4O81A

Saicar synthetase (type-1) in complex with adp and amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAICAR synthetase (Type-1) in complex with ADP AND AMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 73
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o81A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o81A02
4FV6A 4EZ5A 3JS2A 4YJRA 1PJKA 5LMBA 4P4CA 2ITVA 4J53A 3DFCB 3E5AA 5AV3A 1VKZA 4RC4A 5A14A 4GIIA 4CVAA 5E92A 2EVAA 2BVAA 4O0TA 5FDXA 3IW5A 4RJ7A 3PY0A 3HV7A 4FOBA 4FUYA 5AUTA 5L2WA 2W1DA 3AMAA 1IRKA 1JWHA 2PMIA 3V5JA 4AT3A 3ZDUA 2YAKA 2G1TA 3TNPC 2F49A 3NCZA 5AUUA 3IW6A 4QTAA 4D55A 4FNWA 4QTBA 4FIGA 4QP4A 2YCRA 4QP1A 4ZMFA 3KC3A 1P2AA 2GFCA 2W6ZA 1ATPE 4LG4A 5A3XA 3LWBA 3C4FA 3POZA 5EHOA 2YAAA 3QQFA 2XNNA 3ODYX 4F7NA 2OICA 4IMYA 1IOVA 5C1OA 5IMEA 1T45A 4XYMB 4G16A 3GGFA 3PA5A 5HLWA 5AUVA 2PZPA 4JIAA 3SXRA 1LPUA 3C1XA 4AF3A 3ZSHA 1OL2A 2QKWB 2ITQA 1RDQE 1H00A 4GCJA 1R0EA 5CLPA 2Y4IB 2WOTA 3F9NA 3I4BA 4YAKB 3IW4A 4YZDA 4MV1A 5KMOA 2V58A 4WG4A 2WMXA 4RJ5A 3HYHA 4ME6A 4MV9A 4I4TF 3N9XA 4MH7A 1OIUA 3FZSA 3C4XA 4IJPA 4EWQA 1WBVA 4CV9A 3PE1A 3SX9A 3OY1A 3GIDA 2PVNA 4ALWA 1GAGA 3LIJA 2G01A 3EIDA 4E6CA 3RJCA 3HZTA 3VAPA 4DGNA 2XRWA 4FKUA 1CMKE 3UVQA 1VJYA 1JAMA 3FYJX 5BYZA 1O6YA 2A0CX 2X8DA 3G6HA 2X7FA 2QO2A 3M11A 4E6DA 3B8QA 5K4JA 3TZ8A 2VO0A 2OH4A 5KZIA 3AD5A 1ZZ2A 3EB0A 2WTCA 3EKKA 3FWQA 5HNIX 4HCVA 1FGIA 2JKQA 4YHJA 5EW3A 4O21A 3Q32A 2A27A 4FSWA 2ZVAA 3VOTA 3ZOSA 3L8PA 2QOOA 1UWHA 4Z9LA 3FY2A 1Z2OX 1UU9A 2YM7A 4YUQA 4L1KA 4PX6A 4MNEA 4IZAA 4FFLA 2V5QA 2RG5A 4DTBA 4C4IA 4PTEA 2WIPA 4FIFA 5LVNA 4D0XA 2YYAA 3GCPA 1E1VA 3KXZA 2YIQA 3W55A 5CU0A 4N57A 2QOCA 3MFRA 4YJUA 4EBWA 4O7ZA 4TY1A 4DINA 3WE4A 4HOKA 1C3OA 2W6NA 4UWCA 4K77A 4OW8A 2XA4A 3C5UA 3DDPA 4APCA 4IIRA 5E9EA 1F3MC 3HDNA 2XF0A 3GI3A 3VQHA 5IH4A 4WBBB 2PMLX 5HESA 2DUVA 4YJVA 4AW0A 4IIJF 2C6IA 5AUXA 2CNQA 1KBLA 3R0TA 4RIXA 2QOKA 3K54A 2BFXA 3F5PA 4R1VA 4K8AA 1OITA 4LI5A 4KRDA 5CNOA 5DNRA 2OKRA 5CEOA 4M97A 5E8XA 3WYYA 3FE3A 3OXZA 5HEZA 3FLSA 4Q9ZA 1XBBA 1H0WA 3OUZA 3ULIA 3OEFX 2P0AA 5HE0A 5ACBC 3QQUA 5FP5A 2R3GA 3NYVA 2XBJA 1Y8GA 4IAAA 3ORIA 4EK8A 4C3RA 5FP6A 3R7OA 2E9PA 2C47A 2DIKA 4ACGA 5KHXA 4ZLZA 4ZHQF 2XK4A 4IM3A 4JT3A 3A7IA 4RIXB 1G8AA 4O2PA 1W7HA 3ORLA 1SVHA 4XG6A 2W5HA 4RWLA 2J9GA 2GPHA 4FT5A 4ZZNA 4D2RA 2OGVA 2NU8B 4L68A 2ZM4A 3DK6A 4UZHA 4YLJA 3UVPA 4ZTMA 5KX5F 4AGWA 3L1SA 2FO0A 3I7BA 2BALA 4IB1A 2ONLA 3QL8A 5IA5A 4UXLA 5IU2A 3OOMA 5BPFA 4NM0A 5HZNA 3QGYA 2RGPA 1Y8YA 3FZRA 3FL5A 4CFWA 3SG9A 4D1SA 4IB3A 4AU8A 5HLNA 4FG8A 5HG9A 5BUJA 3WF9A 3HO8A 3V8WA 3R1SA 5FRIA 1MRUA 4FR4A 1ZMUA 4GT5A 5T68A 3FI2A 2FH9A 1M6VA 3NUUA 4E26A 2UW7A 2WQNA 3QQGA 3RGFA 4AZEA 4KNBA 3PVWA 3PTGA 4IX3A 3VJNA 3KULB 3DKOA 1ZLTA 5J7HA 4FTNA 2BCJA 2PVFA 2IVSA 4IB0A 4U3ZA 4KS8A 3EQBA 4ZP5A 4CFUA 4BHNA 3EMGA 2YEXA 3AD4A 2Z8CA 3HBLA 2RIOA 3QTIA 4MBJA 2IVUA 3ANQA 3TZ7A 2JIIA 3MY0A 3DK7A 4FIEA 3GCQA 4TXCA 1OKYA 4RMZA 4U80A 5M4FA 5H2UA 4OTIA 3C4EA 1B38A 2RFDA 4DLJA 4FTQA 4RT7A 1OB3A 2Y6MA 5B2LA 3HV4A 4QYGA 2YERA 4Q9SA 3OS3A 3FHRA 1LP4A 1Z57A 2QLQA 4R7IA 3RFCA 4Y85A 4BKJA 1GZKA 2W1ZA 2YZAA 3HDMA 3VUMA 3NAXA 1P14A 3FPQA 1KOAA 2W70A 4YZCA 4IAIA 2P2HA 3F7ZA 4FIJA 2VWBA 2DS1A 1HCKA 4LOQA 3K2LA 4OLIA 3ETAA 3ENHA 4PWNA 5AEPA 3VPCA 1T46A 3EOCA 3WZEA 3C4CA 5LCKA 1VBHA 4O7TA 2VO6A 3E8NA 5IZFA 4C59A 4U0IA 2XCKA 1KUTA 3QD3A 5BUEA 5CX9A 3UFXB 3RALA 4D1ZA 4RWIA 4RFZA 5CEIA 4C4GA 4DEIA 3VA7A 5LOVF 2WMQA 1PXOA 2V7AA 4WKQA 4G1WA 4TRLA 5CZHA 2UZEA 3QF9A 4RLKA 5HIBA 1CE8A 4KB8A 2YS6A 5JFVA 5E90A 2ZV7A 4HGEA 2XEYA 4C58A 3IGOA 3R8ZA 3ZXTA 2WNTA 4EORA 3RV3A 2UZDA 5GHVA 5HVJA 4RBLA 4IVCA 2H9VA 1SCUB 2UVYA 3CC6A 3F88A 2WD1A 3FXZA 3TW6A 5B7VA 4U8ZA 4NYEA 1H0VA 2OI4X 3KALA 1BLXA 2GHMA 5EH0A 3FSKA 4AAAA 1PXNA 2H34A 3HMPA 2VUWA 3UQGA 5FEEA 5LVLA 3OTVA 3VBVA 5IEYA 5JT2A 2YDJA 3HRFA 4F6UA 2J4ZA 3KL8A 5HG5A 3CJFA 5EQYA 1YDTE 3EHAA 3PVBA 2QOQA 5HCZA 3H3CA 1A9XA 2JFMA 2NUAB 3TZ9A 3QQJA 4X2JA 3HRBA 5AWMA 2R3HA 4AT4A 2R5TA 4DG3E 4D4VA 1CM8A 3PXKA 4EHZA 2JDRA 4ACCA 4BZDA 4CG8A 5K4IA 1ZYJA 1DIKA 5CTPA 5DEWA 3OXTA 3NNVA 4I93A 2GS6A 2F7ZE 2NNWB 5CT0A 4AOIA 1U46A 4H3BA 1QPCA 4FSNA 5CXZA 4O0RA 3ET7A 4LRKA 1E9HA 3MVHA 5KKRC 4DTAA 4C33A 3P7AA 1UNLA 2QOIA 2QI8A 4FKQA 3ZTXA 4MCVA 2GCDA 4H36A 3BHHA 1PMNA 3PG1A 2OWBA 5EI6A 2ZV8A 4W4WA 2QR8A 4BCQA 2X6DA 4FKLA 3KN6A 2WELA 1AUVA 2ZMCA 2CKQA 3RPSA 4FFMA 1OPLA 4RVTA 5IEVA 4MV8A 2JKKA 1Q61A 1PMEA 4QNAA 4BDFA 2PUIA 4DTKA 3S3IA 3GFEA 3SXFA 5AX3A 4I21A 3TUBA 3MY1A 5CF4A 2B9IA 4L7FA 1W0XC 2IW9A 3A7HA 2NU7B 1U54A 1W96A 1UV5A 3ATTA 4IX5A 3TUDA 3HB9A 5DYJA 4NTSA 4C7TA 4BDIA 3HMOA 4CRLA 3Q60A 1E4EB 5EI8A 3TINA 2VWUA 1IG1A 3QD2B 2WXVA 3UIBA 3NNWA 5KHWA 4ZTSA 1OL1A 3TNWA 3LQ8A 3GC0A 1TQMA 4AOTA 5CVGA 3R22A 4II5A 3VULA 2UZVA 4R3PA 1J7IA 4C5AA 1OM1A 4YTCA 2QURA 5EOBA 5GIPE 2GNGA 3MN3A 3QLFA 4AN3A 3HGKA 2VTQA 2J5FA 2KTYA 3LVPA 4JX3A 3TKHA 4P5ZA 3TTIA 5HO8A 3U51A 3ZC5A 4C2WA 3FZTA 5FG8A 2C69A 3ACKA 2H96A 2OZAB 2X4FA 5K3YA 1WBTA 4FSTA 5IA0A 5JFSA 4G9RA 3UIUA 4AZSA 5JRQA 