FJGB 5I5VA 3JSNA 5KA6A 4JI6H 2HGSA 1XL4A 1Q6IA 4O82A 4A3MG 1S0VA 3T9DA 2C28A 2NR5A 1YSCA 3LQSA 1IBKH 3MHSC 2W6ZA 1OCZB 3U0ZA 5IP7G 1HWYA 4O81A 5L1LA 1AI5A 5KG0A 1EFRG 4YBZB 2Q2UA 3I4NG 3I12A 1QLEB 4XYMB 3RB6A 4HAMA 2M05A 1LNQA 3UCSC 3NBYB 3DAAA 3IC7A 5A2QW 1B04A 1VQPV 5ITZA 4JI2O 4DAAA 3LMLA 1GGOA 2CNUA 2RF4A 4LF7H 2IW5A 2P6JA 3E22A 3RBDA 5J2TB 3KZIZ 3B8NA 2YEVA 2KSWA 5KX5A 4WD3A 1Q3EA 3QTCA 5LP6A 1I1MA 3SR2C 3VPBA 1IXBA 3CQZA 1N56A 3U55A 2P7TC 1Y14B 1P8LA 2ZGIA 1JA8A 1B06A 1OCOC 3KCXA 3SJQC 1Y1VG 2UUBH 4LFBH 5KFYA 3RAXA 2RJZA 4K0KH 5LXTF 5HNEA 1N34B 4D7TA 4DV5H 1M0WA 2QEXV 4TOIA 3ZHRA 4HQ6A 3CRAA 5IYBO 4F4XA 3GILA 5IWAO 3BVOA 4MVZA 3E8FA 2IJIA 1R3JC 3LNNA 4A3JG 2QTSA 4ECUA 5LL6Y 2GTSA 4K8ZA 2YZLA 2F23A 3RYIA 2FJZA 1TGOA 4DR2H 2NUAB 2CTQA 3KALA 2C2AA 3L71H 4J9QA 1FFXA 3ZJZA 1H8EG 2PTMA 3H1KH 3T54A 2YIAA 2R9RB 2R7LA 4Q8FA 1E1RG 1OV9A 1K8AW 2FK3A 2IH1C 1N33H 1AI7A 2HJWA 5GONB 2CTWA 2EJ3A 5BR8B 4FFOA 2W0XA 5I5TA 4F4ZA 4EBEA 2ETNA 4DV3H 1WCMA 2P06A 3GIPA 3M7MX 1O9GA 1ZHSA 2E3CA 1Y76A 3OHAA 1IBLH 3GLKA 1OCZC 4A3LG 1M90W 4X62O 3Q8RB 4WFFA 5KFVA 2ASJA 1H2GA 3AK2A 3HB3B 1I6UA 2JGDA 3IC9A 5FJ8G 5LXTA 1Q43A 1QLEC 1SETA 3AG1C 3ZHTA 4DR4O 2J6UA 3L73H 1XMOH 3IN5A 2Q69A 4B08A 4B3RB 2Q0AA 2OTJV 1JJ2U 4I55F 4FFBA 5LYJF 1DAAA 1KD1W 1XNQO 5I47A 1N48A 4B7EA 2C00A 3F5WC 3IFXA 1UPGA 4X9QA 3RGXA 3DXRA 2WSSG 1GO3E 3BABA 4IWXA 1EN4A 3FD9A 2CDYA 1Q6UA 4TUYA 3T1HO 5EBWC 3MFIA 1YJWV 4O7RA 3OGCC 4RNMA 4IIJB 4BW5A 2A9HA 1N36B 2ASLA 2JIZG 2PVPA 2E75B 5E25A 4NXNO 2JS5A 1KECA 1N0JA 5F9NA 5JCOA 4BWSC 3QF7A 1WP8A 4BR6A 1RM1B 4UCUA 2RDJA 4FU0A 2QSAA 3IAYA 4MVUA 2IBKA 3C3TA 4F6RA 4U3JB 1HNZB 4A3IG 4G3IA 2W6NA 1KQSU 1AP6A 1HNWO 2BQUA 2W9AA 2CH7A 4DV1H 4O4HB 4O7NA 4X65H 3ETHA 3H4BA 4WFAV 5LYJA 2PBZA 4O3SA 3K5NA 1I1KA 3R5FA 1P16A 3DGEA 3GIQA 4D7SA 4JI5B 3I4MG 1H2LA 3J7AU 4FMTA 4J9SA 2JA5G 1CEZA 5K1XA 1SQPH 2M7WA 1KUTA 2VUMG 5L1IA 4A3GG 1FKAH 3X2QB 3TW6A 2VS0A 2E74B 3E8HA 3U9TA 1SQBH 4KUMA 1NJIW 3QZ7A 2ADQB 4UFZA 3W7WA 3HR0A 1FXHA 1V55B 3DC5A 4LF6H 2R86A 3RB4A 4J42A 5EYPA 5BMVF 2KQXA 4QJFA 3A0BZ 3FDSA 1PL4A 5IE9A 4BW9A 2AZ0A 2PYJA 4O2BF 4E2LA 1GLVA 4JI7O 4ZI7F 2WA4A 4RB1A 3OMIB 3LWBA 1Z2PX 3RUPA 1HP8A 1VQ6V 2ZDIA 2DE0X 2HKOA 3EVKA 5ITZB 1RPRA 2YSUB 4B7KA 5C93A 2PN1A 3E22B 3UT5A 2YEVB 4DL2A 2EZOA 2P67A 1RFYA 1TUBA 5BXZA 5IJ0A 5KX5B 4X66B 5LP6B 3NGDA 2VRZA 5KFXA 4PJ0Z 1ZTEA 3B40A 4NYKA 3K03A 5EC2C 3T7AA 1U97A 2UXBB 4JI4B 2ZM6O 2WDTA 3HKEA 2WLIB 5FR9A 1RM1C 5I5XA 4UVBA 3JCZA 4IAJA 4NXMO 1XILA 3WWIA 1LUWA 4DV4H 5D1OA 2OTLV 3HKZE 5IT9W 4YP3A 3CCRV 5BMVA 3THOA 3HB9A 1G4YB 4JZGA 3D8CA 2VQFB 3RVZA 4NZMA 3T1YH 4IR9A 3GTJA 4O2BA 3HOUG 4YHHO 4LP8A 2W57A 4Q8EA 4WFBV 3U0GA 3GWKC 4ZI7A 3RYIB 1BE3H 4NVPA 1NVPB 3AW8A 1K4CC 3H1JH 3GTMA 4U6PA 1FFXB 4PDRA 3L9DA 5KFMA 4TT3G 4APMA 1OCRB 3X2QC 3GWOA 2HVRA 4KXRA 4DV0H 4JI6O 4I5SA 4LMYA 1L1FA 5CA3A 3HKCA 4M7EA 5EBMC 3BA9A 2CQYA 5FLMG 1WJZA 4M0JA 1R1BA 2XAFA 2R92A 1V55C 1IBKO 2HIVA 3F7VC 1N0NA 4J9PA 1B33N 2HFEC 5AG2A 2YWVA 1PPJH 4RAIA 2B63A 1Y76B 3GB7C 2DPJA 1Z2GA 2KB1A 2HGWA 1K5QA 3I56V 3JSLA 4MVRA 2E5LB 3KCYA 4UV8A 5L3FA 4JAAA 4H44B 1S0OA 1F4MA 4LCUC 2V58A 1YCIA 5LXTB 4DR5B 4I4TF 1KBLA 3J81W 4LF7O 4EG0A 1O9HA 3ZX6A 3JD0A 5LL6b 4FFBB 1QBZA 2AZ2A 4MAMA 1HNXB 4GX5A 5KFSA 4LF9H 3LSSA 5LMNH 3DXRB 3QQMA 2HIXA 3OD4A 2DMXA 2UVRA 4TUYB 5LP6C 2IA6A 4JI3B 1NR1A 1EKPA 5L1KA 1GYFA 1XK5A 1I5YA 4LFBO 3APQA 1A0IA 2HP8A 5BWUA 2VR1A 5BWXA 4K0KO 2QDOA 1QNMA 4EFBA 1VQLV 3WO0A 1IZ3A 1E4GT 4PA6A 4DV5O 1MZFA 3MFHA 1PV0A 2GQSA 4GKKH 2F93B 5LA6F 4WCEV 4FBUA 1R6KA 2OT5A 1A32A 5DQGA 4QE7A 4F6RB 5KG5A 5IYBG 2ZD9A 3N2KA 4W4KA 3ZRXA 4ECSA 5LGNA 3ZMVA 3S24A 4DR2O 1SYXB 5HV6A 5LMNB 1VQ8V 5JVDF 4YY3B 2CH7B 4Q6GA 1NT2B 3H0GG 1YJNV 2A3QA
chains in the Genus database with same CATH topology
3RYHA 5LYJB 2VQFH 4UCRA 4MV7A 3RFRA 2EX3A 4ZOLA 1IBKB 4LF5B 5IJ9B 1TAEA 1XMQH 4HBNA 4LH6A 3N44B 1SQGA 5FNVB 5GONA 1VS0A 4O4LB 2VQEB 2UXCB 3BA8A 3SJBC 4FM1A 4X1KA 4X20A 1I94B 4J0MA 3JAKB 4B3SB 4YJ3B 2IM9A 4TV9B 3U11A 3HKBB 4LFAH 4ZHQB 4RB3C 5EYPB 4RB0A 3JARB 4LF7B 2RQ6A 3BRCA 2ZNIA 3A2FA 2UXDH 3VQYA 3KYHC 5LA6A 4DV7B 3JASA 4YJ2B 2R70A 4GYCB 4LSAA 2ZCEA 4I4TB 2Q7EA 5CA1B 3GJXB 3N42B 2YI9A 4B3TH 2WYOA 4FLWA 2ZIMA 4O2AB 2E5LH 4LF8B 4CS4A 4I9QA 2UUBB 5JVDA 4LFBB 4DR5H 3UT5B 4IIJA 4AHCA 4K0KB 5IJ0B 1TUBB 4RAYA 4DR7H 2UUCH 5JJEB 4DV5B 1HNXH 4DR3H 3RYFB 4I7HA 4R7RA 5JCOC 4JYAH 5JJNB 4DUYB 4OX9B 3HKEB 1N32B 4LH7A 3JATA 1JFFB 3JAWB 1XHZA 3SGIA 4DV6B 3OTOH 2ZM6H 4JI3H 4DR6B 5J2UA 4LFCB 5FD6A 2QM4A 5D1OB 4NXMH 3U10A 4DR2B 3TY9A 4FVMA 4X1IA 1XQ8A 1AN7A 5LA6B 3W1BA 4JI7B 1XHXA 5FLXW 5BMVB 5JJJB 4GKJB 2ZJTA 3CSXA 1RSOA 4B3MH 4JI1B 4CS3A 1T5EA 1N33B 2VPSA 4X64B 4O4HA 3L4JA 4WBNA 4EB6A 2QJ1A 5EIBD 4ZI7B 4EFEA 3N43B 4DV3B 4YHHH 1HR0H 4ETSA 4CC6A 1WN7A 4FLVA 1YEWA 3QWUA 1J5EH 5JQGB 1IBLB 5KHHA 3ICXA 4AQYH 1M0TA 3JALA 2Q7GA 3BHPA 4JI8B 4O4IB 4RB2C 4YY3H 2MCTA 1FJGB 2VUGA 3JSNA 3K58A 4O4JA 4TQDA 3JATB 3T1HH 2KKWA 2Q7HA 1Z2NX 4JI6H 2HGSA 2Q2TA 1XMOB 4MV9A 3TY8A 1IBKH 4LF5H 4PHZA 4FM9A 4X1IB 3U0ZA 3EYYA 2P22C 3RF2A 2VQEH 2UXCH 3RYCA 4DUZB 1I94H 4B3SH 2ZINA 2Q2UA 1TVKB 4PDBA 3DF7A 4CH4A 4I55A 3NBYB 3GDEA 2HVQA 5A2QW 1B04A 5ITZA 3LMLA 3QG5A 4KHPH 4LF7H 3E22A 5J2TB 1HW7A 2KSWA 4DK0A 3HKDA 5KX5A 1Q3EA 3QTCA 5LP6A 3SR2C 4TV8B 4DV7H 4MTDA 1P8LA 3FMAA 5EIBC 4RZQA 2RGVA 4LF8H 1XI1A 2UUBH 4LFBH 1H2SB 2F1MA 2XIGA 2RJZA 4K0KH 1XNRB 3J80W 5CA0A 1N34B 4DV1B 4D7TA 4X65B 4E6NA 4DV5H 1M0WA 4TOIA 5LMUB 4DR1B 2PY5A 4DUYH 4OX9H 4KHPB 1N32H 4PI2A 3LNNA 3N2KB 5CB4A 2YIBA 4DV6H 1MZBA 4K8ZA 4DR6H 3KAKA 3RYIA 1SA0A 4UCVA 2VWKA 3N2GA 4LNUA 3CVZA 4LFCH 1TGOA 4DR2H 1Q8IA 3N6XA 3KALA 4JI7H 1FFXA 5EZYB 4LF6B 2PTMA 2YIAA 4LSXA 3RYHB 1X9NA 4DRXA 4GKJH 