3JSNA

Crystal structure of the adenylation domain of nad+-dependent dna ligase from staphylococcus aureus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
306
structure length
297
Chain Sequence
DLSSRVNELHDLLNQYSYEYYSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the adenylation domain of NAD(+)-dependent DNA ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA ligase
total genus 106
structure length 297
sequence length 306
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jsnA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3jsnA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jsnA02
4AQYB 1FJGB 2F4VB 2CFMA 5FPOA 4GLXA 1FVIA 4LF4B 4E6NA 2VQEB 2VQFB 1XDNA 1TAEA 3NC0B 4EEQA 3VNNA 4DR5B 1ZAUA 4OX9B 4KHPB 2UXDB 3RTXA 4UCOA 2VUGA 1V9PA 1XNQB 1S68A 5D1OA 4LH7A 4NXMB 3GDEA 4LFCB 2UUCB 1N33B 3GJXB 4JYAB 4B3TB 4DR1B 1N34B 2E5LB 2HIVA 4JV5B 3L2PA 1XMQB 4PZ7A 4LF9B 4DRFA 4DV1B 3GB8B 4DR7B 4TOIA 1CKNB 4YHHB 5FPRA 4GKKB 4X64B 4JI5B 3QWUA 1IBMB 3OTOB 1N36B 4B3RB 1I94B 4JI7B 4LFAB 3PN1A 4LFBB 5D1OB 3UQ8A 4DV5B 4DV3B 4JI1B 1J5EB 1XK5A 4DUZB 1HR0B 4YY3B 3BAAA 4EQ5A 4B3SB 1P16A 4PZ8A 1IBLB 4JI6B 4GKJB 3TY8A 4DV7B 1XMOB 2Q2TA 4JI4B 1DGSA 1IBKB 3T1YB 3BA8A 4DUYB 2HVRA 4LH6A 5LMUB 4X62B 4DR2B 4X65B 2HHHB 4JI8B 4DR4B 1HNZB 4PZ6A 4DV0B 4DV4B 4LF7B 5LMNB 4NXNB 4JI3B 3RR5A 5IWAB 4EFBA 5BR8B 1HNXB 4JI2B 1CKOA 1TA8A 4CC5A 4CC6A 4UCRA 1A0IA 2OWOA 1HNWB 1VS0A 3BABA 2ZM6B 3T1HB 1B04A 1CKNA 4X66B 2HVSA 4DR3B 3W1BA 4UCSA 2UXCB 4UFZA 3KYHC 2HVQA 1P8LA 3NBZB 4DV6B 3BA9A 4DV2B 3NBYB 5DISC 3W1GA 4LF5B 2UUBB 2UUAB 4UCTA 4K0KB 2Q2UA 1XNRB 3W5OA 1CKMA 5D1PA 3TY5A 4JI0B 3JSNA 3S24A 2HIXA 4B3MB 1X9NA 4DR6B 3TY9A 4EFEA 4LF8B 2UXBB 3SGIA 1N32B 3JSLA 4UCVA 4UCUA 2UU9B 4LF6B
chains in the Genus database with same CATH superfamily
2JRIA 1FXKC 1W59A 1K9MW 2RCVA 1D5AA 2YZLA 1YITV 1XI1A 2ZDIA 4HYOA 3X2QC 5CMUA 3GILA 4ED7A 4J9LA 1F51A 5KT3A 2FP4B 1JKJB 4LFCB 3N2GA 2R6FA 2W6JG 1SZXA 4U3FH 4JYAB 4YJ3A 3QO7A 2K1EA 4JGSA 2RDIA 1L1FA 4J80A 1K8AW 3WWHA 1VBHA 5EWGA 4TV9B 3OEHG 1AUXA 4DV1B 3BJYA 4CHIA 2HP8A 4EG0A 1N32H 2LFSA 4LFBO 4JTCB 1VIBA 1DIKA 3I12A 1AP5A 4MVMA 2IJHA 4JV1A 4ECRA 4O4JA 2Z04A 1V4YA 4NTYA 4JI5B 2N74A 3T9EA 1IBMB 3K9AA 3OD4A 3F8NA 1FFTB 4FFBB 2FJZA 4DLKA 4A3MG 4DR1O 2W6IG 5DG9A 1AR4A 1FFXB 1IBLH 4YP3A 4GX2A 4BIZA 2BTQB 5EBMC 4Q45A 4GC7A 5LBQA 1UFIA 4FFNA 4YR2A 2UVUA 2ODTX 1K73W 2H94A 3K5LA 2EIYA 2V4QA 1K34A 3JAKA 1TGOA 1DGSA 5BR8O 5KG1A 4YR3A 3H1JH 3CC2V 3WO0A 1ROPA 4A3IG 4DR4B 1FPOA 4JI8O 5KG7A 2UXXA 5DLFA 1N33O 5CA1F 2JA6A 5J2UB 1AB3A 1CKOA 4L87A 4CC6A 3J80N 3AYHB 3KKYA 1XREA 3MD0A 2OWOA 4ABMA 4I7ZB 5GONA 3GTGA 3VPBA 1KUTA 4YBZB 2QJ1A 2ITCC 4F6EA 4F50A 4WBNB 2DYRB 4O2AB 1CS0A 1Y1WA 3K5IA 5I47A 2WLJA 4H0LB 2PMZE 3KHGA 2OYQA 3NBZB 2E74B 2GDSA 1PPJH 2ALZA 4JTAB 3L71H 4M7EA 4EYIB 2C22A 1XBLA 4O3QA 4BWSC 2BSKA 3CRQA 2YRWA 3C0FB 3W7XA 5KFTA 3CC7V 5H5NA 5LL6b 5KFPA 1X9NA 4FM0A 2E2IA 2QGNA 3U9SA 4EGQA 4EBDA 1ZX3A 3JSLA 3ABKC 1KC8W 1K5SA 1Q43A 3ZMVA 2IMWP 1SQFA 1IVSA 4JI3O 4LF8H 2QTOA 1C3OA 1IDSA 4JAVA 1RPRA 5EZYF 2DYSB 1N32O 1CXZB 4P9PA 1VQ5V 2CH7A 3GV5B 4UVAA 1YJNV 1EBOA 1KMIZ 3VQXA 1Q82W 2FPPB 4B3TB 1AVMA 5FNVA 3AG2B 3N44B 3K5OA 2JEXA 1XMQB 2WLNA 4PZ7A 4DRFA 5LXTA 1ZHQA 1RSOA 5E1AC 3THOA 1GN2A 4DR7B 2P90A 4D7TA 5KFIA 4LSAA 4FBTA 2PUSA 3APQA 3T1YH 1AILA 2OIGA 1AI4A 4C5CA 4X88A 1IOWA 5HFLA 3ZBHA 5FLXN 1BQZA 3JATA 2R8JA 1V55B 5L3FA 3K5HA 4LFAB 4YAJB 4O3PA 2XAJA 5D1OB 5I5TA 5KG5A 2GPSA 3FKIG 1XK5A 4BBRG 2GLTA 5IYZB 1HDJA 3DTGA 5KFWA 2OTJV 2YEVB 5LP6F 4PI0A 3QVNA 4BY7G 2HVJC 2XGPA 4IWXA 4TV8A 5EWEA 4NZOA 1ZHSA 4Q8FA 2QWRB 2HJFC 1I0HA 3ZJZA 2OCHA 4RB2C 4DR4O 5KHGA 4LF9O 1VQPV 2C2AA 1K7DA 2DW4A 3OTFA 5C44G 1SYXB 3KHRA 1WNSA 1L2ZA 5BXZA 4AI8A 3RGBA 2XCPA 3M8AA 1K92A 2RNBA 4TUYB 1N0JA 1G4YB 1H2SB 2Q7GA 5IYBG 1EYZA 2VQEO 2V59A 1SA0B 2HVQA 4JI4H 4I55F 2XIGA 5L3EA 1PD3A 1WA8A 1I94H 1G8MA 4DV2B 3CCEV 2XGQA 3IC7A 4IL6Z 4WBNA 5KFNA 1RM1C 1SQXH 1D5NA 3EFFK 1KC7A 2EZOA 2OCCB 3P32A 3JAWB 5D5PA 1GKFA 2L35A 4X9QA 4DUZO 1SKVA 4K0KO 3FAVB 3A0RA 3RBZA 3OFNG 3PW2A 1XNQH 4NTXA 2Y0SA 1I08A 2F4VB 1H2GA 2CFMA 4TV8B 3ZHUA 4QGPA 4XYLB 1RYSA 4ME6A 1V55C 1PP9H 4OGQB 2LW1A 2UXBO 4ZHQF 1R3IC 1VF5B 1I5YA 1Q6HA 1YSCA 1NTMH 2O57A 4CMDA 1M1KW 3ZN0A 3RAXA 2UUCB 1WN7A 4DV2H 1J5EO 1T3NA 4O7TA 5C8YF 1TUEB 2Y4TA 3HKBB 4GX0A 5T14A 3E22A 3LDDA 4CKBA 3IGAC 4BY1G 4L8JA 1R3LC 4JV5B 4ED6A 1WRVA 2V5AA 1Q90D 2R84A 1H8HG 4TUYA 4JI7O 3GTOA 4F6RA 1ZQ7A 4GKKB 2QSAA 1DV1A 2Q6AA 1URFA 3FDSA 3SPIA 2WWWA 1I94B 4FFRA 1BHAA 3OUZA 1RFYA 2BSKB 1MOFA 1MSDA 1OCOB 1QHTA 2JEJA 3GV7B 1WP8A 4ZI7F 4J9RA 3K04A 3VPDA 2AZ2A 1KJ8A 4JI6B 3I4MG 3HB3B 4U3JA 1E4GT 2KSWA 2HVRA 4DUYB 2VS0A 4Q4CA 4PWQA 4UB8Z 4DO2A 1HNZO 1S10A 3ETHA 1FYJA 1S5LZ 3H9VA 5EBLC 1GMGA 2JDIG 5EIBD 5KKNB 4X1IB 1KYOF 5LMNB 1O75A 4ASUG 4EFBA 1YJ9V 1ZL8A 4B3MH 3L74H 1TWFA 4ZBMA 4O4IF 4IHJB 2YI8A 1NS1A 3GIKA 1VQOV 1HNWB 3EVKA 4MTXA 2QB5A 3HKCB 3OR6C 3UYYA 4DUZH 1K33A 5BWXA 3JD2A 3ML0A 1M4UA 1GN4A 1UC9A 4MTOA 3JAKB 5DISC 1IYDA 4LF5B 3ABLB 2Z5UA 2J6SA 2EJ0A 4O4HB 2X6BA 4HNTA 3MDSA 1ZWIC 1VQ7V 2COIA 4U7NA 1Q3EA 3FB5C 2XAGA 3O9OA 4A3GG 4ICGA 4DV5H 1W96A 3ZRXA 4BW9A 4R7CA 2CW7A 5DG7A 2JA5A 2QKAA 3A8TA 3AG1C 5J2TA 4X65O 3OUUA 5A2QN 3HR0A 5LMNO 3G67A 1MMMA 4X1YA 4EEQA 1AP6A 5DAAA 4DR5B 2GTAA 3K0DA 3PZPA 3RYCA 5KFRA 5LP6C 3OW2U 3OM3B 4LR3A 4IIJF 3GQCA 1XNRO 3LNMB 2EINC 4PA9A 4PDLA 5KFLA 4QW9A 4TUYF 1EKFA 3GTMA 3C3TA 5J9PC 4DV6O 4FGRA 2W6PA 2PF4E 3GWKC 3N2GB 4QWAA 3TEKA 3KCXA 2KQXA 4O2AA 4LFCO 1N0NA 4FU0A 2PN1A 4MV1A 5I5WA 1P7BA 5DGIA 2YRXA 3NR7A 3MWEA 2E75B 1NKDA 1EHIA 1S03G 1HWYA 4Z1VA 2ATKC 2XOKG 3H01A 2YXLA 3U11A 1HR0H 1JXLA 4JI7B 5KFEA 4ZOLF 5BMVA 3ZRWA 3HPLC 1JDBB 4F4YA 2Z3YA 3H0GG 3ZRVA 2JS3A 3LSSA 2OTLV 1XMOH 3GTKA 3K0GA 4Q4DA 3Q1KA 5CA0B 4QJFB 3LDCA 2E5LO 4MTEA 4LFAH 5IY5C 4R50A 2WLLA 5BY1A 4QWDA 3G8DA 1MSWD 3UCSC 4B3SB 2Q4PA 1GN6A 1IBLB 1EN5A 3TY8A 1RM1B 5DG8A 4W4LA 2VQEH 1Z2PX 1M57C 2FE3A 4K6NA 1FXHA 4NXMH 1V54B 4DV0B 4ZI7A 1M9NA 1YTFD 5BMVF 4O4LA 3B8NA 4JI2B 2XUMA 3QZ8A 5CM0A 3TW7A 4YJ2B 2XD4A 1YF2A 4DL5A 1M93A 1OHHG 2V1DA 3W1BA 2FYUH 4MVZA 2VRZA 4O2AF 5KG6A 1MNGA 2BCCH 2CQYA 4IAJA 4ECQA 2VWKA 1KT8A 4UVBA 2PYJA 2P7TC 2DLNA 3N6RA 3ETEA 4I0XB 3LMLA 3BVOA 3EPIA 5JQGB 4JI8H 4J10A 2Q8VA 4K0KB 1LUVA 2BOCC 2R92G 1TVKB 4M0JA 1Y1VA 3PO3G 4O84A 1O9GA 3VMMA 3OEEG 5JH7A 4DR6B 4X8AA 3H1IH 5JVDA 3WG7B 3T4ZA 1G6UA 2WPDG 1JVMA 1B6SA 4O7ZA 1IZ3A 4Q6GA 2W70A 1IX9A 1MZBA 4RB3C 1DLBA 4DYLA 1N34O 4OX9H 4MVOA 3TETA 5JH7F 1M7JA 2ITDC 2R9AA 4DL3A 2IU3A 2P06A 3Q4HB 3CHXA 2CGNA 2WLKA 4X1KB 2B9ZA 2FK1A 3ZMUA 4XYMB 2F1MA 2RMKB 2RF4A 3N2KA 4FLYA 4IWYA 5LA6A 3NXSA 4ZKIA 2CH7B 3CCMV 1LNQA 2W0FC 5KA5A 3OHAA 3RB6A 4PA6A 5B3SB 1CQJB 2A1HA 3RN4A 2HIVA 1N36O 4LF9B 4QIWE 1K97A 3QFFA 4A3DG 2QWNB 5KMGB 5FD5A 3ETJA 4A3BG 4H13B 5JJJB 3U55A 4I55A 4DR6O 4ED8A 1Q8IA 2LGQA 5FPRA 1X4TA 1VQMV 4D7SA 2R7KA 2VQFO 3OE7G 4I0XA 3V4ZA 5BZBA 1K1SA 4E2LA 1WAZA 4DR7O 4JASA 2F95B 3GIIA 1OV9A 3K58A 5LGUA 3J81N 4R7RA 1NI8A 2R85A 3AG4B 3PR5B 4IRCA 3U9TA 5L1LA 3T2MA 1BNCA 3ORQA 5IJ9B 4A93G 2RQ6A 2IW5A 4JI4B 3AG3B 5IYDO 2JA7G 3ABUA 2Q5ZA 1XL6A 2N05A 3L4JA 3W7UA 3JRXA 3PFFA 4PDBA 3BCCH 1FKAH 3RYHA 2GUZA 4IZOA 2WAMA 3RGZA 2DN9A 3LWBA 4MV9A 1DAAA 3BHPA 1GLVA 3JRWA 2F43G 4DL6A 4XDJA 2RDJA 3AG3C 2W71A 2GUZB 1VP7A 4Q44A 3EXAA 1Q7YW 4CH5A 3SJAC 5ITZB 1EKPA 3J80W 5CE8A 4DR3B 5LXTB 2VPSA 2R92A 1BL8A 2UXCB 4YHHH 5KS8A 3BPZA 2X5RA 2Y0SE 3SJCC 3RBDA 4Z2WA 3KAKA 1Q81W 3O65A 2R93G 5KT2A 1LUWA 4I9QA 3PW5A 1SF9A 4DR4H 1NU1H 5L3CA 4DAAA 5CR5A 2DWCA 3OGCC 2VA2A 3B40A 2UU9H 4ZHQA 2EJRA 1RSOB 4FM1A 2WLLB 1QU7A 3ZHTA 4LF5H 3ZS8C 1S3JA 1GYFA 2UU9B 5JQGF 5KLVH 1QNMA 2V7QG 3H1KH 5BWRA 4N21A 4J0MA 4QPJA 1G2WA 4LF4B 2VQFB 2W0XA 4UUGA 2EBOA 4ED2A 3JCUZ 4DR2O 3VQVA 4NZMA 1HR0O 2V58A 1JJ2U 3IAYA 3GTQA 1IOVA 1DTOA 3GJXB 4LF7O 3QO8A 2VQDA 