4ZQIA

Crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
306
structure length
292
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop
doi rcsb
source organism Yersinia pestis
total genus 90
structure length 292
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4zqiA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4zqiA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zqiA01
2XD4A 3LP8A 1A48A 2R7KA 1IOWA 2YZLA 2QK4A 2NU7B 3TQTA 2PVPA 2Z02A 3LWBA 1UC9A 2DLNA 1DV2A 3K5HA 1CQIB 2V58A 1CQJB 5H80A 1VBGA 3K3PA 1KJQA 2I8CA 3U54A 4NYEA 5J2UF 4J6EA 5JQGF 5CB4F 2GPWA 3OUZA 4M98A 5JH7F 4O82A 4I4TF 3VOTA 4O7SA 3BSSA 4O7RA 4YAKB 5EZYF 2R7MA 4O4HF 2R87A 3ETJA 5C1OA 1OBGA 2YW2A 3VPBA 5JVDF 4EGQA 3R5HA 1PK8A 2PN1A 3OUUA 3KAKA 4O7NA 4O4IF 3QFFA 3GLKA 3E5NA 5KX5F 5JVLA 2FPGB 2YS7A 5K2MA 2CZGA 4DIMA 1JKJB 4MV6A 4EAAA 4RZQA 1UC8A 1DIKA 5CA1F 4O86A 4O7LA 3KAJA 3AW8A 2V59A 2VPQA 4FFOA 4FE2A 3SE7A 3DF7A 1AUXA 2NU6B 4IHJF 4O81A 2DWCA 1AUVA 4ZHQF 4ME6A 2R7LA 5D8DA 2X0SA 2WYOA 2YL2A 4C5CA 5LOVF 3V4ZA 5HV6A 2GPSA 4GGMX 3HO8A 1Z2NX 4HNUA 1KJJA 2DIKA 2W6OA 5LA6F 2W6ZA 2CQYA 5LP6F 3BSWA 1EYZA 3N8DA 4O84A 2YRWA 1CS0A 3ETHA 4YJ2F 1W93A 5GONF 4QSHA 1KBLA 3WNZA 4O7ZA 2YZNA 4I55F 1I7NA 4MV4A 1WR2A 2V5AA 4C5AA 2FPIB 2DZDA 4I50F 2FP4B 4TV9F 3VA7A 2FB9A 4HR7A 3U9SA 2ZDQA 2Z04A 4EG0A 2CNVA 3U55A 4WBNF 2XCLA 5C8YF 4YB8B 2GQRA 3V4SA 4O7WA 2R84A 2IP4A 3KALA 1T36A 4O83A 1KUTA 1E4EA 5FNVF 2NPOA 3N6RA 4L1KA 4FFMA 4TUYF 3TIGA 1EUCB 5J2TF 2HJWA 2P0AA 3GIDA 4ZOLF 1KJ9A 1M0TA 2ZDHA 2CNUA 2NU8B 1EUDB 2YWVA 2R85A 1PX2A 1CE8A 1I7LA 3JZIA 3MWEA 1GSAA 2VQDA 3R5FA 4Y8VB 2OLSA 1W96A 3JZFA 5CA0F 4XX0B 4M99A 3WO0A 3Q1KA 2W6MA 4FGRA 5BPHA 4M9UA 3G8CA 3I12A 3TIIA 1KC7A 5KKNB 2HGSA 2I80A 4O7VA 4O7YA 2I87A 2W6QA 1GSHA 5HBRB 4DLKA 2GQSA 3VPCA 4O2AF 4EA8A 4EGJA 3JRXA 2W71A 1Z2OX 1BNCA 3KREA 5DMXA 2YS6A 5LXTF 5JQWA 4XZ3B 5BPFA 4IWXA 2VHEA 3R23A 4MV3A 3HB9A 3TW6A 4O4LF 2R86A 3U9TA 3AX6A 1OBDA 4EABA 3R5XA 3BSYA 4MV8A 2R82A 4O7TA 3BG5A 3MJFA 1SCUB 2FPPB 4YJ3F 3ORQA 1B6RA 4XYLB 2J9GA 2QF7A 4MA0A 4ZQIA 4ZI7F 3K5IA 2PBZA 4IWYA 4WD3A 1M6VA 1M0WA 1IOVA 1DV1A 2C00A 1C30A 3G8DA 1EHIA 5LYJF 1GSOA 1KEEA 2W70A 5BMVF 5C1PA 1A9XA 1JLLB 1EZ1A 3TINA 4FU0A 3WO1A 2YZGA 4IZOA 3VPDA 4C5BA 4MV7A 4MV1A 1GLVA 2YYAA 1ULZA 4EA7A 3JRWA 4FFNA 2NUAB 2R7NA 3RFCA 4M9CA 1C3OA 4TV8F 4E4TA 5I47A 4FFRA 4FFPA 1B6SA 2CNQA 1GGOA 4IIJF 2R6FA 2W6PA 4YBZB 1E4EB 3RUPA 2SCUB 2YRXA 2NU9B 3Q2OA 4YAJB 3VMMA 3MWDA 2W6NA 1VKZA 3UFXB 4FFLA 4O4JF 4XYMB 2YZMA 1JDBB 3HBLA 4HNVA 3RV3A 5CAEB 1VBHA 1BXRA 1KJIA 3RV4A 4MV9A 4MAMA 3BFPA 2ZDGA 4MA5A 1KJ8A 2GLTA 2VR1A 3R9RA 1Z2PX 3ORRA 4EA9A 4O2BF 5IYZF 4HNTA 3NUAA 4HQ6A 1JDEA
chains in the Genus database with same CATH superfamily
4XLZA 2MINB 1PDVA 1AQYA 1X7YB 4EH1A 3LWBA 1GGFA 5DP2A 4LFCB 3T12A 4QQNA 1OJLA 3KCQA 4M1YA 1SC6A 2ERYA 3ANYB 3TTYA 1RWPA 4UC0A 4D3XA 1UWLA 1B14A 5NULA 2JFZA 4ZDKA 1WD5A 1R4AA 1L8OA 1DTSA 3CCCA 4PLFA 1HNXH 1F1JA 3U4GA 2L18A 3NBZC 2OFOA 3TR0A 3KXPA 2DUMA 1VSUA 4KHPH 3VZRA 2GGSA 2Z1MA 4GQBA 2PMWB 1LSUA 1NW3A 1X7XA 5A05A 2X4LA 4MHTA 5J1TB 3FYUC 4DAOA 4N3AA 4DHEA 4OI2A 4DL3A 1N75A 2N75A 3MT8A 2HDWA 3GIWA 2P4UA 2H08A 4CG1A 4NMHA 2CL6X 2FNAA 1RE1A 3ADOA 1AURA 4F3YA 5FUBA 3A25A 4EQ6A 1F17A 5EQDA 1C3OB 3KXKA 4KWCA 3SLKA 2NXWA 3FPAA 2IXEA 3HLKA 3L6EA 5JEEA 1OFTA 2V7GA 2EIHA 2A57A 4JEIA 5ESRA 3KAQA 2JI6A 3PHBE 1YZ3A 4AY3A 1HNNA 1ZKDA 1MTOA 3IOYA 1I01A 3BA1A 4F7WA 3MCTA 4UHBA 1VCMA 4I55F 3FSRA 1P17A 3O2QB 4UBNA 1ENOA 3CSUA 3QE3A 3NOVA 4L95C 3SOPA 1F2VA 4LJSA 5GADl 2YW9A 3T1QA 3WB1A 1F3OA 3KJFA 2CLDX 3B2QA 4PPYA 3NG1A 2K5UA 1X80A 4IDCA 4U8HA 5J2TF 2FQXA 1YRQA 1PO7A 1LSSA 4M60A 3H13A 3F4BA 3W6OA 3QEOA 4EFMA 2EQBA 4AZVA 3QKSB 4ZPXA 3ZU2A 3ZNPA 3R5TA 4DLNA 1ZSNA 4JYBA 2RARA 1WUYA 5LQCA 3L4BC 3ECAA 1T9AA 4K9SA 2D5BA 1PGNA 5K3DA 5JY1A 3FWHA 3L1KA 2ENWA 3WGMA 2QN3A 2G70A 1ZRMA 3X1KA 3K2IA 1K5HA 2B1JA 1TJ4A 3VR4D 2HMWA 3EHEA 1ZMXA 2V5UA 3I83A 1M54A 3EY4A 3HLYA 4LY6A 1Z2OX 4AWAA 1Z18A 2YUIA 3SFVA 1JLKA 4LPKA 3DTVB 1UBGA 2Q8QA 2IS6A 1A5ZA 3I1YA 1NJFA 1PRYA 4J7CA 5TB5A 1ES9A 4TZ0A 1SHZA 1NAIA 4FHEA 1Q1EA 3SD7A 2BTOA 2OH2A 1TXGA 3FOBA 4FSHA 1GG2A 4YV0A 5LJIA 1B6RA 3EAFA 4UCXA 5KWEA 4LQ4A 2C00A 3BC1A 4O4LA 1UT5A 5KYUB 5BMOA 4YMSA 5DT2A 3LX6A 4KUEA 1LK7A 2ZYIA 2JIDA 4OHFA 1X70A 4D8UA 2O2YA 4PYIA 5JS1A 3LOPA 3SJ7A 1TVMA 1JEJA 4N6OA 3SYTA 1U3GA 2QTCA 2GILA 1OAOC 1EWYA 3IIKA 1Q17A 3H0KA 2DUWA 2P3QA 1TEVA 2V97A 3GB8B 3TZBA 2Q3CA 4Q4JB 4YMLA 1WEKA 2UZ3A 4P80A 3STHA 2X9VA 1NUQA 4KVAA 5JXGA 1Z7GA 1O9GA 4ZU6X 3MINB 1HF3A 4GUAA 5CFQA 2X0NA 4DY6A 2VHCA 4R84A 1H69A 1POXA 1AKQA 4OAPA 3MWLA 3V7UA 1G20B 4CIAA 4A5SA 4WDRA 3A4MA 3M6WA 1C1XA 3A6ZA 2I67A 4G4GA 4I81A 1Y37A 2X9LA 3GRKA 4DGQA 1TLLA 2BFDB 4BGDA 4UEWA 3D0QA 4PS0A 4XOUA 2UZIR 3SX0A 1TM1E 1ZD3A 2BF4A 2FEWB 2JA5A 3ESRA 1AS3A 4RF4A 5J2UF 3KSZO 2QTVA 2E1PA 4EFKA 1XRJA 1JHAA 1B0PA 1KMCA 5KI6A 3ZBTA 1K6MA 5ITVA 3TPCA 1U28A 1X77A 2R2GA 2UZ1A 2IV3A 2C4VA 1LPBB 2R44A 4AULA 1W6RA 1JG3A 2L42A 2P9BA 3FN4A 3KZOA 3QF4A 3PJRA 