4O81A

Saicar synthetase (type-1) in complex with adp and amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-1) in complex with ADP AND AMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 73
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o81A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o81A02
3F5XA 4TKSA 3W2OA 2PVHA 4BGQA 4HGLA 2XNBA 2YIYA 4UZHA 4EOSA 4F99A 1M0WA 3HRFA 3TXOA 3VULA 3G8DA 1OECA 3FXZA 3DNDA 5DLSA 4FTAA 5CA1F 3IW5A 1XH8A 2G15A 1H1WA 1W83A 4M9UA 2C5XA 2QHNA 4TYEA 3OCGA 3TKIA 2J90A 3EQCA 3NZ0A 4EONA 5ETIA 5JQ8A 2GDOA 2JIUA 4DEGA 3PFQA 2WTDA 5AP3A 4BN1A 4N6YA 5I0BA 3I79A 1OUKA 4AW5A 3ZSGA 5A54A 2CSNA 2QI8A 4KA3A 2QNJA 2ZV2A 2J51A 3FLYA 3LQ3A 4I5HA 4O7WA 3IW8A 2GNIA 4YUQA 3ORMA 4CNHA 4ZY4A 2VWYA 3UIUA 3QA0A 5F94A 3HMPA 4IAZA 5IQGA 3KQ7A 2FSOX 4LOQA 5CEMA 4ME6A 3JY0A 3AT3A 3WZJA 1CTPE 3DJ7A 4CEGA 3QFFA 3HZTA 3HDMA 2C5VA 4IW0A 2BIKB 4TWPA 5HIEA 3OZ6A 4FIEA 2B9JA 2WTKC 3C51A 3PLSA 3RALA 5JQ5A 1UNLA 4DFLA 5E8TA 4AWIA 2YCSA 3R5HA 3EQBA 3TNHA 4ASDA 2NNWB 4YBJA 4RJ3A 3FLQA 4ENYA 2Z60A 3ERKA 4NUSA 3RWQA 2BFXA 3DY7A 2RIOA 3FKLA 4M84A 5I5ZA 3D9VA 4EH9A 2YEXA 2GS6A 3FYKX 3DBQA 1ND4A 4FSRA 5CF6A 3ORQA 2WTIA 1QPDA 4RIYB 4AN9A 5DEYA 1FPUA 1PYEA 4R5YA 4MV4A 2OBJA 2XNEA 1M0TA 3WI6A 2QG7A 2WTKB 2A0CX 3NNVA 4I0RA 5HE0A 2VO0A 4R7BA 4D2SA 1CS0A 4RWIA 3TNWA 4DFNA 3MSSA 2VWVA 2R64A 2PYWA 3TM0A 3VMMA 4UV0A 3L8XA 4ZMEA 4QSHA 4BCGA 3RFCA 4Z3VA 3FLSA 1XWSA 4E6AA 4FV4A 3K3IA 3ACKA 3AG9A 4HNFA 4IX5A 1RDQE 4GU9A 3H0ZA 4MK0A 3GEQA 5TR6A 4GS6A 4YTHA 3RAKA 3H3CA 3N4VA 2R87A 3BPRA 1ZWSA 1B6CB 3KXHA 1RJBA 5KZIA 2XP2A 4XRLA 2QQ7A 4FG7A 4GJ3A 3DKGA 4OTFA 5B2KA 3U4UA 3Q32A 4Y8VB 4OT6A 4CG9A 2NU6B 2R3KA 5JH7F 4O38A 1GSOA 2OU7A 4DYMA 2ZB0A 4X6QC 5HCZA 3UMXA 2CLQA 3WO0A 5LXTF 4DCAA 2YFXA 2OJFE 4BGGA 2XKEA 2W70A 1Q8YA 1SVGA 4BCIA 3C4ZA 4J71A 3VUHA 4FTJA 4QP7A 5FTQA 3KMUA 5BVKA 3ROCA 4BDJA 4BRXA 4XEYA 3C13A 3QTUA 4XG7A 5CTPA 4E5BA 5J9ZA 3MFRA 2PE2A 4LI5A 3A7JA 4C36A 2C3LA 3O8TA 3QXOA 3K5VA 4MKCA 4L53A 4RX7A 4JAJA 2JEDA 1LPUA 2EVAA 1ZARA 4YJQA 2PZIA 2GFCA 2UW7A 2ZDGA 5AWMA 2HZIA 5DVRA 4C58A 3PWYA 4KBKA 2GLTA 2NU9B 3UVRA 1JSUA 1PKDA 3NNXA 1PXPA 3DT1A 3HX4A 5DT0A 4RX5A 4FIFA 3OMVA 2W1CA 4HPTE 1JKTA 3DK6A 5J2UF 3F5UA 3AOXA 4PTCA 5EW3A 5HG5A 3DCVA 4F70A 3UOJA 5IQBA 5FDPA 5J9LA 1X8BA 4C4GA 4QMQA 5IPJA 3KVXA 4QYYA 2WMAA 3THBA 4ANMA 1WVXA 4BHZA 4XX0B 4WBNF 3I60A 3F3VA 2X7GA 4HNTA 2H9VA 3BCEA 3RAWA 1WZYA 4EKKA 1Y6BA 3BQRA 2W6OA 2JBPA 3DFCB 3N9XA 4H3BA 4U42A 1MQBA 5D12A 3E8NA 3WIKA 5EFQA 1H01A 5HGIA 3ZONA 5IISA 4OBQA 3OTVA 5LQFA 3DKFA 5GIPE 2BRNA 5BMVF 3MH3A 4IX3A 5JH6A 1H8FA 5FBOA 4KBAA 4FZ7A 3C9WA 3E92A 4IWQA 3QRUA 4L01A 1A9UA 3AC3A 2C6KA 3TNPC 5JQGF 2IN6A 3EFWA 2UVYA 4E4NA 2O3PA 3G8CA 4BDAA 4A9YA 2YL2A 2A27A 2EUFB 4MV8A 4Q9SA 3BI6A 4FT5A 4EZ7A 5IA1A 1WBTA 3M42A 2W6MA 3NYNA 3EFJA 2OSCA 3EQGA 4IFCA 4XG6A 4IZ7A 3ORLA 3HBLA 4KSPA 2XKDA 2ZDTA 4P2KA 4PUZA 5D9HA 5GHVA 4R5SA 3JS2A 4FK3A 3MN3A 1FOTA 1REKA 3SLSA 4DN5A 4O0TA 3BU5A 2PULA 2PTKA 5A14A 5I9XA 4NCTC 4FFLA 3DK7A 4WHZA 2OKRA 4Y5HA 5CVGA 3V5WA 4CCUA 3DLZA 4AT5A 2OFVA 3UG2A 4DTAA 3FMHA 3MTLA 2XZSA 1ZOGA 3UO4A 5D7VA 1PXJA 3QUPA 2GPHA 2IZSA 3SXRA 4AA4A 3PP0A 3QWKA 2XIKA 2B9FA 5AP7A 2R3NA 4EHZA 4H3QA 3VBTA 4FTUA 2VV9A 3ZTXA 5AUUA 4FV7A 2O63A 3EL7A 4ZTQA 5EI2A 3WYXA 1UU3A 3UO6A 5CALA 3HLLA 5CASA 5JZJA 5L2TA 4ITHA 2XVDA 2VU3A 4HVHA 5EDQA 3TWJA 2JDTA 2Z7RA 5FQDC 3R01A 3TIYA 3TIGA 3SGCA 1VZOA 2QF7A 2QLUA 3EMGA 1KJ9A 3Q6UA 5G6VA 2FB9A 2VTLA 4L1KA 3BGPA 5B2MA 4KIQA 4QMTA 2AC5A 3GI3A 3ACJA 4UALA 3UIXA 3KXNA 3MFUA 4QOXA 3MVJA 5AX9A 3LQ5A 2W9FB 1M7NA 2R3PA 1DI8A 2X6EA 3ZCLA 4FA2A 3NYVA 5FDXA 5CAEB 1IAHA 3MY0A 4ALUA 1E9HA 3FXXA 4Y85A 4ACGA 1GIJA 3KXMA 4X2GA 4CMTA 4BIEA 4GT5A 2PHKA 1MRYA 4QMXA 3F3WA 5FGKA 4ZJJA 1WVWA 4M68A 4PL3A 5EM8A 5BQ0A 5CF5A 2QOHA 2I40A 5JFXA 4WUNA 2V59A 5HV6A 3UODA 3PVUA 4NM0A 3HB9A 1KEEA 4QMZA 2F7ZE 5FP5A 1YWVA 4G3EA 2W17A 2Z8CA 3A4PA 4UYNA 2P0CA 4DINA 1JSTA 2DWCA 3KALA 2BROA 3H9RA 3FL4A 4YNOA 4AT3A 5C1PA 2OZAA 2J0MB 2WMXA 3CY2A 4O6EA 4D58A 4YURA 2XNPA 3GVUA 5C8YF 4GT3A 3MBLA 1G8SA 2BZJA 3G6HA 4V0GA 4RMZA 3PJ3A 4EZ5A 2F2UA 4LYNA 4U80A 1NVRA 2W96B 3D4QA 4YAKB 1UA2A 2C6IA 2OZOA 2WIHA 2WQNA 3BLRA 4FSMA 2OXXA 5HBEA 1MUOA 1OKZA 1PXMA 4O4JF 2J6MA 2B9IA 4Y95A 4NW6A 1AQ1A 4XRJA 2YJRA 3RJCA 3CQUA 4BB4A 3QLGA 3MH1A 2NU7B 2FB8A 3AC2A 3ZM4A 4YO4A 4FKTA 2C6TA 4Z16A 3CD3A 5JSMA 5IQEA 5K4IA 1B6RA 4C2WA 2C3IB 4GMYA 4GYGA 3BKBA 4KS7A 4LRMA 4X2JA 3WIGA 2ZB1A 4RSSA 3VQHA 2QKWB 3PJ1A 3FZ1A 5EHOA 1MRUA 2BAQA 3HGKA 1RQQA 4L52A 5DRBA 1UVRA 3KCFA 3MVLA 3DZOA 3Q2JA 4D4RA 4L9IA 3EN6A 5CVHA 2EWAA 3QTWA 2HZ4A 2RFDA 4MH7A 4Y73A 3E8EA 4GH2A 5DT4A 3V51A 3WE4A 5AA8A 2ZV9A 3MFTA 5EDPA 3IDCA 4I55F 1O6KA 1SYKA 4IB1A 3R8MA 4DIMA 3D7TB 3LFNA 3UC3A 3CEKA 4CFNA 5FG8A 2PMIA 4CV9A 5CAQA 1UU9A 2HW7A 3KB7A 3UIMA 3V4ZA 4DGLC 1JLLB 3MWUA 3SRVA 4LRJA 2GS2A 1LEWA 3CPCA 5HX6A 4FU0A 4LQMA 5CANA 4TV9F 4W8DA 3RWPA 1KE6A 3QRKA 4U79A 3ZLYA 4F64A 2NRUA 4I21A 1TKIA 4FFNA 3HV5A 4ANQA 1OKVA 5AP0A 5A4EA 4WIHA 2QU6A 