4O81A

Saicar synthetase (type-1) in complex with adp and amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-1) in complex with ADP AND AMP
rcsb
source organism Pyrococcus horikoshii
total genus 73
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o81A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o81A02
2G15A 1P4FA 2VWBA 3A8WA 3QFFA 3BX5A 4RFMA 4NWMA 4ERKA 3BLRA 2YA9A 4QP8A 3A99A 1BMKA 3D5VA 3G8DA 1WVWA 3HDNA 2XNBA 3NCGA 1VBGA 4EBVA 3VBWA 3QX2A 1JWHA 4FOCA 3EIDA 3ZYAA 3M1SA 5LCJA 3HV5A 5HG8A 3HGKA 2GTNA 3I81A 3BU6A 5JVLA 3SOAA 4DE4A 5J7HA 5IPJA 5AP1A 1BKXA 4O82A 4YLJA 3LM0A 1WBNA 3SC1A 3MSSA 4FYNA 3HO8A 4ZSJA 1OITA 3ZRLA 3C13A 4KIOA 4WG3A 4YJOA 3JVRA 4C3PA 3JRWA 3DAEA 3VUDA 4FTTA 4O0TA 2XF0A 4USFA 1PMEA 3BZ3A 3LXPA 3ZLWA 2I1MA 4HGEA 4LGGA 4KB8A 3DCVA 3LIJA 2BZIB 2R84A 2UV2A 1O6KA 1I7LA 3FKOA 5DRBA 4ITIA 1GZ8A 1DV1A 4GJ3A 5CAPA 4X3FC 3DK6A 4XG7A 1YDSE 5C1OA 3JXWA 4WD5A 3R22A 3C9WA 1FMKA 2PWLA 4MBJA 3HA6A 1UU9A 2JKMA 4GIHA 4WRGA 5F20A 3WF6A 4BIDA 2GHMA 5CY3A 5HIBA 4U44A 4KABA 1Q41A 2XBJA 4YHJA 4BCMA 2YRXA 2GNJA 4L1KA 5HU3A 4ZSGA 3S2PA 4E4NA 4FSQA 2XJ0A 4I6HA 4R77A 5D9HA 4DG3E 5DEWA 4O4JF 4F65A 3PTGA 3D4QA 3GNIB 3BLQA 3EFWA 3OTUA 4L52A 4HVIA 4ZSLA 5FUTA 2GSFA 3MFTA 3FZSA 3CGOA 3OUNB 3EN9A 4A9YA 3CJGA 4FZAB 3ACKA 3BEGA 3H0ZA 3IDBA 2ACXA 5F1ZA 4FGBA 5HTCA 1ATPE 1PXJA 3BHHA 3F5PA 5JFSA 1QCFA 4XZ3B 3PXFA 4G34A 2PSQA 1WMKA 3RV4A 3ACJA 4XEYA 5K3YA 3R7YA 3NYVA 4DEDA 4P90A 5FM3A 3FKNA 4DH3A 3FLYA 2JFLA 3NUNA 3PZEA 4IAZA 3P0MA 2FSTX 4XG6A 3LJ2A 1XJDA 1Y8YA 3R6XA 5BX0A 4L67A 4BI2A 3BEAA 4YO4A 4AGUA 4AOIA 2YJSA 2WTKB 3NNVA 5IU2A 5AM7A 2PVMA 3F3UA 2J51A 4CT1A 4LQMA 4G31A 4XOYA 5CWZA 5JH6A 2ETMA 3UYSA 4XG9A 3U9NA 2VD5A 4ARKA 3K5UA 1M7NA 2B9IA 2YN8A 3MIAA 3ZOSA 4XJ0A 4AACA 1BNCA 4X2FA 3ZONA 1SVGA 2ITUA 4J8MA 5HBJA 5IISA 2GPHA 3TIYA 4DH8A 2C00A 4L7SA 1YOJA 4R1YA 3VJNA 4YSJA 4ASEA 4PUZA 5GINE 5DMXA 4I4TF 2ITWA 4XP0A 4BDAA 2UW5A 2QO7A 5IDPA 1BYGA 1M17A 2C47A 4HCTA 4OLIA 4U43A 4CFVA 1Q99A 4IE9A 1PHKA 5ANEA 2PZPA 4YURA 2VTSA 3JUHA 4L68A 3V4SA 3SG9A 3IW6A 3R9NA 5M53A 4IM3A 2WOUA 4ZZOA 5HTBA 2I40A 1ND4A 2UUEA 4CKRA 5KMIA 5IMEA 1M0WA 2QODA 4HGTA 4BBMA 3KF4A 2W9FB 4GSBA 4Y85A 2ONLA 2FSOX 2BAKA 2PVLA 5CA1F 1OIRA 3VWAA 4FFLA 4N4SA 2BRBA 3KU2A 4QP6A 3VS3A 5BNJA 1OM1A 2WKMA 3L8VA 3NLBA 4AX8A 4DF3A 3JRXA 3R8VA 4X21A 5JGBA 3G6HA 3DT1A 3FMLA 4YC6A 3UJGA 4EUTA 1R1WA 4G1WA 2W5AA 4O91A 4WUAA 2BRNA 3DQXA 4NTTA 5CAEB 5A14A 3FZPA 2R3KA 4RLLA 4CCBA 4RC4A 3EN6A 4F9YA 5KMKA 2P0AA 4MX9A 5HESA 5LVPA 2YWVA 3F5XA 1S9IA 2YM6A 2V55A 2R3FA 5BYLA 1H25A 2I7QA 2R2PA 3MIYA 4MQ1A 4LL5A 3E92A 4NFNA 2XKFA 3MA3A 3Q32A 2VR1A 3UMWA 4Q5EA 4ZAUA 3MB7A 1GSOA 1IAJA 3UC3A 4H39A 2J7TA 3DGKA 3ORMA 2V22A 4FZDB 2ZJWA 4L3LA 2Q0BA 4EOIA 2YL2A 4XYMB 5IA2A 2IWIA 4AW1A 5IMXA 5J1WA 4ZY4A 2C4GA 4NM7A 4MH7A 3F7ZA 4NT4A 4X3FA 1K9AA 4GK2A 5EH0A 4IWOA 5EKNA 1ZMWA 1KJQA 3ETHA 3K5HA 3NUUA 3P5KA 3EHAA 5CS6A 4TV8F 4TNBA 4EZ3A 4PDSA 3LMHA 4YP8A 4R5SA 2EB3A 2ZB0A 3DBEA 3SV0A 2O5KA 4K9YA 3NYXA 3BU5A 3NDMA 2NO3A 3LVPA 3UOLA 4O81A 4WT6A 3PDTA 5EW9A 3V5WA 3NAXA 4UX9A 2VTPA 4JS8A 4QP7A 3CJFA 3FI3A 3R7EA 4DLIA 3SW7A 1UNLA 3IW4A 5FTQA 2EXCX 4AW5A 5BVFA 1T45A 3RAIA 1KJ9A 1PK8A 3OEZA 5JQGF 4FT5A 2I0EA 3RCDA 2CKEA 3WZJA 3AT3A 3PRIA 2OXDA 3GBZA 4FICA 1WR2A 3ZS5A 4J1RA 4X3FB 3QBNA 4MNFA 4ZS0A 1Z2NX 3FHRA 5CEKA 2VAGA 4QMUA 1FQ1B 5E8YA 4V0GA 5LMKC 5HE0A 4D2SA 3F3ZA 3RK9A 2XH5A 4BCNA 3TUCA 2JITA 2GDOA 3SVVA 3UNKA 5E91A 4CRSA 4ZTSA 5HIDA 3SAYA 4FTIA 5A46A 2W4OA 1JKTA 4KS8A 3ZFMA 5IA0A 2YZGA 4RX8A 4Y83A 1JLUE 1LEWA 4IZYA 5AP2A 2JDTA 4YPSA 1WBVA 1GIIA 4I24A 1ZYSA 4O7TA 3MWDA 4W4XA 3QCYA 2W1ZA 4FFOA 1Q62A 4O0RA 4QMNA 1GAGA 3PPKA 1I44A 2PUUA 1M14A 3I7BA 3QLFA 3VHEA 3ZRKA 4EH7A 2J9GA 3UE4A 3KCKA 4EGQA 4E5WA 3F2RA 3UO5A 4QMYA 2J0MB 4FKOA 3FBVA 3H9OA 4E4MA 4UBAA 2QQ7A 3A7IA 5KMMA 4NK9A 3DFAA 3ZUVA 4EC9A 3DOGA 4ZMFA 4IADA 5KMLA 4O2ZA 1SVHA 5E92A 1GZKA 5CAOA 4V0GB 2O8YA 4YBKA 3BHYA 5EFQA 5TOZA 2C6EA 4BCGA 3LQ3A 4BF2A 3OHTA 2QOHA 4NCTC 2VGOA 4TYHA 5GJGA 2VWXA 5E90A 4FTOA 1E1VA 4IAFA 3QCSA 3RWPA 5KZ0A 4EOOA 1OPKA 3KGAA 2W1GA 4XRLA 4ID7A 2VGPA 3JY9A 3K3PA 2JKOA 3VRZA 5HLWA 4N6ZA 1XKKA 2VTHA 5JH7F 4GG5A 4IANA 2W99B 4N6YA 2H9VA 4IVCA 4MXCA 5D7VA 5CENA 3RPOA 4QP3A 5KBQA 4YB8B 2R64A 2UZTA 2R3RA 2VX1A 2ZDGA 2C0IA 1JAMA 4YAKB 2FUMA 4DFNA 3RWQA 4TT7A 4MV8A 3DV3A 4JBPA 2NU7B 4XHKB 3EN7A 3CIKA 5HE3A 4APPA 5I0BA 3DBFA 4YJNA 3ORXA 2Y4IC 4AN9A 3QX4A 3UPZA 4GFOA 4O0UA 4DTAA 5IYZF 2WXVA 2C6IA 4AWIA 4F6WA 4ZS4A 1M52A 3P23A 2PMIA 4TYHB 1H26A 4C2VA 4G3GA 1FGIA 3LCTA 4BDDA 2QO9A 4YSMA 3RHKA 4BTFA 4GYGA 2GHLA 4U40A 2B52A 2B1PA 3KAKA 4ENYA 2ITZA 1GY3A 1G3NA 1RW8A 2PVFA 2V5QA 2W96B 3LPBA 3M2WA 1HOWA 2OLCA 2X2KA 3QTWA 4KINA 3R28A 2XMYA 2H96A 4A07A 4B9DA 4CVAA 4U8ZA 4UEUA 3R01A 4BCQA 1Q3DA 3D5UA 1JVPP 4JVGA 4X2GA 5HCZA 3ZBXA 5EM6A 5L6WL 3G8CA 4PL3A 2OI4X 3KB7A 4BVUA 2WMAA 5LVOA 5JGDA 2G1TA 4OTFA 3UP2A 3VHKA 5I9ZA 4J96A 3QZFA 1PXLA 5HNIX 3GU6A 1O6YA 3E3PA 4C58A 4O0VA 5E4HA 4S30A 4W8EA 2PPQA 4PTCA 3R8UA 1ZLTA 1PXIA 2C69A 