4ZQIA

Crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
306
structure length
292
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop
doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 90
structure length 292
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4zqiA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4zqiA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zqiA01
3G8DA 4EG0A 2NU9B 4EGQA 2R85A 4DIMA 3UFXB 5CA0F 4IWXA 4MV4A 2FPIB 2I87A 5C8YF 2ZDHA 4MV1A 1C30A 1OBDA 4HNUA 4FU0A 2C00A 3ORRA 4XYLB 3K3PA 1PX2A 4FGRA 2HJWA 4ME6A 2YS7A 1JDBB 2QK4A 2VHEA 4DLKA 1EYZA 1CQJB 3VPBA 3U9TA 1Z2NX 1BXRA 2R87A 2QF7A 3N6RA 4EA8A 1A9XA 1KBLA 2PN1A 4XZ3B 1JLLB 1VKZA 2W6OA 3NUAA 2W6ZA 4O7TA 4HQ6A 2R7NA 5KX5F 5EZYF 3V4ZA 4HNTA 4EAAA 2YRWA 4M99A 3BG5A 4O7YA 1KJQA 1EUCB 3N8DA 4ZOLF 4HNVA 4YAKB 4I55F 4O4IF 2YWVA 3JRWA 3VPDA 4O4HF 4EA7A 4WBNF 1SCUB 3HO8A 4M9UA 3RFCA 1GLVA 5LYJF 5LOVF 5C1OA 3R9RA 2P0AA 1M6VA 2R84A 3TINA 5LXTF 3RV3A 4FFRA 5J2UF 3VA7A 2DLNA 3E5NA 1AUXA 2WYOA 3KAKA 4IZOA 1KJIA 3V4SA 1B6RA 4O7LA 2W6PA 2YZMA 2OLSA 5I47A 2GQSA 2FPPB 2V5AA 2V59A 3KALA 3LWBA 4E4TA 1VBGA 2X0SA 3AW8A 1BNCA 4TUYF 1E4EB 2R86A 1KEEA 3JRXA 4RZQA 5BPHA 2W70A 4O7WA 4ZI7F 1W96A 5H80A 3K5HA 2YZNA 4M9CA 4HR7A 1M0TA 5BMVF 4MAMA 1WR2A 3RV4A 3AX6A 2NUAB 3JZIA 2DIKA 3OUZA 3TIIA 3BFPA 4FFOA 3DF7A 3I12A 2XCLA 5JH7F 2I8CA 1A48A 5LP6F 2YZGA 4O4JF 4FFMA 4YJ3F 1CE8A 2W6QA 2YL2A 1KUTA 3WO0A 2I80A 3R5FA 4MV3A 2XD4A 4O7SA 2VPQA 1KC7A 2CNVA 4MV7A 3BSYA 2GPWA 3R23A 2R6FA 2ZDGA 1EHIA 1PK8A 1JKJB 4YBZB 2CNUA 3G8CA 4FFNA 5FNVF 1GSOA 3RUPA 4TV9F 3MJFA 5D8DA 3TQTA 4YB8B 3HB9A 3TW6A 2V58A 4IIJF 5HBRB 2NU6B 2NU8B 3KREA 4FFLA 2NU7B 4EABA 1I7NA 2W71A 4MV8A 4FFPA 1DV1A 1GSHA 3ETJA 2YYAA 2VQDA 4YJ2F 5GONF 1DV2A 3JZFA 1CQIB 4MA0A 1EUDB 2FB9A 2J9GA 3BSWA 5CA1F 5CAEB 2W6NA 4TV8F 2DZDA 5JQWA 2CNQA 2ZDQA 4IWYA 1VBHA 1KJ8A 3K5IA 1CS0A 2YW2A 1AUVA 3LP8A 2SCUB 2CQYA 4O7ZA 4J6EA 3ETHA 2FPGB 4O83A 3ORQA 2YS6A 1Z2PX 3U9SA 4YAJB 2IP4A 2DWCA 2PBZA 1ULZA 1B6SA 2GLTA 2CZGA 2GQRA 2YZLA 1JDEA 3Q2OA 3R5HA 3OUUA 2W6MA 4MA5A 4MV9A 4C5AA 5JQGF 3HBLA 4Y8VB 2VR1A 4I4TF 1EZ1A 5C1PA 1IOWA 2FP4B 3BSSA 1GGOA 4O7RA 5KKNB 2R82A 5IYZF 4O86A 2PVPA 3KAJA 4EA9A 5LA6F 5BPFA 3TIGA 5HV6A 3VPCA 2R7LA 3U54A 1IOVA 4XYMB 3GIDA 4WD3A 2NPOA 1W93A 4C5BA 5JVDF 1I7LA 2R7MA 4NYEA 4O2BF 1Z2OX 5JVLA 2YRXA 4ZHQF 1OBGA 5K2MA 4O84A 4EGJA 1DIKA 2Z04A 4ZQIA 4QSHA 5CB4F 3Q1KA 4M98A 4O4LF 4L1KA 3VMMA 4XX0B 3QFFA 4I50F 1E4EA 4MV6A 3GLKA 3R5XA 1GSAA 5J2TF 1UC8A 2R7KA 4O81A 3MWEA 3U55A 1KJ9A 1KJJA 2HGSA 1UC9A 1M0WA 3WNZA 4O2AF 3WO1A 4C5CA 4O7NA 2Z02A 3MWDA 1T36A 4O82A 1C3OA 4GGMX 4FE2A 2GPSA 4IHJF 5DMXA 3SE7A 3VOTA 4O7VA
chains in the Genus database with same CATH superfamily
2BGGA 5JQGA 4PSAA 5FYDA 3O73A 3R3VA 1SXGA 3RJMA 3QJYA 4BBSG 2YQ5A 1EXNA 4MQLA 5CX1A 3TVDA 1XQ6A 1KA9H 4FSXA 1RHMA 1FDSA 3M49A 1SVMA 4WXRA 3EXEA 4QJBA 2FW1A 2CVHA 3SIWA 4FBUA 4GRIA 1SBIA 5KYGA 4WNAB 5FI5A 1GFWA 1GPMA 1U3FA 3BHNA 3ELUA 3VISA 3H40A 3VYTB 3BULA 4J7CA 3DAYA 4D0SA 4EYOA 2PUBA 4OHBA 4EL5A 2I2DA 3VPSA 1R8YA 1JFFA 3WFJA 1H4TA 4BXXG 3E5HA 4YFVA 2I29A 3P97A 2IPMA 5EWJA 1AGRA 1ENZA 1FA9A 5EFZA 1ZL2A 1FNDA 2NADA 2X40A 3ZHBA 4EHIA 1VKHA 2B4RO 2BTQB 3IP6A 4RC9A 2ROQA 4O5OA 1GPBA 4OLJA 2LXNA 1M1NB 2H51A 3KSBC 1O7JA 2HZBA 2Y92A 1ZX1A 2SBTA 4K7JA 2VO1A 3JRXA 4JP3A 2XQKA 2PL5A 3LP5A 3GJSA 3NX4A 4DRYA 2OTCA 3VGJA 4HDSB 3FDZB 3NU1A 2ZG6A 3VPGA 2ZJ6A 5FI1B 4J0MA 2BGWA 4TTQA 2DIKA 1NOKA 3S55A 4CF3A 4ACAA 5F7OA 3W0LB 1GDDA 2EP7A 1KTIA 2GAAA 3ICEA 1FFCA 4J9KA 2W2QA 1YS2X 4G4IA 3LX6A 4UU0A 2KPOA 2ZSIA 1NY5A 1G8GA 3FGZA 4Q02A 2WB1A 3RSSA 1UDAA 4X1YB 1KVQA 5E0OA 2C29D 4TKUB 2OB1A 1FLVA 2YX1A 1WCWA 2Q3JA 3T06B 1O6FA 3P94A 2XCSB 3QVXA 1EK5A 4EABA 5HQ3B 4OQMA 5EWMB 4Y1FA 1OKKD 1M73E 4D96A 4C89A 1SAYA 2ZCVA 2NV6A 1TKCA 3H9UA 4I8IA 1OYOA 4RADA 3GYGA 4BV3A 3NAGA 1WVGA 4FCWA 1Y8QA 2RG7A 2C57A 4R0NA 2VN8A 1RJGA 4FCTA 5MF6A 1QSGA 3G2LA 2C7OA 3RB0A 2B21A 3MJTA 3JQBC 5LFAA 4WBNB 1Y3AA 4EVIA 4PX9A 5C8ZA 3V2HA 1DC5A 3A7EA 4OI1A 1EXWA 2FP4B 3HGTA 4ZEWA 2WSMA 5G0SA 4C4YA 3IAXA 4EB6B 3U31A 3UBTA 4C78A 1BC5A 3FWHA 2MDTA 1FTQA 2FCAA 4BV2A 4AJ4A 2PSSA 1N6NA 5G3ZA 1G8MA 2QN3A 1E6LA 4L8LA 2P3OA 3E1KA 3HJGA 3K1YA 1LK5A 4GLLA 3ZS8A 1PJSA 1FYVA 3QE4A 1X0VA 3AETA 1DI0A 5EINA 1IBMB 4KBYA 4Z8XA 4YQYA 5DF1A 2RGVA 3QKIA 1S7GA 3ESDA 4XIFA 2JI8A 4Y2UA 3SNHA 2UVPB 3AM4A 3EEIA 4B85A 3DNMA 1VG9B 5L8VA 2XQGA 2IOQA 4JVMA 3T3GA 4YMSA 3ROPA 1NM5A 1O97C 4CL3A 2IITA 1FUIA 2H2AA 2CW8A 1ES9A 1R6DA 3GVCA 4BN4A 5K2OA 3BIXA 2NVYA 1NY6A 4G4SO 4XM2A 4ZJYA 2D1RA 4KR6A 4AW9A 5LN1A 4S2EA 1G7TA 1V6SA 1ZOPA 5T64A 1W73A 3LVFO 2GEJA 3UK6A 2UYOA 4L07A 3RG2A 2Q5OA 3FPEA 3GCWA 2ZWOA 2WP0A 3SZLA 3PITA 3H05A 3PT9A 2BFBA 3QG1A 4E7PA 4RF3A 4RV4A 3AJEA 1RRCA 3IOBA 4QHTA 1L8AA 4NS4A 2X1LA 1N5MA 1A9XA 4ND5A 4MUFA 1SIUA 1C0EA 1X1AA 3LLVA 5BW5A 3I6ZA 2EJTA 3D7SA 1WP9A 3TM5A 1R5BA 2B6HA 2R9VA 3ZCTA 4FUQA 5CAEA 1GPUA 2YDXA 3EC2A 4DW8A 4JMLA 2I4MA 3GAAA 5A6SA 3VJRA 1MIOB 4D43A 1HDIA 1YE3A 3CMCO 3PD7A 1X1SA 