3GT8A 4LL5A 3DK3A 5EQEA 3S0OA 1GSHA 2IN6A 5M08A 1SNUA 3TJCA 3U9TA 2OFVA 1ND4A 5IQBA 3GEQA 5JFXA 2C5OA 3DBFA 4P5QA 4JBOA 3LCOA 4DAWA 5FEDA 4O4IF 1Q3WA 2UW9A 2GQGA 3DF7A 2ZB1A 4PV0A 4U44A 4GG7A 1MP8A 1OL7A 2ITOA 4A9RA 2X9FA 4BZOA 2C3KA 4A4XA 4I6FA 4YJ2F 1PYXA 4JG8A 4MD7E 4YAJB 3BG5A 2PZ5A 2FSTX 3TQTA 1YWNA 4AGDA 3FJQE 3K3IA 4ZY5A 2FGIA 3KN5A 4A7CA 4DCEA 3A7JA 1VYZA 4BDDA 1J3HA 5HCYA 4XG4A 5L8JA 2A2AA 3TTJA 2R7NA 3GOKA 3DV3A 3OUKA 1H28A 3QHRA 4LUEA 4PMTA 3POOA 3Q6WA 4TPTA 4RX5A 4PTCA 4RVKA 4MV3A 2JKMA 3MB7A 2ZDUA 4PY1A 3BU3A 4OTGA 4W8EA 2Y8OA 3GCUA 4U9AA 4BB4A 2OZOA 3NYNA 3MH2A 4R6VA 5E8UA 5M4UA 5K9IA 5E8YA 1TVOA 2R9SA 4XV1A 3F3TA 4MQ2A 3RCDA 5E8TA 3RNIA 3HEGA 4YR8A 1QMZA 2C5XA 1PYEA 3VS3A 5TR6A 2WEVA 3R28A 3TZMA 1CS0A 2FSLX 3LQ5A 4ZZOA 2YA9A 3DXNA 4XH6A 4LQMA 2IZSA 4QP3A 1VYWA 4EYJA 3P08A 3A8WA 3QC4A 3CY2A 2HW6A 3GC7A 4K2RA 4O7RA 5HG7A 5IQGA 4XJ0A 1V0OA 5EOLA 1VBGA 1PXJA 2I0VA 4AGUA 4GL9A 2XM9A 2JAMA 2YABA 2YCSA 4X21A 5G1XA 5FTQA 5KBRA 1XBCA 3P9JA 4ZTNA 3D5UA 4W4YA 2YIYA 3E3PA 3LJ2A 3W8QA 4XX0B 2WTVA 1MUOA 5HBJA 1WMKA 2QQ7A 3Q52A 4LV5A 1GZ8A 4AW5A 1STCE 3BLQA 3R8UA 4IZOA 5JGAA 1ZMWA 4YP8A 3VQUA 4DA5A 2RFSA 2O65A 4A4OA 1ZY5A 2CKEA 5BVWA 4BCHA 4HQ6A 4I1ZA 4XBRA 5HBRB 3PA3A 4XHKB 3HP5A 5M07A 1O6LA 3QXPA 1W83A 3C0GA 2XJ0A 3GQIA 4PMSA 4EQUA 2VO3A 2OBJA 4XP0A 3QKMA 4AN9A 5TT7A 4BR3A 4ZTHA 5DT3A 5HO7A 2XCLA 1A06A 3JUHA 4RIYB 3DJ7A 3SHEA 5I9UA 3H9RA 3ZO1A 5CZIA 4EH4A 1CKJA 5L3AA 4FNZA 4IZ7A 5HI2A 4G3CA 3Q9ZA 1YXVA 2WQEA 3QQHA 4JDHA 4WRGA 4X6QC 4L6QA 4ZSLA 4G34A 5ANGA 3AW8A 5EHYA 2BDFA 3GU5A 2FYSA 3Q3BA 1ZOGA 3ZSIA 3V5QA 5A54A 2OJ9A 2YRXA 4GSBA 4P2KA 1FMKA 5LQFA 4Q5EA 3OEZA 2XS0A 4R78A 2Z60A 2UVXA 3Q4ZA 2R3PA 1DAWA 3E8DA 4J96A 3VO3A 4E4LA 4F1MA 4C02A 2B9JA 5IA4A 3RK9A 2ONLC 3KREA 4D5HA 3E5NA 3PPZA 3DCVA 4WO5A 4XV2A 2B0QA 2WQOA 5HORA 3DLZA 3NPCA 2PY3A 4EOKA 4QQJA 1Z2PX 4S32A 1J7UA 2B9HA 4DG2E 2VD5A 3NS9A 1M0TA 3A7GA 4YGAA 5K5XA 4JBVA 1ZRZA 4UALA 5CSHA 2CCHA 2OIBA 3EFJA 2VWWA 2JDVA 3RK5A 2JITA 3BYMA 3GOPA 3UOKA 3UYSA 4NIFB 4IH8A 2X7OA 3O8PA 4WD5A 3FKNA 2QF7A 4GT4A 3D83A 3O2MA 1EZ1A 2F2UA 2VO7A 3CJGA 3MWUA 3NVKI 4KINA 3ZM4A 4C61A 3U9SA 1XBAA 1WVYA 4MA5A 4FC0A 3KKVA 3V5LA 3QTQA 2BDWA 3PWYA 3R8VA 3OT8A 4BYIA 3ZLWA 3CCNA 2WMBA 4UBAA 3QKKA 3E63A 5DBXA 4S31A 3QRTA 3I81A 1TQIA 2DWBA 5EZYF 2BFYA 2QO9A 2IJMA 4I24A 4PMPA 3RZBA 2VNWA 4ACHA 3NSZA 4FODA 2XK8A 3MGYA 5JGBA 3DJ5A 5JQGF 4RIOA 4F9BA 5GJDA 5DI1A 2ETRA 4FG9A 2R7KA 5T6KA 3G9LX 3GLKA 1KE9A 2I0YA 3ZS5A 2XRUA 3E92A 2WQBA 4FV2A 2REIA 3HL7A 4TYHB 1E1XA 2BRGA 1VR2A 2YW2A 4FBXA 4G3GA 2VGOA 1UNGA 5CYIA 3KA0A 4Y8DA 3HUCA 4AUAA 4DEGA 3FLYA 3OW4A 2X2MA 2I6LA 2WMUA 2UUEA 2YJRA 2QU5A 3CTHA 5AIRA 4OT5A 4XLIA 1LUFA 3II5A 4E6AA 3OWKA 3QZGA 3QXOA 4GU6A 4L45A 3S2PA 4C4JA 5CAQA 3BU5A 4F4PA 3P7CA 4O38A 3QGWA 4FFPA 1LEWA 3RM6A 3HAVA 4GVAA 3SE7A 4M69B 5EYCA 3U6HA 2UV2A 4EC8A 4F63A 4R5YA 4AZVA 2QHNA 3HMIA 3OF0A 3HA8A 4E8AA 4QMNA 3UJGA 1W8CA 4XRLA 3V4SA 3HV6A 1ZWSA 4EYMA 5CU4A 4KKEA 4C3FA 3IGGA 3EFKA 3ID6C 4UWYA 3MH0A 4C38A 4UZDA 5CSVA 3VS2A 3I5NA 3K3PA 2PHKA 2CHLA 4S30A 2WYOA 2Y0AA 2BROA 3CIKA 3Q9YA 2C6TA 4A07A 1J91A 3F66A 1HOWA 3OY3A 3F69A 4KBKA 2Q0NA 3ZFXA 4QT1A 3PY1A 3LKMA 3W2OA 3VS5A 4DH1A 4BHZA 4X3FB 3O71A 2G2HA 3WF5A 4OTQA 3BELA 3IS5A 2CKOA 3UGCA 4E5AX 4UX9A 3COHA 4HGLA 2P3GX 4IC8A 4G17A 5LMAA 2VTRA 3C0IA 4USFA 5FNVF 1K2PA 1QL6A 5E1EA 3KMMA 4FUXA 5AP1A 5H9BA 4USEA 3DBEA 1Q4LA 3BGPA 3C4WA 4JRNA 4O91A 5CNNA 4QYFA 4EH6A 2UW5A 4WIHA 3V8SA 5FXSA 2Y4PA 2R82A 4IAFA 1KV1A 2YZGA 4YBJA 3LFSA 4E4TA 5HE3A 2V7OA 3AC3A 4IAZA 4BZNA 4I5CA 4HYIA 4RC3A 3ALNA 2Z7RA 4G5PA 1PXLA 3QBNA 1IA9A 3P5KA 1RW8A 5CEQA 3NAYA 4FTKA 4E7WA 3MFUA 5FM2A 3CY3A 2RFEA 4ZJVA 2UW3A 3U6JA 1JKLA 1SMHA 5KZ0A 5A9UA 3CTJA 4D2SA 4Y72A 3OCTA 3DY7A 3UZTA 2PBZA 2W1IA 1AGWA 5DPVA 5IMXA 2JDSA 2PVJA 3KGAA 3KU2A 4FV3A 4O0WA 4BCFA 3EQHA 3UIMA 1OUYA 4BBFA 3PLAE 2WMVA 4D4RA 3WO0A 3MH3A 4DGGA 2VWYA 4OGRA 1OVEA 3FMHA 3VWAA 1T36A 2VTMA 2XUUA 3FZOA 2BDJA 1YI6A 4O2ZA 4QMZA 2YIRA 4U3YA 3UG2A 4ASZA 1H01A 1NW1A 4MYGA 3TL8A 5A4CA 4FSMA 2PL0A 1GSOA 3KRJA 3QFFA 3IONA 5DLSA 1YWVA 3DTCA 4LGGA 4FVPA 4AQCA 5CANA 4USDA 2E9UA 4MXCA 4YJSA 3K3JA 3FHIA 4I6HA 1C30A 2WTIA 4R5SA 3G33A 2HGSA 2IG7A 2CKPA 3Q4TA 4YC6A 4HYSA 4EEVA 2PMNX 3CXWA 3BBTB 4OBQA 1GIHA 3EH9A 3SGCA 1KC7A 3DB6A 3N4VA 4AACA 4QMTA 2G15A 4H3PA 5ETIA 3DZQA 5CQUA 2HELA 3R6XA 1JLLB 2WMRA 1Q8YA 3FQSA 4KUJA 4F1TA 4KRCA 4UB7A 1Q8ZA 3V3VA 2JGZA 2PVKA 4PF4A 5LXMA 1O6KA 4WHZA 4H39A 3LFFA 2B55A 4IFCA 4NZWB 3EFLA 4FV7A 5DE2A 4EBVA 1JSUA 2GTMA 3UNZA 5FDPA 3NIZA 4BC6A 3TV4A 2I1MA 3LM0A 4QMQA 4QP7A 2JBPA 4LYNA 4QQCA 5F4NA 4BF2A 3GXLA 4M84A 3GENA 4EOJA 5J5SA 2VU3A 4R3CA 2C4GA 2BZIB 3PRIA 4QMSA 4CT2A 2C0OA 2J6MA 4FOCA 4FGBA 4L46A 4L67A 5D12A 5FXQA 4EOOA 4QP9A 3BLHA 3RUPA 4L44A 4XP2A 2IW8A 3MWEA 5AV2A 5KKNB 4YJOA 3W32A 2YZMA 4ANSA 4QP2A 5I9XA 4XV3A 4UY9A 4HW7A 4AXAA 3GCVA 3E8CA 5TO8A 3RV4A 2ITTA 4FTCA 3ODZX 4FSUA 4G6OA 2O0UA 4YPDA 5ANJA 2ZYBA 4F0IA 4ZIMA 3KY2A 3VS1A 5IYZF 2XKDA 2ZDQA 5I9VA 3TG1A 2YIXA 1KJQA 4GYIA 