4RC3A 2YAKA 4E5WA 1PXLA 3UNKA 1Q99A 3ORNA 2RFSA 3RAHA 3RK5A 3MDYA 3UNZA 3C4CA 4NW5A 4UXLA 4Y72A 5JT2A 2YZMA 3U9SA 2RL5A 1IEPA 4TYIA 4MXCA 2PUPA 5D11A 1CQIB 3ORPA 4U5JA 4A9SA 2WMSA 2WEVA 3VUIA 2UUEA 5CEKA 2GPWA 4DH1A 1VYZA 3LZBA 3W55A 3DTCA 3BWJA 3Q6WA 1YWNA 3MWEA 3S4QA 1J7LA 2X1NA 5HLNA 4HCVA 4IC8A 3A60A 2R3MA 3LOKA 3ENMA 4I5MA 3AMAA 1JNKA 3SOCA 2ZAZA 4FUXA 2CDZA 4RBLA 5CXHA 3KY2A 3KF4A 3PPZA 1YHWA 1ULZA 5M08A 1BYGA 2IO6A 3N4UA 4MQ2A 4S32A 5IA2A 3CTJA 3RCJA 4B4LA 4DEBA 4F7SA 5C8NA 4TRLA 2XM8A 3ORXA 5JKGA 1O9UA 4MBLA 3W33A 1OL1A 3EN5A 1Q4LA 3SD0A 1K2PA 2YITA 5E90A 3LP8A 3DTWA 5LVPA 3BE9A 2SCUB 4QP8A 4G2FA 2Y8OA 3OT8A 3QC4A 4F7LA 4ZLYA 4EEVA 3KRRA 3U9TA 4WBOA 3SG8A 5K9IA 1KOAA 2X8EA 4BTKA 1E4EA 2ITQA 2RKUA 3H10A 3QKLA 4WNOA 3K2LA 3EZRA 5HVYA 3TJCA 5M44A 4I94A 1H4LA 3LPBA 3POZA 2X8IA 2BIYA 2UZBA 4ZLZA 5KX8A 4EG0A 1WR2A 5DPVA 3GU4A 3I5NA 3PWDA 5BVWA 3VS5A 2C6EA 5IUGA 2VTIA 4UX9A 2JGZA 3I7BA 5A4CA 2BRGA 3QALE 3R9NA 3W10A 1KWPA 4YLKA 5KUPA 2W5BA 4MXXA 1Q24A 4M69B 5EG3A 2GU8A 3EN9A 1BL7A 4Q9ZA 4G17A 3LXLA 4X21A 4ANBA 4BDDA 3G6GA 4FSYA 3TINA 2BFYA 4O7ZA 4IZAA 2EB3A 2Y4IC 5E9EA 4BCJA 4DFYA 3OUKA 3O8UA 3LHJA 4U8ZA 4HVSA 2GNLA 4C0TA 2XCKA 4FL1A 2C5NA 1ERKA 1T46A 3QUDA 4V05A 2ACXA 2I6LA 2R3HA 3NUXA 3ORIA 4G16A 3IW4A 4GRBA 4JOAA 4D0WA 3TQTA 4FKPA 3E3PA 2WD1A 3QKKA 4YHFA 3W8QA 5LMKA 4HCTA 4M0YA 1GNGA 5F4NA 3TDVA 4GK4A 3NRMA 3P4KA 4ACDA 1FQ1B 4IMYA 3BHHA 3W32A 4NH1A 2BAKA 2V7OA 1CSNA 2A2AA 3NIZA 4USFA 1UKIA 2Y4IB 3MGYA 3VUDA 3ZC6A 4D55A 3QQLA 3FLZA 4M97A 1W82A 3TTJA 4RT7A 2GTMA 1PRYA 1LR4A 4FEWA 4XP2A 5IF1A 3UVQA 4AG8A 3DXPA 4EK4A 3C0HA 1CDKA 2NRYA 2IZUA 1PW2A 2ZDUA 3HV3A 4PDOA 4YZCA 3LXKA 3V6RA 5IMXA 4C37A 4DC2A 3HVCA 2P33A 2QOBA 1EHIA 5AIRA 3ANRA 3DGKA 4ZS0A 4IWDA 5EQYA 4E26A 4ZZNA 2Z7QA 3DNEA 3F3TA 4IACA 4GV1A 1P4OA 3GQIA 3QTIA 3UG1A 1YI3A 4YMJA 4G9CA 3Q9WA 4AZWA 1YRPA 4H1JA 1GSHA 3MV5A 4J98A 2Y9QA 2IPXA 3D5VA 3UZRA 4ZOGA 4PP9A 4XOZA 4YPDA 2I0VA 3QCSA 4KABA 4KIOA 2VWBA 3PVWA 2BR1A 4R1YA 1OIUA 4D1XA 4K18A 4F0FA 4I6HA 3VS4A 4EQMA 3FKNA 4RX9A 4CTCA 4D0XA 1BL6A 1H1SA 5AP1A 5AX3A 2ZDHA 4FVQA 2XJ2A 1SNXA 4F6SA 3OOGA 2XKCA 2QOQA 2CGWA 1JSVA 3COHA 3D5XA 2QU5A 3CBLA 2Y6OA 3PXZA 4ZLOA 1B39A 4DHFA 1M17A 3OOMA 3TTIA 2UW9A 4K33A 3WZKA 4MV3A 3ZRKA 2NP8A 3FI4A 3TZMA 2BKKA 1ZYJA 4RJ5A 5IG1A 5CNOA 4UBAA 1FBNA 3I4BA 2ITPA 3UPXA 5A4TA 4Q5EA 4MA5A 2Q83A 2BZKB 3HKOA 4DLJA 2JKKA 2X6DA 3ENHA 5JEBA 3QYZA 2JD5A 2PWLA 3EL8A 4QMOA 3VVHA 1ZYSA 4GCJA 4PL4A 3V5JA 3LCKA 4GU6A 5J95A 3F3ZA 5LA6F 3SKCA 3D2IA 2JDRA 2GQGA 2A19B 3AGLA 3ULIA 4QQTA 3UOKA 4E4XA 1UKHA 4O27B 3WARA 4TYJA 1KOBA 5IUHA 3AXWA 2W1GA 5M07A 4TYHB 4J7BA 2O0UA 3U6IA 4D1ZA 3UTOA 4O21A 5E8VA 2R5TA 4Y5QA 2H96A 5J1VA 4O2BF 4V04A 4XYLB 3PXQA 3GFEA 3QLFA 5F1ZA 2XK3A 5KZ0A 1Z2OX 4DG2E 5ANIA 1QMZA 4EYMA 4FKOA 5JGBA 2R3OA 3D5WA 4A4XA 4R7HA 1KE9A 1U5QA 2I80A 5IU2A 1J1CA 1VEBA 2CZGA 4JQ8A 3TIIA 2DYLA 2UW6A 2F49A 2OF2A 4PDYA 5E8UA 5I9YA 3PJ8A 4N70A 1W98A 1HCLA 2OWBA 3A7FA 3NS9A 3UVPA 4DGMA 4MNEA 5CSVA 4DEDA 4NT4A 4JX7A 4FNZA 4EH4A 4Y8DA 4U44A 1GJOA 1ZZLA 3FLWA 1UU8A 1XBCA 4NSTA 2WNTA 2X4FA 5AMNA 4HZRA 3RTPA 2VWIA 4F08A 1A48A 2CHLA 4AOJA 3LJ2A 3QWJA 5ANKA 1JOWB 2YDIA 4X0MA 3R8VA 4IZ5A 3QYWA 5DMXA 4AF3A 3LFQA 4I6FA 3MS9A 2GS7A 4FTNA 3UQFA 4XV2A 3MIAA 4UWBA 2P0AA 1ZOEA 2CKPA 5CEOA 5I4NA 4UB7A 3TKHA 2QODA 4PMMA 4YLJA 2FPGB 1E1XA 5AV3A 4NZWB 3II5A 4JS8A 1QPCA 3PE2A 4J53A 3VW8A 4Z7HA 4L6QA 1WMKA 2CPKE 3O2MA 4FSZA 4GJ2A 1YKRA 4O91A 3EHAA 3PPJA 4TZRA 3Q5ZA 3VAPA 3PRIA 4APPA 4BCKA 1PF8A 3K5HA 2IZTA 3FMMA 4PDSA 4HVDA 2QURA 3PIXA 5EH0A 4IQ6A 4BI1A 4QNYA 2WQOA 5CX9A 3TL8A 4PQNA 3V4SA 4FNWA 3AC4A 2YM5A 4DH5A 3VPCA 2PMNX 3HV6A 3QD3A 3V5TA 4CXAA 5J2TF 1AD5A 2IW8A 5FEEA 3WF7A 2J7TA 4G3GA 3FMDA 2X9FA 2YERA 2V7AA 4UYAA 1PK8A 4FTCA 4I4TF 5HKMA 3ZRLA 3VHEA 4EK3A 4FE2A 4A07A 4LGGA 2NPQA 3DQXA 3L9PA 3GC0A 3PIYA 4I23A 4BTMA 1F0QA 2G2IA 5EHYA 3IK3A 4XG2A 2ITOA 5C03A 2RFNA 4N4SA 4JBVA 2X9EA 3BLQA 3CD8A 3ZLXA 3BHYA 3OUZA 4XOYA 4M3QA 3P79A 3ZOSA 5AV1A 3OY3A 1KBLA 3MJ1A 4P5ZA 1GZOA 3FQEA 3QTQA 3SW4A 1PMUA 2W99B 4OT5A 4C3RA 3MI9A 4MD9E 3ODZX 3BV3A 1R0PA 1C30A 4E6CA 4EOLA 3S00A 2QR8A 4L7SA 2BDFA 4C5CA 3ZRMA 4WD5A 4M8TA 4QMSA 2G2FA 4EBWA 3WZUA 4YU2A 5JMSA 2YM7A 4OR5A 4AE6A 4EWQA 3FY0A 3A8XA 3DDQA 2R3RA 3V04A 4ASZA 3MVMA 1PMNA 5B0XA 3OBJA 4IZOA 2WTJA 3AMYA 3PXRA 4OBOA 4ZMFA 2QOIA 5L8KA 4MQ1A 3ZUTA 2PN1A 4CKJA 4CRSA 4TL0A 2IVTA 4FMQA 5ANEA 1DAYA 1FVTA 3B2WA 2WQMA 4RIYA 3TJDA 4B9DA 4DT8A 2PMLX 4XLIA 4AZVA 4OTGA 5E8YA 4PRJA 4UXQA 4UZDA 3UE4A 2UW4A 4BCOA 4U81A 5B2LA 4ANLA 2R82A 2VX3A 4RPVA 2OK1A 3I6WA 4JT3A 1YHSA 4IVBA 5E7RA 2W71A 3EYHA 4WG4A 4TWCA 1QL6A 3A7GA 3PSBA 4O7TA 3DK3A 4QP2A 5ACBC 3DXNA 4EI4A 5M06A 4IB5A 4O4LF 3Q4CA 5IQAA 1OIQA 4C02A 4KRCA 3BU3A 4B8MA 4L67A 3Q4ZA 3F61A 2WU6A 5EW9A 1KE7A 4J8MA 3NUSA 3R21A 5CNNA 2ITNA 3KU2A 3OHTA 4XNEA 4ZI7F 3FMKA 5DA3A 2WZJA 5H2UA 4CMOA 1Z9XA 4NFMA 2PUIA 1OKYA 3E5AA 3P5KA 4M67A 4S2ZA 4MV6A 5A9UA 4HYIA 1OZ1A 2C1AA 3KEXA 2YN8A 2GNGA 2YCFA 4YNEA 4FTMA 4D2RA 1KV1A 5HTBA 4IH8A 2Z04A 4MXZA 