3K92A 4E2ZA 3LFHA 4TWAA 4TM8A 2ZVDA 3DL2A 1RTTA 1TZJA 4U7PB 1FU4A 3QE2A 2GVNA 2JAPA 2PZJA 3HTXA 5LYJF 4ZTUB 3WGTA 2GFQA 3NXKA 3ZLTA 5I7AA 3TLCA 2PMZE 4DIDA 3IERA 2ERCA 1ETHA 1ZMRA 2YJ3A 1H9AA 3ZY6A 1TWAA 1ABFA 2XYGA 3U7JA 4R1TA 3AEUB 1VHJA 4HB2A 3CSUA 5KFPA 3HYCA 3DO6A 3CYFA 3PFBA 3GLVA 2VT3A 1JDNA 3DHYA 1GHTA 1C7JA 5MGBA 1FSPA 5F5LA 4F4XA 4LVUA 1L7DA 1HDEA 4Y2PA 4L0DA 2VZLA 2G88A 1CY1A 2UXCB 1UFQA 5D1OA 3HCCA 2XD4A 3HOUG 1Z5ZA 3RKSA 1LNZA 2RHGB 2R6FA 1N5LA 3AR9A 1N0UA 4P2BA 2IXDA 3OLWA 4YXFA 2HHAA 4G97A 1K4MA 1KR5A 2DY0A 4TV9A 5TJHA 4IJ5A 3ZVRA 1YS6A 3SBXA 1U4SA 5HS6A 3ZY3A 2C92A 3L84A 2QAIA 1JSCA 2V03A 3T52A 4LF4H 5LOVA 4U8HA 1N8KA 1AGXA 1T29A 2A88A 5HQJA 5JZOA 1NMSA 2UU9B 2XMPA 1M7HA 4NOJA 1NMZA 5ED4A 4Q03A 1TVKB 5DYNA 1LVGA 1OT5A 5EZYB 5ADWA 3RGZA 4K9QA 2HQSA 3I6IA 2RIRA 2KSQA 4HD8A 3QRWA 221PA 2W9XA 1H6DA 1GLNA 3SN6A 4K1XA 4AZSA 4QGAA 2A9PA 1CDDA 4KRGA 4DR5B 4ZOQI 2ZSAA 2EX0A 3JYOA 2RGYA 2VVTA 3HHPA 4PZ7A 2ZRAA 4RSGA 1DFGA 4TWJA 5JQGF 1QC5A 3WMFA 4HFJA 1Q0UA 2VUGA 3PA6A 4DARA 1YR7A 5JD5A 4NPAA 5DNWA 1EA5A 4DV0H 2JHPA 3HA3A 1T3TA 2DTDA 4Y1EA 1GTRA 1CQXA 3H04A 2C5EA 1WWKA 1S3GA 4HXFB 4O5AA 3D64A 1GZ5A 1VHLA 4N0PA 2XQFA 3MT9A 4GNKA 2Y1WA 2COKA 3U1BA 4WY5A 1H4QA 3Q1KA 4DS3A 2NPFA 1RXYA 3DOJA 3L92A 4WX2B 1WG8A 3GFPA 4QAJA 3QHPA 4LXYA 3PEUA 2GK3A 3U56A 1K9VF 4OQDA 5J4VA 2XDWA 3BHJA 4Z3KA 1L7PA 3LOPA 2J7PA 3Q3CA 3EAQA 2DU8A 3SY8A 3WB0A 3DEZA 2RK3A 1OKKA 2ZJBA 3LPNA 3OIFA 2ZRDA 5CYFA 4MQ4A 1M33A 1L4YA 1U2TA 4BO9A 4PPFA 4UTRA 3H11B 2QPTA 4C4TA 1AH2A 1FTSA 3NTQA 2WJYA 3O1JC 1JS1X 1RAAA 4BLSA 2QTBA 3PSAA 2QVYX 4ZPJA 3RC7A 2JA5G 1H2BA 4LKRA 1Q3HA 2HMAA 4QPCA 4CI0B 3HJTA 2R7AA 5JTTA 2D2VA 1NZDA 4G0NA 1SNYA 3RAXA 4AJEA 1OWLA 1XE3A 4EJ0A 2VDKB 1FW8A 4TRMA 3TCKA 1M2VB 3TR0A 2VHEA 3ANLA 3KXYT 2A59A 4MR9A 4B7XA 4ZIRA 2Z09A 3TW8A 3KT3A 4HDKB 1SQGA 4WCFA 9LDTA 4AZVA 2W6ZA 2O7RA 2HWXA 1KC3A 4OXRA 3TW0A 5DH9A 5IF9A 4WVFA 4ETSA 1B23P 4JLUA 4TQSA 5H4HA 5JASA 2CMHA 3OLVA 2W8BA 1XPUA 1S01A 2PA0A 2Q0XA 1B42A 2XNDD 2Z1DA 3HP4A 5AKZA 1Y7TA 1XNQH 2NOAA 3G9QA 2F55A 1BDHA 1TO2E 3KLMX 3ZDBA 2P0AA 2R84A 2ZT6A 4IY1A 3VH4A 3B1WA 3PTZA 4K9LA 5AVRA 2D5BA 3DMTA 3D1VA 1Q16A 3LC2O 5HHTA 3E2PA 3MT8A 5KSOA 3L8GA 5KT3A 4WOJA 2VUTA 4JJEA 4B6QA 3AW8A 5E2AA 1PEYA 5KT2A 3LGXA 1V9PA 2WINI 1E5LA 1MAWA 3AOEA 3ZLBA 4BBJA 3H0GA 5A4DA 2L82A 2EW1A 3BE8A 1OF1A 2VDWA 2BONA 2ZZKA 4LJ8A 5D86A 3DAAA 1QOZA 2LIPA 1WMDA 1P4HA 3TSYA 1XELA 3ZIAD 1FFBA 2F1RA 3C4QA 4AKSA 2E2IA 2RGUA 4NCXA 4M7PA 2V3VA 3U7QA 3UWPA 2X5XA 1G18A 3QI2A 4PS0A 1H6AA 4DJAA 4ZDKA 4RNMA 3MR6A 4DR2B 3JXEA 2EQBA 2C2BA 2YC4C 2ZAGA 3NONA 1QGUA 4S3MA 2PUWA 4TXJA 1TEZA 4ZN6A 1EWVA 1SULA 2IRWA 2HLDD 2WI8A 1P9LA 3FFWA 4QUGA 1G8JA 1PL6A 4LBZA 3FYUC 1RRGA 1JU3A 1B2LA 4HRVA 5HK8A 3EK2A 4D4LA 1JEDA 1V7PC 4D8YA 1YIOA 3FN4A 1Y82A 3UW3A 1E3DA 4QRHA 2GBCA 4QDXA 5KSWB 4G0YA 3NHKA 1DO8A 3EGOA 2XTJA 2R6R1 3K5IA 4JP8A 2CUTA 2FWBA 3THOA 1PWHA 4MH0R 1IYZA 4L0QA 1SM4A 2V54A 4RH1A 3PCTA 1SCNE 2AG8A 1KJZA 4AL4A 3W5VA 4P7JA 2IOFK 3WKEA 3CE9A 1C9EA 5H3HA 5IJ0A 5F21A 3G7UA 1Z5OA 2LW7A 2LV8A 3FOBA 2XE6A 4PZYA 5BNIA 5C34B 3JVEA 3KQSA 2H52A 3BL8A 2Z1NA 4JYBA 4K3VA 4BB5A 4BNUA 1DWOA 5DG7A 3N0XA 4UTNA 3SK0A 4W8HA 3PGKA 4WZBA 2YVKA 4MWTA 3LGAA 1IUNA 4ZMSA 3B3GA 5ITWA 1KDRA 3ANXA 2B92A 1S2LA 1Q50A 1CY8A 3AU8A 2A9FA 1U2DA 5D01A 2GO7A 2WKWA 1QYIA 4Q9DA 1N36B 3OM9A 3VTAA 4EGJA 4I6GA 1ODSA 3L6BA 2GH1A 4K6CA 4C7KA 3NZEA 1IN6A 5E1OA 1HFKA 2XOKD 3E9QA 2P67A 2NSLA 2GM3A 2A92A 2WWRA 4Y2HA 3WBBA 1UMKA 4XEHA 4G3IA 4XJXA 1RTKA 3Q8KA 1I6LA 3NALA 5I5UA 4BNGA 4P9NA 2PTHA 5CFNA 1SEVA 3VC7A 2O0MA 5KQGA 2P8JA 2NUPB 2I6FA 1EK0A 4FWBA 1ADBA 4TWBA 3WK5A 1WSBA 2GPSA 3TI7A 3DDZX 4WERA 2F9FA 2EJUA 3MTAA 3A32A 4FX5A 5BT8A 2H0QA 5A02A 3OVMA 2VH2A 2BTOA 5D87A 3DO8A 5KJFA 3RUCA 4X64B 3WGVA 4RXTA 4J0DA 2O3TA 2V6JA 3LM8A 2FSVA 2BMJA 4P2GA 3ZD7A 3EG5A 4X95A 1T24A 1T9DA 1XL0A 5DV9A 4RCNA 4G36A 3D8HA 3G02A 1SG6A 2BJVA 3FMGA 2AMYA 2MINB 3DH0A 3LAWA 2KQUA 3OTWA 3HGQA 2NO5A 2ALZA 5KT5A 3ASUA 3HY6A 4O4IA 2BJHA 3OQPA 1TA8A 3M9NB 3DMNA 4OHKA 4ECZA 2WU3A 3D6MA 3KQQA 2W7PA 1NT2A 5LOVF 2H29A 1ORWA 3TRHA 1A9PA 1RMYA 5A5DA 1ESCA 1RWVA 4P7KA 1TOAA 1KYXA 4IUYA 5D3QA 1ZKMA 3X1WA 1YJCA 2RJ3A 1JHQA 1CEEA 4QFDA 3G5AA 4BXOA 2PKXA 1IBLB 1R0XA 2FN9A 3ZCSA 1O9HA 3Q9SA 2AGOA 1L4HA 2R86A 5B3JA 2G04A 3LPDA 3PVZA 2BBTA 2IEAA 4ZI7A 1QIKA 3L0PA 3I09A 3NBQA 3MWEB 4J8PA 3G6WA 4HR7A 4I5FA 2IUEA 3MCAA 1HH4A 3TB6A 4DHWA 2OBLA 3A4NA 5AI5A 1NULA 1PUJA 3KJIA 4LRUA 3WYEA 2JA7A 2I91A 4O4JF 3I34X 3SICE 3LCVB 4NOMA 1LBIA 3GCZA 4Y9SA 1KETA 2R751 5EWEA 2MHCA 4YP6A 4YBZB 1G3UA 2YWHA 3AFIA 3D4OA 1H23A 3V3TA 2RHBA 1W9MA 1G3IA 1QLJA 2BOVA 2ILTA 2NU8B 5FR1A 2EKPA 2BUAA 5KYWA 3DKPA 2GEFA 1ZINA 2IU0A 3LL4A 2B2CA 2B98A 2VQEH 4C6RA 4TVKA 3G8BA 3L79A 3C6ZA 4NOKA 2XNDA 1NR7A 3HXMA 2OAP1 3RAPR 3UB3A 4IV8A 3RVKA 3E7XA 2YH2A 1VPTA 3IBTA 4YMWA 4I1OA 3EVNA 1SVKA 5IKPA 2RGNA 1R7RA 4AZTA 3JAMA 5DWQA 3A9VA 3WIOA 4KU4A 3ZUPA 4A03A 2NVBA 3KZXA 2EJVA 4UQOA 4F4HA 1IOWA 1NI4B 4DLYA 1V5IA 3V48A 5A06A 4J91A 3X2FA 5IH7A 