3BCEA 3KXXA 5HX6A 3D94A 4FKOA 2V62A 2R84A 2HY0A 4I92A 4HJOA 1KJJA 4L52A 3BYUA 5IQCA 3LXLA 3ZRLA 3SD0A 1ZMVA 3VBXA 3AX6A 4XV9A 3QAME 2YDKA 3Q4CA 2YN8A 3VJOA 2C5VA 2CGWA 4JQEA 4CMOA 4EQMA 4RIYA 4EK4A 2BKKA 3S1HA 4RIWB 4QYEA 2HENA 4UYNA 3D0EA 1FVVA 3NUXA 4RJ3A 4B4LA 5JQ5A 3I79A 4I0SA 3Q5ZA 3NDMA 3PXFA 1V0PA 1VZOA 3R21A 3MYGA 1WAKA 1YVJA 4G2FA 4RRVA 4X2NA 5DRDA 1MRVA 4E93A 4F9AA 4TWOA 4BCOA 3EYHA 5AM7A 1XO2B 2JDTA 3E93A 3JZFA 4M12A 5DT4A 3CPCA 2WQMA 5HTCA 4JBPA 5JVLA 5D41A 3UNJA 3SOAA 3HV5A 5EI2A 3LCTA 3N6RA 3ZZWA 4FT0A 3G0EA 3Q2JA 2X4ZA 4MX9A 3ZRMA 4HVHA 3DPKA 1BI8A 1KV2A 3QTZA 3DS6A 3R7YA 5EYKA 5LJJA 4WSYA 3BHVA 2GNFA 2ZMDA 2OK1A 2PN1A 2WMTA 2R7MA 2ITYA 2Z7QA 4TWPA 4I0RA 3KAKA 3LCDA 3EN9A 1TKIA 3IECA 2WKMA 3OXIA 3PXYA 5BUIA 1Q99A 1Q62A 4KD1A 2QK4A 2UZBA 4E4MA 4QMYA 4CFNA 2W1HA 4CMTA 2Z2WA 4M0ZA 5M57A 1ERKA 2RKUA 3V5TA 3UNKA 3FZ1A 4NKAA 4IW0A 5TOZA 3JY9A 5I9WA 3DFAA 4EOLA 5BYYA 4ZI7F 5HVKA 4PP7A 5AUYA 2BAKA 2CGUA 4RWKA 1Q8TA 3LMIA 2X0SA 2WAJA 5T3QA 2W6MA 3PXQA 2CN5A 4IVAA 4QMLA 4CFVA 3R5FA 2UW4A 2XIYA 3R7IA 1EUDB 1PKGA 5IQDA 4CEGA 3DDQA 1Q24A 3T8OA 4U79A 2ZDTA 3N51A 3TNHA 3R5HA 3AQVA 3I7CA 5DT0A 4WNOA 3PP0A 3F2RA 3Q53A 5HD7A 3VPBA 4A06A 3KFAA 3HMNA 4MBIA 4I50F 3R9OA 3JRXA 3G90X 4AZWA 2BUJA 3D5VA 5IDNA 5M4CA 3UO4A 5JH7F 1W98A 2BRMA 4O6LA 5C9CA 1YHSA 2DQ7X 1UNHA 5FQDC 2WFYA 2WIHA 2ZM1A 5ETAA 3W2RA 3ZEWA 2W05A 4PQNA 1J7LA 1GNGA 3LE6A 3Q96A 3ZU7A 3FMDA 1URCA 3SXSA 2WHBA 1B6CB 3HKOA 1M0WA 2YZLA 4IX4A 4Y46A 4YURA 1GIIA 1WBNA 1H1PA 1Q8WA 1YI3A 4IHPA 4AE9A 1S9IA 3NW6A 4ASDA 4DEDA 3FDNA 3P78A 1FINA 3TWJA 1EHIA 5CVFA 1FMOE 3IK3A 3RPVA 3VBYA 4X2KA 2BPMA 3WZDA 2ACXA 5CAVA 3TUCA 5EYDA 1ZOHA 4JAIA 2HK5A 3O0GA 4UXQA 2XNBA 3JY0A 2B7AA 4M68A 1NVRA 1XHAA 2NRYA 4NUSA 2VWXA 3Q9XA 3U8WA 5KBQA 3F7WA 5DHJA 3FI3A 4S33A 2BAQA 4QSHA 3ALOA 5KMLA 3W33A 4W8DA 3VBTA 3GU8A 4BTKA 2E9VA 4E20A 4L7SA 4FZ6A 4F09A 1YW2A 2X9EA 4LMUA 1V0BA 2VPQA 5DEYA 2BIKB 1PF8A 4KSPA 4BCJA 1EYZA 2PU8A 2VX1A 1XKKA 5FLFA 3NZ0A 3WYXA 4WG3A 5J87A 3UO5A 4FNYA 2XK6A 4QYHA 3QZIA 5LP6F 5LXTF 1JQHA 2FB8A 3ETHA 4R3RA 4V01A 4CXAA 4YSJA 3PYYA 4R7HA 4BDHA 3A8XA 4WG5A 3BBWA 4FIHA 2R3JA 3I0QA 2VTIA 3Q2MA 4DBXA 2X2LA 4TV9F 4D9TA 4ENYA 3U6IA 1OL6A 4PP9A 2QOFA 3KF4A 3V5WA 4IANA 1V1KA 3EJ1A 1YKRA 4ERWA 2VNYA 5ANOA 4ZOLF 3LFAA 3LFNA 2HYYA 4C4FA 5IQHA 2AC5A 3OWJA 4ALUA 5C8YF 2X8IA 3F2NA 2I8CA 4EOSA 2BRBA 2CNUA 1H26A 3JZIA 2BZJA 1Q8UA 4FG7A 4MHAA 1OPKA 3NNXA 2PZRA 2XEZA 1ZAOA 4QNYA 4MV7A 3RI1A 2VZ6A 4L3JA 3O51A 4LMNA 1WBOA 3PSDA 4ZXTA 3VC4A 4HCTA 3MJ2A 3WZJA 3WIKA 5AAGA 3F3VA 4RZVA 1WBPA 2Z04A 2W17A 3KQ7A 4JDIA 4RFYA 3HRCA 2W0JA 4O7WA 4LRMA 4C0TA 4FT3A 4NM7A 3GU7A 4XEYA 4FK3A 3V04A 3C5IA 4AGCA 3KXNA 3PJ2A 1YXXA 1Q41A 4H1MA 3VN9A 4D28A 5FGKA 4S34A 3F5GA 2YM3A 3NWWA 1YOLA 4J99A 3QALE 4Q2AA 4DYMA 5IISA 4JR3A 5J9YA 3O8TA 5M4IA 4DIMA 4O84A 2XM8A 5AV1A 2NRUA 3R8PA 3C7QA 4BI1A 4O86A 5GNKA 4M3QA 5B2MA 4TUYF 4FZ7A 4HZRA 5A4QA 4Y8VB 4C4EA 2F2CB 3LMHA 4TN6A 3MESA 3NR9A 4DFXE 2HOGA 2ZDHA 5LVPA 2GU8A 3VHKA 2G9XA 4IEBA 4RVMA 3RHKA 4BCGA 4XS2A 3PG3A 5J9ZA 4NL0A 3AMYA 3IW7A 4FT9A 5HBHA 3RTPA 1W84A 1SVGA 2XJ1A 3QRKA 2P33A 4O96A 4XG9A 3DXQA 2CGVA 1PKDA 2IP4A 5KMIA 4B8MA 1P5EA 4WUAA 4BTFA 2YRWA 3BPRA 1H08A 2WTKC 5HLPA 4F9WA 2OXXA 4YJPA 3R2BA 4CLJA 3BRBA 3BYOA 2VN9A 4R77A 5D10A 2XMYA 1EUCB 2HW7A 3OOGA 5CB4F 4FTTA 2R3NA 4YZMA 4DFBA 4E6QA 3TDWA 2W4KA 3IQ7A 3UDBA 4HCUA 4EC9A 4N6ZA 2UW8A 3D7ZA 4CSVA 1IOWA 3EKNA 4YHTA 1GJOA 3QRUA 4MXZA 1OPJA 1XWSA 4NTTA 3HNGA 4AA5A 4CV8A 2BHEA 3P23A 1CQIB 4FK6A 1OECA 4L42A 4FVRA 3AGMA 3OCGA 4GFMA 4DH3A 5AADA 1BKXA 3FYKX 3S4QA 3RVGA 3GU4A 3I5ZA 3VIDA 1H8FA 4E1ZA 3ZH8A 2FP4B 1PRYA 4A9TA 3FQEA 4YHFA 4CZUA 4G31A 4K0YA 3FKLA 3L8VA 4RVLA 3A62A 5CF6A 4BDGA 1YOMA 3ACJA 4V04A 2XNPA 4FTIA 4EKKA 1GY3A 2WTJA 4FYOA 5JGDA 5KMNA 1K9AA 4KS7A 5GJGA 4NJDA 4EJ7A 2GTNA 4XG7A 3ORZA 1BXRA 3ZC6A 2VTHA 2VWIA 3MPAA 3MFTA 5EW8A 2BZHB 3BU6A 4AT5A 1H1QA 3FXXA 5C26A 3HUBA 1I44A 4GJ3A 1I7LA 5FEQA 2C6MA 2YCFA 4QYYA 5A4EA 3KRRA 3O7LD 2XCHA 4Z7GA 4ZSGA 3NCGA 4XYFA 4M0YA 3ZCLA 3WE8A 4V0GA 4BYJA 4C36A 2WMAA 4AS0A 3ZFYA 3R73A 4EK5A 5L2IA 1MQ4A 5I9YA 1KE5A 3CQWA 4UYAA 4YNEA 4ZSJA 5E1SA 3BWFA 4CKRA 2VAGA 3LLAA 3ULZA 3SQQA 3OCBA 2GDOA 5C03A 4BIEA 2C68A 2CJMA 1YWRA 4XG8A 2F4JA 2ITNA 4DEBA 2VTPA 2E9NA 5EK7A 3ITZA 2SRCA 3FMLA 5KMJA 2FB9A 5HG8A 2OIDA 4HVIA 1S9JA 2IPXA 3PFQA 4HGSA 2C3LA 2PULA 4XP3A 2R3IA 3TJDA 4YJTA 3L9MA 2P0CA 4O27B 3QQKA 5E8WA 4FEQA 3IKAA 4ZS4A 3OFMA 4ZOGA 2ZB0A 1OKWA 4G5JA 3VBQA 2LGCA 3CEKA 3EN6A 3ORXA 3MB6A 1BL7A 3ZONA 4BCPA 3A60A 3EQRA 4GJ2A 4FV4A 4KKHA 4HVSA 3OBJA 2HCKA 4FTOA 3RPOA 2C6LA 2FSMX 2X7GA 2C3IB 3A7FA 4QMOA 4FTLA 4W4VA 3V6SA 3EN5A 2V59A 3SLSA 3PJCA 4FYNA 3DKCA 4L9IA 1Y91A 4YC8A 2VTAA 3E7VA 4K9YA 4FKTA 3W10A 2YM5A 5M53A 1M14A 4ANBA 2WMWA 4PRJA 4TNDA 4A9UA 3G8DA 4FV8A 3I12A 2IO6A 5AM6A 3UC4A 4V05A 1KSWA 1PW2A 2J0KA 5EHLA 3RMFA 3WZKA 3BE9A 2CDZA 2WTKB 4AG8A 5LCJA 4LUDA 2VTLA 3EZRA 5DG5A 5B0XA 3TEIA 4EOQA 3LLTA 5BNJA 4YB8B 1BMKA 3SW7A 4YMJA 1WFCA 3CR0A 1WR2A 2WPAA 4G3FA 3UBDA 4LFIA 