4ZQIA

Crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
306
structure length
292
Chain Sequence
b'MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
molecule tags Ligase
source organism Yersinia pestis
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop
doi rcsb
total genus 90
structure length 292
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4zqiA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4zqiA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zqiA01
5HV6A 2CQYA 1KJQA 1CE8A 5BPFA 2YRWA 2SCUB 1C3OA 3VA7A 4O7LA 4XYLB 4IWXA 4FFNA 4E4TA 1C30A 4YAJB 3BG5A 3QFFA 3HB9A 4M9UA 2CNQA 4TV9F 1E4EA 2YZLA 3RV3A 2NPOA 1KUTA 4ZOLF 2GLTA 5JVDF 4NYEA 4YB8B 3U54A 2Z02A 5FNVF 3BFPA 4O7RA 1BNCA 3KALA 4RZQA 4EAAA 3JZIA 4EA9A 3U9SA 3U9TA 3JRXA 2W6PA 5LA6F 2NU9B 2DZDA 3RFCA 1KJIA 4EGQA 3Q2OA 3RV4A 1I7LA 3HO8A 2WYOA 3KREA 3R5HA 5LP6F 2VHEA 3R9RA 1GGOA 5IYZF 3HBLA 4MV9A 3OUZA 4IWYA 1AUVA 4XYMB 4XX0B 4HNVA 1DV1A 2CZGA 3V4SA 2YL2A 4MV1A 4DIMA 1UC9A 1GSHA 3AX6A 2W6MA 1DV2A 1I7NA 2R7NA 2DLNA 4O2AF 3TQTA 2X0SA 4O4HF 5D8DA 3TINA 4C5CA 2W6NA 4MV4A 2YS7A 1KC7A 5JH7F 1PX2A 3WO0A 1KJ8A 2HGSA 4O7WA 4WBNF 2PN1A 5BMVF 2R6FA 2R86A 2QF7A 3TIIA 3ORQA 1OBDA 2VR1A 3JZFA 2J9GA 1GLVA 2NU8B 2V59A 2P0AA 3N6RA 3RUPA 1KEEA 2R84A 4O7VA 4MAMA 2XD4A 1PK8A 1A9XA 2OLSA 2R7KA 2YRXA 3G8CA 5KX5F 2R85A 4YAKB 3SE7A 3R5FA 2XCLA 2VQDA 1E4EB 4IZOA 5JQWA 3LP8A 3TW6A 1EUCB 4EA7A 1CS0A 2FPIB 4FE2A 4C5BA 1JKJB 2W6QA 2W71A 2ZDGA 3KAKA 1UC8A 1VBHA 2R7LA 2DWCA 5CAEB 3LWBA 1EUDB 4TV8F 3MJFA 1GSOA 2W70A 1B6SA 2W6ZA 2PBZA 2FB9A 2YZMA 3ETJA 4ME6A 3K5HA 4O86A 3BSSA 4IHJF 2GPSA 4HNTA 2I80A 2QK4A 2YW2A 3VPCA 1VKZA 4FGRA 4L1KA 5HBRB 4M99A 4O2BF 4ZHQF 2IP4A 3OUUA 4O7YA 3JRWA 2I8CA 4O4IF 1W93A 4FFLA 2R7MA 2YZGA 4O4LF 5K2MA 2FP4B 3UFXB 4J6EA 4YBZB 1Z2NX 3N8DA 4WD3A 4FFPA 1KJJA 1CQJB 3G8DA 4HQ6A 5C1OA 4EG0A 1GSAA 3I12A 4O84A 4FFRA 5JQGF 3VPDA 5KKNB 2I87A 4MV3A 5LYJF 4MV8A 5CA1F 4MA5A 2W6OA 2YZNA 3BSWA 2GQRA 4O81A 1EHIA 3KAJA 3VOTA 2FPGB 4I50F 4XZ3B 3VMMA 1CQIB 4M9CA 4Y8VB 4O82A 3U55A 4O83A 4ZQIA 5LOVF 2CNUA 2CNVA 1OBGA 4M98A 5C1PA 4O7ZA 2R87A 2VPQA 2C00A 4O4JF 3ORRA 2YYAA 4TUYF 3DF7A 3BSYA 3Q1KA 3K3PA 4FFOA 1JDBB 4O7SA 4YJ3F 4MV7A 1KBLA 2V5AA 2ZDQA 2R82A 4HNUA 4EGJA 3R5XA 4I55F 2DIKA 5BPHA 5CA0F 5H80A 1EZ1A 1AUXA 2FPPB 3WO1A 1IOVA 1BXRA 5CB4F 3TIGA 1W96A 3AW8A 1KJ9A 3ETHA 4FU0A 1Z2PX 4O7TA 3MWDA 4DLKA 1SCUB 4EA8A 4HR7A 1DIKA 1M0WA 5GONF 3R23A 1WR2A 1M0TA 3E5NA 4ZI7F 1JDEA 4EABA 3GIDA 4QSHA 4GGMX 3K5IA 1EYZA 2PVPA 3WNZA 1Z2OX 3V4ZA 1B6RA 2YWVA 2V58A 2Z04A 1A48A 5C8YF 3NUAA 4IIJF 3VPBA 2NU7B 4FFMA 4C5AA 2GPWA 1ULZA 2ZDHA 2GQSA 4YJ2F 2NUAB 1IOWA 4O7NA 5DMXA 2HJWA 3GLKA 4MV6A 2YS6A 2NU6B 5J2UF 1T36A 1JLLB 5LXTF 1M6VA 5J2TF 5JVLA 5I47A 4I4TF 4MA0A 3MWEA 1VBGA 5EZYF
chains in the Genus database with same CATH superfamily
3EFOA 4OJTA 3FDIA 1FFSA 1QIGA 3LTEA 3K0AA 1KJQA 2RCNA 7ADHA 1DAIA 3SDZA 4PZ8A 1QHSA 1OXMA 1D6SA 1XZ8A 2NM0A 4B7CA 3NHJA 2X86A 3WS7A 1O97D 2BV3A 5ED4A 3AR4A 1EKPA 4PZZA 3MCZA 2KJQA 4ETMA 3UHJA 1X7YA 4EI7A 2ZS8A 3D64A 3RO7A 3VA7A 2JA6A 5JZMA 5CCBA 1E7YA 3LT5A 16PKA 4FFNA 1GQSA 4HYQA 5BSMA 2C42A 4YAJB 3DTNA 1I4WA 1PWHA 4B7AA 4RD3A 2W5UA 3A05A 1XZFA 1XL1A 1AO0A 4LV6A 5K4GA 3O8QA 3UMRA 2ZRBA 2HIVA 3PKZA 1KOLA 4E22A 5EHZA 5L3SA 4YAUA 1ECCA 1I33A 4B3DA 1ZRSA 3KETA 3BMCA 2ZWPA 3DDZX 1Z6GA 3T6KA 4YCMA 1M72A 3K73O 1UMBA 2R2AA 2HTEA 3LX5A 3R5TA 2JEGA 1Q1QA 4JI6B 4GBMA 4PM4A 3MLBA 3U54A 3ABOB 4JUCA 5EKXA 2XMZA 3L1JA 2WKQA 3SBOA 4KQIA 1PGOA 3LQSA 4GS5A 5MN5A 3H8WA 1MJHA 3KV1A 3KLMX 6NULA 2WLTA 3FYUB 4IOMA 2XTZA 4BLWA 2X0EA 4R54A 3Q8MA 3C6YA 1BIFA 4X3CA 4QELA 1R37A 3VKFA 3T0FA 2ZYAA 5LKRA 4P32A 2Z08A 3WBKA 1UP6A 2Z98A 5KFHA 2PSDA 3SIPA 2QRJA 5TMEA 1OLXB 2BYTA 5KFPA 2WM9B 4IVRA 3HKCA 2VRWA 2M6KA 1SXIA 5JNSA 4JYAB 2XB6A 4BFUA 2FEPA 2HKIA 3ZD7A 2P5TB 2FK8A 2IWRA 2VK4A 4QUJA 4ERNA 5CM9C 4EGQA 1NUTA 3GF4A 3W6UA 4CU5A 4CKCA 1SBYA 1T26A 5ECDA 4YY3H 3RE1A 4KLCA 3RV4A 2BLLA 2QQ5A 4DWJA 3MD0A 2FWBA 2JANA 1J2UA 1LB1B 4FZJA 4P53A 1TVMA 4ED3A 2QMUA 3DTVA 3GJ6A 5CT5A 5KSZA 1PZXA 2B1QA 2XB4A 2IODA 1SVSA 1V7QA 1NYQA 3EGIA 2IYFA 5KFNA 5L1KA 1G5TA 2YYYA 2FF7A 1EWRA 1UIRA 3AFIA 1J8DA 2P79A 3B53X 1K8ZB 3E4DA 4UDOA 3CZPA 1CD5A 1P1FA 4Q9LA 5HUQA 1A8IA 4MZXA 3HBLA 4JYPA 1IAQA 3PNLA 4OLHA 2IYAA 2CFTA 2QR3A 2VHJA 3LT0A 3M81A 1KMCA 3PX3A 4DTIA 1SXJE 4I4TA 3Q9NA 4YUXA 2PE5A 5ALEA 3RSQA 4ZO4A 2JI9A 1UDBA 4B3FX 1QHYA 3D6NB 2AK3A 3MFQA 4PCAA 3TXXA 3U09A 3BMQA 1D2EA 4BU1A 4PZEA 5SZIA 4MR9B 3O94A 3CXRA 4PNEA 3EIEA 2G6TA 2WRZA 2V7QA 2E48A 2I7VA 4LDQA 2NZXA 4GUDA 3WAKA 10MHA 1P4GA 1BMTA 5HKKD 5HKOA 4WVLA 4D46A 4E32A 3DH0A 2WK1A 4P1ZA 3ZGLA 4JOBA 1FY2A 2JJQA 3CO0S 5DB4A 5KO2A 2R7NA 1RXVA 5MN6A 1FMLA 4BAUA 5IJZA 2GCOA 2WHQA 4QICA 2IDKA 3G23A 3GIWA 4KPGA 2Y4RA 4MV4A 4YDSA 3I3SR 1H94A 4R1MA 3SEAA 4MUMA 3I9MA 4BQFA 2XT6A 1BEEA 5B3LA 5F23A 1D2RA 4J1SA 1Q3KA 1U2DA 2ZOSA 2PWAA 5CH3A 2G9RA 4UUGA 1Q1GA 1UWLA 3RK4A 1NNSA 1MAHA 2PGIA 1G5IA 2JEYA 4E0BA 1EG2A 1ZLYA 4C0QC 1I50A 3HB1A 4KHPH 4G5XA 3WGOA 5EWMA 