3JSNA

Crystal structure of the adenylation domain of nad+-dependent dna ligase from staphylococcus aureus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
306
structure length
297
Chain Sequence
b'DLSSRVNELHDLLNQYSYEYYSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structure of the adenylation domain of NAD(+)-dependent DNA ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 106
structure length 297
sequence length 306
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jsnA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3jsnA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jsnA02
1DGSA 3KYHC 1CKMA 3GDEA 3NBYB 3W1BA 4DRFA 4DR4B 5FPOA 4EFBA 4KHPB 5FPRA 1IBLB 3RR5A 4DV5B 5DISC 3S24A 4E6NA 4LF8B 4DV6B 3BABA 4LF9B 4UCVA 4JI8B 4DV1B 4DR6B 3T1HB 3UQ8A 4EQ5A 1B04A 1P16A 5D1OA 4LH6A 4PZ6A 4LFCB 1N32B 1X9NA 4JI6B 4DR1B 3OTOB 1XMOB 4JI1B 1TAEA 1FJGB 4JV5B 1CKOA 4X64B 1ZAUA 3VNNA 5LMUB 1FVIA 2E5LB 1HR0B 4DR5B 4DV3B 4LH7A 4LFAB 3TY5A 4EFEA 1HNXB 2UUAB 3GJXB 4DV4B 2VQEB 2CFMA 4DUZB 1N33B 1TA8A 3BA9A 1IBKB 4JI4B 4GKKB 2UUBB 4LF4B 1J5EB 4LFBB 1XDNA 3TY8A 3W5OA 1XNRB 3QWUA 4GLXA 2HIXA 4JI7B 1I94B 3RTXA 1V9PA 2UU9B 4OX9B 4GKJB 4CC6A 4NXNB 4X66B 4JI5B 1CKNA 1HNWB 4TOIA 3W1GA 4LF6B 4LF5B 4UCUA 3BA8A 5D1OB 4B3TB 2HIVA 4DUYB 2VUGA 1N34B 1A0IA 4X65B 4JI2B 4K0KB 4DR3B 4CC5A 4EEQA 1S68A 4LF7B 2VQFB 2HVQA 2Q2TA 2UXDB 3JSLA 4DR7B 1XK5A 3GB8B 4JYAB 1XNQB 3JSNA 4UCSA 4B3MB 5BR8B 2HVRA 2Q2UA 4NXMB 4UCRA 5D1PA 1IBMB 3SGIA 5LMNB 4DV2B 3L2PA 4UFZA 2UUCB 1P8LA 4B3SB 3NC0B 2ZM6B 4JI0B 2UXCB 1N36B 4DV0B 1HNZB 4YY3B 4PZ7A 2F4VB 2HVSA 1XMQB 4AQYB 2HHHB 4DR2B 3NBZB 3T1YB 4PZ8A 3PN1A 4UCOA 4DV7B 4JI3B 4X62B 3TY9A 4YHHB 3BAAA 1CKNB 2OWOA 1VS0A 4B3RB 5IWAB 2UXBB 4UCTA
chains in the Genus database with same CATH superfamily
3T7AA 2Q69A 2GQRA 3GDEA 2FP4B 3CRCA 3M8AA 1NTKH 3CEIA 1PL0A 1K3EA 2JEUA 3C3SA 4RUAA 4J9KA 2PUSA 1CS0A 3MHSC 1UJWB 4BR6A 2JS3A 4LF8O 4FE2A 3SR2C 2P22C 2HHFA 3RYFB 2R87A 5JWPA 1GM9A 1H2SB 3CC4V 4DR1B 1BE3H 4PWQA 4LBEC 4QIWF 3W7TA 5C93A 2IW5A 3AG4B 4AYBE 3T5KA 4B7KA 3A8TA 1ZAUA 5H2FZ 2XOKG 4MTDA 1AI6A 1O75A 4LF9H 3ETJA 1RJQA 2C2AA 4F50A 1AROP 1AP5A 3M4IA 4Q8EA 4CH5A 4DR2H 1OCOC 2A0LA 2OCCB 5DLFA 3LQSA 4F4WA 4BBRG 1G4YB 3U9SA 2CAZC 4O3NA 5KFIA 2DWCA 5JUMA 4KXRA 2JJ1G 5EZYA 1IBKO 4LFBB 3JAWB 2CNQA 2QA4V 5KFLA 4EBCA 1GRJA 4JI7B 5KFPA 2R8HA 4DK1A 1US6A 1SC5B 2Q67A 4JYYA 4ETSA 5E1AC 4LF8H 4L87A 4EGQA 2DABA 4UCUA 1YJ9V 5J2UB 4GX1A 5EWEA 2QR4A 4YY3O 4EGJA 2Q7EA 3D36C 4GX5A 1S5LZ 2F66C 4J9YB 3T1YO 3T9BA 5KFVA 2M6YA 3GB8B 2WDTA 4JYAB 2RCVA 2DWDC 2W7OA 4BAYA 2QKAA 1PD3A 1KJJA 2AU0A 1SZTA 4KL1A 4DUYH 2VUMG 3RN4A 2E2IA 3AG1C 5C8YA 5H5NA 1BZKA 3N6XA 1OCRC 5KFOA 2RDCA 1M56B 1KECA 3CRQA 1IBKH 4K3AA 2W7PA 2ZDQA 2XAFA 3H1IH 5JJJB 3MHHC 4LWSB 3V4SA 1IXBA 4O4IB 1RSOA 3B09A 3BG5A 4IRKA 5IYZB 3H9VA 2UXBB 3CCEV 1D5AA 4CS3A 2V9WA 4YY3H 4JV2A 4RO2A 1RP3B 2Y0SA 5L3GA 2Q7HA 3F7YC 2YICA 3SPIA 2VUMA 1E4GT 3TIGA 2QJ1A 3B4SA 4IHJA 3T1YH 2W71A 2ASJA 2VQEO 2W9CA 3CSWA 5E79Z 1M0WA 1G2WA 5D1OA 1KJ8A 4O7VA 1VEWA 3T1HO 2Z02A 5I5UA 2W0FC 5CN0A 4JI6B 4BXXG 3EXAA 1CPYA 1LR1A 2QWQB 2MCTA 1VQMV 3OGIB 1CKOA 1S3JA 4FFMA 1XMOO 5D5PA 1DIKA 3WFVA 1IXMA 2E5LB 2ODMA 1GMGA 4O4JF 1NBMG 3AG2B 3ZMZA 4JI5O 5B1AC 1EUDB 3ETQA 4TM5A 2CNVA 1KMIZ 1GGOA 4J9ZB 4QJFA 4RZRA 1VQ9V 2ADQB 3OE7G 3P3PA 2XAJA 3ML0A 4GX0A 4DUZO 1NTZH 4YJ2A 4WFFA 5J2TF 1S77D 2BTOA 4J0MA 1VF5B 1YIJV 3N2GB 2DE0X 3OEEG 4DRXA 3UYYA 3MWMA 1FD9A 1P49A 2R7ZG 5DEDA 4DR7O 3RWRD 3BJYA 4O4LB 1ULZA 1GYFA 1OCZC 2Y69B 4O3PA 3ZHRA 2VQEH 4ED0A 3MD0A 4J9LA 3W1GA 3GTJA 5B1NA 1QVGU 2HIVA 1S97A 2V58A 2LO1A 4CBCA 4X65B 3GIKA 4CS2A 4B08A 4I9QA 2QK4A 2VA3A 1XHXA 4JI2O 5CM0A 3L4KA 3RIZA 3VQYA 4ME6A 1XMOH 1H38A 3RYIB 4ZBMA 4RNOA 4UVBA 3M7MX 3ZS8C 2Y4UA 1RJPA 1Q3EA 3OFNG 4JI3O 1Y4MA 4JI5H 3ASNC 2R7ZA 4Q44A 4ZHQB 4F4LA 3PZPA 5KG3A 4NTXA 3EYYA 3RYFA 2C00A 5KT3A 2GUZB 5DQGA 4ECWA 4JXUA 4DUZH 5KG0A 1YXBA 1M93A 2QTOA 1CQJB 3T9AA 3E5NA 3ORQA 5BWVA 5JQGB 1R1BA 5LL6Y 4DR7H 4IZOA 2P06A 4PZ8A 1WN7A 3GVMA 5LOVF 1GAXA 3OTFA 4UCOA 4B3MH 4RB3C 1SKVA 1MOFA 1T36A 1BJTA 5KFSA 1JA8A 1WA8B 3CD6V 2WYOA 1ZHSA 2LQTA 2B1IA 2HGSA 1DV1A 3JAWA 5LXTF 3GTKA 3FB6C 4G28B 3I55V 4JI2H 1NR1A 2FLNA 4DW1A 2W9BB 4K8XA 2F1MA 4NB5A 2WLIA 4ZKIA 2ZDHA 4ED7A 4GCZA 1Y67A 2ABJA 4JI3H 4PDBA 3X2QC 4FZ0A 4DV1B 4B7EA 2IU3A 1KJ9A 3UQ8A 2CZGA 5J2UA 2CTQA 4H37A 4J10A 3ZRXA 1VARA 3KXYT 3K9SA 4I50B 2ZE8A 1FJGB 3EHBB 4O2BF 2N04A 4O7YA 4QWBA 5L3FA 4JI1O 4UUGA 3FKSG 2Y0SE 3CPWU 3U9TA 5KFGA 1PM9A 5KT5A 4X64O 1VQ4V 2W6QA 5I5SA 5BWTA 1TWCA 3GTOA 3HXLA 3E86A 3ZJZA 2AGOA 1HNWO 2CNUA 1XL6A 4JF3A 4DV4B 1KUTA 5KUMA 3SYPA 1Y6XA 2PVPA 3BA9A 2DIKA 3JCZA 1Z2NX 5LHHA 2W9AA 1VQ8V 1PKXA 1BNCA 1K83A 1GM8A 3RTXA 1V9PA 3VQVA 1YI2V 2QB5A 1MMMA 4BIZA 4LWSA 4F6EA 4OX9O 5IYCO 4C5AA 4YR2A 4O4IA 5B5EZ 1XDCA 5GW7A 5IT9N 3CCSV 5HFLA 3I5DA 4RZQA 1JX9A 1AN7A 5BZBA 4HYOA 4B3TB 4JV0A 1E1QG 5IYZA 5EBMC 3QVNA 4QPKA 2IBKA 2OCCC 1AJNA 4TV9F 2Z04A 1GO3F 4ED2A 2XCPA 3G6XA 3OUZA 1S76D 2XGPA 4LC1A 3CVZA 4H13B 1I1MA 3B8MA 4JI1H 2YI8A 2ZIOA 4X64H 4O7ZA 4WFAV 1SQFA 3KAKA 1HNWH 1FFTB 1T94A 5KFZA 5IWAO 1KQSU 1KJQA 2JEJA 3SDLA 5LMNB 3IN5A 2ZM6B 4GZRB 2XCLA 3C0FB 3APOA 1YZBA 3C90A 3ABLB 5CR5A 2WPDG 3DAAA 2QM7A 1ZX3A 3R23A 1KBHA 4YR0A 2F95B 4JI8O 2Y4TA 4AQYO 3CRAA 2VWJA 5EC1C 5KA6A 4FM9A 4OX9H 4JZGA 3ASOB 1OHHG 1PX2A 5C1OA 2GPSA 2Z5UA 2OTLV 4UCTA 3N2GA 4PHZA 1I7FA 1CKMA 3ZHQA 5IYDG 5LGUA 3SNOA 3FB7C 5KS8A 4O4LA 4LFAO 3R9RA 4DV5B 3PR5B 1M56C 2DZDA 3G4SV 3IC9A 3RW0A 4NVPA 3T9FA 4JAVA 4PZ6A 5CE8A 3V4ZA 1DF5A 1GN2A 5IWAH 2DAAA 3DSQA 5L9XA 3UO3A 2E75B 4CHIA 3OTOO 1FFXA 3RYIA 4CH4A 3M9OB 3CE2A 3WWHA 4X66O 4U3FH 4ECTA 3A0BZ 2ZIMA 3KTMA 4JI8H 1J95A 1MSWD 4P2ZA 3ZRWB 4ZHQA 4AQYH 4LF6O 2ZD9A 2VOBA 4AI8A 5KX5F 2GUZA 3DF7A 4FGRA 2ILMA 1DTOA 3KCXA 2AGQA 1JMKC 3CCLV 2UUBB 2ZE7A 1NT2B 4JI4O 3ZBHA 1I5YA 1YHQV 3GTGA 1FXVA 1Q82W 4GLXA 2J6TA 1YF2A 5CA1B 4IT5A 4FFRA 2E2HA 4YJ3F 3TJTA 4TV8F 4LFAH 5FLXW 1Z2OX 3PO2G 2V4DA 4I9WA 1QHTA 4FLYA 1O9HA 4GKJO 1YDXA 3M9NB 2HFEC 5D5QA 4WFBV 4O81A 4RQFA 2QEXV 1Q43A 1WA8A 3AG2C 1AB3A 2NLJC 5KFTA 2QKCA 4RAZA 1V55B 2XTAA 3JD1A 2FKXA 4R50A 4DR3B 1W96A 4ZIBA 4MV8A 3OTOH 2W9BA 3OM3B 3MJFA 2Q2TA 3UZOA 3NUAA 5I5WA 1VQNV 5LBQA 4X66H 2ZDIA 5C3EG 4UCSA 3T5HA 3AW8A 4A3MG 5KFYA 4LF6H 2Q2UA 4MVOA 4ZI7F 2JRIA 1JXLA 3EPGA 2Y69C 1EM1A 1MABG 1FS0G 4I50A 3NC0B 1CE8A 4JI0B 1M57B 5L3DA 3LUTB 4JI4H 3WO1A 4U7NA 3F7VC 2KSWA 2HHHB 4IIJB 5A2QN 5EZYF 1H8EG 1SA0B 4Q6GA 4DV7B 4BW5A 1KUQA 1GKFA 4GKJH 4RB1A 4X62B 5DAAA 4YJ3A 4YHHB 3JZIA 3ZRVA 4PD4F 3K57A 2UXNA 1B06A 2NU7B 1JQ0A 1I1KA 5KFUA 1ZHQA 4QSHA 4JGSA 1H2KA 2PYLA 3OUUA 2DWEC 3ZHSA 4O7SA 3HOZG 3HKDB 4IWXA 3U55A 3OT7A 2HJFC 4PDLA 2EILC 3AG7A 4X89A 2JIZG 4DR6B 3HT5A 5L3CA 3ZHUA 1N32B 3JRWA 3PW7A 3H1KH 4KUMA 4JI7O 4JV5B 2HR3A 1SYXB 2R93A 1AI7A 3K5OA 3Q8SB 3K5HA 1KC7A 3ZHVA 3FAVB 2HG8A 1FVIA 1GN4A 2ZINA 3K59A 4LH7A 1H8HG 2GHYA 1HNXB 4RAIA 2DW4A 5BMVF 5CB4F 3E8FA 1DK1A 1TUBB 5EDWA 4MVMA 2XNDG 4DL6A 2DMXA 2ZDIC 4P9OA 4RWUA 2Y4RA 1R3LC 3WO0A 5BYAA 3GIMA 4LF4O 4LNUB 3GIPA 5FL7G 3TGUH 2HIXA 1HP8A 1I94B 4TUYB 4YAKB 4E4TA 5HFMA 5KFNA 1YTFD 1K33A 1I5XA 3RYHB 5LA6F 4O3OA 4FJCC 4MTEA 4A3BG 4M0JA 3AYHB 4H44B 1RK6A 3T4ZA 3ABUA 3CP1A 3BA8A 4MVUA 3E2EA 3IG0A 3RAQA 4AILC 4YAJB 5KT2A 4MS2A 3K5LA 4IRDA 2ZGIA 2CKZB 4CC5A 1OCCB 2Q6AA 3H20A 4JI7H 5AG2A 3JATB 5K2MA 1S68A 1H2GA 2UXDB 1VQOV 3JSLA 1R3JC 3QZ8A 2JEIA 2VQFO 4TSFG 5DQHA 2C28A 3RBZA 1XNQB 2XGQA 4ED6A 1XREA 3SYQA 3H1LH 3H40A 1L1FA 2AZ0A 4TVIA 3PW4A 1XBLA 1YJNV 1M90W 2UXBO 4IR1A 1VBGA 4DV2B 2JK5C 3S3WA 2UVWA 2VPQA 3J7AK 2Q7DA 1FXKB 4DV0B 3N41B 4I4TB 1HNZB 4PZ7A 3L75H 4X1IB 1SFOA 4LF4H 4F4ZA 4YJ2F 2NNUA 4YB8B 3ZRWA 3TQTA 1IOVA 1M0TA 1YCIA 1G8MA 3BPZA 2GLTA 1K4CC 4NTWA 3O9OA 1SQGA 3G67A 1VS0A 3JD2A 4FS1A 1ROPA 4BBSG 3N40P 2ZXWB 4JYCA 3MFIA 2BTQB 1EKPA 2E5LO 4PBCA 