2XNGA 3QUDA 3H9OA 3JXWA 3U4UA 3PSCA 4DGOA 3KMUA 3VF9A 3HMMA 5A46A 3UQCA 4RX8A 3T3VA 4AX8A 3LP8A 5EM6A 3BEAA 2X0GA 4F9CA 3FEGA 3QZFA 3COKA 2UZNA 4IWDA 1LEZA 3G6GA 3LQ3A 3PWDA 4EH5A 2F7XE 2P4IA 1XR1A 2J0JA 5KMKA 3OBGA 3SV0A 5KKRB 2HZ0A 4K6ZA 1PXMA 1H1SA 4O81A 3RPYA 3UODA 5HX8A 1M2RA 2PVHA 3QWJA 1KE7A 1H25A 2PE1A 4ORKA 4EWHA 3OZ6A 4M7IA 4JXFA 3PVUA 4BVUA 1L3RE 3UO6A 5D8DA 2ERZE 4DGLC 1XJDA 2ZV9A 3PZEA 3QRIA 3KCFA 4FT7A 4XOZA 3QYZA 4I6BA 4FV9A 1R1WA 3VVHA 4C62A 5KX8A 1OGUA 2P55A 2PK9A 5ICPA 1OZ1A 4AFJA 1OKZA 5L6WL 5ANKA 5D11A 3LXPA 4IWQA 3W2CA 3WBLA 5CAOA 3MIAA 4NH1A 4F6WA 1ZOEA 1GIJA 1RJBA 4ITHA 2C5YA 4YPSA 3QX2A 3WOWA 3DTWA 4K18A 4Z3VA 4LRJA 1BL6A 2OXYA 5IQEA 5EQPA 1YXTA 2WEIA 2C5NA 5D7VA 4TWNA 5ANDA 5GJFA 3UQFA 4MTAA 2X81A 5I5ZA 2W71A 3GUBA 3TIZA 3MTLA 5H8BA 4I3ZA 1JSVA 3BHTA 3CTQA 4RLLA 2DYLA 3FXWA 4DFUA 4JS8A 5HNBA 1YRPA 2OU7A 4NWMA 4RA5A 5C8NA 2PVRA 4F64A 3QTSA 3QTWA 5KO1A 2GQSA 3D15A 1WBWA 3R9DA 4DG0E 3BYVA 3ORTA 4FSQA 4NW5A 4MQ1A 3UC3A 4MXXA 4BCKA 4EK6A 3HP2A 2C3JA 2JIUA 2HZIA 3BLRA 3PIXA 1RQQA 4KIQA 4RJ4A 1JKSA 2VTTA 1JLUE 1ZYSA 4U7ZA 2R0IA 2PUNA 3VF8A 2LAVA 4RQKA 1XQZA 2J51A 4Y83A 4DEHA 3DBCA 3H30A 5J9LA 5ANEA 4X3FC 5DMXA 3MDYA 2W6PA 4D5KA 2C6EA 4U43A 4BTMA 4IC7A 4JX7A 4B0GA 4MF1A 2X2KA 4R7BA 3C50A 4X2GA 3H0YA 2J7TA 3QTRA 4OBOA 4BIDA 1X8BA 2BRHA 3DJ6A 4AW2A 4DC2A 4G6LA 3E64A 3L9PA 3OP5A 2YACA 3PXZA 3QZHA 2HJWA 4FMQA 4AZFA 2XYNA 4CFFA 2ITZA 2PWLA 3AC5A 5TF9A 2GNHA 5FTGA 3ZUTA 4DT8A 5L6PA 2QHMA 4GIHA 4JI9A 2ERKA 4KSQA 3W18A 4B8LA 3U87A 4FVQA 4EH9A 4DN5A 3A61A 2QKRA 4TYGA 3KVWA 4QTCA 4IJ9A 2BILB 3VUKA 4JRVA 4N70A 4OTRA 3SRVA 3PIZA 3TM0A 4IAKA 3BGZA 5L2SA 2GHGA 1M7QA 5AP7A 4CMUA 5HNGA 1YOJA 2BTSA 4XBUA 2YWPA 2H8HA 3UVRA 4U41A 4Y5HA 2BAJA 4FZDB 4PDYA 3OVVA 2NP8A 4PUZA 1JNKA 1AUXA 2BHHA 4RC2A 2YM6A 3BE2A 3GC8A 5LA6F 1IR3A 3O96A 3H4JA 3E7OA 3A99A 2C6KA 3IOKA 5EKOA 4ASXA 1OIYA 1APME 3MA3A 4Z16A 4KA3A 3FQHA 2AYPA 3AG9A 3TT0A 3PPKA 4LGHA 3THBA 3R01A 3KAJA 1J1CA 4QO9A 3U9CA 2W1CA 3F6XA 2IWIA 4NFMA 5CEMA 2NU9B 1JKJB 5JZNA 5E4HA 5C27A 2VTSA 1ZYCA 2J50A 3P0MA 3EFWA 4FKRA 4ZZMA 3RAWA 4BTJA 2R87A 1SYKA 3LFQA 4BBMA 2QU6A 5AV4A 3NMUF 1UU7A 3Q4UA 5IUIA 3KEXA 4EHGA 4N6YA 5HIEA 2YIWA 4CZTA 2GS7A 4V0GB 4A4LA 2Y6OA 4MWIA 3FPMA 2XZSA 1DM2A 2BIYA 2ETKA 2I0HA 1PXPA 3D5WA 3FLWA 3KVXA 4RPVA 3V01A 4IVDA 4DFZE 4B99A 1FVTA 3CKWA 4J95A 3R7EA 2FUMA 5F20A 2W7XA 2XIKA 4PL4A 4DE4A 3DU8A 4NFNA 2ZM3A 3DNEA 4ZSAA 3BX5A 3ORRA 1GZOA 3KF7A 1OI9A 4EL9A 2RF9A 1BNCA 2PVYA 2JDOA 3G9NA 3RP9A 5M44A 1SZMA 4FKSA 2WU6A 4CKIA 2CPKE 3CBLA 5JRSA 1KEEA 3RINA 4O82A 3LM5A 3R83A 2HWPA 4XUFA 3ROCA 4J8NA 2R7LA 3WF8A 2B4SB 3AC2A 5CI6A 4HNVA 3OT3A 3PZHA 4O0YA 3IDBA 5J1VA 3LXNA 1Y57A 3W16A 4D4SA 4JQ8A 5ITAA 4O7YA 3F82A 1QPEA 3BI6A 1R3CA 3L8SA 3LPBA 2BZKB 4Z55A 2YJSA 3JVSA 3EL7A 3OG7A 2I0EA 2C6DA 4U5JA 3O8UA 3FC2A 2XB7A 5IQFA 4FEUA 4M13A 4YO6A 5HE2A 4MD8E 1NA7A 3ZO2A 4ZY6A 5A4TA 1F0QA 3TDVA 5CU2A 1W93A 1W82A 3VS0A 1IAJA 2W06A 4JDKA 4E4NA 3TV7A 3PA4A 2FSOX 3DKFA 5CSXA 3EQFA 2OLCA 2QC6A 3RWQA 2KULA 3HV3A 4EK3A 2X6EA 4ITIA 5LVMA 5CF5A 1Z2NX 3KMWA 3TIIA 5IG1A 3FLNC 4C3PA 3CS9A 4J71A 4L3PA 4HVDA 1GOLA 3MVMA 2YITA 4QOXA 3T9TA 3UP7A 2F9GA 5HQ0A 3A2CA 5C4KA 3DKGA 2QOBA 3PDTA 5CVHA 4G9CA 2XJ2A 1R39A 3LHJA 4JOAA 5ANIA 5TKDA 4AP7A 4GYGA 4H3QA 2OF2A 4NK9A 4IZYA 3ZDIA 3CGFA 4FTUA 2PE0A 4CTCA 4GEOA 2CSNA 3RHXA 4M15A 4MA0A 4GW8A 4DBNA 1J1BA 5IQAA 4GRBA 4FTJA 4BCNA 5CAUA 4H58A 1ZZLA 2XVDA 2YDIA 4HNFA 4P7EA 4M8TA 4B7TA 4QQ5A 3VRZA 1GLVA 3NYXA 3P86A 2J0LA 4FEVA 4WBOA 1U54B 3ORPA 3OMVA 3FBVA 3U54A 3V8TA 3R02A 1B39A 4ARKA 2XK9A 4C5CA 3ZUVA 3R5XA 1B6RA 2J2IB 5HIDA 4ALVA 4F65A 3IDCA 1H1RA 4YTFA 4RGJA 1KE8A 5A6NA 5BVNA 2J90A 4DITA 2RG6A 2UZOA 3KRLA 3Q04A 4RQVA 4APPA 3KXHA 5JKGA 2HZNA 3LZBA 3LW0A 3SDJA 5BMMA 2OJGA 2OH0E 3BQCA 3MH1A 4L01A 2EU9A 5DR6A 5LMKC 2XD4A 3QD0A 4OUCA 1ZYDA 2YISA 5GINE 2G2IA 3UPXA 4K33A 5IPJA 4WUNA 3I1AA 4I4EA 2GMXA 2IVVA 2IZRA 3TACA 4O7NA 4XYLB 2AUHA 4IHJF 4D58A 5EKNA 3K5UA 4XX9A 3F3ZA 4J7BA 4FU0A 3SOCA 4Y73A 4EQCA 4IFGA 4AA0A 1OIRA 1XH8A 3RAKA 2V22A 4IB5A 3OC1A 3SG8A 4HGTA 3C0HA 4Z7HA 4AZTA 4F7JA 3IDPA 5JSMA 4YZ9A 2Z02A 4EOIA 4IM0A 4F7LA 1GGOA 3OHTA 4FFNA 5HCXA 5CAEB 3AC8A 4XLVA 1RE8A 4O7LA 5CSWA 5I4NA 4JG6A 2JC6A 3ANRA 3FI4A 4HYUA 4RWJA 5EDRA 1VEBA 3MA6A 4U97A 3A4OX 4QPSA 5HKMA 3R1QA 4FA2A 4MNEB 4EGJA 2J5EA 1ZXEA 3OD6X 5FBNC 4I22A 2QOLA 3RWPA 4EHEA 3I6WA 3NLBA 1JPAA 3CKXA 2UVZA 4K11A 5AX9A 2PZYA 3OUUA 5LWNA 5JMSA 1REJA 2I40A 1NVQA 1HCLA 3NW7A 5EDQA 5B2KA 4FKIA 4F0FA 3ORMA 5AMNA 1CQJB 4OBPA 1ULZA 4TW9A 4PNIA 3G5DA 5BQ0A 2IZUA 3R8LA 1UU8A 4TTHB 1KE6A 2V55A 4CT1A 3O50A 3PE2A 1UKHA 3UZRA 5FD2A 4FNXA 2XK3A 3OTUA 2PUUA 1U59A 4RJ8A 4FGRA 3ZEPA 3LFCA 3GU6A 5C4LA 2OXDA 4ZY4A 3VMMA 3FMEA 4XRJA 4EZ3A 2XIXA 4IBMA 5FXRA 4I55F 2QNJA 5IA3A 3FZPA 3LCKA 3QC9A 3RCJA 3VW8A 3HVCA 2NO3A 3H9FA 1BYGA 3LFBA 3NIEA 5AA9A 4NU1A 4I4FA 3UOJA 3Q1KA 5IA2A 4E4XA 3QQLA 1YXUA 5CEPA 4QQTA 2VTJA 3I60A 2Q0BA 2XBAA 2PVLA 2AC3A 2B54A 4WRSA 1XH5A 3REPA 4F0GA 4XOYA 1JOWB 3KK8A 5CF8A 2V0DA 5EM8A 5EDPA 