4O81A

Saicar synthetase (type-1) in complex with adp and amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAICAR synthetase (Type-1) in complex with ADP AND AMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 73
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o81A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o81A02
4ZTSA 2ZM4A 3PVUA 4BDGA 2GFSA 3MW1A 4TYIA 3QRTA 3UIUA 2PMIA 3PSDA 3A61A 1KJIA 2R3MA 5HBRB 3PWDA 4QRCA 4TV8F 1H24A 1TQMA 3DV3A 1CMKE 3UYSA 4DG3E 3DKOA 3VA7A 3GFWA 4QO9A 2EU9A 1UU3A 3EQIA 3GU4A 3OROA 4FG7A 3Q53A 4NM7A 4EL9A 1PYXA 3IPHA 3AMBA 4QYHA 3RPSA 4QT1A 2VTSA 4JDIA 4OT5A 3ULIA 2IN6A 1GIHA 2ETRA 4AN9A 2GPSA 4UYNA 1WMKA 3DAJA 3ETAA 4DH3A 2G15A 2ZDTA 4O0XA 2J9GA 4IZ5A 4WG5A 5BUIA 2J6MA 3PA4A 5IA0A 4JOAA 3D5VA 4G6NA 3EOCA 4I21A 3Q32A 5AV3A 4C2VA 5KKNB 5JQWA 5D7VA 3HEGA 1TVOA 1Q24A 2FYSA 2XNPA 1ZY4A 3RFCA 2YW2A 3FJQE 4M0YA 3D2KA 1KE6A 5FQDC 3OWPA 4M8TA 1JLUE 2XJ1A 3VWAA 4U3ZA 3R8LA 4MV4A 4FTJA 5D8DA 4PTEA 4O4JF 5CTPA 2NRUA 3P1AA 4YJPA 3BKBA 4F0IA 3VW8A 1H07A 5H8BA 1M17A 2YIYA 4ENXA 4XG4A 4ZSAA 5LXMA 4YAKB 3QU0A 3K2LA 3Q3BA 4FNZA 2VZ6A 5FTQA 4GV1A 2V58A 4IBMA 4ARKA 1ND4A 3QWJA 4XP3A 4RQVA 3N9XA 4M15A 2J7TA 3SXSA 3SX9A 4YLLA 5A4EA 3MGYA 4CFNA 3WO0A 1ULZA 1ATPE 4Q5EA 1YOJA 1OKYA 4HCTA 4Q2AA 4YZDA 5HKMA 2HJWA 2PMOX 5E8WA 3GNIB 1U54A 3QA0A 4W4WA 4IDVA 4JIAA 2VWBA 3ZXZA 5K4JA 2GNLA 2C0IA 1M0WA 2OXXA 3QUDA 4L6QA 3RPRA 4FV7A 5I9XA 5ICPA 3EQGA 4F64A 5ANOA 3NNXA 5M51A 1KE9A 3R0TA 3ROYA 2VPQA 5IQGA 3TZ9A 2GS7A 2PE2A 3HV7A 1YVJA 5ACBC 2C5XA 3C5UA 4PRJA 4ERKA 3OMVA 4JXFA 4F7JA 1ZOHA 4L3LA 5FXQA 1LR4A 3E8NA 4M0ZA 1YRPA 3PRFA 4JNWA 3GC9A 3R73A 3S4QA 5JMSA 5LARA 4FODA 5GHVA 4FFNA 5CAEB 3RPYA 2V7AA 4KBKA 4GRBA 1OIUA 3E63A 5AFVA 2ACXA 3DXNA 4JX7A 2O5KA 3VJNA 2R3GA 3C1XA 3IG7A 3LXPA 3SE7A 3TKHA 1KBLA 3U6JA 2PZYA 2XK9A 2WEVA 1UU7A 2J0IA 4X7QA 2JKQA 4KNBA 4YHJA 3TG1A 4C34A 2F9GA 4DC2A 2UVXA 4AA0A 3VUMA 4AGUA 4AU8A 4RC2A 4FSWA 2VTTA 3FLZA 2C1AA 4MD8E 2XIRA 2A0CX 2X7OA 5GONF 1Y91A 3EFJA 4FVQA 4CMUA 4YZ9A 1REKA 3GC7A 3OG7A 4TTHB 5HVJA 4MEDA 4NL0A 3GFEA 2C6EA 3GU7A 1V0BA 3VHEA 3WIGA 3FLYA 5C01A 5DVRA 2QQ7A 3DFAA 4FEXA 4DT9A 5KMMA 2W06A 2YJSA 2NRYA 4OTRA 1URWA 3N4UA 3F7WA 5DE2A 4ORKA 4YTHA 2XBAA 3KMUA 3L8XA 2J0LA 3EQRA 2JDTA 2NO3A 4U81A 4BIEA 4UX9A 3RHXA 3FMDA 2E9NA 4WSYA 5DI1A 4ZJVA 4O2BF 3BWJA 3VS2A 4MV1A 2XCHA 3G9NA 4HZSA 5CY3A 3CGOA 3EQCA 4GW8A 4F6WA 2W1IA 2PVJA 2R9SA 3K5VA 5FEEA 4ACMA 1OPKA 4JBOA 1EHIA 4FSZA 3KC3A 5CAOA 4TY1A 3PPJA 4O6LA 4R78A 4RX7A 2R86A 3LKMA 1Y6BA 3LFSA 4RMZA 3D9VA 3QHWA 4PDYA 5E90A 1H8FA 2I0VA 1OKVA 2I7QA 4R1YA 4OTIA 3ACKA 5AP0A 4AQCA 2DIKA 5HG7A 3ENHA 3UOHA 3EN6A 3NYOA 2PMLX 2PVYA 4DA5A 2R3JA 3GP0A 4G1WA 1W7HA 4OR5A 4EQCA 4I41A 2WAJA 3CS9A 1WVXA 5ANIA 5EYMA 3RHKA 4I6FA 3SOCA 4RC3A 4E73A 3ZZWA 4ONAA 4U43A 3GOPA 5DR2A 1ZYJA 3F2RA 3KK9A 4XEYA 4V01A 5C8YF 5M08A 3DQWA 4TL0A 3OF0A 3DBQA 4I4FA 4XHKB 4LG4A 2XK3A 4G17A 4Y95A 5EI8A 3RI1A 4CV8A 1YHSA 4D9TA 3HUCA 3BIZA 4DLIA 4I93A 1UWHA 4DEEA 3PIZA 3JVRA 4TV9F 4F9WA 4IH8A 3BQCA 3ALOA 2I1MA 3BU5A 2ZOQA 4BY9E 4BCHA 2OW3A 3UNJA 4F09A 2OJFE 2X9EA 3CTHA 5CX9A 3RMFA 3QQFA 3QHRA 4Z16A 4ZZOA 5M4UA 3JZIA 3NMUF 1IAHA 4MNEB 4DGOA 5AUTA 1C30A 4HW7A 1FVVA 2X81A 4BDKA 1XJDA 1XR1A 4RLKA 2ITQA 4NCTC 2EUFB 4F1OA 3G8CA 2HYYA 4DFZE 3BE2A 5HD7A 3KN5A 5B2LA 4XX9A 4TPTA 1JBPE 3KULA 1FVRA 3I7CA 3OEFX 4I24A 3VBTA 3IW6A 2C3IB 3VVHA 4E5WA 4EJNA 1B39A 4UN0C 5JH6A 4UY9A 2QI8A 3C0GA 4GIHA 4KA3A 4AUAA 3S1HA 3D15A 4G3EA 3PJCA 4O7SA 4U45A 2G01A 4IWOA 2C3LA 4KKGA 5KE0A 3BGPA 3GU8A 4G16A 5HCYA 4ANQA 4F1TA 5C8NA 2O63A 3DJ6A 4JT3A 4YNEA 1IA9A 5E8XA 3V04A 2VWZA 3TIIA 3QBNA 4ZAUA 1PHKA 1H08A 3P79A 4KUJA 3MFTA 3MH3A 2HGSA 4O2AF 4ZHQF 2A4LA 4FG8A 1Q97A 5L6WL 3NUNA 3UC3A 4WNMA 2YHVA 2QG5A 2UV2A 5F20A 4IEBA 3RWQA 1HCLA 3FZRA 4TRLA 3ZMMA 4DINA 5KMIA 4D1XA 2OI4X 3BGZA 4A4OA 3QXOA 4RA5A 3LQ3A 2B9IA 2WTKB 3EFKA 4FKIA 3F5XA 3VJOA 4AACA 2ITXA 3L1SA 5ITAA 3DKCA 4P2KA 4LMNA 2BVAA 3II5A 3WBLA 4YLKA 2OZAA 4D4SA 5JGDA 2FPGB 4IIJF 2CLQA 3TJCA 2R3NA 2BHEA 4IIRA 5DRDA 4EI4A 1ERKA 2IZSA 2PE0A 5EOBA 4WBNF 4PQNA 1G5SA 2OLCA 4D28A 1QCFA 1OITA 4BICA 4PDSA 3L8PA 4E6DA 3FQSA 2XNEA 4L67A 3RK5A 4JQ8A 5CF5A 4RVKA 2PVKA 2YAAA 1IASA 5KMKA 3JRXA 5H2UA 2ITTA 1JPAA 5IQFA 5JFXA 4YZNA 3RNIA 4BTMA 5HD4A 2CNVA 5EYKA 2ITZA 4G2FA 4AW2A 3LFCA 4FL2A 1PXPA 3NGAA 4ZZMA 2ETMA 4ACGA 1PY5A 5CS6A 1Q41A 5C4KA 4DE4A 3KMWA 4KINA 1URCA 3MH1A 3QFVA 4ZLYA 3S2PA 3NVMB 3U55A 1XQZA 2X7GA 3QLFA 3R2YA 4X6RA 3RALA 1W84A 4XG9A 4TT7A 1FPUA 3E7OA 2WQEA 2ITOA 2YM6A 3M2WA 2O0UA 3QCXA 2JC6A 4O7WA 4BI2A 3SG9A 5HQ0A 2VQDA 2VX0A 1SVGA 1SYKA 1FMOE 1YDTE 1YXSA 2XB7A 2ZMDA 3KKVA 4CV9A 4WG3A 2FPIB 2VTQA 4D5KA 4TUYF 5K5NA 2R3RA 3PIYA 3AC3A 1TQIA 4JBVA 3GLKA 3DB6A 4IAIA 2C6LA 4QQTA 1KJQA 1YOLA 5AIRA 4DEGA 5CNOA 4AG8A 4M14A 4EUTA 3IK3A 5EI6A 3ZUUA 4YR8A 3P9JA 4AA4A 3F66A 3KY2A 3MH0A 3NAYA 4K9YA 3OWKA 2O3PA 4RZWA 3NPCA 4NSTA 4QPSA 2CN5A 5CI6A 2W1CA 5AP5A 4O0UA 5H3QA 3BBWA 4KWPA 4MQ1A 4FKQA 3LLAA 4CTCA 3SVVA 3RJCA 2PVPA 3C7QA 4M84A 3U9SA 3GCSA 