3JSNA

Crystal structure of the adenylation domain of nad+-dependent dna ligase from staphylococcus aureus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
306
structure length
297
Chain Sequence
DLSSRVNELHDLLNQYSYEYYSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA ligase
publication title Structure of the adenylation domain of NAD(+)-dependent DNA ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 106
structure length 297
sequence length 306
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jsnA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3jsnA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jsnA02
4B3TB 3OTOB 1XDNA 4DR7B 4GLXA 1XK5A 4DR2B 1B04A 4LF5B 2HVRA 4LFCB 4YHHB 3GB8B 3NC0B 1IBMB 4LF9B 4DV3B 3VNNA 5D1OB 4LF7B 5IWAB 3BA8A 2HIXA 1DGSA 2VQEB 4JI5B 4DV0B 3GJXB 4X66B 1CKMA 2HVSA 1TA8A 4DR1B 4JV5B 1CKOA 5BR8B 3W5OA 2ZM6B 3L2PA 4AQYB 1J5EB 4JI8B 3TY8A 1TAEA 1N33B 4KHPB 4B3MB 4UFZA 3UQ8A 4DUYB 4JI4B 1HNWB 2VQFB 4JI7B 1S68A 4JI2B 4TOIA 3W1BA 5D1OA 3W1GA 4PZ8A 1A0IA 4JYAB 3T1YB 4X65B 5LMNB 4UCTA 4EQ5A 4UCVA 1IBKB 4GKKB 2HIVA 4JI1B 4UCSA 4JI3B 3TY9A 2UUCB 3QWUA 1X9NA 5LMUB 4DUZB 2HVQA 2E5LB 3S24A 1N34B 4PZ6A 1V9PA 3TY5A 1N36B 4B3RB 4LF8B 3RTXA 2CFMA 4LFAB 4OX9B 3KYHC 5FPRA 4K0KB 4DV2B 4DV6B 4NXMB 3JSLA 4CC5A 4GKJB 1FVIA 2Q2TA 2HHHB 4YY3B 4UCOA 4DR6B 4B3SB 1CKNB 3BA9A 4LF4B 2OWOA 4JI6B 4PZ7A 1XMQB 4DRFA 2UUBB 1I94B 4DV1B 1HNXB 4DV4B 1P8LA 3GDEA 3NBZB 4DR4B 4UCRA 4E6NA 2Q2UA 1IBLB 3SGIA 4EFBA 4DR3B 1XNRB 2F4VB 1HNZB 1ZAUA 4CC6A 2UXCB 4LFBB 4LF6B 2UXDB 2UUAB 3PN1A 4X62B 4DV7B 4LH7A 1HR0B 4LH6A 1VS0A 1CKNA 3RR5A 4JI0B 4EFEA 1XMOB 1N32B 3BAAA 4X64B 2UXBB 5DISC 2UU9B 1FJGB 4UCUA 3JSNA 5FPOA 4EEQA 1XNQB 4DV5B 2VUGA 1P16A 3NBYB 5D1PA 4DR5B 3T1HB 4NXNB 3BABA
chains in the Genus database with same CATH superfamily
3G6YA 3FFQA 3OTOB 3AG3C 2CH7B 5L1IA 3OHAA 1BGWA 2W9BB 3VBBA 5EWEA 3GTQA 4PDBA 3P30A 5I5WA 2YIDA 4YBZB 2WWWA 2A06H 5BR8H 2F23A 4Q0YA 4EEYA 2ZM6H 4MW3A 1WR2A 2CKZB 2R7ZG 1TUBB 5H80A 3D36A 4DV0O 4RAYA 5LP6B 2QK4A 1RFYA 3L73H 1W96A 4J9KA 3EYYA 5EBMC 2OIGA 1I08A 2IH3C 2BTQB 3X2QB 1PV0A 5I60A 4JAVA 3TY8A 4GYCB 1BJTA 3RYIA 1TAEA 5KG4A 4X65H 4B3MB 4QJFB 3W1BA 4XDJA 5GONF 5D8DA 4U7NA 5J2UA 4O7YA 2AQ4A 4ZIBA 3LSSA 3ASNC 3H20A 5KT5A 1P7BA 3OSPA 3N41B 3I5DA 5LMNB 4O3SA 2JGDA 3G80A 3RYFA 1BL8A 3ZN1A 3RAQA 2HR3A 4EBEA 1T5EA 4O3QA 4DYLA 5LMUB 2E75B 4PDMA 2YU9A 4DUZO 2CH7A 5JQGF 3MR5A 1MG1A 3J7AK 4K0KH 4DV2H 1JJ2U 3WO1A 2JEJA 5H6RA 1A3GA 3JD2A 4RUEA 2A0LA 2EJ2A 1QU7A 1BS3A 2YIAA 2WYOA 2IW5A 3P3PA 1K5QA 3SPIA 4UVAA 3UCSC 2V5AA 5IT9N 1WA8B 2YUAA 4NXMO 1M9NA 1XBLA 1BQZA 1M93A 2Y4UA 4J7ZA 5LP6A 4B3SB 5LGNA 2HG5C 4FK5C 2UUBO 1JPXA 5BMVB 5C93A 1HNXO 3GDEA 1WCMA 5FLXN 4QJFA 2R93G 4A93G 3CRQA 3K0GA 1Y76B 3FAVB 5LGTA 3SPCA 3OFNG 3TQTA 2OT5A 5JVDA 2Y0IA 2FPGB 5EC1C 2CNUA 2UXBH 1JOYA 2OIEA 3JAMW 4LF4H 3ZN0A 3HKCA 1VS0A 4FS1A 1V55B 5DGAA 1I5XA 3G6VA 2GQRA 2AGOA 3RB0A 2QM8A 2OCHA 3KZIZ 1XREA 3S3WA 4JI6O 4F6EA 2WTFA 2PUSA 3G8CA 3NBYB 4QE7A 3WWHA 3Q4HA 2JEUA 4O4IF 2HP8A 4AI8A 4H44B 2HHFB 5I5SA 1LUVA 1WA8A 1V51A 1K97A 1K8AW 2BQ3A 4BY1G 1A0GA 3NC0B 3J81W 5JVLA 1T36A 4DV3B 4NZOA 2L35A 2R8HA 1AI5A 1Q5OA 2ZR2A 4X1YB 2ZJTA 1NTKH 4OXSA 5BMVA 5JQWA 4EBDA 4NYKA 4X9QA 2NVYA 4JI4H 4J7JA 2NU6B 2CGOA 2DWEC 4DR2H 3QO8A 5BR8O 1UNNC 3AG3B 5CB4B 2ZM6O 2R72A 1AI6A 1Y76A 4O4HB 1AP6A 3K58A 3LQSA 4ABMA 3LULA 1HDJA 3CP1A 5DGHA 3I4NG 1KMIZ 3N27A 2KKWA 3RBEA 2JS3A 5DEDA 1MZEA 2KSWA 1XUQA 2RDJA 5KHGA 4PA4A 3CCUV 5HNEA 2PF4E 4DL2A 4BIOA 2FL4A 4X65O 4FIPC 2ZCEA 2R87A 4JI1B 2PY5A 1OCZC 2IJJA 5CA3A 3O9OA 5KFJA 1S9FA 3FB7C 4F4LA 4IYHA 1AVMA 1H2KA 2HHFA 2X6AA 4J9MA 5DG7A 3A0RA 2YI8A 4GX0A 1PL0A 3AYHB 1QQCA 1Y74A 3ASNB 3LDEA 3FYIB 4LFAB 5DECA 5KFPA 1NBMG 4QWDA 4K0KO 4DV2O 1CS0A 1NJIW 2YL2A 4PBCA 1S5JA 4H13B 1EN4A 2FKXA 3BA9A 3GIDA 4H37A 3MWMA 3AK3A 1XNRH 2W6OA 3GTJA 3BQ0A 4MVUA 2ASJA 3ZS8C 1KKDA 5KFWA 2JJ2G 3MHSC 3BEHA 1P49A 4A3MG 3N44B 1IYEA 3N40P 2XAJA 2M7WA 2OCCC 1WN7A 4DO2A 1THZA 3EFFK 3QG5A 3TXQA 5KG6A 4N23A 4JV0A 3ZRWB 4BW5A 3RWRD 4CBCA 2ZNJA 3T1CA 3MR3A 2Q4PA 1Z2OX 3T1HH 4WF9V 3BPZA 1N32B 1RJRA 3RGXA 4CMDA 2VUMG 4TQFA 5E1AC 2UXBO 2ALZA 4W4KA 3GIPA 4DR7H 4LF4O 1AILA 5K1PA 4MV1A 1TWAA 3RVZA 5KFNA 1I0HA 5JUMA 1V9PA 3MR6A 4J0MA 1YZBA 2HEPA 2Q8VA 1H2MA 3JATB 2YRWA 1YHQV 2LFRA 4FFBA 2EIMC 1YJWV 4EG0A 1RYRA 3OMNB 2VWKA 1V54B 1WPBA 4AYBE 2HG8A 1H2NA 3HOUG 2ZDIC 3RB3A 4ZOLA 4DV0B 4KHPH 3OTOH 4J9ZB 3LSUA 5BPHA 1OBDA 1URFA 2RJZA 4ED7A 5KFEA 2WLIA 4NTYA 2QA4V 5IYDO 5C44G 2VS0A 3R5XA 1EKPA 1EKFA 1QVGU 4UFZA 1M90W 4JI4O 2FLPA 4YAKB 4YP3A 4H0LB 4DR2O 2I8CA 2FE3A 3B40A 2DYSC 2PMZA 3H1IH 5CB4F 4ZI7B 4O4HF 2R92G 2YXHA 3V4ZA 3T1YB 1KJJA 3GILA 2E5LH 5L3BA 4JF3A 4DL6A 1PK8A 4LCUC 5ITZB 5LL6Y 2HKOA 2D2CB 2IBZH 1IX9A 3M9MB 1W59A 4B3MH 4LF8H 1ZQ7A 4HNVA 4JASA 5L3CA 4DUZB 5KFYA 4YJ3B 2V4RA 4G3IA 3VPBA 1X4TA 1DF4A 5DLFA 4Q20A 4PI0A 5AG2A 3PW2A 2P4KA 5IT9W 1O9GA 1JDEA 4ECZA 3T9EA 1Q43A 4ETSA 4NXMB 5IJ9A 4MVQA 3JASB 2YW2A 1DTOA 4RZRA 2FK1A 2YWVA 2BTOA 3EHBB 1OCZB 3A2FA 1BNCA 5FLXW 3ZHRA 2UUBB 5KFUA 2JA5A 2X6BA 3HKDB 1HNXB 2AZ2A 1FFTB 3K79A 2GUZA 1S03G 2PBZA 2CDYA 1NTZH 1NS1A 4MVRA 3MD0A 4DR3B 4O3PA 4JYYA 3C3TA 4HBNA 3TIIA 4RUCA 2IJIA 3OR7C 4K8ZA 3G6EV 5KFHA 1Y66A 4O2BB 1JFFB 5ITZA 4EFEA 4O4LB 4I50B 4TUYF 3L70H 4YJ3A 1GN4A 4I9WA 2MK3A 2VA3A 1IZ3A 4UVBA 3ZRVA 3M4IA 3T1HO 4CH4A 2L6LA 3ETQA 2P4VA 5IJ0B 3CQZA 4DR7O 2OLSA 1I7NA 1WSCA 4QWCA 3J80N 2ZQMA 3BG5A 3JASA 3WO0A 1OCOB 5FD5A 2UVVA 5B5EZ 4UB8Z 3GB8B 2HVJC 3HOZG 5CBFA 3VNNA 4R8CA 2F95B 2JA7A 3BRCA 1P4RA 2F43G 1DGSA 3ZMSA 3TIGA 3HKDA 3H0GA 2LGWA 2C22A 1FXHA 2VQFH 5BR8B 5IYZF 2ZM6B 3TETA 4QE9A 3HO8A 4DQNA 5D5QA 4JGSA 5CR5A 2ZGIA 1FD9A 2VWJA 4KHPO 3OTOO 1Q6IA 2EIMB 1ENVA 4O2BA 1JFFA 1B06A 3M8AA 5EIBD 1X59A 2V1DA 2H3OA 4HNAB 1R3JC 2NNUA 5I5UA 2CW8A 1COWG 4X65B 3BJYA 1QNMA 4I50A 3WU2Z 3QQMA 3ZHTA 5KFAA 1JCHA 4NTWA 4RU9A 1YITV 4TV9B 1N0NA 2FPPB 2UUCB 1EZJA 4ZI7F 5IJ0A 3IAYA 2W9AA 2FTKA 3CXCU 3S24A 2DMXA 1Z2PX 2A3QA 2CQYA 1VQOV 4DV6H 2FMLA 4A5UB 2DW4A 4IL6Z 1K73W 3G71V 4MTFA 4B3MO 5BWXA 4IGGA 2RF4A 4LF8O 5C3EG 3SYPA 3SR2C 1VP7A 4K0KB 4DV2B 4YJ3F 4DV1H 5BZBA 3EVKA 3GQCA 4DR4H 2V4QA 1N4CA 5C8YB 4DW1A 5I5YA 3OUFA 3GIMA 4J9PA 3H4BA 1GM8A 2JEIA 3GV7B 4LNUB 3JAWB 4GUNA 3OW2U 2XC9A 4Q45A 3K5OA 1FYJA 1GSAA 3SPJA 4JTCB 4F4WA 4YIOA 3ZIAG 4CC6A 4B08A 4MVMA 4ECUA 3SJAC 4U3FH 5KFXA 2YC0A 2Q73A 2ZDIA 4J41A 2IBKA 1FJGH 1SRYA 4QWEA 3PR5B 3K06A 1OJHA 2Z0AA 5KFGA 3HKBB 2W0FC 3I12A 2A7WA 3BAAA 3O65A 2UXBB 2UU9B 4GC7A 2Q7GA 4B3SO 1YIJV 1M57B 2ZT9B 4EEQA 2WB1A 2R85A 1TWHA 1EN5A 3E8GA 4HYOA 3K08A 4IRCA 2HJDA 1KB9F 3J7AU 3HBLA 2XAHA 5IY5C 1K33A 1NR7A 1IXMA 4BR6A 1KUQA 4O4LF 2VQDA 5CBGA 1OZ0A 1L1FA 3D3IA 4TV8F 2W7OA 2QF7A 5C8YA 3ETHA 2C2RA 3P32A 1RK6A 4X20B 1NH2D 2FYUH 1GSOA 5H5NA 1SZTA 5EDWA 3Q2OA 1SQGA 4LNUA 2OTJV 2B63A 3JAWA 4QNHB 2A9HA 5KT2A 2RMKB 3KALA 2GV9A 1IDSA 3HKZA 4JI2H 4FLYA 4WFAV 1SEIA 1W93A 2LQTA 3DTGA 1JA8A 1K92A 1WH2A 4JI4B 4R6ZA 2EIKC 3UT5B 4APMA 3ASOC 2VQFO 4EKWA 4BY7G 5KHJA 5L1LA 3CC7V 2C2DA 3GIQA 3HKBA 1PNLA 1ZL8B 1RSOB 3L74H 2ZE5A 3BCCH 4EYIB 4ED3A 1L0NH 2W8KA 4DV3O 1GTOA 4LBEC 3ORRA 3WWIA 2MW2B 3NXSA 1AR1B 4A3GG 4I55F 1XEQA 1SQFA 3DTFA 2R82A 3GTPA 3CCSV 4IZOA 3T1YH 2JK5C 4HYKA 1KU9A 1AUXA 4WFHA 4TV9F 3IC9A 5F2VO 1PKXA 1DAAA 2W6NA 3RTXA 4IIJB 3RJ0A 1QR8A 3KXYT 3PW7A 2JEFA 3SYAA 4DV6O 3I4MG 1VKZA 2AU0A 1DF5A 1E79G 2EIJB 1UPGA 4ED2A 1QR9A 2EJ0A 4A3DG 1GM7A 1CKNB 1YDXA 5D5PA 4JI1O 1R3LC 1S77D 2UXCH 1A32A 2EJ7A 3STZC 5IYBO 2UXDH 2LJ2A 3NBZB 4X89A 4DR4O 3UT5A 3SGIA 1AR4A 1I2LA 1XNRB 1PNMA 3QTCA 2Z02A 4RNNA 1ZL8A 1NKDA 1RSOA 5H6QA 4O7VA 2UUAB 3VQVA 4C5BA 4O7WA 2XNDG 4IHJF 3VMMA 1SFOA 3WG7C 3Q8RB 1QHTA 1LUWA 2COGA 1HW7A 2Q7HA 5EC2C 1VAJA 2EILC 1FJGO 4DR3H 4XZ3B 1Y1WA 1GN3A 4K6NA 4UUGA 4Q4CA 1FAFA 3ETJA 3J80W 3T1HB 5JH7F 4Q6GA 2YXYA 4DR7B 4ZQIA 3H01A 