4JVGA 5AAEA 1B6SA 4FL3A 4HVGA 2OG8A 4NCTA 4JLCA 2WZJA 3DAJA 2IW6A 3LFEA 4TL0A 4F9YA 3AGLA 2W96B 4O0VA 4EH2A 2F7EE 3JVRA 3RAHA 4BI0A 1JDBB 3HA6A 1EH4A 2Y7JA 2R86A 4GKHA 3UMWA 5D1JA 1G3NA 2OLSA 3RKBA 2J9MA 3I0OA 1PHKA 4IDTA 2R85A 4O4LF 4ZTRA 4GU9A 2QLUA 2OFUA 2OSCA 3NVMB 4ZQIA 3ZBFA 4TZRA 4A9YA 3ETJA 5IUGA 2PPQA 4D4YA 2R3MA 1H24A 1R78A 3WNZA 3GFWA 2W1FA 4RJ6A 4NKSA 5HICA 3ZMMA 3FMMA 3QUEA 4YBKA 3V6RA 4FE2A 3VS7A 4BDAA 3AD6A 5M51A 1PX2A 1U5RA 1U4DA 3EWHA 1Y6AA 5AP4A 5EW9A 4DLKA 3FLZA 3R23A 3LMGA 3F5UA 1IAHA 4L3LA 2O8YA 2CLXA 4Q5HA 1QCFA 3SA0A 1U5QA 4ITJA 1O9UA 5CQWA 2YM8A 3BEGA 5AP0A 4FI1A 2C0TA 3JR1A 4TYJA 3F2AA 2R7BA 3CLYA 3D4QA 2IVTA 4FSYA 4BDEA 1XH9A 3E87A 5E8ZA 4FV1A 1WZYA 2W5AA 4H1JA 3CD8A 5DGZA 5BVDA 3O17A 5DRBA 3R7VA 1XH4A 2O5KA 3BV3A 4FEWA 4U45A 5HE1A 1YHVA 3N8DA 4HPUE 3PY3A 1QPJA 3SKCA 4A9SA 3UP2A 1PXIA 1KJ8A 4WOVA 5A6OA 1OBGA 4JAJA 4J97A 3LOKA 5K5NA 2R2PA 3AMBA 3QU0A 3GP0A 2PVMA 2ZDGA 1DI8A 1NT2A 3KCKA 3MW1A 5DFPA 4F1OA 4O6EA 5J8IA 5FUTA 2BRNA 1BI7A 2GHLA 3PRFA 5DWRA 4EH7A 2HWOA 4F99A 5JEBA 3R63A 3FAAA 2JFLA 1YXSA 3DNDA 3VRYA 3R00A 4YLLA 2YHVA 5BVFA 3QLGA 4MKCA 1CDKA 3NUSA 2VRXA 3RK7A 3P1AA 3JPVA 4RIWA 2R64A 2W1GA 3MI9A 4MD9E 3ZSGA 2XK7A 4PL5A 4DFLA 2OJIA 2ITXA 3G2FA 1CTPE 3LJ1A 4J8MA 5FM3A 3F5XA 3NX8A 5DOSA 2GLTA 3QA0A 4B9DA 4O4JF 2W6QA 3F3WA 3DT1A 3VBWA 3FKOA 5L2TA 4KIOA 1NXKA 4Y5QA 5IA1A 3PSBA 1AD5A 5GONF 3AOXA 4EGQA 1GZNA 3OW3A 2YL2A 4I0TA 2PMOX 4KBAA 4X3JA 4XG2A 2GPSA 2UZWE 2NU6B 4E5WA 5DA3A 2PSQA 4ANLA 4I6QA 4J98A 5D9HA 2FPGB 4FL2A 2H6DA 1H1WA 3N4TA 1JKKA 3HLLA 2VWZA 5C8MA 5DR9A 4QMVA 5HHWA 3ZXZA 5C1QB 4BY9E 4C4HA 4BN1A 4GK2A 2YZNA 5IUHA 2JIVA 2I87A 3RAIA 5FBOA 4DCAA 2EB2A 3VUIA 4M14A 3MV5A 1UWJA 2F57A 3PVGA 4GMYA 1UU3A 4IVBA 4JDJA 4WT6A 5IEXA 4IWOA 3MIYA 3TXOA 3ORNA 3KB7A 4LOPA 3TI1A 4CG9A 5KMMA 3QHWA 4TKSA 3ENMA 4U6RA 3CE3A 5C8KA 4EH3A 3D2KA 4YJNA 4CLIA 2A1AB 4KIPA 3Q9WA 5L6OA 5L8KA 4OTWA 1WCCA 4I23A 2QD9A 3QD4A 4RX9A 4EI4A 2VQDA 2R7IA 3ZLXA 4EG0A 2OF4A 4MBLA 5KUPA 4IX6A 3KXMA 3COMA 3FC1X 2R4BA 5CENA 4HYHA 3C13A 3E62A 1H4LA 4JJRA 4C35A 5LYJF 3DA6A 5HVYA 3ATSA 3VNTA 3DBDA 1KWPA 5LMKA 4YSMA 2VX0A 2BR1A 3AT4A 3O23A 2OO8X 4TNBA 5DIAA 2QVSE 3QX4A 3ROYA 3WIGA 4RZWA 3O7LB 2VTNA 4IACA 4ANMA 5EG3A 4FZFB 5J1WA 1KJIA 1OKVA 5C01A 3WF7A 1IASA 4JBQA 3C51A 4BBEA 1JDEA 2YFXA 3W2QA 4MWHA 4CFXA 3PIYA 2C1AA 1DV1A 5CWZA 2R3OA 3PJ8A 3ZFMA 4EH8A 2W4JA 4IDVA 1OBDA 4E5BA 2W1EA 3UZPA 1DI9A 4CD0A 5J95A 5L8LA 4IADA 4ZEGA 4JQ7A 1FGKA 2C6OA 2FPIB 4ID7A 4I5HA 4JNWA 3K5HA 2R3KA 5LARA 5F9EA 3MVJA 4BDKA 4CGAA 3QCYA 4GK3A 4R1YA 2BMCA 4J1RA 2ITWA 2QO7A 5F1ZA 3TKUA 4F70A 5J2TF 3KULA 2ZJWA 4O0SA 3UG1A 3WZUA 4AA4A 5DR2A 4IM2A 2QG5A 4GH2A 4JG7A 2QG7A 5CI7A 5AP2A 3VS4A 5HD4A 1PK8A 2WGJA 2WMSA 3QTUA 1MRYA 4DEEA 3FMKA 4QPAA 3M2WA 4UV0A 4S2ZA 4ENXA 1YI4A 1G8SA 3BWJA 1JSTA 3ORKA 5AV0A 4ERKA 3EYGA 4TWCA 4KWPA 3AXWA 2XKEA 4FTAA 4C2VA 4MAMA 4XNEA 1YQJA 1BUHA 3PJ1A 3UIXA 2V5AA 1XH6A 4ZLYA 4GFGA 3ZHPC 3U4WA 3NUAA 3DLSA 3NNUA 4GS6A 4KAOA 3SC1A 3DXPA 5JFWA 2GNLA 1FVRA 5AUZA 4RSSA 5H3QA 4AFEA 3PPJA 1F5QA 1H07A 4BDJA 4K1BA 4G3EA 4XZ3B 4ACDA 2JLDA 2ZV2A 3L9LA 2O64A 5JH6A 4GUEA 5AJQA 2O3PA 2PTKA 2Z7LA 4Y95A 4C37A 3B2WA 1P4OA 3AC4A 3ZM9A 2EWAA 3EQGA 4L43A 3CQEA 4YC3A 2XKCA 5HU9A 3GC9A 3SRVB 4BCMA 4QMXA 1JBPE 3CQUA 4UWBA 1Z9XA 4O7VA 4XMOA 3K5IA 4FKVA 4RX7A 3FUPA 4PMMA 3EQCA 3D14A 2PVPA 2EB3A 5CA0F 3HECA 3DQXA 2J0MB 1URWA 3BGQA 3TCPA 4BRXA 4P90A 5HV6A 2OJJA 4PDSA 3T9IA 3KXGA 3ZZEA 4YO4A 2NPQA 3MS9A 4HR7A 4MV4A 4EOPA 4BDBA 4FV5A 1CKIA 3D5XA 5KE0A 1WVXA 3R9HA 4OT6A 2W9ZB 3LXKA 3EL8A 4N4SA 4FEXA 3IOPA 5A4LA 5DVRA 1Q97A 1YDSE 3IO7A 4HNTA 4ZJIA 3JYAA 4TYHA 2XNOA 3BHUA 3P79A 2HZ4A 4LM5A 5H8EA 4IWPA 4G6NA 2JEDA 4GG5A 4DH5A 5FTOA 1A9UA 2B53A 4C34A 4PDOA 3FI8A 4GK4A 4TYEA 2CGXA 2Y4IC 5CAPA 2O63A 3UTOA 5HTBA 1YDRE 1FOTA 5AP5A 2VTOA 3V4ZA 3H10A 3E88A 4CRSA 1GSAA 4GT3A 4QMWA 1JVPP 2RL5A 3DQWA 5BMSA 3G51A 2ESMA 3TKIA 4EZ7A 2X8EA 1YHWA 2XIZA 4I5PA 4EHVA 5LVOA 4YJ3F 3MVLA 2OJFE 5DN3A 5JQWA 4AE6A 5D7AA 3QWKA 1Q3DA 5HGIA 2Z7SA 3QCXA 3LCSA 4OR5A 4EONA 2QONA 4FIIA 3TNQB 3KK9A 2C30A 5DH3A 4CFMA 2XNMA 4QTEA 3AT2A 3MBLA 1KOBA 4YU2A 4BGGA 1UKIA 3OCSA 3BHYA 2XYUA 3NGAA 3A4PA 3QKLA 2WTWA 4NW6A 3S95A 3SW4A 3V5PA 2YWVA 4ONAA 5I0BA 4HPTE 4ZK5A 2HY81 2VWVA 4ZJJA 4DH8A 4MEDA 4F08A 4ASEA 3DZOA 4F7SA 1OL5A 3W8LA 2BKZA 5LOHA 2UW6A 3EQDA 2PUPA 3ZO4A 3ZUUA 3MY5A 2FA2A 3NEWA 3LAUA 3R1NA 4FKWA 4MK0A 4QMMA 5F95A 3VUGA 1OUKA 3W1FA 4QMUA 1DV2A 1ZARA 2QOHA 5AFVA 3ZYAA 2VX3A 3HX4A 2Y9QA 4GVJA 3UE4A 5LWMA 4DT9A 4WNKA 2GFSA 5BPHA 3EZVA 3GB2A 4FSZA 4QTDA 4D9UA 2HXQA 2W4OA 4BI2A 4LOOA 4PL3A 5ACKA 2RFNA 3QRJA 4WNMA 2E2BA 2UW0A 3PLSA 4FKJA 4BICA 2CZGA 2R3LA 3L9NA 2VGPA 3Q6UA 3RM7A 2CLQA 4MAOA 2OIQA 4ZSEA 2XP2A 3P7BA 3WO1A 2E9OA 2B9FA 2ITPA 3WILA 3EQPA 3BYSA 3IPHA 3FL4A 3OWPA 3R8MA 2B1PA 1P4FA 3C4ZA 5EM5A 3TNIA 3VHEA 4UN0C 4TT7A 3TIGA 4C5BA 2J0IA 4QP8A 4FKPA 4YLKA 2GPWA 3KRWA 4OTDA 4X2FA 5IH5A 5JK3A 4FKGA 4DGMA 2JBOA 5KCVA 3BZ3A 5M06A 2DWCA 3EN7A 4YBZB 4YTIA 4PTGA 3COIA 4I94A 3MWDA 1PY5A 