4FFMA 3KALA 5A9GA 4BXXG 1YZBA 1AJPA 2P4VA 3WU2Z 1W0KG 3RV4A 1M57B 1NT2B 2XCLA 1Y14B 5L1IA 4J9NA 2EIJC 5KAFZ 3OSPA 3A0BZ 4RAIA 5B5EZ 5LA6B 1FXKA 3CCVV 3HKBA 1P49A 3H4DA 2C00A 2EIKC 2JGUA 4O7RA 2CDYA 5IP9G 5DQGA 3ZEDA 3U54A 5JJNB 1GO3F 1JIHA 4TQSA 1N56A 4JYCA 1Y74A 3E2EA 3ASNB 1DF4A 4R6ZA 4O4JB 1K4DC 4GZRB 4JTDB 1I6UA 5JH7B 3GIPA 5EC2C 3BAAA 2ZT9B 2JS5A 1YEWA 4WF9V 4TV8F 2IBZH 1WP7A 4I50F 4MVQA 2Q2TA 4MT8A 1OZ0A 4E4TA 4MVRA 3R9RA 3GIDA 2ZGIA 3OMIB 4X1KA 5LOVB 3N43B 2PTMA 5FR9A 1I2LA 5JVLA 3TQTA 3IN5A 1KJ9A 2EIMC 4RNNA 4O3SA 4YIOA 2C2DA 2EJ3A 2UVWA 3KHLA 1JX4A 4HR7A 2NU9B 4LF9H 3SI8A 1K1QA 1IXMA 1HNZH 2HVSA 1CKNA 1SEIA 5EC1C 2XNDG 5KFHA 3GIMA 1RJRA 1LR1A 4I50A 4RZRA 4DV4O 5CA1A 5KFCA 5KMGA 4ECTA 5EK0A 2AW9A 2PI4A 4TQDA 1NVPD 3CSWA 2DPJA 2DPIA 4ZHQB 2YZMA 2X0SA 1GM7A 1N36H 3OUSA 4B3SO 2B1GA 2OH2A 3JALA 5D1PA 2JEIA 1WLEA 4JI2O 4LF7H 1VF6A 2XHBA 5DGHA 2EX3A 5GTHZ 4QWCA 2ZNJA 5LGTA 2FK3A 3CVZA 1TVKA 4DV5O 3CMEV 1IXBA 3JAMW 1FJGO 3EHBB 1FJGB 1THZA 5DQIA 2CZGA 2QK4A 1YVWA 4EGJA 4YQWA 2IJIA 4DR6H 1NQTA 3DSQA 1XDNA 1R6NA 1TAEA 3AG2C 1OCCB 1NR1A 5LMNH 2UXDB 3H40A 4NLGA 3AK1A 3OMNB 3H1LH 3L72H 1XNQO 5KFQA 1S76D 4DV1H 3K06A 2W7OA 3MWDA 3ASOC 4JXUA 3KXYT 3K03A 2WLIA 5BR8H 4O7WA 5AG2A 5KAIZ 2R87A 1XNRH 2QEXV 2DABA 2LO1A 2DWEC 1PL0A 2VWJA 3CJHB 3L2PA 1IBMH 4BIOA 3HKZE 4JI5H 1GM8A 4FLWA 5DMXA 1N4CA 1Y67A 3GTPA 4DV6H 2AGPA 1AI5A 2B63A 1CKNB 1GO3E 4QE9A 3LDEA 5EZYA 4O3NA 2GTSA 3KREA 1EZ1A 1GH6A 4X64O 1KD1W 4DV0H 2WAQA 1FKAO 2DOSA 4B3RB 4HAMA 4OPAA 5J2UF 4NTWA 2PGGA 5LOVF 3RVYA 2X0LA 3GV8B 1VQ4V 2PZSA 1A3GA 4LC1A 1U97A 4J9YB 1VF7A 4Q8EA 4XDLA 2ZQMA 3ZRWB 3ABTA 2SCUB 5B1NA 5JUMA 3RYIB 1COWG 4ZI7B 1XMOB 4O7SA 1DK1A 1R9TA 3HKZA 4X62B 2Y69B 4X65B 4U7CA 2R7ZA 2NUAB 3I56V 4NXNB 4FK5C 4O3RA 4H44B 3RR5A 1OWTA 4XZ3B 3LNNA 2I8CA 2WAQE 2UXCH 1WCMA 4FLTA 1FJGH 4WFHA 1MZFA 3T5HA 2P67A 4UCRA 3F7YC 3TINA 3BY6A 4MW8A 2XASA 5L3DA 4LF5O 3BABA 1VS0A 4UUJC 2AHYA 2YS7A 4RAYA 1SQPH 3IC9A 1ORQC 2H3OA 1KKDA 1MZEA 2W9CA 2FB5A 1Q86W 2B5UA 2HDKA 4JI7H 4DUYO 2ZM6O 2FPIB 3OTOH 4DW0A 2Q7EA 2ZXWB 2PBZA 2F66C 2NU6B 2ARHA 1C30A 4FIPC 3SPCA 3SJBC 1GGOA 2CNUA 2ASDA 4QW8A 3TXQA 1CKMA 2IU0A 1PNMA 5IWAO 2I80A 5I5YA 5IYCG 5KFOA 2IH3C 1KECA 1UNNC 3AEIA 4JF3A 3JZFA 1NR7A 3Q8RB 4RB1A 4OXSA 4DL7A 2CNQA 1Y1VG 1PV0A 1XMQO 4ECSA 1BQ0A 3DTUB 3CMAV 1BGYH 1M90W 4GKKO 4AQYH 2JGDA 4X66O 5KG4A 5B66Z 3CEIA 1WA8B 4ED0A 4PV1B 1VAJA 3MJFA 2MK3A 3RB3A 3E5NA 4F4XA 1Z5WA 1QR8A 2W8LA 2R7ZG 3M4IA 5CA0A 5KFYA 2NLJC 2F23A 1QVGU 3RAQA 3OMAB 3N2KB 2W6MA 1SZTA 5JJEB 4I4TB 1NVPB 4BIUA 2X6CA 1YJWV 4JI4O 2ZDQA 3PW0A 2YXHA 1W93A 3QWUA 4G27B 3AW8A 1QR9A 2IM9A 5H6QA 2HGSA 1TUBA 5DN6G 2IJKA 2LFRA 3QTCA 3MFIA 4JI6H 4DUZB 2ABJA 4GT1A 2QE7G 3GTLA 4B7KA 4YY3B 4LFCH 4FFKA 3VA7A 2QF7A 1NTZH 1EZVH 3VQYA 1KJQA 5KFSA 3TXSA 1Q5OA 1HNXO 5LGNA 3CQZA 4RWUA 3KCYA 3AG7A 4MTGA 4YJ2A 2WDTA 2ILMA 3TCUA 1MG1A 3JD3A 4JI8B 3GLKA 3P3PA 1FXVA 5KHJA 3OR7C 5BWTA 5B1OA 4A2BA 3L4KA 1UPGA 3WWJA 5B1BC 1SETA 3MHHC 5BR8B 1VQ8V 5BPHA 3Q8SB 1KQSU 4QNHB 2UUBH 5GW7A 4O4LB 4LSXA 3AG4C 4CH4A 4ZIBA 3T1CA 2VUMA 1PL4A 4JYYA 4NZNA 4HBNA 1QLEB 4G28B 3RYCB 1WR2A 5K2MA 4IT5A 4TQRA 2VA3A 1B6QA 1S72V 4KUMA 2KSDA 5KFFA 3CSXA 1IBMO 4O2BF 1SA0A 2V4DA 3JD0A 1O9HA 4CMFA 1KJIA 3JSNA 4YHHO 4EFEA 4FZ0A 1ZL8B 2M6YA 4R8CA 3SGIA 5B3SC 3T7AA 3EYYA 2W7PA 3RYIA 1BCCH 2YIBD 2QM7A 2WA3A 2UVVA 2WE6A 1D2DA 3BQ0A 2OIEA 4UCUA 4WHXA 4IR9A 4AQYB 4K8ZA 4GC6A 1DF5A 3SR2C 2V4RA 4FM9A 4A3LG 2D3OW 3FAVA 3RJ0A 1PNLA 2WSSG 1BGWA 2NVYA 5LMUO 5GONF 3L75H 4I4TF 2F93B 1G1XB 3K79A 3MHSC 1H2LA 5LHGA 1R73A 1RK5A 2DYSC 4PI2A 2GQSA 5JQWA 4ECVA 1RK6A 3PVXA 3JAWA 4B7EA 5LXTF 3IG0A 2HHHO 5FL7G 3GB8B 4RU9A 3R65A 3ZN1A 4B3MO 2RN9A 4J9PA 4RO2A 1H38A 2P4KA 3SYPA 3CPWU 5LP6A 3JD1A 4J9KA 1I5XA 3G8CA 5B1BB 3H0GA 3K3VA 3UT5A 4J7ZA 4DR5H 3PN1A 1TWGA 5C3EG 3UQ8A 3QQMA 5K1XA 2LQTA 4O81A 2QTSA 4B3TO 3OHBA 4AYBE 2UXCO 1JA8A 3PO2G 4DV7H 2W57A 2Y4UA 3H4BA 2DYRC 1E79G 4RNMA 4X65H 4FVMA 3OTOO 5EYPA 2ZM6H 3QF7A 3FFQA 5JWPA 2HG5C 1SESA 4QIWA 2Q0OC 2WA4A 3SYAA 4I9WA 4WFGA 1F4MA 5C5JA 5H9CA 1SERA 2W6QA 4MAMA 4QJFA 1Q6UA 5I5VA 4TT3G 5H2FZ 4CS3A 5I60A 4A3EG 4GUNA 3A2FA 4RUEA 5HBRB 4IR1A 1XHXA 2VUMG 2QA4V 1WB8A 5IWAB 3H3VH 4NB5A 3E8BA 2DZDA 4QE7A 2DQ3A 1A0IA 1VQLV 2BOBC 1VF6C 1YI2V 4O4IB 1S77D 2VOBA 2ZM6B 2QM4A 2L6LA 3CCRV 4AYBA 2NU8B 2PY5A 5KFBA 3SDLA 4Q0YA 3R66A 4MSWC 3T9DA 3SPGA 4U3JB 4LBEC 4X66H 4H33A 5EBWC 4UCTA 4YAKB 4IIJB 1K4CC 1VMGA 1XNRB 1E1QG 1E4FT 2R93A 5I5XA 2EIJB 5KG3A 4R8UA 3ZCCA 4DR7H 4Z1MG 4GYCB 2YW2A 1BS3A 4LF8B 3FYEB 2Q7HA 5F9LA 5E79Z 2YDEA 5LYJB 3HKCA 1I7NA 3ETGA 1XMOO 1RP3B 1W0JG 2YYAA 3UM7A 2V9WA 4LF8O 1T36A 1Y74B 2CUGA 3F5WC 2KG7A 4FLVA 4NXMO 5KFXA 4QSHA 2FK2A 2IA6A 2DWDC 4NXMB 2ZINA 1H2MA 4ED1A 4NXNO 1KEEA 1R6TA 4O4HA 4KL1A 5K3WA 5IY5B 2YEVA 3K57A 4DR1B 1M0TA 1JCHA 1N34B 1HNXH 3X2QB 4X62O 3FYIB 4CKEA 3T9CA 1SQVH 1L0LH 2W8KA 4D6TH 5BWWA 2CNVA 4NYKA 2UVRA 1JX9A 2ETNA 3FKSG 3TJTA 4FFPA 2YZNA 2EJ7A 3TIIA 4B08A 4FFBA 4GX5A 4JI0O 1EFRG 3WWIA 3MR2A 1GM9A 4X64B 5C1OA 2FTKA 3MAQA 1Y1WG 2UUBO 4CZZA 2E2HA 3RFRA 4ECYA 3K9SA 3K59A 2CKZB 2AU0A 1I7FA 2Q69A 5D8DA 3RFCA 3VOUA 5DECA 5KFUA 4EQ5A 2BQ3A 2JA7A 1Y66A 4F4WA 5A2QW 4HNUA 3ETQA 5KUMA 2Q68A 5DQHA 1JFFA 5F9NA 3ZHSA 3CRAA 2IH1C 3NUAA 1T5EA 3SJQC 4PZ6A 4ZQIA 3N27A 2WYOA 3P30A 2AGOA 3QG5A 4LF6O 4RQEA 1TWCA 2HHFA 1IBKO 5F2VO 3Q8QB 5KFDA 4M9UA 3JARB 2AHZA 1TWHA 5EOYA 3JZIA 3M9MB 2FMLA 1S0OA 2Q0AA 1FS0G 3ZMSA 1A0GA 1PM9A 1XUQA 4IHJA 4FMTA 4FZ1A 4JV5O 2GBOA 3UO2A 4F6RB 1QBZA 1AR5A 2YIBA 3G4SV 1YCIA 3L9DA 2AQ4A 2UUCO 3HT5A 2JEGA 2JVDA 3TY5A 2H8PC 2D2CB 3S24A 3ORRA 4TV9A 2ZR2A 4KXRA 1OCCC 2I87A 4NXNH 3KTMA 2UXBB 4HN2A 3ZMZA 4YY3H 5EIBC 1R6KA 1GSAA 4FE2A 3UO3A 2F4VO 4U6PA 1H2NA 5E25A 4GX1A 4MV7A 1SCUB 1QCEA 2UXBH 3H1HH 2C28A 5JVDB 2BTOA 2VQEB 3OAAG 4B3TH 3V6JA 1BHBA 2VUGA 1S0MA 3ZHRA 1JDEA 2W9AA 2VR1A 1RYRA 4TWKA 1YIJV 3K08A 2CGOA 1FFXA 3ZRSA 2W6NA 3D36C 3CC4V 4J42A 4I55B 2ZIMA 2R8IA 3WG7C 3TW6A 4EKWA 1NJIW 3VOTA 3ZHQA 3FX7A 4PELA 3HOVG 4LCUC 2HJWA 3GIQA 2VPQA 4YHHB 4KFMA 4QWEA 2YIAA 3KG2A 2ZJTA 4DR3H 3E8HA 1HW7A 2EZPA 4RUAA 5D5QA 3CS5A 1QLNA 4A3JG 3RBEA 5JCOA 4EYHB 2X7RB 2JIZG 2M7WA 4LNUB 4O7VA 3DF7A 2YIDA 2GSMB 4GCZA 1HR0B 4LFAO 2E3CA 2C2EA 4A2AA 4YR0A 1TUBB 2PVPA 2CE4A 3KZIZ 1ZLZA 2W9CB 4JV5H 4PZ8A 2HG8A 3SNOA 1EKVA 3STZC 4LF4O 5LYJA 2NVXA 3HKDB 4UV8A 2J6UA 5B1AB 4BWAA 4DR2B 3T9AA 2DIKA 2QWPB 4GLWA 2GHYA 1HNZB 3TK1A 1B06A 4LF7B 4C7UA 3G6XA 2W6OA 3JATB 4LWSB 4WFFA 4DXWA 4JI6O 4O82A 4TVIA 5HFMA 3L73H 2R82A 2OT5A 2XAQA 2F4VH 4CS4A 2EILB 5KFKA 3RT3C 5LHIA 4WBNF 4BBSG 3DC6A 1VQNV 1B04A 2WB1A 5EYPB 5LHHA 4K3AA 4XBFA 2XT9A 3ABMB 4IHJF 4JI1O 5KT6A 3CCSV 5GONB 1EUCB 5KFMA 1BT8A 4O3OA 3NBYB 3W1GA 4PDMA 3V4SA 4GKJO 5CA1B 3U0ZA 1I1LA 5TISZ 2LW7A 3I4NG 1QVFU 1XOUA 4MV8A 3W5OA 1V54C 2A79B 4AHCA 1KBHA 5BYBA 1P7GA 5LYJF 2RGVA 4JV0A 4B3MB 3R5FA 1N32B 4K0KH 1JQ0A 2ZDGA 4DR3O 5KHKA 2Z02A 3E8GA 2QKSA 4GLXA 1J95A 3LP8A 2JA5G 1PK8A 1EZJA 1K5QA 3WB2A 4OX9B 2Y48A 4A3KG 1XMQH 5D1OA 1VQKV 5BWVA 3LUTB 2J9GA 1XEQA 5IYCO 1L0NH 2ZXWC 4MS2A 2ADQB 3Q4HA 3QZ7A 1F4NA 4G3IA 1S97A 4J9OA 5IJ9A 3DXRA 4WFEA 2RGRA 1CP9A 5I5SA 2WTFA 3D8CA 2YUAA 4DRXA 1MA1A 1M56B 1BJTA 4DV3H 2K9PA 5C8YA 2BE3A 3FB6C 5KHHA 3CE2A 4DK0A 4JYAH 1AI6A 3SYOA 3APOA 3F7VC 4JI3H 4WD3A 2E76B 4EBEA 4CH3A 3K5NA 4O7LA 3J81W 1N36B 4KP4A 3RWRD 2R7MA 2N04A 2UXDH 3E8FA 3CCQV 1TWAA 4JI2H 4O2BA 3DAAA 5LP6B 1IBKH 1Y4MA 3OSNA 3KAJA 5IP7G 3HKDA 2ZE8A 5KG0A 2FL4A 4PDVA 4MTDA 3TIGA 1Z2NX 1RJPA 1OCZC 1A32A 1KTAA 2AZ0A 1H2KA 4FS1A 5KFVA 1N8RW 4MVUA 4DV7B 1YDXA 3ETDA 1VBGA 2PYLA 2CTPA 3G71V 3DTFA 2HJDA 4RB0A 4MVSA 4DV1O 2R8HA 4HZ3A 1BE3H 3SYCA 1I1MA 4APMA 1AN7A 5KT7A 4CS2A 2ZDHA 1EN4A 3ABKB 1HNXB 2XAHA 5I5UA 1SQQH 1TA8A 4DL4A 2NNUA 3CCLV 4AILC 4W4KA 3Q2OA 4YY3O 2Q7DA 3T1HB 2W6ZA 3HXLA 4JZGA 3UFXB 2YS6A 2M05A 4IRDA 5FD6A 3RB0A 4H37A 4R8UB 5CB4F 3VBBA 2XCAA 