3AK1A 4MTXA 1JXLA 4UV9A 4BBRG 1S3JA 3G6BA 3SPGA 1T94A 3UYYA 2DZDA 3KKYA 5L3GA 3ZRSA 5LOVB 4PI2A 2JEGA 1BQ0A 4GLWA 2QDOA 4J7KA 3GLKA 3SJCC 4DUYH 4JI7H 4L87A 4ECYA 5HBRB 1YTFD 5EOYA 3RYFB 5DQIA 3P3NA 5IY5B 1XQ8A 5L3EA 3U0ZA 3NUAA 3MJFA 4M9UA 3N42B 4KHPB 4D6TH 1SETA 1VF7A 4PHZA 3UQ8A 1WCMG 4TQSA 4FLTA 4JI2O 1M0WA 1QLEC 1HWYA 3CRRA 5DGIA 5LXTB 1GO3F 3HOVG 5EBLC 2CTPA 2R8IA 1QCEA 2W6PA 4XX0B 2CTWA 2Z5UA 3OAAG 1N34H 1K7DA 1ORQC 3EPIA 1ZLZA 3PW4A 2CNQA 1W0JG 4UCSA 2EJ3A 1K4DC 3CCRV 2H94A 1BXRA 3VQYA 4E2LA 2E5LB 4UXNA 5B3SC 2CK3G 2EIKB 3ASOB 2YS8A 1KC8W 2E76B 1G2WA 4WD3A 3RVYA 2YICA 4DK1A 5LOVA 4YY3H 2P5OA 4LF8B 1HP8A 2WA3A 2COIA 2ILMA 5JVDB 2RCVA 2B1IA 2JIZG 1XDCA 3FYEB 2QTOA 2GSMB 4DV4H 2UUCH 2WLJA 4PA9A 3T1YO 3V6JA 3HKCB 4CS2A 4OPHA 2HJFC 3CB2A 4MA0A 3TJTA 1SS3A 4WHXA 1GRJA 2DLNA 1KC7A 4CH5A 3MWDA 4IIJF 2HGWA 5CA1B 3W7XA 1L8DA 4L8JA 3K0DA 1MABG 4LSAA 1Q81W 4EFBA 3RBZA 4JI0H 5LXTA 3E8FA 3QF7A 3Q4HB 1JVMA 2UXDO 3UZBA 3SJBC 2GDSA 4LH7A 4LH6A 5EZYB 3I56V 3JZFA 4O7RA 1VF6C 5B66Z 5CA0B 2F1MA 1OHHG 2PGGA 1I7LA 1IVSA 4X1KB 3ABKC 3F7YC 1AP5A 2QWNB 5K1XA 4U6PA 1AR5A 2RQ6A 2YS6A 2XCPA 3H1HH 2B9ZA 1BMFG 4RB0A 4D7TA 2AGQA 3IC7A 4ZKIA 4DR3O 3TQ1A 4IWYA 3BHPA 3WG7B 2K1EA 3CHXA 2W8LA 5IYCG 2DWCA 3KHLA 2UU9H 3SYQA 2XAGA 2KSDA 2GTSA 4PDVA 3T9FA 4DR1H 4ECQA 2QM7A 1WPXA 2Z3YA 4HR7A 2GPSA 4AQYH 4LC1A 2P6JA 3KAKA 1A9XA 3KHHA 4A3FG 3CYOA 3HB9A 1Q90D 1N33H 5EYPB 5CA1A 1CKMA 2NU8B 2J6UA 1I5YA 1DLBA 3W5OA 5KHHA 4X88A 3UFXB 2EINB 3L2PA 5JJNB 3FB6C 1EHIA 5J2UF 3VOUA 4E4EA 4JZGA 3BFRA 4C5AA 4DUYO 2VQFB 1SF9A 4FZ0A 4JI7O 4TOIA 2RGVA 2ETNA 5K3WA 1GKFA 5EZYA 4IRKA 1QLNA 3W1GA 5CA0A 5TISZ 3T2MA 4PZ8A 4GX1A 5IP9G 1Y74B 1R6TA 2FLLA 1R3IC 1I6UA 4QPJA 4X1KA 1R3KC 2DYRC 4RB2C 2LGQA 5BY1A 3ZHVA 3FKIA 3GTMA 5L1KA 1M6VA 4F4XA 3T5JA 3OGIB 5KLVH 4AILC 5IYBG 3K5IA 4PZ6A 1N34O 1H8EG 3JAKA 3T7AA 3OHBA 5BXZA 2AGPA 3TY5A 1QLEB 3H1KH 1IXBA 2PI5A 2WE6A 2Q5ZA 4GC6A 2ZNIA 4DR6H 3TCUA 5LP6F 3KHGA 5F9LA 1XMQH 4OGQB 4O3OA 4DV6B 2J6SA 2QEXV 3GWOA 3LNMB 4BIUA 1H38A 5EYPA 4YY3O 1AI4A 3U54A 1P7GA 2Y48A 2V58A 2V7QG 2R8GA 4RAIA 2OWOA 4PZ7A 5B3SB 1VF5B 1YVWA 2Y4RA 4DV1B 5JVDF 4QIWA 4DV4O 1N8RW 2UUCO 5KFMA 4DR4B 3PVXA 3G6XA 5I5TA 5KG3A 3RYCB 3F5TA 1PNKA 3AG1C 3QZ7A 4YIPA 5E79Z 1SC5B 1KT8A 2FK3A 1Y67A 5KG2A 3T5LA 3VPDA 4P2ZA 2C28A 1ZTEA 4O82A 2DN9A 4FFBB 4P9OA 2C2EA 4JI0O 4NXNH 3OGCC 1KYOF 4GX5A 1I50A 4JV1A 2K9PA 1VEWA 1YXBA 3DXRB 1FJGB 3JALB 1VQ9V 2QWOB 2VUGA 4RB3C 4ZOLB 3CC4V 2XTAA 4Z1VA 5LBQA 2UUAH 3B8NA 1JIHA 2XAFA 1GMGA 2HVKC 1IBMH 2WLIB 1XILA 1NZ6A 3QZ8A 3M9NB 3PO2G 1GO3E 2YIBD 4X66H 4YB8B 5BMVF 1N56A 3K3WA 5KFRA 4AHCA 2XOKG 3ABKB 4M0JA 5BWRA 1OV9A 4FVMA 2CNVA 2VA2A 1RM1C 2W6ZA 5FNVB 2WAQA 4WBNB 2WSSG 3T9CA 2UU9O 4FFPA 4FPPA 4DR1O 3EXAA 1K4CC 4I4TB 3RYCA 3RGZA 3LNNA 2XGPA 4Z1MG 4AQYO 1GGOA 2JA5G 1N33O 1U97A 3W7UA 4F50A 4JI2B 2JDIG 1IBKH 3AG2C 4FJCC 4JTAB 5D1OA 1KECA 3ZCCA 5K2MA 5CBHA 2Y0SE 3F8NA 4BBSG 3DXRA 4YR2A 3DF7A 3JALA 4EQ5A 2CTRA 4UCVA 5IJ9B 2X5RA 3AG7A 3HR0A 5C4XG 1N36H 4B3RH 2UVRA 3H9VA 3B77A 1A48A 1LNQA 4WCEV 2OTLV 1KEEA 2GUZB 2YI9A 2HHHH 4DL4A 1VF6A 2ODTX 2DYRB 2CZGA 2N74A 2JVDA 3MDSA 4FZ1A 3JSLA 4CC5A 2KG7A 5FNVA 4WBNA 2Q7EA 5CMUA 5BYAA 1CQJB 4UCOA 2GQSA 3AG4C 2A1HA 4DR6O 1SESA 5HFMA 3B09A 2PYLA 4RB1A 1XMQO 2YDEA 2JA7G 4I4TA 2R6FA 1E1RG 3H0GG 1WNSA 2FB5A 3OR6C 4WFBV 1CQIB 3HKEA 3DSQA 5JWPA 3FB5C 2XGQA 1YEWA 1Q86W 4MVOA 4K3AA 4A3KG 2UXCB 1JLLB 2UXDB 1M4UA 3BACA 3H1JH 5KFCA 1W2BU 3E5NA 4UB6Z 1EUDB 3HT5A 4MTEA 5EIBC 4RQEA 5DMXA 3IG0A 4QGPA 2AGAA 4B3TH 3KG2A 2XIGA 1B6QA 1K1SA 4DV5B 2PI4A 1LR1A 3AG1B 2ASLA 4NXNO 5EK0A 2YIBA 4F4ZA 4LF9H 2WLNA 1XNRO 1M1KW 4LF7H 3B8MA 4RZQA 2HFEC 1EUCB 3DGEA 3UKMA 3RFCA 5KG5A 1E4EA 2UUAO 3D8CA 4ZOLF 1VQMV 1IBMO 2R7MA 1R6NA 1VBHA 1TVKA 2YS7A 2YSUB 3GB7C 4MTOA 4O2AB 4X66O 4O7LA 5KUKA 1K1QA 2QWRB 4PD4F 3KCXA 1JKJB 1EYZA 2IJKA 3OUSA 4QPKA 5HV6A 2OCCB 4Q8EA 3OD4A 1JDBB 4R8UB 2XT9A 5LHGA 4DUYB 4WBNF 4JI7B 1S0NA 1VQ4V 4YR0A 5DM6V 2LW1A 1VQNV 2W71A 2YZGA 2YCHA 2X6CA 4JYAB 1F4NA 3OUZA 3CE2A 5GTIZ 1VQ8V 3RV3A 4CKEA 3F5WC 2OYQA 4I7HA 2CE4A 1IBKO 2IM9A 3RGBA 3W7WA 1QVFU 3D3QA 1VQ6V 5BWTA 1X9NA 3LSQA 3JRXA 3OSNA 4YQWA 1N34B 1EM1A 5FLMG 3QO7A 1G4YB 2FKLA 2M05A 3PO3G 2ZXWC 1M56C 4MV9A 1N36O 4B3RO 5IDJA 4J9QA 4FLVA 3Q8PB 2E2HA 2CW7A 3GIJA 2QJ1A 3KTMA 2Y69C 1RJPA 2Q2TA 4YY3B 4O2AA 2HHHO 4N21A 3GWKC 3OEEG 1GK9A 1DK1A 3PJSK 4DV4B 2B63G 4IR9A 4R8UA 1MMMA 1S5LZ 3F7VC 2E5LO 1AB3A 4G28B 4NKGB 2DYSB 1XMOH 2GLTA 3VPCA 4O84A 4FFMA 4X64H 4YJ2B 2O03A 3SPHA 2UVUA 1ZX3A 4CMFA 1N0JA 1NQTA 1I3QA 2YYAA 4BWAA 1Y1VG 3AG4B 2YZLA 3BQ2A 3TK1A 3IFXA 4JI0B 1B33N 2JA6A 1F7YA 1G8MA 1BHBA 5B1OA 3CCVV 3APQA 3V6HA 4F4YA 4CKCA 4LF5H 2RDCA 4LFCH 2OH2A 3B4SA 4B3TO 1XDNA 5KKNB 4GLXA 3R5FA 1TWCA 1GH6A 2P90A 2R9RB 1EBOA 3HOYG 4MTDA 4JI5H 4QWBA 2Y0PA 1C30A 2GBOA 4EBCA 1GN6A 2ZE8A 4X1IB 4YHHB 4FE2A 2Q0OC 4LP8A 4J10A 3ZRXA 4M7EA 2AHZA 3BA8A 5KX5A 4RUAA 2DJVA 3E86A 2EJRA 1R1BA 2VPSA 4P30A 3ABLC 4DR1B 1F4MA 3RN4A 4JV5B 1NVPD 2ABJA 1YSCA 1AJPA 4O2BF 4AQYB 4KP4A 2F66C 5LA6B 5IYDG 4HQ6A 4MA5A 4YJ2A 1N33B 1Z5VA 5KT7A 1EFRG 3OTFA 4I50F 1Q82W 1F23A 1UC9A 4JI3H 3A0BZ 2QTSA 3DC6A 3U10A 2DWDC 2R7KA 4J11A 4DL7A 2BSKB 1WRVA 5J2TB 5KS8A 2X0SA 4IRDA 4O4JB 4J9LA 4OPAA 5DQGA 3R5HA 4JAUA 5L9XA 4I0XA 2FLNA 3ZMTA 2QE7G 4FFNA 2ZINA 2IU3A 1Y1WG 4CS3A 3K3PA 3E83A 3VOTA 5BWWA 5LYJB 3K9SA 4X1IA 1Y1VA 2R9IA 4OX9B 5KG7A 2R70A 3RW0A 1S0VA 4RQFA 3HPLC 1PM9A 2N05A 3ML0A 2IMWP 2ZE7A 5I5VA 3KCYA 1BSMA 4DR6B 3ICXA 4ECXA 2JGUA 2EZOA 1XMQB 5L3DA 1DV1A 3APOA 4F6RA 1I94B 4FGRA 1EN6A 3U11A 2DIKA 5LA6A 3KREA 3SJQC 5FJ8G 3ETGA 4NR1A 2W70A 4X62H 2Q2UA 1K83A 2R8JA 5LHHA 2XASA 4ZHQA 1NT2B 3X2QC 1AI7A 2LW7A 1OBGA 2IP4A 4FFLA 5GW7A 4TVIA 4CE5A 2Y69B 3PN1A 1SZXA 2W9CA 3L4KA 4XDKA 3DAAA 4YXWG 1NH2B 5F9NA 2BSKA 4FM1A 5J2TA 1IYDA 5KFTA 2ZIMA 1XMOO 2NN4A 3MFIA 4O4JA 4X64O 5T14A 5J9PC 2ODMA 1Q7YW 3T4ZA 2IU0A 3FD9A 2A79B 3VQXA 3DTUB 1H2LA 1I7FA 1NTMH 4DV1O 1XI1A 1OCCC 2PMZE 4NXNB 3VQWA 5LYJA 4JZ2A 4RCNA 5C8YF 1ZSPA 3ZMUA 1AUVA 1E1QG 1I2KA 3K04A 1VQ5V 3N6XA 4LR3A 4LF5O 1B3QA 1ZWIC 3LDDA 2RDIA 5EWGA 4LFCO 5JQGB 4I7ZB 3B2EE 1IBMB 5JCOC 4DV5H 3K5LA 4JV2A 4FLWA 1Z2GA 1J5EH 2W0XA 1AROP 3GTOA 4JI5O 4X66B 2HVSA 3T9AA 2BQUA 4O83A 1VQLV 2KB1A 1CKOA 2QKSA 5KFIA 4L1KA 2V9WA 4ECWA 2BOBC 2GHYA 2HJWA 1TGOA 1H2SB 4W4LA 2ZDQA 5KT4A 1SQBH 4O7NA 2E3CA 2M6YA 2WLLB 1BHAA 3T5KA 4DRXA 2ZKOA 3CEIA 4Y8VB 4CHIA 2Q0AA 4YR3A 2RGRA 2ADQB 5GONA 3BY6A 4UCTA 1V55C 1IBKB 1KJ8A 2HLDG 4JI3O 3TY9A 1G6UA 3T54A 5KT6A 2JJ1G 3H1LH 3THOA 1B6SA 4AYBA 3RIZA 4QW9A 3KAJA 4RWUA 1PP9H 3SYCA 2XHBA 4JYAH 4FS2A 1NR1A 5DG9A 1N36B 4B3RB 5JQGA 2EIYA 1E4GT 2ZDGA 2PVPA 3L75H 2CAZC 5FPRA 3AK2A 3U55A 1F51A 4U7OA 1Q6HA 1K34A 3ABTA 2JS5A 4O4IB 1DIKA 3TINA 2HHHB 4MV8A 1H2GA 4KL1A 2CGNA 2ZDHA 4IWXA 3V6KA 1RJQA 1TWGA 4ED1A 4Q8FA 4LF6H 2QWQB 1SQQH 1R6KA 4MVZA 2DPJA 4DV7H 4EB6A 5DG8A 1S97A 2F4VB 2AW9A 2WLLA 2PZSA 4QW8A 3ZMZA 1FXKC 1ZHQA 4X62O 1HR0B 3JZIA 4O81A 3T4DA 1L0LH 2XAQA 3CMAV 2LP7A 4O7SA 3ZHQA 1YTFB 3CVZA 3G4SV 4NYEA 4LSXA 2R7NA 1Q3EA 3FKIG 4R7RA 4A3LG 4B3TB 5DGBA 2QM4A 1RPRA 2KQXA 3CWBH 5KFFA 2VQEH 3JZ6A 2UXCO 4O7TA 3PZPA 4GX2A 4E4TA 2YXLA 5DQHA 4O4IA 3E2EA 4ED0A 2P7TC 1RK5A 4JTDB 4LF9B 4JAAA 1MSDA 3OMIB 3JARB 4LF7B 4K8XA 4A2AA 1KTAA 3OMAB 3AW8A 2WLMA 1OCCB 2BOCC 1WJZA 4GZRB 2ZD9A 5KFLA 4IYIA 4DV5O 2YZMA 4PWQA 3RT3C 3GVMA 1J5EO 1FXVA 2W9BA 1C3OA 3C3SA 4YHHH 3GTGA 4Z2WA 3JAKB 4ECVA 4J42A 4GKKH 2R9AA 2I80A 3ZHSA 3H40A 3OEHG 1TUBA 1A0IA 1MZBA 4JV5H 4TWKA 2EILB 4PA7A 3JYCA 5H2FZ 1SKVA 3CPWU 1M5IA 2BTQA 3SDLA 1JQ0A 3FKSG 4A3BG 4DXWA 4NLGA 2GPWA 2ASDA 5LOVF 2HVQA 4WFGA 3MAQA 4NTXA 1SA0B 1S0MA 1MOFA 1WB7A 2QSAA 5LHIA 1S0OA 4LWSB 4CH3A 4PA3A 2CFMA 3K03A 2FK2A 3CCJV 4R50A 3K5HA 2R7ZA 2WB1E 3JARA 3ZJZA 2NU7B 3U9SA 1WP8A 1T3NA 4FLUA 4JYAO 1GAXA 1BZKA 3C90A 4FMTA 4LMYA 2SCUB 1V54C 2QGNA 4EYHB 1Q6UA 4I9QA 3RUPA 4ECRA 1HNZH 