1QPDA 4CNHA 2OW3A 4O2AF 3FLQA 4O0XA 2CMWA 3GVUA 3CP9A 4MVFA 3I6UA 3ELJA 5AUWA 5CY3A 3ERKA 3QYWA 2XIRA 5AIKA 4FFOA 1OMWA 2JKOA 3CPBA 3OWLA 1PXKA 1R0PA 3UOLA 3AT3A 3EN4A 3ZLYA 3WF6A 4CKJA 2GNJA 3PUPA 5CXHA 4QP6A 2IZTA 3DB8A 4B6LA 4EUTA 2A4LA 3U9NA 3D7TB 5AP6A 4D1XA 4ZAUA 3MTFA 2R3QA 3MPMA 4O7SA 3ZRKA 3G0FA 2B52A 3BV2A 4ZS0A 3FMJA 3W2SA 4X3FA 2ZAZA 4AW1A 4JL9A 4AN2A 3NRMA 4MXOA 4DHFA 2YS7A 5M56A 4NJ3A 3VUHA 3GNIB 3SVVA 4MXAA 5CS6A 3DBQA 4BGQA 5C1PA 5J2UF 3NYOA 2BTRA 4BIBA 1WVWA 3M1SA 4FSRA 2SCUB 2FPPB 2GSFA 1L8TA 5AP3A 4WBNF 4W4XA 4RG0A 2W5BA 5BMVF 3TV6A 2QCSA 2EXCX 3GBZA 3BIZA 4IQ6A 4MXYA 4QMPA 5HU3A 2Q83A 3K5VA 4HNIA 5M55A 2C1BA 4JR7A 3VW6A 1KJ9A 1REKA 4LV8A 4YTHA 1Y6BA 4MNFA 3ZBXA 4WNPA 3PP1A 4EUUA 2I7QA 3NW5A 1PMVA 5CALA 2HIWA 3KRXA 1SM2A 4AOJA 2WTDA 3F61A 3FMNA 4ANQA 3MJFA 3IW8A 1M2PA 3Q2OA 4DH7A 4I20A 5CEKA 4FL1A 4QRCA 4TYIA 3QUPA 5HBEA 1CKPA 4IE9A 5E91A 3NUNA 4XCUA 4YZNA 5BVOA 5JZJA 4LL0A 4ZTLA 1M52A 2PE2A 3PXRA 3QTXA 1WBSA 3M42A 4PNKA 4X0MA 5H80A 3CSVA 5G6VA 5E8VA 5CSPA 1SNXA 3ORQA 4J52A 3MJ1A 3DAEA 4OTHA 4PDPA 4O4HF 1XH7A 2ITUA 5JQ8A 5IH6A 4U42A 1I7NA 4EJNA 3BQRA 4HNUA 2C00A 1AQ1A 4GV1A 3OROA 4O83A 5CU3A 5CU6A 4YNOA 3MFSA 3ZLSA 4CCBA 3B2TA 4DF3A 4O22A 4NM3A 4OTFA 3E8EA 4YJQA 4DEAA 3QCQA 4IAYA 4M9UA 4X7QA 4AWIA 2HXLA 5IF1A 1CSNA 4GKIA 2XKFA 3V51A 1FQ1B 1FBNA 3CD3A 1IEPA 3E3BX 1UA2A 3FSFA 4GFOA 4FTRA 4D0WA 5E8SA 2R0UA 3AC1A 3WARA 3OUNB 4TV8F 3R9RA 1K3AA 3UOHA 1ZY4A 2JD5A 3TN8A 2WB8A 4HZSA 5BVEA 3TIYA 4M67A 3MPTA 3ZO3A 4DFNA 4DFYA 1SVEA 4CCUA 5BX0A 4NM5A 2X1NA 4ZMEA 2OZAA 2GNIA 5IQIA 2FVDA 1NY3A 2P2IA 4NSTA 2YCQA 2W6OA 3T3UA 2W9FB 3PJ3A 2QR7A 1G5SA 2ETMA 3H0ZA 2HAKA 2XH5A 4I41A 3FY0A 2CCIA 2PYWA 5EFQA 3SAYA 3C9WA 4H05A 2UZLA 1TQPA 4YZBA 2EXMA 4EOMA 4F6SA 5AAFA 3S00A 4BGHA 2ZOQA 5BYLA 4FTMA 2XNEA 3R71A 1A48A 1FPUA 3DAKA 2CNVA 3QCSA 3BKBA 2I80A 3W2PA 1M2QA 2WU7A 3HAMA 5ETCA 3VS6A 1M17A 3QA8A 4NT4A 2DZDA 2G2FA 3G8CA 1E4EA 4GUBA 4JIKA 1H27A 3EQIA 3MSSA 2VR1A 4XG3A 4MV6A 5CA1F 3GQLA 5F94A 4UEUA 2UZTA 4KKGA 4L8MA 3RPRA 5JVDF 1Q5KA 3B8RA 4FV0A 4O2BF 4EKLA 3R30A 4L53A 5I9ZA 2WOUA 4RFMA 5KNJA 2O2UA 1DS5A 1BX6A 1PMUA 1Z5MA 4WA9A 3L8XA 5AA8A 2R3FA 3R1YA 4CQEA 1M7NA 1UVRA 4FFRA 2W99B 4L00A 4NCTC 4CTBA 2UZUE 5E7RA 1MQBA 1LR4A 3Q5IA 5CASA 1IA8A 3UMXA 4E73A 3P4KA 1DAYA 4BCIA 2A19B 5BVKA 5GIOE 1JKTA 2GS2A 2YM4A 3CGOA 4RZQA 1I09A 2GQRA 4KABA 3R2YA 2QODA 3WI6A 3UYTA 4O0UA 3D2IA 3NUPA 5IDPA 3QFVA 3R7UA 2R3RA 3LJ0A 4KBCA 4U81A 3JRWA 1OIQA 2VV9A 3UPZA 4I5MA 4U40A 2CN8A 3DOGA 3GCSA 5EM7A 2PZIA 3FV8A 3NUYA 3VUDA 3G15A 3F3UA 4X6RA 3R04A 5EYMA 5ETFA 3N4UA 3IG7A 4BDCA 3R9NA 1NVSA 4ACMA 2JAVA 5M09A 4RA4A 3D9VA 4DLIA 4FICA 4N0SA 2C0IA 2X39A 2EUFB 5CT7A 3LFDA 4FZAB 5H8GA 2DLNA 2WO6A 3D7TA 5JN2A 4FX3A 3U55A 4ZLOA 4ZTQA 5BPYA 4IZ5A 4G3DA 3DGKA
chains in the Genus database with same CATH superfamily
4FV6A 4EZ5A 3JS2A 4YJRA 1PJKA 5LMBA 4P4CA 2ITVA 4J53A 3DFCB 3E5AA 5AV3A 1VKZA 4RC4A 5A14A 4GIIA 4CVAA 5E92A 2EVAA 2BVAA 4O0TA 5FDXA 5FR9A 3IW5A 3PN1A 4RJ7A 3PY0A 3HV7A 4FOBA 4FUYA 5AUTA 5L2WA 2W1DA 3AMAA 1IRKA 1JWHA 2PMIA 3V5JA 4AT3A 3ZDUA 2YAKA 2G1TA 3TNPC 4IWXA 2F49A 3NCZA 5AUUA 3IW6A 4QTAA 4D55A 4FNWA 4QTBA 4FIGA 4QP4A 4K6NA 5I5SA 2YCRA 4QP1A 1UC8A 4ZMFA 3KC3A 1P2AA 2GFCA 2W6ZA 1ATPE 4LG4A 5A3XA 3LWBA 3C4FA 3POZA 3GDEA 5EHOA 2YAAA 3TEKA 3QQFA 2XNNA 3ODYX 4F7NA 2Q7DA 2OICA 4IMYA 1IOVA 5C1OA 5IMEA 1T45A 4XYMB 4G16A 3GGFA 3PA5A 5HLWA 5AUVA 2PZPA 4JIAA 3SXRA 1LPUA 3C1XA 4AF3A 3ZSHA 1OL2A 2QKWB 2ITQA 4UCUA 1RDQE 1H00A 4GCJA 1R0EA 5CLPA 2Y4IB 2WOTA 3F9NA 3I4BA 4YAKB 3IW4A 4YZDA 4MV1A 5KMOA 2V58A 4WG4A 2WMXA 4RJ5A 3HYHA 4ME6A 4MV9A 4I4TF 2ZGIA 3N9XA 4MH7A 1OIUA 3FZSA 3C4XA 4IJPA 4EWQA 1WBVA 4CV9A 3PE1A 3SX9A 3OY1A 1I2KA 2PVNA 3GIDA 4ALWA 1GAGA 3LIJA 2G01A 3EIDA 4E6CA 3RJCA 3HZTA 3VAPA 4DGNA 2XRWA 4FKUA 4DRFA 1CMKE 3UVQA 1S68A 1VJYA 1JAMA 3FYJX 5BYZA 1O6YA 5DAAA 2A0CX 2X8DA 3G6HA 2X7FA 2QO2A 3M11A 4E6DA 4CC5A 3B8QA 5K4JA 3TZ8A 2VO0A 2OH4A 5KZIA 3AD5A 1ZZ2A 3EB0A 2WTCA 3EKKA 3FWQA 5HNIX 4HCVA 1FGIA 2JKQA 4IWYA 4YHJA 5EW3A 4O21A 3Q32A 2A27A 4FSWA 2ZVAA 3VOTA 3ZOSA 4AXCA 3L8PA 2QOOA 1UWHA 4Z9LA 3FY2A 1Z2OX 1UU9A 2YM7A 4YUQA 4L1KA 4PX6A 4MNEA 4IZAA 4FFLA 2V5QA 2RG5A 4DTBA 4C4IA 4PTEA 2WIPA 4FIFA 5LVNA 4D0XA 2YYAA 4EFBA 3GCPA 1E1VA 3KXZA 2YIQA 3W55A 5CU0A 5K2MA 4N57A 2QOCA 3MFRA 4YJUA 4EBWA 4O7ZA 4TY1A 4DINA 3WE4A 4HOKA 1C3OA 2W6NA 4UWCA 4K77A 4OW8A 2XA4A 3C5UA 3DDPA 4APCA 4IIRA 5E9EA 1CKNA 1F3MC 3HDNA 2XF0A 3GI3A 3VQHA 5IH4A 4WBBB 2PMLX 5HESA 2DUVA 4YJVA 4AW0A 4IIJF 2C6IA 5AUXA 4CHIA 2CNQA 4UUGA 1KBLA 2EJ2A 3R0TA 4RIXA 2QOKA 1G2WA 3K54A 2BFXA 3F5PA 4R1VA 4K8AA 3BABA 1OITA 4LI5A 4KRDA 5CNOA 5DNRA 2OKRA 5CEOA 4M97A 5E8XA 3WYYA 3FE3A 3OXZA 5HEZA 3FLSA 4Q9ZA 1XBBA 1H0WA 3OUZA 3ULIA 3OEFX 2P0AA 5E25A 5HE0A 5ACBC 3QQUA 5FP5A 2R3GA 3NYVA 2XBJA 1Y8GA 4IAAA 3ORIA 4EK8A 4C3RA 5FP6A 3R7OA 2E9PA 1B04A 2C47A 2DIKA 2HDKA 4ACGA 5KHXA 4ZLZA 4ZHQF 2XK4A 4IM3A 4JT3A 3A7IA 4RIXB 1G8AA 4O2PA 1W7HA 3ORLA 1SVHA 4XG6A 2W5HA 4RWLA 2J9GA 2GPHA 4FT5A 4ZZNA 4D2RA 2OGVA 