5IYZA 4HNAA 4PZ6A 4JI1H 1N33H 4ZOLB 4X64H 1QQCA 3KXYT 2OWOA 5GONB 1XDNA 4FLZA 5BR8B 1X4TA 4X1YA 4BWAA 2F95B 4DV3H 4X1KB 4X20B 4GLXA 1KU9A 3M7MX 4TQFA 1O9GA 1ZHSA 2E3CA 5K1PA 1IBLH 1E4FT 3MWMA 4JV5B 4JI8H 1I6UA 1FJGH 4I50A 4DV2B 4JI2B 5JH7A 5LXTA 1Q43A 5D5PA 4U3JA 1XMOH 5FPRA 4B08A 4B3RB 2Q0AA 4CC5A 4FFBA 3N40P 3JASB 2PZSA 3RGXA 4DUZH 3BABA 2GV9A 4K8XA 4TUYA 5C8YA 1P49A 2PYLA 5JVDB 5KHGA 2P5OA 4IIJB 4DV4B 5KHIA 1ZHQA 4IHJA 4FLYA 1N36B 4CH6A 1KMIZ 4PZ7A 3IG0A 4UCSA 4RAZA 2JS5A 5LOVA 5DISC 3F8NA 5JCOA 4BWSC 3QF7A 4FM2A 4UCUA 4FLUA 3T1YB 3RGBA 1TA8A 3RTXA 1M5IA 1Z5VA 3IAYA 3RR5A 5IWAB 2UUAB 2CW7A 5J2UB 3FFQA 4UCOA 3K5MA 4F6RA 2VOBA 4U3JB 1HNZB 3M4IA 3GB8B 1CKNA 1SQFA 5KMGA 4A2AA 3RGZA 5D5QA 1XNRH 3WB1A 4DV0B 1N34H 4DV1H 4O4HB 4X65H 4WBNB 2ZNJA 2JVDA 5LMUH 4EB6B 5LYJA 4DR1H 4CH3A 3K5NA 1P16A 1VF7A 3J7AK 2RGRA 3NC0B 3JAMW 4D7SA 4JI5B 5IJ9A 3L4KA 3H20A 5K1XA 5FNVA 2WE6A 4EEQA 1FKAH 4O4LA 1WNSA 3JALB 4FM0A 4DRFA 3JAKA 4UFZA 4YJ3A 1BGWA 4X62B 4O4JB 2FE3A 4LF6H 3HKBA 4ZHQA 1SEIA 5EYPA 4DR4B 3DSQA 3JARA 3W5OA 3SJAC 2V4DA 4JI0B 1FVIA 4BW9A 3K59A 5BR8H 1XNQB 3VQXA 2HEPA 2PGGA 2PYJA 3RYCB 4LF9B 1Q5OA 3TY5A 4YJ2A 4I4TA 5CA1A 1L2ZA 4RB1A 1Z2PX 4JV5H 4I55B 4O2AA 4CS2A 5ITZB 4DK1A 3MAQA 4DV2H 3B2EE 4JI2H 3E22B 3UT5A 4LF4B 4NXNB 3VQWA 1BJTA 5IJ0A 3HKDB 5KX5B 1TUBA 3ZEDA 1L8DA 4X66B 2HHHB 4B3RH 5LP6B 2ZIOA 4GKKB 4FLXA 2VWJA 3RYFA 2UXBB 4JI4B 4CH5A 1D5AA 3HKEA 3ETQA 3RWRD 3PN1A 2WDTA 1JFFA 3JAWA 4IAJA 1WH2A 2UU9B 2CW8A 1M4UA 4DV4H 5D1OA 1N36H 1DGSA 5CA0B 5IT9W 2JGUA 1HNWB 3OTFA 5BMVA 1O75A 3THOA 2VQFB 2F4VH 3T1YH 2PUSA 4Q0YA 1XMQB 2YI8A 5CB4B 3ZS8C 4O2BA 5IWAH 2UUAH 2W57A 4ZI7A 3RYIB 1SA0B 4KL1A 1M93A 4NVPA 3K57A 3N2GB 3K5OA 4LNUB 1CKMA 1HNZH 4PZ8A 1S5JA 4ZIBA 4MTEA 5JQGA 4AILC 3KAJA 1FFXB 2O03A 4LFAB 4APMA 3CHXA 4O4IA 4DRXB 5IYZB 4HNAB 2HVRA 4DV0H 4LMYA 3L2PA 4M7EA 3HKCA 3K5LA 3BA9A 1JJOA 2HIVA 4X1YB 4A2BA 2UXDB 4FLTA 4JI5H 5FD5A 3VQVA 1V9PA 3NBZB 2BTQA 2YIBD 2F4VB 4EQ5A 3W1GA 3HXLA 4B3TB 3UQ8A 2CAZC 1QHTA 3JSLA 3SJCC 2E5LB 5FPOA 1TVKA 4X62H 2F66C 4I50B 2R72A 1IBMH 5JH7B 5LXTB 4O2BB 4DR5B 2HVSA 3N41B 5EOYA 3J81W 3C0FB 1O9HA 2YXLA 4DR4H 5LL6b 4DR7B 4FFBB 2UUCB 1I7FA 1G6UA 5KHKA 4JI0H 5J2TA 1HNXB 4DR3B 1XNQH 1S03G 2BTOA 4LF9H 1SKVA 5LMNH 4JYAB 4TV8A 2HIXA 1Z5WA 3OTOB 1S68A 4TUYB 5C8YB 4UCTA 5LP6C 2ZM6B 3RIZA 2YCHA 4JI3B 3HKCB 1GYFA 1XK5A 2R9AA 4NXMB 3CB2A 4IHJB 1A0IA 2BTQB 5LOVB 4LF4H 1JMKC 4EFBA 1Z2OX 1E4GT 4NXNH 3BPZA 3K3VA 4B3MB 4PI0A 2XHBA 4X66H 2HHHH 4L8JA 5D1PA 5KHJA 1IBMB 1CKOA 4TV9A 4GKKH 2F93B 2OYQA 1WPBA 2CFMA 2UXBH 4JI4H 4LR3A 4YHHB 1HR0B 4F6RB 3WB2A 3N2KA 3BAAA 1J5EB 1ZAUA 3S24A 1CKNB 4AQYB 3WB0A 1SYXB 5LMNB 5KMGB 2UU9H 3RJ0A 4YY3B 4Q6GA 1NT2B 3VNNA 1HNWH 5EZYA 3T1HB 4JI6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1O A;  4UCR A;  1DGS A;  2UU9 B;  1HNW B;  1IBK B;  4DUZ B;  4LF5 B;  1TAE A;  4LH6 A;  4DV4 B;  2Q2U A;  2VQF B;  1N36 B;  1VS0 A;  2VQE B;  4PZ7 A;  2UXC B;  3BA8 A;  4UCS A;  3NBY B;  1XMQ B;  1I94 B;  3GDE A;  2HVQ A;  5DIS C;  4EQ5 A;  4B3S B;  1B04 A;  4UCU A;  3T1Y B;  3RTX A;  1TA8 A;  1CKM A;  4PZ8 A;  3RR5 A;  5IWA B;  2UUA B;  4UCO A;  4LF7 B;  4LFA B;  1HNZ B;  2HVR A;  3GB8 B;  1CKN A;  1P8L A;  3L2P A;  3KYH C;  4DV7 B;  3BA9 A;  2HIV A;  3GJX B;  4DV0 B;  2UXD B;  3NBZ B;  1V9P A;  4LF8 B;  1XNR B;  1N34 B;  2F4V B;  4DV1 B;  2UUB B;  4LFB B;  1P16 A;  3NC0 B;  4B3T B;  4X65 B;  3UQ8 A;  3W1G A;  4E6N A;  4JI5 B;  3JSL A;  4TOI A;  5LMU B;  4DR1 B;  4EEQ A;  2E5L B;  5FPO A;  4K0K B;  4KHP B;  4DR5 B;  2HVS A;  4DV5 B;  4DRF A;  4UFZ A;  4X62 B;  4DR7 B;  4DUY B;  2UUC B;  4OX9 B;  4UCV A;  1N32 B;  4LH7 A;  3SGI A;  4DV6 B;  1HNX B;  4DR3 B;  4DR4 B;  4DR6 B;  4JYA B;  3W5O A;  4LF6 B;  4JI0 B;  4LFC B;  2HIX A;  3OTO B;  1FVI A;  1S68 A;  5D1O B;  1X9N A;  2ZM6 B;  4UCT A;  4DR2 B;  3TY9 A;  4PZ6 A;  1XNQ B;  4JI3 B;  4LF9 B;  3W1B A;  4JI7 B;  3TY5 A;  2OWO A;  1XK5 A;  4NXM B;  4GKJ B;  1XDN A;  5BR8 B;  1A0I A;  4JI1 B;  1N33 B;  4X64 B;  4GLX A;  4EFB A;  4B3M B;  4EFE A;  5D1P A;  4DV3 B;  4JV5 B;  1IBM B;  1CKO A;  4LF4 B;  4CC6 A;  4NXN B;  3QWU A;  2CFM A;  1IBL B;  4X66 B;  2HHH B;  4DV2 B;  4YHH B;  1HR0 B;  4JI2 B;  4JI8 B;  3BAA A;  1J5E B;  4GKK B;  1ZAU A;  1FJG B;  2VUG A;  3JSN A;  5FPR A;  1CKN B;  4B3R B;  2UXB B;  3S24 A;  4AQY B;  4CC5 A;  4JI4 B;  5LMN B;  3PN1 A;  4YY3 B;  2Q2T A;  1XMO B;  3TY8 A;  3VNN A;  3BAB A;  3T1H B;  4JI6 B; 
#chains in the Genus database with same CATH topology
 4J10 A;  5LYJ B;  4HNT A;  4UCR A;  3TW7 A;  3ZBH A;  1Y1W A;  2JA8 G;  1BHB A;  3RFR A;  2EX3 A;  4ZOL A;  5B3S B;  1OCR C;  4YIP A;  5LHI A;  3W7S A;  5KT5 A;  4A3K G;  2Q67 A;  3V6H A;  3K06 A;  4DV3 O;  5F9L A;  2UXC B;  2C2D A;  3BA8 A;  4X20 A;  5BPF A;  5D8D A;  4TV9 B;  4UB8 Z;  5EYP B;  1GMG A;  2FML A;  5IYC O;  1SS3 A;  3EPG A;  3KG2 A;  3UKM A;  1XMO O;  4RZR A;  1EZ1 A;  4IRK A;  1WR2 A;  3FB7 C;  3ZHU A;  2FB9 A;  2ILM A;  3VQY A;  3Q8P B;  5LA6 A;  4DV7 B;  4LSA A;  2Q8V A;  1GM8 A;  2Q7E A;  1TWA A;  2EIY A;  1HDJ A;  2XCA A;  3OSP A;  3N42 B;  2YI9 A;  4B3T H;  2YXY A;  3O9O A;  3Q4H B;  2YS7 A;  1DF5 A;  3CJH A;  2AGP A;  4DXW A;  5JVD A;  1V51 A;  1M57 C;  2FKL A;  2DWE C;  3UT5 B;  4RUE A;  5IJ0 B;  1TUB B;  2EJ0 A;  2UUC H;  2R93 A;  3KHG A;  2UVW A;  4A3E G;  5BYB A;  5KFU A;  2ATK C;  3ZRW B;  5JCO C;  1W0K G;  5JJN B;  4OX9 B;  3HKE B;  4YAK B;  5C1P A;  1N32 B;  4JYA H;  1XHZ A;  3SGI A;  2X5R A;  1RJR A;  2FK2 A;  2QGN A;  4DR6 B;  1BSM A;  5C44 G;  1FD9 A;  4O86 A;  5D1O B;  3TY9 A;  3GV5 B;  4BIO A;  4IGG A;  1BMF G;  3ORR A;  4HNV A;  5BMV B;  3IGA C;  3QNE A;  3GTQ A;  4DV1 O;  