2GQGA 2XP2A 3OY1A 2GPSA 4QYEA 4FTLA 4CZUA 3NNWA 4J71A 4C3FA 3C4CA 4HYUA 2R3IA 3CR0A 3P78A 4NSTA 5CLPA 5D10A 5EHLA 3VNTA 3RPVA 4F9WA 1YOMA 2G01A 5AIKA 5JVDF 1ZMVA 3TUDA 1H07A 1XH4A 3FMKA 4WBNF 5TF9A 5D7AA 1W83A 3WNZA 4ACGA 3KFAA 1OVEA 2C30A 3O0GA 2A2AA 4FZ7A 2WNTA 4NJ3A 2PE1A 3R73A 4ANLA 4HNTA 4M0ZA 4JG6A 2ZDQA 1UA2A 3QZGA 4F6SA 2YEXA 3PYYA 5LMKA 3QKLA 2WTCA 4QMSA 3NWWA 4CV9A 5BVDA 3LCKA 5ITAA 3QKMA 2JDRA 1QPEA 1P4OA 3DS6A 5D12A 3WZEA 5CZIA 5AP0A 5M51A 5E8TA 2VQDA 4CSVA 3FI2A 3K3JA 4TY1A 5CU2A 3RJCA 3U51A 5FEDA 2PULA 2I80A 3ID6C 2CZGA 3P86A 1AD5A 3MY0A 2IZRA 4NYEA 4DBNA 3AC1A 4EH2A 4PP7A 4EHGA 5KX5F 1Z5MA 4E6CA 3KXZA 5EDPA 4ACMA 2W4JA 1R0EA 1UNGA 4X0MA 2XB7A 5BVKA 4PY1A 4BCOA 2W1DA 3HV6A 3KVWA 3QXOA 4O0WA 5IQGA 5CB4F 5HO8A 2JC6A 2QKRA 3TWJA 3VOTA 1KV1A 4ASZA 1W96A 4LI5A 2QCSA 4ZY5A 3SOCA 3BELA 4X2KA 4YTCA 5HU9A 4FL3A 4QP1A 3TTJA 2HK5A 4NCTA 2C1AA 5L2IA 2XM9A 4YTHA 4AXAA 2B9JA 2E9PA 2FH9A 3PJ8A 5AX3A 5HGIA 1CKPA 4Q9ZA 3GCPA 1CM8A 1AQ1A 3UOKA 2ZYBA 1DV2A 2BZJA 4UY9A 5C01A 1SNUA 5T68A 5L8LA 1ZOEA 5M57A 4FSNA 1VJYA 5AP7A 3D7TA 4FNWA 3QA0A 3R2BA 4FV4A 4TYEA 4S32A 4X2NA 1BI7A 3PJCA 4DEHA 3VPBA 2QG5A 4UWCA 3UZPA 3ZC5A 5L8KA 4JBQA 2C5NA 1H1SA 4MKCA 5F95A 2X81A 3PY1A 2YJRA 4PF4A 3TZ7A 3MDYA 2YIWA 4WSYA 4DA5A 2GPWA 4I0RA 3HKOA 2BDJA 4YR8A 4M15A 4C61A 4ME6A 1GZNA 1OI9A 4DGGA 3CQWA 4FC0A 4YJTA 4TWPA 5T6KA 4D55A 5AWMA 3ZM9A 4KRDA 4RJ4A 1UNHA 2CGXA 5AV3A 2VWVA 3KN6A 2HZ0A 3N51A 3O17A 4RWJA 4EJNA 2WD1A 3G9LX 4O7YA 2WHBA 3CXWA 1KJJA 5FBNC 3V8TA 2PYWA 4U80A 3UFXB 4QMPA 3RK5A 4BDKA 2I0YA 2R3JA 3ETAA 4YZBA 5HG9A 3D7TB 4M12A 5EHYA 5J8IA 2ZDTA 3O71A 3QTQA 3MY1A 4FYOA 4JAIA 4QYGA 1DAWA 4K11A 1KJ8A 5M09A 1ZZ2A 3WI6A 2BUJA 1QPCA 1ZRZA 2WMXA 5TT7A 4U45A 4BYIA 3MH0A 4XP3A 4RX7A 3SXFA 3UIBA 2W6ZA 2GQRA 2XZSA 1NVQA 2NP8A 3TV6A 1YHSA 3V8SA 4BBEA 3RINA 5IQCA 1H27A 3ORZA 5A4EA 3SG8A 4C35A 1A9XA 4NU1A 3OTVA 5E8XA 4F08A 3TNHA 4I50F 2PMOX 3OC1A 3DTWA 3FSFA 2Y4IB 4FKQA 3S95A 3WF8A 3FLNC 3BWJA 2CN8A 2J5EA 3OWPA 4LV5A 1G8AA 2YDKA 2PE0A 2J9MA 4JBVA 5E8UA 3EH9A 3BG5A 5J2UF 4IB1A 3HZTA 2OJJA 4GVJA 5CAUA 4RVLA 3Q9ZA 4KD1A 3O7LD 3FC2A 5CVGA 1W8CA 3KULA 4EH5A 5ICPA 3QRKA 5CTPA 4IX3A 4OTQA 1NY3A 4CLIA 4A4LA 4ENXA 1EUCB 2O65A 1JSTA 1B38A 3LFSA 4L01A 5FXQA 2WTWA 4HYIA 2G2HA 4ORKA 4DGLC 2OLSA 4JG8A 3ZHPC 3GFEA 1MRUA 2OICA 2W0JA 2ZB1A 2R3QA 3VBVA 1OIUA 3BHVA 2BRGA 3KXHA 5D41A 4O7SA 1ZOHA 2CCIA 4MYGA 4QQJA 4D4YA 1CQIB 1RDQE 4D5KA 4IAYA 3LM5A 2YM5A 3BPRA 4EOJA 5BPHA 3P4KA 1JPAA 4TWOA 5JRSA 3RALA 4CFWA 5GNKA 5M55A 5CVFA 3DAKA 4HYSA 4AFJA 2FP4B 3NVKI 4KBAA 3C5IA 1QMZA 2YWPA 5CEQA 1H28A 5LOHA 4FKRA 4AZWA 4MV4A 5EZYF 4FT7A 2E9OA 2X6DA 3LFBA 2VRXA 3PG1A 5KX8A 4GV1A 3HECA 1AUVA 1V0OA 3E3BX 1YOLA 4JRNA 3RNIA 2Z8CA 3KULB 4LYNA 4YMJA 3TTIA 3TW6A 4KBKA 4PMMA 4GU6A 3QCQA 2J0JA 5AV0A 3RFCA 3AGMA 4BYJA 1UV5A 2WEIA 5ETIA 5C26A 1OGUA 1PMUA 2OU7A 3LFFA 4BZOA 3CKWA 3VUMA 5JEBA 5KKRB 4R1VA 4U5JA 2R4BA 4J7BA 2C3KA 2W1IA 4G3CA 3OEFX 3V3VA 3ZDUA 2X4FA 3CLYA 1IASA 2A0CX 2XCLA 4F1TA 2WQNA 4QNAA 4R5YA 5AUVA 2ZV8A 4C36A 2FSMX 2BTRA 5H3QA 1VZOA 3POOA 1JSUA 4RWLA 3QKKA 2J2IB 4TN6A 4XV1A 2UW8A 5BVEA 1B39A 4CMUA 5L2SA 4WNKA 2BALA 4BHNA 4J99A 2PBZA 4EZ5A 4ZI7F 3GU5A 4WBBB 5JKGA 2UW0A 5IG1A 4ZJIA 4GFMA 3LKMA 1LPUA 3QTUA 3VPCA 3HMIA 4LFIA 1LR4A 4MHAA 4TYGA 3ZMMA 2QOLA 3LQ8A 4U6RA 4OT6A 5D11A 3CSVA 5GJDA 3LFEA 3V5QA 2WIHA 3PVWA 4E6DA 4FMQA 3C51A 1OIYA 5HNBA 2Y4PA 2WTKC 2P3GX 2YM7A 4E4LA 4F9CA 4TRLA 2ZVAA 2Q83A 3QA8A 4M9UA 4OBOA 5EI2A 2WELA 5FP6A 3NUXA 1T46A 4I6QA 1OL6A 4E5AX 4KIPA 3GU8A 4R6VA 2HIWA 4CT2A 4EGJA 2YAKA 3HNGA 1QL6A 5CF5A 3ODZX 3TZ8A 4CLJA 1JSVA 3NIZA 1ERKA 3FMNA 3GU4A 1PXPA 5FQDC 2WQMA 5HD4A 1KWPA 3TNWA 4QP9A 4C5CA 5EKOA 4XYFA 1J1BA 2BZKB 3JPVA 2YDIA 5LMBA 3RKBA 3LE6A 3T9IA 4D0XA 3VA7A 1IA9A 4G9CA 4QQ5A 5FM2A 5J2TF 1J3HA 1WAKA 3UG1A 3TACA 4FZFB 4EHVA 4L9IA 3R71A 2IG7A 5CXHA 4U42A 4AT5A 2LGCA 4IQ6A 1DS5A 4IH8A 5HX8A 2EVAA 2W1CA 2C5XA 4RX9A 3MVHA 5DEYA 3QZIA 4AOTA 5JQ8A 4R78A 4DFYA 2RFDA 4I21A 3ZUUA 5FEQA 1PXKA 5K5NA 3NX8A 4L43A 4E5BA 4MV6A 3VUIA 4FSTA 4ANMA 1WFCA 1ZY4A 5GIPE 4UYNA 3R7UA 3VMMA 3EQPA 4TWCA 4O0XA 5CNNA 4AQCA 4DHFA 2IW9A 5LMAA 3RAHA 4FG8A 4JQ8A 2BHEA 3FMDA 3EYHA 3I0QA 3SD0A 4IMYA 5DA3A 4FZ6A 4HZRA 2CNUA 5HD7A 3HAMA 3DZOA 2BRHA 3RPYA 2Z7QA 3UO6A 1YXTA 5KZIA 4IB0A 4BIEA 3UNZA 2EXMA 3FZOA 3MH1A 2C3LA 3R1NA 4N57A 1PW2A 3R9OA 4ERWA 5L8JA 4L3JA 4PDYA 5KHXA 3HBLA 5FTGA 3GCVA 1KE9A 2WPAA 4OGRA 5ETAA 1SMHA 4CNHA 2BDWA 2WMVA 5HORA 4GUEA 3EMGA 4YLLA 2WMBA 2JLDA 4BIBA 4DITA 1J7LA 5FGKA 3S00A 5C8YF 1M7QA 2UVZA 5DNRA 2Z7SA 2VTRA 2JKKA 5JQ5A 3I0OA 1VKZA 3EQIA 4DEBA 3DK7A 2W6MA 4RWKA 4FKIA 5EYDA 4XS2A 3W2SA 3G0FA 1IEPA 1GIJA 1VBHA 1OB3A 3HVCA 3ZXTA 4C37A 2W1FA 4DTKA 5CU3A 1P14A 4I5MA 3POZA 3OF0A 2XKCA 3MJ1A 3TV7A 4D5HA 1JKJB 5HCYA 2BPMA 2X6EA 4ZP5A 2VTAA 3ULZA 5FRIA 2CCHA 3QAME 1YI3A 2RL5A 5HVKA 4BI0A 1E1XA 5BPFA 3HA8A 1YDTE 5AUZA 3E8EA 5ANOA 3BRBA 4FV1A 3C4EA 3KVXA 2WQEA 4WO5A 2VTLA 3RV3A 3KK9A 4FKGA 3NW7A 4O7ZA 3A61A 1ZARA 4X3JA 4XV2A 4BTJA 4EORA 4XLIA 4QSHA 1SZMA 4PRJA 