4O81A

Saicar synthetase (type-1) in complex with adp and amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
227
structure length
227
Chain Sequence
b'AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
molecule tags Ligase
source organism Pyrococcus horikoshii
publication title SAICAR synthetase (Type-1) in complex with ADP AND AMP
rcsb
total genus 73
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o81A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o81A02
3UZPA 2RIOA 5HVJA 2XEZA 3EL7A 3NUNA 2C0OA 1YOMA 3Q2OA 3E63A 5M44A 4CT1A 4RVTA 4QNYA 3WF6A 4KAOA 5BUJA 3OUKA 3CE3A 2EXCX 4EUUA 3D2IA 3I4BA 5L2TA 4E20A 2BZKB 3DAKA 4USEA 5HG8A 3DXQA 4F9WA 4GT3A 5JGBA 2CNVA 3GNIB 4M3QA 1R3CA 3MIYA 5LMAA 4FFRA 4CFMA 5LMKA 4CNHA 3C5IA 4F63A 1UNGA 3IECA 3W1FA 4D2RA 3GENA 2NRUA 4H1MA 4TRLA 4KS8A 2ESMA 3MPTA 3NYOA 4NYEA 4D55A 4X2JA 3F5UA 2Z7QA 4TZRA 5AJQA 4BIDA 3BV3A 5EFQA 3ORLA 5FUTA 3AD4A 2HY0A 4XG8A 5CI7A 1VBHA 5T6KA 3UOJA 4I6FA 4TY1A 3I81A 4GK3A 1C30A 1J1BA 3AC1A 4FSNA 4FFPA 4QMOA 3BYOA 4LRKA 4RG0A 4U7ZA 2I8CA 2BAQA 3W33A 4CVAA 2QO2A 3BEAA 1ZZLA 3D5WA 3U6JA 5JZJA 5EKOA 2E9VA 5EDPA 2CMWA 3COMA 1ND4A 2J9MA 2XRWA 3SX9A 3TZMA 4G3GA 1T46A 3BWJA 5EYDA 5AUXA 3RPVA 3R8UA 4XYMB 2XMYA 5C1OA 1Q5KA 2XZSA 3DKOA 4G3DA 5EYKA 3G0EA 3HX4A 4I41A 4EOPA 1M52A 4KABA 4D9TA 3II5A 4FEXA 2WOUA 3CTJA 4G3CA 3KULB 3NUAA 4XLVA 3RGFA 3F5PA 5E8YA 4AOTA 4PNIA 2JFLA 5CU3A 4UXQA 2OJIA 4U3YA 3LOKA 4FG8A 5CSPA 2O0UA 2ZJWA 3EQPA 4FG7A 1YHSA 3UP7A 2C6KA 3ZDIA 2EU9A 1SNUA 3WILA 4G9CA 4G9RA 1NA7A 3CP9A 2CGUA 3NR9A 4FSTA 3CJGA 3QYWA 4S31A 4XS2A 4YZNA 2V7AA 1KC7A 4NFNA 4X3JA 3HMOA 3TZ7A 5I0BA 2XA4A 4EK6A 5C1PA 4FTJA 4NH1A 2OK1A 1H4LA 4S30A 2R4BA 5T68A 3BGQA 3S00A 1J7UA 1YXVA 2C68A 4FV3A 2BKKA 4IQ6A 4QMYA 5BVWA 3V01A 4Y83A 2OLCA 3ATSA 4U6RA 1ZWSA 4PMSA 5T3QA 3V5JA 3UNZA 4JL9A 4UYNA 3SQQA 4JXFA 2JIUA 4FT9A 5IA3A 4RGJA 3OCTA 4ZSGA 5C8MA 4F65A 2R3IA 2XKDA 4DH1A 3C0HA 1H1PA 3B8RA 4UY9A 3NNVA 3NW7A 4FV4A 4V01A 3P5KA 5ACBC 5BPFA 2YAKA 2GPSA 2VWUA 3GC7A 4WA9A 4AA4A 2JFMA 4AOJA 4Q9ZA 4GJ2A 4O0SA 5JVLA 3KXGA 3C4ZA 3UO6A 3TKHA 3WF8A 3EN6A 3GP0A 3ZEPA 3TTIA 4D5KA 4E93A 3KL8A 5L2SA 3HKOA 4JAJA 3TIYA 1IAJA 2YABA 5M4UA 5HTBA 3HMIA 2GQSA 4QMWA 3GCPA 2B9IA 3R22A 3CD3A 4NKAA 4TXCA 3EIDA 2XNBA 5I9ZA 2OU7A 4R7IA 5DT4A 5CAUA 4DG3E 3LE6A 3E8DA 3RV4A 4E6QA 3T3VA 4DGNA 2XK3A 5TOZA 3QGWA 3DAJA 2ZM1A 3V4SA 2QOIA 4BR3A 3SD0A 4WRGA 4WBNF 2V58A 5EDQA 3UNJA 1BXRA 5LVNA 3AG9A 3ZSIA 2J0KA 2WPAA 4LI5A 4I6QA 5AMNA 1CE8A 3TIZA 3HLLA 3KKVA 1J3HA 1H26A 2OSCA 3L9PA 4LM5A 1FMOE 3O23A 2J9GA 3TJCA 5IQFA 2GSFA 3OROA 3H0YA 4QMXA 3C0IA 1WVYA 2E2BA 4YO6A 5GHVA 3TNQB 1L8TA 3PG1A 4EK5A 3WNZA 2UZVA 4YB8B 3CTHA 3NYVA 2UV2A 3Q9XA 5CF5A 3QQGA 4KWPA 4PDOA 2CNQA 3ETAA 3CJFA 2E9PA 5JK3A 3QAME 4IW0A 2R3KA 3IW7A 3PUPA 4FKJA 3VOTA 1PMEA 2HZ0A 3F66A 3OW4A 4EOJA 1NVRA 4O0RA 2E9UA 2UW5A 2UZNA 4L01A 2QOCA 5HD7A 2YDKA 5IUIA 3UJGA 5C4LA 3RNIA 5J95A 4I5PA 4BCGA 2ZV2A 3NUUA 4C3PA 2JGZA 4N4SA 3SGCA 4Q5EA 4M67A 5AP2A 1GZKA 3QZFA 4FK6A 4GFOA 3UMWA 4F08A 4P4CA 3R7EA 5JGDA 3IG7A 3DQWA 5KMNA 3HA8A 4I50F 4BCNA 2BRMA 2XUUA 3FMJA 2YZLA 4USFA 2BZHB 3MB7A 1CKIA 4KRCA 2VPQA 4V0GA 4EH8A 4U8ZA 4YUQA 4HYIA 4CLIA 1ZAOA 4G6OA 3VRYA 5CAOA 2QOFA 2BALA 5A9UA 5LARA 2IVTA 2W9ZB 4GFGA 4E73A 1EUCB 3MWDA 5EI8A 1QPEA 4WG5A 1Z2OX 4FEUA 3LM0A 3AT3A 4EZ5A 3FKOA 1VR2A 2W4JA 4MA0A 1UKHA 1GZ8A 3N9XA 4AA5A 4DLKA 4YJRA 3PLAE 3VHEA 3P1AA 2VWVA 3FI3A 3RUPA 4O91A 3UMXA 3H0ZA 3QXOA 3KGAA 3HNGA 3QZHA 5G1XA 2FUMA 4UWBA 4PY1A 3TKUA 3ZONA 2B4SB 4PF4A 3LAUA 4XV3A 2WTKC 3KCFA 3QRIA 4PRJA 4YBJA 4FV2A 5K3YA 3MY5A 3WI6A 5EHOA 4AA0A 5HX6A 4O38A 3UNKA 2Y4PA 2FO0A 2OZAB 2Y8OA 2R0UA 4FT7A 4YJQA 5EH0A 2C5NA 1GIHA 5EQEA 4DFXE 4AZEA 5KMMA 2C6IA 3VQUA 3PJ2A 2LAVA 1JPAA 3UPXA 2X8IA 4QMSA 1KUTA 4JRNA 4RJ4A 3UTOA 3F7WA 2Z02A 3GCSA 4MBLA 5IPJA 3MWUA 4X6QC 2P0CA 5HBHA 1ZLTA 2V7OA 1Z2PX 1SYKA 2GMXA 3Q4UA 4ZP5A 1A9XA 4KKEA 2UZEA 1ZMWA 3Q1KA 3DK6A 2E9NA 4UV0A 2IW9A 4HOKA 2YM7A 3MH2A 1E1XA 3RPSA 4IHJF 5BMMA 1J7IA 5E90A 2UW8A 3GC0A 4ZTQA 2GFSA 3VS2A 4BCIA 5B2KA 3ZLXA 3K54A 4DFYA 2DWBA 4FMQA 2ITYA 5HX8A 4IX4A 3GCUA 1SVEA 4YHJA 4Y5HA 5EW9A 4GK2A 2Y9QA 3SOCA 1PK8A 2YRXA 4RVMA 1ATPE 1M2PA 4GUEA 4HGSA 4E4MA 2WMXA 4GVAA 4FGBA 4RLKA 5H3QA 3KXNA 4QMTA 3FMNA 1WBVA 4WHZA 2P2IA 1A06A 2F49A 1P4FA 3CTQA 3IO7A 4FG9A 4H36A 1FVTA 4GV1A 4QP8A 4BDEA 4FTRA 4ZY6A 3DNEA 3ANRA 4KIOA 2ZYBA 4ITJA 5E8VA 2X6DA 1GZNA 5IA2A 4LGGA 4LMUA 1DI8A 3DKFA 2PZIA 4FICA 3QQUA 4UEUA 5M4CA 3L8SA 4M8TA 2WTVA 1K3AA 3ZU7A 2XK7A 2J5EA 2WQMA 4H39A 4WBBB 3OOGA 4FKPA 3VWAA 2R7KA 4L67A 4NIFB 3DBEA 2OZOA 3G33A 4QPAA 4MEDA 4RWKA 4XG3A 5LVPA 2FSMX 4IE9A 3P78A 5FBOA 4A4XA 4BCKA 5H2UA 4OLIA 4F64A 1MRYA 1WAKA 1XBBA 3DXPA 3PJ8A 4EHVA 4HR7A 4Y8VB 4U3ZA 3AC5A 3DGKA 3LFNA 4E5BA 3MWEA 4AZVA 2X9FA 3OUNB 4G1WA 4O81A 5FXSA 3R04A 4E8AA 3HV3A 2VTIA 3GC8A 5CAQA 3MN3A 2W70A 4XX9A 5DNRA 1H1RA 3L8XA 2YN8A 3OHTA 4CKRA 4ZY4A 3ZBFA 3GLKA 4UZHA 3KN5A 3PXFA 3PA3A 3I6UA 3R6XA 3QQLA 4AN9A 4IVDA 4JX3A 1OBDA 1Z2NX 2V5QA 5IQBA 3V6SA 2PVFA 2QD9A 1VJYA 4MNFA 4O2ZA 