3SPGA 5CA1A 3TW7A 4DAAA 2AHYA 5DISC 3I12A 2RNBA 3STLC 4PI2A 3OUSA 4CKBA 3ABLC 4ECZA 2VQFH 2GTAA 1VBHA 3H4BA 3J81N 2YW2A 2EJ2A 2ZT9B 3B40A 3RUPA 5KFXA 2UXBH 4CZZA 3HPLC 2V4QA 2YXHA 2Z3YA 2O57A 3ASOC 3SE7A 2BQ3A 1K5SA 1WPBA 3VBBA 1W0KG 3DC6A 4R6ZA 4A3LG 1KBLA 4DV3B 1BSMA 4MVQA 2X5RA 2A1HA 2WTFA 1Q81W 1P7GA 5L1JA 2UUAB 2YU9A 3QNEA 3JZ6A 3I4NG 2EINB 1K7DA 1PV0A 1IYEA 1COWG 1I0HA 4QWAA 3BCCH 4PI0A 2AW9A 2YXLA 2IH3C 2C22A 2P0AA 1XNRB 2XUMA 2ATLA 4OGQB 3RT3C 3BEHA 3JASA 4XDKA 3MAQA 3T9DA 2E5LH 4IIJA 4CKCA 5JH7B 3T5JA 4A5UB 2Q0AA 2JA6G 2WLLB 1SA0A 5C1PA 4RUEA 5FNVF 1WCMG 1Q6UA 1S0MA 1S0NA 2UVRA 1TWFA 3MR2A 4TWKA 2CUGA 2E3CA 1TWGA 2R7MA 2GPWA 1AR1B 2HDKA 2AXTZ 1WR2A 5HV6A 3QO8A 4DUYO 4MV3A 2NN4A 4X1YB 3HBLA 3LMLA 1KT8A 3LULA 3HKDA 2A06H 1KD1W 2P4KA 4QPJA 4EBDA 1XK5A 1BS3A 5BWRA 3DTFA 4MTFA 4WFHA 2YL2A 2K1EA 1P4RA 2JA6A 2WLNA 1EBOA 1WCMA 4O4HF 1HDJA 1IBMO 1RYRA 5DM6V 3SI8A 1AJPA 2P4VA 4J80A 1FYJA 3FAVA 1A48A 3GQCA 3RB4A 2YXYA 2UXCO 4MA0A 3T9CA 1V55C 4A3IG 4RQEA 3NXSA 4DV1O 1JLLB 4X88A 3T1CA 3T4DA 1S0OA 3D3QA 1I6UA 5EYPB 2EZPA 4F6RB 4OXSA 2NVYA 1TUBA 3ABMB 3U54A 4B3RB 1S03G 1BMFG 3K5MA 3DTGA 1WP8A 5CAEB 3VPBA 2RF4A 4LNUA 3KZIZ 5IP7G 1WB7A 3KYHC 4TUYA 3FB5C 1GK9A 1T3NA 3G8CA 2ZNIA 2ZR2A 1MNGA 4ED1A 4PDVA 3JZFA 3V6JA 3RYHA 1M57C 5LP6B 2ZCEA 1IBLO 1VQ6V 1JCHA 1GH6A 5I5VA 3E8BA 2DQ0A 5BYBA 3RFCA 3AK2A 4WBNF 3QF7A 1B04A 2O03A 3UM7A 1GSOA 2WB1A 3TIIA 4OPAA 1X9NA 1S10A 1IBMH 2NVXA 2OLSA 1E4EB 4GC6A 3JATA 4DIMA 5LMUB 1EKFA 4J7KA 2UXCH 3RBDA 1HR0B 2RDIA 1DF4A 3IC7A 3CHXA 2KKWA 2JEXA 4DV1H 3HB3B 4IL6Z 2GQSA 1OZ0A 1JKJB 2HJDA 2RJZA 3ZX6A 4ECYA 2F23A 2YUAA 4MAMA 3KREA 2P5OA 2BQUA 4K6NA 1FXKA 1VMGA 4I4TA 2DYSB 4X1IA 3E89A 3DXRB 1J5EO 1R9TA 3BVOA 4WF9V 5C5JA 1AI4A 4I55B 1W2BU 5KG1A 3N8DA 4NXNB 1IBLH 4AHCA 4FIPC 1TWHA 1Q8IA 5CA0F 3N2KB 2V4RA 4Q43A 2VUGA 1N34B 4K0KB 2BTQA 1QLNA 1SQBH 2CGOA 3MR3A 3OSNA 3OR7C 2GTSA 3HOWG 2ZNJA 1E1RG 3CYOA 2HVQA 2FPIB 4OPHA 4PA3A 5L1KA 4LF7O 3CCVV 2JA5G 3RF2A 4QWDA 1TUEB 3BRCA 4TQDA 5KG4A 1K34A 4MTOA 4HZ3A 4BWAA 4UV8A 2YZGA 4QWEA 4B3MO 4PA4A 3UKMA 1EHIA 3CWBH 3L2PA 1IDSA 1KB9F 2PN1A 4UFZA 3I4MG 4B3SB 2Q73A 5DECA 2NU8B 5KFJA 3L73H 4GYCB 5LL6b 1J5EH 1S5JA 4PDMA 2JVDA 4DR2B 2F4VO 2Q4PA 4I7HA 5KFFA 1OCCC 1I1LA 1SESA 4FLWA 4BWSC 4FFNA 4J11A 3GLKA 1QBZA 1XUQA 1ZSPA 2V7QG 3ETEA 3K03A 4Q20A 2AZ2A 1VKZA 5LMNH 4DL7A 1WPXA 1N8RW 3N6RA 5HNEA 2HP8A 1WB8A 2Q0OC 1N56A 1ZLZA 3QFFA 3AG3B 1JX4A 4TT3G 5JH7A 1KTAA 5FPOA 4EFBA 1AI5A 2WLLA 1DLBA 1FXKC 4LF8B 2KG7B 4FFKA 4UVAA 4LF7H 1FXHA 1U96A 5JJEB 3HKCB 2H94A 5I5XA 3PJSK 4FM2A 3CMEV 2JEFA 4KFMA 1WNSA 1Z5WA 4X1YA 5LGTA 4O7NA 4JYBA 4UVCA 1OWTA 4CMDA 2R82A 3KHRA 4J9SA 4FS2A 4NKGB 3K06A 2ZXWC 5KHGA 2F4VH 3VPDA 2V1DA 3WB1A 4DR5O 3K3WA 4U3JB 4EYHB 1TGOA 4HQ6A 1G6UA 1SCUB 1N33B 1IBKB 4DR3O 3ABKB 2WB1E 1QVFU 5LYJB 4M9UA 4GKKO 3OGCC 3A0RA 3Q2OA 3OMNB 4TQFA 3RBEA 3HOXG 3PW5A 1B6RA 5JQWA 4QIWA 3A0HZ 1P7BA 2X6BA 4WHXA 3SPHA 2CDYA 2YEVB 5IYBG 2W6IG 3H1HH 5EYPA 4J9OA 4UUJC 4F6RA 3L72H 4TOIA 2IJKA 2P67A 5TISZ 4LF5B 3CCJV 5LOVB 1NU1H 4JI0O 4PA9A 2R92G 1A0IA 1UC9A 3JCUZ 1GTOA 2FMAA 2EINC 3T5LA 5B1OA 4BY7G 2RN9A 2XT9A 2QF7A 2FB5A 5GTIZ 1RJRA 5KHHA 1SQVH 5LP6A 5LXTB 4DV7O 2W6NA 4X62O 4TQSA 2WLKA 4DR5H 3AG4C 1NI8A 5KHJA 3RV3A 3SJCC 1M4UA 3R65A 2UUCB 3LDEA 4FLVA 3FB8C 5B66Z 4DR3H 4FBUA 1R6NA 4XX0B 1E4EA 2V59A 4GKKH 4RB0A 2R92A 4LCUC 5H6QA 1I08A 1NVPD 1SERA 4O2BB 1ZWIC 4YXWG 2W8LA 2F93B 3TY9A 1V54B 1CKNB 1X4TA 1Q7YW 2R8KA 5EBWC 4JI0H 2I87A 5JVDF 2SCUB 3A2FA 2M05A 3MDSA 1W0JG 4I55A 2QWOB 4N21A 2R7LA 1XOUA 1OBGA 4DL5A 4CH6A 1ENVA 1A9XA 1HNXO 3HKEB 3GWKC 4DV7H 1VQLV 1IOWA 1UC8A 3EPIA 5B3SB 4X62H 4Q8FA 2P90A 4X1KB 3CC7V 3T1HB 1UNNC 4A3EG 2JA7G 3N2KA 3T99A 4A93G 3F8NA 1GM7A 1K1SA 3JD0A 1FAFA 4LFCO 2YS8A 1XMOB 1I94O 4L1KA 1OV9A 2A9HA 2YSUB 3ABMC 3VNNA 2Q7GA 3T2MA 3U0ZA 3M9MB 4RNMA 4TV9B 3TY5A 4EFEA 2BOCC 4N23A 3SJQC 5GONF 1VQ5V 2P7TC 4DUZB 1Q6IA 4XZ3B 3WWJA 4O82A 5IP9G 5LP6C 2JS5A 3HKBB 1VQKV 2X0SA 3ZMVA 3IAYA 3DGEA 1XDNA 3ETGA 3TY8A 2UXDO 1RPRA 1K1QA 3CMAV 1XNQO 4PV1B 1HNXH 2YWVA 3ZEDA 5CA1F 1AUVA 2W6MA 5DGHA 3G71V 3K0DA 2LJ2A 1HNZO 4JI2B 1SEIA 4LFCH 2Y48A 2PGGA 4G2KA 5IY5B 1I94H 2A7WA 4XDJA 3BQ1A 3C3TA 1B6SA 4WCEV 3LP8A 3GB7C 2H8PC 2BOBC 2KG7A 3LDCA 1MA1A 2EIMB 2DYSC 3SYAA 1YTFB 1K8AW 4QIWE 1V51A 2R9IA 1PNMA 5E25A 3HKCA 5IDJA 4D7TA 5JQGA 3JAMW 2WE6A 1I7LA 4UCRA 4RB2C 3P3NA 2KB1A 3CSXA 4FM1A 4RCNA 3GV5B 1EN6A 4IR9A 3IJ4A 1PK8A 4UV9A 2HVSA 3RB3A 3JARB 1C3OA 1S9FA 2UXDH 2AGAA 2CK3G 1QQCA 2ARHA 2F43G 3OMIB 1XNQH 1I3QA 4U3JA 5F9LA 2IM9A 2XCAA 3TXQA 1AP6A 2R9RB 4RUFA 4MVSA 3G6VA 5FLXN 1SZXA 3K0GA 4O7WA 2RGRA 5D8DA 5LYJA 4I0XB 2FB9A 2PTMA 1QLEB 1YSCA 1HNZH 5KX5B 3P32A 4DRFA 3NBYB 4QWCA 2Q9LA 4DV3O 4CE5A 5KFEA 3Q4HB 2YEVA 3S24A 4E6NA 5L1LA 3O65A 3CCUV 2UUAO 4DV6B 5DGBA 3FYEB 2UXXA 3EFFK 3H4DA 1VF7A 1AUXA 1M5IA 4ZOLB 2DN9A 4TV8B 5LOVA 1IZ3A 4O86A 3H0GG 4IYHA 3CJHB 5KFMA 5CBGA 3UZBA 5EIBD 4JI1B 1TAEA 3VA7A 3CXCU 4DR1O 4X64B 2YIBD 4DK0A 5I47A 2R7NA 1HW7A 5LXTA 3UT5B 4O2AB 3K3PA 1CQIB 2QWPB 2YIAA 2EIKB 3AG3C 3E83A 3GJXB 2C2EA 3RFRA 1S5HC 5L3BA 1Y66A 3VQWA 1LUVA 5KT6A 2QWRB 2FPPB 3K79A 3N42B 3DTUB 3KKYA 3WNZA 2QKSA 4ECXA 2WLJA 3M99B 4ZI7B 4LFBO 3QWUA 2FJZA 1R6TA 3GIIA 2PZSA 3HB9A 3H0GA 3Q8QB 1JVMA 4OX9B 4DV3H 4O2BA 4FLZA 4O3SA 2X6AA 2UUAH 2R6FA 2NUAB 4E4EA 3Q8RB 5C8YF 1CKNA 2ASDA 3GTLA 4W4KA 2R85A 3PW2A 1KYOF 4BW9A 4D7SA 5EZYB 4P30A 3V6KA 4ABMA 1A32A 1F7YA 4YP3A 5LHIA 3TEKA 4Z1MG 4DR1H 4O7LA 3ABKC 3G8DA 2MW2B 1BT8A 1NZ6A 3HKEA 1UFIA 2Q8VA 2OT5A 3RYCB 3J80W 5DG7A 2Q5ZA 1K9MW 2ODTX 4X1KA 1BGYH 2GV9A 1RYSA 2ZQMA 5CMUA 4JYAO 4B3RO 3L9DA 1F4MA 1N0JA 2EBOA 3ICXA 2HGWA 3WB0A 3RGZA 3FDSA 1BL8A 4IHJF 5DG8A 2VRZA 3UCSC 1EZVH 1TWAA 1Y1VG 4LFBH 1XMQB 1RFYA 4TV9A 4AQYB 4APMA 3GWOA 4GC7A 2LW1A 4JTDB 4DL2A 1GSAA 4MV9A 2RDJA 1PPJH 5C4XG 2C2DA 2EIYA 2VA2A 5KFKA 3HKBA 2OWOA 2C35B 3TETA 3PVXA 3K5NA 2B9ZA 5BMVB 5CB4B 5LMUO 3DC5A 1XL4A 2L6LA 3W1BA 3RAXA 4RNNA 4KHPB 5FPRA 4ED3A 2VR1A 1L0NH 1YVWA 2J6UA 1Y1WG 4C2MA 4MW3A 3KG2A 4IWYA 4C7UA 5KAIZ 1Q6HA 4NYEA 4J9MA 1OBDA 3J7AU 1M9NA 3QQMA 1H2LA 4JYAH 4B3RH 2W57A 5LA6B 3ASNB 5KA5A 1BGWA 1SETA 2PI4A 3AX6A 3PW0A 3U11A 4J42A 3OTOB 4ECRA 5IJ0B 2DYRB 1V54C 2P6JA 4QE7A 4JI6O 1PP9H 3FFQA 2ZE6A 1W59A 1VQPV 2XAQA 4TQRA 5EWFA 4NXNO 1QCEA 2ADPA 2R9AA 3SJAC 1NKDA 1L2ZA 1SQPH 4X9QA 2PBZA 1JPXA 3ZN1A 2W6PA 2OH2A 2X7RB 3CS5A 5FJ8G 3ZMUA 2DOSA 1N34O 2QYZA 1TA8A 3JALB 3W7XA 4K0KO 1H2MA 4JI4B 3KAJA 5I60A 5B3SC 3PO3G 1R6KA 5KFRA 4Z1VA 2HG5C 2YRWA 2R7KA 3W5OA 3PFFA 1KU9A 3JARA 5LMUH 3K04A 4RUCA 4MV7A 3CX5F 1I50A 3SPJA 3RVZA 4GKJB 4HBNA 1PL4A 4IAJA 2QM4A 3LNNA 3D8CA 5JH7F 1N48A 4O3QA 1EN4A 1AR5A 2OTJV 1BCCH 1QNMA 2CH7B 4I0XA 4B3SO 2PMZA 4MW8A 3CEBA 1JIHA 3N27A 5KX5A 2N05A 5HBRB 2OIGA 3GTPA 2WLHA 4X65O 1IVSA 3G6YA 3ZHTA 4JI6H 3GIQA 3Q4HA 2HEPA 3LSSA 2YI9A 2EX3A 3RB6A 5T14A 5L3EA 1N0NA 4D6TH 4NXNH 4YIPA 2A3QA 3JSNA 4ZOLA 1QU7A 1VP7A 2NU9B 5BR8B 1CEZA 3ZCCA 4TV8A 2QTSA 2MK3A 4CS4A 5D1PA 4FFLA 2PI5A 5IYDO 3RB0A 3CJHA 3SGIA 3ZN0A 1GSHA 3MWDA 1E79G 3G80A 4C5BA 3QZ7A 5IYCG 4K0KH 2EJRA 2D3OW 1N36B 2DPJA 4DL3A 2BQRA 4MV4A 3HR0A 4O2AA 3UT5A 5BWWA 4NZNA 3NBZB 4FFOA 4J9RA 5IY5C 5J2UF 2LW7A 3CRRA 3GILA 2YZNA 2B1GA 2BE3A 1Y14B 5C44G 1WP7A 2OCHA 1EUCB 4A3JG 2EIMC 4R7RA 1AILA 4B3SH 4MA5A 3K58A 2J9GA 4ZI7A 1OJHA 2EULA 2NU6B 4DR4B 4X65H 1EFRG 3CB2A 1GO3E 5H80A 1BQ0A 3U10A 3W7SA 4YQWA 1N33O 5F9NA 5LP6F 4JPRA 1EKVA 1Z2GA 1P16A 2B63G 1F4NA 2IP4A 1L0LH 2FTKA 1I7NA 5I5TA 2XASA 2N74A 5FNVB 3OMAB 3ETDA 2CW8A 4Q45A 4MV6A 5J9PC 3BQ0A 2WLIB 2YS7A 3MR6A 3OD4A 1Y76B 1FJGO 1Q86W 4FFBB 4Q0YA 3OSPA 4O4IF 4X8AA 1QLEC 3RYCA 4E2LA 4EB6B 2G38A 5IYZF 4DXWA 4LF5O 4A2AA 2LP7A 4O84A 4CKEA 4DV4O 3B8NA 1IYDA 4J9PA 3THOA 4IYIA 4LF4B 1S0VA 5EOYA 1W93A 5FLMG 2B63A 3SYOA 3W7WA 3CCRV 3ZMSA 1B6QA 5BPFA 5DLGA 3PR4A 2COGA 1SRYA 4O4HB 1MZFA 2UU9B 4H33A 4G3IA 4CC6A 4FLUA 5LGNA 