5AAGA 4AN2A 4D58A 4CCBA 3B8RA 1M7QA 3ZSIA 4BI0A 4YO4A 1KEEA 1YI4A 1W82A 3ANQA 5L8LA 4U79A 3GUBA 4BHZA 2UW4A 2I0EA 4P90A 5CXHA 4FV3A 4MF1A 4GSBA 3BU6A 4FTRA 3CCNA 5LP6F 2OZAB 4FK6A 3FI3A 5D10A 3EQPA 5JK3A 2WTCA 4C0TA 5M44A 4BHNA 3OCSA 3MVHA 4Y85A 1OBDA 3WO1A 3D4QA 2FSTX 1ZRZA 4Z7HA 4BDIA 3DNDA 1STCE 3ORNA 4AFJA 5KBQA 4QMUA 4ME6A 2E2BA 2B9HA 2R3FA 5FD2A 4MXAA 5IZFA 2VTPA 4WA9A 1PXJA 3ORTA 1MRUA 1OB3A 3Q04A 3NR9A 5HCZA 5F95A 3PJ2A 1P2AA 4XMOA 2PL0A 2R4BA 4J53A 3VW6A 1EUDB 5JQ8A 3TV4A 4N6ZA 4QYEA 1KV1A 4RWKA 2WOTA 2BZIB 4JAIA 4L46A 2ZAZA 4QMXA 5LOHA 3PY0A 4IX5A 2PSQA 4FTAA 4S34A 4EBVA 5AEPA 4XUFA 1MRYA 4ASZA 3VIDA 2W4JA 5DN3A 4L53A 3LPBA 4IB0A 4IM3A 5KBRA 2CGVA 3A2CA 1NT2A 2JIUA 2OFVA 4I5HA 4JG6A 4AOIA 4FL3A 5I9YA 4IVAA 3IGOA 2HZ0A 2JDOA 2UUEA 4FT0A 5ANDA 2CCHA 2W1DA 3W2OA 2QU5A 1YI3A 4U41A 2EVAA 3PJ1A 2QD9A 3A7IA 5HE0A 3RKBA 3F88A 5M09A 3JXWA 4MV9A 3O8PA 5BVKA 3PWYA 3LZBA 4CKRA 4OW8A 3BHVA 3FKNA 1NVSA 4RIYA 3TI1A 3PXQA 1T46A 3KB7A 3DLZA 4X3FB 5E8SA 3EN4A 3O23A 2R3QA 4KD1A 5FTGA 2WU7A 4R3CA 4ZJJA 1H0VA 4CXAA 2BKKA 5FEQA 3SLSA 4ZMFA 3UOJA 4K0YA 4AE9A 1JSTA 3DT1A 5A14A 1B6RA 1Z2NX 1G8AA 5B0XA 2X2MA 2HY0A 4TYJA 4TN6A 2E9VA 3CLYA 3HO8A 1BLXA 2UVZA 4IFGA 1CS0A 3HYHA 5CVHA 2VTNA 3LFAA 4MD7E 5ANGA 5BPHA 4GL9A 3C51A 2HZIA 3R5FA 3IKAA 3IW7A 4BTFA 2NPQA 1Z5MA 3TNHA 3ZEPA 3POOA 5AP4A 3KRRA 4CFUA 2WELA 1EZ1A 2W1FA 4JIKA 5HORA 4CQEA 4XG3A 3LHJA 1U46A 3OXZA 5LVMA 2C69A 3FZSA 4G31A 5HESA 2W96B 2R2PA 3KCFA 4GT4A 3R23A 3CQEA 2C0OA 4MXOA 4C35A 3R9RA 3K3IA 5AUUA 4FIHA 3C4EA 4CG9A 5M4CA 3WF7A 3GIDA 2ZM1A 4B8MA 5EM5A 2UW7A 2VAGA 3R2BA 5TOZA 2E9OA 5FDXA 3R30A 3ZM4A 4FMQA 4A7CA 4JQEA 5HG5A 4AZSA 3MA3A 2VTJA 4C61A 4USFA 2V55A 3HP5A 3UMXA 4AT3A 4EZ7A 3QXPA 4JBQA 4UALA 2W4KA 3UZRA 3V3VA 4KAOA 4O7LA 4DEIA 2X8EA 4P5QA 4XCUA 3CXWA 3EL8A 4RA4A 3QZGA 2YIWA 3DPKA 3O7LD 4RJ3A 5C26A 4EOPA 3GI3A 1UU9A 3PXRA 5M56A 4CMTA 2ERKA 1OKZA 4LM5A 4DEAA 5C1PA 3TN8A 3DOGA 2RFEA 4J52A 3C4XA 2P55A 4W8DA 4GU6A 3TT0A 3UODA 3WF5A 5HVYA 4MXXA 1CTPE 3SW4A 4CNHA 4QMYA 3QRIA 2XK6A 5JN2A 4FTUA 2X0SA 4IZ7A 4D2RA 3DBDA 4FKJA 4MXCA 4RWLA 4EOMA 3VS3A 5JVLA 4OT6A 1VJYA 4D55A 1FINA 4FIEA 3LXNA 4DITA 3JY0A 4A07A 3PP0A 2C1BA 2FB8A 4AOTA 2B52A 2H9VA 1SVEA 4J8MA 2XEZA 3UBDA 3QZHA 4DFYA 4CT2A 2HENA 2Q0NA 2WEIA 1KJ9A 4O4LF 1GSHA 3RM7A 4BKJA 1ZYDA 1G3NA 2PY3A 4PTGA 4CTBA 5TR6A 2PTKA 5A3XA 3Q9YA 1J7LA 4FUYA 3AC1A 2HWPA 2XA4A 3TINA 2PVRA 5D1JA 3Q6UA 3AD6A 3G5DA 3LFEA 3SV0A 1C3OA 4XV3A 3AT2A 3I6UA 3E88A 5FUTA 2ZV8A 4UB7A 3NAXA 3QTIA 2VNWA 2AC3A 3DZOA 3QKMA 4FEVA 3AXWA 2CNQA 3Q4CA 3BGQA 3FSKA 4EH4A 4HVGA 5KCVA 3A7HA 3QX2A 3UG1A 5DGZA 4XV9A 4F99A 5KNJA 1OZ1A 3S95A 3U4WA 2QOIA 3V5QA 4I5CA 1CQIB 3BV3A 2C00A 5J2UF 4FV9A 2BILB 2NNWB 3MWEA 2ZYBA 5CU3A 4AAAA 4DYMA 1DV1A 4K77A 3R8VA 3W18A 2W1HA 2X4FA 1U4DA 4QP8A 4F6SA 5D11A 3FL4A 5KKRB 4FTQA 3P7CA 4C4HA 4F6UA 4GJ3A 3HAMA 4FC0A 4IMYA 1SNXA 2R3LA 5JFSA 1WR2A 3T3UA 3W2QA 1JVPP 1KSWA 1AGWA 3QLGA 4AA5A 5FLFA 4H1MA 4O82A 2DQ7X 4X6QC 4O38A 1IA8A 4FTTA 2R85A 2OJIA 3OCGA 3QALE 4X0MA 3WZDA 2LAVA 5KMOA 4XYMB 3G15A 3S00A 2W4OA 2W17A 2CN8A 5FXRA 2UW8A 2CHLA 2ZDQA 1YWVA 4W8EA 5HEZA 4FZAB 5FTOA 4IZOA 3AOXA 4YZBA 3NS9A 4RWIA 1LEZA 2B7AA 2XUUA 3AD5A 4WIHA 4S33A 4QMMA 4U9AA 2RG5A 3BHUA 5FRIA 4BBMA 4QYYA 3A7JA 3W8LA 5BVNA 4CKJA 1JDBB 1UNGA 2YS7A 1IG1A 2PVNA 3E7VA 3FLNC 4XJ0A 3WZJA 5L6OA 2YYAA 3VN9A 5EDQA 5I5ZA 2H8HA 4TYHB 1A06A 2FB9A 3Q4UA 4ZLZA 3H4JA 5HNGA 2XYUA 4CFFA 1AQ1A 5JZNA 2B54A 3PZHA 5D7AA 3KU2A 4TW9A 3SHEA 4LUDA 2WD1A 4J97A 4F4PA 2X2KA 3A7FA 3ID6C 2VGPA 5DYJA 4QMSA 4I6BA 2Y6MA 5FGKA 4NM5A 2YL2A 1J1CA 3HP2A 4I23A 4DF3A 4FKRA 3MBLA 4K18A 4YTFA 5AAEA 5DRBA 2YCRA 4MYGA 5JVDF 4ZTQA 4C3FA 3O50A 4WBBB 4I20A 4GMYA 3UNKA 3KMMA 4QP1A 2WMRA 2C47A 3LOKA 3DGKA 4XG2A 4ALWA 2C30A 2XIKA 3UNZA 2JDVA 2PULA 4BDHA 4IFCA 4HGLA 5IA3A 4Y72A 3E87A 4CFVA 4E6AA 2NU9B 5AM6A 3VO3A 2CMWA 2HW6A 2JBPA 3ZTXA 4XNEA 4EOIA 4QSHA 1K3AA 4IE9A 4ITHA 4RG0A 4MA0A 3LAUA 1H25A 5F1ZA 3IGGA 3NYVA 4LQMA 1J91A 2XZSA 3ITZA 5C4LA 3CBLA 3VUIA 1H1PA 3O96A 1UKIA 4YURA 3L9MA 3IECA 4P7EA 4QTEA 5IYZF 3ORLA 1F3MC 3CE3A 5LCKA 1OM1A 4M13A 3ZO1A 3VPCA 2OH0E 3I81A 4H39A 5GJDA 2OH4A 2EXCX 2W9FB 2YIXA 4C36A 3V4SA 5BMSA 4DLKA 3OWJA 4ENYA 5DR9A 3TCPA 1XH4A 1Z9XA 4GVAA 5JH7F 4E4MA 2OBJA 4U42A 2FUMA 2QOLA 3QTRA 3AT3A 4BDJA 4UZHA 1MQBA 3FYKX 3VBXA 1Q8WA 2PE1A 2R7IA 3UE4A 2GNJA 3FMHA 3R7EA 4EK3A 2WTVA 2REIA 2OU7A 4EH8A 3KRWA 3O2MA 3QD0A 2GNIA 4D0WA 2OGVA 5CEOA 2IW6A 4FZ6A 5J7HA 3VUGA 2BDWA 1H01A 4ANLA 1PXMA 3G2FA 5BVOA 4B9DA 4OTFA 4F0FA 2VD5A 4IANA 5IA1A 2W1ZA 3LMIA 1P4FA 1W83A 3Q6WA 3NRMA 3OXIA 4F7LA 1OL7A 5CASA 4RX8A 2J90A 5AUYA 3QRUA 3Q60A 5AUXA 1IOVA 2GPWA 4EH9A 4L00A 4XG6A 4QP2A 3PLAE 3P78A 1Z57A 3HL7A 1I09A 1UVRA 1ZZLA 2ZVAA 1IRKA 3CKXA 3BHHA 4B99A 4I55F 4I4EA 2OLSA 3T3VA 4ZEGA 2B55A 2GQRA 3KALA 2QOOA 2OJJA 2CGXA 3MS9A 3OTVA 3E92A 3TZ8A 2R7BA 2JKKA 5LVOA 2VR1A 5JGAA 5CA1F 4FR4A 3O17A 1R39A 5BVDA 2B1PA 5ETAA 2X9FA 3ZRLA 1PMNA 5CSWA 4HCVA 2X8IA 3HV5A 3ATSA 5CVFA 4F7SA 3QAME 4IWQA 4YGAA 2YRXA 2WMUA 4MKCA 