2ZJT A;  3CSX A;  1RSO A;  4X65 O;  4CS3 A;  1T5E A;  2VPS A;  2LGQ A;  2E2H A;  2JEJ A;  3CCQ V;  4U7O A;  2C2R A;  4NTX A;  1V54 B;  2QJ1 A;  1NI8 A;  2FB5 A;  4ZI7 B;  4EFE A;  3N43 B;  5KUK A;  1FKA O;  4ETS A;  4CC6 A;  1J5E H;  1IDS A;  1AJN A;  3R65 A;  5DEC A;  1S3J A;  4AQY H;  2RMK B;  2Q7G A;  5DG8 A;  2YUA A;  2Z0A A;  2AGA A;  2VUG A;  4HYK A;  4O4J A;  2RNB A;  5BWV A;  3T1H H;  2KKW A;  2Q7H A;  4JI4 O;  4QPJ A;  1UJW B;  1JDB B;  1FXV A;  1H2M A;  3I55 V;  4LF5 H;  3OT7 A;  1VMG A;  3AG7 A;  3ML0 A;  1XUQ A;  4X89 A;  4MTF A;  3CRQ A;  4PBC A;  2LW7 A;  2P22 C;  3RF2 A;  4YR2 A;  5CB4 F;  4JTA B;  4ECZ A;  3ABK B;  4DUZ B;  3MR6 A;  1ROP A;  1RPO A;  2DJV A;  5KFQ A;  4B3S H;  4PWQ A;  2DN9 A;  3DF7 A;  4R6Z A;  4CH4 A;  4DO2 A;  5DG7 A;  3DC6 A;  3GDE A;  1QU7 A;  4O7T A;  2ZDI C;  4KHP H;  4LWS B;  1SZT A;  3BQ0 A;  4EBD A;  3SYA A;  2ODT X;  1JCH A;  1YXB A;  4E4T A;  1DV1 A;  4I7Z B;  3T4D A;  4ME6 A;  3ZCC A;  4TQR A;  5EWF A;  4MTD A;  4JGS A;  2ZE5 A;  1B6Q A;  1KKD A;  1Y74 A;  3G8D A;  4FZ1 A;  4PA4 A;  3VA7 A;  1M56 B;  3FMA A;  1YZB A;  3CWB H;  1I1L A;  4ABM A;  2VPQ A;  2OCC B;  2XND G;  4LF8 H;  1AI6 A;  1N4C A;  4TWK A;  4DV4 O;  1H2S B;  4O7L A;  2QKS A;  3OGI B;  3UM7 A;  2XIG A;  4IRC A;  3A8T A;  2Q5Z A;  5JH7 F;  3LSQ A;  3CS5 A;  2W70 A;  1BQZ A;  3T1Y O;  4MVS A;  3H1L H;  5BZB A;  5LHG A;  4KHP B;  2NU6 B;  4PI2 A;  1WRV A;  3OFN G;  3N2K B;  5CB4 A;  1T3N A;  4N23 A;  4K6N A;  1S0N A;  4UXN A;  1BZK A;  1NQT A;  4O4H F;  2P90 A;  3KAK A;  4J9L A;  1BQ0 A;  3WU2 Z;  2OIG A;  1NBM G;  1F7Y A;  1S0M A;  1HNX O;  1MZE A;  2Q6A A;  4JI7 H;  2R7N A;  4IHJ F;  3CRC A;  4DV0 O;  1BHA A;  4LSX A;  4JI1 H;  4ZOL B;  4X64 H;  4JI3 O;  4A3F G;  4Y8V B;  1XDN A;  2QKA A;  2YRW A;  1PKX A;  1PNK A;  4BWA A;  2F95 B;  1S76 D;  4GLX A;  4X20 B;  2XC9 A;  1WB8 A;  1KU9 A;  4ED2 A;  4IT5 A;  5HFL A;  4JV5 B;  2W9B B;  1Q7Y W;  2ZR2 A;  5IDJ A;  4JI8 H;  1FXK A;  5E1A C;  1Y66 A;  1FJG H;  1AVM A;  4JV0 A;  2JEG A;  4DV2 B;  1YTF B;  2I80 A;  5JH7 A;  3GID A;  4U3J A;  4PEL A;  1PL0 A;  2HJF C;  3J80 N;  2R8J A;  2R8H A;  4IZO A;  4LF9 O;  4UB6 Z;  5LMN O;  5EC1 C;  1AR1 B;  1VAJ A;  3R5H A;  3L70 H;  4YY3 O;  2KSD A;  2R8K A;  2Y4T A;  1K7D A;  5KX5 F;  1D5N A;  2PYL A;  2W6P A;  4IYH A;  3FYE B;  5JVD B;  3P3P A;  4YJ3 F;  3AK3 A;  2JJ2 G;  3CRR A;  5KHI A;  1ZHQ A;  4IHJ A;  2LO1 A;  3EXA A;  3RV3 A;  2OCC C;  3ZHS A;  5LOV A;  2IH3 C;  4GLW A;  2H3O A;  3OSN A;  3QZ8 A;  2CE4 A;  2CNV A;  4GKK O;  4AI8 A;  1TA8 A;  1M5I A;  2UUA B;  4JAV A;  4KP4 A;  2Y4R A;  2CW7 A;  3D3Q A;  4UCO A;  5CA1 F;  3ABL C;  3K5M A;  1RJP A;  2VOB A;  4NR1 A;  5CBG A;  1EKV A;  3P32 A;  4O2A F;  5I5Y A;  2WLL A;  1PK8 A;  4HZ3 A;  4QIW E;  3RGZ A;  1RSO B;  5D5Q A;  1N34 H;  4QGP A;  2PF4 E;  3AG1 B;  1EZV H;  4NKG B;  4UVA A;  3C90 A;  2HVJ C;  3LDC A;  2YRX A;  5FL7 G;  3BAC A;  3Q8Q B;  3J7A K;  2RGR A;  3JAM W;  5IJ9 A;  2VA3 A;  1GSA A;  1MNG A;  2WE6 A;  2SCU B;  4MW3 A;  5JWP A;  1WNS A;  3ASN B;  5LBQ A;  2FLP A;  4J80 A;  4YJ3 A;  1BGW A;  4O4J B;  1JQ0 A;  2FE3 A;  4MVQ A;  4EBC A;  4NZO A;  2WLI A;  1I7L A;  4NZN A;  3IJ4 A;  2AHZ A;  3SJA C;  5IYC G;  2V4D A;  2GSM B;  4JI0 B;  4F4W A;  5DG9 A;  5BR8 H;  1I2L A;  2Z5U A;  2DLN A;  2PGG A;  2AGQ A;  4U7N A;  1Q5O A;  2ATL A;  4B3T O;  5CA1 A;  3EHB B;  4XZ3 B;  1L2Z A;  4GX0 A;  2W6O A;  3GTG A;  3G8C A;  3T1C A;  1CP9 A;  4OXS A;  4HNU A;  2XAJ A;  4O2A A;  1K1Q A;  3OUU A;  3J81 N;  3W7U A;  3MAQ A;  3FKI A;  1DIK A;  1KT8 A;  4O4I F;  3UYY A;  4TUY F;  1US6 A;  4LF4 B;  3SE7 A;  1YI2 V;  1C3O A;  4O7Z A;  2UUC O;  3ZMT A;  2JA7 G;  2DOS A;  4B3R H;  3T9F A;  4U3F H;  3ETG A;  3OMA B;  1Q86 W;  1A0G A;  4JYA O;  1Y74 B;  1I7N A;  3RYF A;  1JPX A;  1IYD A;  4QWD A;  2CK3 G;  1D5A A;  2ALZ A;  1JX4 A;  3PN1 A;  4UUG A;  1PM9 A;  4F4Y A;  1XL6 A;  2LFS A;  3APO A;  3WNZ A;  4FGR A;  1KYO F;  4FJC C;  1EZJ A;  3I5D A;  1JDE A;  2YDE A;  4R8U A;  2UU9 B;  3GV7 B;  2GBO A;  2LGW A;  3HOZ G;  1N36 H;  1DGS A;  3W7X A;  1WLE A;  2R7Z A;  1FAF A;  2XGQ A;  2V59 A;  5DN6 G;  1VQ4 V;  5DQI A;  2F4V H;  2QWQ B;  4HN2 A;  4ECX A;  4F4L A;  4CKC A;  1XMQ B;  2P4K A;  5CB4 B;  2VUM A;  5H6Q A;  2W7P A;  4MA0 A;  1J5E O;  3HOW G;  1M93 A;  3CCJ V;  4YR3 A;  2O57 A;  3K5O A;  3U54 A;  1HNZ H;  3SPG A;  4AQY O;  2JEI A;  5KAF Z;  4FFP A;  4LFA B;  4O4I A;  3ASN C;  1SZX A;  1LR1 A;  2R6F A;  2HDK A;  1JJO A;  1SC5 B;  4LF5 O;  1SER A;  2EIL B;  4TV9 F;  3CC2 V;  1JIH A;  2UXD B;  2Y0I A;  2A0L A;  3AG3 B;  4OPA A;  3B4S A;  4JI5 H;  3VQV A;  1K1S A;  2FPP B;  2F4V B;  4L87 A;  1GK9 A;  3W1G A;  4EQ5 A;  4B3S O;  2DIK A;  5KFL A;  3UQ8 A;  2ARH A;  1NVP D;  1FXK B;  2EJR A;  2W6M A;  2HGX A;  2Q0O C;  2N04 A;  4BIU A;  4O3N A;  1RJQ A;  5JH7 B;  2B9Z A;  1TWH A;  4KHP O;  5EZY F;  4DR7 B;  1I7F A;  1G6U A;  5KHK A;  2DAA A;  4C5C A;  2AHY A;  3T5L A;  4DR3 B;  2BTO A;  1OCC B;  4J9R A;  1S68 A;  3PO2 G;  1OHH G;  1CQI B;  3JRW A;  4RNO A;  4LF8 O;  1JXL A;  2V4R A;  1GKF A;  4J41 A;  3AYH B;  3CB2 A;  4IHJ B;  3T9A A;  3F7Y C;  4QE9 A;  4PDV A;  4NB5 A;  1UFI A;  2BTQ B;  3LSU A;  4BAY A;  5LOV B;  4PD4 F;  4B3M B;  4PI0 A;  4EYH B;  4X66 H;  4DL3 A;  2ABJ A;  1NU1 H;  1WCM G;  4PA9 A;  4MTO A;  2ZKO A;  4TV9 A;  2QKC A;  2PI5 A;  4JV5 O;  5B1B C;  2PMZ A;  2OYQ A;  5KFR A;  2UXB H;  4W4L A;  2Y0P A;  4QW9 A;  4JI4 H;  4LR3 A;  1HR0 B;  4O3P A;  3WB2 A;  1EYZ A;  3BG5 A;  4GX2 A;  4MVO A;  2WLL B;  1S5H C;  1CXZ B;  3G67 A;  4ASU G;  3UFX B;  4MA5 A;  2FK1 A;  3RBE A;  4J9M A;  5L3C A;  5EZY A;  