1CQIB 3ASOB 2YU9A 1S9FA 4YB8B 2DMXA 5IE9A 2BQRA 3HKEA 1I1KA 2OLSA 2ZE7A 5KG2A 1YHQV 1AJQA 2QWQB 3TY9A 5JVDF 1EN6A 2A06H 1KU9A 2Q9LA 2ZR3A 4FFOA 3RF2A 4UCVA 1BMFG 1KUQA 5CAEB 3BFRA 1GTOA 4MW3A 3FD9A 4LF6B 5IYDG 4ED3A 1U96A 3D3IA 1Q6IA 3B77A 1WPBA 1AJNA 4RCNA 4E6NA 3EPGA 4LFBH 1VQ6V 1KP2A 1K83A 2G38A 1SS3A 2JK5C 4FJCC 4KHPB 1N33H 1UJWB 1I2KA 1S68A 4LMYA 2XAFA 1A48A 1P4RA 1FXKB 4TV9F 3VQWA 4J7JA 1I3QA 3WO1A 4LF4H 3GWOA 4I5SA 2E5LB 2EILC 5KFAA 5GTIZ 1Y76B 2YCHA 2OCCC 3WFVA 2R70A 3AK3A 1PKXA 1IBLO 4QWBA 4TOIA 3CCUV 4DR1H 4A5UB 3SPJA 4ECXA 3T5LA 3RVZA 2R7NA 4DV4H 2QDOA 3CEBA 1SQBH 4NKGB 5BPFA 3W7SA 1JR9A 4YJ2F 3C3SA 2DJVA 1IYEA 2RJZA 1ET0A 4PBCA 1T94A 3MR5A 2VQFH 4N23A 3VPCA 5IWAH 1KP3A 1JPXA 3BG5A 4TSFG 1YTFB 3KHHA 4HQ6A 4B3SH 3PW7A 2ATLA 4RAZA 4JPRA 3T1HO 4L1KA 3ABMC 5IJ0B 1FD9A 1ZTEA 4FM2A 3GIJA 4ZOLA 1JLLB 5EDWA 1J5EH 1R3JC 1EUDB 4LH6A 3HOXG 4DR5O 3HOYG 2WB1E 3TGUH 1F7YA 4O7NA 3JALB 2KG7B 3BQ2A 1AUVA 5LMUH 2BQUA 1SRYA 2R8KA 1JFFB 4NYEA 4CC5A 2QR4A 4LF6H 5L3BA 3U0GA 5B1AC 5J2TB 2YSUB 5LL6Y 3OT7A 3HOWG 2HGWA 3MWMA 1M5IA 3UZBA 2IJJA 3B8MA 2Q67A 2A3QA 4UXNA 5JQGA 1KBLA 2YXYA 3PW4A 4UFZA 3KYHC 3I5DA 4OPHA 1PX2A 2AXTZ 2X6AA 3F5TA 4EB6A 1OBDA 4P30A 2COJA 1ZETA 4EEYA 2KB1A 5HV6A 2FB9A 4C5BA 4ECZA 4FS2A 3CYOA 1E4EA 2W9BB 1GK9A 3K3WA 5CN0A 2AGAA 2R72A 1VQ9V 4JAAA 3MR3A 4ECWA 2XTAA 1H8EG 3CWBH 1YXBA 2ODMA 1US6A 1NZ6A 1XDCA 5IYBO 5EZYB 3JD4A 3RYFA 2RDCA 3HKEB 5KX5B 3T9BA 3U10A 4DR2H 5C1PA 4JYAO 2HFEC 3T5JA 4G2KA 3NC0B 5CBFA 3CXHF 3A0HZ 3HB9A 1WCMG 1OJHA 4YJ3B 4UCOA 1CEZA 1XNQB 1EM1A 3H20A 3GDEA 1KKCA 4MA5A 4J7KA 2QKCA 2YZGA 1S5HC 1VARA 1XQ8A 3M99B 1JJOA 1QQCA 5KHIA 1CPYA 3JCZA 4CH6A 2WLHA 4J9QA 4IYIA 2ZCEA 4MTFA 3CXCU 3QNEA 3JARA 2NR5A 4JUZA 2LJ2A 3Q8PB 4X20B 4IRKA 3E86A 3ZHVA 2ZDIC 5FNVB 1I94O 2ZNIA 3RUPA 2C2RA 3RGXA 2YC0A 3T99A 1FAFA 3SE7A 1R1BA 1SC5B 3OTOB 3HBLA 2AGQA 1ZUQA 2GQRA 3GVMA 4DRXB 4PHZA 4MV6A 3PR4A 2B63G 3HOUG 4DV5B 4JI0H 1WJZA 5IDJA 4DV3B 2QWOB 4JI1B 3CP1A 5CA0F 3GTJA 1J5EB 1HP8A 2FLLA 2LGWA 5HNEA 4ECUA 5IT9W 3AG1B 4LP8A 3SPHA 3P3NA 1S5JA 3ZIAG 5J2UA 1S0NA 3T1YB 1Z2GA 2DQ0A 1NH2D 5IJ0A 5LMUB 3B2EE 1OCOC 1Z5VA 4WCEV 4J9MA 5H80A 4F4LA 3W7WA 2HHHB 2UUAH 2YICA 2LP7A 4TM5A 4FLXA 4DV4B 3RV3A 4Y8VB 5LA6F 2CK3G 4AQYO 4GKKH 4EBCA 4HNAA 2FKLA 1WPXA 2P6JA 4NVPA 4IGGA 4PD4F 2J6TA 3W7TA 1X59A 4CKCA 1XILA 2ZD9A 3L70H 3CCJV 2R8GA 4JV2A 4HNAB 3UZOA 4P9OA 1OCZB 1JOYA 5CBHA 1SQGA 4MV4A 5KUKA 3B4SA 5H6RA 3BA9A 3M9NB 2O03A 3UT5B 4YIPA 5J2TF 3MFHA 1B33N 2UUAB 5KFJA 2HHHH 2DE0X 4QPKA 1ULZA 2WLIB 4XX0B 1NBMG 1DV2A 3FMAA 3RYFB 4O7YA 3J7AU 4YJ3F 2QYZA 4DV2O 5CB4A 3OGIB 4DK1A 1M56C 4I4TA 2HVKC 2CAZC 3G80A 3WB0A 2MCTA 2W9BA 3JAMN 2BTQA 1GSHA 2PMZA 2HR3A 5DEDA 3AX6A 4DV7O 1I7LA 1I50A 2KKWA 4J11A 3C90A 3VNNA 4JZ2A 2Q73A 1ZAUA 4O4JF 3LQSA 5DLGA 4RQFA 3N6XA 5L9XA 2EIKB 1RJQA 4E4EA 4YXWG 4A3CG 3RB4A 4FPPA 5C93A 2CTRA 3BQ1A 1XL4A 2ZE5A 4BAYA 2HLDG 3T1HH 1MABG 2MW2B 1XHZA 3CD6V 4HNVA 5EWFA 3G6VA 1W2BU 3R5XA 3OUFA 5BMVB 3ZX6A 3G6YA 3I55V 1S0VA 3RYHB 1Y76A 3WB1A 4OX9O 3LSQA 1BZKA 3TQ1A 1K3EA 1BXRA 4FBUA 1UC8A 3ICXA 4UV9A 4IIJA 3G6EV 3T4DA 4CBCA 1E4EB 3N41B 2Y0IA 5C8YB 2UU9O 2NU7B 3E89A 2UUCH 4DV3O 2JJ1G 5IYZF 3S3WA 3M9OB 2Y0PA 4X89A 2B1IA 5DM6V 4P2ZA 4ETSA 2ZE6A 4FFLA 1M6VA 4LNUA 3IFXA 4GKJB 5KX5A 4WFAV 1IBKB 5FLMG 2GV9A 2Z0AA 2ZKOA 5KFZA 1WB7A 3R5HA 3M7MX 2R7LA 1F23A 4CE5A 1OBGA 1P84F 4RZQA 4JI3B 1OCRC 3SYQA 3V6HA 5DGBA 1B3QA 2YL2A 4UB6Z 4B3RH 3T54A 4Q43A 1IURA 5FNVF 2FLNA 2A9HA 3BRCA 3JYCA 4LWSA 4X20A 2JA8G 4X66B 1KJJA 3CB2A 1NTKH 4RNOA 1CE8A 2CTQA 5L1KA 1ENVA 4O86A 1P8LA 4DV6B 5ITZA 2HGXA 1AROP 2Y69C 2COGA 1AI7A 2EINB 3QO5A 2UUBB 3FB7C 2YS8A 4FLUA 4DUYH 4X62H 4JI1H 1AR1B 5KX5F 2P5OA 4JI0B 3JZ6A 4J41A 3J7AK 2CTWA 1BSMA 2BR0A 4U7OA 4PJ0Z 4X1YB 1N48A 2P0AA 3FKIA 3BACA 2HEPA 4MV3A 4J9SA 4J9ZB 5CB4B 5L1JA 5FPOA 1A9XA 1FVIA 2Y4RA 1KB9F 3E35A 4O83A 4GKJH 4DQNA 3RTXA 3N42B 1V9PA 3E22B 4LH7A 1QLEC 1B6RA 2FPGB 4C2MA 4PA4A 3G6BA 1N33B 3ABLC 4KHPH 2A7WA 2ADPA 1WSCA 5FJ8G 4FLZA 3LSUA 1VKZA 1GAXA 4JI5O 1GSOA 3ZMTA 4HYKA 2E5LH 4RUCA 5C4XG 2QM8A 1R3KC 2YI9A 1V51A 3HOZG 2EIMB 2JEUA 3DXRB 4RUFA 2A0LA 1HNWO 1SFOA 2PI5A 3D3QA 4BW5A 3STLC 2EJ2A 2ZIOA 2UUAO 2UXNA 3CRMA 3E83A 5KA6A 1WH2A 2JJ2G 2JGDB 4QIWF 4LFBB 4B3RO 2ASJA 2NN4A 3D36A 5BYAA 2R9RB 3N8DA 5FLXW 4A3FG 2FLPA 1M0WA 5K1PA 5KFGA 3MR6A 4O4IA 4NR1A 2WLMA 4C5AA 3DC5A 4I50B 3R23A 4DIMA 2FKXA 4O2BB 5IT9N 5BWUA 3CJHA 4UVCA 1OCRB 1P16A 3UKMA 2GPWA 2HKOA 3ASNC 2XC9A 3V6KA 4X1IA 5CA3A 4JAUA 4Q20A 3T5KA 1VEWA 3BA8A 3NGDA 2R9IA 2UXDO 4F4ZA 4XDKA 3GB7C 5JCOC 4ZOLB 3CRRA 4DW1A 5KT5A 4IYHA 4TQFA 4O4LF 2IBKA 3T1YO 5L3GA 2CW8A 1Y6XA 3JASA 3T9FA 5LOVA 3S3XA 4O4HF 1GRJA 3RIZA 3AK2A 3RW0A 4JYBA 2C35B 1RPOA 3N40P 3CX5F 2HHFB 2IP4A 2FMAA 2JA6G 3JASB 3K5MA 4UCSA 4DV0O 4X64H 2EULA 4BR6A 4K8XA 3HO8A 1JMKC 3B09A 5CBGA 2ASLA 3CRCA 4WFBV 2R86A 4K35A 4I7HA 3BEHA 3K3PA 1E1RG 3DGEA 4DL2A 3PJSK 3IJ4A 4MA0A 1GN3A 4PA3A 2Q2UA 1PNKA 3WNZA 1L8DA 1N34H 2YWVA 2HIXA 3LULA 4EB6B 3FB8C 4KHPO 1ZSPA 1NH2B 5DGAA 2DAAA 5IYZA 2JEFA 4PA7A 1Z2OX 4PDRA 5KT4A 1HNWH 2P22C
chains in the Genus database with same CATH topology
4AQYB 4K8ZA 4OX9H 1D5AA 1XI1A 2R9AA 1WPBA 3SR2C 4E6NA 4FM9A 4LFBH 3RJ0A 3CHXA 4KHPB 1BGWA 1N33H 4X1KB 1S68A 4LMYA 2F1MA 2F93B 4LFCB 3N2GA 3N2KA 4FLYA 5LA6A 3VQWA 4JYAB 4YJ3A 4LF4H 4PI2A 2E5LB 2HIVA 2YCHA 3JAWA 4TV9B 4LF9B 2R70A 4DV1B 3IG0A 1N32H 5KMGB 3GB8B 5FD5A 4TOIA 5JJJB 4I55A 1Q8IA 4DR1H 5FPRA 4O4JA 1X4TA 4D7SA 5LP6A 4DV4H 4JI5B 1IBMB 3K3VA 3UT5A 4DR5H 3F8NA 2RJZA 3PN1A 4FFBB 2VQFH 3UQ8A 2F95B 5K1XA 5IWAH 3K58A 4R7RA 4DV7H 4B3SH 2W57A 1FFXB 1IBLH 4RAZA 2BTQB 5IJ0B 2ZM6H 4X65H 4FVMA 5EYPA 5IJ9B 3QF7A 3FFQA 2RQ6A 4FM2A 4ZOLA 3K5LA 3JAKA 4JI4B 1TGOA 1DGSA 1J5EH 4LH6A 3L4JA 4CS3A 4PDBA 1FKAH 3RYHA 4DR4B 3A2FA 3JALB 3RGZA 5LMUH 1XHXA 4MV9A 3BHPA 1JFFB 5J2UB 5IWAB 1CKOA 4CC5A 4LF6H 4CC6A 5J2TB 1A0IA 4CH5A 2OWOA 3SJAC 5GONA 5ITZB 4O4IB 2VOBA 3J80W 2ZM6B 2QM4A 2QJ1A 3MWMA 1M5IA 4DR3B 5LXTB 2VPSA 4WBNB 4O2AB 2UXCB 4YHHH 5JQGA 3BPZA 2PY5A 4UFZA 2OYQA 3KYHC 3SJCC 3NBZB 4Q0YA 4U3JB 4EB6A 3KAKA 4M7EA 4X66H 4I9QA 4BWSC 4UCTA 4DR4H 4IIJB 3C0FB 1XNRB 1E4FT 5LL6b 2R72A 4DR7H 1X9NA 4FM0A 2UU9H 4ZHQA 4GYCB 4FM1A 4LF8B 2Q7HA 4LF5H 3JSLA 5EZYB 3ZS8C 1Q43A 1GYFA 3RYFA 2UU9B 3HKEB 5KX5B 5LYJB 3HKCA 3U10A 1SQFA 4LF8H 4DR2H 4J0MA 4LF4B 2VQFB 3NC0B 4YJ3B 3VQVA 4UCOA 4FLVA 1XNQB 3H20A 4NXMB 2ZINA 3GDEA 3IAYA 1KMIZ 3GJXB 3VQXA 4O4HA 3KALA 1XQ8A 4KL1A 4B3TB 3K57A 4DR1B 1JJOA 1QQCA 1N34B 1M0TA 5FNVA 5KHIA 1HNXH 4CH6A 3N44B 3K5OA 2ZCEA 1NT2B 1XMQB 4PZ7A 4DRFA 5LXTA 3JARA 1ZHQA 1RSOA 5LA6B 3THOA 3HKBA 4DR7B 1P49A 4D7TA 4X20B 4LSAA 2PUSA 5FNVB 2ZNIA 4B08A 2JGUA 4FFBA 3T1YH 3RGXA 4X64B 3ZEDA 5JJNB 3MAQA 3OTOB 4LF6B 3JATA 4DRXB 4LFAB 4PHZA 3RFRA 5D1OB 4DV5B 4JI0H 4O4JB 4DV3B 4JI1B 3K59A 1J5EB 1XK5A 5IYZB 1I7FA 1I6UA 4PI0A 5JH7B 3BAAA 4EQ5A 2JS5A 1YEWA 5IT9W 4TV8A 5A2QW 3ETQA 1S5JA 2Q2TA 1ZHSA 1JFFA 5J2UA 3T1YB 5IJ0A 5LMUB 3B2EE 1Z5VA 4X1KA 5LOVB 3N43B 2PTMA 1T5EA 2HHHB 2UUAH 4RB2C 4FLXA 5KHGA 4PZ6A 4DV4B 2WYOA 4GKKH 3OTFA 3QG5A 4HNAA 1SYXB 1WNSA 1L2ZA 4NVPA 3RGBA 3JARB 4LF9H 5EOYA 4HNAB 1HNZH 2HVSA 4TUYB 1CKNA 1SEIA 2Q7GA 2Q0AA 1H2SB 4I50A 5CA1A 1SQGA 5KMGA 4IHJA 1SA0B 2HVQA 4JI4H 2XIGA 1I94H 3BA9A 4F6RB 4DV2B 4TQDA 2O03A 3UT5B 2YIBA 4ZHQB 2UUAB 2HHHH 4WBNA 1N36H 3FMAA 3RYFB 3JALA 5D1PA 2JVDA 3TY5A 3S24A 3JAWB 4TV9A 5D5PA 5CB4A 4LF7H 4NXNH 2XHBA 2UXBB 4DK1A 2EX3A 1SKVA 2ZNJA 4I4TA 4YY3H 2CAZC 3CVZA 1TVKA 5EIBC 3WB0A 2MCTA 2BTQA 3JAMW 1XNQH 4MV7A 2UXBH 1FJGB 2F4VB 2CFMA 4TV8B 4DR6H 5JVDB 2KKWA 2BTOA 3DSQA 2VQEB 1XDNA 1TAEA 4B3TH 3VNNA 5LMNH 2UXDB 1ZAUA 2VUGA 4DV1H 3KXYT 3N6XA 2UUCB 1WN7A 4DV2H 5BR8H 3HKBB 1FFXA 1XNRH 3E22A 4I55B 2ZIMA 4L8JA 2VWJA 4JV5B 3L2PA 1IBMH 3T1HH 4JI5H 4FLWA 1XHZA 4DV6H 4TUYA 1CKNB 5EZYA 5BMVB 4YHHB 4F6RA 2YIAA 3RYHB 3WB1A 4GKKB 2ZJTA 4DR3H 1HW7A 4DV0H 3ICXA 