2J6SA 4I55F 3JD3A 3TINA 2X0LA 3I56V 2BSKB 3JD4A 2R8GA 1N33H 4A2BA 2UUCO 3RGBA 2EIKC 5B1BB 3T54A 3TCUA 1E4FT 4LSXA 5BWXA 5BMVA 5CB4A 1IX9A 4B3TO 4A3KG 5IJ9B 4M7EA 5EC2C 3K5IA 1SQXH 2ITCC 4MTGA 5K1PA 3H1JH 4JAUA 4XBFA 1NH2B 3UFXB 3CRMA 2VQFB 1FJGH 1PNLA 2W6OA 3F5WC 4DLKA 3WG7B 2DLNA 1BHAA 3UO2A 2PY5A 1QR9A 4LF5H 4NXMB 5H6RA 2CTPA 5LA6A 2LFSA 2HVKC 4DV4H 1JJOA 2PMZE 5IJ0A 1WSCA 2XC9A 4ED8A 4QGPA 4O4LF 4WBNB 5CBFA 5KHIA 5LMNO 4DYLA 2YIDA 1GLVA 3OUFA 2ZM6O 1R3KC 3AEIA 4YIOA 2OYQA 4HN2A 4FLTA 5L1IA 2IMWP 4O83A 1JDBB 4XYMB 5H9CA 2RGVA 1KJIA 3CQZA 5DMXA 1THZA 3JALA 1G1XB 5KAFZ 4LSAA 3V6HA 3AK3A 1GN6A 4J9QA 2UUCH 2A79B 5ITZB 4L8JA 2HGXA 1ORQC 4ASUG 4B3TH 2ZKOA 5KT4A 4UB6Z 1WLEA 4ZHQF 1EYZA 1K97A 3WWIA 5KFQA 4MT8A 3P30A 1NVPB 5KG7A 4LF9B 4DV5O 2QE7G 3JYCA 3GV8B 3BQ2A 1I2KA 2CH7A 4FU0A 1M1KW 4IRCA 1RPOA 2CW7A 2UVVA 3L70H 1K73W 5JQGF 4O4JB 5CA0B 2W6JG 4GT1A 1Y74B 2Q68A 2JA5A 2ZM6H 1XQ8A 4A3DG 1S72V 3TQ1A 2Y0PA 2E76B 4F4YA 1MG1A 4A3FG 4EYIB 2RMKB 3T1HH 5J2TB 4LR3A 1FPOA 2WAMA 2VWKA 5KFBA 1CP9A 1B33N 3HOUG 1ZL8B 1FFXB 3D3IA 4LP8A 4HR7A 3STZC 2IU0A 3ZMTA 2UUBO 4O7RA 5DGAA 2HJWA 3KHHA 1IURA 4C5CA 5LYJF 2W70A 1KP2A 3E35A 3KCYA 2DYRC 4W4LA 5FD6A 2DPIA 2JGDB 3LSQA 4NZOA 2KSDA 4DV5H 4XYLB 4I50F 5KKNB 4NYKA 3FX7A 3OEHG 4EG0A 4FBTA 1O9GA 2EILB 4DUYB 2YRXA 2WAQA 2YDEA 2HKOA 1KC8W 2COJA 3RVYA 4U7CA 3Q1KA 2YC0A 4KP4A 1YITV 2JEGA 1N4CA 1B3QA 2E74B 1NH2D 2HVRA 4ECUA 1XILA 3BHPA 3H01A 4WFGA 2BCCH 3GIJA 2X6CA 1IBMB 2FYUH 5FNVA 3TW6A 1P8LA 1WAZA 4NTYA 5F2VO 3R5XA 4BY1G 2UXCB 2I8CA 4YY3B 1Y76A 2UUBH 4FFBA 3VOUA 5K1XA 1WJZA 2IJIA 4DV6O 3S3XA 4RAYA 3T1YB 1K4DC 4EB6A 2HHHO 4K35A 3L4JA 3SJBC 3BAAA 3BY6A 1JFFB 1T5EA 2ATKC 4YHHO 2AQ4A 3GTQA 5KLVH 2QGNA 1KKCA 4FPPA 4O4HA 1NJIW 4A3GG 5IT9W 1IBLB 4FK5C 1R73A 3N43B 2EZOA 5DN6G 2XHBA 1BHBA 3BACA 4UCVA 3LSUA 5FD5A 2BSKA 2OIEA 3R5FA 3NR7A 3ZRSA 2DQ3A 4LH6A 2YZMA 2CTWA 1H2NA 4DR6O 4HNAB 2ETNA 5DGIA 2FK3A 5IJ9A 1N32O 3AK1A 1NS1A 5EK0A 2EIJB 4JV5O 1U97A 1M7JA 4NZMA 5DG9A 5KFCA 2WA4A 1XEQA 4O7TA 4ECVA 3DXRA 3OAAG 4DV6H 4Q4CA 4H0LB 5CA3A 1NTMH 2HHHH 2VQEB 2CFMA 4PA6A 1HWYA 1QR8A 4G27B 3F5TA 4CH3A 2CGNA 4WBNA 1J5EB 4YHHH 5KHKA 4J7ZA 1RM1B 5KUKA 2FPGB 1VQ7V 5KG5A 1JJ2U 2D2CB 1VIBA 4MTXA 4Y8VB 1V4YA 1WH2A 1AJQA 2WWWA 5KFHA 4JI5B 4FMTA 2YCHA 2ALZA 1RK5A 4R8UB 4J41A 2ZE5A 5ITZA 1F23A 4DR6H 2AHZA 2QWNB 3B2EE 1N32H 1XMQO 1SF9A 2FLLA 4EEQA 4IGGA 4JV5H 4FLXA 4LF7B 3JAKB 4I5SA 1TVKB 2YYAA 3K3VA 1ZETA 5JVDB 2JA7A 2H3OA 2KQXA 4DR7B 4Q4DA 4RU9A 5GTHZ 4B3MB 4X20B 3E8GA 2JDIG 4O3RA 1D5NA 4O4JA 2M7WA 4NLGA 4DV2O 4PDRA 5CA0A 2VPSA 2WAQE 1Q90D 4KHPO 5FR9A 3IGAC 1Y74A 1LNQA 4GUNA 4UB8Z 5B1BC 2F4VB 3H3VH 4DV0O 4NR1A 3OHAA 4CMFA 3BFRA 1FKAO 1Q5OA 5J2TA 4JI3B 5JVLA 3WG7C 1ZL8A 1YEWA 3W7UA 3CC2V 1I2LA 4J7JA 1MZBA 5GONB 1P84F 4K8ZA 3R5HA 2I80A 3U0GA 2NR5A 2CE4A 3VMMA 2IJJA 1XMQH 2R72A 1OCOB 5JJNB 2FKLA 2RQ6A 4ICGA 3RR5A 2JGDA 1XHZA 3HOVG 3BABA 2W0XA 1MZEA 4JAAA 4HAMA 2COIA 1ZUQA 1PNKA 2W6ZA 1JDEA 4WD3A 1DV2A 3QO5A 1UPGA 3ORRA 3HKZA 1BQZA 3ETHA 3KHGA 2GBOA 4EEYA 2W8KA 3JAMN 4IIJF 4ZOLF 2R8JA 3RV4A 4FM0A 4DV2H 4WFEA 1Z2PX 4KHPH 3EVKA 1YJWV 3GTMA 1VF6A 4DV0H 2XAGA 5A9GA 1CXZB 4DR5B 4JUZA 1NR7A 3WU2Z 2HLDG 2ZR3A 1FKAH 4U6PA 3QTCA 4O2AF 2FK2A 2B5UA 3E22B 1BXRA 2LFRA 1KEEA 4GKKB 1VAJA 3B77A 5KMGB 5A2QW 3N44B 4YJ3B 3GV7B 3E8HA 3K9AA 5EBLC 1XNRO 5JCOA 2L35A 2C2RA 4J9NA 3RJ0A 1WRVA 5BR8O 3AG1B 5BWUA 3MR5A 3SYCA 1LUWA 1HNWB 1OCRB 5BXZA 1JFFA 3VPCA 4A3CG 2FK1A 1ZTEA 2HHFB 4YBZB 2EJ0A 2LGWA 1N36O 3CXHF 4QW8A 4EBEA 3JASB 2QM8A 2JA8G 1R3IC 1SQQH 1ET0A 2YZLA 2R93G 2IA6A 1KP3A 1AR4A 3APQA 2BR0A 3HOYG 4BIUA 3QO7A 4GX2A 2GDSA 2FE3A 5KG2A 2XD4A 4HNAA 3JRXA 4UXNA 3NGDA 4TUYF 2XAHA 4ZQIA 3FKIG 2JJ2G 1NQTA 4XDLA 4DR4O 1D2DA 2R70A 3IFXA 4FZ1A 1DAAA 2IH1C 1XNRH 2IJHA 3CCQV 5K3WA 1Z5VA 1ZQ7A 5BR8H 3FD9A 3HO8A 2R8IA 1VF6C 1L8DA 1SS3A 4PA7A 3SPCA 1F51A 3LDDA 4R7CA 2R84A 5IWAB 2V5AA 1X59A 2FMLA 4DO2A 4DW0A 4AYBA 5KT7A 4MSWC 1N36H 1DGSA 2YIBA 5B1AB 3G6BA 4JTAB 4PELA 1A0GA 5BY1A 4YR3A 1C30A 2HVJC 4Z2WA 1JR9A 3FKIA 1KKDA 5EWGA 3FMAA 4JI8B 4JTCB 4R8UA 3VOTA 3VQXA 4EQ5A 5JCOC 3CCMV 4I4TF 5CBHA 1K92A 2IBZH 4LFCB 3L74H 4LMYA 3Q8PB 3J80N 2EJ3A 5DQIA 1EZJA 2QDOA 3OW2U 5C8YB 3MWEA 1EN5A 1GN3A 2PF4E 4JASA 5IYBO 4DQNA 4DR4H 1OCZB 3FYIB 2UU9O 2GSMB 3JAKA 1TVKA 5JVDA 4HYKA 3OHBA 5LHGA 4MVRA 4LFAB 1HR0O 1URFA 3WB2A 3ABTA 1XI1A 3K08A 4X20A 5KFWA 1RSOB 3HKZE 1Y1VA 3RGXA 4ECSA 5IE9A 3TXSA 3ZIAG 2XIGA 4QNHB 5KFAA 4QE9A 4MVZA 3KALA 3MFHA 2ZJTA 4IHJB 2FLPA 4F4XA 4MV1A 2WSSG 2PYJA 4X66B 2EIJC 4NXMO 2W9CB 2EJ7A 4LF6B 2CQYA 5KFDA 1AVMA 2UVUA 1MSDA 5D1OB 2WA3A 5GONA 2VS0A 2CTRA 1EZ1A 4DL4A 3TK1A 4QW9A 1Y1WA 2LGQA 4JZ2A 1N34H 2WLMA 4BIOA 2UU9H 3J81W 4P9PA 2YS6A 5EIBC 1M6VA 4HNVA 4R8CA 4PJ0Z 1K5QA 1RM1C 1HR0H 4JV1A 4FFPA 3L71H 4U7OA 4QJFB 2VQDA 4ECQA 3QG5A 4GLWA 2ASLA 4YJ2B 2QSAA 4EKWA 5KG6A 3LWBA 3G6EV 1JOYA 3R66A 3X2QB 4DRXB 3T9EA 4LF9O 2FL4A 2ZDGA 5BPHA 1A3GA 4FVMA 2R86A 2K9PA 4HNTA 4DR2O 2DJVA 3PN1A 3D36A 2Y0IA 3E22A 4NXMH 5I5YA 2Z0AA 2JGUA 3KHLA 2AGPA 3LNMB 2ITDC 5KMGA 3OR6C 4I7ZB 4HNUA 3GIDA
chains in the Genus database with same CATH topology
4B3TH 3A2FA 1ZHQA 3GDEA 4I55A 2PYLA 4CH6A 3HKDB 3HKEB 2PUSA 4LF9B 4DV7H 4X62H 4DR6B 3SR2C 3T1HB 2P22C 4X1KB 3N2KA 3RYFB 1N32B 3F8NA 1H2SB 4DR1B 2CW7A 1XMOB 4JV5B 1SYXB 4O4JB 3K5OA 5CA0B 1ZAUA 2Q7GA 3VNNA 3U0ZA 2ZM6H 1XQ8A 1FVIA 4MTDA 4TV9B 1O75A 2ZINA 4LF9H 3K59A 4LH7A 3TY5A 4EFEA 3M4IA 4CH5A 1HNXB 4DR2H 3T1HH 5J2TB 4LR3A 4DUZB 5LP6C 2VWKA 2JS5A 1TUBB 3HKBB 2CAZC 1FFXB 3IAYA 4LFBB 5EZYA 1XDNA 3TY8A 3JAWB 4LNUB 2HIXA 4JI7B 1I94B 4TUYB 4DK1A 3RYHB 5FD6A 1HNXH 4MTEA 3ZEDA 4DV5H 4ETSA 4LF8H 4UCUA 3BA8A 5J2UB 3IG0A 1O9GA 4DUYB 4AILC 4JI2B 1SEIA 2Q7EA 4LFCH 3K5LA 2PGGA 3H20A 2F66C 4CC5A 4JI7H 1I94H 3JATB 1S68A 2UXDB 3JSLA 3GB8B 2WDTA 4JYAB 1XNQB 3HKCA 4D7TA 5JQGA 3JAMW 2HVRA 2WE6A 3BHPA 4UCRA 4RB2C 1IBMB 4KL1A 5FNVA 4DUYH 4DV2B 5C8YA 1P8LA 3J7AK 3CSXA 4FM1A 3N6XA 2UXCB 4DV0B 3N41B 1IBKH 4I4TB 4YY3B 1HNZB 4PZ7A 2UUBH 4FFBA 4X1IB 5K1XA 2HVSA 4LF4H 3JARB 2UXDH 4RAYA 1QQCA 3T1YB 4EB6A 1XNQH 4U3JA 3L4JA 2IM9A 5JJJB 1M0TA 3SJBC 3BPZA 4O4IB 1SQGA 1RSOA 3BAAA 1JFFB 1VS0A 1T5EA 2RGRA 5LYJA 5IYZB 2PTMA 2UXBB 3N40P 4CS3A 1D5AA 1HNZH 4YY3H 2BTQB 5KX5B 4DRFA 2Q7HA 3NBYB 5CA1A 4O4HA 1E4GT 5IT9W 1IBLB 2QJ1A 5DISC 4IHJA 3S24A 4E6NA 3N43B 3T1YH 4PI2A 4DV6B 2XHBA 4UCVA 5FD5A 2VQFH 1VF7A 1M5IA 4ZOLB 1M0WA 5D1OA 4TV8B 4LH6A 5LOVA 4HNAB 2UXBH 4JI6B 5IJ9A 5EIBD 4JI1B 1TAEA 2MCTA 1CKOA 4X64B 2YIBD 4DK0A 5D5PA 1WPBA 2E5LB 1HW7A 5LXTA 3UT5B 4O2AB 4DV6H 4DV3B 2YIAA 3ETQA 2HHHH 2UUAB 1KMIZ 3GJXB 3RFRA 2VQEB 2CFMA 3VQWA 4CH3A 4YJ2A 4WBNA 4PI0A 1J5EB 2YXLA 4YHHH 5KHKA 3N42B 2BTOA 4J0MA 1XNRB 3N2GB 4DRXA 4ZI7B 3QWUA 3MWMA 1P49A 3MAQA 3JASA 2E5LH 4IIJA 2PZSA 5JH7B 3RWRD 4OX9B 2Q0AA 4O2BA 4O4LB 4FLZA 4DV3H 1SA0A 1WH2A 1GYFA 2UUAH 4JI5B 2VQEH 2YCHA 1CKNA 3W1GA 4BW9A 4D7SA 5EZYB 5ITZA 2HIVA 2E3CA 4DR6H 4X65B 4CS2A 3B2EE 4B08A 4I9QA 1N32H 1XHXA 4X1YB 3L4KA 4DR1H 4EEQA 3RIZA 3VQYA 3LMLA 1XMOH 3HKDA 4JV5H 3RYIB 4FLXA 4LF7B 3JAKB 3HKEA 1TVKB 3K3VA 3M7MX 3ZS8C 5JVDB 1Q3EA 4DR7B 1XK5A 3RYCB 3J80W 4JI5H 4X1KA 2GV9A 4ZHQB 4B3MB 3EYYA 3RYFA 4X20B 3ICXA 4DUZH 3WB0A 4O4JA 3RGZA 5CA0A 2VPSA 2F4VB 1M93A 4LFBH 1XMQB 4TV9A 4AQYB 5JQGB 4APMA 4DR7H 1Q5OA 4PZ8A 1WN7A 5J2TA 4B3MH 3OTFA 4UCOA 4MV9A 4RB3C 1SKVA 4JI3B 1I6UA 5EYPB 4F6RB 1BJTA 1TUBA 3HKBA 2OWOA 4B3RB 1ZHSA 1YEWA 2WYOA 3K5NA 1MZBA 1S03G 5GONB 3K5MA 2HGSA 3JAWA 4LNUA 5BMVB 5CB4B 4K8ZA 3KYHC 4TUYA 3W1BA 1XMQH 2R72A 2ZNIA 4JI2H 5JJNB 4KHPB 2RQ6A 5FPRA 3RR5A 4K8XA 2F1MA 3RYHA 5LP6B 2ZCEA 1XHZA 3BABA 4PDBA 4JI3H 4DV1B 3QF7A 3UQ8A 1B04A 5J2UA 2O03A 4JYAH 4B3RH 2W57A 5LA6B 1BGWA 1X9NA 3U11A 3OTOB 3KXYT 4I50B 5IJ0B 1FJGB 1IBMH 4FM0A 4DV2H 3JATA 1Z2PX 4KHPH 3FFQA 5LMUB 2UXCH 4DV0H 1HR0B 4DR5B 2R9AA 3CHXA 3SJAC 3HXLA 1L2ZA 2KKWA 1FKAH 4DV1H 4DV4B 3QTCA 3E22B 