4JI1 O;  4A3C G;  3Q4H A;  3RYH A;  4X64 O;  2VQF H;  5A9G A;  4MV7 A;  1NS1 A;  5IJ9 B;  3GII A;  1Y6X A;  4HBN A;  3FX7 A;  1SQG A;  2QWR B;  4C2M A;  2VQE B;  4FZ0 A;  3SJB C;  4Z1V A;  2WLH A;  4X1K A;  1I94 B;  3CME V;  2EIL C;  5J2U F;  4YJ3 B;  3AG3 C;  4JI8 O;  3SNO A;  3TET A;  3H1I H;  2W8K A;  4JUZ A;  1R73 A;  1FJG O;  3ZRW A;  4FS2 A;  2BQR A;  2CGN A;  2Z02 A;  2FKX A;  3FB8 C;  2QE7 G;  3OM3 B;  5DLG A;  1KUQ A;  1FXK C;  1MG1 A;  2J6T A;  1P7G A;  2RN9 A;  5DGA A;  5KFF A;  4RUF A;  4A3D G;  5GTH Z;  4WBN F;  2K9P A;  4JYY A;  2ZNI A;  1G1X B;  3KYH C;  2NU9 B;  5DLF A;  2G38 A;  2Y69 B;  3JAS A;  4GYC B;  2B1I A;  2IJJ A;  3NXS A;  1P4R A;  3B77 A;  3STZ C;  5CA1 B;  1GM9 A;  4ED3 A;  2COJ A;  2DQ0 A;  2QR4 A;  1KC7 A;  1B3Q A;  2EIM B;  3CC4 V;  4DL6 A;  1DTO A;  4O2A B;  2ZDQ A;  3RFC A;  2E5L H;  1OCC C;  1ARO P;  5KFT A;  4I9Q A;  1IX9 A;  2CGO A;  2CZG A;  4DR5 H;  2B5U A;  1F51 A;  4AHC A;  1QR9 A;  2DYS B;  3T4Z A;  4ECQ A;  3ASO B;  3PR5 B;  2V5A A;  1KB9 F;  4XX0 B;  2QWP B;  3ZN1 A;  1HNX H;  3JD2 A;  3RYF B;  2Y0S A;  4R7R A;  1NTK H;  2LFR A;  4DUY B;  3WG7 B;  2JA6 G;  4DV6 B;  1THZ A;  4JI3 H;  2ZE8 A;  5J2U A;  1AP5 A;  4BY7 G;  4R8U B;  4ED1 A;  1DLB A;  3VOT A;  4LFC B;  1EHI A;  4AYB A;  3RBZ A;  1COW G;  5FLX W;  3G6V A;  1N34 O;  1AUX A;  4GKJ B;  4JXU A;  3CE2 A;  4DW1 A;  1KP3 A;  3MR5 A;  1EUD B;  4WBN A;  5KFC A;  2D2C B;  4EB6 A;  4JAS A;  5KA5 A;  1B6R A;  5LGU A;  4J7K A;  4BBS G;  4N21 A;  2QWN B;  3RB0 A;  4LWS A;  3HT5 A;  1IUR A;  1K83 A;  2Q68 A;  1EN6 A;  2C35 B;  4ZOL F;  5KHH A;  2DAB A;  4RU9 A;  1M0T A;  3PW7 A;  2KG7 A;  4O4I B;  4YB8 B;  4YY3 H;  1M57 B;  2FPG B;  1S72 V;  3K58 A;  3STL C;  3E86 A;  3JAT B;  1EUC B;  3WFV A;  3E2E A;  1Z2N X;  1EKF A;  5BYA A;  4GUN A;  3Q8S B;  1RP3 B;  5BR8 O;  2FLL A;  4QNH B;  4FM9 A;  1WAZ A;  2Q4P A;  2UXC H;  1IVS A;  5BY1 A;  2L35 A;  2D3O W;  2ZIN A;  1S5L Z;  4PDB A;  2Y69 C;  4FFK A;  2YYA A;  2HVQ A;  2EIM C;  2J6S A;  3TXQ A;  5IYZ F;  2A1H A;  4B3R O;  1HW7 A;  3LUL A;  1RK6 A;  4O7S A;  3GTK A;  1ZX3 A;  1ULZ A;  2DYS C;  4DV7 H;  4P2Z A;  2WAQ A;  1VQO V;  4LC1 A;  2ADP A;  3ASO C;  3JYC A;  1GRJ A;  2W6J G;  4GCZ A;  5C5J A;  5EIB C;  4RZQ A;  1PNL A;  2RGV A;  3W7T A;  4FFN A;  4O7Y A;  3WG7 C;  1XI1 A;  4QWA A;  1I5X A;  1AJP A;  1N36 O;  2F1M A;  4WF9 V;  2HVK C;  5L3B A;  1XNR B;  4CBC A;  4ICG A;  3RW0 A;  2HG8 A;  1Q90 D;  4E6N A;  2F4V O;  3SPH A;  4M9U A;  2Q7D A;  3PW2 A;  2W9B A;  2R7M A;  5LMU B;  4DR1 B;  3K3W A;  1VKZ A;  4FE2 A;  1GN3 A;  4H13 B;  2E76 B;  2PY5 A;  3K5I A;  1S9F A;  4OX9 H;  1N32 H;  2CTR A;  2YIB A;  1K92 A;  1MZB A;  5J9P C;  1KEE A;  1MMM A;  3JD3 A;  3G4S V;  1HNZ O;  4DR6 H;  2VWK A;  3N2G A;  2EZP A;  4LNU A;  3CVZ A;  1Q8I A;  2GLT A;  2W6I G;  4DIM A;  4JTC B;  5KFN A;  3R9R A;  5EZY B;  3R66 A;  3QO7 A;  3RYH B;  1X9N A;  5IYZ A;  5A2Q N;  4NTW A;  1MA1 A;  2A7W A;  1AR4 A;  4K3A A;  2H94 A;  3JAM N;  3KXY T;  2OWO A;  2ZQM A;  3GTO A;  1QR8 A;  4O4J F;  1SF9 A;  1W0J G;  4Q20 A;  3ZHQ A;  4JI5 O;  4ECW A;  1E79 G;  4DQN A;  3BJY A;  4X1K B;  1ZET A;  1JX9 A;  2FL4 A;  5C4X G;  4TQF A;  2C22 A;  2XGP A;  4H0L B;  5K1P A;  4K35 A;  1E4F T;  3FYI B;  4B3M O;  3MWM A;  2XAG A;  1CE8 A;  3K9S A;  2GQR A;  2F43 G;  2NVY A;  4GX1 A;  4I50 A;  4JI2 B;  3UO2 A;  1FPO A;  3G6B A;  3BQ2 A;  3ABM B;  3T9C A;  2EIJ B;  2MK3 A;  5FPR A;  5IYD G;  2EJ7 A;  2ZDH A;  3JAS B;  1Y67 A;  4D6T H;  4BIZ A;  2PZS A;  3LUT B;  4DUZ H;  3ZHV A;  3SPI A;  3PVX A;  4K8X A;  1IOV A;  4ECR A;  4GC6 A;  4U7C A;  3MWE A;  3E8G A;  5KHG A;  2EIN B;  1AUV A;  1PD3 A;  4PDL A;  4FLY A;  1Y1W G;  4Q4D A;  5KG2 A;  1KMI Z;  3ETJ A;  4PZ7 A;  4MV4 A;  2OIE A;  1YTF D;  3G6E V;  5DIS C;  4X66 O;  3SPC A;  4FM2 A;  2W8L A;  2YL2 A;  4FLU A;  2W71 A;  3RGB A;  5CAE B;  4J9N A;  1Z5V A;  3D36 A;  2UXB O;  5IWA B;  5L1J A;  3Q2O A;  3FB6 C;  4J9K A;  5J2U B;  3FFQ A;  3UZB A;  1U96 A;  2HG5 C;  3E8B A;  3CSW A;  3FAV B;  4JPR A;  2X7R B;  2QA4 V;  4H33 A;  3L75 H;  2EIK B;  3WWJ A;  1H38 A;  3HPL C;  3NR7 A;  4FIP C;  3VBB A;  2OLS A;  3WB1 A;  1UNN C;  2WB1 A;  5KG3 A;  4XYL B;  4PV1 B;  2VQF O;  4WBN B;  4MV6 A;  4JF3 A;  2DYR B;  3H40 A;  3CCL V;  3BEH A;  4EB6 B;  1JLL B;  4CH3 A;  2E2I A;  2R9I A;  2QF7 A;  3AEI A;  3L4K A;  3H20 A;  3JRX A;  4EEQ A;  4FFM A;  4WHX A;  4O4L A;  5KG4 A;  4FM0 A;  2KG7 B;  4O83 A;  4DRF A;  2WWW A;  4X62 B;  2R93 G;  4QPK A;  2JDI G;  2ZE7 A;  3HKB A;  4ZHQ A;  2GHY A;  1NTM H;  1BT8 A;  2XCL A;  5LHH A;  4DR4 B;  1VQM V;  4ECY A;  3DSQ A;  3JAR A;  3HBL A;  2DQ3 A;  3W5O A;  5KS8 A;  1R3K C;  2BE3 A;  1D2D A;  1TWC A;  2GDS A;  1QCE A;  1GM7 A;  1XNQ B;  2Q9L A;  4J9Z B;  1OBG A;  5KUM A;  3K0D A;  3ABM C;  4ZBM A;  2EIJ C;  1K4D C;  4O3Q A;  4JYC A;  3L74 H;  3RN4 A;  3ABL B;  3K08 A;  3HO8 A;  5H80 A;  1E1Q G;  4RWU A;  4FFL A;  3HOY G;  2E5L O;  1T36 A;  4JV5 H;  5BPH A;  1TWF A;  3TJT A;  2LJ2 A;  4DK1 A;  4DR5 O;  3PZP A;  3CPW U;  4DV2 H;  5KFO A;  2C2E A;  4NXN B;  2NU7 B;  2K1E A;  3H01 A;  3VQW A;  3E5N A;  1VAR A;  1BJT A;  2DW4 A;  3ZED A;  1SQQ H;  1L8D A;  5CM0 A;  2EIN C;  2HHH B;  4YAJ B;  4EGQ A;  5C1O A;  1ZQ7 A;  3GIK A;  2ZIO A;  3ABT A;  4XDK A;  4FLX A;  3GQC A;  2VWJ A;  1T94 A;  1TWG A;  4J9O A;  4O7W A;  4Z1M G;  5LOV F;  3RWR D;  4MTX A;  1GH6 A;  2QTO A;  5H2F Z;  5I5S A;  4P9P A;  5GTI Z;  3JCU Z;  1M4U A;  4TSF G;  1HNW B;  3E89 A;  2VQD A;  4UV9 A;  2EIK C;  5KT4 A;  2XCP A;  2WTF A;  3JZI A;  2DWC A;  3GTP A;  2PUS A;  3ETD A;  1NH2 B;  2P0A A;  4HR7 A;  3T9B A;  4Q0Y