2NU8B 4L68A 3RTXA 2ZM4A 3DK6A 4UZHA 4YLJA 3UVPA 4ZTMA 5KX5F 4AGWA 3L1SA 2FO0A 3I7BA 1G8JA 2BALA 4IB1A 2ONLA 3QL8A 5IA5A 3AKLA 4UXLA 3OOMA 5IU2A 4NM0A 5BPFA 5HZNA 3QGYA 2RGPA 1Y8YA 2ZFYA 1P16A 3FZRA 3FL5A 4CFWA 3W1BA 3SG9A 4D1SA 3DAAA 1TA8A 4IB3A 4AU8A 5HLNA 4FG8A 5HG9A 5BUJA 3WF9A 3HO8A 3V8WA 3R1SA 5FRIA 1MRUA 4FR4A 1ZMUA 4GT5A 5T68A 3FI2A 2FH9A 1M6VA 3NUUA 4E26A 2UW7A 2WQNA 3QQGA 3RGFA 4AZEA 3L2PA 4KNBA 3BL9A 3PTGA 3PVWA 4IX3A 3KULB 3DKOA 1ZLTA 3VJNA 5J7HA 4FTNA 2BCJA 2PVFA 2IVSA 4IB0A 4U3ZA 4KS8A 3EQBA 4ZP5A 4CFUA 5FPOA 4BHNA 3EMGA 2YEXA 4TVIA 3AD4A 2Z8CA 3HBLA 2RIOA 3QTIA 4MBJA 2IVUA 3ANQA 3TZ7A 2JIIA 3MY0A 3DK7A 4FIEA 3GCQA 2HG8A 4TXCA 1OKYA 4RMZA 4AAYA 4U80A 5M4FA 5H2UA 4OTIA 3C4EA 1B38A 2RFDA 4DLJA 4FTQA 4RT7A 1OB3A 2Y6MA 5B2LA 3HV4A 4QYGA 2YERA 4Q9SA 3OS3A 3FHRA 1LP4A 1Z57A 2QLQA 4R7IA 3BA8A 3BA9A 4Y85A 3RFCA 4BKJA 5I47A 1GZKA 2W1ZA 2YZAA 3HDMA 3VUMA 3NAXA 1P14A 3FPQA 1KOAA 2W70A 4YZCA 4IAIA 2P2HA 3F7ZA 4FIJA 2VWBA 2DS1A 1HCKA 4LOQA 3K2LA 4OLIA 3ETAA 3ENHA 4PWNA 5AEPA 3VPCA 1T46A 3EOCA 3WZEA 3C4CA 5LCKA 1VBHA 4O7TA 2VO6A 3E8NA 5IZFA 4C59A 4U0IA 2XCKA 1KUTA 3QD3A 5BUEA 5CX9A 3UFXB 3RALA 4D1ZA 4RWIA 4RFZA 5CEIA 4C4GA 4DEIA 3VA7A 5LOVF 2WMQA 1PXOA 2V7AA 4WKQA 4G1WA 4TRLA 5CZHA 2UZEA 3QF9A 4RLKA 5HIBA 1CE8A 4KB8A 2YS6A 5JFVA 5E90A 2ZV7A 4HGEA 2XEYA 4C58A 3IGOA 3R8ZA 3ZXTA 2WNTA 4EORA 3RV3A 2UZDA 5GHVA 5HVJA 4RBLA 4IVCA 2H9VA 1SCUB 2UVYA 3CC6A 3F88A 2WD1A 3FXZA 3TW6A 5B7VA 4U8ZA 4NYEA 1H0VA 2OI4X 3KALA 1BLXA 2GHMA 5EH0A 3FSKA 4AAAA 1PXNA 2H34A 3HMPA 2VUWA 3UQGA 5FEEA 5LVLA 3OTVA 3VBVA 5IEYA 5JT2A 2YDJA 3HRFA 4F6UA 2J4ZA 3KL8A 5HG5A 3CJFA 5EQYA 1YDTE 3EHAA 3PVBA 2QOQA 5HCZA 3H3CA 1A9XA 3KIOC 2JFMA 2NUAB 3TZ9A 4AXEA 3QQJA 4X2JA 3HRBA 5AWMA 2R3HA 4AT4A 2R5TA 4DG3E 4D4VA 1CM8A 3PXKA 4EHZA 2JDRA 4ACCA 4BZDA 4CG8A 5K4IA 1ZYJA 1DIKA 1X9NA 5CTPA 5DEWA 3OXTA 3NNVA 4I93A 2GS6A 2F7ZE 2NNWB 5CT0A 4AOIA 1U46A 4H3BA 1QPCA 4FSNA 5CXZA 4O0RA 3ET7A 3UDZA 4LRKA 5BWWA 1E9HA 3MVHA 5KKRC 4DTAA 4C33A 3P7AA 1UNLA 2QOIA 2QI8A 4FKQA 3ZTXA 4MCVA 2GCDA 4H36A 3BHHA 1PMNA 3BL7A 3PG1A 2OWBA 5EI6A 2ZV8A 4W4WA 2QR8A 4BCQA 2X6DA 4FKLA 3KN6A 2WELA 1AUVA 2ZMCA 2CKQA 3RPSA 4FFMA 1OPLA 4RVTA 5IEVA 4MV8A 2JKKA 1Q61A 1PMEA 4QNAA 4BDFA 2PUIA 4DTKA 3S3IA 3GFEA 3SXFA 5AX3A 1I2LA 4I21A 3TUBA 3MY1A 5CF4A 2B9IA 4L7FA 1W0XC 2IW9A 3A7HA 2NU7B 1U54A 1W96A 1UV5A 3ATTA 4IX5A 3TUDA 2HVRA 3HB9A 5DYJA 4NTSA 4C7TA 4BDIA 3HMOA 4CRLA 3Q60A 1E4EB 5EI8A 3TINA 2VWUA 1IG1A 3QD2B 2WXVA 3UIBA 3NNWA 5KHWA 4ZTSA 1OL1A 4LDTA 3LQ8A 3TNWA 3GC0A 3UDTA 1TQMA 3TYKA 5CVGA 4AOTA 3R22A 4II5A 3VULA 2UZVA 4R3PA 1J7IA 4C5AA 1OM1A 4YTCA 2QURA 2HIXA 5EOBA 5GIPE 2GNGA 3MN3A 3QLFA 4AN3A 3HGKA 2COGA 2VTQA 2J5FA 2KTYA 3LVPA 4JX3A 3TKHA 4P5ZA 3TTIA 5HO8A 3U51A 3ZC5A 4C2WA 3FZTA 5FG8A 2C69A 3ACKA 2H96A 2OZAB 2X4FA 5K3YA 1CKOA 1WBTA 4FSTA 5IA0A 5JFSA 4G9RA 3UIUA 4AZSA 5JRQA 3GT8A 4LL5A 3DK3A 5EQEA 3S0OA 1GSHA 2IN6A 5M08A 1SNUA 3RNYA 3TJCA 3U9TA 2OFVA 1EKVA 1ND4A 5IQBA 3GEQA 5JFXA 1WRVA 2C5OA 3DBFA 3NFFB 4P5QA 4JBOA 3LCOA 4DAWA 5FEDA 4O4IF 1Q3WA 2UW9A 1I1LA 4UFZA 2GQGA 3DF7A 2ZB1A 4PV0A 4U44A 4GG7A 1MP8A 1OL7A 2ITOA 4A9RA 2X9FA 4BZOA 2C3KA 4A4XA 4I6FA 4YJ2F 1PYXA 4JG8A 4MD7E 4YAJB 3BG5A 2PZ5A 2FSTX 3TQTA 1YWNA 4AGDA 3FJQE 3K3IA 4ZY5A 2FGIA 1TAEA 3KN5A 4A7CA 4DCEA 3A7JA 1VYZA 4BDDA 1J3HA 5HCYA 4XG4A 5L8JA 5BYBA 2A2AA 3TTJA 2R7NA 3GOKA 3DV3A 3OUKA 1H28A 3QHRA 4LUEA 4PMTA 3POOA 3Q6WA 4TPTA 4RX5A 4PTCA 4RVKA 4MV3A 2JKMA 3MB7A 2ZDUA 4PY1A 2Q2TA 3BU3A 4OTGA 4W8EA 2Y8OA 3GCUA 4U9AA 4BB4A 2OZOA 3NYNA 4GLXA 3MH2A 4R6VA 5E8UA 3W0NA 5M4UA 5K9IA 5E8YA 1TVOA 2R9SA 4XV1A 3F3TA 4MQ2A 3RCDA 5E8TA 3RNIA 3HEGA 4YR8A 1QMZA 2C5XA 1PYEA 3VS3A 5TR6A 2WEVA 3R28A 3TZMA 1CS0A 2FSLX 3LQ5A 4ZZOA 2YA9A 3DXNA 4XH6A 1ZAUA 4LQMA 2IZSA 4QP3A 1VYWA 4EYJA 3P08A 3A8WA 3QC4A 3CY2A 2HW6A 3GC7A 4K2RA 4O7RA 5HG7A 5IQGA 4XJ0A 1V0OA 5EOLA 1VBGA 1PXJA 2I0VA 4AGUA 4GL9A 2XM9A 2JAMA 2YABA 2YCSA 4X21A 5G1XA 5FTQA 5KBRA 1XBCA 3P9JA 4ZTNA 3D5UA 4W4YA 2YIYA 3E3PA 3LJ2A 5I5YA 3W8QA 4XX0B 2WTVA 1MUOA 5HBJA 3DTFA 1WMKA 2QQ7A 3Q52A 4LV5A 1GZ8A 4AW5A 1STCE 3BLQA 3R8UA 4IZOA 5JGAA 1ZMWA 3VONA 4YP8A 3VQUA 4DA5A 2RFSA 4PZ7A 2O65A 4A4OA 1ZY5A 2CKEA 5BVWA 4BCHA 4HQ6A 4NZOA 4I1ZA 4XBRA 5HBRB 3PA3A 4XHKB 3HP5A 5M07A 1O6LA 3QXPA 1W83A 3C0GA 2XJ0A 3GQIA 4PMSA 4EQUA 2VO3A 2OBJA 4XP0A 3QKMA 4AN9A 5TT7A 4BR3A 3T9CA 5BV3A 4ZTHA 5DT3A 5HO7A 2XCLA 1A06A 3JUHA 4RIYB 3DJ7A 3SHEA 5I9UA 3H9RA 3ZO1A 5CZIA 5DISC 4EH4A 1CKJA 5L3AA 4FNZA 4IZ7A 5HI2A 4G3CA 3Q9ZA 1YXVA 2WQEA 3QQHA 4JDHA 4WRGA 4X6QC 4L6QA 4ZSLA 4G34A 5ANGA 3AW8A 5EHYA 2BDFA 3GU5A 2FYSA 5CE8A 3Q3BA 1ZOGA 3ZSIA 3V5QA 5A54A 2Y4RA 2OJ9A 2QB5A 2YRXA 4GSBA 2XARA 4P2KA 1FMKA 5LQFA 4Q5EA 3OEZA 2XS0A 4R78A 2Z60A 2UVXA 3Q4ZA 2R3PA 4CMDA 1DAWA 3E8DA 4J96A 3VO3A 4E4LA 4F1MA 4C02A 2B9JA 5IA4A 3RK9A 2ONLC 3KREA 4D5HA 3E5NA 3PPZA 3DCVA 4WO5A 2HGWA 4XV2A 2B0QA 2WQOA 5HORA 3DLZA 3NPCA 2PY3A 4EOKA 4QQJA 1Z2PX 4S32A 1J7UA 2B9HA 4DG2E 2VD5A 3NS9A 4UCTA 1M0TA 3A7GA 4YGAA 5K5XA 4JBVA 1ZRZA 4UALA 5CSHA 2CCHA 2OIBA 