3JSNA

Crystal structure of the adenylation domain of nad+-dependent dna ligase from staphylococcus aureus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
306
structure length
297
Chain Sequence
DLSSRVNELHDLLNQYSYEYYSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structure of the adenylation domain of NAD(+)-dependent DNA ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 106
structure length 297
sequence length 306
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jsnA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3jsnA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jsnA02
4EFBA 4PZ6A 4YY3B 5BR8B 4DR4B 4JI3B 4DV5B 4DR7B 3NBYB 5D1OB 4LF5B 4JV5B 1X9NA 3BABA 4B3TB 1XNRB 2UXBB 3NC0B 4X65B 4JI2B 1XNQB 3GJXB 3S24A 4PZ8A 4EQ5A 3W5OA 1A0IA 2ZM6B 4LH7A 2HIVA 2UUAB 4JI8B 4JI6B 1DGSA 4KHPB 2UXDB 1P16A 2HIXA 4NXMB 4B3MB 1V9PA 3BA9A 2CFMA 3GB8B 1CKOA 4DV2B 4JI7B 1HNWB 3QWUA 4LF9B 1IBLB 1CKNA 4DRFA 3PN1A 4EEQA 5IWAB 4DR6B 4GLXA 4JI0B 3JSLA 4X64B 3RR5A 5LMNB 2Q2UA 3T1YB 1XMQB 5D1OA 4JI1B 4DV3B 1IBKB 5FPOA 4B3RB 3TY9A 4E6NA 1VS0A 3TY5A 4UCOA 5D1PA 2Q2TA 4EFEA 4DR2B 5LMUB 4LF8B 1CKMA 4UCVA 4NXNB 4DR1B 1N34B 4UCUA 4K0KB 4LFAB 4GKKB 2UUCB 4DR3B 1FJGB 4DV1B 3SGIA 4DV7B 3L2PA 3GDEA 3W1GA 1N36B 4OX9B 1N32B 4DV4B 2E5LB 4LF7B 2F4VB 4LF6B 4X66B 4JI5B 1ZAUA 1IBMB 4DR5B 4LF4B 2UU9B 4AQYB 3T1HB 4CC5A 1HR0B 2HHHB 1B04A 1P8LA 2UUBB 4YHHB 4B3SB 2UXCB 1TAEA 1HNZB 3VNNA 4DV0B 2VQEB 4DUZB 2OWOA 1XDNA 4UCRA 4UCTA 3TY8A 3BA8A 4DUYB 4LFCB 3OTOB 2HVQA 5DISC 1I94B 1N33B 1J5EB 4PZ7A 3RTXA 4LH6A 4UCSA 5FPRA 3KYHC 4X62B 1HNXB 3BAAA 1XK5A 4CC6A 2VUGA 4LFBB 4GKJB 1XMOB 4UFZA 1CKNB 1S68A 3UQ8A 4JYAB 3W1BA 3NBZB 1TA8A 4DV6B 4JI4B 3JSNA 2HVSA 4TOIA 1FVIA 2HVRA 2VQFB
chains in the Genus database with same CATH superfamily
1N32H 3A8TA 3J7AK 2ZDIC 4F6RA 3RFCA 1BCCH 2EX3A 5HV6A 3E8HA 5D1OB 5BYBA 2YXHA 4ECUA 3Q2OA 4UUGA 3BHPA 4ED3A 2VWJA 4MV9A 2C2RA 3E35A 4U3JB 2C2EA 3SYPA 4BBRG 3HKZA 4QW9A 4L1KA 5EBLC 1FFXB 2DQ0A 3QQMA 2A7WA 1GH6A 4O4JF 2YI8A 4X65O 5CB4F 4IRCA 4YAKB 1E4GT 3G6XA 5J2UA 1VF6C 2FK2A 3FD9A 1Y1WA 5L1JA 2Y0IA 2FJZA 4X1YA 1M57C 5E25A 4DRFA 4CMFA 1HP8A 3FKSG 1K73W 2Q7HA 5KFAA 3QG5A 4JASA 2BOBC 4LBEC 3RYFB 1SZXA 1QR8A 1JX4A 3E89A 2DABA 1S97A 2I8CA 1X4TA 4OPHA 5IWAO 3TY9A 2ZNJA 4A2AA 2YYAA 5LMNO 5KA6A 5KFRA 2UXBO 1V55B 3HOZG 1GGOA 4LF8B 5A2QW 4DL2A 2WLLA 1VARA 3OW2U 4PDMA 4PI2A 3SPJA 5KFJA 3PZPA 1DK1A 4LF5H 3TGUH 4A3LG 2AW9A 4B3MO 2OIGA 3VOUA 2HJFC 2LFRA 2AZ0A 3SE7A 2ZQMA 3ETQA 4DV4B 2BQ3A 2R72A 5DEDA 2M7WA 4ED8A 3D36A 4H33A 2UXDH 1Z2PX 3R5FA 1IBMB 4XZ3B 4NXMH 3T5LA 3FX7A 1GO3E 5BPHA 2E5LO 1LNQA 1HNWH 2ALZA 3UM7A 2ETNA 4DV1H 3W7WA 3J81N 2EJ3A 2V4RA 3K3PA 3SJQC 4H44B 4DUZB 3SI8A 3VPDA 4NB5A 4I50A 5FNVA 2P7TC 3BRCA 4MTDA 1YDXA 4O4JB 2W57A 1YZBA 2VS0A 4ECSA 2FLNA 1ZWIC 4O3SA 4B3RH 2ZDIA 4CZZA 3AG4C 3RBEA 3U9SA 4ZHQF 1QU7A 1VQ9V 2LW1A 4MVZA 3ML0A 3T9FA 5KT2A 1T3NA 4GX1A 5LA6A 2CAZC 2EJ7A 4I4TA 3ZRSA 1CE8A 2GQRA 3UQ8A 2ZDHA 2BQRA 1SQBH 2HVSA 5KX5A 5GONF 2XGPA 2VQFB 3VPCA 4NR1A 2JEUA 2EZPA 4UVBA 4LFBO 1R3JC 1ZL8A 3ZMTA 4NZOA 2JK5C 4FBTA 3BPZA 1K33A 3JAWA 4O7TA 1FXKA 2O03A 3RBDA 1RJPA 3ZX6A 5DG8A 4O7VA 4R7RA 2JS3A 4YIPA 3X2QC 1KJ8A 2P22C 5IY5C 3IGAC 1A0IA 1HNZH 4TWKA 1AN7A 3CQZA 5C4XG 2IJIA 3NGDA 1Z5VA 4KHPB 1P16A 3N8DA 3HB9A 4YP3A 3RVYA 4JI2O 3JD1A 4LNUB 4O4HA 2Q7EA 2FMAA 1JQ0A 4LFCH 4JI7B 4X9QA 5B5EZ 3QWUA 2H8PC 2OCHA 3OEEG 2UUAO 4FLZA 2GPWA 3RGXA 3OR7C 1H2MA 2NU6B 1Y74A 2UXXA 1THZA 4X64B 3OUFA 4DW1A 4EG0A 4R8CA 5JCOC 1XMQB 2YXYA 3N44B 5JQGA 2RQ6A 4JI1B 4MTGA 4O7LA 3BY6A 1H2KA 4ZI7F 4GKJH 1B6RA 1P4RA 3JD0A 3CCMV 4M7EA 1FYJA 5KMGA 5FJ8G 3I12A 5LHIA 3U54A 1WN7A 1TVKA 3AG1B 2WLMA 2WDTA 1KUQA 1FJGB 3GIJA 2HGXA 2VOBA 3FDSA 4WFFA 2IU0A 3JASA 3K57A 4LF6B 3AK1A 4DR3O 2UUCO 2COIA 4K3AA 3ABLC 1OCZC 5KFTA 4OX9O 1HR0B 1P8LA 4TV9B 1KB9F 4YJ2B 1N4CA 2GV9A 4P2ZA 4QIWA 3HKEA 5FD6A 1EYZA 1YCIA 3I4MG 4LP8A 1N56A 4YXWG 4IL6Z 2QKAA 4H13B 4HR7A 1Q6IA 3BA8A 1PP9H 2FK1A 1IBKH 2ZR3A 2W7OA 4QGPA 2VQEO 3V6JA 2HJWA 4O3PA 5KT5A 1Q86W 3UT5A 1XDCA 3UCSC 4J0MA 2JA5A 4PDBA 4PJ0Z 4WBNA 3CCUV 3CVZA 3Q1KA 4DR2H 5FD5A 3K5OA 1L2ZA 4QNHB 3K5LA 3VQWA 2EIYA 4WFAV 2V7QG 1QNMA 1J5EO 3ABUA 2XOKG 4JI5O 1O75A 4UFZA 4AILC 4KXRA 5CN0A 4ZI7B 1XILA 1FVIA 1FS0G 4ECYA 4X1IB 4IIJF 1IVSA 4LF7H 5DQIA 4QW8A 2EULA 1XMOO 4G28B 5EC2C 3THOA 3CCSV 3NBYB 1Y66A 5JH7F 5IJ0A 1IOVA 1KQSU 1AP5A 3T1HH 3C3TA 4YY3O 5JCOA 1XNQB 3I55V 1NJIW 2P0AA 1A3GA 1I1KA 5LP6F 2Q73A 1QLEC 5L3CA 4I55A 3K04A 1CKOA 5EYPB 3IC7A 3AX6A 1AJQA 1IBLB 5EK0A 3HT5A 4ED0A 2OT5A 3TXQA 3H1KH 1RPRA 2VQDA 1Z2NX 1RM1B 1JOYA 5KT7A 4YR3A 1V54C 5D1OA 3GWKC 4FFBB 2OTJV 3N40P 4FLXA 3RB3A 2QWNB 4U3JA 3VA7A 3HOVG 1AI5A 3T4ZA 1EN6A 5KAFZ 5DG9A 2R93G 2R9RB 5BMVB 1BXRA 1XNRO 1FFXA 1Q5OA 3TW7A 2ARHA 2FB9A 2E2IA 1E1RG 4DV7B 2YW2A 5I60A 2XUMA 2QWQB 5I5XA 1N36B 4PDVA 4A3BG 1WP7A 4JTCB 4ABMA 2PN1A 1N48A 1R6KA 1N34O 4K0KO 4UUJC 3RYFA 1M9NA 3AG2C 3B8NA 4JPRA 1AROP 1WB8A 5JH7B 1DV1A 1R6NA 2LFSA 3SNOA 3Q8QB 1TWHA 3DXRB 4B3SB 5KFEA 3RYCB 3VQXA 4GZRB 5LYJF 1R9TA 1W96A 1SESA 4AQYO 2YS8A 3F7VC 4DXWA 4BXXG 1VF7A 1VQ8V 2FKXA 2ODMA 5LP6B 3KHHA 4ECZA 4DUYB 4QE7A 5KFPA 2B5UA 4Z1VA 1VQPV 4HN2A 2CTWA 3ETDA 3MFIA 2IBKA 1F23A 2MK3A 3CRCA 4PA9A 4IT5A 1AVMA 4A3MG 2WPDG 3KAJA 3T54A 4MVSA 2IBZH 4FMTA 2CUGA 3OE7G 1CQJB 3TQTA 4WFGA 4XDJA 5DLFA 2SCUB 2X0SA 