1SOMA 1ZEJA 2PT7A 4NXMB 2XBUA 4NZ9A 1W75A 2VHCA 2Y0BA 3G6WA 1N33H 3HJNA 4HLQB 1AM4D 1PJBA 4Q03A 1BX1A 4BASA 1ZJYA 4TSFA 1HTBA 2Z09A 3IURA 3RUPA 5FOVA 1VMEA 5BYJA 4UXJA 2IHZA 1UBRS 4F2GA 4Z4QA 4FWTA 5KUTA 2PWPA 4EBEA 3ETLA 3GRRA 4MYDA 3S1AA 2FKLA 5IXJA 3BD9A 4DEYA 1Y8CA 2GVNA 2OSBA 1MDFA 1R4MB 2H00A 3CIOA 1Z4QA 5AT1A 3DEIA 5AUNB 5AW4A 3THXB 1CIJA 3W7BA 6ABPA 2W6IA 1QX3A 3CEPB 3WI7A 1Q3TA 4M8NE 4QDXA 1UNNC 4IQ4A 2WIDA 4W5NA 2V55B 1AS0A 2EBWA 4HDKB 4U7GA 3GROA 5CR5A 3EXEB 1XB2A 5FLKA 5CXSA 2PCLA 1AS2A 3DLPX 1O9HA 4QUBA 1XQ1A 3WK7A 4TQUS 5LUAA 4TMVA 1MPTA 3AU8A 4ZAWA 3S8EA 1EJ6A 2L2QA 2X8LA 2YV5A 1VXOA 2Q9UA 5IYDG 5D3KA 3VO9A 3OZBA 3RK1A 3VKWA 1ZOPA 3IJRA 4CM7A 4QJBA 5LZ8A 4QWAA 1QLJA 5ILOA 2EJ0A 1T5OA 1RMTA 4A6DA 4DSUA 4PRZA 3ENQA 1Z26A 1IBKH 5AUOB 2PUDA 3VZSA 4BNHA 2J33A 3P9CA 1A0GA 2QB5A 1ZD3A 2GA8A 5EE1A 1QG2A 2IFTA 2ADOA 1SZPA 1EVKA 2VJYA 1GAQA 2P8JA 1BFUA 1NF2A 3C6QA 5D6OA 1FNDA 2FW8A 3UT5B 3MR5A 3HJTA 4ZMBA 1QC5B 2MR5A 2MDTA 4FMDF 3WOHA 3D4LA 3H0KA 8AT1A 4J03A 3HOZG 1YF3A 3L8FA 1PVDA 2GXUA 2PKEA 3ILYA 1US8B 3C3XA 3DCNA 4BQRA 2WWYA 1NIJA 2XYPA 3INTA 3OZEA 2B99A 1HQCA 1DBWA 1PGQA 5I5TA 3PUIA 2IYZA 4IBOA 5L3RA 1EUDB 5I7RA 3CLUC 2VEOA 2ADMA 5LBTA 4Q66C 1JHYA 1X6VA 1HE1C 3GJ7A 3KYDB 6PFKA 1E63A 2OGTA 1RYSA 3M5WA 1XRLA 2ERXA 2ILTA 1JH8A 4LNAA 5ABPA 4RMIA 5IBPA 5I4KA 5D3MB 5IT4A 2F17A 3A6HA 3HACA 1TA4A 5ILGA 2O19A 3OOJA 1V39A 3NHYA 3Q7EA 5TRTA 3REQA 3ZH9B 3Q8RB 2FLNA 3ZDQA 2HHFA 3M6XA 4G8CA 4C7BA 1H8ED 1JPVA 3VHLB 3QKTA 4MR8B 1UL1X 3PC4A 1QDLB 3EXFB 4EB6A 4IHJF 3FNIA 2NO4A 1RWVA 4MUKA 4DIUA 5DP2A 1IZ0A 1SOAA 1SYXB 1WWKA 4WQMA 5EHGA 4JWKA 1DGQA 1T6BY 1WO8A 1ODKA 4WXMA 5HBRB 1LRKA 3DG9A 4U2GA 1EUYA 3ZHTA 1UOPA 3EGWA 1PFYA 1IZ9A 1KDYA 3RVRA 1EZ4A 2WD9A 3SSNA 2BP7B 4CCAA 4F96A 5REQA 2FLKA 2LKCA 3BXOA 1RD4A 5IF3A 3R9XA 1ES9A 5HMMA 5HTKA 4TWAA 2Q2OA 4AC9A 3Q85A 1PWEA 4Y2TA 5K0EA 4ZHQF 3CSDA 2H16A 4LI3X 1WSCA 1TA8A 2OEPA 1TVKA 3GMSA 1NF3A 2EFEB 2ZYTX 4TVOA 2JAXA 2BFMA 3C98A 3CY6A 3BIXA 1V8DA 1E1CA 3DBVO 2R0QC 5COBA 2A9VA 1OIVA 4H08A 2ONJA 5GOZA 1OJ7A 3AY3A 1A8PA 3CVJA 3ZV6A 4YASA 5C2JB 4KFRA 1P7CA 2QGNA 2C2DA 4ZO9A 2YWFA 4XWWA 1G66A 1J49A 2YU9A 1FF9A 1PR1A 3DFMA 3WWEA 1O77A 2AZTA 2WT8A 4WD3A 5JSFA 2Q1SA 2CUNA 4F91B 4LI0A 3EZGA 3ODPA 4W6QA 4DWVA 2ZYSA 1T3SA 2YV3A 4NTZA 3UPUA 2IZZA 1KZHA 3DD5A 3FOZA 4FIDA 4IJWA 1GPLA 2P69A 4WN3A 2RAVA 3TRJA 5GVSA 5JV5A 4O84A 2HDKA 3B48A 1Y1SA 1YDHA 3PZPA 4XVQA 4QXPA 3VPDA 3CVXA 5KG3A 1BCSB 2P5YA 1OZAA 2XDYA 3JQ7A 5TF4A 4DLSA 2AEEA 2BD0A 4HGNA 3TD6A 3WLTA 1EXDA 3ENZA 1R4NB 1M1YB 1Z5PA 3HP7A 3MILA 3T34A 1P1IA 3E9MA 5CA1F 1KAGA 4K46A 3CLUD 1G8JA 1QZTA 1U1CA 4JXZA 4EVRA 2C2WA 5JVDB 2I67A 1CB0A 4JI7B 4KH1A 3U13A 2C9BA 1IZ7A 1ZI8A 5G0VA 1BXRB 3DTYA 2FFBA 2JNWA 1H2ZA 3BD6A 2Z1DA 2IKQA 2O4CA 3MUNA 3GTGA 4JGGA 5DPMA 4GEGA 3MJ4A 3WK6A 2ORED 4CM6A 3VDXA 1DCKA 4DPMA 4IOLA 3TSZA 4ZJUA 1BCRB 1SPXA 1I1OA 2ZITA 1UBHS 4W4TA 4HWOA 4FN4A 2BHLA 1P2UA 4M0CA 1JFLA 4NMWA 2NPFA 3WGLA 4WJLA 1ZHOA 4ASUD 1TUBB 3TE6A 1K0FA 4ECYA 1S4MA 2Q6LA 2WUVA 2YZ7A 3L0IB 4LC1A 2G36A 4BB9A 1QONA 4BZQA 1O7JA 3RS3A 5LOVF 4FS1A 1P6UA 3TQHA 3UK6A 1DB3A 4WCVA 2GLXA 4JJ4A 1LBIA 1MF7A 1IEWA 2JJ1D 1UAAA 1FOEB 1PE0A 3G6KA 3IPAA 4Y1EA 4NHEA 4X64B 1RPZA 4P3XA 4ZQEA 1IRXA 1JXLA 1KNXA 3V8NA 1KK0A 1E1RA 4ZALA 3F5QA 1GNTA 1PIWA 4A2AA 4FD2A 4NNPA 1ZUWA 1EIWA 5JC1A 3A9VA 4P7KA 5I4BA 5K0TA 3F9CA 3FW1A 3IIJA 1SC1A 3WHKA 1I94B 4RZSA 1DMRA 1JKMA 2EJTA 3G5UA 4HQRA 1YE3A 3V4RA 4TUYF 1W30A 3DF7A 3EZYA 4K9LA 3WSWA 1LPBB 2EJ3A 1I6LA 5DRTA 4ITRC 4EMUA 5KDDA 2Q27A 2OO3A 5BWOA 3KPYA 2YY7A 4OQ4A 1A5BB 5TMBA 1XD9A 4XIYA 2NUPA 3V4VB 5HOQA 5J47A 3CIFA 5LXTA 4F4UA 3TI9A 5JS8A 1DWOA 4MK4A 1Z8DA 2Y6UA 1F8GA 5KFYA 3D8SA 1SHTX 5J23A 3GIKA 3W3ZB 2H48A 2JFVA 3F1LA 2Q5OA 3JR7A 4F6LA 5K4HA 2IEAA 2O20A 4R2KA 3KQSA 5EVCA 3LIIA 1TM1E 1ISSA 2EJVA 1NUAA 1U3GA 3K53A 4FGJA 4KW7A 1JYFA 4Q37A 3CNBA 1T3NA 3A6EA 3TOVA 1LLUA 1F8YA 2WU3A 5DBGA 3TPFA 1EFUA 1MT3A 3K0SA 2QD3A 4G3XA 2JGDB 4H60A 2ZJ3A 4JJFA 4OYHA 4RYDA 5CYFA 3R7DA 5KCZA 1TO2E 3K5PA 1KVTA 1K86A 1QIIA 1Y9DA 2IHBA 3NHFA 3P0JA 4LYDA 2YNMC 4UVGA 4ZOAA 1F2DA 5TGTA 3NTXA 3RBXA 3LY5A 3ROPA 2GF2A 2VPWA 4WEOA 1JUDA 1SG0A 1VSUA 1Z39A 4PBTA 1SIUA 3DBLB 2BRUC 3EIFA 2RKOA 2ZK7A 3CEHA 4NK4A 3PX7A 4HVLA 1M2HA 1R6UA 5EGSA 2XT0A 1SXJA 3IP3A 5IW8A 2UYQA 3BF7A 2ZYDA 5AUQA 3GMTA 3OU7A 4GBGA 2IW1A 2Y05A 3G0CA 1H3EA 2FQ1A 1BHSA 2HMYB 2IU4A 1ONOA 4ONEA 4YREA 4EJSA 2BJHA 1S3GA 5FPKA 3COJA 2XITA 1IONA 3ST7A 3II6X 4TTQA 4MWTA 3K94A 4DL7A 1YS1X 4IQ8A 4F3NA 1TQ2A 1X1TA 1N9GB 1YI1A 2AS0A 3HL4A 4OUDB 1QG6A 2WIJA 3DT8A 3WGJA 1R27A 3TGPA 3GPLA 1XZCA 3GUYA 3ICQB 4M1YA 2GPAA 1KP2A 2EP5A 2JCXA 2P2GA 5E1OA 4HGRA 1X87A 2BQUA 3F3SA 1GFWA 1CTQA 3RRYA 5ENDA 3W4JA 5TLSA 3G7NA 2QR5A 4HXFB 5DSXA 2F59A 2F3PA 1U0SY 1WUTA 5F5XA 1UJ2A 5BSTA 4KQWA 3SZMA 4C87A 5JNVA 3HN2A 2FV8A 3FLBA 1HNZB 3ZWAA 3C5HA 3PSHA 3ICPA 4Y67A 1OU0A 4UUNA 2XVMA 4YMUA 1I10A 2B9VA 4XD7D 5JYEA 2ZDHA 1QKJA 3BILA 2G6BA 4YRQA 4G4GA 4I46A 4OSOA 5EJGA 3RGWS 5LDHA 3UV7A 1AQ6A 5D5PA 4YJ2F 2BR4A 4D8VA 4C4YA 4NU5A 