1NNEA 1IOLA 3H1GA 5FTLA 4FS1A 2GDJA 2QMZA 1WD5A 3GO4A 3ESYA 3RSFA 4PPGA 4KGXA 2XXAB 1IB6A 2C5AA 3AH8A 4PZZA 5AJWA 1EFDN 3ZIAA 1Q6ZA 3H8SA 4QREA 4BMZA 5IM5A 4FYYA 2YC2C 5HK9A 3OMWA 4FJ1A 5BOSA 4WXHA 4AK9A 4ENWA 4GH5A 3WQBA 3ZEAA 4TYNA 3TOCA 2PH1A 1TWFA 4D8TA 2PS9A 3LRTA 3DMGA 3UANA 1E4EA 3T4XA 2HLDA 1XT6A 4XFDA 4IIUA 5HMMA 2CLIB 3FDSA 4LTNA 2FSGA 2ZI9A 2VJMB 8ABPA 1CR2A 2PRZA 5TQ0B 3S29A 2X2FA 2EZ8A 5LB2A 1WO8A 3RIXA 2F43B 4DLWA 3U1TA 1VMKA 3I4FA 3QYAA 2A1TS 2Z2IA 2UVRA 2UZ0A 1OBCA 3RVLA 3N6RA 3DTYA 2RARA 4W8GA 4RJIA 4C7OA 4WZZA 5A3VA 4YJ2B 3BKWA 3DGEC 1WEHA 5FO0A 4RH0A 3RE1A 3E7WA 2QAJA 3SI7A 3DXZA 3BCRA 2P9BA 2ZBQA 2HJWA 1V1MB 1SKYE 5D6NA 3AV0B 5AOVA 3U81A 2M6LA 4RKWA 3IE2A 2GZHA 3TO5A 3VO2A 5I5XA 1H5UA 1VKZA 3LLSA 4HNSA 3LH5A 1C9DB 2NWQA 5ERXA 1WY7A 3IPRA 2YCBA 3LKZA 3HCFA 2OHFA 3DVSX 3V33A 4ZOLF 2G0AA 4I55A 4NEQA 1BCRB 1W35A 2JKVA 4BC0A 2CDNA 4TX1A 4MUKA 5JPDA 2WJWA 5FV7A 1PGNA 1RC1A 2XOKA 3NBMA 3TLYA 3GYBA 3TUZC 1HDXA 4DL9A 2KB0A 1JAIA 1QV7A 4FYWA 5CJPA 2GNOA 3V1UA 1L8LA 2I2CA 1KSHA 1HY3A 3RR2A 2BT4A 3V4SA 3OX1A 4MEBA 4KR0A 2AJTA 3FOZA 3H19A 2ZYDA 3NJRA 1JHUA 2ZCJA 2XTZA 3T1NA 1M6NA 4A9AA 2QLFA 5EJEA 1CEXA 3UJAA 4FZJA 1Z3CA 3ZWWA 1NUSA 3UMBA 1OZFA 2QZSA 4BQEA 3R74A 1JDVA 4HLDA 5TPWA 1JSZA 3DEAA 1UDBA 4WLUA 3LD9A 4G67A 1KUTA 4IZ6A 1MF7A 3HXKA 3ZD9A 2GGSA 3R5FA 4CMKA 2QRVA 3BSYA 2PU7A 2I1WA 2VEDA 2XXBA 4EPRA 3W7BA 4M8LA 3H1PA 5H83A 1K9SA 2XUFA 2D3TA 4H0CA 2BBSA 3BXGA 2GPAA 3ADDA 1OHHD 1UL1X 3DFFA 5FNVA 1GSOA 2HHFA 3Q0EA 3GJ0A 2ZI3A 2H9YA 4JOQA 2LBPA 5AOAA 1MQSA 5CBPB 3H2BA 1GGJA 1ZSNA 1W48A 3KZCA 4D9CA 2WE7A 1NUQA 1TM3E 1G21B 1JVSA 2CL5A 2J67A 2H1CA 4HSEA 3DR3A 5GONA 1E2BA 2YJ6A 3KEMA 2G7MC 2PLWA 1H4VB 2EFEB 3QELB 1CUWA 1JXQA 5J58A 4Y1RB 1B74A 4CGYA 2HYIC 1HDRA 1KHHA 1KIFA 2QLNA 3S1AB 2YW2A 3LP8A 1T5DX 1CKMA 3ZTWA 4ZQBA 1B04A 2GHTA 4E03A 3HCPA 2FPGB 2JEJA 2AF4C 3ONWA 1KO8A 3TDMA 1KY4A 1O0SA 2XMBA 3V3KA 5JALA 1GAWA 2AWNA 1JLLA 1ZSVA 2G8NA 4MWOA 1OTYA 1C0PA 3NNSA 1RYYA 4FZRA 5ALIA 3ZW8A 3DD5A 1FS6A 3AEZA 3KKOA 2PUVA 4JI8H 1UFOA 4NZZA 4DUGD 5DE3A 5IYZA 3KZMA 3TLGA 1TF2A 4Z0TA 4D9MA 3U54A 4X85A 1AZTA 3RTBA 4G65A 2P2NA 3RYHB 1UANA 1A9YA 2BGIA 4NFSA 3JWPA 2JJ1D 4YNBA 4DL5A 4ZGBA 2PM8A 2D5AA 2PZEA 3E6AA 3GA7A 1V3VA 2FUEA 2D6FA 4DANA 1UDRA 1MRNA 2E87A 2WUFA 2Q5EA 3GH3A 3RU3A 3PA8A 3DFZA 2PVSA 3RLFA 1DIBA 3FPFA 1WPRA 1E59A 4LJKA 3CTMA 5EE5B 3HOVG 4F9EA 1PD1A 3IDAA 2VUMA 1Q0SA 4H35A 1P7ZA 4YRIA 1C3OA 5FWYA 1B3RA 4EG7A 2F48A 2GVDC 1DJQA 5ALRA 3MPOA 5CPBA 5M34A 2WIGA 2QG9A 4GVXA 4UZEA 3G1TA 3T3DA 2Q7XA 2EKZA 1OFUA 5ICCA 5IJWA 4D82A 3KVRA 2IPNA 4G4GA 3KLNA 3USES 3N2GB 2ZYGA 3TRFA 4B3CA 3BMQB 3WKDA 1CR0A 2G28A 2Z08A 2GD2A 1I9CA 4KLCA 4PYMA 3AVTA 1QCDA 4ZOCA 1GG2A 3OTOH 5EI5A 3ADPA 3Q72A 1CV2A 4ZVMA 4QM7A 5LQJA 1FRFS 2FZLA 4Q48A 4BNIA 2J5BA 5KG6A 2Q45A 1QYCA 1CZLA 2XRYA 3LVBA 1EUCB 3VBEA 3EVZA 1TKBA 2I7XA 3TVYA 4LJ4A 5EP2A 4NYJR 2J9YB 4MQ5A 1B16A 2I4RA 3H5IA 2Y0EA 4BZWA 1Y8AA 3LPLA 2D1QA 3T5AA 1QO9A 1Z4IA 1OB5A 1J49A 3ICOA 2O8FB 4E13A 2Q49A 4BKRA 4IL5A 2K7ZA 2WSLA 4ZRNA 2ORIA 4KGDA 2C31A 1J1ZA 4UCOA 4A36A 1G42A 2RAVA 5DBEX 3PHGA 2M05A 1EBUA 3L8DA 3JYHA 3KALA 3N53A 4LMPA 3PWTA 2P8SA 2X0JA 5DLQC 2D62A 3PQ7A 4XM1A 1RWNA 1TYBE 3IX7A 1UXOA 2HIGA 5ECWA 4KIWA 3BA9A 3W5DA 3VNRA 1TPYA 4HEQA 4QA9A 3HA5A 2VA9A 4PQEA 5JH7F 4XYEA 4J1QA 4A8TA 3W8RA 3CIFA 2P6NA 2M6RA 3CZQA 3BQ2A 1AKVA 2IS6A 1E1KA 2J08A 4KIGA 4RVNA 2Q99A 5ECGC 1YB6A 2FU5C 3CR7A 3HSKA 3GEEA 3ZS9A 1XI2A 1WRBA 5IUNC 2JLQA 1F4VA 1W6RA 4L5AA 3V1KA 2NU6B 3URMA 3WL8A 4XVRA 1SC3A 3A6KA 3OE1A 1QG4A 1YI1A 5C7LO 1Y1LA 2IODA 3A04A 2FPIA 4LOIA 2AG5A 4HYTA 3WOVA 3KTAA 3MCUA 5AM1A 1QYRA 5K99A 2NVUB 4RKEA 5ILOA 1JFSA 2C59A 4OSPA 4BO8A 2ZETA 2J5XA 4L75A 1TGYA 5SY6A 4UBJA 2YFYA 1AB6A 3JQ8A 2PMCA 2G9VA 4DGQA 4EFEA 5EWGA 1FFWA 4CDRA 5L6MB 1EKPA 2BGKA 3RTCA 1DAEA 1T2NA 3THWB 3SNKA 5GTDA 1KF0A 4HMOA 1C1DA 5B7QA 5ILQA 3LQRA 2JJ2D 1NMQA 3DL0A 4CF6A 3CR3C 2ZBFA 2CXPA 3BMCA 4NYIQ 5C1PA 2DLDA 5K3CA 1OLUB 3TG2A 2J7KA 4QG7A 3FPGA 3KZ1E 1QANA 3BRWD 3OZXA 4BX8A 2NO9A 1XZAA 1AG9A 4MMYB 4IHJB 2C98A 1NYLA 2ZSFA 4IQFA 1X70A 3K1TA 2JEYA 3PQFA 3VNUA 1I7LA 4PZCA 5CLGA 1SOMA 1AF4A 3QVUA 4UCRA 5AVXA 4BNNA 2C4TA 5LQCA 1R4MB 4BNDB 2UVUA 1HNZH 4LXXA 2VSXA 4MV0A 3ZPXA 2JFUA 1OHHA 1D6NA 3IB3A 4RFLA 2VC2B 3WL4A 2HIAA 1NKSA 2CBGA 4JDPA 4WN9B 4KO3S 2AE1A 3WWDA 2AOTB 4LRQA 2XI4A 2BHTA 3T9EA 4MHTA 4ZVPA 4DJTA 4B3HA 1JB1A 4EFDA 1JLKA 1FLNA 2AXQA 2PZGA 5ECDA 1NLMA 2X0NA 3IFSA 2JD0A 1UQTA 1H2WA 3U7IA 3CTPA 5THKA 5GV8A 2UXBB 3R8FA 1DO2A 1XCGB 1LPBB 4R51A 4B4OA 3QVVA 5E4TA 1DIGA 3TKYA 4L15A 1LSUA 3A05A 4RY0A 3DOOA 1QXSA 1NBME 2C42A 3GNSA 1I2AA 4BFCA 4MZDA 3TNYA 1Y37A 4I4CA 4M2LA 2ZQYA 4AX4A 1LGYA 2C88A 5C51B 5TX7A 4EMBA 4BRSA 4R81A 2E4ZA 3JTEA 3F3KA 5HIAA 1SVWA 4QGFA 4L3OA 4DUGA 5SV2A 2XEXA 1JDTA 2X8WA 4UJ5A 5IAAA 1XROA 5KOYA 1N56A 3AIIA 5CRIA 4EKEA 1JHDA 5CTAA 1P2GA 4D80A 1EGMB 5KWVA 4KYTA 1Y6GA 1MH9A 4X9XA 1BDMA 4D3YA 2JJ1A 1I3LA 1P8AA 1B41A 1XYYA 1HZZC 4EKDA 3AM3A 4RKRA 4V0MA 3DKVA 2IXEA 5LYJA 3QXSA 2VPZA 4A3FG 3PQ6A 