5DLGA 3KHLA 3OT7A 4LF8H 3BAAA 3T2MA 5DGBA 2A9HA 4PA6A 2CNVA 1S5LZ 2F4VO 1E4FT 4X66O 4IRKA 4GC7A 4TQSA 2BR0A 1EZJA 1P7GA 2PI5A 1D5AA 3JARB 3JALB 2HVRA 4MTOA 5B1NA 1LUVA 4EFBA 4DV4H 2OIEA 1MG1A 4KFMA 1KECA 4DR4B 1YVWA 2DOSA 4RQFA 1IBMH 2HVJC 4O4JA 3WG7B 4RUCA 3HOXG 4HNVA 4DV0O 5CB4A 3RT3C 2V4DA 1O9GA 5F9NA 4XDKA 5BR8O 2Q68A 2Y69B 3QTCA 1OCOB 2ZXWC 4DUZH 2VA2A 4JXUA 3FAVB 2WA4A 3PO3G 1I94O 2IH1C 1WSCA 3GIPA 3IG0A 5KT6A 2QK4A 5KHGA 4RZQA 5LYJB 2Z04A 3GIDA 4A5UB 3GTGA 2R8KA 2ABJA 4DV3B 4TQRA 2CZGA 3H1HH 2Y4UA 2MW2B 3OGIB 3QNEA 4J9ZB 4DV5O 2VR1A 4NTYA 5B3SC 1S0OA 4UCOA 2AZ2A 5D1PA 4CH6A 5CBHA 1GRJA 3IAYA 2B1GA 3UZOA 4LNUA 4A3KG 4J9KA 4DR1B 2CGNA 1K92A 4R8UA 4I0XB 4DV1B 5I47A 3R65A 2JA6G 4XX0B 5DGHA 3O65A 2R8HA 4YIOA 5KFMA 1TUBB 2R8GA 4Q4CA 2FE3A 1F4MA 3CCQV 1SYXB 4DR5B 4YB8B 4K8XA 5IE9A 1OCCB 3TIIA 1M6VA 5EC1C 3WU2Z 4O3NA 4MT8A 1RYRA 2JEFA 4GT1A 4ETSA 1E79G 1Q8IA 3OHBA 1MZBA 1I1MA 5LL6Y 2OWOA 4OXSA 1Y6XA 1XL4A 4P9PA 4RO2A 1AR4A 2F1MA 4R50A 5EZYF 4O3OA 3E83A 1XMQH 5C93A 3D3QA 4JI1H 1ZHQA 2YEVB 4F50A 1ZHSA 3B4SA 4IGGA 1SEIA 1RM1C 1Y1WG 5HFMA 1VP7A 2ZDQA 3HXLA 5HFLA 1EUCB 4LH6A 2NVYA 4X62B 1JJ2U 2ZIOA 2ITDC 3WB0A 1SZTA 3IJ4A 5KUMA 4L87A 1S9FA 1FJGH 4O3RA 3N2GB 4TV9A 2N74A 3CXHF 1CKNB 3W1BA 4MSWC 4DW0A 4YJ2A 1TA8A 2ODTX 4DLKA 2DPIA 3GTLA 4TOIA 2Q67A 1TWAA 3L4JA 2Q0OC 1M57B 5L1KA 2EJ2A 4R7CA 3N6RA 2VUMA 3WO0A 4LF6H 3LDEA 4DK1A 4AYBA 2YZGA 3A0HZ 3V6KA 2CGOA 1F4NA 3JAWB 1KTAA 4X88A 2CTQA 3L70H 4WCEV 4DV6O 4JV5B 4QIWE 2J6TA 1W0JG 3J7AU 1HR0H 1Q43A 4RAYA 1VBHA 5D5QA 2YRXA 1Q6UA 1EUDB 3OD4A 3RAXA 1XBLA 3QO8A 4O4HB 5IYZF 1SFOA 3ZMUA 3G67A 1H8EG 4DV2B 1AI6A 1GTOA 3K9SA 4ICGA 3M7MX 2JEIA 2BOCC 5C44G 1KKDA 1RSOB 5CMUA 5LHHA 3LUTB 2UXDO 2NR5A 4ZI7A 3CHXA 5KFBA 5LP6C 2I80A 3ETHA 3OSNA 5KFOA 4O2AB 1HNWO 1M4UA 5JQGB 4K35A 1WP8A 4JGSA 2FK3A 5EZYB 4G2KA 3H4DA 1NT2B 4CE5A 2A3QA 2JA7A 5DGAA 1WAZA 4B3RO 1TVKB 4CH4A 4O7NA 2EIMC 3CCRV 1EN5A 1C30A 4MA0A 3LWBA 5EYPA 2YZLA 4UCUA 1G4YB 3H40A 2W6NA 3FKIA 3E22B 2B1IA 1KU9A 1ZSPA 4O7RA 1DF4A 2HJDA 3L2PA 4ECWA 1HDJA 1XNQH 2AGOA 2DQ3A 3AG4B 5FR9A 4JV2A 1G6UA 4Q0YA 1N0JA 2HFEC 4MV3A 4XYMB 2OH2A 2PVPA 2LGQA 4D7TA 2Y69C 4CMDA 1A9XA 3LNMB 2GPSA 3ZHVA 3GTQA 4UV9A 3N41B 3HKEB 5ITZA 5BWVA 4RB3C 2A79B 3ICXA 1M0WA 4JAVA 5BMVA 3CMAV 1GAXA 3HBLA 2ADQB 3G80A 1M7JA 1WJZA 4DO2A 1ZQ7A 4WF9V 1HNZO 2YL2A 5KFKA 3KKYA 3SYCA 3NR7A 4AI8A 1OWTA 3H4BA 2KSDA 5KFFA 3T5KA 1S76D 3N2KB 1MNGA 3X2QB 2IW5A 2N05A 3CB2A 2R92A 3U55A 5JH7A 5CBFA 5DAAA 3DXRA 3RYCA 1M56C 4LF4O 4DV7H 3J80N 2GUZB 1N36H 2MCTA 4NZNA 4WFHA 4MW8A 3CP1A 4LSXA 1NI8A 3LULA 5LP6A 4IWXA 1Q82W 1GSOA 2ZT9B 4B3TB 3K03A 5EBWC 2UXBB 2YZMA 4B3SH 4YAJB 3S24A 2QKCA 1OCCC 3TQ1A 3K0DA 3GIMA 1SQVH 4F6EA 4B3MB 1U97A 2DJVA 4GC6A 4NLGA 1YF2A 4DR7H 3OEHG 5KFWA 5IP7G 2PF4E 5L3FA 5KG1A 4FFOA 3JARA 3JALA 4Q44A 3VOTA 2E3CA 2QM4A 2GHYA 2WAQE 2R86A 4PWQA 3RF2A 4RNNA 1CXZB 1B3QA 3ABLB 1OCZB 1VAJA 3H01A 1NKDA 2QEXV 3K3VA 2W8LA 2Z02A 4CKEA 1O9HA 3G6YA 2YS6A 2UVRA 2WSSG 1IBKO 2QB5A 3OUUA 5DQHA 2JA5G 2DAAA 4JUZA 1VBGA 3FAVA 3CCLV 4DR4H 1P84F 2LQTA 2UXNA 3EVKA 4JI8O 2OLSA 1NQTA 3HOWG 1W59A 4DR2O 5FL7G 1KBHA 3RWRD 1OCRB 4UVAA 1FKAH 2FYUH 2Z5UA 4BW5A 4F4WA 5LYJA 4YJ3F 5EWFA 3K06A 2B9ZA 3W7TA 1VF5B 1I50A 1K34A 1JKJB 1SS3A 4DR6O 3JAKB 4RZRA 3G6VA 3ZRXA 1K97A 2E76B 3QO7A 1FXVA 1ZETA 3E2EA 5KFHA 3U0ZA 4J9YB 1GN6A 1ZUQA 5A9GA 2JRIA 3T1HO 3Q8RB 3HOUG 5AG2A 2YWVA 2QDOA 3S3XA 4I0XA 4O4IF 3QZ8A 3MFHA 2IM9A 4C5AA 1AJPA 4DV3H 1WPXA 2HVQA 3TJTA 3ZHTA 5KHIA 3ZMZA 5KAIZ 5C3EG 4GKKO 1N33B 1TUBA 3RTXA 3MDSA 1ENVA 3NUAA 3RYHA 1RJRA 2CDYA 2IP4A 3LMLA 1XK5A 2IMWP 4DR1H 4ECXA 4JZ2A 3K79A 1I0HA 1QLEB 3MR6A 3BQ2A 3KCXA 1JA8A 3PW7A 4JI4B 5L3DA 5DM6V 3APQA 3OTOH 2PBZA 3K9AA 2CE4A 4DR5H 3LSSA 5CB4B 3ABMB 5JJNB 1PNKA 5L3GA 3EPGA 2E75B 2YEVA 1V54B 2CW8A 1OZ0A 3ASNB 3NC0B 1BMFG 5KFUA 4GYCB 2NUAB 1GO3F 2Y4TA 3W5OA 5JUMA 2IJKA 1DAAA 3ORRA 1DGSA 1L8DA 3GV8B 5I5YA 4FLTA 3RYIB 2CFMA 1W93A 2F66C 1GM9A 4I9WA 1K3EA 5J2TF 3N2GA 4MA5A 1CKNA 2DYSC 3U9TA 1VF6A 1ORQC 4W4LA 1Y1VA 4FFKA 3RBZA 5KT3A 1FXHA 4CH3A 3ORQA 1Q81W 5JWPA 3JSLA 2QR4A 3GLKA 2ZM6H 2FL4A 2P90A 3DSQA 4X62H 2NVXA 3BACA 2W6MA 5DMXA 2CNQA 2DN9A 3AG2B 4O4IB 3T99A 4PA4A 4ZOLF 2X6AA 2XASA 3Q8SB 1GM8A 4IAJA 4YQWA 3NXSA 5LOVF 4AHCA 2D3OW 1Q7YW 1OHHG 3W7UA 4O3QA 5KG5A 4R8UB 4JV5H 4JI6O 4MTXA 2NU7B 5BWTA 1RSOA 4NTWA 4FK5C 4JAAA 1I7FA 3GDEA 1COWG 3K5NA 5KFCA 2W9BB 4C7UA 4LF9O 4O2AA 5F2VO 4JI5B 4J9LA 3JZIA 1SRYA 2QF7A 1AI4A 1R6TA 3U10A 1P7BA 1UPGA 2YS7A 1M93A 5HBRB 4A3EG 5EZYA 2C28A 2XGQA 2WLKA 4DV2H 3PFFA 5BPFA 1GM7A 1XREA 3SPIA 1WR2A 1DLBA 1IBMO 4ZHQB 4O7ZA 2W71A 3CMEV 1A48A 2LW7A 4RU9A 2K1EA 1PK8A 3HR0A 1PL0A 1PNLA 4FFLA 3TEKA 3J81W 4ME6A 4HNAB 3E22A 5IT9N 4NXNO 3RGBA 3ZRWA 4LFAO 4F4ZA 5GONB 2JEGA 2WA3A 3E5NA 4N23A 2FLPA 2AGPA 2ZXWB 4FLYA 3KALA 4U7CA 1QR9A 1ROPA 1JLLB 3UO3A 3TETA 3HB3B 4JYBA 3RVZA 2YCHA 3JSNA 5T14A 4ZOLB 4HZ3A 1UC8A 5EIBC 1WLEA 2R6FA 1KKCA 3T5HA 1G2WA 3CEBA 2KSWA 1JPXA 3G8CA 1OCRC 1KUTA 1MOFA 3RFRA 4Q43A 3JD2A 2VQFO 5DN6G 1XNRB 1A0GA 2DPJA 5KHKA 4QSHA 5D5PA 3N2KA 5B3SB 5CA0F 4MV6A 4F4XA 3B09A 5JVDF 1JDBB 3BA9A 3G8DA 4EBDA 2Y0SA 4RUEA 2XCPA 2W9CB 3B8MA 4FM0A 2HGWA 4QPJA 4KHPO 2GUZA 4U3FH 4O7WA 1K1SA 1K83A 4RUAA 2XTAA 4LSAA 1R3IC 4JI7O 4J7KA 3T1YB 3ZCCA 1W0KG 2CTRA 2H94A 3DTFA 5FPOA 2LJ2A 3FB8C 2XNDG 4NYEA 2P5OA 4X64O 3RIZA 2HR3A 2W70A 4F4LA 4MVUA 