4QMVA 4DCEA 4YC8A 4XJ0A 2PBZA 1IR3A 3P86A 4DLKA 5HI2A 4CV8A 3MTFA 2R3GA 2VGPA 4WRSA 3QUEA 2X7OA 3DKCA 2VRXA 2WMBA 2YIXA 2V62A 4KS8A 5M55A 4B8LA 1APME 3R1QA 4S33A 1F3MC 4C33A 2VWZA 3GCPA 4GYIA 5E8WA 3R6XA 4RG0A 3ZZWA 1NVSA 5HNGA 2BZHB 4U3YA 3T9IA 3JY9A 2E9VA 4EH3A 2P3GX 5KMJA 4FSQA 2UZTA 3BIZA 5DN3A 4GG5A 4HNUA 2VD5A 4RJ8A 3QA8A 2QOLA 2RF9A 4WUAA 3KF7A 4QMWA 4R78A 4TY1A 3AGMA 3MJ2A 1GSAA 1QPJA 3F5GA 3OCSA 4WNKA 4FG8A 4HZSA 5BVEA 4G5JA 3FSFA 3BG5A 3I6UA 4GIHA 4ITIA 4ZTNA 2GCDA 3BWFA 5J9YA 2C5YA 3OWLA 3F2AA 3D15A 3IS5A 4FV2A 4LV8A 4PMSA 3MJFA 1ZXEA 4IVDA 3E63A 3P08A 5CZIA 1R39A 3LCTA 3UDBA 3L8PA 4JVGA 4I20A 2QKRA 3MPMA 4YP8A 3UIBA 5CSXA 3BEGA 4BDCA 4WNMA 2VUWA 3COIA 4GSBA 2C30A 4PTEA 2JDVA 1SMHA 1CKPA 2VTHA 4EOMA 4YAJB 5FXRA 4D9UA 5FM2A 1U4DA 4FTQA 5EDRA 1B6SA 2NUAB 4MX9A 1YOJA 3V5PA 4DG0E 5BUIA 1H26A 2W5AA 3LXNA 4HOKA 3R1SA 1XHAA 2YCRA 4FEUA 5DWRA 2OFUA 4FKIA 3JUHA 4F1OA 2HWPA 2V0DA 2JLDA 2XBAA 3LFFA 4FKJA 4FTLA 1SM2A 2GSFA 4JBQA 4PF4A 5A4LA 3F6XA 4AP7A 2VGOA 3SAYA 2PZRA 5FD2A 4PNIA 3ROYA 4ERKA 2W4OA 5KO1A 5IDPA 5A46A 1UU7A 4FZFB 1IG1A 4WA9A 3W2PA 4OBPA 1WBWA 4YJTA 1Y8GA 4L3PA 1BNCA 4WT6A 4FBXA 2LAVA 1GZKA 5HBHA 1J3HA 1NW1A 2WTWA 4RA5A 5EQPA 3OEFX 4ZQIA 2CN5A 5HCXA 3E5NA 3DBCA 1DV1A 4ZP5A 3P0MA 4FKLA 4FR4A 2J5EA 4JLCA 5LMBA 2AUHA 4S31A 5ANOA 3WF6A 1QCFA 4AGDA 3UP2A 4DEEA 2VTJA 4JDHA 1P14A 4K9YA 4LRKA 4QP3A 2YM8A 4LGHA 4U6RA 4NCTA 3EQRA 2F57A 5GNKA 3CGOA 4WBBB 1TVOA 1XR1A 4A9RA 3VS7A 2GNHA 4XV1A 2Q0NA 4FT7A 4E4MA 3OVVA 3PRFA 2QOKA 3ORRA 3R1NA 2YIWA 3WF5A 5ANDA 3LWBA 4FEVA 3H9FA 5AUVA 4IIRA 2UV2A 3RHXA 4Q2AA 4FFOA 3OD6X 4C7TA 4CG8A 1GZNA 5AP6A 4PP7A 2P55A 4CT2A 4E93A 4I5CA 4TYGA 4R3CA 4EHEA 2UW8A 4YJNA 2R4BA 1V0BA 4F0GA 5I9WA 2OXDA 1K9AA 3C50A 3UYSA 2IVSA 3EYGA 5ANJA 1NY3A 5JFWA 2OO8X 3Q5IA 1P5EA 3R7YA 3LAUA 2BHHA 3O7LB 3VA7A 1YXVA 4BGHA 4IC7A 4FVPA 2CN8A 4YLLA 2HXLA 3QZFA 2X39A 3BRBA 4YC6A 2W1FA 4KKEA 4KNBA 4AA5A 4YTFA 5HNIX 1JKJB 3O0GA 5M53A 3FHIA 3DBFA 4JG7A 2UZVA 2E9NA 3PIZA 5CA0F 3GCSA 3DV3A 4O0SA 3B8RA 1U46A 4L3LA 3POOA 4GVJA 2WOTA 2XIYA 2DQ7X 5DE2A 2JITA 5C8MA 4M13A 3FBVA 3RPYA 4O7NA 2WPAA 3I0OA 4E4LA 2UZEA 4FGBA 5IH5A 1AGWA 2CCIA 4FZDB 2YZAA 3KK9A 5HG8A 5TO8A 1M6VA 4FIJA 4BDBA 2VN9A 4YO6A 1YWRA 2I0YA 4YJVA 5CEIA 4BVUA 3BGZA 1SVEA 2J9MA 5EM5A 1XQZA 4I93A 3PXYA 4HYSA 3QTSA 3ZYAA 4YB8B 3PA4A 2VX1A 3Q2MA 5M4IA 4C5AA 4BZOA 3K3PA 3F88A 3KC3A 3EJ1A 4O22A 5CF8A 2GTNA 5FM3A 1Z2PX 4C5BA 1VYWA 3PSCA 3AC5A 5F95A 3R9DA 3ITZA 5EYDA 3QX2A 1EYZA 3Q53A 3KKVA 2J0JA 5FLFA 4K11A 3TIZA 4YJSA 3ZU7A 4BZDA 2UZOA 5FTOA 3LLTA 4OTIA 2H34A 3SQQA 5HBJA 1Y8YA 3D7TA 2WMUA 1PXNA 2WTVA 2UZUE 2ZM1A 4M12A 2FSLX 4RGJA 4C4HA 2PK9A 4EQUA 4FKGA 5JRSA 3NCGA 3BX5A 3NW5A 2WMVA 3NWWA 5LYJF 2PZPA 4LUEA 5ANGA 3RV3A 5A6OA 3A7IA 1YDRE 3I7CA 3QTRA 1YHVA 5AM7A 2CNVA 3ZLSA 1XH4A 3ZM9A 3ZO2A 3OROA 5FUTA 5IEYA 4MV1A 3UBDA 2FP4B 1Q61A 2CNUA 3PY1A 4YJOA 2QO9A 4AUAA 5IA0A 4F1TA 3DKOA 4QMLA 5L6PA 3ZSIA 3VNTA 4C3FA 3OC1A 3DOGA 4BTJA 4EC8A 3EZVA 2R3LA 4ALWA 4E4TA 2WQEA 4F9BA 5DYJA 2H8HA 2FA2A 5KCVA 1UV5A 3BYUA 1ZMVA 3ORTA 1OIYA 4RIXA 2PVMA 4NTTA 2XJ0A 3PVGA 4FNXA 3ZDUA 4USEA 3DS6A 2C3JA 1JDEA 1W93A 2BVAA 1XBAA 5LVLA 1GZ8A 4JQEA 3D0EA 5EOLA 2WB8A 1FGIA 2OG8A 4L44A 4RVKA 3BQCA 2I0EA 3LCDA 1PMEA 1GIIA 1Y91A 4JR7A 3RNIA 3HL7A 4EZ3A 4EOJA 2OI4X 4RZWA 4TNBA 2IW9A 3GLKA 4JIAA 4PTGA 2KTYA 4TWNA 1Q8WA 3RM7A 1REJA 1GIHA 5D1JA 3QHRA 5DNRA 4FT0A 3R7OA 3QL8A 2W0JA 4QT1A 4X2KA 3BU6A 4AOIA 4CT1A 2QC6A 2WOUA 5IH4A 4TUYF 4RFZA 3UC4A 3LW0A 5CAUA 3AMBA 4ZSEA 4RWJA 3KVWA 4ENXA 1MP8A 3C5IA 3FI8A 4FFMA 1XH5A 4QNAA 3GC9A 4HW7A 4W4VA 2OICA 4C3PA 3GC7A 3HV7A 3OT3A 2XNGA 3LCOA 3OF0A 3ZHPC 4FV9A 4AZTA 1STCE 3JRXA 2WIPA 2FSMX 2CCHA 4R77A 3VF9A 3UJGA 3AD6A 3P78A 5TF9A 4FVRA 3PP1A 2GNFA 3JVSA 3KFAA 1Q62A 4FV6A 1M2PA 5T6KA 2O64A 4E73A 1MQ4A 3P7CA 4DH7A 4FEXA 1W7HA 5ITAA 4EBVA 4KUJA 2W9ZB 4NM7A 2ITZA 2QONA 4AQCA 1YVJA 3HA6A 2JAMA 4F65A 5BVFA 3HRBA 4WNPA 4XH6A 3KK8A 4EHVA 3QXPA 3LFDA 2ZM4A 5IA5A 5JQWA 3E8CA 5A6NA 5M4CA 2XNMA 1JDBB 3FPMA 1Z5MA 2WMRA 3FI2A 2I87A 5HIBA 4U3ZA 5M4UA 5CQWA 4MBIA 3UNJA 1IRKA 3L1SA 2Z02A 4ZTLA 3CTHA 3MA6A 5DBXA 3O8PA 3U51A 4AN3A 2SRCA 4MD7E 3TDWA 5AA9A 3I1AA 2Z7LA 4I6QA 3QTXA 5CSHA 4YHJA 5DIAA 3ZEPA 4ACCA 4AZSA 4EH8A 5I9ZA 2AC3A 1NT2A 3G51A 5CU6A 2UZDA 4BDEA 5L3AA 3ET7A 4FZAB 5CU0A 3F2NA 2OJJA 4GUEA 5HCYA 2HGSA 5E91A 5CYIA 4D5KA 5I9VA 4KD1A 3IW7A 3C4EA 3KMWA 4FTRA 2WMWA 1RE8A 4QMPA 5IQHA 3D5UA 1OI9A 2F4JA 2ITVA 2XK7A 2OIBA 4YTCA 2OJIA 3B8QA 4MAOA 2B52A 4MYGA 4RVTA 4U45A 3MA3A 3VF8A 4BHNA 4GKHA 1JLUE 4R6VA 2PZ5A 2XK9A 3DAJA 3W16A 2QD9A 4GK2A 1C3OA 2F7XE 5BNJA 2R3QA 5KBQA 2DIKA 4XG9A 1SNUA 4ACHA 3JYAA 1H27A 3KRJA 4V0GB 2HZ0A 3NUUA 1KC7A 4RFMA 3GGFA 4XZ3B 4FUYA 2PY3A 2EU9A 5L2SA 3CE3A 1OPJA 5HVKA 4E6QA 2QG5A 1KV2A 2YCQA 4LMUA 1R1WA 2GHLA 5IUIA 3VW6A 4ZTMA 1A06A 2WAJA 4IAYA 2C00A 5JRQA 4BTFA 3RUPA 5LWMA 3C4XA 4ZY5A 2QCSA 3PXFA 4LV5A 3PJ2A 1XBBA 5JFSA 1FINA 3PE1A 3R5XA 2PVRA 4RZVA 5CAVA 1H1PA 3SE7A 4GL9A 4F9CA 2O2UA 4FKQA 4AS0A 4L45A 4EHGA 3LFAA 4F6UA 2X2LA 4NKSA 