1RE1A 5D1HA 4LY6A 2FSUA 3WWOA 4QDZA 4DNPA 1E0DA 3GD5A 3UUWA 2J3LA 4MDFA 4LF9B 1ZH4A 4Q15A 2F55A 3IUEA 3P19A 3HKZE 3OBIA 3M4XA 4MRRA 1IUKA 2WHEA 3O8RA 3KKLA 3F6EX 4B6EA 4NICA 4KN8A 4WASA 1FVOA 2H1VA 3ABZA 3Q7TA 1LF5A 1WKVA 1FEZA 3N2GA 1NY6A 4N40A 2CLOB 5I7HA 2QORA 1LWOA 4DT1B 2R1UA 3FMGA 4ILEA 3EFBA 3GQVA 2D8AA 3PHBE 3I05A 2C4UA 5FBQB 3PW4A 3TB4A 1HQKA 3T1QA 2VSQA 3OCCA 3H4DA 1H0KA 4RNMA 1SUPA 1VHJA 1T3GA 1KSJA 2C3OA 3C3BA 3P0RA 5DBHX 2HPAA 3SYLA 2JBAA 4JJGA 1E77A 4PV7A 1PJCA 2AZXA 5J43A 4K03A 4FPXA 4UHEA 2IBMA 4F3CA 4PRKA 3M6MD 1Z62A 3ZNNA 5E3HA 4DPLA 3F5SA 4PRLA 3C7TA 3DQQA 1JEJA 2VP6A 4ER6A 5JD5A 3RC8A 5JUMA 4PICA 1MZBA 1L8LA 4IDBA 1YAHA 3GJSA 4RV4A 5BSWA 2FSPA 3UHPA 1W6UA 1ZHHA 4AZ3A 2ZSDA 3WLIA 3PE3A 1FUEA 2GEBA 2C96A 4MWCA 1TLLA 2ZUBA 4NP6A 2IV7A 2X6TA 4OHYA 4Y98A 1RK6A 3C39A 3VOSA 1UPTA 3MINB 4M9UA 1KZ4A 5IAGA 4PQEA 4ZO8A 3EGEA 3HSKA 1XP8A 3PJEA 4DQUA 4CMDA 3L8ZA 4PTLA 3Q7PA 4GOLD 1H69A 1QG0A 2J9YB 1KUTA 3OSNA 1DJOA 3HEBA 1WSWA 1NVKA 4GZLA 4R9VA 4TQSA 2NX2A 3QVMA 4B2LA 5DGIA 1H2AS 1W44A 4IXMA 4OQXA 4C3VA 5JSKA 3T35A 4F8JA 3RYCA 2VAVA 4NFSA 3OPYI 2E87A 1AD2A 2OHFA 3FZYA 4IOJA 4OJQA 4OYLA 3JZIA 4HC4A 1T9BA 2Q46A 3QGMA 4KIGA 4MIEA 1JXQA 4KMOA 1X77A 4RFSB 5F7ZA 3D5QA 2ZJBA 4KI0A 4YJGB 3EXHB 5JCJD 4ECTA 1XAGA 2OQIA 3M2PA 4LNHA 5FWXB 1N57A 2IQIA 2HRBA 3C41J 2P67A 5FIUA 2BFWA 4J49A 4E4RA 1IIRA 1OTHA 1PKEA 3ZCPA 1MGOA 3G9XA 5TPZD 1X92A 3EC1A 1A27A 2P9CA 1KQFA 2OYSA 3LUPA 1S2NA 1D6NA 4Y2YA 4LZPA 3A1UA 1HLFA 3CRQA 4WLVA 5C1IA 3E61A 2NO6A 3ZDDA 3ZLJA 1NI5A 4CMJA 3G8AA 2Q2UA 2QMHA 1TW3A 1BX0A 2ZIGA 1K63A 4KFTA 4PXSA 4JKYA 3CG0A 4DIBA 4N5IX 2M6SA 1R8JA 5IDXA 3O8BA 2OZLA 3TTUA 3FGPA 4LSXA 2PLRA 3ULKA 2VUTA 3LQYA 1YXMA 2XODA 4B7XA 4ZOEA 1V7ZA 1W6RA 2BMAA 3PJGA 5KJCA 1RC8A 3QP9A 1YCFA 1YQEA 4WLUA 3RUHA 2JJYA 3V4SA 3K8ZA 5CK5A 1N6PA 4XXHA 4XFJA 5J9FA 4XYBA 1KIFA 2PAFA 4GLLA 1T4BA 1OT3A 1Q91A 5FL7A 2X76A 3NV9A 1Q0SA 4KQJA 2PX4A 2OWEA 2PMFA 3R24A 4KRGA 3TB6A 4ZQBA 3Q7QA 4QBFA 4JYMA 2WHPB 1U7PA 2IYOA 5EVJA 1EGVB 4ZC1A 3WL4A 2XDQA 3CPEA 3LDUA 4PAWA 3TY5A 1M67A 3PDCA 1UFKA 4LXXA 2X4DA 3AR3A 2GRAA 3THYB 5A7HA 3SQLA 4BWFB 3E8SA 2PBRA 4B85A 1JQEA 1LCIA 1CY6A 4Q1CA 3HE3A 3M6UA 3RKRA 5I7OA 2CVZA 1JPJA 4CQJA 4DMUB 2PBLA 1NI4B 5CNIA 4Q7EA 1E0AA 2J09A 1C29B 3INRA 3ZE8A 3ZY2A 4OB7A 1SCDA 4O7WA 1GZ7A 1W4ZA 2IP2A 3G5MA 2B9EA 3KU4A 4IFEA 5E95A 5IK2D 3P2YA 2GK3A 3I6BA 2ZBQA 1KHHA 1TYCA 1N5OX 2DOKA 5ELLA 3W9SA 3VR4A 3AVWA 2FCRA 4IMRA 4AULA 3CNQS 4CKBB 4JZYA 5JWRA 4AF8A 4Q0MA 5C5IA 3QX3A 5LMZA 1IHPA 3T5LA 3KD3A 3PE4A 4ZODA 4A15A 1GUDA 4HAOA 3NNNA 4O1MA 1GWNA 2D1FA 3OCJA 3OEHD 4Q45A 1KERA 2WAYA 1P3DA 1XEFA 3QZ7A 5EOYA 3BH7A 4MRSA 5KX5B 4APMA 4M1WA 4CL8A 2I2FA 3SYRA 1TUGA 4QATA 3T95A 2MINB 3TQ1A 4PCLA 3TXAA 2Q1WA 1T5HX 3OM8A 2QPLA 2J3KA 2V8OA 3DLIA 5TVGA 4QM6A 4P5DA 4NYIQ 3ESDA 1XMOB 1WHSA 3NPMA 3WA7A 1C0EA 4L5IA 2PS9A 4PG4A 3G8CA 1DRVA 1BROA 5JT1A 3PFIA 3B36A 4GPD1 1I6UA 4JI0H 3QVSA 4GT1A 3BCHA 3OOWA 4WXEA 2RGAA 4C6TB 1Z36A 4KI7A 3Q0IA 4LJAA 4JP3A 3ZV7A 2OV4A 5CAEA 2JFZA 3DDCA 3FOAA 2XIGA 1W34A 1ZESA 3G2OA 4YWHA 2DBYA 3AUAA 1YTUA 2WJ6A 3M1AA 4KXQA 2E49A 3NTOA 5BWCA 4KE6A 3T4EA 5B5SA 2TYSB 3EZFA 2BR0A 4R51A 4X62H 3Q41A 3MJVA 4ZKEA 3RNLA 1DIGA 2COGA 4YRAA 4C3UA 4JB2A 2GH1A 4YJ3B 3U44B 2GRUA 4YJ3A 1LI5A 1FP1D 4YV2A 4MYRA 5K4AA 2O06A 4EUHA 1ZC4A 5AKXA 2IEZA 2ZR0A 3P9ZA 4OAPA 4DJJA 4XYLA 4BJHB 1DQSA 1MKYA 2GZ3A 2WWGA 2K6GA 4G5GA 4YGYA 2ZIXB 3QVTA 4WIAA 1CY1A 2ZYGA 3EWAA 1P6XA 4QHYA 1G98A 2WTBA 2AIRA 1NVMB 1NHGA 2C8KA 2OCLA 4QBGB 3U40A 4YO7A 4QNNA 1HL7A 1W5AA 3W2EA 4C4XA 4E5MA 2PU5A 2Y92A 2WKPA 3FR7A 3WVNA 4B0PA 5C7IO 1H22A 4JJ8A 4TV8F 1SC6A 4MOWA 3COZA 3K9FC 4EX6A 3M9WA 3NAGA 4EMSA 4YRLA 1VBMA 1UPAA 2YFQA 3O21A 1ZIYA 5E7JA 4A36A 1RIIA 3W06A 3AHDA 4JDUA 5LZ9A 1FFAA 1INLA 1HK7A 4A2BA 2UZAA 3RHZA 4ZI3A 4MQ4A 5J3JA 3L5OA 1KBZA 1YQUA 4M7PA 2VHZA 4XB1A 5DHQA 3WLLA 3SYNA 2IH5A 2ETXA 4GI2A 1BVUA 4X7MA 4E30A 1M2EA 1GL3A 3JPWA 1DC4A 1S4QA 4X62B 3FTDA 3DAHA 3RVSA 1M76A 1PEYA 4CL2A 1HE5A 4ALNA 3IP7A 2QUBA 4HDMA 2FSFA 2J6IA 2WSIA 2ZREA 1IHYA 3CLSC 4KYVA 4L8LA 2W90A 2Y4NA 4CM8B 4UTRA 4Y2XA 4JXKA 2NTNA 1H9CA 1V25A 1EJ0A 2JFQA 3NXKA 3QITA 4JLBA 1HETA 2C3PA 3EVFA 5F2EA 2C2HA 3ICEA 1YZTA 4A7PA 1JWLA 1VI5A 2PZBA 1VLLA 1BD4A 3OUUA 1ZCBA 1DTEA 3FDFA 4GR9A 4A3SA 2IYNA 3PUXA 1EFVB 2PUEA 1ZX1A 4RK1A 3PZBA 3NNDA 2Q2WA 1BS9A 1U5BB 5FOQA 1XDNA 1ICEA 1RHQA 2R3SA 3D3EA 3GY0A 4GM1A 2OCIA 4YDHB 2B5OA 2Z2YA 2PRYA 4CM9D 1DRWA 2CBGA 3NRCA 3GQBB 2ZATA 1C7RA 1JG3A 2PTHA 2N75A 1T2FA 5D86A 3C3CA 1Z0FA 1NVUQ 4BBRG 1NV9A 1QB7A 2OHIA 3T5CA 4KIJA 3W5SA 1Z2NX 1IXZA 3OY2A 1DCMA 1LS6A 3PFNA 5C44G 2JA7A 1QGDA 1UH5A 2OXCA 4FYWA 2X1HA 3C3MA 1RLUA 4FFPA 4AYXA 2H65A 2Q3JA 2G70A 4IFIA 2GAIA 1OZHA 3K9CA 2LPMA 2Z8YA 5JC8A 3AILA 4DR1B 1YHZA 2GN2A 3ZLBA 3H2JA 1LK7A 1WDTA 1MQ9A 1GPUA 1NW6A 3L8CA 3OJLA 4H17A 4QTTB 4QYIB 1Z4OA 1D9ZA 1P5ZB 5CFMA 1JIJA 1IQUA 2QN2A 4YCDA 5EJ7A 4FCCA 1NX6A 1OI3A 2ZPTX 1U8UA 1NUPA 2Q3DA 3P2MA 4UNPA 3TE7A 3LBFA 1J23A 2CJWA 4DJFC 2OILA 1Y3IA 2YICA 2EU8A 3A4LA 1ARZA 1NQAO 3JWJA 