3LLAA 4XLVA 3ZLYA 5BUEA 4BCJA 3EL8A 4U3ZA 2CLXA 2W9ZB 1GJOA 4Y8DA 4I5CA 5C8MA 3TJDA 2CMWA 1OIQA 2CHLA 2WGJA 4S34A 3BHUA 2XK9A 3GCUA 3O96A 3TIIA 4LRMA 4EK8A 4DT8A 3D9VA 4APCA 5IZFA 3UTOA 2IVSA 1YHVA 3BLHA 4D4RA 1BLXA 1A48A 3IOKA 4Y95A 4IHJF 3HLLA 4XX9A 4EONA 3BIZA 3BYUA 5CEPA 4RGJA 5CX9A 4GT3A 4OT5A 5F9EA 3PY0A 2GQSA 3GUBA 5DR2A 4YJ2F 3IS5A 3ROCA 1H1RA 3U87A 3R7IA 3BGPA 3W55A 5BUIA 4USEA 4EYMA 2C5OA 3B2TA 3MBLA 2ZAZA 4OW8A 4LG4A 4K0YA 1FMOE 2ETKA 3DFCB 4WG5A 4KKHA 2R3OA 2VX0A 3Q2JA 3I6UA 3LCOA 2PVYA 3R9HA 2YYAA 3H0YA 4ALWA 5LWMA 2HJWA 4YNEA 3F61A 2QURA 4FKVA 4LOOA 5ETCA 3LMIA 4F4PA 3AC3A 3SLSA 3GXLA 2O64A 3WYXA 3LXKA 4LUDA 4EC8A 4ACCA 5JN2A 3IW7A 3WOWA 3EQHA 3DZQA 5K4JA 4FV6A 4IB5A 2CSNA 4IB3A 2QOQA 4KKEA 3ZO3A 5IA4A 3AD4A 1CE8A 2VO7A 2J0IA 3W16A 1FPUA 3OOMA 4IJ9A 3ZTXA 1EH4A 4D1SA 2YS6A 3UODA 1J7UA 1YQJA 5CNOA 4ZY6A 4DYMA 5HVYA 3TZ9A 2CGWA 4AOJA 4JX7A 4C2WA 5HI2A 2OIBA 3GQLA 3BE2A 4G16A 4ZJJA 1OZ1A 2XJ2A 4AW2A 3TN8A 3PJ2A 1XHAA 4OTDA 3FI4A 5H8BA 2C6KA 4U41A 4K18A 4L7FA 4FNZA 4G6OA 4O96A 3KMMA 4EEVA 3R30A 4OUCA 4PNKA 2YACA 3DXQA 3FPQA 4Y73A 5EG3A 4RMZA 4EK5A 3ZSIA 3HMOA 3A7FA 4MWHA 5AP3A 4IDVA 4CEGA 3OROA 3IDPA 4LRJA 4EOLA 5CAVA 3NUAA 4TW9A 5AAFA 2J5FA 3UVRA 2ZV9A 1ZWSA 3EJ1A 4EK6A 3QL8A 4QTCA 1SVEA 2PZIA 1W84A 3AD5A 3EL7A 4XBRA 4QYHA 4YU2A 4FI1A 5HLNA 2GTMA 2VX3A 1H4LA 2RFEA 2Y9QA 2HZNA 2HCKA 2IP4A 1Y91A 3DAJA 5E7RA 4AW0A 3U6HA 3Q6WA 4H3PA 3WE4A 4ZLZA 5ANGA 4Z16A 1R0PA 2O0UA 3FLQA 3VF8A 2UZUE 3BQCA 4E73A 2PVRA 3MA6A 3KK8A 2JDVA 2ZV2A 2WMTA 3DB6A 4KA3A 4YJPA 3PVUA 3CD8A 4DGNA 4QTEA 2ESMA 3VW8A 2BDFA 5H9BA 5IQDA 3MWEA 3GOPA 2I87A 4BDEA 3QHWA 2YRWA 4HNUA 3R8PA 3ZDIA 4ANSA 4DGOA 2A4LA 4IVBA 3V8WA 4B4LA 1EUDB 1H08A 5I9XA 2OK1A 3PLAE 1PJKA 1MRYA 2R3LA 2OGVA 3KY2A 1REKA 4F6UA 5DT4A 3MVJA 5IF1A 2YERA 2GNGA 4B6LA 1X8BA 4AT4A 5M07A 4FIEA 4FKPA 4IM0A 1WBPA 4PX6A 4E6QA 3OVVA 5BPYA 5M4IA 4S33A 2WIPA 4RPVA 4OBPA 5DI1A 4HVHA 4F0FA 1H1QA 2YITA 4M8TA 4PTEA 1KOBA 5CSXA 5M06A 4GKIA 4NKSA 3ERKA 1BXRA 4NIFB 4QP4A 3BYSA 3V6RA 5EYCA 2LAVA 3DLZA 5AV2A 3BU3A 4DBXA 1IA8A 3MV5A 2DZDA 5JFXA 5JZNA 4AN2A 3CTJA 3DTCA 4UXQA 2QLQA 2GFCA 4RJ3A 1UU7A 2PU8A 3HP2A 4ALUA 2WYOA 2R7MA 3L9LA 4KSPA 1Q5KA 2XRUA 3L8PA 1MRVA 2FVDA 4I0SA 3V01A 3U6JA 4RVKA 3OUZA 3EFKA 5CVHA 4R3RA 5E1SA 5D1JA 3ULIA 3QF9A 4FTUA 4IAIA 4K1BA 4A9RA 5EDQA 3PVGA 3G5DA 1KE7A 4G3FA 4Y5QA 3BWFA 5CI6A 2X39A 3OBGA 1ZOGA 4EKKA 4FIGA 1HCLA 3ZEPA 4I0TA 2YAAA 5A4QA 2OWBA 3CPCA 3QGWA 4JL9A 2J0LA 2BIKB 3OCSA 5BMMA 2R7BA 4I4EA 4EI4A 2GLTA 5HV6A 3TUBA 4EK4A 4BB4A 4ANQA 1ZYJA 4GT4A 4I4FA 2Z7LA 1URWA 4UYAA 5CEIA 4FGRA 2PY3A 4A06A 4EWHA 2XUUA 2C6OA 5AUYA 2C0TA 1J1CA 5LYJF 3HV3A 1YDRE 3RTPA 1OL5A 4FTCA 4BGGA 3F5GA 4GS6A 3WZDA 1U5RA 4AS0A 4BHZA 4PMTA 1PYEA 3DKCA 1P2AA 3V51A 4JR3A 2PVPA 2R3MA 4O6LA 4EH9A 3B8RA 2OW3A 3MFSA 3PP1A 1E4EA 4FVRA 1PMVA 4C5BA 4L42A 3FXWA 2XJ1A 4UN0C 2J90A 2P2HA 1B6RA 4EH3A 3TCPA 2ERZE 3IGOA 3U6IA 2ZDUA 4KBCA 2XIYA 3ORKA 2P0CA 4ZEGA 4DEAA 2B55A 2BVAA 4L00A 5I9WA 3WILA 5K9IA 1OL1A 4CRLA 3ENMA 5CF4A 3FL5A 5EQPA 5ACKA 3JS2A 2BFXA 4O0SA 4F7JA 3I60A 4GT5A 4QP2A 4RIXA 2FYSA 2PZRA 2XK4A 2FB9A 4RLKA 4O2PA 3O7LB 3ROYA 4FSUA 3EYGA 4RG0A 2YM3A 4HCVA 4YJUA 3C50A 2QU5A 4F9BA 4YLKA 2GS6A 3FZ1A 1U4DA 3ALOA 4TKSA 1URCA 5HVJA 4IWPA 4F0IA 3LJ0A 3O23A 1E4EB 5HLPA 4I20A 4YBJA 4XBUA 1SCUB 1JBPE 2IO6A 4GG7A 1KE5A 1Z9XA 3C4XA 1UWJA 3JVSA 4PNIA 5CZHA 4D9TA 3RUPA 2ITQA 4H3BA 4FX3A 3H30A 3SE7A 2W6QA 5CXZA 5B2MA 4AZFA 5IEVA 3WZUA 3FYJX 3HEGA 4DH5A 4I1ZA 4QRCA 3VUKA 2WOTA 4RIXB 4G5JA 4AN3A 5KMOA 2JBOA 3IDCA 2B53A 3OCBA 4GUBA 2EB2A 2Z02A 2QHMA 3UIMA 4A4XA 4JIKA 1RE8A 5AA8A 2JEDA 2O63A 2PMLX 3PPZA 4QMMA 3FLWA 2WAJA 1GLVA 5CI7A 2UZDA 3FLSA 4EWQA 2WQBA 3EN4A 5BVNA 3R23A 4FEWA 2RG6A 1CS0A 4O22A 3Q3BA 3EFLA 1H01A 4IWDA 5HCXA 3PJ1A 3P7CA 3DJ7A 5IA5A 2QC6A 4R7BA 4ZTQA 2F49A 3DBCA 5TR6A 1Y6BA 3NGAA 1TQIA 3GB2A 3IGGA 3QQGA 3REPA 5IUGA 4GYIA 1JDBB 3OXZA 4QYYA 3R83A 3TXOA 1XBAA 3PXQA 4FT3A 4RA4A 4I5HA 4RC2A 4XV9A 2OFUA 3PIYA 4QMWA 3WYYA 4FUXA 2W1EA 2X7GA 4WNOA 3R1YA 4JDJA 1F3MC 2QOOA 5C8KA 4MV1A 2YW2A 4NFMA 1FOTA 4D1XA 1KE6A 2X7FA 3VVHA 3NW5A 3G2FA 4I6FA 3AG9A 5KKRC 4IW0A 2Y6MA 4O38A 3EZRA 1U54A 3KRLA 4I23A 5HE2A 4ZOLF 3SX9A 2V7OA 4UALA 3KXXA 5BUJA 4U97A 4MD7E 5F94A 2Z2WA 1GOLA 1I09A 2XNPA 3NPCA 3IOPA 4U0IA 3W2RA 3F3TA 4BDHA 3QQKA 3QZHA 2W6NA 1Q8UA 3R1QA 4JT3A 3GFWA 4O84A 4YJQA 4ZTMA 3UZRA 1V1KA 2QO2A 2OKRA 4FSZA 4NW5A 5FEEA 4XG4A 5FD2A 3A8XA 3ORTA 1IAHA 4J8NA 1BI8A 1ZAOA 4Q2AA 4XV3A 3AC8A 1H00A 4NL0A 3Q2OA 2PVJA 3D0EA 4F70A 3TL8A 2BR1A 3JY0A 3OFMA 3LFNA 4FKSA 1J7IA 4G3EA 4IX4A 5B0XA 2PUIA 2J6MA 1OMWA 2HOGA 4R3CA 4DH7A 2E9NA 4FTKA 5A4LA 5JFVA 4FL2A 2WMQA 3HRCA 3W32A 4DLJA 3D14A 3OW4A 4HQ6A 3KXNA 3VC4A 2OSCA 1G8SA 1U54B 3EZVA 3BGZA 4BI1A 2F7ZE 4ZTRA 3PA5A 4DN5A 2X8EA 3CQUA 5IUIA 2UW4A 4UWYA 2PE2A 1CTPE 2XK7A 4H36A 3GU7A 5CASA 5HO7A 4HJOA 4KNBA 2VWYA 2PZYA 3EWHA 1YW2A 3R2YA 4DH1A 2ITYA 3RI1A 4F64A 2OJ9A 3AOXA 3O2MA 4YZMA 3LLTA 5IA3A 4WNPA 4EOMA 2G2IA 2PVNA 4H58A 3FL4A 3ELJA 5IH6A 3HRBA 2OFVA 4AA5A 