3CIKA 5CANA 5J5SA 4BN1A 2XCLA 5DMXA 2WU6A 1JKTA 2CN5A 5HICA 3F3UA 3C51A 4KRDA 4BGGA 2EVAA 4FIEA 4FKRA 3EOCA 4L9IA 2JDOA 4OTFA 3D5VA 5KKRB 4RJ6A 1Q99A 3DJ7A 5C9CA 1AUXA 1B6CB 3AOXA 3BGZA 4B0GA 3KY2A 4BGQA 3F3TA 3V5TA 1GAGA 3K3IA 5A6NA 3SAYA 3E3BX 4IVAA 1XKKA 3R28A 4LGHA 4UYAA 4D1ZA 1KJ8A 3I60A 3LKMA 2ITXA 3NCGA 3OS3A 4IBMA 3E92A 5E8UA 3W8LA 4CFFA 3EKNA 4K33A 1VYWA 4E1ZA 3V8SA 4C4EA 2ETKA 2YZNA 2ITZA 4FSZA 5E7RA 3W32A 3JYAA 4OT5A 4I0RA 4L46A 5IH6A 5BMVF 5CQWA 2ETRA 2OJJA 4O7YA 5BVDA 2R84A 4JJRA 4ONAA 4XBRA 5D10A 2C5YA 5CLPA 4YJOA 4EOLA 2VAGA 4BCPA 5KBRA 3C4EA 3GB2A 2XS0A 3ENMA 2QONA 4BBMA 2W71A 2CKPA 5JFWA 2BIKB 1XH9A 3TCPA 1O9UA 1O6YA 4S2ZA 5IQIA 5JQ8A 2CCHA 2WMRA 3GVUA 4JOAA 3ODZX 5DG5A 3EJ1A 2NP8A 3M2WA 4EQCA 2H9VA 2YS6A 1M2RA 1EHIA 4IAFA 4LG4A 1PXLA 3MPMA 3JRXA 1GNGA 3ZLSA 4ALWA 3S3IA 3QX2A 2O3PA 3BBWA 5IA5A 3FAAA 4HZSA 4CG8A 2BZIB 2W5AA 3MVJA 5D8DA 4FC0A 2QVSE 4XG7A 4MBIA 4MAOA 3ATTA 3IGGA 3NDMA 5IUHA 3VUKA 1H1SA 3DLSA 3NIEA 1OIRA 2W1DA 4A9YA 5A4QA 5L2IA 2I0YA 3ODYX 2IZUA 2GNGA 3KB7A 4R5YA 4BDAA 4FEVA 5HI2A 3L1SA 3RPRA 2VQDA 4JIAA 4RJ7A 2OKRA 2W6NA 4YHTA 4AXAA 1MUOA 3OT3A 3PVUA 4MK0A 4QYFA 1Y8YA 4XP2A 3ALOA 4G2FA 2W9FB 3CQWA 2VRXA 4V04A 4RZWA 2HY81 3K5VA 4LMNA 4CTBA 5IQDA 2XNNA 4HYUA 3TUCA 3W2PA 3GT8A 2JITA 4L7SA 2W96B 4NW6A 2ERZE 4Z16A 3ANQA 5ANGA 4UX9A 4FFLA 4TKSA 3LLAA 1LEWA 5KCVA 5FEDA 1DM2A 5CXZA 3EN5A 3HDNA 3QF9A 4DTKA 3BHYA 4D1XA 2PVRA 3AXWA 3IPHA 3ACJA 5A4TA 2WHBA 3LJ1A 3RK7A 3MTLA 4LUEA 3PJCA 4O0XA 4TNDA 3WYYA 3VBTA 2UUEA 3AC3A 3QUEA 4F0FA 3OZ6A 4J53A 4KBKA 4X3FB 2WMTA 2ITNA 4XHKB 3QLGA 3K5HA 5ETIA 2YIYA 3ZCLA 3RWQA 4JI9A 4RT7A 3T9IA 1KJJA 1CSNA 5IG1A 3BE9A 4RVKA 3FE3A 2HZ4A 4C2VA 2W6MA 4U0IA 1OM1A 4IB3A 3N8DA 4ZSLA 4YTIA 3OG7A 4U79A 2YCQA 3PRIA 5F1ZA 1Z9XA 2B7AA 3DJ6A 5L6OA 2CGVA 4OR5A 4BICA 4YJ3F 4AFEA 4F6UA 4I4FA 3COKA 2R7IA 3L8VA 4AGUA 3FLWA 2PHKA 4IHPA 3OEFX 4DYMA 2DS1A 4DCAA 1X8BA 3U4UA 1VBGA 3ENHA 4IFCA 4EWHA 1XH4A 4IX6A 4J71A 3R5XA 3NVMB 4QSHA 4ACDA 3OY3A 5IA0A 4GIIA 5GIOE 4I21A 4XG2A 4TYGA 4V0GB 4AGDA 4JIKA 3FPQA 4GYIA 3O0GA 4ZK5A 4TWOA 2JIIA 2C4GA 2OO8X 4FNZA 3N6RA 3QCSA 3TXOA 2CZGA 4TNBA 5AV1A 2PULA 1XO2B 4XV9A 5FBNC 4EH7A 4K2RA 2VWXA 2FSTX 3WE8A 4A06A 4CFVA 5I9YA 1GGOA 2VN9A 1KV1A 1Q8WA 2B55A 4DH3A 5KX5F 1UNLA 2PY3A 5DI1A 3ZEWA 3SKCA 2VTOA 3W10A 3NYNA 4MV1A 4J96A 4TWNA 4ASEA 1PX2A 2JKKA 4YJTA 1PYXA 3FLQA 3MGYA 4EK3A 3PDTA 2YAAA 4F1TA 4X3FC 5AEPA 4FEWA 4O0TA 4ZEGA 2VNWA 4MV3A 1OUKA 4AU8A 3TT0A 4BGHA 4KKHA 5AV2A 5AWMA 1IRKA 3G2FA 5CENA 5HD4A 3LM5A 4GU6A 2UVZA 4FZ7A 1FVVA 4FV5A 1H07A 3KK8A 5ETFA 4EZ3A 4F9CA 2GU8A 5FP5A 4XBUA 4CD0A 3OTVA 3GCVA 4FT0A 5AP6A 5I9VA 4N6ZA 2XJ0A 4PX6A 4ARKA 1Q4LA 3VW6A 4ZAUA 3FI2A 3FKLA 4BY9E 3QCXA 3R9OA 5BNJA 1U54B 3QQHA 2YACA 4PDSA 3VJNA 4Z55A 1ZMUA 5E1EA 5KZ0A 5FM2A 4FTUA 1W84A 4RA5A 1SNXA 4AWIA 3Q52A 3PLSA 2RFNA 3R2YA 4EOKA 3V4ZA 1Q61A 5DR2A 4XRLA 5M51A 4Z7GA 4DN5A 4YJVA 4I6HA 2OJFE 1YDTE 5TKDA 3DFCB 1TVOA 2QODA 4MVFA 4RIYA 4DEGA 1J7LA 3B2WA 4EK4A 4OBQA 3QWJA 2J51A 2FVDA 5CSVA 4J95A 1OKYA 1OL1A 4QTBA 1Q41A 2FGIA 2HENA 1ZOGA 4FVPA 3WF7A 2YJSA 4DEEA 2ITUA 3IW4A 4E5AX 2VWBA 2YW2A 4TYEA 1H27A 2YYAA 3QKLA 5M57A 4H58A 4NCTA 4MF1A 3RAIA 3KMUA 1WVXA 4IIRA 4RMZA 5TF9A 5AP4A 4FA2A 3KMMA 4NWMA 2J0LA 4M0YA 4U9AA 3R7UA 3DT1A 3WBLA 3F88A 5BYLA 4IWDA 4ALUA 3QLFA 5AV3A 4QQTA 2IVUA 1H01A 3E3PA 5IISA 3G90X 4EH6A 2WU7A 3NLBA 4P2KA 3EQCA 4XNEA 4O7SA 4M69B 3TACA 4AW5A 3M42A 2ZV8A 3N4VA 5AX9A 3MI9A 1YOJA 2IO6A 2R86A 3TTJA 4IZAA 4ANMA 4RJ8A 4B7TA 2PL0A 1VKZA 2VTAA 5D9HA 4M14A 2W1GA 3PXZA 3DBDA 4RIXB 4BDBA 4A9RA 5DRDA 5HG5A 1JLUE 2VTHA 4P7EA 3ZSGA 1Y57A 2R3FA 4KSQA 5FP6A 3SE7A 2G2HA 2X7FA 2GNFA 5AAGA 3V8WA 5HE3A 1OECA 4I22A 4C4HA 2UZBA 4XLIA 2X2MA 3GQIA 1OBGA 1OPKA 3EKKA 3MJ2A 3R00A 1G5SA 4JDIA 4XP0A 3LVPA 2VU3A 3RK9A 2R82A 3O7LD 2VTQA 4OBPA 3UOLA 3PY0A 5C1QB 1PKDA 3SW7A 5M55A 4BDJA 3KULA 4J98A 3FXWA 4RQVA 5CNOA 1H00A 2XRUA 5HNGA 1E4EB 2NRYA 1UU8A 3K5UA 4QMMA 5IA1A 1PXPA 2GTNA 2WMBA 3WF9A 2VTMA 2XEYA 4MWIA 1VYZA 2WO6A 4DAWA 2I0HA 3F2RA 3MFRA 1P5EA 5CEIA 4APPA 3SOAA 4PMMA 3OT8A 2O63A 4MXAA 4NU1A 3RAKA 4IZYA 3ZYAA 1CQJB 4F9YA 3DZOA 2FH9A 4MV4A 3P7CA 3PIXA 1AD5A 3E8EA 4QP1A 2NUAB 4DG0E 4OTRA 4XOZA 2Z04A 4FL2A 3FBVA 4WNOA 3ETJA 1OKZA 4FOBA 5JFVA 2ZB0A 4H3QA 3NX8A 4L7FA 1IG1A 2GTMA 2JDSA 2Y0AA 5FGKA 4EHEA 3U9TA 2QLUA 4I0TA 1OIYA 1OI9A 2X0SA 1W8CA 5K4JA 3OUZA 2VWIA 2B9HA 3EH9A 5AUWA 2OIQA 4TV8F 4BRXA 4OBOA 2H96A 4U45A 5AM6A 2HWOA 4O7VA 1UWHA 5JT2A 3AX6A 4WOVA 3UIMA 3QD0A 4O83A 4HPTE 4PTEA 2R3HA 3NUXA 2WTIA 4C5BA 4F1MA 2H6DA 1M7QA 3H10A 1JKKA 2GNHA 4O7LA 2QURA 2RG5A 5IEYA 2UW4A 3UC4A 1PMVA 5JH6A 4YO4A 4FVRA 1TKIA 2WGJA 3NW6A 3W2QA 4CKJA 3FC1X 5HBJA 1KJ9A 2JDVA 4XP3A 4I4EA 2YCRA 4M13A 3P7AA 3MESA 3TW6A 4J99A 4JR3A 2R87A 3KEXA 5JN2A 4JBVA 4XG6A 3NMUF 3RWPA 2QOLA 4DFLA 4O96A 5FEEA 1CM8A 5DYJA 4EGQA 5IH4A 4ITIA 5DEYA 2GNJA 3FDNA 3FC2A 4PWNA 4GKHA 3WIGA 4EI4A 3EZVA 5EI6A 1H1QA 4UWCA 2ITWA 5LWNA 1PHKA 3SRVA 3ZRKA 4K77A 3TV6A 3O96A 5KHXA 4PL5A 5LQFA 2F4JA 2UZWE 2ZB1A 4LV5A 3HB9A 5EZYF 3DDPA 2W1EA 3U55A 2JEDA 