2V6BA 3DV9A 3PHJA 4M37A 4HWTA 1VSVA 4TQRA 4LFCB 3EGXB 3UJ3X 5ALNA 4E5KA 5AVJA 2L82A 4MW5A 4P58A 2GF0A 4MGEA 4B4UA 4K88A 4H3SA 1E89A 5CP8A 1BFDA 5CGZA 3QUSA 4F4CA 5K2OA 1EHIA 4FHZA 4TS1A 2ROQA 3VOTA 2JIZA 3FNFA 4KB5A 1RI4A 4M9CA 4DY6A 4Q48A 2QMEA 4CG1A 3P1JA 3LPLA 2QW1A 5JFTA 5TT1A 1AVTA 1D2MA 1KHTA 5KYYA 2ZIFA 3HKDB 4AYBA 2CDBA 4JASB 3RJTA 3R3VA 1I4EB 4PTYA 3S3TA 3UVEA 4RWZA 4D9EA 4OP3A 4D4JA 2Z4SA 4FVTA 5T6MA 4ZV4A 3CHYA 3EEYA 2CNVA 5JCZA 1MO5A 3E7WA 1ZIXA 3QOFA 1KS2A 5BRJA 4IIEA 2R6CA 2O2ZA 1U8TA 3NDPA 4OQDA 4LV5B 4LFBH 4QREA 3D2AA 3KO8A 1CBUA 5FFMA 4ZEVA 3IAS6 4Q9DA 2FN4A 2HWUA 1BWQA 3KDPA 3EA5A 3DKIA 3KKOA 2JDID 1E61A 2MT9A 3HQ4O 3P2KA 4ENTA 1Y4AE 3OTOH 2JRCA 1CR6A 1ZHFA 4FEYA 4GNKA 4R8VA 2B7CA 4ABTA 5JPCA 3PYXA 1YOBA 2ID7A 3SJAA 4IIBA 1U2PA 1VHQA 1YFLA 4HFJA 1GXSA 3QE9Y 2C4NA 3LK6A 2JGLA 3CN9A 4NS4A 1B15A 3KQOA 3LKVA 3SLKA 3DDSA 4Z7NB 2FUG6 1JDBB 2YY5A 1Z4KA 3NETA 4CQMD 4NYJR 1G7RA 1NQOA 1ZH6A 2EW2A 4KDRA 4S35A 4YQFA 5YASA 1J07A 3ZJVA 1T5TA 4BL5A 2ZDQA 2VQFH 5I5SA 1R5BA 5DT9A 2WY2D 4KZPA 4J0GA 4QTUB 2ZE8A 1T0JB 3CPHA 4LY9A 3SDSA 3E22A 2C92A 4EHKA 2YOGA 4JFRA 1JI3A 4JIGA 2OR3A 4IZ6A 3MOGA 2D0DA 4XZ3A 3GFQA 1ZAUA 4DADA 3MINA 4Q1EA 3WIOA 3L9XA 2HXGA 1Z6XA 2JHCA 2NO5A 1JDBC 2AFIE 4G67A 1QH0A 4X20B 1JHPA 5FEUA 2XGOA 2EZ8A 2RMKA 2W8BA 4QWWA 4CMAA 4Q4HB 1G60A 1P5HA 1S8NA 4IFTA 3TOXA 3PQEA 4MI6A 1V96A 1EXWA 2DABA 3BTUA 4BNFA 4FW9A 1TMKA 4BVJA 1J90A 1JXOA 1OFUX 3AW9A 4E5PA 4F85A 5B6JA 5LWHA 5LLTA 4L0MA 2H8KA 1DQNA 3DKPA 4DC1A 5LQCA 4RVFA 3T4UA 4WT7A 4UBNA 1FNNA 1F51E 1DARA 4O4LA 1DWUA 3PHGA 2OCYC 3TSAA 5ITZA 1XNRB 2P6MA 4KXVA 1KO7A 1C14A 3BXXA 3REGA 3QE4A 2W93A 1WPRA 2WNSA 4X41A 5MDHA 5L6LB 3HWRA 1NBWB 3DTTA 3FFBA 4OOEA 2QLLA 3ZI7A 4ENSA 4KBFA 4V24A 1FW6A 2NTJA 3H3VH 3QLVA 1AQNA 4EBCA 1R8XA 1EDOA 1QVVA 4OGKA 3TTVA 3W5AA 4CEJA 3OJWA 4P80A 5CEEA 2Z3ZA 3A6LA 3PWZA 4PLHA 5E4FA 1QANA 2R96A 2I7XA 3M8KA 4D8UA 1U9JA 1ZNQO 3IO3A 1RE0A 5ICCA 4F5ZA 2RAUA 2G3YA 4B81A 4GLOA 2NLOA 4ZYTA 4HRVA 4Y2UA 2OPHA 4AT1A 5A4IS 3I2FA 4LYEA 5L3QB 1LZLA 3C14C 5HG0A 2QE7D 1L0BA 4PSUA 5BORA 1KDOA 1GY8A 4QBTA 4N7BA 4TKVB 4DQKA 4O4JB 1P2FA 1NXTA 2ZRFA 2Z04A 1F3LA 3QFRA 5C8YF 5AI9A 5AW8A 2QN6A 4LJRA 3CUTA 1F1JA 2WT9A 1E6LA 5I9BA 3I6ZA 4ESHA 5C7OO 3O8OB 4D9CA 2I6GA 1R8YA 1UOEA 1TGYA 2Q9BA 2Z8ZA 3V1YA 3KYJB 4CF3A 2XTNA 1JYSA 1R0LA 4IHJA 2B36A 4WLEA 4QFBA 1MGPA 4KAJA 4AB1A 4LSGA 4L7QA 3AR6A 1C50A 1D4ZA 1KR2A 2X0IA 3FIUA 4CC6A 2EWVA 2C2OA 5L40A 3PQ7A 3IE2A 5FUMA 3CW2A 1FMFA 3G9QA 1L4MA 3KSDO 3TRDA 3L7OA 4HXGA 4ECRA 1M6VA 3S4YA 3TSWA 3QKRB 3EB9A 4GPBA 1XCBA 5F9NA 5AVZA 1RHUA 2I7TA 4DDUA 2AQIA 3M3DA 3O90A 4BFYA 1YZQA 3JWHA 4OGLA 3TVYA 4B3RH 2EZ4A 3PVCA 4NMLA 2YMLA 4U2KA 1KGDA 4EJSB 3ZGYA 3QVWA 3OQHA 2BI7A 2GNPA 5T8KC 1P16A 3HOXG 5BQPA 2P4HX 4OHUA 4RVGA 5G40A 1RYEA 3ZGXA 1RYRA 2GX6A 1Z08A 2UKDA 2DFKB 5EMLA 3FKSD 1MMFB 1I9CA 3QVXA 2A5DA 3G59A 1K8QA 2C1EA 3OY7A 3RAJA 2VNAA 4E7PA 3K0CA 1O0SA 3DBLA 1YIAA 4O59O 4P33A 2WOOA 4RKEA 1SCAA 4AMUA 1GNPA 3R3ZA 3ZCUA 2PUCA 5GGYA 4I3FA 1L8OA 2P9EA 4J0CA 5L4LA 4N12A 1WZ2A 5H59A 3PR5B 1Y7PA 1X1BA 4D6PA 4GRDA 2P3LA 3B70A 4XLZA 1VGVA 1CWUA 3H1AA 5ECWA 3UUEA 3L07A 3WX0A 3OQPA 3FPSA 2FLWA 3D8TA 2QV0A 3B1XA 1NJ5A 1NF8A 3B38A 2QT9A 3CCCA 4GNRA 1VQ1A 4KGZA 1ZKDA 3GJYA 3FRHA 3U3RA 4BY9E 3O4JA 1KGSA 4WKGA 3ET4A 4R6XA 5DVZA 2W42A 1V3VA 1YRHA 1XTRA 3PT5A 1ZK1A 2Q99A 2ZUUA 4LBZA 3ZNQA 5HIAA 1EXMA 2AX4A 4R1TA 2X1MA 4DJ5X 4KXUA 4M9ZA 4WOBA 2ZSUA 4K0RA 3JAKB 5EUMA 1DRKA 1E9AA 3RK0A 3RREA 1SXHA 2RHJA 1H1LA 3OT1A 4FYIA 1IG0A 4KVFA 4QUHA 4ZGGA 4YUAA 1MJGA 4QXQA 5CFOA 1I2LA 1Q57A 1JPNA 1U5CA 3EIXA 5A4JA 5LXTB 1QRSA 3IXLA 2Q1XA 3Q8WA 2AI2A 4RBNA 4X8OA 4ZDIA 3C43A 1B8NA 3X1DA 1O94A 3SS8A 2XXAA 4CMEA 1J09A 4GMKA 1ATIA 3EBLA 3E1SA 3L93A 2JW5A 3DVAB 4Y1RB 2XRMA 4PFKA 1U8YA 3EULA 1RM5A 2B2CA 2C20A 3HYLA 3ISVA 5JTTA 2V03A 3FHOA 1VMKA 4ECZA 4KNYA 4PVDA 5A4DA 1RWQA 3IUQA 1NUQA 4OJMX 2C9CA 2UXDB 4JQOA 4ZDWA 1JBEA 2FOLA 3LJKA 2MSCB 4OXKA 5HR5A 3M1LA 4JYBA 5DNDA 2I4IA 1CF4A 4ZU6X 2DY1A 3IESA 4V03A 1BU5A 1VECA 2OGWA 4K6HA 3WQSB 3N43B 1J0AA 3LC0A 3DBIA 4HWKA 3WSVA 4EQ6B 3AKDA 4JEIA 5JAHA 5LPNA 3HRIA 2C2RA 3U37A 1Y1WG 2CCKA 3P71T 5BW4A 7REQA 4AKEA 1FPQA 4DLRA 4A26A 2ZWAA 1I7LA 1GN8A 3B5IA 3R6GA 4JB0A 5D01A 1Z82A 5U4QA 2EV9A 4DQDA 2DFTA 3OPYA 2I34A 2JA5G 4IIJB 4R5HA 2QRVA 5E9JA 2VCHA 3L8EA 4MUBA 1UM9B 4NWIA 5C8YB 1KYXA 2X1LA 2PXCA 4RKYA 4OHFA 4QNRA 3MBIA 3RARA 3O95A 3B6EA 4X91A 3MAJA 1XC7A 1CJMA 4D81A 1WETA 3IUYA 5IMBA 3T1NA 5AKLA 4ZMRA 3INYA 5L9XA 3MEQA 4MDYA 4WK0B 4MGIR 4JC0A 2WB2A 2X9NA 4LQ4A 1QJ4A 4Y9TA 3SI8A 4RVCA 3GN1A 4MLZA 4BNTA 4U7WA 4GL4A 1T1GA 4NSNA 1R4NA 1CQXA 2X5NA 2OV8A 3TIFA 1NFFA 5KOYA 3GTPA 3GLGA 4CCSA 1Z5NA 2V7TA 4M9XA 3QF4A 1DIHA 1JGTA 1PYDA 2B2NA 3C3WA 4Q3OA 4TQGA 3W90A 5K0ZA 1MR3F 3H65A 5B3AA 1MJFA 4J3FA 4B40A 1NVBA 3IEUA 2HQ1A 1CZOA 2E6KA 4DBLC 3L9WA 4R1PA 2DBZA 4OQPA 1C1DA 2Q3FA 4J76A 4LAFA 5JMTA 3T54A 2PMZA 1JAXA 3C5EA 1C0PA 3EWNA 1E9DA 2CLDX 3L40A 1N7HA 1BDJA 1OI4A 1VL6A 2GOYA 2Q8NA 1EM6A 2ZYRA 3INGA 3O74A 4L15A 1L7VC 1G63A 4JLOA 4ECVA 