2YFXA 4TPTA 4ACHA 4L8MA 1YXVA 2JD5A 3W10A 1R3CA 2QOKA 4DEEA 3OCGA 3F6XA 3LCDA 2WTDA 4IX5A 5DYJA 3HUBA 4IAKA 1OUKA 5DT0A 5E9EA 3G51A 2ERKA 2CKQA 4BRXA 3JR1A 3OBJA 3ZCLA 3DY7A 3HX4A 3R04A 2F7EE 5AJQA 1NVRA 3COMA 1Z57A 3FMJA 4HGLA 3BQRA 4BN1A 4IEBA 3N4VA 3L9MA 5LVLA 5AM6A 1Q8YA 5G1XA 3RMFA 2XKEA 1NXKA 4KS7A 5CU0A 3UQFA 1U59A 3Q52A 3DBQA 4FV8A 1M6VA 1PXOA 2BRMA 4MBIA 1Q8ZA 3FY2A 2X8IA 3R63A 4YTFA 2DUVA 4FV0A 3ORQA 1Q4LA 3FV8A 3V04A 4AE6A 4MD9E 4M3QA 3QRIA 4E4XA 5AUUA 3D83A 3FYKX 3F2AA 3CPBA 4BDGA 3QXPA 5KCVA 3COKA 2X1NA 1U5QA 2Y8OA 3CY3A 4L3PA 4D9UA 4DFXE 3OXIA 5ETFA 4DAWA 1YXUA 2C6LA 3T3VA 1JKLA 1RJBA 2UZVA 2RFNA 3OT8A 4MD8E 5C9CA 2PMNX 2O3PA 3U55A 4M69B 4OBQA 4MA0A 2RKUA 2HAKA 3AC5A 3DU8A 4C3RA 4ZMEA 2QOBA 4GCJA 4IC7A 3RM7A 2EWAA 5CSPA 1XWSA 2IZUA 3F88A 4C62A 2R3NA 3VS0A 2HGSA 3ZC6A 3CEKA 2XD4A 4GMYA 3E93A 4CKIA 3U8WA 4BGHA 4C4EA 1B6SA 4A9UA 3JZIA 2X4ZA 4DEIA 3VS6A 4XH6A 4ZOGA 2JAMA 2XEYA 3KXGA 4ACDA 4FFPA 4ASDA 4WA9A 3W2CA 4CZTA 4RJ6A 1H24A 3DKGA 4XRJA 2R7LA 3COHA 1KEEA 2H8HA 2UW9A 5JFWA 4HVSA 5C4KA 4U81A 3SHEA 4ALVA 2XIZA 3IK3A 4O7WA 4KRCA 3SW4A 3VN9A 3WBLA 4F1MA 5LVMA 4FTMA 2ITTA 5AV1A 2KULA 2VO0A 4GU9A 2R85A 3DB8A 5EOLA 1WVYA 3WF7A 3ZO1A 3UQGA 3MVMA 2B9HA 4IZ7A 1JLLB 4IM2A 1YI6A 3E63A 3PXKA 3FMEA 2W4KA 4G2FA 3PXZA 3ZFYA 2HY81 1UU8A 4D2RA 5C1QB 4YBZB 4QMQA 4BKJA 3FUPA 2H34A 2JDOA 4PDPA 4MXAA 4IJPA 3UNJA 3V5TA 4JRVA 2J4ZA 2W6OA 4FFMA 1V0BA 3RP9A 3IQ7A 5M4UA 3W2PA 3FXXA 1VR2A 3FMHA 3U54A 4YZCA 5ANJA 1Z2OX 3WE8A 2AUHA 3P7AA 4Y5HA 5K5XA 3NR9A 2BMCA 4M7IA 4B7TA 5DG5A 4O4LF 4CD0A 5JK3A 2HELA 5HIEA 3CGFA 4GFGA 3ZSGA 1OBGA 4RBLA 4Q5HA 1DI9A 4QTAA 5FP5A 2B0QA 2CNVA 3ZSHA 2YZLA 3CTQA 5FLFA 1FINA 3NAYA 5FXSA 2YDJA 4XG8A 4B0GA 5M56A 5DBXA 3VS5A 2QG7A 1PYXA 2I0VA 4QT1A 2QR8A 3D94A 3G90X 3WF9A 3BI6A 3GGFA 4O6EA 4WNMA 4C4HA 4F7SA 5ANDA 5E8VA 2FPGB 3COIA 2H6DA 4HCUA 4P5QA 3C4ZA 4A4OA 3JYAA 4BDJA 3A60A 3IKAA 3BYVA 2PK9A 3GC8A 3ORLA 4JIAA 4L44A 4QMZA 3TNIA 4E8AA 2F4JA 4RA5A 2WTIA 5DHJA 1NVSA 1W0XC 3K3IA 3U4UA 4MV3A 5IQIA 4MXXA 4BZDA 4CG8A 2QLUA 1CSNA 3QWJA 4FTNA 2CPKE 2A27A 5A9UA 1KC7A 5IEYA 2Y0AA 2V0DA 4D1ZA 5KNJA 5TKDA 4HW7A 3HV4A 2FSLX 2WU6A 3NYOA 3GI3A 5HBRB 3VIDA 5T3QA 3QD3A 1DIKA 4MCVA 1BL7A 3C4FA 3L1SA 4AGCA 4HR7A 2YZNA 3QGYA 4J98A 1Z2PX 5HBEA 3Q9WA 2WMRA 4I22A 4MTAA 2CLQA 3FZTA 2VNWA 3P7BA 4KSQA 3QC9A 3VBYA 4W4YA 1Y57A 3MGYA 4FT9A 4LOPA 2B54A 4LV8A 4ONAA 4MF1A 4FVQA 3H9RA 3NVMB 4HYHA 1Q24A 3OMVA 1STCE 2GMXA 3ET7A 3PVBA 5FTOA 4EH4A 4FK6A 4FKTA 1GSAA 4YZDA 2GNFA 3GC9A 2W17A 3D5XA 2I8CA 4O7LA 2JFMA 4NUSA 3TG1A 4E20A 5EW8A 2F7XE 4RT7A 5L2WA 2BKKA 4F99A 2UZOA 3DQWA 4GVAA 4R7HA 3NUSA 4RIYA 5E8ZA 4YJ3F 3AMYA 4YZ9A 1YWVA 2CGUA 4BDIA 4PMPA 4QTBA 4FBXA 4GK3A 3R7VA 5HZNA 4P2KA 4O0YA 4K77A 5HQ0A 2VTJA 2ITOA 3OD6X 4XP2A 3LFCA 3CBLA 3EN5A 2WB8A 3KRRA 4I55F 2VNYA 4TXCA 2VTQA 3RZBA 3TKHA 4BTMA 5J9YA 4ZTLA 2W05A 2JKQA 3R9DA 4DCEA 3FC1X 1KOAA 4PWNA 2XA4A 3W18A 4ITHA 5KBRA 2YS7A 1ZZLA 3NNXA 5KO1A 3HB9A 1Y8GA 3G33A 2UZEA 2OO8X 5CANA 5CU4A 5DT3A 4FUYA 5JT2A 4GJ2A 4RIYB 1ULZA 4EOPA 2YISA 2PVKA 3MFUA 5A6NA 4FV3A 3IG7A 2IN6A 3OP5A 2PUNA 4ZZMA 3PXYA 3VO3A 3MVLA 1ZYDA 2VO3A 2ZOQA 4DEGA 5DRDA 1MQBA 5C27A 3SKCA 3EQDA 3VQHA 2Z04A 2OZAA 3LFDA 1FBNA 3Q4UA 4WBOA 5F4NA 3FKLA 4UWBA 2JBPA 3V5LA 5TO8A 4ASXA 2YZMA 3DK3A 3S1HA 1S9JA 4AG8A 3VS7A 4EHZA 2XS0A 5ANKA 3PP0A 4S31A 3PUPA 4NM5A 1TQPA 4FIJA 3QRJA 3PG3A 3KL8A 2VU3A 3U9CA 2IVTA 4U9AA 2YM8A 3AXWA 2QVSE 4CKJA 3DPKA 5AUWA 4AE9A 4BDBA 1H8FA 2YM4A 4RX5A 2WQOA 2QK4A 4FV2A 3EFJA 5IEXA 1MP8A 4B8LA 4U7ZA 3QQHA 4BZNA 4DFZE 2BAQA 2DYLA 1A06A 3EKNA 2C5YA 5FG8A 4ZHQF 2SCUB 5D8DA 3PA3A 4ZQIA 4IZAA 2FGIA 1ZMUA 1FVTA 3ORPA 2GHGA 3QD4A 3R1SA 4AA0A 4IHPA 2DQ7X 3N4TA 3CCNA 2XK6A 4OTWA 4O7NA 3N8DA 5J1VA 1W98A 1WBWA 4AUAA 1PY5A 4RFZA 5ANIA 1BX6A 2OZAB 2W70A 4JQ7A 2IZTA 3QTIA 1PRYA 4MVFA 4QMVA 5CEOA 3A7HA 3PY3A 4GIIA 3Q5IA 1TVOA 1QPJA 3GQIA 3HL7A 2R7IA 3TI1A 3ZLSA 4FKJA 4EG0A 3DXPA 2BAJA 3O8UA 4AA4A 3CD3A 3MWUA 3ORNA 2FA2A 4YC3A 3W8LA 3E8DA 4EOKA 1OL2A 4WIHA 2OG8A 3NMUF 5AP5A 5E1EA 4FV9A 2R0IA 2YCRA 1OKZA 2GS7A 2UZLA 4L53A 3MN3A 5B2LA 4FK3A 3C7QA 3PSCA 3BV3A 3FE3A 1GGOA 3HMNA 3GCQA 3WF5A 3ZH8A 4ZLYA 4EYJA 1H0VA 3DNEA 3IW5A 4MAOA 1CQJB 3WIGA 4WRSA 4CTBA 2B7AA 4C4IA 1SM2A 3E8CA 2QD9A 3JZFA 5LCKA 3MTFA 1AGWA 4JDHA 3KRJA 1OKYA 3IW8A 4FTJA 1M2PA 4C0TA 4N70A 3CE3A 2VTNA 4P4CA 3Q6UA 4TYJA 2KTYA 3R8ZA 2VTOA 3BE9A 2RGPA 4HGSA 5BYYA 4BTKA 3E88A 4X6QC 2YCSA 3DKFA 2YIYA 3LOKA 1H1WA 2XNGA 4GEOA 3TJCA 3KRXA 1T36A 5GHVA 2AC3A 3KKVA 4OTIA 1YWRA 3ANQA 5L6OA 4XG3A 4F63A 3T9TA 4FSWA 1CKJA 2XCKA 4V01A 2OBJA 3KXMA 5IQBA 4FT0A 5LXMA 1CKIA 3ZUTA 4RRVA 3ETJA 2C6TA 3UDBA 4HNVA 2IW6A 2ZMDA 1XQZA 5HHWA 3V5PA 4J97A 3AD6A 4QQCA 1A9UA 2ZMCA 4HPTE 4Q9SA 3QC4A 4EUUA 5AAGA 4RSSA 4UB7A 1F5QA 5CSWA 3W33A 2HWOA 3CC6A 4MBLA 3AMAA 3R02A 4C33A 5A4CA 4FR4A 5CALA 2OJFE 5J9LA 5E8SA 5KE0A 5CQWA 4MV7A 1OKWA 3OUUA 1E9HA 5DPVA 5M44A 3DLSA 3LJ1A 4E93A 4UZDA 3UC4A 4DC2A 4RJ7A 2FPPB 4CFMA 4EQUA 1IOWA 1Q8TA 3CY2A 2UVXA 4C59A 2HW7A 5CT0A 3GENA 5CYIA 2Q0NA 2IZSA 