2W5BA 3RKBA 2O2UA 4AP7A 3FSKA 1G8AA 4CCBA 2X2KA 2R3QA 2WEIA 1VEBA 4FSQA 4G16A 1GIJA 5D7VA 3QALE 5HCYA 4HVGA 4ZI7F 1JKJB 4IAIA 5DFPA 3C13A 5DN3A 2BZJA 1L3RE 3FL4A 3POOA 3UFXB 4ACHA 3VUHA 4F7SA 4FV0A 4WNPA 4YR8A 3LFSA 4X2GA 2X7OA 3IS5A 2YL2A 2OFVA 4C02A 1OIQA 2GPHA 4RX5A 3ELJA 1CMKE 2ITPA 1KBLA 1U5RA 3QL8A 1ZARA 3PJ3A 4TYHA 3EQDA 5DOSA 2ZDUA 3TV4A 4IZ5A 2EUFB 4JDHA 1H1WA 3R21A 4N70A 4PQNA 4N6YA 1WBOA 1XBAA 4RIYB 5DLSA 2YZMA 3RPYA 4RWJA 2G2IA 3DB8A 4DLIA 2WELA 3VPCA 3A62A 2OICA 4BBEA 4CMOA 2OJ9A 4YU2A 2OJGA 3AT4A 3VS1A 3F69A 2P4IA 2XK4A 4QP4A 5E4HA 4I5HA 3R71A 2FA2A 4AG8A 3A60A 2A4LA 3WARA 4ENXA 4G34A 1IOWA 1F3MC 3D94A 4BCQA 3H4JA 1PXNA 5IYZF 4AOIA 4E26A 4WRSA 2PVHA 1GSAA 3QZIA 1M7NA 5GJFA 2REIA 4OTWA 5HG7A 4FUYA 5HE1A 3W2SA 4CKIA 5CEPA 2XK8A 5TO8A 4FU0A 2W4KA 4AZTA 3QRKA 3ORQA 2J50A 4I4TF 4WUAA 5BPHA 5KKNB 1J91A 5CVFA 4EG0A 5EM7A 2O65A 1KOBA 2G01A 3LFAA 4PV0A 5ANJA 4CCUA 2XM9A 1FPUA 3F2AA 4C2WA 4QPSA 4IIJF 2HJWA 2XP2A 2OH0E 3FL5A 3OCGA 4U5JA 3PWDA 4I23A 5M06A 5LOVF 4ZS4A 1S9IA 4FSRA 2X8EA 1G3NA 3UP2A 3ITZA 3FI8A 2VO7A 4ANBA 1I44A 2I7QA 3KF4A 3E8CA 2BRNA 5IH5A 4ZJJA 3ROYA 4BDKA 2HIWA 2WAJA 1CKJA 4QP7A 5A3XA 3O8PA 4QTDA 3A2CA 3PG3A 2QK4A 2HW7A 3NNXA 3DOGA 2WQBA 4J1RA 4FTMA 4ZTMA 3BPRA 5C8NA 4Z7HA 3I6WA 2R3MA 3KRXA 4RZVA 3GEQA 2ZM3A 5L6PA 1U54A 3VO3A 4YPDA 3FMDA 4MXCA 2C3LA 2BHEA 2VWYA 3A7JA 4O82A 5IQCA 5FDXA 4CG9A 5L8KA 3ZUTA 4DTAA 2R3RA 4C33A 4QYYA 2YCFA 3ORIA 4O0VA 2W6QA 4G17A 3UG1A 1XJDA 2EB3A 2PE2A 4IH8A 3UYSA 4D4RA 1OKVA 3U6IA 4G5JA 4QTAA 1YHVA 2BROA 4FKSA 4LOPA 3R7IA 5A4LA 4YNEA 5LMKC 3CLYA 4LRMA 3VS5A 2HZIA 4NSTA 4RQKA 4D0WA 4EEVA 4O86A 2XNMA 3FZOA 4FV9A 3OWLA 4W4YA 4Q2AA 4GL9A 4YZCA 3I1AA 4O7RA 4MHAA 2R2PA 4UWYA 4QMUA 4RFMA 5CY3A 4ANSA 3RV3A 3CQEA 2IPXA 3KVWA 3JRWA 2GNIA 5CI6A 5BUEA 2HWPA 3QC4A 2DZDA 2YM3A 3AC4A 1KEEA 2R0IA 4UZDA 4JG8A 4C59A 4EKKA 2ITOA 4NJDA 3NS9A 3A8WA 1PRYA 3BZ3A 3VW8A 4R3PA 4IMYA 2WIHA 3QKMA 5H8GA 4I3ZA 5D1JA 4DC2A 5HORA 4DH5A 3ZSHA 1U46A 3L9LA 1JDEA 3GU8A 4I0SA 4RIOA 4L45A 4O0UA 1PXMA 3EN4A 4QYGA 2W6ZA 3VC4A 3O17A 1KE6A 2XJ1A 2PMIA 5C27A 4GT5A 3Q4CA 1Z57A 4QP2A 4MNEB 1P14A 3HP2A 3TL8A 3NVKI 4FTTA 4F6WA 3UO4A 4DGMA 4TW9A 2GLTA 4AZSA 4USDA 4QMZA 4WSYA 2Q83A 2C69A 2PN1A 2W6PA 2XIRA 2JD5A 2ONLA 1PMNA 2YWVA 3BYMA 3R2BA 4NTSA 5HBEA 4MBJA 2OIBA 5J8IA 3ZHPC 3ET7A 4HGTA 2PK9A 4GRBA 4MA5A 5EQPA 3R63A 2ZM4A 2OF4A 3NUYA 5CNNA 5FD2A 3D7ZA 4ASZA 5CEMA 4TYIA 4E4XA 3WO1A 3ORTA 1A9UA 3BE2A 4NZWB 1E1VA 3DTWA 1PXJA 3AMBA 4RC2A 4XYFA 2WIPA 3MVLA 5GINE 3D9VA 2XYNA 2AC3A 2IG7A 3GU6A 3ZS5A 4C4GA 4F09A 4FK3A 1QL6A 4FKVA 4J7BA 3HA6A 4MYGA 5AX3A 3Q2MA 4A9SA 2WQNA 2SCUB 2R3LA 2C0IA 4MWHA 5DVRA 3S2PA 4IJPA 1LEZA 3DQXA 4C61A 4YLLA 5DR6A 4IC7A 2X4ZA 5ANKA 4DFNA 5C4KA 5GIPE 2CNUA 4OUCA 2XNPA 4FIJA 2XIZA 4V05A 2YERA 3QTWA 5HBRB 3HBLA 4C0TA 5B7VA 5AIKA 4L44A 2I0EA 1W82A 4ZTSA 4OW8A 4XV1A 2I1MA 4ZIMA 3R8MA 3FSFA 4E5WA 3FY0A 3FXZA 1W93A 1BX6A 3NNUA 4R6VA 4K11A 3PVWA 2PU8A 3OP5A 5HEZA 1ZMVA 4EOSA 3VA7A 4C7TA 4HVHA 4AX8A 1LPUA 2Y7JA 3A99A 2DUVA 2W1ZA 3VBXA 4FTIA 1QPJA 3U6HA 1WBTA 4UN0C 3OWKA 4ZTRA 4JBOA 4BDCA 3EYGA 4KNBA 2JAVA 3VAPA 2PVKA 2C30A 2DLNA 5C8KA 3OW3A 4CV9A 5LWMA 3QBNA 2QOQA 2QOBA 1IR3A 2X0GA 3OEZA 4BDHA 4I5CA 5DBXA 3LXNA 2I87A 2VO0A 4M84A 4IVBA 3THBA 3IK3A 3TG1A 2UZOA 3VF9A 3B8QA 1U59A 2BIYA 2BPMA 2UZTA 4ZS0A 4MCVA 3WZJA 4EH2A 4I94A 3VPBA 1M17A 2HOGA 1UA2A 2VTJA 4W4VA 3IQ7A 2HCKA 4QQCA 4FT3A 3V6RA 3KVXA 3P0MA 2X4FA 4MXXA 3R9NA 2ZDHA 4I55F 4EOQA 3I5NA 4HVDA 2VX1A 4Y72A 3PYYA 3UBDA 3MH1A 4GEOA 3VS7A 2XCKA 3MB6A 3SHEA 2W99B 2HAKA 4FTLA 2QCSA 2FPIB 4GS6A 5IEXA 2V62A 5LJJA 1KJIA 4IDTA 2RG6A 3MIAA 3QQKA 4AAAA 3RAHA 4BCJA 2JAMA 2WTJA 3RM7A 2CKEA 1OUYA 2CGXA 4OTIA 3HL7A 1GY3A 3H9RA 1YWRA 3I7BA 3D15A 2NO3A 2QC6A 1IA9A 1SZMA 2GNLA 3G6HA 4I24A 4IWQA 2OF2A 4EYMA 4XH6A 2FSOX 5ANDA 5CVHA 3TI1A 3DKCA 4IJ9A 5A14A 2UW6A 2A2AA 3KXZA 2YZGA 3AMYA 3MH0A 2JDRA 4O6EA 3Q6UA 4NTTA 3REPA 4YP8A 5J87A 4YJSA 3HVCA 3DBCA 3F7ZA 3PXRA 3QZGA 4RBLA 2OXXA 4AW2A 4C37A 1V0PA 1DAWA 4AZWA 2B0QA 2JC6A 5BYYA 5CALA 3R1SA 3EQHA 5ANEA 5K9IA 3R9HA 3PPZA 4M0ZA 4Y5QA 3NUPA 4FE2A 3W2OA 1EZ1A 3TNPC 3OWPA 5AUVA 4LL5A 3BKBA 4FNWA 3FZSA 3PVBA 4EBWA 1KOAA 2WOTA 4PP9A 3PSBA 3K3PA 1CKPA 4C5CA 4YJPA 3RM6A 2OXDA 3E5AA 5AP1A 4H1JA 4XG4A 3UE4A 4FZ6A 2CPKE 3FMLA 4BZDA 4RPVA 1IASA 2C5VA 4IM2A 4PL4A 1OITA 3CD8A 4M68A 1MP8A 4NW5A 3O2MA 4O2BF 3N4TA 1Z5MA 3NIZA 1Y6AA 2G15A 2OIDA 1YXUA 3R7YA 3W18A 4H3BA 2PUNA 1DV2A 3JR1A 2G2FA 5EHYA 1GJOA 3O8UA 4HPUE 4MNEA 4EL9A 4FFOA 4I1ZA 4YLKA 2VTSA 4XCUA 4ZSEA 5DGZA 3BU3A 1K9AA 1ZRZA 4TT7A 5KUPA 3C4FA 1WFCA 2QU5A 3KK9A 3U4WA 2WXVA 3EFLA 1QPDA 3ZM4A 5M4FA 4JG6A 2WMWA 4TV9F 4GVJA 4FEQA 1XH5A 2QOHA 3DJ5A 3NEWA 4OTDA 4I5MA 4P5QA 3SDJA 3UO5A 2CKQA 3PTGA 4H05A 3VBQA 4YAJB 2JBPA 3ZC5A 5BMSA 2VD5A 5IZFA 1MRVA 1I09A 4PTGA 3LQ5A 3LXKA 2YM8A 3I0QA 4B4LA 3QFFA 3QFVA 4Y85A 1IA8A 4QP6A 1Q8UA 3CR0A 3DNDA 5HVYA 3RALA 5K5XA 4CFUA 3G15A 1H0WA 3WOWA 2BR1A 4HVSA 4WG4A 5F4NA 3NWWA 4UBAA 4KA3A 2VGPA 3R9RA 3EWHA 1JWHA 4LFIA 2F7XE 4YZBA 3LQ8A 3TKIA 1KE8A 5CXHA 5EOLA 