4O81A

Saicar synthetase (type-1) in complex with adp and amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-1) in complex with ADP AND AMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 73
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o81A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o81A02
3K3IA 4QTEA 3NUXA 5EW3A 5IH5A 3UDBA 4QP3A 4EZ5A 2V7AA 4B9DA 3MFUA 3UMXA 2UVZA 4BCKA 5AX9A 2X7OA 2BRNA 4IQ6A 3VN9A 1ZOGA 3DK7A 5EHOA 4AUAA 2J7TA 4O2PA 4C5CA 3KRRA 4GFGA 4MV8A 5D1JA 3EN7A 5AV3A 3RCDA 2FSTX 4EOIA 4IX6A 3QZIA 4E7WA 4FK3A 5E4HA 4YNEA 3HV4A 2JFMA 4HGLA 3EZRA 3I7CA 4FEXA 4KD1A 4M97A 4QQCA 1W0XC 4DEIA 4HQ6A 1M7NA 3SE7A 2ITOA 3G9LX 3G0EA 1SNXA 4JLCA 4F7SA 4ASEA 3GC0A 4R7IA 1GY3A 1Q62A 1H27A 3R9DA 3FZ1A 2AC3A 3CQWA 1FMKA 4EQCA 3QQUA 5EYKA 3OZ6A 3ZOSA 4F7JA 2NO3A 3A7GA 3TIYA 1PXPA 4RJ6A 3OEZA 5EDPA 5HTBA 2BTSA 4NT4A 1QCFA 4DTKA 4RIXA 3VUIA 3WYYA 3FKLA 5AV0A 3N6RA 5LMAA 1QPEA 3KMUA 3RVGA 5CEOA 5A4EA 2BFYA 5M4IA 3O7LB 4ACCA 3FXWA 1PKDA 4IX4A 4HYUA 2XM8A 3LJ2A 5BYYA 3O96A 4FV0A 4RBLA 3G90X 1GAGA 3QFVA 3MI9A 4I6BA 4FTRA 3UODA 2JDSA 2IW8A 4RC2A 3ZRMA 4HVIA 2B52A 2XB7A 3FMJA 4YJSA 4XV3A 3FLWA 3S95A 4FIHA 4EZ7A 4FV4A 1JKKA 1GZ8A 2QQ7A 4TPTA 5IF1A 2IZRA 3QKMA 4C37A 3EN4A 5DR9A 1H26A 2UW3A 3GC9A 5HCYA 1GZKA 3UQFA 3FSKA 4EC9A 4E8AA 4NZWB 2CN5A 2XK7A 4FSTA 3HUBA 4OTRA 5C8NA 5FEDA 3KC3A 4JAJA 4FSZA 4MBLA 5GHVA 3GI3A 3TM0A 3PJ3A 4CLJA 1WVYA 4J96A 2QOBA 3R73A 5E91A 5B2KA 3RAWA 4F7NA 1J7IA 5BUJA 2OLCA 4ASZA 3LCKA 4GG5A 1I7NA 3LM0A 3CE3A 3NNUA 2ITYA 4QP4A 3T9TA 1NVSA 4ZJVA 3FDNA 4ZHQF 4V0GA 4M0ZA 4HNTA 2NRYA 2C4GA 4FKUA 1PKGA 2RG5A 1IA9A 3BV3A 1Q61A 2X39A 3E8NA 4YUQA 1VZOA 4UWBA 2OJIA 2UZOA 3MVLA 4MV4A 4HNUA 4G3CA 1RE8A 4UV0A 4D1SA 2OU7A 2YZLA 4HGSA 3ORXA 5HQ0A 1H1PA 4O83A 4AW1A 2IVSA 2QG7A 2J5FA 4PL5A 2HY0A 3OXIA 3QC4A 2OH4A 4QPAA 4YJOA 5EI2A 3E7OA 2ERKA 3BEGA 2HWPA 5CU3A 3F3WA 5J9ZA 4MA0A 4TNBA 5JZNA 3G15A 2X6DA 4FNXA 3RWQA 4HYHA 5FDXA 5CAVA 1J7UA 1JOWB 3A4PA 5AP5A 1DAYA 2BZKB 4I5HA 4GJ3A 3PXYA 3ATTA 4F99A 5BVFA 3UTOA 2WQOA 2OK1A 3ZS5A 4LL5A 4FUXA 3OP5A 3W32A 4DGOA 5B2MA 3ZH8A 3F66A 2F49A 3DDPA 2QKRA 2YW2A 3SRVA 2A2AA 3BBTB 2PVMA 2XNEA 4KIQA 4L3PA 3V6SA 4F9CA 5JT2A 3DAKA 3BGPA 2X9FA 4FYNA 2J0LA 4W4VA 3ZSIA 4AW5A 2XK6A 3UFXB 3HYHA 4XH6A 4ALUA 4O0VA 3HGKA 4LQMA 3LFDA 4B4LA 2BCJA 5C03A 3GCSA 5LCKA 3R7EA 3E8CA 4M14A 2XH5A 5FLFA 4HNIA 4ZEGA 3ZONA 3CPCA 4D58A 5IMXA 5JZJA 2R7KA 2P4IA 3HV3A 4G6OA 4B6LA 4LGGA 4EBWA 5IQDA 2QONA 3AT3A 4D9TA 3WF9A 3R83A 4TXCA 2X4FA 4PL4A 3IDBA 4I92A 2V5AA 1YDRE 2OZOA 4YTFA 2BUJA 1IOWA 4KKEA 5JVDF 3BELA 4H1MA 3O0GA 3ZSGA 4ZSJA 4QP6A 4LFIA 3AMYA 3FKOA 2A0CX 3G5DA 3R0TA 4JS8A 4ZY6A 4E6QA 3D2KA 3REPA 3QCSA 4IM3A 3UO6A 3QA0A 2R3LA 3BBWA 2PMNX 4LOOA 4ZTMA 1MRYA 3LIJA 5E9EA 3RGFA 4JQEA 4PL3A 3AGMA 5ANJA 5FQDC 3WARA 2CGWA 2JIUA 1NVRA 2PYWA 4EORA 4I4EA 1J91A 1UV5A 3UVPA 3G33A 3VBWA 4CG9A 5EKOA 3W18A 2C00A 3VUHA 4IAZA 1KWPA 3ZXTA 1AGWA 3A8XA 3VUKA 2DWCA 3N4UA 5CI7A 2GHGA 3I1AA 5J2TF 1IA8A 3FHIA 5HVJA 3R1SA 4R5SA 4NJDA 4IEBA 4FI1A 5AP7A 3B2WA 5CX9A 4FMQA 4EOMA 1OKWA 4IAIA 4FSRA 5HG5A 4BVUA 3OF0A 1PHKA 2BRHA 4WBBB 4BIBA 5HVKA 1YDTE 3OWLA 4O4JF 2F7XE 4O7SA 3MFSA 5E1SA 4UX9A 3E5NA 1OBGA 2O63A 3FI2A 5CT0A 2GNLA 5JRQA 1R0EA 1GJOA 2H96A 4GH2A 4FEQA 5KMLA 4GYIA 3ZLSA 4MA5A 3DJ7A 4Q2AA 4CCBA 3S1HA 2H34A 3I7BA 4GT3A 2YABA 5T68A 4BDKA 3V5WA 3TZ8A 4PNIA 4HW7A 1NT2A 3AG9A 3Q4CA 4FG7A 4GU6A 3ACJA 3W2CA 4KIPA 2Z60A 5HCZA 5M07A 3L9NA 3QALE 1STCE 2HENA 3DBDA 5CT7A 4JX7A 4X3JA 1PYEA 4GUBA 2EB3A 3VQHA 5M06A 3O17A 2JDOA 3OW3A 4DHFA 4YJTA 1JSTA 4P5QA 3DBQA 2ITWA 3H9RA 1M7QA 2F2CB 3EQRA 3Q9YA 5BYZA 4USEA 5HZNA 1KV2A 1T45A 3QF9A 3RTPA 3N8DA 1XKKA 2HGSA 1GSOA 3U9CA 2C6TA 4HPUE 2ZDQA 1BI8A 2B7AA 1ZWSA 1JSVA 3F6XA 3G9NA 4EQMA 3AD4A 4O7TA 4NH1A 5AFVA 3RV3A 5E92A 1A9XA 2XIXA 4IWOA 2PVFA 2XK8A 2WMSA 2ZM1A 4L8MA 2WMRA 1IAHA 4FNYA 4S33A 1FQ1B 3F2NA 5C1PA 4W8DA 3PE1A 4C59A 4F6SA 2XIRA 4MBIA 3VS0A 1OGUA 4ZMFA 4FEWA 5CEMA 4YJQA 4IAAA 3QD2B 3DU8A 4FKPA 1AUVA 2PVKA 1L8TA 4MD7E 4PMSA 1YKRA 4ORKA 1EUDB 1E4EA 4R77A 4XZ3B 4QMMA 1U54A 5AA9A 5KMIA 1S9JA 3OMVA 4IAYA 5D12A 4P4CA 2BAJA 3P1AA 2OSCA 4FT7A 4WSYA 1U46A 4YLLA 4UYAA 4ZTHA 4RJ5A 2CKEA 2QOIA 3E3PA 2QHNA 5HNBA 4LOPA 4ZZMA 3SHEA 3K3PA 1U4DA 2VX0A 4YBJA 4ENXA 4YR8A 5CSXA 4X2FA 3HMNA 3QWJA 4GK3A 5CA0F 4PP7A 1WFCA 3IW5A 4M84A 2YZAA 3R30A 3U6HA 4M9UA 5K9IA 3VJOA 3DY7A 3RPYA 2WMWA 3RHKA 3W16A 1DV1A 2X7GA 3TCPA 2W6NA 3WZJA 4R3RA 4GL9A 2GQSA 4FKGA 3BWFA 5GONF 4AZEA 4U42A 3LHJA 2FB8A 4KSPA 3RM6A 4B8MA 2I8CA 2GNJA 5IA5A 1XWSA 5KX8A 2G2FA 2V55A 4FIEA 4DEDA 5M08A 5HG8A 1YW2A 4YLKA 5HBHA 4FZ7A 5J1VA 4RX9A 5H8BA 3JXWA 3CY2A 4ERWA 4DGMA 5AAEA 2HXQA 3RINA 3TJCA 4USFA 2QU6A 4GT4A 1VBHA 2WAJA 1L3RE 4ZTSA 3LQ8A 2NRUA 3BHHA 1CDKA 3PYYA 4CVAA 3KF4A 1FVTA 4LV5A 4YC6A 3DKGA 4ZJIA 3Q9ZA 2QOKA 4UN0C 5HNIX 1OPLA 3BYMA 4AXAA 4ZP5A 4DH8A 3EQGA 4ZY5A 3P08A 4RGJA 4FZAB 3D5XA 4P7EA 5L6WL 4E4TA 1JKTA 4D5HA 3QUEA 3BU3A 3DQWA 3VS5A 4C02A 3DOGA 2G9XA 2YFXA 5E8UA 1OECA 3DFAA 3FEGA 4EGJA 3UGCA 4G17A 2WMVA 