4IIJA 5D5QA 4B3RB 1I94B 3N41B 5JCOA 5C8YB 2PGGA 4LNUB 2UUCH 1QHTA 3DF7A 2PZSA 1HR0B 4ETSA 1VF7A 2E3CA 4A2AA 1TUBB 3RYIB 4LNUA 4JV5H 4PZ8A 4JI6B 4GKJB 4ZI7B 5LYJA 5KX5A 1XMOB 4U3JA 3HKDB 1E4GT 1IBKB 2KSWA 2HVRA 2GV9A 4DUYB 4BWAA 4X62B 4DR2B 4X65B 3M7MX 4RB3C 5EIBD 1HNZB 4X1IB 4LF7B 5LMNB 4NXNB 4RZQA 4JI3B 1O75A 3RR5A 3JATB 4EFBA 4B3MH 2UXCH 3LNNA 4FLTA 4B3RH 1FJGH 2F4VH 4IHJB 4CS4A 2YI8A 4UCRA 1HNWB 3HKCB 3BRCA 1VS0A 3BABA 1B04A 4X20A 4X66B 3CB2A 4RAYA 4DUZH 5EYPB 1P8LA 1M4UA 4DV6B 5GONB 5ITZA 4JI7H 3JAKB 3NBYB 5DISC 3OTOH 3W1GA 2Q7EA 4LF5B 2UUBB 2F66C 4O4HB 3SJBC 5CA1B 3U0ZA 4FLUA 4DUYH 3W5OA 4X62H 1CKMA 4JI1H 4AHCA 2P5OA 4JI0B 1Q3EA 2RGVA 3J7AK 4B3MB 4DV5H 4RB1A 1N32B 4BW9A 4K0KH 4X1YB 2CW7A 5J2TA 2HEPA 5KHKA 5CB4B 5FPOA 4GLXA 1FVIA 4X1YA 4EEQA 3WB2A 4GKJH 4DR5B 4OX9B 3RTXA 4AQYH 3RYCA 3N42B 1V9PA 1XMQH 3E22B 5LP6C 5D1OA 4LH7A 4LR3A 1N33B 4KHPH 1Z5WA 3M4IA 5CA0A 4FLZA 5IJ9A 2RGRA 3N2GB 3N2KB 5JJEB 4O2AA 2E5LH 4I4TB 4DRXA 1BJTA 2YI9A 4DV3H 5C8YA 4DK0A 4JYAH 5KHHA 4JI3H 1S03G 4CH3A 3QWUA 3K5NA 2ZIOA 2YXLA 3J81W 1N36B 3U11A 3RWRD 1HR0H 2UXDH 2IM9A 4JI7B 1WH2A 2HGSA 4LFBB 5BMVA 1TUBA 3QTCA 4JI2H 4O2BA 5FLXW 5LP6B 4JI6H 1IBKH 1M0WA 5K1PA 4DUZB 1XMOH 4O4IA 3KAJA 3HKDA 5CA0B 4LFCH 4YY3B 4MTDA 1Z2NX 4MTEA 4LFAH 4I50B 4O2BB 3VQYA 4B3SB 1P16A 1IBLB 1Q5OA 4X1IA 3TY8A 4DV7B 2VQEH 1Z2PX 2FE3A 3BA8A 2PYLA 4YJ2A 2WDTA 4RB0A 4NXMH 4JI8B 5JCOC 4ZOLB 4DV0B 1MZBA 4ZI7A 4TQFA 5KHJA 4A2BA 4APMA 4O4LA 1AN7A 3L4KA 2CW8A 4CS2A 3JASA 4JI2B 5LOVA 5BR8B 1HNXB 1TA8A 4YJ2B 3RIZA 1M93A 4AILC 2UUBH 3N40P 4O4LB 4LSXA 3T1HB 4CH4A 3HXLA 3JASB 3K5MA 4ZIBA 3W1BA 4UCSA 4X64H 4HBNA 4IAJA 4K8XA 2VWKA 1JMKC 3RYCB 2PYJA 5FD6A 3LMLA 4I7HA 3CSXA 5JQGB 4JI8H 4K0KB 1SA0A 2Q2UA 1TVKB 2V4DA 1O9HA 1L8DA 3HKEA 3JSNA 1N34H 2HIXA 1O9GA 4EB6B 5JH7A 4DR6B 3TY9A 4EFEA 5JVDA 1G6UA 3EYYA 5IYZA 3SGIA 3RF2A 1KU9A 3RYIA 2YIBD 1Z2OX 4UCVA 2WE6A 4UCUA 1HNWH 4Q6GA 2P22C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY B;  1FJG B;  2F4V B;  2CFM A;  5FPO A;  4GLX A;  1FVI A;  4LF4 B;  4E6N A;  2VQE B;  2VQF B;  1XDN A;  1TAE A;  3NC0 B;  4EEQ A;  3VNN A;  4DR5 B;  1ZAU A;  4OX9 B;  4KHP B;  2UXD B;  3RTX A;  4UCO A;  2VUG A;  1V9P A;  1XNQ B;  1S68 A;  5D1O A;  4LH7 A;  4NXM B;  3GDE A;  4LFC B;  2UUC B;  1N33 B;  3GJX B;  4JYA B;  4B3T B;  4DR1 B;  1N34 B;  2E5L B;  2HIV A;  4JV5 B;  3L2P A;  1XMQ B;  4PZ7 A;  4LF9 B;  4DRF A;  4DV1 B;  3GB8 B;  4DR7 B;  4TOI A;  1CKN B;  4YHH B;  5FPR A;  4GKK B;  4X64 B;  4JI5 B;  3QWU A;  1IBM B;  3OTO B;  1N36 B;  4B3R B;  1I94 B;  4JI7 B;  4LFA B;  3PN1 A;  4LFB B;  5D1O B;  3UQ8 A;  4DV5 B;  4DV3 B;  4JI1 B;  1J5E B;  1XK5 A;  4DUZ B;  1HR0 B;  4YY3 B;  3BAA A;  4EQ5 A;  4B3S B;  1P16 A;  4PZ8 A;  1IBL B;  4JI6 B;  4GKJ B;  3TY8 A;  4DV7 B;  1XMO B;  2Q2T A;  4JI4 B;  1DGS A;  1IBK B;  3T1Y B;  3BA8 A;  4DUY B;  2HVR A;  4LH6 A;  5LMU B;  4X62 B;  4DR2 B;  4X65 B;  2HHH B;  4JI8 B;  4DR4 B;  1HNZ B;  4PZ6 A;  4DV0 B;  4DV4 B;  4LF7 B;  5LMN B;  4NXN B;  4JI3 B;  3RR5 A;  5IWA B;  4EFB A;  5BR8 B;  1HNX B;  4JI2 B;  1CKO A;  1TA8 A;  4CC5 A;  4CC6 A;  4UCR A;  1A0I A;  2OWO A;  1HNW B;  1VS0 A;  3BAB A;  2ZM6 B;  3T1H B;  1B04 A;  1CKN A;  4X66 B;  2HVS A;  4DR3 B;  3W1B A;  4UCS A;  2UXC B;  4UFZ A;  3KYH C;  2HVQ A;  1P8L A;  3NBZ B;  4DV6 B;  3BA9 A;  4DV2 B;  3NBY B;  5DIS C;  3W1G A;  4LF5 B;  2UUB B;  2UUA B;  4UCT A;  4K0K B;  2Q2U A;  1XNR B;  3W5O A;  1CKM A;  5D1P A;  3TY5 A;  4JI0 B;  3JSN A;  3S24 A;  2HIX A;  4B3M B;  1X9N A;  4DR6 B;  3TY9 A;  4EFE A;  4LF8 B;  2UXB B;  3SGI A;  1N32 B;  3JSL A;  4UCV A;  4UCU A;  2UU9 B;  4LF6 B; 
#chains in the Genus database with same CATH topology
 2JRI A;  1FXK C;  1W59 A;  1K9M W;  2RCV A;  1D5A A;  2YZL A;  1YIT V;  1XI1 A;  2ZDI A;  4HYO A;  3X2Q C;  5CMU A;  3GIL A;  4ED7 A;  4J9L A;  1F51 A;  5KT3 A;  2FP4 B;  1JKJ B;  4LFC B;  3N2G A;  2R6F A;  2W6J G;  1SZX A;  4U3F H;  4JYA B;  4YJ3 A;  3QO7 A;  2K1E A;  4JGS A;  2RDI A;  1L1F A;  4J80 A;  1K8A W;  3WWH A;  1VBH A;  5EWG A;  4TV9 B;  3OEH G;  1AUX A;  4DV1 B;  3BJY A;  4CHI A;  2HP8 A;  4EG0 A;  1N32 H;  2LFS A;  4LFB O;  4JTC B;  1VIB A;  1DIK A;  3I12 A;  1AP5 A;  4MVM A;  2IJH A;  4JV1 A;  4ECR A;  4O4J A;  2Z04 A;  1V4Y A;  4NTY A;  4JI5 B;  2N74 A;  3T9E A;  1IBM B;  3K9A A;  3OD4 A;  3F8N A;  1FFT B;  4FFB B;  2FJZ A;  4DLK A;  4A3M G;  4DR1 O;  2W6I G;  5DG9 A;  1AR4 A;  1FFX B;  1IBL H;  4YP3 A;  4GX2 A;  4BIZ A;  2BTQ B;  5EBM C;  4Q45 A;  4GC7 A;  5LBQ A;  1UFI A;  4FFN A;  4YR2 A;  2UVU A;  2ODT X;  1K73 W;  2H94 A;  3K5L A;  2EIY A;  2V4Q A;  1K34 A;  3JAK A;  1TGO A;  1DGS A;  5BR8 O;  5KG1 A;  4YR3 A;  3H1J H;  3CC2 V;  3WO0 A;  1ROP A;  4A3I G;  4DR4 B;  1FPO A;  4JI8 O;  5KG7 A;  2UXX A;  5DLF A;  1N33 O;  5CA1 F;  2JA6 A;  5J2U B;  1AB3 A;  1CKO A;  4L87 A;  4CC6 A;  3J80 N;  3AYH B;  3KKY A;  1XRE A;  3MD0 A;  2OWO A;  4ABM A;  4I7Z B;  5GON A;  3GTG A;  3VPB A;  1KUT A;  4YBZ B;  2QJ1 A;  2ITC C;  4F6E A;  4F50 A;  4WBN B;  2DYR B;  4O2A B;  1CS0 A;  1Y1W A;  3K5I A;  5I47 A;  2WLJ A;  4H0L B;  2PMZ E;  3KHG A;  2OYQ A;  3NBZ B;  2E74 B;  2GDS A;  1PPJ H;  2ALZ A;  4JTA B;  3L71 H;  4M7E A;  4EYI B;  2C22 A;  1XBL A;  4O3Q A;  4BWS C;  2BSK A;  3CRQ A;  2YRW A;  3C0F B;  3W7X A;  5KFT A;  3CC7 V;  5H5N A;  5LL6 b;  5KFP A;  1X9N A;  4FM0 A;  2E2I A;  2QGN A;  3U9S A;  4EGQ A;  4EBD A;  1ZX3 A;  3JSL A;  3ABK C;  1KC8 W;  1K5S A;  1Q43 A;  3ZMV A;  2IMW P;  1SQF A;  1IVS A;  4JI3 O;  4LF8 H;  2QTO A;  1C3O A;  1IDS A;  4JAV A;  1RPR A;  5EZY F;  2DYS B;  1N32 O;  1CXZ B;  4P9P A;  1VQ5 V;  2CH7 A;  3GV5 B;  4UVA A;  1YJN V;  1EBO A;  1KMI Z;  3VQX A;  1Q82 W;  2FPP B;  4B3T B;  1AVM A;  5FNV A;  3AG2 B;  3N44 B;  3K5O A;  2JEX A;  1XMQ B;  2WLN A;  4PZ7 A;  4DRF A;  5LXT A;  1ZHQ A;  1RSO A;  5E1A C;  3THO A;  1GN2 A;  4DR7 B;  2P90 A;  4D7T A;  5KFI A;  4LSA A;  4FBT A;  2PUS A;  3APQ A;  3T1Y H;  1AIL A;  2OIG A;  1AI4 A;  4C5C A;  4X88 A;  1IOW A;  5HFL A;  3ZBH A;  5FLX N;  1BQZ A;  3JAT A;  2R8J A;  1V55 B;  5L3F A;  3K5H A;  4LFA B;  4YAJ B;  4O3P A;  2XAJ A;  5D1O B;  5I5T A;  5KG5 A;  2GPS A;  3FKI G;  1XK5 A;  4BBR G;  2GLT A;  5IYZ B;  1HDJ A;  3DTG A;  5KFW A;  2OTJ V;  2YEV B;  5LP6 F;  4PI0 A;  3QVN A;  4BY7 G;  2HVJ C;  2XGP A;  4IWX A;  4TV8 A;  5EWE A;  4NZO A;  1ZHS A;  4Q8F A;  2QWR B;  2HJF C;  1I0H A;  3ZJZ A;  2OCH A;  4RB2 C;  4DR4 O;  5KHG A;  4LF9 O;  1VQP V;  2C2A A;  1K7D A;  2DW4 A;  3OTF A;  5C44 G;  1SYX B;  3KHR A;  1WNS A;  1L2Z A;  5BXZ A;  4AI8 A;  3RGB A;  2XCP A;  3M8A A;  1K92 A;  2RNB A;  4TUY B;  1N0J A;  1G4Y B;  1H2S B;  2Q7G A;  5IYB G;  1EYZ A;  2VQE O;  2V59 A;  1SA0 B;  2HVQ A;  4JI4 H;  4I55 F;  2XIG A;  5L3E A;  1PD3 A;  1WA8 A;  1I94 H;  1G8M A;  4DV2 B;  3CCE V;  2XGQ A;  3IC7 A;  4IL6 Z;  4WBN A;  5KFN A;  1RM1 C;  1SQX H;  1D5N A;  3EFF K;  1KC7 A;  2EZO A;  2OCC B;  3P32 A;  3JAW B;  5D5P A;  1GKF A;  2L35 A;  4X9Q A;  4DUZ O;  1SKV A;  4K0K O;  3FAV B;  3A0R A;  3RBZ A;  3OFN G;  3PW2 A;  1XNQ H;  4NTX A;  2Y0S A;  1I08 A;  2F4V B;  1H2G A;  2CFM A;  4TV8 B;  3ZHU A;  4QGP A;  4XYL B;  1RYS A;  4ME6 A;  1V55 C;  1PP9 H;  4OGQ B;  2LW1 A;  2UXB O;  4ZHQ F;  1R3I C;  1VF5 B;  1I5Y A;  1Q6H A;  1YSC A;  1NTM H;  2O57 A;  4CMD A;  1M1K W;  3ZN0 A;  3RAX A;  2UUC B;  1WN7 A;  4DV2 H;  1J5E O;  1T3N A;  4O7T A;  5C8Y F;  1TUE B;  2Y4T A;  3HKB B;  4GX0 A;  5T14 A;  3E22 A;  3LDD A;  4CKB A;  3IGA C;  4BY1 G;  4L8J A;  1R3L C;  4JV5 B;  4ED6 A;  1WRV A;  2V5A A;  1Q90 D;  2R84 A;  1H8H G;  4TUY A;  4JI7 O;  3GTO A;  4F6R A;  1ZQ7 A;  4GKK B;  2QSA A;  1DV1 A;  2Q6A A;  1URF A;  3FDS A;  3SPI A;  2WWW A;  1I94 B;  4FFR A;  1BHA A;  3OUZ A;  1RFY A;  2BSK B;  1MOF A;  