1Y14B 1VQ7V 1NU1H 2Q2TA 4JI1O 3CYOA 5IWAH 5LMNH 1ET0A 4EGQA 2B63A 4EGJA 4ECRA 2AGQA 4BWSC 3GQCA 4B3TH 2UXBH 2BSKB 5DQGA 2ZDGA 3LQSA 4QWBA 1X59A 4O7SA 2COGA 3ABMC 1NTZH 2PUSA 1SERA 2F4VB 3VQVA 4X66B 4FZ1A 3JZFA 3ASNC 1ZAUA 4B3MH 1Q6HA 3B40A 3JAMN 2W6ZA 2VUMG 2LO1A 2ZE6A 1JMKC 2W8KA 1C3OA 1B04A 4PV1B 3OUZA 4GX5A 3SPCA 5ITZB 3K58A 2EILC 4MV8A 1WA8B 2Y48A 4DV0B 4A3CG 3G4SV 2E5LH 1AR1B 1SF9A 1Z2OX 3HKZE 1OJHA 5JVDB 1EKPA 2VWKA 4EKWA 2YIAA 3OMAB 3BEHA 2Q69A 3L71H 2QE7G 5BY1A 4OGQB 4ED7A 4NVPA 1I94B 3C90A 1SKVA 1V51A 3CX5F 3V4ZA 2ASLA 4IIJB 1J95A 2YU9A 3UYYA 1YTFB 2BTQB 4O82A 3JAKA 1GMGA 4JTDB 4FPPA 3H1JH 3M99B 5FLMG 4QPKA 4X20B 4FLWA 4EEYA 1CS0A 2JA7G 3CC4V 2DLNA 4DV5B 4DR7B 1KBLA 2EJ0A 3LDDA 3KREA 1EBOA 1JX9A 2XAFA 3FKIG 4FJCC 2COJA 3M4IA 2R7LA 4EQ5A 5FLXN 4K6NA 1ZX3A 2X6CA 2ZE7A 5GTIZ 1G1XB 1XNQO 1CP9A 4M9UA 5B66Z 2EIMB 1JR9A 3HKCA 2JGDA 1JCHA 4YR2A 1I6UA 1MZFA 4CHIA 3MR5A 4LWSA 5BWUA 4C5BA 2GTSA 2DZDA 1A32A 1IZ3A 1SQPH 4JI2H 3PR5B 3H3VH 1N33H 4CKBA 1KEEA 4GLXA 4JI0B 3DC6A 4D6TH 4JYAO 2R82A 5IJ9B 4MVMA 1IBLO 3GVMA 2UUAH 3CCVV 1YJWV 3RV4A 1XUQA 2CH7A 2W7PA 4H0LB 4O2BF 3T9EA 1GLVA 3T9BA 2HHFB 4JI3O 4A2BA 3ASOC 2C35B 1U96A 1EZ1A 5KHJA 4JI4H 3K5IA 1RPOA 2AGAA 2EINC 2EIKC 1BGWA 1VQKV 4X8AA 3D3IA 4PA7A 4YJ3A 2JJ1G 3E8BA 1NVPB 3RYIA 2WYOA 2X5RA 4O7YA 5IYBG 2ITCC 3CCJV 3EFFK 2J6SA 2R92G 2R70A 5C5JA 2J9GA 4Z1MG 3BVOA 2GLTA 3OMNB 2OCCC 3RB4A 5F9LA 4PA3A 4TSFG 4J7JA 3F7YC 4I50F 5KFYA 4DV7O 2BCCH 1N36O 4JF3A 3RW0A 5LL6b 5IYBO 2BQUA 2UUBB 4O4IA 5CA3A 4DR3H 2HP8A 1US6A 1T5EA 3WWIA 1TAEA 3FB6C 3ZIAG 1FAFA 1M56B 4OX9H 1NR1A 1S5JA 3GV5B 2F43G 3STZC 5LA6F 3LNNA 5LMUO 4I4TF 2Q7DA 5JVLA 3CC7V 3OTOB 2M6YA 3D8CA 2W9BA 1UNNC 3RYHB 2ZINA 4DUYO 4PZ7A 5CAEB 3R5XA 3S3WA 2R9AA 3ETEA 4O83A 1V4YA 1Y67A 2A1HA 1N32O 1LR1A 3OHAA 1K1QA 5TISZ 2F23A 1H38A 3NBZB 4O2BB 4QWEA 5H2FZ 2WE6A 4ZHQA 4FGRA 5IYDG 3PW4A 2QKSA 3P3PA 3DTGA 1M0TA 1J5EH 4JI5H 3FYEB 3N42B 1XI1A 5KG0A 1X9NA 4HNAA 4FFNA 4TQFA 1BHAA 3T9CA 1I5XA 1PM9A 5J2TA 2E2HA 2F93B 1I5YA 1WPBA 5EDWA 5KFDA 2QM7A 5GONA 3ZN0A 2ZM6B 2YRWA 4QJFA 2R7KA 2P67A 4CS4A 3C3SA 3L72H 4HBNA 4YY3H 2DYRB 1KD1W 1XL6A 3IN5A 4A3IG 4G3IA 1KJIA 1Y76B 1R1BA 2WTFA 2VPSA 3RB0A 2RCVA 1T36A 4ZOLA 4JYYA 1SETA 1K4DC 3FFQA 3ZHQA 2W0XA 5LOVA 4C5CA 3ABTA 3OTFA 4RB1A 5H5NA 2KB1A 2V4QA 1GYFA 3OFNG 4LF5O 3M9NB 4APMA 3HKDB 5KFSA 4ZBMA 4J9SA 4CH5A 1N0NA 3N6XA 2W9CA 2AHYA 3I5DA 4LCUC 4KUMA 4NXMO 1ZTEA 4A3FG 1XNRH 2RN9A 1HW7A 1K7DA 4DR1O 2W9AA 3H1IH 3ZJZA 4DV1O 2IA6A 2XCAA 5KFQA 4LF4B 4MAMA 4F4YA 2UU9B 5CBGA 2HHHB 3OR6C 4YHHB 1N34H 1K5SA 3OAAG 4FLUA 1VQMV 2UXCB 1FD9A 1L1FA 3ETJA 3GTMA 2GDSA 1K4CC 3SYQA 1SQQH 3LSUA 2W6JG 4MVQA 3HPLC 3SJAC 3WO1A 4UCTA 2HGSA 1TWFA 3T1YH 2ZNIA 2EIJC 3ETGA 2GQSA 4GX0A 2QGNA 5I5WA 1I3QA 1GK9A 2P06A 4BIOA 4RWUA 3CEIA 1H2NA 2Q9LA 3ZRWB 4CKCA 2BSKA 3WB1A 2A06H 5KFGA 4EYIB 4YBZB 1R3LC 2W0FC 2V59A 3DAAA 5GW7A 1Y1VG 4UCSA 4BAYA 4BR6A 3JD3A 3GIQA 4DK0A 3GTOA 1HNXB 2WB1A 1F7YA 1NH2B 4E4TA 2N04A 2QWPB 3JD4A 5B1BC 3G71V 1PX2A 4X62O 1WA8A 2C00A 4IRDA 5L3BA 2DYSB 3CCEV 4PZ6A 3EPIA 2RDJA 2F4VH 4X66H 3A2FA 1JJOA 5CA0A 3CSXA 1XQ8A 5IYZB 1JXLA 5JVDA 4U7NA 1AB3A 4X65B 2G38A 3H1LH 5C8YF 4LFCO 1H8HG 1AUVA 4JI8B 4IIJA 4DV0H 1KJJA 1UFIA 3I56V 3JATB 2BTQA 2AHZA 5L1IA 3T7AA 3GB8B 4TM5A 5DGIA 4HNUA 5BR8H 4N21A 4IWYA 3MWDA 1S5HC 1WCMA 1MMMA 1IYEA 2DWCA 5I5VA 2FKLA 2XIGA 5KFZA 3JZ6A 1I7NA 4X20A 3MWEA 2LP7A 5I5UA 1I94H 4GKJO 5IWAB 4DR6B 4DV2O 5LMNB 1NTKH 5K3WA 2Q2UA 1VQLV 3VBBA 3AG3C 3APOA 4FLVA 2Z0AA 5A2QN 2QJ1A 1G8MA 4E6NA 4DRXB 1K9MW 3BQ1A 4RQEA 3I4NG 4MV7A 3OMIB 2FMLA 2GSMB 5JJJB 4DV5H 4PHZA 1B06A 3P32A 3UFXB 1KJ9A 4FS2A 4GKKB 3CRQA 4ASUG 3FYIB 1KP3A 3SGIA 1MABG 4RUFA 3CRRA 4TT3G 4J9MA 3MD0A 3GTJA 4J9RA 2X6BA 2E5LB 2FPIB 1MA1A 5IJ9A 1IXMA 1SCUB 3WB2A 3ZEDA 3MWMA 1QHTA 1YXBA 2PZSA 2HHFA 1RK5A 3JRWA 4TVIA 2K9PA 3CPWU 3M9OB 2DYRC 2YI9A 4GLWA 3VNNA 3CJHB 5KFNA 5C8YB 3Q4HB 4JI0H 5IDJA 1I1LA 2PMZA 3LDCA 4BIUA 3GV7B 4FFRA 4P30A 3PR4A 2ATLA 1KMIZ 2L35A 1WRVA 2AQ4A 1VQNV 4FFMA 5FPRA 4Q4DA 1CEZA 2WWWA 3SDLA 3GIKA 1BSMA 1MSDA 3F5WC 4LF7O 3ZHUA 4LFBB 2RF4A 1WB7A 5BYAA 3QZ7A 2IJJA 1XHZA 1KYOF 3UZBA 1I08A 4WHXA 4FU0A 2CNUA 3QVNA 3T1CA 1UJWB 1KJQA 1H2LA 5B1OA 4I5SA 1FXKC 4XDLA 2V58A 3J80W 1I2KA 1E1QG 3CRMA 4O4LF 2UUBH 2Q7GA 4JI2B 2B63G 1GN4A 3KHGA 3L9DA 2UUAB 3RV3A 4DV6H 1RFYA 1PD3A 4JI6B 2QA4V 4B3TO 2VRZA 1OV9A 3JYCA 3HKCB 4WFEA 2JGDB 5L3EA 1TUEB 4UXNA 1IDSA 2HG5C 4LWSB 4LF9B 4O84A 4TV8F 4BY1G 4JYCA 4O2BA 1DTOA 3WFVA 1KC8W 4J9OA 3PO2G 1BQ0A 1WNSA 3UO2A 3FB5C 3Q8PB 2Q4PA 4L8JA 3MAQA 3KHRA 2IU3A 1Y4MA 2CH7B 3E86A 3GB7C 2R8JA 1NS1A 2HKOA 2ZJTA 1BT8A 3MR2A 3KAKA 3TK1A 2JVDA 2D2CB 4MW3A 4YJ3B 4RAZA 2EILB 1CPYA 4PD4F 1CKMA 2Z3YA 4NXNB 1B33N 4LFAB 4FIPC 4DR3B 2UUCB 1XEQA 1Y76A 3PW0A 3PJSK 1S72V 2R7NA 4OX9B 4G27B 1S0MA 1YIJV 3K3WA 5LHGA 2XAJA 2QTSA 1JVMA 2X7RB 5B1AC 2R85A 4QE9A 5LGUA 2YUAA 5KFXA 2A0LA 1M5IA 4Y8VB 5C1PA 1AR5A 2JJ2G 4AYBE 2R8IA 3BQ0A 4JZGA 3L73H 4O4LB 3U11A 1YTFD 3GTKA 3HKDA 4UB8Z 2VQEB 4ECTA 4UCRA 3TY8A 3KCYA 3AW8A 2CW7A 3G6BA 1KT8A 1IYDA 4LF8O 4TV9F 3EXAA 3CS5A 4YJ2F 1W2BU 3KXYT 1OBDA 4TV8B 1RYSA 1GSAA 1J5EB 5EOYA 1Z5WA 3MHHC 5BWWA 1QQCA 3FMAA 1S03G 5J9PC 4Q8FA 3CXCU 4DV4O 4Q20A 1N33O 1XMOB 4FVMA 4D7SA 1B6QA 2KG7B 2P4VA 2WLIB 2Q0AA 1PV0A 2E74B 5E1AC 4FM9A 1SA0A 2RDCA 3RN4A 3R23A 4PBCA 4HYKA 5LXTF 4YY3B 2FPPB 3ABKC 2ZD9A 4YR0A 