2RJZA 1TA8A 3JALB 2P5OA 3BA9A 3KAJA 4JI4B 4GKKB 1Z2NX 5KMGB 4I4TA 3N44B 5A2QW 4YJ3B 3W5OA 4X1IA 1KU9A 3JARA 5LMUH 4MV7A 4I55B 5JCOA 1V9PA 3VQVA 3RTXA 3RJ0A 4GKJB 4HBNA 4IAJA 2QM4A 3LNNA 4NXNB 1IBLH 4AHCA 4O4IA 1HNWB 1AN7A 1Q8IA 4RZQA 1JFFA 3N2KB 4B3TB 5IYZA 2VUGA 1N34B 3JASB 4K0KB 2BTQA 5KX5A 3CVZA 4JI6H 2HEPA 4JI1H 2ZNJA 2YI8A 2YI9A 2EX3A 2ZIOA 2HVQA 4X64H 4NXNH 3RF2A 3JSNA 1SQFA 4ZOLA 3KAKA 1HNWH 2FE3A 3BRCA 4TQDA 5BR8B 4TV8A 4BWAA 4CS4A 5D1PA 4HNAA 1N34H 3SGIA 5LMNB 3L2PA 4K0KH 4UFZA 4B3SB 2ZM6B 3C0FB 1N36B 2R70A 4GYCB 5LL6b 1J5EH 1S5JA 3UT5A 4O2AA 2JVDA 4DR2B 3NBZB 4I7HA 1XNRH 2F95B 1Z5VA 2VWJA 4FLWA 5BR8H 4FM9A 4OX9H 4BWSC 1L8DA 5LMNH 4R7RA 4B3SH 5IWAB 3K58A 1N36H 4UCTA 3N2GA 4ZI7A 1DGSA 2YIBA 4PHZA 1I7FA 1CKMA 5JH7A 4DR4B 4X65H 5FPOA 3CB2A 4EFBA 4O4LA 4DV5B 4LF8B 3FMAA 3U10A 4JI8B 4LF7H 5JJEB 3HKCB 3VQXA 4NVPA 4EQ5A 5JCOC 1P16A 4PZ6A 4LFCB 4LMYA 4FM2A 5IWAH 5FNVB 3DSQA 2CW8A 5C8YB 1WNSA 1Z5WA 4X1YA 4DR4H 1FFXA 3RYIA 4CH4A 4FFBB 3JAKA 4Q0YA 1TVKA 5JVDA 5KHGA 3RYCA 2F4VH 4LFAB 2ZIMA 3WB1A 4JI8H 4EB6B 4ZHQA 4AQYH 4U3JB 4A2AA 3WB2A 2VOBA 1TGOA 1G6UA 1XI1A 3DF7A 4X20A 1N33B 1IBKB 3THOA 1JMKC 2UUBB 3RGXA 1NT2B 4LF4B 5LYJB 5EOYA 2XIGA 4TQFA 4GLXA 5CA1B 4O4HB 2UU9B 3KALA 4LFAH 5FLXW 1Z2OX 4IHJB 2ZJTA 4CC6A 2V4DA 4FLUA 2PYJA 1QHTA 4X66B 4FLYA 1O9HA 5EYPA 4F6RA 5D5QA 4TOIA 1N33H 4LF6B 1Q43A 4LF5B 4A2BA 5D1OB 3RGBA 5LOVB 4RAZA 1E4FT 5GONA 4LSXA 1A0IA 5BMVA 5CB4A 5IJ9B 4DR3B 4M7EA 4ZIBA 5K1PA 3OTOH 2UU9H 5KHHA 3J81W 5LP6A 2VQFB 1FJGH 5EIBC 2Q2TA 5LXTB 4X66H 1HR0H 4UCSA 2PY5A 4DR5H 4LF6H 4LF5H 2Q2UA 4NXMB 5KHJA 5LA6A 3SJCC 3QG5A 1M4UA 4DV4H 1JJOA 2UUCB 4FLVA 4I50A 5IJ0A 4DR3H 3NC0B 4YJ2B 4WBNB 5KHIA 4JI0B 4JI4H 4GKKH 2OYQA 2KSWA 4RB0A 4DRXB 4FLTA 2HHHB 4IIJB 4FVMA 4O2BB 1SA0B 3PN1A 2RGVA 4Q6GA 4DV7B 2F93B 3E22A 4NXMH 4GKJH 4RB1A 4X62B 4YJ3A 2JGUA 4YHHB 3JALA 1CKNB 3TY9A 4LSAA 1X4TA 3K57A 2UUCH 5ITZB 5KMGA 4JI0H 4L8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGS A;  3KYH C;  1CKM A;  3GDE A;  3NBY B;  3W1B A;  4DRF A;  4DR4 B;  5FPO A;  4EFB A;  4KHP B;  5FPR A;  1IBL B;  3RR5 A;  4DV5 B;  5DIS C;  3S24 A;  4E6N A;  4LF8 B;  4DV6 B;  3BAB A;  4LF9 B;  4UCV A;  4JI8 B;  4DV1 B;  4DR6 B;  3T1H B;  3UQ8 A;  4EQ5 A;  1B04 A;  1P16 A;  5D1O A;  4LH6 A;  4PZ6 A;  4LFC B;  1N32 B;  1X9N A;  4JI6 B;  4DR1 B;  3OTO B;  1XMO B;  4JI1 B;  1TAE A;  1FJG B;  4JV5 B;  1CKO A;  4X64 B;  1ZAU A;  3VNN A;  5LMU B;  1FVI A;  2E5L B;  1HR0 B;  4DR5 B;  4DV3 B;  4LH7 A;  4LFA B;  3TY5 A;  4EFE A;  1HNX B;  2UUA B;  3GJX B;  4DV4 B;  2VQE B;  2CFM A;  4DUZ B;  1N33 B;  1TA8 A;  3BA9 A;  1IBK B;  4JI4 B;  4GKK B;  2UUB B;  4LF4 B;  1J5E B;  4LFB B;  1XDN A;  3TY8 A;  3W5O A;  1XNR B;  3QWU A;  4GLX A;  2HIX A;  4JI7 B;  1I94 B;  3RTX A;  1V9P A;  2UU9 B;  4OX9 B;  4GKJ B;  4CC6 A;  4NXN B;  4X66 B;  4JI5 B;  1CKN A;  1HNW B;  4TOI A;  3W1G A;  4LF6 B;  4LF5 B;  4UCU A;  3BA8 A;  5D1O B;  4B3T B;  2HIV A;  4DUY B;  2VUG A;  1N34 B;  1A0I A;  4X65 B;  4JI2 B;  4K0K B;  4DR3 B;  4CC5 A;  4EEQ A;  1S68 A;  4LF7 B;  2VQF B;  2HVQ A;  2Q2T A;  2UXD B;  3JSL A;  4DR7 B;  1XK5 A;  3GB8 B;  4JYA B;  1XNQ B;  3JSN A;  4UCS A;  4B3M B;  5BR8 B;  2HVR A;  2Q2U A;  4NXM B;  4UCR A;  5D1P A;  1IBM B;  3SGI A;  5LMN B;  4DV2 B;  3L2P A;  4UFZ A;  2UUC B;  1P8L A;  4B3S B;  3NC0 B;  2ZM6 B;  4JI0 B;  2UXC B;  1N36 B;  4DV0 B;  1HNZ B;  4YY3 B;  4PZ7 A;  2F4V B;  2HVS A;  1XMQ B;  4AQY B;  2HHH B;  4DR2 B;  3NBZ B;  3T1Y B;  4PZ8 A;  3PN1 A;  4UCO A;  4DV7 B;  4JI3 B;  4X62 B;  3TY9 A;  4YHH B;  3BAA A;  1CKN B;  2OWO A;  1VS0 A;  4B3R B;  5IWA B;  2UXB B;  4UCT A; 
#chains in the Genus database with same CATH topology
 3T7A A;  2Q69 A;  2GQR A;  3GDE A;  2FP4 B;  3CRC A;  3M8A A;  1NTK H;  3CEI A;  1PL0 A;  1K3E A;  2JEU A;  3C3S A;  4RUA A;  4J9K A;  2PUS A;  1CS0 A;  3MHS C;  1UJW B;  4BR6 A;  2JS3 A;  4LF8 O;  4FE2 A;  3SR2 C;  2P22 C;  2HHF A;  3RYF B;  2R87 A;  5JWP A;  1GM9 A;  1H2S B;  3CC4 V;  4DR1 B;  1BE3 H;  4PWQ A;  4LBE C;  4QIW F;  3W7T A;  5C93 A;  2IW5 A;  3AG4 B;  4AYB E;  3T5K A;  4B7K A;  3A8T A;  1ZAU A;  5H2F Z;  2XOK G;  4MTD A;  1AI6 A;  1O75 A;  4LF9 H;  3ETJ A;  1RJQ A;  2C2A A;  4F50 A;  1ARO P;  1AP5 A;  3M4I A;  4Q8E A;  4CH5 A;  4DR2 H;  1OCO C;  2A0L A;  2OCC B;  5DLF A;  3LQS A;  4F4W A;  4BBR G;  1G4Y B;  3U9S A;  2CAZ C;  4O3N A;  5KFI A;  2DWC A;  5JUM A;  4KXR A;  2JJ1 G;  5EZY A;  1IBK O;  4LFB B;  3JAW B;  2CNQ A;  2QA4 V;  5KFL A;  4EBC A;  1GRJ A;  4JI7 B;  5KFP A;  2R8H A;  4DK1 A;  1US6 A;  1SC5 B;  2Q67 A;  4JYY A;  4ETS A;  5E1A C;  4LF8 H;  4L87 A;  4EGQ A;  2DAB A;  4UCU A;  1YJ9 V;  5J2U B;  4GX1 A;  5EWE A;  2QR4 A;  4YY3 O;  4EGJ A;  2Q7E A;  3D36 C;  4GX5 A;  1S5L Z;  2F66 C;  4J9Y B;  3T1Y O;  3T9B A;  5KFV A;  2M6Y A;  3GB8 B;  2WDT A;  4JYA B;  2RCV A;  2DWD C;  2W7O A;  4BAY A;  2QKA A;  1PD3 A;  1KJJ A;  2AU0 A;  1SZT A;  4KL1 A;  4DUY H;  2VUM G;  3RN4 A;  2E2I A;  3AG1 C;  5C8Y A;  5H5N A;  1BZK A;  3N6X A;  1OCR C;  5KFO A;  2RDC A;  1M56 B;  1KEC A;  3CRQ A;  1IBK H;  4K3A A;  2W7P A;  2ZDQ A;  2XAF A;  3H1I H;  5JJJ B;  3MHH C;  4LWS B;  3V4S A;  1IXB A;  4O4I B;  1RSO A;  3B09 A;  3BG5 A;  4IRK A;  5IYZ B;  3H9V A;  2UXB B;  3CCE V;  1D5A A;  4CS3 A;  2V9W A;  4YY3 H;  4JV2 A;  4RO2 A;  1RP3 B;  2Y0S A;  5L3G A;  2Q7H A;  3F7Y C;  2YIC A;  3SPI A;  2VUM A;  1E4G T;  3TIG A;  2QJ1 A;  3B4S A;  4IHJ A;  3T1Y H;  2W71 A;  2ASJ A;  2VQE O;  2W9C A;  3CSW A;  5E79 Z;  1M0W A;  1G2W A;  5D1O A;  1KJ8 A;  4O7V A;  1VEW A;  3T1H O;  2Z02 A;  5I5U A;  2W0F C;  5CN0 A;  4JI6 B;  4BXX G;  3EXA A;  1CPY A;  1LR1 A;  2QWQ B;  2MCT A;  1VQM V;  3OGI B;  1CKO A;  1S3J A;  4FFM A;  1XMO O;  5D5P A;  1DIK A;  3WFV A;  1IXM A;  2E5L B;  2ODM A;  1GMG A;  4O4J F;  1NBM G;  3AG2 B;  3ZMZ A;  4JI5 O;  5B1A C;  1EUD B;  3ETQ A;  4TM5 A;  2CNV A;  1KMI Z;  1GGO A;  4J9Z B;  4QJF A;  4RZR A;  1VQ9 V;  2ADQ B;  3OE7 G;  3P3P A;  2XAJ A;  3ML0 A;  4GX0 A;  4DUZ O;  1NTZ H;  4YJ2 A;  4WFF A;  5J2T F;  1S77 D;  2BTO A;  4J0M A;  1VF5 B;  1YIJ V;  3N2G B;  2DE0 X;  3OEE G;  4DRX A;  3UYY A;  3MWM A;  1FD9 A;  1P49 A;  2R7Z G;  5DED A;  4DR7 O;  3RWR D;  3BJY A;  4O4L B;  1ULZ A;  1GYF A;  1OCZ C;  2Y69 B;  4O3P A;  3ZHR A;  2VQE H;  4ED0 A;  3MD0 A;  4J9L A;  3W1G A;  3GTJ A;  5B1N A;  1QVG U;  2HIV A;  1S97 A;  2V58 A;  2LO1 A;  4CBC A;  4X65 B;  3GIK A;  4CS2 A;  4B08 A;  4I9Q A;  2QK4 A;  2VA3 A;  1XHX A;  4JI2 O;  5CM0 A;  3L4K A;  3RIZ A;  3VQY A;  4ME6 A;  1XMO H;  1H38 A;  3RYI B;  4ZBM A;  4RNO A;  4UVB A;  3M7M X;  3ZS8 C;  2Y4U A;  1RJP A;  1Q3E A;  3OFN G;  4JI3 O;  1Y4M A;  4JI5 H;  3ASN C;  2R7Z A;  4Q44 A;  4ZHQ B;  4F4L A;  3PZP A;  5KG3 A;  4NTX A;  3EYY A;  3RYF A;  2C00 A;  5KT3 A;  2GUZ B;  5DQG A;  4ECW A;  4JXU A;  4DUZ H;  5KG0 A;  1YXB A;  1M93 A;  2QTO A;  1CQJ B;  3T9A A;  3E5N A;  3ORQ A;  5BWV A;  5JQG B;  1R1B A;  5LL6 Y;  4DR7 H;  4IZO A;  2P06 A;  4PZ8 A;  1WN7 A;  3GVM A;  5LOV F;  1GAX A;  3OTF A;  4UCO A;  4B3M H;  4RB3 C;  1SKV A;  1MOF A;  1T36 A;  1BJT A;  5KFS A;  1JA8 A;  1WA8 B;  3CD6 V;  2WYO A;  1ZHS A;  2LQT A;  2B1I A;  2HGS A;  1DV1 A;  3JAW A;  5LXT F;  3GTK A;  3FB6 C;  4G28 B;  3I55 V;  4JI2 H;  1NR1 A;  2FLN A;  4DW1 A;  2W9B B;  4K8X A;  2F1M A;  4NB5 A;  2WLI A;  4ZKI A;  2ZDH A;  4ED7 A;  4GCZ A;  1Y67 A;  2ABJ A;  4JI3 H;  4PDB A;  3X2Q C;  4FZ0 A;  4DV1 B;  4B7E A;  2IU3 A;  1KJ9 A;  3UQ8 A;  2CZG A;  5J2U A;  2CTQ A;  4H37 A;  4J10 A;  3ZRX A;  1VAR A;  3KXY T;  3K9S A;  4I50 B;  2ZE8 A;  1FJG B;  3EHB B;  4O2B F;  2N04 A;  4O7Y A;  4QWB A;  5L3F A;  4JI1 O;  4UUG A;  3FKS G;  2Y0S E;  3CPW U;  3U9T A;  5KFG A;  1PM9 A;  5KT5 A;  4X64 O;  1VQ4 V;  2W6Q A;  5I5S A;  5BWT A;  