3I0QA 3ULZA 3FZTA 4CRLA 2GNHA 1PW2A 5IUGA 2YN8A 1PX2A 3IQ7A 5EK7A 4KABA 5LMAA 2PMNX 1E4EB 4N6YA 3MTLA 4NYEA 4CZUA 3OUZA 3E3BX 4XG7A 3V8WA 3WYXA 3MWDA 3HB9A 3ET7A 4LI5A 3D5WA 4FKUA 1EH4A 5HI2A 3SW7A 3FL5A 5LVNA 4DEDA 1WAKA 5AMNA 2GNFA 2W1EA 3DDPA 4YPDA 5EYDA 4ZSGA 3JZFA 2FP4B 4FICA 5AWMA 4ZS0A 1Z2PX 3FMKA 1APME 3ORMA 4LV8A 4BGGA 2PVLA 3VMMA 5EFQA 3P08A 1ZMUA 3GCPA 4BDAA 4AFEA 3NYXA 4Y8VB 3V01A 3NEWA 2R7LA 4CLJA 1YW2A 5HLPA 3QC9A 1NW1A 3NUUA 5E8ZA 1M0TA 2PZPA 1PRYA 3P4KA 5AM7A 4K6ZA 2PBZA 3GU6A 3G9LX 4IAZA 4UBAA 4ASDA 4IAYA 5K9IA 3R00A 1BUHA 2YIQA 4HJOA 4NWMA 3NUYA 3O8TA 4GIIA 4RFMA 4E20A 5CAVA 3KAJA 5EI2A 5CU6A 2QKWB 2C5YA 3FMNA 1DM2A 4FTMA 4Y83A 2VO3A 2WMQA 2W5HA 2JKMA 4FIJA 2AC5A 4B4LA 2J0KA 4RFZA 4IC7A 3PDTA 5L2SA 2YDJA 2WMTA 1HOWA 5FP6A 3NSZA 3ZZEA 2QO9A 5CXZA 2Y7JA 4CVAA 1XH9A 3JVSA 4MQ2A 3OD6X 3TZMA 3UOLA 2JDSA 4WRSA 4USEA 3OT8A 5CEPA 3OFMA 2C6KA 4HZRA 4QP9A 3KVWA 5IMXA 2I0YA 3Q5ZA 1VKZA 3LMHA 5GJGA 4FSMA 3TNWA 3LCDA 3IDPA 4IHPA 3R8ZA 4RIXA 2VV9A 2WB8A 3GC8A 5IQAA 4FYOA 2C6OA 4KRDA 2YAKA 4FNYA 3R7YA 3KRJA 2VWWA 4QTBA 4ACHA 4PP7A 5CWZA 4AP7A 1ZXEA 3OY3A 5CAQA 3ZBFA 5KZ0A 4RLLA 4ANSA 1O6LA 3KVXA 3V51A 2VWXA 3FMLA 5HG9A 2UZUE 4BYJA 1DS5A 4XV1A 2E9PA 5CU4A 2DWBA 4PL4A 4ZOGA 4IWPA 2UW3A 4QMZA 3AC4A 3WE4A 1OUKA 2V59A 2JITA 2WHBA 4QQCA 3OBGA 1RE8A 1YOMA 5LA6F 5HTCA 4FFOA 3Q2JA 3QQHA 1LP4A 1WBPA 2R3HA 2X2LA 4C5BA 4ZTLA 4LOQA 3V5LA 5M06A 1E4EA 3GC0A 4F7NA 3C13A 3U9CA 4NH1A 3O7LB 5A4CA 2XNOA 3UG2A 5EW9A 1I44A 4MTAA 4YTCA 1IOWA 3EYGA 4GUBA 4WNPA 3TACA 3QWKA 5A46A 3KXMA 3RAIA 5EZYF 2PVMA 2PZIA 3FAAA 4KBCA 5CQWA 1IR3A 4BDBA 1QPDA 2BRHA 3OWLA 4M67A 2W6NA 3KQ7A 4IM2A 5I0BA 3HDMA 3ORPA 4EHEA 1T45A 3GQIA 4ZY4A 4MV8A 2HELA 4JR7A 2VWUA 4FSQA 5KHXA 5AADA 3GCQA 3HBLA 3DAEA 4AS0A 3CTJA 4FT5A 4J98A 3HUBA 4UWBA 2WXVA 2HXQA 3C4CA 3O0GA 2XM9A 5ANEA 3SGCA 4L7SA 2WQOA 1H27A 3KL8A 1OECA 5GIPE 4N70A 2ONLA 2Y9QA 4S31A 2C68A 4UEUA 3JPVA 2JBOA 3UPXA 2BRMA 3C9WA 4A9RA 4H36A 4FGBA 3B8QA 4E4LA 3FHIA 3QTXA 1GZOA 2CDZA 4N57A 4BGQA 5A4QA 3VS0A 3MJFA 3EL7A 4YJ3F 4I6HA 1JAMA 4EJ7A 2PUIA 3NCZA 4J95A 3WZUA 3KFAA 5C03A 1M2RA 5AV1A 5HX6A 4C59A 1SZMA 4C5AA 3BEGA 4AZWA 3M11A 2JKOA 3DJ5A 1ZMWA 3KCKA 4YTIA 3UDBA 4EOJA 4XYFA 3BELA 4EZ3A 4O0SA 4TNDA 2C3KA 3FV8A 3ACJA 4YHTA 2V0DA 3PG1A 4FSUA 2W0JA 3AC5A 2C6IA 1KWPA 1PMEA 3UVPA 3MIYA 4FIGA 4E26A 5HZNA 3PPZA 1ZWSA 4XV2A 2XMYA 2YM8A 3I0OA 4CFXA 4X3FC 2V62A 3I7BA 3NVKI 3OY1A 5HICA 5EKNA 5LVPA 2XCLA 5CLPA 4I50F 2UZVA 4I4TF 3FHRA 4IVBA 4BDEA 5F94A 3FXZA 1RJBA 3U4UA 5J87A 3OVVA 4TYEA 4EK6A 5IA2A 4GYGA 4XBRA 4Y5HA 2QCSA 5HBJA 4U97A 5E8TA 3QGWA 5EW3A 5BVEA 3TIYA 4HPTE 3PVWA 4JDJA 3ZU7A 4E7WA 4EOOA 3ERKA 1R78A 3ZLSA 2XK4A 1H1SA 1DV2A 4QMTA 3I5ZA 5AAFA 4ZS4A 3FUPA 2V22A 3AQVA 3TW6A 2YM4A 3ZO3A 1XH8A 2WZJA 3HECA 4E4XA 3EKKA 3WIKA 4QTCA 4DTKA 1L3RE 2UZOA 3UPZA 1AUXA 2C3JA 4TWPA 4EYMA 1WBWA 3VHKA 4F70A 2OF4A 3VF9A 2WTWA 3CEKA 3I4BA 4ZXTA 2ITWA 4GKIA 4QMLA 4FU0A 3TV6A 3KXNA 1P4OA 3NUSA 1J3HA 4QNAA 2XKCA 3UIXA 5I4NA 3BHTA 4LUEA 4PMPA 5BUJA 4UWCA 3G6HA 4IACA 1LEWA 2RFSA 4GK2A 4RJ5A 5BVWA 4IAAA 3PFQA 3COIA 3ZFYA 4L68A 3ATTA 5CF8A 5BYYA 4ZSLA 4G9RA 3W16A 3PTGA 3VRYA 3W2SA 1H28A 1YHVA 4R77A 5CEQA 4C4EA 4D5HA 5JFVA 3FI8A 3BHYA 3A4OX 5EDPA 3F9NA 2C6TA 1KE5A 5L6PA 5CEIA 5CNNA 5JFWA 2F7ZE 4DLJA 3DXQA 2BMCA 2HIWA 4NCTA 3TKIA 3P23A 3TEIA 3WARA 4PDOA 5DT3A 3PSCA 4HR7A 3COHA 5LWNA 3EN7A 2OIQA 3PZEA 4BCOA 3CJGA 4MBLA 4RFYA 1YWNA 1GNGA 2UZLA 2OWBA 3AGLA 1YDSE 1HCKA 1B38A 2WOUA 4JRVA 2Z02A 1M14A 3NNVA 2ITNA 4FFRA 3E8DA 4L3JA 3LLTA 4JQ7A 1SMHA 2IVVA 3PYYA 3NIZA 1SCUB 4U0IA 3QUPA 4G5PA 5HG8A 3SRVB 2VO7A 2FH9A 4G6OA 3WE8A 4RJ7A 3OW4A 3PRIA 2X1NA 5JRSA 2IVSA 3WF6A 4BF2A 3LQ8A 2XRWA 3SXFA 3LM5A 3MFSA 2VTMA 4DGGA 3S0OA 3LVPA 1Z2OX 4WKQA 3ODZX 1W98A 5A4TA 3DK3A 3N8DA 4FFLA 1BKXA 2UZWE 3B2WA 4IAFA 4OLIA 4A4LA 2UZNA 3NUXA 4PL3A 4U7ZA 5KKRC 2UZTA 3MPAA 3F69A 3UVQA 4AW0A 3ZSHA 4TYGA 5B2KA 5DOSA 4PNIA 4IX6A 3V5WA 4BCMA 5IDPA 3AC2A 1YKRA 3MSSA 4LRJA 1K2PA 4RVLA 1R3CA 5E8UA 5GINE 3KULB 1XKKA 3LCSA 5E1EA 3UVRA 4XX0B 4B8LA 3LJ2A 4R3RA 4G9CA 4JG7A 4AGWA 3W8QA 4APCA 4AOJA 3OCBA 1FBNA 1BYGA 1OKWA 4L3PA 4ACDA 1XBCA 4WD5A 3MPMA 5EQEA 2WFYA 4YUQA 1VYWA 1UA2A 2V7OA 3F2AA 2R3PA 4FKWA 1BL6A 4BCPA 1WFCA 2FPPB 1H1WA 1OUYA 2FA2A 2Y4PA 2G2IA 3CIKA 4JI9A 3ZDUA 3D83A 4E6QA 5JSMA 4FFMA 3EFLA 3MA6A 4FI1A 4QMPA 1JKKA 3L9LA 1WVWA 4O96A 1UV5A 3MVMA 2XNBA 3FZPA 3I6WA 4F9CA 4DN5A 4MNFA 4ZIMA 3FMJA 3JYAA 4JDHA 2XNMA 1ZYCA 5DEWA 4BCJA 3ZEWA 4ALUA 5LQFA 2W6PA 3QKLA 2BZKB 4RZQA 2W5AA 4XRJA 3GEQA 3QZIA 1KE8A 3H10A 4HGEA 4NK9A 4YHFA 3H3CA 4PTCA 4O7NA 4C3PA 2YZMA 4WOVA 3NYNA 4JAJA 2GNGA 3MN3A 3NW5A 2QG7A 3EJ1A 4O2ZA 3G33A 4K8AA 2F49A 3F3WA 5EYCA 5HE3A 3Q5IA 2W6QA 3U9TA 1OGUA 3AGMA 2E9UA 3UMWA 4FZFB 3EB0A 2OICA 4H3BA 2XK8A 4EOLA 3LFNA 5LYJF 4AN3A 4C62A 4RQKA 3KF4A 3SG8A 3MTFA 3QTWA 4JS8A 2DYLA 4OUCA 4C7TA 5M4IA 4FV0A 4GCJA 4J1RA 3QRKA 2YIRA 3RAHA 2ZMCA 3WZEA 3BBTB 4IC8A 3ORIA 1BI7A 4F9AA 4XP2A 4L45A 1O6YA 2XJ0A 5CANA 3LCKA 3EIDA 4NFMA 2FO0A 4I5PA 3FI4A 4GEOA 4I3ZA 5CU2A 