2PI4A 4Q6GA 5I5SA 2VA3A 4LF4H 4JI4O 4E4EA 2UU9H 3KTMA 3BABA 4DUZO 1TGOA 3GTPA 3RAQA 2Y0PA 5J2TB 2HHHH 4YHHH 1YHQV 1BL8A 2JS5A 2X0LA 2UXCH 4QJFB 4RB2C 4LH7A 1QVGU 3ASOB 2VPQA 3UKMA 3A0BZ 2W6IG 1KC7A 2EZOA 1K5QA 2EINB 2EIKB 1M90W 2ZKOA 2ASJA 2O57A 4DL3A 4JV1A 4EYHB 4O81A 1Q90D 4NTXA 4CS3A 4B08A 3G6EV 1EKVA 3W7XA 1NVPD 5KG3A 2WB1E 4EEQA 2RDIA 2OCCB 4QWCA 5LOVB 3RR5A 2FLLA 1IXBA 2PYJA 1HWYA 5IYZA 1HNXH 2WAMA 1JDEA 2HVKC 2R84A 4MS2A 3T9AA 1BQZA 3OGCC 5BWRA 1GSHA 5DG7A 3TW6A 1VS0A 3TY5A 5KS8A 4B7KA 5BWXA 5K1PA 4FZ0A 3K5HA 3JATA 2J6UA 2HG8A 1N34B 2EJRA 1AI7A 1QVFU 4K0KB 3H20A 2IJHA 1EZVH 1URFA 4MVRA 2ZE5A 4X65H 4IHJF 5BMVF 3ZRVA 2ADPA 2P6JA 2R7ZG 4JI8H 3JCUZ 4C2MA 2UVUA 3R66A 3BFRA 5LXTB 2YZNA 2M05A 2ZGIA 5H6QA 4AQYB 3U0GA 3DGEA 4J41A 5JJEB 4BW9A 1XMQO 4DRXA 1V55C 3VMMA 5IP9G 4QWAA 2UVWA 3DTUB 2V1DA 1P49A 4DR6H 3HKBB 1XDNA 2PYLA 5KT4A 5EWGA 4HQ6A 3T5JA 4U6PA 3TIGA 3WNZA 1TWGA 5C1OA 3F5TA 5KG6A 3VQYA 3JCZA 3AK3A 3RB6A 1R73A 1FJGO 1BZKA 2CQYA 3MR3A 5IT9W 1GN2A 2WLHA 3SYOA 1YI2V 2H3OA 4NKGB 4X89A 2VUGA 3BJYA 2V9WA 4LF6O 2QTOA 1S10A 4GKKH 3CWBH 5CA1F 1E4EA 5KFIA 1RJQA 1NTMH 1PNMA 1Z2GA 2NU8B 4JYAB 3P3NA 2YICA 1JFFB 5KG4A 4EB6B 2YDEA 3N27A 2XD4A 1L0NH 2JGUA 1HR0O 3CJHA 1FPOA 4J10A 5C8YA 4KP4A 3R5HA 4TUYF 3Q4HA 3H0GG 5CA0B 1ULZA 5BR8B 1T94A 4JI3B 1QBZA 1S0NA 5K1XA 3TXSA 4FFPA 1M1KW 5IYCG 3B77A 4RB0A 1YJNV 1XHXA 2PMZE 2DWEC 2HIVA 1YSCA 4IHJB 2HIXA 4DL6A 4IZOA 1V9PA 2QSAA 3EYYA 2QWRB 4W4KA 2LGWA 4K8ZA 4CS2A 5EWEA 3T9DA 1VEWA 2F95B 2Q8VA 3PN1A 1UC9A 1NZ6A 2W6QA 4UB6Z 4X1KB 5IYCO 4ECQA 2C2DA 1H2GA 3E8FA 2R87A 5J2UF 4FM1A 3C0FB 2ZIMA 3O9OA 4LFBH 3MJFA 3T1YO 3SJBC 4EFEA 1EFRG 2PGGA 5KLVH 4JAUA 1BNCA 5LMUB 4FS1A 3M8AA 4UCVA 1GKFA 5LBQA 4FM2A 4NZMA 4M0JA 3L74H 1QLNA 2WLNA 2EIJB 1VQ6V 2L6LA 3ZHSA 4GX2A 5CA1B 3W1GA 4RNMA 1YEWA 2XHBA 4P9OA 1N32B 4PDLA 2C2AA 2HEPA 2NLJC 4ED1A 4JI6H 4TUYB 4ZQIA 4JV0A 3ZBHA 4J9QA 3HOYG 4E2LA 3BCCH 3DC5A 4CC5A 5KFLA 5LGNA 2C22A 2WAQA 2FB5A 4LF9H 3GILA 4NYKA 2YIDA 5B1BB 3JAMW 3AG1C 1NH2D 1LUWA 1VIBA 3SPHA 4F6RB 3DF7A 3QFFA 3H9VA 4A93G 2RGRA 2Q6AA 1R3KC 1WCMG 4KL1A 2YXLA 2ZE8A 3CRAA 5FNVF 2V5AA 2JA8G 1D5NA 5L1LA 3P30A 4NXNH 5BXZA 4QWDA 5J2UB 2QM8A 2JEXA 4LFAH 4MV1A 3LP8A 2UUCH 4BBSG 4X1YB 2FTKA 1EHIA 4DV6B 4O4LA 4B3SO 5EBMC 1S0VA 3AEIA 1PPJH 4ED6A 4GUNA 4EBEA 2XT9A 4LF5B 4J7ZA 3JRXA 2AU0A 3L4KA 3AG3B 1MSWD 3GJXB 1BGYH 2JDIG 5KX5F 4PZ8A 4PELA 4DR7O 4TV8A 4BIZA 4JTAB 2ATKC 3RGZA 2EBOA 2JEJA 2UXDB 2VQEH 3ZHRA 4NXMB 2VQFH 1NR7A 3AYHB 2FPGB 5KG2A 2WLLB 5BZBA 1AUXA 1HNWB 5FLXW 1QCEA 4GCZA 2JIZG 2R7ZA 2KG7A 2WLIA 4CBCA 4WFBV 2YSUB 3TINA 1S77D 1DV2A 1N8RW 3ZMVA 4O4HF 3K5MA 2R7MA 1PKXA 1DF5A 4Q45A 4KHPH 2W6PA 1S3JA 2GTAA 4B3RB 5KA5A 3PW2A 2RNBA 5KUKA 1XMOH 3OM3B 4DR4O 4JI0O 4JI7H 1VMGA 1I7LA 4J9NA 3OUSA 2QYZA 3GIIA 4O2AF 2ASDA 3R9RA 5IYDO 5JQGF 2KQXA 2ZCEA 5DECA 1FKAO 2YIBA 4I50B 5FNVB 1BS3A 1TWCA 4DQNA 4X64H 5CE8A 4OPAA 4H37A 3A0RA 2Q5ZA 1MZEA 2I87A 4I7ZB 4I9QA 2DMXA 3WWJA 5EIBD 1H2SB 1DIKA 2CK3G 4DYLA 1BHBA 1D2DA 3MHSC 1YITV 4I7HA 5LA6B 4DIMA 3H0GA 4MV4A 2OTLV 4I4TB 5KKNB 5KFVA 3LSQA 2R9IA 3E8GA 5KG7A 3PW5A 4MTEA 4TQDA 4BWAA 2XC9A 2DWDC 1KP2A 3ZS8C 5KX5B 4IYHA 4DV3O 5LGTA 1HNZB 4MTFA 4Z2WA 1IOWA 4BY7G 2Y4RA 3PVXA 2NU9B 4ECVA 1ZL8B 2UUBO 4O86A 2XAQA 4MVOA 4HYOA 4LFCB 4RNOA 4ZKIA 1FXKB 2YC0A 1EM1A 4FE2A 1RP3B 2RGVA 5H6RA 4R6ZA 4QIWF 2R93A 2ZR2A 1YJ9V 4RCNA 5DISC 2Y0SE 2UVVA 2RMKB 2PTMA 2FP4B 4HNTA 5LXTA 3OTOO 4DL4A 2ILMA 4CC6A 4DAAA 1PL4A 4PDRA 2W6OA 4K0KH 4GKJB 1IX9A 2AXTZ 1AJNA 3K0GA 4DR5O 1SA0B 4WBNF 2DE0X 1Y74B 5CR5A 4WD3A 4XBFA 4IR9A 3HKBA 1GN3A 4X1IA 2XAHA 5K2MA 1RK6A 3V6HA 3IC9A 2QWOB 1Q3EA 2DIKA 4J42A 4AQYH 4A3JG 1F51A 5H80A 3KZIZ 3CC2V 4J80A 4B7EA 2WLJA 4XYLB 2HLDG 2CTPA 3STLC 1XOUA 5KMGB 3SPGA 1CQIB 3B2EE 2ZM6O 4PI0A 3T4DA 3V4SA 3VPBA 3N43B 1JFFA 1WH2A 4EB6A 3OSPA 3JASB 3GWOA 3M9MB 1EN4A 3WG7C 4I55F 4DL7A 1VKZA 1EKFA 3FB7C 4HAMA 5GTHZ 1IBKB 4A3GG 1NBMG 5B1AB 4FFBA 5HNEA 1OCOC 2XAGA 1VQOV 4JYAH 1IBLH 4JV5O 3EHBB 4IHJA 4DR2B 4A3DG 3WWHA 1AP6A 3ZMSA 1I2LA 4JI3H 1SQXH 4LMYA 1BE3H 3SJCC 1FFTB 1VQ4V 3W7SA 3AK2A 3CD6V 2NN4A 1IURA 3QO5A 1SQGA 2XCLA 2IH3C 5L9XA 3UT5B 4DL5A 5I5TA 2KKWA 5KHHA 4LF7B 4WBNB 4X1KA 3K59A 4ED2A 3L75H 1B6SA 3TCUA 5IY5B 3T1HB 2GBOA 5E79Z 2HDKA 1BJTA 1K8AW 3SR2C 4LR3A 3AG7A 1VQ5V 3RJ0A 5JQWA 2PY5A 3ZN1A 3HO8A 4FBUA 2UU9O 4RAIA 2HHHO 3K08A 3SYAA 4YHHO 3QF7A 5CM0A 2UXCO 5D8DA 5IJ0B 3ABKB 4IR1A 2NNUA 1ZLZA 4EBCA 4Q8EA 1SQFA 3D36C 2OYQA 5CA1A 3IFXA 4LC1A 3CSWA 2DW4A 3F8NA 4U7OA 3KYHC 4UVCA 5LMUH 5H9CA 4TUYA 1OBGA 2CKZB 4J9PA 4I55B 2JA6A 3BG5A 1E4EB 4ZIBA 3CE2A 3RUPA 2BTOA 4DUYH 4UV8A 1JIHA 4IYIA 1SC5B 1AILA 2P4KA 1S68A 4J11A 2BE3A 3KG2A 2YIBD 1HNXO 1L0LH 2RJZA
chains in the Genus database with same CATH topology