3EFJA 2VWWA 2JDVA 3RK5A 2JITA 3BYMA 3GOPA 3UOKA 3UYSA 4NIFB 4IH8A 2X7OA 3O8PA 4WD5A 3FKNA 2QF7A 4GT4A 3D83A 3O2MA 1EZ1A 2F2UA 2VO7A 3CJGA 3MWUA 3NVKI 4KINA 3AKJA 3ZM4A 4C61A 5DGIA 3U9SA 1XBAA 1WVYA 4MA5A 4FC0A 3KKVA 3V5LA 3QTQA 2BDWA 1OGYA 3PWYA 3R8VA 3OT8A 4BYIA 3ZLWA 3CCNA 2WMBA 4UBAA 3QKKA 3E63A 5DBXA 4S31A 3QRTA 3I81A 1TQIA 2DWBA 5EZYF 2BFYA 2QO9A 2IJMA 4I24A 4PMPA 3RZBA 2VNWA 4ACHA 3NSZA 4FODA 2XK8A 3MGYA 5JGBA 3T9EA 3DJ5A 4CE5A 5JQGF 4RIOA 4F9BA 5GJDA 5DI1A 2ETRA 4FG9A 2R7KA 5T6KA 3G9LX 1DAAA 3GLKA 1KE9A 2I0YA 3ZS5A 2XRUA 3E92A 2WQBA 4FV2A 2REIA 3HL7A 4TYHB 1E1XA 2BRGA 1VR2A 2YW2A 4FBXA 4G3GA 2VGOA 1UNGA 5CYIA 3UZOA 3KA0A 4Y8DA 2XAMA 3HUCA 4AUAA 4DEGA 3FLYA 3OW4A 2X2MA 2I6LA 2WMUA 2UUEA 2YJRA 2QU5A 3CTHA 5AIRA 4OT5A 4XLIA 1LUFA 3II5A 4E6AA 3OWKA 3QZGA 3QXOA 4GU6A 4L45A 3S2PA 4C4JA 3WWHA 5CAQA 3BU5A 4F4PA 3P7CA 4O38A 3QGWA 4FFPA 1LEWA 3RM6A 3HAVA 4GVAA 3SE7A 4LH7A 4M69B 5EYCA 3U6HA 2UV2A 4EC8A 4F63A 4R5YA 4AZVA 2QHNA 3HMIA 3OF0A 3HA8A 4E8AA 4QMNA 3UJGA 1W8CA 4XRLA 3V4SA 3HV6A 1ZWSA 4EYMA 5CU4A 4KKEA 4EFEA 4C3FA 3IGGA 3EFKA 3ID6C 4UWYA 3MH0A 4C38A 4UZDA 5CSVA 3VS2A 3I5NA 3K3PA 2PHKA 2CHLA 4S30A 2WYOA 2Y0AA 2BROA 3CIKA 3Q9YA 2C6TA 4A07A 4RCNA 1J91A 3F66A 1HOWA 3OY3A 3F69A 4KBKA 2Q0NA 3ZFXA 4QT1A 3PY1A 3LKMA 3W2OA 3VS5A 3GB8B 4DH1A 4BHZA 4X3FB 3O71A 2G2HA 3WF5A 4OTQA 3BELA 3IS5A 2CKOA 3UGCA 4E5AX 4UX9A 3COHA 4HGLA 2P3GX 4IC8A 4G17A 5LMAA 2VTRA 3C0IA 4F78A 4USFA 1K2PA 1QL6A 5E1EA 3KMMA 4FUXA 5AP1A 5H9BA 4USEA 3DBEA 1Q4LA 3BGPA 3C4WA 4JRNA 4O91A 5CNNA 4QYFA 4EH6A 2UW5A 4WIHA 3V8SA 5FXSA 2Y4PA 2R82A 4IAFA 1KV1A 2YZGA 4YBJA 3LFSA 4E4TA 5HE3A 2V7OA 3AC3A 4IAZA 4BZNA 4I5CA 4HYIA 4RC3A 3ALNA 2Z7RA 4G5PA 1PXLA 3QBNA 1IA9A 3P5KA 1RW8A 5CEQA 3NAYA 4FTKA 4E7WA 3MFUA 5FM2A 3CY3A 2RFEA 4ZJVA 2UW3A 3U6JA 1JKLA 1SMHA 5KZ0A 5A9UA 3CTJA 4D2SA 4Y72A 3OCTA 3DY7A 3UZTA 2PBZA 2W1IA 1AGWA 5DPVA 5IMXA 2JDSA 2PVJA 3KGAA 3KU2A 4FV3A 4O0WA 4BCFA 3EQHA 3UIMA 1OUYA 4BBFA 3PLAE 2WMVA 4D4RA 3WO0A 3MH3A 4DGGA 2VWYA 4OGRA 1OVEA 3FMHA 3VWAA 1T36A 5DGHA 2VTMA 2XUUA 3FZOA 2BDJA 1YI6A 4O2ZA 4QMZA 2YIRA 4U3YA 3UG2A 4PZ6A 4ASZA 1H01A 1NW1A 4MYGA 3TL8A 5A4CA 4FSMA 2PL0A 1GSOA 3KRJA 3QFFA 3IONA 5DLSA 1YWVA 3DTCA 4LGGA 4FVPA 4AQCA 5CANA 4USDA 2E9UA 4MXCA 4YJSA 3K3JA 3FHIA 4I6HA 1C30A 2WTIA 4R5SA 3G33A 4AQKA 2HGSA 2IG7A 2CKPA 3Q4TA 4YC6A 4HYSA 4BJJA 4EEVA 2PMNX 3CXWA 3BBTB 4OBQA 1GIHA 3EH9A 3SGCA 1KC7A 3DB6A 3N4VA 4AACA 4QMTA 2G15A 4H3PA 5ETIA 3DZQA 5CQUA 2HELA 3R6XA 1JLLB 2WMRA 1Q8YA 3FQSA 4KUJA 4F1TA 4KRCA 4UB7A 4UCOA 1Q8ZA 3V3VA 2JGZA 2PVKA 4PF4A 5LXMA 1O6KA 4WHZA 4H39A 3LFFA 2B55A 4IFCA 4NZWB 3EFLA 4FV7A 5DE2A 4EBVA 1JSUA 2GTMA 3UNZA 5FDPA 3NIZA 4BC6A 3QQMA 3TV4A 2I1MA 3LM0A 4QMQA 4QP7A 2JBPA 4LYNA 4QQCA 5F4NA 4BF2A 3GXLA 4M84A 3GENA 4EOJA 5J5SA 2VU3A 4R3CA 2C4GA 2BZIB 3PRIA 4QMSA 4CT2A 2C0OA 2J6MA 4FOCA 4FGBA 4L46A 4L67A 5D12A 5FXQA 4EOOA 4QP9A 3BLHA 3RUPA 4L44A 4XP2A 2IW8A 3MWEA 5AV2A 5KKNB 4YJOA 3W32A 2YZMA 4ANSA 4QP2A 5I9XA 4XV3A 4UY9A 4HW7A 4AXAA 3GCVA 3E8CA 5TO8A 3RV4A 2ITTA 4FTCA 3ODZX 4FSUA 4G6OA 2O0UA 4YPDA 5ANJA 2ZYBA 4F0IA 4ZIMA 3KY2A 2HVQA 3VS1A 5IYZF 2XKDA 2ZDQA 5I9VA 1KT8A 3TG1A 2YIXA 1KJQA 4GYIA 3BCEA 3KXXA 5HX6A 3D94A 4FKOA 2V62A 2R84A 2HY0A 4I92A 4HJOA 1KJJA 4L52A 3BYUA 5IQCA 3LXLA 3ZRLA 3SD0A 1ZMVA 3VBXA 3AX6A 4XV9A 3QAME 2YDKA 3Q4CA 2YN8A 3VJOA 2C5VA 2CGWA 4JQEA 4CMOA 4EQMA 4RIYA 4EK4A 2BKKA 3S1HA 1UC9A 4RIWB 4QYEA 2HENA 4UYNA 3D0EA 1FVVA 3NUXA 4RJ3A 4B4LA 5JQ5A 3I79A 4I0SA 5I5TA 3Q5ZA 3NDMA 3PXFA 1V0PA 1VZOA 3R21A 3MYGA 1WAKA 1YVJA 4G2FA 4RRVA 4X2NA 5DRDA 1MRVA 4E93A 4F9AA 4TWOA 4BCOA 3EYHA 5AM7A 3T9BA 1XO2B 2JDTA 3E93A 3JZFA 4M12A 5DT4A 3TY9A 3CPCA 2WQMA 5HTCA 4JBPA 5JVLA 5D41A 3UNJA 3SOAA 3HV5A 5EI2A 3LCTA 3N6RA 3ZZWA 4FT0A 3G0EA 3Q2JA 2X4ZA 4MX9A 3ZRMA 4HVHA 3NBZB 3DPKA 1BI8A 1KV2A 3QTZA 3DS6A 3R7YA 5EYKA 5LJJA 4WSYA 3BHVA 2GNFA 2ZMDA 1CKNB 2OK1A 2PN1A 2WMTA 2R7MA 2ITYA 2Z7QA 4TWPA 4I0RA 3KAKA 3LCDA 3EN9A 1TKIA 3IECA 2WKMA 3OXIA 3PXYA 5BUIA 1Q99A 3VPDA 1Q62A 4KD1A 2QK4A 2UZBA 4E4MA 4QMYA 4CFNA 2W1HA 4CMTA 2Z2WA 4M0ZA 5M57A 1ERKA 2RKUA 3V5TA 3UNKA 4AXFA 1EKPA 3FZ1A 4NKAA 4IW0A 5TOZA 3JY9A 5I9WA 3DFAA 4EOLA 5BYYA 4ZI7F 5HVKA 2A1HA 4PP7A 5AUYA 2BAKA 2CGUA 4RWKA 1Q8TA 3LMIA 2X0SA 2WAJA 5T3QA 2W6MA 3PXQA 2CN5A 4IVAA 2AEGA 4QMLA 4CFVA 2UW4A 3R5FA 1I1KA 2XIYA 3R7IA 1EUDB 1PKGA 5IQDA 4CEGA 3DDQA 1Q24A 3T8OA 4U79A 2ZDTA 3N51A 3TNHA 3R5HA 3NC0B 3AQVA 3I7CA 5DT0A 4WNOA 3PP0A 3F2RA 3Q53A 5HD7A 3VPBA 4A06A 3KFAA 3HMNA 4MBIA 4I50F 3R9OA 3JRXA 3G90X 4AZWA 2BUJA 4CKBA 3D5VA 5IDNA 5M4CA 3UO4A 5JH7F 1W98A 2BRMA 4O6LA 5C9CA 1YHSA 2DQ7X 1UNHA 5FQDC 2WFYA 2WIHA 2ZM1A 5ETAA 3W2RA 3ZEWA 2W05A 4PQNA 1J7LA 1GNGA 3LE6A 3Q96A 3ZU7A 3FMDA 3JSLA 1URCA 3SXSA 2WHBA 1B6CB 3HKOA 1M0WA 2YZLA 4IX4A 4Y46A 1DGSA 4YURA 1GIIA 2HGXA 1H1PA 1Q8WA 1WBNA 1YI3A 4IHPA 4AE9A 1S9IA 3NW6A 4ASDA 4DEDA 3FDNA 3P78A 1FINA 3TWJA 1EHIA 5CVFA 1FMOE 3IK3A 3RPVA 3VBYA 4X2KA 2BPMA 3WZDA 2ACXA 5CAVA 3TUCA 5EYDA 1ZOHA 4JAIA 2HK5A 3O0GA 4UXQA 2XNBA 3JY0A 2B7AA 5BWVA 4M68A 3JZ6A