3QYZA 2O2UA 3U6IA 2CPKE 4YJSA 3ZONA 3PA3A 4H58A 2ZV9A 3N4TA 4U3YA 4V0GB 4NKSA 4WG4A 5C9CA 1QL6A 1YQJA 2JLDA 3EN5A 4DCAA 4R1VA 2KTYA 5FBOA 3UZPA 1JLLB 2I0HA 4UV0A 2ITPA 3HMOA 3TDVA 1OIRA 3FI2A 4QMVA 3TNIA 4HOKA 4L9IA 3RK7A 5LMBA 1U54B 3TKUA 3OBJA 4NT4A 4S2ZA 2OIBA 4FEWA 4X3FA 3U51A 3HZTA 2HK5A 5HIDA 1ZZ2A 4EBWA 2W5BA 3E62A 5HIBA 4FZDB 5A54A 4EK4A 2EWAA 5B7VA 4O0YA 5IA4A 3RZBA 2FSOX 2GQGA 4HNFA 5IDNA 1JSVA 2GTMA 3E93A 3F5UA 4H1JA 2J5EA 4FSYA 1BNCA 2W6ZA 3BE9A 3TZ7A 5DFPA 5DLSA 4DTBA 5BPFA 4IW0A 3CY2A 3OCTA 2X6DA 4QP7A 4EHVA 2BRNA 3PJ8A 3Q96A 4CT1A 4GVJA 5HLNA 2B9JA 2YJRA 5J1WA 1ZY5A 2VX3A 3D0EA 2CJMA 2QOKA 3DS6A 3OTUA 3SXRA 2QK4A 4EC9A 3K5IA 3KXGA 4ASXA 2J0JA 2HAKA 4C4GA 2WO6A 2CCIA 4F9BA 4ZP5A 3CD8A 2GTNA 3ZFMA 3OT3A 4BGHA 1W93A 1Q61A 2YERA 2ITYA 3GENA 4GG5A 2Z7SA 4FOCA 4XP0A 2XF0A 4MH7A 3WYYA 3IW8A 4FV5A 4ASEA 2PYWA 3HX4A 3E3PA 2G2HA 3PY3A 3C0IA 4XG8A 4DG0E 1NA7A 4EK5A 1YI6A 1ZYSA 1H1RA 3V8TA 3UO5A 4HNTA 2VTOA 1S9JA 2R5TA 2YISA 2YWPA 3D5UA 4FT7A 5DA3A 4WNKA 4BCNA 3FZ1A 5EH0A 1JOWB 2V5QA 3KXZA 1FQ1B 4BTKA 1OVEA 4LRKA 3MPTA 3QQGA 4NM3A 4YAJB 4AE6A 5BVFA 4BR3A 1KJ8A 5A6NA 2YEXA 3ZYAA 3Q2MA 4ZQIA 2J5FA 3BI6A 4RSSA 4GFGA 4BDFA 3UQFA 3KK8A 2WQMA 3DCVA 3EZVA 4NZWB 4M68A 4AT5A 2X6EA 3VUDA 2W6OA 5IISA 3A62A 3F5PA 2BFYA 5IF1A 2WMWA 3PJ3A 5M57A 1DAWA 3DNEA 2W05A 3Q4ZA 4FNXA 5DWRA 4EG0A 3UP7A 3GU5A 4MX9A 1ZARA 4CCUA 4ZSJA 4RWJA 5IEXA 2XVDA 4N4SA 2R64A 3EN9A 4LRMA 4MVFA 4BTJA 4W4YA 3F3TA 4FEQA 3BQRA 2C5NA 1JWHA 3R6XA 3RINA 4CFWA 3V5TA 5IH5A 2G9XA 5D9HA 3SOAA 4ZTNA 3HRBA 3RPVA 3IDCA 4WUAA 3ELJA 4OBOA 3VC4A 1PXLA 3FXWA 4JG8A 3IW5A 4RPVA 2NP8A 4E4TA 2P3GX 2VTAA 2VWIA 2A19B 3G90X 2P2IA 3PPKA 2A1AB 3K3JA 5EG3A 3ZM9A 3IW4A 4ZTMA 3R5HA 4AZFA 1GGOA 2OJGA 4EKKA 5G6VA 5IQIA 3MB6A 4QMNA 3R1SA 4KS7A 4R7HA 4H3QA 1O6KA 3FYJX 3KXHA 3MYGA 4YJUA 2RKUA 4JLCA 4S30A 3REPA 3RTPA 3U87A 3W55A 2F7XE 4CZTA 2H34A 4YLJA 4ZZNA 5GIOE 4U5JA 3R1QA 2XNGA 3ZO4A 5AV0A 2XP2A 3RPOA 4NFNA 5HV6A 4RIXB 3PXKA 4ZK5A 1U5QA 2IZRA 4RBLA 3DY7A 3QQLA 4GT3A 5ANKA 3W1FA 5CZHA 3AD4A 3KXXA 4OTWA 3AMYA 4CMOA 1A9XA 3N51A 3ODYX 3LJ0A 4JL9A 4CFMA 5T3QA 3TNQB 4C4IA 5J9ZA 3NX8A 5TKDA 2UVYA 4NJ3A 3F3ZA 5AP1A 3RCDA 2GDOA 5L3AA 5BQ0A 2WMXA 3EFWA 2QKRA 4XS2A 1PXNA 3FLWA 2WYOA 1CSNA 2RFDA 4QP6A 3OW3A 2FGIA 4IQ6A 4FKVA 3Q2OA 3A8WA 4IX3A 2VTHA 1PKDA 1XH5A 4O21A 5I9UA 3W10A 2QC6A 5EOLA 3HA8A 5LMKC 4APPA 1IAJA 5CQUA 3CKWA 4YP8A 3R01A 1OI9A 1EUCB 2Y0AA 4Y73A 1XH6A 4AZEA 2QR8A 3EQHA 4DBXA 2C5OA 2YZGA 4MNEA 5JQ5A 4Q9SA 2WIPA 2OXYA 2UW5A 2YS6A 5CF6A 3RCJA 3CD3A 4LOPA 1R0PA 4FKSA 5GNKA 3QTUA 4O0WA 2VWYA 5CT0A 1H26A 4M7IA 4UZDA 5HO8A 2BALA 2YACA 3VS6A 4DCEA 1VR2A 4O0VA 4YMJA 5IQDA 4LL0A 4YPSA 4GK3A 4RZVA 4XLIA 3QF9A 3G8DA 3TIGA 4ZMEA 3RAWA 4IWDA 1W0XC 5CYIA 2RIOA 1JDEA 3FBVA 4GYIA 5BUEA 3N4VA 4WO5A 2R7MA 3CY3A 4E93A 3TL8A 3AX6A 4AX8A 4E4NA 5HE1A 2WTKC 1GJOA 3JY9A 2R82A 3ZH8A 4YJOA 4QQ5A 3HV3A 4J71A 2W6MA 2YCSA 4IB5A 4D2SA 3E5NA 2XCKA 3DJ7A 4FK3A 4I0TA 3QD4A 4E5AX 2ZDHA 1Q8UA 3ZUTA 5HO7A 3QTZA 3RV3A 3TV7A 2XH5A 5IQHA 2BDJA 4D4YA 1VZOA 4B0GA 4Z9LA 5AP6A 4FTLA 4EOKA 1GY3A 2X0GA 4FT3A 2RFNA 3QFFA 5AUZA 5T68A 4O7ZA 2LGCA 4D1ZA 3R9NA 2EB2A 4NJDA 5EHOA 2CKEA 5CU0A 3FDNA 3V4ZA 2I6LA 4PP9A 1S9IA 2A2AA 3PXYA 4X21A 2SCUB 3FY2A 2IVTA 5IUIA 4D0XA 5H80A 4IB3A 3OUKA 5C27A 2UZEA 3BYSA 4TXCA 5CENA 4DFUA 1E9HA 3EQBA 3GVUA 2VNYA 3C5IA 1V0PA 2YDIA 1Y8GA 5A9UA 2KULA 4I92A 4OBPA 4TNBA 2CGUA 5E8YA 3AC8A 3ZFXA 5JKGA 2QU6A 4DGLC 5FDPA 4V05A 4UWYA 4G3CA 2YFXA 3V5PA 3SC1A 1WVYA 2GHMA 2VTRA 3HAVA 3MDYA 4YO6A 3GBZA 3FLQA 3H0ZA 3TXOA 3PE1A 4FTKA 3MESA 3OOGA 3L8VA 4OBQA 4J99A 2CGWA 3I1AA 3JR1A 1WBVA 2BHHA 3MI9A 3QQKA 3RK9A 4EWQA 1E1VA 3ZRMA 5JT2A 3A60A 1UWJA 2QOHA 3HMMA 2XJ2A 3EQFA 3G0FA 3OUNB 3UO4A 3ALNA 3HA6A 3QQJA 4EH3A 2XRUA 4FVRA 3QYWA 3BX5A 1P14A 2YITA 4X2KA 4A06A 1KJJA 4N0SA 3DU8A 3QQUA 4IB1A 5E7RA 3CQWA 4I22A 4C4JA 1U5RA 3CP9A 4L7FA 3HGKA 1FMKA 3DKGA 2Z7LA 3G0EA 4L44A 2DUVA 4IAKA 1XBAA 5TT7A 4A9SA 1SM2A 3O51A 1RDQE 4U44A 4RGJA 5KZIA 5KMNA 5HCXA 3E5AA 2WU6A 3R83A 3HNGA 3HVCA 3QL8A 4XYLB 1AD5A 3TDWA 1FGIA 4FG9A 3PVBA 3U8WA 5AA9A 4AT4A 3R5XA 2JAMA 2B53A 5LVLA 2W71A 3HMIA 4U6RA 1K9AA 4XOZA 4YC3A 5E92A 2BZHB 3TNPC 3GT8A 5L8JA 4PWNA 4M69B 2BAQA 3D7TB 4L42A 4BI1A 5I9VA 3LM0A 3LJ1A 3LQ5A 5IQEA 2HZNA 1ZOGA 3UIBA 1GIJA 5K5XA 4GK4A 4KB8A 5LXTF 4QMWA 5KO1A 5AA8A 3ORKA 4R3PA 4IM0A 4IZAA 2Z8CA 4B6LA 1Q8TA 5M53A 3UTOA 2QOQA 3R71A 5H9BA 4MHAA 3MJ2A 5FNVF 1WBTA 3LIJA 5HBEA 4RT7A 3KAKA 2AYPA 3BV2A 1QMZA 4YC8A 2IW8A 4FZ7A 3NNUA 3D94A 1PKGA 5CEKA 4E6CA 3C50A 3QD3A 3WILA 2IO6A 4PMTA 4PX6A 4QMOA 4QTDA 3F3VA 4M3QA 5J95A 3R9DA 3W2RA 3LFDA 1PMVA 4YZMA 5EHLA 4G5JA 4JRNA 3WZKA 3G6GA 3JS2A 3ZBXA 1JKTA 3I5NA 4ID7A 4ZJIA 3Q52A 2O8YA 2QLUA 3I60A 3R9HA 4DBNA 3BCEA 4JDKA 3QRJA 4R6VA 2B4SB 1JSUA 1X8BA 3R7VA 5DHJA 4CD0A 5D41A 4DAWA 4DH8A 1BMKA 4FX3A 5AV2A 2WTIA 3VAPA 1PXIA 3PSBA 5CALA 4RIYB 5C1QB 2J9MA 2YA9A 2ZB1A 4QPAA 5IH6A 2XS0A 3FKLA 3DQXA 4BRXA 3ZXTA 3KA0A 3NUAA 4EONA 5IUHA 4KSPA 4LMUA 4D9UA 3DTCA 4R7IA 3QC4A 2R7KA 3S3IA 1GZNA 2XKFA 5IH4A 