5DI3A 4R83A 5JVDB 4GMHA 4XVCA 3PE3A 4RU9A 2J6SA 3A1WA 4RF5A 3TSWA 1MX3A 5C1DA 4IFIA 2INGX 2VYCA 3H2ZA 4RJKA 4KMSA 1HTBA 4A93G 1E5QA 1Q21A 2QUBA 5IF3A 4RLHA 4LYHA 1HLPA 4MEJA 2O5CA 3M83A 4RD6A 1WF6A 3RU7A 4B2YA 3O4HA 4ALMA 3OKPA 2OVBA 1TTPB 4URWR 5JTUA 4RB1A 1N32H 4UU7A 2FH5B 4DMKA 1P0CA 3RASA 1OXBB 3GGCA 1E7RA 4OKIA 1E8NA 2WWWA 1Y0BA 4R5MA 4Y2TA 4KXMA 1DQSA 4Q3KA 1C4WA 4KR3A 1TJ3A 1Z16A 2GPBA 5L9AA 4C0SA 4NZYA 3DE7X 1RI1A 3CSWA 4JITA 4JLSA 4RGQA 2I8LA 2IU6A 1A0GA 3DOUA 3SJBA 4BWYA 1LDYA 2QAGA 2BR5A 3MN1A 3IVMA 1S02A 3LY8A 3DBHB 3PEVA 4BO0A 4QOHA 3NM4A 1S68A 3DTVB 1M72A 3FOWA 4EMUA 4Y6RA 1XD2B 3C5EA 2YMMA 5JAZA 2POQX 3N07A 1AS3A 1M8FA 1T1GA 5AJVB 1J9ZA 2XE8A 2FJPA 2IHJA 1PJ4A 4J0EA 1T8UA 3LL7A 4MSUA 1SEPA 2VQ6A 4LXIA 4AUKA 1E3WA 1F3OA 1DC8A 1PX0A 5K3WA 1YGYA 4BVAA 2DCMA 5IX8A 4LV8B 4YT5A 1GP2A 4U63A 1YS9A 5FOSA 2W8KA 5BORA 3FLEA 1YQ9A 2JIMA 2WHQA 3AWDA 4X97A 5AOCA 2I78A 4OQPA 3FVQA 2N1BA 1BE1A 4YAKA 4M1QA 1N2ZA 3CNOA 2IU4A 2XTAA 4LMYA 1HWYA 3L0ZA 2AN9A 4ZHSA 1MW9X 1E9CA 5DRTA 4ZYTA 2ZIGA 3NOQA 4NDZA 4XUDA 4BYGA 1MTOA 1USIA 2X8JA 2FYTA 3DAOA 3CZCA 4X3OA 3F7TA 4KJXA 3NHWA 1NBAA 4Y0NA 4PY2A 4G26A 4HGZA 3CCBA 4CCYA 3IT3A 2WRZA 4JC0A 5I60A 4U2KA 3QFFA 1L4MA 4DMRA 1RQLA 4MUGA 2WUEA 5EJAA 3WLLA 3ESRA 4P0TA 4YY3H 4XYGA 4ZKDA 1W46A 4OQFA 4Z5XA 2ISCA 1P0PA 1A9ZA 2F9MA 4O8CA 4YPVA 4YRAA 2FMAA 2DPJA 2GOYA 2C5FA 4EW3A 1ONOA 4GKKB 3AHJA 4A92A 4R8LA 4EW1A 1DAAA 1IQUA 4M0JA 3TSAA 2WD7A 5DEOA 1FEZA 4HWKA 3A11A 5IWAH 1ET0A 3V6MA 4MIKA 2JA6G 1BHQ1 5BR8B 1PV2A 4P3OA 3UGJA 1KAGA 5T8KC 4YDRA 2VQFH 1LDMA 4YAFA 1UXKA 2A5DA 3U0GA 4JELA 3KO8A 2FW7A 4CGZA 1RAFA 3EMVA 2FK8A 1K3UB 2JGKA 4Z4FA 3K09C 1RKVA 3Q10A 2ACEA 1VCIA 4YV1A 1CULC 1C1XB 5M7EA 2JJ2A 3IV7A 3N39C 2PUGA 2A14A 1QGAA 2ZI7A 3LUHA 1OWMA 3CQZA 3TMYA 1PQWA 4EA8A 3V4OA 3BRWA 4IVQA 4YBRA 4BECA 1ENOA 2VTBA 1C9YA 1FSSA 4NCNA 1VBFA 3K5PA 4UVEA 4OCZA 2Q4EA 5CDUA 4D9EA 4M88A 1E3LA 4DQUA 4YRMA 4BO2A 2PSEA 2P90A 1TUIA 3C8MA 3IRUA 1IYEA 5ALOA 3KOYA 3KS9A 2FPMA 2ZRHA 1KI6B 1WMFA 2J7PD 4M7WA 4DV5H 4JV0A 4YFYA 1SCUB 1DXQA 3ICWA 2QZPA 3FFAA 1DKQA 3FNGA 3K1AA 4GOJA 3UMRA 2GEVA 3DFKA 5BMOA 3OEYA 4J07A 3SZGA 2C0CA 4P82A 5BUQA 3KNZA 1DG1G 2FOIA 1NUHA 4ASUD 4QO7A 2P69A 3S8MA 3W2FA 4ZQHA 4B81A 2DPIA 3MGKA 3HYSA 3CF0A 1QCZA 1VLZA 3L9WA 4II7A 3E9DA 2Q5JA 1GCOA 1XZ8A 4XA8A 1HE3A 1HE2A 3MLBA 1C0KA 3LWZA 3HL4A 5AXCA 1RBQA 2UYYA 1YS7A 3OF3A 3CRVA 4D4GA 4MEAA 1RBZA 4TYPA 3HDHA 4DDMA 4Z7JA 1UMDA 4Y2XA 3KE9A 1CY7A 4K2HA 4YJ3F 2IYOA 5FPPA 4LY6A 3OWHA 3FM9A 4BMYA 2O50A 3MSCA 1VLHA 3BWCA 5B6IA 3O84A 4GC7A 1QGYA 2X4IA 3V7YA 1VGQA 1JT2A 4IRDA 3E58A 4MAAA 4KTVE 1TTHA 2WZCA 2ZRJA 3LBAA 3P2YA 5B3KA 4CODB 3KREA 5IP9G 2FX2A 5BQ3A 5IBCA 5C31A 1P2BA 3CUWA 5JY1A 5DO9A 1KWKA 3QXCA 3C45A 4KFCA 2GCEA 1U5BA 5I5EA 2J9RA 3C39A 2TMGA 3S68A 4S04A 4A16A 3GFQA 3DOFA 5J9FA 1P7PA 4BO7A 1TLFA 4GXNA 2NUAA 1OV4A 4BAZA 3LHFA 3S7ZA 3PHCA 1WJGA 4H7FA 2ATVA 3FSJX 3K73O 4ZO7A 4D42A 1VXOA 3N2YA 1Z22A 5ALGA 3P9IA 2A4KA 1IN1A 5JATA 1B6SA 2QX4A 2HSZA 4QWBA 4L95C 4QXOA 1X80A 1QQTA 4BVBA 4D4IA 5JAOA 3QBTA 1GZSA 3H13A 3VR1A 3R0IA 1X7WA 4LCEA 5TF0A 3JWIA 3GGOA 2JJYA 4KQWA 3LXRA 1R50A 2G70A 1Z35A 1UP4A 2H5JA 3QOYA 4JT8A 3F1KA 5DHRA 1H1LB 5JWRA 4A2WA 2NQ2C 4U6QA 1AKQA 4A3MG 1IOVA 2NIPA 4MVJP 4WV3A 3FAKA 4GSKA 3R0VA 1O0CA 4D41A 1SR8A 4Q4CA 1NVMB 4YP5A 3NV7A 1I94H 4H3SA 4CMJA 2IMWP 4C0LA 3HVRA 3HUUA 4QWWA 5KG0A 5JS6A 3EVTA 3RUFA 2LGJA 4Z0HO 4I3HA 3EG9B 4JYAH 3VMMA 4G8JA 1LC3A 4TTSA 1JBQA 3FKIG 1AQYA 4YT8A 2J87A 2CW5A 4Q16A 1NVTA 2FPKA 1QVWA 4O1IA 3CW2A 3S7TA 2R7ZA 1OUMA 1W52X 3WWEA 4Q4HB 3RNLA 5I3ZA 4DT1A 4YPOA 2WV9A 3AR2A 5JADA 3WWJA 3HKEA 1F17A 3Q98A 3K3VA 2ODAA 1RYSA 3I9JA 3DE5X 4NFHA 4LH7A 1T0IA 4FYHA 1YQQA 3U16A 1F2UA 1SHKA 5JXGA 3ITDA 2RFLA 2JLCA 1R6BX 2J0EA 2ZSBA 3ND7A 3TGPA 4PHTA 3IL2A 3Q9NA 4OFZA 2C2EA 4OOEA 4BRUA 2JEZA 3JV7A 4P92A 4DJDC 3WC4A 2GS9A 1NC1A 5TGDA 5A9TA 2JIOA 4FONA 2HDHA 3DULA 4BBRG 4FBMA 3HKCB 4C3VA 3H75A 2KS6A 4G0VA 3NHYA 4TMWA 4HVAA 4JLOA 4YV2A 5CUQA 5H70A 2XCOA 3QF4B 3MWYW 3L6DA 4FHFA 2PBRA 4P84A 1R3DA 3PR3A 3H2JA 5BNZA 1CZNA 1SCQA 1IQPA 3TIFA 4EYIB 1KS9A 2P9JA 3A0RB 3HR8A 4I46A 1FMCA 4HUTA 3K4QA 2L2QA 1E58A 4B1FA 5DQIA 4YCCA 2R8PA 3JR3A 3BPSA 4LSXA 4UOQA 2WM9B 3O31A 4FT2A 1R9JA 3Q6MA 3UJPA 2YZMA 1CIVA 4HRXA 4XWGA 4Z54A 2QR5A 4CU5A 3AL0C 1KH1A 3QA3E 3FZNA 4DEXA 3A1CA 2IZ5A 2QZ9A 4DLBA 4YRLA 4TSRA 1LRLA 5CA1B 1OFTA 4IMJB 4M54A 3U09A 3REQB 3H4IA 3BAZA 4FFOA 3FBWA 1SRQA 2A7XA 4O4JA 2IY7A 3I5MA 5KNCD 4MV3A 1K6XA 1PJZA 3BD8A 3SZUA 4LRSB 1MO3A 5HSGA 1IM5A 1LB1B 1EEXB 4LQDA 4MITA 3RIYA 2KI5A 3KJZA 2DWQA 5C8YB 2Q6KA 1CJSA 4RK0A 1BS2A 4QAQA 1AHIA 4LC9A 1XMJA 3DG9A 3I8OA 1UKZA 3K0FA 4KPUA 4HV4A 4IKPA 4EKIA 4CNBA 5L4SA 4AQDA 1ZHSA 4CEJB 1WR8A 3T61A 1G2IA 3AB8A 5CDYA 3BWXA 1PTKA 2HHHB 4F5EA 1DBIA 1O94D 1KQGA 1ZJYA 5J1SB 4WI1A 2JLAA 5TS3A 1ZH2A 1Z6XA 3A10A 3RHFA 2P79A 4MARA 1G4UR 5TIIA 4R8MA 3GUVA 1ZD2P 4ASUA 2WB1E 4LDNA 13PKA 4CR8A 4BP9A 4FQ7A 3OTHA 4AS2A 3O26A 4RIGA 1QX4A 4CETA 1GGVA 2PT9A 2QR3A 3ZU2A 2VR1A 2R1TA 5LMUB 5EMLA 