1P8LA 5LXTF 3N43B 5KA6A 1SYXB 4E6NA 4TT3G 1V4YA 4Q44A 4OX9H 3R9RA 1FKAH 2YZNA 4DW0A 5JCOA 5I5XA 4ED6A 2C2AA 3QVNA 3R66A 3ETEA 4LF6O 3RYHB 5HFLA 4CZZA 2X0LA 3M99B 4DV7O 3T5HA 1VQ7V 3HKZE 2G38A 1I94H 2WDTA 4DR5H 1XMOB 1KP2A 4X64B 5DISC 4MSWC 1MSWD 1TUEB 4IR1A 5FPOA 1ZHSA 4MS2A 2ITDC 4PDRA 2F93B 2NLJC 3FAVA 1JJOA 2WLHA 1SA0A 1FPOA 1Y14B 3BABA 4RAZA 3MFHA 2J9GA 4HNUA 2D3OW 4LWSA 1FXKB 3LWBA 1GN2A 4KFMA 3GV8B 2AXTZ 5IWAH 4LF5B 3CSXA 2JEXA 1YJ9V 4LFCB 1PX2A 4IAJA 1BCCH 1JR9A 3RF2A 3LDCA 5CA1F 3MHHC 1PPJH 5D1OB 5B1AC 4JI8H 4JI5B 2VQEO 3GJXB 1BE3H 1SCUB 4TM5A 1ZETA 1HNWH 2R93A 4EGQA 3WB1A 2NVXA 3CXHF 1SQVH 1VARA 3L72H 1KJ9A 5EZYF 2CTQA 3WFVA 5C5JA 5CA0F 3K9AA 3RYHA 1B6RA 3A8TA 1JX9A 5L3FA 3WWJA 3AEIA 1GM9A 3CCEV 3RV4A 3TW7A 5KFSA 1R9TA 3R65A 4X1YA 1G1XB 1E4FT 2MCTA 4YHHO 3NGDA 2R7LA 4O86A 1VIBA 2UXXA 2WA4A 5CB4A 4GKKO 1Z2NX 2KG7B 4O4HA 4JI3B 2HIVA 5CE8A 5KHIA 2FPIB 5IP7G 3QWUA 5FR9A 1EZ1A 4ECSA 1OCRC 4JV5O 2RN9A 5L1JA 3L9DA 3RB6A 1NU1H 1I1LA 2QB5A 1BGYH 1FXKA 3W7SA 1KP3A 4J9OA 4GKJH 3LUTB 4PA6A 4TUYB 2Z04A 3HKEB 3TEKA 2C35B 2IJHA 2O57A 3CCMV 1WAZA 4CH6A 3EPGA 5BWUA 3IN5A 1OCOC 4QIWF 3HXLA 2FMAA 1IBLH 3K5NA 4C2MA 3FDSA 4JUZA 3NR7A 1S5HC 3CRMA 4UUJC 2WPDG 4A2BA 3JD3A 4LFBH 1N48A 1MZFA 3QFFA 4HNTA 4JXUA 1S10A 5DAAA 2H8PC 1HNZO 3C0FB 1IOVA 3JD1A 3PW0A 1S76D 5IYZB 4X62B 3PW5A 4DL5A 1UFIA 5CN0A 4OX9O 1XNQH 1FKAO 2Q68A 2ADPA 2GTAA 3E35A 1E4EB 5KMGB 2W57A 2BR0A 1QBZA 3JSNA 4BW9A 3CCQV 1AJNA 5I47A 4A3EG 2F4VH 1TVKB 1I94O 2DPIA 4DR5O 2EZPA 2DQ0A 3ABMC 4TUYA 4WFEA 2HGXA 2LFSA 1HR0H 4QSHA 1I1KA 4EGJA 2Y4TA 1AJQA 3ZRWA 1XK5A 1FFXB 4HZ3A 3E89A 3TW6A 2BCCH 4U3JB 1GSHA 2IH1C 2XUMA 3SI8A 3M9OB 1RPOA 2R84A 2HVRA 5BWVA 5B1NA 2DE0X 1VQKV 3CS5A 3JD4A 1ZUQA 2BE3A 1RP3B 1JX4A 2HIXA 1EZVH 3N6RA 2EULA 5IWAO 5KFQA 1CEZA 1Q8IA 4FM9A 2ATLA 3K3VA 1XHXA 2DQ3A 4B7EA 3Q1KA 1CPYA 2AHYA 3JATA 1J5EB 3CEBA 4JI8O 3UO3A 5IE9A 3CSWA 2NUAB 5KAFZ 3CJHB 3K59A 2XCLA 1S68A 5EWFA 5IYZA 3U0GA 1HNWO 4RNOA 5LMNH 1WB8A 4A3CG 3G8DA 4D7SA 2VUMA 5B1AB 3SE7A 4ED8A 1GLVA 2COJA 5KMGA 5LMUH 1J95A 2UVWA 5A9GA 3K5MA 3V4SA 3CX5F 1VQPV 1M0TA 2P06A 2QKAA 2JA6G 5DLGA 3M7MX 1Z5WA 5KUMA 3PFFA 1M57C 5KFDA 4RNMA 1FFXA 2QKCA 4U3JA 1TWFA 3ZEDA 1CE8A 4MW8A 3ORQA 4ZI7A 1IOWA 5FNVF 4CS4A 5KFOA 4UVCA 4B3SH 2V59A 3KYHC 1PL4A 4DIMA 2N04A 2ATKC 1BT8A 1RM1B 4RUFA 3U9TA 2PTMA 4I4TF 4GKJO 1FVIA 3GV5B 4UV8A 1US6A 3R23A 3CCLV 2X7RB 1K9MW 5BPFA 1OCRB 4NVPA 4JI6B 1JMKC 4TV8B 3SNOA 4J80A 4NZMA 2DABA 3CJHA 3VA7A 1IBLO 1KBHA 1ZAUA 3AG2B 3S3XA 4J9SA 2R92A 3GIKA 4KUMA 3K57A 5KG0A 1KJIA 4LF6B 1VMGA 4LFBO 2ARHA 4ICGA 4DV7B 2P22C 1KBLA 2FP4B 2Q69A 3FB8C 3DC5A 1YCIA 2B1GA 1IURA 1KUTA 5LL6b 1ULZA 4PDLA 1XNQO 5KX5B 4B7KA 1P16A 1GYFA 2NU9B 5D1PA 2AZ0A 4FFKA 5LGUA 3TXSA 3LP8A 1O9HA 4DV3H 3Q8SB 4Q4DA 5A2QN 1B04A 2F4VO 4FFOA 3GTLA 2EBOA 4XBFA 3HOXG 4I55B 3RBDA 2HGSA 4XYMB 4MV3A 2VR1A 1HR0O 5JJJB 3CD6V 4O4LA 1EKVA 4MAMA 2J6TA 4BIZA 3UZOA 3RFRA 2VQEB 4TV8A 4MTGA 2QR4A 2EIJC 1WP7A 1L2ZA 3ABMB 4DK0A 3H4DA 2NR5A 1XL6A 5EBWC 5KHKA 4YAJB 3UM7A 3OT7A 5KT3A 4GT1A 2DOSA 2R8KA 4I0XB 4MT8A 3WB2A 2XCAA 1UC8A 2DAAA 3N8DA 4FFRA 3RAXA 4FM2A 1NI8A 1D5NA 3IGAC 1W0KG 4JI1H 1MNGA 4Q43A 3CC2V 4QIWE 4LF9O 4NZNA 4FBUA 4DLKA 5LMNO 3Q8QB 4GKKB 4LF7O 4FLZA 3GIIA 5KAIZ 3ABUA 4A3JG 2I87A 4C7UA 1XOUA 3OUUA 2W6MA 4IHJB 1KKCA 3LMLA 1YF2A 5LMUO 4MV6A 4LFAH 1U96A 2HDKA 4F6RB 3E22B 3D36C 3UO2A 4I55A 3L4JA 2EX3A 4HNAA 4CKBA 1P84F 4ZHQB 4J9YB 4O2AF 2FJZA 3ETDA 4PELA 3WNZA 5JH7B 3WB0A 4G27B 4TV9A 1DV2A 4MVSA 2W9CB 1AN7A 3CRAA 4XDLA 2QYZA 2YEVB 1K5SA 4LF4B 3N2KB 2WAMA 1K3EA 4RO2A 2PYJA 2E2IA 4MV4A 1SERA 1WLEA 2XD4A 5C1PA 5B1BC 1D5AA 4ECTA 1HNZB 3MWEA 3IJ4A 1XL4A 1N32H 2ZIOA 5KFBA 2P0AA 2WAQE 3AX6A 4ME6A 3JCUZ 4U7CA 3OE7G 3RB4A 4ZBMA 2VPQA 3PR4A 3FMAA 1I1MA 3JD0A 2RNBA 3RR5A 1SQPH 1ROPA 5C1OA 3JAMN 4IHJA 2ITCC 1RYSA 2JA8G 3W7TA 1NVPB 1D2DA 1KD1W 3FX7A 3E22A 3OM3B 3ZX6A 5LP6C 2ZXWB 4DR5B 2IA6A 1M56B 4R7CA 4DR2B 4PJ0Z 3JRWA 5KFZA 5JH7A 5IYCO 4TSFG 2PN1A 4DV0H 5KX5F 1S72V 4DL3A 1YJNV 1OWTA 2LO1A 2YEVA 4DRXB 3N2KA 5IWAB 5CM0A 4J9NA 1Y6XA 4WFFA 4JYCA 4HAMA 5GONB 3J81N 1XHZA 1TA8A 3ZBHA 4YJ2F 3G67A 5GTHZ 4G2KA 1KQSU 4JI8B 4JPRA 4FLXA 1UJWB 4XYLB 4FM0A 4FU0A 3E8BA 1YI2V 1HNWB 4J9RA 5BYBA 4X20A 3CMEV 4I5SA 3TGUH 4TQDA 4JYBA 4K35A 3I55V 5DN6G 2B5UA 1FS0G 4DUZH 2ZR3A 5JJEB 2JRIA 3SYOA 4HN2A 3MR2A 5E25A 4TQRA 3H3VH 1O75A 2P67A 3QNEA 2Q9LA 4PV1B 2YRXA 1M7JA 3E8HA 4BXXG 3N2GB 3STLC 1SQXH 3A0HZ 4C5CA 4GCZA 5KG1A 2CUGA 4KXRA 1CXZB 4NXMH 3HOWG 5KFKA 2WLKA 2Q67A 3QO5A 3BVOA 5CAEB 4EB6B 1KJQA 1CP9A 4LFAO 3JCZA 2UUBH 5H9CA 2ZE6A 3ZMVA 1HNXH 2C00A 4GKJB 2VOBA 4O3RA 4NB5A 3HB3B 4MV7A 5LA6F 2W6QA 4X8AA 1PD3A 2FB9A 4O3NA 3ABLB 4P9PA 2V4DA 3BQ1A 4DRFA 4ZHQF 2W7PA 2Y0SA 2VRZA 1R73A 4UCRA 1IBLB 2Q7DA 1VBGA 2R86A 4BWSC 4FBTA 2EINC 3ZHUA 4IT5A 5KFVA 4IIJA 4ASUG 2W6IG 3RYIB 5J2TF 3GTKA 4LFBB 1MA1A 4O4JF 4JI6H 5KA5A 4A3IG 4BAYA 1CKNA 2Q6AA 5J2UB 1H8HG 1Y4MA 1ET0A 3CRCA 2E74B 1N32O 3N2GA 5LYJF 2W6JG 4UCUA 1XNQB 2JGDB 5FL7G 3L71H 4H33A 4O7ZA 2UXNA 3T99A 4DAAA 5FD6A 4QWAA 5A2QW 5B1BB 3KHRA 2BQRA 3T9BA 2QWPB 3T9DA
chains in the Genus database with same CATH topology
3FFQA 4RAZA 2YIBA 3OTOB 4LF9H 1BGWA 4LF7H 5IWAH 4PDBA 4LF5B 3CSXA 4RZQA 4LFCB 4IAJA 3RF2A 5C8YA 5BR8H 4Q0YA 4X20B 2ZM6H 5D1OB 4JI8H 1SQGA 4LNUA 1TUBB 4JI5B 3JAWA 1TVKA 3GJXB 4RAYA 4O2AB 5LP6B 3KALA 2GV9A 1HNWH 4JI2H 3EYYA 4FLYA 3WB1A 2BTQB 1SEIA 1BJTA 3TY8A 4GYCB 3RYIA 1TAEA 1WH2A 4X65H 4B3MB 4JI4B 4DUYB 3RYHA 3UT5B 4APMA 4JI7B 3W1BA 5KHJA 5J2UA 3HKBA 4ZIBA 2YCHA 4X1YA 1E4FT 4JYAB 2MCTA 3H20A 3N41B 5LMNB 2OYQA 3RYFA 1Z2NX 4I7HA 2IM9A 5CB4A 2HIVA 4O4HA 4JI3B 3RGBA 5KHIA 1T5EA 3QWUA 1X9NA 5LMUB 1N34B 1SQFA 3J7AK 4K0KH 4DV2H 4GKJH 4TUYB 3T1YH 3HKEB 1KU9A 4MV9A 3RTXA 2YIAA 2WYOA 4FLVA 4IIJB 3RJ0A 4CH6A 2CW7A 3KXYT 2QJ1A 1M93A 2Q2TA 4YY3B 4O2AA 5LP6A 3HXLA 1IBLH 3K5NA 4B3SB 1CKNB 5D5PA 5BMVB 2UXCH 4DV4B 4A2BA 4LFBH 2UXDH 3GDEA 3NBZB 3UT5A 3SGIA 1XNRB 3QTCA 5JVDA 3C0FB 1XMOH 4X64H 4YJ2B 2O03A 2UXBH 1RSOA 5IYZB 2UUAB 3VQVA 4X62B 3JAMW 4LF4H 1XNQH 4BWAA 3HKCA 1VS0A 1QHTA 4JI0B 1HW7A 2Q7HA 5KMGB 2W57A 3JSNA 4BW9A 4DR3H 2F4VH 1TVKB 2PUSA 3NBYB 4LF5H 3J80W 3T1HB 4TUYA 4Q6GA 4LFCH 1HR0H 1XDNA 4DR7B 4GLXA 1XK5A 1FFXB 4U3JB 4MTDA 4JI5H 5LOVB 2HVRA 4X1IB 4YHHB 4PI2A 3NC0B 3J81W 4M7EA 4DV3B 2HIXA 1Q5OA 3BA8A 4X1YB 5KX5A 3SJCC 2ZJTA 1Q8IA 5BMVA 4FM9A 4DUYH 4JI4H 2VPSA 4JI7H 4DR1B 4JV5B 3K3VA 1XHXA 4DR2H 5EOYA 3RYFB 5CB4B 2R72A 4O4HB 3K58A 4AQYB 3JATA 1XQ8A 3U0ZA 1J5EB 2F66C 5LA6B 3N42B 1KMIZ 4YJ2A 2KKWA 3K59A 4KHPB 1N33B 3UQ8A 1VF7A 4PHZA 1Z5VA 5IYZA 1S68A 2KSWA 4FLTA 5LMNH 1M0WA 3OTFA 5KHGA 4JI3H 5LXTB 4D7SA 3U10A 5KMGA 5LMUH 1N34H 3K5MA 2ZCEA 1M0TA 5J2TB 4JI1B 4UCSA 2PY5A 4O4JB 3M7MX 1Z5WA 3VQYA 2E5LB 1FFXA 2ZINA 4U3JA 2YI8A 4CS3A 3ZEDA 5LYJB 4DK1A 4ZI7A 5LOVA 4YY3H 1QQCA 4X1IA 2P5OA 4LF8B 4CS4A 4B3SH 4LFAB 4OX9B 3KYHC 5JVDB 2R70A 2PTMA 4DV4H 2UUCH 1S5JA 1FVIA 4DR6B 3HKCB 3ICXA 3BA9A 4CS2A 2JGUA 4NVPA 4JI6B 3CB2A 1XMQB 3MWMA 1XNRH 1JMKC 4TV8B 4F6RA 4CH5A 1I94B 3U11A 5LA6A 5CA1B 1L8DA 4L8JA 4X62H 4LSAA 3ZS8C 2Q2UA 4ZHQA 1P49A 3N44B 4EFBA 1NT2B 3N40P 1ZAUA 4JI0H 5LXTA 1WN7A 3QF7A 3K57A 4LF6B 3QG5A 3SJBC 3PN1A 3RWRD 4DV7B 4LH7A 2P22C 3L4KA 4LH6A 5EZYB 2ZNJA 4FM1A 5J2TA 5CA0B 1Z2OX 2ZIMA 1N32B 2F1MA 3BPZA 2PGGA 3RGXA 4O4JA 3T1HH 4TQFA 4X1KB 5LL6b 4DR7H 5K1PA 5K1XA 5KX5B 3VQXA 1I7FA 2RQ6A 1P16A 1GYFA 5D1PA 1XI1A 1V9PA 4NXNB 3VQWA 5LYJA 4RB0A 4J0MA 2HEPA 4D7TA 1O9HA 4DV3H 3JATB 1B04A 3BHPA 3CHXA 4I55B 4LR3A 4FFBA 3N6XA 2HGSA 2UU9H 5JQGB 4DR1H 3B2EE 5JJJB 1IBMB 4O4LA 2VWKA 5JCOC 4DV5H 3K5LA 1WPBA 4FLWA 4AQYH 1J5EH 3RFRA 2VQEB 3KAKA 4TV8A 4ZOLA 4DV0B 1N33H 4KHPH 4X66B 5EYPB 5CA1A 1CKMA 2HVSA 3OTOH 1L2ZA 4DK0A 2RJZA 1CKOA 3W5OA 5KHHA 5KHKA 3L2PA 5JJNB 1TGOA 1H2SB 3WB2A 4UFZA 2VQFB 2RGVA 4TOIA 4FM2A 2E3CA 2FE3A 5EZYA 4JI1H 4DRXA 3W1GA 4ZI7B 5CA0A 4PZ8A 3T1YB 