A;  1ZUQ A;  2UUA H;  4TV8 F;  3L72 H;  4RNN A;  2HHF A;  1VEW A;  3H1H H;  2DYR C;  4KL1 A;  4J9Y B;  3N2G B;  4LNU B;  2ZT9 B;  5K2M A;  2UVU A;  2R84 A;  4ZIB A;  4MTE A;  4WFE A;  4AIL C;  3M9M B;  5F2V O;  2O03 A;  4MSW C;  3CHX A;  1ZWI C;  5IYZ B;  5TIS Z;  2YW2 A;  5KG7 A;  3L2P A;  2EJ2 A;  2ITC C;  1Y1V A;  2HJD A;  3K5L A;  4NLG A;  3ZIA G;  5KT6 A;  2WLK A;  2XAQ A;  4ZKI A;  4R7C A;  2MW2 B;  4OGQ B;  2CKZ B;  1IXM A;  4A2B A;  2EUL A;  1YVW A;  1GO3 F;  2ZE6 A;  2QWO B;  5FD5 A;  2OH2 A;  3NBZ B;  2UXC O;  2BTQ A;  4F50 A;  1EM1 A;  3HXL A;  5BWR A;  4Q44 A;  1WA8 A;  1QHT A;  3SJC C;  2DPI A;  1TVK A;  2F66 C;  4I50 B;  1IBM H;  2HVS A;  5EOY A;  5KAI Z;  4X88 A;  2YXL A;  5IT9 N;  4CMF A;  4JI0 H;  4EYI B;  4ED6 A;  5CMU A;  4OPH A;  4XDL A;  4DV7 O;  2LP7 A;  1S97 A;  5JUM A;  1S03 G;  1TUE B;  5KFZ A;  4TV8 A;  3G80 A;  1Z5W A;  3OTO B;  5B5E Z;  2ZM6 B;  4UCT A;  2FLN A;  1VF6 A;  3RIZ A;  2YCH A;  2DZD A;  2R9A A;  4O3R A;  4NXM B;  5B1A B;  5I60 A;  3NUA A;  2QB5 A;  2QM7 A;  4YR0 A;  1URF A;  4LF4 H;  4EGJ A;  3K3V A;  5KFP A;  2XHB A;  4L8J A;  3N8D A;  5D1P A;  5KHJ A;  1IBM B;  1KKC A;  1BS3 A;  3OR6 C;  1CKO A;  5KKN B;  4OX9 O;  1WPB A;  1N32 O;  3JD4 A;  2WAM A;  1K97 A;  3JZ6 A;  3CCM V;  5JVL A;  4YHH B;  3PW0 A;  2BCC H;  4DR6 O;  1ZAU A;  2BSK A;  5HBR B;  3RT3 C;  5FLX N;  1QVF U;  2ITD C;  2UU9 H;  3RJ0 A;  1KP2 A;  3DTG A;  3CYO A;  4RUA A;  3VNN A;  5IY5 B;  3V4S A;  1A9X A;  4JI6 B;  1KJI A;  1K34 A;  1C30 A;  1UC8 A;  1NZ6 A;  4RQF A;  2DWD C;  2AU0 A;  1IBK B;  1Q81 W;  1XMQ H;  1A3G A;  4LH6 A;  5JQW A;  4O4L B;  2YIC A;  3CP1 A;  4I0X A;  5B66 Z;  4FM1 A;  3TIN A;  5KFK A;  2GPS A;  4QSH A;  5KFG A;  2Y4U A;  2R7K A;  2IM9 A;  2ZXW C;  3U11 A;  3HKB B;  4LFA H;  4ZHQ B;  1AR5 A;  4RB0 A;  2XAH A;  3JAR B;  5H5N A;  4LF7 B;  3H3V H;  2VA2 A;  5KT7 A;  1GSH A;  1DF4 A;  2UXD H;  2RCV A;  5B1B B;  4QWB A;  5LGT A;  2ZCE A;  2XT9 A;  5DM6 V;  2NU8 B;  1SQX H;  1MSD A;  4DUZ O;  1L0L H;  1VQ5 V;  3QO5 A;  2QM8 A;  2JK5 C;  2JA5 A;  2IMW P;  4CS4 A;  3B09 A;  2W0F C;  2UUB B;  2AXT Z;  4LFB B;  3Q1K A;  1F23 A;  5T14 A;  4K0K B;  1NR7 A;  2WLJ A;  3DTF A;  1R6N A;  4RAY A;  4DR7 H;  1WSC A;  1SES A;  4DV5 B;  2QK4 A;  5B1A C;  4RCN A;  1I0H A;  4DR3 H;  1Q82 W;  3D3I A;  3T5H A;  4E4E A;  4CKE A;  4LH7 A;  3JAT A;  1OWT A;  3ZMU A;  4PA3 A;  3D36 C;  3OEE G;  3TXS A;  5FD6 A;  4CE5 A;  4PDM A;  4DR2 B;  5KFB A;  4FVM A;  5CE8 A;  1AN7 A;  4NYE A;  1XHX A;  2HLD G;  5JJJ B;  4XDJ A;  1YF2 A;  4B3M H;  3A0H Z;  5KT2 A;  4JYB A;  1N33 B;  2LQT A;  1R3I C;  1FYJ A;  3BY6 A;  5IYD O;  3UO3 A;  5EIB D;  5IY5 C;  2HHF B;  2R87 A;  4DV3 B;  1HR0 H;  1XRE A;  2XUM A;  2YC0 A;  4FLV A;  3FKI G;  1CQJ B;  1IBL B;  3ICX A;  3A0R A;  2IJK A;  4DL4 A;  4JV1 A;  3JAL A;  2JEU A;  3BHP A;  2HHH O;  1Y4M A;  3HKZ A;  5E79 Z;  3FB5 C;  2XAS A;  3MHH C;  2MCT A;  3H4D A;  3PO3 G;  2X6A A;  1EBO A;  1JKJ B;  4FK5 C;  4TQD A;  3AX6 A;  5CA0 F;  2YS6 A;  5CBH A;  3K5H A;  2Q2T A;  1XMO B;  2V1D A;  4MV9 A;  3TY8 A;  1CPY A;  1I3Q A;  3KHH A;  4DL7 A;  4PHZ A;  4X1I B;  1K9M W;  1DK1 A;  3MDS A;  2Z3Y A;  4I9W A;  4MV8 A;  3EYY A;  2VQE H;  1R3L C;  4YIO A;  3RYC A;  4Z2W A;  4FBT A;  1BCC H;  1WA8 B;  1I94 H;  5KFE A;  2CUG A;  5KFA A;  3GIM A;  1TVK B;  2R7Z G;  5DMX A;  3R23 A;  1RK5 A;  2RDI A;  1OBD A;  3EPI A;  4I55 A;  2NVX A;  5DGI A;  4DV2 O;  3WO1 A;  2XOK G;  4A3B G;  3AG4 B;  3QG5 A;  2R8G A;  2NLJ C;  3BCC H;  1B6S A;  4ED8 A;  2QYZ A;  4ECT A;  4DK0 A;  3K3P A;  1ZLZ A;  3HKD A;  1VQN V;  4A93 G;  4TV8 B;  4DLK A;  2JA6 A;  1I2K A;  3RVY A;  1NKD A;  1MOF A;  5KFJ A;  2A79 B;  3PJS K;  3LDE A;  1XEQ A;  3M99 B;  4GZR B;  2ZDG A;  3J80 W;  5CA0 A;  1AJQ A;  4DV1 B;  2J9G A;  4EEY A;  4RO2 A;  4DYL A;  4X65 B;  4BBR G;  4MVM A;  2WA3 A;  2COI A;  4UVC A;  5CR5 A;  3CCS V;  2UXX A;  4IWY A;  3CCE V;  2UUA O;  5DGH A;  1AB3 A;  4CKB A;  4DUY H;  5B1N A;  3VOU A;  4DV6 H;  1YHQ V;  1RYS A;  3RAQ A;  2BSK B;  2Y48 A;  5C8Y F;  1SA0 A;  4UCV A;  4LFC H;  1PP9 H;  1IOW A;  3N6X A;  1AIL A;  3T99 A;  4G28 B;  4LF6 B;  1CS0 A;  3VMM A;  5KT3 A;  4MV3 A;  5KFW A;  3DTU B;  4GKJ H;  4DRX A;  3AK1 A;  4HNA A;  5H9C A;  3OTO O;  4PZ6 A;  1QQC A;  3M9N B;  3TCU A;  1SFO A;  3E35 A;  4FLZ A;  1X4T A;  4X1Y A;  5DQH A;  4I0X B;  3SYP A;  2UVV A;  1M9N A;  3O65 A;  3R5X A;  3SYC A;  4Q43 A;  3T9E A;  1R9T A;  5IP9 G;  3GTL A;  2BR0 A;  4J7Z A;  1IBM O;  2X6C A;  2B1G A;  2GUZ A;  3TQ1 A;  4LBE C;  1H2N A;  1GN4 A;  5D5P A;  1A48 A;  2GPW A;  3T5K A;  2R85 A;  3FAV A;  5HFM A;  1E4E A;  4JI0 O;  3TEK A;  2UXN A;  2YXH A;  4CC5 A;  4ED7 A;  3N40 P;  3H0G A;  1QVG U;  3OMN B;  3AG4 C;  2V4Q A;  1KTA A;  4G27 B;  5FNV F;  2PMZ E;  3MWD A;  3TK1 A;  4L1K A;  1WB7 A;  2GV9 A;  2FYU H;  3K79 A;  5C8Y A;  1P49 A;  3JD1 A;  3GV8 B;  2I8C A;  2M6Y A;  2FP4 B;  4A5U B;  2ASD A;  3AG2 B;  2P5O A;  3V6J A;  1VF6 C;  4DV4 B;  4CH6 A;  4LF4 O;  5L9X A;  3IG0 A;  1XOU A;  3V6K A;  1FFT B;  4UCS A;  5DED A;  4RAZ A;  3F8N A;  3N6R A;  3LP8 A;  3CX5 F;  2IBZ H;  1X59 A;  2L6L A;  3T1Y B;  2AW9 A;  3RTX A;  1PNM A;  1ZL8 A;  1P7B A;  3RR5 A;  2JGD B;  1FS0 G;  4YJ2 F;  3E83 A;  3ZMS A;  3S3W A;  3FKS G;  4O7V A;  4JTD B;  3M4I A;  3GB8 B;  2R82 A;  2UU9 O;  2ODM A;  2NNU A;  1CKN A;  4CMD A;  3CCU V;  1SQF A;  5KMG A;  4A2A A;  3VPC A;  2JEX A;  1XNR H;  2YZN A;  3HOX G;  4DV0 B;  2JEF A;  4HYO A;  4XBF A;  3C3S A;  2ZNJ A;  2JVD A;  3B8M A;  4CHI A;  4IR1 A;  5LMU H;  4DR1 H;  4FS1 A;  4KFM A;  1OJH A;  1XMQ O;  1VF7 A;  4QWE A;  3NC0 B;  4MW8 A;  