4IWDA 4QP8A 4PWNA 4XP2A 2RF9A 4ZTQA 3QYZA 4BC6A 1WBVA 3TZ7A 3VNTA 3RHXA 3ULZA 3A7FA 2IWIA 3KMMA 2PVNA 5CALA 2WQEA 4EWHA 5I9WA 3FMDA 4D0XA 2JC6A 3CD8A 5AM6A 3LXLA 4JJRA 4GUEA 4L3LA 4O4HF 5IQHA 3QXPA 5LMBA 4NFMA 2G01A 4XRJA 5A3XA 3AX6A 3MGYA 1PXOA 5FTQA 2XBJA 4F9AA 3TIZA 1I7LA 4O81A 3GCPA 3WO1A 2CLQA 4MXAA 2QODA 4FTLA 3LFAA 3VJNA 3NLBA 4BGGA 5CF6A 4DGNA 5JFXA 4L00A 1JPAA 5A9UA 3LFQA 5CI6A 3TZ9A 2YN8A 3EN9A 1F5QA 2PHKA 3AD5A 4MD8E 5AV2A 3U6JA 2PVPA 2ITZA 3U9TA 3ALNA 4NJ3A 4C62A 3TW6A 3PXQA 4AU8A 3EL8A 3Q2JA 4I6FA 1PXLA 3PPZA 1KE5A 4NCTA 2R64A 4UXLA 3RALA 3ZZEA 3MY1A 2BKZA 2QLQA 2XS0A 3GQIA 3LLAA 3QU0A 1NY3A 4O22A 2J9GA 4ZLYA 4XG3A 3VOTA 4RA4A 3W2RA 5EZYF 4O21A 5FM2A 4AGDA 3A7JA 4K33A 5KBQA 2WFYA 4I21A 4FA2A 4N0SA 1VJYA 5J95A 5GINE 4LL0A 1YXSA 2R0UA 4QO9A 2B9HA 2XA4A 3QAME 1EH4A 5DT3A 5AV1A 3GU7A 5EHYA 4FX3A 3R8PA 4RWJA 4IACA 4LI5A 4TN6A 3HMOA 5FRIA 2C0TA 3HO8A 2HYYA 4DH1A 3S4QA 4OW8A 5IA3A 2A4LA 4OGRA 4BGHA 3A4OX 5IZFA 5L3AA 5HVYA 2WMUA 2I87A 3RFCA 2WTCA 2ETMA 4Y73A 4ENYA 5EM6A 2C69A 4B99A 5CANA 5FNVF 2YIRA 4R3PA 5DN3A 5E8YA 3ZLXA 4AQCA 4BDBA 5HBRB 2W1FA 2PUIA 1YRPA 2W5BA 4L7SA 1APME 4NM5A 5KHWA 4RVMA 4D28A 4I55F 3ZBFA 5C1QB 3LM5A 4GK4A 3V8TA 4QMXA 5CZIA 5G1XA 5GJFA 3E93A 3F5PA 3PFQA 3E64A 2KTYA 4LOQA 5FM3A 3TNQB 3UOHA 3DF7A 3C4ZA 4DN5A 4EHEA 1V0BA 1KV1A 3COMA 3EMGA 5CF4A 3AMAA 2WMQA 3Q4UA 3FQSA 3D9VA 5KMJA 3DQXA 3F61A 3ZUTA 4TYGA 3QL8A 1URCA 1OVEA 2J9MA 3JYAA 3BHVA 3EQBA 3PXFA 3UPXA 1CS0A 3JRXA 3KL8A 3OS3A 1VYWA 4LRMA 4NSTA 2AUHA 2JIVA 3PWYA 4L44A 4L42A 4C4HA 1OUYA 3L8SA 4OT6A 4LRKA 3KRWA 4YZMA 1Y8YA 4RIWA 3NW6A 1YXTA 4K77A 4KSQA 3WIGA 4A9RA 4ANSA 4D0WA 4EK6A 4QMZA 4GIHA 4N6YA 2BKKA 4JDJA 3AXWA 5ICPA 5J5SA 5LWNA 1ZOEA 4L52A 2QOQA 4XMOA 3NW7A 3JZIA 3JY0A 3IGGA 5BUEA 2OZAA 5CNNA 2PMIA 4YJNA 4KAOA 3DA6A 1KC7A 3NCZA 3K54A 3QTSA 4NYEA 1XBAA 5HI2A 2OIQA 2YDJA 3A2CA 2PUNA 1KUTA 1K2PA 4LG4A 3CGOA 1JVPP 1QPJA 3L8XA 3OTVA 4XG4A 4AGUA 4F9BA 3LCSA 5A14A 5LMKA 4RIYA 1B39A 4X2NA 1VKZA 4XYMB 3VW8A 3PY1A 2CN8A 3R9HA 3ZC6A 1PMNA 3GFWA 4MX9A 3W2QA 4V05A 3W33A 3VBTA 3ETAA 4LUEA 5DFPA 5A4CA 2EVAA 3FUPA 1Y6AA 4ZOGA 4ZLZA 4RJ7A 5CS6A 4EUTA 4K18A 2B0QA 3BLRA 3NNWA 3K2LA 2GS6A 2QI8A 3QTWA 3LKMA 3TV4A 3ORPA 2ETRA 3ZTXA 4ZI7F 3GGFA 2EB2A 1JDBB 2VTHA 2CLXA 2W1GA 4Y85A 1KE9A 4FGBA 1PXJA 4MWHA 4O7WA 5AUUA 2W0JA 3EZVA 3HP2A 4RC3A 4BR3A 3N51A 4DEEA 4ZZOA 4PNKA 3BKBA 2FSOX 3LOKA 3MVMA 5CEQA 1SYKA 3ELJA 1E1VA 4CMOA 4HVSA 5KKRB 2IW9A 1GSAA 4NM3A 4MD9E 1Z2NX 4CNHA 3ORRA 3DXPA 4FTOA 4CRSA 2WD1A 3ZMMA 4CKJA 3PA5A 5KHXA 5J9LA 4FTMA 3QC9A 4FKWA 3WF7A 5IU2A 3R23A 2V0DA 5FXRA 2OLSA 4OT5A 3C13A 3BYVA 4O2ZA 2YIYA 1KJ8A 2UZBA 5BVWA 1KSWA 5CXZA 4FV8A 2PVYA 2GTNA 3MSSA 3PLSA 4IB5A 3U87A 3ZLWA 3FZSA 2YZNA 1Q99A 3OWPA 2BDFA 4FTJA 1OIQA 2VN9A 2C6LA 1GGOA 1SVGA 4OUCA 2J4ZA 3VULA 4ME6A 3FBVA 4IB1A 5GJGA 4CG8A 2DUVA 4TWPA 3CBLA 2YM4A 4C61A 4TZRA 3G8DA 3E8EA 4FIJA 3VS4A 1DV2A 5KBRA 1OMWA 3QTRA 3U4UA 2I0YA 1PK8A 4EJ7A 4DG3E 5L8JA 3CTHA 1A9UA 4GEOA 4CT2A 3W2OA 1T36A 3LP8A 4EI4A 3WF8A 2YZGA 2ZDHA 4JR7A 3OBGA 3PA4A 4L9IA 3SGCA 4RZQA 2ZV2A 2WQNA 2VGPA 4S34A 2VWXA 4I6QA 1UWHA 4KBCA 4OTIA 4Q5EA 4PUZA 4PRJA 5ETCA 3W2SA 3E7VA 4GW8A 4MNEA 4B7TA 2C6MA 2P0CA 3WZUA 1Q8UA 4GFOA 2WQBA 2YDKA 2ITXA 1OL7A 4RPVA 4ANMA 5KCVA 4CFWA 2AC5A 1U5QA 2NU9B 3C4XA 4MVFA 2XKCA 2WYOA 4FKLA 3R2YA 3MH0A 4FTTA 4Z7GA 4HGEA 2IVVA 2IVTA 3JRWA 1H0VA 3Q6UA 2HZIA 1Q3DA 5AJQA 3DGKA 1OITA 4U44A 3KXMA 2Y4IC 2P2IA 2EU9A 3CR0A 4L43A 3FXZA 3UIUA 5KKNB 3PVGA 2YAAA 4FTUA 2J51A 2C3KA 4O96A 3A7HA 2OIDA 4JVGA 3NNXA 1UKIA 4GS6A 3ZSHA 4IMYA 1YHVA 2BRBA 2Y7JA 3COHA 3DNEA 3GT8A 4FV1A 4IBMA 2CKOA 4YJRA 5EH0A 2CZGA 3VRYA 2E9UA 4RVKA 4YJUA 1XH8A 4FVRA 4AN3A 5CZHA 5EI8A 5H80A 2VGOA 4EOPA 4FFRA 4TYIA 2UW0A 5IISA 4F1OA 2XVDA 3NIZA 4JR3A 2CKQA 4O0XA 2BTRA 4IWQA 4EH9A 4I5CA 4QYHA 4MV9A 4FTQA 5DYJA 5HG7A 5L6PA 3QLGA 3SC1A 1UNHA 4U3YA 2I0VA 2YM7A 3N4VA 2J0MB 2QVSE 1TQIA 2HOGA 2W70A 3R8VA 3FLSA 5DI1A 2WXVA 2X7FA 3AT4A 4ZTLA 3AC1A 4FG9A 4BCOA 4BCMA 4BDAA 1WAKA 4YAKB 1NA7A 3ZYAA 2OJ9A 1WBNA 5C27A 3WF5A 5ETAA 4L53A 3HV6A 4MK0A 5H8EA 3HVCA 4HNFA 1SZMA 2BIKB 5KZ0A 4CGAA 3PLAE 2PE1A 4TUYF 1R3CA 3VVHA 4RX5A 3ORQA 2EUFB 4YZCA 2XNPA 2W7XA 3CQUA 4XG6A 3UQCA 5GIPE 3WO0A 3SXSA 5DR6A 2O2UA 5CSHA 2Z8CA 3ZDIA 2IJMA 3PIXA 3CSVA 3V5TA 4XLIA 4JAIA 2O65A 4FL2A 3BRBA 1ZYJA 1E1XA 1OIRA 3FSFA 3R9NA 5M57A 4BGQA 4D4VA 4GRBA 3CP9A 2B1PA 4E26A 2VWYA 3OOMA 4BTMA 4EH8A 2Z7SA 4XX9A 1XH6A 3MA6A 2W9ZB 4DINA 3FKNA 3R6XA 3D7TB 5HX6A 3HDNA 2YYAA 4Y5QA 1Q8YA 3UYSA 2QO7A 3WE4A 3NVMB 5CLPA 5AIKA 2FO0A 4QTAA 4J8MA 3F3TA 2PTKA 2F4JA 2VWIA 2ITVA 2BALA 3OEFX 2GFCA 4DT9A 1ZZ2A 2JAVA 4IZYA 1MRVA 3RPRA 3C0IA 4FT3A 3LFSA 3FQEA 4J8NA 5AP6A 2Z04A 4HCVA 2QU5A 4DH5A 1WZYA 5FBNC 4GK2A 1H28A 3SKCA 4C35A 2G2IA 3VC4A 3EKKA 4FZDB 3ZBXA 2JKQA 3QGYA 2UUEA 1WBPA 4JIAA 3SAYA 4XUFA 4IB3A 5EI6A 1CSNA 3W8LA 3VMMA 3RPSA 3QTQA 3UOLA 2E9OA 3ETJA 4AGCA 2RIOA 2UW8A 2XF0A 4WT6A 5E1EA 4A9TA 3L8VA 2WTDA 3T3UA 3DLSA 3VQUA 2CNVA 1H1WA 3RK5A 3K5HA 2JDRA 3TEIA 4UALA 4I22A 5ETIA 2FB9A 3UIBA 