2Q0AA 1I6UA 2RGRA 4X1KA 5GONA 2E5LH 4UCTA 5ITZB 1IBKB 4GKKB 4RB2C 4FLZA 3TY9A 1G6UA 4B3MH 4IHJB 4AILC 3LMLA 3THOA 4LF8H 4DUZB 4YJ3B 3RIZA 4LFAH 4PZ6A 1X4TA 3JAKA 3KAJA 4PI0A 4F6RB 3E22B 3TY5A 5IT9W 2WE6A 2XHBA 1O9GA 4I55A 3L4JA 4JYAH 2EX3A 4HNAA 1N36B 2ZNIA 4B3RB 5JQGA 4DR6H 4ZHQB 1E4GT 1Q43A 2CAZC 1XMQH 5FPRA 4ETSA 4NXMB 5IJ9A 5JH7B 4DV6B 3JASB 2JS5A 3WB0A 2BTOA 4TV9A 4O4IB 2HHHB 3A2FA 5EYPA 1AN7A 4KL1A 5FLXW 4LF4B 2OWOA 4PZ7A 3N2KB 2UUBB 2PYJA 3HKDB 4DV1B 1HNXB 4LF6H 4DR4B 1S03G 4DV7H 4EB6A 1D5AA 3RYCB 4DR3B 2F4VB 1HNZB 2PZSA 4HBNA 1N32H 2ZIOA 4K8ZA 1ZHQA 1HR0B 4O2BB 1JFFB 5ITZA 3FMAA 4FFBB 3RR5A 4EFEA 4NXNH 4O4LB 4I50B 4IHJA 1FJGB 3JALB 4YJ3A 3CVZA 2VUGA 3E22A 4RB3C 4ZOLB 4LSXA 5LP6C 4DR5B 1Q3EA 4R7RA 3M4IA 4CH4A 2UUAH 3ETQA 5IJ0B 4B3TB 1IBMH 2QM4A 4DR2B 2VQEH 5JH7A 3JASA 5FD5A 2YIBD 4DV0H 4X66H 2YXLA 4O4IA 3GB8B 4LF9B 4AHCA 3VNNA 4FVMA 2F95B 4DRXB 3JARB 3N2KA 3BRCA 5IWAB 4K8XA 4LF7B 1DGSA 5FNVB 4A2AA 3HKDA 4WBNB 5GONB 1XHZA 1TA8A 2VQFH 5BR8B 2ZM6B 3RGZA 4I4TB 3RYCA 3LNNA 4JI8B 5D5QA 4FLXA 4FM0A 4YHHH 2VWJA 1HNWB 3JAKB 4JI2B 4O2BA 1JFFA 1IBKH 4X20A 4GKKH 2R9AA 5EIBD 4TQDA 5D1OA 4HNAB 1TUBA 1A0IA 2CW8A 1MZBA 4X65B 3F8NA 4JV5H 4DUZH 4I50A 5JJEB 3DF7A 3JALA 4EQ5A 1SKVA 4UCVA 5IJ9B 1O75A 4TV9B 1M5IA 2BTQA 2UUCB 3N2GB 1N36H 4B3RH 5IJ0A 3IAYA 2HVQA 3MAQA 3S24A 1Z2PX 4NXMH 4DV6H 1SA0B 2YI9A 2HHHH 4EB6B 4CH3A 2CFMA 3SR2C 2UUBH 4K0KB 4DV2B 2JVDA 3JARA 1HNXH 3JSLA 4DV1H 4CC5A 4GKJB 5FNVA 4FLUA 2VOBA 4WBNA 2Q7EA 4MV7A 4DR4H 5C8YB 4UCOA 4LMYA 2V4DA 2PYLA 4RB1A 4I9QA 4DRFA 1HNZH 4I4TA 4LNUB 3JAWB 1P8LA 1WNSA 3HKEA 3N43B 3K5OA 4UCRA 3DSQA 4E6NA 1SYXB 4OX9H 1IBLB 4BWSC 1YEWA 1FKAH 5JCOA 4IIJA 4CC6A 4B08A 3RYIB 2UXCB 3SJAC 4LFBB 2UXDB 1M4UA 3RYHB 1FJGH 4JI6H 4MTEA 5EIBC 1CKNA 5J2UB 1I94H 3HKBB 2WDTA 3IG0A 4DR5H 1XMOB 3BAAA 4X64B 2UXBB 3N2GA 5DISC 2UU9B 4B3TH 2Q7GA 4UCUA 5FPOA 2XIGA 1ZHSA 4EEQA 1XNQB 4DV5B 5FD6A 2F93B 1JJOA 5A2QW 1SA0A 3BABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T B;  3OTO B;  1XDN A;  4DR7 B;  4GLX A;  1XK5 A;  4DR2 B;  1B04 A;  4LF5 B;  2HVR A;  4LFC B;  4YHH B;  3GB8 B;  3NC0 B;  1IBM B;  4LF9 B;  4DV3 B;  3VNN A;  5D1O B;  4LF7 B;  5IWA B;  3BA8 A;  2HIX A;  1DGS A;  2VQE B;  4JI5 B;  4DV0 B;  3GJX B;  4X66 B;  1CKM A;  2HVS A;  1TA8 A;  4DR1 B;  4JV5 B;  1CKO A;  5BR8 B;  3W5O A;  2ZM6 B;  3L2P A;  4AQY B;  1J5E B;  4JI8 B;  3TY8 A;  1TAE A;  1N33 B;  4KHP B;  4B3M B;  4UFZ A;  3UQ8 A;  4DUY B;  4JI4 B;  1HNW B;  2VQF B;  4JI7 B;  1S68 A;  4JI2 B;  4TOI A;  3W1B A;  5D1O A;  3W1G A;  4PZ8 A;  1A0I A;  4JYA B;  3T1Y B;  4X65 B;  5LMN B;  4UCT A;  4EQ5 A;  4UCV A;  1IBK B;  4GKK B;  2HIV A;  4JI1 B;  4UCS A;  4JI3 B;  3TY9 A;  2UUC B;  3QWU A;  1X9N A;  5LMU B;  4DUZ B;  2HVQ A;  2E5L B;  3S24 A;  1N34 B;  4PZ6 A;  1V9P A;  3TY5 A;  1N36 B;  4B3R B;  4LF8 B;  3RTX A;  2CFM A;  4LFA B;  4OX9 B;  3KYH C;  5FPR A;  4K0K B;  4DV2 B;  4DV6 B;  4NXM B;  3JSL A;  4CC5 A;  4GKJ B;  1FVI A;  2Q2T A;  2HHH B;  4YY3 B;  4UCO A;  4DR6 B;  4B3S B;  1CKN B;  3BA9 A;  4LF4 B;  2OWO A;  4JI6 B;  4PZ7 A;  1XMQ B;  4DRF A;  2UUB B;  1I94 B;  4DV1 B;  1HNX B;  4DV4 B;  1P8L A;  3GDE A;  3NBZ B;  4DR4 B;  4UCR A;  4E6N A;  2Q2U A;  1IBL B;  3SGI A;  4EFB A;  4DR3 B;  1XNR B;  2F4V B;  1HNZ B;  1ZAU A;  4CC6 A;  2UXC B;  4LFB B;  4LF6 B;  2UXD B;  2UUA B;  3PN1 A;  4X62 B;  4DV7 B;  4LH7 A;  1HR0 B;  4LH6 A;  1VS0 A;  1CKN A;  3RR5 A;  4JI0 B;  4EFE A;  1XMO B;  1N32 B;  3BAA A;  4X64 B;  2UXB B;  5DIS C;  2UU9 B;  1FJG B;  4UCU A;  3JSN A;  5FPO A;  4EEQ A;  1XNQ B;  4DV5 B;  2VUG A;  1P16 A;  3NBY B;  5D1P A;  4DR5 B;  3T1H B;  4NXN B;  3BAB A; 
#chains in the Genus database with same CATH topology
 3G6Y A;  3FFQ A;  3OTO B;  3AG3 C;  2CH7 B;  5L1I A;  3OHA A;  1BGW A;  2W9B B;  3VBB A;  5EWE A;  3GTQ A;  4PDB A;  3P30 A;  5I5W A;  2YID A;  4YBZ B;  2WWW A;  2A06 H;  5BR8 H;  2F23 A;  4Q0Y A;  4EEY A;  2ZM6 H;  4MW3 A;  1WR2 A;  2CKZ B;  2R7Z G;  1TUB B;  5H80 A;  3D36 A;  4DV0 O;  4RAY A;  5LP6 B;  2QK4 A;  1RFY A;  3L73 H;  1W96 A;  4J9K A;  3EYY A;  5EBM C;  2OIG A;  1I08 A;  2IH3 C;  2BTQ B;  3X2Q B;  1PV0 A;  5I60 A;  4JAV A;  3TY8 A;  4GYC B;  1BJT A;  3RYI A;  1TAE A;  5KG4 A;  4X65 H;  4B3M B;  4QJF B;  3W1B A;  4XDJ A;  5GON F;  5D8D A;  4U7N A;  5J2U A;  4O7Y A;  2AQ4 A;  4ZIB A;  3LSS A;  3ASN C;  3H20 A;  5KT5 A;  1P7B A;  3OSP A;  3N41 B;  3I5D A;  5LMN B;  4O3S A;  2JGD A;  3G80 A;  3RYF A;  1BL8 A;  3ZN1 A;  3RAQ A;  2HR3 A;  4EBE A;  1T5E A;  4O3Q A;  4DYL A;  5LMU B;  2E75 B;  4PDM A;  2YU9 A;  4DUZ O;  2CH7 A;  5JQG F;  3MR5 A;  1MG1 A;  3J7A K;  4K0K H;  4DV2 H;  1JJ2 U;  3WO1 A;  2JEJ A;  5H6R A;  1A3G A;  3JD2 A;  4RUE A;  2A0L A;  2EJ2 A;  1QU7 A;  1BS3 A;  2YIA A;  2WYO A;  2IW5 A;  3P3P A;  1K5Q A;  3SPI A;  4UVA A;  3UCS C;  2V5A A;  5IT9 N;  1WA8 B;  2YUA A;  4NXM O;  1M9N A;  1XBL A;  1BQZ A;  1M93 A;  2Y4U A;  4J7Z A;  5LP6 A;  4B3S B;  5LGN A;  2HG5 C;  4FK5 C;  2UUB O;  1JPX A;  5BMV B;  5C93 A;  1HNX O;  3GDE A;  1WCM A;  5FLX N;  4QJF A;  2R93 G;  4A93 G;  3CRQ A;  3K0G A;  1Y76 B;  3FAV B;  5LGT A;  3SPC A;  3OFN G;  3TQT A;  2OT5 A;  5JVD A;  2Y0I A;  2FPG B;  5EC1 C;  2CNU A;  2UXB H;  1JOY A;  2OIE A;  3JAM W;  4LF4 H;  3ZN0 A;  3HKC A;  1VS0 A;  4FS1 A;  1V55 B;  5DGA A;  1I5X A;  3G6V A;  2GQR A;  2AGO A;  3RB0 A;  2QM8 A;  2OCH A;  3KZI Z;  1XRE A;  3S3W A;  4JI6 O;  4F6E A;  2WTF A;  2PUS A;  3G8C A;  3NBY B;  4QE7 A;  3WWH A;  3Q4H A;  2JEU A;  4O4I F;  2HP8 A;  4AI8 A;  4H44 B;  2HHF B;  5I5S A;  1LUV A;  1WA8 A;  1V51 A;  1K97 A;  1K8A W;  2BQ3 A;  4BY1 G;  1A0G A;  3NC0 B;  3J81 W;  5JVL A;  1T36 A;  4DV3 B;  4NZO A;  2L35 A;  2R8H A;  1AI5 A;  1Q5O A;  2ZR2 A;  4X1Y B;  2ZJT A;  1NTK H;  4OXS A;  5BMV A;  5JQW A;  4EBD A;  4NYK A;  4X9Q A;  2NVY A;  4JI4 H;  4J7J A;  2NU6 B;  2CGO A;  2DWE C;  4DR2 H;  3QO8 A;  5BR8 O;  1UNN C;  3AG3 B;  5CB4 B;  2ZM6 O;  2R72 A;  1AI6 A;  1Y76 A;  4O4H B;  1AP6 A;  3K58 A;  3LQS A;  4ABM A;  3LUL A;  1HDJ A;  3CP1 A;  5DGH A;  3I4N G;  1KMI Z;  3N27 A;  2KKW A;  3RBE A;  2JS3 A;  5DED A;  1MZE A;  2KSW A;  1XUQ A;  2RDJ A;  5KHG A;  4PA4 A;  3CCU V;  5HNE A;  2PF4 E;  4DL2 A;  4BIO A;  2FL4 A;  4X65 O;  4FIP C;  2ZCE A;  2R87 A;  4JI1 B;  2PY5 A;  1OCZ C;  2IJJ A;  5CA3 A;  3O9O A;  5KFJ A;  1S9F A;  3FB7 C;  4F4L A;  4IYH A;  1AVM A;  1H2K A;  2HHF A;  2X6A A;  4J9M A;  5DG7 A;  3A0R A;  2YI8 A;  4GX0 A;  1PL0 A;  3AYH B;  1QQC A;  1Y74 A;  3ASN B;  3LDE A;  3FYI B;  4LFA B;  5DEC A;  5KFP A;  1NBM G;  4QWD A;  4K0K O;  4DV2 O;  1CS0 A;  1NJI W;  2YL2 A;  4PBC A;  1S5J A;  4H13 B;  1EN4 A;  2FKX A;  3BA9 A;  3GID A;  4H37 A;  3MWM A;  3AK3 A;  1XNR H;  2W6O A;  3GTJ A;  3BQ0 A;  4MVU A;  2ASJ A;  3ZS8 C;  1KKD A;  5KFW A;  2JJ2 G;  3MHS C;  3BEH A;  1P49 A;  4A3M G;  3N44 B;  1IYE A;  3N40 P;  2XAJ A;  2M7W A;  2OCC C;  1WN7 A;  4DO2 A;  1THZ A;  3EFF K;  3QG5 A;  3TXQ A;  5KG6 A;  4N23 A;  4JV0 A;  3ZRW B;  4BW5 A;  3RWR D;  4CBC A;  2ZNJ A;  3T1C A;  3MR3 A;  2Q4P A;  1Z2O X;  3T1H H;  4WF9 V;  3BPZ A;  1N32 B;  1RJR A;  3RGX A;  4CMD A;  2VUM G;  4TQF A;  5E1A C;  2UXB O;  2ALZ A;  4W4K A;  3GIP A;  4DR7 H;  4LF4 O;  1AIL A;  5K1P A;  4MV1 A;  1TWA A;  3RVZ A;  5KFN A;  1I0H A;  5JUM A;  1V9P A;  3MR6 A;  4J0M A;  1YZB A;  2HEP A;  2Q8V A;  1H2M A;  3JAT B;  2YRW A;  1YHQ V;  2LFR A;  4FFB A;  2EIM C;  1YJW V;  4EG0 A;  1RYR A;  3OMN B;  2VWK A;  1V54 B;  1WPB A;  4AYB E;  2HG8 A;  1H2N A;  3HOU G;  2ZDI C;  3RB3 A;  4ZOL A;  4DV0 B;  4KHP H;  3OTO H;  4J9Z B;  3LSU A;  5BPH A;  1OBD A;  1URF A;  2RJZ A;  4ED7 A;  5KFE A;  2WLI A;  4NTY A;  2QA4 V;  5IYD O;  5C44 G;  2VS0 A;  3R5X A;  1EKP A;  1EKF A;  1QVG U;  4UFZ A;  1M90 W;  4JI4 O;  2FLP A;  