4LH7A

Crystal structure of a liga inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
321
structure length
321
Chain Sequence
b'EQQPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Identification through structure-based methods of a bacterial NAD(+)-dependent DNA ligase inhibitor that avoids known resistance mutations.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase/ligase inhibitor
total genus 111
structure length 321
sequence length 321
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4lh7A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4lh7A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lh7A02
4LF9B 4X64B 4EFEA 3W5OA 4DV7B 4B3MB 4DV1B 4B3RB 4CC6A 2Q2TA 4X66B 1XK5A 3GDEA 1N33B 5IWAB 3NBZB 3TY5A 2CFMA 4B3SB 1HNZB 4DR7B 4NXMB 4UCSA 1P8LA 4CC5A 3S24A 4JI7B 4KHPB 4UCTA 4GLXA 1XDNA 1DGSA 4X65B 4B3TB 4UCVA 2UXDB 1VS0A 4JI5B 3RR5A 3T1HB 3GB8B 3NC0B 4GKKB 3GJXB 3QWUA 4DV6B 4DV4B 1P16A 2UUCB 4JI1B 1XMQB 1I94B 4LF8B 3TY8A 4UCOA 1N34B 5D1OA 2HIXA 1N36B 5D1PA 4DR4B 3VNNA 5FPRA 2UXCB 4PZ8A 4AQYB 5D1OB 4DV3B 2UU9B 1ZAUA 1XMOB 4NXNB 2HVRA 4JI6B 3BAAA 5LMNB 1FVIA 4LF4B 3TY9A 1X9NA 4LF5B 2F4VB 5LMUB 4OX9B 1XNQB 4EEQA 4YY3B 3W1GA 3OTOB 4DV2B 1HR0B 1FJGB 4LFAB 3RTXA 1TA8A 4DR2B 3BABA 4UFZA 1N32B 2HHHB 4LF6B 2VUGA 1A0IA 3SGIA 1XNRB 5FPOA 4JI3B 1CKMA 3JSNA 4YHHB 2UUBB 3BA9A 3KYHC 2ZM6B 4EQ5A 3NBYB 3UQ8A 4DUYB 4UCRA 2HVSA 4DR1B 2UUAB 3JSLA 2E5LB 4K0KB 1J5EB 2Q2UA 3W1BA 4TOIA 2VQEB 4DUZB 1CKNA 4PZ7A 3PN1A 4DR6B 2HIVA 1CKNB 1IBLB 4E6NA 3T1YB 4PZ6A 4EFBA 4GKJB 3L2PA 1HNWB 1IBMB 4DV0B 1HNXB 1S68A 4DR3B 2OWOA 4DRFA 4LF7B 5DISC 4LFCB 4DV5B 2HVQA 1B04A 3BA8A 4JI8B 2VQFB 1IBKB 4LFBB 2UXBB 1CKOA 4JI0B 1V9PA 1TAEA 5BR8B 4UCUA 4LH6A 4X62B 4JI4B 4DR5B 4JI2B 4JYAB 4LH7A 4JV5B
chains in the Genus database with same CATH superfamily
2Q6AA 1QVFU 1Q8IA 2W6NA 1XDCA 5BWUA 2JEGA 5LGNA 2W6OA 1I08A 4LFCH 5J2UA 2W70A 1JPXA 5CA3A 1N33B 2VWJA 4RZRA 4ED8A 2FKXA 1FKAO 4B3SB 1FXKA 1KEEA 4I4TA 4J9KA 1XUQA 4KHPB 1JDBB 4GLXA 2UUCH 1IOVA 2VQEO 4C5BA 1RJQA 3RGXA 3C0FB 3VMMA 2YXLA 4D7SA 2YZLA 4F4WA 3E22B 1JR9A 5KFZA 2RJZA 4UVCA 3TK1A 2HVJC 3GJXB 1DV2A 5I5VA 4JTDB 4JI1B 1M90W 2X0LA 3PW5A 1S10A 3JZFA 2DE0X 1RK5A 1A48A 1OWTA 4CMDA 2VQFO 3JAMW 5LHGA 4HBNA 5LYJB 3RIZA 5CBGA 2JGDA 1WSCA 5D1OB 2HVRA 1UPGA 1NH2B 1AR1B 3DXRB 1JCHA 5C4XG 1TVKB 1FAFA 2Y0PA 3CXHF 4DRXB 3QO8A 4ECSA 1I1MA 1V55B 1SYXB 4BAYA 2MCTA 1Z2GA 4LCUC 3RYCB 2KSDA 1VQ7V 1CE8A 4U7NA 1YSCA 3N8DA 3CRRA 1I7NA 4UVAA 2W6JG 5LOVB 5EWGA 2ZDIA 4ECWA 4Q4CA 4RB0A 5KX5A 1VQ6V 3BEHA 3E8FA 3ZRXA 3K3VA 3T5HA 2I87A 2NN4A 1Y74B 5CR5A 4EQ5A 4YJ2F 1B06A 5KHJA 5C8YB 3UQ8A 2R8IA 3J7AU 1VF6A 2ATLA 1YI2V 1NTMH 3OW2U 1N36O 1J5EB 3Q8RB 1CP9A 4FM0A 2FMAA 3BCCH 4TOIA 4E4TA 2H3OA 2V9WA 3MAQA 3BHPA 2YWVA 3E8HA 4DR6B 3T1YB 1WR2A 2CUGA 3C90A 2P67A 4JI0H 3L2PA 3RAXA 4AYBE 1NVPD 4DRFA 4LF7B 3N6XA 2Y69C 2XCAA 2BTQB 5EDWA 1M56C 2O03A 3PO3G 2EILB 1SQXH 2MW2B 3ABMC 4PI2A 2A0LA 4X8AA 1Q82W 4UB6Z 4DUYO 4B3MB 3AG1C 1ZWIC 3CMEV 3K57A 2QM8A 2DYRB 3CXCU 4NZNA 1E79G 2GBOA 4U3FH 3BRCA 3N2GA 4QIWA 5DGAA 1TGOA 5L3CA 4GKKH 1AB3A 4NXMB 4JZGA 1L1FA 4X62H 3PR4A 2CNUA 2W8KA 1VQMV 2JEXA 4PDBA 4PA9A 2Q69A 1IVSA 2QDOA 1AJQA 2GDSA 5B3SB 1FPOA 1WA8A 4IHJB 5EOYA 4JAAA 2DMXA 4QWBA 1I94B 2HGXA 4JI6H 5IY5B 3FAVA 2DYSC 1AI5A 4L87A 4LWSB 4YJ2B 5LMUH 3X2QB 5L9XA 4Z1VA 4BY7G 3NGDA 1NT2B 3JD3A 3U10A 1R3KC 4LP8A 4X64O 2HJWA 3T9EA 3L72H 4UV8A 4QWCA 3T1CA 4LF5B 2F4VB 3T9BA 1XNQB 2R93A 1KC7A 3EFFK 5FR9A 3JZ6A 1ZSPA 4FBUA 2W6QA 1FJGB 4Y8VB 3GIPA 1XNRH 4L1KA 4YHHH 4MTXA 1N56A 3B4SA 5C93A 3H0GG 1H2MA 3H1JH 3F8NA 5B5EZ 4NZOA 4ED2A 3ZMZA 4J9YB 1N4CA 4ZHQA 2XD4A 4Q0YA 1KMIZ 2ZE6A 2XIGA 3E2EA 5KFSA 2ZM6B 3NBYB 2C2RA 1W93A 4DXWA 1OBGA 3JCZA 4DL7A 2UXCO 1BMFG 5H6RA 2DLNA 1IXMA 4FPPA 1SA0B 3OAAG 4FGRA 1CKNA 3L71H 1HNXH 4PZ7A 2C2AA 4JUZA 3RB3A 2XGQA 5BZBA 1MZFA 2AHYA 3CCSV 1YEWA 1L0NH 2I8CA 1B6SA 2JJ1G 4RCNA 4KFMA 5EZYA 1S68A 4O4HF 1NR1A 4X1KA 2Z02A 4MA0A 4MVOA 2CK3G 3UZOA 3G6VA 4IZOA 4TV9F 3CEBA 2V59A 4O2AF 3ZHSA 1KJ9A 5JJEB 2Y0SE 2QK4A 4PDMA 1A9XA 4QWAA 2W57A 3H1LH 2XAGA 4I7ZB 5EBWC 4JI2B 4DR7H 3CYOA 2ZQMA 2LO1A 4JI7H 3V6JA 1K5SA 3LSUA 3UKMA 2VUMG 1KBLA 4CC6A 5EC2C 2EBOA 2BTOA 1RYRA 4O4IA 3T1HH 2AQ4A 1KD1W 3B77A 2VRZA 2RNBA 2F43G 1PKXA 4A3MG 4XZ3B 1UNNC 4JYAH 3K5HA 2BOCC 3G6EV 3N43B 1IBLO 4GYCB 1IYEA 1FFXA 3JATA 3RWRD 1YZBA 4DV6B 4DR4H 2E75B 5IYBO 3DGEA 4DV4B 3CCVV 1Y6XA 1BGYH 3A0BZ 1XMQB 2BOBC 2VS0A 3K5MA 3BVOA 2F23A 1D5AA 2ZNIA 4ZBMA 2M7WA 1GYFA 2M6YA 4CS2A 2Q68A 4Q6GA 1LNQA 3TCUA 2LW1A 1T36A 3EPIA 4NXNB 1GM9A 2EINC 3TEKA 4M9UA 4FFRA 4BWAA 3M7MX 4JASA 4ASUG 1EKPA 1X9NA 4CH5A 5I60A 4I5SA 3IG0A 4IWXA 2OCHA 1K9MW 4P9OA 2YZMA 2W6PA 3ETGA 3D36C 1HR0B 5KFVA 4K6NA 4U7OA 2ADPA 1QVGU 1E4EA 5B1AC 4NTWA 3J81W 2LW7A 3MHSC 2UXDO 1DF5A 3R5XA 1N32B 3GV5B 4O4HB 1SESA 1GGOA 2GTSA 4J9NA 4R6ZA 3U11A 4JF3A 2ODMA 1F4NA 5CMUA 4O2AB 3H1KH 4A3CG 4J9QA 2KG7B 1JFFA 4UCRA 5E79Z 4PA4A 5H2FZ 2HVSA 5KFJA 2WA4A 1K1SA 3HB9A 5JJJB 1XMOO 4JAVA 2W0FC 4MSWC 3VA7A 4DR3H 4MTEA 5KFMA 3OMAB 2NU8B 3RBEA 2RN9A 2EJ7A 4YY3O 2JA7G 4DV2O 1O9HA 3VBBA 3DF7A 1VMGA 3K3WA 4F4LA 3IFXA 3HKBB 2HHFA 4IIJA 3LSQA 2D3OW 2FLLA 4DV5B 4KL1A 1V55C 3ZHRA 4PA6A 2UXBB 4WCEV 1KUTA 5CN0A 3KG2A 1GO3E 1N33H 3WG7C 4CS4A 4CE5A 4B3SH 1WPBA 5LP6A 5DGIA 2HG8A 4KHPH 4LF9B 3HKCB 4EBDA 1AI4A 3ZRWB 4Q4DA 3T5JA 1RJPA 1MZBA 3E89A 5KFRA 5IWAB 2XGPA 1T5EA 2QWOB 1HR0O 5DQHA 5IYZA 2YIBD 4APMA 4JI1H 1NR7A 3L74H 3SYOA 3KHLA 3PW0A 3LDCA 1KC8W 5GONF 3FB6C 3CE2A 2NVXA 3RUPA 3H4BA 3M9MB 4ZKIA 4LF8B 1BJTA 1YJ9V 3M4IA 4QPJA 1N34B 1RFYA 1MMMA 1Z2NX 1T3NA 4PI0A 4YQWA 4JI4O 1NKDA 3CC4V 3HBLA 4PELA 2XAQA 4JV5O 5LMNB 3SI8A 5JQGF 2CDYA 3RYFB 2XAFA 4C2MA 4EEQA 1H2SB 3ZHTA 2R7ZG 1O75A 4JTCB 1RM1B 1S5LZ 3E8GA 4A3IG 5EYPA 3VOTA 3GTMA 2DYRC 4BY1G 3W7SA 4LF6B 1A0IA 1TWHA 1VF5B 2WLJA 5CA0B 5L3BA 1KT8A 2ZE7A 1R9TA 2DQ3A 2UUBB 1J5EH 3BA9A 1QR9A 5LA6F 2QB5A 4MA5A 5I5TA 3APQA 1W96A 2JIZG 4LF9O 3K5IA 2W9CB 3IGAC 2YCHA 1Q6IA 4ZI7A 5A9GA 5L1JA 4DR6H 3D8CA 5B3SC 2CAZC 2WE6A 2E5LB 2V58A 3T1YH 5IWAO 1BSMA 3GTJA 3AG3B 3SYCA 3A0HZ 4DV3O 1M7JA 3I4MG 5IY5C 4HN2A 3BACA 4LF7H 3L4JA 4J9MA 4RAYA 4DL3A 2IJHA 1PL4A 1BCCH 1KUQA 3X2QC 1NI8A 1YVWA 1AI6A 5L3DA 4NVPA 3APOA 1I5YA 2R7MA 4EFBA 3WWJA 1I2LA 5CA1F 5KFPA 1URFA 1MABG 1KECA 2N05A 4DR2O 3CJHA 5FD5A 5KG3A 4RNOA 4GX1A 5ITZB 4Q45A 3PW4A 4DL4A 3JD4A 4B3MH 5IYCO 3LDEA 3PR5B 2CTWA 4NXMH 5L1IA 3WFVA 4FM1A 3PW2A 1QR8A 3M99B 2EJ3A 1OZ0A 4IYIA 1GTOA 2NU7B 3V6KA 2N04A 4WFEA 2P6JA 2B5UA 4DLKA 2WDTA 4I50A 2DYSB 2YI8A 5K2MA 3PW7A 2AZ2A 2WAQE 1CQJB 1K7DA 5GTIZ 3CRQA 3WB2A 2XC9A 4J7JA 2BR0A 3BY6A 2WYOA 3GILA 1I94H 4O84A 4UCVA 3VPBA 4JI5B 1M93A 3GB8B 1GRJA 1IOWA 2VR1A 2OT5A 3OMNB 1BE3H 4O7YA 1K4CC 4R7RA 2C28A 2IA6A 4IRKA 1IBMO 2EULA 5KUKA 5KMGA 4DV0O 4O7ZA 2WLLA 3RBZA 4GLWA 2YYAA 4ETSA 4J11A 3R9RA 3PO2G 5KS8A 5LA6B 4JI8O 4PWQA 4LFBO 4LF5H 2F4VH 5IJ9B 1XNQH 2HIXA 2JS5A 3ZMSA 1MNGA 4X62O 2R92G 4HAMA 4I7HA 4AQYB 3L70H 1Q6UA 1FJGH 3FKIA 2V5AA 4ECXA 2EIJB 3G8CA 3JARB 5BMVA 1FXVA 4CZZA 4H33A 4RUAA 2GPSA 1PD3A 4MTGA 3HKZA 4I9WA 5HFLA 5IYDO 5CE8A 2AGOA 5DG8A 1K4DC 2JEJA 1TA8A 3A8TA 3KTMA 3RVYA 2ZM6H 1L8DA 3WWHA 2YRXA 2W7PA 5CA1B 2C2EA 3SJQC 3ZRSA 4X65O 4X1YB 4O3NA 5DEDA 2WLIB 3WB1A 4MV1A 2BSKB 2IH3C 5FPOA 4JI3B 2CE4A 1R6KA 4YJ3A 1NU1H 1FYJA 1TWCA 3H0GA 3N40P 2HLDG 1BXRA 2ZINA 4OPHA 4Q43A 2XCPA 3K59A 1I7FA 1AI7A 1Q86W 4MVZA 1SCUB 2C22A 3WNZA 3RN4A 3GIQA 3OUFA 2W9BA 4E4EA 2UU9O 5KFNA 3AK3A 4O3SA 3GTGA 2VQEB 5JQWA 5KT3A 1COWG 1ZLZA 2AGQA 2R9RB 3MR5A 4GT1A 4ZOLB 3OTOO 3G4SV 4WBNF 2CKZB 1WCMG 1JQ0A 5IYCG 5JVDF 4U3JB 1OV9A 5IP7G 4JI2H 5FL7G 4O7TA 3J80N 5DISC 4R8UB 2DOSA 3LUTB 4DUZH 1QCEA 2VQFB 2FP4B 3TXSA 5C1OA 2HHHO 2R8JA 2Q0OC 4UXNA 3RB0A 3KZIZ 2EX3A 1YITV 4QW9A 5LYJA 1W0JG 3GIKA 4QPKA 2A06H 5BWXA 1Y1WG 4W4KA 3OR6C 4DR1O 4DQNA 3T9AA 4K0KO 2CFMA 4DRXA 5LOVF 1P8LA 