2UUB O;  4ECV A;  1KJQ A;  5FNV A;  1XBL A;  1MAB G;  2NN4 A;  3JAL B;  4F6E A;  1VQK V;  2BQ3 A;  2EBO A;  3ABU A;  3JAK A;  2W9C A;  3S3X A;  4LFA O;  3MJF A;  1VF5 B;  4C5A A;  4BXX G;  1SEI A;  1JOY A;  4MTG A;  4WFG A;  3OUZ A;  2I87 A;  2BOC C;  3KRE A;  3P3N A;  1FVI A;  2UXD O;  3TII A;  2R92 G;  4I50 F;  4PA7 A;  3K59 A;  2JJ1 G;  3GVM A;  5C3E G;  3VQX A;  2HEP A;  4LF9 B;  3RYC B;  3TY5 A;  2Y0S E;  4YJ2 A;  2XD4 A;  3WWH A;  4I4T A;  2B63 G;  2JRI A;  2FMA A;  3BQ1 A;  5I5U A;  3ZRS A;  1VQ9 V;  4I55 B;  5JQG F;  3UZO A;  1N33 O;  1LUV A;  3SDL A;  3CXC U;  3KKY A;  4CS2 A;  2X0L A;  4AYB E;  1YIJ V;  4H37 A;  3B2E E;  4JI2 H;  4O3O A;  5CN0 A;  3CCV V;  1M6V A;  2V7Q G;  4DR7 O;  3HKD B;  1I50 A;  3AG2 C;  4TM5 A;  1G2W A;  2X6B A;  3KHR A;  1IBL O;  1BL8 A;  4DR3 O;  3K0G A;  4IL6 Z;  4CZZ A;  4GKK B;  1ZSP A;  1WP7 A;  4CH5 A;  3ETQ A;  1JFF A;  1XDC A;  3JAW A;  4QJF B;  1VP7 A;  3M9O B;  3GIJ A;  2P4V A;  1WH2 A;  2N74 A;  2CW8 A;  2YZG A;  5KG1 A;  4R8C A;  5CA0 B;  5I5W A;  2JGU A;  4DW0 A;  1OZ0 A;  5EDW A;  3OTF A;  5B1O A;  1O75 A;  3OE7 G;  1GN2 A;  4ZQI A;  4J7J A;  1ENV A;  1V4Y A;  3PFF A;  5GW7 A;  5J2T F;  1SQV H;  2YI8 A;  3KHL A;  3PW4 A;  3ZS8 C;  5IWA H;  1KBH A;  1HR0 O;  1KJJ A;  3QO8 A;  2ZR3 A;  4MV1 A;  2RDC A;  3OUS A;  1SA0 B;  3ZN0 A;  3K57 A;  2FPI B;  4TVI A;  1CKM A;  1I08 A;  3MR2 A;  5L3D A;  1DV2 A;  4PZ8 A;  1S5J A;  4NTY A;  3U9S A;  1W2B U;  2COG A;  5JQG A;  3OUF A;  3KAJ A;  1K73 W;  3SYO A;  2N05 A;  2X0S A;  4O4L F;  4DRX B;  4HNA B;  4IYI A;  1H8H G;  3N27 A;  1S77 D;  1W59 A;  2HR3 A;  2WPD G;  4X1Y B;  4GC7 A;  4ZHQ F;  1SCU B;  2CNQ A;  4FLT A;  2PI4 A;  1NH2 D;  1F4N A;  1BXR A;  2VQE O;  3VPD A;  1V9P A;  3CD6 V;  4C5B A;  2YIB D;  2Z04 A;  2WAQ E;  4RQE A;  1I94 O;  1PX2 A;  2R8I A;  4B3T B;  2V9W A;  2CAZ C;  2IJH A;  2BOB C;  2GTA A;  3LNM B;  5FPO A;  3F5T A;  4X62 H;  2GUZ B;  2R72 A;  1YIT V;  4O2B B;  3N41 B;  3SYQ A;  3C0F B;  1SRY A;  1YDX A;  1E4E B;  5KFD A;  4DR4 H;  4Q45 A;  4YXW G;  2UUC B;  3EFF K;  5L3E A;  5EBL C;  3HOV G;  3ZRV A;  5J2T A;  5B3S C;  1BGY H;  1XNQ H;  4P9O A;  5GON F;  1SKV A;  1GTO A;  3BFR A;  4JYA B;  5H6R A;  3PW5 A;  3TGU H;  4LF6 O;  4G2K A;  1BNC A;  5C8Y B;  5CBF A;  3HKC B;  3QFF A;  2LW1 A;  2WLM A;  3CRM A;  3ETE A;  3K04 A;  3CEB A;  4QIW F;  2CTP A;  4QW8 A;  2Q73 A;  4EKW A;  1GN6 A;  3RV4 A;  4RUC A;  1JMK C;  1Z2O X;  4NXN H;  2A06 H;  3BPZ A;  3LDD A;  2HHH H;  2XTA A;  1ZL8 B;  4YQW A;  4DUY O;  2CFM A;  3M8A A;  5EWE A;  4DV6 O;  4R50 A;  1MSW D;  3BAA A;  1J5E B;  1IYE A;  2H8P C;  3H9V A;  4LFC O;  1CKN B;  3V4Z A;  5K3W A;  4AQY B;  3OAA G;  3WB0 A;  5KMG B;  2AQ4 A;  1UC9 A;  1N8R W;  1G8M A;  1AI4 A;  1W93 A;  4IIJ F;  3OR7 C;  1HNW H;  4GKJ O;  3MR3 A;  3T1H B;  3OEH G;  5BWT A;  4JAU A;  3RB3 A;  4LF5 B;  1TAE A;  1WPX A;  2YID A;  4MT8 A;  3N44 B;  5FNV B;  5GON A;  1VS0 A;  5BWW A;  3MD0 A;  1K33 A;  4JV2 A;  1VBH A;  4J0M A;  3JAK B;  1JR9 A;  4B3S B;  2W9C B;  2JS3 A;  1QLN A;  5KG6 A;  4DL5 A;  2AGO A;  4X8A A;  4ED0 A;  3CC7 V;  3T5J A;  3CXH F;  4O84 A;  4QIW A;  5L3G A;  4RB3 C;  5DGB A;  4JZ2 A;  1M1K W;  3SPJ A;  1VBG A;  2RQ6 A;  3BRC A;  2WLN A;  3A2F A;  2IU0 A;  1V54 C;  3CEI A;  3ORQ A;  3JZF A;  1P84 F;  4YJ2 B;  2R70 A;  1KC8 W;  4IRD A;  4I4T B;  4MS2 A;  1M7J A;  3GJX B;  4FFR A;  1KJ9 A;  1NTZ H;  3P30 A;  1S10 A;  2WYO A;  4FLW A;  2ZIM A;  2OCH A;  1VQ7 V;  4LF8 B;  5KFI A;  5EWG A;  1Q6H A;  4IIJ A;  1JVM A;  1KJ8 A;  1L0N H;  3G6X A;  4BY1 G;  2IU3 A;  3K9A A;  4UUJ C;  5JJE B;  3CMA V;  2WB1 E;  2YU9 A;  1J95 A;  1EN5 A;  1OCO B;  1K3E A;  1GAX A;  1YJ9 V;  4I7H A;  2W6Q A;  3OTO H;  1JFF B;  1K5S A;  3JAW B;  3ABK C;  2ZM6 H;  2W7O A;  1R6T A;  3PR4 A;  1ET0 A;  1VIB A;  3TIG A;  3G6Y A;  2QM4 A;  4WFH A;  4NXM H;  4P30 A;  3U10 A;  4X1I A;  2IP4 A;  1XQ8 A;  2ZXW B;  1GSO A;  3QVN A;  5LA6 B;  4JI7 B;  3W1B A;  3SI8 A;  5KFH A;  2FTK A;  1XNR O;  2YZM A;  3ZMZ A;  4TQS A;  3OHB A;  3G71 V;  1RYR A;  4JI1 B;  3TQT A;  1H2K A;  4X64 B;  4O4H A;  5LMU O;  4DR1 O;  4QWC A;  3L4J A;  3CJH B;  5LP6 F;  5EK0 A;  3OW2 U;  1W96 A;  1ORQ C;  4C7U A;  5KLV H;  2JA7 A;  4YHH H;  3KTM A;  1WN7 A;  1M56 C;  1YEW A;  4GT1 A;  3QWU A;  5JQG B;  4Q4C A;  3T2M A;  4J11 A;  2YS8 A;  4FPP A;  4JI8 B;  5DAA A;  4RB2 C;  1FJG B;  5I5V A;  3JSN A;  5KA6 A;  4JI6 H;  2HGS A;  1XL4 A;  1Q6I A;  4O82 A;  4A3M G;  1S0V A;  3T9D A;  2C28 A;  2NR5 A;  1YSC A;  3LQS A;  1IBK H;  3MHS C;  2W6Z A;  1OCZ B;  3U0Z A;  5IP7 G;  1HWY A;  4O81 A;  5L1L A;  1AI5 A;  5KG0 A;  1EFR G;  4YBZ B;  2Q2U A;  3I4N G;  3I12 A;  1QLE B;  4XYM B;  3RB6 A;  4HAM A;  2M05 A;  1LNQ A;  3UCS C;  3NBY B;  3DAA A;  3IC7 A;  5A2Q W;  1B04 A;  1VQP V;  5ITZ A;  4JI2 O;  4DAA A;  3LML A;  1GGO A;  2CNU A;  2RF4 A;  4LF7 H;  2IW5 A;  2P6J A;  3E22 A;  3RBD A;  5J2T B;  3KZI Z;  3B8N A;  2YEV A;  2KSW A;  5KX5 A;  4WD3 A;  1Q3E A;  3QTC A;  5LP6 A;  1I1M A;  3SR2 C;  3VPB A;  1IXB A;  3CQZ A;  1N56 A;  3U55 A;  2P7T C;  1Y14 B;  1P8L A;  2ZGI A;  1JA8 A;  1B06 A;  1OCO C;  3KCX A;  3SJQ C;  1Y1V G;  2UUB H;  4LFB H;  5KFY A;  3RAX A;  2RJZ A;  4K0K H;  5LXT F;  5HNE A;  1N34 B;  4D7T A;  4DV5 H;  1M0W A;  2QEX V;  4TOI A;  3ZHR A;  4HQ6 A;  3CRA A;  5IYB O;  4F4X A;  3GIL A;  5IWA O;  3BVO A;  4MVZ A;  3E8F A;  2IJI A;  1R3J C;  3LNN A;  4A3J G;  2QTS A;  4ECU A;  5LL6 Y;  2GTS A;  4K8Z A;  2YZL A;  2F23 A;  3RYI A;  2FJZ A;  1TGO A;  4DR2 H;  2NUA B;  2CTQ A;  3KAL A;  2C2A A;  3L71 H;  4J9Q A;  1FFX A;  3ZJZ A;  1H8E G;  2PTM A;  3H1K H;  3T54 A;  2YIA