3ZO2A 2GNIA 3QUEA 1YXXA 5DH3A 3WIKA 4L46A 4F9AA 4IBMA 3ATSA 3QQFA 3N9XA 4IX6A 3QD0A 5LARA 3NW6A 4QNYA 3H4JA 2NRUA 4BCIA 4TNDA 2P4IA 3KMUA 3R9RA 5AADA 4FG9A 4ZXTA 3UQCA 2R9SA 3KF7A 3FLZA 3TM0A 3VBTA 3QQJA 3KN5A 3TEIA 2W6PA 3GIDA 5H80A 5LA6F 3LW0A 5DGZA 5AX9A 3FZRA 2BIYA 2YABA 4YC8A 1DI8A 4CCUA 3QYZA 2I0HA 4JOAA 4EHEA 2RIOA 2YIXA 4DFLA 3M42A 2V58A 1VYWA 5J95A 1B6CB 4FIFA 4OTRA 3VQUA 1O9UA 2JGZA 2UW7A 1PMNA 3RHXA 3Q4ZA 4XUFA 3ZFXA 4EOQA 3FI8A 2QU6A 4R7IA 5M4CA 3OCTA 3ODYX 3ZM4A 3I5ZA 3LXLA 3O8PA 3UIXA 4JJRA 5IUHA 1UKHA 4NKAA 4EK3A 4LL0A 3TDVA 2B9FA 3T8OA 3KA0A 4CFFA 2QF7A 2C5VA 3IONA 5IQFA 3QTSA 3QWKA 2HWPA 4IFCA 3EQFA 3IECA 1NW1A 3W2QA 1JKSA 2R5TA 4QQTA 3SXRA 2WZJA 5HG5A 1C30A 3DXNA 4R3PA 3MYGA 3BHTA 3W8QA 4FEQA 1ZY5A 2ZM3A 5KKNB 1JQHA 2JIUA 4IVAA 3F3WA 3RAKA 4CXAA 4JNWA 4TL0A 3DA6A 5BMSA 4G6NA 3RPSA 2P55A 5J5SA 3KAJA 3N6RA 3SRVA 5KHWA 3AGLA 4HNFA 3UO4A 5IQHA 2PN1A 5DR6A 2PUPA 4YAJB 1PXMA 2QR7A 2FB8A 1JNKA 3K2LA 3QTRA 4RJ8A 2W71A 1WBSA 3KCFA 1WBTA 2W06A 2ITPA 3FDNA 3F5UA 3RPRA 3ATTA 2F9GA 4BBFA 3RGFA 2UZBA 2F2CB 3BYMA 2XNOA 5EM5A 4AGWA 1AUXA 3DJ6A 1YHWA 4QOXA 1XH6A 2W5BA 1CMKE 3I6WA 3I1AA 3OWKA 4LMUA 3UZTA 3TDWA 2DLNA 2O2UA 3BGQA 1GZOA 3VJOA 2CGVA 2C1BA 5M4FA 4K33A 2NNWB 3KRWA 4O7VA 5CQUA 3KALA 2X9FA 2WU7A 4YZNA 1DAYA 4J95A 4LRKA 4YJSA 3PJ3A 4EJ7A 3C5UA 2NU8B 4AP7A 2ZM1A 3G9NA 2P33A 4JX3A 1HCKA 5C8NA 4DLKA 5CEMA 3GC0A 4JR7A 3E7VA 5IH5A 4AZVA 3SRVB 5J87A 4TUYF 4QMOA 1OUYA 4ZSEA 4M84A 4NTSA 3ZXZA 2JAVA 3MJFA 4JBOA 4ZTNA 3FEGA 3UYTA 1L3RE 4BR3A 4RIWA 3AW8A 3L9NA 1R78A 3F9NA 4PV0A 2WO6A 3Q9YA 3UVQA 3PIZA 4UV0A 5JSMA 4D0WA 2BHHA 4ITJA 2V5AA 3QYWA 2ITVA 4IVDA 4DINA 4E6AA 2W5HA 3A7JA 2YIRA 4GRBA 3KMWA 4II5A 4EKLA 4MK0A 3I79A 3FXZA 2IVVA 4AFEA 3IPHA 5C1PA 5HBHA 2OH0E 3QD2B 4O2AF 4EQMA 3K5VA 3PLSA 5KUPA 4FKUA 5I9UA 2BILB 3QQUA 3WO0A 3Q96A 2VTIA 4EQCA 3DKOA 4USDA 3D7ZA 2QONA 5L3AA 4YJVA 4BY9E 3OOGA 1PF8A 4L6QA 2AYPA 2NRYA 5BMVF 4HOKA 2CJMA 3RVGA 1XH8A 2X9EA 5I5ZA 2V7AA 1JOWB 5EQEA 3UP7A 1YWNA 3D2KA 3LQ5A 2VO6A 2W7XA 3GVUA 4RIWB 3R8LA 2WTJA 4RZWA 3DDPA 1FVVA 4IWQA 4YPDA 3SQQA 2C6MA 1VYZA 2NPQA 2OH4A 3MJ2A 2RFSA 3AT2A 4V05A 3RK7A 3QRTA 3MFRA 3S3IA 2GU8A 4HZSA 4I93A 1BL6A 4CQEA 5IH4A 3BYOA 3OWLA 3PE2A 4P7EA 2HW6A 1K2PA 3EKKA 1SNXA 1DM2A 2F2UA 4WKQA 3TKUA 5LXTF 2VN9A 4C02A 3R5FA 2HZIA 4AGDA 5HG7A 3P08A 3MY5A 1YKRA 2E9UA 3QTZA 4KKGA 4YHTA 3I12A 4FFNA 4I3ZA 4BGQA 2Y7JA 1OKVA 4AU8A 3VBXA 3ANRA 2WEVA 1BUHA 4LOQA 5EK7A 4FTRA 4I92A 5IDNA 4QTDA 2UZWE 4C4FA 1XR1A 1WZYA 3EQBA 2REIA 3DNDA 2R3PA 2HENA 2PHKA 3LXNA 2HY0A 4KIQA 4TTHB 2R3HA 3HDMA 4G3DA 2X7OA 1Q3WA 2XKDA 2WTVA 4W4WA 2XCHA 2X2MA 3MH2A 4RQKA 5EDRA 4F0GA 5B7VA 4HVGA 2XK3A 2QOFA 3MS9A 5HKMA 4MXOA 1V0PA 1WVXA 3FY0A 1Y6AA 4DG2E 3NCZA 4CMTA 4FV7A 3GCSA 4ZIMA 2F57A 2X0GA 3OWJA 5EI6A 4AF3A 1KJIA 4YUQA 5ACBC 3NIEA 4ZZNA 3TNPC 5M08A 5I9VA 2GFSA 4RIOA 4W4VA 4MXZA 4AZTA 5JRQA 2CKOA 4IAAA 4I94A 2PTKA 4GKHA 5G6VA 4FKLA 5HICA 1OPJA 5AUXA 2J50A 2R0UA 3F2NA 3ALNA 4FSYA 5CU6A 2E2BA 3LCSA 4MXYA 4PQNA 1EZ1A 2VWZA 1UWHA 1FGKA 2XNMA 4GW8A 1ZYCA 5BVOA 4O4IF 3K5IA 3VUHA 1KE8A 5AP4A 4E1ZA 3TIGA 4F09A 3OZ6A 3BCEA 3BBWA 3ITZA 3L9PA 3S4QA 3ZO4A 4QMLA 3OG7A 4EL9A 4YNOA 4WOVA 5I4NA 5KMJA 1LUFA 3B2WA 2HXQA 3P9JA 3PRFA 3VULA 3LFQA 5BYZA 2XM8A 5HNGA 4FSRA 4ZK5A 3UG2A 4D58A 2V62A 5C4LA 5GIOE 5DOSA 2VWIA 3E64A 4DCAA 2PL0A 3HP5A 1PXNA 2XIRA 4FEUA 3BKBA 3TKIA 2VPQA 3K54A 3OS3A 2OXYA 2BTSA 3II5A 5CT7A 2C6DA 3UPXA 4RC3A 2E9VA 4FA2A 5K4IA 1KV2A 3MESA 2XNEA 3ZZEA 4V04A 4RWIA 3HV7A 4QYFA 5AAEA 2R82A 4I5PA 5I9YA 4MA5A 2HXLA 5HE1A 5JQWA 3R5XA 1Q61A 3NUYA 3PFQA 5AP6A 4MAMA 3N4UA 2QNJA 3DJ5A 3TIZA 4YGAA 2R86A 3TQTA 3MI9A 3FHIA 4LUEA 3QU0A 3E5AA 2BFYA 2IPXA 4WHZA 2G2FA 5IQAA 3UOHA 3A62A 3A7GA 5AV4A 3QTXA 4W8DA 4BCFA 3VUGA 3F82A 2B4SB 2R7NA 1GIHA 3EB0A 4JDKA 4CFUA 4Z55A 3DDQA 5B2KA 3THBA 3OY3A 3DBDA 3RCJA 3SA0A 4FOBA 4WUNA 2XK8A 1CDKA 2OF4A 3WARA 5DIAA 5FXRA 5AUTA 3EQCA 5DN3A 1U46A 4JDIA 2XNNA 1H1PA 5LJJA 4RZVA 3Q4TA 3VW6A 4JQEA 1SYKA 2QOCA 3F66A 3PWYA 2GS2A 2UVYA 3QLGA 3PA4A 2HYYA 2YIQA 4H1MA 3AMBA 1REJA 1YVJA 3OW3A 1NT2A 3R5HA 1OBDA 2YCQA 2YZAA 3O51A 2X0SA 4XOZA 2PZ5A 4FEXA 4JXFA 3S0OA 5DE2A 4YJRA 3O50A 4LMNA 2ITNA 1IR3A 2GNLA 4O21A 2EU9A 3D2IA 4O86A 3LFAA 3ORRA 4FE2A 3FSKA 4B8MA 3C4WA 5A6OA 1RQQA 3E87A 2PVHA 4AZSA 4BC6A 4F7NA 2ZDHA 4C4GA 4RZQA 3PXRA 3FQEA 3C0IA 3HRFA 1NA7A 4FEVA 4K8AA 3SXSA 3LMGA 3ZU7A 2P2IA 5LOVF 5E8WA 1JKKA 5A3XA 4C38A 3PZHA 3VRYA 2Y6OA 4S2ZA 4Z7HA 5EYMA 4FL1A 2JIIA 4PTGA 4MV9A 2QI8A 2CDZA 2CKPA 4EH6A 5JGAA 1L8TA 3PE1A 3FWQA 5EHOA 1UU3A 3GT8A 2XIXA 4NM0A 2OXXA 4G6LA 4FFRA 3U9SA 3PIXA 4X2JA 5EOBA 3LWBA 4IIJF 3VS1A 4RVTA 1O6LA 3HUCA 3I4BA 2R3GA 3SGCA 3F3VA 4I6BA 3R21A 3I7CA 3NEWA 2ITXA 4M14A 4XG2A 3RM6A 1KBLA 3QUPA 2ETRA 4DFUA 4XNEA 1W93A 1IRKA 4DGMA 3NNUA 2IW8A 1TKIA 2R7KA 1MUOA 1PKDA 1QPDA 3E62A 5FDXA 1XO2B 4U3YA 5BVWA 3PWDA 2C3JA 2W1HA 4EZ7A 4O7RA 4QPAA 3EQGA 5AEPA 4CG9A 5EYKA 1F0QA 3ZLXA 5JZJA 3KQ7A 4D4VA 2XEZA 4OTHA 3V5JA 3FPMA 3UMXA 4H3QA 4DFBA 1W7HA 2A19B 2VWUA 3E8NA 1APME 3NRMA 2DWCA 