2QSYA 3ZJUA 1ZIXA 2WVGA 3WGZA 4O3QA 1VL2A 2BI4A 2XMCA 5AVSA 3TRJA 1H05A 4HZGA 3TSZA 2FPGB 2J7PA 5ICFA 3I0MA 1OX5A 1FXWF 4WK4B 3KL2A 4O86A 5F9LA 5JVDA 2JGNA 3H1TA 2DX7A 3UBMA 4EO7A 1XTUA 3V00A 2OECA 3TY8A 5DQHA 4UHKA 4HF7A 4BLTA 5C4IA 1G2QA 1DQPA 1DXOA 2HQSA 3UGTA 4HNAB 1IHPA 4IDOA 1EAYA 2Z08A 3RS5A 1QPZA 5KG7A 3CEMA 2O1SA 1FTNA 5KTRA 1BZYA 2WIJA 2Y1LA 3RVLA 4CKCA 3JR3A 4IH9A 4L28A 1NKVA 2D2VA 2C58A 4KKXB 5F2OA 4JR0A 3U55A 3F5FA 2YHUA 4LF5B 2FPKA 2ZJ6A 5FOWA 3OFJA 1VJ5A 4L1KA 3BIJA 4RQTA 1YF3A 2LD4A 1SBZA 2O2HA 4X0EA 4C2UA 2WJWA 1OREA 2QJRA 4HYYA 2NAPA 3R7LA 4Q1CA 3FHTA 5HJ2A 3UA3A 1YL6A 1T5DX 2IQIA 1GGNA 1QBGA 2OEPA 2R6DA 3UG6A 1BQEA 2WZQA 1EWQA 2QRMA 3Q1KA 2BISA 2PSDA 3JQ9A 4ZOLA 1AGNA 1P16A 4JZYA 4FP9A 2UYCA 2HDOA 3S6JA 4TLCA 3HV2A 5DBHX 4NCIA 2V7WA 4HEHA 3HKZA 4C14A 3MB5A 3P9XA 5A9SA 3ESAA 3RKRA 2W8BB 1PR0A 3ZGZA 2X1VA 5KNCA 2X6RA 3KKPA 3RVKA 2Z30A 1TYDE 3WMRA 2PX5A 2YFHA 3B6ZA 3C3AA 3BERA 1W581 4QHSA 1S3IA 2B6HA 5EL0A 1JSRA 3WWEA 2R8RA 3DZFA 5EMNA 3OP1A 3QVUA 1Y8RA 2OXFA 2BGKA 4CMCA 1OFUA 5CLFA 2JVJA 3TFWA 4D4JA 2GA8A 1PD1A 4D26A 1M0WA 4PIPA 1DV1A 4WVFA 1EM8B 4PR3A 2Z9CA 4C7JA 2UVQA 3JQFA 5E6UA 4CV2A 4ISBA 4GQIA 1T9BA 4BNNA 5KSPA 4FEYA 3TZCA 1UBKS 5KJCA 4LSXA 3VNQA 1BVHA 3BX1A 3TR6A 3O9MA 4EY4A 5HK9A 2VAVA 3DMTC 3TE7A 5A1JA 2EKBA 2PIAA 2JHPA 5CYOA 2JA6G 2VPXA 4CM6A 1P1HA 3N0WA 1H2ZA 4Y2GA 4BE9A 1C2TA 1H3NA 2B3DA 4PPFA 1C0KA 4B6QA 4LDJA 3Q2OA 1O03A 1A0OA 4AICA 2NYUA 3WNBA 1RKQA 3MJ4A 1C9MA 3S40A 2HNAA 3WNDA 1M1YE 1B26A 1WXFA 3HPRA 2E55A 4ND5A 3TSYA 3CBGA 2FOIA 1P7ZA 3O0DA 4O5AA 3PIDA 4H0CA 3OJLA 3RSHA 3TOCA 2P6MA 2LXNA 2Y68A 2V7EA 3OIFA 4J49A 3EE6A 2EWVA 4M76B 3JD4A 1EVYA 4Y0VA 1QIJA 2ZBFA 5TJHA 1RRFA 1A27A 4PO1A 4XDGA 1DC8A 4F4DA 1RAGA 5DNCA 1ATIA 4RKRA 5EJ7A 2FMKA 2HA7A 1FOEB 4CFZA 4MZDA 4CJXA 5B53A 4HQLA 1DEXA 3EUWA 3CR7A 3IAM1 3OM9A 2ZJYA 4V39A 1P9WA 2G9VA 4MDHA 3INNA 2B34A 4LMAA 4R71A 3DOCA 3BMCA 5T5QA 1XMOB 4J2TA 3QFFA 2P4HX 5J3JA 1NFRA 1LW6E 2P6OA 4ND8B 5JCJA 4YP3A 3OLVA 4GC6A 2O50A 4M83A 2VA3A 1SFOA 4M0KA 5FFFA 4WRRA 4LHWA 2Q28A 2D1RA 4X1KB 3EXFB 2WSBA 2CD9A 2COIA 4YRTA 4YRPA 3MWJA 1NI4A 4R2IA 2YZ7A 3UA4A 4AMVA 2KJQA 3H5OA 2F3RA 1AUVA 3K0CA 1M2EA 3O4RA 4WESA 1AG9A 2XAAA 4NXMB 1A77A 1NBWB 4AK9A 4YR0A 2WD7A 3KKQA 4X7MA 1LUAA 4CF6A 1N0HA 3EQ7A 5FPPA 4QQ8A 1CEEA 2WA2A 1XELA 2IU6A 1GEGA 4LX8A 5KFZA 4HH3C 1H2WA 2YRWA 3BS4A 2OUIA 1JLLA 3BD7A 2FSGA 1QMPA 4DIBA 1WUHS 2DZDA 3L04A 2FXVA 3GTLA 3ADPA 5TPWA 3CYFA 3QU7A 2FMFA 1Z3IX 2VUHB 1ADFA 4WKPA 4A8JB 1SHLA 2DUUA 5K6RA 4O83A 4YBZA 3QE4A 1D09A 4LZLA 3QMWA 5AJYA 4P7BA 4CDNA 4ZEMA 4UNQA 3OTIA 1RPTA 1UFQA 4L2IA 3V1UA 1CE8A 4D9JA 3J81W 1DIAA 1XDWA 1EKFA 5DX1A 4IJKA 1U0SY 4XD2A 5FJJA 2F3SA 3KB2A 5E6UB 3CT6A 4GPBA 3GTJA 4EPXA 3KVOA 2OFFA 4KNVA 4NCJA 4RAQA 3QJ5A 3NWOA 4QSMA 2R8YA 3EW9A 1D5CA 5JFGA 5HK8A 3QTLA 1X7ZA 3SYMA 3ACDA 5FI0B 3KZMA 4FKMA 4IUCS 2BP7B 5GIOE 2P9TA 2R00C 4O2AF 4NFSA 1ILWA 2HJRA 2PJRA 2FZWA 1JL3A 1RLJA 1VG8A 2IUTA 1LPPA 3LCVB 1KETA 1AZSC 3OC6A 3LT4A 3IVGA 3VO2A 2AQIA 5FJIA 1L0BA 1KAMA 2X8WA 3IOBA 3F3KA 3V8MA 1U2SA 3UVEA 3WRYC 5JCOC 1PW5A 2X2PA 3H65A 3EQZA 3E9ZA 1ZFNA 3ZY2A 2XOKA 2JZOA 1YQTA 4GKBA 2I34A 4ZVUA 4Z7QB 4GBJA 1C9EA 4RLHA 3K53A 3ZZMA 2F55A 5BXYA 1N6LA 4YJ3A 2MSWA 4EFEA 4DM4A 2D2EA 4WZAE 2E4AA 1WD7A 1NZDA 1J0DA 1XR3A 3OZDA 2Z43A 2JGIA 2CW5A 2FLPA 2OT3B 1H5NA 4KHPB 3CWCA 3FNRA 4CCSA 2P2YA 4KWIA 2B61A 2HYIC 2QJOA 2QL7A 2J0QA 2J07A 5A4DA 3ZBPA 1KK1A 2FG5A 4URZR 4BO5A 1LPAB 3VYTB 2V1UA 5EZQA 4L4XA 1ZH6A 4EI7A 3QVTA 1Y7IA 2R8OA 5BSVA 4P3NA 1JXMA 4UEOA 4K6MA 1N5OX 4CMKA 2B8EA 1XAGA 1JEYB 4J07A 4MQ5A 3WLTA 1WXGA 1TKBA 2C9BA 2ZIGA 1VLLA 2P0EA 4EA9A 1UBEA 4MDYA 1WDLA 1TLTA 3W3AD 3E4CA 2IHVA 2R7AA 1EVZA 3PUVA 4P86A 1JBQA 4C4ZA 1RMYA 2BR0A 3T5CA 2ODNA 3D8RA 2IOFA 2O23A 5K0ZA 4WESB 4YTEA 4BLRA 2RGAA 1WMAA 3UYKA 3PWTA 4L4RA 5LD2B 2VBCA 1JF8A 5AVXA 1DUIA 5LQNA 3G1WA 2B36A 4ZMRA 3CEPB 3ZDDA 5MN6A 1F9AA 1USKA 2NACA 2OFXA 4EKDA 3EIOA 3LKBA 5LPNA 4XD7A 3OCUA 3DC2A 2CLLB 1DPFA 3BH6A 3JWIA 4BFSA 3R9XB 4DMKA 5I7RA 5I5YA 4Q0YA 3ZGLA 1CUXA 4AUEA 4B7UA 3P4XA 3RS9A 5EE9A 4YYZA 2Q6LA 2XCRB 5IVIA 2WIFA 4L9AA 2R92A 1FRVA 5CLLA 1RJ9A 2RHCA 4FEEA 1WZIA 2HBYA 3VYRB 3FYDA 4CMIB 1B0AA 2VZ0A 2VPZA 2HY7A 1ABFA 3D8HA 1S2DA 5IANA 1GZSA 5GM1A 1ZOLA 3SHVA 2XBLA 4KAFA 4N3GA 4D45A 3I9V6 3WYDA 1UBJS 4ME6A 2JJ8A 3ASVA 1D6MA 2W93A 3IBCA 4PQFA 1P7YA 3SKVA 3K9HA 1MC8A 1WXIA 4RZUA 2AMFA 1E4OA 3AMVA 1JQDA 3DBLB 1BW9A 1OXTA 4CXMA 1JDTA 1JXAA 1YDWA 3UT6A 3LQRA 1NDUA 3BACA 2PKWA 1E32A 1ZU5A 1P1RA 3SEZA 4DA7A 3LULA 2RCYA 4EUSA 1T2NA 4MWEA 2FB9A 1ZCJA 2UUPA 4YMIA 1E9BA 5DLYA 3GFQA 3AWDA 3KALA 2W4MA 3NTUA 3PFCA 1K4MA 3VHQA 1XDNA 4DR3H 2XLCA 4YAJA 2XWBF 4J0HA 3M33A 2GXAA 2R1ZA 3UFXA 1KSGA 2EERA 1R6XA 3EEIA 3LC1O 5CNIA 4B45A 4TKZA 3TZ6A 4IAOA 1ZI8A 1YS1X 1XPRA 2PUWA 4X94A 4AYTA 1V6CA 1U4SA 1EHCA 5F5NA 5JBIA 3RYIA 3H83A 3U40A 1K97A 2BMWA 4NKRA 3MQ2A 3HRIA 1JFFB 4LC0A 1LD3A 5LB4A 3WLNA 1QTQA 3PNLA 2HJVA 5JMOA 1M5UA 4JCCA 5FLMG 1OHHD 3FKIA 2GLUA 3OZSA 5ED0A 2W9XA 2I87A 1T25A 2OXEA 3SS7X 1N2OA 