3GLIA 4WGGA 1NJFA 2ORWA 2HT6A 1UJNA 2XPCA 2BI7A 3JYPA 3FHCB 4EW2A 4OQYA 4GIBA 5IBRA 3KKMA 2W0MA 4X1OA 2LTAA 2K7FA 4RVFA 3B1ZA 3DGFC 2BSQA 4V2UA 3RB4A 1C4OA 1RJQA 3L7JA 2A6PA 1T4CA 2CFRA 4XUEA 5L3ZA 3K96A 1QPGA 4N6OA 4H4DA 4NE9A 5CD9A 5BSKA 1UBUS 4Y6LA 1XLTC 4AMYA 2IIVA 3OJEA 5JISA 3D7KA 1UBGA 1PJLA 1UDXA 2ZB4A 2VH1A 3HB7A 5LSAA 2JVJA 1MVOA 3NT2A 4X41A 2AEEA 3UIEA 2DKFA 2X5RA 1D4OA 2ZUTA 3HNOA 1XKLA 3N2ZB 4JI4H 3WGKA 1JEAA 2R92A 2M1XA 3UZBA 4UE6A 2IH4A 2GCNA 1O95C 2AFHA 1TT5A 2FF7A 2Z2YA 3SQMA 2I87A 4U2GA 5F4ZA 5K6AC 4J6FA 2XNSA 1S3IA 1LS1A 1XV5A 3NPAA 3RD5A 5IANA 1TQHA 3IBSA 2Q9CA 2HPHA 3AXTA 4V03A 3B8HA 2G5TA 3Q1LA 2QI9C 3DC2A 3W2HA 1JQAA 1LNSA 1NZJA 4NY1A 2PH5A 3BB1A 2WAMA 2HSGA 4RIEA 2HNAA 2OLEA 2CDRA 3BHMA 4HEA6 5AJZA 5E1BA 3QU4A 4JJFA 4JXKA 1FVOA 821PA 3O2JA 2PUFA 3WB9A 2OV6A 4GEGA 1WD7A 4OQLA 9GPBA 5DCUA 3PL1A 4ZOLA 1EUYA 3UOWA 2ZYAA 3W9SA 3RKUA 5KEIA 1SUBA 1YFJA 2FMTA 1I36A 4MGYR 2J0VA 1K3TA 3NBUA 1XN4A 4GPZA 2RF4A 3DQQA 1Z7YA 3ZHVA 4NDNE 4TKVB 3KEOA 1CCWA 1J42A 5B57C 3WMGA 4IINA 5IZCC 5K8LA 5JDIA 4K3UA 3R2JA 2Q6IA 2CXRA 3GJRA 1BKYA 4GBED 1U2PA 3L1VA 1W5BA 1MJHA 4CMIA 1UUFA 4YUXA 1KOFA 5BMVF 1NSYA 1OH5A 4RMGA 2XR1A 4AZ0A 4YR0A 3PCXA 2UZ1B 1OFIA 1BVRA 2GLXA 2XT9A 3SQNA 4XX0A 2XGPA 3NUGA 3E7PA 1U6IA 4O7SA 3HY4A 4P35A 4LPSA 2RAPA 3HB4X 2AN5A 2AJLI 1OJLA 2PUEA 5K6TA 1FVHA 1EAYA 3I9OA 1DQNA 3GIMA 3G1UA 1W59A 2G82A 2ZW9A 1WNFA 1GILA 3PD1A 3QLEA 1W9HA 4C07A 5FIUA 1KZ6A 2R6GA 1I3KA 5JBNA 3NHZA 1TD9A 3U6BA 2ECQA 4ZU6X 3UJNA 5IAEA 2DR0A 4FB4A 1E9DA 1P5FA 4J2TA 1CP3A 1JIJA 1WB4A 4R16A 3IEMA 2YXEA 3SDBA 4RBNA 3JPYA 5FPYA 4WJLA 3DO5A 2BUBA 1NN5A 4CQMD 1NBHA 3GHYA 1KJ8A 3PGJA 5U4XA 3GLFB 5A4JA 2XADA 3H42B 1C8VB 3IG0A 2YS6A 4JUFA 4U6PA 1VSVA 3I6BA 1E18A 3I83A 2J59A 3NTRA 4B09A 4B46A 4C5AA 2HBQA 4BN0A 4ZCIA 3DBLA 3PNMA 3IVCA 4JI1B 2AS0A 3H9EO 2Q5LA 1G0NA 2GM9A 2Y1XA 2PFKA 2W8LA 2R1ZA 1G4AE 4PCLA 1R5OA 1M5RA 2RHTA 5LP1A 2KE5A 1N33H 2WHYA 1R15A 1OIXA 5B2FA 1E98A 1UXIA 3ZDRA 3IURA 2WD8A 2RGWA 3GT4A 1A27A 4MUEA 1F8UA 1OJ7A 5KNCA 4KC0A 1Z2OX 3MJSA 1G19A 1SQFA 3GA5A 4EFKA 2V97A 3BGOS 3VHQA 4WRRA 3VU0A 2NZ8A 2PDAA 1FFDA 1ISHA 3JD4A 5FR9A 1MRZA 5F9NA 3REGA 3W2EA 1CTQA 3N7UA 3NORA 1EVZA 3U6KA 2HQBA 2PK3A 4BKQA 2VAMA 4WFIA 3PXAA 3T35A 3NEPX 1WA5A 4FDMA 4ECTA 2HMSA 2AJ8A 1GO3E 5CEEA 1O9BA 3FZEA 2CK3D 1O94A 2JBAB 1ZRNA 3SC3A 1A9TA 5K8IA 2XGQA 1LVUA 4XR9A 5U9CA 2VJLA 3VO8A 4D4JA 4DC1A 1XWIA 2X14A 3WLRA 4RA9A 4CV2A 3WWIA 1CP2A 2VUSA 2F4NA 4YECA 2QN9A 5CXQA 3UAGA 2GXQA 2XIGA 4XYLB 3RVSA 4M0DA 3ROXA 2GK4A 4CG3A 1AK9A 6Q21A 5NLLA 3G0DA 4MLCA 1THTA 2PD3A 2OQVA 3K4HA 4P36A 4ROTA 3SR0A 3C43A 4L50A 1AQUA 2PZAA 4QDKA 2XTMA 3OI7A 2ZCUA 5LZ2A 2OXFA 1GEEA 5BYKA 2A0YA 2W2NA 2VUUA 3LQYA 2LDXA 2WK1A 7MHTA 5F5NA 1XEXB 4AJ9A 1X94A 4BL5A 2PX4A 4WTOA 4PSKA 1VLMA 4D9KA 3GLUA 3E0QA 3JATB 3CRW1 1U0GA 1JJAA 2E9SA 1U4OA 2O2XA 2J3MA 1P6UA 2QT0A 1T4MA 3PBKA 4ZPXA 4Z1OA 4AY4A 5IEBA 1RQNA 3H18A 2ZU0C 4IIDA 4INZA 1TD1A 1E0KA 3FE2A 1GWNA 1K06A 5CT6A 3T1QA 1URPA 4RMHA 4KPFC 3RK1A 3IIMA 2GQSA 2HB6A 3OOEA 2F00A 4HGQA 2O1SA 1UF9A 1UC5B 3O8OB 5FPSA 5CK4A 4G4JA 3LRXA 2ZJ8A 5A4IS 4IFBA 4IHKA 3X1JA 3BIFA 4N6NA 3LI2A 1UBEA 4UXIA 2VP2A 4UMVA 3BREA 1JHAA 3Q9LA 3EY9A 3UT6A 1N2CA 1YZTA 4PGMA 4IDAA 5TQ2B 5JH7A 1VMIA 3DB2A 1YDFA 3WLHA 2CHGA 2WSSD 3QXJA 3FPHA 4DMMA 1AQNA 4QXQA 4NH4A 2GPJA 1XTSA 2VXYA 1HDOA 5B36A 3IPCA 5KVVA 5A0FA 1HYGA 4QX6A 4DJ5X 2P75A 2F67A 2IHZA 3VFDA 2EERA 2R93A 4LOLA 1MIHA 3U3DA 1ZJ6A 4RVDA 4IQ0A 3OD5A 1Y1QA 4HATA 1Z6PA 2MMGA 5KYXA 3S44A 5KT4A 4IS2A 4JC8A 2AL7A 3BFKA 2GK6A 1QUEA 1ZA2A 3R7WA 4UVIA 1DC4A 2PL3A 4ZZIA 1K63A 1R0KA 4WJZA 4JI3H 4WZAA 2AXPA 4D25A 4G5SA 2ZT8A 1MQAA 4ANFA 2C7QA 3P9CA 2GYUA 3R9WA 1XNJA 2EWMA 1IEWA 1L3IA 1MHTA 2HMWA 1CQJA 3B9RA 1D8AA 3NP9A 3CEJA 1Q19A 2B2XA 3EGEA 2HGWA 3FTDA 3KKNA 3V7UA 1Y5IA 1X0XA 4I1UA 5CVTA 3VMFA 1ZW6A 2QYTA 4IGIA 4DSNA 4K5QA 4D02A 2DF8A 4GLJA 2HU7A 4OEHA 3E9ZA 3PQ8A 2A9RA 1EXMA 1JSXA 5ABPA 1JTVA 2PEZA 4Y7CA 2V7VA 1YZGA 1D2GA 2CNOA 4FMDB 2C5BA 1DEAA 4GI3A 3NPMA 4AXBA 2UV8A 2I6UA 3YASA 1GTSA 1EUDA 2IHTA 3OZGA 3MTIA 1JG6A 4DV6H 4XVUA 1RP7A 3I6MA 2HA2A 1D5WA 1IPEA 1VBMA 1A97A 1OMOA 1XZLA 3AERA 3MRSA 4OQEA 3KYCA 1EIWA 3GFSA 2HMYB 1SVLA 2DUMA 5JSZA 5KNDD 1BVUA 5A6VA 2IE8A 1PYGA 3PLNA 8LDHA 1VL5A 3QZUA 4FGSA 3P9KA 1Z26A 5L9XA 5CVDA 3LUAA 3EPJA 4NBUA 3JZAA 2HGSA 3HVHA 4AS1A 2B3TA 4CMEA 3QG5A 2XLBA 4ZVKA 5HFNA 1I4DD 2J45A 4WZBE 2YKGA 2B4YA 3U44A 3A3NA 4DIUA 3QEBZ 4DCVA 4B6GA 4CQMA 1S9HA 1NAIA 3FYTA 2QVXX 4C6HA 1QBGA 2RAFA 1D2HA 1AN7A 4WLVA 4FFVA 4LY9A 2PWAA 1NONA 3MR2A 4R3NA 4JX8A 4CKEA 3F0TA 1WSCA 3G9ZA 2HMTA 2JEOA 1RJWA 2C2ZA 4CEIA 2H5EA 3BDIA 1ESEA 5KHLB 5EE3A 1ZMOA 4J90A 3NYQA 2Y99A 2ASVA 2QYZA 4XR4A 4LGMA 1BCSA 3PNKA 5ALSA 2PS1A 1NURA 2CCJA 4NENB 1QZTA 1IY2A 4DQLA 1YB1A 4JK3A 1ZGHA 4IV5A 5HZMA 2FEXA 1WE2A 1PGOA 1FFEA 1CETA 4LY3A 5ICGA 4M49A 4MOWA 2ZP1A 1ID1A 3G49A 5SZKB 4B3RB 3OJWA 5DVZA 3MJDA 3EEOA 2MYPA 2V8OA 4QU5A 3DCJA 2F1IA 4JGBA 3GTKA 4NZNA 3QNMA 1N5OX 4FSHA 2GF2A 3U4MA 1K6EA 2BM8A 2C4HA 4R84A 3EPLA 4W5RA 