4CC5A 4DV6H 4DV4H 3AK1A 3JASA 2C35B 3RYCA 1XMQH 1IURA 3RT3C 1XOUA 5HBRB 1DTOA 2CGOA 4JPRA 4LBEC 4CS3A 3CSWA 4FM2A 3QWUA 5KAFZ 3CS5A 5KG7A 5B1AB 4NXNH 3KCXA 4TV8B 5EIBC 2RDJA 1EUDB 2CTPA 3E86A 1KJJA 2ODTX 1SQQH 2VOBA 1N36B 4YIPA 2ITDC 5C8YA 5FPRA 3VNNA 2ZDQA 3ABKB 3HO8A 1LUWA 2N74A 4BWSC 2E2HA 5KLVH 3L75H 1R6TA 1YIJV 1FD9A 5KA5A 3LMLA 3QZ7A 5KFGA 5DAAA 4ED7A 4DV7O 4U6PA 3CWBH 2PI4A 1KP3A 3ZN0A 1YXBA 1VBHA 3GIDA 1N32H 5E1AC 2COGA 5H9CA 2ZR3A 2R85A 3CEIA 3RJ0A 1OCOB 1NQTA 1A0GA 4JXUA 1QLNA 2VQDA 3T99A 2LP7A 1GM8A 3CRCA 4WBNB 1VBGA 5F9LA 1G8MA 5JVDB 2RGVA 1CPYA 1VQKV 3AEIA 1ZHQA 1YTFB 3B8NA 2R87A 4DW0A 1EKFA 1P49A 3Q2OA 4CHIA 4BBSG 4GX5A 3GVMA 5J2TB 2BTQA 4TUYA 5BXZA 1JDEA 3PVXA 1VQPV 4RQEA 4DUYB 2CNVA 4IAJA 5DM6V 3SJBC 4FBTA 1K33A 2X6AA 3RYIB 1S72V 5KG1A 4A3LG 4ZIBA 1V4YA 2EJRA 2YIBA 1KJIA 2YEVB 3J7AK 3WG7B 3SE7A 2DWEC 2QWQB 3JRWA 3RYHB 2WA3A 2ASDA 4IR1A 4X1IB 1DK1A 2P0AA 2R7NA 3G67A 4DV5H 1SQGA 5J9PC 2YI9A 4OX9O 2WWWA 4BIUA 4IHJF 1G6UA 1YF2A 4E6NA 4ECQA 1S77D 2UXBH 3JAWB 4PDLA 4HNTA 3ASNB 5CBFA 1XILA 2EJ0A 5C44G 1Z2OX 4AHCA 4NZMA 5A2QN 2IBKA 1VQNV 3BJYA 2A3QA 1JLLB 2DN9A 1V51A 3RAQA 3HOYG 4QNHB 1WB7A 3H3VH 4FFBB 1RM1C 3QQMA 4EB6B 2P22C 4LWSA 4YJ2A 2P7TC 2XAHA 4X64B 2DAAA 3TQ1A 4JV2A 4Q20A 1US6A 4X89A 4O86A 1PP9H 3CCLV 2UVUA 2UUAO 4K3AA 2O57A 1T94A 3VPDA 3T9DA 2XTAA 5J2UB 3ORRA 5IJ0A 1VKZA 4ECVA 3E5NA 5C3EG 4NYEA 1SRYA 3FMAA 3OM3B 3G6YA 4LF8H 2K1EA 2QGNA 3AG4C 4YP3A 4A3DG 1N34H 1SQPH 4EEYA 4GKJO 2QE7G 2L35A 3AG3C 3CCQV 5FD6A 5B1BB 3U9TA 5KFQA 1X4TA 2PMZA 4RNNA 2DPJA 5LMNH 4CKEA 4YAKB 5K3WA 2UXCB 1S0OA 2XAJA 3SJCC 5KT5A 3MR2A 2CW7A 3ETHA 4RB2C 2E3CA 1UFIA 4KP4A 3K58A 4J9SA 4B3RO 4P9PA 1EZ1A 5C1PA 2R8HA 1Q90D 2R8GA 1EN4A 2XT9A 1Q3EA 4XYLB 4CMFA 1HNZO 3N41B 3SJAC 2UUBH 2YS8A 4IGGA 4N23A 3HXLA 4B3TO 2NR5A 4GCZA 1VP7A 1AJPA 3OTFA 3LWBA 3SGIA 5KFFA 2R7ZA 5FJ8G 2PN1A 2XOKG 4ICGA 3JSNA 2E5LH 4YIOA 5KX5B 3JD1A 1N48A 1VAJA 1WAZA 1ZL8B 2VA2A 3HPLC 2QEXV 2R72A 3K0DA 5KAIZ 4RAZA 2BQ3A 2Q2UA 4F4ZA 1PM9A 2KKWA 5KG4A 4PV1B 1Y76B 4DL2A 2XNDG 4LF4O 1TWFA 5GW7A 2Q4PA 1IBLB 4GX2A 3K04A 4MW3A 1M1KW 2AXTZ 2XASA 1WRVA 3CC7V 4LFAO 2VPSA 5FLMG 2EIJC 3UT5A 1ORQC 1XL6A 1SFOA 1ZHSA 1KTAA 4WHXA 3G6BA 4J7ZA 2W6IG 5EBLC 1UC8A 2SCUB 1Y4MA 1DIKA 1Z2PX 4FE2A 3H40A 4UV9A 4UCUA 4YB8B 1OCZB 1JJ2U 3CPWU 3U54A 1FS0G 3U9SA 4QWDA 1GO3F 2JEUA 3W7UA 2UXXA 3OMIB 3HOUG 3IC7A 4JI5H 4O81A 3THOA 3W7WA 5DMXA 3BQ1A 1K73W 3N2GB 4EGQA 1HP8A 1XHXA 2R86A 1P7BA 4DR5H 2VWKA 5LL6Y 4Q8FA 2UXDB 1K92A 3H20A 5B1OA 2LGWA 2JGUA 5BYAA 3ABLB 4DV1H 3WO1A 1EKVA 2CTQA 4O4HA 2Q9LA 4FJCC 5I5XA 4AQYH 3M8AA 2DABA 4ECZA 1THZA 1WA8B 5BYBA 4TV9A 2PVPA 2CZGA 1RK6A 4O2AA 4CH3A 2WAMA 3FAVB 5D1PA 4NR1A 4PD4F 2V7QG 5BR8O 3W7XA 5LXTF 4GZRB 3VQVA 3T4ZA 1XMOB 1S0VA 3GWKC 3CX5F 4G28B 1NTKH 4ED0A 5DLFA 3FYEB 1MG1A 1KKDA 3FB8C 2WB1A 4YY3B 2QYZA 4DV2B 5T14A 2LQTA 4J80A 2R7KA 4J9RA 4JV1A 1QHTA 3B09A 1H8EG 4JI3H 3BABA 4O7LA 1HWYA 1KQSU 2QM7A 1YCIA 3PJSK 3UM7A 5KG6A 3RFRA 2J6UA 1P7GA 2DWCA 3TJTA 2CQYA 3SPHA 1FKAH 5KUMA 2CGNA 2ZE8A 3E8BA 2CW8A 2C00A 4O7NA 4QIWE 3GQCA 3NUAA 4O3PA 2VQEH 4ME6A 4H0LB 5EBMC 1YTFD 4MW8A 1JXLA 3J81N 2OTLV 3ZRWA 1NH2D 2VPQA 5I5WA 2LGQA 4RWUA 3UYYA 1AP6A 2IP4A 4EBCA 3A0RA 4J41A 4TVIA 4RUCA 2LFRA 3QNEA 1YJNV 3ICXA 1B33N 1MOFA 1CKNB 4O82A 2VQFH 1B6QA 1VQ9V 5IT9N 4J42A 3QFFA 3ABKC 4MV4A 2A9HA 2EZOA 5KFEA 3T5LA 4P2ZA 1OCCC 1YDXA 2JVDA 2FLPA 3V4ZA 2Z0AA 4LFCB 2JA6G 4QWEA 5EZYB 1QNMA 4X1KB 2F93B 5LGTA 5I5SA 1V9PA 1TAEA 2Q7HA 1OCOC 1WCMA 4KUMA 4KXRA 3UO2A 4JI4B 2YS7A 3I4NG 2E2IA 2NLJC 4JV5B 5KFKA 4ED6A 4DL6A 4HNAB 5LXTB 1KJ8A 3MWMA 1JVMA 2IW5A 2HP8A 4MVMA 3NBZB 4MTDA 1DLBA 1N0JA 4DUZO 1I6UA 4LR3A 5CA0F 3NXSA 4R8CA 5FLXW 4C5AA 1XQ8A 3Q4HA 1AP5A 1WJZA 1N36H 3Q8QB 3E83A 1HNWO 5KFOA 2GHYA 3WB0A 2EIMC 2DZDA 1UC9A 4UUGA 1E1QG 2FL4A 1JX9A 1IBKO 4FFPA 1KU9A 4JYCA 1TUBB 3T54A 3T5KA 3ASNC 2W9CA 4FLZA 4DV3B 1ROPA 1M5IA 3SPCA 4N21A 2HEPA 1FVIA 1JIHA 3G8DA 3CRAA 5IYBG 3SPGA 4WFHA 2DQ0A 4X66O 3K03A 3WO0A 2BQRA 3MR3A 2ZR2A 3JAKA 1I2KA 4MVUA 1UJWB 4DR2B 2QSAA 4RNMA 1SZXA 5GONA 4LFCO 3RV3A 4DUYH 2YUAA 3N6RA 3U0GA 4A3BG 1XI1A 3K08A 2R6FA 3IC9A 5ITZA 4FLUA 2Q8VA 1V54B 3HKEB 2YIAA 3MWDA 2UUCO 1S76D 3SNOA 5CB4F 4I55F 1BT8A 2ETNA 3ML0A 3CSXA 4JYYA 3ZMUA 2ZCEA 1H2GA 4FFLA 5KFDA 3ZX6A 5KG5A 5B1BC 4JV0A 4UVBA 1PK8A 1WN7A 5BY1A 2J9GA 4LSXA 5JQGA 2QWNB 4BW9A 3ZMTA 2UVWA 2VA3A 4J7KA 4X20A 3KREA 4A3EG 1EHIA 2ASJA 4O2BF 4DYLA 2JK5C 1IBMB 2GSMB 5JVLA 4DV0B 4DIMA 2WLNA 5KHKA 4X64H 2HHFB 4JI8B 4IIJB 3U0ZA 4LFBB 3ZEDA 3B2EE 3N2KA 2JDIG 3AG2C 3AG4B 3OT7A 4MVQA 1PX2A 4LH6A 4X62B 5LA6A 3OD4A 1NZ6A 5IJ9A 1RP3B 1W59A 1K5QA 3W5OA 3UFXB 4XX0B 2R93G 2Q2TA 3DSQA 4MV7A 2ZDIC 3PFFA 4ZI7F 1SETA 5DG9A 3JARA 4DW1A 5DGBA 4O7RA 4XYMB 1EFRG 3GTPA 4UCTA 2W71A 3D3IA 3SPIA 3RGBA 3GV7B 4O4JF 3KXYT 4LNUB 3OFNG 1NTZH 2A79B 4X65B 4F6RA 1GN2A 5IYZB 4RAIA 3ZN1A 2A1HA 2AU0A 2PTMA 5HV6A 5FNVF 4O4LF 3TIIA 2DW4A 3R5HA 1YHQV 5CA1A 1DAAA 4DAAA 1VF6C 1DV1A 1VQ8V 2UXCH 1CXZB 2YU9A 4XDJA 3EVKA 2PYLA 3JCUZ 2Q7EA 3TINA 1I5XA 3TGUH 2GQRA 4YR0A 3M9OB 3ASOB 5CB4B 2P5OA 4I55B 4J0MA 2D2CB 4E2LA 4WFGA 4JI0O 4FLWA 3CB2A 3CP1A 1QLEB 3FB5C 4PZ8A 5JH7F 2GTAA 2UU9B 4Q8EA 4A3JG 2X7RB 4RUEA 2YS6A 1AVMA 4ZOLF 1OBDA 1PNMA 4BXXG 3OTOB 3GV8B 1S3JA 5AG2A 1OCZC 3VQWA 2CH7B 1QBZA 1JKJB 3C3TA 4O2BB 1VIBA 2Q67A 5EK0A 4FU0A 1NVPB 4OGQB 2I80A 4U3JA 2AHZA 2HHHB 3O9OA 1AR4A 4GKKO 3FFQA 5TISZ 2JS3A 4G27B 1ET0A 2WTFA 3ZHVA 2ABJA 3SYPA 5H80A 3ABLC 3H1HH 4DR1B 5KFBA 2QKAA 4K0KB 1IBLH 3RV4A 1M9NA 4I0XB 1I3QA 3OGCC 4ZI7B 1R73A 4A93G 4JI6O 2MK3A 3DC6A 3JYCA 1Q6HA 1C30A 5LMUO 1D2DA 1AUXA 1U97A 2HJDA 2YICA 4O4JB 3JALB 1L2ZA 3HKDB 4TV8F 3K9SA 1F7YA 5FNVB 4O4LB 3P3NA 2E74B 2GQSA 3SDLA 1AROP 3DC5A 1BQZA 3D36A 4QJFA 1EN5A 3CJHB 5DQGA 2QWPB 4UB8Z 1XNRO 1BS3A 4YHHO 1CEZA 2PGGA 1VEWA 2R70A 4JYAB 4PHZA 3MJFA 5KFIA 2OIGA 4FIPC 4BW5A 4EFEA 1GM7A 4AILC 4DV7B 2ZE5A 5JH7B 1LUVA 3MR6A 3DTGA 2UXDH 3CMAV 2Y48A 3N27A 3FKSG 1CS0A 2IM9A 2P4KA 1WP8A 4EYHB 2ZT9B 5KKNB 4YBZB 3E22A 2OIEA 1AUVA 1KB9F 5EIBD 1L0LH 5BPHA 4O3OA 3AW8A 2GPWA 3OGIB 4MTFA 4PDRA 1OJHA 3RR5A 4IYHA 1EBOA 1SEIA 2Z04A 1MSDA 4OXSA 4WBNA 5J2TF 2OYQA 1JA8A 5JVDA 4NKGB 3I55V 1HNXO 1Y66A 1XMOH 3BQ2A 5DECA 4RZQA 1B3QA 2QJ1A 2V1DA 2EIYA 3KAJA 2WLLB 5D1OA 1FFTB 3GWOA 4JGSA 3AK2A 4BIOA 4AYBA 3DXRA 4A3GG 4YY3H 3BQ0A 5JJNB 1TVKA 1VQ5V 1SQVH 5EC1C 5LBQA 2DWDC 2JJ2G 3ZMVA 3BAAA 4BBRG 2YXYA 2YEVA 1ZQ7A 2F95B 2JRIA 2VUMA 4OX9B 4Z2WA 2FB9A 4LMYA 3ZHUA 3J80W 4X1IA 5LOVA 5KG2A 4MV3A 4DR7O 2CTRA 4JI7O 1Y14B 2F1MA 1K34A 4TM5A 3JAWA 3RVZA 4CBCA 2KSWA 2AGAA 4IL6Z 4P30A 3QG5A 3T1HO 2VUGA 1Y74A 2BE3A 4YAJB 3TQTA 2YIDA 1MZEA 3MFIA 2B63G 4F4YA 1H38A 3LP8A 4X88A 1RPRA 1HR0H 2V4QA 4JYAO 1BQ0A 5KT7A 1OCCB 5IYDG 4FLTA 2HJFC 2OCCB 2AZ0A 4MV6A 1PNKA 1S5JA 5H6QA 4F6EA 3RF2A 4FLVA 3S3XA 5J2UF 2UUAB 4ED3A 4DR4O 1RSOB 2FK3A 2JA5G 2DPIA 2GUZB 4I4TF 3JAMN 4J10A 3FX7A 1H8HG 3LULA 2ZD9A 3K5LA 2W9BB 3HOZG 2ITCC 3R5FA 5DG7A 5KFXA 2HIVA 5D5PA 3GTOA 4PA7A 4PZ6A 4GKJB 3BG5A 4JI4H 2HR3A 2OWOA 3OUUA 1G1XB 2ILMA 2WLKA 3LSSA 4JV5H 1S0NA 4TSFG 3QO5A 1EN6A 1SF9A 1CKOA 3OHAA 4BIZA 3T9CA 3CQZA 1JOYA 1AN7A 2ZDGA 1GKFA 3V4SA 1BZKA 1B6RA 4TUYF 4LH7A 1OHHG 3HKZE 5K1PA 2EIMB 2IBZH 2JA6A 1E4FT 2DIKA 4B3RB 4NYKA 2UVRA 3GDEA 3K3PA 3MDSA 3ETJA 5IE9A 1V54C 3WWIA 3OSPA 1HNZB 4UCSA 1BNCA 5L3FA 1XDNA 2IU3A 4PBCA 1Q5OA 4YXWG 4HYKA 4B3TB 1MA1A 4LF9H 3O65A 1OCRB 3JASB 4IHJA 4AI8A 2IJJA 1WPXA 1DF4A 2HVKC 2V4RA 4TWKA 5KX5F 4FS2A 4RB1A 5KT6A 4FS1A 2JA7A 2YZGA 2ASLA 4IR9A 5IWAH 1WH2A 5F9NA 4A2BA 4DR3O 4DV3H 2YSUB 4M0JA 4G3IA 4WFFA 4D7TA 4L8JA 4HQ6A 4UUJC 4B08A 1ZL8A 1BHAA 2ZXWB 2UXNA 4DR2H 4LF4B 4TQSA 2Y0SA 5C5JA 1FXKB 5I47A 4I4TB 3TW6A 4FM9A 3UZBA 1R3IC 1Y76A 4XDKA 2NUAB 5A2QW 1N33O 1GN4A 3W1GA 3QTCA 4NTYA 4B3SO 4U7CA 5IDJA 4LFAB 4KHPO 4B7EA 3GB7C 4RQFA 3IAYA 3ZRVA 5LP6C 3OR7C 4FLYA 3VQXA 2ZIMA 1GSAA 1C3OA 1PPJH 1KYOF 4JI1O 3K0GA 