3ZD7A 3O73A 3GP8A 5ECGC 5IJXA 5HP4A 3A0RB 1ZM4A 2CDCA 2PLRA 2REXB 2Q3MA 3JY6A 1YFKA 4A2AA 2D0IA 4IGAA 1DEKA 1TAHA 4NULA 2RI0A 3QMPA 1XKTA 1W0KD 2QVYX 4IDHA 3K3VA 4HMPA 3BBLA 3NR2A 1SM4A 4YGXB 4ED2A 3P9IA 1DG1G 4Q7MB 5FULA 1CRLA 2P7IA 3HUTA 1H4TA 4BY9E 1NC3A 3T0FA 3MJRA 1ZJ4A 3SY8A 1C0IA 3HFGA 4DRXB 4ZQIA 1AHNA 2ASDA 4IFIA 5KDDA 5CG1A 2QSJA 3RF6A 1TM7E 4JHXA 3R0XA 2JCGA 3LV8A 4Q47A 5LDGA 4RTMA 3M83A 2IS1A 1ND6A 2W9BB 2C8JA 3QX8A 3QVGB 1H2HA 1W25A 2R751 5BW6B 1GU1A 2XRZA 1WHTA 2RGVA 4FHGA 2PO7A 3K73O 2QPOA 1R66A 1TM2A 4ED8A 1SB9A 1J8VA 4L5CA 3JQGB 2HADA 1ZQ9A 1W88A 3KJIA 3ET4A 1V5GA 3PRYA 1L9XA 5DXAA 3G0CA 4OATA 3MGKA 4FS8A 4OQXA 2NQ8A 3Q8SB 4ZOQI 5EWEA 1QBKC 3ASZA 2Q9UA 2IVFA 1F2TB 1HT1E 2ZSHA 4DV5B 3TW7A 3TQIA 4KQ1A 2WHYA 1LC0A 3DMDA 3TMYA 3GMIA 5TT0A 4IFTA 4YGYA 3KM0A 1HZZA 1PVOA 3O82A 4HGZA 2QUBA 3GWGA 4LJ7A 3ZJVA 4CTJA 2KBFA 2RKOA 4GYYA 1MABB 5BN5B 1DXYA 4KI7A 1RR6A 1PJ8A 1AZWA 4F2HA 2XZLA 5CVDA 4IINA 2H9IA 2XITA 4UHFA 2Q4EA 2CKMA 3SF8A 3OJCA 3KPVA 3HJUA 2JJQA 1RXVA 2E3JA 3CKLA 1VIMA 1FS6A 1JU4A 3FCAA 3B1ZA 3Q88A 1TM5E 3OZBA 4Z3DA 5KNDH 3X1ZA 4CIXA 3KQTA 5F7ZA 1DXQA 2C1ZA 1Q11A 4KO2S 3L6DA 3FNGA 2WU3A 2ATLA 3O84A 5JDIC 5IRCD 1QYRA 2J4DA 2WIBA 1D1PA 4ZVRA 1F2DA 5JVLA 4DJFC 2P9YA 2GRUA 9MHTA 3U0VA 3GI1A 4UU8A 5H0IA 1I3LA 4IEEA 2I99A 3L8CA 2V59A 3U80A 2TMYA 1KBQA 3BMNA 4KQCA 5FL3A 2HSGA 1RQRA 3LQKA 1UCFA 2A86A 1SNYA 2I8LA 2EXXA 4H1WA 3PUJA 4WN9A 4V2IA 2VDMB 1VKNA 3WYNA 2CK3A 2DETA 3Q9UA 2Z0MA 4RANA 3OP4A 4W9MC 4JC8A 4EIWA 5AK6A 2Q1TA 3EBLA 4J0QA 2FQQA 2J45A 2AI3A 1L1RA 1D2NA 1KDYA 1KH2A 1XXHA 3H05A 4HH0A 3U4IA 5AW3A 3GPBA 4GUDA 5FNVF 4P3KA 3OTQA 4KRYA 4X65B 1EUCB 3F78A 4WCFB 5IDVA 2WFZA 4RUCA 2HXSA 4DDVA 1HV8A 2YFYA 2G77B 5JI2E 1SUCA 2OPBA 2O3JA 3U3RA 3C45A 2R85A 2DF8A 4GMHA 2OLEA 2GT1A 4AG3A 5HUJA 4TMXA 1P31A 1YZUA 1NVUQ 1I2BA 3RC8A 5BV8A 4C0XA 3MILA 1OV4A 1VYTA 4I4TB 4KXVA 3RARA 4DR5H 3LDFA 4QWEA 2VP3A 5IUNC 5HVNA 3GZNA 3P9PA 3HOUG 3GNSA 1E92A 5F51A 1NXVA 2XZOA 3FYTA 3ZCVA 5SV2A 4RJTA 1J20A 2R8IA 1DBWA 2OBYA 3VR6D 1AKUA 3CVOA 4YN3A 4EHLA 3GJQA 2Y8EA 5KAPA 5KOHB 4GE3A 4ZANA 2P8SA 4Q03A 2P67A 4P4TA 1L5QA 2HK8A 1CEQA 3SMQA 1MIOA 3UPTA 3IURA 4WD3A 4Q05A 3VC2A 3H7AA 3HR7A 3LCUA 3S3TA 3PDJA 4EZEA 4AKHA 2CEAA 4JXJA 3RU9A 5J1SB 1F3LA 3PDHA 1BD4A 4Z7OB 2C2MA 2WE6A 3VU0A 4UVDA 4CLOA 4Y2PA 4BNXA 3AEQA 4LYHA 1DIGA 3MBKA 7MDHA 2XXBA 4DNFA 4JL5A 3WLQA 3IAS6 5CVTA 1BXGB 6REQA 4I9GA 5DOVA 2B7BA 4DMFA 4BNGA 5EP2A 2HCRA 2XMQA 4KVGA 2X6TA 1WL8A 1H3FA 3PQ5A 4ZEWA 5K8VA 1B00A 2FWBA 3RRJA 2IFTA 1IJFA 2AXQA 5DTEA 3HVHA 1JKXA 1T9ZA 1OGJA 3A27A 1Y9EA 4CVNA 2QM0A 1JHUA 1EVQA 3RB8A 3P9CA 5F2KA 3BGOS 1XQXA 1XHEA 3U7QA 2H31A 2QLTA 3AONB 3CKKA 4OLJA 2HT1A 2DY0A 2GMWA 4HSGA 1LB1B 3EZ2A 4DMRA 1VS0A 4QUGA 4Y1RB 5C1DA 3WMGA 5ERYA 2OV1A 3IELA 1FFCA 1BA2A 1SHJA 2NSLA 2I8CA 1RK6A 3NC0C 4LNAA 4X3OA 5J40A 2XOEA 2YN4A 4WN9B 3OAAD 3LA6A 1R5NA 3WC4A 3ZV5A 1LY1A 5BR4A 4DEYA 5HRAA 2X5JO 5B7PA 1WH2A 3TEMA 4CM9A 4EX7A 5IEJA 3D7MA 1H9AA 1E7QA 1SD2A 1IXSB 3HKCB 2NZYA 2NZJA 1CDOA 5ALUA 4MKFA 1TD1A 3FIJA 3AVTA 3N7TA 5DIFA 3M70A 3PFKA 1WOYA 3KBOA 4AZTA 3VOAA 2XWPA 3ZGYA 1WXXA 3HHPA 2WIAA 3CNQS 3Q2KA 1GGJA 4Z9FA 3IJPA 3GYGA 3CVVA 3MAGA 4CMGA 5KG4A 2GTPA 2PWBA 1XDUA 4E2ZA 3IRUA 2ZUCA 1FUEA 5KWIA 3D8UA 1GO2A 4NCBA 4CMDA 5HZGA 3D7LA 4BP8A 4R1SA 1TWAA 3WL6A 1JTVA 5IZCA 1K6JA 4R41A 5CBPA 3E5RA 2VUUA 1GAJA 4Z51A 1YMUA 4Z5XA 3UN1A 4BFWA 5HHTA 1UPAA 1TA0A 4V02A 4AJ4A 5M5BA 1P2VA 4CDGA 4IIJB 1EX7A 2VJMB 4TVSA 3H1FA 5K0BA 2YZNA 5CEEA 4B09A 1IOLA 4YMTA 3R5JA 4C5AA 5AKXA 1RKUA 3P97A 2QTWB 4JI8H 3IOMA 1P3DA 3WWDA 4HQFA 5KT3A 5I4KA 1E59A 2AH5A 1H5UA 4RPHA 5K3AA 8ATCA 1Z8FA 4G01B 2ST1A 5T64A 1OE0A 4QRHA 4J0JA 3I76A 1P5ZB 4FCWA 1H2YA 4JA0A 2CLEB 1EUDB 3RSCA 1FFYA 3V80A 1PKXA 2J5KA 1GTSA 3MD9A 3SPXA 4BATA 3UWMA 3GTKA 4POAA 5IVPA 4ABYA 3GMTA 1G42A 5CE8A 2PWYA 2EKPA 3QLEA 3L1IA 3REOA 1YL5A 5FPHA 1PGPA 4OQMA 3PZBA 3A06A 2GI4A 3AHGA 2IY9A 5CCDA 2BJWA 1U2DC 1U1DA 5HG0A 2VG8A 5JROA 3H2GA 2AC4A 5DG8A 3DLTA 4D5EA 1HE3A 4W1QA 1PJZA 1K7EB 1IMOA 2VRNA 3D4OA 4QL3A 4ARZB 4P81A 1QK3A 2JGJA 1U3CA 4BWVA 3AUSA 3RS7A 4UASA 2F59A 1F38A 5I7EA 5AESA 4LF9B 3GYBA 4RK5A 5HOEA 2AOTB 1CZRA 3AQ4A 4HSEA 3HB9A 1ISMA 4G2TA 2CCKA 4PYQA 4KRFA 3NHAA 2X7XA 4TMYA 3OKAA 2Y9MB 3FZYA 5ICGA 3AF6A 1N6PA 3KLOA 4B73A 5I7VA 1X1BA 3AM3A 4Q9AA 1VPLA 3NOOA 2GZ3A 3M9MB 4ESHA 2GN4A 3A3PA 1KSFX 4HVAA 1JYFA 3HXTA 2EVWX 4B3FX 1WEHA 4KI0A 5EIBC 2HU5A 3RVBA 3B89A 1I7DA 3WXBA 1P5RA 4YDRA 1CJSA 3F71A 2OWOA 1IEQA 1KWKA 3WP0A 3IESA 1VA5A 2A58A 3IDQA 2Y66A 4ECXA 5AVYA 2E48A 1ZUIA 3B6MA 3TOXA 5CP8A 2HF2A 4MWDA 3B5EA 4EARA 1Z4QA 1ZM9A 2V4ZA 5DM2A 3H1PA 4UEJA 3CRMA 4N0MA 1JV2B 1NVKA 5AKYA 1ZG3A 3WX0A 1E66A 1N3BA 3RAQA 4LOIA 4C4PA 3PXBA 3B1WA 5LN1A 2W8LA 2XGOA 2HSDA 2HI0A 1AIPA 5LQRA 1X1TA 3ZDXB 3OA0A 1VG0B 1N5JA 3LY5A 3LCMA 2JCVA 1NJ1A 3V7YA 5CM2Z 1GKIA 5AFSA 3DTGA 2Y71A 1OXSC 1IK6A 3ORRA 4KQMA 2DHRA 2QE6A 3EMVA 1G8YA 1QZZA 3VJMA 3JD3A 2OOKA 5JY6A 1WV1A 4NC9A 5FBHA 3OQJA 4W5QA 5E1DA 3CG4A 3Q8QB 2HPVA 3A4TA 3BPSA 1PJBA 2ATCA 