1U4OA 1IHUA 1JTVA 2CWWA 4INPA 4LRQA 4C5CA 2EKLA 1NWCA 3BWYA 3KWFA 2GJ9A 4H18A 5H16A 5JLAA 2RHHA 3O0TA 4RM3A 2HA5A 2WKWA 2WU4A 1ZM3A 3MGCA 2DCUA 3KEFA 3RPEA 1RR6A 3C1OA 1E1CB 4RVUA 4TYMA 2W58A 3QLUA 2HGSA 1N32H 4LHXA 4E4YA 1E5LA 4WBNF 5DHTA 2OENG 4G0QA 1HMPA 3N6XA 1NE7A 2BR3A 3IT0A 5K0JA 3BL8A 3V8PA 4PSVA 2HLNA 1W49A 3KHHA 2HWYA 2L17A 2HO4A 3KZCA 2FUKA 2PGDA 4B33A 1U3CA 1THZA 1KAOA 2H5IA 3U62A 2V97A 3GRKA 2HJRA 2H63A 3RSHA 2P35A 5HBRA 3RI3A 4KJZA 3V7YA 3D7KA 2YXEA 1JILA 1CB7A 4Y2VA 5M29A 2QMYA 2PM8A 3RVMA 2ZP1A 2ASJA 4DCCA 3MGGA 3EC2A 4B1FA 3K09A 3EXFA 4M8KA 4DUGA 4WGGA 4EB6B 4ND6A 4ETNA 1XPRA 4PX9A 3VDRA 1ECFA 3F8SA 3LPNA 3OHPA 1EJBA 4HYKA 1WJGA 1SBQA 2RG7A 2JFGA 3M83A 4NBUA 4R40A 3LHKA 3FF1A 1MVLA 1WNFA 2O6LA 1NMXA 1G4UR 2M1ZA 2R44A 3FTQA 4K8OA 4LGMA 5D3MA 3WNDA 5MGBA 4S04A 5HHTA 2V1UA 4JQCA 4JI8H 1II9A 4JNCA 4RE5A 1SU7A 1RRMA 2WAXA 3OA0A 5LC1A 2VPSA 4D9GA 1CUZA 2CVQA 4D9KA 1F14A 3LKBA 2VJCA 4X45A 4H7FA 2F9FA 3ND8A 4WX2B 3WL6A 3H6KA 3F6PA 2BVNA 3GIIA 4N03A 5KDLA 3RNOA 3TRHA 2AFHA 1WHTA 4JVLA 1I7DA 4P36A 2PIAA 4HYTA 3KSZO 2C5AA 3E3OA 1US8A 1W73A 4Q4AA 2JCBA 4YPVA 1WUYA 3G7UA 3DTVD 1SUCA 1XN1A 4FGWA 3TNJA 1KYWA 1UINA 3GVHA 1RXSA 3OLCX 2WE8A 3T8YA 3UV6A 1U04A 3WDMA 2QTBA 2RGCA 3G5LA 3GCWA 4Q9JA 3FBGA 5D00A 3UJ7A 4B3JA 4Z1MD 4IV5A 2O8CB 1T0UA 1CUUA 3NU1A 4OMFG 4H7JA 3EVBA 1OLUB 3C8HA 5MFZA 1GRRA 5ELMA 4N7RA 4P2BA 4P5EA 3KUUA 2AOTA 1KVRA 2P7HA 5JSZB 3JRNA 3QLUC 2XIJA 5IKMA 2VHYA 5DM1A 5B3KA 1J8MF 3JAMA 1ESMA 4GPEA 4MW7A 4RUAA 1CY0A 4ZI7B 3IBCA 3OPXA 4X8MA 3TWOA 1YR8A 4ARCA 2B61A 4CIDA 4R3WA 2D4HA 1FP4B 1A7KA 3E70C 1ZI6A 3MRSA 4RCYA 3UK0A 4J2TA 2B37A 1K66A 4MGKR 4L4UA 1FU7A 3PCRB 5K3OA 1ZMRA 2CNKA 1SVMA 1NQVA 3JD0A 4YLYA 4HDKA 1QR2A 4PBCA 1Y8RA 2RHCA 4DDVA 5JJBA 1L8QA 4PY2A 2YZMA 1BTOA 1Z47A 2WVJA 4WFKA 5LMCA 4HSEA 2QD4A 3ETJA 5G1OA 4K05A 4BO9A 1ODJA 3F5FA 4R7GA 2R4UA 1CJKC 3CRNA 4NBSA 4Y2SA 1EKFA 4ME6A 4A6PA 3V42A 4A8TA 5KOIA 3KDSE 2ZQ5A 2GBIA 3EFHA 4MMZB 4UMFA 4LX8A 2R8BA 3ZBUA 3VR0A 1MIOB 2K7ZA 5ADHA 2R6HA 3T9DA 3SHVA 1LVUA 5I9TA 3IYLW 4L3OA 1QP4A 2BR5A 4L1KA 1QR6A 1U11A 2AJ8A 2P7IA 3GELA 3QKUA 4IIUA 3STWA 1T24A 4UASA 3GOHA 4QO7A 8ABPA 2AFRA 2BLNA 2H17A 3L7IA 3ZNOA 4YYZA 3AL2A 1MPXA 4LVNA 4KACA 3GLHE 4ESEA 1XQYA 1SU8A 1GPKA 2GXQA 1U7TA 4HFNA 3ZTYA 4B2IA 1R3DA 1O4VA 1S3FA 4OGWA 3KXLA 5FD8A 3PNBA 2GYVA 1ZMBA 3W8DA 4PSAA 1SVUA 1OH6A 2A6PA 1V2GA 3PEFA 3DD1A 1WD7A 1YR3A 1ZJ4A 1V1RA 2EATA 3O1LA 2UAGA 1CUVA 1CKOA 4IW3B 4DR3H 4Y0AA 2VOEA 4ZO6A 2MSEB 4EMBA 1YRQA 1NW7A 1U7ZA 1ZCFA 4JOSA 1ANKA 2F8MA 3ML1A 3H2YA 3R0IA 4RVDA 5D1OB 2BJVA 1DAKA 2OD7A 1ZSYA 2ZPUA 3W3AA 1B33N 5AOCA 4X0EA 3MHTA 1R0CA 2DFVA 3V4LA 1V37A 1I4TD 4L9AA 2ZWVA 1LC0A 4J3JA 1AB5A 4ZGBA 3G9TA 3B89A 1RAFA 3SKVA 1P7WA 1JG7A 2I3DA 1XRRA 3IERA 1PFKA 4Q24A 4YRTA 1ZD1A 4ZJZA 4TLDA 1QRTA 3F4KA 4RX1A 5DLEA 4YHHH 1GZ6A 3QXCA 4KYUA 1QGED 4K6GA 3TRIA 4BX3A 3U5TA 1N78A 3TQIA 4TYYA 1U0GA 4QJ5A 1W88B 3IPLA 2PMBA 5DLFA 2AA3A 4DLTA 2ZJTA 4A8JA 1Q7EA 3H8VA 4DBLE 4KPEC 3USES 3GYBA 4U9UA 4URWR 5BV1A 3EIQA 1XD2B 3FCYA 2F6RA 2SNIE 3I2JA 3I30X 3CXUA 4FOSA 4I1VA 5I8PA 5LZ4A 2I2WA 3IJPA 4KXYA 5CXXA 4N5HX 4IJUA 1F48A 3B1VA 3D6TB 2Q0XA 3H2BA 3IOYA 1ZINA 4IDGA 2ARKA 1X80B 3M9OB 1KF0A 1UK9A 2B21A 2YZNA 2O7VA 1WCYA 4UM7A 3PWSA 4GXTA 1SFRA 3A4VA 3DXXA 1ZL0A 4G0ZA 1QGAA 2CHVA 1DS6A 4XKJA 1IHDA 3H7AA 4D4HA 5IXYA 2NV6A 3F1KA 4IEEA 1VLQA 3WJ7A 2XTJA 2WM2A 2QN7A 2JJ1A 5E6RA 1HGXA 2KSQA 3DTVB 3I83A 2R1ZA 3BA8A 4RKRA 3ZHOA 5KNDD 3TCXB 4QU8A 4DR5B 3B8EA 2IYEA 3L6UA 3U16A 1QYXA 4YHHB 1F7UA 5HZGA 4CLRA 1E99A 4X71A 1VSTA 3RYHB 3UB4A 4HDCA 3RJMA 2FH5B 1FRZA 5LQKA 1GUZA 3KJGA 4JLUA 2BHNA 1E9RA 2HAEA 4HYEA 5JHGB 1C8BA 1IK4A 1KEUA 3FJ1A 3BEOA 5C4GB 4QBIA 5FO1A 4EKDA 1UZUA 2QSYA 4PX3A 1LFAA 1AN7A 2GN9A 2WPDD 3DKRA 3N1UA 1CHNA 4GKBA 1BOFA 4DV6B 3S1LA 2X3FA 3HVKA 1DADA 3I64A 3R74A 2GQ0A 1ZU4A 4ZHQA 4ZZIA 1S7CA 2OBBA 2ATLA 3D6MA 3R8XA 3ZCRA 5BV7A 3CNHA 1N1DA 3SP1A 5H81A 1R8QA 4F8YA 1GKKA 1DQRA 3TXYA 1XQWA 1NLFA 4R2MA 2IDJA 5KVQA 2ZUTA 1O9GA 1QH1B 4ND8B 2Q9AA 5FL3A 2GM5A 4TQ9A 5KCMA 3RUEA 2YRFA 4IZIA 5JNRA 1GL7A 1XWFA 4BNJA 5FLMG 3U4QB 2O2SA 2YQZA 2IPMA 1J70A 2QYSA 3C87A 4GC9A 4YIKA 2BHRA 5KU1A 4GMGA 2V74B 4NBNA 3IPYA 2EDAA 3FPGA 5ALTA 4AI6A 2SKDA 2XGMA 3H8SA 2FZEA 1W2GA 4I9HA 2GZRA 4IEFB 3ZJUA 4LFBB 5G0WA 5L3SB 1RBYA 4HDQB 3G3EA 4IS3A 4KK3A 3O8QB 1M2FA 1NLZA 1SD5A 1X1SA 3CC8A 5KNBA 5IS2A 2ZM6B 5A4AA 3KJFA 5B64A 5F3DA 3VBCA 2W2NA 3SBDA 3UNXA 3QXJA 4I3GA 4BFZA 4EG4A 2CW7A 3CUKA 4RU1A 2F3QA 4A0HA 4GI5A 2J5QA 4YAJA 3ZK9A 2JA1A 2RGBA 3NUGA 4PGAA 1C30B 5FUQA 2DWUA 1NG9A 2QU8A 1YBVA 1E7WA 1W5EA 2DUUA 3EQ2A 2G17A 4WNIA 4PZAA 1YS7A 3I5UA 3DLHA 3DKKA 5KFCA 2EF1A 3LQRA 4FGZA 4B44A 4ZCIA 1JR3D 4ND3A 5A9RA 3CCFA 4MMYB 2QRKA 4EIWA 4MRPA 3EJWA 4XGKA 4KSCA 1RACA 4FBMA 4KN6A 2PFKA 4I7HA 1MB3A 2VF2A 1JYEA 3HJHA 3I4LA 2XWQA 4JLWA 2WD7A 4K9QA 4MQLA 3RQIA 3RYIB 4QFCA 3UK1A 3WYNA 2ZG6A 2ZIEA 3GIDA 3PW2A 2CV1A 3L0DA 4QSHA 3MWEB 3NWOA 2ZIWB 4IIXA 5EFZA 3UMFA 3AERA 4KBGA 2NG1A 1YS6A 2F4VB 1SVWA 3D3WB 2NNLD 4QPJC 1L1QA 2J41A 2JBHA 