5HE0A 1W82A 3P9JA 2XZSA 3M11A 3KULB 4O0SA 5EDQA 3SX9A 1M6VA 1UVRA 2QC6A 1XH4A 4DCEA 4DFBA 5FDPA 1YQJA 4I20A 4QMLA 4NCTC 5GNKA 2C68A 3F7WA 5T3QA 1ZMUA 2CDZA 4AZSA 5LXMA 5M55A 2OH0E 3S00A 5E8ZA 1OI9A 2VTRA 3FI4A 4FODA 1UWJA 2A19B 2BDWA 3BLQA 4RVTA 3GU6A 3OT3A 3QUPA 1XBBA 4FL3A 4UB7A 4FKRA 4TWCA 4D1ZA 4IM0A 2XRWA 5DNRA 4DFXE 5L8LA 4JI9A 5ETFA 3UNKA 2B9IA 5FG8A 3I79A 2GHMA 4C0TA 5LJJA 3QQFA 4YC8A 4UWCA 1REJA 4F65A 5CAPA 4HJOA 4G6NA 4CV8A 1OB3A 3O50A 3MWDA 2E9NA 2YM6A 5I9VA 4NKSA 3R7UA 4M67A 2VTAA 4DFNA 3LQ5A 1OIUA 2OO8X 3VS6A 3DAEA 2OI4X 3UBDA 3R1QA 5A6NA 5CAOA 3VBQA 2VV9A 2YS6A 2VO7A 4FV2A 4M13A 4XOZA 3RAKA 2W1ZA 4A9YA 3OD6X 2GU8A 4U43A 2W71A 3OTUA 3ZM9A 5F94A 4JRNA 4CFMA 5CAUA 3DZQA 3QQLA 5CEIA 5JMSA 4H1JA 4AA0A 2CGXA 3MTFA 4WNOA 5CY3A 3MJFA 2QG5A 5BPYA 4QMUA 3H30A 2F9GA 2B55A 4U81A 3SXFA 3C4EA 3BZ3A 3NDMA 3U54A 4G3EA 3QZGA 4BZDA 5C1OA 2PY3A 1VR2A 4KINA 4H39A 4RWIA 3UO4A 4EOOA 2W99B 4YP8A 2C0OA 3F5UA 4W4WA 4ANBA 3B8RA 3FAAA 2Y6OA 2R86A 3MH1A 4Y5HA 5EYDA 3GU8A 4BZNA 4CFVA 4DCAA 3QFFA 5M4CA 1LUFA 4GT5A 4O84A 5LVNA 4PMTA 3DKCA 1CKPA 1ZY5A 4HZSA 3D5WA 4K0YA 4DAWA 5D41A 4X2KA 2X81A 2F7EE 1Q8TA 3ORTA 3QRKA 5M4FA 3P4KA 2IZTA 3BG5A 1P2AA 1BNCA 2P55A 1J1BA 4GYGA 2XP2A 3MN3A 2WNTA 3WI6A 4EOQA 2CPKE 3PZEA 3KB7A 1E9HA 4O82A 3CJFA 3GP0A 5FEQA 1NW1A 4CKRA 3TNPC 3UVQA 4QMQA 4EOSA 3CCNA 3OG7A 2CKPA 2J0KA 4G3FA 2ZB0A 5JQ8A 4OTFA 3B2TA 4D2SA 4JDKA 1KJQA 5KZIA 2UZNA 4YSMA 2H6DA 5ANEA 4KB8A 2YRXA 4G16A 2BZJA 2PZPA 3LZBA 4XYFA 5HCXA 4EEVA 1URWA 4N57A 5D7VA 5LMKC 4JQ8A 5CEKA 4I4TF 4YLJA 2EXCX 3KK9A 4IIJF 2XJ1A 1JAMA 3HMMA 4MXZA 1NVQA 1A48A 4NKAA 5EYCA 3U9SA 1YWVA 5EM8A 4FIFA 1IRKA 3OFMA 3A7IA 2HZ4A 4CMTA 4XV1A 1B6SA 4IAFA 2QOOA 2R4BA 3CIKA 3PVWA 4S2ZA 4IZOA 2C30A 1VYZA 4XG2A 2PWLA 4CXAA 2HZ0A 3OVVA 3CPBA 1FINA 4WHZA 3EL7A 4QRCA 5M4UA 2ESMA 4RQVA 5FBOA 2FPIB 1OPKA 5HBJA 3DXNA 4X6RA 5EM5A 1CKIA 4MXOA 5JFSA 3ZCLA 5LWMA 4EKLA 3R5XA 2HJWA 3COIA 4G6LA 3R9OA 1P4FA 4N70A 5D9HA 4D55A 3RJCA 2CJMA 3UNZA 4CEGA 3EFWA 4ARKA 2WTKC 2C6EA 5JQ5A 3TIIA 4WNPA 3R71A 1CQJB 3F3VA 4IH8A 4ZQIA 3RI1A 3PZHA 4QMTA 4ZLOA 3C0GA 1V0PA 2ERZE 5HIEA 3O71A 2CMWA 3PSDA 5E90A 4IC8A 4YU2A 2VTTA 2GLTA 3IO7A 4D5KA 3ZRKA 2XKEA 5BVNA 5IPJA 4OTWA 4EK3A 2R82A 3BEAA 3PJ2A 4FV3A 1V1KA 4ZAUA 2OJGA 4O7VA 4HR7A 1I44A 5CF8A 4JBVA 2FUMA 3CD3A 3F5XA 4XRLA 3UJGA 3O8PA 4K1BA 4V04A 3ZRLA 3RPVA 3IDCA 2JGZA 2C1AA 2VUWA 3R28A 4YNOA 2RL5A 4RG0A 4H3BA 4BI1A 3C1XA 4G5JA 4F9WA 3ROCA 2PL0A 3HEGA 4I6HA 2UZTA 2WB8A 3UQGA 2PULA 3HX4A 3VPCA 1W93A 3C5UA 3PVUA 4HVHA 5IQIA 2XIYA 2XCKA 3R01A 4ONAA 5DT4A 5CENA 3PWDA 2WU6A 4Q9ZA 2OXXA 5JGDA 1Y8GA 3U55A 5IQEA 3DPKA 5CXHA 4BCHA 3WILA 4YJPA 4FU0A 3TINA 4MXYA 4XLVA 5ANIA 2C5OA 4KKHA 4FG8A 4O6EA 4FVQA 5AP4A 2X4ZA 3EQIA 4W4XA 3A60A 3NW5A 4F7LA 3TDWA 4C4GA 2QNJA 2X8DA 3BCEA 4EYMA 4KKGA 2JDVA 3ZXZA 4HCTA 2YIXA 5FXQA 3MY5A 3UVRA 3QKLA 4NUSA 5IH6A 4YTIA 1ZARA 4CKIA 3GLKA 2WMXA 4BIDA 5JH6A 2C3JA 3VW6A 2YIWA 2YL2A 1ZAOA 3DV3A 1XH5A 3ZEWA 5K5NA 4FV6A 1OKVA 2R3PA 4CFUA 5IQFA 3Q9XA 4X3FB 1H1RA 2F57A 2W4KA 3OCBA 4U40A 3MIYA 5DVRA 2VX3A 1K3AA 3LXKA 3NX8A 5I9YA 4FFNA 3DBEA 3UC4A 4KIOA 1XO2B 5AWMA 2GSFA 3KKVA 4AWIA 4JRVA 4IHJF 3F2AA 3IGOA 3O23A 4ZS0A 3WNZA 3DXQA 1Q41A 4I0RA 3V6RA 2NUAB 4OR5A 4O0UA 5EDRA 3RZBA 3ZC5A 3CGFA 2ZV7A 2FYSA 5A4QA 3V8SA 5AP1A 1OIYA 4ACDA 5A6OA 3FZTA 1WVXA 4QP9A 4TV8F 4I1ZA 3DB8A 3D14A 4E6CA 3PPJA 3TACA 3KALA 2YIQA 3FMNA 3UG1A 5EHLA 2ZDGA 4IVDA 3Q2MA 4ACMA 4GU9A 3DTWA 1Q4LA 3HMPA 4P2KA 3RK9A 5HESA 4HOKA 2IG7A 5JFWA 3MB6A 4BDEA 2R87A 3WZEA 1JBPE 4GKIA 1ZLTA 4QSHA 2DYLA 3KXHA 4B0GA 3MWUA 5IUIA 4Y8DA 5AIRA 2Z7RA 4PQNA 3PSBA 4E4LA 3HDMA 4S32A 3R7VA 1RQQA 2Q0BA 4DEHA 3ENMA 4CT1A 5CEPA 3V3VA 4FSQA 4U8ZA 5L6OA 1PY5A 3Q32A 4ANLA 3UNJA 4C5AA 3EQPA 3HNGA 3KRJA 3TXOA 4IDVA 4AT5A 2YCQA 5CB4F 1KEEA 4AW0A 3V51A 4PDOA 3POZA 4FTCA 3GIDA 3ZO4A 1OL5A 2YACA 3Q5ZA 3NIEA 4FNZA 5L8KA 4U6RA 3V5LA 2XNGA 2XK4A 3NNVA 4HPTE 4S31A 2LAVA 3UG2A 1V0OA 3F69A 5LP6F 4R78A 1RW8A 3SG9A 3IOPA 4EUUA 2WKMA 3GOKA 2RFSA 5L2IA 3DZOA 4YURA 3FMHA 4M8TA 1H0WA 2GFSA 2UW5A 3PY3A 2VTNA 2E9VA 4XCUA 4XP3A 5AP0A 5DRBA 3VWAA 4C3RA 2NU7B 1P5EA 2PUUA 3QHRA 4ZY4A 3PXZA 2R7BA 3P0MA 3SXRA 3JPVA 2VR1A 2IP4A 4DGLC 4ZK5A 5IA1A 3NAXA 2HW6A 3IKAA 3E63A 2F7ZE 4P5ZA 4MTAA 5FTOA 3R5FA 2JKMA 3R7YA 3COKA 1GIIA 4M69B 1SNUA 3NAYA 4QNAA 4O7LA 3FY0A 3EN5A 3FMEA 1FMOE 5T6KA 3ID6C 3K5UA 2PVRA 1U5RA 2GHLA 2XEZA 4I23A 4LUDA 3VRZA 5EG3A 4I0TA 5LVLA 4QMVA 4MV3A 1YOMA 3UO5A 4RLLA 4DTBA 5LQFA 4XV2A 5IG1A 1VEBA 3PRFA 1DAWA 3B8QA 3KGAA 3W8QA 1QL6A 1ZZLA 2WOUA 5AUXA 4XEYA 4E20A 1WBTA 5C4KA 1CKJA 4CFXA 2BAQA 4EH5A 5H2UA 4O91A 3DAJA 2JBOA 4E5WA 4FBXA 2HELA 4EOLA 4I5MA 2R3FA 2OICA 4K8AA 4WBNF 3THBA 2BR1A 4PP9A 5KE0A 4BKJA 3NZ0A 4P90A 4BI0A 1IG1A 4U41A 4Y72A 5E8XA 1JKJB 4HGTA 3UP2A 4AN2A 4CV9A 5HV6A 4YTHA 4BF2A 5DEYA 4NFNA 1OL1A 3GCVA 4GSBA 3QCXA 4JDIA 4RWLA 4E1ZA 3VA7A 4M12A 2GPHA 2GTMA 2RFDA 3MVJA 1ZRZA 1WCCA 3FMKA 1W84A 5FEEA 1IEPA 4QYYA 3DS6A 3E92A 4IWPA 1PMUA 3NUAA 4EQUA 4WNMA 5AUWA 3BYSA 5AUZA 3FY2A 2ZM4A 3L9LA 3IOKA 