2GLTA 1A3GA 3N44B 1YJWV 1BHBA 1M57B 5KFWA 2FB5A 3FD9A 5BWTA 2JGDB 1VQ4V 4WFAV 2B1IA 4TUYB 1GN6A 3B8MA 2L6LA 1F4MA 4I9QA 1SA0A 3GIMA 3JSLA 5KA6A 2QTSA 1SQBH 4QIWF 5JWPA 2AGPA 4LF6H 4RU9A 1ENVA 3AG2B 2E76B 3F7VC 4G2KA 2C2DA 3ETDA 2ZNJA 3W1BA 1IBMH 5EWEA 4DV0H 3ASOC 3OUZA 4QW8A 1XHZA 1E1RG 1NJIW 3L4KA 1S03G 3UCSC 5KT2A 4JI8H 3KHHA 1FXHA 2EIKB 2R9AA 1QLEC 3K9AA 2PBZA 1I50A 4LFBH 2YW2A 3STLC 3ETQA 1GSHA 1KKCA 2YXHA 2IH1C 1R3JC 3BA8A 2DJVA 2W8LA 4PJ0Z 3A2FA 5BR8B 1XREA 3FKIG 1KBHA 4TT3G 2OLSA 1U96A 3L73H 4MVSA 4CH6A 3ZCCA 2R9IA 4D6TH 4X65H 4JYBA 3W7TA 4RO2A 5K1XA 4EGJA 3RBDA 3EPGA 1KJQA 5JCOC 1J5EO 1PL0A 3R66A 3S24A 3TW7A 2RMKB 3JD2A 1WNSA 4JAUA 1DGSA 1SQFA 3E35A 3ABTA 3L9DA 1O9GA 1EZVH 5IJ0B 5KFYA 4DR6O 2NU6B 4A5UB 3T1YO 4ZHQF 3SYQA 3JD0A 4O83A 3ZHQA 3LDDA 2UU9H 4LF7O 4FFNA 3WU2Z 4EYIB 2Z5UA 5KFTA 3IN5A 3H4DA 1H2NA 5D5QA 1EM1A 3R65A 4ECYA 2H8PC 2HGWA 3OTOH 1Z5VA 2ARHA 4MTOA 5B1NA 1IYDA 1K1QA 1JMKC 2A7WA 2JA8G 4B3MO 5HFMA 1K83A 3OSNA 4RUFA 2HGSA 2HHHH 1Y1VG 3B40A 4NXMO 2FJZA 5IP9G 1GAXA 5EZYF 5B66Z 1VQOV 3QZ8A 3GTLA 4ZQIA 1TUEB 2FK2A 4ECRA 3N42B 3G71V 5L1KA 1IX9A 4HYOA 5CM0A 1CKMA 1SS3A 2H94A 5KHIA 5LL6b 4DR1H 4K0KH 2KG7A 2QKSA 3TXQA 2YL2A 1S0MA 1I94O 2Q0AA 4CKCA 3I56V 4O3RA 2BQUA 1PNLA 3CRMA 4A3KG 2R8KA 2PUSA 4Z1MG 3K5NA 4HNAA 4O4IF 3MFHA 2FPPB 3LQSA 2NNUA 5LXTA 3TETA 2B9ZA 2R92A 1I1LA 1RYSA 1NS1A 3CC2V 4DUZB 4FZ0A 4IRDA 2RGRA 3HB3B 1Y67A 3FB7C 4LF5O 2F4VO 1ULZA 1XNQO 3HKBA 4HZ3A 2PMZE 1G4YB 2QWRB 1FJGO 1A32A 2Y4UA 2Z3YA 1HNWB 4IRCA 2B1GA 4ZHQB 4NB5A 2R7LA 4O7VA 1W0KG 3ORQA 1IBKB 4DV7H 3UT5B 5KT4A 1S97A 4XBFA 4MV9A 1GMGA 3HKCA 1CQIB 4GX0A 2ZM6O 1TUBA 1F23A 2EZPA 3ETEA 1M0WA 2WPDG 4QE7A 4TQFA 1K97A 2HDKA 4MAMA 2JEIA 4FVMA 4X66B 2Y0IA 1BL8A 1N8RW 5H5NA 1VQLV 4TQRA 2ZJTA 1QQCA 3GLKA 2WSSG 2ALZA 1N0NA 3KCYA 2OCCC 2QA4V 3I12A 3GIJA 3G6XA 1J95A 2QTOA 2AW9A 3EHBB 3ZS8C 1HW7A 5HNEA 2W6MA 2UUCB 1EZJA 1XBLA 3OEHG 1EUCB 5LHIA 2NU9B 3HKEA 4UCOA 2UVVA 1RJRA 3T7AA 2GV9A 1VF7A 4M7EA 4EBEA 4A3FG 4OX9H 2HKOA 3STZC 4TV9B 5DGHA 3RYFA 4J9OA 2J6SA 1ZAUA 4JI2O 2XCLA 4CKBA 1SERA 4O4IB 5FLXN 4NLGA 5IT9W 1NBMG 2PY5A 3ZJZA 5EWFA 1ZETA 1P84F 2R82A 4A2AA 1Y1WA 4HNVA 3HOVG 4X9QA 2X6BA 2QKCA 2COIA 4IIJF 2WAQA 1FFXB 2P06A 3JATB 3R23A 4UFZA 5CA0A 3CVZA 1X59A 4RB3C 2FTKA 1R3LC 3CCRV 2Q73A 3RFCA 2UUAH 3KHRA 4DV6O 2ZDHA 4DV4O 3KALA 3KYHC 4F4XA 1XMQO 5LP6F 5L1LA 3JRXA 1OCRC 1WLEA 4IT5A 2FKLA 1G2WA 5KHHA 3P32A 3FYIB 3QF7A 2B63A 3LNNA 2PI5A 1EYZA 4GKJH 1GN3A 4NXNO 1Q43A 5IYZF 4DO2A 4JTAB 2OTJV 2CNQA 1I1KA 1E4EB 3KKYA 3HOXG 3HOWG 3AYHB 4LNUA 2JA5A 3ABUA 2FK1A 3LNMB 4FFMA 3M9NB 5KFUA 2YDEA 2ZXWC 1IZ3A 1FXKC 4Q44A 3RB6A 2W0XA 2FYUH 1N32O 4B3RH 1R1BA 2HG5C 4JI0B 3K5OA 1H2KA 2ZIOA 3V6HA 1JFFB 4R50A 5CB4A 2Y4TA 4I55A 2WB1E 1HNZH 5KFLA 4DL5A 3PZPA 2WLMA 2P90A 4YR2A 3KAKA 2ADQB 4FZ1A 4B3TH 3CCJV 4K8ZA 1XK5A 3TY5A 4BR6A 5F2VO 1M6VA 2FLNA 1M57C 1H2LA 3DTFA 2Q7DA 1GLVA 4MVRA 2X5RA 3OEEG 2CH7A 1K8AW 3NC0B 3P3PA 2EILC 4F50A 3BFRA 4GKKB 4O2BA 4J9LA 2WLHA 3H1IH 4EKWA 1P16A 3H9VA 4PA3A 4FMTA 3Q4HB 4NTXA 5JCOA 4DV5O 2COJA 4W4LA 2IJKA 2ZGIA 3QVNA 4LF4H 1AR5A 2F66C 3K06A 5LP6B 2UXBO 2RCVA 2EIKC 3OE7G 4MV8A 2QF7A 1SC5B 4GC7A 3SR2C 5KFHA 4ECUA 4QE9A 5CBHA 4LFAH 4JI6B 4FK5C 3TY9A 1WP7A 5I5UA 4J9ZB 4I0XA 2Y69B 4K35A 3U55A 5LMUB 2W6ZA 2P4VA 4J9PA 3F5WC 3JZIA 1F51A 4JZ2A 1M56B 1MSWD 3S3WA 3RTXA 4QGPA 1TWAA 4X1YA 3ABMB 3JAKB 4O4JA 2WLIA 3JALA 2BSKA 3MHHC 3HKDA 3FDSA 3Q8PB 3AG1B 5FNVA 4O4LA 4IWYA 3T2MA 2X6CA 2PZSA 3HT5A 4O3QA 1XNRB 3D3QA 5GONB 3RW0A 5L3GA 1Q7YW 5I5YA 4YHHB 3IJ4A 4LSAA 3RGZA 2PF4E 5DLGA 1R6NA 3T9FA 3GIIA 4LF8O 2JEFA 1N34O 4I50F 3DAAA 5JH7A 2ATKC 3SPJA 2FPIB 5LGUA 5DQIA 5GTHZ 1AJNA 5LMNO 2RF4A 4ZOLA 2XHBA 2RQ6A 3PN1A 4WFBV 4LC1A 4CH4A 2X0SA 5EYPB 5JQGB 3MWEA 3H01A 1GK9A 1P4RA 4R8UA 4X20B 5BR8H 1HNXB 4ED1A 4R7CA 1GSOA 2LFSA 4LF6O 4TQDA 3Q8SB 3TIGA 3EXAA 1XEQA 4B7KA 4K8XA 2UUBO 3DTUB 1LR1A 3NR7A 4DR5B 3N2KB 1I0HA 2EJ2A 1BGWA 2M05A 4O7WA 3GTKA 2KQXA 1AILA 4XDLA 4DV1B 5BMVF 2Q5ZA 2G38A 1IXBA 2ZKOA 4GUNA 4WF9V 5E25A 2E5LO 1K3EA 4H37A 1W2BU 4DR7B 1IDSA 5BWVA 4JI7B 3P30A 4DK1A 5KHGA 2QM4A 3K79A 4H44B 1VS0A 2HFEC 3ZIAG 3T1HB 5JUMA 1Z5WA 2XUMA 4PDVA 2KB1A 4F6RB 2W7OA 4TV8A 3AX6A 3AG7A 4YJ3F 4ECTA 2RDCA 5DN6G 5BPFA 4H13B 2K9PA 1KP2A 4ABMA 1I7LA 2W9AA 2FPGB 3TY8A 3I5DA 5KG0A 1M0TA 4FFKA 4DR4B 3CCEV 2YZNA 3SYAA 5D8DA 4MT8A 3Q1KA 3KHGA 4I50B 2IMWP 1QU7A 1E4GT 1RSOA 2YC0A 2GUZA 2QR4A 3G80A 1VARA 3VPCA 4WD3A 3ZBHA 1SKVA 3F5TA 1ZX3A 5BWWA 2OH2A 5L3EA 4FLXA 2Y4RA 4O7SA 2J6TA 4JI5O 5KMGB 5J2TA 4HNUA 3VOUA 4C5CA 2NVYA 1Y1VA 2R84A 1TWGA 3CCUV 1ZTEA 1GH6A 4DV2H 3RYIA 3CCMV 1JJOA 3GTQA 3BPZA 3CHXA 3MD0A 4DR5O 4DK0A 5LYJF 2PYJA 4C7UA 3OUSA 2LJ2A 1S5HC 1SZTA 4YR3A 4DV1O 4QSHA 1ZUQA 3C3SA 3F7YC 3RYHA 2BCCH 1S9FA 5BMVB 5BWRA 4AQYO 1HNWH 4GC6A 3QO7A 5KFAA 1WB8A 3T4DA 1RPOA 2V4DA 1IBKH 2IU0A 3CD6V 4MS2A 1Q81W 3RB4A 1XL4A 2RDIA 4DR3B 2YRWA 2EINB 3EYYA 2IJIA 4EG0A 2HVQA 1B04A 1HDJA 4FFBA 2FE3A 3UO3A 3HR0A 4YJ3B 3VQYA 4EB6A 2FMLA 4OPAA 4FFOA 5KFCA 5LHHA 4X66H 1M4UA 1PV0A 2Q7GA 4JI3O 1JX4A 5C8YF 4QJFB 4HR7A 1D5NA 3OHBA 5CAEB
chains in the Genus database with same CATH topology
4HNAB 1Q8IA 4CH6A 5LXTB 3MWMA 2WDTA 4X65H 4LFCH 4I50A 5J2UA 2YI8A 5K1XA 1N33B 3NBZB 4MTDA 5JCOC 2VWJA 4B3SB 4I4TA 3WB2A 3S24A 4KHPB 4GLXA 2UUCH 1WNSA 2WYOA 3RGXA 1DGSA 4LR3A 1SQFA 2YXLA 4D7SA 3C0FB 1I94H 1I6UA 4UCVA 1O9GA 4JI5B 5IJ0B 3E22B 1M93A 3GB8B 2RJZA 5FLXW 1XQ8A 3GJXB 4R7RA 1N36H 4JI1B 5KMGA 3WB0A 4ETSA 2UU9H 5LA6B 3JAMW 4LF5H 2F4VH 1KU9A 4HBNA 1TUBB 5IJ9B 5LYJB 5D5QA 2HIXA 3RIZA 1XNQH 2JS5A 3OTOH 4I7HA 1Z5VA 4FLZA 4DV3B 4AQYB 5D1OB 1M5IA 2HVRA 1FJGH 1JMKC 1TVKB 2HEPA 1FVIA 3JARB 5BMVA 4DRXB 1SYXB 2MCTA 2HGSA 2HHHH 3RYCB 3JAKA 1TA8A 4DR2B 5LOVB 2ZM6H 1L8DA 5CA1B 5GONA 4X1YB 4DUYH 3N42B 4RB0A 1XI1A 3WB1A 5KX5A 5FPOA 4JI3B 5ITZA 4FLUA 1CKMA 5KHIA 3K3VA 3HKEB 2YIAA 5LL6b 4DR1H 4K0KH 4YJ3A 4EQ5A 3N40P 3CSXA 2Q0AA 2ZINA 5C8YB 5KHJA 3UQ8A 2ZCEA 3K59A 1I7FA 2PUSA 3K5NA 4HNAA 1J5EB 5LXTA 4FM0A 1WN7A 4TOIA 2VQEB 4LSXA 4DUZB 5JQGA 2RGRA 3MAQA 3BHPA 4BW9A 4X20A 4DR6B 3HKBA 3T1YB 4ZOLB 4JI0H 3L2PA 1HNWB 1IBMB 4DV0B 4U3JB 4ZHQB 4JI2H 4DRFA 4LF7B 5KHKA 5DISC 3N6XA 4X64H 4DUZH 4JI8B 2VQFB 1IBKB 4DV7H 4IIJB 3UT5B 3U0ZA 4LFBB 2BTQB 3ZEDA 3B2EE 3N2KA 2O03A 4MV9A 2EX3A 3HKCA 4LH6A 4X62B 5LA6A 4PI2A 5IJ9A 5LYJA 1TUBA 3W5OA 1M0WA 4B3MB 4TQFA 3K57A 2Q2TA 3DSQA 4FVMA 4X66B 4MV7A 3BRCA 3N2GA 1TGOA 3JARA 2CFMA 4DRXA 4GKKH 4NXMB 1P8LA 2ZJTA 4CC5A 4DV6H 1QQCA 4DV4H 4UCTA 4X62H 3JASA 3RYCA 3RGBA 1XMQH 3KXYT 4LNUB 4X65B 4F6RA 5IYZB 4PDBA 2PTMA 4CS3A 3ZS8C 1HW7A 4FM2A 5CA1A 3QWUA 4IHJB 2UUCB 5EOYA 2UXCH 2PYLA 2Q7EA 4NXNH 1I94B 4JI6H 4TV8B 5EIBC 3HKEA 5CB4B 2P5OA 4I55B 4UCOA 4YJ2B 4J0MA 5LMUH 2GV9A 1VF7A 2VOBA 1N36B 4M7EA 4OX9H 4FLWA 3CB2A 5FPRA 4TV9B 5C8YA 3VNNA 4PZ8A 3RYFA 4BWSC 2UU9B 1ZAUA 1NT2B 3U10A 4O4IB 5IT9W 3LMLA 2PY5A 4LF5B 2F4VB 1XNQB 1N32H 3OTOB 4A2AA 3RJ0A 1FJGB 1XNRH 3VQWA 4YHHH 4WBNB 4O2BB 1FFXB 3JATB 3F8NA 4UFZA 5CA0A 5JVDB 3CVZA 2RGVA 4RB3C 4U3JA 2HHHB 4ZHQA 4Q0YA 1ZHQA 1KMIZ 2XIGA 1P49A 2UUAH 3FFQA 3KALA 3KYHC 5J2TB 2ZM6B 2BTQA 4TUYA 3NBYB 4DUYB 4IAJA 3SJBC 3RYIB 5KHHA 4DR1B 4ZIBA 4K0KB 2YIBA 1IBLH 3QF7A 3LNNA 4GKJH 3J7AK 4ZI7B 1Q43A 1SA0B 3RYHB 1CKNA 1HNXH 4X1IB 4PZ7A 4DV5H 1SQGA 2YI9A 1G6UA 4E6NA 2UXBH 3JAWB 4O4JB 3JALB 1YEWA 4LNUA 1L2ZA 3HKDB 5FNVB 4O4LB 5EZYA 1S68A 1Z2OX 4X1KA 4AHCA 4B3RH 5JJEB 4JI0B 3K5OA 4FFBB 2ZIOA 2W57A 4EB6B 1JFFB 2P22C 2PGGA 5CB4A 2R70A 4JI2B 4I55A 4YJ2A 4JYAB 1HNZH 4DR7H 4PHZA 4JI7H 4X64B 4EFEA 4AILC 3KAKA 4DV7B 5JH7B 4CC6A 4B3TH 2UXDH 2BTOA 4K8ZA 4O4IA 1XK5A 3T1HH 2IM9A 3TY5A 5J2UB 5IJ0A 3E22A 5EIBD 4JYAH 3RR5A 3FMAA 4LF8H 3N43B 3NC0B 1SEIA 4GYCB 4WBNA 4O2BA 4GKKB 1FFXA 3JATA 3RWRD 2OYQA 1N34H 4DV6B 5JVDA 4DR4H 4DV4B 1P16A 5FD6A 1XMQB 3K5MA 1XMOH 1X4TA 4RZQA 2QJ1A 5JCOA 5LMNH 1D5AA 2ZNIA 3KAJA 4LF4H 1GYFA 5D1OA 