5EQYA 2VUWA 3PPJA 4BCPA 4GK4A 5CF6A 4U79A 3E7OA 3TV4A 3UVPA 3W2OA 4BCHA 4H05A 4F7LA 4KUJA 1ZXEA 2Z60A 5FNVF 3LP8A 3F7WA 2OJGA 3F69A 5EI8A 1FVRA 3O8TA 5DLSA 4FIIA 3AX6A 1IOVA 3HAVA 2WFYA 3CTHA 1LP4A 2BROA 3MB6A 5CF8A 4QMXA 2XRWA 3NZ0A 4O2BF 5L6PA 2X2LA 4C7TA 3CQEA 5IQEA 4JI9A 3TINA 3QUDA 1EYZA 1GSHA 3TT0A 4K6ZA 4ZTHA 4A9SA 4BICA 3AT4A 3EQRA 4AT3A 4YHFA 4I41A 2IVUA 1G5SA 1LEZA 3NUPA 4G9RA 4YO6A 4O4HF 4E4TA 3LHJA 2SRCA 2XYUA 5LWNA 2QHNA 3KC3A 4OR5A 2UW6A 5CSHA 2NU9B 4JLCA 4X6RA 3QHRA 4PMSA 1TQMA 2OZOA 3PSBA 4FVPA 4AZEA 4EBWA 3UOJA 3WZKA 4FTQA 2DS1A 2XYNA 4XCUA 4Y46A 4TV9F 4C4JA 1R39A 3AC2A 4ZLOA 4BDCA 4C34A 4CFXA 1XBCA 3W1FA 4DG0E 4FSMA 3GC7A 5AA9A 3FAAA 3Q04A 4M97A 5IA1A 3Q1KA 4RVMA 4H1JA 3QQLA 5DWRA 3ORIA 5LQFA 1YI4A 2A1AB 3NS9A 4KAOA 1H0WA 2UZNA 3NYNA 4Z7GA 4JG7A 2JIVA 4TWNA 3C1XA 5DVRA 3MW1A 5A4TA 1I7NA 2BCJA 2CNQA 3D15A 2NUAB 3MPAA 2VTMA 3I5NA 3L8XA 3P1AA 3Q4CA 4WG4A 3SDJA 4CV8A 3CS9A 3Q5ZA 1OECA 3R00A 4IC8A 4RQVA 4B99A 3H10A 2WMUA 3U4WA 2RF9A 1C3OA 5CA0F 4Z3VA 4M13A 4X7QA 2FPIB 3Q2MA 4NM3A 4E26A 2C68A 3ENHA 4FV5A 4IACA 4BDFA 2YHVA 3GEQA 5H8GA 1WBOA 4XMOA 1JDEA 3AQVA 3TZMA 3H3CA 3OT3A 3G0EA 3ZEWA 4EH8A 5HX6A 3GLKA 2YCFA 4MEDA 4QO9A 3UIUA 4F1OA 3OUKA 4FKWA 4PDOA 3Q53A 2Z7RA 3QALE 4TYIA 1Q97A 4GH2A 4O27B 2FO0A 3Q9XA 3M11A 1J91A 1Q8WA 3KEXA 4FNXA 4MQ2A 1IG1A 3FJQE 1M0TA 3V6SA 1XH7A 4UXLA 3AC4A 1KUTA 3C0HA 1M2RA 1W82A 3UBDA 4DT9A 4G17A 4IDTA 4PL5A 5EM8A 4IIRA 3A4OX 2UW3A 3GOKA 3B8QA 4KWPA 4UZHA 4JAJA 4RFYA 3HMMA 5FBOA 3VF9A 3VS4A 3GP0A 3G6GA 4MNEA 4E7WA 3ZBFA 2OF2A 3C0GA 3ZZWA 4NJDA 4Y8VB 3FQHA 2C3IB 2XVDA 4Z9LA 3R8MA 5DR9A 3PSDA 2CN5A 4DIMA 1YRPA 3P79A 4J52A 4M67A 4NZWB 3HYHA 5AMNA 5EM7A 5AIRA 3WO1A 2EUFB 4HPUE 2DIKA 1XH9A 2AC5A 2WMSA 3OXTA 4XX0B 1XH5A 3D5WA 4G5PA 4EOSA 4FODA 3QCXA 3R0TA 2XBAA 4N0SA 4D4SA 2G9XA 1PKGA 2OIDA 3CKXA 3IO7A 2GNHA 3LAUA 4Y72A 5EW3A 5C03A 2DWBA 2OIQA 4CGAA 5A54A 4FIHA 4QPSA 4HNIA 1UKIA 1EHIA 4FU0A 3MPTA 3TNQB 3EOCA 3UGCA 2HZ4A 4PL4A 1M2QA 2J0KA 4IZ5A 5CAQA 4L45A 3VAPA 1P5EA 2R87A 2C0OA 4D28A 4IFGA 5H2UA 1VEBA 4A9TA 5LVNA 5HEZA 1UVRA 4GL9A 4MNEB 4RJ5A 1PX2A 4P5ZA 2X8DA 3HMPA 1OL7A 3DF7A 3FMMA 3A4PA 2I6LA 1MQ4A 2VZ6A 1K3AA 2WMWA 3FQSA 3KREA 4OTGA 4CFNA 3V4ZA 4FNYA 3G15A 4FG7A 3H9FA 2JDSA 2ZV7A 4A7CA 5BQ0A 3ZRMA 4IZOA 3QRUA 1OPLA 4NH1A 2BKZA 5JMSA 5LP6F 4LM5A 4TZRA 3VS2A 5FDPA 4HVDA 4O83A 3L8SA 4XYLB 3LZBA 4QMTA 3RAWA 4AAAA 1KSWA 2V59A 2NU6B 1GNGA 4DTBA 4K2RA 3VBQA 4CTCA 3QFVA 4J53A 3U9TA 4C5AA 2QOIA 5DFPA 5J9ZA 5CSVA 4MWIA 2VV9A 3NSZA 4FTAA 5AFVA 4NW6A 3CP9A 4YTIA 2IJMA 3A2CA 4M68A 3MPMA 5H8EA 3R7OA 1XBBA 5L2TA 3Q60A 2VTTA 4ZSAA 2XIKA 5KMNA 3MTLA 4ZJVA 3BV2A 4ANBA 3T3UA 2VWWA 3MH3A 4LGHA 2QKWB 5GONF 2GCDA 1YXSA 2ZM4A 5GJFA 2BZHB 2RG5A 2OJIA 1WCCA 3BBTB 4M0YA 4PP9A 4BCKA 3E5NA 4CMOA 2ONLC
chains in the Genus database with same CATH superfamily
2G15A 1P4FA 2VWBA 3A8WA 3QFFA 3BX5A 4RFMA 4NWMA 4ERKA 3BLRA 2YA9A 4QP8A 3A99A 1BMKA 2Q2UA 3D5VA 3G8DA 1WVWA 3HDNA 2XNBA 3NCGA 1VBGA 4EBVA 3VBWA 3QX2A 1JWHA 4FOCA 3EIDA 3ZYAA 3M1SA 5LCJA 3HV5A 5HG8A 3HGKA 2GTNA 3I81A 3BU6A 5JVLA 3SOAA 4DE4A 5J7HA 5IPJA 5AP1A 1BKXA 4O82A 4YLJA 3LM0A 1WBNA 3SC1A 3MSSA 4FYNA 3HO8A 4ZSJA 1OITA 3ZRLA 3C13A 4KIOA 4WG3A 4YJOA 3UDSA 3JVRA 4C3PA 3RTXA 3JRWA 3DAEA 3VUDA 5BV3A 4FTTA 4O0TA 2XF0A 4USFA 5BPHA 1PMEA 3BZ3A 3LXPA 1OGYA 2I1MA 4HGEA 3ZLWA 5BYBA 4LGGA 4KB8A 3DCVA 3LIJA 2BZIB 2R84A 2UV2A 1O6KA 1I7LA 3FKOA 5DRBA 4ITIA 1GZ8A 4MUQA 1DV1A 4GJ3A 5CAPA 4X3FC 3DK6A 4XG7A 1YDSE 5C1OA 3JXWA 4WD5A 3R22A 3C9WA 1FMKA 2PWLA 4MBJA 3HA6A 1UU9A 2JKMA 4GIHA 4WRGA 5F20A 3WF6A 4BIDA 2GHMA 5CY3A 5HIBA 4U44A 4KABA 1Q41A 2XBJA 4YHJA 4BCMA 2YRXA 2GNJA 4L1KA 5HU3A 4ZSGA 3S2PA 4E4NA 4FSQA 2XJ0A 4I6HA 4R77A 5D9HA 4DG3E 5DEWA 4O4JF 4F65A 3PTGA 3D4QA 3GNIB 3BLQA 3EFWA 3OTUA 4L52A 4HVIA 4ZSLA 5FUTA 2GSFA 3BLAA 3MFTA 3FZSA 3CGOA 3OUNB 3EN9A 4A9YA 3CJGA 4FZAB 3ACKA 3BEGA 3H0ZA 3IDBA 2ACXA 5F1ZA 4FGBA 5HTCA 1ATPE 1PXJA 3BHHA 3F5PA 5JFSA 1QCFA 4XZ3B 3PXFA 4G34A 2PSQA 1WMKA 3RV4A 3ACJA 4XEYA 5K3YA 3R7YA 3NYVA 4DEDA 4P90A 5FM3A 3FKNA 4DH3A 3FLYA 2JFLA 3NUNA 3PZEA 4IAZA 3P0MA 1B04A 2FSTX 4XG6A 3LJ2A 1XJDA 1Y8YA 1I2LA 3R6XA 5BX0A 4L67A 4BI2A 3BEAA 2ZGIA 4YO4A 4AGUA 4AOIA 2YJSA 2WTKB 3NNVA 5IU2A 5AM7A 2PVMA 3F3UA 2J51A 4CT1A 4LQMA 4G31A 4XOYA 5CWZA 5JH6A 2ETMA 3NBZB 3UYSA 4XG9A 3U9NA 2VD5A 4ARKA 3K5UA 1M7NA 2B9IA 2YN8A 3MIAA 3ZOSA 4XJ0A 4AACA 1BNCA 4X2FA 3ZONA 1SVGA 2ITUA 4J8MA 5HBJA 5IISA 2GPHA 3TIYA 4DH8A 2C00A 4L7SA 1YOJA 4R1YA 3VJNA 4YSJA 4ASEA 4PUZA 5GINE 5DMXA 4I4TF 2ITWA 4XP0A 4BDAA 2UW5A 2QO7A 5IDPA 1BYGA 1M17A 2C47A 4HCTA 4OLIA 4M0JA 4U43A 4CFVA 1Q99A 4IE9A 3W0OA 1PHKA 5ANEA 2PZPA 4YURA 2VTSA 3JUHA 4L68A 3V4SA 3SG9A 3IW6A 3R9NA 5M53A 4IM3A 2WOUA 4ZZOA 5HTBA 2I40A 1ND4A 2UUEA 4CKRA 5KMIA 5IMEA 2XAOA 2QODA 4HGTA 4BBMA 3KF4A 2W9FB 4GSBA 4Y85A 1M0WA 2HDKA 2ONLA 2FSOX 2BAKA 4UCRA 2PVLA 5CA1F 1OIRA 3VWAA 4FFLA 4N4SA 2BRBA 3KU2A 4QP6A 3VS3A 5BNJA 3T9AA 1OM1A 2WKMA 3L8VA 3NLBA 4AX8A 4DF3A 3JRXA 3ML1A 3R8VA 4X21A 5JGBA 3G6HA 3DT1A 3FMLA 4YC6A 3UJGA 