4LGGA 3Q4TA 4J7BA 5AP7A 4EH6A 1V1KA 4AW1A 1OIYA 4ITIA 3UQCA 3SAYA 3NZ0A 3G51A 5JRQA 4NUSA 3NWWA 4PV0A 4JVGA 2P33A 4EOQA 4EK8A 3D5XA 4DFLA 3K5UA 4AW5A 3LCTA 4R5SA 1ZAOA 1ZOEA 4BBFA 3ORQA 3PLSA 4EORA 4ZOLF 2QVSE 3HKOA 3ORZA 4RC4A 4DT8A 4ANBA 5EM6A 5CSPA 5J9LA 2V5AA 2YM5A 4TWNA 5L2TA 4AXAA 1VBGA 5C8KA 4QOXA 1M2QA 4PMMA 2CNUA 3SKCA 1FGKA 4F65A 2F57A 1YXXA 3IOKA 2W7XA 3T9TA 1OBGA 4H3PA 3BYUA 4PNKA 4FTNA 1Y57A 4OGRA 3PP1A 4I6QA 4MK0A 4ZY5A 4HNIA 2YZAA 2R87A 1WZYA 4BC6A 2DWCA 3RAKA 5H8EA 5GJFA 3Q9WA 5DT4A 5L2WA 1O9UA 3OUUA 3NIEA 4FNWA 3V6RA 2HCKA 4YJNA 3VUKA 4FA2A 2I87A 5E1SA 1EYZA 3MB7A 3NNWA 3FQEA 3FMMA 4P4CA 3VBVA 4YJRA 2DLNA 4O2PA 3EZRA 2JIIA 5CB4F 3ZUVA 1SNUA 5IMEA 4MWHA 4GUEA 2BZJA 5A4LA 2Y6OA 3EH9A 3QTQA 2IP4A 2XBJA 5AX3A 2R7NA 2X39A 4W4VA 3DK7A 4RVMA 5J8IA 3SDJA 2O64A 3BYVA 3VPBA 1QPCA 3ORXA 4ALVA 5IG1A 4C2WA 3C0HA 2ZB0A 2QF7A 2QLQA 3FLSA 2WMAA 4FSNA 5E8VA 4S32A 3UGCA 4Z7GA 3DA6A 1B6SA 1YHWA 3KEXA 3KREA 3O71A 4Q9ZA 3U6HA 1CQJB 3COMA 4X2JA 5TO8A 3P7AA 5C8MA 5JQGF 2XKEA 5LWMA 2FVDA 2VTLA 4GH2A 1JKLA 3MFUA 4X2FA 3ZLYA 4HCUA 2ITVA 4RRVA 2YDKA 1OL6A 4HYSA 1VBHA 2PHKA 2JD5A 2GPHA 3A8XA 3IDBA 2GS2A 4NTSA 4MBJA 5FM3A 3VULA 2GHLA 4BYIA 4E5BA 2YCQA 4NIFB 3V5JA 4CEGA 2GU8A 3A7GA 3UC4A 5IEYA 3FMEA 4ANMA 5KX8A 2W99B 2ETKA 3DBEA 4O4IF 4FV4A 1L8TA 3WNZA 4FBXA 3OZ6A 5H8GA 3PA5A 2X4ZA 1CE8A 2CKQA 3C4FA 4YC6A 3QUEA 3MVLA 4A9TA 5J9YA 3FXXA 4M97A 3F2NA 1YDRE 3FPMA 4RJ4A 3R63A 2GCDA 3EWHA 4MV3A 3DXPA 3OXTA 4PL5A 2R3KA 4HVDA 4LGHA 5EM8A 1XO2B 2ESMA 5CA0F 4FIFA 2IPXA 4GS6A 4YNOA 2VTIA 3BYMA 2NU6B 3AT4A 2OZOA 3EYHA 5EHYA 2Q0BA 5FEDA 1Q3WA 4DHFA 3VS7A 4XRLA 5TF9A 3EQDA 3GOKA 4KRCA 4Z55A 2ZDGA 4DEBA 3RWPA 3VRZA 5KMJA 3W33A 4EH5A 3LE6A 4O84A 3R7OA 3HMNA 2WPAA 2BDFA 4FOBA 3LFFA 4K1BA 4WBOA 4WUNA 4BBEA 4E8AA 1Q3DA 5J2TF 2W9ZB 2WTDA 2Q83A 3A4PA 4FVPA 3CTQA 4RJ8A 5IA5A 3W2PA 4DH1A 5BPYA 4EYJA 5KX5F 4FKLA 4BVUA 5L8KA 4RX9A 2YRWA 5AJQA 1NXKA 3QZFA 2GMXA 3ZC6A 4U8ZA 2OF2A 4DTAA 4G6LA 5EQYA 4AZVA 4F08A 2PN1A 3PG3A 4U40A 5ETIA 5AX9A 4M12A 3Q9XA 2HWOA 2VO0A 4HNVA 4L52A 4FFPA 1NVRA 3M1SA 4FEUA 1J1BA 3ZCLA 2VRXA 4ZTHA 1ZLTA 2J4ZA 2JGZA 2UW9A 3F61A 3U54A 3ZLWA 5IEVA 3GQLA 3QCYA 5DEYA 5KHWA 3UZTA 5DIAA 2NU7B 1GIIA 3M42A 4PUZA 4ZY6A 4E1ZA 5AP2A 5ETFA 1J7UA 4HPUE 3GB2A 2P0CA 2BUJA 3R28A 4USDA 3C4WA 4Y5QA 1Q8YA 3FSFA 2C6MA 2VX1A 3F5GA 2QNJA 1OL1A 3DAKA 2XKDA 3BRBA 2XK7A 3MV5A 1F5QA 5DG5A 1G8SA 2IWIA 3PY1A 4EQUA 1YWRA 1WCCA 4FUXA 4P5ZA 4BB4A 3LWBA 5LOVF 4FKGA 3KN6A 4FSRA 4C33A 4GFOA 2HY81 2P2HA 4CSVA 5BMMA 4F0GA 4FTOA 2XD4A 3HV4A 4K33A 1H1QA 2JDRA 3TUDA 2QR7A 1E1XA 3E8CA 4IJPA 4GJ2A 4PMSA 3CJFA 4YJQA 1SVHA 3UJGA 2HZ4A 5BX0A 1OMWA 1YXTA 1H00A 3HV6A 4QP3A 5CVGA 4QYGA 4G3FA 4QQJA 4O7TA 3WF8A 4YJ2F 4V0GA 5FG8A 1KV2A 3MIAA 2UZBA 4XOYA 3P5KA 2QOCA 4O7VA 5EW8A 4FKPA 5G1XA 2OFUA 5M55A 3THBA 3VNTA 5AV4A 2GLTA 5BMVF 4DEHA 3D2IA 4K11A 5IPJA 3CPCA 3DLSA 1OPJA 2CSNA 4K2RA 2I8CA 1PJKA 4O81A 4HQ6A 2ZV7A 2R3IA 4G3GA 3Q9ZA 5A6OA 4F63A 5EKOA 3TQTA 3FC2A 3QCQA 2HXLA 4GG7A 1UNLA 3SA0A 4C3RA 1RQQA 5DNRA 2CKPA 3HLLA 4FKTA 1Q5KA 2QHNA 5B2MA 3BEAA 3EMGA 3BU3A 3TUBA 4BIBA 2X8DA 3PUPA 4O0RA 4MAMA 3BZ3A 1JQHA 1REJA 5FXSA 4ZLOA 3ZOSA 3UOKA 1T36A 1MRVA 2GSFA 3PXFA 3WOWA 4AWIA 2JAVA 3AMAA 4D1SA 4C02A 3ROCA 3BLRA 3MVJA 3RP9A 4BZDA 4GKHA 2G1TA 5HVKA 3MWUA 3MFRA 3I79A 1GSAA 1UU8A 3R1YA 2YABA 4NU1A 4BCKA 1KOAA 4NW6A 3ORRA 4QYFA 2BR1A 5AP3A 3A99A 2QOBA 4QP4A 5FM2A 4AZTA 5CF4A 1M7NA 3WI6A 5CEMA 3P86A 4C38A 4DH5A 1GZ8A 4MAOA 4EUUA 5AUVA 2G2FA 2Z7RA 4BCQA 4ERWA 2BROA 3F82A 3MY5A 4X2GA 5LJJA 1IEPA 4HGTA 4C4FA 3ETHA 1I7LA 1R0EA 2B9FA 2BRGA 2QO2A 2ZV2A 1PXOA 2BAJA 5ACKA 1LUFA 2ZJWA 2IVUA 3L9NA 4TYHA 3ZSGA 2WMVA 2R0UA 3DTWA 4G3DA 4BN1A 1UKHA 4H05A 3OOMA 3FWQA 1BXRA 3R8PA 1DAYA 2PZRA 4MA5A 3QX4A 3DBFA 4HNUA 4YSJA 3MY0A 4C58A 4EOSA 1YXVA 5HX8A 4Y46A 3LP8A 3GCVA 4EZ5A 4NTTA 1LPUA 2VO6A 4FV1A 5EDRA 3DFCB 3ZHPC 5KMLA 4LYNA 1Y6AA 4YB8B 1DI9A 4FKOA 3GXLA 2JFLA 4G34A 1P5EA 2WMBA 3P0MA 5J1VA 1QPJA 5M07A 3OHTA 2VWVA 4GFMA 5DMXA 3TM0A 1OPLA 4FIIA 4KIPA 3KRLA 4UXQA 3R9OA 3D7ZA 5HLWA 4MXZA 3CPBA 4HYIA 4WNOA 2W1GA 2C4GA 2ITUA 2QONA 3E8EA 4DFBA 1PYEA 1OL5A 4PF4A 2XNNA 4EHZA 5LMKA 1BL7A 3D7TA 3IS5A 2PWLA 2Y8OA 2ZDUA 3CC6A 2HOGA 3R22A 4HVSA 1A9UA 5HU3A 2BAKA 2R3OA 1R1WA 4XH6A 4BZOA 2NUAB 3AG9A 3EKNA 1MQ4A 5CZIA 5HNBA 2EXMA 5CAUA 1QPEA 4FV8A 4EKLA 1GLVA 5L2IA 3VS4A 4DH7A 3LMGA 3UQGA 1FVTA 4KSQA 4NKAA 4R7BA 1GAGA 3SRVA 2VN9A 4MBIA 2IZTA 2UW6A 5CSHA 1W96A 3UFXB 3BLHA 4TWOA 4KKHA 1BX6A 5F9EA 4M9UA 2B0QA 2NU8B 5IU2A 1TQPA 2ERZE 3OS3A 2CLXA 1H0WA 1DI8A 3P7BA 5BYZA 4F1MA 1GOLA 2F2UA 2DZDA 2F2CB 4X2NA 2IW9A 4EGJA 4L1KA 5BNJA 2F4JA 3GGFA 4WHZA 4YBKA 3KGAA 3T9IA 5IQCA 3ZC5A 2WTJA 3PE2A 3F7ZA 4UXLA 3FQHA 2UZDA 2OG8A 2RL5A 4BCFA 5E4HA 4RJ6A 3UIMA 3TUCA 4YSMA 4MCVA 3E64A 2BKZA 3CR0A 4L43A 4QNYA 4A4XA 2R84A 4AGCA 4JR3A 5JGBA 4EHGA 2J0MB 3K5HA 1A48A 2Y4IB 2GS6A 3NCGA 3WF9A 2J2IB 4Y8DA 2OK1A 3N6RA 1Y8YA 2OJ9A 5JZJA 3LFQA 4FYNA 3FE3A 2P0AA 2H96A 4IVCA 3QA8A 2XYNA 5E9EA 4EQMA 4DGNA 3HRCA 2WQBA 1PXKA 3R1NA 2ZM3A 3UO6A 