A;  2R9R B;  2R7L A;  4Q8F A;  1E1R G;  1OV9 A;  1K8A W;  2FK3 A;  2IH1 C;  1N33 H;  1AI7 A;  2HJW A;  5GON B;  2CTW A;  2EJ3 A;  5BR8 B;  4FFO A;  2W0X A;  5I5T A;  4F4Z A;  4EBE A;  2ETN A;  4DV3 H;  1WCM A;  2P06 A;  3GIP A;  3M7M X;  1O9G A;  1ZHS A;  2E3C A;  1Y76 A;  3OHA A;  1IBL H;  3GLK A;  1OCZ C;  4A3L G;  1M90 W;  4X62 O;  3Q8R B;  4WFF A;  5KFV A;  2ASJ A;  1H2G A;  3AK2 A;  3HB3 B;  1I6U A;  2JGD A;  3IC9 A;  5FJ8 G;  5LXT A;  1Q43 A;  1QLE C;  1SET A;  3AG1 C;  3ZHT A;  4DR4 O;  2J6U A;  3L73 H;  1XMO H;  3IN5 A;  2Q69 A;  4B08 A;  4B3R B;  2Q0A A;  2OTJ V;  1JJ2 U;  4I55 F;  4FFB A;  5LYJ F;  1DAA A;  1KD1 W;  1XNQ O;  5I47 A;  1N48 A;  4B7E A;  2C00 A;  3F5W C;  3IFX A;  1UPG A;  4X9Q A;  3RGX A;  3DXR A;  2WSS G;  1GO3 E;  3BAB A;  4IWX A;  1EN4 A;  3FD9 A;  2CDY A;  1Q6U A;  4TUY A;  3T1H O;  5EBW C;  3MFI A;  1YJW V;  4O7R A;  3OGC C;  4RNM A;  4IIJ B;  4BW5 A;  2A9H A;  1N36 B;  2ASL A;  2JIZ G;  2PVP A;  2E75 B;  5E25 A;  4NXN O;  2JS5 A;  1KEC A;  1N0J A;  5F9N A;  5JCO A;  4BWS C;  3QF7 A;  1WP8 A;  4BR6 A;  1RM1 B;  4UCU A;  2RDJ A;  4FU0 A;  2QSA A;  3IAY A;  4MVU A;  2IBK A;  3C3T A;  4F6R A;  4U3J B;  1HNZ B;  4A3I G;  4G3I A;  2W6N A;  1KQS U;  1AP6 A;  1HNW O;  2BQU A;  2W9A A;  2CH7 A;  4DV1 H;  4O4H B;  4O7N A;  4X65 H;  3ETH A;  3H4B A;  4WFA V;  5LYJ A;  2PBZ A;  4O3S A;  3K5N A;  1I1K A;  3R5F A;  1P16 A;  3DGE A;  3GIQ A;  4D7S A;  4JI5 B;  3I4M G;  1H2L A;  3J7A U;  4FMT A;  4J9S A;  2JA5 G;  1CEZ A;  5K1X A;  1SQP H;  2M7W A;  1KUT A;  2VUM G;  5L1I A;  4A3G G;  1FKA H;  3X2Q B;  3TW6 A;  2VS0 A;  2E74 B;  3E8H A;  3U9T A;  1SQB H;  4KUM A;  1NJI W;  3QZ7 A;  2ADQ B;  4UFZ A;  3W7W A;  3HR0 A;  1FXH A;  1V55 B;  3DC5 A;  4LF6 H;  2R86 A;  3RB4 A;  4J42 A;  5EYP A;  5BMV F;  2KQX A;  4QJF A;  3A0B Z;  3FDS A;  1PL4 A;  5IE9 A;  4BW9 A;  2AZ0 A;  2PYJ A;  4O2B F;  4E2L A;  1GLV A;  4JI7 O;  4ZI7 F;  2WA4 A;  4RB1 A;  3OMI B;  3LWB A;  1Z2P X;  3RUP A;  1HP8 A;  1VQ6 V;  2ZDI A;  2DE0 X;  2HKO A;  3EVK A;  5ITZ B;  1RPR A;  2YSU B;  4B7K A;  5C93 A;  2PN1 A;  3E22 B;  3UT5 A;  2YEV B;  4DL2 A;  2EZO A;  2P67 A;  1RFY A;  1TUB A;  5BXZ A;  5IJ0 A;  5KX5 B;  4X66 B;  5LP6 B;  3NGD A;  2VRZ A;  5KFX A;  4PJ0 Z;  1ZTE A;  3B40 A;  4NYK A;  3K03 A;  5EC2 C;  3T7A A;  1U97 A;  2UXB B;  4JI4 B;  2ZM6 O;  2WDT A;  3HKE A;  2WLI B;  5FR9 A;  1RM1 C;  5I5X A;  4UVB A;  3JCZ A;  4IAJ A;  4NXM O;  1XIL A;  3WWI A;  1LUW A;  4DV4 H;  5D1O A;  2OTL V;  3HKZ E;  5IT9 W;  4YP3 A;  3CCR V;  5BMV A;  3THO A;  3HB9 A;  1G4Y B;  4JZG A;  3D8C A;  2VQF B;  3RVZ A;  4NZM A;  3T1Y H;  4IR9 A;  3GTJ A;  4O2B A;  3HOU G;  4YHH O;  4LP8 A;  2W57 A;  4Q8E A;  4WFB V;  3U0G A;  3GWK C;  4ZI7 A;  3RYI B;  1BE3 H;  4NVP A;  1NVP B;  3AW8 A;  1K4C C;  3H1J H;  3GTM A;  4U6P A;  1FFX B;  4PDR A;  3L9D A;  5KFM A;  4TT3 G;  4APM A;  1OCR B;  3X2Q C;  3GWO A;  2HVR A;  4KXR A;  4DV0 H;  4JI6 O;  4I5S A;  4LMY A;  1L1F A;  5CA3 A;  3HKC A;  4M7E A;  5EBM C;  3BA9 A;  2CQY A;  5FLM G;  1WJZ A;  4M0J A;  1R1B A;  2XAF A;  2R92 A;  1V55 C;  1IBK O;  2HIV A;  3F7V C;  1N0N A;  4J9P A;  1B33 N;  2HFE C;  5AG2 A;  2YWV A;  1PPJ H;  4RAI A;  2B63 A;  1Y76 B;  3GB7 C;  2DPJ A;  1Z2G A;  2KB1 A;  2HGW A;  1K5Q A;  3I56 V;  3JSL A;  4MVR A;  2E5L B;  3KCY A;  4UV8 A;  5L3F A;  4JAA A;  4H44 B;  1S0O A;  1F4M A;  4LCU C;  2V58 A;  1YCI A;  5LXT B;  4DR5 B;  4I4T F;  1KBL A;  3J81 W;  4LF7 O;  4EG0 A;  1O9H A;  3ZX6 A;  3JD0 A;  5LL6 b;  4FFB B;  1QBZ A;  2AZ2 A;  4MAM A;  1HNX B;  4GX5 A;  5KFS A;  4LF9 H;  3LSS A;  5LMN H;  3DXR B;  3QQM A;  2HIX A;  3OD4 A;  2DMX A;  2UVR A;  4TUY B;  5LP6 C;  2IA6 A;  4JI3 B;  1NR1 A;  1EKP A;  5L1K A;  1GYF A;  1XK5 A;  1I5Y A;  4LFB O;  3APQ A;  1A0I A;  2HP8 A;  5BWU A;  2VR1 A;  5BWX A;  4K0K O;  2QDO A;  1QNM A;  4EFB A;  1VQL V;  3WO0 A;  1IZ3 A;  1E4G T;  4PA6 A;  4DV5 O;  1MZF A;  3MFH A;  1PV0 A;  2GQS A;  4GKK H;  2F93 B;  5LA6 F;  4WCE V;  4FBU A;  1R6K A;  2OT5 A;  1A32 A;  5DQG A;  4QE7 A;  4F6R B;  5KG5 A;  5IYB G;  2ZD9 A;  3N2K A;  4W4K A;  3ZRX A;  4ECS A;  5LGN A;  3ZMV A;  3S24 A;  4DR2 O;  1SYX B;  5HV6 A;  5LMN B;  1VQ8 V;  5JVD F;  4YY3 B;  2CH7 B;  4Q6G A;  1NT2 B;  3H0G G;  1YJN V;  2A3Q A; 
#chains in the Genus database with same CATH homology
 3RYH A;  5LYJ B;  2VQF H;  4UCR A;  4MV7 A;  3RFR A;  2EX3 A;  4ZOL A;  1IBK B;  4LF5 B;  5IJ9 B;  1TAE A;  1XMQ H;  4HBN A;  4LH6 A;  3N44 B;  1SQG A;  5FNV B;  5GON A;  1VS0 A;  4O4L B;  2VQE B;  2UXC B;  3BA8 A;  3SJB C;  4FM1 A;  4X1K A;  4X20 A;  1I94 B;  4J0M A;  3JAK B;  4B3S B;  4YJ3 B;  2IM9 A;  4TV9 B;  3U11 A;  3HKB B;  4LFA H;  4ZHQ B;  4RB3 C;  5EYP B;  4RB0 A;  3JAR B;  4LF7 B;  2RQ6 A;  3BRC A;  2ZNI A;  3A2F A;  2UXD H;  3VQY A;  3KYH C;  5LA6 A;  4DV7 B;  3JAS A;  4YJ2 B;  2R70 A;  4GYC B;  4LSA A;  2ZCE A;  4I4T B;  2Q7E A;  5CA1 B;  3GJX B;  3N42 B;  2YI9 A;  4B3T H;  2WYO A;  4FLW A;  2ZIM A;  4O2A B;  2E5L H;  4LF8 B;  4CS4 A;  4I9Q A;  2UUB B;  5JVD A;  4LFB B;  4DR5 H;  3UT5 B;  4IIJ A;  4AHC A;  4K0K B;  5IJ0 B;  1TUB B;  4RAY A;  4DR7 H;  2UUC H;  5JJE B;  4DV5 B;  1HNX H;  4DR3 H;  3RYF B;  4I7H A;  4R7R A;  5JCO C;  4JYA H;  5JJN B;  4DUY B;  4OX9 B;  3HKE B;  1N32 B;  4LH7 A;  3JAT A;  1JFF B;  3JAW B;  1XHZ A;  3SGI A;  4DV6 B;  3OTO H;  2ZM6 H;  4JI3 H;  4DR6 B;  5J2U A;  4LFC B;  5FD6 A;  2QM4 A;  5D1O B;  4NXM H;  3U10 A;  4DR2 B;  3TY9 A;  4FVM A;  4X1I A;  1XQ8 A;  1AN7 A;  5LA6 B;  3W1B A;  4JI7 B;  1XHX A;  5FLX W;  5BMV B;  5JJJ B;  4GKJ B;  2ZJT A;  3CSX A;  1RSO A;  4B3M H;  4JI1 B;  4CS3 A;  1T5E A;  1N33 B;  