4EUTA 1R1WA 4G1WA 2W5AA 4O91A 4WUAA 2BRNA 3DQXA 4NTTA 5CAEB 5A14A 3FZPA 2R3KA 4RLLA 4CCBA 1VLRA 4RC4A 3EN6A 4F9YA 5KMKA 2P0AA 4CMDA 4MX9A 5HESA 5LVPA 2YWVA 3F5XA 1S9IA 2YM6A 1CKMA 2V55A 2R3FA 5BYLA 1H25A 2I7QA 2R2PA 3MIYA 4MQ1A 4LL5A 3E92A 4NFNA 2XKFA 3MA3A 3Q32A 2VR1A 3UMWA 4Q5EA 4ZAUA 3MB7A 1GSOA 1IAJA 3UC3A 4H39A 2J7TA 3DGKA 3ORMA 2V22A 4FZDB 2ZJWA 4L3LA 2Q0BA 4EOIA 2YL2A 4XYMB 5IA2A 2IWIA 4AW1A 5IMXA 5J1WA 4ZY4A 2C4GA 4NM7A 4MH7A 3F7ZA 4NT4A 4X3FA 1K9AA 4GK2A 5EH0A 4IWOA 5EKNA 1ZMWA 1KJQA 3ETHA 3K5HA 3NUUA 3P5KA 3EHAA 5CS6A 4TV8F 4TNBA 4EZ3A 4PDSA 3LMHA 4YP8A 4R5SA 2EB3A 2ZB0A 3DBEA 3SV0A 2O5KA 4K9YA 3NYXA 3BU5A 3NDMA 2NO3A 3LVPA 2COIA 3UOLA 4O81A 4WT6A 3PDTA 5EW9A 3V5WA 3NAXA 4UX9A 2VTPA 4JS8A 4QP7A 3CJFA 3FI3A 3R7EA 4DLIA 3SW7A 1UNLA 3IW4A 5FTQA 2EXCX 4AW5A 5BVFA 1T45A 3RAIA 1KJ9A 1PK8A 3OEZA 4DHZA 5JQGF 4FT5A 2I0EA 3RCDA 2CKEA 3WZJA 3AT3A 3PRIA 2OXDA 3GBZA 4FICA 1WR2A 3ZS5A 2EJ0A 4J1RA 2DAAA 4X3FB 3QBNA 4MNFA 4ZS0A 1TAEA 3NFFB 1Z2NX 3FHRA 5CEKA 2VAGA 4QMUA 1FQ1B 5E8YA 4V0GA 1UC8A 5LMKC 5HE0A 4D2SA 3F3ZA 3RK9A 2XH5A 4BCNA 3TUCA 2JITA 2GDOA 3SVVA 3UNKA 5E91A 4CRSA 4ZTSA 5HIDA 3SAYA 4FTIA 5A46A 2W4OA 1JKTA 4KS8A 3ZFMA 5IA0A 2YZGA 4RX8A 4Y83A 1JLUE 1LEWA 4IZYA 5AP2A 2JDTA 4YPSA 2Y4RA 1WBVA 1GIIA 4I24A 1ZYSA 4O7TA 3MWDA 4W4XA 5K3WA 3QCYA 2W1ZA 4FFOA 3T9FA 3TY8A 1Q62A 4O0RA 4QMNA 3CEBA 1GAGA 3PPKA 1I44A 2PUUA 1M14A 3I7BA 3QLFA 3VHEA 3ZRKA 4EH7A 2J9GA 3UE4A 3KCKA 4EGQA 4E5WA 3F2RA 3UO5A 4QMYA 2J0MB 4FKOA 3FBVA 3H9OA 4E4MA 2EJ3A 4UBAA 2QQ7A 3A7IA 5KMMA 4NK9A 3DFAA 3ZUVA 4EC9A 3DOGA 4ZMFA 4IADA 5KMLA 4O2ZA 1SVHA 5E92A 1GZKA 5CAOA 4V0GB 2O8YA 4YBKA 3BHYA 5EFQA 5TOZA 2C6EA 4BCGA 3LQ3A 4BF2A 3OHTA 2QOHA 4NCTC 2VGOA 4TYHA 5GJGA 2VWXA 5E90A 4FTOA 1E1VA 4IAFA 3QCSA 3RWPA 5KZ0A 5I5SA 4EOOA 1OPKA 3KGAA 2W1GA 4XRLA 4ID7A 2VGPA 3JY9A 3K3PA 2JKOA 3VRZA 5HLWA 4N6ZA 1XKKA 2VTHA 3SNOA 5JH7F 4GG5A 4IANA 2W99B 4N6YA 2H9VA 4IVCA 4MXCA 5D7VA 5CENA 3RPOA 4QP3A 5KBQA 5I5XA 4YB8B 2R64A 2UZTA 2R3RA 2VX1A 2ZDGA 2C0IA 1JAMA 4YAKB 2FUMA 4DFNA 3RWQA 4TT7A 4MV8A 3DV3A 4JBPA 2NU7B 4XHKB 3EN7A 3CIKA 5HE3A 4APPA 5I0BA 3DBFA 4YJNA 3ORXA 2Y4IC 4AN9A 3QX4A 3UPZA 4GFOA 4O0UA 4DTAA 5IYZF 2WXVA 2C6IA 4AWIA 4F6WA 5D1PA 4ZS4A 1M52A 3P23A 2PMIA 4TYHB 4QEBA 1H26A 4FJVA 4C2VA 4G3GA 1FGIA 4CKEA 3LCTA 4BDDA 2QO9A 4YSMA 3RHKA 4BTFA 4GYGA 2GHLA 4U40A 2DABA 2B52A 2B1PA 3KAKA 4ENYA 2ITZA 1GY3A 1G3NA 1RW8A 2PVFA 2V5QA 2W96B 3LPBA 3M2WA 1HOWA 2OLCA 2X2KA 3QTWA 5K2MA 4KINA 3R28A 2XMYA 2H96A 4A07A 4B9DA 4CVAA 4U8ZA 4UEUA 3R01A 4BCQA 1Q3DA 3D5UA 1JVPP 4JVGA 4X2GA 5HCZA 3ZBXA 3GDEA 5EM6A 5L6WL 3BAAA 4TM5A 3G8CA 4PL3A 2OI4X 3KB7A 4BVUA 2WMAA 5LVOA 5JGDA 2G1TA 4OTFA 3UP2A 3VHKA 5I9ZA 2EJ2A 4J96A 3QZFA 1PXLA 5HNIX 3GU6A 1O6YA 3E3PA 4C58A 4O0VA 5E4HA 4S30A 4W8EA 2PPQA 4PTCA 3R8UA 1ZLTA 1PXIA 2C69A 2GQGA 2XP2A 3OY1A 2GPSA 4QYEA 4FTLA 4CZUA 3NNWA 4J71A 4C3FA 3C4CA 4HYUA 2R3IA 3CR0A 3P78A 4NSTA 5CLPA 5D10A 5EHLA 3VNTA 3RPVA 4F9WA 1YOMA 2G01A 5AIKA 5JVDF 1ZMVA 3TUDA 1H07A 1XH4A 3FMKA 4WBNF 5TF9A 5D7AA 1W83A 3WNZA 4ACGA 3KFAA 1OVEA 2C30A 3O0GA 2A2AA 4FZ7A 2WNTA 4NJ3A 2PE1A 3R73A 4ANLA 5BWUA 4HNTA 4M0ZA 4JG6A 2ZDQA 1UA2A 3QZGA 4F6SA 2YEXA 3PYYA 5LMKA 3QKLA 2WTCA 4QMSA 3NWWA 4CV9A 5BVDA 3LCKA 5ITAA 3QKMA 2JDRA 1QPEA 1P4OA 3DS6A 5D12A 3WZEA 5CZIA 5AP0A 5M51A 5E8TA 2VQDA 4CSVA 3FI2A 3K3JA 4TY1A 5CU2A 3RJCA 3U51A 5FEDA 2PULA 2I80A 3ID6C 2CZGA 3P86A 1AD5A 3MY0A 2IZRA 4NYEA 4DBNA 3AC1A 4EH2A 4PP7A 5I5TA 4EHGA 3RR5A 5KX5F 1Z5MA 4E6CA 3KXZA 5EDPA 4ACMA 2W4JA 1R0EA 1UNGA 4X0MA 2XB7A 5BVKA 4PY1A 4BCOA 2W1DA 3HV6A 3KVWA 3QXOA 4O0WA 5IQGA 5CB4F 5HO8A 2JC6A 2QKRA 3TWJA 3VOTA 1KV1A 4ASZA 1W96A 4LI5A 2QCSA 4ZY5A 3SOCA 3BELA 4X2KA 4YTCA 2VUGA 1IYDA 5HU9A 4FL3A 4QP1A 3TTJA 4BJJA 2HK5A 4NCTA 2C1AA 5L2IA 2XM9A 4YTHA 4AXAA 2B9JA 2E9PA 2FH9A 3PJ8A 5AX3A 5HGIA 1CKPA 4Q9ZA 3GCPA 1CM8A 1AQ1A 3UOKA 2ZYBA 1DV2A 2BZJA 4UY9A 5C01A 1SNUA 5T68A 5L8LA 1ZOEA 5M57A 4FSNA 1VJYA 5AP7A 3D7TA 4FNWA 3QA0A 3R2BA 4FV4A 4TYEA 4S32A 4X2NA 1BI7A 3PJCA 4DEHA 3VPBA 2QG5A 4UWCA 3UZPA 3ZC5A 5L8KA 4JBQA 2C5NA 3TW7A 1H1SA 4MKCA 5F95A 2X81A 3PY1A 2YJRA 4PF4A 3NC0B 3TZ7A 3MDYA 2YIWA 4WSYA 4DA5A 2GPWA 4I0RA 3HKOA 2BDJA 4YR8A 4M15A 4C61A 4ME6A 1GZNA 1OI9A 4DGGA 3LQSA 3CQWA 4FC0A 4YJTA 4TWPA 5T6KA 4D55A 5AWMA 3ZM9A 4KRDA 4RJ4A 1UNHA 2CGXA 5AV3A 2VWVA 4BJJB 3KN6A 2HZ0A 3N51A 3O17A 4RWJA 4EJNA 2WD1A 3G9LX 4O7YA 2WHBA 4EFEA 3CXWA 1KJJA 5FBNC 1UC9A 3V8TA 2PYWA 4U80A 3UFXB 4QMPA 3RK5A 4BDKA 2I0YA 2R3JA 3ETAA 4YZBA 5HG9A 3D7TB 4M12A 5EHYA 5J8IA 2ZDTA 3O71A 3QTQA 3MY1A 4FYOA 4JAIA 4QYGA 1DAWA 4K11A 1KJ8A 5M09A 1ZZ2A 3WI6A 2BUJA 1QPCA 1ZRZA 2WMXA 5TT7A 4U45A 4BYIA 3MH0A 4XP3A 4RX7A 3SXFA 3UIBA 2W6ZA 2GQRA 2XZSA 1NVQA 2NP8A 3TV6A 1YHSA 3V8SA 4BBEA 3RINA 5IQCA 1H27A 3ORZA 5A4EA 3SG8A 4C35A 1A9XA 4NU1A 3OTVA 5E8XA 4F08A 3TNHA 4I50F 4IWYA 2PMOX 3OC1A 3DTWA 3FSFA 2Y4IB 4FKQA 3S95A 3WF8A 3FLNC 3BWJA 3AKJA 2CN8A 2J5EA 3OWPA 4LV5A 1G2WA 1G8AA 2YDKA 4Q4DA 2PE0A 2J9MA 4JBVA 5E8UA 3EH9A 3BG5A 1ZAUA 5J2UF 4IB1A 3HZTA 2OJJA 4GVJA 4AXDA 