4ACCA 1WBSA 4TZRA 5HGIA 4OTQA 3BWFA 5HIEA 3FY0A 5JEBA 1Q4LA 4FGRA 2GHGA 3ANRA 2YZNA 3NUPA 2JFMA 3VS5A 1CKPA 3UYTA 1OL2A 3FC1X 2XIXA 2VGOA 3ZO2A 4CGAA 4BZNA 1CM8A 4DFNA 3GCUA 2C5VA 3LXLA 3IOPA 3COKA 3SD0A 5K4IA 2QHMA 3DKFA 3FZOA 3V6SA 1B6CB 2C6DA 1V0OA 5DT0A 4C5CA 2X7FA 4IADA 3FPQA 2WMSA 5AIKA 1WBNA 4XLVA 2W70A 3U9NA 2YWVA 1KE7A 5T6KA 4YU2A 2H6DA 5D12A 1VEBA 1XWSA 1PMUA 4MD9E 4FV2A 5CAPA 2F7EE 3EHAA 3DF7A 3VBWA 2R0IA 5FBNC 2BRBA 2WNTA 3QKKA 1XH7A 5CI7A 1MP8A 4JJRA 3F3UA 3L8SA 4GU9A 5K3YA 3QD2B 3CGFA 4MWIA 4QTAA 2PPQA 5DBXA 1NY3A 2WKMA 2XM8A 2Z60A 3T8OA 4EWHA 3CQUA 3TIZA 3ZS5A 1GZKA 2BTSA 3TJDA 2HW7A 2I80A 1Q8ZA 4MXYA 4O22A 3VS1A 2PUNA 2BTRA 4JX3A 2FSLX 4EEVA 4XZ3B 2QURA 3DB8A 4O6EA 5E91A 2IG7A 4IZYA 4RX5A 3RUPA 4PY1A 4RVTA 4BCGA 2VUWA 4YJVA 5HU9A 3LXKA 4RIOA 4FV6A 2ONLC 2WIHA 4TWCA 4OTGA 4IVDA 1JNKA 4YZCA 3VQUA 4HVHA 2WGJA 3VF8A 4TKSA 3HMPA 5DH3A 3QCSA 2EB3A 4DIMA 1NVQA 3BYOA 1OIQA 3R21A 4CRSA 1UNHA 1U59A 4DFXE 1DIKA 2OXDA 4OTDA 4HYUA 3BLQA 1YXUA 4FE2A 4L01A 3RGFA 3SQQA 3ZRKA 1W8CA 3PIXA 5J5SA 4MV7A 3ZDIA 3OP5A 5HNIX 3ENMA 4D4RA 5HE2A 3H9OA 1J7IA 2O65A 3H9RA 5I9ZA 1FOTA 4CKIA 3CSVA 5IQBA 3JRWA 1XHAA 2SRCA 4WRGA 2PVHA 2IZUA 4KIOA 4WT6A 3RM6A 2Z2WA 2BIKB 2VU3A 4IDTA 3RV4A 5I9WA 3I12A 3KF7A 4LV5A 2Z04A 4V04A 3AW8A 2WQNA 2QO7A 4YBJA 3C4ZA 3O8UA 3JUHA 3ETJA 3TWJA 2J50A 2BIYA 2JIVA 1KUTA 1M2PA 2XEYA 3D14A 1AUVA 3LCOA 1XBBA 2PZ5A 4QMQA 4I1ZA 3Q1KA 4II5A 2P4IA 3VQHA 2XIYA 4C37A 2YM3A 4HGSA 5BYLA 4IHJF 4R5YA 1VYZA 3MJ1A 4BDCA 2RF9A 1JKSA 3PVGA 1CKJA 2BCJA 4HYHA 4O7RA 3KRXA 4KKEA 4OTHA 4Q5HA 3POZA 4YJTA 3BG5A 4YBZB 3MY1A 1GSOA 2BPMA 1CKIA 4FT9A 4L8MA 2RG6A 2UW0A 2OIDA 4LL5A 4O0TA 2AUHA 2Z7QA 4IX4A 5ETCA 4J96A 1KC7A 5DR6A 4AGDA 2DS1A 3DK6A 5ANJA 1RW8A 3BPRA 4GT5A 3HDNA 3V8SA 1TKIA 1Q62A 3IONA 3UP2A 4A9YA 2PUPA 3IO7A 1KOBA 3K3PA 2CZGA 1PK8A 2PVFA 4NM0A 5KUPA 4I0RA 5LCJA 1MUOA 3LFBA 4DGMA 2PUUA 2YM7A 3B2TA 3F6XA 4J8NA 5CSXA 1H4LA 5DPVA 4AF3A 5HTBA 5F4NA 3FKOA 4F9YA 5EM7A 3R04A 3VOTA 4RIWA 2FSMX 2C0TA 2PU8A 4LOOA 4KS8A 4XBUA 4O86A 3R02A 4BDDA 4CLIA 1M52A 4JBPA 4B7TA 4I5MA 4D4VA 2I40A 1F0QA 1Q99A 4EH7A 1PF8A 3OEZA 4HVIA 4UYAA 4ITJA 2CKOA 2JEDA 4LFIA 1JKJB 4EGQA 2OO8X 2QOFA 3DZQA 3L9PA 3QGYA 3R8MA 4CG8A 4Z3VA 3H30A 4W4XA 4DG2E 3NW6A 2YCFA 4KBAA 4O91A 2PK9A 1CDKA 5HBHA 3ZLXA 5FP5A 3W2CA 4ZTRA 3DDQA 3HRFA 4O4HF 2OSCA 3OC1A 4FTIA 1M6VA 1ZMVA 1I7NA 3QTSA 3LW0A 4BCIA 3H0YA 4FSTA 3VUHA 3DBCA 5AUWA 3W32A 4I0SA 2GFCA 2IJMA 2RGPA 4O7YA 2OKRA 4O83A 4ZSEA 3R7UA 3TTIA 4I94A 5HHWA 4MV6A 2QODA 1WBOA 4KIQA 3PXZA 1BI8A 3K54A 2J51A 3MH2A 3NW7A 4NW5A 4O27B 3R7IA 3RVGA 3NDMA 2A27A 4PDPA 4ZI7F 2Y4IC 3H9FA 3VBQA 4U80A 5EQPA 4BIDA 5C1OA 2GQSA 5M4FA 3FEGA 2XIZA 4FL1A 2BFXA 4FTCA 4IJ9A 4RIWB 4A9UA 2YZLA 3TTJA 4EH2A 3VBYA 4X3JA 3NLBA 4EC8A 5CT7A 3R8UA 5CSVA
chains in the Genus database with same CATH superfamily
4ZTSA 2ZM4A 3PVUA 4BDGA 2GFSA 3MW1A 4TYIA 3QRTA 3UIUA 2PMIA 3PSDA 3A61A 1KJIA 3JSNA 2R3MA 5HBRB 3PWDA 4QRCA 4TV8F 1H24A 1TQMA 3DV3A 1CMKE 3UYSA 4DG3E 3DKOA 3VA7A 3GFWA 4QO9A 2EU9A 1UU3A 3EQIA 3GU4A 3OROA 4FG7A 3Q53A 4NM7A 4EL9A 1PYXA 3IPHA 3AMBA 4QYHA 3RPSA 4QT1A 2VTSA 4JDIA 4OT5A 3ULIA 2IN6A 3GJXB 1GIHA 2ETRA 4AN9A 2GPSA 4UYNA 4UCOA 1WMKA 3DAJA 3ETAA 4DH3A 2G15A 2ZDTA 4O0XA 2J9GA 4IZ5A 4WG5A 5BUIA 1TA8A 2J6MA 3PA4A 5IA0A 4JOAA 3D5VA 4G6NA 3EOCA 4I21A 3Q32A 5AV3A 4C2VA 5KKNB 5JQWA 5D7VA 3HEGA 1TVOA 1Q24A 4TVIA 2FYSA 2XNPA 1ZY4A 3TW7A 3RFCA 2YW2A 3FJQE 4M0YA 3D2KA 1KE6A 5FQDC 3OWPA 4M8TA 1JLUE 2XJ1A 3VWAA 4U3ZA 3R8LA 4MV4A 4FTJA 5D8DA 4PTEA 4O4JF 5CTPA 2NRUA 3P1AA 4YJPA 3BKBA 4F0IA 3VW8A 1H07A 5KS8A 5H8BA 1M17A 2YIYA 4ENXA 4XG4A 4ZSAA 5LXMA 4YAKB 3QU0A 3K2LA 3Q3BA 4FNZA 2VZ6A 5FTQA 4GV1A 2V58A 4IBMA 4ARKA 1ND4A 3QWJA 4XP3A 4RQVA 3N9XA 4M15A 2J7TA 3SXSA 3SX9A 4YLLA 5A4EA 3MGYA 4CFNA 3SNOA 1ULZA 3WO0A 1ATPE 4EFBA 4Q5EA 1YOJA 1OKYA 4HCTA 4Q2AA 4YZDA 5HKMA 2HJWA 2PMOX 5E8WA 3GNIB 1U54A 3QA0A 4W4WA 4IDVA 4JIAA 2VWBA 3ZXZA 5K4JA 2GNLA 2C0IA 2Y4RA 1M0WA 2OXXA 3QUDA 4L6QA 3RPRA 3PN1A 4FV7A 5I9XA 5ICPA 3EQGA 4F64A 4JXUA 5ANOA 3NNXA 5BWRA 4I6LA 5M51A 1KE9A 3R0TA 3ROYA 2VPQA 5IQGA 3TZ9A 2GS7A 2PE2A 3HV7A 1YVJA 5ACBC 2C5XA 3C5UA 4PRJA 4ERKA 3OMVA 4JXFA 4F7JA 4EFEA 1ZOHA 4L3LA 5FXQA 1LR4A 3E8NA 4M0ZA 1YRPA 3PRFA 4JNWA 3GC9A 3R73A 3S4QA 5JMSA 5LARA 4FODA 5GHVA 4FFNA 5CAEB 3RPYA 2V7AA 4KBKA 4GRBA 1OIUA 3E63A 5AFVA 2ACXA 3DXNA 4JX7A 2O5KA 3VJNA 2R3GA 3C1XA 3IG7A 3LXPA 3SE7A 3TKHA 1KBLA 3U6JA 2PZYA 2XK9A 2WEVA 1UU7A 2J0IA 4X7QA 2JKQA 4KNBA 4YHJA 3TG1A 4C34A 2F9GA 4DC2A 2UVXA 4AXEA 4AA0A 2EIYA 3VUMA 4AGUA 4AU8A 4RC2A 4FSWA 2VTTA 3FLZA 2C1AA 4MD8E 2XIRA 2A0CX 2X7OA 5GONF 4EQ5A 1Y91A 3EFJA 4FVQA 4CMUA 4YZ9A 1REKA 3GC7A 3OG7A 4TTHB 5HVJA 4MEDA 4NL0A 3W0SA 2ABJA 3GFEA 2C6EA 3GU7A 1V0BA 3VHEA 3WIGA 3FLYA 5C01A 5DVRA 2QQ7A 3DFAA 4FEXA 4DT9A 5KMMA 2W06A 2YJSA 2NRYA 4OTRA 1URWA 3N4UA 3F7WA 5DE2A 4ORKA 4YTHA 2XBAA 3KMUA 3L8XA 2J0LA 3EQRA 1ST0A 2JDTA 2NO3A 4U81A 4BIEA 4UX9A 3RHXA 3FMDA 2E9NA 4WSYA 5DI1A 4ZJVA 4O2BF 3BWJA 3VS2A 4MV1A 2QB5A 2XCHA 3G9NA 4HZSA 5CY3A 