1TWC A;  3GTO A;  3HXL A;  3E86 A;  3ZJZ A;  2AGO A;  1HNW O;  2CNU A;  1XL6 A;  4JF3 A;  4DV4 B;  1KUT A;  5KUM A;  3SYP A;  1Y6X A;  2PVP A;  3BA9 A;  2DIK A;  3JCZ A;  1Z2N X;  5LHH A;  2W9A A;  1VQ8 V;  1PKX A;  1BNC A;  1K83 A;  1GM8 A;  3RTX A;  1V9P A;  3VQV A;  1YI2 V;  2QB5 A;  1MMM A;  4BIZ A;  4LWS A;  4F6E A;  4OX9 O;  5IYC O;  4C5A A;  4YR2 A;  4O4I A;  5B5E Z;  1XDC A;  5GW7 A;  5IT9 N;  3CCS V;  5HFL A;  3I5D A;  4RZQ A;  1JX9 A;  1AN7 A;  5BZB A;  4HYO A;  4B3T B;  4JV0 A;  1E1Q G;  5IYZ A;  5EBM C;  3QVN A;  4QPK A;  2IBK A;  2OCC C;  1AJN A;  4TV9 F;  2Z04 A;  1GO3 F;  4ED2 A;  2XCP A;  3G6X A;  3OUZ A;  1S76 D;  2XGP A;  4LC1 A;  3CVZ A;  4H13 B;  1I1M A;  3B8M A;  4JI1 H;  2YI8 A;  2ZIO A;  4X64 H;  4O7Z A;  4WFA V;  1SQF A;  3KAK A;  1HNW H;  1FFT B;  1T94 A;  5KFZ A;  5IWA O;  1KQS U;  1KJQ A;  2JEJ A;  3SDL A;  5LMN B;  3IN5 A;  2ZM6 B;  4GZR B;  2XCL A;  3C0F B;  3APO A;  1YZB A;  3C90 A;  3ABL B;  5CR5 A;  2WPD G;  3DAA A;  2QM7 A;  1ZX3 A;  3R23 A;  1KBH A;  4YR0 A;  2F95 B;  4JI8 O;  2Y4T A;  4AQY O;  3CRA A;  2VWJ A;  5EC1 C;  5KA6 A;  4FM9 A;  4OX9 H;  4JZG A;  3ASO B;  1OHH G;  1PX2 A;  5C1O A;  2GPS A;  2Z5U A;  2OTL V;  4UCT A;  3N2G A;  4PHZ A;  1I7F A;  1CKM A;  3ZHQ A;  5IYD G;  5LGU A;  3SNO A;  3FB7 C;  5KS8 A;  4O4L A;  4LFA O;  3R9R A;  4DV5 B;  3PR5 B;  1M56 C;  2DZD A;  3G4S V;  3IC9 A;  3RW0 A;  4NVP A;  3T9F A;  4JAV A;  4PZ6 A;  5CE8 A;  3V4Z A;  1DF5 A;  1GN2 A;  5IWA H;  2DAA A;  3DSQ A;  5L9X A;  3UO3 A;  2E75 B;  4CHI A;  3OTO O;  1FFX A;  3RYI A;  4CH4 A;  3M9O B;  3CE2 A;  3WWH A;  4X66 O;  4U3F H;  4ECT A;  3A0B Z;  2ZIM A;  3KTM A;  4JI8 H;  1J95 A;  1MSW D;  4P2Z A;  3ZRW B;  4ZHQ A;  4AQY H;  4LF6 O;  2ZD9 A;  2VOB A;  4AI8 A;  5KX5 F;  2GUZ A;  3DF7 A;  4FGR A;  2ILM A;  1DTO A;  3KCX A;  2AGQ A;  1JMK C;  3CCL V;  2UUB B;  2ZE7 A;  1NT2 B;  4JI4 O;  3ZBH A;  1I5Y A;  1YHQ V;  3GTG A;  1FXV A;  1Q82 W;  4GLX A;  2J6T A;  1YF2 A;  5CA1 B;  4IT5 A;  4FFR A;  2E2H A;  4YJ3 F;  3TJT A;  4TV8 F;  4LFA H;  5FLX W;  1Z2O X;  3PO2 G;  2V4D A;  4I9W A;  1QHT A;  4FLY A;  1O9H A;  4GKJ O;  1YDX A;  3M9N B;  2HFE C;  5D5Q A;  4WFB V;  4O81 A;  4RQF A;  2QEX V;  1Q43 A;  1WA8 A;  3AG2 C;  1AB3 A;  2NLJ C;  5KFT A;  2QKC A;  4RAZ A;  1V55 B;  2XTA A;  3JD1 A;  2FKX A;  4R50 A;  4DR3 B;  1W96 A;  4ZIB A;  4MV8 A;  3OTO H;  2W9B A;  3OM3 B;  3MJF A;  2Q2T A;  3UZO A;  3NUA A;  5I5W A;  1VQN V;  5LBQ A;  4X66 H;  2ZDI A;  5C3E G;  4UCS A;  3T5H A;  3AW8 A;  4A3M G;  5KFY A;  4LF6 H;  2Q2U A;  4MVO A;  4ZI7 F;  2JRI A;  1JXL A;  3EPG A;  2Y69 C;  1EM1 A;  1MAB G;  1FS0 G;  4I50 A;  3NC0 B;  1CE8 A;  4JI0 B;  1M57 B;  5L3D A;  3LUT B;  4JI4 H;  3WO1 A;  4U7N A;  3F7V C;  2KSW A;  2HHH B;  4IIJ B;  5A2Q N;  5EZY F;  1H8E G;  1SA0 B;  4Q6G A;  4DV7 B;  4BW5 A;  1KUQ A;  1GKF A;  4GKJ H;  4RB1 A;  4X62 B;  5DAA A;  4YJ3 A;  4YHH B;  3JZI A;  3ZRV A;  4PD4 F;  3K57 A;  2UXN A;  1B06 A;  2NU7 B;  1JQ0 A;  1I1K A;  5KFU A;  1ZHQ A;  4QSH A;  4JGS A;  1H2K A;  2PYL A;  3OUU A;  2DWE C;  3ZHS A;  4O7S A;  3HOZ G;  3HKD B;  4IWX A;  3U55 A;  3OT7 A;  2HJF C;  4PDL A;  2EIL C;  3AG7 A;  4X89 A;  2JIZ G;  4DR6 B;  3HT5 A;  5L3C A;  3ZHU A;  1N32 B;  3JRW A;  3PW7 A;  3H1K H;  4KUM A;  4JI7 O;  4JV5 B;  2HR3 A;  1SYX B;  2R93 A;  1AI7 A;  3K5O A;  3Q8S B;  3K5H A;  1KC7 A;  3ZHV A;  3FAV B;  2HG8 A;  1FVI A;  1GN4 A;  2ZIN A;  3K59 A;  4LH7 A;  1H8H G;  2GHY A;  1HNX B;  4RAI A;  2DW4 A;  5BMV F;  5CB4 F;  3E8F A;  1DK1 A;  1TUB B;  5EDW A;  4MVM A;  2XND G;  4DL6 A;  2DMX A;  2ZDI C;  4P9O A;  4RWU A;  2Y4R A;  1R3L C;  3WO0 A;  5BYA A;  3GIM A;  4LF4 O;  4LNU B;  3GIP A;  5FL7 G;  3TGU H;  2HIX A;  1HP8 A;  1I94 B;  4TUY B;  4YAK B;  4E4T A;  5HFM A;  5KFN A;  1YTF D;  1K33 A;  1I5X A;  3RYH B;  5LA6 F;  4O3O A;  4FJC C;  4MTE A;  4A3B G;  4M0J A;  3AYH B;  4H44 B;  1RK6 A;  3T4Z A;  3ABU A;  3CP1 A;  3BA8 A;  4MVU A;  3E2E A;  3IG0 A;  3RAQ A;  4AIL C;  4YAJ B;  5KT2 A;  4MS2 A;  3K5L A;  4IRD A;  2ZGI A;  2CKZ B;  4CC5 A;  1OCC B;  2Q6A A;  3H20 A;  4JI7 H;  5AG2 A;  3JAT B;  5K2M A;  1S68 A;  1H2G A;  2UXD B;  1VQO V;  3JSL A;  1R3J C;  3QZ8 A;  2JEI A;  2VQF O;  4TSF G;  5DQH A;  2C28 A;  3RBZ A;  1XNQ B;  2XGQ A;  4ED6 A;  1XRE A;  3SYQ A;  3H1L H;  3H40 A;  1L1F A;  2AZ0 A;  4TVI A;  3PW4 A;  1XBL A;  1YJN V;  1M90 W;  2UXB O;  4IR1 A;  1VBG A;  4DV2 B;  2JK5 C;  3S3W A;  2UVW A;  2VPQ A;  3J7A K;  2Q7D A;  1FXK B;  4DV0 B;  3N41 B;  4I4T B;  1HNZ B;  4PZ7 A;  3L75 H;  4X1I B;  1SFO A;  4LF4 H;  4F4Z A;  4YJ2 F;  2NNU A;  4YB8 B;  3ZRW A;  3TQT A;  1IOV A;  1M0T A;  1YCI A;  1G8M A;  3BPZ A;  2GLT A;  1K4C C;  4NTW A;  3O9O A;  1SQG A;  3G67 A;  1VS0 A;  3JD2 A;  4FS1 A;  1ROP A;  4BBS G;  3N40 P;  2ZXW B;  4JYC A;  3MFI A;  2BTQ B;  1EKP A;  2E5L O;  4PBC A;  3SPG A;  5CA1 A;  3TW7 A;  4DAA A;  2AHY A;  5DIS C;  3I12 A;  2RNB A;  3STL C;  4PI2 A;  3OUS A;  4CKB A;  3ABL C;  4ECZ A;  2VQF H;  2GTA A;  1VBH A;  3H4B A;  3J81 N;  2YW2 A;  2EJ2 A;  2ZT9 B;  3B40 A;  3RUP A;  5KFX A;  2UXB H;  4CZZ A;  3HPL C;  2V4Q A;  2YXH A;  2Z3Y A;  2O57 A;  3ASO C;  3SE7 A;  2BQ3 A;  1K5S A;  1WPB A;  3VBB A;  1W0K G;  3DC6 A;  4R6Z A;  4A3L G;  1KBL A;  4DV3 B;  1BSM A;  4MVQ A;  2X5R A;  2A1H A;  2WTF A;  1Q81 W;  1P7G A;  5L1J A;  2UUA B;  2YU9 A;  3QNE A;  3JZ6 A;  3I4N G;  2EIN B;  1K7D A;  1PV0 A;  1IYE A;  1COW G;  1I0H A;  4QWA A;  3BCC H;  4PI0 A;  2AW9 A;  2YXL A;  2IH3 C;  2C22 A;  2P0A A;  1XNR B;  2XUM A;  2ATL A;  4OGQ B;  3RT3 C;  3BEH A;  3JAS A;  4XDK A;  3MAQ A;  3T9D A;  2E5L H;  4IIJ A;  4CKC A;  5JH7 B;  3T5J A;  4A5U B;  2Q0A A;  2JA6 G;  2WLL B;  1SA0 A;  5C1P A;  4RUE A;  5FNV F;  1WCM G;  1Q6U A;  1S0M A;  1S0N A;  2UVR A;  1TWF A;  3MR2 A;  4TWK A;  2CUG A;  2E3C A;  1TWG A;  2R7M A;  2GPW A;  1AR1 B;  2HDK A;  2AXT Z;  1WR2 A;  5HV6 A;  3QO8 A;  4DUY O;  4MV3 A;  2NN4 A;  4X1Y B;  3HBL A;  3LML A;  1KT8 A;  3LUL A;  3HKD A;  2A06 H;  1KD1 W;  2P4K A;  4QPJ A;  4EBD A;  1XK5 A;  1BS3 A;  5BWR A;  3DTF A;  4MTF A;  4WFH A;  2YL2 A;  2K1E A;  1P4R A;  2JA6 A;  2WLN A;  1EBO A;  1WCM A;  4O4H F;  1HDJ A;  1IBM O;  1RYR A;  5DM6 V;  3SI8 A;  1AJP A;  2P4V A;  4J80 A;  1FYJ A;  3FAV A;  1A48 A;  3GQC A;  3RB4 A;  2YXY A;  2UXC O;  4MA0 A;  3T9C A;  1V55 C;  4A3I G;  4RQE A;  3NXS A;  4DV1 O;  1JLL B;  4X88 A;  3T1C A;  3T4D A;  1S0O A;  3D3Q A;  1I6U A;  5EYP B;  2EZP A;  4F6R B;  4OXS A;  2NVY A;  1TUB A;  3ABM B;  3U54 A;  4B3R B;  1S03 G;  1BMF G;  3K5M A;  3DTG A;  1WP8 A;  5CAE B;  3VPB A;  2RF4 A;  4LNU A;  3KZI Z;  5IP7 G;  1WB7 A;  3KYH C;  4TUY A;  3FB5 C;  1GK9 A;  1T3N A;  3G8C A;  2ZNI A;  2ZR2 A;  1MNG A;  4ED1 A;  4PDV A;  3JZF A;  3V6J A;  3RYH A;  1M57 C;  5LP6 B;  2ZCE A;  1IBL O;  1VQ6 V;  1JCH A;  1GH6 A;  5I5V A;  3E8B A;  2DQ0 A;  5BYB A;  3RFC A;  3AK2 A;  4WBN F;  3QF7 A;  1B04 A;  2O03 A;  3UM7 A;  1GSO A;  2WB1 A;  3TII A;  4OPA A;  1X9N A;  1S10 A;  1IBM H;  2NVX A;  2OLS A;  1E4E B;  4GC6 A;  3JAT A;  4DIM A;  5LMU B;  1EKF A;  4J7K A;  2UXC H;  3RBD A;  1HR0 B;  2RDI A;  1DF4 A;  3IC7 A;  3CHX A;  2KKW A;  2JEX A;  4DV1 H;  3HB3 B;  4IL6 Z;  2GQS A;  1OZ0 A;  1JKJ B;  2HJD A;  2RJZ A;  3ZX6 A;  4ECY A;  2F23 A;  2YUA A;  4MAM A;  3KRE A;  2P5O A;  2BQU A;  4K6N A;  1FXK A;  1VMG A;  4I4T A;  2DYS B;  4X1I A;  3E89 A;  3DXR B;  1J5E O;  1R9T A;  3BVO A;  4WF9 V;  5C5J A;  1AI4 A;  4I55 B;  1W2B U;  5KG1 A;  3N8D A;  4NXN B;  1IBL H;  4AHC A;  4FIP C;  1TWH A;  1Q8I A;  5CA0 F;  3N2K B;  2V4R A;  4Q43 A;  2VUG A;  1N34 B;  4K0K B;  2BTQ A;  1QLN A;  1SQB H;  2CGO A;  3MR3 A;  3OSN A;  3OR7 C;  2GTS A;  3HOW G;  2ZNJ A;  1E1R G;  3CYO A;  2HVQ A;  2FPI B;  4OPH