1MSD A;  1OCO B;  1QHT A;  2JEJ A;  3GV7 B;  1WP8 A;  4ZI7 F;  4J9R A;  3K04 A;  3VPD A;  2AZ2 A;  1KJ8 A;  4JI6 B;  3I4M G;  3HB3 B;  4U3J A;  1E4G T;  2KSW A;  2HVR A;  4DUY B;  2VS0 A;  4Q4C A;  4PWQ A;  4UB8 Z;  4DO2 A;  1HNZ O;  1S10 A;  3ETH A;  1FYJ A;  1S5L Z;  3H9V A;  5EBL C;  1GMG A;  2JDI G;  5EIB D;  5KKN B;  4X1I B;  1KYO F;  5LMN B;  1O75 A;  4ASU G;  4EFB A;  1YJ9 V;  1ZL8 A;  4B3M H;  3L74 H;  1TWF A;  4ZBM A;  4O4I F;  4IHJ B;  2YI8 A;  1NS1 A;  3GIK A;  1VQO V;  1HNW B;  3EVK A;  4MTX A;  2QB5 A;  3HKC B;  3OR6 C;  3UYY A;  4DUZ H;  1K33 A;  5BWX A;  3JD2 A;  3ML0 A;  1M4U A;  1GN4 A;  1UC9 A;  4MTO A;  3JAK B;  5DIS C;  1IYD A;  4LF5 B;  3ABL B;  2Z5U A;  2J6S A;  2EJ0 A;  4O4H B;  2X6B A;  4HNT A;  3MDS A;  1ZWI C;  1VQ7 V;  2COI A;  4U7N A;  1Q3E A;  3FB5 C;  2XAG A;  3O9O A;  4A3G G;  4ICG A;  4DV5 H;  1W96 A;  3ZRX A;  4BW9 A;  4R7C A;  2CW7 A;  5DG7 A;  2JA5 A;  2QKA A;  3A8T A;  3AG1 C;  5J2T A;  4X65 O;  3OUU A;  5A2Q N;  3HR0 A;  5LMN O;  3G67 A;  1MMM A;  4X1Y A;  4EEQ A;  1AP6 A;  5DAA A;  4DR5 B;  2GTA A;  3K0D A;  3PZP A;  3RYC A;  5KFR A;  5LP6 C;  3OW2 U;  3OM3 B;  4LR3 A;  4IIJ F;  3GQC A;  1XNR O;  3LNM B;  2EIN C;  4PA9 A;  4PDL A;  5KFL A;  4QW9 A;  4TUY F;  1EKF A;  3GTM A;  3C3T A;  5J9P C;  4DV6 O;  4FGR A;  2W6P A;  2PF4 E;  3GWK C;  3N2G B;  4QWA A;  3TEK A;  3KCX A;  2KQX A;  4O2A A;  4LFC O;  1N0N A;  4FU0 A;  2PN1 A;  4MV1 A;  5I5W A;  1P7B A;  5DGI A;  2YRX A;  3NR7 A;  3MWE A;  2E75 B;  1NKD A;  1EHI A;  1S03 G;  1HWY A;  4Z1V A;  2ATK C;  2XOK G;  3H01 A;  2YXL A;  3U11 A;  1HR0 H;  1JXL A;  4JI7 B;  5KFE A;  4ZOL F;  5BMV A;  3ZRW A;  3HPL C;  1JDB B;  4F4Y A;  2Z3Y A;  3H0G G;  3ZRV A;  2JS3 A;  3LSS A;  2OTL V;  1XMO H;  3GTK A;  3K0G A;  4Q4D A;  3Q1K A;  5CA0 B;  4QJF B;  3LDC A;  2E5L O;  4MTE A;  4LFA H;  5IY5 C;  4R50 A;  2WLL A;  5BY1 A;  4QWD A;  3G8D A;  1MSW D;  3UCS C;  4B3S B;  2Q4P A;  1GN6 A;  1IBL B;  1EN5 A;  3TY8 A;  1RM1 B;  5DG8 A;  4W4L A;  2VQE H;  1Z2P X;  1M57 C;  2FE3 A;  4K6N A;  1FXH A;  4NXM H;  1V54 B;  4DV0 B;  4ZI7 A;  1M9N A;  1YTF D;  5BMV F;  4O4L A;  3B8N A;  4JI2 B;  2XUM A;  3QZ8 A;  5CM0 A;  3TW7 A;  4YJ2 B;  2XD4 A;  1YF2 A;  4DL5 A;  1M93 A;  1OHH G;  2V1D A;  3W1B A;  2FYU H;  4MVZ A;  2VRZ A;  4O2A F;  5KG6 A;  1MNG A;  2BCC H;  2CQY A;  4IAJ A;  4ECQ A;  2VWK A;  1KT8 A;  4UVB A;  2PYJ A;  2P7T C;  2DLN A;  3N6R A;  3ETE A;  4I0X B;  3LML A;  3BVO A;  3EPI A;  5JQG B;  4JI8 H;  4J10 A;  2Q8V A;  4K0K B;  1LUV A;  2BOC C;  2R92 G;  1TVK B;  4M0J A;  1Y1V A;  3PO3 G;  4O84 A;  1O9G A;  3VMM A;  3OEE G;  5JH7 A;  4DR6 B;  4X8A A;  3H1I H;  5JVD A;  3WG7 B;  3T4Z A;  1G6U A;  2WPD G;  1JVM A;  1B6S A;  4O7Z A;  1IZ3 A;  4Q6G A;  2W70 A;  1IX9 A;  1MZB A;  4RB3 C;  1DLB A;  4DYL A;  1N34 O;  4OX9 H;  4MVO A;  3TET A;  5JH7 F;  1M7J A;  2ITD C;  2R9A A;  4DL3 A;  2IU3 A;  2P06 A;  3Q4H B;  3CHX A;  2CGN A;  2WLK A;  4X1K B;  2B9Z A;  2FK1 A;  3ZMU A;  4XYM B;  2F1M A;  2RMK B;  2RF4 A;  3N2K A;  4FLY A;  4IWY A;  5LA6 A;  3NXS A;  4ZKI A;  2CH7 B;  3CCM V;  1LNQ A;  2W0F C;  5KA5 A;  3OHA A;  3RB6 A;  4PA6 A;  5B3S B;  1CQJ B;  2A1H A;  3RN4 A;  2HIV A;  1N36 O;  4LF9 B;  4QIW E;  1K97 A;  3QFF A;  4A3D G;  2QWN B;  5KMG B;  5FD5 A;  3ETJ A;  4A3B G;  4H13 B;  5JJJ B;  3U55 A;  4I55 A;  4DR6 O;  4ED8 A;  1Q8I A;  2LGQ A;  5FPR A;  1X4T A;  1VQM V;  4D7S A;  2R7K A;  2VQF O;  3OE7 G;  4I0X A;  3V4Z A;  5BZB A;  1K1S A;  4E2L A;  1WAZ A;  4DR7 O;  4JAS A;  2F95 B;  3GII A;  1OV9 A;  3K58 A;  5LGU A;  3J81 N;  4R7R A;  1NI8 A;  2R85 A;  3AG4 B;  3PR5 B;  4IRC A;  3U9T A;  5L1L A;  3T2M A;  1BNC A;  3ORQ A;  5IJ9 B;  4A93 G;  2RQ6 A;  2IW5 A;  4JI4 B;  3AG3 B;  5IYD O;  2JA7 G;  3ABU A;  2Q5Z A;  1XL6 A;  2N05 A;  3L4J A;  3W7U A;  3JRX A;  3PFF A;  4PDB A;  3BCC H;  1FKA H;  3RYH A;  2GUZ A;  4IZO A;  2WAM A;  3RGZ A;  2DN9 A;  3LWB A;  4MV9 A;  1DAA A;  3BHP A;  1GLV A;  3JRW A;  2F43 G;  4DL6 A;  4XDJ A;  2RDJ A;  3AG3 C;  2W71 A;  2GUZ B;  1VP7 A;  4Q44 A;  3EXA A;  1Q7Y W;  4CH5 A;  3SJA C;  5ITZ B;  1EKP A;  3J80 W;  5CE8 A;  4DR3 B;  5LXT B;  2VPS A;  2R92 A;  1BL8 A;  2UXC B;  4YHH H;  5KS8 A;  3BPZ A;  2X5R A;  2Y0S E;  3SJC C;  3RBD A;  4Z2W A;  3KAK A;  1Q81 W;  3O65 A;  2R93 G;  5KT2 A;  1LUW A;  4I9Q A;  3PW5 A;  1SF9 A;  4DR4 H;  1NU1 H;  5L3C A;  4DAA A;  5CR5 A;  2DWC A;  3OGC C;  2VA2 A;  3B40 A;  2UU9 H;  4ZHQ A;  2EJR A;  1RSO B;  4FM1 A;  2WLL B;  1QU7 A;  3ZHT A;  4LF5 H;  3ZS8 C;  1S3J A;  1GYF A;  2UU9 B;  5JQG F;  5KLV H;  1QNM A;  2V7Q G;  3H1K H;  5BWR A;  4N21 A;  4J0M A;  4QPJ A;  1G2W A;  4LF4 B;  2VQF B;  2W0X A;  4UUG A;  2EBO A;  4ED2 A;  3JCU Z;  4DR2 O;  3VQV A;  4NZM A;  1HR0 O;  2V58 A;  1JJ2 U;  3IAY A;  3GTQ A;  1IOV A;  1DTO A;  3GJX B;  4LF7 O;  3QO8 A;  2VQD A;  4FFM A;  3KAL A;  5A9G A;  4BXX G;  1YZB A;  1AJP A;  2P4V A;  3WU2 Z;  1W0K G;  3RV4 A;  1M57 B;  1NT2 B;  2XCL A;  1Y14 B;  5L1I A;  4J9N A;  2EIJ C;  5KAF Z;  3OSP A;  3A0B Z;  4RAI A;  5B5E Z;  5LA6 B;  1FXK A;  3CCV V;  3HKB A;  1P49 A;  3H4D A;  2C00 A;  2EIK C;  2JGU A;  4O7R A;  2CDY A;  5IP9 G;  5DQG A;  3ZED A;  3U54 A;  5JJN B;  1GO3 F;  1JIH A;  4TQS A;  1N56 A;  4JYC A;  1Y74 A;  3E2E A;  3ASN B;  1DF4 A;  4R6Z A;  4O4J B;  1K4D C;  4GZR B;  4JTD B;  1I6U A;  5JH7 B;  3GIP A;  5EC2 C;  3BAA A;  2ZT9 B;  2JS5 A;  1YEW A;  4WF9 V;  4TV8 F;  2IBZ H;  1WP7 A;  4I50 F;  4MVQ A;  2Q2T A;  4MT8 A;  1OZ0 A;  4E4T A;  4MVR A;  3R9R A;  3GID A;  2ZGI A;  3OMI B;  4X1K A;  5LOV B;  3N43 B;  2PTM A;  5FR9 A;  1I2L A;  5JVL A;  3TQT A;  3IN5 A;  1KJ9 A;  2EIM C;  4RNN A;  4O3S A;  4YIO A;  2C2D A;  2EJ3 A;  2UVW A;  3KHL A;  1JX4 A;  4HR7 A;  2NU9 B;  4LF9 H;  3SI8 A;  1K1Q A;  1IXM A;  1HNZ H;  2HVS A;  1CKN A;  1SEI A;  5EC1 C;  2XND G;  5KFH A;  3GIM A;  1RJR A;  1LR1 A;  4I50 A;  4RZR A;  4DV4 O;  5CA1 A;  5KFC A;  5KMG A;  4ECT A;  5EK0 A;  2AW9 A;  2PI4 A;  4TQD A;  1NVP D;  3CSW A;  2DPJ A;  2DPI A;  4ZHQ B;  2YZM A;  2X0S A;  1GM7 A;  1N36 H;  3OUS A;  4B3S O;  2B1G A;  2OH2 A;  3JAL A;  5D1P A;  2JEI A;  1WLE A;  4JI2 O;  4LF7 H;  1VF6 A;  2XHB A;  5DGH A;  2EX3 A;  5GTH Z;  4QWC A;  2ZNJ A;  5LGT A;  2FK3 A;  3CVZ A;  1TVK A;  4DV5 O;  3CME V;  1IXB A;  3JAM W;  1FJG O;  3EHB B;  1FJG B;  1THZ A;  5DQI A;  2CZG A;  2QK4 A;  1YVW A;  4EGJ A;  4YQW A;  2IJI A;  4DR6 H;  1NQT A;  3DSQ A;  1XDN A;  1R6N A;  1TAE A;  3AG2 C;  1OCC B;  1NR1 A;  5LMN H;  2UXD B;  3H40 A;  4NLG A;  3AK1 A;  3OMN B;  3H1L H;  3L72 H;  1XNQ O;  5KFQ A;  1S76 D;  4DV1 H;  3K06 A;  2W7O A;  3MWD A;  3ASO C;  4JXU A;  3KXY T;  3K03 A;  2WLI A;  5BR8 H;  4O7W A;  5AG2 A;  5KAI Z;  2R87 A;  1XNR H;  2QEX V;  2DAB A;  2LO1 A;  2DWE C;  1PL0 A;  2VWJ A;  3CJH B;  3L2P A;  1IBM H;  4BIO A;  3HKZ E;  4JI5 H;  1GM8 A;  4FLW A;  5DMX A;  1N4C A;  1Y67 A;  3GTP A;  4DV6 H;  2AGP A;  1AI5 A;  2B63 A;  1CKN B;  1GO3 E;  4QE9 A;  3LDE A;  5EZY A;  4O3N A;  2GTS A;  3KRE A;  1EZ1 A;  1GH6 A;  4X64 O;  1KD1 W;  4DV0 H;  2WAQ A;  1FKA O;  2DOS A;  4B3R B;  4HAM A;  4OPA A;  5J2U F;  4NTW A;  2PGG A;  5LOV F;  3RVY A;  2X0L A;  3GV8 B;  1VQ4 V;  2PZS A;  1A3G A;  4LC1 A;  1U97 A;  4J9Y B;  1VF7 A;  4Q8E A;  4XDL A;  2ZQM A;  3ZRW B;  3ABT A;  2SCU B;  5B1N A;  5JUM A;  3RYI B;  1COW G;  4ZI7 B;  1XMO B;  4O7S A;  1DK1 A;  1R9T A;  3HKZ A;  4X62 B;  2Y69 B;  4X65 B;  4U7C A;  2R7Z A;  2NUA B;  3I56 V;  4NXN B;  4FK5 C;  4O3R A;  4H44 B;  3RR5 A;  1OWT A;  4XZ3 B;  3LNN A;  2I8C A;  2WAQ E;  2UXC H;  1WCM A;  4FLT A;  1FJG H;  4WFH A;  1MZF A;  3T5H A;  2P67 A;  4UCR A;  3F7Y C;  3TIN A;  3BY6 A;  4MW8 A;  2XAS A;  5L3D A;  4LF5 O;  3BAB A;  1VS0 A;  4UUJ C;  2AHY A;  2YS7 A;  4RAY