3KPJA 6CHYA 2O4UX 2CF5A 2DR2A 3PUWA 5HIMA 4AJHA 3PWKA 2H17A 1ZVKA 1Q7GA 4UOEA 4QEKA 3S1SA 121PA 3GNTA 3LKVA 1WCYA 3KETA 3K9CA 3LSTA 2CK3A 4EGSA 4A0SA 3H2YA 2QRGA 2LP4Y 2O5RA 1J8DA 3I28A 3TZBA 3LF1A 1PHRA 3U4DA 4G5QA 1CHDA 1J2TA 1JIKA 3DOIA 2GD1O 1S9FA 4X44A 1QB7A 1P4RA 4QBFA 1TVEA 3L0BA 3W6PA 1L2TA 5JI3E 5DAAA 3MWDB 1T36B 2PQ0A 2CB0A 3ABQB 1CIJA 1EX6A 5FTJA 4DKXA 3UUEA 4OIMA 4BVKA 4QYWA 2HA4A 5J63A 3RRMA 3CXUA 2X6RA 1RK6A 3F49S 3JQFA 4O0MA 2ZJTA 4AUMA 1UKBA 3W1EA 1CVIA 1H3FA 4AURA 1KDYA 3F8SA 3OIUA 1ULBA 3PKJA 2GERA 4QDUA 4CQJA 2VHUA 5KNLA 3IXLA 4B43A 1EJ0A 2EFHB 1BHSA 3S2IA 3F71A 3H0CA 2NU9A 5JMWA 4A82A 4EWLA 2QW1A 4BQPA 4NC9A 1TU4A 4KUEA 4URXR 2A1TR 3C6KA 1XTKA 3KLBA 1XAGA 5JDCC 1Q12A 2FPRA 3EQ7A 4J03A 5EERA 2AI2A 2R1VA 1RIIA 2X7JA 3C6XA 5KQPA 3JAKB 2W6ID 5FPRA 4MNTA 5I5VA 3A06A 5DG8A 3UJHA 1DB3A 4V38A 3SVLA 4F3KA 2PWPA 3QKUA 3ILVA 3GJ3A 4N03A 1DTSA 3KQHA 4KRFA 4HK4A 4DNOA 1RWBA 3W90A 1L5YA 4US1R 4F97A 1ZRHA 4CIBA 5A7GA 1ONSA 5E4YA 3GGDA 3OPYB 4KO4S 4FP9A 4BTVA 3T7IA 4V1CB 3CWQA 2G25A 4RY8A 1ULUA 2CJPA 4F2PA 4Y3UA 5CTJA 2WSSA 3FOEC 1ZOIA 2COIA 1EFLA 2H2IA 4B7ZA 3IA2A 1B3BA 3SFZA 2NZXA 1P5RA 2G6BA 3L07A 1Q3KA 4ZCLA 2QN2A 4A8JB 1JIQA 2PGLA 4PAMA 3RIHA 1Y5MA 3P27A 4CKZA 4C01A 5BVHA 2FJUA 1FQJA 1OFGA 1UKCA 4KSCA 3DT6A 1KEUA 1X1RA 3OWOA 4X65H 1GIAA 4QECA 2WM8A 3PQ2A 1WMAA 1E3SA 3VH2A 4HEA1 1AKUA 2DUUA 3KBOA 2DERA 4A4DA 3P2MA 5KNDH 4XCVA 2ASJA 5KFAA 1R4NB 1P1CA 3R44A 2AC7A 4BFYA 1UC4B 3G2MA 3MFYA 2OO5A 5GZ3A 4JUIA 1XPRA 3ZLJA 4EG0A 4DIMA 1C14A 1SIOA 1P4AA 3R5JA 3EASA 1XJ5A 3EZLA 2ZDHA 5A5GA 1TUEA 4H1HA 2IYLD 1DVRA 2MSLA 5F1PA 2QN8A 2QQ0A 3RS8A 1KEVA 2OGWA 2NTJA 2DX7A 1NRXA 3KR1A 1ZC3A 4IGKA 4M87A 5J4YA 3LPCA 3FJ1A 3T5LA 2X4GA 1L5MA 3OQIB 2Z5GA 4TKLA 4ZO8A 1VSTA 3MB5A 4BS9A 1CUFA 2FFQA 3HKBA 1W4AA 2A33A 4DFDA 1TWCA 3PHLA 4O7YA 4EHHA 3DE2X 2I9PA 5K0LA 1MORA 2Q0QA 3LYLA 3WADA 1MABB 4QFBA 2V4UA 1THZA 1WXEA 4MVJM 4GT1A 4EA7A 3Q8QB 1XQXA 2CLLB 4YXWD 4FEGA 5AK0A 4B3MH 4PPNA 4C0BA 4BZPA 3RGGA 1DBSA 3R0QA 4EY6A 2I2XB 3R7AA 5KNDA 1KYWA 3OOWA 1RC0A 3LDAA 1BU8A 2VG8A 5E9AA 1K08A 4J16A 3CEMA 4F2GA 1V95A 3HS3A 3EIUA 2W48A 2VOBA 1CLUA 4FS8A 1X3SA 1OAOA 3ZVKA 1OGYA 2FK2A 1NW6A 4QEZA 3ZDYB 3GG2A 2ODWA 2L0XA 4AUNA 2IZ1A 4MS4B 1V41E 1JDZA 1S1CA 3KXIA 1NP6A 3QE0A 3QZ7A 1L5HB 4ENPA 2J5QA 1JJ7A 2Y66A 3L40A 5JYCA 4KL8S 5FFFA 1MPXA 2J09A 3KQMA 3NAZA 2H1WA 4YJ3A 1WB5A 4B6FA 1CEQA 4GYWA 4WNIA 3SYTA 4PVDA 2XKAA 3GB9A 3IP7A 5F2OA 5IDXA 4MV7A 2GM4A 2IUUA 2HBZA 6AT1A 2RHMA 2Z2KA 2DPHA 2FRDA 2VTKA 5L1JA 1XMOH 2B6NA 2WJ6A 4MKXA 4BFTA 1I33A 2UVDA 5EEHA 5GOTA 1NXVA 2ZTSA 4CFZA 3O4JA 2GDZA 4B9AA 4L27A 1I32A 3HBFA 1ODFA 4FFPA 1DV1A 4ZDWA 1TZMA 3AHGA 3VYVA 3PJDA 2VAVA 2Y1FA 5LDDC 1YZKA 1VIMA 2QP9X 3CO0S 4MI6A 5ANRB 3RPEA 3ICQB 2C9OA 4JUZA 1B8OA 1V1RB 4DRXB 1YCHA 3GLHB 5CT4A 4NWIA 3QKSB 3AQIA 1IG3A 4M8KA 3B38A 1M5TA 1QGED 3PR5B 2BMDA 5DTEA 4L5YA 4HZGA 4LISA 2ASEA 4YP7A 4U2CA 1DKPA 3HVKA 4B3SH 1IN5A 2RB5A 1KVTA 3ZY2A 2HMVA 1MB9A 4LXTA 3PNQA 2WJVA 4KN6A 2QLBA 1T8YA 1U0HC 1FCJA 1Y81A 3GGPA 3T0FA 2GXAA 3DEYX 4WD3A 1PQYA 4A0FA 3NLLA 1NJGA 1HR0H 4PCAA 5JCJD 1V7QA 4RH3A 3ZJVA 4IJKA 3NAQA 3G8AA 4RCYA 1V37A 4JUBA 3PNBA 2Y9PB 2XVAA 5DDIP 3TGLA 2HJSA 1XP8A 2FX3A 4L2IA 2BEVB 2G40A 5KTSA 2X9VA 4FYKA 3ZWNA 3D8NA 2ZRMA 4CLHA 2PGOA 1V43A 2ZBGA 2ZUWA 1FJHA 1V8ZA 1VAJA 2ZRIA 1FP1D 5B30A 5FUMA 3O0DA 3WGHA 1WXFA 3QWUA 4QFCA 3AUKA 4HPWA 2J0QA 2NTYC 3O8LA 4XIYA 1FYFA 1J5PA 4GGMX 2O2CA 3FJOA 1QIIA 4X8MA 1IN8A 1XDZA 4F04A 5E3HA 4O02B 4BB9A 3HCNA 2BF7A 2WB2A 2OFXA 3UH1A 3I9NA 2W6IA 4N0MA 4FDVA 2DWUA 3CF6R 2XDQA 4AG6A 1Z7EA 3OCZA 4ODIA 1E1CB 1MOPA 5CT8A 3N6VA 3BD6A 1YACA 3TCXB 1T6NA 1U8EA 5KHAA 1D2RA 2P41A 2TMDA 2X9QA 2GRAA 3QK7A 3EA5A 4JEUA 4JT9A 1I9GA 1Q2XA 1XMIA 4RIFA 4XEUA 4PN7A 2CDAA 4D98A 1U7UA 3B3JA 1MEEA 1X19A 5GIPE 1TF7A 1WB6A 2JATA 3HWX1 3SOPA 1JPUA 5K0TA 1SVUA 4L0MA 4BP3A 5DXAA 4MGZR 5AXDA 1Z0IA 4NVRA 3VHXA 1B6TA 2K6GA 4MR8A 3RQIA 1E9AA 2QQGA 2D54A 3UAOA 1E6UA 2RD2A 4Q0YA 2NACA 1ZBQA 3DEJA 4DXAA 4G1FA 4MRMB 3IQDB 5HE9A 1RCFA 3RRZA 3ROQA 4RZXA 3PHBE 3PYMA 3NOOA 2J1LA 3I4LA 3UWDA 4YO7A 1XHFA 3GHHA 5JCOC 2ZM5A 5A05A 3FIJA 4JU9A 5A03A 4RHUA 2MCTA 1AKRA 3D7MA 4GM4A 3LPMA 4BY7G 4HS4A 1ABEA 4ONEA 1JG4A 5EAIA 1KWGA 3M2PA 3TQCA 2B61A 1ODCA 3MCWA 4MYHA 3B9BA 4H0NA 2VHXA 5EZ6B 4K86A 3AFGA 3BZWA 5F1YA 4C4SA 1VI2A 3SLGA 5BVGA 2F3SA 2Q6LA 5TMDA 4HB0A 4XIGS 4CFSA 3ESXA 4CF7A 4J1TA 1LI4A 4JS0A 4AMUA 3B9QA 1G3MA 3FF1A 3UHAA 5BNWA 1AS2A 4L8GA 2ATIA 5EHQA 3V1NA 1LSSA 3M6LA 2ACWA 2XA2A 3O4GA 1G8YA 1K5GA 3R40A 4NRDA 3B9PA 2DFNA 1B14A 2FPPA 3UA4A 4IQGA 4NF2A 2Z8YA 1BN6A 1T3ZA 2X19A 3TQSA 5KS2A 3DVQX 4YACA 4N18A 2UXDH 2RHDA 4TZ0A 1YR1A 4YXWA 2BELA 2ZJAA 3MA0A 5I5SA 4FJ0A 4I8DA 2MSNA 4LF9B 4B32A 1V4BA 2X2EA 2J5RA 1G8SA 3FNIA 3SF0A 3LU1A 2ANCA 2G77B 2AFVA 4PYLA 1CJVC 4JB2A 4WMLA 2ONJA 2AJBA 1TKRA 1XK7A 4DA0A 4G1UC 1H8ED 4MI9A 2XAAA 1STOA 2JGNA 4GZ6A 5JWOA 5LVAA 1CB7A 3FCSB 3H5VA 1H5NA 3MIZA 1U5AA 4BVGA 3G13A 2HHJA 3R7SA 3NYRA 3GJZA 3DDOA 2V9PA 1EPUA 4CUJA 4MIYA 1H4SA 3C3KA 2ICAA 3DDCA 