4IFCA 5AMNA 4I93A 4FKQA 4EG0A 4AF3A 1ZYDA 3ORKA 3EYGA 5E7RA 4L67A 1NXKA 4XHKB 2I0HA 3S2PA 2BRGA 2CNQA 2ZMDA 2UZVA 4RJ3A 3HB9A 3FLQA 2R3RA 3R2BA 4H3PA 2O64A 3VS1A 1PXIA 5CWZA 1GNGA 5JGBA 4DLJA 4J99A 5M56A 2BHEA 5HU3A 3EFKA 3A62A 4AX8A 3OW4A 2VWBA 2WEIA 3F3ZA 4FICA 4JG6A 2GCDA 2VWZA 3JVSA 2QF7A 1TQMA 2HK5A 4EHVA 5K4IA 2Z02A 3QKKA 4AOTA 4G9RA 5CTPA 3U6IA 3PJCA 4YAJB 3PSCA 2C6OA 3CJGA 3BU6A 3D15A 5A46A 4RFYA 4CLIA 5IEVA 3SD0A 1OM1A 1G5SA 3GCQA 5CSWA 3GBZA 2I40A 5ANGA 4DLIA 4FOCA 1H08A 3ZO3A 4JG7A 1DM2A 3D0EA 3RAHA 4I50F 3LWBA 5BUIA 3DLZA 4WO5A 4RSSA 2ZOQA 4F1TA 3D83A 4AAAA 2QR7A 3PPKA 1KOBA 2DS1A 1FVRA 2O3PA 3LAUA 4XBRA 4EK4A 4II5A 4ASDA 3P7BA 1GZOA 3CLYA 3FHRA 3ZU7A 2J0IA 4BCIA 4L6QA 2VQDA 3UZRA 4F1MA 2I1MA 1W7HA 5F20A 4APCA 4S30A 5ANDA 5H8GA 1Q97A 4IFGA 3BLHA 2X2LA 2UV2A 3ZUUA 2UZLA 5DBXA 5HICA 4JBOA 4IM2A 3GUBA 4IVCA 4O0TA 4RQKA 3NMUF 4XG8A 4FSNA 4O38A 2REIA 5KUPA 4YO6A 3WE8A 4Y95A 2O8YA 4YPDA 4R7BA 4AGWA 4DEBA 3MJ2A 4DFLA 3SOAA 5M53A 2RFEA 5DOSA 2YERA 3NYNA 3TNIA 1UU7A 1UU8A 2VTIA 3DTCA 2A1AB 2KULA 1PMEA 3R7IA 3TNWA 1XJDA 2YEXA 3UE4A 3WZDA 4DF3A 2VNWA 4L1KA 2BHHA 2VTQA 1G8AA 4QNYA 4QMNA 4BHNA 4DA5A 2VTMA 2ITTA 2I6LA 2HCKA 2JIIA 3ZFMA 2R3KA 3Q6WA 3OCTA 5TKDA 4WD5A 2JKKA 4R1VA 4EH2A 2NPQA 3I6WA 5EQYA 1J1CA 1UNLA 4Z7HA 2B4SB 3GC7A 3R00A 2V58A 2WIHA 5HBEA 4WUNA 5B0XA 5F4NA 5HLWA 3HRCA 3T9IA 2PMLX 3ETHA 5EM7A 3C9WA 1PMVA 3O51A 4EOKA 3JUHA 1CMKE 4O27B 1XH7A 3UMWA 4CRLA 3TUCA 4DFUA 2W6ZA 2VTSA 2YCFA 1FGKA 5EQPA 5CSVA 4JT3A 4TYHB 3U9NA 4EHGA 4M7IA 1JQHA 1H1QA 1RDQE 2R7NA 3FLNC 4R3CA 5EW9A 4WG5A 4K6ZA 5F1ZA 3W55A 1I09A 3R1NA 4ACGA 4JL9A 4AZWA 3A8WA 4DEGA 2OF2A 4WKQA 3LXNA 1W98A 2XRUA 3QRUA 1TKIA 4EK8A 3K5IA 4AZTA 4FSWA 4D2RA 2PZRA 1DIKA 4E6AA 2CSNA 2WELA 1OKZA 4R7HA 4F70A 1M52A 3RK7A 5HLPA 5JSMA 1TVOA 3VS3A 4BBFA 1H1SA 4OBOA 3RMFA 3R21A 4KBKA 2XYUA 3NUNA 4ZIMA 3SG8A 5AP3A 3QYWA 2PBZA 3LQ3A 2R3OA 5ACBC 4RRVA 4A9UA 3GU5A 4FK6A 3ZFYA 1LEZA 4BTJA 4QMOA 4AW2A 1H24A 4LV8A 3BX5A 4QMSA 3IW4A 3EQFA 3VS7A 3V5QA 3WBLA 5IDNA 1Z9XA 4F63A 3HV5A 3F5GA 4E6DA 4FT9A 2W6OA 4CMUA 4CTCA 1KJJA 4CSVA 3NYOA 2FSLX 3ORZA 2WEVA 3CKXA 3QA8A 3T3VA 2Y6MA 2ZDTA 3PIYA 4I0SA 2ZV8A 1AD5A 2J0JA 3LVPA 4KS7A 4XP0A 4FT0A 5DG5A 5DT0A 5BVOA 4IZ7A 2UZDA 1FBNA 2VTPA 4GG7A 4QQJA 4BDDA 3AW8A 4IADA 4OTQA 3Q9WA 4FZFB 3N4TA 1M2QA 4ITHA 4LM5A 3P79A 4BBEA 3NRMA 5FP5A 4FR4A 2ITQA 3F2RA 4E73A 5KMOA 3ALOA 2XNOA 2VO0A 1O6LA 4X7QA 3MW1A 3LW0A 3C5IA 5D8DA 1HCLA 2W1DA 5IUHA 1BI7A 4MWIA 4WBOA 3TKUA 3OWJA 2W5AA 4YTCA 1DS5A 5DRDA 2YM3A 5IUGA 4FVPA 4TWOA 4FFMA 4RZVA 2DQ7X 4G2FA 4J1RA 2UVYA 4O4LF 3AC4A 3QBNA 3CEKA 4E4NA 3QX2A 3OUKA 4E93A 4BDGA 3QRIA 3HUCA 5HIDA 5HU9A 1F0QA 3LJ0A 3MVHA 4ZMEA 5HO7A 1GIJA 2C5VA 3P78A 1KBLA 2HW7A 4U3ZA 4QMYA 4FSMA 4RX7A 2W4JA 2XNNA 1Q24A 2WO6A 5ANKA 2DZDA 3BIZA 3M1SA 3FPMA 4NW6A 5CQWA 5EW8A 5I9ZA 2YM5A 5C01A 1IASA 4A07A 3KREA 4PDYA 5CSPA 3G6GA 3R02A 3V8WA 5HE2A 3ZEPA 2HWOA 4YMJA 4F0FA 4FT5A 2J2IB 4J7BA 2QHMA 4AT3A 2SCUB 3KU2A 4GIIA 3QTXA 5EFQA 4A7CA 3OBJA 4BCJA 3LPBA 2PPQA 3UP7A 3FE3A 4NTSA 3G51A 3MTLA 5AAFA 4EHZA 4EGQA 3LCTA 4C38A 2OIBA 3AC2A 3ODZX 4PY1A 2PE2A 1LP4A 2XBAA 3FMMA 3D4QA 2C0IA 2Z7LA 3G2FA 2OJFE 2IPXA 4FEVA 4IJ9A 4RIXB 4N6ZA 4YPSA 2R3GA 5HO8A 3VHKA 2G15A 1SVEA 2BFXA 3PRIA 4D4RA 2W17A 3D5UA 3FXXA 3HLLA 4QP1A 2UW6A 2WHBA 3MB7A 4IE9A 2OG8A 2FPPB 2R9SA 2A27A 4YC3A 3ERKA 5JKGA 3EH9A 4TV9F 5L2SA 4MF1A 2GNGA 2G1TA 3ZUVA 1YI3A 1J3HA 4XJ0A 4NIFB 1EZ1A 2C6KA 3TTJA 4LMNA 2OXDA 3VAPA 2BVAA 5M51A 4QP7A 2X0SA 4G9CA 5K3YA 4F6UA 3LMGA 2HY81 2GMXA 3C4CA 5C4LA 5HLNA 5K4JA 3FLZA 4V01A 3R8ZA 4TT7A 4YZBA 2VO3A 5FP6A 1BL7A 3GENA 2GNHA 4Z55A 3HAVA 1YHWA 1JSUA 3N9XA 3F7ZA 4YZDA 4LGHA 4IB0A 4F4PA 5KO1A 4X0MA 3GEQA 4Y46A 4AZVA 4M0YA 3V4SA 4NTTA 1H07A 3IONA 3GC8A 1CM8A 3C51A 4HNVA 1EHIA 1YDSE 2YJSA 5IEXA 1G8SA 2JKOA 4HCUA 5FUTA 5CNOA 1PYXA 4YBKA 5EQEA 5CF5A 5CU2A 5TO8A 4KS8A 3SW4A 4O86A 2V7OA 4F08A 4DG0E 4FTIA 4C58A 3Q1KA 4QTBA 4V0GB 5CQUA 2QK4A 4DBNA 3PVBA 3OUZA 5H3QA 4EH4A 3AMBA 2C5XA 2LGCA 3CKWA 3JY9A 3Q53A 4J71A 4RFZA 1M0TA 4D4SA 2VWWA 2UZWE 3KN6A 4DLKA 3NUPA 2J6MA 2ZJWA 1M17A 1MP8A 3AD6A 3FL4A 3MPMA 1VBGA 2NU6B 1AQ1A 4I94A 3KRXA 3ZFXA 4YO4A 4JQ7A 4FV5A 2Y8OA 1HOWA 4DEAA 2WGJA 2WMTA 3EOCA 5IYZF 2JFLA 3QXOA 3D7TA 1R78A 4FKTA 5ANOA 3QRJA 2W05A 2YDIA 1WBOA 3D2IA 3I0QA 4U80A 4FFPA 4H05A 2G2HA 4G3GA 3IQ7A 1PX2A 2VTOA 3KXXA 4GMYA 3E88A 3ANQA 4DFYA 2QKWB 2OWBA 4GJ2A 2YA9A 4FKJA 3LFFA 3V5PA 3POOA 1MRUA 2H8HA 4WRSA 3CQEA 5HD4A 2IW6A 2C6IA 5GIOE 3S0OA 5GJDA 1AUXA 4UEUA 4XG7A 3SRVB 3SV0A 4FEUA 2GNIA 3PA3A 4EYJA 2QOFA 5BMSA 3EFLA 4YHJA 2R85A 3RM7A 4ZSGA 4F0IA 3OY1A 3LCDA 4RFMA 4YZNA 4OBPA 4C36A 2QD9A 4G5PA 4FV7A 1H8FA 3O8TA 4O7RA 4L3JA 3TUDA 5JK3A 4W4YA 3NUYA 4TRLA 3UIXA 4CFFA 1PXNA 5JVLA 1YWNA 1KE7A 4FE2A 5LOVF 2CCIA 4QMPA 4R5YA 3OC1A 4L45A 1LPUA 4EH3A 4O4IF 4WG3A 2R3IA 4FV9A 4BBMA 3R04A 3KULA 2J5EA 1Q5KA 2XMYA 3MH2A 4A9SA 4C5BA 4F6WA 4QT1A 2GQGA 2X6EA 4BDIA 4IHPA 4MNFA 1XH9A 3R5HA 2WQMA 1JLUE 1QMZA 3PJ1A 4E5AX 1W83A 3TNHA 4DGGA 2OKRA 3ZO2A 4OBQA 2X1NA 3KMWA 