3Q8XB 1XNHA 2N3ZA 4V2IA 3UCXA 3IKTA 4CDMA 1DPGA 1ZO8A 1WW8A 1BZYA 5ALXA 2ZETA 1U8EA 1VHDA 5K1ZA 1AKNA 4MO2A 3MIIA 2IL1A 4BKRA 3HK2A 1X3LA 4LF5B 3C97A 3PXDA 1F8FA 3CRRA 5TS2A 2Q6TA 1DTSA 4XQ0A 1UADA 4E6NA 1NV8A 4LBYA 3SI7A 1PEAA 3U4HA 4QW9A 4GE3A 3NBXX 4G9BA 2RHDA 4JBXA 3IAEA 4F2DA 1EVIA 3MRTA 3TUJC 4C5AA 3U49A 2VUUA 1K98A 2VAWA 1KC1A 1QIHA 4B43A 1JFTA 1XLWA 4LOHA 1DG1G 1T8TA 2PRJA 3CISA 4KXFB 3ZIAD 4C0HA 1EUZA 1KVQA 1KY4A 1DG3A 4NK5A 2C94A 2NUAB 4DMLA 3W5OA 5CURA 4EHAA 7YASA 5JEDA 1RRFA 5JXGA 4BEVA 2XPCA 4R05A 5KT7A 1UQTA 3RC1A 1AT1A 5IARA 4C30A 1A2OA 1XTPA 1PTKA 4NLGA 4RHTA 4C2UA 5AW6A 1NMQA 4I4LA 4D3DA 3OQVA 4Q8EA 3D8UA 4PZ7A 5DTJA 2XA1A 1TQDA 3HABA 2GN8A 2H2WA 5BY2A 2JLQA 1PBTA 4L02A 1KMMA 1LSJA 2O1WA 4I1SA 3TMYA 3MWEA 1HSZA 2HB6A 3R2JA 1AKMA 1LSUA 2BGRA 3IELA 5DHAA 5GWXA 2X0KA 2JF0A 1H8HA 3Q87B 2PMWB 1WOMA 5FXMA 1E79A 3RYIA 1UBLS 2KQUA 4KWHA 1H0RA 1LRJA 1RCUA 1K27A 1RQNA 1T91A 1WLSA 2P9FA 2GKGA 3T99A 3EASA 4IXWA 6REQB 2GR9A 1VL2A 1WBJB 2B8JA 2DC1A 3H20A 1H6CA 3HM2A 4RPJA 5BPFA 1VIMA 1XDUA 3I4CA 1JTFA 5ALVA 3A04A 4G0NA 1YGPA 4IOKA 3WJAA 5CT6A 2COKA 5G1PA 5JO9A 1WB6A 2MMCA 4UHFA 3WNVA 2WMNB 3JTEA 3TF5A 4UQLA 1CUBA 4URYR 2CF5A 2HH9A 4KCGA 1U1IA 2MU1A 2QX7A 2Q6VA 4W9RA 1C30A 1E18A 3NUQA 3SXPA 2FKNA 2Q6IA 4O63O 3A8TA 3RU9A 4F6RB 2H2AA 3U3ZA 1JH9A 1ACMA 3ILHA 3QFFA 3OZFA 1UKEA 3L6RA 1MEEA 3CUEF 3G0OA 3P9NA 3Q11A 3HRHA 5AJWA 4PN3A 1UOQA 3VSBA 1HT2E 5BSEA 1K68A 3NT5A 2W6CX 4XM0A 1TYZA 1VPEA 5KFDA 1EJ2A 2VJNA 2VNHA 3E53A 1VIAA 3EEIA 4QRDA 4WI1A 4ALLA 2FUNB 2X9GA 3K70D 1B73A 3G1UA 4DUZB 1JFFB 1ZM7A 3HSYA 3W1EA 5H5JA 1PDVA 4A2WA 3RADC 1TCAA 2AUNA 1LBQA 3EIUA 4R9UC 2IELA 1SXQA 1IY0A 4XFDA 3BMOB 3UJPA 3H42B 4AO6A 1QH1A 3RHTA 4CQLB 4J0MA 4BVGA 1VRVA 1O6CA 5LD2B 4EG1A 3KALA 2A9QA 1IHXA 5EERA 3BUSA 1LH0A 4BZZA 4OQNA 4AJHA 1Z8NA 4A9AA 4ZCTA 3D7RA 3GEDA 5L95A 4BLSA 2D74A 3QFTA 3WGQA 4DXAA 5JJLA 3I9NA 1B0PA 1A5TA 2CD7A 4FQ5A 4RAOA 1Z6PA 3WP0A 2AG6A 3UYYA 1UMCB 3ETNA 1SRRA 2R8YA 2I22A 4PYMA 1H4VB 3SVZA 3VVBA 3WGVA 3HMQA 5JSUA 4MLCA 1YCDA 2GARA 2Q29A 2W4IA 4H27A 4PPGA 3NKLA 2X8WA 2O5CA 5J4LA 1M1ZA 3CVYA 1EX7A 1QKKA 2BZGA 5C1DA 5HIKA 2F43B 3RFCA 4LKRA 4M1EA 3B12A 3HCEA 5HJ2A 3T1HB 4UHKA 1CUGA 1BJKA 1O0BA 3RFUA 1AUQA 3RYHA 3PLAE 3KEMA 1CW2B 4CODB 2NIPA 5JE8A 1EU1A 4IDPA 3L7NA 5FLYA 4IVPA 3H17A 4X3OA 3RHSA 4IPTA 3UYKA 3V1TC 2IMWP 1Z7YA 3UOGA 1FVFA 2FQXA 3IBYA 4J6FA 4KQ9A 5JROA 4N5NA 4WJZA 5E6RB 3RT7A 3AU9A 2O59A 1DKOA 2BJWA 2QG6A 3PWKA 4U5XA 1JALA 3ZCXA 1NJ8A 1IIBA 1RTKA 4TM5A 4BRWA 1AX9A 5F3WB 2CE2X 2Q5QA 2Y68A 3BCSA 4Q01A 4PF1A 4RD2A 4ZOBA 5KG5A 4ZU1X 1OXVA 2OBLA 4I0WB 1OA1A 2JI6A 4ZEWA 1ORWA 2WMYA 1X80A 1GAJA 2BEVA 4QUGA 1EHCA 5ALDA 2VTBA 2IRWA 5DZSA 3TEFA 4IWYA 1I4LD 2EKDA 3LI2A 2HA6A 1RM3A 3N7UA 1YULA 2BN4A 5FR1A 4UBJA 1KI9A 4RSGA 2V9CA 1TAQA 1A71A 1ONSA 1NASA 2AMJA 2FI1A 1U6IA 4WINA 2VYCA 2F1RA 4PS0A 3V7WA 2HX1A 1QS0B 3E15A 5DMHA 4LMRA 2WR8A 3MMNA 1E2GA 2FAXA 1Z6QA 3TIVA 4BMPB 4ZZ3A 2QL7A 4LRYA 1PX0A 4MUHA 1BXKA 3T1HH 1AKRA 2DXIA 4NC9A 5EEGA 2CUTA 3X1ZA 4YP5A 2RD2A 4RQUA 4WK4B 1DV2A 4YMTA 4P7BA 1QQAA 3ZDCA 1L5QA 3BXGA 4FE4A 4MRMA 4JFAA 1W0KA 3ZV4A 2XEXA 4O2AF 4E7OA 1QKIA 3L7AA 4KTVE 2PUWA 2XEDA 4KGXA 1BS1A 1T4MA 2P2SA 3B3AA 3IT2A 3U48A 5KVSA 3WFIA 4CPDA 4UCTA 2IPXA 4PS1A 5JMPA 3I9OA 1PX2A 5MFPA 3E3NA 4YMGA 5HQ3B 1SIWA 5IVKA 1NBMD 1QFJA 1V8PA 4RENA 4EGFA 1KYTA 1I94H 3JWPA 4ND7A 5FHQA 1GQRA 4PINA 4NVRA 3OQOA 3VC7A 1W0CA 9GPBA 4BMSA 3N05A 4HLNA 1PLJA 1R6DA 2JIQA 2WIBA 1XCLA 2HBYA 3ABIA 4BLVA 5WRFA 1NU6A 1TD1A 2XUAA 3S28A 2PS0A 1V9SA 3FBWA 4K9KA 1Q2UA 3L8HA 3OTWA 3QW2A 4WPGA 5UKDA 2P9HA 3G0HA 2GBLA 2L69A 4B76A 1P0MA 3ZWQA 4LF4H 1Y1VG 2IEYA 1KVUA 3KOYA 1JJIA 1RKVA 1P2DA 3DEYX 3E3AA 3PUVA 1S03G 5AM2A 3VI3B 5LQRA 521PA 4MA4A 5LDGA 4B3MH 4LHWA 1DAHA 2W7TA 3N3AC 5EQJB 2A0WA 4NZNA 2AQ8A 1Y8AA 3CJTA 3S2ZA 2FMFA 1F2UA 4JHLA 4HDRA 4KXXA 3RR2A 5ALHA 4B3IA 4JUZA 2GEDA 2FLLA 2ZB8A 2J0QA 1HE3A 1YC2A 4CGZA 2IVFA 4GMDA 4AUKA 1YQ9A 2F3UA 2LVBA 1KH1A 3IPXA 3Q2IA 3LO5A 4HUQA 4YGXB 1P0FA 1SVKA 1GYRA 1M1XB 1DFIA 5BW6B 5KYNA 2HEGA 1DKQA 3F49S 4PYRA 4MKFA 4IV0A 4MVJM 1U8AA 3BRWD 3JVEA 2Q5IA 3CRMA 3NC0C 4AWAA 3F74A 1DKNA 4D4MA 3KSUA 2WI8A 3LFHA 4ZJYA 3MT8A 2Y0DA 1E8DA 2LIVA 1T8SA 4HZUB 4AQYB 1TU4A 4TVKA 2AOTB 1Z0IA 2WZQA 4GM4A 3TL2A 3ZKAA 1CIPA 3LQFA 1EWKA 4ZD6A 3TK1A 2X9QA 5JSHA 4LF7B 2O2DA 4G41A 4G4IA 1XXLA 4RPLA 3ZR4B 2QZ4A 4I1PA 2RH8A 1CRWG 4FDVA 3RIHA 5JNLA 2AL7A 1MABB 2ODNA 3B52X 2ON6A 5JMOA 4WL0A 3BWEA 3ZW7A 1Q83A 4BYGA 1QWOA 3PXXA 2P2DA 4C03A 4Q4AB 4HAWA 1PT7A 1ZGHA 4JI2H 2AFHB 1SWWA 3WBJA 3ONFA 1T3TA 2C9ZA 2DHEA 2O5VA 2XGJA 3LBIA 3SE0A 1T3HA 4NJMB 2ZYUX 4DL9A 3HYNA 2HIGA 1B6SA 4KNVA 2O3TA 3IDAA 2PBZA 3IBFA 4YFVA 1FUUA 5AXBA 3LLVA 3W6OA 1VB5A 2BGKA 2CVOA 2I33A 1WZUA 2JHAA 3DO5A 3E82A 4UCQA 2POCA 2XDAA 4WY5A 3X2EA 3HN6A 1UKYA 1WMAA 4X66H 2OQ2A 3PE6A 5AD1A 3EVNA 1KEZA 4DG8A 4LH7A 3KZXA 1AQLA 1ZVQA 1GA6A 4BN4A 2C2BA 4KODA 4N41A 1A9YA 1YDWA 1YL5A 1E4VA 4J8PA 1AKQA 1JSCA 3RIYA 1LBHA 4ABYA 3LSYA 5MGNA 2VYND 4HSGA 4BNGA 3LBNA 2RHMA 3HR8A 1GP2A 5G3YA 1F1BA 