3CGOA 3EQCA 4GW8A 4F6WA 2W1IA 2PVJA 2R9SA 3K5VA 5FEEA 4ACMA 1OPKA 4JBOA 1EHIA 4FSZA 2A1HA 3KC3A 5CAOA 5CR5A 4TY1A 3PPJA 4O6LA 4R78A 4IWYA 4RX7A 2R86A 3LKMA 1Y6BA 3LFSA 4RMZA 3D9VA 3QHWA 4PDYA 5E90A 1H8FA 2I0VA 1OKVA 2I7QA 4R1YA 4OTIA 5DGHA 3ACKA 5AP0A 4AQCA 2DIKA 5HG7A 3ENHA 3UOHA 5BWUA 3EN6A 3NYOA 2PMLX 2PVYA 4DA5A 2R3JA 3GP0A 4G1WA 1W7HA 4OR5A 4EQCA 4I41A 2WAJA 3CS9A 1WVXA 5ANIA 5EYMA 3RHKA 4I6FA 3SOCA 1A0GA 4RC3A 4E73A 3ZZWA 4ONAA 3W1BA 4U43A 3GOPA 5DR2A 1ZYJA 3F2RA 3KK9A 4XEYA 4V01A 4UCUA 5C8YF 5M08A 3DQWA 4TL0A 3OF0A 3DBQA 4I4FA 4XHKB 4LG4A 2XK3A 4G17A 4Y95A 5EI8A 3RI1A 4CV8A 1YHSA 4D9TA 2COGA 3HUCA 3BIZA 4DLIA 4I93A 1UWHA 4DEEA 3PIZA 3JVRA 4TV9F 4F9WA 4IH8A 3BQCA 3ALOA 2I1MA 3BU5A 2ZOQA 4BY9E 4BCHA 2OW3A 3UNJA 4F09A 2OJFE 2X9EA 3CTHA 5CX9A 3RMFA 3QQFA 3QHRA 4Z16A 4ZZOA 5M4UA 3JZIA 3NMUF 1IAHA 4MNEB 4DGOA 5AUTA 1C30A 4LH6A 4HW7A 1FVVA 2X81A 4BDKA 1EKFA 1XJDA 1XR1A 4RLKA 2ITQA 4UCSA 4NCTC 2EUFB 4F1OA 3G8CA 2HYYA 4DFZE 3BE2A 5HD7A 3KN5A 5B2LA 4XX9A 4TPTA 1JBPE 3KULA 1FVRA 3I7CA 3OEFX 4I24A 3VBTA 3IW6A 2C3IB 3VVHA 4E5WA 4EJNA 1B39A 4UN0C 5JH6A 4UY9A 2QI8A 3C0GA 4GIHA 4KA3A 4AUAA 3S1HA 3D15A 4G3EA 3PJCA 4O7SA 4U45A 2G01A 4IWOA 2C3LA 4KKGA 5KE0A 3BGPA 3GU8A 4G16A 5HCYA 4ANQA 4F1TA 5C8NA 2DAAA 2O63A 3DJ6A 5I47A 4JT3A 4YNEA 1IA9A 5E8XA 3V04A 2VWZA 3TIIA 3QBNA 4ZAUA 1PHKA 1H08A 3P79A 4KUJA 5D1OB 3MFTA 3MH3A 2HGSA 4O2AF 4ZHQF 2A4LA 4FG8A 1Q97A 5L6WL 3NUNA 3UC3A 4WNMA 2YHVA 2QG5A 2UV2A 5F20A 4IEBA 3RWQA 1HCLA 3FZRA 4TRLA 3ZMMA 4DINA 5KMIA 4D1XA 2OI4X 3BGZA 4A4OA 4PBCA 3QXOA 4RA5A 3LQ3A 2B9IA 2WTKB 3EFKA 4FKIA 5BWVA 3F5XA 3VJOA 4AACA 2ITXA 3L1SA 5ITAA 3DKCA 4P2KA 4LMNA 2BVAA 4UCRA 3II5A 3WBLA 4YLKA 2OZAA 4D4SA 5JGDA 2FPGB 4IIJF 2CLQA 3TJCA 2R3NA 2BHEA 4IIRA 5DRDA 4EI4A 1ERKA 2IZSA 2PE0A 5EOBA 4WBNF 4PQNA 1G5SA 2OLCA 4D28A 1QCFA 1OITA 4BICA 4PDSA 3L8PA 4E6DA 3FQSA 2XNEA 4L67A 3RK5A 4JQ8A 5CF5A 4RVKA 2PVKA 2YAAA 1IASA 5KMKA 3JRXA 5H2UA 4RCNA 2ITTA 3BA9A 1JPAA 5IQFA 5JFXA 4YZNA 3RNIA 4BTMA 5HD4A 2CNVA 5EYKA 2ITZA 4G2FA 4AW2A 3LFCA 4FL2A 1PXPA 3NGAA 4ZZMA 2CFMA 2ETMA 4ACGA 1PY5A 5CS6A 1Q41A 5C4KA 3CSWA 4DE4A 3KMWA 4KINA 1URCA 4PZ6A 3MH1A 3QFVA 4DAAA 4ZLYA 3S2PA 3NVMB 3U55A 1XQZA 2X7GA 1VLRA 3QLFA 3R2YA 4X6RA 1W84A 3RALA 4XG9A 4TT7A 1FPUA 3E7OA 2WQEA 2ITOA 2YM6A 3M2WA 2O0UA 3QCXA 2JC6A 4O7WA 4BI2A 3SG9A 5HQ0A 2VQDA 2VX0A 1SVGA 1SYKA 1FMOE 1YDTE 1YXSA 2XB7A 2ZMDA 3KKVA 4CV9A 4WG3A 2FPIB 2VTQA 4D5KA 4TUYF 5K5NA 2R3RA 3PIYA 3AC3A 1TQIA 4JBVA 3GLKA 3DB6A 4IAIA 2C6LA 4QQTA 1KJQA 1YOLA 5AIRA 4DEGA 5CNOA 4AG8A 4M14A 4EUTA 3IK3A 5EI6A 3ZUUA 4YR8A 3P9JA 4AA4A 3F66A 3KY2A 3MH0A 3NAYA 4K9YA 3OWKA 2O3PA 4RZWA 3NPCA 4NSTA 4QPSA 2CN5A 5CI6A 2W1CA 5AP5A 4O0UA 5H3QA 3BBWA 4KWPA 4MQ1A 4FKQA 3LLAA 4CTCA 3SVVA 3RJCA 2PVPA 4HN2A 3C7QA 4M84A 3U9SA 3GCSA 5AAGA 4AN2A 4D58A 4CCBA 3B8RA 1M7QA 3ZSIA 4BI0A 4YO4A 1KEEA 1YI4A 1W82A 3ANQA 5L8LA 4U79A 3GUBA 4BHZA 4UCTA 2UW4A 2I0EA 4P90A 5CXHA 4FV3A 4MF1A 4GSBA 3BU6A 4FTRA 3CCNA 5LP6F 2OZAB 4FK6A 3FI3A 5D10A 3EQPA 5JK3A 1KTAA 2WTCA 1UC9A 4C0TA 5M44A 4BHNA 3OCSA 3UQ8A 3MVHA 4Y85A 1OBDA 3WO1A 3D4QA 2FSTX 1ZRZA 4Z7HA 4BDIA 2HDKA 3DNDA 1STCE 3ORNA 4AFJA 5KBQA 4QMUA 4ME6A 2E2BA 2B9HA 2R3FA 5FD2A 4MXAA 5IZFA 2VTPA 4WA9A 5CM0A 2HVSA 1PXJA 3ORTA 1MRUA 1OB3A 3Q04A 3NR9A 5HCZA 5F95A 3PJ2A 1P2AA 4XMOA 2PL0A 2R4BA 3BL9A 4J53A 3VW6A 1EUDB 5JQ8A 3TV4A 4N6ZA 4QYEA 1KV1A 4RWKA 2WOTA 2BZIB 4JAIA 4L46A 2ZAZA 4QMXA 5LOHA 3PY0A 4IX5A 2PSQA 4FTAA 4S34A 4EBVA 5AEPA 4XUFA 1MRYA 4ASZA 3VIDA 1G8KA 3QWUA 2W4JA 5DN3A 4L53A 3LPBA 4IB0A 4IM3A 5KBRA 2CGVA 3A2CA 1NT2A 2JIUA 2OFVA 4I5HA 4JG6A 4AOIA 4FL3A 5I9YA 4IVAA 3IGOA 2HZ0A 2JDOA 2UUEA 2XALA 4FT0A 5ANDA 2CCHA 2W1DA 3W2OA 2QU5A 1YI3A 4U41A 2EVAA 3PJ1A 2QD9A 3A7IA 5HE0A 3RKBA 3F88A 5M09A 3JXWA 4MV9A 3O8PA 5BVKA 3PWYA 3LZBA 4CKRA 4OW8A 3BHVA 3FKNA 1NVSA 4RIYA 3TI1A 3PXQA 1T46A 3KB7A 3DLZA 4X3FB 5E8SA 3EN4A 3O23A 2R3QA 4KD1A 5FTGA 3QQMA 2WU7A 4R3CA 4ZJJA 1H0VA 4CXAA 2BKKA 1IYDA 5FEQA 3SLSA 4ZMFA 3UOJA 4K0YA 4AE9A 1JSTA 3DT1A 5A14A 1B6RA 1Z2NX 3JZ6A 1G8AA 5B0XA 2X2MA 5CE8A 5I5WA 2HY0A 4TYJA 1S68A 4TN6A 2E9VA 3CLYA 3HO8A 1BLXA 2UVZA 4IFGA 4AXCA 3HYHA 5CVHA 2VTNA 3LFAA 4MD7E 5ANGA 1CS0A 5BPHA 4GL9A 3C51A 2HZIA 3R5FA 3IKAA 3IW7A 4BTFA 2NPQA 1Z5MA 3TNHA 3ZEPA 3POOA 5AP4A 1XMMA 3KRRA 2WELA 4CFUA 1EZ1A 2W1FA 4JIKA 5HORA 4CQEA 3NBYB 4XG3A 3LHJA 1U46A 3OXZA 5LVMA 2C69A 3FZSA 4G31A 5HESA 2W96B 2R2PA 3KCFA 4GT4A 4CMDA 3R23A 3CQEA 2C0OA 4MXOA 4C35A 3R9RA 3K3IA 5AUUA 4FIHA 3C4EA 4CG9A 5M4CA 3WF7A 3GIDA 2ZM1A 4B8MA 5EM5A 2UW7A 2VAGA 3R2BA 5TOZA 2E9OA 5FDXA 3R30A 3ZM4A 4FMQA 4A7CA 4JQEA 5HG5A 4AZSA 3MA3A 2VTJA 4C61A 4USFA 2V55A 3HP5A 3UMXA 4AT3A 4EZ7A 3QXPA 4JBQA 4UALA 2W4KA 3UZRA 3V3VA 4KAOA 4O7LA 4DEIA 2X8EA 4P5QA 4XCUA 2HIVA 3CXWA 3EL8A 4RA4A 3QZGA 2YIWA 3DPKA 3O7LD 4RJ3A 5C26A 4EOPA 3GI3A 1UU9A 3PXRA 5M56A 4CMTA 2ERKA 1OKZA 4LM5A 4DEAA 5C1PA 3TN8A 4QDVA 3DOGA 2RFEA 4J52A 3C4XA 2P55A 4W8DA 4GU6A 3TT0A 3UODA 3WF5A 5HVYA 4MXXA 1CTPE 3SW4A 4CNHA 4QMYA 3QRIA 2XK6A 5JN2A 4FTUA 2X0SA 4IZ7A 