2VPS A;  4X64 B;  4O4H A;  3L4J A;  4WBN A;  4EB6 A;  2QJ1 A;  5EIB D;  4ZI7 B;  4EFE A;  3N43 B;  4DV3 B;  4YHH H;  1HR0 H;  4ETS A;  4CC6 A;  1WN7 A;  4FLV A;  1YEW A;  3QWU A;  1J5E H;  5JQG B;  1IBL B;  5KHH A;  3ICX A;  4AQY H;  1M0T A;  3JAL A;  2Q7G A;  3BHP A;  4JI8 B;  4O4I B;  4RB2 C;  4YY3 H;  2MCT A;  1FJG B;  2VUG A;  3JSN A;  3K58 A;  4O4J A;  4TQD A;  3JAT B;  3T1H H;  2KKW A;  2Q7H A;  1Z2N X;  4JI6 H;  2HGS A;  2Q2T A;  1XMO B;  4MV9 A;  3TY8 A;  1IBK H;  4LF5 H;  4PHZ A;  4FM9 A;  4X1I B;  3U0Z A;  3EYY A;  2P22 C;  3RF2 A;  2VQE H;  2UXC H;  3RYC A;  4DUZ B;  1I94 H;  4B3S H;  2ZIN A;  2Q2U A;  1TVK B;  4PDB A;  3DF7 A;  4CH4 A;  4I55 A;  3NBY B;  3GDE A;  2HVQ A;  5A2Q W;  1B04 A;  5ITZ A;  3LML A;  3QG5 A;  4KHP H;  4LF7 H;  3E22 A;  5J2T B;  1HW7 A;  2KSW A;  4DK0 A;  3HKD A;  5KX5 A;  1Q3E A;  3QTC A;  5LP6 A;  3SR2 C;  4TV8 B;  4DV7 H;  4MTD A;  1P8L A;  3FMA A;  5EIB C;  4RZQ A;  2RGV A;  4LF8 H;  1XI1 A;  2UUB H;  4LFB H;  1H2S B;  2F1M A;  2XIG A;  2RJZ A;  4K0K H;  1XNR B;  3J80 W;  5CA0 A;  1N34 B;  4DV1 B;  4D7T A;  4X65 B;  4E6N A;  4DV5 H;  1M0W A;  4TOI A;  5LMU B;  4DR1 B;  2PY5 A;  4DUY H;  4OX9 H;  4KHP B;  1N32 H;  4PI2 A;  3LNN A;  3N2K B;  5CB4 A;  2YIB A;  4DV6 H;  1MZB A;  4K8Z A;  4DR6 H;  3KAK A;  3RYI A;  1SA0 A;  4UCV A;  2VWK A;  3N2G A;  4LNU A;  3CVZ A;  4LFC H;  1TGO A;  4DR2 H;  1Q8I A;  3N6X A;  3KAL A;  4JI7 H;  1FFX A;  5EZY B;  4LF6 B;  2PTM A;  2YIA A;  4LSX A;  3RYH B;  1X9N A;  4DRX A;  4GKJ H;  5IYZ A;  4HNA A;  4PZ6 A;  4JI1 H;  1N33 H;  4ZOL B;  4X64 H;  1QQC A;  3KXY T;  2OWO A;  5GON B;  1XDN A;  4FLZ A;  5BR8 B;  1X4T A;  4X1Y A;  4BWA A;  2F95 B;  4DV3 H;  4X1K B;  4X20 B;  4GLX A;  1KU9 A;  3M7M X;  4TQF A;  1O9G A;  1ZHS A;  2E3C A;  5K1P A;  1IBL H;  1E4F T;  3MWM A;  4JV5 B;  4JI8 H;  1I6U A;  1FJG H;  4I50 A;  4DV2 B;  4JI2 B;  5JH7 A;  5LXT A;  1Q43 A;  5D5P A;  4U3J A;  1XMO H;  5FPR A;  4B08 A;  4B3R B;  2Q0A A;  4CC5 A;  4FFB A;  3N40 P;  3JAS B;  2PZS A;  3RGX A;  4DUZ H;  3BAB A;  2GV9 A;  4K8X A;  4TUY A;  5C8Y A;  1P49 A;  2PYL A;  5JVD B;  5KHG A;  2P5O A;  4IIJ B;  4DV4 B;  5KHI A;  1ZHQ A;  4IHJ A;  4FLY A;  1N36 B;  4CH6 A;  1KMI Z;  4PZ7 A;  3IG0 A;  4UCS A;  4RAZ A;  2JS5 A;  5LOV A;  5DIS C;  3F8N A;  5JCO A;  4BWS C;  3QF7 A;  4FM2 A;  4UCU A;  4FLU A;  3T1Y B;  3RGB A;  1TA8 A;  3RTX A;  1M5I A;  1Z5V A;  3IAY A;  3RR5 A;  5IWA B;  2UUA B;  2CW7 A;  5J2U B;  3FFQ A;  4UCO A;  3K5M A;  4F6R A;  2VOB A;  4U3J B;  1HNZ B;  3M4I A;  3GB8 B;  1CKN A;  1SQF A;  5KMG A;  4A2A A;  3RGZ A;  5D5Q A;  1XNR H;  3WB1 A;  4DV0 B;  1N34 H;  4DV1 H;  4O4H B;  4X65 H;  4WBN B;  2ZNJ A;  2JVD A;  5LMU H;  4EB6 B;  5LYJ A;  4DR1 H;  4CH3 A;  3K5N A;  1P16 A;  1VF7 A;  3J7A K;  2RGR A;  3NC0 B;  3JAM W;  4D7S A;  4JI5 B;  5IJ9 A;  3L4K A;  3H20 A;  5K1X A;  5FNV A;  2WE6 A;  4EEQ A;  1FKA H;  4O4L A;  1WNS A;  3JAL B;  4FM0 A;  4DRF A;  3JAK A;  4UFZ A;  4YJ3 A;  1BGW A;  4X62 B;  4O4J B;  2FE3 A;  4LF6 H;  3HKB A;  4ZHQ A;  1SEI A;  5EYP A;  4DR4 B;  3DSQ A;  3JAR A;  3W5O A;  3SJA C;  2V4D A;  4JI0 B;  1FVI A;  4BW9 A;  3K59 A;  5BR8 H;  1XNQ B;  3VQX A;  2HEP A;  2PGG A;  2PYJ A;  3RYC B;  4LF9 B;  1Q5O A;  3TY5 A;  4YJ2 A;  4I4T A;  5CA1 A;  1L2Z A;  4RB1 A;  1Z2P X;  4JV5 H;  4I55 B;  4O2A A;  4CS2 A;  5ITZ B;  4DK1 A;  3MAQ A;  4DV2 H;  3B2E E;  4JI2 H;  3E22 B;  3UT5 A;  4LF4 B;  4NXN B;  3VQW A;  1BJT A;  5IJ0 A;  3HKD B;  5KX5 B;  1TUB A;  3ZED A;  1L8D A;  4X66 B;  2HHH B;  4B3R H;  5LP6 B;  2ZIO A;  4GKK B;  4FLX A;  2VWJ A;  3RYF A;  2UXB B;  4JI4 B;  4CH5 A;  1D5A A;  3HKE A;  3ETQ A;  3RWR D;  3PN1 A;  2WDT A;  1JFF A;  3JAW A;  4IAJ A;  1WH2 A;  2UU9 B;  2CW8 A;  1M4U A;  4DV4 H;  5D1O A;  1N36 H;  1DGS A;  5CA0 B;  5IT9 W;  2JGU A;  1HNW B;  3OTF A;  5BMV A;  1O75 A;  3THO A;  2VQF B;  2F4V H;  3T1Y H;  2PUS A;  4Q0Y A;  1XMQ B;  2YI8 A;  5CB4 B;  3ZS8 C;  4O2B A;  5IWA H;  2UUA H;  2W57 A;  4ZI7 A;  3RYI B;  1SA0 B;  4KL1 A;  1M93 A;  4NVP A;  3K57 A;  3N2G B;  3K5O A;  4LNU B;  1CKM A;  1HNZ H;  4PZ8 A;  1S5J A;  4ZIB A;  4MTE A;  5JQG A;  4AIL C;  3KAJ A;  1FFX B;  2O03 A;  4LFA B;  4APM A;  3CHX A;  4O4I A;  4DRX B;  5IYZ B;  4HNA B;  2HVR A;  4DV0 H;  4LMY A;  3L2P A;  4M7E A;  3HKC A;  3K5L A;  3BA9 A;  1JJO A;  2HIV A;  4X1Y B;  4A2B A;  2UXD B;  4FLT A;  4JI5 H;  5FD5 A;  3VQV A;  1V9P A;  3NBZ B;  2BTQ A;  2YIB D;  2F4V B;  4EQ5 A;  3W1G A;  3HXL A;  4B3T B;  3UQ8 A;  2CAZ C;  1QHT A;  3JSL A;  3SJC C;  2E5L B;  5FPO A;  1TVK A;  4X62 H;  2F66 C;  4I50 B;  2R72 A;  1IBM H;  5JH7 B;  5LXT B;  4O2B B;  4DR5 B;  2HVS A;  3N41 B;  5EOY A;  3J81 W;  3C0F B;  1O9H A;  2YXL A;  4DR4 H;  5LL6 b;  4DR7 B;  4FFB B;  2UUC B;  1I7F A;  1G6U A;  5KHK A;  4JI0 H;  5J2T A;  1HNX B;  4DR3 B;  1XNQ H;  1S03 G;  2BTO A;  4LF9 H;  1SKV A;  5LMN H;  4JYA B;  4TV8 A;  2HIX A;  1Z5W A;  3OTO B;  1S68 A;  4TUY B;  5C8Y B;  4UCT A;  5LP6 C;  2ZM6 B;  3RIZ A;  2YCH A;  4JI3 B;  3HKC B;  1GYF A;  1XK5 A;  2R9A A;  4NXM B;  3CB2 A;  4IHJ B;  1A0I A;  2BTQ B;  5LOV B;  4LF4 H;  1JMK C;  4EFB A;  1Z2O X;  1E4G T;  4NXN H;  3BPZ A;  3K3V A;  4B3M B;  4PI0 A;  2XHB A;  4X66 H;  2HHH H;  4L8J A;  5D1P A;  5KHJ A;  1IBM B;  1CKO A;  4TV9 A;  4GKK H;  2F93 B;  2OYQ A;  1WPB A;  2CFM A;  2UXB H;  4JI4 H;  4LR3 A;  4YHH B;  1HR0 B;  4F6R B;  3WB2 A;  3N2K A;  3BAA A;  1J5E B;  1ZAU A;  3S24 A;  1CKN B;  4AQY B;  3WB0 A;  1SYX B;  5LMN B;  5KMG B;  2UU9 H;  3RJ0 A;  4YY3 B;  4Q6G A;  1NT2 B;  3VNN A;  1HNW H;  5EZY A;  3T1H B;  4JI6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...