4IIJF 1SZMA 4MF1A 3NNWA 2VO3A 3PA3A 3NNUA 4XG3A 4FTIA 4EYJA 2J4ZA 2X2KA 4O0UA 2VNYA 2O5KA 1VJYA 4BDKA 2GNJA 4MVFA 2V55A 2YHVA 4G3CA 3R22A 4I1ZA 4J1RA 4LOOA 4TTHB 2A4LA 2OIDA 4EK6A 4BI2A 4QQJA 1BMKA 4Y46A 4GT4A 4BIBA 2OIQA 1JQHA 4JQ7A 3EFKA 4O7RA 1OVEA 5LVNA 2PL0A 5ETCA 4G6OA 3UZTA 2J0LA 3R9OA 4WOVA 4ZJIA 5AP2A 2XRUA 4CFFA 5HORA 2RG5A 4QP4A 5HTCA 1PY5A 2R7NA 4F4PA 1CQJB 2PPQA 5K4JA 3FC2A 4TYHA 3D94A 3SRVB 2B1PA 3FKOA 3MESA 4QTDA 4EKLA 5LVOA 2YM4A 1PXOA 3U6HA 1OIRA 4PL5A 4R3RA 4L8MA 2WHBA 4XCUA 1AUVA 4IM2A 3U54A 4BF2A 1T36A 2X0SA 5FNVF 3NW7A 2ETRA 4I92A 5H8EA 5HIDA 4MA0A 3TKUA 1URWA 5CU4A 3O96A 4NL0A 4ZSAA 3EOCA 3FQHA 4IBMA 3AT4A 2W06A 3MY1A 4C62A 4KB8A 5H80A 2F2CB 5I9UA 4DTBA 4EUTA 1NA7A 3ZFXA 2BPMA 3NUNA 4F9WA 3ZC5A 2RFEA 3TV4A 4I50F 4MTAA 3RKBA 2R7BA 1J7UA 3BELA 5FEQA 1G3NA 3BHVA 4FV3A 2UZWE 4RRVA 4CD0A 2B53A 2XIZA 3K54A 4KSQA 4QMYA 4D4YA 2VTPA 3VS2A 4E6DA 3PY3A 5KMLA 3TNIA 3MFSA 4X3JA 2VPQA 5E8ZA 2QOFA 3BHUA 3F7WA 2CKQA 2ITWA 3HYHA 4TNDA 3FPQA 3RHKA 2G9XA 3U87A 3KXXA 3FSKA 4FGRA 4O4IF 4J99A 4LM5A 4W4WA 4O7SA 3W18A 4DH8A 3Q9XA 4OTDA 4QYEA 4W8EA 3U6JA 2ZJWA 4MNFA 2YJSA 5DT3A 1A9XA 5T68A 3TG1A 2GFSA 3O17A 3MIYA 2REIA 4E8AA 2VTOA 3MPTA 1XH7A 4AACA 4CFUA 4ASXA 4UWYA 5BVDA 2W1DA 1K3AA 4HNIA 3WO1A 2QVSE 4C35A 4F7JA 1T45A 5FXQA 4MEDA 5J7HA 4A4LA 3LXPA 2W1HA 4L43A 1XH9A 4BCMA 2DUVA 2A1AB 4I24A 1YXSA 3ID6C 1Q3WA 3Q60A 2C69A 2OLCA 3HA8A 3GU5A 5CZHA 2EB2A 2WMTA 3I81A 4D28A 4D9TA 3SC1A 3LE6A 1UWJA 4J8NA 4RX8A 4HQ6A 3QTZA 4U7ZA 4M7IA 4BDFA 2HZNA 4MXYA 4YPSA 4YJ2F 2ZVAA 2ITUA 3KAKA 4H36A 3IDPA 2R0IA 2VTMA 1WCCA 3NAXA 5E1EA 5CY3A 5LJJA 3RVGA 4ZZOA 3KN5A 4TN6A 3T3VA 2V58A 5EI6A 3TUDA 1BI7A 3EFLA 4YGAA 5HEZA 4IFGA 3TN8A 3W1FA 1TQMA 1UWHA 2VTRA 5AM6A 3P23A 3W8LA 3NUAA 5DRDA 3KMMA 2HYYA 2CKOA 5AP5A 4QO9A 3SOAA 4D1SA 2XM9A 3IQ7A 3MB7A 4Z55A 4FEQA 3R63A 3A8WA 3CJGA 5EYKA 4DG3E 5M51A 4AZEA 4RZQA 4NJDA 3DZQA 5EW8A 2B55A 1S9JA 3CIKA 3E87A 1BX6A 1H00A 2YA9A 3QZGA 4O0XA 5KE0A 4YJRA 4BDGA 5IEVA 3O7LD 4H05A 4IJ9A 4FOCA 2VTSA 2YIQA 1EUCB 1HOWA 1E1VA 4XG4A 4DA5A 4NM3A 5ICPA 3O51A 5CT0A 2ZV8A 4O7VA 1KJIA 5LWNA 2X7FA 5KBRA 4DH3A 2B4SB 1VBHA 4FTTA 3GNIB 3QRTA 2IG7A 3E3BX 3HMOA 3P7BA 3RK7A 5CQUA 3JRWA 1G5SA 5GJDA 3W2QA 2XS0A 4IWOA 4YSJA 1U54B 3U9NA 2HWOA 3QRJA 3GFWA 3FZTA 3QZIA 1ZLTA 4U9AA 3UMWA 2C6LA 2VTTA 3DAEA 4R1VA 4XBRA 2ZYBA 3KL8A 4AAAA 2BRBA 2ESMA 1H0VA 3E7OA 5HG7A 4BZNA 3E64A 4FV5A 2GHMA 2HAKA 3LFEA 4I5PA 3BZ3A 3OW4A 3F66A 3QCXA 2X81A 3GU7A 3R2BA 4K6ZA 3RK9A 2FH9A 2CLXA 4OTQA 5D8DA 4EH5A 2W4JA 3E8DA 4UWCA 4RIOA 5AEPA 5LCKA 5JZNA 1WFCA 3GCQA 5C26A 2B0QA 4AGCA 3BLHA 4OGRA 3R04A 2BZIB 3FZOA 1WVYA 4QTEA 2C6OA 3UGCA 3H0YA 2IZRA 2X8DA 3NCZA 4O96A 1BKXA 2FYSA 2VNWA 5AUYA 4N0SA 4M0ZA 5HE2A 4QP1A 2Z2WA 3FC1X 4PDPA 2PVPA 3N8DA 4NFNA 5BYZA 4XYFA 2DZDA 3Q2OA 2YIRA 3DLSA 4YZBA 4X3FB 2XCHA 4C38A 4ZHQF 3OXIA 2QHMA 3VBYA 2OJGA 2FGIA 1SVHA 3IECA 3QX4A 4FG9A 3FUPA 4BY9E 4AU8A 5K3YA 4ZXTA 3H30A 3O71A 2QOOA 3KXZA 3PDTA 3LQ8A 3F82A 3NDMA 1H25A 1ZYCA 5FP6A 3VIDA 5BMSA 4FFRA 4QTBA 4O0WA 4BCFA 2XNOA 3IO7A 1YXTA 2YACA 4ZEGA 4L42A 1QPEA 1RW8A 4QYHA 2E9UA 4IWPA 5L8JA 2YYAA 3HAVA 5J5SA 3CXWA 4FSUA 4BCHA 3H9OA 4I4FA 4ANSA 3CS9A 3QFVA 4J96A 4XS2A 3A2CA 5ACKA 1I44A 1JVPP 2XIRA 3FY2A 4ACMA 2ITYA 1VKZA 4BCQA 4EOQA 2C1BA 3IKAA 4JX3A 5DG5A 3BGQA 3R7IA 4XV9A 3RPSA 3C1XA 2W6ZA 2HELA 1J7IA 2R0UA 3M1SA 2C4GA 4FZ6A 4DE4A 3PTGA 3ORKA 3UQGA 4D5HA 3EQHA 4JI9A 4RWLA 4U43A 4ZIMA 4O2AF 2JFLA 4MNEB 5HBRB 3D7ZA 2X2MA 4FT3A 4LG4A 3SA0A 3LM0A 1UNGA 1ZZ2A 4DF3A 2QO7A 2H6DA 3KULB 4J97A 3FJQE 5CXZA 2HJWA 3ORZA 4HVGA 4MV7A 3R9HA 3FV8A 1W0XC 4FTOA 1OKWA 2XF0A 3TEIA 4XYMB 2G1TA 3MW1A 2VWUA 4DFBA 1GY3A 2E2BA 4FL2A 2XMYA 3DBDA 4G3DA 3JR1A 1P4FA 4RQVA 1Z57A 4Z7GA 4NU1A 3MWDA 1XO2B 3VBWA 5JFVA 5AUZA 3HP2A 2YABA 5IQFA 2W6PA 1WBVA 3GU6A 1I7LA 5C8KA 3RP9A 5KKNB 3O50A 2OXYA 3BYOA 2JKQA 3PYYA 4FX3A 5L2IA 4N6ZA 3NMUF 4JL9A 1KJJA 2XB7A 3NYOA 4L3JA 3QQGA 3PSDA 3N51A 3R7VA 2B54A 5L8LA 1CM8A 2YZLA 4RJ4A 1OBDA 3SX9A 1OPKA 4JDKA 2PE0A 2W1EA 3IOKA 3PA5A 4PX6A 4IX6A 5KKRC 5BPHA 4H3PA 2YS6A 4Y83A 4AGUA 4GFGA 4QRCA 5ETFA 5GJGA 4ZSLA 1WAKA 3R9RA 4AW2A 3FWQA 1PKGA 1WBNA 2WELA 3DDPA 4FODA 3R02A 5CSWA 4F1MA 3R8ZA 3GXLA 4DEHA 3L9MA 1Y6AA 4UN0C 2VO7A 2R3JA 3UOHA 3AW8A 3VOTA 3DAKA 4GG7A 4K77A 4LMNA 2PVJA 3RAIA 4K1BA 2J2IB 4AOTA 2IP4A 1YDSE 2KULA 5KKRB 1F5QA 1ZY4A 2FUMA 2XYNA 4MCVA 3SHEA 3WZDA 4APCA 2ZOQA 1R3CA 3F7ZA 4QP6A 5E8SA 4KKHA 3VUKA 3ZO3A 3C0IA 2P4IA 5J87A 1BLXA 3VHKA 4AA0A 2FPPB 3ZLWA 4C4FA 2R7KA 3EQFA 3IOPA 4FKVA 2ETKA 1S9IA 3FL5A 3SG9A 2BTSA 5IDNA 1YOMA 2I7QA 5HO8A 3ULZA 3PY0A 2CJMA 4NTSA 4JXFA 4HPUE 4IAAA 3LMHA 4P4CA 4EH2A 4F6WA 1IOVA 2Y6MA 4DBXA 5HESA 4DFZE 3RMFA 2YZNA 4P90A 4I0TA 1Q8UA 2C6MA 3V8WA 2XNNA 3IPHA 3VQUA 4CMUA 3HNGA 4YR8A 5C01A 4MWHA 5AUXA 3F3UA 5F9EA 3ZXTA 2XK4A 2WYOA 4I41A 3C4FA 5LARA 4TV8F 4O83A 2J50A 4IAFA 4FSTA 3QF9A 4QMMA 4G6LA 1FVRA 3WBLA 1OB3A 4XG8A 4OTHA 3MPAA 4J52A 2I8CA 3OP5A 4IM3A 3P1AA 4IAIA 4A4OA 4IZYA 4WG5A 5IA3A 4EQCA 3VWAA 4TW9A 1ZRZA 2HENA 2R9SA 1YXUA 2FSTX 2WXVA 