3JD1A 1N5DA 5TIIA 4JSTA 2R5FA 4KXYA 1O5OA 1TJ3A 3RJZA 2CFMA 5FHQA 2A0FA 2W90A 4D02A 3NJRA 4N41A 1B76A 3C3YA 4MVJE 3RU7A 2OZKA 4Z9YA 1W44A 3TQ1A 1LZKA 5KNDA 2E4ZA 1NATA 4F4IA 3Q7SA 1JQ3A 2XHEA 2FZ5A 1W5TA 1F4PA 1YVDA 4LHYA 1JR3D 1TE2A 3H18A 2PZBA 1E2FA 2HSJA 1LTHR 3HK2A 4PX9A 4KLRA 4UHEA 4JEHA 5KFFA 3WHPA 3EASA 2VA2A 3DWGA 5KX5F 1JJVA 1ESCA 2HRDA 4DLRA 4M37A 4HXYA 3GFVA 1I5EA 1QVRA 2Y1CA 4MQUA 1SUBA 1OYOA 2OCLA 2QNIA 2PJDA 4OPMA 4WK6A 3PEWA 2WKWA 3GJ7A 3RTAA 4QBFA 2GTHA 1CLUA 2OPHA 2IDZA 2IU3A 4F2DA 4WXYB 1NXQA 4CLDA 4YMGA 3SQNA 5CXXA 1IN4A 2F64A 1XJ0A 1QJ4A 2XJ4A 2J9FA 1ZC4A 5G4KA 3OPYB 3TXXA 1K7SN 1IZ9A 2IEIA 2WK1A 4MTEA 3Q3IA 4JYPA 4B2IA 4ER3A 2PXCA 1G1MA 2BRUC 1NHWA 5LP6C 1LZLA 2QTFA 2YFKA 3VUFA 4XEHA 1HSOA 3BH0A 2DBVO 5BT8A 4B76A 3BMXA 5EIXA 3NBMA 1VBKA 3C43A 4DCMA 4QNRA 2GCOB 4TV9A 3VDMA 2HQOA 3ELUA 2UXCH 2Y9PB 1KOGA 2KS6A 4EZBA 1U2GA 1II9A 4REQB 1JSXA 2IRWA 4H1VA 5CT8A 3GRFA 2WRZA 3UHPA 4F5ZA 1D1QA 1E9RA 3UENA 4B3GA 1XKQA 3EPRA 1ZCBA 5HJEA 1KC7A 4L07A 3SVLA 2B63A 1LGYA 3PW7A 4GZLA 3Q8WA 4AXBA 2CL5A 3DWEX 3H17A 3ZI7A 2YXDA 3BVPA 1UKBA 1PR1A 1RAIA 5DJ5A 2J33A 1L5VA 1U6IA 5AW1A 2PZGA 3VZSA 2QBYA 1NBHA 5CIWA 1QH1B 5HQJA 5GTDA 2B8NA 4ZYTA 3OIDA 2ALZA 1YA6A 3GVCA 4PPNA 3ES9A 4BLVA 3A4YA 2J3IA 1NJ5A 3VR6H 4BZXA 3V6JA 1EG7A 4CCYB 4HG2A 4LYFA 5KFTA 1GTZA 2VHXA 2BY4A 5IT0A 4ONEA 2BEVB 5TS3A 4Q45A 3F5QA 3IB3A 4WKGA 1FBNA 4BEWA 5K3OA 2IK8A 2W2LA 3IAXA 3Q85A 4EY6A 4DLPA 5MHTA 1GRCA 1NF2A 4R68A 1ENYA 1EI9A 3AR9A 3JQAB 3KR2A 1DX6A 4AKIA 1IBMH 4P93A 5IM4F 2W37A 1JILA 1AY0A 2RJNA 2NADA 4DV2B 3QWUA 3NMUF 2VZ9A 1AKWA 4JBGA 2ODBA 1DC5A 4U7CA 1ZISA 2JLYA 3E9CA 4UJ5A 3H99A 1Z35A 1NVEA 4NJEB 2PK3A 1AB5A 5AMXA 3I58A 4N0QA 2EGGA 2QTAA 4MB0A 4O3RA 2V6BA 3LCJA 1SOMA 2B2NA 1XL1A 4GH5A 3L06A 4U9UA 4IH4A 1ADGA 1TQ4A 2WI8A 2NUPA 4RS4A 3KX2A 3VTZA 5BWBA 1DXHA 3F7MA 2Q1XA 2BKEA 4RKWA 4EQZA 1R8SA 2FJPA 5JJBA 2E5LB 1L5GB 2F4VB 3V34A 1ICIA 4QU9A 2GZHA 4MINA 5TF0A 4J4HA 3UAGA 1A48A 2C78A 3DBVO 1R2QA 3BXEA 3SIRA 1ZGBA 4H77A 4NAHA 4W9NC 4IAJA 4INPA 2QL9A 4ZV4A 3K09C 4EYOA 2XA1A 3QE0A 2V58A 4OHYA 1TMOA 3T7KA 4E5PA 4DUZH 4PLVA 2WOJA 4JJKA 1N1DA 4EF6A 1AF4A 1ZL2A 1I51A 3RJTA 5KFXA 1XZBA 4MVJG 4E2YA 3OIWA 3EZ6A 5IJAA 2R87A 3I05A 3QU4A 2E4YA 2V6IA 3UJNA 3P2KA 9ABPA 1T0PA 5DNEA 4P53A 5JQGA 1F0PA 1RBMA 2PYIA 2Z1DA 3BGWA 5E3HA 4ECWA 4BDSA 1GM5A 1ZIYA 5L51A 2PLAA 3AEUA 4CR8A 3I1JA 5A5GA 1XYVA 3DBHB 1E0DA 2CZGA 1XBTA 3RAFC 4MV6A 3F47A 2ZYWX 2IPXA 1KMQA 1OWPA 1FCJA 2X7JA 2M6RA 1EM6A 1CUCA 3FFXA 1MT3A 4KKVA 2Q3DA 2FUEA 3EXHB 4ZV7A 3UK2A 3Q2IA 5E8JA 4C4YA 4WADA 3FFAA 3D59A 2FQYA 4DHWA 4HFMA 5IFLA 1LBTA 4LJYA 1KJJA 4UHCA 2W7PA 3GHHA 4LYJA 4HVTA 1T0UA 1ULTA 3KSMA 5GMOA 4RF2A 3DFZA 4KH1A 3LP5A 3QPCA 3NS7A 4LCJA 1V5EA 2FPIB 3K31A 4RLFA 1EDBA 2NUAA 2JVIA 1Q2XA 3HT5A 2XH8A 4MUJA 4F4XA 2F9LA 2QLLA 4AKTA 3EGVA 3HJFA 4CHTA 1L4HA 2O05A 3THWA 2PMKA 5AJWA 5AI0A 2Z3VA 3NDRA 3OESA 4JSRA 1DFHA 4H0FA 1WB9A 4OQLA 1ZEMA 4EMSA 5B7NA 2B0JA 4RV4A 2WWXA 1UMCA 5CAEA 3MS2A 3H5LA 3W1GA 4RIEA 3UMRA 2R66A 3Q6MA 4GS5A 1CF4A 4YHHH 3GO4A 3OZWA 3PQ7A 2Y1EA 3HP1A 4JNKA 1Q7GA 3P0JA 4QGBA 3P96A 2P5TB 1KQPA 3Q87B 1X7XB 1LTKA 5TC4A 4CFSA 4QGSA 2CHEA 1JIHA 3QXHA 4J9VA 2JA2A 3ZHOA 4ZTBA 3C4JA 3BRWD 4I9FA 4EKGA 1M7GA 1QUEA 3HCFA 3IQGX 1VDZA 3UYYA 1QH8A 2YDYA 4JLAA 1UJCA 5JEDA 3KHHA 1UBRS 3OTWA 3LBNA 4EQ6B 4YJKA 2PL9A 1VDMA 2NUPB 4XWTA 4IJQA 3L8YA 3TNYA 4MMZB 2B4RO 4HGYA 4DVJA 1ZLYA 4CEHA 3LPDA 1R37A 1PCXA 2AZTA 2DECA 1TCUA 2CJPA 4CMBA 1QO9A 2FLWA 4MEAA 5FQOA 2XRYA 3L8EA 2XVAA 4K6FA 4NARA 1O75A 1H6AA 4L3WA 1ECGA 3OQBA 4IV0A 4K6NA 3V1LA 2P9GA 3T9AA 3OJEA 3BXXA 5F12A 1LPSA 4EHKA 5BRAA 3RS4A 2H5EA 3UJ3X 1KFKB 1XPUA 4PX2A 5EQFA 3ZI4A 4KHZA 3PR2B 4YEDA 4OH1A 4LYDA 2WSYB 4L6CA 4JSYA 4UU0A 3TYXA 4UPVA 5LYJA 5CR9A 5B6JA 3WADA 4DSTA 1DBRA 5KHLB 1BEUB 4LF8H 1PJSA 2ZRKA 1X80B 3PJDA 3PNMA 4L16A 2FW9A 3DKRA 2PGDA 1BKSB 3IR6A 3ORSA 1S1CA 5A04A 1I3OA 1E4FT 4CQLA 4BAGA 1GUYA 1CRWG 4JX9A 2O7NA 1TJYA 16PKA 2ODAA 2AG1A 4FBLA 1TA4A 3GFFA 4BE7B 2JCBA 4K9KA 3QYPA 3G5LA 3NKFA 2VR1A 4Y9UA 1W46A 1XRPA 1MB0A 2DJ5A 1KNQA 4ECTA 2CSUA 3F6EX 4FHFA 5KTTA 4ESEA 3Q3EA 3C3EA 4NBKA 3FM9A 3PQFA 5DU2A 1Y3DE 5DEIA 5E2IA 4OOEA 1J56A 2AMJA 3WDKA 4YUAA 2HV9A 3U54A 3I6IA 3DOEA 2C4UA 2GD0A 1SXJA 1UP4A 4WE3A 4ZC1A 4GKJH 1KZGB 4K05A 1ZGJA 2AW3A 5CLIA 3BSSA 4OJYA 5FADA 4JI8B 1GQOA 1WZUA 1ENZA 4YT4A 4DR2B 4DAEA 3VNUA 4CETA 1L4EA 1TYAE 3UHJA 3MT0A 4M46A 3ZDBA 2Z2YA 4G37A 3I37X 4P5PA 1R15A 3TE6A 2IZ1A 4O4LB 2XAUA 2P78A 1OZ0A 2J3JA 1IQ0A 2XMZA 4EB6A 1XRNA 4LJ8A 4OHBA 2W6CX 2C7VA 5AYVA 3I2IA 2XQGA 3HDVA 3U7EB 4UULA 3IIMA 4OB8A 1MB9A 3ZGVA 2V0GA 4JP1A 2LBPA 4WKBA 3CU5A 3LQ2A 4X7RA 5DNYB 4AQYB 3PXGA 4AYBE 4EHDA 4LMPA 1T3HA 3LQQA 1B04A 3U3DA 3JU3A 4BO2A 3UJ9A 2W6OA 3PUIA 2ECFA 2Q62A 2AWNA 5KFMA 1JIVA 2MOKA 3JARA 3G49A 4R1QA 1WS6A 4MWOA 2HRRA 1EWTA 5FTMA 1HRKA 1KBZA 4I19A 4QOFA 3S99A 2VP9A 3I30X 1C1XB 3SS9X 2GERA 5FFNA 3DAGA 4ZVVA 1NTRA 4L78A 4A6DA 3C1UA 5JTUA 3HJGA 3A26A 1K7XB 3ZD6A 3M1IA 1LNZA 2D00A 1E1RA 4UUGA 4PLCA 1PX2A 3ZHXA 2GK6A 5LDHA 