4YAK B;  4YP3 A;  4H0L B;  4DR2 O;  2I8C A;  2FE3 A;  3B40 A;  2DYS C;  2PMZ A;  3H1I H;  5CB4 F;  4ZI7 B;  4O4H F;  2R92 G;  2YXH A;  3V4Z A;  3T1Y B;  1KJJ A;  3GIL A;  2E5L H;  5L3B A;  4JF3 A;  4DL6 A;  1PK8 A;  4LCU C;  5ITZ B;  5LL6 Y;  2HKO A;  2D2C B;  2IBZ H;  1IX9 A;  3M9M B;  1W59 A;  4B3M H;  4LF8 H;  1ZQ7 A;  4HNV A;  4JAS A;  5L3C A;  4DUZ B;  5KFY A;  4YJ3 B;  2V4R A;  4G3I A;  3VPB A;  1X4T A;  1DF4 A;  5DLF A;  4Q20 A;  4PI0 A;  5AG2 A;  3PW2 A;  2P4K A;  5IT9 W;  1O9G A;  1JDE A;  4ECZ A;  3T9E A;  1Q43 A;  4ETS A;  4NXM B;  5IJ9 A;  4MVQ A;  3JAS B;  2YW2 A;  1DTO A;  4RZR A;  2FK1 A;  2YWV A;  2BTO A;  3EHB B;  1OCZ B;  3A2F A;  1BNC A;  5FLX W;  3ZHR A;  2UUB B;  5KFU A;  2JA5 A;  2X6B A;  3HKD B;  1HNX B;  2AZ2 A;  1FFT B;  3K79 A;  2GUZ A;  1S03 G;  2PBZ A;  2CDY A;  1NTZ H;  1NS1 A;  4MVR A;  3MD0 A;  4DR3 B;  4O3P A;  4JYY A;  3C3T A;  4HBN A;  3TII A;  4RUC A;  2IJI A;  3OR7 C;  4K8Z A;  3G6E V;  5KFH A;  1Y66 A;  4O2B B;  1JFF B;  5ITZ A;  4EFE A;  4O4L B;  4I50 B;  4TUY F;  3L70 H;  4YJ3 A;  1GN4 A;  4I9W A;  2MK3 A;  2VA3 A;  1IZ3 A;  4UVB A;  3ZRV A;  3M4I A;  3T1H O;  4CH4 A;  2L6L A;  3ETQ A;  2P4V A;  5IJ0 B;  3CQZ A;  4DR7 O;  2OLS A;  1I7N A;  1WSC A;  4QWC A;  3J80 N;  2ZQM A;  3BG5 A;  3JAS A;  3WO0 A;  1OCO B;  5FD5 A;  2UVV A;  5B5E Z;  4UB8 Z;  3GB8 B;  2HVJ C;  3HOZ G;  5CBF A;  3VNN A;  4R8C A;  2F95 B;  2JA7 A;  3BRC A;  1P4R A;  2F43 G;  1DGS A;  3ZMS A;  3TIG A;  3HKD A;  3H0G A;  2LGW A;  2C22 A;  1FXH A;  2VQF H;  5BR8 B;  5IYZ F;  2ZM6 B;  3TET A;  4QE9 A;  3HO8 A;  4DQN A;  5D5Q A;  4JGS A;  5CR5 A;  2ZGI A;  1FD9 A;  2VWJ A;  4KHP O;  3OTO O;  1Q6I A;  2EIM B;  1ENV A;  4O2B A;  1JFF A;  1B06 A;  3M8A A;  5EIB D;  1X59 A;  2V1D A;  2H3O A;  4HNA B;  1R3J C;  2NNU A;  5I5U A;  2CW8 A;  1COW G;  4X65 B;  3BJY A;  1QNM A;  4I50 A;  3WU2 Z;  3QQM A;  3ZHT A;  5KFA A;  1JCH A;  4NTW A;  4RU9 A;  1YIT V;  4TV9 B;  1N0N A;  2FPP B;  2UUC B;  1EZJ A;  4ZI7 F;  5IJ0 A;  3IAY A;  2W9A A;  2FTK A;  3CXC U;  3S24 A;  2DMX A;  1Z2P X;  2A3Q A;  2CQY A;  1VQO V;  4DV6 H;  2FML A;  4A5U B;  2DW4 A;  4IL6 Z;  1K73 W;  3G71 V;  4MTF A;  4B3M O;  5BWX A;  4IGG A;  2RF4 A;  4LF8 O;  5C3E G;  3SYP A;  3SR2 C;  1VP7 A;  4K0K B;  4DV2 B;  4YJ3 F;  4DV1 H;  5BZB A;  3EVK A;  3GQC A;  4DR4 H;  2V4Q A;  1N4C A;  5C8Y B;  4DW1 A;  5I5Y A;  3OUF A;  3GIM A;  4J9P A;  3H4B A;  1GM8 A;  2JEI A;  3GV7 B;  4LNU B;  3JAW B;  4GUN A;  3OW2 U;  2XC9 A;  4Q45 A;  3K5O A;  1FYJ A;  1GSA A;  3SPJ A;  4JTC B;  4F4W A;  4YIO A;  3ZIA G;  4CC6 A;  4B08 A;  4MVM A;  4ECU A;  3SJA C;  4U3F H;  5KFX A;  2YC0 A;  2Q73 A;  2ZDI A;  4J41 A;  2IBK A;  1FJG H;  1SRY A;  4QWE A;  3PR5 B;  3K06 A;  1OJH A;  2Z0A A;  5KFG A;  3HKB B;  2W0F C;  3I12 A;  2A7W A;  3BAA A;  3O65 A;  2UXB B;  2UU9 B;  4GC7 A;  2Q7G A;  4B3S O;  1YIJ V;  1M57 B;  2ZT9 B;  4EEQ A;  2WB1 A;  2R85 A;  1TWH A;  1EN5 A;  3E8G A;  4HYO A;  3K08 A;  4IRC A;  2HJD A;  1KB9 F;  3J7A U;  3HBL A;  2XAH A;  5IY5 C;  1K33 A;  1NR7 A;  1IXM A;  4BR6 A;  1KUQ A;  4O4L F;  2VQD A;  5CBG A;  1OZ0 A;  1L1F A;  3D3I A;  4TV8 F;  2W7O A;  2QF7 A;  5C8Y A;  3ETH A;  2C2R A;  3P32 A;  1RK6 A;  4X20 B;  1NH2 D;  2FYU H;  1GSO A;  5H5N A;  1SZT A;  5EDW A;  3Q2O A;  1SQG A;  4LNU A;  2OTJ V;  2B63 A;  3JAW A;  4QNH B;  2A9H A;  5KT2 A;  2RMK B;  3KAL A;  2GV9 A;  1IDS A;  3HKZ A;  4JI2 H;  4FLY A;  4WFA V;  1SEI A;  1W93 A;  2LQT A;  3DTG A;  1JA8 A;  1K92 A;  1WH2 A;  4JI4 B;  4R6Z A;  2EIK C;  3UT5 B;  4APM A;  3ASO C;  2VQF O;  4EKW A;  4BY7 G;  5KHJ A;  5L1L A;  3CC7 V;  2C2D A;  3GIQ A;  3HKB A;  1PNL A;  1ZL8 B;  1RSO B;  3L74 H;  2ZE5 A;  3BCC H;  4EYI B;  4ED3 A;  1L0N H;  2W8K A;  4DV3 O;  1GTO A;  4LBE C;  3ORR A;  3WWI A;  2MW2 B;  3NXS A;  1AR1 B;  4A3G G;  4I55 F;  1XEQ A;  1SQF A;  3DTF A;  2R82 A;  3GTP A;  3CCS V;  4IZO A;  3T1Y H;  2JK5 C;  4HYK A;  1KU9 A;  1AUX A;  4WFH A;  4TV9 F;  3IC9 A;  5F2V O;  1PKX A;  1DAA A;  2W6N A;  3RTX A;  4IIJ B;  3RJ0 A;  1QR8 A;  3KXY T;  3PW7 A;  2JEF A;  3SYA A;  4DV6 O;  3I4M G;  1VKZ A;  2AU0 A;  1DF5 A;  1E79 G;  2EIJ B;  1UPG A;  4ED2 A;  1QR9 A;  2EJ0 A;  4A3D G;  1GM7 A;  1CKN B;  1YDX A;  5D5P A;  4JI1 O;  1R3L C;  1S77 D;  2UXC H;  1A32 A;  2EJ7 A;  3STZ C;  5IYB O;  2UXD H;  2LJ2 A;  3NBZ B;  4X89 A;  4DR4 O;  3UT5 A;  3SGI A;  1AR4 A;  1I2L A;  1XNR B;  1PNM A;  3QTC A;  2Z02 A;  4RNN A;  1ZL8 A;  1NKD A;  1RSO A;  5H6Q A;  4O7V A;  2UUA B;  3VQV A;  4C5B A;  4O7W A;  2XND G;  4IHJ F;  3VMM A;  1SFO A;  3WG7 C;  3Q8R B;  1QHT A;  1LUW A;  2COG A;  1HW7 A;  2Q7H A;  5EC2 C;  1VAJ A;  2EIL C;  1FJG O;  4DR3 H;  4XZ3 B;  1Y1W A;  1GN3 A;  4K6N A;  4UUG A;  4Q4C A;  1FAF A;  3ETJ A;  3J80 W;  3T1H B;  5JH7 F;  4Q6G A;  2YXY A;  4DR7 B;  4ZQI A;  3H01 A;  3AK1 A;  4MTX A;  1JXL A;  4UV9 A;  4BBR G;  1S3J A;  3G6B A;  3SPG A;  1T94 A;  3UYY A;  2DZD A;  3KKY A;  5L3G A;  3ZRS A;  5LOV B;  4PI2 A;  2JEG A;  1BQ0 A;  4GLW A;  2QDO A;  4J7K A;  3GLK A;  3SJC C;  4DUY H;  4JI7 H;  4L87 A;  4ECY A;  5HBR B;  1YTF D;  5EOY A;  3RYF B;  5DQI A;  3P3N A;  5IY5 B;  1XQ8 A;  5L3E A;  3U0Z A;  3NUA A;  3MJF A;  4M9U A;  3N42 B;  4KHP B;  4D6T H;  1SET A;  1VF7 A;  4PHZ A;  3UQ8 A;  1WCM G;  4TQS A;  4FLT A;  4JI2 O;  1M0W A;  1QLE C;  1HWY A;  3CRR A;  5DGI A;  5LXT B;  1GO3 F;  3HOV G;  5EBL C;  2CTP A;  2R8I A;  1QCE A;  2W6P A;  4XX0 B;  2CTW A;  2Z5U A;  3OAA G;  1N34 H;  1K7D A;  1ORQ C;  3EPI A;  1ZLZ A;  3PW4 A;  2CNQ A;  1W0J G;  4UCS A;  2EJ3 A;  1K4D C;  3CCR V;  2H94 A;  1BXR A;  3VQY A;  4E2L A;  2E5L B;  4UXN A;  5B3S C;  2CK3 G;  2EIK B;  3ASO B;  2YS8 A;  1KC8 W;  2E76 B;  1G2W A;  4WD3 A;  3RVY A;  2YIC A;  4DK1 A;  5LOV A;  4YY3 H;  2P5O A;  4LF8 B;  1HP8 A;  2WA3 A;  2COI A;  2ILM A;  5JVD B;  2RCV A;  2B1I A;  2JIZ G;  1XDC A;  3FYE B;  2QTO A;  2GSM B;  4DV4 H;  2UUC H;  2WLJ A;  4PA9 A;  3T1Y O;  3V6J A;  3HKC B;  4CS2 A;  4OPH A;  2HJF C;  3CB2 A;  4MA0 A;  3TJT A;  1SS3 A;  4WHX A;  1GRJ A;  2DLN A;  1KC7 A;  4CH5 A;  3MWD A;  4IIJ F;  2HGW A;  5CA1 B;  3W7X A;  1L8D A;  4L8J A;  3K0D A;  1MAB G;  4LSA A;  1Q81 W;  4EFB A;  3RBZ A;  4JI0 H;  5LXT A;  3E8F A;  3QF7 A;  3Q4H B;  1JVM A;  2UXD O;  3UZB A;  3SJB C;  2GDS A;  4LH7 A;  4LH6 A;  5EZY B;  3I56 V;  3JZF A;  4O7R A;  1VF6 C;  5B66 Z;  5CA0 B;  2F1M A;  1OHH G;  2PGG A;  1I7L A;  1IVS A;  4X1K B;  3ABK C;  3F7Y C;  1AP5 A;  2QWN B;  5K1X A;  4U6P A;  1AR5 A;  2RQ6 A;  2YS6 A;  2XCP A;  3H1H H;  2B9Z A;  1BMF G;  4RB0 A;  4D7T A;  2AGQ A;  3IC7 A;  4ZKI A;  4DR3 O;  3TQ1 A;  4IWY A;  3BHP A;  3WG7 B;  2K1E A;  3CHX A;  2W8L A;  5IYC G;  2DWC A;  3KHL A;  2UU9 H;  3SYQ A;  2XAG A;  2KSD A;  2GTS A;  4PDV A;  3T9F A;  4DR1 H;  4ECQ A;  2QM7 A;  1WPX A;  2Z3Y A;  4HR7 A;  2GPS A;  4AQY H;  4LC1 A;  2P6J A;  3KAK A;  1A9X A;  3KHH A;  4A3F G;  3CYO A;  3HB9 A;  1Q90 D;  1N33 H;  5EYP B;  5CA1 A;  1CKM A;  2NU8 B;  2J6U A;  1I5Y A;  1DLB A;  3W5O A;  5KHH A;  4X88 A;  3UFX B;  2EIN B;  3L2P A;  5JJN B;  3FB6 C;  1EHI A;  5J2U F;  3VOU A;  4E4E A;  4JZG A;  3BFR A;  4C5A A;  4DUY O;  2VQF B;  1SF9 A;  4FZ0 A;  4JI7 O;  4TOI A;  2RGV A;  2ETN A;  5K3W A;  1GKF A;  5EZY A;  4IRK A;  1QLN A;  3W1G A;  5CA0 A;  5TIS Z;  3T2M A;  4PZ8 A;  4GX1 A;  5IP9 G;  1Y74 B;  1R6T A;  2FLL A;  1R3I C;  1I6U A;  4QPJ A;  4X1K A;  1R3K C;  2DYR C;  4RB2 C;  2LGQ A;  5BY1 A;  3ZHV A;  3FKI A;  3GTM A;  5L1K A;  1M6V A;  4F4X A;  3T5J A;  3OGI B;  5KLV H;  4AIL C;  5IYB G;  3K5I A;  4PZ6 A;  1N34 O;  1H8E G;  3JAK A;  3T7A A;  3OHB A;  5BXZ A;  2AGP A;  3TY5 A;  1QLE B;  3H1K H;  1IXB A;  2PI5 A;  2WE6 A;  2Q5Z A;  4GC6 A;  2ZNI A;  4DR6 H;  3TCU A;  5LP6 F;  3KHG A;  5F9L