2YIWA 1T45A 4R5SA 4U41A 4YPSA 4AT5A 4IB1A 4ZSAA 3NAXA 4O4JF 1G8SA 5CX9A 3Q6WA 2PE0A 3NRMA 5KBQA 4K18A 4P90A 4QYHA 5IUGA 2X9EA 5AFVA 3SXSA 4BC6A 5AP5A 4IB5A 4ZQIA 4UXLA 3NW5A 3R9DA 2WYOA 4O22A 4A9TA 4AGWA 3OXIA 4PP7A 2NU7B 2GQGA 2RFEA 3S95A 5AA8A 1YXSA 3IOKA 4D4VA 4F7JA 1YI4A 5CVGA 2FP4B 2YM5A 4IWOA 1ERKA 2R3PA 1PXOA 3O50A 4OTGA 5A4CA 5IDNA 3OXZA 4ZTLA 3ZOSA 4QMQA 5HIBA 5FXRA 3NAYA 2YWPA 3BRBA 5AADA 3GXLA 2KTYA 3I0OA 4ZZNA 3SXFA 1UV5A 2ETMA 5TR6A 3QUDA 2J90A 5EW3A 5LXTF 3BEGA 3LCSA 4MQ2A 3ZUVA 3GOPA 2F7ZE 2V59A 4FX3A 1E9HA 4KIPA 3R73A 4X2KA 3B2TA 3HP5A 2XIKA 4BI1A 3HMPA 4S32A 4X3FA 5JQ5A 4DH7A 4EBVA 3JVRA 3KF7A 4BCOA 3ZZEA 3MY1A 4KINA 2BVAA 2GDOA 2B1PA 2HXLA 4TWCA 4ZSJA 2XIXA 4JQ7A 4FSMA 1YXXA 3V5LA 5EW8A 2YIQA 4X6RA 2OH4A 3VQHA 5BVOA 4KKGA 1NW1A 3Q53A 3PPKA 3C5UA 4KUJA 3E64A 5D12A 2YEXA 3LP8A 1H24A 2PSQA 4RSSA 5AUUA 2QG5A 3V51A 4BCHA 1ZYDA 3CY3A 2QKWB 4JX7A 3OBGA 2W1FA 4DGOA 4TL0A 2XVDA 4JR7A 4LYNA 4JLCA 4LOOA 3K3JA 3MV5A 4QP9A 3KRRA 2XNEA 3MBLA 4I6BA 1R0EA 2H34A 2XF0A 1WZYA 3JS2A 5FTQA 3LFBA 3DCVA 4RX7A 2V0DA 4PNKA 2YIXA 2W6OA 4L1KA 5CSHA 3A7HA 3EFKA 3OOMA 3PZEA 1JSUA 2UW7A 4K9YA 3RI1A 3EQFA 3A4PA 4DEIA 4DIMA 5CF6A 3MA3A 5JGAA 1UU9A 3OY1A 4JT3A 1R78A 4DHFA 1CQIB 5LP6F 1ZXEA 2UVXA 3R5HA 2VR1A 3MDYA 2QOKA 1SMHA 5HE2A 3TINA 3E7OA 4W4XA 5ETCA 4F6SA 1UU7A 3QQJA 2O5KA 4HYHA 4YJUA 4BTKA 2X8DA 3P9JA 1JLLB 2HW6A 4D1SA 2JKMA 3O51A 3SW4A 2W05A 4MXYA 3BCEA 3E62A 3DAEA 4F99A 3TZ9A 4BB4A 5I9XA 1URWA 2YIRA 3CKWA 4LRJA 3O8TA 4FT5A 2W5HA 4MD9E 4EUTA 5JQGF 3FHIA 5HU9A 4TYJA 5E8WA 4D0XA 2YISA 4IAYA 2XH5A 3FMEA 2QR8A 3VRZA 4J97A 3R8PA 2C5OA 5CS6A 3RVGA 3QD2B 4D4YA 1OL5A 2Z7SA 3ORZA 4QTCA 3VVHA 1UVRA 3AMAA 1YWVA 2ZV7A 4HNVA 2F9GA 1UU3A 2EXMA 2SRCA 4ZJIA 3R8LA 4EKLA 3G9LX 3OFMA 2NU9B 3KREA 1ZY5A 2C6TA 2J0JA 2JDTA 5B0XA 3DF7A 3F9NA 3KU2A 3LPBA 4CTCA 3JVSA 2JBOA 3QXPA 4DGGA 1XQZA 4DT9A 3FV8A 4PMPA 1FVRA 2IW6A 5A54A 2R3NA 4AT4A 3Q4TA 3VS0A 2P3GX 3TNWA 3W55A 1FGKA 3QD3A 3AD5A 2JKOA 2P2HA 4FV7A 5A6OA 4C3RA 2GFCA 3BGPA 4KB8A 3UIXA 3TNIA 4XV2A 5D11A 3GBZA 2W1IA 5E91A 4WUNA 2PZRA 3PE1A 3Q9YA 1V1KA 4AZFA 3O7LB 2WQEA 4WIHA 2R5TA 3PPJA 5A46A 5AP0A 3TEIA 5KNJA 1CS0A 5AP3A 5CU6A 2OBJA 3FXXA 4YC8A 4EJNA 5AUTA 2DWCA 3I12A 4EONA 3COIA 4FKTA 1WBNA 4A4LA 4O0YA 1YW2A 3LFDA 3D5UA 3MVHA 3VUIA 3DPKA 4FKWA 4RIWA 3ULZA 4CZTA 1EH4A 3FQHA 2DIKA 5EM8A 4R3RA 2P33A 4KD1A 5AP7A 5J7HA 3FUPA 3KMWA 4FKOA 2C00A 4X21A 4AW0A 1Q3DA 5HO8A 3ORNA 3R01A 2XNOA 4L00A 3OWJA 2XIYA 3ZO1A 4KSPA 2XNGA 4B9DA 4BDIA 2BCJA 4LL0A 2VX3A 5LCKA 1WVWA 2R3JA 4EK8A 1I7NA 2ZMDA 4HNUA 4O84A 4X2FA 2IJMA 4R3CA 1YHWA 5AV0A 4ASXA 2J0IA 4AW1A 3AQVA 2RGPA 4YZ9A 4CV8A 5KKRC 2WQOA 1RDQE 2R3GA 2R7BA 3DU8A 3CS9A 1YI3A 5CEQA 3UVPA 3E5NA 4AQCA 2GS7A 4JAIA 4CMTA 3PVGA 2C6OA 3MS9A 4FVQA 4IAZA 3ID6C 3KCKA 3R02A 4U80A 3F6XA 5DE2A 4AE9A 3HRCA 3GU4A 3H30A 3RP9A 1WR2A 2XKEA 3H9OA 5CT0A 5CU4A 2I0VA 4Z3VA 2YHVA 3NUSA 1ULZA 4MV6A 5HZNA 2VV9A 4IFGA 3VS4A 1AQ1A 3C4WA 3KXHA 2W1CA 2WTKB 3NZ0A 3PWYA 3BBTB 5CZIA 4BZOA 4EOMA 4EORA 5IQGA 2FYSA 2PMLX 5CSWA 4CRSA 3SVVA 3CPBA 4A4OA 3FLSA 5DT0A 3COHA 5AM7A 2PZ5A 4CT2A 4QQJA 1YVJA 3UC3A 4E6AA 4C5AA 5M56A 3R7OA 5M53A 4JBQA 3W2CA 4AE6A 3JY0A 4MQ1A 2GPWA 5I5ZA 1BI8A 2QLQA 3WZEA 3EHAA 3Q4ZA 3ZXTA 2GQRA 4FYNA 2NNWB 2IVVA 4FBXA 4ORKA 3FQSA 4IANA 5KX8A 1YI6A 5CQUA 2Y6MA 4R7BA 4RIWB 5KZIA 4FNYA 3PE2A 4UALA 5EYCA 4YMJA 3QTZA 1B38A 4FOCA 4HGLA 2I80A 3HV5A 1M2QA 2C6MA 2PVPA 5EDRA 1WCCA 3MVMA 4QOXA 5F94A 4UB7A 4QYEA 4QMNA 4S33A 5JRQA 2GS2A 5E8TA 5IEVA 2W0JA 5EI2A 3IOPA 2VNYA 2WFYA 4K1BA 5CA1F 5CT7A 4JVGA 4Z9LA 3LMHA 5M4IA 3FEGA 4XYLB 4RRVA 2RKUA 5IDPA 3NYXA 3DK7A 2Q0BA 3EN7A 3BHUA 4G6NA 3LJ2A 5HCXA 1UNHA 5EQYA 5BQ0A 4EQUA 4KIQA 4QO9A 3G6GA 2FSLX 2Z7LA 4F1OA 2UZUE 4D28A 2X7GA 3QTRA 4CLJA 2QF7A 4YLJA 4YJNA 4YSMA 4EHGA 2AC5A 2W17A 3EQRA 3A8XA 4U40A 4AN3A 3FHRA 2VTRA 5LVMA 4X2NA 4XRJA 3BWFA 4BF2A 1KV2A 3AW8A 3MW1A 3TN8A 1U4DA 3D7TA 3MSSA 4IVCA 4N0SA 4GYGA 4OTQA 3WIKA 3QWKA 3PP1A 2ITQA 4MKCA 2J2IB 3FY2A 5LYJF 4IDVA 3K2LA 5CF8A 4RC3A 2CLQA 3QKKA 4U42A 3ORPA 1Q3WA 5CASA 4J52A 3BYVA 4FFNA 4IAAA 5KMJA 4G3EA 4OT6A 3CSVA 4TUYF 1UKIA 2XK6A 5H80A 1SVHA 4DF3A 3LQ3A 5JSMA 2WEVA 4D4SA 5BVKA 4F9BA 5BX0A 2JLDA 5GNKA 4D5HA 1B6SA 3VBVA 3UODA 4WNKA 2C1AA 1C3OA 4L8MA 1QMZA 3Q5IA 3EYHA 4CFWA 2QR7A 4O7NA 5DHJA 4GUBA 5DRBA 1R1WA 2Z2WA 4B8LA 4EH5A 1NT2A 4YTCA 5J2TF 4MXOA 4D2SA 4HCVA 4ZJVA 5M07A 5JH7F 4M12A 4FFMA 3BU5A 3BIZA 3QC9A 4WNMA 5JMSA 2J5FA 3GCQA 3UDBA 2E9OA 4MD8E 3KALA 2XKFA 3VS6A 3EFJA 2H8HA 4FSUA 4ZOGA 5HIEA 2BTSA 5KO1A 1GZOA 4L3PA 4FKUA 3NGAA 1XH7A 2VTTA 4C4FA 3KAKA 4K6ZA 4DT8A 3HAMA 4EH4A 4KS7A 5LCJA 2Y4IC 4DE4A 2PVJA 4GG5A 5DT3A 2PWLA 1GLVA 2ZDGA 4ZHQF 1JDBB 4BI0A 2NPQA 1CDKA 3FYKX 1SVGA 4A7CA 1NY3A 3LXPA 3HDMA 5EG3A 2X81A 4GCJA 4HNTA 3R7VA 3LLTA 2R7NA 1B39A 4RFZA 4ZZOA 1V0OA 3BG5A 2CSNA 2QHMA 3DFAA 3W2RA 4RJ3A 3V04A 1QCFA 2PE1A 1PMUA 4CGAA 3QD4A 1OL2A 1WBSA 2RL5A 2UW3A 2PVLA 4M15A 1BNCA 3P08A 4U43A 3UGCA 2HYYA 3P7BA 1PW2A 2BHHA 5GONF 2OXYA 4FKIA 4YBZB 2V22A 3TQTA 4F7LA 4IWPA 4ZXTA 4F7NA 1EYZA 4D9UA 3BV2A 