3QU0A 3QD2B 4LFIA 5D10A 3BHTA 3E62A 1PXIA 3HECA 5LXMA 4MD8E 4JJRA 4C2VA 5CSPA 3EN4A 3OXTA 1CKJA 4YZMA 4RVLA 2YAAA 5LVMA 3HO8A 3LIJA 3A99A 1OPLA 5D41A 2QO2A 2JBOA 3TZ8A 4I4EA 4IX4A 5CU2A 3TACA 1YOLA 4DTKA 3S0OA 3RV4A 3DJ5A 4NIFB 4L00A 4MV9A 2ITXA 4GEOA 1CMKE 5AP4A 5HD4A 1HCKA 4RIWB 5IQIA 3Q9YA 3BEAA 2FVDA 4IE9A 1ZMUA 5AUTA 1O6YA 3KRXA 3FZRA 2PZYA 1M14A 3BYSA 5AAFA 2GHGA 1XJDA 2P2HA 2ONLA 3A61A 5DFPA 4AX8A 2WFYA 4CRLA 5IZFA 1IAJA 1IASA 4DFXE 4O0VA 4QYGA 5JGDA 3FZPA 2BAJA 3UYTA 3RINA 4EK8A 3R8LA 4LOPA 3WF9A 1H0WA 3N6RA 5G1XA 3CQWA 3K5UA 5DR6A 3VJNA 2P2IA 3G15A 4FSNA 2VAGA 3HMNA 3PVBA 5BVOA 1M2QA 3GCUA 4CLIA 3KAJA 4DEAA 3VS3A 2C3KA 4NK9A 1R78A 2LGCA 4F9YA 3LVPA 1JPAA 4RC4A 4F7NA 4H1MA 4WSYA 3MYGA 3RI1A 4JG6A 4ZAUA 4BCPA 1BXRA 4O7LA 3ETHA 2QOCA 1PXKA 2JKOA 4RVMA 5H3QA 3VO3A 4II5A 3VC4A 3PG3A 2XKFA 3OCBA 5CAPA 3AX6A 4GUBA 2ITTA 2DWBA 1LUFA 3PZHA 3S95A 3ATSA 3EKNA 4IVCA 4G31A 3CCNA 4WO5A 5CWZA 1UNHA 2J0KA 4KRDA 4A7CA 3HUCA 3L9NA 3CPBA 1GOLA 4BDIA 2XD4A 4G3FA 4NM5A 3KRWA 3LFBA 3A7HA 1NXKA 2C6DA 3PUPA 4OW8A 1OM1A 3G9NA 4Q5HA 4U0IA 4UEUA 3T9TA 2R7IA 4AW0A 5KX5F 2YDKA 2ERZE 1H07A 3QD4A 3WE8A 1P2AA 3OUNB 4JBPA 4QTCA 1ZY5A 2Q0BA 4RLKA 1DV2A 3FHRA 3QRIA 4PWNA 5HNBA 4IB3A 3Q52A 2X0GA 3TI1A 2ONLC 1KUTA 4M14A 3UOLA 1PX2A 2XA4A 1YQJA 1R0EA 2HXQA 2R3IA 2VTAA 3LLAA 4FC0A 4PMTA 3ZUVA 4HVIA 1XKKA 2VWXA 1OL5A 4BICA 4FKSA 4DLIA 3UFXB 2R2PA 4NKAA 3NEWA 2W1IA 3HAMA 3HEGA 1FVVA 3EQDA 3TZ7A 2JIIA 4O2PA 2EXMA 4USDA 5EYMA 3OCTA 4KWPA 5J8IA 4BI0A 2NU8B 2VZ6A 4GKIA 3DXQA 1JKSA 2AYPA 5C1QB 3R0TA 3P7AA 5JVDF 4ITJA 2HW6A 3CTQA 3ZMMA 4KIPA 4G5PA 4ERWA 2DS1A 4FICA 2NO3A 3D83A 2YWPA 5HLWA 2OF4A 3QHWA 3REPA 3ZO4A 2OW3A 3TNQB 3V8SA 4QPAA 2PMOX 2YW2A 5CF4A 3I12A 4H58A 3G0FA 1PJKA 2C0OA 3IGGA 3KRLA 3MH2A 1OMWA 4HGTA 4ZY6A 4EOIA 5BX0A 1Z2NX 2C0TA 3IGOA 4FI1A 4K2RA 4I0SA 3F9NA 5L2WA 2QLQA 4S34A 4O82A 4IDVA 2XIXA 4RJ6A 2XUUA 3VS6A 2DLNA 3R23A 4C4JA 3FLNC 2YM3A 3Q4UA 4FKWA 3V3VA 2XCLA 5CS6A 1YDTE 3G90X 5LP6F 3KGAA 4IJPA 5GJFA 3OTUA 5EK7A 3WYYA 4BDHA 1LP4A 4YJ3F 2J9GA 4PY1A 5H8GA 3EH9A 4CZUA 3V5LA 2PSQA 3CC6A 3VS1A 3E93A 4HNVA 1W84A 3G0EA 1ZMWA 2WQBA 5C9CA 1TQIA 2RG6A 3AT2A 4I3ZA 1OL6A 2R7LA 3TZ9A 4B99A 3JXWA 5AAEA 2UZNA 3OEZA 3GQLA 5LMAA 3DPKA 5EQEA 5FEDA 4EWHA 4DGNA 2HOGA 3GP0A 3PG1A 2E9OA 3G5DA 3R8PA 3A62A 2BDJA 3RGFA 2QR7A 3CP9A 3DBEA 4QTAA 3HUBA 5AFVA 4G9RA 4ARKA 3NPCA 4IAKA 4OLIA 5HE3A 5BYLA 2OGVA 4CTBA 4BBFA 3OUUA 1ZOHA 2Y4PA 4GK3A 3TUCA 2Y0AA 1H1RA 4FKRA 4IHPA 3LM5A 5ETAA 4WRGA 4OTRA 4ASEA 3UO5A 3R73A 3FI3A 4U97A 3OXZA 3T3UA 4XV3A 2PUUA 4H39A 4XMOA 2IJMA 3Q96A 2UVXA 3DB6A 1J1BA 3ATTA 3R28A 5EM7A 3M2WA 4AW1A 2JAVA 3O23A 3GBZA 3OG7A 4QP9A 5AADA 5A3XA 5GIOE 5FRIA 1PMVA 4RFYA 3DA6A 3NUPA 1V1KA 3ZXZA 1DIKA 3GUBA 5KMKA 2Y7JA 5CVFA 4DITA 3R8UA 3PPKA 1BI8A 2F7EE 4XP0A 4CFVA 2VWWA 3L8SA 4O81A 1Q3DA 3HV4A 4XUFA 1DS5A 2JFMA 4MWIA 3VBQA 5KMOA 4HR7A 2GPSA 4O2ZA 4N57A 3W2SA 4CGAA 3JZFA 5BUJA 2UW5A 3JZIA 5HU9A 3LCSA 4FTKA 2ERKA 3R83A 3FXWA 3QGYA 2GQSA 5HLPA 3V8TA 5T3QA 5LCJA 5JGAA 5HZNA 3QKMA 3Q1KA 1OL7A 5DI1A 2Z7SA 5CAOA 3KREA 4DGGA 5HE1A 1H28A 2R3FA 3R71A 4C61A 1IOWA 3PXKA 4BC6A 3AC8A 4RA4A 4C34A 2UW0A 2CGUA 3ALOA 4CSVA 1JKLA 3OS3A 3QZHA 2C5OA 3NIEA 2FO0A 3ELJA 5EYCA 4BR3A 1Q5KA 5CB4F 4R7IA 4I22A 5CT7A 5CEPA 4IB0A 3P9JA 3QQKA 5EHLA 3VBXA 2ZV7A 4O7YA 1Q41A 5K5NA 3Q4TA 3V6SA 1U59A 1JAMA 3NVMB 4FV0A 5L6OA 3S1HA 4TT7A 1V0PA 4BCNA 4BBEA 3SDJA 3AD5A 4DT9A 3CLYA 3KXGA 5EKNA 3D14A 3FMLA 4W4XA 1JBPE 4CFMA 1BUHA 4FOBA 3NVKI 4TXCA 2PUNA 2XH5A 4YJPA 3ZZEA 5C4LA 5KMMA 3GC8A 3AC1A 1Q8ZA 3ANQA 3C7QA 1FMOE 3EKKA 4D4SA 3NUYA 4X2NA 2PVLA 3ZBXA 5D7AA 1M2RA 4GFOA 3ZO1A 4FL3A 4A9UA 3ALNA 2WGJA 2F9GA 3SV0A 5DEWA 5CEQA 3IW6A 2ZDQA 4AT4A 3UP7A 3M11A 4X2FA 4EOPA 2V5QA 4HGEA 3U55A 2OZAB 3COKA 4RQKA 4YHTA 3BBWA 3FEGA 3R1YA 4RIXB 4BYJA 2VTQA 2JDOA 2XEZA 3AD4A 5AJQA 3OWPA 4O0RA 5IYZF 2YISA 4PNKA 3WNZA 1M52A 1MRVA 4FIGA 4C4EA 3Q9ZA 4K8AA 4ZTSA 3VRZA 3K5IA 1DM2A 3EQPA 3PZEA 2BHEA 2W1ZA 4EJNA 3V01A 1KJQA 1KJ8A 2OH4A 2W7XA 5AUWA 3NGAA 3CR0A 4GW8A 4IVAA 5KHXA 3ZUUA 3EB0A 4JBOA 2W4KA 4O6LA 4P5QA 4V01A 5BUEA 4FT9A 5M4FA 4ZSGA 4ZOLF 3VBVA 1J91A 4LL0A 3ETAA 3S2PA 5FTGA 1L3RE 3W2RA 4BYIA 1Y57A 3TT0A 1B38A 4BBMA 5HHWA 1OITA 4CFXA 2XBJA 4JDIA 5AV2A 4CVAA 2UZLA 2VR1A 2C0IA 3NR9A 4E1ZA 4U40A 4IEBA 4EORA 3WZEA 4EH7A 5DR2A 5AIKA 2VTNA 3IDBA 5IMEA 3V5QA 3ZFMA 4TPTA 2C47A 2YS7A 4FNYA 3MB6A 5E8XA 2BRMA 4L46A 3R7UA 2BKZA 2W6QA 3BYMA 3C4WA 3U4WA 2W05A 2G2HA 3FQSA 1YXXA 4J95A 3ZS5A 1ZAOA 5IH6A 4NJ3A 2C68A 4ZS4A 3TV7A 3WOWA 4JR3A 3TCPA 3ZFYA 5IQDA 1Q8TA 4NYEA 3HDNA 2W5HA 4L68A 2R7MA 3F5PA 2XJ1A 2B9HA 2IVUA 3MVHA 5HU3A 3FYJX 1ZYDA 3OFMA 2XYUA 3QQHA 3ZEWA 4YBKA 3CKXA 3F69A 4JNWA 5B7VA 2UVZA 4WKQA 3ETJA 4BIDA 2E9PA 1SCUB 4KBCA 3BYVA 4EOOA 4EH6A 2XK8A 4MXAA 3VPBA 3OW3A 2GMXA 4MHAA 4EC9A 4JIKA 4MXOA 3GCVA 4ZTHA 4P7EA 4ZZMA 1XH6A 4G6NA 4ID7A 4OTWA 5AV0A 4DGOA 5J1WA 4CZTA 3IG7A 2BRHA 2VQDA 5BMMA 4Z9LA 1EUDB 4YZNA 3ODYX 1DI9A 3GU8A 1V0OA 2YDJA 3HP5A 3NLBA 4HYUA 3UZPA 3ZH8A 4CCBA 5GINE 2HCKA 2OJ9A 3G33A 2VX0A 