4D2RA 3DBDA 4FKJA 4MXCA 4RWLA 4EOMA 3VS3A 5JVLA 4OT6A 1VJYA 4D55A 3T54A 1FINA 4FIEA 3LXNA 4DITA 3JY0A 4A07A 3PP0A 2C1BA 2FB8A 1P16A 4AOTA 2B52A 2H9VA 1SVEA 4J8MA 2XEZA 3UBDA 3QZHA 3HT5A 4DFYA 4CT2A 2HENA 2Q0NA 2WEIA 1KJ9A 4O4LF 1GSHA 3RM7A 4BKJA 1ZYDA 1G3NA 2PY3A 4PTGA 4NZNA 4TM5A 4CTBA 5TR6A 4UUGA 2PTKA 5A3XA 3Q9YA 1J7LA 4FUYA 2HGXA 3AC1A 2HWPA 2XA4A 3TINA 2PVRA 5D1JA 3Q6UA 3AD6A 3G5DA 3JSLA 3LFEA 3SV0A 1C3OA 4XV3A 3AT2A 3I6UA 3E88A 5FUTA 2ZV8A 4UB7A 3NAXA 3QTIA 2VNWA 2AC3A 3DZOA 3QKMA 4FEVA 3AXWA 2CNQA 3Q4CA 3BGQA 3FSKA 4EH4A 4HVGA 5KCVA 3A7HA 3QX2A 3UG1A 5DGZA 4XV9A 4F99A 5KNJA 1OZ1A 3S95A 3U4WA 2QOIA 3V5QA 4I5CA 1CQIB 2HGWA 3BV3A 2C00A 5J2UF 4FV9A 2BILB 2NNWB 3MWEA 2ZYBA 5CU3A 4AAAA 4DYMA 5HNEA 1DV1A 3WWJA 4K77A 3R8VA 3W18A 2W1HA 2X4FA 1U4DA 4QP8A 4F6SA 5D11A 3FL4A 5KKRB 5I60A 3UZBA 4FTQA 3P7CA 4C4HA 4F6UA 4GJ3A 3HAMA 4FC0A 4IMYA 1SNXA 2R3LA 5JFSA 1WR2A 3T3UA 3LQSA 4UCVA 3W2QA 1JVPP 1KSWA 1AGWA 3QLGA 4AA5A 5FLFA 4H1MA 4O82A 2DQ7X 4X6QC 4O38A 1IA8A 4FTTA 2R85A 2OJIA 3OCGA 3QALE 4X0MA 3WZDA 2LAVA 5KMOA 4XYMB 3G15A 3S00A 2W4OA 4FJVA 2W17A 2CN8A 5FXRA 2UW8A 2CHLA 2ZDQA 1YWVA 4W8EA 5HEZA 4FZAB 5FTOA 4IZOA 3AOXA 4YZBA 3NS9A 4RWIA 1LEZA 2B7AA 2XUUA 3AD5A 4WIHA 4S33A 4QMMA 4U9AA 2RG5A 3BHUA 5FRIA 4BBMA 4QYYA 3A7JA 3P5JC 3W8LA 5BVNA 4CKJA 1JDBB 1UNGA 2YS7A 1IG1A 2PVNA 3E7VA 3FLNC 4XJ0A 3WZJA 4AQKA 5L6OA 3VN9A 5EDQA 5I5ZA 2H8HA 4TYHB 1A06A 2FB9A 3Q4UA 4ZLZA 3H4JA 5HNGA 2XYUA 4CFFA 1AQ1A 5JZNA 2B54A 3PZHA 5D7AA 3KU2A 4TW9A 3SHEA 4LUDA 2WD1A 4J97A 4F4PA 5DISC 2X2KA 3A7FA 3ID6C 2VGPA 5DYJA 4QMSA 4I6BA 2Y6MA 5FGKA 4NM5A 2YL2A 1J1CA 3TY5A 3HP2A 4I23A 4DF3A 4FKRA 3MBLA 4K18A 4YTFA 5AAEA 5DRBA 2YCRA 4MYGA 5JVDF 4ZTQA 4C3FA 3O50A 4WBBB 4I20A 4GMYA 3UNKA 3KMMA 4QP1A 2WMRA 2C47A 3LOKA 3DGKA 4XG2A 4ALWA 2C30A 2XIKA 3UNZA 2JDVA 2PULA 4BDHA 4IFCA 4HGLA 5IA3A 4Y72A 3E87A 4CFVA 4E6AA 2NU9B 5AM6A 3VO3A 2CMWA 2HW6A 2JBPA 3ZTXA 4XNEA 3O5AA 4EOIA 1I2LA 4QSHA 1K3AA 4IE9A 4ITHA 4RG0A 4MA0A 3LAUA 1H25A 5F1ZA 3IGGA 3NYVA 4LQMA 1J91A 2XZSA 3ITZA 5C4LA 3CBLA 3VUIA 1H1PA 3O96A 1UKIA 4YURA 3L9MA 3IECA 4P7EA 4QTEA 5IYZF 3ORLA 1F3MC 3CE3A 5LCKA 1OM1A 4M13A 3ZO1A 3VPCA 2OH0E 3I81A 4H39A 5GJDA 2OH4A 2EXCX 1CKOA 5DGIA 2W9FB 2YIXA 4C36A 3V4SA 5BMSA 4DLKA 3OWJA 4AAYA 5DR9A 4ENYA 3TCPA 1XH4A 1Z9XA 4GVAA 5JH7F 4E4MA 2OBJA 4U42A 2FUMA 2QOLA 3QTRA 3AT3A 4BDJA 4UZHA 1MQBA 3FYKX 3VBXA 1Q8WA 2PE1A 2R7IA 3UE4A 3WWHA 2GNJA 3FMHA 3R7EA 4EK3A 2WTVA 2AEGA 2OU7A 2REIA 4EH8A 3KRWA 3O2MA 3QD0A 3T9FA 2GNIA 4D0WA 4PZ7A 2OGVA 5CEOA 4CKEA 2IW6A 4FZ6A 5J7HA 3VUGA 2BDWA 1H01A 4ANLA 4M0JA 1PXMA 3G2FA 5BVOA 4B9DA 4OTFA 4F0FA 2VD5A 4IANA 5IA1A 2W1ZA 3LMIA 1P4FA 1W83A 3Q6WA 3NRMA 3OXIA 4F7LA 1OL7A 5CASA 4RX8A 2J90A 5AUYA 3QRUA 3Q60A 5AUXA 1IOVA 2GPWA 4EH9A 1I1KA 4L00A 4XG6A 4QP2A 3PLAE 3P78A 1Z57A 3HL7A 1I09A 1UVRA 1ZZLA 2ZVAA 1IRKA 3CKXA 3BHHA 4B99A 4I55F 4I4EA 2OLSA 3T3VA 4ZEGA 2B55A 2GQRA 3KALA 2QOOA 2OJJA 2CGXA 3MS9A 3OTVA 3E92A 3TZ8A 2R7BA 2JKKA 5LVOA 2VR1A 5JGAA 5CA1F 4FR4A 3O17A 1R39A 5BVDA 5I5SA 2B1PA 5ETAA 2X9FA 3ZRLA 1PMNA 5CSWA 4HCVA 2X8IA 3HV5A 3ATSA 5CVFA 4F7SA 3QAME 4IWQA 4YGAA 2YRXA 2WMUA 4MKCA 3I0QA 3ULZA 5BYBA 3FZTA 4CRLA 2GNHA 1PW2A 5IUGA 2YN8A 1PX2A 3IQ7A 5EK7A 4KABA 5LMAA 2PMNX 1E4EB 4N6YA 3MTLA 4NYEA 4CZUA 3OUZA 3E3BX 4XG7A 3V8WA 3WYXA 3MWDA 3HB9A 2Q2TA 3ET7A 4LI5A 3D5WA 4FKUA 1EH4A 5HI2A 3SW7A 3FL5A 5LVNA 4DEDA 1WAKA 5AMNA 2GNFA 2W1EA 3DDPA 4YPDA 5EYDA 4ZSGA 3JZFA 2FP4B 4FICA 5AWMA 4ZS0A 1KT8A 1Z2PX 3FMKA 1APME 3ORMA 4LV8A 4BGGA 2PVLA 3VMMA 5EFQA 3P08A 1ZMUA 3GCPA 4BDAA 4AFEA 3NYXA 4Y8VB 3V01A 3NEWA 2R7LA 4CLJA 1YW2A 5HLPA 3QC9A 1NW1A 3NUUA 5E8ZA 1M0TA 2PZPA 1PRYA 3P4KA 5AM7A 4K6ZA 2PBZA 3GU6A 3G9LX 4IAZA 4UBAA 4ASDA 4IAYA 5K9IA 3R00A 1BUHA 2YIQA 4HJOA 4NWMA 3NUYA 3O8TA 4GIIA 4RFMA 4E20A 5CAVA 3KAJA 5EI2A 5CU6A 2QKWB 2C5YA 3FMNA 1DM2A 4FTMA 4Y83A 5I5YA 2VO3A 3TY8A 2WMQA 2W5HA 2JKMA 4FIJA 2AC5A 4B4LA 2J0KA 4RFZA 4IC7A 3PDTA 5L2SA 2YDJA 2WMTA 1HOWA 5FP6A 3NSZA 3ZZEA 2QO9A 5CXZA 2Y7JA 4CVAA 1XH9A 3JVSA 4MQ2A 3OD6X 3TZMA 3UOLA 2JDSA 4WRSA 4USEA 3OT8A 5CEPA 3OFMA 2C6KA 4HZRA 4QP9A 3KVWA 5IMXA 2I0YA 3Q5ZA 1VKZA 3LMHA 5GJGA 4FSMA 3TNWA 3LCDA 3IDPA 4IHPA 3R8ZA 4RIXA 2VV9A 2WB8A 3GC8A 5IQAA 1P8LA 4FYOA 4CMFA 2C6OA 4KRDA 2YAKA 4FNYA 3R7YA 3KRJA 2VWWA 4QTBA 4ACHA 4PP7A 5CWZA 4AP7A 1ZXEA 3OY3A 5CAQA 3ZBFA 5KZ0A 4RLLA 4ANSA 1O6LA 3KVXA 3V51A 2VWXA 3FMLA 5HG9A 2UZUE 4BYJA 1DS5A 4XV1A 2E9PA 5CU4A 2DWBA 4PL4A 4ZOGA 4IWPA 2UW3A 4QMZA 3AC4A 3WE4A 1OUKA 2V59A 2JITA 3W0RA 2WHBA 4QQCA 3OBGA 1RE8A 1YOMA 5LA6F 5HTCA 4FFOA 3Q2JA 3QQHA 1XK5A 1LP4A 1WBPA 2R3HA 2X2LA 4C5BA 4ZTLA 4LOQA 3V5LA 5M06A 1E4EA 3GC0A 4F7NA 3C13A 3U9CA 4NH1A 3O7LB 5A4CA 2XNOA 3UG2A 1TFFA 5EW9A 1I44A 4MTAA 4YTCA 1IOWA 3EYGA 4GUBA 4WNPA 3TACA 3QWKA 5FR9A 5A46A 3UZOA 4EEQA 3KXMA 3RAIA 5EZYF 2PVMA 2PZIA 4BJJA 3FAAA 4KBCA 5CQWA 1IR3A 4BDBA 1QPDA 2BRHA 3OWLA 4M67A 2W6NA 3KQ7A 4IM2A 5I0BA 3HDMA 3ORPA 4EHEA 1T45A 3GQIA 4MUQA 4ZY4A 4MV8A 1UC8A 2HELA 4JR7A 2VWUA 4FSQA 5KHXA 5AADA 3GCQA 3HBLA 3DAEA 4AS0A 3CTJA