2C1ZA 3B82A 3L6OO 2ISSD 3WHLA 1H5NA 3VR5D 4EFKA 4YR7A 2GXSA 5BYAA 1DC7A 2A9KA 2B35A 2I3GA 3L7MA 4I1OA 4D9NA 4UXHA 4DIEA 1X15A 4MS1B 1UMKA 4ARSA 1CY8A 4URVR 2GKSA 3G2JA 1GGVA 4XQCA 1S0MA 4WXRA 1SEIA 4MVJI 3DJYA 3O03A 5LYJA 5IAOA 3BQMB 2XWBF 2J07A 1U28A 1U7OA 3E84A 5DW0A 4YRBA 4PHFA 1AU9A 3FAZA 1VBNA 2FFQA 3DUWA 1QOQB 2HBZA 1QMGA 2W9XA 2WM3A 4ARZA 4C6HA 5AESA 5K2MA 1YZVA 5KI6A 1YBFA 1KO5A 1N0VC 2XNJA 3M6IA 1HT1E 5H83A 1VKNA 3PPIA 2OGZA 3L8MA 3QLEA 3UJNA 3LCCA 4RS3A 3VU8A 5E8JA 4A91A 1N3BA 2YMPA 1GG2A 4J2HA 2C4TA 2QBYA 1NW8A 2IYYA 1V5GA 4ED9A 4GKKH 1NT2A 5LB4A 5JIBA 1DZIA 1KMNA 3ZDFA 2I78A 3F67A 2ZRAA 1C1DB 3G7SA 5DWDA 5DLQC 1FU4A 3HP1A 3M3HA 4B48A 4I9FA 1KQPA 4EL0A 4XDZA 3L0BA 1SCUA 3L49A 4Z7JA 2YHBA 4TTRA 3AG5A 4D9HA 2EGUA 4KHZA 3RAEC 1FP7A 8OHMA 3LDGA 3RWBA 1GPYA 3R3SA 2AJLI 3DM9B 4ECEA 4O2AA 3GRYA 4J0IA 3RF2A 3RC3A 3LXRA 4A8JC 3QI7A 3KTFA 4F9TA 1WBBA 1VKRA 4EEQA 5FA5A 3RVLA 1RJRA 5JY6A 3S0JA 3IR7A 4PAMA 1WV0A 4F2WA 3KZOA 2AGQA 2YR0A 3P0HA 5C51B 3FOCA 2ZRCA 5EWLA 4FXPA 3UF0A 3U9LA 2ZJOA 2G4LA 4OLFA 3BACA 2GPBA 3M3PA 5DCUA 5A1TA 5C8YA 4DL5A 5HJ7A 4EENA 3HR7A 1TQ4A 4Z0HO 3M6LA 3AP3A 4BO7A 4RETA 3GXBA 4KZKA 1CUIA 2Y0EA 4N9QA 1MORA 4CIYA 5K45A 2IH4A 1U2TA 1NF9A 2ZI7A 4KX3A 1LK0A 1ZA2A 2R1TA 1BDIA 4C2TA 4TMFA 2DB3A 1NOJA 4GQAA 4PCUA 3ZHVA 7REQB 1W8IA 4M89A 2GEVA 2I65A 4I81A 1VBKA 1LVGA 2KWIA 4UHJA 5AW3A 5H9WA 3KYCB 3PQ4A 1N7JA 1KTVA 2R4QA 1QGYA 3OZTA 4UJ5A 1B6TA 1AO3A 3KCNA 4ALIA 4MJLA 2NUTA 2C1XA 4RPCA 3ELWA 4TXMA 3ZS9A 4QIWE 1XZNA 5C1PA 4QOEA 2VCYA 1PRYA 4A10A 3M5CA 4JBNA 2EKQA 3EE6A 3ME5A 3Q3VA 3PNPA 3FAKA 4P4TA 1VE7A 3T4PA 2R87A 2B2XA 4YONB 2Q2TA 2FK3A 4CBVA 2GJAA 1B14A 1S0UA 1BMFD 4MYTA 3EVCA 3HR4A 4IDQA 4ZQCB 3H18A 4EK9A 5F1KA 3V55A 4HMOA 4L8FA 1DX9A 4WWHA 2WFLB 5IJ9A 2HNBA 1UT8A 4ZP1A 1BGXT 3KB6A 4ETWA 3QJYA 2W2MA 4TWIA 1S10A 3OC6A 5K9ZA 3OKPA 3ASYA 1K6EA 1PU2A 1JX4A 4MV7A 5ER6A 3WISA 3CWCA 1UZNA 4ZAYA 3L0ZA 2G8LA 1YGYA 3GLFE 1Z7BA 3JASB 4L27A 3OT1B 4MSUA 1FCJA 3F6SA 2FWIA 1WRVA 4DV0H 1SCQA 3GDFA 2HHLA 4IYJA 1P31A 5B37A 1OH5A 2FFRA 1TXGA 4PGGA 2VDKB 1TUEA 2JI8A 3P4YA 3S68A 3X3HA 3HLTA 4UAJA 4EKIA 5JWOA 1P7VA 2YXLA 5EHNA 3KLBA 1ML3A 1SXPA 1M8GA 2JIPA 1FTNA 4Y1FA 2C2XA 4FZ3A 4XYEA 1H42A 2H3EA 2PKWA 2JFOA 4KUEA 3W5DA 3UPTA 3HDYA 1JQAA 2FPMA 2QNBA 5HF8A 2PXAA 4EQ5A 4WEQA 2NP7A 4FLMA 3UO8B 3TY8A 4A3EG 1UDWA 2O2IA 1LKZA 4PONA 3TZEA 4Z4HA 1UFQA 4G1VA 2E2WA 4GR5A 2HSZA 3UXYA 5EXXA 3FI0A 3BTVA 1SCUB 3OIFA 3EDQA 3OM1A 3PQ8A 2IYXA 3LDFA 4BFXA 1JAZA 3RYCB 1NOKA 2ATXA 3MTQA 4KN9S 1GQFA 4QGBA 4DMGA 3CM0A 3CF2A 2EERA 3HFJA 4TTPA 4MV0A 3TR0A 3ZYZA 4B09A 2ZROA 1Y98A 1MV8A 2GNAA 3RABA 3N0TA 3P52A 3EPRA 3AV3A 3DMHA 4BCCA 4MCJA 3S99A 3KSRA 1BQ3A 3GV0A 5AI5A 1VZ3A 4NBVA 5TPZA 3WGKA 4KLAA 3KHRA 2H07A 2YOFA 1UZMA 3CEMA 1G2WA 4GGMX 3UWKA 2FZ4A 3VQTA 3QYAA 2EL7A 3ABSB 1HNXB 2PANA 4H4CA 1N3YA 3KTAA 3LXUX 3HKBB 3L1IA 1N2GA 1U98A 1T10A 3VKHA 4PRYA 1PK9A 4HF7A 2XWPA 4IV8A 3U31A 3KSBC 4X6LA 1POWA 2EBFX 3A31A 4L5BA 3V2GA 3T41A 3D1VA 2FSVA 2Y1FA 3FYSA 4MXDA 3UJBA 2Q5LA 2C5SA 1CHDA 1YONA 3Q3EA 2QI9F 4NECA 4IIJF 1U7HA 1MHTA 1F06A 2E4ZA 4BNNA 1RI2A 1OH7A 4ZIRA 1G0NA 4P0QB 3FM9A 4GGPA 1QHHB 2XMDA 3W5CA 2BHSA 2HOQA 4MRNA 1QTQA 4YCAA 4II2A 5G0UA 1MD9A 3NHBA 4ERXA 4BMDA 1ZMOA 3A4MA 4R83A 1NR7A 2F9MA 4CTMA 2W2PA 5LL6b 3O1IC 3WL8A 2KI5A 2PUTA 4O7NA 4BP1A 4DM7A 3GLKA 4ESOA 4EATA 3C5VA 2YWGA 5K51A 1IBMH 3M9LA 3MOIA 4AY4A 3IRUA 3COYA 3EUAA 3VV2A 1GDTA 2IP1A 1L7QA 1U0NA 3SJZA 5BR8B 1RRGA 4QSMA 4MA0A 3F8TA 4LOAA 2WZCA 4R0VA 5HW0A 1XMPA 1J20A 2PUHA 3Q3CA 3E4CA 2FPUA 3IAUA 4JUAA 1J5EB 1OFGA 1LDBA 1UBFA 3W3AD 3KL4A 2V7GA 3K96A 4L76A 4MVJA 3EMVA 2XOXA 4RMJA 2V7UA 4GG1A 2CQYA 5THXA 3SFVA 1EX6A 5AVWA 3AF3A 4QXRA 2A35A 4MR7B 1XZEA 1ZM4A 4YECA 4K2AA 4I66A 1RP1A 2YCLA 2BCEA 3DAFA 3GLTA 5DN6A 4O4LB 5DN6D 4LFCH 2H2DA 1ZM2A 5E7IA 1TEHA 2EJWA 3A7EA 4GECA 4RNDB 3UW1A 3BB1A 1HDXA 1PR3A 4JUBA 2QVCA 3IBSA 1MABA 2D0IA 1SRQA 3FHJA 3WQQA 4JP1A 5HBGA 2NZYA 3BJEA 1L7AA 3EBOA 3OESA 3R7BA 2B3DA 3TN7A 4EBBA 5BMVA 3IPCA 4DW8A 5INTA 5IZ4A 1QP7A 1EIZA 4CLOA 3A25A 3A2NA 4Q4HA 1G3UA 1Q74A 4JD5A 2W8BB 2LDBA 2AG1A 5C37A 1HDRA 2QTMA 1O2DA 2XIQA 4E46A 3M9MB 2WWWA 3UMSA 1Z2CA 4URXR 3TRFA 5JAOA 1ISFA 3OQIB 4B80A 2ISQA 3E18A 4WY2A 3ROZA 1PVOA 4OHVA 4JI5H 3AY7A 1CEXA 1T2AA 5E1DA 1C0KA 3ZK8A 2E1PA 3OAAA 5HPYB 3B60A 4AJKA 3CURA 2NO7A 2X4GA 4EPWA 1X8KA 3GFOA 4GSKA 3GT0A 4EG5A 3SSMA 3BWDD 2O52A 3RBZA 4OJYA 4HUQB 1C9JA 2WVHA 4X1IA 3RGXA 2P3QA 5TMDA 3V9PA 4CDNA 3OE7A 3VKUA 5CBKA 4C4SA 5JS6A 5ALWA 1RNLA 4XW2A 1JU9A 1K7EB 1F2UB 2FMAA 4LK2A 2C3YA 2RH4A 3LQ1A 4HS9A 4D96A 1ZGGA 4U39A 1FDOA 2Q3LA 4QUEA 2LCIA 3HVUA 1LQTA 1HL3A 5BWTA 2O8BB 4E1VA 1YFJA 2XZLA 2ZRMA 2HRCA 2I66A 2XCOA 3AOEA 1GAWA 4RNOA 3AIOA 1YS9A 3C8ZA 3CE6A 3HGTA 4XUDA 4D3YA 2OHHA 1CVIA 2ENWA 4GL2A 4Z8XA 4EZEA 3UMMA 1C4WA 4DUZH 2BEWA 5KG1A 3PPVA 5PNTA 1E96A 1MOZA 5K3SA 4KSYA 1WUHS 3GARA 3F96A 4IM7A 3TO5A 5HKLA 1VKJA 1XTJA 2BDEA 1S2DA 3Q4GA 4ENVA 2J32A 3WR5A 1NN1A 5EWJA 3NHAA 2RE8A 1LU9A 2QGZA 3AR5A 2H29A 2ODWA 4TL8A 1Z6ZA 4LDJA 2OAQ1 4FKBA 