2F66C 5LP6B 4CS2A 4YY3H 4Q6GA 5JJNB 1TVKA 2UXCB 3SJCC 3SR2C 4NXNB 2CW7A 4LFAH 4JI6B 3BAAA 4BWAA 3M7MX 3TY9A 4RB2C 2E3CA 1X9NA 4CH5A 3K58A 2F95B 3IG0A 5LMUB 4OX9B 4LMYA 3J80W 4X1IA 5LOVA 1HR0B 1Q3EA 3RTXA 3N41B 4X1YA 3SJAC 2UUBH 2F1MA 3JAKB 3JAWA 4O4JA 2KSWA 3J81W 3JALA 3HXLA 3HKDA 1N32B 5FNVA 4O4HB 4O4LA 3OTFA 3QG5A 2VUGA 2PZSA 3SGIA 1XNRB 5GONB 3U11A 3JSNA 4YHHB 2E5LH 1HR0H 4O2AB 4LSAA 5KX5B 3RGZA 4FLTA 1JFFA 1S5JA 4UCRA 3RF2A 2R72A 4FLVA 2HVSA 2UUAB 4RAZA 2Q2UA 5JH7A 5JJJB 2KKWA 4DR3H 3K5LA 4MTEA 4ZOLA 2XHBA 2RQ6A 3PN1A 4CH4A 2HIVA 5D5PA 5EYPB 5JQGB 1IBLB 4PZ6A 1O9HA 4GKJB 3DF7A 4X20B 2VPSA 5BR8H 3HKBB 1HNXB 4JI4H 4IIJA 3UT5A 2OWOA 1ZHSA 4JV5H 4DV5B 4KL1A 2UXBB 1CKOA 4TQDA 1Z2PX 1N33H 4CS4A 4UCUA 4K8XA 1AN7A 4B3SH 4DR5B 3N2KB 1WPBA 5LP6A 1BGWA 4LH7A 4KHPH 5K1PA 4LF9B 3HKCB 1E4FT 4DV1B 4B3RB 1MZBA 4JI5H 3GDEA 5IWAB 1T5EA 1HNZB 3THOA 4DR7B 4UCSA 5IYZA 2YIBD 4JI7B 4APMA 1XDNA 3N2GB 4DK1A 4JI1H 1XHXA 5KHGA 1Q5OA 4DR5H 2VWKA 4B3TB 2QM4A 2UXDB 1VS0A 4LF9H 3H20A 3JASB 4IHJA 3T1HB 1Z5WA 2JGUA 4DV1H 4F6RB 4RB1A 4TV8A 4O4HA 1WH2A 5IWAH 4A2BA 4AQYH 4DV3H 4D7TA 4LF8B 4TV9A 1BJTA 3TY8A 4L8JA 3M4IA 4CH3A 4O2AA 1N34B 4B08A 1Z2NX 1M0TA 5D1PA 4DR4B 4PI0A 3VQVA 1XMOB 4I50B 5LMNB 1E4GT 4LF4B 4DR2H 1RSOA 3RYFB 4I4TB 4FM9A 4EEQA 4YY3B 5A2QW 1H2SB 3W1GA 4DV2B 1SKVA 3QTCA 1O75A 1QHTA 4LFAB 4JI3H 5EYPA 3BABA 4FLXA 3IAYA 5LP6C 3RFRA 5KMGB 4FLYA 4LF6B 5J2TA 1A0IA 3VQXA 5CA0B 2ZIMA 2UUBB 4DV2H 3BA9A 1J5EH 1FKAH 3RYIA 1JJOA 2CW8A 3N44B 3BPZA 3CHXA 4DK0A 2PYJA 2VQEH 2YCHA 4TUYB 4ZI7A 4I9QA 1SA0A 4DR6H 2WE6A 2CAZC 3JSLA 3RYHA 2E5LB 3T1YH 5BMVB 4LF6H 1HNWH 2ZNJA 3W1BA 1IBMH 4DV0H 4LF7H 1XHZA 3L4JA 3ICXA 4RAYA 3L4KA 1S03G 2V4DA 1CKNB 2VQFH 1IBKH 4JI8H 4LFBH 2R9AA 4NVPA 4EFBA 3ETQA 4DR3B 2JVDA 3EYYA 5FD5A 4LFCB 5ITZB 2HVQA 1B04A 4FFBA 3BA8A 2FE3A 5EZYB 4YJ3B 3VQYA 4EB6A 4B3MH 4X1KB 2F93B 4X66H 1V9PA 1M4UA 1TAEA 2Q7HA 2Q7GA 3A2FA 5BR8B 4JI4B 4NXMH 4FM1A 4JV5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 B;  4X64 B;  4EFE A;  3W5O A;  4DV7 B;  4B3M B;  4DV1 B;  4B3R B;  4CC6 A;  2Q2T A;  4X66 B;  1XK5 A;  3GDE A;  1N33 B;  5IWA B;  3NBZ B;  3TY5 A;  2CFM A;  4B3S B;  1HNZ B;  4DR7 B;  4NXM B;  4UCS A;  1P8L A;  4CC5 A;  3S24 A;  4JI7 B;  4KHP B;  4UCT A;  4GLX A;  1XDN A;  1DGS A;  4X65 B;  4B3T B;  4UCV A;  2UXD B;  1VS0 A;  4JI5 B;  3RR5 A;  3T1H B;  3GB8 B;  3NC0 B;  4GKK B;  3GJX B;  3QWU A;  4DV6 B;  4DV4 B;  1P16 A;  2UUC B;  4JI1 B;  1XMQ B;  1I94 B;  4LF8 B;  3TY8 A;  4UCO A;  1N34 B;  5D1O A;  2HIX A;  1N36 B;  5D1P A;  4DR4 B;  3VNN A;  5FPR A;  2UXC B;  4PZ8 A;  4AQY B;  5D1O B;  4DV3 B;  2UU9 B;  1ZAU A;  1XMO B;  4NXN B;  2HVR A;  4JI6 B;  3BAA A;  5LMN B;  1FVI A;  4LF4 B;  3TY9 A;  1X9N A;  4LF5 B;  2F4V B;  5LMU B;  4OX9 B;  1XNQ B;  4EEQ A;  4YY3 B;  3W1G A;  3OTO B;  4DV2 B;  1HR0 B;  1FJG B;  4LFA B;  3RTX A;  1TA8 A;  4DR2 B;  3BAB A;  4UFZ A;  1N32 B;  2HHH B;  4LF6 B;  2VUG A;  1A0I A;  3SGI A;  1XNR B;  5FPO A;  4JI3 B;  1CKM A;  3JSN A;  4YHH B;  2UUB B;  3BA9 A;  3KYH C;  2ZM6 B;  4EQ5 A;  3NBY B;  3UQ8 A;  4DUY B;  4UCR A;  2HVS A;  4DR1 B;  2UUA B;  3JSL A;  2E5L B;  4K0K B;  1J5E B;  2Q2U A;  3W1B A;  4TOI A;  2VQE B;  4DUZ B;  1CKN A;  4PZ7 A;  3PN1 A;  4DR6 B;  2HIV A;  1CKN B;  1IBL B;  4E6N A;  3T1Y B;  4PZ6 A;  4EFB A;  4GKJ B;  3L2P A;  1HNW B;  1IBM B;  4DV0 B;  1HNX B;  1S68 A;  4DR3 B;  2OWO A;  4DRF A;  4LF7 B;  5DIS C;  4LFC B;  4DV5 B;  2HVQ A;  1B04 A;  3BA8 A;  4JI8 B;  2VQF B;  1IBK B;  4LFB B;  2UXB B;  1CKO A;  4JI0 B;  1V9P A;  1TAE A;  5BR8 B;  4UCU A;  4LH6 A;  4X62 B;  4JI4 B;  4DR5 B;  4JI2 B;  4JYA B;  4LH7 A;  4JV5 B; 
#chains in the Genus database with same CATH topology
 2Q6A A;  1QVF U;  1Q8I A;  2W6N A;  1XDC A;  5BWU A;  2JEG A;  5LGN A;  2W6O A;  1I08 A;  4LFC H;  5J2U A;  2W70 A;  1JPX A;  5CA3 A;  1N33 B;  2VWJ A;  4RZR A;  4ED8 A;  2FKX A;  1FKA O;  4B3S B;  1FXK A;  1KEE A;  4I4T A;  4J9K A;  1XUQ A;  4KHP B;  1JDB B;  4GLX A;  2UUC H;  1IOV A;  2VQE O;  4C5B A;  1RJQ A;  3RGX A;  3C0F B;  3VMM A;  2YXL A;  4D7S A;  2YZL A;  4F4W A;  3E22 B;  1JR9 A;  5KFZ A;  2RJZ A;  4UVC A;  3TK1 A;  2HVJ C;  3GJX B;  1DV2 A;  5I5V A;  4JTD B;  4JI1 B;  1M90 W;  2X0L A;  3PW5 A;  1S10 A;  3JZF A;  2DE0 X;  1RK5 A;  1A48 A;  1OWT A;  4CMD A;  2VQF O;  3JAM W;  5LHG A;  4HBN A;  5LYJ B;  3RIZ A;  5CBG A;  2JGD A;  1WSC A;  5D1O B;  2HVR A;  1UPG A;  1NH2 B;  1AR1 B;  3DXR B;  1JCH A;  5C4X G;  1TVK B;  1FAF A;  2Y0P A;  3CXH F;  4DRX B;  3QO8 A;  4ECS A;  1I1M A;  1V55 B;  1SYX B;  4BAY A;  2MCT A;  1Z2G A;  4LCU C;  3RYC B;  2KSD A;  1VQ7 V;  1CE8 A;  4U7N A;  1YSC A;  3N8D A;  3CRR A;  1I7N A;  4UVA A;  2W6J G;  5LOV B;  5EWG A;  2ZDI A;  4ECW A;  4Q4C A;  4RB0 A;  5KX5 A;  1VQ6 V;  3BEH A;  3E8F A;  3ZRX A;  3K3V A;  3T5H A;  2I87 A;  2NN4 A;  1Y74 B;  5CR5 A;  4EQ5 A;  4YJ2 F;  1B06 A;  5KHJ A;  5C8Y B;  3UQ8 A;  2R8I A;  3J7A U;  1VF6 A;  2ATL A;  1YI2 V;  1NTM H;  3OW2 U;  1N36 O;  1J5E B;  3Q8R B;  1CP9 A;  4FM0 A;  2FMA A;  3BCC H;  4TOI A;  4E4T A;  2H3O A;  2V9W A;  3MAQ A;  3BHP A;  2YWV A;  3E8H A;  4DR6 B;  3T1Y B;  1WR2 A;  2CUG A;  3C90 A;  2P67 A;  4JI0 H;  3L2P A;  3RAX A;  4AYB E;  1NVP D;  4DRF A;  4LF7 B;  3N6X A;  2Y69 C;  2XCA A;  2BTQ B;  5EDW A;  1M56 C;  2O03 A;  3PO3 G;  2EIL B;  1SQX H;  2MW2 B;  3ABM C;  4PI2 A;  2A0L A;  4X8A A;  1Q82 W;  4UB6 Z;  4DUY O;  4B3M B;  3AG1 C;  1ZWI C;  3CME V;  3K57 A;  2QM8 A;  2DYR B;  3CXC U;  4NZN A;  1E79 G;  2GBO A;  4U3F H;  3BRC A;  3N2G A;  4QIW A;  5DGA A;  1TGO A;  5L3C A;  4GKK H;  1AB3 A;  4NXM B;  4JZG A;  1L1F A;  4X62 H;  3PR4 A;  2CNU A;  2W8K A;  1VQM V;  2JEX A;  4PDB A;  4PA9 A;  2Q69 A;  1IVS A;  2QDO A;  1AJQ A;  2GDS A;  5B3S B;  1FPO A;  1WA8 A;  4IHJ B;  5EOY A;  4JAA A;  2DMX A;  4QWB A;  1I94 B;  2HGX A;  4JI6 H;  5IY5 B;  3FAV A;  2DYS C;  1AI5 A;  4L87 A;  4LWS B;  4YJ2 B;  5LMU H;  3X2Q B;  5L9X A;  4Z1V A;  4BY7 G;  3NGD A;  1NT2 B;  3JD3 A;  3U10 A;  1R3K C;  4LP8 A;  4X64 O;  2HJW A;  3T9E A;  3L72 H;  4UV8 A;  4QWC A;  3T1C A;  4LF5 B;  2F4V B;  3T9B A;  1XNQ B;  2R93 A;  1KC7 A;  3EFF K;  5FR9 A;  3JZ6 A;  1ZSP A;  4FBU A;  2W6Q A;  1FJG B;  4Y8V B;  3GIP A;  1XNR H;  4L1K A;  4YHH H;  4MTX A;  1N56 A;  3B4S A;  5C93 A;  3H0G G;  1H2M A;  3H1J H;  3F8N A;  5B5E Z;  4NZO A;  4ED2 A;  3ZMZ A;  4J9Y B;  1N4C A;  4ZHQ A;  2XD4 A;  4Q0Y A;  1KMI Z;  2ZE6 A;  2XIG A;  3E2E A;  5KFS A;  2ZM6 B;  3NBY B;  2C2R A;  1W93 A;  4DXW A;  1OBG A;  3JCZ A;  4DL7 A;  2UXC O;  1BMF G;  5H6R A;  2DLN A;  1IXM A;  4FPP A;  1SA0 B;  3OAA G;  4FGR A;  1CKN A;  3L71 H;  1HNX H;  4PZ7 A;  2C2A A;  4JUZ A;  3RB3 A;  2XGQ A;  5BZB A;  1MZF A;  2AHY A;  3CCS V;  1YEW A;  1L0N H;  2I8C A;  1B6S A;  2JJ1 G;  4RCN A;  4KFM A;  5EZY A;  1S68 A;  4O4H F;  1NR1 A;  4X1K A;  2Z02 A;  4MA0 A;  4MVO A;  2CK3 G;  3UZO A;  3G6V A;  4IZO A;  4TV9 F;  3CEB A;  2V59 A;  4O2A F;  3ZHS A;  1KJ9 A;  5JJE B;  2Y0S E;  2QK4 A;  4PDM A;  1A9X A;  4QWA A;  2W57 A;  3H1L H;  2XAG A;  4I7Z B;  5EBW C;  4JI2 B;  4DR7 H;  3CYO A;  2ZQM A;  2LO1 A;  4JI7 H;  3V6J A;  1K5S A;  3LSU A;  3UKM A;  2VUM G;  1KBL A;  4CC6 A;  5EC2 C;  2EBO A;  2BTO A;  1RYR A;  4O4I A;  3T1H H;  2AQ4 A;  1KD1 W;  3B77 A;  2VRZ A;  2RNB A;  2F43 G;  1PKX A;  4A3M G;  4XZ3 B;  1UNN C;  4JYA H;  3K5H A;  2BOC C;  3G6E V;  3N43 B;  1IBL O;  4GYC B;  1IYE A;  1FFX A;  3JAT A;  3RWR D;  1YZB A;  4DV6 B;  4DR4 H;  2E75 B;  5IYB O;  3DGE A;  4DV4 B;  3CCV V;  1Y6X A;  1BGY H;  3A0B Z;  1XMQ B;  2BOB C;  2VS0 A;  3K5M A;  3BVO A;  2F23 A;  1D5A A;  2ZNI A;  4ZBM A;  2M7W A;  1GYF A;  2M6Y A;  4CS2 A;  2Q68 A;  4Q6G A;  1LNQ A;  3TCU A;  2LW1 A;  1T36 A;  3EPI A;  4NXN B;  1GM9 A;  2EIN C;  3TEK A;  