1OGUA 3CY2A 4FNXA 3G8DA 2XM8A 4TYHB 4AUAA 3PA5A 4MXZA 4FYOA 3TUBA 3OCBA 5D7AA 3QCQA 5FXQA 5IU2A 2GHGA 2IN6A 3W8QA 4BDDA 3G5DA 4WKQA 1DS5A 3VUGA 2PBZA 2PPQA 4XUFA 3U8WA 4F0IA 1ZOEA 3BYUA 4JQEA 3SG8A 4QP3A 4ANQA 5CEKA 4RC4A 5JRSA 5E8SA 1H8FA 1U5QA 4BDFA 1FINA 3D5XA 3ZH8A 3BI6A 5HU3A 3L8PA 5EM6A 4BIEA 4EQMA 1JVPP 2ERKA 4G5PA 1REKA 3ACKA 5HG9A 4CSVA 3KAJA 3FQEA 2VUWA 2PVMA 3LFFA 4DFBA 3ORXA 2BMCA 5M09A 2IVSA 3U51A 3PY1A 4E7WA 4GW8A 3IDBA 2HELA 3QYZA 2YCSA 3RPOA 5L3AA 1Q24A 4FZFB 3HO8A 2PVNA 5AUZA 4TWPA 2UVYA 3LCDA 3QTUA 3SRVB 3GQLA 3PRFA 3QA0A 3V5WA 4MH7A 2FPPB 3R83A 1KWPA 2PMNX 1PXIA 5DWRA 1MQBA 4Q5HA 2YFXA 4IB0A 3U54A 3ZO4A 2ZVAA 4O4IF 3OBJA 2Z60A 3CC6A 4MAMA 3E93A 1Q97A 2CKOA 3QTXA 2XYUA 1PJKA 4IM3A 3WZDA 4FSYA 2Z7RA 1KE5A 2XBJA 4IC8A 4RFYA 1O6KA 3Q2JA 3H3CA 3HZTA 3QU0A 4I92A 4C36A 4HZRA 2PUIA 1Q8TA 3UOKA 4WBOA 3IGOA 5H8EA 2YM6A 5E8XA 4BI2A 3HYHA 2C6LA 4QMPA 5DA3A 3HECA 4L43A 4QNAA 1F5QA 3HMNA 3UVRA 4C3FA 3DS6A 1BI7A 3LFEA 4JRVA 4C38A 5CYIA 4YJ2F 4N57A 2W4OA 3TUDA 2PTKA 4JNWA 2VWZA 4Q9SA 2IZTA 4O4HF 4WD5A 2YDJA 4J8NA 3ZO3A 3BYSA 5BVNA 3F61A 2OGVA 5E92A 1NVSA 1GIIA 3F3WA 3KN6A 5E8ZA 5IF1A 3HAVA 2BTRA 3I7CA 3PIYA 4AN2A 2XD4A 2WKMA 4O4LF 3WZKA 2R85A 4C35A 1IOVA 4EH9A 1ZZ2A 1S9JA 5HCZA 4JBPA 5EOBA 5FNVF 3QRJA 4YAKB 3U9NA 4FIGA 3UIUA 2VTNA 4FTOA 2YJRA 1OZ1A 3Q9WA 3AD6A 2R3OA 5JQWA 2B53A 5CU0A 3ZFMA 4WO5A 3HMMA 4WT6A 3FZPA 4GG7A 3RMFA 1MRUA 3LCTA 4EH3A 4QQ5A 3EQGA 3OXTA 1W0XC 1JSTA 5ANIA 3Q04A 3QQFA 4O27B 3PSCA 4LQMA 5HESA 4ALVA 4AT3A 3L9NA 4HQ6A 1M0WA 2VTLA 3KXXA 4C34A 4ID7A 3ZFXA 4FL3A 4I93A 3VS3A 2B9JA 5K5NA 2C47A 5LVOA 4FTKA 2J6MA 2A19B 3IDPA 4DEHA 5H8BA 2P55A 5J1WA 4NJ3A 2OI4X 5KE0A 4CRLA 3FWQA 3ORKA 5DIAA 2V55A 2QU6A 4BVUA 3LFCA 3F5XA 4QMVA 3FI4A 3QGYA 4U81A 5KMLA 1PXKA 5H9BA 3TDVA 4WG3A 1F0QA 4JDKA 1STCE 2WB8A 2F7EE 4U44A 4GKIA 3QA8A 4XJ0A 5CZHA 4XOYA 2V5AA 2JKQA 5HNBA 3M1SA 4PTCA 4Y46A 3UOHA 3NPCA 2HXQA 4BIBA 4ENYA 3EFWA 2WMSA 4FR4A 5KMIA 2PZYA 3DY7A 3DTCA 3HGKA 5ETAA 3GUBA 4J8MA 3MPAA 2QQ7A 4LV8A 4C4JA 4HVIA 2JIVA 5IQAA 4AF3A 4C58A 2RFDA 4K0YA 3BQCA 2NU6B 3VNTA 3K5IA 4EGJA 2VO6A 5EHLA 2C0TA 3Q9ZA 5IMXA 4AS0A 2BFXA 3KQ7A 1XH8A 4X0MA 4CFXA 2J4ZA 4A9UA 3OTUA 4CFNA 4YZDA 4PUZA 4Y73A 3M11A 4FZAB 3QRUA 5FQDC 3UIBA 2OLSA 2YM4A 1GSOA 1IAHA 3OC1A 4O7ZA 3TM0A 3P23A 5HLWA 1KJQA 3R5FA 4QTEA 4ZY5A 3TIIA 3IONA 3ZMMA 5DR9A 4BYIA 3HV6A 1YDSE 4EJ7A 5HO7A 1XR1A 3EB0A 4L42A 4YNOA 1B6RA 4RZQA 4RA4A 3PZHA 4DFUA 3D14A 3GGFA 3HV7A 3ZZWA 3VULA 4JS8A 3MFTA 3UQGA 3DDQA 1IEPA 2BFYA 3GU7A 5FLFA 2EWAA 4CEGA 4DINA 4GU9A 2WZJA 5LVLA 4Y95A 4PDYA 5AA9A 1Y6BA 2PVYA 4HCUA 3T3UA 1HCLA 3OVVA 3P4KA 5FTGA 2I40A 3KRJA 4MV8A 3T9TA 2YZAA 3ORMA 4K8AA 5E1SA 3S0OA 2AUHA 1H28A 2QI8A 4LOQA 4NM5A 4RX9A 2IW8A 4B6LA 3PIZA 4TN6A 5K4IA 1OL6A 3CXWA 1CTPE 5BVFA 4DBNA 3VN9A 3IKAA 4ZMEA 2OW3A 1Q62A 1Q8ZA 2XK9A 4LUDA 3RHKA 3R1NA 1DAYA 3UPZA 1OB3A 2A0CX 3F2NA 4IM0A 1ZYSA 3LZBA 2O8YA 2YS7A 5J9ZA 4GSBA 1V0BA 3POZA 3RHXA 4ASDA 4ANLA 2BDJA 2PUUA 4HCTA 4HNIA 3EQBA 3VMMA 5CWZA 4OGRA 1BYGA 3KA0A 1DI9A 3HRFA 2A1AB 4FIIA 3MY0A 3LW0A 1WBPA 2PMOX 4IZ7A 5GJGA 3FZRA 3MH3A 3TZ8A 4ACCA 2A27A 2VX0A 3SC1A 4MV9A 3MJ1A 1PYEA 2W7XA 4O7WA 3WF5A 3Q3BA 3D2KA 5M08A 1RE8A 3EL8A 3JXWA 3KC3A 3R0TA 2C5XA 4G6LA 5HGIA 3G8CA 3UZRA 2GS6A 3OUUA 3ZTXA 2VGOA 4CXAA 4W4WA 1OMWA 3VIDA 3UZTA 3UVQA 4O21A 4ACGA 2YDIA 3WYXA 5LOHA 1M0TA 2WMUA 2BRGA 2X39A 3R8VA 5ITAA 3PFQA 2WTWA 2CJMA 3IW8A 4X7QA 4BZNA 4GT4A 4EOIA 4P5ZA 1W83A 3E88A 3ZLYA 2WD1A 3NCZA 4Y8DA 2XCHA 4S34A 4CZUA 3NNWA 4DEDA 2QG7A 4FODA 3ZO2A 1Y91A 3BHHA 4NL0A 3PJ1A 4O2PA 2ZOQA 5FM3A 3DLZA 3A4OX 3PXQA 3P86A 2WMQA 3A61A 3ZDUA 4BTMA 1JSVA 4PDPA 5D41A 1FBNA 1GOLA 3DXNA 3DK3A 4FSWA 3I5ZA 3NSZA 4BTFA 4MV7A 3U87A 3JZFA 3IW6A 3RAWA 1OPLA 2OWBA 2OFUA 3H9FA 4FTCA 4DGLC 2IP4A 4IZOA 4DH8A 4BCMA 4KBAA 1JNKA 4FTQA 5AIRA 5ACKA 1W96A 3ZFYA 3D83A 3AC8A 2C1BA 1FGIA 4E4NA 4MD7E 3OCSA 3PXKA 3SLSA 1BL6A 4FV1A 3BQRA 3D7TB 4FTNA 5BYZA 4RJ5A 2HGSA 4HW7A 2QKRA 2BKZA 4EOOA 2OG8A 3C4CA 1LUFA 5DPVA 4ERWA 3ZLWA 2ZDQA 3GC9A 2Y4IB 1JKSA 2G1TA 4BDGA 2CN8A 4ZZMA 4BKJA 1RW8A 2XKCA 1Q8YA 1XH6A 5AV4A 3FPMA 1OPJA 2QO7A 1J1CA 2F2CB 3FZTA 1YQJA 3Q5ZA 2F57A 3GU5A 3QTIA 4QT1A 4R1VA 2X2LA 4JG7A 4R78A 3VJOA 4F0GA 2UZLA 4PL3A 3DA6A 3S1HA 2CGWA 4FKLA 5EM5A 5BUIA 3UYTA 1JOWB 1QPCA 2FB9A 3CCNA 2W1HA 4EWQA 3C50A 1W98A 1XHAA 1LR4A 5EK7A 3ULIA 1BKXA 1XWSA 3E7VA 1ZY4A 2R64A 1P2AA 4NM0A 2W06A 1OVEA 4EYJA 3QCYA 3EQIA 1I7LA 1R0PA 3Q60A 4EC8A 5A4EA 2BAJA 2BDWA 4YTHA 2WTDA 3TDWA 4E6DA 3KRLA 3CQUA 4O2AF 2ITVA 1AUVA 2AYPA 3FLNC 4DEAA 1NVQA 4FKQA 4O7TA 2C6EA 3LHJA 4NM7A 5FRIA 5GJDA 5HIDA 1TQIA 4BBFA 4FUXA 1ZYCA 4F9AA 3C9WA 4DLJA 1ZOHA 4NT4A 4DG2E 4RWLA 3FMMA 5CU2A 4XZ3B 3VUDA 4HJOA 5HQ0A 3MFSA 3JUHA 4NCTC 3VBWA 2O64A 4R1YA 1BUHA 3V5PA 5C26A 3IDCA 2QO9A 4G3FA 2YITA 1MQ4A 2CHLA 4GK4A 2B54A 1NXKA 2J0MB 2ZMCA 5E9EA 5F20A 5AAFA 4L3LA 2LGCA 2VTPA 3ZXZA 3SA0A 1YXTA 3ORRA 2UZDA 4U97A 5G6VA 2R9SA 2QOOA 5HHWA 5CAEB 2B9FA 3P79A 5CF4A 4DCEA 1DV1A 2UW9A 4E4LA 2J7TA 3LJ0A 3QHRA 5I4NA 4ZLOA 3LIJA 3Q32A 4IADA 5IA4A 5C8YF 4GJ3A 