4B7TA 3QBNA 1WBSA 1GLVA 1FGKA 3TW6A 5IQCA 1U54A 3E7VA 1YI4A 4R3PA 3JPVA 5DGZA 3SXFA 2ZMCA 2UW3A 3NYXA 4K0YA 4MAMA 3RCDA 3Q04A 3VUMA 2XK6A 3FDNA 2WU7A 4HCUA 5EM6A 4EJ7A 2IVVA 2J5FA 3LJ1A 4NWMA 1E4EB 3DF7A 3WF8A 5H9BA 3RPOA 5FXSA 4DEIA 5KMIA 1NVQA 4FIIA 1ATPE 1EH4A 4FSWA 4L7FA 1IA8A 5EZYF 2JKMA 3S3IA 2BALA 4O4HF 3IONA 3A4OX 4GIIA 4JRNA 2R84A 3OY1A 3R5FA 3AQVA 4OUCA 3FMEA 3TV6A 3MY5A 5BPFA 4O86A 1GAGA 2EXCX 3LMIA 1FMKA 4FK6A 3R7EA 5LMKC 3HMMA 2O65A 4ORKA 3GENA 4QQ5A 4XX9A 5DHJA 3L8VA 5E4HA 4G1WA 2YWVA 4FKUA 3G2FA 2WMQA 5JK3A 4EGJA 5IEXA 2R85A 2XEYA 3NSZA 5EKOA 5TKDA 4X3FA 4UY9A 2BUJA 3E88A 2BMCA 1U5RA 1JKKA 3L9LA 3NAYA 4ZJVA 3I0QA 5C27A 3VRYA 1Q97A 5CLPA 4RWKA 3KCKA 5E1SA 5EI8A 3G9LX 3OBGA 4O84A 4QQCA 3GB2A 3U9CA 3QCQA 4WG3A 1G8AA 2CGVA 1KSWA 3EQIA 2IWIA 2PVYA 5HD7A 1OL2A 2X4ZA 1JWHA 5JN2A 4YBZB 4QYFA 3LFSA 4KKGA 2XRWA 2RGPA 4JDJA 5K5XA 4FV8A 2OH0E 2CNQA 3ZBFA 4DFUA 4KINA 5AV4A 2BILB 1PHKA 4PMPA 1LEZA 3OWJA 4YZDA 3RZBA 3TUBA 2V5AA 3UPZA 3EIDA 4E20A 4AXAA 3C5UA 1H1QA 2BDWA 2GQRA 1WBPA 3RPVA 3FMJA 3GOPA 4AN2A 4HJOA 3JVRA 4A9TA 2I0HA 4X7QA 4FIHA 5DOSA 2W6NA 3D2KA 3NX8A 4CFWA 3PJCA 1I7NA 1O6LA 4B6LA 5E92A 5CENA 1H08A 5CI6A 4BKJA 4ZSJA 3KULA 5AAGA 5C4KA 3W2CA 3DFAA 4M15A 3VUGA 4DAWA 1PYXA 4YJUA 3R30A 2HY81 5EOBA 4CQEA 4IHJF 1OUYA 4X3FC 1L8TA 2PE1A 2PVFA 4EK5A 4EL9A 1OBGA 3MH0A 2ZMDA 4F09A 1KE8A 2WKMA 3LMGA 4XLVA 4TWOA 3ZSHA 2J0IA 3U8WA 4YSMA 3WILA 1YW2A 3FAAA 3DB8A 4S30A 2BCJA 2JIVA 3EN7A 1AUXA 2QK4A 3B2TA 1CKIA 3T8OA 3N4TA 1CE8A 3HRCA 5LOHA 4EUUA 4XBUA 5DH3A 4RJ7A 5LOVF 5BVNA 5DR9A 4FFPA 4O0YA 3Q3BA 4CLJA 4F9AA 4YZ9A 4IANA 2YZGA 1W8CA 3FZSA 5CI7A 4QMNA 3QD0A 3QCYA 5H8BA 3CQEA 5KNJA 4MBJA 2BTRA 2JDSA 3LKMA 2YRXA 1TQPA 3CSVA 4FV1A 5HQ0A 4XHKB 3KN6A 2CKEA 4AGWA 5M56A 2CGXA 5HICA 3BE2A 2HIWA 1IA9A 5JVLA 3BBTB 3F2RA 5HG9A 3VN9A 2ZM3A 5M57A 1YI6A 4HGSA 5M09A 3QQJA 5L6WL 3BV2A 3LJ0A 5KHWA 5TOZA 4C4IA 4JRVA 1W96A 2FPIB 3EWHA 3QQFA 3FMNA 4XP3A 1KE5A 2G01A 4YC3A 5CU3A 5A4QA 2WO6A 5BYYA 3KA0A 3CGFA 5HVJA 2PVNA 2IW6A 4ZK5A 3PLAE 4JG8A 4F63A 5GONF 1M7QA 5F20A 2I1MA 3SXSA 4QPSA 4YTIA 3H4JA 3GT8A 3GIDA 4PV0A 2JC6A 5KMNA 4G34A 3ZDIA 2WEIA 1GGOA 3LFCA 4ALVA 4ZTRA 1URCA 3QAME 3UQCA 3COMA 4IADA 2PU8A 4JAIA 4HYHA 4X6RA 3I5ZA 2B7AA 3CY3A 2CMWA 3VJOA 3R2YA 4W4YA 3DU8A 4GFMA 4IDTA 4DBNA 4C59A 3RM6A 3VS0A 4E5AX 4E7WA 5HO7A 2R86A 4AE9A 3K3JA 4A06A 3DQWA 5BPYA 5IA4A 2V22A 2YM6A 4KAOA 3CKWA 3NW6A 1H24A 1VR2A 4LL5A 4IM0A 5HX8A 3RPRA 1DAWA 3C0GA 3SVVA 3SW7A 2HY0A 3R00A 2OLSA 3QQUA 3FE3A 4LUDA 4FYNA 4RLLA 3QC9A 3HMIA 4I6BA 4U41A 5TT7A 1I09A 3OWKA 4GVAA 2YRWA 2O8YA 4ONAA 4D4VA 5C1OA 4F0IA 2VO6A 4EOKA 3QGWA 4RC2A 1EZ1A 4AZFA 4AFEA 2HK5A 5FBNC 4FYOA 1WBOA 4AFJA 1OGUA 3GOKA 2WTCA 3DJ6A 4QMUA 2ETMA 4CKRA 4CKIA 3CJFA 2PVKA 1VBGA 4EGQA 4RIWA 4B0GA
chains in the Genus database with same CATH superfamily
3F5XA 4TKSA 3W2OA 2PVHA 4BGQA 4HGLA 2XNBA 2YIYA 4UZHA 4EOSA 4F99A 1M0WA 3HRFA 3TXOA 3VULA 3G8DA 1OECA 3FXZA 3DNDA 5DLSA 4FTAA 5CA1F 3IW5A 1XH8A 2G15A 1H1WA 1W83A 4M9UA 1TFFA 2C5XA 2QHNA 3OCGA 4TYEA 3TKIA 2J90A 3W0QA 3EQCA 3NZ0A 4EONA 5ETIA 5JQ8A 2GDOA 2JIUA 4DEGA 3PFQA 2WTDA 5AP3A 4BN1A 4N6YA 5I0BA 3I79A 1OUKA 4AW5A 3ZSGA 5A54A 2CSNA 2QI8A 4KA3A 2QNJA 2ZV2A 2J51A 3FLYA 3LQ3A 4I5HA 4O7WA 3IW8A 2GNIA 4YUQA 3ORMA 4CNHA 4ZY4A 2VWYA 3UIUA 3QA0A 5F94A 3HMPA 4IAZA 5IQGA 3KQ7A 2FSOX 4LOQA 5CEMA 3BACA 4ME6A 3JY0A 3AT3A 3WZJA 1CTPE 3DJ7A 4CEGA 3QFFA 3HZTA 4DHZA 3HDMA 2C5VA 4IW0A 2BIKB 4TWPA 5HIEA 3OZ6A 4FIEA 2B9JA 2WTKC 3C51A 3PLSA 3RALA 5JQ5A 1UNLA 4DFLA 5E8TA 4AWIA 2YCSA 3R5HA 3EQBA 3TNHA 4ASDA 2NNWB 4YBJA 4RJ3A 3FLQA 4ENYA 2Z60A 3ERKA 4NUSA 3RWQA 2BFXA 3DY7A 2RIOA 3FKLA 4M84A 5I5ZA 5I5TA 3D9VA 4EH9A 2YEXA 2GS6A 3FYKX 3DBQA 1ND4A 4FSRA 5CF6A 3ORQA 2WTIA 1QPDA 4RIYB 4AN9A 5DEYA 1FPUA 1PYEA 4R5YA 4MV4A 2OBJA 2XNEA 1M0TA 3WI6A 2QG7A 2WTKB 2A0CX 3NNVA 1XMMA 4I0RA 5HE0A 2VO0A 4R7BA 4D2SA 1CS0A 4RWIA 3TNWA 4DFNA 3MSSA 2VWVA 2R64A 2PYWA 3TM0A 3VMMA 4UV0A 3L8XA 4ZMEA 4QSHA 3W0OA 4BCGA 3RFCA 4Z3VA 3FLSA 1XWSA 4E6AA 4CC5A 4FV4A 3K3IA 3ACKA 3AG9A 4HNFA 4IX5A 5BV3A 1RDQE 4GU9A 3H0ZA 4MK0A 3GEQA 5TR6A 4GS6A 4YTHA 3RAKA 3H3CA 3N4VA 2R87A 3BPRA 1ZWSA 1B6CB 3KXHA 1RJBA 5KZIA 3T99A 2XP2A 4XRLA 2QQ7A 4FG7A 4GJ3A 3DKGA 4OTFA 5B2KA 3U4UA 3Q32A 4Y8VB 4OT6A 4CG9A 2NU6B 2R3KA 5JH7F 4O38A 1GSOA 2OU7A 4DYMA 2ZB0A 4X6QC 5HCZA 3UMXA 2CLQA 4K6NA 3WO0A 5LXTF 4DCAA 2YFXA 2OJFE 4BGGA 4UCTA 2XKEA 2W70A 1Q8YA 1SVGA 4BCIA 3C4ZA 4J71A 3VUHA 4FTJA 4QP7A 5FTQA 3KMUA 5BVKA 3ROCA 4BDJA 4BRXA 4XEYA 3C13A 3QTUA 4XG7A 5CTPA 4E5BA 5J9ZA 3MFRA 5DISC 2PE2A 4LI5A 3A7JA 4C36A 2C3LA 3O8TA 3QXOA 3K5VA 4MKCA 4L53A 4RX7A 4JAJA 2JEDA 1LPUA 2EVAA 1G2WA 1ZARA 4YJQA 2PZIA 2GFCA 2UW7A 2ZDGA 4UCSA 5AWMA 2HZIA 5DVRA 4C58A 3PWYA 4KBKA 1I2KA 4AXCA 4NZOA 2GLTA 2NU9B 3UVRA 1JSUA 1PKDA 3NNXA 1PXPA 3DT1A 3HX4A 5DT0A 4RX5A 4FIFA 3OMVA 1VS0A 2W1CA 4HPTE 1JKTA 3DK6A 1S68A 5J2UF 3F5UA 3AOXA 4PTCA 5EW3A 5HG5A 3DCVA 4F70A 3UOJA 3T9CA 5IQBA 5FDPA 5J9LA 1X8BA 4C4GA 4QMQA 5IPJA 3CEBA 3KVXA 4QYYA 2WMAA 3THBA 4ANMA 1WVXA 