4M9U A;  4FFR A;  4BWA A;  3M7M X;  4JAS A;  4ASU G;  1EKP A;  1X9N A;  4CH5 A;  5I60 A;  4I5S A;  3IG0 A;  4IWX A;  2OCH A;  1K9M W;  4P9O A;  2YZM A;  2W6P A;  3ETG A;  3D36 C;  1HR0 B;  5KFV A;  4K6N A;  4U7O A;  2ADP A;  1QVG U;  1E4E A;  5B1A C;  4NTW A;  3J81 W;  2LW7 A;  3MHS C;  2UXD O;  1DF5 A;  3R5X A;  1N32 B;  3GV5 B;  4O4H B;  1SES A;  1GGO A;  2GTS A;  4J9N A;  4R6Z A;  3U11 A;  4JF3 A;  2ODM A;  1F4N A;  5CMU A;  4O2A B;  3H1K H;  4A3C G;  4J9Q A;  2KG7 B;  1JFF A;  4UCR A;  5E79 Z;  4PA4 A;  5H2F Z;  2HVS A;  5KFJ A;  2WA4 A;  1K1S A;  3HB9 A;  5JJJ B;  1XMO O;  4JAV A;  2W0F C;  4MSW C;  3VA7 A;  4DR3 H;  4MTE A;  5KFM A;  3OMA B;  2NU8 B;  3RBE A;  2RN9 A;  2EJ7 A;  4YY3 O;  2JA7 G;  4DV2 O;  1O9H A;  3VBB A;  3DF7 A;  1VMG A;  3K3W A;  4F4L A;  3IFX A;  3HKB B;  2HHF A;  4IIJ A;  3LSQ A;  2D3O W;  2FLL A;  4DV5 B;  4KL1 A;  1V55 C;  3ZHR A;  4PA6 A;  2UXB B;  4WCE V;  1KUT A;  5CN0 A;  3KG2 A;  1GO3 E;  1N33 H;  3WG7 C;  4CS4 A;  4CE5 A;  4B3S H;  1WPB A;  5LP6 A;  5DGI A;  2HG8 A;  4KHP H;  4LF9 B;  3HKC B;  4EBD A;  1AI4 A;  3ZRW B;  4Q4D A;  3T5J A;  1RJP A;  1MZB A;  3E89 A;  5KFR A;  5IWA B;  2XGP A;  1T5E A;  2QWO B;  1HR0 O;  5DQH A;  5IYZ A;  2YIB D;  4APM A;  4JI1 H;  1NR7 A;  3L74 H;  3SYO A;  3KHL A;  3PW0 A;  3LDC A;  1KC8 W;  5GON F;  3FB6 C;  3CE2 A;  2NVX A;  3RUP A;  3H4B A;  3M9M B;  4ZKI A;  4LF8 B;  1BJT A;  1YJ9 V;  3M4I A;  4QPJ A;  1N34 B;  1RFY A;  1MMM A;  1Z2N X;  1T3N A;  4PI0 A;  4YQW A;  4JI4 O;  1NKD A;  3CC4 V;  3HBL A;  4PEL A;  2XAQ A;  4JV5 O;  5LMN B;  3SI8 A;  5JQG F;  2CDY A;  3RYF B;  2XAF A;  4C2M A;  4EEQ A;  1H2S B;  3ZHT A;  2R7Z G;  1O75 A;  4JTC B;  1RM1 B;  1S5L Z;  3E8G A;  4A3I G;  5EYP A;  3VOT A;  3GTM A;  2DYR C;  4BY1 G;  3W7S A;  4LF6 B;  1A0I A;  1TWH A;  1VF5 B;  2WLJ A;  5CA0 B;  5L3B A;  1KT8 A;  2ZE7 A;  1R9T A;  2DQ3 A;  2UUB B;  1J5E H;  3BA9 A;  1QR9 A;  5LA6 F;  2QB5 A;  4MA5 A;  5I5T A;  3APQ A;  1W96 A;  2JIZ G;  4LF9 O;  3K5I A;  2W9C B;  3IGA C;  2YCH A;  1Q6I A;  4ZI7 A;  5A9G A;  5L1J A;  4DR6 H;  3D8C A;  5B3S C;  2CAZ C;  2WE6 A;  2E5L B;  2V58 A;  3T1Y H;  5IWA O;  1BSM A;  3GTJ A;  3AG3 B;  3SYC A;  3A0H Z;  4DV3 O;  1M7J A;  3I4M G;  5IY5 C;  4HN2 A;  3BAC A;  4LF7 H;  3L4J A;  4J9M A;  4RAY A;  4DL3 A;  2IJH A;  1PL4 A;  1BCC H;  1KUQ A;  3X2Q C;  1NI8 A;  1YVW A;  1AI6 A;  5L3D A;  4NVP A;  3APO A;  1I5Y A;  2R7M A;  4EFB A;  3WWJ A;  1I2L A;  5CA1 F;  5KFP A;  1URF A;  1MAB G;  1KEC A;  2N05 A;  4DR2 O;  3CJH A;  5FD5 A;  5KG3 A;  4RNO A;  4GX1 A;  5ITZ B;  4Q45 A;  3PW4 A;  4DL4 A;  3JD4 A;  4B3M H;  5IYC O;  3LDE A;  3PR5 B;  2CTW A;  4NXM H;  5L1I A;  3WFV A;  4FM1 A;  3PW2 A;  1QR8 A;  3M99 B;  2EJ3 A;  1OZ0 A;  4IYI A;  1GTO A;  2NU7 B;  3V6K A;  2N04 A;  4WFE A;  2P6J A;  2B5U A;  4DLK A;  2WDT A;  4I50 A;  2DYS B;  2YI8 A;  5K2M A;  3PW7 A;  2AZ2 A;  2WAQ E;  1CQJ B;  1K7D A;  5GTI Z;  3CRQ A;  3WB2 A;  2XC9 A;  4J7J A;  2BR0 A;  3BY6 A;  2WYO A;  3GIL A;  1I94 H;  4O84 A;  4UCV A;  3VPB A;  4JI5 B;  1M93 A;  3GB8 B;  1GRJ A;  1IOW A;  2VR1 A;  2OT5 A;  3OMN B;  1BE3 H;  4O7Y A;  1K4C C;  4R7R A;  2C28 A;  2IA6 A;  4IRK A;  1IBM O;  2EUL A;  5KUK A;  5KMG A;  4DV0 O;  4O7Z A;  2WLL A;  3RBZ A;  4GLW A;  2YYA A;  4ETS A;  4J11 A;  3R9R A;  3PO2 G;  5KS8 A;  5LA6 B;  4JI8 O;  4PWQ A;  4LFB O;  4LF5 H;  2F4V H;  5IJ9 B;  1XNQ H;  2HIX A;  2JS5 A;  3ZMS A;  1MNG A;  4X62 O;  2R92 G;  4HAM A;  4I7H A;  4AQY B;  3L70 H;  1Q6U A;  1FJG H;  3FKI A;  2V5A A;  4ECX A;  2EIJ B;  3G8C A;  3JAR B;  5BMV A;  1FXV A;  4CZZ A;  4H33 A;  4RUA A;  2GPS A;  1PD3 A;  4MTG A;  3HKZ A;  4I9W A;  5HFL A;  5IYD O;  5CE8 A;  2AGO A;  5DG8 A;  1K4D C;  2JEJ A;  1TA8 A;  3A8T A;  3KTM A;  3RVY A;  2ZM6 H;  1L8D A;  3WWH A;  2YRX A;  2W7P A;  5CA1 B;  2C2E A;  3SJQ C;  3ZRS A;  4X65 O;  4X1Y B;  4O3N A;  5DED A;  2WLI B;  3WB1 A;  4MV1 A;  2BSK B;  2IH3 C;  5FPO A;  4JI3 B;  2CE4 A;  1R6K A;  4YJ3 A;  1NU1 H;  1FYJ A;  1TWC A;  3H0G A;  3N40 P;  2HLD G;  1BXR A;  2ZIN A;  4OPH A;  4Q43 A;  2XCP A;  3K59 A;  1I7F A;  1AI7 A;  1Q86 W;  4MVZ A;  1SCU B;  2C22 A;  3WNZ A;  3RN4 A;  3GIQ A;  3OUF A;  2W9B A;  4E4E A;  2UU9 O;  5KFN A;  3AK3 A;  4O3S A;  3GTG A;  2VQE B;  5JQW A;  5KT3 A;  1COW G;  1ZLZ A;  2AGQ A;  2R9R B;  3MR5 A;  4GT1 A;  4ZOL B;  3OTO O;  3G4S V;  4WBN F;  2CKZ B;  1WCM G;  1JQ0 A;  5IYC G;  5JVD F;  4U3J B;  1OV9 A;  5IP7 G;  4JI2 H;  5FL7 G;  4O7T A;  3J80 N;  5DIS C;  4R8U B;  2DOS A;  3LUT B;  4DUZ H;  1QCE A;  2VQF B;  2FP4 B;  3TXS A;  5C1O A;  2HHH O;  2R8J A;  2Q0O C;  4UXN A;  3RB0 A;  3KZI Z;  2EX3 A;  1YIT V;  4QW9 A;  5LYJ A;  1W0J G;  3GIK A;  4QPK A;  2A06 H;  5BWX A;  1Y1W G;  4W4K A;  3OR6 C;  4DR1 O;  4DQN A;  3T9A A;  4K0K O;  2CFM A;  4DRX A;  5LOV F;  1P8L A;  4CC5 A;  4DV6 H;  4DV4 H;  3AK1 A;  3JAS A;  2C35 B;  3RYC A;  1XMQ H;  1IUR A;  3RT3 C;  1XOU A;  5HBR B;  1DTO A;  2CGO A;  4JPR A;  4LBE C;  4CS3 A;  3CSW A;  4FM2 A;  3QWU A;  5KAF Z;  3CS5 A;  5KG7 A;  5B1A B;  4NXN H;  3KCX A;  4TV8 B;  5EIB C;  2RDJ A;  1EUD B;  2CTP A;  3E86 A;  1KJJ A;  2ODT X;  1SQQ H;  2VOB A;  1N36 B;  4YIP A;  2ITD C;  5C8Y A;  5FPR A;  3VNN A;  2ZDQ A;  3ABK B;  3HO8 A;  1LUW A;  2N74 A;  4BWS C;  2E2H A;  5KLV H;  3L75 H;  1R6T A;  1YIJ V;  1FD9 A;  5KA5 A;  3LML A;  3QZ7 A;  5KFG A;  5DAA A;  4ED7 A;  4DV7 O;  4U6P A;  3CWB H;  2PI4 A;  1KP3 A;  3ZN0 A;  1YXB A;  1VBH A;  3GID A;  1N32 H;  5E1A C;  2COG A;  5H9C A;  2ZR3 A;  2R85 A;  3CEI A;  3RJ0 A;  1OCO B;  1NQT A;  1A0G A;  4JXU A;  1QLN A;  2VQD A;  3T99 A;  2LP7 A;  1GM8 A;  3CRC A;  4WBN B;  1VBG A;  5F9L A;  1G8M A;  5JVD B;  2RGV A;  1CPY A;  1VQK V;  3AEI A;  1ZHQ A;  1YTF B;  3B8N A;  2R87 A;  4DW0 A;  1EKF A;  1P49 A;  3Q2O A;  4CHI A;  4BBS G;  4GX5 A;  3GVM A;  5J2T B;  2BTQ A;  4TUY A;  5BXZ A;  1JDE A;  3PVX A;  1VQP V;  4RQE A;  4DUY B;  2CNV A;  4IAJ A;  5DM6 V;  3SJB C;  4FBT A;  1K33 A;  2X6A A;  3RYI B;  1S72 V;  5KG1 A;  4A3L G;  4ZIB A;  1V4Y A;  2EJR A;  2YIB A;  1KJI A;  2YEV B;  3J7A K;  3WG7 B;  3SE7 A;  2DWE C;  2QWQ B;  3JRW A;  3RYH B;  2WA3 A;  2ASD A;  4IR1 A;  4X1I B;  1DK1 A;  2P0A A;  2R7N A;  3G67 A;  4DV5 H;  1SQG A;  5J9P C;  2YI9 A;  4OX9 O;  2WWW A;  4BIU A;  4IHJ F;  1G6U A;  1YF2 A;  4E6N A;  4ECQ A;  1S77 D;  2UXB H;  3JAW B;  4PDL A;  4HNT A;  3ASN B;  5CBF A;  1XIL A;  2EJ0 A;  5C44 G;  1Z2O X;  4AHC A;  4NZM A;  5A2Q N;  2IBK A;  1VQN V;  3BJY A;  2A3Q A;  1JLL B;  2DN9 A;  1V51 A;  3RAQ A;  3HOY G;  4QNH B;  1WB7 A;  3H3V H;  4FFB B;  1RM1 C;  3QQM A;  4EB6 B;  2P22 C;  4LWS A;  4YJ2 A;  2P7T C;  2XAH A;  4X64 B;  2DAA A;  3TQ1 A;  4JV2 A;  4Q20 A;  1US6 A;  4X89 A;  4O86 A;  1PP9 H;  3CCL V;  2UVU A;  2UUA O;  4K3A A;  2O57 A;  1T94 A;  3VPD A;  3T9D A;  2XTA A;  5J2U B;  3ORR A;  5IJ0 A;  1VKZ A;  4ECV A;  3E5N A;  5C3E G;  4NYE A;  1SRY A;  3FMA A;  3OM3 B;  3G6Y A;  4LF8 H;  2K1E A;  2QGN A;  3AG4 C;  4YP3 A;  4A3D G;  1N34 H;  1SQP H;  4EEY A;  4GKJ O;  2QE7 G;  2L35 A;  3AG3 C;  3CCQ V;  5FD6 A;  5B1B B;  3U9T A;  5KFQ A;  1X4T A;  2PMZ A;  4RNN A;  2DPJ A;  5LMN H;  4CKE A;  4YAK B;  5K3W A;  2UXC B;  1S0O A;  2XAJ A;  3SJC C;  5KT5 A;  3MR2 A;  2CW7 A;  3ETH A;  4RB2 C;  2E3C A;  1UFI A;  4KP4 A;  3K58 A;  4J9S A;  4B3R O;  4P9P A;  1EZ1 A;  5C1P A;  2R8H A;  1Q90 D;  2R8G A;  1EN4 A;  2XT9 A;  1Q3E A;  4XYL B;  4CMF A;  1HNZ O;  3N41 B;  3SJA C;  2UUB H;  2YS8 A;  4IGG A;  4N23 A;  3HXL A;  4B3T O;  2NR5 A;  4GCZ A;  1VP7 A;  1AJP A;  3OTF A;  3LWB A;  3SGI A;  5KFF A;  2R7Z A;  5FJ8 G;  2PN1 A;  2XOK G;  4ICG A;  3JSN A;  2E5L H;  4YIO A;  5KX5 B;  3JD1 A;  1N48 A;  1VAJ A;  1WAZ A;  1ZL8 B;  2VA2 A;  3HPL C;  2QEX V;  2R72 