3ZRMA 5JEBA 4KBCA 1M6VA 3BLHA 1YOLA 1DIKA 4IX5A 3RCJA 1RJBA 3G51A 1VZOA 2NU8B 5AAEA 3UG2A 1XBCA 3LCOA 4JDJA 2I6LA 2F2UA 1K2PA 1YDRE 3EMGA 3GOKA 5JVDF 4YURA 3FMHA 3BLQA 1O6LA 2FB8A 4IACA 1LP4A 3V8TA 3F82A 4FL1A 2ACXA 4YBKA 4HGEA 4QMLA 5JZNA 4B8MA 4DA5A 4AACA 1HCKA 1APME 2VO3A 3RZBA 1OIUA 3VBYA 1H08A 2YA9A 2BUJA 5IMEA 5IQHA 1BLXA 3U9CA 3T8OA 3LMIA 2XB7A 3RCDA 5EKNA 4HNFA 4FKGA 3C0GA 5ANOA 3KRWA 3ZC6A 5HLNA 3LFQA 1T36A 2VZ6A 4ERKA 2HZNA 4L52A 3LMGA 3HUCA 3LWBA 2CDZA 4JQ8A 4M7IA 4YC6A 4RWIA 4YZMA 4O0WA 2XJ2A 3CPCA 1PY5A 2UW0A 5HKMA 3W16A 1BL7A 4R77A 5F95A 3C7QA 4AFJA 4FZDB 4RVLA 5LA6F 5LMBA 3RK5A 2PZPA 3MJFA 5L8LA 4G31A 1P4OA 3FLZA 4GIHA 3V3VA 4BHNA 4NK9A 3BHVA 4ZOLF 3TIGA 4EC9A 5I9WA 4E4TA 3DBFA 2RF9A 3AC2A 3EZRA 4E6CA 5JFSA 2X6EA 2IZSA 4FV6A 3V5QA 2ZAZA 3FMKA 3MYGA 4II5A 2BRBA 3PA4A 3R1QA 3QHWA 1YKRA 2BDFA 2WTCA 3AGLA 2X1NA 3FKNA 3KFAA 3PSDA 4B99A 2Z8CA 4ZMFA 5BPYA 5IQEA 5EYMA 3FYJX 4ACMA 5CA0F 3E8NA 4ITHA 1Y8GA 1YWNA 3HV4A 5I9UA 4RX8A 4A07A 3RJCA 5F9EA 4AGCA 5HTCA 4HYSA 5FG8A 2BILB 2BRHA 3PXYA 4O6LA 3HRBA 3EN9A 2IZRA 3R23A 1JAMA 2PYWA 3TV7A 4GMYA 4FI1A 2GCDA 1H25A 4NFMA 4APCA 4XX0B 3F3ZA 2KULA 1PKGA 3MTFA 3N51A 1E4EA 5BVEA 3GI3A 4FTAA 1FMKA 2XBAA 3TWJA 2ZV9A 4L6QA 3GIDA 3FJQE 5CSXA 5CTPA 4BTJA 4NUSA 1H0VA 5FEQA 3SV0A 3ALNA 2HK5A 3GFWA 3DV3A 4DFZE 3CGOA 3QRTA 4IEBA 5B2LA 2YRWA 5J9LA 5C03A 3R8ZA 4ZTHA 5C01A 4ZLYA 1W7HA 1OL7A 4QRCA 4F70A 3VUMA 3KXMA 3ZBXA 1WBWA 2GHMA 3OD6X 1JKLA 1EUDB 3A7IA 4FV8A 5KMKA 1ZYJA 4IX3A 5L2WA 4FIFA 3N4UA 3L9MA 2QHNA 2FPGB 4PMTA 4I20A 2DQ7X 4YC3A 3IW5A 3I79A 2BAKA 1RQQA 4DITA 3PY3A 4W8EA 3LCKA 5FDPA 4EZ7A 3U9SA 4F4PA 1PF8A 3GFEA 5J1VA 3HEGA 3ZUUA 4NKSA 3ERKA 3JPVA 2C3JA 5ICPA 5JKGA 3WZUA 1M14A 3MA6A 5CAPA 5DEWA 3C4XA 5J2UF 1TQPA 4IAKA 4MTAA 3FZ1A 1YRPA 4TPTA 5L6WL 5TT7A 1KE7A 1KSWA 3ETHA 3RFCA 3TJDA 4YHFA 1BMKA 4BYJA 4R7HA 3E87A 4GH2A 3A7GA 4M97A 4BHZA 5CAVA 2WMVA 3DKGA 1KE9A 4W8DA 1SM2A 3CKXA 5HNIX 3JY9A 3TNHA 4YGAA 2RFSA 2WMAA 3R1YA 2C6DA 2OZAA 3DB6A 1TQMA 2R7MA 5B2MA 3JZIA 4RLLA 3C1XA 1OKWA 2PUPA 3R30A 5AUYA 5HLPA 3ROCA 3VF8A 4DTBA 4YSJA 3HUBA 4L68A 4ZLZA 2R7LA 2G9XA 3A7FA 3AGMA 1FQ1B 4FIHA 4XEYA 2WNTA 2C3KA 3SG9A 1HOWA 3S4QA 2ONLC 3F3VA 4RIXA 5FTOA 4C4IA 1GSHA 3O71A 4CMUA 5KHWA 1REJA 1A48A 4MX9A 4ZTNA 4CQEA 3DBQA 5CEOA 1UWJA 5LXMA 4EHZA 2CCIA 2ZDTA 4D58A 3Q96A 1JQHA 4YTFA 1AGWA 2IWIA 5J9YA 2VWWA 1WMKA 3UQFA 4DEBA 3QX4A 3CEKA 3CGFA 3CBLA 2P0AA 4GFMA 4BCFA 3ZRLA 3SXRA 1FOTA 4XMOA 3VHKA 2CLXA 5HV6A 3AT2A 3BHTA 1URCA 3BX5A 2Q0NA 2QNJA 4OTHA 3UQCA 4M9UA 2ITTA 3MFUA 3RINA 3RTPA 5JFXA 3D4QA 4ME6A 1JBPE 2Y6OA 2DYLA 3OF0A 5DH3A 1R39A 2B52A 1SCUB 5CB4F 3QUPA 3BELA 4TTHB 2C3IB 3BLRA 3D0EA 3OMVA 2GHLA 3PP0A 4NM3A 3DZQA 5L8JA 3G0FA 5HE0A 2EB2A 3WE4A 5HVKA 4XG9A 4FGRA 5KMOA 3F5GA 4DBXA 3QTSA 3FLYA 3G9NA 3LXLA 3QTQA 3BU6A 4H3PA 3WO0A 4L53A 3ZM9A 4L3JA 4C62A
chains in the Genus database with same CATH superfamily
3UZPA 2RIOA 5HVJA 2XEZA 3EL7A 3NUNA 3TY8A 2C0OA 1YOMA 3Q2OA 3E63A 5M44A 4CT1A 4RVTA 4QNYA 3WF6A 4KAOA 5BUJA 3OUKA 3CE3A 2EXCX 4EUUA 4HN2A 3D2IA 3I4BA 5L2TA 4E20A 2BZKB 3DAKA 4USEA 5HG8A 3DXQA 4F9WA 4GT3A 5JGBA 3DAAA 2CNVA 3GNIB 4M3QA 1R3CA 3MIYA 5LMAA 4FFRA 4CFMA 5LMKA 3S24A 4CNHA 3C5IA 4F63A 1UNGA 3IECA 3W1FA 4D2RA 3GENA 2NRUA 4H1MA 4TRLA 4KS8A 2ESMA 3MPTA 3NYOA 4NYEA 4D55A 4X2JA 3F5UA 2Z7QA 4TZRA 5AJQA 4BIDA 3BV3A 5EFQA 3ORLA 5FUTA 3AD4A 2HY0A 4XG8A 5CI7A 1VBHA 4CHIA 5T6KA 3UOJA 4I6FA 4TY1A 3I81A 4GK3A 5I60A 1C30A 1J1BA 3AC1A 4FSNA 4FFPA 4QMOA 3BYOA 4LRKA 3UZOA 4RG0A 4U7ZA 2I8CA 2BAQA 3W33A 4CVAA 2QO2A 3BEAA 1ZZLA 3D5WA 3U6JA 5JZJA 2XANA 5EKOA 2E9VA 5EDPA 2CMWA 3COMA 1ND4A 2J9MA 2XRWA 3SX9A 3TZMA 4G3GA 1T46A 3BWJA 5EYDA 5AUXA 3RPVA 3R8UA 4XYMB 2XMYA 3W1GA 1Q5KA 2XZSA 3DKOA 4G3DA 5EYKA 3G0EA 3HX4A 4I41A 4EOPA 1M52A 4KABA 4D9TA 3II5A 4FEXA 2WOUA 3CTJA 4G3CA 3KULB 3NUAA 4XLVA 3RGFA 3F5PA 5E8YA 4AOTA 4PNIA 2JFLA 5CU3A 3QWUA 4UXQA 2OJIA 4AXCA 4U3YA 3LOKA 4FG8A 5CSPA 2O0UA 2ZJWA 3EQPA 4FG7A 1YHSA 3UP7A 2C6KA 3ZDIA 2EU9A 1SNUA 3WILA 4G9CA 4G9RA 1NA7A 3CP9A 2CGUA 3NR9A 4FSTA 1I1LA 3CJGA 3QYWA 4S31A 4XS2A 4YZNA 2V7AA 1KC7A 4NFNA 4X3JA 3HMOA 3TZ7A 5I0BA 3W1BA 2XA4A 4EK6A 5C1PA 4FTJA 4NH1A 2OK1A 2Q7DA 1H4LA 4S30A 2R4BA 5T68A 3BGQA 3S00A 1J7UA 1YXVA 2C68A 4I6LA 4FV3A 2BKKA 3DTGA 4IQ6A 4QMYA 5BVWA 3V01A 4Y83A 2OLCA 3ATSA 4U6RA 1ZWSA 4PMSA 5T3QA 3V5JA 3UNZA 4JL9A 4UYNA 3SQQA 4JXFA 2JIUA 4FT9A 3TMOA 4RGJA 3OCTA 4ZSGA 5IA3A 5C8MA 4F65A 4Q4CA 2R3IA 5K3WA 2XKDA 4DH1A 3C0HA 1H1PA 3B8RA 4UY9A 3NNVA 3NW7A 4FV4A 4V01A 3P5KA 5ACBC 5BPFA 2YAKA 2GPSA 2VWUA 3GC7A 4WA9A 4AA4A 2JFMA 4AOJA 4Q9ZA 4GJ2A 4O0SA 5JVLA 3KXGA 3C4ZA 3UO6A 3TKHA 3WF8A 3EN6A 3GP0A 3ZEPA 3TTIA 4D5KA 4E93A 3KL8A 5L2SA 3HKOA 4JAJA 3TIYA 1IAJA 2YABA 5M4UA 5HTBA 3HMIA 2GQSA 4QMWA 3GCPA 2B9IA 3R22A 3CD3A 4NKAA 4TXCA 3EIDA 1XMMA 2XNBA 5I9ZA 2OU7A 4R7IA 5DT4A 5CAUA 4DG3E 4PZ6A 3LE6A 3E8DA 3RV4A 4E6QA 3T3VA 4DGNA 2XK3A 5TOZA 3QGWA 3DAJA 2ZM1A 3V4SA 2QOIA 4BR3A 3SD0A 4WRGA 4WBNF 2V58A 5EDQA 3UNJA 1BXRA 5LVNA 3AG9A 3ZSIA 1A3GA 2J0KA 2WPAA 5CE8A 4LI5A 4I6QA 5AMNA 