A;  1XMQ H;  4OGQ B;  4O3O A;  4DV6 B;  2J6S A;  2QEX V;  3GWO A;  3LNM B;  4BIU A;  1H38 A;  5EYP A;  4YY3 O;  1AI4 A;  3U54 A;  1P7G A;  2Y48 A;  2V58 A;  2V7Q G;  2R8G A;  4RAI A;  2OWO A;  4PZ7 A;  5B3S B;  1VF5 B;  1YVW A;  2Y4R A;  4DV1 B;  5JVD F;  4QIW A;  4DV4 O;  1N8R W;  2UUC O;  5KFM A;  4DR4 B;  3PVX A;  3G6X A;  5I5T A;  5KG3 A;  3RYC B;  3F5T A;  1PNK A;  3AG1 C;  3QZ7 A;  4YIP A;  5E79 Z;  1SC5 B;  1KT8 A;  2FK3 A;  1Y67 A;  5KG2 A;  3T5L A;  3VPD A;  4P2Z A;  2C28 A;  1ZTE A;  4O82 A;  2DN9 A;  4FFB B;  4P9O A;  2C2E A;  4JI0 O;  4NXN H;  3OGC C;  1KYO F;  4GX5 A;  1I50 A;  4JV1 A;  2K9P A;  1VEW A;  1YXB A;  3DXR B;  1FJG B;  3JAL B;  1VQ9 V;  2QWO B;  2VUG A;  4RB3 C;  4ZOL B;  3CC4 V;  2XTA A;  4Z1V A;  5LBQ A;  2UUA H;  3B8N A;  1JIH A;  2XAF A;  1GMG A;  2HVK C;  1IBM H;  2WLI B;  1XIL A;  1NZ6 A;  3QZ8 A;  3M9N B;  3PO2 G;  1GO3 E;  2YIB D;  4X66 H;  4YB8 B;  5BMV F;  1N56 A;  3K3W A;  5KFR A;  4AHC A;  2XOK G;  3ABK B;  4M0J A;  5BWR A;  1OV9 A;  4FVM A;  2CNV A;  2VA2 A;  1RM1 C;  2W6Z A;  5FNV B;  2WAQ A;  4WBN B;  2WSS G;  3T9C A;  2UU9 O;  4FFP A;  4FPP A;  4DR1 O;  3EXA A;  1K4C C;  4I4T B;  3RYC A;  3RGZ A;  3LNN A;  2XGP A;  4Z1M G;  4AQY O;  1GGO A;  2JA5 G;  1N33 O;  1U97 A;  3W7U A;  4F50 A;  4JI2 B;  2JDI G;  1IBK H;  3AG2 C;  4FJC C;  4JTA B;  5D1O A;  1KEC A;  3ZCC A;  5K2M A;  5CBH A;  2Y0S E;  3F8N A;  4BBS G;  3DXR A;  4YR2 A;  3DF7 A;  3JAL A;  4EQ5 A;  2CTR A;  4UCV A;  5IJ9 B;  2X5R A;  3AG7 A;  3HR0 A;  5C4X G;  1N36 H;  4B3R H;  2UVR A;  3H9V A;  3B77 A;  1A48 A;  1LNQ A;  4WCE V;  2OTL V;  1KEE A;  2GUZ B;  2YI9 A;  2HHH H;  4DL4 A;  1VF6 A;  2ODT X;  2DYR B;  2CZG A;  2N74 A;  2JVD A;  3MDS A;  4FZ1 A;  3JSL A;  4CC5 A;  2KG7 A;  5FNV A;  4WBN A;  2Q7E A;  5CMU A;  5BYA A;  1CQJ B;  4UCO A;  2GQS A;  3AG4 C;  2A1H A;  4DR6 O;  1SES A;  5HFM A;  3B09 A;  2PYL A;  4RB1 A;  1XMQ O;  2YDE A;  2JA7 G;  4I4T A;  2R6F A;  1E1R G;  3H0G G;  1WNS A;  2FB5 A;  3OR6 C;  4WFB V;  1CQI B;  3HKE A;  3DSQ A;  5JWP A;  3FB5 C;  2XGQ A;  1YEW A;  1Q86 W;  4MVO A;  4K3A A;  4A3K G;  2UXC B;  1JLL B;  2UXD B;  1M4U A;  3BAC A;  3H1J H;  5KFC A;  1W2B U;  3E5N A;  4UB6 Z;  1EUD B;  3HT5 A;  4MTE A;  5EIB C;  4RQE A;  5DMX A;  3IG0 A;  4QGP A;  2AGA A;  4B3T H;  3KG2 A;  2XIG A;  1B6Q A;  1K1S A;  4DV5 B;  2PI4 A;  1LR1 A;  3AG1 B;  2ASL A;  4NXN O;  5EK0 A;  2YIB A;  4F4Z A;  4LF9 H;  2WLN A;  1XNR O;  1M1K W;  4LF7 H;  3B8M A;  4RZQ A;  2HFE C;  1EUC B;  3DGE A;  3UKM A;  3RFC A;  5KG5 A;  1E4E A;  2UUA O;  3D8C A;  4ZOL F;  1VQM V;  1IBM O;  2R7M A;  1R6N A;  1VBH A;  1TVK A;  2YS7 A;  2YSU B;  3GB7 C;  4MTO A;  4O2A B;  4X66 O;  4O7L A;  5KUK A;  1K1Q A;  2QWR B;  4PD4 F;  3KCX A;  1JKJ B;  1EYZ A;  2IJK A;  3OUS A;  4QPK A;  5HV6 A;  2OCC B;  4Q8E A;  3OD4 A;  1JDB B;  4R8U B;  2XT9 A;  5LHG A;  4DUY B;  4WBN F;  4JI7 B;  1S0N A;  1VQ4 V;  4YR0 A;  5DM6 V;  2LW1 A;  1VQN V;  2W71 A;  2YZG A;  2YCH A;  2X6C A;  4JYA B;  1F4N A;  3OUZ A;  3CE2 A;  5GTI Z;  1VQ8 V;  3RV3 A;  4CKE A;  3F5W C;  2OYQ A;  4I7H A;  2CE4 A;  1IBK O;  2IM9 A;  3RGB A;  3W7W A;  1QVF U;  3D3Q A;  1VQ6 V;  5BWT A;  1X9N A;  3LSQ A;  3JRX A;  3OSN A;  4YQW A;  1N34 B;  1EM1 A;  5FLM G;  3QO7 A;  1G4Y B;  2FKL A;  2M05 A;  3PO3 G;  2ZXW C;  1M56 C;  4MV9 A;  1N36 O;  4B3R O;  5IDJ A;  4J9Q A;  4FLV A;  3Q8P B;  2E2H A;  2CW7 A;  3GIJ A;  2QJ1 A;  3KTM A;  2Y69 C;  1RJP A;  2Q2T A;  4YY3 B;  4O2A A;  2HHH O;  4N21 A;  3GWK C;  3OEE G;  1GK9 A;  1DK1 A;  3PJS K;  4DV4 B;  2B63 G;  4IR9 A;  4R8U A;  1MMM A;  1S5L Z;  3F7V C;  2E5L O;  1AB3 A;  4G28 B;  4NKG B;  2DYS B;  1XMO H;  2GLT A;  3VPC A;  4O84 A;  4FFM A;  4X64 H;  4YJ2 B;  2O03 A;  3SPH A;  2UVU A;  1ZX3 A;  4CMF A;  1N0J A;  1NQT A;  1I3Q A;  2YYA A;  4BWA A;  1Y1V G;  3AG4 B;  2YZL A;  3BQ2 A;  3TK1 A;  3IFX A;  4JI0 B;  1B33 N;  2JA6 A;  1F7Y A;  1G8M A;  1BHB A;  5B1O A;  3CCV V;  3APQ A;  3V6H A;  4F4Y A;  4CKC A;  4LF5 H;  2RDC A;  4LFC H;  2OH2 A;  3B4S A;  4B3T O;  1XDN A;  5KKN B;  4GLX A;  3R5F A;  1TWC A;  1GH6 A;  2P90 A;  2R9R B;  1EBO A;  3HOY G;  4MTD A;  4JI5 H;  4QWB A;  2Y0P A;  1C30 A;  2GBO A;  4EBC A;  1GN6 A;  2ZE8 A;  4X1I B;  4YHH B;  4FE2 A;  2Q0O C;  4LP8 A;  4J10 A;  3ZRX A;  4M7E A;  2AHZ A;  3BA8 A;  5KX5 A;  4RUA A;  2DJV A;  3E86 A;  2EJR A;  1R1B A;  2VPS A;  4P30 A;  3ABL C;  4DR1 B;  1F4M A;  3RN4 A;  4JV5 B;  1NVP D;  2ABJ A;  1YSC A;  1AJP A;  4O2B F;  4AQY B;  4KP4 A;  2F66 C;  5LA6 B;  5IYD G;  4HQ6 A;  4MA5 A;  4YJ2 A;  1N33 B;  1Z5V A;  5KT7 A;  1EFR G;  3OTF A;  4I50 F;  1Q82 W;  1F23 A;  1UC9 A;  4JI3 H;  3A0B Z;  2QTS A;  3DC6 A;  3U10 A;  2DWD C;  2R7K A;  4J11 A;  4DL7 A;  2BSK B;  1WRV A;  5J2T B;  5KS8 A;  2X0S A;  4IRD A;  4O4J B;  4J9L A;  4OPA A;  5DQG A;  3R5H A;  4JAU A;  5L9X A;  4I0X A;  2FLN A;  3ZMT A;  2QE7 G;  4FFN A;  2ZIN A;  2IU3 A;  1Y1W G;  4CS3 A;  3K3P A;  3E83 A;  3VOT A;  5BWW A;  5LYJ B;  3K9S A;  4X1I A;  1Y1V A;  2R9I A;  4OX9 B;  5KG7 A;  2R70 A;  3RW0 A;  1S0V A;  4RQF A;  3HPL C;  1PM9 A;  2N05 A;  3ML0 A;  2IMW P;  2ZE7 A;  5I5V A;  3KCY A;  1BSM A;  4DR6 B;  3ICX A;  4ECX A;  2JGU A;  2EZO A;  1XMQ B;  5L3D A;  1DV1 A;  3APO A;  4F6R A;  1I94 B;  4FGR A;  1EN6 A;  3U11 A;  2DIK A;  5LA6 A;  3KRE A;  3SJQ C;  5FJ8 G;  3ETG A;  4NR1 A;  2W70 A;  4X62 H;  2Q2U A;  1K83 A;  2R8J A;  5LHH A;  2XAS A;  4ZHQ A;  1NT2 B;  3X2Q C;  1AI7 A;  2LW7 A;  1OBG A;  2IP4 A;  4FFL A;  5GW7 A;  4TVI A;  4CE5 A;  2Y69 B;  3PN1 A;  1SZX A;  2W9C A;  3L4K A;  4XDK A;  3DAA A;  4YXW G;  1NH2 B;  5F9N A;  2BSK A;  4FM1 A;  5J2T A;  1IYD A;  5KFT A;  2ZIM A;  1XMO O;  2NN4 A;  3MFI A;  4O4J A;  4X64 O;  5T14 A;  5J9P C;  2ODM A;  1Q7Y W;  3T4Z A;  2IU0 A;  3FD9 A;  2A79 B;  3VQX A;  3DTU B;  1H2L A;  1I7F A;  1NTM H;  4DV1 O;  1XI1 A;  1OCC C;  2PMZ E;  4NXN B;  3VQW A;  5LYJ A;  4JZ2 A;  4RCN A;  5C8Y F;  1ZSP A;  3ZMU A;  1AUV A;  1E1Q G;  1I2K A;  3K04 A;  1VQ5 V;  3N6X A;  4LR3 A;  4LF5 O;  1B3Q A;  1ZWI C;  3LDD A;  2RDI A;  5EWG A;  4LFC O;  5JQG B;  4I7Z B;  3B2E E;  1IBM B;  5JCO C;  4DV5 H;  3K5L A;  4JV2 A;  4FLW A;  1Z2G A;  1J5E H;  2W0X A;  1ARO P;  3GTO A;  4JI5 O;  4X66 B;  2HVS A;  3T9A A;  2BQU A;  4O83 A;  1VQL V;  2KB1 A;  1CKO A;  2QKS A;  5KFI A;  4L1K A;  2V9W A;  4ECW A;  2BOB C;  2GHY A;  2HJW A;  1TGO A;  1H2S B;  4W4L A;  2ZDQ A;  5KT4 A;  1SQB H;  4O7N A;  2E3C A;  2M6Y A;  2WLL B;  1BHA A;  3T5K A;  4DRX A;  2ZKO A;  3CEI A;  4Y8V B;  4CHI A;  2Q0A A;  4YR3 A;  2RGR A;  2ADQ B;  5GON A;  3BY6 A;  4UCT A;  1V55 C;  1IBK B;  1KJ8 A;  2HLD G;  4JI3 O;  3TY9 A;  1G6U A;  3T54 A;  5KT6 A;  2JJ1 G;  3H1L H;  3THO A;  1B6S A;  4AYB A;  3RIZ A;  4QW9 A;  3KAJ A;  4RWU A;  1PP9 H;  3SYC A;  2XHB A;  4JYA H;  4FS2 A;  1NR1 A;  5DG9 A;  1N36 B;  4B3R B;  5JQG A;  2EIY A;  1E4G T;  2ZDG A;  2PVP A;  3L75 H;  2CAZ C;  5FPR A;  3AK2 A;  3U55 A;  1F51 A;  4U7O A;  1Q6H A;  1K34 A;  3ABT A;  2JS5 A;  4O4I B;  1DIK A;  3TIN A;  2HHH B;  4MV8 A;  1H2G A;  4KL1 A;  2CGN A;  2ZDH A;  4IWX A;  3V6K A;  1RJQ A;  1TWG A;  4ED1 A;  4Q8F A;  4LF6 H;  2QWQ B;  1SQQ H;  1R6K A;  4MVZ A;  2DPJ A;  4DV7 H;  4EB6 A;  5DG8 A;  1S97 A;  2F4V B;  2AW9 A;  2WLL A;  2PZS A;  4QW8 A;  3ZMZ A;  1FXK C;  1ZHQ A;  4X62 O;  1HR0 B;  3JZI A;  4O81 A;  3T4D A;  1L0L H;  2XAQ A;  3CMA V;  2LP7 A;  4O7S A;  3ZHQ A;  1YTF B;  3CVZ A;  3G4S V;  4NYE A;  4LSX A;  2R7N A;  1Q3E A;  3FKI G;  4R7R A;  4A3L G;  4B3T B;  5DGB A;  2QM4 A;  1RPR A;  2KQX A;  3CWB H;  5KFF A;  2VQE H;  3JZ6 A;  2UXC O;  4O7T A;  3PZP A;  4GX2 A;  4E4T A;  2YXL A;  5DQH A;  4O4I A;  3E2E A;  4ED0 A;  2P7T C;  1RK5 A;  4JTD B;  4LF9 B;  4JAA A;  1MSD A;  3OMI B;  