3P7CA 2C1BA 3NUUA 4DFZE 1UU3A 2R3HA 2VRXA 2QR8A 4J97A 3PUPA 5IQCA 4MV1A 5F9EA 4O0RA 4ANQA 3BGZA 1MUOA 4LYNA 3LFBA 3JR1A 2OBJA 5B2LA 1X8BA 3DNDA 2QO9A 2CNUA 2XIKA 1QPCA 4AZFA 2Q83A 3CXWA 5EOLA 4MXCA 2J90A 3HZTA 3ORNA 4CTBA 1WBSA 2BRMA 2H9VA 4GVAA 3P23A 5JQWA 4UBAA 3KXGA 4WNKA 2XCLA 4CZUA 3OWKA 1JNKA 4BDFA 5IA4A 4DG2E 3QQHA 4O7YA 2GPSA 4N4SA 2ZAZA 5IDPA 5LYJF 3GXLA 3K3JA 5KNJA 5DA3A 4FFOA 3UIMA 3OUUA 3FI3A 2XKFA 2OJJA 4M68A 5FTGA 3EFJA 1J7LA 3I4BA 4FNWA 3AC3A 3EWHA 4QPSA 4QYEA 1C30A 4I3ZA 3FLYA 3I12A 4IVAA 3KF7A 4NU1A 4AE6A 2W06A 4OTGA 1PRYA 2PZYA 4UWYA 3I5ZA 4IZAA 4XOYA 1FVVA 5K5XA 2GPWA 1ZXEA 3FYJX 3PDTA 4TW9A 3FZRA 4AA5A 5JH7F 3RP9A 5KX5F 2V62A 3GVUA 4FKSA 3PJ8A 4A4OA 2VX1A 4BCPA 1GLVA 1B38A 3KEXA 4KNBA 5BNJA 3QRTA 5IA2A 2BZHB 3QX4A 2WU7A 4H36A 3ZM4A 2UW9A 3UPZA 1M2RA 2EXMA 4XYLB 4Q9SA 1R1WA 4GCJA 4YBZB 4AACA 5D11A 3M2WA 3MS9A 2ZVAA 2EWAA 3Q4TA 2PU8A 4APPA 5C8YF 2W6QA 5EKNA 2E2BA 1OKYA 2W96B 3OCGA 4ITJA 4OLIA 3P7AA 2P2HA 5LVPA 3WIKA 1S9IA 4FC0A 4RX8A 5FXSA 5IH4A 1BLXA 2Y4IB 3NSZA 1F3MC 1O6YA 3AC5A 3E62A 3O2MA 4FSUA 3W1FA 3OCSA 4C33A 1MQ4A 3NS9A 4JNWA 5JRSA 1DI8A 4U5JA 3UC3A 3TG1A 2VNYA 3DK3A 3KFAA 4E4MA 2JDTA 2B53A 3IG7A 4UYNA 4QMWA 2RKUA 5DMXA 4GKHA 4MQ2A 4IIRA 1ZY4A 1YWRA 3H0ZA 1E4EB 4XX0B 3ZDUA 1WVWA 3LLTA 1U54B 1YOJA 3BI6A 3QQJA 4FTAA 4O0YA 4JXFA 5C9CA 3KCKA 3PP0A 3AGLA 1B6RA 1YXXA 3C50A 5A4TA 4EOJA 4A4LA 3FC1X 3BU5A 1JLLB 1H25A 3HP5A 3PG1A 5EOBA 4FIIA 1PW2A 3KN5A 2SRCA 2W4OA 2C6DA 2OF4A 3ORLA 5E8SA 5JFVA 2XK3A 4WG4A 4JG8A 4IX3A 4KWPA 2CGUA 5TOZA 4F9YA 5M09A 4RWKA 3VO3A 4BDJA 4FOBA 5KKRC 4O7NA 4PMMA 4RJ4A 5CVGA 5I9UA 1SMHA 4BTFA 3G8CA 3PXKA 4K9YA 1R0PA 4JBPA 2WZJA 2IZSA 2FP4B 2R2PA 1GOLA 4KRDA 2W1HA 4JX3A 4O2BF 2ZV9A 3SDJA 2PMOX 5B7VA 3MJ1A 2R3QA 4MCVA 3QTZA 2IO6A 1OZ1A 2OW3A 4I4FA 1M2PA 2WTJA 4PV0A 3D94A 5E8VA 1HCKA 3MV5A 5ITAA 2R3MA 1JWHA 3BPRA 2YJRA 3EQCA 3RAIA 5BPFA 3IW8A 2JLDA 5J7HA 2C3LA 2PSQA 3C7QA 3EN6A 4WRGA 4PTCA 3FV8A 3R8LA 4TKSA 3MPTA 2IVUA 4FYOA 3BHYA 2J50A 4KRCA 4K11A 3HECA 3PE2A 1KJ9A 4H3QA 4E5BA 3MIAA 4A06A 4HVGA 1XQZA 5L2WA 4KA3A 4EKKA 3AC8A 2BROA 5I0BA 3FPQA 3MWEA 2NNWB 2BAKA 3DBFA 4C3PA 3H10A 2HZNA 2GQRA 2C5YA 5FD2A 4Y8VB 3PXRA 3HA8A 3EHAA 4EH7A 2R0IA 4EJNA 4EWQA 2QO2A 3PTGA 3OROA 4FL1A 3ULIA 2BDJA 4AP7A 4C4JA 2OFVA 3RV4A 4C7TA 1M14A 1Y57A 3ROYA 5D7AA 3M42A 4FZ6A 3GOPA 3LCOA 3OT8A 3HRBA 3KRLA 5CA1F 3KAJA 2VU3A 3F3UA 4UY9A 3EJ1A 3FZPA 5HORA 4D1XA 4PX6A 5IQBA 4IJPA 3RKBA 3KXZA 3TT0A 3BYOA 5DH3A 2XJ0A 2B9FA 4G34A 3FC2A 3ATSA 3FWQA 5CVFA 2DIKA 2XNBA 4ZS4A 2WOTA 3IW6A 4AA4A 4JOAA 3D7ZA 5LVMA 3A99A 4IC7A 3Q3BA 4O6LA 3IDPA 4RA5A 2QOCA 4ACHA 3RNIA 3TUBA 3QUDA 5CU0A 1YI6A 2Y0AA 3HAMA 3R1YA 1ZYCA 3T8OA 4RC4A 4FGRA 3W2PA 1GSHA 2I80A 4MXXA 3EB0A 4X3FA 2R3NA 4YB8B 1O6KA 2B54A 1ZOHA 1UU9A 2X8EA 3I6UA 3GB2A 4QYFA 2Z2WA 3TI1A 4J98A 4TL0A 5LCJA 3G0FA 3ORMA 3R7OA 4J95A 3E8DA 4PMPA 2XM9A 3KVXA 2ONLA 3JZFA 2X8IA 4BCQA 2X2MA 2OXYA 2W1CA 2WTIA 5HD7A 1JKLA 4EK5A 4IVBA 1RJBA 1R39A 3NYXA 3U51A 4C2WA 2PZIA 5E8TA 4TY1A 4ZTNA 2O5KA 3VUDA 3ZZWA 5KMKA 3U8WA 5CAEB 4DIMA 5JQGF 1WBWA 3LJ1A 4PF4A 5AUTA 3IW7A 4BI2A 3BE9A 3VBYA 3KAKA 2B9JA 4C4EA 5CAQA 3TKIA 4HYSA 5CYIA 4TYEA 3NYVA 4C4FA 3R63A 5J87A 3H9FA 4GVJA 2E9PA 2I7QA 3MBLA 1MQBA 2VTJA 2P33A 3F9NA 5HE1A 1Q3WA 1XHAA 1B6CB 4U97A 3NEWA 4EC8A 2NU8B 4MH7A 5DE2A 4BDCA 2XEYA 3IK3A 4ZSLA 4USDA 2GDOA 1ERKA 3P5KA 4OTHA 2VWVA 1XBCA 5J1WA 2PK9A 5DGZA 3II5A 3UYTA 4D4YA 1ZMWA 1U59A 3NGAA 2P3GX 5H9BA 3TTIA 2RFNA 2JEDA 2O0UA 3U4WA 2QURA 2YM8A 5DIAA 3HBLA 2CGVA 3GU4A 3KVWA 4O7ZA 1GZNA 3FYKX 2W5HA 4ZTRA 4UXQA 4YHFA 5BQ0A 1ATPE 4ID7A 4TYJA 4UZDA 4PTGA 4WIHA 3WYXA 2ZMCA 2R7LA 4EBVA 2NP8A 4TWNA 1M0WA 3D5VA 2QCSA 4GFMA 3HV7A 4RIWB 2HIWA 3CC6A 3GFEA 3R22A 1O9UA 2W1IA 3MPAA 1Q8WA 3TV6A 4BN1A 3SVVA 4AFEA 4MKCA 3Q04A 4ZZNA 3CTJA 4TNDA 1Z57A 4IZ5A 3R8MA 3VIDA 2Z7QA 4K2RA 2OZAB 3ORIA 4IDTA 4QTCA 3AT2A 3NR9A 5DEWA 4C3FA 1BMKA 2WMBA 2WTWA 3KCFA 5BX0A 2YS7A 2BILB 2OFUA 3DFCB 3QCQA 4MQ1A 5AM7A 2IZUA 2R7IA 4W8EA 5AX3A 2XIZA 3MDYA 4X2JA 3EQHA 3OHTA 4BIEA 4BB4A 4DH7A 4EZ3A 5AEPA 5I5ZA 4NK9A 4RLKA 5I4NA 1OL2A 2GS7A 3TL8A 4CQEA 3QTUA 4E4XA 3HA6A 1Z5MA 5BMMA 4RIYB 3NPCA 4G31A 5CU4A 3MESA 3BQRA 2XJ2A 4ALWA 2WIPA 3RUPA 4ZXTA 1Q8ZA 3DJ5A 2ITNA 4QQ5A 3BV2A 4ERKA 3ODYX 3TDVA 4Z9LA 1OUKA 1OPJA 3QQKA 5HEZA 2FSMX 3CY3A 3WOWA 4BYIA 2W9FB 4C34A 4L68A 3ZHPC 1YXVA 4AT4A 3JVRA 2YZMA 3BWJA 3SLSA 2FGIA 5AUYA 4FTKA 1YXUA 4NW5A 3L8PA 3ZO1A 3PG3A 5J9YA 5DPVA 3H9OA 2VO6A 3FMLA 2CHLA 4U0IA 2I0EA 2JBPA 1SM2A 4AG8A 1UKHA 4EL9A 1KE6A 2VPQA 4AFJA 2DWBA 2ITUA 2PVJA 5J8IA 4YJ2F 2WTKB 2JITA 4R1YA 4WOVA 3ZLYA 2XYNA 4DC2A 5DHJA 2YWPA 5C8KA 1Z2OX 1FGIA 4G1WA 3DKFA 3SOCA 3TKHA 3Q4ZA 3R8UA 4C4IA 4KABA 1YVJA 4FUYA 1YI4A 4B8LA 1FOTA 3OUNB 3Q96A 1IAJA 5CU6A 4DE4A 4RT7A 3LFEA 1KOAA 3BHTA 3F82A 3KK8A 1H4LA 1SVHA 3UZPA 4QQTA 4BICA 4ZSAA 4IAKA 4R6VA 4U79A 1ZYSA 4YGAA 1ULZA 4MV6A 4Q5HA 3Q52A 5LOHA 3CS9A 3VHEA 2ZM3A 3QWKA 1H01A 3FJQE 3OY3A 1DI9A 2P0AA 3DT1A 5IQGA 2PVLA 4YJ3F 3VUGA 2AYPA 3E3BX 3I81A 4YSJA 2HAKA 2PN1A 4JDHA 2BIYA 2PZ5A 