2QTVB 2DBRA 2JGFA 1XTRA 2AQHA 5C18A 3WFZA 4BNDA 1JFVA 2XQVA 3RAXA 4LDZA 1J06A 2UZ1B 4ZZ1A 3RGXA 5JZSA 3QW4B 1M7BA 1JAZA 1KY4A 5HQTA 3N70A 2VNKA 5BN3A 3QF4B 2EW2A 4RZHA 1X92A 4QO7A 4RSGA 3ULKA 3UUWA 3VNRA 1ISJA 2XWQA 4D57A 3OZCA 4DL4A 1B1AA 3R7DA 4BUZA 2EG9A 3AOEC 3VI4B 3H8WA 3NUQA 5BSEA 4L50A 1ZWLA 4ENTA 1PZHA 2UU9B 4BO1A 1ZD2P 2BONA 4CQLB 4R98A 2IXDA 1SY7A 3BK2A 5JVDB 3VR6A 5JYCA 3DXFA 1HDOA 2VK1A 4B2PA 3IBYA 1X94A 5AIBA 3RU3A 2Q6OA 4LSAA 3OHAA 4G0XA 4LZPA 2BHSA 4E5SA 3H40A 3URKA 1KNXA 5HX7A 4UEQA 1K8XB 1XNQH 5K0EA 2KM1A 5D1PA 1GV0A 4JLKA 1AMUA 5U4XA 2O48X 3WMWA 1T8TA 1N2CE 1V4BA 4F72A 2BZGA 2EJVA 4WERA 1J9GA 2NYVA 3NDJA 1KORA 4FSXA 3UHOA 3TSOA 3L7YA 2ZKLA 2EAUA 5DLEA 2Y1DA 4NRDA 4CKCB 1J70A 3KFXA 4EA7A 4CQNA 1O6CA 1M6YA 4IKOA 2FU5C 4A3LG 3E9EA 5CT5A 3TQCA 2J0VA 2UVWA 5JHHB 3R3WA 2F3UA 3DAAA 1UK7A 4XAQA 4JN6B 4O02B 3IQZA 4XASA 2BPOA 1A0GA 4DLUA 1OR8A 4K6KA 3WYEA 3AZPA 1V3VA 1ZK3A 2BW0A 3MWDA 3L1VA 4MA4A 3RRZA 4X92A 2J6HA 1KMHA 3B6IA 4LHZA 1E3MA 4HDRA 4G1FA 4HUJA 4YCMA 3JYQA 3FMVA 2MIIA 1JWAB 4GRDA 2ZDGA 4PGMA 1LLUA 1A8SA 2QXYA 1RBZA 2I4MA 4PWZA 3GMSA 4AMYA 3UPUA 1HI9A 4Z4QA 5ADWA 4ZOLB 4ZDJA 1OI2A 3PD0A 4MARA 1JG7A 2TMDA 3T3HA 5IZ4A 3LPCA 2SHKA 1Q1ZA 5T3YA 3OY2A 2QZZA 2CCJA 4ZK2A 3PW2A 4UCRA 4JT2A 2VOJA 3K1JA 5TXGA 1LI4A 4YACA 5A9SB 4BEJA 4EVIA 3FJOA 4NEHB 3DPIA 2IHYA 1V5FA 2ICAA 5MF6A 2PWZA 3NNSA 3UM9A 1NVAA 4Y8VA 1DQNA 2C7GA 3I42A 4A6XA 1THMA 3QFHA 2X9NA 4IZIA 4LRWA 1EKVA 4UVEA 2DB3A 3LPAA 1Y8RB 4PVCA 1W0JD 3D0OA 4D9FA 5IJWA 1SR8A 1ZM7A 5CM9C 4F2GA 3PXAA 4KNYA 1GZ4A 3SC3A 3K9GA 3TDNA 5FORA 3JS5A 3AK4A 1R0RE 3OMLA 4HGOA 4QXRA 4E31A 2YJ4A 1F48A 1JVSA 2FFAA 3M1LA 3CW2A 4DIMA 1OVMA 3FMGA 1GVHA 5KBYA 2PGLA 2PZ8A 2AC2A 2HUNA 2Q5IA 3MB8A 1N34H 3BGVA 2H7XA 4MRPA 3IGFA 1EFVA 3PTAA 4NTZA 3L0SA 2O0LA 4E46A 2BBSA 1AVTA 5IYDG 1CEXA 1N78A 5CD9A 2YV2A 1W47A 2R7LA 3CS3A 4NDNE 2QUZA 2QIPA 1Z4KA 2WNHA 4YRNA 5EG5A 2XCPA 2VKQA 4MW7A 3VR4H 1CETA 3I4FA 5DM60 4D46A 4CU5A 1I2AA 3F4LA 1Y6QA 4U7GA 1SWVA 1SXPA 3AG6A 3DB1A 1NOIA 4GO1A 3GNQA 1QO0D 3WNZA 1JMVA 3ASYA 5DASA 5D85A 5KU1A 3KOWA 2NO9A 4FR5A 1I1OA 4I99A 2CNVA 3RVPA 3ZWWA 1E1DA 1BOFA 4NCHA 4WUTA 2Z5GA 3WWJA 3JATA 1J0BA 1UC5B 1F9EA 2B69A 3BXPA 3C70A 1KUTA 2BSAA 1E77A 3ORFA 3AHHA 3CURA 1CJBA 4WFIA 1M83A 3L7BA 5CYPA 5KO2A 3K1AA 1P73A 3RRNA 3YASA 1CV2A 3EUFA 1L7RA 5A7FA 3VPAA 1HNXB 4R8VA 4DMHA 1CB7A 2OAP1 2PXHA 4OJKA 1FX0A 4LXXA 4ZO8A 1V9PA 4OQFA 1J24A 2I5PO 3NTOA 1JIXA 2XB4A 1O77A 4P31A 3IE0A 2VJNA 3ESQA 3BMCB 3F5MA 5HTKA 1K86A 4MKXA 5JZBA 4YCNA 5BRJA 1ECPA 3QZ7A 2ISQA 3W2HA 3IKMB 3WIBA 2G5TA 3OLWA 1J21A 2MSCB 4HDRB 1IEWA 4ND1A 1I2KA 2JD2A 1GARA 5AKKA 4NBUA 1JQBA 1NI4B 5THXA 4UDNA 3I4NG 3IKJA 1EJ6A 4GXRA 2WF8A 1EGHA 2Y05A 4DCPA 4HMOA 2AR7A 3OTOH 2DKNA 4YI3A 2H2IA 5L7WA 4HYQA 2EP7A 3U3JA 4KV7A 2LIPA 4HX9A 4IIUA 2WD7B 3K5IA 1M67A 3RROA 2WZDA 1DRUA 4O8ZA 2OFPA 4M8KA 3QF7A 3W0LB 2YMPA 5B2FA 1Y8AA 1NVBA 3OICA 4DUZB 4DIUA 2IF0A 2PZKA 5ALIA 2IHZA 3BGDA 1RTKA 2VEDA 1JLLB 2XKKA 2ZIFA 2XGJA 1MO4A 5EWMA 2A9RA 7YASA 1ZM2A 4EW2A 5TPWB 5GIPE 5EERA 3K9LA 1UDAA 1Y1WA 1Z0ZA 2P3LA 5E6RA 3EEQA 1XI2A 3WYBA 2WPDD 2C2OA 2JKYA 2OV2A 2XPCA 1FTWA 4BY1G 4YBZB 2Y1KA 2QNBA 2R3SA 4OQDA 3ZLVA 3BBPA 1I0LA 4IQ4A 3NDBB 4L2IB 1D8AA 3KQMA 1AN9A 1CE8B 4U7PB 2O2GA 1IDOA 1I1HA 3WKBA 3HACA 1BXRA 3DT8A 3RHZA 5D3ZA 2R5WA 3L2PA 2ZB2A 4NECA 1R8YA 1VECA 2EJ3A 5EXSA 2E5WA 1FTSA 2VUTA 2P5UA 1Y82A 4YRCA 2R0QC 1DBPA 1R7RA 2I62A 1M2FA 1GZDA 2FP3A 3AVPA 4EUFA 3J81A 2R6R1 2JA7G 2XD4A 1TK9A 1QVZA 1X1DA 3LY7A 1X7ZB 2R97A 1J8QA 2BGRA 4WBSA 4IH1A 3FZEA 4WXEA 1QGOA 5CDTA 4LOLA 3RHFA 1EUYA 1AGXA 2WIDA 1PV2A 4J1TA 2RONA 2OA0A 1L7AA 1N57A 1JAHA 1ZXXA 5F9FA 2QKYA 3GQVA 3A2KA 1JR3A 4B7ZA 2ZVDA 3T6KA 5J4KA 4HAZA 4F7DA 2Y0SA 2C4NA 4WKOA 4DARA 3ZR4B 1N1MA 4JJIA 3BM5A 5ER6A 4OQQA 4K40A 2I22A 3C97A 1ZI9A 1SCBA 3P2YA 1RQPA 4EW1A 2H0AA 5ALQA 4OTZA 1R50A 1UFVA 3WS7A 4C88A 4YRDA 1YI0A 3OE1A 2O5RA 4YJ3B 1C8VB 3REQA 3B9QA 3F3SA 4LXTA 1UPXA 2MSDB 3O5AA 4C7XA 3NVAA 4L7QA 3WRXA 1FX0B 1PEKE 2XMBA 3L05A 1KVQA 5B1EA 2W2OA 2EFHB 3IP5A 2D59A 4QPDA 2YV5A 1UXOA 3RC2A 4ZPJA 3D7RA 3DE2X 2WOOA 4R5HA 2Y3IA 2DULA 2X9GA 4KE6A 4DM7A 3RSOA 5EJMA 4R8MA 1GR0A 1YJCA 4QTZA 2OCKA 1M2KA 5FPYA 4PC2A 5AK4A 3H5IA 4RVNA 5CXSA 3WBBA 1J5EH 5D7BA 2AN9A 3E0XA 2IUSA 3DMNA 2BR4A 4TS1A 1N5RA 2K6GA 2AGPA 2SCUA 3QVLA 1ZGCA 4E5NA 1ZHFA 1Y5MA 4B87A 3HSSA 3IUYA 1E3QA 4X1IA 4FMPA 1Z2DA 2Q3BA 2XDQA 1JIQA 2XUQA 5JSKA 3R8FA 1WPRA 4WBNA 4XW2A 3NHYA 2M6KA 2QZ4A 4KN6A 4RU1A 1FS4A 3MBIA 2VDQB 2QIOA 1CFZA 4Y1GA 2W6MA 2GF2A 5IT5A 3AWIA 4RMHA 2X19A 2XTZA 4RY0A 3AO0B 4NPAA 1GRNA 4RU9A 1PIWA 4BFLA 2RKWA 1ZN9A 2FN7A 3FVVA 2WINI 1JB1A 4EYIB 3PC8C 1RJ9B 4KX5A 4A91A 3ANXA 3NQ41 5J5AA 3BREA 4Q4DA 4EG6A 1Z68A 4CM8A 2ZJOA 4MUXA 2XLBA 3GTMA 1NY6A 2IC5A 3EIWA 3O74A 2XV1A 3CLHA 3HOWG 1ZEJA 4PHGA 1KZ9A 3EZ7A 3H2HA 4HAYA 3E27A 2OG1A 4NU8X 2P40A 2V7VA 4QW9A 1VJ0A 4CNQA 4JXUA 3MJFA 1QOZA 1C0LA 3CONA 1VL6A 3NATA 4FX5A 4N3BA 1BW9B 1O5TA 1W4ZA 4BB0A 1KYQA 4RMJA 2X76A 4UE2A 4FXPA 3W5DA 1W35A 4GKJB 3BAFA 4FMBB 