A;  3K0D A;  5KAI Z;  4RAZ A;  2BQ3 A;  2Q2U A;  4F4Z A;  1PM9 A;  2KKW A;  5KG4 A;  4PV1 B;  1Y76 B;  4DL2 A;  2XND G;  4LF4 O;  1TWF A;  5GW7 A;  2Q4P A;  1IBL B;  4GX2 A;  3K04 A;  4MW3 A;  1M1K W;  2AXT Z;  2XAS A;  1WRV A;  3CC7 V;  4LFA O;  2VPS A;  5FLM G;  2EIJ C;  3UT5 A;  1ORQ C;  1XL6 A;  1SFO A;  1ZHS A;  1KTA A;  4WHX A;  3G6B A;  4J7Z A;  2W6I G;  5EBL C;  1UC8 A;  2SCU B;  1Y4M A;  1DIK A;  1Z2P X;  4FE2 A;  3H40 A;  4UV9 A;  4UCU A;  4YB8 B;  1OCZ B;  1JJ2 U;  3CPW U;  3U54 A;  1FS0 G;  3U9S A;  4QWD A;  1GO3 F;  2JEU A;  3W7U A;  2UXX A;  3OMI B;  3HOU G;  3IC7 A;  4JI5 H;  4O81 A;  3THO A;  3W7W A;  5DMX A;  3BQ1 A;  1K73 W;  3N2G B;  4EGQ A;  1HP8 A;  1XHX A;  2R86 A;  1P7B A;  4DR5 H;  2VWK A;  5LL6 Y;  4Q8F A;  2UXD B;  1K92 A;  3H20 A;  5B1O A;  2LGW A;  2JGU A;  5BYA A;  3ABL B;  4DV1 H;  3WO1 A;  1EKV A;  2CTQ A;  4O4H A;  2Q9L A;  4FJC C;  5I5X A;  4AQY H;  3M8A A;  2DAB A;  4ECZ A;  1THZ A;  1WA8 B;  5BYB A;  4TV9 A;  2PVP A;  2CZG A;  1RK6 A;  4O2A A;  4CH3 A;  2WAM A;  3FAV B;  5D1P A;  4NR1 A;  4PD4 F;  2V7Q G;  5BR8 O;  3W7X A;  5LXT F;  4GZR B;  3VQV A;  3T4Z A;  1XMO B;  1S0V A;  3GWK C;  3CX5 F;  4G28 B;  1NTK H;  4ED0 A;  5DLF A;  3FYE B;  1MG1 A;  1KKD A;  3FB8 C;  2WB1 A;  4YY3 B;  2QYZ A;  4DV2 B;  5T14 A;  2LQT A;  4J80 A;  2R7K A;  4J9R A;  4JV1 A;  1QHT A;  3B09 A;  1H8E G;  4JI3 H;  3BAB A;  4O7L A;  1HWY A;  1KQS U;  2QM7 A;  1YCI A;  3PJS K;  3UM7 A;  5KG6 A;  3RFR A;  2J6U A;  1P7G A;  2DWC A;  3TJT A;  2CQY A;  3SPH A;  1FKA H;  5KUM A;  2CGN A;  2ZE8 A;  3E8B A;  2CW8 A;  2C00 A;  4O7N A;  4QIW E;  3GQC A;  3NUA A;  4O3P A;  2VQE H;  4ME6 A;  4H0L B;  5EBM C;  1YTF D;  4MW8 A;  1JXL A;  3J81 N;  2OTL V;  3ZRW A;  1NH2 D;  2VPQ A;  5I5W A;  2LGQ A;  4RWU A;  3UYY A;  1AP6 A;  2IP4 A;  4EBC A;  3A0R A;  4J41 A;  4TVI A;  4RUC A;  2LFR A;  3QNE A;  1YJN V;  3ICX A;  1B33 N;  1MOF A;  1CKN B;  4O82 A;  2VQF H;  1B6Q A;  1VQ9 V;  5IT9 N;  4J42 A;  3QFF A;  3ABK C;  4MV4 A;  2A9H A;  2EZO A;  5KFE A;  3T5L A;  4P2Z A;  1OCC C;  1YDX A;  2JVD A;  2FLP A;  3V4Z A;  2Z0A A;  4LFC B;  2JA6 G;  4QWE A;  5EZY B;  1QNM A;  4X1K B;  2F93 B;  5LGT A;  5I5S A;  1V9P A;  1TAE A;  2Q7H A;  1OCO C;  1WCM A;  4KUM A;  4KXR A;  3UO2 A;  4JI4 B;  2YS7 A;  3I4N G;  2E2I A;  2NLJ C;  4JV5 B;  5KFK A;  4ED6 A;  4DL6 A;  4HNA B;  5LXT B;  1KJ8 A;  3MWM A;  1JVM A;  2IW5 A;  2HP8 A;  4MVM A;  3NBZ B;  4MTD A;  1DLB A;  1N0J A;  4DUZ O;  1I6U A;  4LR3 A;  5CA0 F;  3NXS A;  4R8C A;  5FLX W;  4C5A A;  1XQ8 A;  3Q4H A;  1AP5 A;  1WJZ A;  1N36 H;  3Q8Q B;  3E83 A;  1HNW O;  5KFO A;  2GHY A;  3WB0 A;  2EIM C;  2DZD A;  1UC9 A;  4UUG A;  1E1Q G;  2FL4 A;  1JX9 A;  1IBK O;  4FFP A;  1KU9 A;  4JYC A;  1TUB B;  3T54 A;  3T5K A;  3ASN C;  2W9C A;  4FLZ A;  4DV3 B;  1ROP A;  1M5I A;  3SPC A;  4N21 A;  2HEP A;  1FVI A;  1JIH A;  3G8D A;  3CRA A;  5IYB G;  3SPG A;  4WFH A;  2DQ0 A;  4X66 O;  3K03 A;  3WO0 A;  2BQR A;  3MR3 A;  2ZR2 A;  3JAK A;  1I2K A;  4MVU A;  1UJW B;  4DR2 B;  2QSA A;  4RNM A;  1SZX A;  5GON A;  4LFC O;  3RV3 A;  4DUY H;  2YUA A;  3N6R A;  3U0G A;  4A3B G;  1XI1 A;  3K08 A;  2R6F A;  3IC9 A;  5ITZ A;  4FLU A;  2Q8V A;  1V54 B;  3HKE B;  2YIA A;  3MWD A;  2UUC O;  1S76 D;  3SNO A;  5CB4 F;  4I55 F;  1BT8 A;  2ETN A;  3ML0 A;  3CSX A;  4JYY A;  3ZMU A;  2ZCE A;  1H2G A;  4FFL A;  5KFD A;  3ZX6 A;  5KG5 A;  5B1B C;  4JV0 A;  4UVB A;  1PK8 A;  1WN7 A;  5BY1 A;  2J9G A;  4LSX A;  5JQG A;  2QWN B;  4BW9 A;  3ZMT A;  2UVW A;  2VA3 A;  4J7K A;  4X20 A;  3KRE A;  4A3E G;  1EHI A;  2ASJ A;  4O2B F;  4DYL A;  2JK5 C;  1IBM B;  2GSM B;  5JVL A;  4DV0 B;  4DIM A;  2WLN A;  5KHK A;  4X64 H;  2HHF B;  4JI8 B;  4IIJ B;  3U0Z A;  4LFB B;  3ZED A;  3B2E E;  3N2K A;  2JDI G;  3AG2 C;  3AG4 B;  3OT7 A;  4MVQ A;  1PX2 A;  4LH6 A;  4X62 B;  5LA6 A;  3OD4 A;  1NZ6 A;  5IJ9 A;  1RP3 B;  1W59 A;  1K5Q A;  3W5O A;  3UFX B;  4XX0 B;  2R93 G;  2Q2T A;  3DSQ A;  4MV7 A;  2ZDI C;  3PFF A;  4ZI7 F;  1SET A;  5DG9 A;  3JAR A;  4DW1 A;  5DGB A;  4O7R A;  4XYM B;  1EFR G;  3GTP A;  4UCT A;  2W71 A;  3D3I A;  3SPI A;  3RGB A;  3GV7 B;  4O4J F;  3KXY T;  4LNU B;  3OFN G;  1NTZ H;  2A79 B;  4X65 B;  4F6R A;  1GN2 A;  5IYZ B;  4RAI A;  3ZN1 A;  2A1H A;  2AU0 A;  2PTM A;  5HV6 A;  5FNV F;  4O4L F;  3TII A;  2DW4 A;  3R5H A;  1YHQ V;  5CA1 A;  1DAA A;  4DAA A;  1VF6 C;  1DV1 A;  1VQ8 V;  2UXC H;  1CXZ B;  2YU9 A;  4XDJ A;  3EVK A;  2PYL A;  3JCU Z;  2Q7E A;  3TIN A;  1I5X A;  3TGU H;  2GQR A;  4YR0 A;  3M9O B;  3ASO B;  5CB4 B;  2P5O A;  4I55 B;  4J0M A;  2D2C B;  4E2L A;  4WFG A;  4JI0 O;  4FLW A;  3CB2 A;  3CP1 A;  1QLE B;  3FB5 C;  4PZ8 A;  5JH7 F;  2GTA A;  2UU9 B;  4Q8E A;  4A3J G;  2X7R B;  4RUE A;  2YS6 A;  1AVM A;  4ZOL F;  1OBD A;  1PNM A;  4BXX G;  3OTO B;  3GV8 B;  1S3J A;  5AG2 A;  1OCZ C;  3VQW A;  2CH7 B;  1QBZ A;  1JKJ B;  3C3T A;  4O2B B;  1VIB A;  2Q67 A;  5EK0 A;  4FU0 A;  1NVP B;  4OGQ B;  2I80 A;  4U3J A;  2AHZ A;  2HHH B;  3O9O A;  1AR4 A;  4GKK O;  3FFQ A;  5TIS Z;  2JS3 A;  4G27 B;  1ET0 A;  2WTF A;  3ZHV A;  2ABJ A;  3SYP A;  5H80 A;  3ABL C;  3H1H H;  4DR1 B;  5KFB A;  2QKA A;  4K0K B;  1IBL H;  3RV4 A;  1M9N A;  4I0X B;  1I3Q A;  3OGC C;  4ZI7 B;  1R73 A;  4A93 G;  4JI6 O;  2MK3 A;  3DC6 A;  3JYC A;  1Q6H A;  1C30 A;  5LMU O;  1D2D A;  1AUX A;  1U97 A;  2HJD A;  2YIC A;  4O4J B;  3JAL B;  1L2Z A;  3HKD B;  4TV8 F;  3K9S A;  1F7Y A;  5FNV B;  4O4L B;  3P3N A;  2E74 B;  2GQS A;  3SDL A;  1ARO P;  3DC5 A;  1BQZ A;  3D36 A;  4QJF A;  1EN5 A;  3CJH B;  5DQG A;  2QWP B;  4UB8 Z;  1XNR O;  1BS3 A;  4YHH O;  1CEZ A;  2PGG A;  1VEW A;  2R70 A;  4JYA B;  4PHZ A;  3MJF A;  5KFI A;  2OIG A;  4FIP C;  4BW5 A;  4EFE A;  1GM7 A;  4AIL C;  4DV7 B;  2ZE5 A;  5JH7 B;  1LUV A;  3MR6 A;  3DTG A;  2UXD H;  3CMA V;  2Y48 A;  3N27 A;  3FKS G;  1CS0 A;  2IM9 A;  2P4K A;  1WP8 A;  4EYH B;  2ZT9 B;  5KKN B;  4YBZ B;  3E22 A;  2OIE A;  1AUV A;  1KB9 F;  5EIB D;  1L0L H;  5BPH A;  4O3O A;  3AW8 A;  2GPW A;  3OGI B;  4MTF A;  4PDR A;  1OJH A;  3RR5 A;  4IYH A;  1EBO A;  1SEI A;  2Z04 A;  1MSD A;  4OXS A;  4WBN A;  5J2T F;  2OYQ A;  1JA8 A;  5JVD A;  4NKG B;  3I55 V;  1HNX O;  1Y66 A;  1XMO H;  3BQ2 A;  5DEC A;  4RZQ A;  1B3Q A;  2QJ1 A;  2V1D A;  2EIY A;  3KAJ A;  2WLL B;  5D1O A;  1FFT B;  3GWO A;  4JGS A;  3AK2 A;  4BIO A;  4AYB A;  3DXR A;  4A3G G;  4YY3 H;  3BQ0 A;  5JJN B;  1TVK A;  1VQ5 V;  1SQV H;  5EC1 C;  5LBQ A;  2DWD C;  2JJ2 G;  3ZMV A;  3BAA A;  4BBR G;  2YXY A;  2YEV A;  1ZQ7 A;  2F95 B;  2JRI A;  2VUM A;  4OX9 B;  4Z2W A;  2FB9 A;  4LMY A;  3ZHU A;  3J80 W;  4X1I A;  5LOV A;  5KG2 A;  4MV3 A;  4DR7 O;  2CTR A;  4JI7 O;  1Y14 B;  2F1M A;  1K34 A;  4TM5 A;  3JAW A;  3RVZ A;  4CBC A;  2KSW A;  2AGA A;  4IL6 Z;  4P30 A;  3QG5 A;  3T1H O;  2VUG A;  1Y74 A;  2BE3 A;  4YAJ B;  3TQT A;  2YID A;  1MZE A;  3MFI A;  2B63 G;  4F4Y A;  1H38 A;  3LP8 A;  4X88 A;  1RPR A;  1HR0 H;  2V4Q A;  4JYA O;  1BQ0 A;  5KT7 A;  1OCC B;  5IYD G;  4FLT A;  2HJF C;  2OCC B;  2AZ0 A;  4MV6 A;  1PNK A;  1S5J A;  5H6Q A;  4F6E A;  3RF2 A;  4FLV A;  3S3X A;  5J2U F;  2UUA B;  4ED3 A;  4DR4 O;  1RSO B;  2FK3 A;  2JA5 G;  2DPI A;  2GUZ B;  4I4T F;  3JAM N;  4J10 A;  3FX7 A;  1H8H G;  3LUL A;  2ZD9 A;  3K5L A;  2W9B B;  3HOZ G;  2ITC C;  3R5F A;  5DG7 A;  5KFX A;  2HIV A;  5D5P A;  3GTO A;  4PA7 A;  4PZ6 A;  4GKJ B;  3BG5 A;  4JI4 H;  2HR3 A;  2OWO A;  3OUU A;  1G1X B;  2ILM A;  2WLK A;  3LSS A;  4JV5 H;  1S0N A;  4TSF G;  3QO5 A;  1EN6 A;  1SF9 A;  1CKO A;  3OHA A;  4BIZ A;  3T9C A;  3CQZ A;  1JOY A;  1AN7 A;  2ZDG A;  1GKF A;  3V4S A;  1BZK A;  1B6R A;  4TUY F;  4LH7 A;  1OHH G;  3HKZ E;  5K1P A;  2EIM B;  2IBZ H;  2JA6 A;  1E4F T;  2DIK A;  4B3R B;  4NYK A;  2UVR