2V22A 1FPUA 3VBVA 3RCJA 1T46A 3Q5IA 4X2GA 3LXPA 2ZYBA 4EONA 5AADA 2GS2A 4RMZA 5AV4A 5KMNA 2FH9A 4RVLA 3KXNA 1BUHA 2WTVA 3DBCA 3ET7A 4KBAA 3BHUA 4BRXA 4BCFA 1KJIA 4GV1A 4YHTA 2C5NA 4JIKA 2Y4PA 4O2AF 3MY0A 1PXKA 4MNEB 3H3CA 1ND4A 4FTNA 2PUPA 2W6MA 1CTPE 3LFCA 3QCYA 1EUCB 1BXRA 4LRJA 2R3JA 3C4WA 5EYMA 1BL6A 4I24A 4HYIA 5EK7A 3P86A 5HG9A 1IOVA 3DDQA 3O7LD 1Y6BA 2XCHA 4MEDA 2VTLA 3LMIA 4NM0A 2R84A 1OBDA 3ENHA 2BZIB 4X21A 5ACKA 2R7MA 4L01A 5KMMA 1UA2A 4XBUA 2WMAA 2Y9QA 2FPGB 3L9MA 1PJKA 4BCNA 4M15A 3RPOA 2R5TA 5TT7A 2YWVA 5BYLA 1OL6A 2UW7A 3MFTA 3NVKI 2XKDA 3BQCA 2ITPA 3F88A 3FI8A 2UW4A 2XNMA 4F64A 3EYHA 2QLUA 2VZ6A 5DR2A 1CQIB 1BKXA 4O0WA 5AP2A 3WF6A 1LEWA 3UZTA 3C0HA 2HXLA 4HZRA 4RZWA 5BVEA 3BYUA 3GCUA 4C2VA 3I0OA 4CFNA 4L7FA 3GQLA 2X2KA 5TF9A 2YRWA 2GNFA 1KE8A 3K5VA 4CD0A 3TIGA 1IR3A 2RGPA 1PXMA 2ZDUA 4NM7A 1QPDA 3IPHA 4FFLA 3H0YA 1WMKA 3HMIA 4Z3VA 2XD4A 4PTEA 4X6QC 3V4ZA 3VUMA 3MFRA 3QD0A 1Z2PX 1BYGA 1YOLA 3BE2A 4L46A 3E87A 5HX8A 3IS5A 3TJDA 2W6PA 3GNIB 5AAGA 3VF9A 3I5NA 3MH3A 3VPBA 5DLSA 2X0GA 3WZKA 4BYJA 4AN9A 4QOXA 3V01A 5E8WA 1TQPA 3HKOA 4BTKA 3FL5A 3O8UA 1ZMVA 1EYZA 3R9RA 4EH6A 1YHSA 3OXZA 1Y91A 3TN8A 3VS2A 4FKVA 4IX5A 4MAOA 2C3IB 3LFNA 3CTQA 3TZMA 1P4OA 3MYGA 3QD3A 5IA0A 5CASA 3BGQA 3NWWA 5JGAA 5HE3A 4BY9E 1LR4A 3ANRA 2XUUA 3HL7A 1REKA 1XR1A 3ACKA 4RIOA 5G6VA 5IQAA 4BZOA 2RG6A 4DTAA 1W8CA 4LMUA 2OGVA 4MAMA 2YCSA 5L2TA 3S3IA 4AS0A 5HTCA 5IEYA 4Y83A 3KY2A 2V5QA 4DITA 4FKIA 2C47A 5AA8A 5HIBA 3FQHA 1G3NA 2UZEA 2ETKA 4G3DA 4I5PA 4XV9A 4MV7A 2ACXA 2BPMA 4TYHA 4PDSA 1UNGA 4IW0A 3I60A 3L1SA 4BHZA 2Q0NA 4U7ZA 3OOGA 3DB6A 4H58A 4QYGA 4DT8A 3RWPA 4XG9A 4F09A 3PP1A 4XNEA 3EKNA 5AUVA 3VF8A 4M3QA 3QQGA 3EQDA 4A4XA 1C3OA 2IN6A 3QHWA 2JAMA 5LARA 4ITIA 3PIZA 3C4FA 2PVHA 4J52A 3UOJA 4QTDA 3AQVA 5CVHA 3JS2A 1GIHA 1H00A 3AOXA 2XK9A 4WUAA 2BMCA 2WPAA 4I41A 4WA9A 4OTDA 5HKMA 5I9XA 3LE6A 3QZFA 5HHWA 3UOKA 4FIGA 2W1EA 2FA2A 5J2UF 5A4LA 4ZJJA 3V04A 4IANA 3PY0A 2UVXA 2QOLA 4MBJA 4ZOLF 4PDPA 4DH3A 5TR6A 5FGKA 2ZB1A 3SQQA 2YCRA 3HRFA 2YAKA 3Q60A 4U9AA 5LVOA 3DCVA 4ASXA 5IMEA 1W96A 3LMHA 3KQ7A 4BDHA 2V59A 5M44A 3H4JA 1PF8A 4NL0A 5BVDA 3A61A 4YJVA 3TWJA 2JD5A 2VAGA 3NCGA 3QGWA 4ALVA 4DYMA 4MYGA 4F0GA 3G6HA 3TV7A 5C26A 5D10A 4MHAA 1A06A 5C8MA 4CCUA 5JN2A 5LXTF 4FKOA 4TTHB 5LA6F 3NUSA 4NWMA 2CCHA 3Q2OA 4ZSEA 4BCGA 2QOHA 4QP2A 4X3FC 1BX6A 1CE8A 3DKOA 3QLFA 3ITZA 2F2UA 5HNGA 3OXTA 4HVDA 3KA0A 1K9AA 4AOIA 5A54A 3SW7A 1SCUB 5BPHA 3E5AA 1JKSA 4AOJA 3FZOA 2ONLC 3L9PA 2FVDA 2PE0A 2YISA 2YITA 4RJ8A 5F95A 5BMVF 2UZUE 3DJ6A 1JDEA 2DLNA 3QZHA 5DWRA 3VBXA 2VWUA 2X9EA 3IECA 5HGIA 4Z16A 3TQTA 4YZ9A 4UZHA 3V5JA 4XS2A 5JEBA 4U45A 4KUJA 4CZTA 3W10A 1WR2A 3EIDA 4DBXA 1P14A 3DK6A 2VD5A 3MA3A 4JBQA 4D9UA 4FSYA 4AE9A 3SA0A 3QTIA 3QD4A 5BVKA 4J53A 2YHVA
chains in the Genus database with same CATH superfamily
3K3IA 4QTEA 3NUXA 5EW3A 5IH5A 3UDBA 4QP3A 4EZ5A 2V7AA 4B9DA 3MFUA 3UMXA 2UVZA 4BCKA 5AX9A 2X7OA 2BRNA 4IQ6A 3VN9A 1ZOGA 3DK7A 4AAYA 5EHOA 4AUAA 2J7TA 4O2PA 4C5CA 3KRRA 4GFGA 4MV8A 5D1JA 3EN7A 5AV3A 3RCDA 2FSTX 4EOIA 4IX6A 3QZIA 4E7WA 4FK3A 5E4HA 4PZ7A 5BWXA 4YNEA 3HV4A 3CSWA 2JFMA 4HGLA 3EZRA 3I7CA 4FEXA 4KD1A 4M97A 4QQCA 1W0XC 4DEIA 4HQ6A 1M7NA 3BABA 3SE7A 2ITOA 3G9LX 3G0EA 1SNXA 4JLCA 4F7SA 4ASEA 3GC0A 4R7IA 1GY3A 1Q62A 1H27A 3R9DA 3FZ1A 2AC3A 3CQWA 1FMKA 4EQCA 3QQUA 5EYKA 3OZ6A 3ZOSA 4F7JA 2NO3A 3A7GA 3TIYA 1PXPA 4RJ6A 3OEZA 1ET0A 5EDPA 5HTBA 2BTSA 4NT4A 1QCFA 4DTKA 4RIXA 3VUIA 3WYYA 1A3GA 3FKLA 5AV0A 3N6RA 5LMAA 1QPEA 3KMUA 3RVGA 5CEOA 5A4EA 2BFYA 5M4IA 3O7LB 4ACCA 3FXWA 4AXDA 1PKDA 4IX4A 4HYUA 2XM8A 3LJ2A 5BYYA 2XANA 3VPDA 3O96A 4FV0A 4RBLA 3G90X 1GAGA 3QFVA 3MI9A 4I6BA 4FTRA 3UODA 2JDSA 2IW8A 4RC2A 3ZRMA 4HVIA 2B52A 2XB7A 3FMJA 4YJSA 4XV3A 3FLWA 3S95A 4FIHA 1TAEA 4EZ7A 4FV4A 1JKKA 1GZ8A 2QQ7A 4TPTA 5IF1A 2IZRA 3QKMA 4C37A 3EN4A 5DR9A 1H26A 2UW3A 3GC9A 5HCYA 1GZKA 3UQFA 3FSKA 4EC9A 4E8AA 4NZMA 4NZWB 2CN5A 2XK7A 4FSTA 3HUBA 4OTRA 5C8NA 5FEDA 3JSLA 3KC3A 4JAJA 5FR9A 4FSZA 4MBLA 1IYEA 4UCVA 5GHVA 3GI3A 4BJJA 3TM0A 4AXCA 3PJ3A 4CLJA 1WVYA 4J96A 2QOBA 3R73A 5E91A 5B2KA 3RAWA 4F7NA 1J7IA 5BUJA 2OLCA 4ASZA 3LCKA 4GG5A 1I7NA 3LM0A 3CE3A 3NNUA 2ITYA 4QP4A 1OGYA 1NVSA 3T9TA 3FDNA 4ZJVA 5FPRA 4V0GA 1V9PA 4ZHQF 4M0ZA 4HNTA 2NRYA 2C4GA 4FKUA 1PKGA 2RG5A 1IA9A 3BV3A 1Q61A 2X39A 3E8NA 4YUQA 1VZOA 4UWBA 2OJIA 2UZOA 3MVLA 4MV4A 4HNUA 4G3CA 1RE8A 3AKLA 4UV0A 4D1SA 2OU7A 2YZLA 4HGSA 3ORXA 5HQ0A 1H1PA 4O83A 4AW1A 2IVSA 2QG7A 2J5FA 4PL5A 2HY0A 3OXIA 3QC4A 2OH4A 4QPAA 4YJOA 5EI2A 3E7OA 2ERKA 3BEGA 2HWPA 5CU3A 3F3WA 5J9ZA 5BWWA 4MA0A 4TNBA 5JZNA 3G15A 2X6DA 4FNXA 4E6NA 3RWQA 4HYHA 5FDXA 5CAVA 1J7UA 1JOWB 3A4PA 3NFGB 5AP5A 1DAYA 2BZKB 4I5HA 4GJ3A 3PXYA 1UC9A 3ATTA 3W1BA 4F99A 5BVFA 3UTOA 2WQOA 2OK1A 3ZS5A 1KTAA 4LL5A 4FUXA 3OP5A 3W32A 4DGOA 5B2MA 3ZH8A 3F66A 2F49A 3DDPA 2QKRA 2YW2A 3SRVA 2A2AA 3BBTB 2PVMA 2XNEA 4KIQA 4L3PA 3V6SA 4F9CA 5JT2A 3DAKA 3BGPA 2X9FA 4FYNA 2J0LA 4W4VA 3ZSIA 4AW5A 2XK6A 3UFXB 3HYHA 4XH6A 4ALUA 4O0VA 3HGKA 4LQMA 3LFDA 4B4LA 2BCJA 5C03A 