A;  1SQP H;  3IC9 A;  1ORQ C;  2H3O A;  1KKD A;  1MZE A;  2W9C A;  2FB5 A;  1Q86 W;  2B5U A;  2HDK A;  4JI7 H;  4DUY O;  2ZM6 O;  2FPI B;  3OTO H;  4DW0 A;  2Q7E A;  2ZXW B;  2PBZ A;  2F66 C;  2NU6 B;  2ARH A;  1C30 A;  4FIP C;  3SPC A;  3SJB C;  1GGO A;  2CNU A;  2ASD A;  4QW8 A;  3TXQ A;  1CKM A;  2IU0 A;  1PNM A;  5IWA O;  2I80 A;  5I5Y A;  5IYC G;  5KFO A;  2IH3 C;  1KEC A;  1UNN C;  3AEI A;  4JF3 A;  3JZF A;  1NR7 A;  3Q8R B;  4RB1 A;  4OXS A;  4DL7 A;  2CNQ A;  1Y1V G;  1PV0 A;  1XMQ O;  4ECS A;  1BQ0 A;  3DTU B;  3CMA V;  1BGY H;  1M90 W;  4GKK O;  4AQY H;  2JGD A;  4X66 O;  5KG4 A;  5B66 Z;  3CEI A;  1WA8 B;  4ED0 A;  4PV1 B;  1VAJ A;  3MJF A;  2MK3 A;  3RB3 A;  3E5N A;  4F4X A;  1Z5W A;  1QR8 A;  2W8L A;  2R7Z G;  3M4I A;  5CA0 A;  5KFY A;  2NLJ C;  2F23 A;  1QVG U;  3RAQ A;  3OMA B;  3N2K B;  2W6M A;  1SZT A;  5JJE B;  4I4T B;  1NVP B;  4BIU A;  2X6C A;  1YJW V;  4JI4 O;  2ZDQ A;  3PW0 A;  2YXH A;  1W93 A;  3QWU A;  4G27 B;  3AW8 A;  1QR9 A;  2IM9 A;  5H6Q A;  2HGS A;  1TUB A;  5DN6 G;  2IJK A;  2LFR A;  3QTC A;  3MFI A;  4JI6 H;  4DUZ B;  2ABJ A;  4GT1 A;  2QE7 G;  3GTL A;  4B7K A;  4YY3 B;  4LFC H;  4FFK A;  3VA7 A;  2QF7 A;  1NTZ H;  1EZV H;  3VQY A;  1KJQ A;  5KFS A;  3TXS A;  1Q5O A;  1HNX O;  5LGN A;  3CQZ A;  4RWU A;  3KCY A;  3AG7 A;  4MTG A;  4YJ2 A;  2WDT A;  2ILM A;  3TCU A;  1MG1 A;  3JD3 A;  4JI8 B;  3GLK A;  3P3P A;  1FXV A;  5KHJ A;  3OR7 C;  5BWT A;  5B1O A;  4A2B A;  3L4K A;  1UPG A;  3WWJ A;  5B1B C;  1SET A;  3MHH C;  5BR8 B;  1VQ8 V;  5BPH A;  3Q8S B;  1KQS U;  4QNH B;  2UUB H;  5GW7 A;  4O4L B;  4LSX A;  3AG4 C;  4CH4 A;  4ZIB A;  3T1C A;  2VUM A;  1PL4 A;  4JYY A;  4NZN A;  4HBN A;  1QLE B;  4G28 B;  3RYC B;  1WR2 A;  5K2M A;  4IT5 A;  4TQR A;  2VA3 A;  1B6Q A;  1S72 V;  4KUM A;  2KSD A;  5KFF A;  3CSX A;  1IBM O;  4O2B F;  1SA0 A;  2V4D A;  3JD0 A;  1O9H A;  4CMF A;  1KJI A;  3JSN A;  4YHH O;  4EFE A;  4FZ0 A;  1ZL8 B;  2M6Y A;  4R8C A;  3SGI A;  5B3S C;  3T7A A;  3EYY A;  2W7P A;  3RYI A;  1BCC H;  2YIB D;  2QM7 A;  2WA3 A;  2UVV A;  2WE6 A;  1D2D A;  3BQ0 A;  2OIE A;  4UCU A;  4WHX A;  4IR9 A;  4AQY B;  4K8Z A;  4GC6 A;  1DF5 A;  3SR2 C;  2V4R A;  4FM9 A;  4A3L G;  2D3O W;  3FAV A;  3RJ0 A;  1PNL A;  2WSS G;  1BGW A;  2NVY A;  5LMU O;  5GON F;  3L75 H;  4I4T F;  2F93 B;  1G1X B;  3K79 A;  3MHS C;  1H2L A;  5LHG A;  1R73 A;  1RK5 A;  2DYS C;  4PI2 A;  2GQS A;  5JQW A;  4ECV A;  1RK6 A;  3PVX A;  3JAW A;  4B7E A;  5LXT F;  3IG0 A;  2HHH O;  5FL7 G;  3GB8 B;  4RU9 A;  3R65 A;  3ZN1 A;  4B3M O;  2RN9 A;  4J9P A;  4RO2 A;  1H38 A;  2P4K A;  3SYP A;  3CPW U;  5LP6 A;  3JD1 A;  4J9K A;  1I5X A;  3G8C A;  5B1B B;  3H0G A;  3K3V A;  3UT5 A;  4J7Z A;  4DR5 H;  3PN1 A;  1TWG A;  5C3E G;  3UQ8 A;  3QQM A;  5K1X A;  2LQT A;  4O81 A;  2QTS A;  4B3T O;  3OHB A;  4AYB E;  2UXC O;  1JA8 A;  3PO2 G;  4DV7 H;  2W57 A;  2Y4U A;  3H4B A;  2DYR C;  1E79 G;  4RNM A;  4X65 H;  4FVM A;  3OTO O;  5EYP A;  2ZM6 H;  3QF7 A;  3FFQ A;  5JWP A;  2HG5 C;  1SES A;  4QIW A;  2Q0O C;  2WA4 A;  3SYA A;  4I9W A;  4WFG A;  1F4M A;  5C5J A;  5H9C A;  1SER A;  2W6Q A;  4MAM A;  4QJF A;  1Q6U A;  5I5V A;  4TT3 G;  5H2F Z;  4CS3 A;  5I60 A;  4A3E G;  4GUN A;  3A2F A;  4RUE A;  5HBR B;  4IR1 A;  1XHX A;  2VUM G;  2QA4 V;  1WB8 A;  5IWA B;  3H3V H;  4NB5 A;  3E8B A;  2DZD A;  4QE7 A;  2DQ3 A;  1A0I A;  1VQL V;  2BOB C;  1VF6 C;  1YI2 V;  4O4I B;  1S77 D;  2VOB A;  2ZM6 B;  2QM4 A;  2L6L A;  3CCR V;  4AYB A;  2NU8 B;  2PY5 A;  5KFB A;  3SDL A;  4Q0Y A;  3R66 A;  4MSW C;  3T9D A;  3SPG A;  4U3J B;  4LBE C;  4X66 H;  4H33 A;  5EBW C;  4UCT A;  4YAK B;  4IIJ B;  1K4C C;  1VMG A;  1XNR B;  1E1Q G;  1E4F T;  2R93 A;  5I5X A;  2EIJ B;  5KG3 A;  4R8U A;  3ZCC A;  4DR7 H;  4Z1M G;  4GYC B;  2YW2 A;  1BS3 A;  4LF8 B;  3FYE B;  2Q7H A;  5F9L A;  5E79 Z;  2YDE A;  5LYJ B;  3HKC A;  1I7N A;  3ETG A;  1XMO O;  1RP3 B;  1W0J G;  2YYA A;  3UM7 A;  2V9W A;  4LF8 O;  1T36 A;  1Y74 B;  2CUG A;  3F5W C;  2KG7 A;  4FLV A;  4NXM O;  5KFX A;  4QSH A;  2FK2 A;  2IA6 A;  2DWD C;  4NXM B;  2ZIN A;  1H2M A;  4ED1 A;  4NXN O;  1KEE A;  1R6T A;  4O4H A;  4KL1 A;  5K3W A;  5IY5 B;  2YEV A;  3K57 A;  4DR1 B;  1M0T A;  1JCH A;  1N34 B;  1HNX H;  3X2Q B;  4X62 O;  3FYI B;  4CKE A;  3T9C A;  1SQV H;  1L0L H;  2W8K A;  4D6T H;  5BWW A;  2CNV A;  4NYK A;  2UVR A;  1JX9 A;  2ETN A;  3FKS G;  3TJT A;  4FFP A;  2YZN A;  2EJ7 A;  3TII A;  4B08 A;  4FFB A;  4GX5 A;  4JI0 O;  1EFR G;  3WWI A;  3MR2 A;  1GM9 A;  4X64 B;  5C1O A;  2FTK A;  3MAQ A;  1Y1W G;  2UUB O;  4CZZ A;  2E2H A;  3RFR A;  4ECY A;  3K9S A;  3K59 A;  2CKZ B;  2AU0 A;  1I7F A;  2Q69 A;  5D8D A;  3RFC A;  3VOU A;  5DEC A;  5KFU A;  4EQ5 A;  2BQ3 A;  2JA7 A;  1Y66 A;  4F4W A;  5A2Q W;  4HNU A;  3ETQ A;  5KUM A;  2Q68 A;  5DQH A;  1JFF A;  5F9N A;  3ZHS A;  3CRA A;  2IH1 C;  3NUA A;  1T5E A;  3SJQ C;  4PZ6 A;  4ZQI A;  3N27 A;  2WYO A;  3P30 A;  2AGO A;  3QG5 A;  4LF6 O;  4RQE A;  1TWC A;  2HHF A;  1IBK O;  5F2V O;  3Q8Q B;  5KFD A;  4M9U A;  3JAR B;  2AHZ A;  1TWH A;  5EOY A;  3JZI A;  3M9M B;  2FML A;  1S0O A;  2Q0A A;  1FS0 G;  3ZMS A;  1A0G A;  1PM9 A;  1XUQ A;  4IHJ A;  4FMT A;  4FZ1 A;  4JV5 O;  2GBO A;  3UO2 A;  4F6R B;  1QBZ A;  1AR5 A;  2YIB A;  3G4S V;  1YCI A;  3L9D A;  2AQ4 A;  2UUC O;  3HT5 A;  2JEG A;  2JVD A;  3TY5 A;  2H8P C;  2D2C B;  3S24 A;  3ORR A;  4TV9 A;  2ZR2 A;  4KXR A;  1OCC C;  2I87 A;  4NXN H;  3KTM A;  2UXB B;  4HN2 A;  3ZMZ A;  4YY3 H;  5EIB C;  1R6K A;  1GSA A;  4FE2 A;  3UO3 A;  2F4V O;  4U6P A;  1H2N A;  5E25 A;  4GX1 A;  4MV7 A;  1SCU B;  1QCE A;  2UXB H;  3H1H H;  2C28 A;  5JVD B;  2BTO A;  2VQE B;  3OAA G;  4B3T H;  3V6J A;  1BHB A;  2VUG A;  1S0M A;  3ZHR A;  1JDE A;  2W9A A;  2VR1 A;  1RYR A;  4TWK A;  1YIJ V;  3K08 A;  2CGO A;  1FFX A;  3ZRS A;  2W6N A;  3D36 C;  3CC4 V;  4J42 A;  4I55 B;  2ZIM A;  2R8I A;  3WG7 C;  3TW6 A;  4EKW A;  1NJI W;  3VOT A;  3ZHQ A;  3FX7 A;  4PEL A;  3HOV G;  4LCU C;  2HJW A;  3GIQ A;  2VPQ A;  4YHH B;  4KFM A;  4QWE A;  2YIA A;  3KG2 A;  2ZJT A;  4DR3 H;  3E8H A;  1HW7 A;  2EZP A;  4RUA A;  5D5Q A;  3CS5 A;  1QLN A;  4A3J G;  3RBE A;  5JCO A;  4EYH B;  2X7R B;  2JIZ G;  2M7W A;  4LNU B;  4O7V A;  3DF7 A;  2YID A;  2GSM B;  4GCZ A;  1HR0 B;  4LFA O;  2E3C A;  2C2E A;  4A2A A;  4YR0 A;  1TUB B;  2PVP A;  2CE4 A;  3KZI Z;  1ZLZ A;  2W9C B;  4JV5 H;  4PZ8 A;  2HG8 A;  3SNO A;  1EKV A;  3STZ C;  4LF4 O;  5LYJ A;  2NVX A;  3HKD B;  4UV8 A;  2J6U A;  5B1A B;  4BWA A;  4DR2 B;  3T9A A;  2DIK A;  2QWP B;  4GLW A;  2GHY A;  1HNZ B;  3TK1 A;  1B06 A;  4LF7 B;  4C7U A;  3G6X A;  2W6O A;  3JAT B;  4LWS B;  4WFF A;  4DXW A;  4JI6 O;  4O82 A;  4TVI A;  5HFM A;  3L73 H;  2R82 A;  2OT5 A;  2XAQ A;  2F4V H;  4CS4 A;  2EIL B;  5KFK A;  3RT3 C;  5LHI A;  4WBN F;  4BBS G;  3DC6 A;  1VQN V;  1B04 A;  2WB1 A;  5EYP B;  5LHH A;  4K3A A;  4XBF A;  2XT9 A;  3ABM B;  4IHJ F;  4JI1 O;  5KT6 A;  3CCS V;  5GON B;  1EUC B;  5KFM A;  1BT8 A;  4O3O A;  3NBY B;  3W1G A;  4PDM A;  3V4S A;  4GKJ O;  5CA1 B;  3U0Z A;  1I1L A;  5TIS Z;  2LW7 A;  3I4N G;  1QVF U;  1XOU A;  4MV8 A;  3W5O A;  1V54 C;  2A79 B;  4AHC A;  1KBH A;  5BYB A;  1P7G A;  5LYJ F;  2RGV A;  4JV0 A;  4B3M B;  3R5F A;  1N32 B;  4K0K H;  1JQ0 A;  2ZDG A;  4DR3 O;  5KHK A;  2Z02 A;  3E8G A;  2QKS A;  4GLX A;  1J95 A;  3LP8 A;  2JA5 G;  1PK8 A;  1EZJ A;  1K5Q A;  3WB2 A;  4OX9 B;  2Y48 A;  4A3K G;  1XMQ H;  5D1O A;  1VQK V;  5BWV A;  3LUT B;  2J9G A;  1XEQ A;  5IYC O;  1L0N H;  2ZXW C;  4MS2 A;  2ADQ B;  3Q4H A;  3QZ7 A;  1F4N A;  4G3I A;  1S97 A;  4J9O A;  5IJ9 A;  3DXR A;  4WFE A;  2RGR A;  1CP9 A;  5I5S A;  2WTF A;  3D8C A;  2YUA A;  4DRX A;  1MA1 A;  1M56 B;  1BJT A;  4DV3 H;  2K9P A;  5C8Y A;  2BE3 A;  3FB6 C;  