1N32H 3J7AK 4YY3B 4LF6H 4DK1A 4F6RA 4DV5B 4DR7B 3JAWB 4Q6GA 2EX3A 5D1OB 4LF4H 4JV5B 2UU9H 3BABA 1TGOA 1HR0H 1Q43A 3BHPA 5J2TB 2VWJA 4MV9A 4RAYA 2HHHH 4YHHH 2JS5A 4U3JB 5D5QA 2UXCH 3M4IA 4EQ5A 4RB2C 4LH7A 1FFXB 2YI8A 4O4HB 1E4GT 5J2UA 4DV2B 3M7MX 3HKCA 4CS3A 4B08A 1I6UA 4X1YA 4DRFA 4ZI7A 3CHXA 5LP6C 2Q7HA 4JI2H 4EEQA 1N33H 3QG5A 4GLXA 4JI0B 4O2AB 5LOVB 3RR5A 5IJ9B 1M4UA 3RYFB 5JQGB 2PYJA 2UUAH 4FM9A 5IYZA 1HNXH 5EZYB 1X4TA 3TY9A 2ZNJA 4A2BA 4A2AA 1NT2B 1VS0A 3TY5A 5KHJA 4JI4H 1BGWA 5K1PA 1TVKB 2WYOA 3JATA 4YJ3A 4CH4A 4LF8B 5A2QW 3RYIA 5EYPA 1N34B 4UCUA 4K0KB 4PI2A 4LF5H 2R70A 3E22B 3H20A 1KU9A 3L2PA 4X65H 1XNQH 3ETQA 4DV4B 2R72A 1G6UA 4Q0YA 4JI8H 2UXDH 1Z2PX 1IBMB 4NXMH 5LXTB 4D7TA 4AQYB 5LL6b 1HNWH 2UUBB 4O4IA 5JJEB 3N41B 4DR3H 3HKEB 4BW9A 4DV1H 4DRXA 1T5EA 5ITZA 1TAEA 4RB3C 3ICXA 1M0WA 5BMVA 1P49A 4DUZB 4OX9H 4DR6H 3HKBB 1XDNA 2PYLA 4I50A 5FNVA 1S5JA 3BRCA 4MTDA 4O4JB 2W57A 3LNNA 4B3RH 3OTOB 3VQYA 3RYHB 2ZINA 4PZ7A 3N2KB 5IT9W 2R9AA 3CB2A 2VUGA 5LA6A 5JH7A 4GKKH 2CAZC 4I4TA 3UQ8A 3RYCA 4JYAB 3NBZB 4O2BB 1JFFB 4DV7H 4EB6B 2HVSA 2MCTA 5KX5A 2WE6A 4ZHQA 1N36H 2JGUA 2VQFB 5C8YA 5CA0B 4LSXA 5BR8B 1M0TA 4JI3B 1J5EH 4JI5H 5LP6A 3N42B 3BPZA 3JAWA 1XI1A 1X9NA 2O03A 4HNAA 5K1XA 4TQFA 4B3TB 2UXBB 4R7RA 4B3SH 5J2TA 3S24A 2F93B 1WPBA 4RB0A 1XHXA 2P22C 5GONA 1A0IA 2ZM6B 1HNZH 2HIVA 1AN7A 4IHJB 4CS4A 1Z5VA 4KHPB 1P16A 2HIXA 4B3MB 1V9PA 4HBNA 4YY3H 4LNUB 4O4HA 3EYYA 2Q7EA 4DR7H 4LFCH 4JI7B 4K8ZA 3QWUA 4CS2A 4FLZA 3RGXA 2F95B 3JARA 3JALA 2VPSA 3PN1A 4ZOLA 2E3CA 2QM4A 4X1KB 4X64B 3FFQA 3RF2A 5JCOC 5LOVA 1XMQB 4FM1A 3N44B 5JQGA 3OTFA 2RQ6A 4JI1B 4RB1A 3C0FB 2ZIMA 4LFBH 4GKJH 1GYFA 3K3VA 1O9HA 4M7EA 3SJBC 3HKDB 4APMA 4EFEA 2PGGA 5KMGA 5LMUB 1WN7A 1TVKA 4UCVA 4CH5A 4DR4H 3N6XA 2WDTA 4FM2A 1FJGB 1XNRH 2VOBA 5CA1B 1HW7A 3RWRD 3W1GA 1FKAH 1YEWA 3JASA 2XHBA 3K57A 1N32B 5LYJA 4LF6B 4JI6H 2HEPA 4TUYB 4LF4B 2UU9B 3JAKB 4CC5A 1HR0B 2HHHB 1P8LA 4YHHB 1N34H 4FLUA 4TV9B 2UXCB 4LF9H 4YJ2B 2GV9A 3HKEA 3JAMW 5FD6A 3U0ZA 3SJAC 4F6RB 4UCTA 2HGSA 3DF7A 3T1YH 3BA8A 2ZNIA 2RGRA 4DV3H 1IBKH 2IM9A 2HVQA 3WB1A 3UT5A 5KHIA 4J0MA 4PDBA 4KL1A 1N33B 2YXLA 1TUBA 4WBNA 3RTXA 4UCSA 3RYHA 3CVZA 4DR2H 5FD5A 4DK0A 3K5OA 1L2ZA 1HNXB 3K5LA 3VQWA 3LMLA 4NXNH 1XK5A 4DR1H 5J2UB 4LFAH 2UUCH 1O75A 4UFZA 4X1YB 4AILC 4ZI7B 4O4LA 4DV6B 4JI4B 1FVIA 3OTOH 4X1IB 4PZ6A 4LF7H 2F4VH 4X66H 3A2FA 1JJOA 3THOA 5CA0A 3CSXA 1XQ8A 3NBYB 5IYZB 4DR5H 5JVDA 5CB4B 5IJ0A 5JJNB 4LF5B 3T1HH 3L4KA 2CW8A 3NC0B 4X65B 5JCOA 1XNQB 3GJXB 4PZ8A 4GYCB 4TV8A 3W5OA 3RGZA 4JI8B 4IIJA 4DV0H 2UXDB 1DGSA 1L8DA 2VQEH 3JATB 4NXMB 2VQFH 4FLTA 3RYIB 2CFMA 2BTQA 2F66C 4I55A 3GB8B 1CKOA 5EYPB 5BR8H 1HNWB 5FLXW 3N2GA 1IBLB 1CKNA 2XIGA 4X20A 1I94H 5IWAB 4CH3A 4DR6B 3JSLA 5LMNB 1Z2NX 2Q2UA 2ZM6H 3K5MA 3DSQA 4X62H 5D1OA 4KHPH 4FFBB 4FLVA 4B3RB 3N40P 2QJ1A 4FLXA 1XMOH 4O4IB 4U3JA 4E6NA 4JI7H 4DRXB 5BMVB 4MV7A 4IAJA 1FFXA 1Q5OA 4AHCA 2ZCEA 5JJJB 2YIBA 4DV5H 4I50B 4PHZA 5FNVB 4X64H 4GKKB 4JV5H 3SGIA 1RSOA 4DV7B 1I7FA 3GDEA 4I9QA 1N36B 3K5NA 2E5LB 5EIBD 1H2SB 4O2AA 4JI5B 5IJ9A 3RYFA 3U10A 1M93A 3WB2A 4I7HA 3ZEDA 5EZYA 5LA6B 3MWMA 4DV2H 1QHTA 5JH7B 2PZSA 4I4TB 4B3SB 3RYCB 3VQXA 4MTEA 4TQDA 4BWAA 3ZS8C 5KX5B 2YI9A 4ZHQB 1HNZB 3VNNA 5C8YB 4JI0H 1VF7A 5LP6B 4DUYB 4LFCB 3J81W 4HNAB 3E22A 2RGVA 1KMIZ 3RGBA 5DISC 3KAJA 5GONB 2PTMA 5FPRA 4LF8H 5LXTA 3BAAA 4FLYA 4CC6A 3KALA 1E4FT 4K0KH 4LFBB 4GKJB 2YCHA 1SA0B 3JSNA 1XHZA 1D5AA 3JARB 3JALB 2HVRA 4ZOLB 4EFBA 4DV4H 5EIBC 3HKBA 4X1IA 4DR4B 2KSWA 1IBMH 4O4JA 1Q3EA 3J80W 3RFRA 5CB4A 4AQYH 1XNRB 2V4DA 2UUBH 1O9GA 2Q7GA 4JI2B 5KHKA 5D5PA 3QTCA 4DV6H 3N2KA 2UUAB 5KMGB 4JI6B 4DUZH 3BA9A 3B2EE 3HKCB 4FM0A 4LF9B 4PI0A 3IG0A 3N43B 4O2BA 1JFFA 1WH2A 4EB6A 5KHGA 3JASB 4RZQA 5LYJB 1WNSA 4LSAA 3T1YB 4L8JA 3MAQA 4DV3B 1IBKB 5FPOA 4FFBA 2ZJTA 2P5OA 3RIZA 4JYAH 4UCOA 1IBLH 5D1PA 3KAKA 2Q2TA 2JVDA 4IHJA 4YJ3B 4CH6A 4DR2B 4RAZA 3IAYA 1CKMA 5IWAH 4NXNB 4JI3H 4LNUA 5LMNH 4DR1B 4LFAB 2UUCB 4DR3B 4LMYA 3SJCC 4DV1B 4B3TH 4BWSC 2UXBH 1SQGA 3UT5B 4OX9B 2KKWA 2PUSA 5KHHA 1TUBB 4WBNB 4LF7B 4X1KA 3VQVA 2F4VB 4X66B 3K59A 2FE3A 1ZAUA 1SYXB 4DR5B 4B3MH 4K8XA 1JMKC 3T1HB 1M5IA 1B04A 1BJTA 5ITZB 3SR2C 4LR3A 4ETSA 3RJ0A 1Q8IA 3K58A 4O4LB 1MZBA 3U11A 2PY5A 3HKDA 4DV0B 2VQEB 2OWOA 4UCRA 3TY8A 2E5LH 3QF7A 2F1MA 1Z2OX 2CW7A 1XMQH 5JVDB 5IJ0B 2VWKA 4JI1H 1ZHQA 1SQFA 2YIAA 1ZHSA 2OYQA 1SEIA 5CA1A 3KXYT 4NVPA 3HXLA 1I94B 4TV8B 1SKVA 3F8NA 1J5EB 5EOYA 1Z5WA 4IIJB 4LH6A 3KYHC 5LMUH 4X62B 4TUYA 1QQCA 3FMAA 1S03G 2ZIOA 2BTQB 4I55B 3WB0A 4ZIBA 3JAKA 1XMOB 1FJGH 2BTOA 4FVMA 4D7SA 3N2GB 4DUYH 4TV9A 1CKNB 1S68A 3W1BA 4YJ2A 1TA8A 2Q0AA 4TOIA 2YIBD 4X20B 4FLWA 3L4JA 1SA0A 2RJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFB A;  4PZ6 A;  4YY3 B;  5BR8 B;  4DR4 B;  4JI3 B;  4DV5 B;  4DR7 B;  3NBY B;  5D1O B;  4LF5 B;  4JV5 B;  1X9N A;  3BAB A;  4B3T B;  1XNR B;  2UXB B;  3NC0 B;  4X65 B;  4JI2 B;  1XNQ B;  3GJX B;  3S24 A;  4PZ8 A;  4EQ5 A;  3W5O A;  1A0I A;  2ZM6 B;  4LH7 A;  2HIV A;  2UUA B;  4JI8 B;  4JI6 B;  1DGS A;  4KHP B;  2UXD B;  1P16 A;  2HIX A;  4NXM B;  4B3M B;  1V9P A;  3BA9 A;  2CFM A;  3GB8 B;  1CKO A;  4DV2 B;  4JI7 B;  1HNW B;  3QWU A;  4LF9 B;  1IBL B;  1CKN A;  4DRF A;  3PN1 A;  4EEQ A;  5IWA B;  4DR6 B;  4GLX A;  4JI0 B;  3JSL A;  4X64 B;  3RR5 A;  5LMN B;  2Q2U A;  3T1Y B;  1XMQ B;  5D1O A;  4JI1 B;  4DV3 B;  1IBK B;  5FPO A;  4B3R B;  3TY9 A;  4E6N A;  1VS0 A;  3TY5 A;  4UCO A;  5D1P A;  2Q2T A;  4EFE A;  4DR2 B;  5LMU B;  4LF8 B;  1CKM A;  4UCV A;  4NXN B;  4DR1 B;  1N34 B;  4UCU A;  4K0K B;  4LFA B;  4GKK B;  2UUC B;  4DR3 B;  1FJG B;  4DV1 B;  3SGI A;  4DV7 B;  3L2P A;  3GDE A;  3W1G A;  1N36 B;  4OX9 B;  1N32 B;  4DV4 B;  2E5L B;  4LF7 B;  2F4V B;  4LF6 B;  4X66 B;  4JI5 B;  1ZAU A;  1IBM B;  4DR5 B;  4LF4 B;  2UU9 B;  4AQY B;  3T1H B;  4CC5 A;  1HR0 B;  2HHH B;  1B04 A;  1P8L A;  2UUB B;  4YHH B;  4B3S B;  2UXC B;  1TAE A;  1HNZ B;  3VNN A;  4DV0 B;  2VQE B;  4DUZ B;  2OWO A;  1XDN A;  4UCR A;  4UCT A;  3TY8 A;  3BA8 A;  4DUY B;  4LFC B;  3OTO B;  2HVQ A;  5DIS C;  1I94 B;  1N33 B;  1J5E B;  4PZ7 A;  3RTX A;  4LH6 A;  4UCS A;  5FPR A;  3KYH C;  4X62 B;  1HNX B;  3BAA A;  1XK5 A;  4CC6 A;  2VUG A;  4LFB B;  4GKJ B;  1XMO B;  4UFZ A;  1CKN B;  1S68 A;  3UQ8 A;  4JYA B;  3W1B A;  3NBZ B;  1TA8 A;  4DV6 B;  4JI4 B;  3JSN A;  2HVS A;  4TOI A;  1FVI A;  2HVR A;  2VQF B; 