4RVLA 3Q9ZA 5CAUA 4KD1A 3O7LD 3FC2A 5CVGA 1W8CA 3KULA 4EH5A 5ICPA 3QRKA 5CTPA 4IX3A 4OTQA 1NY3A 4CLIA 4A4LA 4ENXA 1EUCB 2O65A 1JSTA 1B38A 3LFSA 4L01A 5FXQA 2WTWA 4HYIA 2G2HA 4ORKA 4DGLC 2OLSA 2OWOA 4JG8A 3ZHPC 3GFEA 1MRUA 2OICA 2W0JA 2ZB1A 2R3QA 3VBVA 1OIUA 3BHVA 2BRGA 5FPRA 1I1LA 3KXHA 5D41A 4O7SA 1ZOHA 2CCIA 4MYGA 4QQJA 4D4YA 1CQIB 1RDQE 4D5KA 4IAYA 3LM5A 2YM5A 3BPRA 4EOJA 2CFMA 3P4KA 1JPAA 4TWOA 5JRSA 3RALA 1A3GA 4UCVA 4CFWA 5GNKA 5M55A 5CVFA 3DAKA 4HYSA 4AFJA 2FP4B 3NVKI 4KBAA 3DAAA 3C5IA 1QMZA 2YWPA 5CEQA 1H28A 5LOHA 4FKRA 4AZWA 4MV4A 5EZYF 4FT7A 2E9OA 2X6DA 3LFBA 2VRXA 3PG1A 5KX8A 4GV1A 3HECA 1AUVA 1V0OA 3E3BX 1YOLA 4JRNA 3RNIA 2Z8CA 3KULB 4LYNA 4YMJA 3TTIA 1EKVA 3TW6A 4KBKA 4PMMA 4GU6A 3QCQA 2J0JA 5AV0A 3RFCA 3AGMA 4BYJA 1UV5A 2WEIA 5ETIA 5C26A 1ET0A 1OGUA 1PMUA 2OU7A 3LFFA 4BZOA 3CKWA 3VUMA 5JEBA 5KKRB 4R1VA 4U5JA 2R4BA 4J7BA 2C3KA 2W1IA 4G3CA 3OEFX 3V3VA 3ZDUA 2X4FA 3CLYA 1IASA 2A0CX 4DQNA 2XCLA 4F1TA 2WQNA 4QNAA 4R5YA 5AUVA 2ZV8A 4C36A 2FSMX 2BTRA 5H3QA 1VZOA 3POOA 1JSUA 4NZNA 4RWLA 3QKKA 2J2IB 4TN6A 4XV1A 2UW8A 5BVEA 1B39A 4CMUA 5L2SA 4WNKA 2BALA 4BHNA 3W5OA 4J99A 2PBZA 2ABJA 4EZ5A 4ZI7F 3GU5A 4WBBB 5JKGA 2UW0A 5IG1A 4ZJIA 4GFMA 3LKMA 1LPUA 3QTUA 3VPCA 3HMIA 4LFIA 1LR4A 4MHAA 4TYGA 3ZMMA 2QOLA 3LQ8A 4U6RA 4OT6A 5D11A 3CSVA 5GJDA 3LFEA 3V5QA 2WIHA 3PVWA 4I6LA 4FMQA 4E6DA 3C51A 1OIYA 5HNBA 2Y4PA 2WTKC 2P3GX 3UZBA 2YM7A 4E4LA 4F9CA 4TRLA 2ZVAA 2Q83A 3QA8A 4M9UA 4OBOA 5EI2A 2WELA 5FP6A 3NUXA 1T46A 4I6QA 1OL6A 4E5AX 4KIPA 4QDEA 3GU8A 4R6VA 2HIWA 4CT2A 4EGJA 2YAKA 3HNGA 1QL6A 4LDTA 5CF5A 3ODZX 3TZ8A 4CLJA 1JSVA 3VPDA 3NIZA 1ERKA 3FMNA 3GU4A 1PXPA 5FQDC 2WQMA 5HD4A 1KWPA 3TNWA 4QP9A 4C5CA 5EKOA 4XYFA 1J1BA 2BZKB 3JPVA 2YDIA 3O5AA 5LMBA 3RKBA 3LE6A 3T9IA 4D0XA 3S24A 1IA9A 4G9CA 4QQ5A 5FM2A 3KYHC 5J2TF 1J3HA 1WAKA 3UG1A 3TACA 4FZFB 4EQ5A 4EHVA 4L9IA 3R71A 2IG7A 5CXHA 4U42A 4AT5A 2LGCA 4IQ6A 1DS5A 4IH8A 5HX8A 2EVAA 2W1CA 2C5XA 4RX9A 3MVHA 5DEYA 3QZIA 4AOTA 5JQ8A 4R78A 4DFYA 2RFDA 4I21A 3ZUUA 5FEQA 1PXKA 5K5NA 3NX8A 5DAAA 4L43A 4E5BA 4MV6A 3VUIA 4FSTA 4ANMA 1WFCA 1ZY4A 5GIPE 4UYNA 3R7UA 3VMMA 3EQPA 4TWCA 4O0XA 5CNNA 4AQCA 4DHFA 2IW9A 5LMAA 3RAHA 4FG8A 4JQ8A 2BHEA 3FMDA 3EYHA 3I0QA 3SD0A 4IMYA 5DA3A 4FZ6A 4HZRA 2CNUA 5HD7A 3HAMA 3PFYA 3DZOA 2BRHA 3RPYA 2Z7QA 3UO6A 1YXTA 5KZIA 4IB0A 4BIEA 3UNZA 2EXMA 3FZOA 3MH1A 2C3LA 3R1NA 4N57A 1PW2A 3R9OA 4ERWA 5L8JA 4L3JA 4PDYA 5KHXA 3HBLA 5FTGA 3GCVA 1KE9A 2WPAA 4OGRA 5ETAA 1SMHA 4CNHA 2BDWA 2WMVA 5HORA 4GUEA 3EMGA 4YLLA 2WMBA 2JLDA 4BIBA 4DITA 1J7LA 5FGKA 3S00A 5BWXA 5C8YF 1M7QA 2UVZA 5DNRA 2Z7SA 2VTRA 2JKKA 5JQ5A 3I0OA 1VKZA 3EQIA 4DEBA 3DK7A 2W6MA 4RWKA 4FKIA 5EYDA 4XS2A 3WWJA 3W2SA 4NZMA 3G0FA 1IEPA 1GIJA 1VBHA 1OB3A 3HVCA 3ZXTA 4C37A 2W1FA 2HIVA 3U0GA 4DTKA 5CU3A 1P14A 4I5MA 3POZA 3OF0A 2XKCA 3MJ1A 3TV7A 4D5HA 1JKJB 5HCYA 2BPMA 2X6EA 4ZP5A 2VTAA 3ULZA 5FRIA 2CCHA 3QAME 1YI3A 2RL5A 5HVKA 4BI0A 1E1XA 5BPFA 3HA8A 1YDTE 5AUZA 3E8EA 5ANOA 3BRBA 4FV1A 3C4EA 3KVXA 2WQEA 4WO5A 2VTLA 3RV3A 3KK9A 4FKGA 5FR9A 3NW7A 4O7ZA 3A61A 1ZARA 4X3JA 4XV2A 4BTJA 4EORA 4XLIA 4QSHA 1SZMA 4PRJA 3LLAA 4XLVA 3ZLYA 5BUEA 4BCJA 3EL8A 4U3ZA 2CLXA 2W9ZB 1GJOA 4Y8DA 4I5CA 5C8MA 3TJDA 4LH7A 2CMWA 1OIQA 2CHLA 2WGJA 4RCNA 4S34A 3BHUA 2XK9A 3GCUA 3O96A 3TIIA 4LRMA 4EK8A 4DT8A 3D9VA 3T99A 4APCA 5IZFA 3UTOA 2IVSA 1YHVA 3BLHA 4D4RA 1BLXA 1A48A 3IOKA 4Y95A 4IHJF 3HLLA 4XX9A 4EONA 3BIZA 3BYUA 5CEPA 4UUGA 4RGJA 5CX9A 4GT3A 4OT5A 5F9EA 3PY0A 2GQSA 3GUBA 5DR2A 4YJ2F 3IS5A 3ROCA 1H1RA 3DTGA 3U87A 3R7IA 3BGPA 3W55A 5BUIA 4USEA 4EYMA 2COGA 2C5OA 3B2TA 3MBLA 2ZAZA 4LV7A 4OW8A 4LG4A 4K0YA 2HG8A 1FMOE 2ETKA 3DFCB 4WG5A 4KKHA 2R3OA 2VX0A 3Q2JA 3I6UA 3LCOA 2PVYA 3R9HA 2YYAA 3H0YA 4ALWA 5LWMA 2HJWA 4YNEA 3F61A 2QURA 4FKVA 4LOOA 5ETCA 3LMIA 4F4PA 3AC3A 3SLSA 3GXLA 2O64A 3WYXA 3LXKA 4LUDA 4EC8A 4ACCA 5JN2A 3W0SA 3IW7A 3WOWA 3EQHA 3DZQA 5K4JA 5FPOA 4FV6A 4IB5A 1X9NA 2CSNA 4IB3A 2QOQA 4KKEA 3ZO3A 5IA4A 3AD4A 1CE8A 2VO7A 2J0IA 3W16A 1FPUA 3OOMA 4IJ9A 3ZTXA 1EH4A 4D1SA 2YS6A 3UODA 1J7UA 1YQJA 5CNOA 4ZY6A 4DYMA 5HVYA 3TZ9A 2CGWA 4AOJA 4JX7A 4C2WA 1I2KA 5HI2A 4DRFA 2OIBA 3GQLA 3BE2A 4G16A 4ZJJA 1OZ1A 2XJ2A 4AW2A 4DHJA 3TN8A 3PJ2A 1XHAA 4OTDA 3FI4A 5H8BA 2C6KA 4U41A 4K18A 4L7FA 4FNZA 4G6OA 4O96A 3KMMA 4EEVA 3R30A 4OUCA 4PNKA 2YACA 3DXQA 3T9CA 3FPQA 4Y73A 5EG3A 4RMZA 4EK5A 3ZSIA 3HMOA 3A7FA 4MWHA 5AP3A 4IDVA 4CEGA 3T9BA 3OROA 3IDPA 4LRJA 4EOLA 5CAVA 3NUAA 4TW9A 5AAFA 2J5FA 3UVRA 2ZV9A 1ZWSA 3EJ1A 4EK6A 3QL8A 4E6NA 4QTCA 1SVEA 2PZIA 1W84A 3AD5A 3EL7A 4XBRA 4QYHA 4YU2A 4FI1A 5HLNA 2GTMA 2VX3A 1H4LA 2Y9QA 2RFEA 2HZNA 2HCKA 2IP4A 1Y91A 3DAJA 5E7RA 4AW0A 3U6HA 3Q6WA 4H3PA 3WE4A 4ZLZA 5ANGA 4Z16A 1R0PA 2O0UA 3FLQA 3VF8A 2UZUE 3BQCA 4E73A 1DGSA 2PVRA 3MA6A 3KK8A 2JDVA 2ZV2A 2WMTA 3DB6A 4KA3A 4YJPA 3PVUA 3CD8A 4DGNA 4QTEA 2ESMA 3VW8A 2BDFA 5H9BA 5IQDA 3MWEA 3PN1A 3GOPA 1P8LA 4BDEA 3QHWA 2I87A 2YRWA 4HNUA 3R8PA 3ZDIA 4ANSA 4DGOA 2A4LA 4IVBA 3V8WA 4B4LA 1EUDB 1H08A 5I9XA 2OK1A 3PLAE 1PJKA 1MRYA 2R3LA 2OGVA 3KY2A 1REKA 4F6UA 5DT4A