1CE8A 3TIZA 3HLLA 4CMFA 3KKVA 1J3HA 1H26A 2OSCA 3L9PA 4LM5A 1FMOE 3O23A 2J9GA 3TJCA 5IQFA 1CKOA 2GSFA 5DGIA 3OROA 4DRFA 3H0YA 4QMXA 3C0IA 1WVYA 2E2BA 4YO6A 5GHVA 3TNQB 1L8TA 3PG1A 4EK5A 3WNZA 2UZVA 3VNNA 4YB8B 3CTHA 3NYVA 2UV2A 3Q9XA 5CF5A 3QQGA 4KWPA 4PDOA 2CNQA 3ETAA 3CJFA 2E9PA 5JK3A 3QAME 4IW0A 2R3KA 3IW7A 3PUPA 4FKJA 1ET0A 3VOTA 1PMEA 2HZ0A 3F66A 3OW4A 4EOJA 1NVRA 4O0RA 2E9UA 2UW5A 2UZNA 4L01A 2QOCA 5HD7A 2YDKA 5IUIA 3UJGA 5C4LA 3RNIA 5J95A 4I5PA 4BCGA 2ZV2A 3NUUA 4C3PA 2JGZA 4N4SA 3SGCA 4Q5EA 4M67A 5AP2A 1GZKA 3QZFA 4FK6A 4GFOA 3UMWA 4F08A 4TM5A 4P4CA 3R7EA 5JGDA 3IG7A 3DQWA 5KMNA 3HA8A 4I50F 4BCNA 2BRMA 2XUUA 3FMJA 2YZLA 4USFA 2BZHB 3MB7A 1CKIA 4KRCA 2VPQA 4V0GA 4EH8A 4U8ZA 4YUQA 4HYIA 4CLIA 1ZAOA 4G6OA 3VRYA 5CAOA 2QOFA 2BALA 5A9UA 3UDTA 5LARA 2IVTA 2W9ZB 4GFGA 4E73A 1EUCB 3MWDA 5EI8A 1QPEA 4WG5A 1Z2OX 4FEUA 3LM0A 3AT3A 4EZ5A 3FKOA 1VR2A 2W4JA 4MA0A 1UKHA 1GZ8A 3N9XA 4AA5A 4DLKA 4YJRA 3PLAE 3VHEA 3P1AA 2VWVA 3FI3A 3RUPA 4O91A 3UMXA 3H0ZA 3QXOA 3KGAA 3HNGA 3QZHA 5G1XA 2FUMA 4UWBA 4PY1A 3TKUA 3ZONA 4TVIA 2B4SB 4PF4A 3LAUA 4XV3A 2WTKC 3KCFA 3QRIA 4PRJA 4YBJA 4FV2A 5K3YA 3MY5A 3WI6A 5EHOA 4AA0A 5HX6A 4O38A 3UNKA 2Y4PA 2FO0A 2OZAB 2Y8OA 2R0UA 4FT7A 4YJQA 5EH0A 2Q2UA 2C5NA 1GIHA 5EQEA 4DFXE 4AZEA 5KMMA 2C6IA 3VQUA 3PJ2A 2LAVA 1JPAA 3UPXA 2X8IA 4QMSA 1KUTA 4JRNA 4RJ4A 5CR5A 3UTOA 3F7WA 2Z02A 3GCSA 4MBLA 5IPJA 3MWUA 4X6QC 2P0CA 5HBHA 1ZLTA 2V7OA 1Z2PX 1ZYLA 1SYKA 2GMXA 3Q4UA 4ZP5A 1A9XA 4KKEA 2UZEA 1ZMWA 1CKNB 3Q1KA 3DK6A 2E9NA 4UV0A 2IW9A 4HOKA 2YM7A 3MH2A 1E1XA 3RPSA 4IHJF 5BMMA 1J7IA 5E90A 2UW8A 3GC0A 4ZTQA 2GFSA 3VS2A 4BCIA 5B2KA 3ZLXA 3K54A 4DFYA 2DWBA 4FMQA 2ITYA 5HX8A 4IX4A 3GCUA 1SVEA 4YHJA 4Y5HA 5EW9A 4GK2A 2Y9QA 3SOCA 1PK8A 2YRXA 4RVMA 1ATPE 1M2PA 4GUEA 4HGSA 4E4MA 2WMXA 4GVAA 4FGBA 4RLKA 5H3QA 3KXNA 4QMTA 3FMNA 4K6NA 1WBVA 4WHZA 2P2IA 1A06A 2F49A 1P4FA 3CTQA 3IO7A 4FG9A 4H36A 1FVTA 4GV1A 4QP8A 4BDEA 4FTRA 4ZY6A 3DNEA 3ANRA 4KIOA 2ZYBA 4ITJA 5E8VA 2X6DA 1GZNA 5IA2A 4LGGA 4LMUA 3DKFA 1DI8A 2PZIA 4FICA 3QQUA 4UEUA 5M4CA 3L8SA 4M8TA 2WTVA 1K3AA 3ZU7A 2XK7A 2J5EA 2WQMA 4H39A 4WBBB 3OOGA 4FKPA 3VWAA 2R7KA 4L67A 4NIFB 3DBEA 2OZOA 3G33A 4QPAA 4MEDA 4RWKA 4XG3A 5LVPA 2FSMX 4IE9A 3P78A 5FBOA 4A4XA 4BCKA 5H2UA 5FPRA 4OLIA 4F64A 1MRYA 1WAKA 1XBBA 3DXPA 3PJ8A 4EHVA 4HR7A 4Y8VB 2HG8A 4U3ZA 3AC5A 3DGKA 3LFNA 4E5BA 3MWEA 4AZVA 2X9FA 3OUNB 4G1WA 4O81A 3RNYA 5FXSA 3R04A 4E8AA 3HV3A 2VTIA 3GC8A 5CAQA 3MN3A 2W70A 4XX9A 5DNRA 1H1RA 3L8XA 2YN8A 3AKLA 3OHTA 4CKRA 4ZY4A 3ZBFA 3GLKA 4UZHA 3KN5A 3PXFA 3PA3A 3I6UA 3R6XA 3QQLA 4AN9A 4IVDA 4JX3A 1OBDA 1Z2NX 2V5QA 5IQBA 3V6SA 2PVFA 2QD9A 1VJYA 4MNFA 4O2ZA 3CIKA 5CANA 5J5SA 4BN1A 2XCLA 5DMXA 2WU6A 1JKTA 2CN5A 1EKFA 5HICA 3F3UA 3C51A 4KRDA 4BGGA 2EVAA 4FIEA 4FKRA 3W0OA 3EOCA 4L9IA 2JDOA 4OTFA 3D5VA 4UCOA 5KKRB 4RJ6A 1Q99A 3DJ7A 5C9CA 1AUXA 1B6CB 3AOXA 3BGZA 4B0GA 3KY2A 4BGQA 3F3TA 3V5TA 1GAGA 3K3IA 5A6NA 3SAYA 3E3BX 4IVAA 1XKKA 3R28A 4LGHA 4UYAA 4D1ZA 1KJ8A 3I60A 3LKMA 2ITXA 3NCGA 1ST4A 3OS3A 4IBMA 3E92A 5E8UA 3W8LA 4CFFA 3EKNA 4K33A 1VYWA 4E1ZA 3V8SA 4C4EA 2ETKA 2YZNA 2ITZA 4FSZA 5E7RA 3W32A 3JYAA 4OT5A 4I0RA 4L46A 5IH6A 5BMVF 5CQWA 2ETRA 2OJJA 5HNEA 4O7YA 5BVDA 2R84A 4JJRA 4ONAA 4XBRA 5D10A 2Q2TA 2HIXA 2C5YA 5CLPA 4YJOA 4EOLA 2VAGA 4BCPA 5KBRA 3C4EA 3GB2A 2XS0A 4M0JA 3ENMA 2QONA 1G2WA 4BBMA 2W71A 2CKPA 5JFWA 2BIKB 1XH9A 3TCPA 1O9UA 1O6YA 4S2ZA 5IQIA 5JQ8A 2CCHA 2WMRA 3GVUA 4JOAA 4EFBA 3ODZX 5DG5A 3EJ1A 2NP8A 3M2WA 4EQCA 2H9VA 2YS6A 1M2RA 1EHIA 4IAFA 4LG4A 1PXLA 3MPMA 3JRXA 1GNGA 3ZLSA 4ALWA 3S3IA 3QX2A 2QB5A 3AKJA 2O3PA 1P8LA 3BBWA 5IA5A 3FAAA 4HZSA 4CG8A 2BZIB 2W5AA 3MVJA 5D8DA 4FC0A 2QVSE 4XG7A 4MBIA 4MAOA 3ATTA 3IGGA 3NDMA 4DHIB 3VUKA 5IUHA 1H1SA 3DLSA 3NIEA 1OIRA 2W1DA 4A9YA 5A4QA 5L2IA 2I0YA 4YAJB 3ODYX 2IZUA 2GNGA 3KB7A 3WWIA 4R5YA 4BDAA 4FEVA 5HI2A 3L1SA 3RPRA 2VQDA 4JIAA 4RJ7A 2OKRA 2W6NA 4YHTA 4AXAA 1MUOA 3OT3A 3PVUA 4MK0A 4QYFA 1Y8YA 4XP2A 3ALOA 4G2FA 2W9FB 3CQWA 2VRXA 4V04A 4RZWA 2HY81 3K5VA 4LMNA 4CTBA 5IQDA 2XNNA 4HYUA 3TUCA 3W2PA 3GT8A 2JITA 4L7SA 4RCNA 2W96B 4NW6A 2ERZE 4Z16A 3ANQA 5ANGA 4UX9A 4FFLA 4TKSA 3LLAA 1LEWA 5KCVA 5FEDA 1DM2A 5CXZA 3EN5A 3HDNA 3QF9A 4DTKA 3BHYA 4D1XA 2PVRA 3AXWA 3IPHA 1ST0A 3ACJA 5A4TA 2WHBA 3LJ1A 3RK7A 3MTLA 4LUEA 3PJCA 4O0XA 4TNDA 3WYYA 3VBTA 2UUEA 3AC3A 3QUEA 4F0FA 3OZ6A 4J53A 4KBKA 4X3FB 2WMTA 2ITNA 4XHKB 3QLGA 3K5HA 5ETIA 2YIYA 3ZCLA 3RWQA 4GLWA 4JI9A 4RT7A 3T9IA 1KJJA 1CSNA 5IG1A 3BE9A 4RVKA 3FE3A 2HZ4A 4C2VA 2W6MA 4U0IA 1OM1A 4IB3A 3N8DA 4ZSLA 4YTIA 3OG7A 4U79A 2YCQA 3PRIA 5F1ZA 1Z9XA 2B7AA 3DJ6A 5L6OA 2CGVA 4OR5A 4BICA 4YJ3F 4AFEA 4F6UA 4I4FA 3COKA 2R7IA 2XAOA 3L8VA 4AGUA 4BJJB 3FLWA 2PHKA 4IHPA 3OEFX 4DYMA 2DS1A 4DCAA 1X8BA 3U4UA 1VBGA 3ENHA 4IFCA 4EWHA 3TY9A 1XH4A 4IX6A 4J71A 3R5XA 3NVMB 4QSHA 4ACDA 3OY3A 5IA0A 4GIIA 5GIOE 4I21A 4XG2A 4TYGA 4NZOA 4V0GB 4AGDA 4JIKA 3FPQA 4GYIA 3O0GA 4ZK5A 4TWOA 2JIIA 2C4GA 2OO8X 4FNZA 3N6RA 3QCSA 3TXOA 4NZMA 2CZGA 4TNBA 5AV1A 2PULA 1XO2B 3TY5A 4XV9A 5FBNC 4EH7A 4K2RA 2VWXA 2FSTX 3WE8A 4A06A 4CFVA 5I9YA 1GGOA 