A;  4PA3 A;  5L1K A;  4LF7 O;  3CCV V;  2JA5 G;  3RF2 A;  4QWD A;  1TUE B;  3BRC A;  4TQD A;  5KG4 A;  1K34 A;  4MTO A;  4HZ3 A;  4BWA A;  4UV8 A;  2YZG A;  4QWE A;  4B3M O;  4PA4 A;  3UKM A;  1EHI A;  3CWB H;  3L2P A;  1IDS A;  1KB9 F;  2PN1 A;  4UFZ A;  3I4M G;  4B3S B;  2Q73 A;  5DEC A;  2NU8 B;  5KFJ A;  3L73 H;  4GYC B;  5LL6 b;  1J5E H;  1S5J A;  4PDM A;  2JVD A;  4DR2 B;  2F4V O;  2Q4P A;  4I7H A;  5KFF A;  1OCC C;  1I1L A;  1SES A;  4FLW A;  4BWS C;  4FFN A;  4J11 A;  3GLK A;  1QBZ A;  1XUQ A;  1ZSP A;  2V7Q G;  3ETE A;  3K03 A;  4Q20 A;  2AZ2 A;  1VKZ A;  5LMN H;  4DL7 A;  1WPX A;  1N8R W;  3N6R A;  5HNE A;  2HP8 A;  1WB8 A;  2Q0O C;  1N56 A;  1ZLZ A;  3QFF A;  3AG3 B;  1JX4 A;  4TT3 G;  5JH7 A;  1KTA A;  5FPO A;  4EFB A;  1AI5 A;  2WLL A;  1DLB A;  1FXK C;  4LF8 B;  2KG7 B;  4FFK A;  4UVA A;  4LF7 H;  1FXH A;  1U96 A;  5JJE B;  3HKC B;  2H94 A;  5I5X A;  3PJS K;  4FM2 A;  3CME V;  2JEF A;  4KFM A;  1WNS A;  1Z5W A;  4X1Y A;  5LGT A;  4O7N A;  4JYB A;  4UVC A;  1OWT A;  4CMD A;  2R82 A;  3KHR A;  4J9S A;  4FS2 A;  4NKG B;  3K06 A;  2ZXW C;  5KHG A;  2F4V H;  3VPD A;  2V1D A;  3WB1 A;  4DR5 O;  3K3W A;  4U3J B;  4EYH B;  1TGO A;  4HQ6 A;  1G6U A;  1SCU B;  1N33 B;  1IBK B;  4DR3 O;  3ABK B;  2WB1 E;  1QVF U;  5LYJ B;  4M9U A;  4GKK O;  3OGC C;  3A0R A;  3Q2O A;  3OMN B;  4TQF A;  3RBE A;  3HOX G;  3PW5 A;  1B6R A;  5JQW A;  4QIW A;  3A0H Z;  1P7B A;  2X6B A;  4WHX A;  3SPH A;  2CDY A;  2YEV B;  5IYB G;  2W6I G;  3H1H H;  5EYP A;  4J9O A;  4UUJ C;  4F6R A;  3L72 H;  4TOI A;  2IJK A;  2P67 A;  5TIS Z;  4LF5 B;  3CCJ V;  5LOV B;  1NU1 H;  4JI0 O;  4PA9 A;  2R92 G;  1A0I A;  1UC9 A;  3JCU Z;  1GTO A;  2FMA A;  2EIN C;  3T5L A;  5B1O A;  4BY7 G;  2RN9 A;  2XT9 A;  2QF7 A;  2FB5 A;  5GTI Z;  1RJR A;  5KHH A;  1SQV H;  5LP6 A;  5LXT B;  4DV7 O;  2W6N A;  4X62 O;  4TQS A;  2WLK A;  4DR5 H;  3AG4 C;  1NI8 A;  5KHJ A;  3RV3 A;  3SJC C;  1M4U A;  3R65 A;  2UUC B;  3LDE A;  4FLV A;  3FB8 C;  5B66 Z;  4DR3 H;  4FBU A;  1R6N A;  4XX0 B;  1E4E A;  2V59 A;  4GKK H;  4RB0 A;  2R92 A;  4LCU C;  5H6Q A;  1I08 A;  1NVP D;  1SER A;  4O2B B;  1ZWI C;  4YXW G;  2W8L A;  2F93 B;  3TY9 A;  1V54 B;  1CKN B;  1X4T A;  1Q7Y W;  2R8K A;  5EBW C;  4JI0 H;  2I87 A;  5JVD F;  2SCU B;  3A2F A;  2M05 A;  3MDS A;  1W0J G;  4I55 A;  2QWO B;  4N21 A;  2R7L A;  1XOU A;  1OBG A;  4DL5 A;  4CH6 A;  1ENV A;  1A9X A;  1HNX O;  3HKE B;  3GWK C;  4DV7 H;  1VQL V;  1IOW A;  1UC8 A;  3EPI A;  5B3S B;  4X62 H;  4Q8F A;  2P90 A;  4X1K B;  3CC7 V;  3T1H B;  1UNN C;  4A3E G;  2JA7 G;  3N2K A;  3T99 A;  4A93 G;  3F8N A;  1GM7 A;  1K1S A;  3JD0 A;  1FAF A;  4LFC O;  2YS8 A;  1XMO B;  1I94 O;  4L1K A;  1OV9 A;  2A9H A;  2YSU B;  3ABM C;  3VNN A;  2Q7G A;  3T2M A;  3U0Z A;  3M9M B;  4RNM A;  4TV9 B;  3TY5 A;  4EFE A;  2BOC C;  4N23 A;  3SJQ C;  5GON F;  1VQ5 V;  2P7T C;  4DUZ B;  1Q6I A;  4XZ3 B;  3WWJ A;  4O82 A;  5IP9 G;  5LP6 C;  2JS5 A;  3HKB B;  1VQK V;  2X0S A;  3ZMV A;  3IAY A;  3DGE A;  1XDN A;  3ETG A;  3TY8 A;  2UXD O;  1RPR A;  1K1Q A;  3CMA V;  1XNQ O;  4PV1 B;  1HNX H;  2YWV A;  3ZED A;  5CA1 F;  1AUV A;  2W6M A;  5DGH A;  3G71 V;  3K0D A;  2LJ2 A;  1HNZ O;  4JI2 B;  1SEI A;  4LFC H;  2Y48 A;  2PGG A;  4G2K A;  5IY5 B;  1I94 H;  2A7W A;  4XDJ A;  3BQ1 A;  3C3T A;  1B6S A;  4WCE V;  3LP8 A;  3GB7 C;  2H8P C;  2BOB C;  2KG7 A;  3LDC A;  1MA1 A;  2EIM B;  2DYS C;  3SYA A;  1YTF B;  1K8A W;  4QIW E;  1V51 A;  2R9I A;  1PNM A;  5E25 A;  3HKC A;  5IDJ A;  4D7T A;  5JQG A;  3JAM W;  2WE6 A;  1I7L A;  4UCR A;  4RB2 C;  3P3N A;  2KB1 A;  3CSX A;  4FM1 A;  4RCN A;  3GV5 B;  1EN6 A;  4IR9 A;  3IJ4 A;  1PK8 A;  4UV9 A;  2HVS A;  3RB3 A;  3JAR B;  1C3O A;  1S9F A;  2UXD H;  2AGA A;  2CK3 G;  1QQC A;  2ARH A;  2F43 G;  3OMI B;  1XNQ H;  1I3Q A;  4U3J A;  5F9L A;  2IM9 A;  2XCA A;  3TXQ A;  1AP6 A;  2R9R B;  4RUF A;  4MVS A;  3G6V A;  5FLX N;  1SZX A;  3K0G A;  4O7W A;  2RGR A;  5D8D A;  5LYJ A;  4I0X B;  2FB9 A;  2PTM A;  1QLE B;  1YSC A;  1HNZ H;  5KX5 B;  3P32 A;  4DRF A;  3NBY B;  4QWC A;  2Q9L A;  4DV3 O;  4CE5 A;  5KFE A;  3Q4H B;  2YEV A;  3S24 A;  4E6N A;  5L1L A;  3O65 A;  3CCU V;  2UUA O;  4DV6 B;  5DGB A;  3FYE B;  2UXX A;  3EFF K;  3H4D A;  1VF7 A;  1AUX A;  1M5I A;  4ZOL B;  2DN9 A;  4TV8 B;  5LOV A;  1IZ3 A;  4O86 A;  3H0G G;  4IYH A;  3CJH B;  5KFM A;  5CBG A;  3UZB A;  5EIB D;  4JI1 B;  1TAE A;  3VA7 A;  3CXC U;  4DR1 O;  4X64 B;  2YIB D;  4DK0 A;  5I47 A;  2R7N A;  1HW7 A;  5LXT A;  3UT5 B;  4O2A B;  3K3P A;  1CQI B;  2QWP B;  2YIA A;  2EIK B;  3AG3 C;  3E83 A;  3GJX B;  2C2E A;  3RFR A;  1S5H C;  5L3B A;  1Y66 A;  3VQW A;  1LUV A;  5KT6 A;  2QWR B;  2FPP B;  3K79 A;  3N42 B;  3DTU B;  3KKY A;  3WNZ A;  2QKS A;  4ECX A;  2WLJ A;  3M99 B;  4ZI7 B;  4LFB O;  3QWU A;  2FJZ A;  1R6T A;  3GII A;  2PZS A;  3HB9 A;  3H0G A;  3Q8Q B;  1JVM A;  4OX9 B;  4DV3 H;  4O2B A;  4FLZ A;  4O3S A;  2X6A A;  2UUA H;  2R6F A;  2NUA B;  4E4E A;  3Q8R B;  5C8Y F;  1CKN A;  2ASD A;  3GTL A;  4W4K A;  2R85 A;  3PW2 A;  1KYO F;  4BW9 A;  4D7S A;  5EZY B;  4P30 A;  3V6K A;  4ABM A;  1A32 A;  1F7Y A;  4YP3 A;  5LHI A;  3TEK A;  4Z1M G;  4DR1 H;  4O7L A;  3ABK C;  3G8D A;  2MW2 B;  1BT8 A;  1NZ6 A;  3HKE A;  1UFI A;  2Q8V A;  2OT5 A;  3RYC B;  3J80 W;  5DG7 A;  2Q5Z A;  1K9M W;  2ODT X;  4X1K A;  1BGY H;  2GV9 A;  1RYS A;  2ZQM A;  5CMU A;  4JYA O;  4B3R O;  3L9D A;  1F4M A;  1N0J A;  2EBO A;  3ICX A;  2HGW A;  3WB0 A;  3RGZ A;  3FDS A;  1BL8 A;  4IHJ F;  5DG8 A;  2VRZ A;  3UCS C;  1EZV H;  1TWA A;  1Y1V G;  4LFB H;  1XMQ B;  1RFY A;  4TV9 A;  4AQY B;  4APM A;  3GWO A;  4GC7 A;  2LW1 A;  4JTD B;  4DL2 A;  1GSA A;  4MV9 A;  2RDJ A;  1PPJ H;  5C4X G;  2C2D A;  2EIY A;  2VA2 A;  5KFK A;  3HKB A;  2OWO A;  2C35 B;  3TET A;  3PVX A;  3K5N A;  2B9Z A;  5BMV B;  5CB4 B;  5LMU O;  3DC5 A;  1XL4 A;  2L6L A;  3W1B A;  3RAX A;  4RNN A;  4KHP B;  5FPR A;  4ED3 A;  2VR1 A;  1L0N H;  1YVW A;  2J6U A;  1Y1W G;  4C2M A;  4MW3 A;  3KG2 A;  4IWY A;  4C7U A;  5KAI Z;  1Q6H A;  4NYE A;  4J9M A;  1OBD A;  3J7A U;  1M9N A;  3QQM A;  1H2L A;  4JYA H;  4B3R H;  2W57 A;  5LA6 B;  3ASN B;  5KA5 A;  1BGW A;  1SET A;  2PI4 A;  3AX6 A;  3PW0 A;  3U11 A;  4J42 A;  3OTO B;  4ECR A;  5IJ0 B;  2DYR B;  1V54 C;  2P6J A;  4QE7 A;  4JI6 O;  1PP9 H;  3FFQ A;  2ZE6 A;  1W59 A;  1VQP V;  2XAQ A;  4TQR A;  5EWF A;  4NXN O;  1QCE A;  2ADP A;  2R9A A;  3SJA C;  1NKD A;  1L2Z A;  1SQP H;  4X9Q A;  2PBZ A;  1JPX A;  3ZN1 A;  2W6P A;  2OH2 A;  2X7R B;  3CS5 A;  5FJ8 G;  3ZMU A;  2DOS A;  1N34 O;  2QYZ A;  1TA8 A;  3JAL B;  3W7X A;  4K0K O;  1H2M A;  4JI4 B;  3KAJ A;  5I60 A;  5B3S C;  3PO3 G;  1R6K A;  5KFR A;  4Z1V A;  2HG5 C;  2YRW A;  2R7K A;  3W5O A;  3PFF A;  1KU9 A;  3JAR A;  5LMU H;  3K04 A;  4RUC A;  4MV7 A;  3CX5 F;  1I50 A;  3SPJ A;  3RVZ A;  4GKJ B;  4HBN A;  1PL4 A;  4IAJ A;  2QM4 A;  3LNN A;  3D8C A;  5JH7 F;  1N48 A;  4O3Q A;  1EN4 A;  1AR5 A;  2OTJ V;  1BCC H;  1QNM A;  2CH7 B;  4I0X A;  4B3S O;  2PMZ A;  4MW8 A;  3CEB A;  1JIH A;  3N27 A;  5KX5 A;  2N05 A;  5HBR B;  2OIG A;  3GTP A;  2WLH A;  4X65 O;  1IVS A;  3G6Y A;  3ZHT A;  4JI6 H;  3GIQ A;  3Q4H A;  2HEP A;  3LSS A;  2YI9 A;  2EX3 A;  3RB6 A;  5T14 A;  5L3E A;  1N0N A;  4D6T H;  4NXN H;  4YIP A;  2A3Q A;  3JSN A;  4ZOL A;  1QU7 A;  1VP7 A;  2NU9 B;  5BR8 B;  1CEZ A;  3ZCC A;  4TV8 A;  2QTS A;  2MK3 A;  4CS4 A;  5D1P A;  4FFL A;  2PI5 A;  5IYD O;  3RB0 A;  3CJH A;  3SGI A;  3ZN0 A;  1GSH A;  3MWD A;  1E79 G;  3G80 A;  4C5B A;  3QZ7 A;  5IYC G;  4K0K H;  2EJR A;  2D3O W;  1N36 B;  2DPJ A;  4DL3 A;  2BQR A;  4MV4 A;  3HR0 A;  4O2A A;  3UT5 A;  5BWW A;  4NZN A;  3NBZ B;  4FFO A;  4J9R A;  5IY5 C;  5J2U F;  2LW7 A;  3CRR A;  3GIL A;  2YZN A;  2B1G A;  2BE3 A;  