3AYZB 1XVLA 3N1UA 3PGMA 4D3ZA 4LDPA 2DBYA 1P1IA 1K27A 5B3JA 2HHHH 4UD2A 1KC1A 4BKRA 2XGSA 3LLUA 5JECA 1IWBB 1U8EA 3OQ6A 1E5VA 1G9XA 4ECUA 1GRQA 2W2NA 3HCEA 3VBCA 4YAJB 1GQFA 4RJJA 5KG2A 4GP6A 4CWAA 1ODJA 3UFXB 1K9VF 1Q0HA 3NAGA 1VBHA 4DFDA 1C7JA 5B7QA 2C98A 2YYZA 4MVXA 2I7DA 4KFCA 2QG6A 2BOVA 3GIJA 1G1AA 5K20A 3KZCA 3JWPA 3RYIB 5BR1A 3P19A 3L8GA 2AI2A 2JRLA 3OM8A 4NH4A 1F4VA 4F91B 2A3RA 1KI9A 4J75A 4D9BA 2P1ZA 2H51A 5G02A 3VSBA 2OHJA 2YXBA 2XYRA 5HWSA 4DL5A 3OCWA 1SIOA 4R83A 4CLHA 4MI1A 1PUJA 2C5BA 1EAMA 3DR5A 1SXHA 1E20A 3VHRA 2QT1A 4UUNA 4GPD1 2FCAA 4PYRA 1HXHA 4JLJA 3UZBA 3HZRA 3KO8A 4D80A 4LY0A 4K9MA 4I4TF 4XB1A 4K87A 2QD4A 1JDVA 1U5BA 3GLGE 2DCMA 4YV1A 1ZINA 5T8KA 1QDUA 3LBIA 3GT4A 3IV6A 3QVWA 4TTRA 4F12A 13PKA 1QVWA 4G5RA 1MNQA 1NQTA 3W2GA 3H3FA 4IMRA 5ITZA 4PG4A 3D54D 2XT9A 2R6ZA 1X13A 3TLXA 3C5VA 4QARA 3AXSA 3AW8A 2A0UA 1WHTB 3NDPA 3DF7A 1VPDA 3CX8A 1GT91 2FZGA 1FDUA 1NVVQ 3N07A 2K2QB 2KBEA 3BQ0A 4C0HA 3VR4A 2P9EA 1CDDA 5CA0A 2X5KO 1W88B 3OTHA 1KVUA 4ZQHA 1POWA 4U7DA 4GLXA 1RXSA 1JQJC 1S9DA 4IOJA 3TZKA 5JCPA 3HOZG 4DG9A 3RRXA 2X4IA 3PQ8A 2BFPA 4QICA 4YRLA 4EW3A 2QW8A 2ZJ0A 2Z8ZA 1ORHA 3QY0A 1KMMA 1G6HA 4JITA 3QLUC 3WE7A 3SZRA 3I5UA 1K66A 1FXUA 4TYPA 1HYEA 5K8LA 1L8QA 2VUMG 4U6PA 4BX9A 3T7JA 4YRMA 5JAHA 1JJAA 2NPOA 1GFIA 4QOSA 1RD4A 4WKNA 3G88A 4GVPA 4KJZA 4LI3X 3SF8B 4PRKA 3AYHB 4H1TA 1S0UA 1YK0A 5HCNA 1P2GA 3CINA 1O8BA 1M76A 3WL8A 3R7FA 4A3SA 4ACAA 1EBBA 3ZJYA 2I2CA 3DV2A 4TYQA 2GKSA 4UFNA 2PFGA 4L5BA 3WWZA 5EP3A 1P91A 3KYJB 4NYJR 4MVJD 3FFWA 3PCRB 1U31A 3W1BA 4RSHA 1KYIA 3DT9A 1CC1S 3I39X 4AN0A 1WSDA 1P7WA 4A8TA 2HD4A 2B3TA 2C5SA 4C6TA 1S6YA 3IPCA 221PA 1QFZA 2YWFA 2W6QA 2XUHA 1HE2A 4J90A 2AFHA 3BRWA 1FSPA 2RJ3A 5KFDA 3C3KA 1QHSA 4OXNA 1MGOA 4N3CA 1ZYUA 5FLKA 1JA9A 1RHQA 5DIZA 1BFDA 3W3AH 3A04A 3BMNB 3D6HA 2YXEA 1C7RA 3P2JA 4DR6H 1IHOA 3OY7A 2ZUFA 2A0XA 4MWZA 3E4DA 2EGUA 4OF4A 3N7UA 3VVCA 2HR1A 3ZXSA 2G1KA 3H3XA 1AF7A 4FGSA 5C1PA 1NP7A 4FM9A 4DMCA 4L8VA 1FTYA 2F48A 4OXIA 4K9RA 1R5JA 4C5BA 2YWXA 5FCDA 5U4QA 4X6YA 4M0LA 2YMMA 4M9CA 3GBVA 5JV5A 1XXHB 2XRMA 2AFIA 3K71B 4IIJF 2GZAA 3BF8A 2YRFA 1UKCA 3L4BA 4E32A 3ZVRA 3K9BA 4M6WA 2ZITA 1ZXBA 3AH8A 5CBKA 4Q1VA 1J0EA 3IDOA 3KJGA 4UCOA 3DTNA 5ITZB 4MUBA 4BKUA 3EFBA 4QNMA 4AJPA 2J3MA 5ALHA 2BR3A 1JFLA 4KIJA 3PD1A 1CTQA 4W5RA 4O29A 4NBTA 3HCPA 4ECSA 2AEEA 4PN7A 3RANA 5DTRA 3UFBA 3MRTA 4BDTA 1AKMA 4I3GA 3FX2A 3L49A 3NAMA 2KE5A 1Z38A 3I2GA 2BZ0A 1AZTA 3E03A 1F7UA 3WK7A 3WNVA 2Q5JA 1SCDA 4NCKA 5LP1A 3ZJTA 4F71A 5KYXA 3GZNB 4D3SA 2VTEA 1DLJA 1I80A 3KLNA 4NYEA 2BEJA 4TL8A 4H3KB 3AHEA 1E3IA 4QYSA 2GJAA 3KVVA 4ARVA 4M98A 3T99A 2BJHA 4RJIA 3N3AC 2CUTA 5K0LA 2W58A 1PR6A 1WAMA 1A7UA 2GN1A 4GPTA 1V41E 3W5CA 2VXYA 5F9NA 1MIOB 1WMDA 4I36A 1GIAA 4KFSA 4O2LA 4XI9A 3UNXA 3NETA 1V0JA 1YSCA 1Q14A 4G5YA 3N2LA 4D0GA 3QHPA 1KHHA 1DAEA 1UK9A 3AI2A 1Z4PX 3U1BA 2WJ3A 4WBXC 1WBJB 4CLOB 1YS9A 3GARA 5GAJA 2GNPA 1T1GA 3AEQB 1GCIA 2R6AA 1PR5A 4P5DA 3NCTA 2CNDA 4ZZ0A 4W8HA 2PZFA 4F86A 1YA8A 2W7TA 4YRBA 2QYTA 2H2FA 6REQB 2ZR9A 3UXYA 4KE9A 2XI4A 5KVCA 1PL7A 1C8KA 2AFHB 3VFDA 1CERA 2WAAA 1GP2A 3UJPA 1O6BA 5T57A 2WUWE 4NNOA 4BZZA 4BYGA 3ZW8A 1VHJA 3U7QB 3UUEA 3WLOA 5KTSA 3CUUA 5JD5A 3CUTA 3OTOB 5IABA 1T8WA 2WKSA 3N40P 2VF7A 1OT3A 5F73A 1FNDA 5H5JA 1AGRA 1U94A 1DAAA 4S04A 5BORA 1CF2O 4BNVA 5CFMA 4NS4A 1Z06A 4DV1H 2A1IA 4U2GA 1QP7A 3HB1A 4XGNA 4JLDA 4UTZA 2KWIA 3SJCA 3G79A 2INGX 4YX9A 4DGSA 3AM5A 1GPLA 1NXSA 1ZIPA 4G4SP 3VU9A 4J9NA 5DWQA 4ZD6A 3AERA 4XM2A 3WGGA 5ALMA 4ND3A 1JKMA 2X5NA 5DSTA 3G2KA 4HV4A 3FGZA 3BWXA 2FPMA 4CODB 3ZE6A 2E49A 1I6WA 4KR6A 4MO9A 1WF3A 4JUAA 3GJ0A 1R8XA 1FA9A 5AW0A 3K2BA 3OMWA 3LVRE 2ARKA 3KR1A 2C94A 2WV7A 4C2BA 1HMPA 3PC3A 1IOZA 3H5TA 2GYYA 3G0HA 2WQZA 5FPSA 2O7SA 5CBPB 4DSZA 1QE3A 5JUMA 3OQHA 2F7SA 1E7YA 1C30A 2C2EA 2H54A 3LBHA 5I9TA 2C7RA 3S1LA 3UKDA 2E89A 1KI7A 2TSYB 3ED5A 1NRWA 2PMDA 3OC0A 1IB6A 5C0OE 4B6PA 2H0RA 2H17A 4DR3B 3G9TA 4M87A 4U63A 2IHJA 1IATA 4IDFA 4AJJA 1XMVA 3GLRA 3GGDA 5KT4A 5IYBG 5K05A 3UUGA 3G9XA 1S9HA 5EJFA 3P2EA 3IMGA 3D6MA 4YPFA 1VCHA 1XNHA 4WPGA 3OURA 2LZ0A 2LIVA 2R96A 1XYYA 4KGVA 4YRIA 1FP2A 4FBGA 1USUA 3NUAA 5JD3A 1KDOA 4XM1A 2Z4TA 4OHMA 1RRMA 3LHKA 1CZUA 1XF9A 3G2OA 5BSFA 3QNMA 3LYLA 4R16A 3M5DA 3UK0A 4KR0A 1UOPA 4IL5A 3HKDA 4BNMA 4WLUA 3ZH9B 3ANLA 3LZDA 2XQIA 5GJVC 3NYQA 3LL4A 3IL2A 3T7AA 4KL8S 2HVQA 3MERA 2VJCA 4A7PA 4HN9A 1PSWA 8OHMA 2VSNA 1QYXA 4LE2A 1MD9A 4B4OA 4B7CA 5EIBD 1W0JA 4BMPB 1BQ3A 4HO1X 4ENSA 5CR5A 1DCFA 2D2XA 1MB2A 3ZJ5A 1OBGA 2J9RA 4MKHA 3DMTA 3QSYA 2GCIA 3HJBA 4ZFNA 4WASA 4K9DA 1KY3A 2CL0X 4EMBA 3TZHA 1CR0A 2NO6A 2O1EA 3Q3JB 3N5KA 3TAUA 2DQ4A 2O1WA 4RIHA 1VG1A 2C8LA 4C2AA 4MV5A 821PA 3EEYA 4FB4A 4YQEA 1MOPA 4JV1A 4JOSA 2BUAA 1TM4E 1P4GA 1Q15A 3H1BA 3OF5A 1WNTA 2X0EA 6AT1A 2G06A 4GHWA 1A97A 5I9LA 5AXAA 2PX2A 4LKRA 2VYVD 2FN4A 4YV7A 4WVLA 3AVYA 4LGMA 5AOCA 2YOHA 3QLTA 5BN4A 1AMOA 1EE1A 3EIUA 1Q7RA 7GPBA 1NW8A 4YMUA 2ZDQA 1X7HA 3ER6A 4KVZA 3V8QA 4TXHA 1X39A 1QRTA 2V65A 4K2AA 4MLCA 2GNAA 4MKRA 1KERA 3FLEA 4QU8A 4MMXB 3ZIDA 