3JAR B;  4LF7 B;  4K8X A;  4A2A A;  1KTA A;  3OMA B;  3AW8 A;  2WLM A;  1OCC B;  2BOC C;  1WJZ A;  4GZR B;  2ZD9 A;  5KFL A;  4IYI A;  4DV5 O;  2YZM A;  4PWQ A;  3RT3 C;  3GVM A;  1J5E O;  1FXV A;  2W9B A;  1C3O A;  3C3S A;  4YHH H;  3GTG A;  4Z2W A;  3JAK B;  4ECV A;  4J42 A;  4GKK H;  2R9A A;  2I80 A;  3ZHS A;  3H40 A;  3OEH G;  1TUB A;  1A0I A;  1MZB A;  4JV5 H;  4TWK A;  2EIL B;  4PA7 A;  3JYC A;  5H2F Z;  1SKV A;  3CPW U;  1M5I A;  2BTQ A;  3SDL A;  1JQ0 A;  3FKS G;  4A3B G;  4DXW A;  4NLG A;  2GPW A;  2ASD A;  5LOV F;  2HVQ A;  4WFG A;  3MAQ A;  4NTX A;  1SA0 B;  1S0M A;  1MOF A;  1WB7 A;  2QSA A;  5LHI A;  1S0O A;  4LWS B;  4CH3 A;  4PA3 A;  2CFM A;  3K03 A;  2FK2 A;  3CCJ V;  4R50 A;  3K5H A;  2R7Z A;  2WB1 E;  3JAR A;  3ZJZ A;  2NU7 B;  3U9S A;  1WP8 A;  1T3N A;  4FLU A;  4JYA O;  1GAX A;  1BZK A;  3C90 A;  4FMT A;  4LMY A;  2SCU B;  1V54 C;  2QGN A;  4EYH B;  1Q6U A;  4I9Q A;  3RUP A;  4ECR A;  1HNZ H;  1P8L A;  5LXT F;  3N43 B;  5KA6 A;  1SYX B;  4E6N A;  4TT3 G;  1V4Y A;  4Q44 A;  4OX9 H;  3R9R A;  1FKA H;  2YZN A;  4DW0 A;  5JCO A;  5I5X A;  4ED6 A;  2C2A A;  3QVN A;  3R66 A;  3ETE A;  4LF6 O;  3RYH B;  5HFL A;  4CZZ A;  2X0L A;  3M99 B;  4DV7 O;  3T5H A;  1VQ7 V;  3HKZ E;  2G38 A;  1I94 H;  2WDT A;  4DR5 H;  1XMO B;  1KP2 A;  4X64 B;  5DIS C;  4MSW C;  1MSW D;  1TUE B;  4IR1 A;  5FPO A;  1ZHS A;  4MS2 A;  2ITD C;  4PDR A;  2F93 B;  2NLJ C;  3FAV A;  1JJO A;  2WLH A;  1SA0 A;  1FPO A;  1Y14 B;  3BAB A;  4RAZ A;  3MFH A;  2J9G A;  4HNU A;  2D3O W;  4LWS A;  1FXK B;  3LWB A;  1GN2 A;  4KFM A;  3GV8 B;  2AXT Z;  5IWA H;  4LF5 B;  3CSX A;  2JEX A;  1YJ9 V;  4LFC B;  1PX2 A;  4IAJ A;  1BCC H;  1JR9 A;  3RF2 A;  3LDC A;  5CA1 F;  3MHH C;  1PPJ H;  5D1O B;  5B1A C;  4JI8 H;  4JI5 B;  2VQE O;  3GJX B;  1BE3 H;  1SCU B;  4TM5 A;  1ZET A;  1HNW H;  2R93 A;  4EGQ A;  3WB1 A;  2NVX A;  3CXH F;  1SQV H;  1VAR A;  3L72 H;  1KJ9 A;  5EZY F;  2CTQ A;  3WFV A;  5C5J A;  5CA0 F;  3K9A A;  3RYH A;  1B6R A;  3A8T A;  1JX9 A;  5L3F A;  3WWJ A;  3AEI A;  1GM9 A;  3CCE V;  3RV4 A;  3TW7 A;  5KFS A;  1R9T A;  3R65 A;  4X1Y A;  1G1X B;  1E4F T;  2MCT A;  4YHH O;  3NGD A;  2R7L A;  4O86 A;  1VIB A;  2UXX A;  2WA4 A;  5CB4 A;  4GKK O;  1Z2N X;  2KG7 B;  4O4H A;  4JI3 B;  2HIV A;  5CE8 A;  5KHI A;  2FPI B;  5IP7 G;  3QWU A;  5FR9 A;  1EZ1 A;  4ECS A;  1OCR C;  4JV5 O;  2RN9 A;  5L1J A;  3L9D A;  3RB6 A;  1NU1 H;  1I1L A;  2QB5 A;  1BGY H;  1FXK A;  3W7S A;  1KP3 A;  4J9O A;  4GKJ H;  3LUT B;  4PA6 A;  4TUY B;  2Z04 A;  3HKE B;  3TEK A;  2C35 B;  2IJH A;  2O57 A;  3CCM V;  1WAZ A;  4CH6 A;  3EPG A;  5BWU A;  3IN5 A;  1OCO C;  4QIW F;  3HXL A;  2FMA A;  1IBL H;  3K5N A;  4C2M A;  3FDS A;  4JUZ A;  3NR7 A;  1S5H C;  3CRM A;  4UUJ C;  2WPD G;  4A2B A;  3JD3 A;  4LFB H;  1N48 A;  1MZF A;  3QFF A;  4HNT A;  4JXU A;  1S10 A;  5DAA A;  2H8P C;  1HNZ O;  3C0F B;  1IOV A;  3JD1 A;  3PW0 A;  1S76 D;  5IYZ B;  4X62 B;  3PW5 A;  4DL5 A;  1UFI A;  5CN0 A;  4OX9 O;  1XNQ H;  1FKA O;  2Q68 A;  2ADP A;  2GTA A;  3E35 A;  1E4E B;  5KMG B;  2W57 A;  2BR0 A;  1QBZ A;  3JSN A;  4BW9 A;  3CCQ V;  1AJN A;  5I47 A;  4A3E G;  2F4V H;  1TVK B;  1I94 O;  2DPI A;  4DR5 O;  2EZP A;  2DQ0 A;  3ABM C;  4TUY A;  4WFE A;  2HGX A;  2LFS A;  1HR0 H;  4QSH A;  1I1K A;  4EGJ A;  2Y4T A;  1AJQ A;  3ZRW A;  1XK5 A;  1FFX B;  4HZ3 A;  3E89 A;  3TW6 A;  2BCC H;  4U3J B;  1GSH A;  2IH1 C;  2XUM A;  3SI8 A;  3M9O B;  1RPO A;  2R84 A;  2HVR A;  5BWV A;  5B1N A;  2DE0 X;  1VQK V;  3CS5 A;  3JD4 A;  1ZUQ A;  2BE3 A;  1RP3 B;  1JX4 A;  2HIX A;  1EZV H;  3N6R A;  2EUL A;  5IWA O;  5KFQ A;  1CEZ A;  1Q8I A;  4FM9 A;  2ATL A;  3K3V A;  1XHX A;  2DQ3 A;  4B7E A;  3Q1K A;  1CPY A;  2AHY A;  3JAT A;  1J5E B;  3CEB A;  4JI8 O;  3UO3 A;  5IE9 A;  3CSW A;  2NUA B;  5KAF Z;  3CJH B;  3K59 A;  2XCL A;  1S68 A;  5EWF A;  5IYZ A;  3U0G A;  1HNW O;  4RNO A;  5LMN H;  1WB8 A;  4A3C G;  3G8D A;  4D7S A;  2VUM A;  5B1A B;  3SE7 A;  4ED8 A;  1GLV A;  2COJ A;  5KMG A;  5LMU H;  1J95 A;  2UVW A;  5A9G A;  3K5M A;  3V4S A;  3CX5 F;  1VQP V;  1M0T A;  2P06 A;  2QKA A;  2JA6 G;  5DLG A;  3M7M X;  1Z5W A;  5KUM A;  3PFF A;  1M57 C;  5KFD A;  4RNM A;  1FFX A;  2QKC A;  4U3J A;  1TWF A;  3ZED A;  1CE8 A;  4MW8 A;  3ORQ A;  4ZI7 A;  1IOW A;  5FNV F;  4CS4 A;  5KFO A;  4UVC A;  4B3S H;  2V59 A;  3KYH C;  1PL4 A;  4DIM A;  2N04 A;  2ATK C;  1BT8 A;  1RM1 B;  4RUF A;  3U9T A;  2PTM A;  4I4T F;  4GKJ O;  1FVI A;  3GV5 B;  4UV8 A;  1US6 A;  3R23 A;  3CCL V;  2X7R B;  1K9M W;  5BPF A;  1OCR B;  4NVP A;  4JI6 B;  1JMK C;  4TV8 B;  3SNO A;  4J80 A;  4NZM A;  2DAB A;  3CJH A;  3VA7 A;  1IBL O;  1KBH A;  1ZAU A;  3AG2 B;  3S3X A;  4J9S A;  2R92 A;  3GIK A;  4KUM A;  3K57 A;  5KG0 A;  1KJI A;  4LF6 B;  1VMG A;  4LFB O;  2ARH A;  4ICG A;  4DV7 B;  2P22 C;  1KBL A;  2FP4 B;  2Q69 A;  3FB8 C;  3DC5 A;  1YCI A;  2B1G A;  1IUR A;  1KUT A;  5LL6 b;  1ULZ A;  4PDL A;  1XNQ O;  5KX5 B;  4B7K A;  1P16 A;  1GYF A;  2NU9 B;  5D1P A;  2AZ0 A;  4FFK A;  5LGU A;  3TXS A;  3LP8 A;  1O9H A;  4DV3 H;  3Q8S B;  4Q4D A;  5A2Q N;  1B04 A;  2F4V O;  4FFO A;  3GTL A;  2EBO A;  4XBF A;  3HOX G;  4I55 B;  3RBD A;  2HGS A;  4XYM B;  4MV3 A;  2VR1 A;  1HR0 O;  5JJJ B;  3CD6 V;  4O4L A;  1EKV A;  4MAM A;  2J6T A;  4BIZ A;  3UZO A;  3RFR A;  2VQE B;  4TV8 A;  4MTG A;  2QR4 A;  2EIJ C;  1WP7 A;  1L2Z A;  3ABM B;  4DK0 A;  3H4D A;  2NR5 A;  1XL6 A;  5EBW C;  5KHK A;  4YAJ B;  3UM7 A;  3OT7 A;  5KT3 A;  4GT1 A;  2DOS A;  2R8K A;  4I0X B;  4MT8 A;  3WB2 A;  2XCA A;  1UC8 A;  2DAA A;  3N8D A;  4FFR A;  3RAX A;  4FM2 A;  1NI8 A;  1D5N A;  3IGA C;  1W0K G;  4JI1 H;  1MNG A;  4Q43 A;  3CC2 V;  4QIW E;  4LF9 O;  4NZN A;  4FBU A;  4DLK A;  5LMN O;  3Q8Q B;  4GKK B;  4LF7 O;  4FLZ A;  3GII A;  5KAI Z;  3ABU A;  4A3J G;  2I87 A;  4C7U A;  1XOU A;  3OUU A;  2W6M A;  4IHJ B;  1KKC A;  3LML A;  1YF2 A;  5LMU O;  4MV6 A;  4LFA H;  1U96 A;  2HDK A;  4F6R B;  3E22 B;  3D36 C;  3UO2 A;  4I55 A;  3L4J A;  2EX3 A;  4HNA A;  4CKB A;  1P84 F;  4ZHQ B;  4J9Y B;  4O2A F;  2FJZ A;  3ETD A;  4PEL A;  3WNZ A;  5JH7 B;  3WB0 A;  4G27 B;  4TV9 A;  1DV2 A;  4MVS A;  2W9C B;  1AN7 A;  3CRA A;  4XDL A;  2QYZ A;  2YEV B;  1K5S A;  4LF4 B;  3N2K B;  2WAM A;  1K3E A;  4RO2 A;  2PYJ A;  2E2I A;  4MV4 A;  1SER A;  1WLE A;  2XD4 A;  5C1P A;  5B1B C;  1D5A A;  4ECT A;  1HNZ B;  3MWE A;  3IJ4 A;  1XL4 A;  1N32 H;  2ZIO A;  5KFB A;  2P0A A;  2WAQ E;  3AX6 A;  4ME6 A;  3JCU Z;  4U7C A;  3OE7 G;  3RB4 A;  4ZBM A;  2VPQ A;  3PR4 A;  3FMA A;  1I1M A;  3JD0 A;  2RNB A;  3RR5 A;  1SQP H;  1ROP A;  5C1O A;  3JAM N;  4IHJ A;  2ITC C;  1RYS A;  2JA8 G;  3W7T A;  1NVP B;  1D2D A;  1KD1 W;  3FX7 A;  3E22 A;  3OM3 B;  3ZX6 A;  5LP6 C;  2ZXW B;  4DR5 B;  2IA6 A;  1M56 B;  4R7C A;  4DR2 B;  4PJ0 Z;  3JRW A;  5KFZ A;  5JH7 A;  5IYC O;  4TSF G;  2PN1 A;  4DV0 H;  5KX5 F;  1S72 V;  4DL3 A;  1YJN V;  1OWT A;  2LO1 A;  2YEV A;  4DRX B;  3N2K A;  5IWA B;  5CM0 A;  4J9N A;  1Y6X A;  4WFF A;  4JYC A;  4HAM A;  5GON B;  3J81 N;  1XHZ A;  1TA8 A;  3ZBH A;  4YJ2 F;  3G67 A;  5GTH Z;  4G2K A;  1KQS U;  4JI8 B;  4JPR A;  4FLX A;  1UJW B;  4XYL B;  4FM0 A;  4FU0 A;  3E8B A;  1YI2 V;  1HNW B;  4J9R A;  5BYB A;  4X20 A;  3CME V;  4I5S A;  3TGU H;  4TQD A;  4JYB A;  4K35 A;  3I55 V;  5DN6 G;  2B5U A;  1FS0 G;  4DUZ H;  2ZR3 A;  5JJE B;  2JRI A;  3SYO A;  4HN2 A;  3MR2 A;  5E25 A;  4TQR A;  3H3V H;  1O75 A;  2P67 A;  3QNE A;  2Q9L A;  4PV1 B;  2YRX A;  1M7J A;  3E8H A;  4BXX G;  3N2G B;  3STL C;  1SQX H;  3A0H Z;  4C5C A;  4GCZ A;  5KG1 A;  2CUG A;  4KXR A;  1CXZ B;  4NXM H;  3HOW G;  5KFK A;  2WLK A;  2Q67 A;  3QO5 A;  3BVO A;  5CAE B;  4EB6 B;  1KJQ A;  1CP9 A;  4LFA O;  3JCZ A;  2UUB H;  5H9C A;  2ZE6 A;  3ZMV A;  1HNX H;  2C00 A;  4GKJ B;  2VOB A;  4O3R A;  4NB5 A;  3HB3 B;  4MV7 A;  5LA6 F;  2W6Q A;  4X8A A;  1PD3 A;  2FB9 A;  4O3N A;  3ABL B;  4P9P A;  2V4D A;  3BQ1 A;  4DRF A;  4ZHQ F;  2W7P A;  2Y0S A;  2VRZ A;  1R73 A;  4UCR A;  1IBL B;  2Q7D A;  1VBG A;  2R86 A;  4BWS C;  4FBT A;  2EIN C;  3ZHU A;  4IT5 A;  5KFV A;  4IIJ A;  4ASU G;  2W6I G;  3RYI B;  5J2T F;  3GTK A;  4LFB B;  1MA1 A;  4O4J F;  4JI6 H;  5KA5 A;  4A3I G;  4BAY A;  1CKN A;  2Q6A A;  5J2U B;  1H8H G;  1Y4M A;  1ET0 A;  3CRC A;  2E74 B;  1N32 O;  3N2G A;  5LYJ F;  2W6J G;  4UCU A;  1XNQ B;  2JGD B;  5FL7 G;  3L71 H;  4H33 A;  4O7Z A;  2UXN A;  3T99 A;  4DAA A;  5FD6 A;  4QWA A;  5A2Q W;  5B1B B;  3KHR A;  2BQR A;  3T9B A;  2QWP B;  3T9D A; 