1Y14 B;  5C44 G;  1WP7 A;  2OCH A;  1EUC B;  4A3J G;  2EIM C;  4R7R A;  1AIL A;  4B3S H;  4MA5 A;  3K58 A;  2J9G A;  4ZI7 A;  1OJH A;  2EUL A;  2NU6 B;  4DR4 B;  4X65 H;  1EFR G;  3CB2 A;  1GO3 E;  5H80 A;  1BQ0 A;  3U10 A;  3W7S A;  4YQW A;  1N33 O;  5F9N A;  5LP6 F;  4JPR A;  1EKV A;  1Z2G A;  1P16 A;  2B63 G;  1F4N A;  2IP4 A;  1L0L H;  2FTK A;  1I7N A;  5I5T A;  2XAS A;  2N74 A;  5FNV B;  3OMA B;  3ETD A;  2CW8 A;  4Q45 A;  4MV6 A;  5J9P C;  3BQ0 A;  2WLI B;  2YS7 A;  3MR6 A;  3OD4 A;  1Y76 B;  1FJG O;  1Q86 W;  4FFB B;  4Q0Y A;  3OSP A;  4O4I F;  4X8A A;  1QLE C;  3RYC A;  4E2L A;  4EB6 B;  2G38 A;  5IYZ F;  4DXW A;  4LF5 O;  4A2A A;  2LP7 A;  4O84 A;  4CKE A;  4DV4 O;  3B8N A;  1IYD A;  4J9P A;  3THO A;  4IYI A;  4LF4 B;  1S0V A;  5EOY A;  1W93 A;  5FLM G;  2B63 A;  3SYO A;  3W7W A;  3CCR V;  3ZMS A;  1B6Q A;  5BPF A;  5DLG A;  3PR4 A;  2COG A;  1SRY A;  4O4H B;  1MZF A;  2UU9 B;  4H33 A;  4G3I A;  4CC6 A;  4FLU A;  5LGN A;  2J6S A;  4I55 F;  3JD3 A;  3TIN A;  2X0L A;  3I56 V;  2BSK B;  3JD4 A;  2R8G A;  1N33 H;  4A2B A;  2UUC O;  3RGB A;  2EIK C;  5B1B B;  3T54 A;  3TCU A;  1E4F T;  4LSX A;  5BWX A;  5BMV A;  5CB4 A;  1IX9 A;  4B3T O;  4A3K G;  5IJ9 B;  4M7E A;  5EC2 C;  3K5I A;  1SQX H;  2ITC C;  4MTG A;  5K1P A;  3H1J H;  4JAU A;  4XBF A;  1NH2 B;  3UFX B;  3CRM A;  2VQF B;  1FJG H;  1PNL A;  2W6O A;  3F5W C;  4DLK A;  3WG7 B;  2DLN A;  1BHA A;  3UO2 A;  2PY5 A;  1QR9 A;  4LF5 H;  4NXM B;  5H6R A;  2CTP A;  5LA6 A;  2LFS A;  2HVK C;  4DV4 H;  1JJO A;  2PMZ E;  5IJ0 A;  1WSC A;  2XC9 A;  4ED8 A;  4QGP A;  4O4L F;  4WBN B;  5CBF A;  5KHI A;  5LMN O;  4DYL A;  2YID A;  1GLV A;  3OUF A;  2ZM6 O;  1R3K C;  3AEI A;  4YIO A;  2OYQ A;  4HN2 A;  4FLT A;  5L1I A;  2IMW P;  4O83 A;  1JDB B;  4XYM B;  5H9C A;  2RGV A;  1KJI A;  3CQZ A;  5DMX A;  1THZ A;  3JAL A;  1G1X B;  5KAF Z;  4LSA A;  3V6H A;  3AK3 A;  1GN6 A;  4J9Q A;  2UUC H;  2A79 B;  5ITZ B;  4L8J A;  2HGX A;  1ORQ C;  4ASU G;  4B3T H;  2ZKO A;  5KT4 A;  4UB6 Z;  1WLE A;  4ZHQ F;  1EYZ A;  1K97 A;  3WWI A;  5KFQ A;  4MT8 A;  3P30 A;  1NVP B;  5KG7 A;  4LF9 B;  4DV5 O;  2QE7 G;  3JYC A;  3GV8 B;  3BQ2 A;  1I2K A;  2CH7 A;  4FU0 A;  1M1K W;  4IRC A;  1RPO A;  2CW7 A;  2UVV A;  3L70 H;  1K73 W;  5JQG F;  4O4J B;  5CA0 B;  2W6J G;  4GT1 A;  1Y74 B;  2Q68 A;  2JA5 A;  2ZM6 H;  1XQ8 A;  4A3D G;  1S72 V;  3TQ1 A;  2Y0P A;  2E76 B;  4F4Y A;  1MG1 A;  4A3F G;  4EYI B;  2RMK B;  3T1H H;  5J2T B;  4LR3 A;  1FPO A;  2WAM A;  2VWK A;  5KFB A;  1CP9 A;  1B33 N;  3HOU G;  1ZL8 B;  1FFX B;  3D3I A;  4LP8 A;  4HR7 A;  3STZ C;  2IU0 A;  3ZMT A;  2UUB O;  4O7R A;  5DGA A;  2HJW A;  3KHH A;  1IUR A;  4C5C A;  5LYJ F;  2W70 A;  1KP2 A;  3E35 A;  3KCY A;  2DYR C;  4W4L A;  5FD6 A;  2DPI A;  2JGD B;  3LSQ A;  4NZO A;  2KSD A;  4DV5 H;  4XYL B;  4I50 F;  5KKN B;  4NYK A;  3FX7 A;  3OEH G;  4EG0 A;  4FBT A;  1O9G A;  2EIL B;  4DUY B;  2YRX A;  2WAQ A;  2YDE A;  2HKO A;  1KC8 W;  2COJ A;  3RVY A;  4U7C A;  3Q1K A;  2YC0 A;  4KP4 A;  1YIT V;  2JEG A;  1N4C A;  1B3Q A;  2E74 B;  1NH2 D;  2HVR A;  4ECU A;  1XIL A;  3BHP A;  3H01 A;  4WFG A;  2BCC H;  3GIJ A;  2X6C A;  1IBM B;  2FYU H;  5FNV A;  3TW6 A;  1P8L A;  1WAZ A;  4NTY A;  5F2V O;  3R5X A;  4BY1 G;  2UXC B;  2I8C A;  4YY3 B;  1Y76 A;  2UUB H;  4FFB A;  3VOU A;  5K1X A;  1WJZ A;  2IJI A;  4DV6 O;  3S3X A;  4RAY A;  3T1Y B;  1K4D C;  4EB6 A;  2HHH O;  4K35 A;  3L4J A;  3SJB C;  3BAA A;  3BY6 A;  1JFF B;  1T5E A;  2ATK C;  4YHH O;  2AQ4 A;  3GTQ A;  5KLV H;  2QGN A;  1KKC A;  4FPP A;  4O4H A;  1NJI W;  4A3G G;  5IT9 W;  1IBL B;  4FK5 C;  1R73 A;  3N43 B;  2EZO A;  5DN6 G;  2XHB A;  1BHB A;  3BAC A;  4UCV A;  3LSU A;  5FD5 A;  2BSK A;  2OIE A;  3R5F A;  3NR7 A;  3ZRS A;  2DQ3 A;  4LH6 A;  2YZM A;  2CTW A;  1H2N A;  4DR6 O;  4HNA B;  2ETN A;  5DGI A;  2FK3 A;  5IJ9 A;  1N32 O;  3AK1 A;  1NS1 A;  5EK0 A;  2EIJ B;  4JV5 O;  1U97 A;  1M7J A;  4NZM A;  5DG9 A;  5KFC A;  2WA4 A;  1XEQ A;  4O7T A;  4ECV A;  3DXR A;  3OAA G;  4DV6 H;  4Q4C A;  4H0L B;  5CA3 A;  1NTM H;  2HHH H;  2VQE B;  2CFM A;  4PA6 A;  1HWY A;  1QR8 A;  4G27 B;  3F5T A;  4CH3 A;  2CGN A;  4WBN A;  1J5E B;  4YHH H;  5KHK A;  4J7Z A;  1RM1 B;  5KUK A;  2FPG B;  1VQ7 V;  5KG5 A;  1JJ2 U;  2D2C B;  1VIB A;  4MTX A;  4Y8V B;  1V4Y A;  1WH2 A;  1AJQ A;  2WWW A;  5KFH A;  4JI5 B;  4FMT A;  2YCH A;  2ALZ A;  1RK5 A;  4R8U B;  4J41 A;  2ZE5 A;  5ITZ A;  1F23 A;  4DR6 H;  2AHZ A;  2QWN B;  3B2E E;  1N32 H;  1XMQ O;  1SF9 A;  2FLL A;  4EEQ A;  4IGG A;  4JV5 H;  4FLX A;  4LF7 B;  3JAK B;  4I5S A;  1TVK B;  2YYA A;  3K3V A;  1ZET A;  5JVD B;  2JA7 A;  2H3O A;  2KQX A;  4DR7 B;  4Q4D A;  4RU9 A;  5GTH Z;  4B3M B;  4X20 B;  3E8G A;  2JDI G;  4O3R A;  1D5N A;  4O4J A;  2M7W A;  4NLG A;  4DV2 O;  4PDR A;  5CA0 A;  2VPS A;  2WAQ E;  1Q90 D;  4KHP O;  5FR9 A;  3IGA C;  1Y74 A;  1LNQ A;  4GUN A;  4UB8 Z;  5B1B C;  2F4V B;  3H3V H;  4DV0 O;  4NR1 A;  3OHA A;  4CMF A;  3BFR A;  1FKA O;  1Q5O A;  5J2T A;  4JI3 B;  5JVL A;  3WG7 C;  1ZL8 A;  1YEW A;  3W7U A;  3CC2 V;  1I2L A;  4J7J A;  1MZB A;  5GON B;  1P84 F;  4K8Z A;  3R5H A;  2I80 A;  3U0G A;  2NR5 A;  2CE4 A;  3VMM A;  2IJJ A;  1XMQ H;  2R72 A;  1OCO B;  5JJN B;  2FKL A;  2RQ6 A;  4ICG A;  3RR5 A;  2JGD A;  1XHZ A;  3HOV G;  3BAB A;  2W0X A;  1MZE A;  4JAA A;  4HAM A;  2COI A;  1ZUQ A;  1PNK A;  2W6Z A;  1JDE A;  4WD3 A;  1DV2 A;  3QO5 A;  1UPG A;  3ORR A;  3HKZ A;  1BQZ A;  3ETH A;  3KHG A;  2GBO A;  4EEY A;  2W8K A;  3JAM N;  4IIJ F;  4ZOL F;  2R8J A;  3RV4 A;  4FM0 A;  4DV2 H;  4WFE A;  1Z2P X;  4KHP H;  3EVK A;  1YJW V;  3GTM A;  1VF6 A;  4DV0 H;  2XAG A;  5A9G A;  1CXZ B;  4DR5 B;  4JUZ A;  1NR7 A;  3WU2 Z;  2HLD G;  2ZR3 A;  1FKA H;  4U6P A;  3QTC A;  4O2A F;  2FK2 A;  2B5U A;  3E22 B;  1BXR A;  2LFR A;  1KEE A;  4GKK B;  1VAJ A;  3B77 A;  5KMG B;  5A2Q W;  3N44 B;  4YJ3 B;  3GV7 B;  3E8H A;  3K9A A;  5EBL C;  1XNR O;  5JCO A;  2L35 A;  2C2R A;  4J9N A;  3RJ0 A;  1WRV A;  5BR8 O;  3AG1 B;  5BWU A;  3MR5 A;  3SYC A;  1LUW A;  1HNW B;  1OCR B;  5BXZ A;  1JFF A;  3VPC A;  4A3C G;  2FK1 A;  1ZTE A;  2HHF B;  4YBZ B;  2EJ0 A;  2LGW A;  1N36 O;  3CXH F;  4QW8 A;  4EBE A;  3JAS B;  2QM8 A;  2JA8 G;  1R3I C;  1SQQ H;  1ET0 A;  2YZL A;  2R93 G;  2IA6 A;  1KP3 A;  1AR4 A;  3APQ A;  2BR0 A;  3HOY G;  4BIU A;  3QO7 A;  4GX2 A;  2GDS A;  2FE3 A;  5KG2 A;  2XD4 A;  4HNA A;  3JRX A;  4UXN A;  3NGD A;  4TUY F;  2XAH A;  4ZQI A;  3FKI G;  2JJ2 G;  1NQT A;  4XDL A;  4DR4 O;  1D2D A;  2R70 A;  3IFX A;  4FZ1 A;  1DAA A;  2IH1 C;  1XNR H;  2IJH A;  3CCQ V;  5K3W A;  1Z5V A;  1ZQ7 A;  5BR8 H;  3FD9 A;  3HO8 A;  2R8I A;  1VF6 C;  1L8D A;  1SS3 A;  4PA7 A;  3SPC A;  1F51 A;  3LDD A;  4R7C A;  2R84 A;  5IWA B;  2V5A A;  1X59 A;  2FML A;  4DO2 A;  4DW0 A;  4AYB A;  5KT7 A;  4MSW C;  1N36 H;  1DGS A;  2YIB A;  5B1A B;  3G6B A;  4JTA B;  4PEL A;  1A0G A;  5BY1 A;  4YR3 A;  1C30 A;  2HVJ C;  4Z2W A;  1JR9 A;  3FKI A;  1KKD A;  5EWG A;  3FMA A;  4JI8 B;  4JTC B;  4R8U A;  3VOT A;  3VQX A;  4EQ5 A;  5JCO C;  3CCM V;  4I4T F;  5CBH A;  1K92 A;  2IBZ H;  4LFC B;  3L74 H;  4LMY A;  3Q8P B;  3J80 N;  2EJ3 A;  5DQI A;  1EZJ A;  2QDO A;  3OW2 U;  5C8Y B;  3MWE A;  1EN5 A;  1GN3 A;  2PF4 E;  4JAS A;  5IYB O;  4DQN A;  4DR4 H;  1OCZ B;  3FYI B;  2UU9 O;  2GSM B;  3JAK A;  1TVK A;  5JVD A;  4HYK A;  3OHB A;  5LHG A;  4MVR A;  4LFA B;  1HR0 O;  1URF A;  3WB2 A;  3ABT A;  1XI1 A;  3K08 A;  4X20 A;  5KFW A;  1RSO B;  3HKZ E;  1Y1V A;  3RGX A;  4ECS A;  5IE9 A;  3TXS A;  3ZIA G;  2XIG A;  4QNH B;  5KFA A;  4QE9 A;  4MVZ A;  3KAL A;  3MFH A;  2ZJT A;  4IHJ B;  2FLP A;  4F4X A;  4MV1 A;  2WSS G;  2PYJ A;  4X66 B;  2EIJ C;  4NXM O;  2W9C B;  2EJ7 A;  4LF6 B;  2CQY A;  5KFD A;  1AVM A;  2UVU A;  1MSD A;  5D1O B;  2WA3 A;  5GON A;  2VS0 A;  2CTR A;  1EZ1 A;  4DL4 A;  3TK1 A;  4QW9 A;  1Y1W A;  2LGQ A;  4JZ2 A;  1N34 H;  2WLM A;  4BIO A;  2UU9 H;  3J81 W;  4P9P A;  2YS6 A;  5EIB C;  1M6V A;  4HNV A;  4R8C A;  4PJ0 Z;  1K5Q A;  1RM1 C;  1HR0 H;  4JV1 A;  4FFP A;  3L71 H;  4U7O A;  4QJF B;  2VQD A;  4ECQ A;  3QG5 A;  4GLW A;  2ASL A;  4YJ2 B;  2QSA A;  4EKW A;  5KG6 A;  3LWB A;  3G6E V;  1JOY A;  3R66 A;  3X2Q B;  4DRX B;  3T9E A;  4LF9 O;  2FL4 A;  2ZDG A;  5BPH A;  1A3G A;  4FVM A;  2R86 A;  2K9P A;  4HNT A;  4DR2 O;  2DJV A;  3PN1 A;  3D36 A;  2Y0I A;  3E22 A;  4NXM H;  5I5Y A;  2Z0A A;  2JGU A;  3KHL A;  2AGP A;  3LNM B;  2ITD C;  5KMG A;  3OR6 C;  4I7Z B;  4HNU A;  3GID A; 