5KHH A;  3CE2 A;  4DK0 A;  4JYA H;  1AI6 A;  3SYO A;  3APO A;  3F7V C;  4JI3 H;  4WD3 A;  2E76 B;  4EBE A;  4CH3 A;  3K5N A;  4O7L A;  3J81 W;  1N36 B;  4KP4 A;  3RWR D;  2R7M A;  2N04 A;  2UXD H;  3E8F A;  3CCQ V;  1TWA A;  4JI2 H;  4O2B A;  3DAA A;  5LP6 B;  1IBK H;  1Y4M A;  3OSN A;  3KAJ A;  5IP7 G;  3HKD A;  2ZE8 A;  5KG0 A;  2FL4 A;  4PDV A;  4MTD A;  3TIG A;  1Z2N X;  1RJP A;  1OCZ C;  1A32 A;  1KTA A;  2AZ0 A;  1H2K A;  4FS1 A;  5KFV A;  1N8R W;  4MVU A;  4DV7 B;  1YDX A;  3ETD A;  1VBG A;  2PYL A;  2CTP A;  3G71 V;  3DTF A;  2HJD A;  4RB0 A;  4MVS A;  4DV1 O;  2R8H A;  4HZ3 A;  1BE3 H;  3SYC A;  1I1M A;  4APM A;  1AN7 A;  5KT7 A;  4CS2 A;  2ZDH A;  1EN4 A;  3ABK B;  1HNX B;  2XAH A;  5I5U A;  1SQQ H;  1TA8 A;  4DL4 A;  2NNU A;  3CCL V;  4AIL C;  4W4K A;  3Q2O A;  4YY3 O;  2Q7D A;  3T1H B;  2W6Z A;  3HXL A;  4JZG A;  3UFX B;  2YS6 A;  2M05 A;  4IRD A;  5FD6 A;  3RB0 A;  4H37 A;  4R8U B;  5CB4 F;  3VBB A;  2XCA A;  1CQI B;  3ASO B;  2YU9 A;  1S9F A;  4YB8 B;  2DMX A;  5IE9 A;  2BQR A;  3HKE A;  1I1K A;  2OLS A;  2ZE7 A;  5KG2 A;  1YHQ V;  1AJQ A;  2QWQ B;  3TY9 A;  5JVD F;  1EN6 A;  2A06 H;  1KU9 A;  2Q9L A;  2ZR3 A;  4FFO A;  3RF2 A;  4UCV A;  1BMF G;  1KUQ A;  5CAE B;  3BFR A;  1GTO A;  4MW3 A;  3FD9 A;  4LF6 B;  5IYD G;  4ED3 A;  1U96 A;  3D3I A;  1Q6I A;  3B77 A;  1WPB A;  1AJN A;  4RCN A;  4E6N A;  3EPG A;  4LFB H;  1VQ6 V;  1KP2 A;  1K83 A;  2G38 A;  1SS3 A;  2JK5 C;  4FJC C;  4KHP B;  1N33 H;  1UJW B;  1I2K A;  1S68 A;  4LMY A;  2XAF A;  1A48 A;  1P4R A;  1FXK B;  4TV9 F;  3VQW A;  4J7J A;  1I3Q A;  3WO1 A;  4LF4 H;  3GWO A;  4I5S A;  2E5L B;  2EIL C;  5KFA A;  5GTI Z;  1Y76 B;  2YCH A;  2OCC C;  3WFV A;  2R70 A;  3AK3 A;  1PKX A;  1IBL O;  4QWB A;  4TOI A;  3CCU V;  4DR1 H;  4A5U B;  3SPJ A;  4ECX A;  3T5L A;  3RVZ A;  2R7N A;  4DV4 H;  2QDO A;  3CEB A;  1SQB H;  4NKG B;  5BPF A;  3W7S A;  1JR9 A;  4YJ2 F;  3C3S A;  2DJV A;  1IYE A;  2RJZ A;  1ET0 A;  4PBC A;  1T94 A;  3MR5 A;  2VQF H;  4N23 A;  3VPC A;  5IWA H;  1KP3 A;  1JPX A;  3BG5 A;  4TSF G;  1YTF B;  3KHH A;  4HQ6 A;  4B3S H;  3PW7 A;  2ATL A;  4RAZ A;  4JPR A;  3T1H O;  4L1K A;  3ABM C;  5IJ0 B;  1FD9 A;  1ZTE A;  4FM2 A;  3GIJ A;  4ZOL A;  1JLL B;  5EDW A;  1J5E H;  1R3J C;  1EUD B;  4LH6 A;  3HOX G;  4DR5 O;  3HOY G;  2WB1 E;  3TGU H;  1F7Y A;  4O7N A;  3JAL B;  2KG7 B;  3BQ2 A;  1AUV A;  5LMU H;  2BQU A;  1SRY A;  2R8K A;  1JFF B;  4NYE A;  4CC5 A;  2QR4 A;  4LF6 H;  5L3B A;  3U0G A;  5B1A C;  5J2T B;  2YSU B;  5LL6 Y;  3OT7 A;  3HOW G;  2HGW A;  3MWM A;  1M5I A;  3UZB A;  2IJJ A;  3B8M A;  2Q67 A;  2A3Q A;  4UXN A;  5JQG A;  1KBL A;  2YXY A;  3PW4 A;  4UFZ A;  3KYH C;  3I5D A;  4OPH A;  1PX2 A;  2AXT Z;  2X6A A;  3F5T A;  4EB6 A;  1OBD A;  4P30 A;  2COJ A;  1ZET A;  4EEY A;  2KB1 A;  5HV6 A;  2FB9 A;  4C5B A;  4ECZ A;  4FS2 A;  3CYO A;  1E4E A;  2W9B B;  1GK9 A;  3K3W A;  5CN0 A;  2AGA A;  2R72 A;  1VQ9 V;  4JAA A;  3MR3 A;  4ECW A;  2XTA A;  1H8E G;  3CWB H;  1YXB A;  2ODM A;  1US6 A;  1NZ6 A;  1XDC A;  5IYB O;  5EZY B;  3JD4 A;  3RYF A;  2RDC A;  3HKE B;  5KX5 B;  3T9B A;  3U10 A;  4DR2 H;  5C1P A;  4JYA O;  2HFE C;  3T5J A;  4G2K A;  3NC0 B;  5CBF A;  3CXH F;  3A0H Z;  3HB9 A;  1WCM G;  1OJH A;  4YJ3 B;  4UCO A;  1CEZ A;  1XNQ B;  1EM1 A;  3H20 A;  3GDE A;  1KKC A;  4MA5 A;  4J7K A;  2QKC A;  2YZG A;  1S5H C;  1VAR A;  1XQ8 A;  3M99 B;  1JJO A;  1QQC A;  5KHI A;  1CPY A;  3JCZ A;  4CH6 A;  2WLH A;  4J9Q A;  4IYI A;  2ZCE A;  4MTF A;  3CXC U;  3QNE A;  3JAR A;  2NR5 A;  4JUZ A;  2LJ2 A;  3Q8P B;  4X20 B;  4IRK A;  3E86 A;  3ZHV A;  2ZDI C;  5FNV B;  1I94 O;  2ZNI A;  3RUP A;  2C2R A;  3RGX A;  2YC0 A;  3T99 A;  1FAF A;  3SE7 A;  1R1B A;  1SC5 B;  3OTO B;  3HBL A;  2AGQ A;  1ZUQ A;  2GQR A;  3GVM A;  4DRX B;  4PHZ A;  4MV6 A;  3PR4 A;  2B63 G;  3HOU G;  4DV5 B;  4JI0 H;  1WJZ A;  5IDJ A;  4DV3 B;  2QWO B;  4JI1 B;  3CP1 A;  5CA0 F;  3GTJ A;  1J5E B;  1HP8 A;  2FLL A;  2LGW A;  5HNE A;  4ECU A;  5IT9 W;  3AG1 B;  4LP8 A;  3SPH A;  3P3N A;  1S5J A;  3ZIA G;  5J2U A;  1S0N A;  3T1Y B;  1Z2G A;  2DQ0 A;  1NH2 D;  5IJ0 A;  5LMU B;  3B2E E;  1OCO C;  1Z5V A;  4WCE V;  4J9M A;  5H80 A;  4F4L A;  3W7W A;  2HHH B;  2UUA H;  2YIC A;  2LP7 A;  4TM5 A;  4FLX A;  4DV4 B;  3RV3 A;  4Y8V B;  5LA6 F;  2CK3 G;  4AQY O;  4GKK H;  4EBC A;  4HNA A;  2FKL A;  1WPX A;  2P6J A;  4NVP A;  4IGG A;  4PD4 F;  2J6T A;  3W7T A;  1X59 A;  4CKC A;  1XIL A;  2ZD9 A;  3L70 H;  3CCJ V;  2R8G A;  4JV2 A;  4HNA B;  3UZO A;  4P9O A;  1OCZ B;  1JOY A;  5CBH A;  1SQG A;  4MV4 A;  5KUK A;  3B4S A;  5H6R A;  3BA9 A;  3M9N B;  2O03 A;  3UT5 B;  4YIP A;  5J2T F;  3MFH A;  1B33 N;  2UUA B;  5KFJ A;  2HHH H;  2DE0 X;  4QPK A;  1ULZ A;  2WLI B;  4XX0 B;  1NBM G;  1DV2 A;  3FMA A;  3RYF B;  4O7Y A;  3J7A U;  4YJ3 F;  2QYZ A;  4DV2 O;  5CB4 A;  3OGI B;  4DK1 A;  1M56 C;  4I4T A;  2HVK C;  2CAZ C;  3G80 A;  3WB0 A;  2MCT A;  2W9B A;  3JAM N;  2BTQ A;  1GSH A;  2PMZ A;  2HR3 A;  5DED A;  3AX6 A;  4DV7 O;  1I7L A;  1I50 A;  2KKW A;  4J11 A;  3C90 A;  3VNN A;  4JZ2 A;  2Q73 A;  1ZAU A;  4O4J F;  3LQS A;  5DLG A;  4RQF A;  3N6X A;  5L9X A;  2EIK B;  1RJQ A;  4E4E A;  4YXW G;  4A3C G;  3RB4 A;  4FPP A;  5C93 A;  2CTR A;  3BQ1 A;  1XL4 A;  2ZE5 A;  4BAY A;  2HLD G;  3T1H H;  1MAB G;  2MW2 B;  1XHZ A;  3CD6 V;  4HNV A;  5EWF A;  3G6V A;  1W2B U;  3R5X A;  3OUF A;  5BMV B;  3ZX6 A;  3G6Y A;  3I55 V;  1S0V A;  3RYH B;  1Y76 A;  3WB1 A;  4OX9 O;  3LSQ A;  1BZK A;  3TQ1 A;  1K3E A;  1BXR A;  4FBU A;  1UC8 A;  3ICX A;  4UV9 A;  4IIJ A;  3G6E V;  3T4D A;  4CBC A;  1E4E B;  3N41 B;  2Y0I A;  5C8Y B;  2UU9 O;  2NU7 B;  3E89 A;  2UUC H;  4DV3 O;  2JJ1 G;  5IYZ F;  3S3W A;  3M9O B;  2Y0P A;  4X89 A;  2B1I A;  5DM6 V;  4P2Z A;  4ETS A;  2ZE6 A;  4FFL A;  1M6V A;  4LNU A;  3IFX A;  4GKJ B;  5KX5 A;  4WFA V;  1IBK B;  5FLM G;  2GV9 A;  2Z0A A;  2ZKO A;  5KFZ A;  1WB7 A;  3R5H A;  3M7M X;  2R7L A;  1F23 A;  4CE5 A;  1OBG A;  1P84 F;  4RZQ A;  4JI3 B;  1OCR C;  3SYQ A;  3V6H A;  5DGB A;  1B3Q A;  2YL2 A;  4UB6 Z;  4B3R H;  3T54 A;  4Q43 A;  1IUR A;  5FNV F;  2FLN A;  2A9H A;  3BRC A;  3JYC A;  4LWS A;  4X20 A;  2JA8 G;  4X66 B;  1KJJ A;  3CB2 A;  1NTK H;  4RNO A;  1CE8 A;  2CTQ A;  5L1K A;  1ENV A;  4O86 A;  1P8L A;  4DV6 B;  5ITZ A;  2HGX A;  1ARO P;  2Y69 C;  2COG A;  1AI7 A;  2EIN B;  3QO5 A;  2UUB B;  3FB7 C;  2YS8 A;  4FLU A;  4DUY H;  4X62 H;  4JI1 H;  1AR1 B;  5KX5 F;  2P5O A;  4JI0 B;  3JZ6 A;  4J41 A;  3J7A K;  2CTW A;  1BSM A;  2BR0 A;  4U7O A;  4PJ0 Z;  4X1Y B;  1N48 A;  2P0A A;  3FKI A;  3BAC A;  2HEP A;  4MV3 A;  4J9S A;  4J9Z B;  5CB4 B;  5L1J A;  5FPO A;  1A9X A;  1FVI A;  2Y4R A;  1KB9 F;  3E35 A;  4O83 A;  4GKJ H;  4DQN A;  3RTX A;  3N42 B;  1V9P A;  3E22 B;  4LH7 A;  1QLE C;  1B6R A;  2FPG B;  4C2M A;  4PA4 A;  3G6B A;  1N33 B;  3ABL C;  4KHP H;  2A7W A;  2ADP A;  1WSC A;  5FJ8 G;  4FLZ A;  3LSU A;  1VKZ A;  1GAX A;  4JI5 O;  1GSO A;  3ZMT A;  4HYK A;  2E5L H;  4RUC A;  5C4X G;  2QM8 A;  1R3K C;  2YI9 A;  1V51 A;  3HOZ G;  2EIM B;  2JEU A;  3DXR B;  4RUF A;  2A0L A;  1HNW O;  1SFO A;  2PI5 A;  3D3Q A;  4BW5 A;  3STL C;  2EJ2 A;  2ZIO A;  2UUA O;  2UXN A;  3CRM A;  3E83 A;  5KA6 A;  1WH2 A;  2JJ2 G;  2JGD B;  4QIW F;  4LFB B;  4B3R O;  2ASJ A;  2NN4 A;  3D36 A;  5BYA A;  2R9R B;  3N8D A;  5FLX W;  4A3F G;  2FLP A;  1M0W A;  5K1P A;  5KFG A;  3MR6 A;  4O4I A;  4NR1 A;  2WLM A;  4C5A A;  3DC5 A;  4I50 B;  3R23 A;  4DIM A;  2FKX A;  4O2B B;  5IT9 N;  5BWU A;  3CJH A;  4UVC A;  1OCR B;  1P16 A;  3UKM A;  2GPW A;  2HKO A;  3ASN C;  2XC9 A;  3V6K A;  4X1I A;  5CA3 A;  4JAU A;  4Q20 A;  3T5K A;  1VEW A;  3BA8 A;  3NGD A;  2R9I A;  2UXD O;  4F4Z A;  4XDK A;  3GB7 C;  5JCO C;  4ZOL B;  3CRR A;  4DW1 A;  5KT5 A;  4IYH A;  4TQF A;  4O4L F;  2IBK A;  3T1Y O;  5L3G A;  2CW8 A;  1Y6X A;  3JAS A;  3T9F A;  5LOV A;  3S3X A;  4O4H F;  1GRJ A;  3RIZ A;  3AK2 A;  3RW0 A;  4JYB A;  2C35 B;  1RPO A;  3N40 P;  3CX5 F;  2HHF B;  2IP4 A;  2FMA A;  2JA6 G;  3JAS B;  3K5M A;  4UCS A;  4DV0 O;  4X64 H;  2EUL A;  4BR6 A;  4K8X A;  3HO8 A;  1JMK C;  3B09 A;  5CBG A;  2ASL A;  3CRC A;  4WFB V;  2R86 A;  4K35 A;  4I7H A;  3BEH A;  3K3P A;  1E1R G;  3DGE A;  4DL2 A;  3PJS K;  3IJ4 A;  4MA0 A;  1GN3 A;  4PA3 A;  2Q2U A;  1PNK A;  3WNZ A;  1L8D A;  1N34 H;  2YWV A;  2HIX A;  3LUL A;  4EB6 B;  3FB8 C;  4KHP O;  1ZSP A;  1NH2 B;  5DGA A;  2DAA A;  5IYZ A;  2JEF A;  4PA7 A;  1Z2O X;  4PDR A;  5KT4 A;  1HNW H;  2P22 C; 