#chains in the Genus database with same CATH topology
 1N32 H;  3A8T A;  3J7A K;  2ZDI C;  4F6R A;  3RFC A;  1BCC H;  2EX3 A;  5HV6 A;  3E8H A;  5D1O B;  5BYB A;  2YXH A;  4ECU A;  3Q2O A;  4UUG A;  3BHP A;  4ED3 A;  2VWJ A;  4MV9 A;  2C2R A;  3E35 A;  4U3J B;  2C2E A;  3SYP A;  4BBR G;  3HKZ A;  4QW9 A;  4L1K A;  5EBL C;  1FFX B;  2DQ0 A;  3QQM A;  2A7W A;  1GH6 A;  4O4J F;  2YI8 A;  4X65 O;  5CB4 F;  4IRC A;  4YAK B;  1E4G T;  3G6X A;  5J2U A;  1VF6 C;  2FK2 A;  3FD9 A;  1Y1W A;  5L1J A;  2Y0I A;  2FJZ A;  4X1Y A;  1M57 C;  5E25 A;  4DRF A;  4CMF A;  1HP8 A;  3FKS G;  1K73 W;  2Q7H A;  5KFA A;  3QG5 A;  4JAS A;  2BOB C;  4LBE C;  3RYF B;  1SZX A;  1QR8 A;  1JX4 A;  3E89 A;  2DAB A;  1S97 A;  2I8C A;  1X4T A;  4OPH A;  5IWA O;  3TY9 A;  2ZNJ A;  4A2A A;  2YYA A;  5LMN O;  5KA6 A;  5KFR A;  2UXB O;  1V55 B;  3HOZ G;  1GGO A;  4LF8 B;  5A2Q W;  4DL2 A;  2WLL A;  1VAR A;  3OW2 U;  4PDM A;  4PI2 A;  3SPJ A;  5KFJ A;  3PZP A;  1DK1 A;  4LF5 H;  3TGU H;  4A3L G;  2AW9 A;  4B3M O;  2OIG A;  3VOU A;  2HJF C;  2LFR A;  2AZ0 A;  3SE7 A;  2ZQM A;  3ETQ A;  4DV4 B;  2BQ3 A;  2R72 A;  5DED A;  2M7W A;  4ED8 A;  3D36 A;  4H33 A;  2UXD H;  1Z2P X;  3R5F A;  1IBM B;  4XZ3 B;  4NXM H;  3T5L A;  3FX7 A;  1GO3 E;  5BPH A;  2E5L O;  1LNQ A;  1HNW H;  2ALZ A;  3UM7 A;  2ETN A;  4DV1 H;  3W7W A;  3J81 N;  2EJ3 A;  2V4R A;  3K3P A;  3SJQ C;  4H44 B;  4DUZ B;  3SI8 A;  3VPD A;  4NB5 A;  4I50 A;  5FNV A;  2P7T C;  3BRC A;  4MTD A;  1YDX A;  4O4J B;  2W57 A;  1YZB A;  2VS0 A;  4ECS A;  2FLN A;  1ZWI C;  4O3S A;  4B3R H;  2ZDI A;  4CZZ A;  3AG4 C;  3RBE A;  3U9S A;  4ZHQ F;  1QU7 A;  1VQ9 V;  2LW1 A;  4MVZ A;  3ML0 A;  3T9F A;  5KT2 A;  1T3N A;  4GX1 A;  5LA6 A;  2CAZ C;  2EJ7 A;  4I4T A;  3ZRS A;  1CE8 A;  2GQR A;  3UQ8 A;  2ZDH A;  2BQR A;  1SQB H;  2HVS A;  5KX5 A;  5GON F;  2XGP A;  2VQF B;  3VPC A;  4NR1 A;  2JEU A;  2EZP A;  4UVB A;  4LFB O;  1R3J C;  1ZL8 A;  3ZMT A;  4NZO A;  2JK5 C;  4FBT A;  3BPZ A;  1K33 A;  3JAW A;  4O7T A;  1FXK A;  2O03 A;  3RBD A;  1RJP A;  3ZX6 A;  5DG8 A;  4O7V A;  4R7R A;  2JS3 A;  4YIP A;  3X2Q C;  1KJ8 A;  2P22 C;  5IY5 C;  3IGA C;  1A0I A;  1HNZ H;  4TWK A;  1AN7 A;  3CQZ A;  5C4X G;  2IJI A;  3NGD A;  1Z5V A;  4KHP B;  1P16 A;  3N8D A;  3HB9 A;  4YP3 A;  3RVY A;  4JI2 O;  3JD1 A;  4LNU B;  4O4H A;  2Q7E A;  2FMA A;  1JQ0 A;  4LFC H;  4JI7 B;  4X9Q A;  5B5E Z;  3QWU A;  2H8P C;  2OCH A;  3OEE G;  2UUA O;  4FLZ A;  2GPW A;  3RGX A;  3OR7 C;  1H2M A;  2NU6 B;  1Y74 A;  2UXX A;  1THZ A;  4X64 B;  3OUF A;  4DW1 A;  4EG0 A;  4R8C A;  5JCO C;  1XMQ B;  2YXY A;  3N44 B;  5JQG A;  2RQ6 A;  4JI1 B;  4MTG A;  4O7L A;  3BY6 A;  1H2K A;  4ZI7 F;  4GKJ H;  1B6R A;  1P4R A;  3JD0 A;  3CCM V;  4M7E A;  1FYJ A;  5KMG A;  5FJ8 G;  3I12 A;  5LHI A;  3U54 A;  1WN7 A;  1TVK A;  3AG1 B;  2WLM A;  2WDT A;  1KUQ A;  1FJG B;  3GIJ A;  2HGX A;  2VOB A;  3FDS A;  4WFF A;  2IU0 A;  3JAS A;  3K57 A;  4LF6 B;  3AK1 A;  4DR3 O;  2UUC O;  2COI A;  4K3A A;  3ABL C;  1OCZ C;  5KFT A;  4OX9 O;  1HR0 B;  1P8L A;  4TV9 B;  1KB9 F;  4YJ2 B;  1N4C A;  2GV9 A;  4P2Z A;  4QIW A;  3HKE A;  5FD6 A;  1EYZ A;  1YCI A;  3I4M G;  4LP8 A;  1N56 A;  4YXW G;  4IL6 Z;  2QKA A;  4H13 B;  4HR7 A;  1Q6I A;  3BA8 A;  1PP9 H;  2FK1 A;  1IBK H;  2ZR3 A;  2W7O A;  4QGP A;  2VQE O;  3V6J A;  2HJW A;  4O3P A;  5KT5 A;  1Q86 W;  3UT5 A;  1XDC A;  3UCS C;  4J0M A;  2JA5 A;  4PDB A;  4PJ0 Z;  4WBN A;  3CCU V;  3CVZ A;  3Q1K A;  4DR2 H;  5FD5 A;  3K5O A;  1L2Z A;  4QNH B;  3K5L A;  3VQW A;  2EIY A;  4WFA V;  2V7Q G;  1QNM A;  1J5E O;  3ABU A;  2XOK G;  4JI5 O;  1O75 A;  4UFZ A;  4AIL C;  4KXR A;  5CN0 A;  4ZI7 B;  1XIL A;  1FVI A;  1FS0 G;  4ECY A;  4X1I B;  4IIJ F;  1IVS A;  4LF7 H;  5DQI A;  4QW8 A;  2EUL A;  1XMO O;  4G28 B;  5EC2 C;  3THO A;  3CCS V;  3NBY B;  1Y66 A;  5JH7 F;  5IJ0 A;  1IOV A;  1KQS U;  1AP5 A;  3T1H H;  3C3T A;  4YY3 O;  5JCO A;  1XNQ B;  3I55 V;  1NJI W;  2P0A A;  1A3G A;  1I1K A;  5LP6 F;  2Q73 A;  1QLE C;  5L3C A;  4I55 A;  3K04 A;  1CKO A;  5EYP B;  3IC7 A;  3AX6 A;  1AJQ A;  1IBL B;  5EK0 A;  3HT5 A;  4ED0 A;  2OT5 A;  3TXQ A;  3H1K H;  1RPR A;  2VQD A;  1Z2N X;  1RM1 B;  1JOY A;  5KT7 A;  4YR3 A;  1V54 C;  5D1O A;  3GWK C;  4FFB B;  2OTJ V;  3N40 P;  4FLX A;  3RB3 A;  2QWN B;  4U3J A;  3VA7 A;  3HOV G;  1AI5 A;  3T4Z A;  1EN6 A;  5KAF Z;  5DG9 A;  2R93 G;  2R9R B;  5BMV B;  1BXR A;  1XNR O;  1FFX A;  1Q5O A;  3TW7 A;  2ARH A;  2FB9 A;  2E2I A;  1E1R G;  4DV7 B;  2YW2 A;  5I60 A;  2XUM A;  2QWQ B;  5I5X A;  1N36 B;  4PDV A;  4A3B G;  1WP7 A;  4JTC B;  4ABM A;  2PN1 A;  1N48 A;  1R6K A;  1N34 O;  4K0K O;  4UUJ C;  3RYF A;  1M9N A;  3AG2 C;  3B8N A;  4JPR A;  1ARO P;  1WB8 A;  5JH7 B;  1DV1 A;  1R6N A;  2LFS A;  3SNO A;  3Q8Q B;  1TWH A;  3DXR B;  4B3S B;  5KFE A;  3RYC B;  3VQX A;  4GZR B;  5LYJ F;  1R9T A;  1W96 