A;  3GDE A;  3K3P A;  3MDS A;  3ETJ A;  5IE9 A;  1V54 C;  3WWI A;  3OSP A;  1HNZ B;  4UCS A;  1BNC A;  5L3F A;  1XDN A;  2IU3 A;  4PBC A;  1Q5O A;  4YXW G;  4HYK A;  4B3T B;  1MA1 A;  4LF9 H;  3O65 A;  1OCR B;  3JAS B;  4IHJ A;  4AI8 A;  2IJJ A;  1WPX A;  1DF4 A;  2HVK C;  2V4R A;  4TWK A;  5KX5 F;  4FS2 A;  4RB1 A;  5KT6 A;  4FS1 A;  2JA7 A;  2YZG A;  2ASL A;  4IR9 A;  5IWA H;  1WH2 A;  5F9N A;  4A2B A;  4DR3 O;  4DV3 H;  2YSU B;  4M0J A;  4G3I A;  4WFF A;  4D7T A;  4L8J A;  4HQ6 A;  4UUJ C;  4B08 A;  1ZL8 A;  1BHA A;  2ZXW B;  2UXN A;  4DR2 H;  4LF4 B;  4TQS A;  2Y0S A;  5C5J A;  1FXK B;  5I47 A;  4I4T B;  3TW6 A;  4FM9 A;  3UZB A;  1R3I C;  1Y76 A;  4XDK A;  2NUA B;  5A2Q W;  1N33 O;  1GN4 A;  3W1G A;  3QTC A;  4NTY A;  4B3S O;  4U7C A;  5IDJ A;  4LFA B;  4KHP O;  4B7E A;  3GB7 C;  4RQF A;  3IAY A;  3ZRV A;  5LP6 C;  3OR7 C;  4FLY A;  3VQX A;  2ZIM A;  1GSA A;  1C3O A;  1PPJ H;  1KYO F;  4JI1 O;  3K0G A;  2GLT A;  1A3G A;  3N44 B;  1YJW V;  1BHB A;  1M57 B;  5KFW A;  2FB5 A;  3FD9 A;  5BWT A;  2JGD B;  1VQ4 V;  4WFA V;  2B1I A;  4TUY B;  1GN6 A;  3B8M A;  2L6L A;  1F4M A;  4I9Q A;  1SA0 A;  3GIM A;  3JSL A;  5KA6 A;  2QTS A;  1SQB H;  4QIW F;  5JWP A;  2AGP A;  4LF6 H;  4RU9 A;  1ENV A;  3AG2 B;  2E76 B;  3F7V C;  4G2K A;  2C2D A;  3ETD A;  2ZNJ A;  3W1B A;  1IBM H;  5EWE A;  4DV0 H;  3ASO C;  3OUZ A;  4QW8 A;  1XHZ A;  1E1R G;  1NJI W;  3L4K A;  1S03 G;  3UCS C;  5KT2 A;  4JI8 H;  3KHH A;  1FXH A;  2EIK B;  2R9A A;  1QLE C;  3K9A A;  2PBZ A;  1I50 A;  4LFB H;  2YW2 A;  3STL C;  3ETQ A;  1GSH A;  1KKC A;  2YXH A;  2IH1 C;  1R3J C;  3BA8 A;  2DJV A;  2W8L A;  4PJ0 Z;  3A2F A;  5BR8 B;  1XRE A;  3FKI G;  1KBH A;  4TT3 G;  2OLS A;  1U96 A;  3L73 H;  4MVS A;  4CH6 A;  3ZCC A;  2R9I A;  4D6T H;  4X65 H;  4JYB A;  3W7T A;  4RO2 A;  5K1X A;  4EGJ A;  3RBD A;  3EPG A;  1KJQ A;  5JCO C;  1J5E O;  1PL0 A;  3R66 A;  3S24 A;  3TW7 A;  2RMK B;  3JD2 A;  1WNS A;  4JAU A;  1DGS A;  1SQF A;  3E35 A;  3ABT A;  3L9D A;  1O9G A;  1EZV H;  5IJ0 B;  5KFY A;  4DR6 O;  2NU6 B;  4A5U B;  3T1Y O;  4ZHQ F;  3SYQ A;  3JD0 A;  4O83 A;  3ZHQ A;  3LDD A;  2UU9 H;  4LF7 O;  4FFN A;  3WU2 Z;  4EYI B;  2Z5U A;  5KFT A;  3IN5 A;  3H4D A;  1H2N A;  5D5Q A;  1EM1 A;  3R65 A;  4ECY A;  2H8P C;  2HGW A;  3OTO H;  1Z5V A;  2ARH A;  4MTO A;  5B1N A;  1IYD A;  1K1Q A;  1JMK C;  2A7W A;  2JA8 G;  4B3M O;  5HFM A;  1K83 A;  3OSN A;  4RUF A;  2HGS A;  2HHH H;  1Y1V G;  3B40 A;  4NXM O;  2FJZ A;  5IP9 G;  1GAX A;  5EZY F;  5B66 Z;  1VQO V;  3QZ8 A;  3GTL A;  4ZQI A;  1TUE B;  2FK2 A;  4ECR A;  3N42 B;  3G71 V;  5L1K A;  1IX9 A;  4HYO A;  5CM0 A;  1CKM A;  1SS3 A;  2H94 A;  5KHI A;  5LL6 b;  4DR1 H;  4K0K H;  2KG7 A;  2QKS A;  3TXQ A;  2YL2 A;  1S0M A;  1I94 O;  2Q0A A;  4CKC A;  3I56 V;  4O3R A;  2BQU A;  1PNL A;  3CRM A;  4A3K G;  2R8K A;  2PUS A;  4Z1M G;  3K5N A;  4HNA A;  4O4I F;  3MFH A;  2FPP B;  3LQS A;  2NNU A;  5LXT A;  3TET A;  2B9Z A;  2R92 A;  1I1L A;  1RYS A;  1NS1 A;  3CC2 V;  4DUZ B;  4FZ0 A;  4IRD A;  2RGR A;  3HB3 B;  1Y67 A;  3FB7 C;  4LF5 O;  2F4V O;  1ULZ A;  1XNQ O;  3HKB A;  4HZ3 A;  2PMZ E;  1G4Y B;  2QWR B;  1FJG O;  1A32 A;  2Y4U A;  2Z3Y A;  1HNW B;  4IRC A;  2B1G A;  4ZHQ B;  4NB5 A;  2R7L A;  4O7V A;  1W0K G;  3ORQ A;  1IBK B;  4DV7 H;  3UT5 B;  5KT4 A;  1S97 A;  4XBF A;  4MV9 A;  1GMG A;  3HKC A;  1CQI B;  4GX0 A;  2ZM6 O;  1TUB A;  1F23 A;  2EZP A;  3ETE A;  1M0W A;  2WPD G;  4QE7 A;  4TQF A;  1K97 A;  2HDK A;  4MAM A;  2JEI A;  4FVM A;  4X66 B;  2Y0I A;  1BL8 A;  1N8R W;  5H5N A;  1VQL V;  4TQR A;  2ZJT A;  1QQC A;  3GLK A;  2WSS G;  2ALZ A;  1N0N A;  3KCY A;  2OCC C;  2QA4 V;  3I12 A;  3GIJ A;  3G6X A;  1J95 A;  2QTO A;  2AW9 A;  3EHB B;  3ZS8 C;  1HW7 A;  5HNE A;  2W6M A;  2UUC B;  1EZJ A;  1XBL A;  3OEH G;  1EUC B;  5LHI A;  2NU9 B;  3HKE A;  4UCO A;  2UVV A;  1RJR A;  3T7A A;  2GV9 A;  1VF7 A;  4M7E A;  4EBE A;  4A3F G;  4OX9 H;  2HKO A;  3STZ C;  4TV9 B;  5DGH A;  3RYF A;  4J9O A;  2J6S A;  1ZAU A;  4JI2 O;  2XCL A;  4CKB A;  1SER A;  4O4I B;  5FLX N;  4NLG A;  5IT9 W;  1NBM G;  2PY5 A;  3ZJZ A;  5EWF A;  1ZET A;  1P84 F;  2R82 A;  4A2A A;  1Y1W A;  4HNV A;  3HOV G;  4X9Q A;  2X6B A;  2QKC A;  2COI A;  4IIJ F;  2WAQ A;  1FFX B;  2P06 A;  3JAT B;  3R23 A;  4UFZ A;  5CA0 A;  3CVZ A;  1X59 A;  4RB3 C;  2FTK A;  1R3L C;  3CCR V;  2Q73 A;  3RFC A;  2UUA H;  3KHR A;  4DV6 O;  2ZDH A;  4DV4 O;  3KAL A;  3KYH C;  4F4X A;  1XMQ O;  5LP6 F;  5L1L A;  3JRX A;  1OCR C;  1WLE A;  4IT5 A;  2FKL A;  1G2W A;  5KHH A;  3P32 A;  3FYI B;  3QF7 A;  2B63 A;  3LNN A;  2PI5 A;  1EYZ A;  4GKJ H;  1GN3 A;  4NXN O;  1Q43 A;  5IYZ F;  4DO2 A;  4JTA B;  2OTJ V;  2CNQ A;  1I1K A;  1E4E B;  3KKY A;  3HOX G;  3HOW G;  3AYH B;  4LNU A;  2JA5 A;  3ABU A;  2FK1 A;  3LNM B;  4FFM A;  3M9N B;  5KFU A;  2YDE A;  2ZXW C;  1IZ3 A;  1FXK C;  4Q44 A;  3RB6 A;  2W0X A;  2FYU H;  1N32 O;  4B3R H;  1R1B A;  2HG5 C;  4JI0 B;  3K5O A;  1H2K A;  2ZIO A;  3V6H A;  1JFF B;  4R50 A;  5CB4 A;  2Y4T A;  4I55 A;  2WB1 E;  1HNZ H;  5KFL A;  4DL5 A;  3PZP A;  2WLM A;  2P90 A;  4YR2 A;  3KAK A;  2ADQ B;  4FZ1 A;  4B3T H;  3CCJ V;  4K8Z A;  1XK5 A;  3TY5 A;  4BR6 A;  5F2V O;  1M6V A;  2FLN A;  1M57 C;  1H2L A;  3DTF A;  2Q7D A;  1GLV A;  4MVR A;  2X5R A;  3OEE G;  2CH7 A;  1K8A W;  3NC0 B;  3P3P A;  2EIL C;  4F50 A;  3BFR A;  4GKK B;  4O2B A;  4J9L A;  2WLH A;  3H1I H;  4EKW A;  1P16 A;  3H9V A;  4PA3 A;  4FMT A;  3Q4H B;  4NTX A;  5JCO A;  4DV5 O;  2COJ A;  4W4L A;  2IJK A;  2ZGI A;  3QVN A;  4LF4 H;  1AR5 A;  2F66 C;  3K06 A;  5LP6 B;  2UXB O;  2RCV A;  2EIK C;  3OE7 G;  4MV8 A;  2QF7 A;  1SC5 B;  4GC7 A;  3SR2 C;  5KFH A;  4ECU A;  4QE9 A;  5CBH A;  4LFA H;  4JI6 B;  4FK5 C;  3TY9 A;  1WP7 A;  5I5U A;  4J9Z B;  4I0X A;  2Y69 B;  4K35 A;  3U55 A;  5LMU B;  2W6Z A;  2P4V A;  4J9P A;  3F5W C;  3JZI A;  1F51 A;  4JZ2 A;  1M56 B;  1MSW D;  3S3W A;  3RTX A;  4QGP A;  1TWA A;  4X1Y A;  3ABM B;  3JAK B;  4O4J A;  2WLI A;  3JAL A;  2BSK A;  3MHH C;  3HKD A;  3FDS A;  3Q8P B;  3AG1 B;  5FNV A;  4O4L A;  4IWY A;  3T2M A;  2X6C A;  2PZS A;  3HT5 A;  4O3Q A;  1XNR B;  3D3Q A;  5GON B;  3RW0 A;  5L3G A;  1Q7Y W;  5I5Y A;  4YHH B;  3IJ4 A;  4LSA A;  3RGZ A;  2PF4 E;  5DLG A;  1R6N A;  3T9F A;  3GII A;  4LF8 O;  2JEF A;  1N34 O;  4I50 F;  3DAA A;  5JH7 A;  2ATK C;  3SPJ A;  2FPI B;  5LGU A;  5DQI A;  5GTH Z;  1AJN A;  5LMN O;  2RF4 A;  4ZOL A;  2XHB A;  2RQ6 A;  3PN1 A;  4WFB V;  4LC1 A;  4CH4 A;  2X0S A;  5EYP B;  5JQG B;  3MWE A;  3H01 A;  1GK9 A;  1P4R A;  4R8U A;  4X20 B;  5BR8 H;  1HNX B;  4ED1 A;  4R7C A;  1GSO A;  2LFS A;  4LF6 O;  4TQD A;  3Q8S B;  3TIG A;  3EXA A;  1XEQ A;  4B7K A;  4K8X A;  2UUB O;  3DTU B;  1LR1 A;  3NR7 A;  4DR5 B;  3N2K B;  1I0H A;  2EJ2 A;  1BGW A;  2M05 A;  4O7W A;  3GTK A;  2KQX A;  1AIL A;  4XDL A;  4DV1 B;  5BMV F;  2Q5Z A;  2G38 A;  1IXB A;  2ZKO A;  4GUN A;  4WF9 V;  5E25 A;  2E5L O;  1K3E A;  4H37 A;  1W2B U;  4DR7 B;  1IDS A;  5BWV A;  4JI7 B;  3P30 A;  4DK1 A;  5KHG A;  2QM4 A;  3K79 A;  4H44 B;  1VS0 A;  2HFE C;  3ZIA G;  3T1H B;  5JUM A;  1Z5W A;  2XUM A;  4PDV A;  2KB1 A;  4F6R B;  2W7O A;  4TV8 A;  3AX6 A;  3AG7 A;  4YJ3 F;  4ECT A;  2RDC A;  5DN6 G;  5BPF A;  4H13 B;  2K9P A;  1KP2 A;  4ABM A;  1I7L A;  2W9A A;  2FPG B;  3TY8 A;  3I5D A;  5KG0 A;  1M0T A;  4FFK A;  4DR4 B;  3CCE V;  2YZN A;  3SYA A;  5D8D A;  4MT8 A;  3Q1K A;  3KHG A;  4I50 B;  2IMW P;  1QU7 A;  1E4G T;  1RSO A;  2YC0 A;  2GUZ A;  2QR4 A;  3G80 A;  1VAR A;  3VPC A;  4WD3 A;  3ZBH A;  1SKV A;  3F5T A;  1ZX3 A;  5BWW A;  2OH2 A;  5L3E A;  4FLX A;  2Y4R A;  4O7S A;  2J6T A;  4JI5 O;  5KMG B;  5J2T A;  4HNU A;  3VOU A;  4C5C A;  2NVY A;  1Y1V A;  2R84 A;  1TWG A;  3CCU V;  1ZTE A;  1GH6 A;  4DV2 H;  3RYI A;  3CCM V;  1JJO A;  3GTQ A;  3BPZ A;  3CHX A;  3MD0 A;  4DR5 O;  4DK0 A;  5LYJ F;  2PYJ A;  4C7U A;  3OUS A;  2LJ2 A;  1S5H C;  1SZT A;  4YR3 A;  4DV1 O;  4QSH A;  1ZUQ A;  3C3S A;  3F7Y C;  3RYH A;  2BCC H;  1S9F A;  5BMV B;  5BWR A;  4AQY O;  1HNW H;  4GC6 A;  3QO7 A;  5KFA A;  1WB8 A;  3T4D A;  1RPO A;  2V4D A;  1IBK H;  2IU0 A;  3CD6 V;  4MS2 A;  1Q81 W;  3RB4 A;  1XL4 A;  2RDI A;  4DR3 B;  2YRW A;  2EIN B;  3EYY A;  2IJI A;  4EG0 A;  2HVQ A;  1B04 A;  1HDJ A;  4FFB A;  2FE3 A;  3UO3 A;  3HR0 A;  4YJ3 B;  3VQY A;  4EB6 A;  2FML A;  4OPA A;  4FFO A;  5KFC A;  5LHH A;  4X66 H;  1M4U A;  1PV0 A;  2Q7G A;  4JI3 O;  1JX4 A;  5C8Y F;  4QJF B;  4HR7 A;  1D5N A;  3OHB A;  5CAE B; 