3GCSA 5LCKA 3R7EA 3E8CA 3BLAA 2XH5A 4M14A 4HNIA 5FLFA 4ZEGA 3CPCA 3ZONA 4D58A 5IMXA 5JZJA 2P4IA 3HV3A 2R7KA 4G6OA 4B6LA 4LGGA 4CKBA 4EBWA 5IQDA 2QONA 3AT3A 4D9TA 3WF9A 3R83A 4TXCA 2X4FA 4PL4A 3IDBA 4I92A 2V5AA 1YDRE 2OZOA 4YTFA 2BUJA 1IOWA 4KKEA 5JVDF 3BELA 4H1MA 3O0GA 3ZSGA 4ZSJA 4QP6A 4LFIA 3AMYA 3FKOA 2A0CX 3G5DA 3R0TA 4JS8A 4ZY6A 4E6QA 3D2KA 3REPA 3QCSA 4IM3A 3UO6A 3QA0A 2R3LA 3BBWA 2PMNX 4LOOA 4ZTMA 1MRYA 3LIJA 5E9EA 3RGFA 4JQEA 3DTFA 5D1OB 4PL3A 3AGMA 5ANJA 5FQDC 3WARA 1TA8A 5CE8A 2CGWA 2JIUA 1NVRA 2PYWA 4EORA 4I4EA 1J91A 1UV5A 3UVPA 5BWRA 1G8KA 3G33A 3VBWA 4CG9A 5EKOA 2YS7A 3W18A 2C00A 3VUHA 4IAZA 1KWPA 3ZXTA 1AGWA 3A8XA 3VUKA 1CKOA 2DWCA 3N4UA 5CI7A 2GHGA 3I1AA 5J2TF 4WHXA 1IA8A 3FHIA 5HVJA 3R1SA 4R5SA 4NJDA 4IEBA 4FI1A 5AP7A 3B2WA 5CX9A 4FMQA 4EOMA 1OKWA 4IAIA 4FSRA 5HG5A 4BVUA 3OF0A 1PHKA 2BRHA 4WBBB 4BIBA 5HVKA 5DGIA 1YDTE 3OWLA 4O4JF 4UCTA 2ZFYA 2F7XE 4O7SA 3MFSA 5E1SA 5K3WA 4UX9A 3E5NA 1OBGA 2O63A 3FI2A 5CT0A 2GNLA 5JRQA 1R0EA 1GJOA 2H96A 4GH2A 4FEQA 5KMLA 4GYIA 3ZLSA 4MA5A 3DJ7A 4Q2AA 4CCBA 3S1HA 2H34A 3I7BA 4GT3A 2YABA 5T68A 4BDKA 3V5WA 3TZ8A 4PNIA 4HW7A 1NT2A 3AG9A 3Q4CA 4FG7A 4GU6A 3ACJA 3W2CA 4KIPA 2Z60A 5HCZA 5M07A 3L9NA 3QALE 1STCE 2HENA 3DBDA 5CT7A 4JX7A 4X3JA 1PYEA 4GUBA 2EB3A 2AEGA 3VQHA 5M06A 3O17A 2JDOA 3OW3A 4DHFA 4YJTA 1JSTA 3S24A 4DQNA 4P5QA 3DBQA 2ITWA 3H9RA 1M7QA 2F2CB 3EQRA 3Q9YA 5BYZA 4USEA 5HZNA 1KV2A 1T45A 3QF9A 3RTPA 4JXUA 3N8DA 1XKKA 4Q4DA 2HGSA 1GSOA 3U9CA 2C6TA 4HPUE 2ZDQA 1BI8A 2B7AA 3T7AA 1ZWSA 1JSVA 3F6XA 3G9NA 4EQMA 3AD4A 4O7TA 4NH1A 5AFVA 3RV3A 5E92A 1A9XA 2XIXA 4IWOA 2PVFA 2XK8A 2WMSA 2ZM1A 4L8MA 2WMRA 1IAHA 4FNYA 4S33A 1FQ1B 3F2NA 3UDTA 5C1PA 4W8DA 3PE1A 4C59A 4F6SA 2XIRA 4MBIA 4JMQA 1OGUA 3VS0A 4ZMFA 4FEWA 5CEMA 4YJQA 4IAAA 3QD2B 3DU8A 4FKPA 1AUVA 2PVKA 1L8TA 4MD7E 4PMSA 1YKRA 4ORKA 1EUDB 1E4EA 4R77A 4XZ3B 4QMMA 1U54A 5AA9A 5KMIA 1S9JA 3OMVA 4IAYA 5D12A 4P4CA 2BAJA 3P1AA 2OSCA 4FT7A 4WSYA 1U46A 4YLLA 4UYAA 4ZTHA 4RJ5A 2CKEA 2QOIA 3E3PA 2QHNA 5HNBA 4LOPA 4ZZMA 3SHEA 3BACA 1U4DA 3K3PA 2VX0A 4YBJA 4ENXA 4YR8A 5CSXA 4X2FA 3HMNA 3QWJA 4GK3A 3TW7A 5CA0F 4PP7A 1WFCA 3IW5A 4M84A 2YZAA 3R30A 3U6HA 4M9UA 5K9IA 3VJOA 3DY7A 3RPYA 3RR5A 2WMWA 3RHKA 4QDVA 3W16A 1DV1A 2X7GA 3TCPA 2W6NA 3LULA 3WZJA 4R3RA 4GL9A 2GQSA 4FKGA 3BWFA 5GONF 5I5UA 2DABA 4AZEA 4U42A 3LHJA 2FB8A 4KSPA 3RM6A 4B8MA 2I8CA 2GNJA 5IA5A 1XWSA 5KX8A 2G2FA 2V55A 4FIEA 4DEDA 5M08A 5HG8A 1YW2A 4YLKA 5HBHA 4FZ7A 5J1VA 4RX9A 5H8BA 3JXWA 3CY2A 4ERWA 3WWIA 4DGMA 5AAEA 2HXQA 3RINA 3TJCA 4USFA 2QU6A 4GT4A 1VBHA 2WAJA 1L3RE 4ZTSA 3LQ8A 2NRUA 3BHHA 1CDKA 3PYYA 4CVAA 3KF4A 1FVTA 4LV5A 4YC6A 3DKGA 4ZJIA 5KS8A 3Q9ZA 2QOKA 4UN0C 5HNIX 1OPLA 3BYMA 4AXAA 4ZP5A 4DH8A 3EQGA 4ZY5A 3P08A 2X5RA 4RGJA 4FZAB 3D5XA 4P7EA 5L6WL 4E4TA 1JKTA 4D5HA 3W0SA 3QUEA 3BU3A 3DQWA 3VS5A 4C02A 3DOGA 2G9XA 2YFXA 5E8UA 1OECA 3DFAA 3FEGA 1EKVA 3UGCA 4EGJA 4G17A 2WMVA 4IWDA 4QP8A 4PWNA 4XP2A 2RF9A 4ZTQA 3QYZA 4BC6A 1WBVA 3TZ7A 3VNTA 3RHXA 3ULZA 3A7FA 2IWIA 3KMMA 2PVNA 5CALA 2WQEA 4EWHA 5I9WA 3FMDA 4D0XA 2JC6A 4CHIA 3CD8A 5AM6A 3LXLA 4JJRA 4GUEA 4L3LA 3LQSA 4O4HF 5IQHA 3QXPA 5LMBA 4NFMA 2G01A 4XRJA 5A3XA 3AX6A 3MGYA 1PXOA 3GB8B 5FTQA 2XBJA 4F9AA 3TIZA 1I7LA 4O81A 3GCPA 3WO1A 2CLQA 4MXAA 2QODA 4FTLA 3LFAA 3VJNA 3NLBA 4BGGA 5CF6A 4DGNA 5JFXA 4L00A 1JPAA 5A9UA 3LFQA 5CI6A 3TZ9A 2YN8A 3EN9A 1F5QA 2PHKA 3AD5A 4MD8E 5AV2A 3U6JA 2PVPA 2ITZA 3U9TA 3ALNA 4NJ3A 4C62A 3TW6A 3PXQA 4AU8A 4TM5A 3EL8A 3Q2JA 4IWXA 4I6FA 3KIOC 1PXLA 4CKCA 5BYAA 3PPZA 1KE5A 4NCTA 2R64A 4UXLA 3RALA 3ZZEA 3MY1A 2DAAA 2BKZA 2QLQA 2XS0A 3GQIA 3LLAA 3QU0A 1NY3A 4O22A 3W0RA 2J9GA 4ZLYA 4XG3A 3VOTA 3W0OA 4RA4A 3W2RA 5EZYF 4O21A 5FM2A 4AGDA 3A7JA 4K33A 5KBQA 2WFYA 4I21A 4FA2A 4N0SA 1VJYA 5J95A 5GINE 4LL0A 1YXSA 2R0UA 4QO9A 2B9HA 2XA4A 3QAME 1EH4A 5DT3A 5AV1A 3GU7A 5EHYA 4FX3A 3R8PA 4RWJA 4IACA 4LI5A 4TN6A 3HMOA 5FRIA 2C0TA 3HO8A 2Q7DA 2HYYA 4DH1A 3S4QA 4OW8A 5IA3A 2A4LA 4OGRA 4BGHA 3A4OX 5IZFA 5L3AA 5HVYA 2WMUA 3O5AA 2I87A 2WTCA 3RFCA 2ETMA 3TY9A 4Y73A 4ENYA 5EM6A 2C69A 4B99A 5CANA 5FNVF 2YIRA 4R3PA 5DN3A 5E8YA 3ZLXA 4AQCA 4BDBA 5HBRB 2W1FA 2PUIA 1YRPA 2W5BA 4L7SA 1APME 4NM5A 5KHWA 4RVMA 4D28A 4I55F 3ZBFA 5C1QB 2CFMA 3LM5A 4GK4A 3V8TA 4QMXA 5CZIA 5G1XA 5GJFA 4TVIA 3E93A 3F5PA 3PFQA 3E64A 2KTYA 4LOQA 5FM3A 3TNQB 3UOHA 3DF7A 3C4ZA 4DN5A 4EHEA 1V0BA 1KV1A 3COMA 3EMGA 5CF4A 3AMAA 2WMQA 3Q4UA 3FQSA 3D9VA 5KMJA 3DQXA 3F61A 3ZUTA 4TYGA 3QL8A 1URCA 1OVEA 2J9MA 3JYAA 3BHVA 3EQBA 3PXFA 3UPXA 1CS0A 3JRXA 3KL8A 3OS3A 3T54A 1XMLA 1VYWA 4LRMA 1ST0A 2AUHA 4I6LA 2JIVA 3PWYA 4NSTA 4L44A 4L42A 4C4HA 1OUYA 3L8SA 4OT6A 4LRKA 3KRWA 4YZMA 1Y8YA 4RIWA 3NW6A 1YXTA 4K77A 4KSQA 3WIGA 4A9RA 4ANSA 4D0WA 4EK6A 4QMZA 4GIHA 4N6YA 2BKKA 4JDJA 3AXWA 5ICPA 5J5SA 5LWNA 1ZOEA 4L52A 2QOQA 4XMOA 3NW7A 3JZIA 3JY0A 3IGGA 5BUEA 2OZAA 5CNNA 2PMIA 4YJNA 4KAOA 3DA6A 1KC7A 3NCZA 3K54A 3QTSA 4NYEA 1XBAA 5HI2A 2OIQA 2Q2UA 2YDJA 3A2CA 2PUNA 1KUTA 1K2PA 4LG4A 3CGOA 1JVPP 1QPJA 3L8XA 3OTVA 4XG4A 4AGUA 4F9BA 3LCSA 5A14A 5LMKA 4RIYA 1B39A 