3RB6A 3NGXA 1KEEB 3MB8A 3THRA 4IIHA 2CUNA 3G2NA 2VYQA 3W3ZB 3FWNA 3ABIA 3HLTA 4H9GA 3R3SA 2BGTA 3KQNA 1X9GA 3V7WA 3PZBA 4EDHA 3BTOA 3DUWA 1UPFA 4GKBA 1QPBA 1CLEA 3HJUA 1RKBA 3DCNA 1CR6A 4LBYA 1RMTA 4RVUA 4PU0A 5DLPA 3DBVO 2B2NA 2VHZA 3ZWVA 3UYYA 3Q8XB 2J4DA 2IH2A 1I2KA 3ZI7A 1QGDA 3K70B 4AQYH 1L6IA 1QKKA 1V2HE 3PE6A 3EGDB 3ZV7A 1CJUC 2DH5A 2Z6QA 2C07A 1HDGO 2XE4A 2P4QA 3U3XA 4LA4A 3AW9A 4K81B 1B73A 3SE7A 4CR7A 5CNMA 3KHSA 1U3UA 3KU4A 3OCYA 1KFJB 1GYQA 3K70C 2IYNA 3WRXC 2NTEA 3E3NA 3SF8A 3BN3A 4CMHA 2C28A 5HUJA 2H92A 5DCLA 3DFUA 1FJ2A 2CKMA 3O21A 1X9IA 4RAZA 3ZNOA 3SHOA 2YWFA 4EI7A 2GWHA 3HJAA 4LOJA 5F9FA 2EXXA 3HKDA 2MT9A 3HMQA 1CZOA 3QLVC 5E9QA 2RDIA 4WA8A 4DV4H 4DJEC 4F3CA 5JCJA 1QIGA 3VU8A 2CFSA 5DXFA 4ENRA 1P0MA 1YZYA 3R8CA 4KLAA 4B79A 3K9WA 3O4IA 1OR8A 4HDRA 2ZS8A 1AJEA 5CM0A 2C9DA 1JG3A 1WMBA 3BB4A 2HGZA 1A9SA 3IQEA 1Z0SA 1NIPA 2V0NA 3ECSA 2HRCA 5AI4A 1Y5NA 3ZJ5A 3W9YA 4AJ1A 1UM9B 1EMDA 4KMOA 2IBMA 2C2GA 7ABPA 3AONB 3BDVA 3O4VA 4E1BA 5DB4A 4PNZA 1CJMA 1NQWA 4TSFD 3VDQA 1Q92A 3RGXA 4D26A 5BMVA 4JWKA 2HA0A 3OCCA 1QYVA 3NP7A 3BQ0A 4V02A 6ABPA 1PS9A 2CE2X 2H1HA 3HE3A 2R66A 4V0ME 1TW2A 1CX9B 3DP9A 2YCLA 1WTAA 3GLGA 3DMHA 2JGAA 2REXB 5ES4B 5BN3B 2Q9AA 1H9BA 4N7RA 3NRBA 2H65A 1SK8A 1VMEA 1JLHA 2W7TA 1AC5A 5I8WA 1N6IA 2X22A 4OG2A 1BA3A 4WBSA 4FPXA 4K9PA 1KAOA 3RBVA 1Y9AA 5EMKA 3CCCA 4CMAA 2GN6A 3A9CA 1BZYA 1V5FA 3KAPA 1F5NA 1GQRA 5K6RA 1WX1A 3UYLA 4Y9TA 1J24A 3ST7A 3RK0A 1YASA 4O1MA 4X20B 1L7OA 2QTVA 3RKRA 3TOZA 2IZ0A 1RWOA 1PWXA 2ZDQA 3LLUA 3DZKA 4G9BA 3TXXA 4TTRA 4F0JA 1J20A 4GPEA 2XUHA 2H16A 3RROA 4KE7A 3ROTA 3U4IA 2C7VA 3AKDA 3M70A 5LQDA 2EFCB 3OSNA 2PZBA 5EIOA 1P7CA 3BD9A 3OUUA 4MA5A 2DULA 5IJ9B 1XZMA 3ORHA 1QIMA 3LW8A 5EKDA 4J43A 3Q87B 2P9YA 5F5XA 5GM2A 4CZ2A 4RTQA 1JFRA 3NWOA 2YVLA 4G56A 4AVYA 4G0QA 4Q7MB 5ED0A 4FMCB 4C2BA 5IABA 2P62A 1B93A 1IOZA 5FYQA 3UV3A 3KWMA 4Y2GA 4URUR 5HV6A 3FRJA 4U7WA 3T5PA 1U8TA 3NDIA 4K0KH 3K9HA 2NPOA 4JP5A 1K5DA 4C5BA 2IBSA 4IVRA 1DJPA 3GQBB 1R0BA 3K20A 2ZS7A 1LTQA 3FPAA 1E79D 3FYHA 4O84A 1IVYA 4CLRB 4DA7A 1XA4A 2PL9A 2AR7A 3L0DA 3EGIA 1EGVB 3O4RA 4RAYA 3UV7A 4H3KB 4ZREA 2GCPA 1DS6A 2Q1XA 3ZGOA 4B44A 1U90A 2DUWA 4GZ5A 4MWEA 2D00A 1VJ1A 2FG6C 1HNWB 4H1UA 1MXFA 2BY4A 1Z6TA 1DDGA 4EELA 1DADA 4XKJA 3CKLA 1AA6A 4K2AA 4ESOA 3KJEA 4R9SA 3DHNA 4XJVA 2PX5A 5AM5A 3EB9A 3OPMA 2D0PB 4EGQA 4YJFA 4RZRA 1RQRA 2V45A 3M1YA 3WL5A 5BSEA 6NULA 2CYAA 4DEYA 1E1YA 2AQ8A 3CZMA 5ALKA 2X5KO 1QS0B 1H8EA 1NVVR 3DW3X 4C7XA 1P74A 5GY7A 4OO3A 3RYFA 3TZLA 3RT1A 4RHEA 1Z34A 4U39A 1JQLB 3TFOA 4LYDA 4J3JA 2LZ0A 2BH9A 4J75A 3L5OA 4IJMA 1PJBA 3TB4A 1UEJA 1XMQB 3EFEA 2QD2A 3TTUA 3O8QB 4WIAA 3ROMA 1N4DA 3D0OA 1FFXA 4NBLA 5FV4A 1KVSA 5LDGA 2ZRBA 1N2XA 1UAGA 5DBFA 3TLBA 1KAMA 5HYVA 1OILA 5D3KA 1H66A 2NGRA 2Z57A 4ND3A 1VA4A 2AJCA 5BQXA 5E1MA 5NULA 1QHSA 4NG5A 4GDMA 3OZDA 5C18A 1P1FA 4BEWA 4LJ5A 2CNDA 4RYDA 1U65A 4RMJA 4DVJA 3MRXA 1BXGA 2D5IA 5JS7A 1BGVA 3MD9A 1UBHS 4W5JA 5A2GA 3D43A 3V2IA 5EE1A 1U04A 2OEPA 2G67A 1YF3A 2FPXA 1IEQA 1JAXA 3BL6A 5DSTA 4FKBA 3W5AA 1LU9A 3NNNA 4JR1A 1D4FA 4D56A 1RI4A 3MCZA 1RQGA 1UKEA 4N76A 4UATA 3CURA 4NJMA 1P61B 4KDCA 1DEHA 1U99A 1M0TA 3GUYA 2DT5A 2VJDA 2DFLA 1PZNA 4R7RA 1JFVA 1ZVVA 2ILVA 5LP6F 1OXXK 2V4QA 5G53C 1ULAA 2F8MA 5EJGA 4GPTA 4G9GA 5C7IO 1D1TA 2Y27A 4AYWA 3FZGA 2HSWA 3EFBA 1OBFO 1MCZA 3ENNA 3VZQA 2J0UB 4QGBA 3MOGA 3ORYA 4E15A 3OUTA 1UK8A 1W1UA 4BMOB 5FT9A 1XVUA 4UBNA 3KYBA 2WTBA 2DFTA 4IRCA 1OI7A 4Q6BA 3C3MA 1JT9A 1LK0A 1F51E 5E8RA 1QAMA 1T1SA 1XCBA 4UCVA 3UMVA 2C22A 3UXYA 1FPQA 1R66A 2AFIB 4YJHA 1GUFA 4XIIA 3Q3EA 1D6JA 2EU8A 5G02A 4R2XA 4UHEA 3RTGA 4G5OA 1M2KA 3R4CA 4CIWA 1FQWA 4LNUB 2FKLA 1AM4D 3PK0A 4D8WA 4QBIA 5G4LA 2BEWB 1I3MA 3CGGA 4TSFA 3CH6A 3NJ8A 2G5PA 2FK7A 4P83A 3C0KA 3LF2A 1U0EA 2GCIA 1P3JA 2QPOA 5B58T 4Q0MA 4F1JA 4Z8YA 3ABSB 3A9TA 4WDQA 1TQ6A 2O6HA 4OHRA 1I2CA 4YUZA 2Q5CA 5LMNB 1PDOA 2WAQA 2QV7A 3GGGA 4U7HA 2OY0A 4CTOA 5CFRA 3LOUA 4PPYA 1UT6A 4YUYA 3RAFC 4R7ZA 1KHTA 3EVFA 3FW1A 1A9OA 4P53A 1B00A 1XTIA 2ZT7A 2O6LA 3H2HA 4XRGA 1KEKA 4PZUA 1UCFA 3PKZA 4R1MA 1EM8B 1L4UA 3S2SA 4GQAA 1L5KA 3GDEA 3TY5A 2OUKA 4ZJPA 2JFGA 2RBKA 4MMZB 1VE1A 2OESA 2I7TA 4HPXB 1RHQA 1HEIA 1IAQA 1QH8A 3ZDEA 1ZCZA 3V4LA 3GLGE 1LH0A 2Z9CA 3AESB 3MZ0A 4OHCA 3EPGA 5AK4A 5T41A 1QWSA 3SZRA 4AKIA 2CXTA 4IO1A 2F4VB 3NIFB 4PTLA 3AVUA 1X6VA 4ECEA 2VRBA 1U9IC 5B2EA 1PX2A 3WLAA 4GBMA 3KXLA 4LJ7A 5BXYA 3AWIA 4KHZA 4EKNB 3TVTA 4YX9A 5BN1A 4RVCA 1FZTA 2ZREA 3MAJA 3RGWS 2IOYA 5JU6A 3NUAA 2PNJA 3MYYA 3VKUA 3HM9A 1Z6ZA 2O7SA 4Q19A 3NT4A 2ZK7A 1YCGA 4OQXA 1M5UA 3JZMA 4MZXA 2OYRA 3ETLA 2II6A 2VYND 2BCGY 3D6UA 1MU0A 1CF4A 3D2BA 1E79A 5KNCH 5MFZA 1S4QA 3SFVA 2P6MA 4NFLA 1JIXA 2NTNA 4YMUA 4WBNF 1WP4A 3O7MA 1RRMA 4PAGA 4DCOA 4GL4A 4US0R 3PFFA 3IPXA 4R40A 2ZULA 4YRFA 3BVPA 1N6KA 4PG7A 3WIBA 1GA4A 3PUXA 1OH8A 4B84A 1ZITA 4BLWA 5I47A 1RPTA 3UA3A 3EC7A 4ESVA 5M5BA 5I4KA 1WZEA 4KGVA 3FYUA 4I50B 4YPFA 5IFKA 2Q0SA 3O9MA 2WWYA 4CVNA 4MUNA 1AV6A 4UC0A 2OPHA 5E9WA 4L8YA 4BJ5A 1SKAA 2IF0A 3ONFA 1S8NA 2ECFA 4RTMA 1X86B 