1WCMA 5K3FB 3H6HA 3NVKI 5GGXA 1HDGO 1KYQA 2GB4A 2HUNA 3SLGA 2FN7A 1MX5A 1OYYA 3UQYS 4GZ3A 4YRNA 3I09A 5BQXA 3ZWDA 1I13A 5TARA 5HM8A 1J1UA 2BPOA 1OROA 3R9RA 3IP8A 1W85B 4TZ6A 1VXRA 4NE9A 1Y1KE 2SKEA 1SK8A 2JGIA 3EQ7A 2FE4A 2ZI3A 4HDOB 4QPCA 4R31A 3KHLA 4DRFA 1OWMA 4U7PB 3TPZA 1S6YA 2XZDA 2X0NA 3EGXA 4QYTA 3T3GA 3UICA 4REOA 1QQ5A 5ICFA 3VAZA 3ZCTA 2H5EA 4EPTA 4TN5A 2DKNA 3A3OA 4FGLA 1TWHA 4TV8B 4YACA 4YRZA 1W581 2BH9A 2JCGA 1F0YA 3IT3A 4YX9A 3P9KA 3WIBA 4BOYA 3UJ8A 1U65A 3HRKA 1Q92A 3BZUA 3ZKWA 3N8GA 3U1TA 3I72A 3QTLA 2QUZA 1FXWA 2QPOA 4UXIA 5A2QA 4ZXFA 1QS0A 1J2EA 2I2XB 2QHXA 2ZJZA 4OM8A 5BQFA 1JIXA 5FWYB 2QROA 1L5RA 3BGSA 1DUVG 1K92A 1SUSA 3BORA 3W2GA 3OC0A 2RHOA 3BPSA 5E6SB 4UBKA 5B1YA 2WAQA 1N75A 5CLFA 2BGTA 1N3LA 3MMPA 4PGMA 1SVIA 4XLTA 2ZTMA 1E1DA 3KD2A 4HEQA 1GTG1 4NOMA 3SQMA 3TFQA 2COEA 2HDWA 2QPTA 4GVXA 4HEHA 4IXTA 4LMBA 3D8BA 2QSJA 4HQOA 2XCUA 4MUXA 4PSCA 5I45A 3JARB 1KZ1A 2BMDA 3PENA 1G0OA 2D5LA 3QF7A 2H5LA 5I4IA 1OXBB 1NUHA 3I45A 4LCBA 4RXUA 2R25B 1RLMA 4BY1G 1KP3A 1NLYA 1U2DC 3JZAA 3WLNA 3IKVA 1KJ8A 2WG2A 1YMVA 3ZVNA 2C5GA 2WU0A 2PN1A 1U8ZA 3LC2O 4R2XA 1M8FA 4QWCA 3IOCA 4BYMA 4FMCB 4WVFA 3RUFA 2MSWA 4PPQA 4QGGA 4US1R 3TLCA 3H2IA 4AU1A 1ZUHA 5EC8A 4L6AA 5KFXA 2JFNA 3MWKA 4B5KA 3TUIC 4QWBA 3HMKA 3IQDB 1V3UA 4DR7H 1JECA 4PG7A 4EHJA 2YXPX 4AZVA 5AOBA 2IIBA 3S2YA 2J59A 4CUZA 4S1PA 4HX9A 1WPQA 3AHEA 4FMDB 3Q9SA 1OLOA 4QA9A 1KWKA 1BWPA 1ZSNA 1GILA 1DXOA 2PKQO 2RIRA 3EXIA 3IULA 3LY7A 4O7VA 1QVRA 3G0DA 3OZ7A 1WV1A 1NJ6A 4J9UE 4V0KA 4YROA 5DTEA 3SGLA 3WLMA 4BECA 1K0UA 1ZD9A 3CW8X 5CDHA 1WCMG 5BWWA 3LPMA 3L43A 4Q3NA 1DBVO 2RHTA 5LR6A 3A7DA 1PK8A 1TRHA 4NDAA 4C2BA 4YT2A 2HA3A 2I8LA 3NBFA 5L7YA 3OD5A 3FVRA 1U2SA 2OLSA 2GWRA 2B20A 1PWXA 1X74A 3BHIA 3G8YA 4PQRA 1NAHA 4TMTA 4A0SA 3BXFA 3O1HB 2BF4A 3GFVA 4F0JA 3ASVA 1V41E 1TFRA 4I5DA 4NOKA 4QJIA 1WZCA 3RJ0A 2AC4A 3WLAA 3LRTA 4EW2A 2D59A 5KOJB 4BCBA 3PN1A 5IP7G 1KFBB 1U8CB 4GWGA 4HATA 4J94A 4OQQA 1JIUA 3R5FA 1O87A 2Q7OE 4ED8A 2GZAA 3SZRA 5LJLA 1FYXA 1QIKA 4YH1A 2VPXA 1Y1QA 3GT3A 4IZOA 4PZCA 2JI4A 4DY4A 1T5LA 5K99A 1Y5NA 5HEKA 2ZIXA 3A6DA 1QO0A 1KEKA 2UXCB 3Q9UA 2GZ2A 4XSGA 1CNFA 4K3VA 1BE0A 3C3KA 5EJEA 1SHZA 3G68A 2O8DB 2VXOA 2FP3A 3MIZA 4PO3X 1R64A 3U44A 1BGWA 3J81W 3OWXA 1ZSVA 2NYUA 4B3CA 1KFJB 1PT6A 4JEMA 4I6JA 5CMLA 4PCVA 4W7SA 5G53C 1RKUA 2IW3A 3O9VA 3OX1A 1J0DA 3KAKA 1B74A 1AG9A 2Z3WA 5C34B 5JAQA 2B7BA 5F98A 3JWEA 3LLSA 3VX4A 4GOND 4NF2A 5DBEX 2GASA 1ZIDA 5CAEB 1DAEA 2VXYA 1NNUA 1U7DA 3O2NA 5BXYA 2YWCA 1P2BA 1UBOS 1GGMA 2RJOA 1R0WA 1UFOA 2ZRHA 1TWFA 3OT4A 2XQFA 2C2YA 1SB9A 3U26A 2VT2A 2OG2A 5DGAA 2W70A 1CNEA 1ZOOA 2WU1A 2JL1A 1CVLA 3D6FA 1G8HA 5KQSA 3RT1A 2FMIA 2CV2A 2XMQA 2OWOA 4UZSA 2PZMA 2YJTD 4ER5A 1UKVY 1TVCA 1P4RA 1HC7A 1E59A 3MS2A 3GAZA 3WZMA 5AKYA 2MINA 3EQZA 2OTCA 1ADJA 1RAIA 3OZRA 5KTYA 2LCFA 1XDZA 1YB5A 1T9GS 1XDDA 2V6FA 1YC5A 5B53A 2AOWA 4BQNA 3F46A 3NCTA 1F20A 2GPSA 4YP7A 1OFVA 1FMJA 2BM1A 5AM1A 4BXXG 1DRJA 1DDOA 1GZ3A 1YO6A 1V1MA 2QZ9A 2F8LA 2YYZA 3KOMA 3G1WA 1W2HA 1XCGB 4QVKA 4MZDA 1QF9A 5E8RA 4B31A 2VTDA 4Q0YA 5K20A 1G8AA 5FFFA 3ZOZA 4LF8B 1CEQA 1SKAA 2GBFA 4MEBA 4U63A 1JHAA 1ISJA 1J8QA 4IDDA 1C1XA 4CKBA 3VYRB 2ZBRA 2YJ5A 3AESB 4XR9A 2JZNA 2CCJA 1TIPA 3L8YA 4NZZA 2XBMA 1HDZA 1K4MA 3IA2A 4GOOD 4MKHA 4BE4A 1A5SB 2GCEA 4WZBA 3W5HA 2X13A 1NBIA 2RC5A 2VYVD 4G36A 3HBNA 4Q05A 4TMYA 3HCFA 4DCUA 1M1YE 1P4JA 2QT0A 4K0KH 4RHEA 5NULA 1DKRA 3QG1A 2ZSIA 5LOVA 1L4BA 2DH5A 3ZE2B 4MW4A 5EKDA 3F73A 3GA0A 3KE9A 2C03A 1KY5A 5M3BA 2G1KA 3JYHA 4O4LF 3ZUPA 3K8OE 2K2WA 4BFVA 2ST1A 2WWRA 3N44B 4KOAA 3I9V6 2NSLA 3BDIA 3L06A 5JI2E 1FXSA 1P9RA 3G2NA 4YP0A 4JBWA 4KPYA 3THYA 2WYIA 1HLGA 2ZRDA 4IY1A 2RGRA 1EDBA 1NDHA 4H1UA 3H2ZA 2ID4A 2XDQB 1G4HA 2HWKA 2G7MC 3LM8A 5CFPA 1ZHSA 3WHPA 1PQWA 2GFQA 3IP5A 3UGKA 4EG0A 1MC4A 2P2CA 4CKYA 4ECSA 4BV9A 2XJ4A 3DWEX 2VDMB 3ZDBA 2UVUA 2BTQB 3DKVA 3IAXA 2I6XA 3PKJA 1TX4B 1YT5A 2XYRA 3QLJA 5C32A 2FDXA 4ZT6A 5T64A 2Q0HA 2IXFA 2C7BA 3EPKA 4LF8H 1FDRA 1QFZA 2CE7A 3NNSA 2WIGA 4RTLA 1NNEA 1GPJA 4XQGA 2EHJA 4K0KB 3FOBA 2ONZA 4EBDA 1QU2A 4MA5A 1L7EA 2BY4A 5FFNA 3RRNA 2KE5A 3BGDA 4EOGA 4EW6A 5IZCC 2O2YA 1B1CA 1P7ZA 4IG4A 2OZLB 4F71A 3LQQA 1N5DA 5DYYA 2PLFA 1EFCA 3ANYB 5DYWA 4AQYH 1PZNA 1U9IC 2X5RA 3A9RA 3E3LA 1ZYUA 2JHGA 3OUTA 4PWYA 3R3XA 1JFSA 1IN4A 1RFLA 1FX0A 5BO5A 1NVDA 1Y5IA 3TJMA 2PTGA 2QZZA 2IX9A 3OX4A 4FONA 2R8HA 2NYVA 5ISMA 2ONYA 4L7VA 2PKRA 5EXSA 5IUNC 2FLPA 2UXDH 2NOAA 4D9IA 3FDXA 3VU0A 4Z7QB 1A9ZA 1AV7A 1I5EA 3AVXA 2JA6G 2NPIA 2FWAA 1M34B 1PNVA 1SUBA 1ETUA 4R01A 2IF2A 4HB0A 3AZOA 5KHLB 5JISA 5IJAA 2EIYA 1F8UA 4MLPA 2Q7DA 3H4IA 4A1FA 3M4YA 4LE2A 3TTXA 2GEFA 4LF6H 2E89A 4FNOA 3DQPA 4H3KB 4LTMA 4ND8A 4V0ME 5CFQA 3RIEA 3G02A 5FWXA 4QLBA 3IEMA 2HSJA 3H1TA 3HFGA 4E88A 3WA6A 1NKTA 4NQRA 3M82A 4WOJA 4YJGA 3BDAA 2W2KA 5E38A 5F3RA 1CUDA 4RFSA 1R0RE 1VIDA 1U8XX 2GM9A 2GZ1A 2DBQA 2Q4TA 2ZSKA 3OHAA 1PT9A 5EFOA 2YZKA 3L84A 4FLFA 4O2BB 2NO1A 2X2OA 3NBZC 2GJKA 2WZBA 5ESRA 5ARDA 3VZDA 3A11A 3QPBA 3HCBA 3RGGA 2KM1A 2VA9A 4R1LA 2A57A 2A78A 2XB8A 2ZRNA 3QI2A 4ZVSA