2VN9A 1KV1A 1Q8WA 2B55A 4DH3A 5KX5F 1UNLA 2PY3A 5DI1A 3ZEWA 3SKCA 2VTOA 3W10A 3NYNA 4MV1A 4J96A 4TWNA 4ASEA 1I2KA 1PX2A 2JKKA 4YJTA 1PYXA 3FLQA 3MGYA 4EK3A 3PDTA 3UDSA 2YAAA 4F1TA 4X3FC 5AEPA 4FEWA 4O0TA 4ZEGA 2VNWA 4MV3A 1OUKA 4AU8A 3TT0A 4CMDA 4BGHA 4KKHA 5AV2A 5AWMA 1IRKA 3G2FA 5CENA 5HD4A 3LM5A 4GU6A 2UVZA 4FZ7A 1FVVA 4FV5A 1H07A 3KK8A 5ETFA 4EZ3A 4F9CA 2GU8A 5FP5A 4XBUA 4CD0A 3OTVA 3GCVA 4FT0A 5AP6A 5I9VA 4N6ZA 2XJ0A 4PX6A 4ARKA 1Q4LA 3VW6A 4ZAUA 3FI2A 3FKLA 4BY9E 3QCXA 3BLAA 1VLRA 3R9OA 5BNJA 1U54B 3QQHA 2YACA 4PDSA 3VJNA 4Z55A 1ZMUA 5E1EA 5KZ0A 5FM2A 4FTUA 1W84A 4RA5A 1SNXA 4AWIA 3Q52A 3PLSA 2RFNA 3R2YA 4EOKA 3V4ZA 5I5XA 1Q61A 5DR2A 4XRLA 5M51A 4Z7GA 4DN5A 4YJVA 4I6HA 2OJFE 1YDTE 5TKDA 3JSLA 3DFCB 1TVOA 2QODA 4MVFA 4RIYA 4DEGA 1J7LA 3B2WA 4EK4A 4OBQA 3QWJA 2J51A 2FVDA 5CSVA 3NBZB 4J95A 4IWYA 1OKYA 1OL1A 4QTBA 1Q41A 2FGIA 2HENA 1ZOGA 4FVPA 3WF7A 2YJSA 4DEEA 2ITUA 3IW4A 4E5AX 2VWBA 2YW2A 4TYEA 1H27A 3NC0B 2YYAA 3QKLA 5M57A 4H58A 4NCTA 4MF1A 3RAIA 3KMUA 3T99A 1WVXA 4IIRA 4RMZA 5TF9A 5AP4A 4FA2A 3KMMA 4NWMA 2HHFA 2J0LA 4M0YA 4U9AA 3R7UA 3DT1A 3WBLA 3F88A 5BYLA 4IWDA 4ALUA 3QLFA 5AV3A 4QQTA 2IVUA 1H01A 3E3PA 5IISA 3G90X 4EH6A 2WU7A 3NLBA 4P2KA 3EQCA 4XNEA 4O7SA 4M69B 3TACA 4AW5A 3M42A 2ZV8A 3N4VA 5AX9A 3MI9A 1YOJA 2IO6A 2R86A 3TTJA 4IZAA 4ANMA 4RJ8A 4B7TA 2PL0A 1VKZA 2VTAA 5D9HA 4M14A 2W1GA 3PXZA 3DBDA 4RIXB 4BDBA 4A9RA 5DRDA 5HG5A 1JLUE 3W0MA 1TAEA 2VTHA 4P7EA 3ZSGA 1Y57A 2R3FA 4KSQA 5FP6A 3SE7A 2G2HA 2X7FA 2GNFA 5AAGA 3V8WA 5HE3A 1OECA 4I22A 4C4HA 2UZBA 4XLIA 3W5OA 2X2MA 3GQIA 1OBGA 1OPKA 3EKKA 3MJ2A 3R00A 1G5SA 4JDIA 4XP0A 3LVPA 2VU3A 3RK9A 2R82A 3O7LD 3JSNA 2VTQA 4OBPA 3UOLA 3PY0A 5C1QB 3T54A 1PKDA 3SW7A 5M55A 4BDJA 3KULA 4J98A 3FXWA 4RQVA 5CNOA 1H00A 2XRUA 5HNGA 1E4EB 2NRYA 1UU8A 3K5UA 4QMMA 5IA1A 1PXPA 2GTNA 2WMBA 3WF9A 2VTMA 2XEYA 4MWIA 1VYZA 2WO6A 4DAWA 2I0HA 4UFZA 3F2RA 3MFRA 1P5EA 5CEIA 4APPA 3SOAA 4PMMA 3OT8A 2O63A 4MXAA 4NU1A 3RAKA 4IZYA 3ZYAA 1CQJB 4F9YA 2EJ0A 3DZOA 2FH9A 4MV4A 3P7CA 3PIXA 2X5RA 1AD5A 3E8EA 4QP1A 2NUAB 4DG0E 4OTRA 4XOZA 2Z04A 4FL2A 3FBVA 4WNOA 3ETJA 1OKZA 4FOBA 5JFVA 2ZB0A 3BA8A 4H3QA 3NX8A 4L7FA 1IG1A 2GTMA 2JDSA 2Y0AA 5FGKA 2HVSA 4EHEA 3U9TA 2QLUA 4I0TA 1OIYA 1OI9A 2X0SA 1W8CA 5K4JA 3OUZA 2VWIA 2B9HA 3EH9A 5AUWA 2OIQA 3CEBA 4TV8F 4BRXA 4OBOA 2H96A 4U45A 4AQKA 5AM6A 2HWOA 4O7VA 1UWHA 5JT2A 3AX6A 4WOVA 3UIMA 3QD0A 4O83A 4E6NA 4HPTE 4PTEA 2R3HA 3NUXA 2WTIA 4C5BA 4F1MA 2H6DA 1M7QA 3H10A 1JKKA 2GNHA 4O7LA 2QURA 2RG5A 5IEYA 2UW4A 3UC4A 1PMVA 5JH6A 4YO4A 4FVRA 1TKIA 2WGJA 3NW6A 3W2QA 4CKJA 3FC1X 5HBJA 1KJ9A 5I5VA 2JDVA 4XP3A 4I4EA 2YCRA 4M13A 3P7AA 3MESA 3TW6A 4J99A 4JR3A 2R87A 3KEXA 5JN2A 4JBVA 4XG6A 3NMUF 3RWPA 2QOLA 4DFLA 4O96A 5FEEA 1CM8A 5DYJA 4EGQA 5IH4A 4ITIA 5DEYA 2GNJA 3FDNA 3T9FA 3FC2A 4PWNA 4GKHA 3WIGA 4EI4A 3EZVA 5EI6A 1H1QA 4UWCA 2ITWA 5LWNA 1PHKA 3SRVA 2XAMA 3ZRKA 4K77A 3TV6A 3O96A 5KHXA 4PL5A 5LQFA 2F4JA 2UZWE 2ZB1A 4LV5A 3HB9A 5EZYF 3DDPA 2W1EA 3U55A 2JEDA 2W5BA 3RKBA 2O2UA 4AP7A 3FSKA 1G8AA 3T9DA 4CCBA 2X2KA 2R3QA 2WEIA 1VEBA 4FSQA 4G16A 5BWUA 1GIJA 5D7VA 3QALE 5HCYA 4HVGA 4ZI7F 1JKJB 4IAIA 5DFPA 3C13A 5DN3A 2BZJA 1L3RE 3FL4A 3POOA 3UFXB 4CKEA 4ACHA 3VUHA 4F7SA 4FV0A 4WNPA 4YR8A 3LFSA 4X2GA 2X7OA 3IS5A 2YL2A 2OFVA 4C02A 1OIQA 2GPHA 4RX5A 3ELJA 1CMKE 2ITPA 1KBLA 1U5RA 3QL8A 4LV7A 1ZARA 3PJ3A 4TYHA 3EQDA 5DOSA 2COJA 2ZDUA 3TV4A 4IZ5A 2EUFB 4JDHA 1H1WA 3R21A 4N70A 4PQNA 4N6YA 1WBOA 1XBAA 4RIYB 5DLSA 2YZMA 3RPYA 4RWJA 2G2IA 3DB8A 4DLIA 2WELA 3VPCA 3A62A 2OICA 4BBEA 4CMOA 2EIYA 2OJ9A 4YU2A 2OJGA 3AT4A 3VS1A 4AXFA 3F69A 2P4IA 2XK4A 4QP4A 5E4HA 4I5HA 3R71A 3NBYB 2FA2A 4AG8A 3A60A 2A4LA 3WARA 4ENXA 4G34A 1IOWA 1F3MC 3D94A 4BCQA 3H4JA 1PXNA 5IYZF 4AOIA 4E26A 4WRSA 2PVHA 1GSAA 3QZIA 1M7NA 5GJFA 2REIA 4OTWA 5HG7A 4FUYA 5HE1A 3W2SA 4CKIA 5CEPA 2XK8A 5TO8A 4FU0A 3T9BA 2W4KA 4AZTA 3QRKA 3ORQA 2J50A 4I4TF 4WUAA 3SGIA 5BPHA 5KKNB 1J91A 5CVFA 4EG0A 5EM7A 2O65A 1KOBA 2G01A 3LFAA 4PV0A 5ANJA 4CCUA 2XM9A 1FPUA 3F2AA 4C2WA 4QPSA 4IIJF 2HJWA 2XP2A 2OH0E 3FL5A 3OCGA 4U5JA 3PWDA 4I23A 5M06A 5LOVF 4ZS4A 1S9IA 4FSRA 2X8EA 1G3NA 3UP2A 3ITZA 3FI8A 3BL7A 4EFEA 2VO7A 4ANBA 1I44A 2I7QA 3KF4A 3O5AA 3E8CA 2BRNA 5IH5A 4ZJJA 3ROYA 4BDKA 2HIWA 2WAJA 1CKJA 4QP7A 5A3XA 3O8PA 4QTDA 3A2CA 3PG3A 2QK4A 2HW7A 3NNXA 3DOGA 2WQBA 4J1RA 4FTMA 4ZTMA 3BPRA 5C8NA 4Z7HA 3I6WA 2R3MA 3KRXA 4RZVA 3GEQA 2ZM3A 5L6PA 1U54A 3VO3A 4YPDA 3FMDA 4MXCA 2C3LA 2BHEA 2VWYA 3A7JA 4O82A 5IQCA 5FDXA 4CG9A 5L8KA 3ZUTA 4DTAA 2R3RA 4C33A 4QYYA 2YCFA 3ORIA 5DGHA 4O0VA 2HDKA 4G17A 2W6QA 3UG1A 3UDZA 1XJDA 2EB3A 2PE2A 4IH8A 3NFFB 3UYSA 1OKVA 4D4RA 3U6IA 4G5JA 4QTAA 1YHVA 2BROA 4FKSA 4LOPA 3R7IA 5A4LA 2ZGIA 4YNEA 5LMKC 3CLYA 4LRMA 3VS5A 2HZIA 4NSTA 4RQKA 2HGXA 4D0WA 4EEVA 4O86A 2XNMA 3FZOA 4FV9A 4DQNA 3OWLA 4W4YA 4Q2AA 4GL9A 4YZCA 3I1AA 1S68A 4O7RA 4MHAA 2R2PA 4UWYA 4QMUA 4RFMA 5CY3A 4ANSA 3RV3A 3CQEA 2IPXA 3KVWA 3JRWA 2GNIA 5CI6A 5BUEA 2HWPA 3QC4A 2DZDA 2YM3A 3AC4A 1KEEA 2R0IA 1EKVA 4UZDA 4JG8A 4C59A 4EKKA 2ITOA 4NJDA 3NS9A 3A8WA 1PRYA 3BZ3A 3VW8A