4X2NA 1VKZA 4XYMB 3VW8A 3PY1A 2CN8A 3R9HA 3ZC6A 1PMNA 3GFWA 4MX9A 3W2QA 4V05A 3W33A 3VBTA 3ETAA 4LUEA 3W0PA 5DFPA 5A4CA 2EVAA 3FUPA 1Y6AA 4ZOGA 4ZLZA 4RJ7A 5CS6A 4EUTA 4K18A 2B0QA 3BLRA 3NNWA 3K2LA 2GS6A 2QI8A 3QTWA 4UCOA 3LKMA 3TV4A 3ORPA 2ETRA 3ZTXA 4ZI7F 3GGFA 2EB2A 1JDBB 2VTHA 2CLXA 2W1GA 4Y85A 1KE9A 4FGBA 1PXJA 4MWHA 4O7WA 5AUUA 2W0JA 3EZVA 3HP2A 4RC3A 4BR3A 3N51A 4DEEA 4ZZOA 4PNKA 3BKBA 2FSOX 3LOKA 3MVMA 5CEQA 1SYKA 3ELJA 1E1VA 4CMOA 4HVSA 5KKRB 2IW9A 1GSAA 4NM3A 4MD9E 1Z2NX 4CNHA 3ORRA 3DXPA 4FTOA 4CRSA 2WD1A 3ZMMA 4CKJA 3PA5A 5KHXA 5J9LA 4FTMA 3QC9A 4FKWA 3WF7A 5IU2A 1CKNA 3R23A 2V0DA 5FXRA 2OLSA 4OT5A 3C13A 3BYVA 4GLXA 4O2ZA 2YIYA 1KJ8A 2UZBA 5BVWA 1KSWA 5CXZA 4FV8A 2PVYA 2GTNA 3MSSA 3PLSA 4IB5A 3U87A 3ZLWA 3FZSA 2YZNA 1Q99A 3OWPA 2BDFA 4FTJA 1OIQA 2VN9A 2C6LA 1GGOA 1SVGA 4OUCA 2J4ZA 3VULA 3UYYA 4ME6A 3FBVA 4IB1A 5GJGA 4CG8A 2DUVA 4TWPA 3CBLA 2YM4A 4C61A 4TZRA 3G8DA 3E8EA 4FIJA 3VS4A 1DV2A 5KBRA 1OMWA 3QTRA 3U4UA 2I0YA 1PK8A 4EJ7A 4PZ6A 4DG3E 5L8JA 3CTHA 1A9UA 4GEOA 4CT2A 3W2OA 1G2WA 1T36A 4EI4A 3WF8A 2YZGA 2ZDHA 4JR7A 3OBGA 3PA4A 4L9IA 3SGCA 1S68A 4RZQA 2ZV2A 2WQNA 2VGPA 4S34A 2VWXA 4I6QA 1UWHA 4KBCA 4OTIA 4Q5EA 4PUZA 4PRJA 5ETCA 3W2SA 3E7VA 4GW8A 4MNEA 4B7TA 2ABJA 2C6MA 2P0CA 3WZUA 2Q2TA 1Q8UA 4GFOA 2WQBA 2YDKA 2ITXA 1OL7A 4RPVA 4ANMA 5KCVA 4CFWA 2AC5A 1U5QA 2NU9B 3C4XA 4MVFA 2XKCA 2WYOA 3PUFC 4FKLA 3R2YA 3MH0A 4FTTA 4Z7GA 4HGEA 2IVVA 2IVTA 3JRWA 1H0VA 3Q6UA 2HZIA 1Q3DA 5AJQA 3DGKA 1OITA 4U44A 3KXMA 2Y4IC 2P2IA 2EU9A 3CR0A 4L43A 3FXZA 3UIUA 5KKNB 3PVGA 2YAAA 4FTUA 2J51A 2C3KA 4O96A 3A7HA 2OIDA 4JVGA 3NNXA 1UKIA 4GS6A 3ZSHA 4IMYA 1YHVA 2BRBA 2Y7JA 3COHA 3DNEA 3GT8A 4FV1A 4IBMA 2CKOA 4YJRA 5EH0A 2CZGA 3VRYA 2E9UA 4RVKA 4DRFA 4YJUA 1XH8A 4FVRA 4AN3A 5CZHA 5EI8A 5H80A 2VGOA 4EOPA 4FFRA 4TYIA 2UW0A 3QWUA 5IISA 4F1OA 2XVDA 3NIZA 4JR3A 2CKQA 4O0XA 2BTRA 4IWQA 4EH9A 4I5CA 4QYHA 4MV9A 4FTQA 5DYJA 5HG7A 5L6PA 3QLGA 1I1LA 3SC1A 1UNHA 4U3YA 2I0VA 2YM7A 3N4VA 2J0MB 2QVSE 1TQIA 2HOGA 2W70A 3R8VA 3FLSA 5DI1A 2WXVA 2X7FA 3AT4A 4ZTLA 3AC1A 4FG9A 4BCOA 4BCMA 4BDAA 1WAKA 1CKMA 4YAKB 1NA7A 3ZYAA 2OJ9A 1WBNA 5C27A 3WF5A 5ETAA 4L53A 3HV6A 4MK0A 5H8EA 3HVCA 4HNFA 1SZMA 2BIKB 5KZ0A 4CGAA 3PLAE 2PE1A 4TUYF 1R3CA 3VVHA 4RX5A 3ORQA 2EUFB 4YZCA 2XNPA 2W7XA 3CQUA 4XG6A 3UQCA 5GIPE 3WO0A 3SXSA 5DR6A 2O2UA 5CSHA 2Z8CA 3ZDIA 2IJMA 3PIXA 3CSVA 3T9DA 3V5TA 4XLIA 4JAIA 2O65A 4FL2A 3BRBA 5DISC 1ZYJA 1E1XA 1OIRA 3FSFA 3R9NA 5M57A 4BGQA 4D4VA 3T9FA 4GRBA 3CP9A 1IYDA 2B1PA 4E26A 2VWYA 3OOMA 4BTMA 4EH8A 2Z7SA 3SGIA 4XX9A 1XH6A 3MA6A 2W9ZB 4DINA 4EQ5A 3FKNA 3R6XA 3D7TB 5HX6A 3HDNA 2ODTX 2YYAA 4Y5QA 1Q8YA 3UYSA 2QO7A 3WE4A 3NVMB 5CLPA 5AIKA 2FO0A 4QTAA 4J8MA 3F3TA 2PTKA 2F4JA 2VWIA 2ITVA 2BALA 3OEFX 2GFCA 1FVIA 4DT9A 1ZZ2A 2JAVA 4IZYA 1MRVA 3RPRA 3C0IA 4FT3A 3LFSA 3FQEA 4J8NA 5AP6A 2Z04A 4HCVA 2QU5A 4DH5A 1WZYA 5FBNC 4GK2A 1H28A 3SKCA 4C35A 2G2IA 3VC4A 3EKKA 4FZDB 3ZBXA 2HVSA 2JKQA 3QGYA 2UUEA 1WBPA 4JIAA 3SAYA 4XUFA 4IB3A 5EI6A 4NZOA 1CSNA 3W8LA 3VMMA 3RPSA 3QTQA 3UOLA 2E9OA 3ETJA 4AGCA 5I5SA 2RIOA 2UW8A 2XF0A 4WT6A 5E1EA 4A9TA 3L8VA 2WTDA 3T3UA 3DLSA 3JSNA 3VQUA 2CNVA 1H1WA 3RK5A 3K5HA 2JDRA 3W0NA 3TEIA 4UALA 4I22A 5ETIA 2FB9A 3UIBA 5HE0A 1W82A 3P9JA 2XZSA 3M11A 3KULB 4O0SA 5EDQA 3SX9A 1M6VA 1UVRA 2QC6A 1XH4A 4DCEA 1G8JA 4DFBA 5FDPA 1YQJA 4I20A 4QMLA 4NCTC 5GNKA 2C68A 3F7WA 5T3QA 1ZMUA 2CDZA 4AZSA 5LXMA 5M55A 2OH0E 3S00A 5E8ZA 3NBZB 1OI9A 2VTRA 3FI4A 4FODA 1UWJA 2A19B 2BDWA 3BLQA 4RVTA 3GU6A 3OT3A 3QUPA 1XBBA 4FL3A 4UB7A 4FKRA 4TWCA 4D1ZA 4IM0A 2XRWA 5DNRA 4DFXE 5L8LA 4JI9A 5ETFA 3UNKA 2B9IA 2HGXA 3NC0B 5FG8A 3I79A 2GHMA 4C0TA 5LJJA 3QQFA 4YC8A 4UWCA 1REJA 4F65A 5CAPA 4HJOA 4G6NA 4CV8A 1OB3A 3O50A 3MWDA 2E9NA 2YM6A 5I9VA 4NKSA 3R7UA 4M67A 2VTAA 4DFNA 3LQ5A 3RTXA 1OIUA 2OO8X 3VS6A 3DAEA 2OI4X 3UBDA 3R1QA 5A6NA 5CAOA 3VBQA 2VV9A 2YS6A 2VO7A 4FV2A 4M13A 4XOZA 3RAKA 2W1ZA 4A9YA 2EJ3A 3OD6X 2GU8A 4U43A 2W71A 3L2PA 3OTUA 3ZM9A 5F94A 4JRNA 4CFMA 5CAUA 3DZQA 3QQLA 5CEIA 5JMSA 4H1JA 4AA0A 2CGXA 3MTFA 4WNOA 5CY3A 3MJFA 2QG5A 5BPYA 4QMUA 3H30A 2F9GA 2B55A 4U81A 3SXFA 3C4EA 3BZ3A 3NDMA 3U54A 4G3EA 3QZGA 4BZDA 5C1OA 2PY3A 1VR2A 4KINA 4H39A 4RWIA 3UO4A 4EOOA 2W99B 4YP8A 2C0OA 3F5UA 4W4WA 4ANBA 3B8RA 3FAAA 2Y6OA 2R86A 3MH1A 4Y5HA 5EYDA 3GU8A 4BZNA 4CFVA 4DCAA 3QFFA 5M4CA 1LUFA 4GT5A 4O84A 5LVNA 4PMTA 3DKCA 1CKPA 1ZY5A 4HZSA 3D5WA 4K0YA 4DAWA 5D41A 4X2KA 2X81A 2F7EE 1Q8TA 3ORTA 3QRKA 5M4FA 3P4KA 2IZTA 3BG5A 1P2AA 1BNCA 2P55A 1J1BA 4GYGA 2XP2A 3MN3A 2WNTA 3WI6A 4EOQA 2CPKE 3PZEA 3KB7A 1E9HA 4O82A 3CJFA 3GP0A 5FEQA 1NW1A 4CKRA 3TNPC 3UVQA 4QMQA 4EOSA 2HIXA 3CCNA 3OG7A 2CKPA 2J0KA 4G3FA 2ZB0A 5JQ8A 4OTFA 3B2TA 4D2SA 4JDKA 1KJQA 5KZIA 2UZNA 4YSMA 2H6DA 5ANEA 4KB8A 2YRXA 4G16A 2BZJA 2PZPA 3LZBA 4XYFA 2HHFB 4PBCA 5HCXA 4EEVA 4FJVA 1URWA 4N57A 5D7VA 5LMKC 4JQ8A 5CEKA 4I4TF 4YLJA 2EXCX 3KK9A 4IIJF 2XJ1A 1JAMA 3HMMA 4MXZA 1NVQA 1A48A 4NKAA 5EYCA 3U9SA 1YWVA 2HG8A 5EM8A 4FIFA 1IRKA 3OFMA 3A7IA 2HZ4A 4CMTA 4XV1A 1B6SA 4IAFA 2QOOA 2R4BA 3CIKA 3PVWA 4S2ZA