A;  1SES A;  4AQY O;  2YS8 A;  3F7V C;  4DXW A;  4BXX G;  1VF7 A;  1VQ8 V;  2FKX A;  2ODM A;  5LP6 B;  3KHH A;  4ECZ A;  4DUY B;  4QE7 A;  5KFP A;  2B5U A;  4Z1V A;  1VQP V;  4HN2 A;  2CTW A;  3ETD A;  3MFI A;  2IBK A;  1F23 A;  2MK3 A;  3CRC A;  4PA9 A;  4IT5 A;  1AVM A;  4A3M G;  2WPD G;  3KAJ A;  3T54 A;  4MVS A;  2IBZ H;  4FMT A;  2CUG A;  3OE7 G;  1CQJ B;  3TQT A;  4WFG A;  4XDJ A;  5DLF A;  2SCU B;  2X0S A;  5DLG A;  3KHL A;  3OT7 A;  4LF8 H;  3BAA A;  3T2M A;  5DGB A;  2A9H A;  4PA6 A;  2CNV A;  1S5L Z;  2F4V O;  1E4F T;  4X66 O;  4IRK A;  4GC7 A;  4TQS A;  2BR0 A;  1EZJ A;  1P7G A;  2PI5 A;  1D5A A;  3JAR B;  3JAL B;  2HVR A;  4MTO A;  5B1N A;  1LUV A;  4EFB A;  4DV4 H;  2OIE A;  1MG1 A;  4KFM A;  1KEC A;  4DR4 B;  1YVW A;  2DOS A;  4RQF A;  1IBM H;  2HVJ C;  4O4J A;  3WG7 B;  4RUC A;  3HOX G;  4HNV A;  4DV0 O;  5CB4 A;  3RT3 C;  2V4D A;  1O9G A;  5F9N A;  4XDK A;  5BR8 O;  2Q68 A;  2Y69 B;  3QTC A;  1OCO B;  2ZXW C;  4DUZ H;  2VA2 A;  4JXU A;  3FAV B;  2WA4 A;  3PO3 G;  1I94 O;  2IH1 C;  1WSC A;  3GIP A;  3IG0 A;  5KT6 A;  2QK4 A;  5KHG A;  4RZQ A;  5LYJ B;  2Z04 A;  3GID A;  4A5U B;  3GTG A;  2R8K A;  2ABJ A;  4DV3 B;  4TQR A;  2CZG A;  3H1H H;  2Y4U A;  2MW2 B;  3OGI B;  3QNE A;  4J9Z B;  4DV5 O;  2VR1 A;  4NTY A;  5B3S C;  1S0O A;  4UCO A;  2AZ2 A;  5D1P A;  4CH6 A;  5CBH A;  1GRJ A;  3IAY A;  2B1G A;  3UZO A;  4LNU A;  4A3K G;  4J9K A;  4DR1 B;  2CGN A;  1K92 A;  4R8U A;  4I0X B;  4DV1 B;  5I47 A;  3R65 A;  2JA6 G;  4XX0 B;  5DGH A;  3O65 A;  2R8H A;  4YIO A;  5KFM A;  1TUB B;  2R8G A;  4Q4C A;  2FE3 A;  1F4M A;  3CCQ V;  1SYX B;  4DR5 B;  4YB8 B;  4K8X A;  5IE9 A;  1OCC B;  3TII A;  1M6V A;  5EC1 C;  3WU2 Z;  4O3N A;  4MT8 A;  1RYR A;  2JEF A;  4GT1 A;  4ETS A;  1E79 G;  1Q8I A;  3OHB A;  1MZB A;  1I1M A;  5LL6 Y;  2OWO A;  4OXS A;  1Y6X A;  1XL4 A;  4P9P A;  4RO2 A;  1AR4 A;  2F1M A;  4R50 A;  5EZY F;  4O3O A;  3E83 A;  1XMQ H;  5C93 A;  3D3Q A;  4JI1 H;  1ZHQ A;  2YEV B;  4F50 A;  1ZHS A;  3B4S A;  4IGG A;  1SEI A;  1RM1 C;  1Y1W G;  5HFM A;  1VP7 A;  2ZDQ A;  3HXL A;  5HFL A;  1EUC B;  4LH6 A;  2NVY A;  4X62 B;  1JJ2 U;  2ZIO A;  2ITD C;  3WB0 A;  1SZT A;  3IJ4 A;  5KUM A;  4L87 A;  1S9F A;  1FJG H;  4O3R A;  3N2G B;  4TV9 A;  2N74 A;  3CXH F;  1CKN B;  3W1B A;  4MSW C;  4DW0 A;  4YJ2 A;  1TA8 A;  2ODT X;  4DLK A;  2DPI A;  3GTL A;  4TOI A;  2Q67 A;  1TWA A;  3L4J A;  2Q0O C;  1M57 B;  5L1K A;  2EJ2 A;  4R7C A;  3N6R A;  2VUM A;  3WO0 A;  4LF6 H;  3LDE A;  4DK1 A;  4AYB A;  2YZG A;  3A0H Z;  3V6K A;  2CGO A;  1F4N A;  3JAW B;  1KTA A;  4X88 A;  2CTQ A;  3L70 H;  4WCE V;  4DV6 O;  4JV5 B;  4QIW E;  2J6T A;  1W0J G;  3J7A U;  1HR0 H;  1Q43 A;  4RAY A;  1VBH A;  5D5Q A;  2YRX A;  1Q6U A;  1EUD B;  3OD4 A;  3RAX A;  1XBL A;  3QO8 A;  4O4H B;  5IYZ F;  1SFO A;  3ZMU A;  3G67 A;  1H8E G;  4DV2 B;  1AI6 A;  1GTO A;  3K9S A;  4ICG A;  3M7M X;  2JEI A;  2BOC C;  5C44 G;  1KKD A;  1RSO B;  5CMU A;  5LHH A;  3LUT B;  2UXD O;  2NR5 A;  4ZI7 A;  3CHX A;  5KFB A;  5LP6 C;  2I80 A;  3ETH A;  3OSN A;  5KFO A;  4O2A B;  1HNW O;  1M4U A;  5JQG B;  4K35 A;  1WP8 A;  4JGS A;  2FK3 A;  5EZY B;  4G2K A;  3H4D A;  1NT2 B;  4CE5 A;  2A3Q A;  2JA7 A;  5DGA A;  1WAZ A;  4B3R O;  1TVK B;  4CH4 A;  4O7N A;  2EIM C;  3CCR V;  1EN5 A;  1C30 A;  4MA0 A;  3LWB A;  5EYP A;  2YZL A;  4UCU A;  1G4Y B;  3H40 A;  2W6N A;  3FKI A;  3E22 B;  2B1I A;  1KU9 A;  1ZSP A;  4O7R A;  1DF4 A;  2HJD A;  3L2P A;  4ECW A;  1HDJ A;  1XNQ H;  2AGO A;  2DQ3 A;  3AG4 B;  5FR9 A;  4JV2 A;  1G6U A;  4Q0Y A;  1N0J A;  2HFE C;  4MV3 A;  4XYM B;  2OH2 A;  2PVP A;  2LGQ A;  4D7T A;  2Y69 C;  4CMD A;  1A9X A;  3LNM B;  2GPS A;  3ZHV A;  3GTQ A;  4UV9 A;  3N41 B;  3HKE B;  5ITZ A;  5BWV A;  4RB3 C;  2A79 B;  3ICX A;  1M0W A;  4JAV A;  5BMV A;  3CMA V;  1GAX A;  3HBL A;  2ADQ B;  3G80 A;  1M7J A;  1WJZ A;  4DO2 A;  1ZQ7 A;  4WF9 V;  1HNZ O;  2YL2 A;  5KFK A;  3KKY A;  3SYC A;  3NR7 A;  4AI8 A;  1OWT A;  3H4B A;  2KSD A;  5KFF A;  3T5K A;  1S76 D;  3N2K B;  1MNG A;  3X2Q B;  2IW5 A;  2N05 A;  3CB2 A;  2R92 A;  3U55 A;  5JH7 A;  5CBF A;  5DAA A;  3DXR A;  3RYC A;  1M56 C;  4LF4 O;  4DV7 H;  3J80 N;  2GUZ B;  1N36 H;  2MCT A;  4NZN A;  4WFH A;  4MW8 A;  3CP1 A;  4LSX A;  1NI8 A;  3LUL A;  5LP6 A;  4IWX A;  1Q82 W;  1GSO A;  2ZT9 B;  4B3T B;  3K03 A;  5EBW C;  2UXB B;  2YZM A;  4B3S H;  4YAJ B;  3S24 A;  2QKC A;  1OCC C;  3TQ1 A;  3K0D A;  3GIM A;  1SQV H;  4F6E A;  4B3M B;  1U97 A;  2DJV A;  4GC6 A;  4NLG A;  1YF2 A;  4DR7 H;  3OEH G;  5KFW A;  5IP7 G;  2PF4 E;  5L3F A;  5KG1 A;  4FFO A;  3JAR A;  3JAL A;  4Q44 A;  3VOT A;  2E3C A;  2QM4 A;  2GHY A;  2WAQ E;  2R86 A;  4PWQ A;  3RF2 A;  4RNN A;  1CXZ B;  1B3Q A;  3ABL B;  1OCZ B;  1VAJ A;  3H01 A;  1NKD A;  2QEX V;  3K3V A;  2W8L A;  2Z02 A;  4CKE A;  1O9H A;  3G6Y A;  2YS6 A;  2UVR A;  2WSS G;  1IBK O;  2QB5 A;  3OUU A;  5DQH A;  2JA5 G;  2DAA A;  4JUZ A;  1VBG A;  3FAV A;  3CCL V;  4DR4 H;  1P84 F;  2LQT A;  2UXN A;  3EVK A;  4JI8 O;  2OLS A;  1NQT A;  3HOW G;  1W59 A;  4DR2 O;  5FL7 G;  1KBH A;  3RWR D;  1OCR B;  4UVA A;  1FKA H;  2FYU H;  2Z5U A;  4BW5 A;  4F4W A;  5LYJ A;  4YJ3 F;  5EWF A;  3K06 A;  2B9Z A;  3W7T A;  1VF5 B;  1I50 A;  1K34 A;  1JKJ B;  1SS3 A;  4DR6 O;  3JAK B;  4RZR A;  3G6V