#chains in the Genus database with same CATH homology
 4B3T H;  3A2F A;  1ZHQ A;  3GDE A;  4I55 A;  2PYL A;  4CH6 A;  3HKD B;  3HKE B;  2PUS A;  4LF9 B;  4DV7 H;  4X62 H;  4DR6 B;  3SR2 C;  3T1H B;  2P22 C;  4X1K B;  3N2K A;  3RYF B;  1N32 B;  3F8N A;  1H2S B;  4DR1 B;  2CW7 A;  1XMO B;  4JV5 B;  1SYX B;  4O4J B;  3K5O A;  5CA0 B;  1ZAU A;  2Q7G A;  3VNN A;  3U0Z A;  2ZM6 H;  1XQ8 A;  1FVI A;  4MTD A;  4TV9 B;  1O75 A;  2ZIN A;  4LF9 H;  3K59 A;  4LH7 A;  3TY5 A;  4EFE A;  3M4I A;  4CH5 A;  1HNX B;  4DR2 H;  3T1H H;  5J2T B;  4LR3 A;  4DUZ B;  5LP6 C;  2VWK A;  2JS5 A;  1TUB B;  3HKB B;  2CAZ C;  1FFX B;  3IAY A;  4LFB B;  5EZY A;  1XDN A;  3TY8 A;  3JAW B;  4LNU B;  2HIX A;  4JI7 B;  1I94 B;  4TUY B;  4DK1 A;  3RYH B;  5FD6 A;  1HNX H;  4MTE A;  3ZED A;  4DV5 H;  4ETS A;  4LF8 H;  4UCU A;  3BA8 A;  5J2U B;  3IG0 A;  1O9G A;  4DUY B;  4AIL C;  4JI2 B;  1SEI A;  2Q7E A;  4LFC H;  3K5L A;  2PGG A;  3H20 A;  2F66 C;  4CC5 A;  4JI7 H;  1I94 H;  3JAT B;  1S68 A;  2UXD B;  3JSL A;  3GB8 B;  2WDT A;  4JYA B;  1XNQ B;  3HKC A;  4D7T A;  5JQG A;  3JAM W;  2HVR A;  2WE6 A;  3BHP A;  4UCR A;  4RB2 C;  1IBM B;  4KL1 A;  5FNV A;  4DUY H;  4DV2 B;  5C8Y A;  1P8L A;  3J7A K;  3CSX A;  4FM1 A;  3N6X A;  2UXC B;  4DV0 B;  3N41 B;  1IBK H;  4I4T B;  4YY3 B;  1HNZ B;  4PZ7 A;  2UUB H;  4FFB A;  4X1I B;  5K1X A;  2HVS A;  4LF4 H;  3JAR B;  2UXD H;  4RAY A;  1QQC A;  3T1Y B;  4EB6 A;  1XNQ H;  4U3J A;  3L4J A;  2IM9 A;  5JJJ B;  1M0T A;  3SJB C;  3BPZ A;  4O4I B;  1SQG A;  1RSO A;  3BAA A;  1JFF B;  1VS0 A;  1T5E A;  2RGR A;  5LYJ A;  5IYZ B;  2PTM A;  2UXB B;  3N40 P;  4CS3 A;  1D5A A;  1HNZ H;  4YY3 H;  2BTQ B;  5KX5 B;  4DRF A;  2Q7H A;  3NBY B;  5CA1 A;  4O4H A;  1E4G T;  5IT9 W;  1IBL B;  2QJ1 A;  5DIS C;  4IHJ A;  3S24 A;  4E6N A;  3N43 B;  3T1Y H;  4PI2 A;  4DV6 B;  2XHB A;  4UCV A;  5FD5 A;  2VQF H;  1VF7 A;  1M5I A;  4ZOL B;  1M0W A;  5D1O A;  4TV8 B;  4LH6 A;  5LOV A;  4HNA B;  2UXB H;  4JI6 B;  5IJ9 A;  5EIB D;  4JI1 B;  1TAE A;  2MCT A;  1CKO A;  4X64 B;  2YIB D;  4DK0 A;  5D5P A;  1WPB A;  2E5L B;  1HW7 A;  5LXT A;  3UT5 B;  4O2A B;  4DV6 H;  4DV3 B;  2YIA A;  3ETQ A;  2HHH H;  2UUA B;  1KMI Z;  3GJX B;  3RFR A;  2VQE B;  2CFM A;  3VQW A;  4CH3 A;  4YJ2 A;  4WBN A;  4PI0 A;  1J5E B;  2YXL A;  4YHH H;  5KHK A;  3N42 B;  2BTO A;  4J0M A;  1XNR B;  3N2G B;  4DRX A;  4ZI7 B;  3QWU A;  3MWM A;  1P49 A;  3MAQ A;  3JAS A;  2E5L H;  4IIJ A;  2PZS A;  5JH7 B;  3RWR D;  4OX9 B;  2Q0A A;  4O2B A;  4O4L B;  4FLZ A;  4DV3 H;  1SA0 A;  1WH2 A;  1GYF A;  2UUA H;  4JI5 B;  2VQE H;  2YCH A;  1CKN A;  3W1G A;  4BW9 A;  4D7S A;  5EZY B;  5ITZ A;  2HIV A;  2E3C A;  4DR6 H;  4X65 B;  4CS2 A;  3B2E E;  4B08 A;  4I9Q A;  1N32 H;  1XHX A;  4X1Y B;  3L4K A;  4DR1 H;  4EEQ A;  3RIZ A;  3VQY A;  3LML A;  1XMO H;  3HKD A;  4JV5 H;  3RYI B;  4FLX A;  4LF7 B;  3JAK B;  3HKE A;  1TVK B;  3K3V A;  3M7M X;  3ZS8 C;  5JVD B;  1Q3E A;  4DR7 B;  1XK5 A;  3RYC B;  3J80 W;  4JI5 H;  4X1K A;  2GV9 A;  4ZHQ B;  4B3M B;  3EYY A;  3RYF A;  4X20 B;  3ICX A;  4DUZ H;  3WB0 A;  4O4J A;  3RGZ A;  5CA0 A;  2VPS A;  2F4V B;  1M93 A;  4LFB H;  1XMQ B;  4TV9 A;  4AQY B;  5JQG B;  4APM A;  4DR7 H;  1Q5O A;  4PZ8 A;  1WN7 A;  5J2T A;  4B3M H;  3OTF A;  4UCO A;  4MV9 A;  4RB3 C;  1SKV A;  4JI3 B;  1I6U A;  5EYP B;  4F6R B;  1BJT A;  1TUB A;  3HKB A;  2OWO A;  4B3R B;  1ZHS A;  1YEW A;  2WYO A;  3K5N A;  1MZB A;  1S03 G;  5GON B;  3K5M A;  2HGS A;  3JAW A;  4LNU A;  5BMV B;  5CB4 B;  4K8Z A;  3KYH C;  4TUY A;  3W1B A;  1XMQ H;  2R72 A;  2ZNI A;  4JI2 H;  5JJN B;  4KHP B;  2RQ6 A;  5FPR A;  3RR5 A;  4K8X A;  2F1M A;  3RYH A;  5LP6 B;  2ZCE A;  1XHZ A;  3BAB A;  4PDB A;  4JI3 H;  4DV1 B;  3QF7 A;  3UQ8 A;  1B04 A;  5J2U A;  2O03 A;  4JYA H;  4B3R H;  2W57 A;  5LA6 B;  1BGW A;  1X9N A;  3U11 A;  3OTO B;  3KXY T;  4I50 B;  5IJ0 B;  1FJG B;  1IBM H;  4FM0 A;  4DV2 H;  3JAT A;  1Z2P X;  4KHP H;  3FFQ A;  5LMU B;  2UXC H;  4DV0 H;  1HR0 B;  4DR5 B;  2R9A A;  3CHX A;  3SJA C;  3HXL A;  1L2Z A;  2KKW A;  1FKA H;  4DV1 H;  4DV4 B;  3QTC A;  3E22 B;  2RJZ A;  1TA8 A;  3JAL B;  2P5O A;  3BA9 A;  3KAJ A;  4JI4 B;  4GKK B;  1Z2N X;  5KMG B;  4I4T A;  3N44 B;  5A2Q W;  4YJ3 B;  3W5O A;  4X1I A;  1KU9 A;  3JAR A;  5LMU H;  4MV7 A;  4I55 B;  5JCO A;  1V9P A;  3VQV A;  3RTX A;  3RJ0 A;  4GKJ B;  4HBN A;  4IAJ A;  2QM4 A;  3LNN A;  4NXN B;  1IBL H;  4AHC A;  4O4I A;  1HNW B;  1AN7 A;  1Q8I A;  4RZQ A;  1JFF A;  3N2K B;  4B3T B;  5IYZ A;  2VUG A;  1N34 B;  3JAS B;  4K0K B;  2BTQ A;  5KX5 A;  3CVZ A;  4JI6 H;  2HEP A;  4JI1 H;  2ZNJ A;  2YI8 A;  2YI9 A;  2EX3 A;  2ZIO A;  2HVQ A;  4X64 H;  4NXN H;  3RF2 A;  3JSN A;  1SQF A;  4ZOL A;  3KAK A;  1HNW H;  2FE3 A;  3BRC A;  4TQD A;  5BR8 B;  4TV8 A;  4BWA A;  4CS4 A;  5D1P A;  4HNA A;  1N34 H;  3SGI A;  5LMN B;  3L2P A;  4K0K H;  4UFZ A;  4B3S B;  2ZM6 B;  3C0F B;  1N36 B;  2R70 A;  4GYC B;  5LL6 b;  1J5E H;  1S5J A;  3UT5 A;  4O2A A;  2JVD A;  4DR2 B;  3NBZ B;  4I7H A;  1XNR H;  2F95 B;  1Z5V A;  2VWJ A;  4FLW A;  5BR8 H;  4FM9 A;  4OX9 H;  4BWS C;  1L8D A;  5LMN H;  4R7R A;  4B3S H;  5IWA B;  3K58 A;  1N36 H;  4UCT A;  3N2G A;  4ZI7 A;  1DGS A;  2YIB A;  4PHZ A;  1I7F A;  1CKM A;  5JH7 A;  4DR4 B;  4X65 H;  5FPO A;  3CB2 A;  4EFB A;  4O4L A;  4DV5 B;  4LF8 B;  3FMA A;  3U10 A;  4JI8 B;  4LF7 H;  5JJE B;  3HKC B;  3VQX A;  4NVP A;  4EQ5 A;  5JCO C;  1P16 A;  4PZ6 A;  4LFC B;  4LMY A;  4FM2 A;  5IWA H;  5FNV B;  3DSQ A;  2CW8 A;  5C8Y B;  1WNS A;  1Z5W A;  4X1Y A;  4DR4 H;  1FFX A;  3RYI A;  4CH4 A;  4FFB B;  3JAK A;  4Q0Y A;  1TVK A;  5JVD A;  5KHG A;  3RYC A;  2F4V H;  4LFA B;  2ZIM A;  3WB1 A;  4JI8 H;  4EB6 B;  4ZHQ A;  4AQY H;  4U3J B;  4A2A A;  3WB2 A;  2VOB A;  1TGO A;  1G6U A;  1XI1 A;  3DF7 A;  4X20 A;  1N33 B;  1IBK B;  3THO A;  1JMK C;  2UUB B;  3RGX A;  1NT2 B;  4LF4 B;  5LYJ B;  5EOY A;  2XIG A;  4TQF A;  4GLX A;  5CA1 B;  4O4H B;  2UU9 B;  3KAL A;  4LFA H;  5FLX W;  1Z2O X;  4IHJ B;  2ZJT A;  4CC6 A;  2V4D A;  4FLU A;  2PYJ A;  1QHT A;  4X66 B;  4FLY A;  1O9H A;  5EYP A;  4F6R A;  5D5Q A;  4TOI A;  1N33 H;  4LF6 B;  1Q43 A;  4LF5 B;  4A2B A;  5D1O B;  3RGB A;  5LOV B;  4RAZ A;  1E4F T;  5GON A;  4LSX A;  1A0I A;  5BMV A;  5CB4 A;  5IJ9 B;  4DR3 B;  4M7E A;  4ZIB A;  5K1P A;  3OTO H;  2UU9 H;  5KHH A;  3J81 W;  5LP6 A;  2VQF B;  1FJG H;  5EIB C;  2Q2T A;  5LXT B;  4X66 H;  1HR0 H;  4UCS A;  2PY5 A;  4DR5 H;  4LF6 H;  4LF5 H;  2Q2U A;  4NXM B;  5KHJ A;  5LA6 A;  3SJC C;  3QG5 A;  1M4U A;  4DV4 H;  1JJO A;  2UUC B;  4FLV A;  4I50 A;  5IJ0 A;  4DR3 H;  3NC0 B;  4YJ2 B;  4WBN B;  5KHI A;  4JI0 B;  4JI4 H;  4GKK H;  2OYQ A;  2KSW A;  4RB0 A;  4DRX B;  4FLT A;  2HHH B;  4IIJ B;  4FVM A;  4O2B B;  1SA0 B;  3PN1 A;  2RGV A;  4Q6G A;  4DV7 B;  2F93 B;  3E22 A;  4NXM H;  4GKJ H;  4RB1 A;  4X62 B;  4YJ3 A;  2JGU A;  4YHH B;  3JAL A;  1CKN B;  3TY9 A;  4LSA A;  1X4T A;  3K57 A;  2UUC H;  5ITZ B;  5KMG A;  4JI0 H;  4L8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...