#chains in the Genus database with same CATH homology
 4AQY B;  4K8Z A;  4OX9 H;  1D5A A;  1XI1 A;  2R9A A;  1WPB A;  3SR2 C;  4E6N A;  4FM9 A;  4LFB H;  3RJ0 A;  3CHX A;  4KHP B;  1BGW A;  1N33 H;  4X1K B;  1S68 A;  4LMY A;  2F1M A;  2F93 B;  4LFC B;  3N2G A;  3N2K A;  4FLY A;  5LA6 A;  3VQW A;  4JYA B;  4YJ3 A;  4LF4 H;  4PI2 A;  2E5L B;  2HIV A;  2YCH A;  3JAW A;  4TV9 B;  4LF9 B;  2R70 A;  4DV1 B;  3IG0 A;  1N32 H;  5KMG B;  3GB8 B;  5FD5 A;  4TOI A;  5JJJ B;  4I55 A;  1Q8I A;  4DR1 H;  5FPR A;  4O4J A;  1X4T A;  4D7S A;  5LP6 A;  4DV4 H;  4JI5 B;  1IBM B;  3K3V A;  3UT5 A;  4DR5 H;  3F8N A;  2RJZ A;  3PN1 A;  4FFB B;  2VQF H;  3UQ8 A;  2F95 B;  5K1X A;  5IWA H;  3K58 A;  4R7R A;  4DV7 H;  4B3S H;  2W57 A;  1FFX B;  1IBL H;  4RAZ A;  2BTQ B;  5IJ0 B;  2ZM6 H;  4X65 H;  4FVM A;  5EYP A;  5IJ9 B;  3QF7 A;  3FFQ A;  2RQ6 A;  4FM2 A;  4ZOL A;  3K5L A;  3JAK A;  4JI4 B;  1TGO A;  1DGS A;  1J5E H;  4LH6 A;  3L4J A;  4CS3 A;  4PDB A;  1FKA H;  3RYH A;  4DR4 B;  3A2F A;  3JAL B;  3RGZ A;  5LMU H;  1XHX A;  4MV9 A;  3BHP A;  1JFF B;  5J2U B;  5IWA B;  1CKO A;  4CC5 A;  4LF6 H;  4CC6 A;  5J2T B;  1A0I A;  4CH5 A;  2OWO A;  3SJA C;  5GON A;  5ITZ B;  4O4I B;  2VOB A;  3J80 W;  2ZM6 B;  2QM4 A;  2QJ1 A;  3MWM A;  1M5I A;  4DR3 B;  5LXT B;  2VPS A;  4WBN B;  4O2A B;  2UXC B;  4YHH H;  5JQG A;  3BPZ A;  2PY5 A;  4UFZ A;  2OYQ A;  3KYH C;  3SJC C;  3NBZ B;  4Q0Y A;  4U3J B;  4EB6 A;  3KAK A;  4M7E A;  4X66 H;  4I9Q A;  4BWS C;  4UCT A;  4DR4 H;  4IIJ B;  3C0F B;  1XNR B;  1E4F T;  5LL6 b;  2R72 A;  4DR7 H;  1X9N A;  4FM0 A;  2UU9 H;  4ZHQ A;  4GYC B;  4FM1 A;  4LF8 B;  2Q7H A;  4LF5 H;  3JSL A;  5EZY B;  3ZS8 C;  1Q43 A;  1GYF A;  3RYF A;  2UU9 B;  3HKE B;  5KX5 B;  5LYJ B;  3HKC A;  3U10 A;  1SQF A;  4LF8 H;  4DR2 H;  4J0M A;  4LF4 B;  2VQF B;  3NC0 B;  4YJ3 B;  3VQV A;  4UCO A;  4FLV A;  1XNQ B;  3H20 A;  4NXM B;  2ZIN A;  3GDE A;  3IAY A;  1KMI Z;  3GJX B;  3VQX A;  4O4H A;  3KAL A;  1XQ8 A;  4KL1 A;  4B3T B;  3K57 A;  4DR1 B;  1JJO A;  1QQC A;  1N34 B;  1M0T A;  5FNV A;  5KHI A;  1HNX H;  4CH6 A;  3N44 B;  3K5O A;  2ZCE A;  1NT2 B;  1XMQ B;  4PZ7 A;  4DRF A;  5LXT A;  3JAR A;  1ZHQ A;  1RSO A;  5LA6 B;  3THO A;  3HKB A;  4DR7 B;  1P49 A;  4D7T A;  4X20 B;  4LSA A;  2PUS A;  5FNV B;  2ZNI A;  4B08 A;  2JGU A;  4FFB A;  3T1Y H;  3RGX A;  4X64 B;  3ZED A;  5JJN B;  3MAQ A;  3OTO B;  4LF6 B;  3JAT A;  4DRX B;  4LFA B;  4PHZ A;  3RFR A;  5D1O B;  4DV5 B;  4JI0 H;  4O4J B;  4DV3 B;  4JI1 B;  3K59 A;  1J5E B;  1XK5 A;  5IYZ B;  1I7F A;  1I6U A;  4PI0 A;  5JH7 B;  3BAA A;  4EQ5 A;  2JS5 A;  1YEW A;  5IT9 W;  4TV8 A;  5A2Q W;  3ETQ A;  1S5J A;  2Q2T A;  1ZHS A;  1JFF A;  5J2U A;  3T1Y B;  5IJ0 A;  5LMU B;  3B2E E;  1Z5V A;  4X1K A;  5LOV B;  3N43 B;  2PTM A;  1T5E A;  2HHH B;  2UUA H;  4RB2 C;  4FLX A;  5KHG A;  4PZ6 A;  4DV4 B;  2WYO A;  4GKK H;  3OTF A;  3QG5 A;  4HNA A;  1SYX B;  1WNS A;  1L2Z A;  4NVP A;  3RGB A;  3JAR B;  4LF9 H;  5EOY A;  4HNA B;  1HNZ H;  2HVS A;  4TUY B;  1CKN A;  1SEI A;  2Q7G A;  2Q0A A;  1H2S B;  4I50 A;  5CA1 A;  1SQG A;  5KMG A;  4IHJ A;  1SA0 B;  2HVQ A;  4JI4 H;  2XIG A;  1I94 H;  3BA9 A;  4F6R B;  4DV2 B;  4TQD A;  2O03 A;  3UT5 B;  2YIB A;  4ZHQ B;  2UUA B;  2HHH H;  4WBN A;  1N36 H;  3FMA A;  3RYF B;  3JAL A;  5D1P A;  2JVD A;  3TY5 A;  3S24 A;  3JAW B;  4TV9 A;  5D5P A;  5CB4 A;  4LF7 H;  4NXN H;  2XHB A;  2UXB B;  4DK1 A;  2EX3 A;  1SKV A;  2ZNJ A;  4I4T A;  4YY3 H;  2CAZ C;  3CVZ A;  1TVK A;  5EIB C;  3WB0 A;  2MCT A;  2BTQ A;  3JAM W;  1XNQ H;  4MV7 A;  2UXB H;  1FJG B;  2F4V B;  2CFM A;  4TV8 B;  4DR6 H;  5JVD B;  2KKW A;  2BTO A;  3DSQ A;  2VQE B;  1XDN A;  1TAE A;  4B3T H;  3VNN A;  5LMN H;  2UXD B;  1ZAU A;  2VUG A;  4DV1 H;  3KXY T;  3N6X A;  2UUC B;  1WN7 A;  4DV2 H;  5BR8 H;  3HKB B;  1FFX A;  1XNR H;  3E22 A;  4I55 B;  2ZIM A;  4L8J A;  2VWJ A;  4JV5 B;  3L2P A;  1IBM H;  3T1H H;  4JI5 H;  4FLW A;  1XHZ A;  4DV6 H;  4TUY A;  1CKN B;  5EZY A;  5BMV B;  4YHH B;  4F6R A;  2YIA A;  3RYH B;  3WB1 A;  4GKK B;  2ZJT A;  4DR3 H;  1HW7 A;  4DV0 H;  3ICX A;  4IIJ A;  5D5Q A;  4B3R B;  1I94 B;  3N41 B;  5JCO A;  5C8Y B;  2PGG A;  4LNU B;  2UUC H;  1QHT A;  3DF7 A;  2PZS A;  1HR0 B;  4ETS A;  1VF7 A;  2E3C A;  4A2A A;  1TUB B;  3RYI B;  4LNU A;  4JV5 H;  4PZ8 A;  4JI6 B;  4GKJ B;  4ZI7 B;  5LYJ A;  5KX5 A;  1XMO B;  4U3J A;  3HKD B;  1E4G T;  1IBK B;  2KSW A;  2HVR A;  2GV9 A;  4DUY B;  4BWA A;  4X62 B;  4DR2 B;  4X65 B;  3M7M X;  4RB3 C;  5EIB D;  1HNZ B;  4X1I B;  4LF7 B;  5LMN B;  4NXN B;  4RZQ A;  4JI3 B;  1O75 A;  3RR5 A;  3JAT B;  4EFB A;  4B3M H;  2UXC H;  3LNN A;  4FLT A;  4B3R H;  1FJG H;  2F4V H;  4IHJ B;  4CS4 A;  2YI8 A;  4UCR A;  1HNW B;  3HKC B;  3BRC A;  1VS0 A;  3BAB A;  1B04 A;  4X20 A;  4X66 B;  3CB2 A;  4RAY A;  4DUZ H;  5EYP B;  1P8L A;  1M4U A;  4DV6 B;  5GON B;  5ITZ A;  4JI7 H;  3JAK B;  3NBY B;  5DIS C;  3OTO H;  3W1G A;  2Q7E A;  4LF5 B;  2UUB B;  2F66 C;  4O4H B;  3SJB C;  5CA1 B;  3U0Z A;  4FLU A;  4DUY H;  3W5O A;  4X62 H;  1CKM A;  4JI1 H;  4AHC A;  2P5O A;  4JI0 B;  1Q3E A;  2RGV A;  3J7A K;  4B3M B;  4DV5 H;  4RB1 A;  1N32 B;  4BW9 A;  4K0K H;  4X1Y B;  2CW7 A;  5J2T A;  2HEP A;  5KHK A;  5CB4 B;  5FPO A;  4GLX A;  1FVI A;  4X1Y A;  4EEQ A;  3WB2 A;  4GKJ H;  4DR5 B;  4OX9 B;  3RTX A;  4AQY H;  3RYC A;  3N42 B;  1V9P A;  1XMQ H;  3E22 B;  5LP6 C;  5D1O A;  4LH7 A;  4LR3 A;  1N33 B;  4KHP H;  1Z5W A;  3M4I A;  5CA0 A;  4FLZ A;  5IJ9 A;  2RGR A;  3N2G B;  3N2K B;  5JJE B;  4O2A A;  2E5L H;  4I4T B;  4DRX A;  1BJT A;  2YI9 A;  4DV3 H;  5C8Y A;  4DK0 A;  4JYA H;  5KHH A;  4JI3 H;  1S03 G;  4CH3 A;  3QWU A;  3K5N A;  2ZIO A;  2YXL A;  3J81 W;  1N36 B;  3U11 A;  3RWR D;  1HR0 H;  2UXD H;  2IM9 A;  4JI7 B;  1WH2 A;  2HGS A;  4LFB B;  5BMV A;  1TUB A;  3QTC A;  4JI2 H;  4O2B A;  5FLX W;  5LP6 B;  4JI6 H;  1IBK H;  1M0W A;  5K1P A;  4DUZ B;  1XMO H;  4O4I A;  3KAJ A;  3HKD A;  5CA0 B;  4LFC H;  4YY3 B;  4MTD A;  1Z2N X;  4MTE A;  4LFA H;  4I50 B;  4O2B B;  3VQY A;  4B3S B;  1P16 A;  1IBL B;  1Q5O A;  4X1I A;  3TY8 A;  4DV7 B;  2VQE H;  1Z2P X;  2FE3 A;  3BA8 A;  2PYL A;  4YJ2 A;  2WDT A;  4RB0 A;  4NXM H;  4JI8 B;  5JCO C;  4ZOL B;  4DV0 B;  1MZB A;  4ZI7 A;  4TQF A;  5KHJ A;  4A2B A;  4APM A;  4O4L A;  1AN7 A;  3L4K A;  2CW8 A;  4CS2 A;  3JAS A;  4JI2 B;  5LOV A;  5BR8 B;  1HNX B;  1TA8 A;  4YJ2 B;  3RIZ A;  1M93 A;  4AIL C;  2UUB H;  3N40 P;  4O4L B;  4LSX A;  3T1H B;  4CH4 A;  3HXL A;  3JAS B;  3K5M A;  4ZIB A;  3W1B A;  4UCS A;  4X64 H;  4HBN A;  4IAJ A;  4K8X A;  2VWK A;  1JMK C;  3RYC B;  2PYJ A;  5FD6 A;  3LML A;  4I7H A;  3CSX A;  5JQG B;  4JI8 H;  4K0K B;  1SA0 A;  2Q2U A;  1TVK B;  2V4D A;  1O9H A;  1L8D A;  3HKE A;  3JSN A;  1N34 H;  2HIX A;  1O9G A;  4EB6 B;  5JH7 A;  4DR6 B;  3TY9 A;  4EFE A;  5JVD A;  1G6U A;  3EYY A;  5IYZ A;  3SGI A;  3RF2 A;  1KU9 A;  3RYI A;  2YIB D;  1Z2O X;  4UCV A;  2WE6 A;  4UCU A;  1HNW H;  4Q6G A;  2P22 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...