#chains in the Genus database with same CATH homology
 4HNA B;  1Q8I A;  4CH6 A;  5LXT B;  3MWM A;  2WDT A;  4X65 H;  4LFC H;  4I50 A;  5J2U A;  2YI8 A;  5K1X A;  1N33 B;  3NBZ B;  4MTD A;  5JCO C;  2VWJ A;  4B3S B;  4I4T A;  3WB2 A;  3S24 A;  4KHP B;  4GLX A;  2UUC H;  1WNS A;  2WYO A;  3RGX A;  1DGS A;  4LR3 A;  1SQF A;  2YXL A;  4D7S A;  3C0F B;  1I94 H;  1I6U A;  4UCV A;  1O9G A;  4JI5 B;  5IJ0 B;  3E22 B;  1M93 A;  3GB8 B;  2RJZ A;  5FLX W;  1XQ8 A;  3GJX B;  4R7R A;  1N36 H;  4JI1 B;  5KMG A;  3WB0 A;  4ETS A;  2UU9 H;  5LA6 B;  3JAM W;  4LF5 H;  2F4V H;  1KU9 A;  4HBN A;  1TUB B;  5IJ9 B;  5LYJ B;  5D5Q A;  2HIX A;  3RIZ A;  1XNQ H;  2JS5 A;  3OTO H;  4I7H A;  1Z5V A;  4FLZ A;  4DV3 B;  4AQY B;  5D1O B;  1M5I A;  2HVR A;  1FJG H;  1JMK C;  1TVK B;  2HEP A;  1FVI A;  3JAR B;  5BMV A;  4DRX B;  1SYX B;  2MCT A;  2HGS A;  2HHH H;  3RYC B;  3JAK A;  1TA8 A;  4DR2 B;  5LOV B;  2ZM6 H;  1L8D A;  5CA1 B;  5GON A;  4X1Y B;  4DUY H;  3N42 B;  4RB0 A;  1XI1 A;  3WB1 A;  5KX5 A;  5FPO A;  4JI3 B;  5ITZ A;  4FLU A;  1CKM A;  5KHI A;  3K3V A;  3HKE B;  2YIA A;  5LL6 b;  4DR1 H;  4K0K H;  4YJ3 A;  4EQ5 A;  3N40 P;  3CSX A;  2Q0A A;  2ZIN A;  5C8Y B;  5KHJ A;  3UQ8 A;  2ZCE A;  3K59 A;  1I7F A;  2PUS A;  3K5N A;  4HNA A;  1J5E B;  5LXT A;  4FM0 A;  1WN7 A;  4TOI A;  2VQE B;  4LSX A;  4DUZ B;  5JQG A;  2RGR A;  3MAQ A;  3BHP A;  4BW9 A;  4X20 A;  4DR6 B;  3HKB A;  3T1Y B;  4ZOL B;  4JI0 H;  3L2P A;  1HNW B;  1IBM B;  4DV0 B;  4U3J B;  4ZHQ B;  4JI2 H;  4DRF A;  4LF7 B;  5KHK A;  5DIS C;  3N6X A;  4X64 H;  4DUZ H;  4JI8 B;  2VQF B;  1IBK B;  4DV7 H;  4IIJ B;  3UT5 B;  3U0Z A;  4LFB B;  2BTQ B;  3ZED A;  3B2E E;  3N2K A;  2O03 A;  4MV9 A;  2EX3 A;  3HKC A;  4LH6 A;  4X62 B;  5LA6 A;  4PI2 A;  5IJ9 A;  5LYJ A;  1TUB A;  3W5O A;  1M0W A;  4B3M B;  4TQF A;  3K57 A;  2Q2T A;  3DSQ A;  4FVM A;  4X66 B;  4MV7 A;  3BRC A;  3N2G A;  1TGO A;  3JAR A;  2CFM A;  4DRX A;  4GKK H;  4NXM B;  1P8L A;  2ZJT A;  4CC5 A;  4DV6 H;  1QQC A;  4DV4 H;  4UCT A;  4X62 H;  3JAS A;  3RYC A;  3RGB A;  1XMQ H;  3KXY T;  4LNU B;  4X65 B;  4F6R A;  5IYZ B;  4PDB A;  2PTM A;  4CS3 A;  3ZS8 C;  1HW7 A;  4FM2 A;  5CA1 A;  3QWU A;  4IHJ B;  2UUC B;  5EOY A;  2UXC H;  2PYL A;  2Q7E A;  4NXN H;  1I94 B;  4JI6 H;  4TV8 B;  5EIB C;  3HKE A;  5CB4 B;  2P5O A;  4I55 B;  4UCO A;  4YJ2 B;  4J0M A;  5LMU H;  2GV9 A;  1VF7 A;  2VOB A;  1N36 B;  4M7E A;  4OX9 H;  4FLW A;  3CB2 A;  5FPR A;  4TV9 B;  5C8Y A;  3VNN A;  4PZ8 A;  3RYF A;  4BWS C;  2UU9 B;  1ZAU A;  1NT2 B;  3U10 A;  4O4I B;  5IT9 W;  3LML A;  2PY5 A;  4LF5 B;  2F4V B;  1XNQ B;  1N32 H;  3OTO B;  4A2A A;  3RJ0 A;  1FJG B;  1XNR H;  3VQW A;  4YHH H;  4WBN B;  4O2B B;  1FFX B;  3JAT B;  3F8N A;  4UFZ A;  5CA0 A;  5JVD B;  3CVZ A;  2RGV A;  4RB3 C;  4U3J A;  2HHH B;  4ZHQ A;  4Q0Y A;  1ZHQ A;  1KMI Z;  2XIG A;  1P49 A;  2UUA H;  3FFQ A;  3KAL A;  3KYH C;  5J2T B;  2ZM6 B;  2BTQ A;  4TUY A;  3NBY B;  4DUY B;  4IAJ A;  3SJB C;  3RYI B;  5KHH A;  4DR1 B;  4ZIB A;  4K0K B;  2YIB A;  1IBL H;  3QF7 A;  3LNN A;  4GKJ H;  3J7A K;  4ZI7 B;  1Q43 A;  1SA0 B;  3RYH B;  1CKN A;  1HNX H;  4X1I B;  4PZ7 A;  4DV5 H;  1SQG A;  2YI9 A;  1G6U A;  4E6N A;  2UXB H;  3JAW B;  4O4J B;  3JAL B;  1YEW A;  4LNU A;  1L2Z A;  3HKD B;  5FNV B;  4O4L B;  5EZY A;  1S68 A;  1Z2O X;  4X1K A;  4AHC A;  4B3R H;  5JJE B;  4JI0 B;  3K5O A;  4FFB B;  2ZIO A;  2W57 A;  4EB6 B;  1JFF B;  2P22 C;  2PGG A;  5CB4 A;  2R70 A;  4JI2 B;  4I55 A;  4YJ2 A;  4JYA B;  1HNZ H;  4DR7 H;  4PHZ A;  4JI7 H;  4X64 B;  4EFE A;  4AIL C;  3KAK A;  4DV7 B;  5JH7 B;  4CC6 A;  4B3T H;  2UXD H;  2BTO A;  4K8Z A;  4O4I A;  1XK5 A;  3T1H H;  2IM9 A;  3TY5 A;  5J2U B;  5IJ0 A;  3E22 A;  5EIB D;  4JYA H;  3RR5 A;  3FMA A;  4LF8 H;  3N43 B;  3NC0 B;  1SEI A;  4GYC B;  4WBN A;  4O2B A;  4GKK B;  1FFX A;  3JAT A;  3RWR D;  2OYQ A;  1N34 H;  4DV6 B;  5JVD A;  4DR4 H;  4DV4 B;  1P16 A;  5FD6 A;  1XMQ B;  3K5M A;  1XMO H;  1X4T A;  4RZQ A;  2QJ1 A;  5JCO A;  5LMN H;  1D5A A;  2ZNI A;  3KAJ A;  4LF4 H;  1GYF A;  5D1O A;  2F66 C;  5LP6 B;  4CS2 A;  4YY3 H;  4Q6G A;  5JJN B;  1TVK A;  2UXC B;  3SJC C;  3SR2 C;  4NXN B;  2CW7 A;  4LFA H;  4JI6 B;  3BAA A;  4BWA A;  3M7M X;  3TY9 A;  4RB2 C;  2E3C A;  1X9N A;  4CH5 A;  3K58 A;  2F95 B;  3IG0 A;  5LMU B;  4OX9 B;  4LMY A;  3J80 W;  4X1I A;  5LOV A;  1HR0 B;  1Q3E A;  3RTX A;  3N41 B;  4X1Y A;  3SJA C;  2UUB H;  2F1M A;  3JAK B;  3JAW A;  4O4J A;  2KSW A;  3J81 W;  3JAL A;  3HXL A;  3HKD A;  1N32 B;  5FNV A;  4O4H B;  4O4L A;  3OTF A;  3QG5 A;  2VUG A;  2PZS A;  3SGI A;  1XNR B;  5GON B;  3U11 A;  3JSN A;  4YHH B;  2E5L H;  1HR0 H;  4O2A B;  4LSA A;  5KX5 B;  3RGZ A;  4FLT A;  1JFF A;  1S5J A;  4UCR A;  3RF2 A;  2R72 A;  4FLV A;  2HVS A;  2UUA B;  4RAZ A;  2Q2U A;  5JH7 A;  5JJJ B;  2KKW A;  4DR3 H;  3K5L A;  4MTE A;  4ZOL A;  2XHB A;  2RQ6 A;  3PN1 A;  4CH4 A;  2HIV A;  5D5P A;  5EYP B;  5JQG B;  1IBL B;  4PZ6 A;  1O9H A;  4GKJ B;  3DF7 A;  4X20 B;  2VPS A;  5BR8 H;  3HKB B;  1HNX B;  4JI4 H;  4IIJ A;  3UT5 A;  2OWO A;  1ZHS A;  4JV5 H;  4DV5 B;  4KL1 A;  2UXB B;  1CKO A;  4TQD A;  1Z2P X;  1N33 H;  4CS4 A;  4UCU A;  4K8X A;  1AN7 A;  4B3S H;  4DR5 B;  3N2K B;  1WPB A;  5LP6 A;  1BGW A;  4LH7 A;  4KHP H;  5K1P A;  4LF9 B;  3HKC B;  1E4F T;  4DV1 B;  4B3R B;  1MZB A;  4JI5 H;  3GDE A;  5IWA B;  1T5E A;  1HNZ B;  3THO A;  4DR7 B;  4UCS A;  5IYZ A;  2YIB D;  4JI7 B;  4APM A;  1XDN A;  3N2G B;  4DK1 A;  4JI1 H;  1XHX A;  5KHG A;  1Q5O A;  4DR5 H;  2VWK A;  4B3T B;  2QM4 A;  2UXD B;  1VS0 A;  4LF9 H;  3H20 A;  3JAS B;  4IHJ A;  3T1H B;  1Z5W A;  2JGU A;  4DV1 H;  4F6R B;  4RB1 A;  4TV8 A;  4O4H A;  1WH2 A;  5IWA H;  4A2B A;  4AQY H;  4DV3 H;  4D7T A;  4LF8 B;  4TV9 A;  1BJT A;  3TY8 A;  4L8J A;  3M4I A;  4CH3 A;  4O2A A;  1N34 B;  4B08 A;  1Z2N X;  1M0T A;  5D1P A;  4DR4 B;  4PI0 A;  3VQV A;  1XMO B;  4I50 B;  5LMN B;  1E4G T;  4LF4 B;  4DR2 H;  1RSO A;  3RYF B;  4I4T B;  4FM9 A;  4EEQ A;  4YY3 B;  5A2Q W;  1H2S B;  3W1G A;  4DV2 B;  1SKV A;  3QTC A;  1O75 A;  1QHT A;  4LFA B;  4JI3 H;  5EYP A;  3BAB A;  4FLX A;  3IAY A;  5LP6 C;  3RFR A;  5KMG B;  4FLY A;  4LF6 B;  5J2T A;  1A0I A;  3VQX A;  5CA0 B;  2ZIM A;  2UUB B;  4DV2 H;  3BA9 A;  1J5E H;  1FKA H;  3RYI A;  1JJO A;  2CW8 A;  3N44 B;  3BPZ A;  3CHX A;  4DK0 A;  2PYJ A;  2VQE H;  2YCH A;  4TUY B;  4ZI7 A;  4I9Q A;  1SA0 A;  4DR6 H;  2WE6 A;  2CAZ C;  3JSL A;  3RYH A;  2E5L B;  3T1Y H;  5BMV B;  4LF6 H;  1HNW H;  2ZNJ A;  3W1B A;  1IBM H;  4DV0 H;  4LF7 H;  1XHZ A;  3L4J A;  3ICX A;  4RAY A;  3L4K A;  1S03 G;  2V4D A;  1CKN B;  2VQF H;  1IBK H;  4JI8 H;  4LFB H;  2R9A A;  4NVP A;  4EFB A;  3ETQ A;  4DR3 B;  2JVD A;  3EYY A;  5FD5 A;  4LFC B;  5ITZ B;  2HVQ A;  1B04 A;  4FFB A;  3BA8 A;  2FE3 A;  5EZY B;  4YJ3 B;  3VQY A;  4EB6 A;  4B3M H;  4X1K B;  2F93 B;  4X66 H;  1V9P A;  1M4U A;  1TAE A;  2Q7H A;  2Q7G A;  3A2F A;  5BR8 B;  4JI4 B;  4NXM H;  4FM1 A;  4JV5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...