4BHZA 4XX0B 4WBNF 3I60A 3F3VA 2X7GA 4HNTA 2H9VA 3BCEA 3RAWA 1WZYA 4EKKA 1Y6BA 3BQRA 2W6OA 2JBPA 3DFCB 3N9XA 4H3BA 4U42A 1EKFA 1MQBA 5D12A 3E8NA 3WIKA 5EFQA 1H01A 5HGIA 3ZONA 5IISA 4OBQA 3OTVA 5LQFA 3DKFA 5GIPE 2BRNA 5BMVF 3MH3A 4IX3A 5JH6A 1H8FA 5FBOA 4KBAA 4FZ7A 3C9WA 3E92A 4IWQA 3QRUA 4L01A 1A9UA 3AC3A 2C6KA 3TNPC 5JQGF 2IN6A 3EFWA 2UVYA 4E4NA 2O3PA 3G8CA 4EFBA 4BDAA 4A9YA 2YL2A 2A27A 2EUFB 4MV8A 4Q9SA 3BI6A 3UDTA 4FT5A 4EZ7A 5IA1A 1WBTA 3M42A 2W6MA 3NYNA 3EFJA 2OSCA 3EQGA 4IFCA 4XG6A 4IZ7A 3ORLA 3HBLA 4KSPA 2XKDA 2ZDTA 4P2KA 4PUZA 5D9HA 5GHVA 4R5SA 3JS2A 4FK3A 3MN3A 1FOTA 1REKA 3SLSA 4DN5A 4O0TA 3BU5A 4CMFA 2PULA 2PTKA 5A14A 5I9XA 4NCTC 4FFLA 3DK7A 4WHZA 2OKRA 4Y5HA 5CVGA 3V5WA 4CCUA 3DLZA 4AT5A 2OFVA 3UG2A 1I1MA 4DTAA 3FMHA 3MTLA 2XZSA 1ZOGA 3UO4A 5D7VA 1PXJA 3QUPA 2GPHA 2IZSA 3SXRA 4AA4A 3PP0A 3QWKA 2XIKA 2B9FA 5AP7A 2R3NA 4EHZA 4H3QA 3VBTA 4FTUA 2VV9A 3ZTXA 5AUUA 4FV7A 2O63A 3EL7A 4ZTQA 5EI2A 3WYXA 1UU3A 3UO6A 5CALA 3HLLA 5CASA 5JZJA 5L2TA 4ITHA 2XVDA 2VU3A 4HVHA 5EDQA 3TWJA 4Q4CA 2JDTA 2Z7RA 5FQDC 3R01A 3TIYA 3TIGA 3SGCA 1VZOA 2QF7A 2QLUA 3EMGA 1KJ9A 4GLWA 3TY5A 3Q6UA 5G6VA 2FB9A 2VTLA 4L1KA 3BGPA 5B2MA 4KIQA 4QMTA 2AC5A 3GI3A 3ACJA 4UALA 3UIXA 3KXNA 3MFUA 4QOXA 3MVJA 5AX9A 3LQ5A 2W9FB 1M7NA 2R3PA 1DI8A 2X6EA 3ZCLA 4JXUA 4FA2A 3NYVA 5FDXA 5CAEB 2NYAA 1IAHA 3MY0A 4ALUA 1E9HA 3FXXA 4Y85A 4ACGA 1GIJA 3KXMA 4X2GA 4CMTA 4BIEA 4GT5A 2ODTX 2PHKA 5I5YA 4NZNA 1MRYA 4QMXA 3NFGB 3F3WA 5FGKA 2HVRA 4ZJJA 1WVWA 4M68A 4PL3A 5EM8A 5BQ0A 5CF5A 2QOHA 2I40A 5JFXA 4WUNA 2V59A 3T9EA 5HV6A 3UODA 3PVUA 4NM0A 3HB9A 1KEEA 4QMZA 2F7ZE 5FP5A 1YWVA 4G3EA 2W17A 2Z8CA 3A4PA 4UYNA 2P0CA 4DINA 1JSTA 2DWCA 3KALA 2BROA 3H9RA 3FL4A 4YNOA 3AKLA 4AT3A 5C1PA 2OZAA 2J0MB 2WMXA 3CY2A 4O6EA 4D58A 4YURA 2XNPA 3GVUA 5C8YF 4GT3A 3MBLA 1G8SA 2BZJA 3G6HA 4V0GA 4RMZA 3PJ3A 4EZ5A 2F2UA 4LYNA 4U80A 1NVRA 2W96B 3D4QA 4HN2A 4YAKB 1UA2A 2C6IA 2OZOA 2WIHA 2WQNA 3BLRA 4FSMA 2OXXA 5HBEA 1MUOA 1OKZA 1PXMA 3PUFC 4O4JF 2J6MA 2B9IA 4Y95A 4NW6A 1AQ1A 4XRJA 2YJRA 3RJCA 3CQUA 4BB4A 3QLGA 3MH1A 2COJA 2NU7B 2FB8A 3AC2A 3ZM4A 4YO4A 4FKTA 2C6TA 4Z16A 3CD3A 5JSMA 5IQEA 5K4IA 1B6RA 4C2WA 4FJVA 2C3IB 4GMYA 4GYGA 3BKBA 4KS7A 4LRMA 4X2JA 3WIGA 2ZB1A 4RSSA 3VQHA 2QKWB 3PJ1A 3FZ1A 5EHOA 1MRUA 2BAQA 3HGKA 1RQQA 4L52A 5DRBA 1UVRA 3KCFA 3MVLA 3DZOA 3Q2JA 4D4RA 4L9IA 3EN6A 5CVHA 2EWAA 3QTWA 2HZ4A 2RFDA 4MH7A 4Y73A 3E8EA 4GH2A 5DT4A 3V51A 3WE4A 5AA8A 2ZV9A 3MFTA 5EDPA 3IDCA 4I55F 1O6KA 1SYKA 4IB1A 3R8MA 4DIMA 3D7TB 3LFNA 3UC3A 3CEKA 4CFNA 5FG8A 2PMIA 4CV9A 4CHIA 5CAQA 1UU9A 2HW7A 3KB7A 3UIMA 5K2MA 3V4ZA 4DGLC 1JLLB 3MWUA 3SRVA 4LRJA 2GS2A 1LEWA 3CPCA 5HX6A 2HDKA 4FU0A 4LQMA 5CANA 4TV9F 4W8DA 3RWPA 1KE6A 3QRKA 4U79A 3ZLYA 4F64A 2NRUA 4I21A 1TKIA 2EJ0A 4FFNA 3HV5A 4ANQA 1OKVA 5AP0A 5A4EA 4WIHA 2QU6A 4RC3A 2YAKA 4E5WA 1PXLA 3UNKA 1Q99A 3ORNA 2RFSA 3RAHA 3RK5A 3MDYA 3UNZA 3C4CA 4NW5A 4UXLA 4Y72A 5JT2A 2YZMA 3U9SA 2RL5A 1IEPA 4TYIA 4MXCA 2PUPA 5D11A 1CQIB 3ORPA 4U5JA 4A9SA 2WMSA 2WEVA 3VUIA 2UUEA 5CEKA 2GPWA 4DH1A 1VYZA 5KS8A 3LZBA 3W55A 3DTCA 3BWJA 3Q6WA 1YWNA 3MWEA 3S4QA 1J7LA 2X1NA 5HLNA 4HCVA 4IC8A 3A60A 2R3MA 3LOKA 3ENMA 4I5MA 3AMAA 1V9PA 1JNKA 3SOCA 2ZAZA 4FUXA 2CDZA 4RBLA 5CXHA 3KY2A 3KF4A 4M0JA 3PPZA 1YHWA 1ULZA 5M08A 3NBYB 1BYGA 2IO6A 3N4UA 4MQ2A 4S32A 5IA2A 4EFEA 3CTJA 3RCJA 4B4LA 4DEBA 4F7SA 5C8NA 1XK5A 4TRLA 2XM8A 3ORXA 5JKGA 1O9UA 4MBLA 3W33A 2XANA 1OL1A 3EN5A 1Q4LA 3SD0A 1K2PA 2YITA 5E90A 3LP8A 4PBCA 3DTWA 5LVPA 3BE9A 1UC8A 2SCUB 4QP8A 4G2FA 2Y8OA 3OT8A 3QC4A 4F7LA 4ZLYA 4EEVA 3KRRA 3U9TA 4EQ5A 4WBOA 3SG8A 5K9IA 1KOAA 2X8EA 4BTKA 1E4EA 2EJ3A 2ITQA 2RKUA 3H10A 3QKLA 4WNOA 3K2LA 3EZRA 5HVYA 3W5OA 3TJCA 5M44A 4I94A 1H4LA 3SNOA 3LPBA 3POZA 2X8IA 2BIYA 2UZBA 4ZLZA 5KX8A 4EG0A 1WR2A 2XAOA 3GU4A 3I5NA 3PWDA 5DPVA 5BVWA 2C6EA 3VS5A 5IUGA 2VTIA 4UX9A 2JGZA 3I7BA 5A4CA 2BRGA 3QALE 3R9NA 3W10A 1KWPA 4YLKA 5KUPA 2W5BA 4MXXA 1Q24A 4M69B 5EG3A 2GU8A 3EN9A 1BL7A 4Q9ZA 4G17A 3LXLA 4X21A 4ANBA 4BDDA 3G6GA 4FSYA 4BJJA 3TINA 2BFYA 4O7ZA 4IZAA 4IWYA 2EB3A 2Y4IC 5E9EA 4BCJA 4DFYA 3OUKA 3O8UA 3LHJA 4U8ZA 3RTXA 4HVSA 2GNLA 4C0TA 2XCKA 4FL1A 2C5NA 1ERKA 1T46A 3QUDA 4V05A 2ACXA 2I6LA 2R3HA 3NUXA 3ORIA 4G16A 3IW4A 4GRBA 4JOAA 4D0WA 3TQTA 4UCVA 4FKPA 3E3PA 2WD1A 3QKKA 4YHFA 3W8QA 5LMKA 4HCTA 4M0YA 1GNGA 5F4NA 3TDVA 4GK4A 3NRMA 3P4KA 4ACDA 1FQ1B 4IMYA 3BHHA 3W32A 4NH1A 2BAKA 2V7OA 1CSNA 2A2AA 3NIZA 4USFA 1UKIA 2Y4IB 3MGYA 3VUDA 3ZC6A 4D55A 3QQLA 3FLZA 4M97A 1W82A 3TTJA 4RT7A 2GTMA 1PRYA 1LR4A 4FEWA 4XP2A 5IF1A 3UVQA 4AG8A 3DXPA 4EK4A 3C0HA 1CDKA 2NRYA 2IZUA 1PW2A 2ZDUA 3HV3A 4PDOA 4YZCA 3LXKA 3V6RA 5IMXA 4C37A 4DC2A 3HVCA 2P33A 2QOBA 1EHIA 5I60A 5AIRA 3ANRA 3DGKA 4ZS0A 4IWDA 5EQYA 4E26A 4ZZNA 2Z7QA 3DNEA 3F3TA 4IACA 3W0NA 4GV1A 5BWWA 1P4OA 3GQIA 3QTIA 3UG1A 1YI3A 4YMJA 4G9CA 3Q9WA 5FPOA 4AZWA 1YRPA 4H1JA 1GSHA 3MV5A 4J98A 2Y9QA 2IPXA 3D5VA 3UZRA 4ZOGA 4PP9A 4XOZA 4YPDA 2I0VA 3QCSA 4KABA 4KIOA 2VWBA 3PVWA 2BR1A 4R1YA 1OIUA 4D1XA 4K18A 1I2LA 4F0FA 4I6HA 3VS4A 4EQMA 2HHFA 3FKNA 4RX9A 4CTCA 