4M22A 3PDJA 2QVZX 4UM9B 4FKMA 3FVRA 4QXRA 5DLEA 1HQCA 2UUAH 4LYJA 3MFQA 3LZ6A 2I66A 2GN1A 3D2AA 2Q4OA 3KT8A 3E8MA 1K6JA 5AFSA 4X8OA 3BE6A 3KKLA 3H5TA 2GPTA 2HF7A 5AHKA 1M1YA 2OFFA 2W2OA 2W93A 1ZAKA 2VUHB 3MNFA 1P1RA 1JAHA 1MT0A 4YR9A 4EO4A 1JMYA 5M2QA 1ZMTA 3OP1A 4I6JA 3M5WA 5A4KA 1YKSA 3NGMA 1K1EA 4YJGA 1LPOA 2G08A 1GPYA 4UXHA 1YTUA 4ECUA 1TYEB 1TKAA 3JZFA 3K2IA 1KMQA 1NXTA 3UTCA 1JEYB 3MTDA 2EDCA 1CJKC 2C2DA 1NNUA 1ACLA 1BU5A 3ND5A 1YS1X 2RGBA 3PL5A 1EH5A 2XWQA 5HNKA 4L4XA 4JI5H 5BWMA 1VDMA 1FU7A 1ZVJA 3T5GA 5BSFA 3J80A 1YQWA 4PYJA 5SY4A 3A4VA 5KTMA 5HRAA 4UBOA 4QOIA 4F6RA 3EW9A 2GBIA 5AM0A 4DR4H 1VYUA 1TLTA 5KI6A 1A50B 4X00A 3BGVA 3O75A 4ZV9A 1N57A 1P9RA 1ZD1A 3ABOB 3OT4A 2FZ4A 4E5UA 1PK9A 4ZHQF 2AT1A 3KXKA 2PT6A 2Y2UA 5C8DA 5KU7A 1KK0A 4QWCA 4K1LA 3PJGA 3ZHYA 2R2GA 1JPNA 1UJBA 4IXMA 1RZ3A 1VIYA 1O03A 3WQHA 5KWSA 4ER6A 4KK3A 1D1PA 1UZUA 4Y2VA 3FWZA 1I1MA 3GLIE 5CB0A 1SG0A 2WKSA 1W5AA 1M0WA 4LZOA 1JHOA 1Y8RB 2A9QA 5CDSA 4LN1A 3U5ZB 4WSOA 1G9XA 2G4VA 4ALJA 3WHIA 1DXHA 1FW6A 4O82A 3AY0A 3EY4A 1CF2O 3IAEA 1UJMA 4JLKA 3P0RA 4LZNA 5KFIA 4FCCA 2HSDA 1EVLA 5LPNA 2QJRA 3L0CA 1Q7TA 5G4KB 4R8SA 1ENPA 4OYRA 2YJZA 4P22A 3KFVA 2GZ1A 5C80A 2A1UB 3CA8A 3TECE 4GSLA 4DRZA 2J48A 4B47A 5DHSA 4RPLA 5JEEA 3PGXA 1IJEA 3AYZB 4EY7A 2JW5A 3CQ9A 3L8MA 3S8YA 1ZG3A 4CQLA 1P80A 5EFOA 3RFUA 2HK6A 4KNVA 1RSZA 5EZYF 1RIFA 4HNTA 5H5JA 4ZP1A 2EVWX 1VBNA 5KUTA 3TY9A 5EIAA 5EHZA 3K9GA 3UMYA 4ARSA 1F0YA 1CUVA 5KFTA 2AFHE 4DZZA 4Q9JA 1QQ6A 3QMVA 5G1OA 4WA7A 2WY2D 5I7UA 3Q6NA 2EJCA 2XGSA 1OBOA 3TQRA 2BMFA 4EX7A 1DTWA 1Z5NA 3D6FA 1CUCA 5JS8A 1TEVA 2PAAA 4YAOA 5KU1A 3COWA 3FVVA 3OCJA 1VP3A 2PGJA 3GJ5A 4HLQB 3H5WA 3IE1A 3BT7A 1F0PA 3ZLVA 3D8RA 2IY8A 1DL5A 3OCUA 4EHDA 2C7RA 3CH4B 4E5NA 1YVEI 2QTAA 4QWEA 3ZDQA 2NXNA 2Q50A 5TF4A 2QVGA 4MP8A 5EDWA 1VP9A 1QV6A 4EFNA 3TXYA 1XNRH 5E3JA 1NTRA 1WXXA 3CO5A 2OHHA 4BNWA 1ACJA 5HUQA 4UDNA 1AKYA 3RARA 2Q7DA 3I0NA 1LI7A 2IIQA 1XA3A 3GH1A 3TNFA 4KMMA 4R71A 3EF1A 1ZGCA 4O3FA 4EZBA 3ZXYA 3WRYC 4QO8A 1TTQB 5HRCA 1EHIA 4B48A 1RACA 2YU9A 3WVNA 2OCDA 4Z0PA 5TB5A 4YR3A 4EPWA 3GTOA 3HJHA 2VNHA 5I8ZA 5IDYA 4KE6A 1ZLXA 1XNGA 4PWZA 3KR9A 4W1RA 3NM5A 2YASA 4MUYA 3M9OB 3AV3A 5DN6D 1G5FA 1JU9A 2VYNA 1YIDA 3CZRA 7ADHA 2O2DA 5C5DA 4EMSA 6ADHA 4CPDA 1BWSA 1TYCA 5A3QA 3OIVA 4HGOA 4PAOA 1V11B 1V8BA 5AVQA 2PUHA 4WEOA 1LFDB 4OQZA 4P4TA 5MN4A 5AIAA 3DZFA 4C29A 2I4NA 2CYCA 1UMBA 1Z2PX 4G1MB 5EXTA 4JC4A 3ISTA 1MGOA 4O3PA 3TEFA 3HJRA 4AN0A 4BNZA 1I51A 1D04A 1GA6A 4F8YA 3HDGA 5CIYA 2H2HA 2G1PA 5IARA 1LD3A 5DBIA 4MMXB 3AJRA 1J09A 1GL3A 2ZITA 2X41A 1RJ9A 4JBLA 4ZT6A 2VYFA 1OSNA 3KTOA 1TAHA 1DEKA 1E60A 5ITZA 5TMPA 4BMSA 1FP7A 2X7HA 3BC1A 4TLDA 5IDWA 1DIKA 3TN7A 2UYCA 2QI9F 1LDGA 1EJBA 4XLZA 2MSKA 4GVLA 5HF5A 1KDZA 2AX4A 2FX5A 2P68A 2EARA 3ROGA 4XJTA 4MKZA 1WZNA 1KE1A 3ER6A 2HLNA 2GN0A 4ARCA 1W25A 3DQZA 4DYHA 4UHKA 4FBLA 3MINA 5BQ5A 4BTEA 5AQ1A 4FXOA 2B69A 1SOUA 3EXHB 3PV0A 1K2VN 3DTFA 4NP6A 3WSTA 5DGDA 3BGWA 3QBEA 3A1NA 3ZOZA 2O3JA 4D8VA 1J07A 5BY2A 7REQA 4BQOA 4RPGA 5LUBA 1OFUX 3C7TA 5CJJA 3CINA 1T8RA 4OAQA 4N49A 4IXNA 2FEWB 1AQJA 1JIUA 2XB8A 3CEPB 3EXHC 1C7ZA 4XFJA 4UDXX 1ZQ9A 1DWUA 3RAJA 1YQUA 4JB8A 4LOHA 2HU5A 3L8FA 2JCGA 4QVIA 4PFQA 1L5LA 1JSRA 5JW6A 3HUEA 3ITNA 4FSDA 4D2IA 3PZPA 4J0KA 2KX7A 2DSTA 3F6BX 3V97A 2BGMA 3ENQA 5AJTA 4Z9BA 1EQAA 1DGSA 1UPTA 1ZM9A 1QVAA 4EFLA 2QT9A 2V6BA 4KYVA 3WNCA 5FI0B 1Z5WA 2CVFA 4OOFA 1N2BA 2F6RA 3IQXA 4RB0A 3ETCA 3ONDA 1SU7A 4RK1A 2UZ3A 1T3NA 4DYDA 4M4SA 3UMGA 4AWXA 2Q62A 3HC7A 5C1BA 2C03A 2ZANA 2CV0A 4N01A 3VX3A 3WYFA 3FUTA 4DV1H 1DAKA 3UCEA 3HUFA 2HK8A 2HQ1A 5LD2B 2JRLA 3VKHA 2VQSA 2AQHA 3O3CA 3EIWA 1SZJG 1RI5A 1GQYA 3CU5A 3KBBA 4AWBA 3DLAA 4P0PB 2G7ZA 5L45A 4PR0A 1WHTB 5J1TB 3EODA 3MJEA 3ZHSA 1NVKA 4BO4A 2G1KA 3N28A 2QX8A 1Z5VA 4CM8A 1R10A 4OB7A 4UARA 1EA7A 1Z4LA 3NKFA 2I5PO 2GX6A 4A73A 1GQFA 2YJ5A 4Q45A 1CKNB 1RQPA 5AKIA 5C3UA 1T4GA 1IJBA 1KI1A 2HI0A 4ITRC 4QJIA 4DSAA 4MRRA 3TMAA 1GUAA 1SY7A 3KYDA 4A6XA 1T25A 1N9GB 5JG7A 3S2YA 3RYCB 1AVTA 3M9WA 2FZVA 3NV9A 5TRTA 4OA8A 5MGNA 1HZJA 3F6PA 3H4DA 1Z4PX 3OTIA 1RXSA 4M9SA 5I48A 2YW9A 1U9ZA 3CLSD 5AW5A 3JQ6A 2R8RA 4EQ6A 2B4QA 1N2CE 4IYRA 2ZJ4A 1Z4NA 1YJQA 5JNTA 4J9PA 4GMGA 1HT0A 2NPIA 2CD9A 4L4SA 4XUCA 5JIBA 1VIDA 2GKGA 1IULA 4A8JC 4CKCB 3RWBA 5AWFC 4DMHA 5FPHA 1C3XA 1USVA 1NU6A 2C2WA 1BDIA 4ESEA 1A72A 4BX9A 4JODA 4X91A 1GPWB 3Q2OA 2W6MA 3C3DA 1Y3CE 4ZOAA 3TRKA 1WMEA 1V51A 3MGGA 4I2VA 2G9RA 1I4OA 4ARZB 3RRFA 3ZV5A 1TRKA 1T2UA 4FZVA 4LY0A 1KORA 1BX1A 2ATEA 2JANA 1ZXXA 4WZAE 4KGZA 5EL0A 3V7NA 5B7NA 2J32A 1PFVA 1P60A 3HA7A 2V7WA 4ZAFA 2ZUCA 5IASA 1XPOA 2E6UX 5DHTA 4Z9FA 3ENZA 4JT4A 1PZEA 4MGEA 3VV2A 2JAQA 4OHPA 5DN6A 2QY6A 3UAZA 3HDVA 4EATA 5KG5A 1L8OA 1SFOA 3CUEF 3CNLA 2JFZA 4EDFA 4IEFB 2NX2A 3WNVA 3I8SA 4FYPA 2PUCA 4KX5A 1SVSA 4X45A 2ID8A 1GUYA 3QVGA 3BJEA 1PWZA 4YLGA 4REQB 1TVCA 2XIQA 2XZOA 1ZEJA 4MGHA 2Z6VA 4MV4A 5I3CA 3IC5A 2A84A 1BA2A 5JYEA 4PVCA 2ESRA 2A1HA 4O2RA 4LYGA 3FMOB 1JHRA 3EXIA 3OEHD 1V48A 1KKMA 4DAAA 3ZDFA 1OTHA 4J29A 1XSEA 4IRUB 1T15A 1LZLA