#chains in the Genus database with same CATH homology
 3FFQ A;  4RAZ A;  2YIB A;  3OTO B;  4LF9 H;  1BGW A;  4LF7 H;  5IWA H;  4PDB A;  4LF5 B;  3CSX A;  4RZQ A;  4LFC B;  4IAJ A;  3RF2 A;  5C8Y A;  5BR8 H;  4Q0Y A;  4X20 B;  2ZM6 H;  5D1O B;  4JI8 H;  1SQG A;  4LNU A;  1TUB B;  4JI5 B;  3JAW A;  1TVK A;  3GJX B;  4RAY A;  4O2A B;  5LP6 B;  3KAL A;  2GV9 A;  1HNW H;  4JI2 H;  3EYY A;  4FLY A;  3WB1 A;  2BTQ B;  1SEI A;  1BJT A;  3TY8 A;  4GYC B;  3RYI A;  1TAE A;  1WH2 A;  4X65 H;  4B3M B;  4JI4 B;  4DUY B;  3RYH A;  3UT5 B;  4APM A;  4JI7 B;  3W1B A;  5KHJ A;  5J2U A;  3HKB A;  4ZIB A;  2YCH A;  4X1Y A;  1E4F T;  4JYA B;  2MCT A;  3H20 A;  3N41 B;  5LMN B;  2OYQ A;  3RYF A;  1Z2N X;  4I7H A;  2IM9 A;  5CB4 A;  2HIV A;  4O4H A;  4JI3 B;  3RGB A;  5KHI A;  1T5E A;  3QWU A;  1X9N A;  5LMU B;  1N34 B;  1SQF A;  3J7A K;  4K0K H;  4DV2 H;  4GKJ H;  4TUY B;  3T1Y H;  3HKE B;  1KU9 A;  4MV9 A;  3RTX A;  2YIA A;  2WYO A;  4FLV A;  4IIJ B;  3RJ0 A;  4CH6 A;  2CW7 A;  3KXY T;  2QJ1 A;  1M93 A;  2Q2T A;  4YY3 B;  4O2A A;  5LP6 A;  3HXL A;  1IBL H;  3K5N A;  4B3S B;  1CKN B;  5D5P A;  5BMV B;  2UXC H;  4DV4 B;  4A2B A;  4LFB H;  2UXD H;  3GDE A;  3NBZ B;  3UT5 A;  3SGI A;  1XNR B;  3QTC A;  5JVD A;  3C0F B;  1XMO H;  4X64 H;  4YJ2 B;  2O03 A;  2UXB H;  1RSO A;  5IYZ B;  2UUA B;  3VQV A;  4X62 B;  3JAM W;  4LF4 H;  1XNQ H;  4BWA A;  3HKC A;  1VS0 A;  1QHT A;  4JI0 B;  1HW7 A;  2Q7H A;  5KMG B;  2W57 A;  3JSN A;  4BW9 A;  4DR3 H;  2F4V H;  1TVK B;  2PUS A;  3NBY B;  4LF5 H;  3J80 W;  3T1H B;  4TUY A;  4Q6G A;  4LFC H;  1HR0 H;  1XDN A;  4DR7 B;  4GLX A;  1XK5 A;  1FFX B;  4U3J B;  4MTD A;  4JI5 H;  5LOV B;  2HVR A;  4X1I B;  4YHH B;  4PI2 A;  3NC0 B;  3J81 W;  4M7E A;  4DV3 B;  2HIX A;  1Q5O A;  3BA8 A;  4X1Y B;  5KX5 A;  3SJC C;  2ZJT A;  1Q8I A;  5BMV A;  4FM9 A;  4DUY H;  4JI4 H;  2VPS A;  4JI7 H;  4DR1 B;  4JV5 B;  3K3V A;  1XHX A;  4DR2 H;  5EOY A;  3RYF B;  5CB4 B;  2R72 A;  4O4H B;  3K58 A;  4AQY B;  3JAT A;  1XQ8 A;  3U0Z A;  1J5E B;  2F66 C;  5LA6 B;  3N42 B;  1KMI Z;  4YJ2 A;  2KKW A;  3K59 A;  4KHP B;  1N33 B;  3UQ8 A;  1VF7 A;  4PHZ A;  1Z5V A;  5IYZ A;  1S68 A;  2KSW A;  4FLT A;  5LMN H;  1M0W A;  3OTF A;  5KHG A;  4JI3 H;  5LXT B;  4D7S A;  3U10 A;  5KMG A;  5LMU H;  1N34 H;  3K5M A;  2ZCE A;  1M0T A;  5J2T B;  4JI1 B;  4UCS A;  2PY5 A;  4O4J B;  3M7M X;  1Z5W A;  3VQY A;  2E5L B;  1FFX A;  2ZIN A;  4U3J A;  2YI8 A;  4CS3 A;  3ZED A;  5LYJ B;  4DK1 A;  4ZI7 A;  5LOV A;  4YY3 H;  1QQC A;  4X1I A;  2P5O A;  4LF8 B;  4CS4 A;  4B3S H;  4LFA B;  4OX9 B;  3KYH C;  5JVD B;  2R70 A;  2PTM A;  4DV4 H;  2UUC H;  1S5J A;  1FVI A;  4DR6 B;  3HKC B;  3ICX A;  3BA9 A;  4CS2 A;  2JGU A;  4NVP A;  4JI6 B;  3CB2 A;  1XMQ B;  3MWM A;  1XNR H;  1JMK C;  4TV8 B;  4F6R A;  4CH5 A;  1I94 B;  3U11 A;  5LA6 A;  5CA1 B;  1L8D A;  4L8J A;  4X62 H;  4LSA A;  3ZS8 C;  2Q2U A;  4ZHQ A;  1P49 A;  3N44 B;  4EFB A;  1NT2 B;  3N40 P;  1ZAU A;  4JI0 H;  5LXT A;  1WN7 A;  3QF7 A;  3K57 A;  4LF6 B;  3QG5 A;  3SJB C;  3PN1 A;  3RWR D;  4DV7 B;  4LH7 A;  2P22 C;  3L4K A;  4LH6 A;  5EZY B;  2ZNJ A;  4FM1 A;  5J2T A;  5CA0 B;  1Z2O X;  2ZIM A;  1N32 B;  2F1M A;  3BPZ A;  2PGG A;  3RGX A;  4O4J A;  3T1H H;  4TQF A;  4X1K B;  5LL6 b;  4DR7 H;  5K1P A;  5K1X A;  5KX5 B;  3VQX A;  1I7F A;  2RQ6 A;  1P16 A;  1GYF A;  5D1P A;  1XI1 A;  1V9P A;  4NXN B;  3VQW A;  5LYJ A;  4RB0 A;  4J0M A;  2HEP A;  4D7T A;  1O9H A;  4DV3 H;  3JAT B;  1B04 A;  3BHP A;  3CHX A;  4I55 B;  4LR3 A;  4FFB A;  3N6X A;  2HGS A;  2UU9 H;  5JQG B;  4DR1 H;  3B2E E;  5JJJ B;  1IBM B;  4O4L A;  2VWK A;  5JCO C;  4DV5 H;  3K5L A;  1WPB A;  4FLW A;  4AQY H;  1J5E H;  3RFR A;  2VQE B;  3KAK A;  4TV8 A;  4ZOL A;  4DV0 B;  1N33 H;  4KHP H;  4X66 B;  5EYP B;  5CA1 A;  1CKM A;  2HVS A;  3OTO H;  1L2Z A;  4DK0 A;  2RJZ A;  1CKO A;  3W5O A;  5KHH A;  5KHK A;  3L2P A;  5JJN B;  1TGO A;  1H2S B;  3WB2 A;  4UFZ A;  2VQF B;  2RGV A;  4TOI A;  4FM2 A;  2E3C A;  2FE3 A;  5EZY A;  4JI1 H;  4DRX A;  3W1G A;  4ZI7 B;  5CA0 A;  4PZ8 A;  3T1Y B;  2Q0A A;  1I6U A;  2RGR A;  4X1K A;  5GON A;  2E5L H;  4UCT A;  5ITZ B;  1IBK B;  4GKK B;  4RB2 C;  4FLZ A;  3TY9 A;  1G6U A;  4B3M H;  4IHJ B;  4AIL C;  3LML A;  3THO A;  4LF8 H;  4DUZ B;  4YJ3 B;  3RIZ A;  4LFA H;  4PZ6 A;  1X4T A;  3JAK A;  3KAJ A;  4PI0 A;  4F6R B;  3E22 B;  3TY5 A;  5IT9 W;  2WE6 A;  2XHB A;  1O9G A;  4I55 A;  3L4J A;  4JYA H;  2EX3 A;  4HNA A;  1N36 B;  2ZNI A;  4B3R B;  5JQG A;  4DR6 H;  4ZHQ B;  1E4G T;  1Q43 A;  2CAZ C;  1XMQ H;  5FPR A;  4ETS A;  4NXM B;  5IJ9 A;  5JH7 B;  4DV6 B;  3JAS B;  2JS5 A;  3WB0 A;  2BTO A;  4TV9 A;  4O4I B;  2HHH B;  3A2F A;  5EYP A;  1AN7 A;  4KL1 A;  5FLX W;  4LF4 B;  2OWO A;  4PZ7 A;  3N2K B;  2UUB B;  2PYJ A;  3HKD B;  4DV1 B;  1HNX B;  4LF6 H;  4DR4 B;  1S03 G;  4DV7 H;  4EB6 A;  1D5A A;  3RYC B;  4DR3 B;  2F4V B;  1HNZ B;  2PZS A;  4HBN A;  1N32 H;  2ZIO A;  4K8Z A;  1ZHQ A;  1HR0 B;  4O2B B;  1JFF B;  5ITZ A;  3FMA A;  4FFB B;  3RR5 A;  4EFE A;  4NXN H;  4O4L B;  4I50 B;  4IHJ A;  1FJG B;  3JAL B;  4YJ3 A;  3CVZ A;  2VUG A;  3E22 A;  4RB3 C;  4ZOL B;  4LSX A;  5LP6 C;  4DR5 B;  1Q3E A;  4R7R A;  3M4I A;  4CH4 A;  2UUA H;  3ETQ A;  5IJ0 B;  4B3T B;  1IBM H;  2QM4 A;  4DR2 B;  2VQE H;  5JH7 A;  3JAS A;  5FD5 A;  2YIB D;  4DV0 H;  4X66 H;  2YXL A;  4O4I A;  3GB8 B;  4LF9 B;  4AHC A;  3VNN A;  4FVM A;  2F95 B;  4DRX B;  3JAR B;  3N2K A;  3BRC A;  5IWA B;  4K8X A;  4LF7 B;  1DGS A;  5FNV B;  4A2A A;  3HKD A;  4WBN B;  5GON B;  1XHZ A;  1TA8 A;  2VQF H;  5BR8 B;  2ZM6 B;  3RGZ A;  4I4T B;  3RYC A;  3LNN A;  4JI8 B;  5D5Q A;  4FLX A;  4FM0 A;  4YHH H;  2VWJ A;  1HNW B;  3JAK B;  4JI2 B;  4O2B A;  1JFF A;  1IBK H;  4X20 A;  4GKK H;  2R9A A;  5EIB D;  4TQD A;  5D1O A;  4HNA B;  1TUB A;  1A0I A;  2CW8 A;  1MZB A;  4X65 B;  3F8N A;  4JV5 H;  4DUZ H;  4I50 A;  5JJE B;  3DF7 A;  3JAL A;  4EQ5 A;  1SKV A;  4UCV A;  5IJ9 B;  1O75 A;  4TV9 B;  1M5I A;  2BTQ A;  2UUC B;  3N2G B;  1N36 H;  4B3R H;  5IJ0 A;  3IAY A;  2HVQ A;  3MAQ A;  3S24 A;  1Z2P X;  4NXM H;  4DV6 H;  1SA0 B;  2YI9 A;  2HHH H;  4EB6 B;  4CH3 A;  2CFM A;  3SR2 C;  2UUB H;  4K0K B;  4DV2 B;  2JVD A;  3JAR A;  1HNX H;  3JSL A;  4DV1 H;  4CC5 A;  4GKJ B;  5FNV A;  4FLU A;  2VOB A;  4WBN A;  2Q7E A;  4MV7 A;  4DR4 H;  5C8Y B;  4UCO A;  4LMY A;  2V4D A;  2PYL A;  4RB1 A;  4I9Q A;  4DRF A;  1HNZ H;  4I4T A;  4LNU B;  3JAW B;  1P8L A;  1WNS A;  3HKE A;  3N43 B;  3K5O A;  4UCR A;  3DSQ A;  4E6N A;  1SYX B;  4OX9 H;  1IBL B;  4BWS C;  1YEW A;  1FKA H;  5JCO A;  4IIJ A;  4CC6 A;  4B08 A;  3RYI B;  2UXC B;  3SJA C;  4LFB B;  2UXD B;  1M4U A;  3RYH B;  1FJG H;  4JI6 H;  4MTE A;  5EIB C;  1CKN A;  5J2U B;  1I94 H;  3HKB B;  2WDT A;  3IG0 A;  4DR5 H;  1XMO B;  3BAA A;  4X64 B;  2UXB B;  3N2G A;  5DIS C;  2UU9 B;  4B3T H;  2Q7G A;  4UCU A;  5FPO A;  2XIG A;  1ZHS A;  4EEQ A;  1XNQ B;  4DV5 B;  5FD6 A;  2F93 B;  1JJO A;  5A2Q W;  1SA0 A;  3BAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...