4D0XA 1BL6A 1H1SA 5AP1A 5AX3A 3U0GA 2ZDHA 4FVQA 2XJ2A 1SNXA 4F6SA 3OOGA 2XKCA 2QOQA 2CGWA 1JSVA 3COHA 3D5XA 2QU5A 3CBLA 2Y6OA 3PXZA 4ZLOA 1B39A 4DHFA 3RR5A 1M17A 3OOMA 3TTIA 2UW9A 4K33A 1UC9A 3WZKA 4MV3A 4CKEA 3ZRKA 2NP8A 3FI4A 3TZMA 2BKKA 1ZYJA 4RJ5A 5IG1A 5D1OA 5CNOA 4UBAA 1FBNA 3I4BA 2ITPA 3UPXA 3W0SA 5A4TA 4Q5EA 4MA5A 2Q83A 2BZKB 3HKOA 4DLJA 2JKKA 2X6DA 3ENHA 5JEBA 3QYZA 2JD5A 2PWLA 3EL8A 4QMOA 3BAAA 3VVHA 1ZYSA 4GCJA 4PL4A 3UYYA 3V5JA 3LCKA 4GU6A 5J95A 4Q4DA 5CR5A 3F3ZA 5LA6F 3SKCA 3D2IA 2JDRA 2GQGA 2A19B 3AGLA 3ULIA 1ET0A 4QQTA 3UOKA 4E4XA 1UKHA 4O27B 3WARA 4TYJA 1KOBA 5IUHA 3AXWA 2W1GA 5M07A 4TYHB 4J7BA 2O0UA 3U6IA 4D1ZA 3UTOA 4O21A 5E8VA 2R5TA 4DHIB 4Y5QA 2H96A 5J1VA 4O2BF 4V04A 1P16A 4XYLB 3PXQA 3GFEA 3QLFA 5F1ZA 2XK3A 5KZ0A 1Z2OX 3BABA 4DG2E 5ANIA 1QMZA 4EYMA 4FKOA 5JGBA 2R3OA 3D5WA 4A4XA 4R7HA 1KE9A 1U5QA 2I80A 1XMLA 5IU2A 1J1CA 1VEBA 2CZGA 4JQ8A 3TIIA 2DYLA 2UW6A 2F49A 2OF2A 4PDYA 5E8UA 5I9YA 5BWXA 4QEBA 3PJ8A 4N70A 1W98A 1HCLA 2OWBA 3A7FA 3NS9A 3UVPA 4DGMA 4MNEA 5CSVA 4DEDA 4NT4A 4JX7A 4FNZA 4EH4A 3T54A 4Y8DA 4U44A 1GJOA 1ZZLA 1ST4A 3FLWA 1UU8A 1XBCA 4NSTA 2WNTA 2X4FA 5AMNA 4HZRA 3RTPA 2VWIA 4F08A 1A48A 2CHLA 4AOJA 3LJ2A 3QWJA 5ANKA 1JOWB 2YDIA 4X0MA 3R8VA 4IZ5A 3QYWA 5DMXA 4AF3A 3LFQA 4I6FA 3MS9A 2GS7A 4FTNA 3UQFA 4XV2A 3MIAA 4UWBA 2P0AA 1ZOEA 2CKPA 5CEOA 5I4NA 4UB7A 3TKHA 2QODA 4PMMA 4YLJA 2FPGB 1E1XA 5AV3A 4NZWB 3II5A 4JS8A 1QPCA 3PE2A 4J53A 3VW8A 4Z7HA 4L6QA 1WMKA 2CPKE 3O2MA 4FSZA 4GJ2A 1YKRA 4O91A 3EHAA 3PPJA 4TZRA 3Q5ZA 3VAPA 3PRIA 4APPA 4BCKA 1PF8A 1CKNB 3K5HA 2IZTA 3FMMA 1VLRA 4PDSA 2QURA 3PIXA 5EH0A 4IQ6A 3TMOA 4QNYA 2WQOA 4BI1A 5CX9A 3TL8A 4PQNA 2ZGIA 4FNWA 3AC4A 2YM5A 4DH5A 3V4SA 2PMNX 3HV6A 3QD3A 3V5TA 4CXAA 2Y4RA 3LULA 3VPCA 3L2PA 5J2TF 1AD5A 2IW8A 5FEEA 3WF7A 2J7TA 3UQ8A 4G3GA 3FMDA 2X9FA 2YERA 2V7AA 4UYAA 1PK8A 4FTCA 4I4TF 5HKMA 3ZRLA 3VHEA 4EK3A 4FE2A 2XALA 4A07A 4LGGA 2NPQA 3DQXA 3L9PA 3GC0A 3PIYA 4I23A 4BTMA 1F0QA 2G2IA 5EHYA 3IK3A 4XG2A 2ITOA 5C03A 2RFNA 4N4SA 4JBVA 2X9EA 3BLQA 3CD8A 3ZLXA 3BHYA 3OUZA 4XOYA 4M3QA 5DGIA 3P79A 3ZOSA 5AV1A 3OY3A 1KBLA 3MJ1A 4P5ZA 1GZOA 3FQEA 3QTQA 3SW4A 1PMUA 2W99B 4OT5A 4C3RA 5HNEA 3MI9A 4MD9E 3ODZX 3BV3A 1R0PA 1C30A 4E6CA 4EOLA 3S00A 2QR8A 4L7SA 2BDFA 4C5CA 3ZRMA 4WD5A 4M8TA 4QMSA 2G2FA 4EBWA 3WZUA 4YU2A 5JMSA 2YM7A 4OR5A 4AE6A 4EWQA 3FY0A 3A8XA 3DDQA 2R3RA 3V04A 4ASZA 3MVMA 1PMNA 5B0XA 3OBJA 4IZOA 2WTJA 3AMYA 3PXRA 4OBOA 4ZMFA 2QOIA 5L8KA 4MQ1A 3ZUTA 2PN1A 4CKJA 4CRSA 4TL0A 2IVTA 1TA8A 4FMQA 5ANEA 1DAYA 1FVTA 3B2WA 2WQMA 4RIYA 3TJDA 4B9DA 4DT8A 5I47A 2PMLX 4XLIA 4AZVA 4OTGA 5E8YA 4PRJA 4UXQA 4UZDA 3UE4A 2UW4A 4BCOA 4U81A 5B2LA 2HIXA 4ANLA 2R82A 2VX3A 4RPVA 2OK1A 3I6WA 4JT3A 1YHSA 4IVBA 5E7RA 3KYHC 2W71A 3EYHA 4WG4A 1IYEA 4TWCA 1QL6A 3A7GA 3PSBA 4O7TA 3DK3A 4QP2A 5ACBC 3DXNA 4EI4A 5M06A 4IB5A 4O4LF 3Q4CA 5IQAA 1OIQA 4C02A 4KRCA 3BU3A 4B8MA 1CKOA 4L67A 3Q4ZA 3F61A 2WU6A 5EW9A 1KE7A 4J8MA 3NUSA 3R21A 5CNNA 2ITNA 3KU2A 3OHTA 4XNEA 4ZI7F 3FMKA 5DA3A 2WZJA 5H2UA 4CMOA 1Z9XA 4NFMA 2PUIA 1OKYA 3E5AA 3P5KA 4M67A 2AEGA 4S2ZA 4MV6A 5A9UA 4HYIA 1OZ1A 2C1AA 3KEXA 1DGSA 2YN8A 2GNGA 2YCFA 4YNEA 4FTMA 4D2RA 1KV1A 5HTBA 4IH8A 2Z04A 4MXZA 4QMVA 4DCEA 4YC8A 4XJ0A 2PBZA 1IR3A 3P86A 4DLKA 5HI2A 4CV8A 3MTFA 2R3GA 2VGPA 4WRSA 3QUEA 2X7OA 3DKCA 2VRXA 2WMBA 2YIXA 2V62A 4KS8A 5M55A 4B8LA 1APME 5K3WA 3R1QA 4S33A 1F3MC 4C33A 2VWZA 3GCPA 4GYIA 5E8WA 3R6XA 4RG0A 3ZZWA 1NVSA 5HNGA 2BZHB 1IYDA 4U3YA 3T9IA 3JY9A 2E9VA 4EH3A 2P3GX 5KMJA 4FSQA 2UZTA 3BIZA 5DN3A 1WRVA 5I5UA 4GG5A 4CC6A 4HNUA 2VD5A 4RJ8A 3QA8A 2QOLA 2RF9A 4WUAA 3KF7A 4QMWA 4R78A 4TY1A 3AGMA 3MJ2A 1GSAA 1QPJA 3F5GA 3OCSA 4WNKA 4FG8A 4HZSA 5BVEA 4G5JA 3FSFA 3BG5A 3I6UA 4GIHA 4ITIA 4ZTNA 2GCDA 3BWFA 5J9YA 1B04A 5BWUA 2C5YA 3OWLA 3F2AA 3D15A 3IS5A 4FV2A 4LV8A 4PMSA 3MJFA 1ZXEA 4IVDA 3E63A 3P08A 5CZIA 1R39A 3LCTA 3UDBA 3L8PA 4JVGA 4I20A 2QKRA 3MPMA 4YP8A 3UIBA 5CSXA 3BEGA 4BDCA 4WNMA 2VUWA 3COIA 4GSBA 2C30A 4PTEA 2JDVA 1SMHA 1CKPA 2VTHA 4EOMA 4YAJB 5FXRA 4D9UA 5FM2A 1U4DA 4FTQA 5EDRA 1B6SA 2NUAB 4MX9A 1YOJA 3V5PA 4DG0E 5BUIA 1H26A 2W5AA 3LXNA 4HOKA 3R1SA 1XHAA 2YCRA 4FEUA 5DWRA 2OFUA 4FKIA 3JUHA 4F1OA 2HWPA 2V0DA 2JLDA 2XBAA 3LFFA 4FKJA 4FTLA 1SM2A 2GSFA 4JBQA 4PF4A 5A4LA 3F6XA 4AP7A 2VGOA 4UCOA 3SAYA 2PZRA 5FD2A 4PNIA 3ROYA 4ERKA 2W4OA 5KO1A 5IDPA 5A46A 1UU7A 4FZFB 1IG1A 4WA9A 3W2PA 5CE8A 4OBPA 1WBWA 4YJTA 1Y8GA 5DAAA 4L3PA 1BNCA 4WT6A 4FBXA 2LAVA 1GZKA 5HBHA 1J3HA 1NW1A 2WTWA 4RA5A 5EQPA 3OEFX 4ZQIA 2CN5A 5HCXA 3QWUA 3E5NA 3DBCA 1DV1A 4ZP5A 3P0MA 4FKLA 4FR4A 2J5EA 4JLCA 5LMBA 2AUHA 4S31A 5ANOA 3WF6A 2HVQA 1QCFA 4AGDA 3UP2A 4DEEA 2VTJA 4JDHA 1P14A 4K9YA 4LRKA 4QP3A 2YM8A 4LGHA 4U6RA 4NCTA 3EQRA 2F57A 5GNKA 3CGOA 4WBBB 1TVOA 1XR1A 4A9RA 3VS7A 2GNHA 4XV1A 2Q0NA 4FT7A 4E4MA 3OVVA 3PRFA 2QOKA 3ORRA 3R1NA 2YIWA 3WF5A 5ANDA 3LWBA 4FEVA 3H9FA 5AUVA 4IIRA 2UV2A 3RHXA 4Q2AA 4FFOA 3OD6X 4C7TA 4CG8A 1GZNA 5AP6A 4PP7A 2P55A 4CT2A 4E93A 4I5CA 4TYGA 4R3CA 5D1PA 4EHEA 2UW8A 4YJNA 2R4BA 1V0BA 4F0GA 5I9WA 2OXDA 1K9AA 3C50A