3VDXA 1PEDA 3BAAA 1Q12A 1GPH1 3JYNA 3T3OA 1U02A 1KZ4A 2IZ7A 2IITA 4C4SA 1ISRA 5IVDA 4IS3A 1XCPA 3A14A 2DSTA 1RJDA 2MTBA 1E2IA 4BY7G 1NULA 5JSFA 1BGWA 4J7UA 3TB4A 2AUNA 4FPXA 3O2NA 3LRTA 4DKJA 5AJHA 4DA4A 3R0JA 2HLHA 1SKQA 2PJZA 2MMCA 1S8OA 1L5ZA 4ER7A 1DDGA 1RYEA 5T41A 2HGWA 4B79A 3OKPA 3HOXG 3NPMA 3W3AA 4H7JA 1WU7A 3FTCA 2HU2A 2QYZA 1PZNA 1E3WA 5LUBA 1B8VA 1MOZA 4YR2A 1U2PA 4CL0A 3WZLA 2A35A 3U0GA 4JBIA 1U2QA 2G1PA 4RK0A 4YS6A 2DGDA 3SC4A 4C4AA 1E2PA 4F46A 3RBAA 4HXFB 1FQWA 2IBKA 3E8SA 4Z8YA 3MD0A 3RREA 2J9FB 2BHNA 2JEIA 4XB2A 5F21A 1VJDA 1EHIA 5G4KB 1NRJB 3MJTA 4QIHA 1PWHA 1I4TD 5L45A 1QU3A 1I0IA 2FLNA 3FWKA 4H16A 2HWYA 4FC6A 1ULZA 3L0OA 4F9TA 1I14A 1O5IA 1BFUA 2WPDA 1PTJA 2CJXA 1U0BB 4UE3S 1T91A 1MAHA 2A84A 3PKIA 1HUQA 3DNPA 2OCDA 4DQNA 2NNLD 1DIHA 3OE5A 3PV0A 2ID9A 1BWSA 2D7DA 4TV9B 4XLTA 1NQWA 2JFGA 4II3A 3M3HA 5K6AA 1WPGA 1H2AS 2PKYX 5HKBA 1PG0A 1DC4A 4QX6A 2IYQA 4BIIA 1T4GA 2R00A 2VTKA 3U37A 4LECA 4TVBA 1P19A 1PI3A 1RQ7A 3RVRA 4F4YA 1VGRA 4DR5B 3HG7A 3AUYA 1L5WA 4OQYA 4H7PA 1LEHA 3HCAA 4QFDA 4EEXA 3A6PC 4UDYX 1P1CA 3QMVA 2PS1A 3GOQA 2CLFB 3OF3A 1VYVA 3CMCO 4V38A 3OE4A 4G5SA 4FOLA 4UDOA 1EFTA 2QBYB 2HJSA 1J23A 1OAKA 3ODPA 1L3IA 3PQ6A 3PHHA 3IO3A 3KSRA 1UZNA 2GHIA 4C0QC 4MICA 3N75A 2QN9A 4RB3C 2HJ9A 4PHTA 1DJOA 4WZ6A 5KPDA 1V5WA 3VO8A 1T9HA 3CEJA 1M34E 4FKZA 2F6RA 2QQFA 3EH2A 2W2TA 2YIMA 1RYNA 3TG2A 2QTGA 1NKSA 2Q2TA 4O7LA 1OHHA 3C15C 2OR3A 1J42A 1SK9A 3RSFA 3IQXA 5FOTA 1PNVA 2JLRA 3KOMA 4F3NA 3KRTA 1H1LA 4Y7DA 1SCUA 4PSDA 1V1MA 1GL6A 1DZIA 1W7AA 2HQRA 3ZKWA 3KUCA 2YINC 1CJUC 2PKXA 4RVDA 4LVNA 1W0KA 5KT6A 4YK7A 1TCCA 4DUGD 4AX4A 2QMYA 1EPUA 4Q93A 3S7TA 1S0MA 4RGVA 3FMFA 4KOAA 5KT2A 2VZLA 4IPTA 4B0PA 4UOZA 1KE1A 4BVFA 3GUYA 4J7XA 4A2CA 1AQ6A 3RAEC 4L5AA 3VPSA 4DR6B 2Z04A 4R9SA 3KDAA 4BP1A 5K0NA 3EZXA 3AJ9A 4EQ5A 4FINA 2IYLD 2C92A 4R4JA 4K0RA 4YJ2A 2E1RA 1MAUA 3NX4A 4FDAA 3RWOA 1P44A 2HF9A 5GZ6A 1KAQA 4TSFD 5JSHA 2JHFA 4EJFA 1LVGA 4DLSA 3I5XA 1GAWA 2AI1A 3LRXA 4Y0AA 1IYEA 4QXMA 2IYNA 3WV5A 4XQ9A 2C35B 4J0DA 3A4IA 1Y14B 2WJPA 3CF4G 4FWIB 3I72A 3LXUX 3SR4A 1JAXA 4I5FA 4XWWA 3SLGA 2BCEA 3ZLBA 5JQGB 1BMTA 2ZVPX 4LV5B 1E2KA 4CDRA 4DSAA 2DT8A 1GNRA 1XCBA 4A2PA 4EITA 1NXWA 1N3IA 4FZVA 5A5DA 3AEUB 2H8GA 4FHDA 1Z22A 4NE7A 3ESBA 4CRWB 2RGBA 3HS3A 2PUVA 1WLSA 4ECAA 4ERNA 4F60A 3C3MA 4EY7A 1RPJA 1TRKA 2ZRGA 2YS6A 3JCZA 4ZQGA 3PPYA 3O03A 4PM4A 3RSLA 3L93A 4B46A 2FAXA 2HGXA 2HREA 1NM5A 4O4LF 5JASA 3RBZA 3G9ZA 2FF7A 3HEAA 4DB2A 1I2LA 2VHZA 2ZE8A 1M1NA 1L4NA 3W9SA 3K9FC 3EBPA 1AUPA 3AR3A 5L4NA 1WBDA 3V8PA 5KQSA 2D1SA 3THXA 4DLWA 2ZIUB 3VH1A 4Q9NA 2E6KA 2BMDA 4OUKX 3BWCA 2IW3A 3L40A 1DAKA 4Q4LA 3HYRA 2NUAB 3PR4A 2IHUA 1XT6A 1L2TA 2IIQA 1XP8A 3TAXA 1XLVA 1GN8A 5EUQB 5K4GA 4G0WA 2V54A 5JH7A 2NM0A 3L92A 3AIOA 3VZBA 4D4MA 4I2VA 3THWB 1SQ0A 1YOVA 4ZO4A 4ZAWA 1UZLA 1UJ4A 4XLLA 1VKZA 3W7AA 2JGEA 4QU5A 5JOQA 5F4BA 1UMCB 1ZAUA 5CAEB 3TXAA 1EFDN 1N6RA 3E23A 3FNIA 1W48A 2RHJA 5DX0A 4C7BA 3JD0A 1KJ8A 1C3VA 3GDWA 2VYCA 1ZK4A 1ID8A 2PA3A 3MSXA 4CQMD 2O8NA 1E0KA 4MLPA 1F5SA 3PL1A 2IEYA 1XRQA 3N2ZB 3CMMA 1CUGA 5JJCA 2ODPA 2OAQ1 1Q1BA 1P4RA 4Y7CA 2P7HA 8GPBA 1AKEA 2JFYA 1I7SB 2BFFA 4POOA 3W9YA 2HRBA 3MWMA 4UBKA 2GM3A 5BNTA 1V1MB 2ONYA 4YRFA 4Q43A 2QRLA 2VRWA 4P2GA 4BV9A 1FE8A 1CR2A 2VTBA 2QN1A 1O95C 4LOHA 4GZMA 1QH8B 2QL5A 3BQNB 1OYVA 1KOLA 4PZ0A 1EJ0A 5DG7A 4D5GA 2MYUA 2UZ4A 5BT9A 4CEHB 3VMFA 1FLAA 2DFPA 5HS6A 3MS4A 4GU5A 2FX5A 3AKDA 5EXXA 3A2LA 5HIKA 3MS7A 2W00A 5JVDF 4EGQA 3EA0A 2ZJ7A 1J8MF 1JR2A 2A88A 3NYIA 3C5EA 1HPLA 3HMKA 1XZQA 2DY1A 1VLHA 4G23A 5E1BA 2AQ8A 1A9PA 3I9NA 1OLOA 1S01A 1Z07A 5EFZA 4EX6A 2BDTA 1BHSA 2YS7A 5EXPA 4ZO9A 1PT9A 1PL8A 4UFPA 4RADA 1YKFA 4RHYA 3KWFA 1LFDB 3PX7A 4FZRA 1QV6A 4C7OA 4MKIA 2PL1A 3MTEA 4EGSA 5LYJB 3PX2A 4OM8A 3E8MA 5KFLA 1I9CA 5AXCA 1RXIA 1E7RA 3W6PA 1BXZA 3FOFC 4YLGA 2VUGA 3O31A 2PMFA 4NNPA 5E95A 2ZB4A 4FHZA 2BLNA 3C4QA 4G1CA 1VAJA 1E4YA 1WMEA 1G0NA 2WD9A 2G07A 3K0SA 3KVYA 1FFWA 2AKEA 2VCYA 1E3EA 1OTYA 4M8NE 5HYVA 4XQGA 3TOSA 1SWWA 1JSZA 1Z0AA 1VLJA 1DMSA 2X2EA 2B8JA 3HYCA 1K7CA 2IX9A 4P84A 4ZOLF 4RLSA 4KQFA 1IJBA 3H5WA 2FEOA 1MZPA 4XJTA 3O4JA 4TMVA 1SXJB 4R2JA 3B5JA 5EHZA 1LH0A 5JDIA 3OLCX 1TUGA 1SG6A 1YRYE 4DM3A 4G0VA 3CTPA 3DKPA 4NZYA 4ZREA 1PGOA 3PXEA 2PAFA 1XDZA 2I1WA 2CJYA 4TQ9A 1V8OA 4Q3OA 1XLTC 4TTIA 1V1RA 1IPFA 5JH7B 4A3KG 3JSAA 5LZ4A 5I45A 1GKLA 1ZBQA 3Q40A 4EA8A 2B30A 3ERCA 4EB6B 2E21A 4D9CA 4DLZA 5SICE 2ANCA 4E08A 4XWKA 3EDYA 5AICA 2GM4A 4DBVO 4JXXA 2GASA 1GL7A 1QGED 1VJ1A 1M2GA 3JTEA 1D04A 1I3CA 1ORIA 1K1QA 5K4AA 5CGQB 3BG5A 4ZP1A 1N4DA 1H2RS 3BTVA 4Z1OA 2M1XA 3BTUA 4FR0A 4JBNA 3TNLA 4XR9A 1C0PA 3COWA 3RQSA 1DCKA 4BFYA 3OAAA 1R6VA 2HIHA 4PZ6A 4EJ0A 3P8ZA 5AO9A 5MFPA 3L4JA 4L72A 4DOMA 1A04A 2J32A 3JARB 2CVHA 2QN2A 5AI4A 2BKLA 5F1PA 4E21A 4RPGA 3LPNA 1T13A 3F7TA 4JJFA 4YLYA 4Z9AA 5M7EA 4PX5A 3EFHA 3TPFA 2G1AA 4FXOA 1C3EA 2LE0A 5IPFA 1VC2A 3QVJA 3RC1A 2UXCB 1U11A 2P1DA 1JWBB 3QV2A 1FVHA 3JQRA 4IDAA 4YCLA 1F14A 3KHKA 3H4IA 4F3KA 2NSDA 4UVGA 5ARCA 4J9LA 4BKOA 1G3IA 2EJ2A 1U7UA 4RMIA 4BNDB 1DEHA 3RRMA 4MWGA 4N48A 3E22A 2ZXFA 2ZBUA 5BN3B 5JPCA 5AIAA 3H4MA 3DDZX 3UJBA 1LXCA 5GGYA 2EL9A 3CN9A 3EC7A 3LFUA 4IVPA 4D3DA 1PHPA 3MJDA 3PYLA 3HDJA 1T2FA 3H8JA 5LOVA 1WMBA 2VKTA 5FR9A 4CF5A 4ARAA 1WP9A 4BNKA 1EE9A 2YJGA 5TEVA 4WK0B 3ETGA 3X1WA 4DQDA 5HF5A 2QTZA 4Q82A 2G4LA 4ZZIA 3GC6A 3JQBC 2PR7A 1Q19A 2XA9A 1ISFA 4US1R 4UUOA 5HIIA 3WGJA 4E15A 2JGMA 3ETJA 4CZ2A 2PGNA 2V6JA 1PJRA 1T3SA 3RQIA 3H5VA 4YYEA 4EKEA 3LD9A 2P8JA 3OUUA 4GGPA 1AOXA 4AN1A 2RHDA 4UNPA 4G97A 1IBMB 1SZCA 3MZ0A 3BXHA 3DVSX 4C20A 4P34A 1UWCA 2H2GA 5AVWA 2QYOA 2KI5A 2MCFA 3T94A 4D25A 2WTXA 4BUJA 4EKNB 3T7DA 4LJ6A 4OREX 4NYMR 3I2FA 4OHKA 2AWOA 2ZBRA 4EUKA 5JDCC 4RD4A 1FMJA 3AYXB 4DA9A 3KFLA 2NTJA 2ACEA 1KYZA 2VQSA 4E07A 1S96A 1XEWX 2PHZA 1YR9A 3MWDB 1KMHB 3JQCA 4PLYA 4Z3KA 3PW5A 4G84A 4PEVA 4IUDS 4EEYA 4X95A 1K3FA 4LWZA 2ZSAA 4YP6A 3OM0A 3KWJA 5J58A 1DTWA 1FLNA 1FVXA 3KK0A 4KXLA 3ICCA 1NW9B 2XDAA 2PBRA 4ACBA 4LZAA 3GIMA 1PWEA 2O3RA 3DDHA 2G36A 3KOXA 4V0LA 1JFTA 4UAUA 3H11A 4WI1A 5KOJA 4B3RH 4FGUA 2H65A 2BELA 4YY3H 2Y77A 1RCFA 4Y8VB 2HCFA 3WWCA 3GLUA 4I3FA 1PQWA 1JYEA 2W2KA 3GCZA 3Q98A 1HDXA 1R9GA 4G0UA 5AVKA 6CHYA 2QTRA 3MYYA 3VTAA 2ZRNA 1NPTO 1AC5A 1G8HA 4H17A 3N6VA 4TTQA 4FS3A 4NAUA 4WW0A 4JJ6A 3TY5A 1PL6A 3ICWA 5L3VA 4IEFB 3EPPA 3R0ZA 1N7HA 1SELA 3RS3A 3UAYA 1YASA 3OOYA 3KE9A 3ZQ4A 4B4UA 3WSVA 2V9PA 1NOKA 2YJ6A 1OD6A 4WXMA 2O7QA 3HB7A 4I6JA 4ZXFA 4EG8A 4GSYA 1EFVB 1XA0A 2DTEA 2SKDA 1D8TA 2R82A 3PGKA 1QR2A 2IIVA 3PRHA 1WRVA 3L01A 1VKJA 4IJ5A 4EF5A 4YJ3F 5EMLA 5AH0A 5MGBA 6ABPA 3FOAA 4G6ZA 1BE0A 4QTYA 3CLRC 4FOPA 4EELA 3HU1A 4P58A 1U99A 4OD0A 1T8UA 5FAKA 4DG8A 3WO1A 5LOVB 1ABBA 3SYNA 1Z2EA 4AZ0A 3KQPA 4FFNA 2JLSA 1H23A 1K8QA 3VU8A 5JXHA 3K4HA 3A6LA 1A88A 3JATB 3DEZA 3LKVA 2W6PA 3HCCA 1R0CA 1KR5A 4G25A 3AY6A 1H4SA 1VI6A 1QG4A 3E3LA 2YH2A 1CDZA 1UIRA 3K1AB 5FOXA 1ZGHA 3W8RA 2JAXA 4MW9A 4FNAA 4DRYA 4YHHB 4NZMA 1YQEA 1D2HA 1CB0A 2O03A 5BURA 1M8PA 2X3FA 5H82A 1MC1A 2JA6A 3A70A 3R7AA 1ZOSA 3S1AA 2F4NA 2F8LA 4UDXX 1NT4A 3VHLB 4GM0A 4JXKA 4GC9A 4D9IA 2L19A 1BA3A 1T9CA 1R0ZA 2OB1A 4F4FA 4GL2A 2JASA 3SAJA 2VNJA 1R16A 3W90A 1SKMA 4PZEA 1G4UR 3AG5A 3OUZA 1KKUA 3G2MA 1IVNA 2AZDA 1RKVA 2ZSIA 3I9KA 4JJ4A 1NG9A 4X97A 2D74A 1DTWB 3AHCA 3QX9A 4BL5A 2CXRA 2WD8A 4H6VA 1EGVB 2EFCB 4RY9A 4YUYA 3SJBA 5A06A 5FJ8G 3TKYA 4H6WA 1W5SA 5CYGA 3A1FA 2VJQA 4AI6A 3R41A 1GTL1 3KB6A 5EWMB 3NHWA 4Z86A 2HWKA 5AVVA 3ZY5A 3KPJA 4X91A 2D5AA 5EKUA 4LF8B 1LW7A 2WAMA 3R6DA 4PZ7A 3ZNQA 4C30A 5E6RB 1IAVA 1QS0A 1TQ6A 3IOCA 3NPAA 1T4MA 3HBJA 4MIKA 4X20A 4HWPA 4A82A 3M0EA 5FV4A 4MUYA 2QN8A 5HV6A 3E2PA 4A36A 1S8AA 3ZWPA 4N7BA 3QVOA 1MP0A 1A8UA 3MG9A 1BXRB 3FHOA 3BSWA 4RH0A 1CPYA 1CS0A 3AR5A 4JI2H 3GVPA 3E3OA 2CV2A 5I5TA 4YV2A 1X8XA 3RUEA 1SG0A 1VIVA 1F6WA 1SU7A 5TX7A 2QW1A 2FUG1 3AEXA 1A9OA 5B1HA 1K0FA 2Y4NA 4O7WA 4LBVA 2XGPA 4JJEA 4RHUA 4B33A 4AY2A 3HU3A 1RWNA 4ZJZA 1Y5LA 4HRXA 3SZ3A 1REQA 3UC5A 3DNFA 2P77A 2XE8A 3X1MA 1LDGA 1HE8B 2KW5A 1FU8A 5ESXA 3PZRA 2RGNC 4M8SA 3OIYA 3HDTA 1Q0LA 4IJMA 2HYDA 3KSAC 4JP8A 1S2NA 3DYIA 2R47A 3IDSA 3UQYS 2BM0A 4JS0A 4X90A 2GPYA 2QG9A 1BHQ1 1Q3HA 1FYWA 4LYGA 3TO5A 1O9BA 1J4AA 1G8KA 1ZRSA 2JIOA 2E5FA 5F3WB 1UBTS 2X41A 4C4RA 3N2EA 5KOYA 3PYXA 4G5HA 4MUMA 4I46A 2CVPA 1JVBA 3M9WA 2AYYA 2EZUA 2E9SA 3REQB 3MOSA 2VJOA 3D7KA 3FNBA 1T3ZA 3UYLA 4MGIR 2YWGA 1W4BA 3UGQA 3U3ZA 4CIBA 2GPNA 4O7TA 5JNUA 4QOIA 5TY0A 4N18A 1IVSA 4AKSA 2Y2VA 3MJVA 2ZJ3A 1YKGA 2DUJA 1XWIA 3KP1A 3IAAA 4KGXA 1Q2UA 2A9QA 1Q0SA 2M6LA 2C4WA 1TC1A 4OIMA 2EW1A 2VHWA 3THYA 1EK0A 2I9PA 4OX9H 4R7ZA 1Z5VA 1PJAA 4LBWA 2JAHA 1KQFA 2YWHA 3DONA 1E0AA 3JR7A 2Y0DA 2ZI7A 4Z9BA 3U3XA 1PK9A 2ES4A 1CR1A 4PZZA 1U1GA 2BDUA 3IYLW 4IZ6A 4Q9LA 1TPZA 3V4FA 1NKTA 2SCUB 5DLFA 4FWBA 1R1DA 1Y3HA 3HXLA 4ZDIA 1DIOB 3SZUA 3K70B 4X1IB 2QX4A 1IY1A 2XDQB 3ME5A 4HWGA 1Z37A 4I14A 4WBNB 5DEOA 1EX6A 3DAPA 3T1OA 2PDAA 4GLFA 4RHXA 2OC9A 3R9RA 3U3OA 3T4XA 1K08A 2AXPA 3LECA 1SFRA 4I1VA 2QX7A 2UZ0A 5DHUA 1MO6A 2ATVA 5C5IA 3QXJA 2ZATA 4G36A 2YWJA 5EE0A 1UMKA 4X20B 3PUZA 3QKTA 3IAFA 1P45A 2IE0A 4KQXA 5IMSA 2P2DA 1VJGA 3V97A 1IQUA 1BWRA 3AVOA 4CM8B 1YE3A 1M1YA 3D1LA 1JNXX 4GM1A 2ASJA 1TWFA 2DAAA 3DSRA 1XNQB 2QM3A 3V3KA 1GUZA 1EVLA 1RI1A 4I2NA 2R93G 4PXYA 1NQOA 4B3SH 5DTMA 3TKLA 1NYLA 2QM8A 1XTZA 4PLWA 4YQWA 2CVQA 1FLDA 1VLMA 2QL6A 2Q9CA 6NULA 5AVOA 1N2IA 5BSUA 4ZO6A 3M9XA 1GL9B 4FJ1A 3AUAA 4ZWNA 1S4QA 4N6NA 1G7SA 3FYUA 3DE1X 3K5WA 2Q1UA 3EG9A 2VPWA 1ZK2A 2VHVA 4HWRA 3HM2A 3GV7B 1ZMBA 1U2RA 2QZ9A 4MLZA 4AUMA 2OGZA 3MTBA 1CCWA 1YC2A 1V8DA 2FF5A 3I53A 3IQFA 4DLVA 1XEAA 3SHFA 1C9DB 3DD1A 3HL0A 5CJJA 3AR7A 3ZH2A 4GGMX 3NORA 3VYVA 4TL9A 4XM0A 1ZZGA 2QR2A 1NDHA 3QUQA 4IX1A 2EQAA 3QUCA 3CX6A 1Q3TA 3GEBA 3GPLA 2CZCA 3NHUA 3IE2A 1GCGA 4F3RA 5KINB 2MDTA 2Q5HA 4KWHA 1IYZA 1TIBA 3QWHA 2HJGA 1LJUA 3L7NA 3WTCA 2IDMA 1WA5A 4R54A 4OLBA 1LNQA 2MU1A 3WGYA 5H3LA 3GX1A 1YACA 2A9JA 3V46A 1TTPB 3I5YA 2NTEA 4G63A 5DVZA 4UPEA 2NU9A 4DLLA 1DDOA 4F6RA 4Q3EA 1P75A 2RCNA 2HMVA 3THYB 4J94A 4CTOA 3NB0A 4P3OA 5EKXA 4M7PA 2VT7A 2GQ0A 5JNRA 5CA0F 1U5BB 1T4CA 3ENZA