A;  3ZRX A;  1K97 A;  2E76 B;  3QO7 A;  1FXV A;  1ZET A;  3E2E A;  5KFH A;  3U0Z A;  4J9Y B;  1GN6 A;  1ZUQ A;  5A9G A;  2JRI A;  3T1H O;  3Q8R B;  3HOU G;  5AG2 A;  2YWV A;  2QDO A;  3S3X A;  4I0X A;  4O4I F;  3QZ8 A;  3MFH A;  2IM9 A;  4C5A A;  1AJP A;  4DV3 H;  1WPX A;  2HVQ A;  3TJT A;  3ZHT A;  5KHI A;  3ZMZ A;  5KAI Z;  5C3E G;  4GKK O;  1N33 B;  1TUB A;  3RTX A;  3MDS A;  1ENV A;  3NUA A;  3RYH A;  1RJR A;  2CDY A;  2IP4 A;  3LML A;  1XK5 A;  2IMW P;  4DR1 H;  4ECX A;  4JZ2 A;  3K79 A;  1I0H A;  1QLE B;  3MR6 A;  3BQ2 A;  3KCX A;  1JA8 A;  3PW7 A;  4JI4 B;  5L3D A;  5DM6 V;  3APQ A;  3OTO H;  2PBZ A;  3K9A A;  2CE4 A;  4DR5 H;  3LSS A;  5CB4 B;  3ABM B;  5JJN B;  1PNK A;  5L3G A;  3EPG A;  2E75 B;  2YEV A;  1V54 B;  2CW8 A;  1OZ0 A;  3ASN B;  3NC0 B;  1BMF G;  5KFU A;  4GYC B;  2NUA B;  1GO3 F;  2Y4T A;  3W5O A;  5JUM A;  2IJK A;  1DAA A;  3ORR A;  1DGS A;  1L8D A;  3GV8 B;  5I5Y A;  4FLT A;  3RYI B;  2CFM A;  1W93 A;  2F66 C;  1GM9 A;  4I9W A;  1K3E A;  5J2T F;  3N2G A;  4MA5 A;  1CKN A;  2DYS C;  3U9T A;  1VF6 A;  1ORQ C;  4W4L A;  1Y1V A;  4FFK A;  3RBZ A;  5KT3 A;  1FXH A;  4CH3 A;  3ORQ A;  1Q81 W;  5JWP A;  3JSL A;  2QR4 A;  3GLK A;  2ZM6 H;  2FL4 A;  2P90 A;  3DSQ A;  4X62 H;  2NVX A;  3BAC A;  2W6M A;  5DMX A;  2CNQ A;  2DN9 A;  3AG2 B;  4O4I B;  3T99 A;  4PA4 A;  4ZOL F;  2X6A A;  2XAS A;  3Q8S B;  1GM8 A;  4IAJ A;  4YQW A;  3NXS A;  5LOV F;  4AHC A;  2D3O W;  1Q7Y W;  1OHH G;  3W7U A;  4O3Q A;  5KG5 A;  4R8U B;  4JV5 H;  4JI6 O;  4MTX A;  2NU7 B;  5BWT A;  1RSO A;  4NTW A;  4FK5 C;  4JAA A;  1I7F A;  3GDE A;  1COW G;  3K5N A;  5KFC A;  2W9B B;  4C7U A;  4LF9 O;  4O2A A;  5F2V O;  4JI5 B;  4J9L A;  3JZI A;  1SRY A;  2QF7 A;  1AI4 A;  1R6T A;  3U10 A;  1P7B A;  1UPG A;  2YS7 A;  1M93 A;  5HBR B;  4A3E G;  5EZY A;  2C28 A;  2XGQ A;  2WLK A;  4DV2 H;  3PFF A;  5BPF A;  1GM7 A;  1XRE A;  3SPI A;  1WR2 A;  1DLB A;  1IBM O;  4ZHQ B;  4O7Z A;  2W71 A;  3CME V;  1A48 A;  2LW7 A;  4RU9 A;  2K1E A;  1PK8 A;  3HR0 A;  1PL0 A;  1PNL A;  4FFL A;  3TEK A;  3J81 W;  4ME6 A;  4HNA B;  3E22 A;  5IT9 N;  4NXN O;  3RGB A;  3ZRW A;  4LFA O;  4F4Z A;  5GON B;  2JEG A;  2WA3 A;  3E5N A;  4N23 A;  2FLP A;  2AGP A;  2ZXW B;  4FLY A;  3KAL A;  4U7C A;  1QR9 A;  1ROP A;  1JLL B;  3UO3 A;  3TET A;  3HB3 B;  4JYB A;  3RVZ A;  2YCH A;  3JSN A;  5T14 A;  4ZOL B;  4HZ3 A;  1UC8 A;  5EIB C;  1WLE A;  2R6F A;  1KKC A;  3T5H A;  1G2W A;  3CEB A;  2KSW A;  1JPX A;  3G8C A;  1OCR C;  1KUT A;  1MOF A;  3RFR A;  4Q43 A;  3JD2 A;  2VQF O;  5DN6 G;  1XNR B;  1A0G A;  2DPJ A;  5KHK A;  4QSH A;  5D5P A;  3N2K A;  5B3S B;  5CA0 F;  4MV6 A;  4F4X A;  3B09 A;  5JVD F;  1JDB B;  3BA9 A;  3G8D A;  4EBD A;  2Y0S A;  4RUE A;  2XCP A;  2W9C B;  3B8M A;  4FM0 A;  2HGW A;  4QPJ A;  4KHP O;  2GUZ A;  4U3F H;  4O7W A;  1K1S A;  1K83 A;  4RUA A;  2XTA A;  4LSA A;  1R3I C;  4JI7 O;  4J7K A;  3T1Y B;  3ZCC A;  1W0K G;  2CTR A;  2H94 A;  3DTF A;  5FPO A;  2LJ2 A;  3FB8 C;  2XND G;  4NYE A;  2P5O A;  4X64 O;  3RIZ A;  2HR3 A;  2W70 A;  4F4L A;  4MVU A;  1Y14 B;  1VQ7 V;  1NU1 H;  2Q2T A;  4JI1 O;  3CYO A;  5IWA H;  5LMN H;  1ET0 A;  4EGQ A;  2B63 A;  4EGJ A;  4ECR A;  2AGQ A;  4BWS C;  3GQC A;  4B3T H;  2UXB H;  2BSK B;  5DQG A;  2ZDG A;  3LQS A;  4QWB A;  1X59 A;  4O7S A;  2COG A;  3ABM C;  1NTZ H;  2PUS A;  1SER A;  2F4V B;  3VQV A;  4X66 B;  4FZ1 A;  3JZF A;  3ASN C;  1ZAU A;  4B3M H;  1Q6H A;  3B40 A;  3JAM N;  2W6Z A;  2VUM G;  2LO1 A;  2ZE6 A;  1JMK C;  2W8K A;  1C3O A;  1B04 A;  4PV1 B;  3OUZ A;  4GX5 A;  3SPC A;  5ITZ B;  3K58 A;  2EIL C;  4MV8 A;  1WA8 B;  2Y48 A;  4DV0 B;  4A3C G;  3G4S V;  2E5L H;  1AR1 B;  1SF9 A;  1Z2O X;  3HKZ E;  1OJH A;  5JVD B;  1EKP A;  2VWK A;  4EKW A;  2YIA A;  3OMA B;  3BEH A;  2Q69 A;  3L71 H;  2QE7 G;  5BY1 A;  4OGQ B;  4ED7 A;  4NVP A;  1I94 B;  3C90 A;  1SKV A;  1V51 A;  3CX5 F;  3V4Z A;  2ASL A;  4IIJ B;  1J95 A;  2YU9 A;  3UYY A;  1YTF B;  2BTQ B;  4O82 A;  3JAK A;  1GMG A;  4JTD B;  4FPP A;  3H1J H;  3M99 B;  5FLM G;  4QPK A;  4X20 B;  4FLW A;  4EEY A;  1CS0 A;  2JA7 G;  3CC4 V;  2DLN A;  4DV5 B;  4DR7 B;  1KBL A;  2EJ0 A;  3LDD A;  3KRE A;  1EBO A;  1JX9 A;  2XAF A;  3FKI G;  4FJC C;  2COJ A;  3M4I A;  2R7L A;  4EQ5 A;  5FLX N;  4K6N A;  1ZX3 A;  2X6C A;  2ZE7 A;  5GTI Z;  1G1X B;  1XNQ O;  1CP9 A;  4M9U A;  5B66 Z;  2EIM B;  1JR9 A;  3HKC A;  2JGD A;  1JCH A;  4YR2 A;  1I6U A;  1MZF A;  4CHI A;  3MR5 A;  4LWS A;  5BWU A;  4C5B A;  2GTS A;  2DZD A;  1A32 A;  1IZ3 A;  1SQP H;  4JI2 H;  3PR5 B;  3H3V H;  1N33 H;  4CKB A;  1KEE A;  4GLX A;  4JI0 B;  3DC6 A;  4D6T H;  4JYA O;  2R82 A;  5IJ9 B;  4MVM A;  1IBL O;  3GVM A;  2UUA H;  3CCV V;  1YJW V;  3RV4 A;  1XUQ A;  2CH7 A;  2W7P A;  4H0L B;  4O2B F;  3T9E A;  1GLV A;  3T9B A;  2HHF B;  4JI3 O;  4A2B A;  3ASO C;  2C35 B;  1U96 A;  1EZ1 A;  5KHJ A;  4JI4 H;  3K5I A;  1RPO A;  2AGA A;  2EIN C;  2EIK C;  1BGW A;  1VQK V;  4X8A A;  3D3I A;  4PA7 A;  4YJ3 A;  2JJ1 G;  3E8B A;  1NVP B;  3RYI A;  2WYO A;  2X5R A;  4O7Y A;  5IYB G;  2ITC C;  3CCJ V;  3EFF K;  2J6S A;  2R92 G;  2R70 A;  5C5J A;  2J9G A;  4Z1M G;  3BVO A;  2GLT A;  3OMN B;  2OCC C;  3RB4 A;  5F9L A;  4PA3 A;  4TSF G;  4J7J A;  3F7Y C;  4I50 F;  5KFY A;  4DV7 O;  2BCC H;  1N36 O;  4JF3 A;  3RW0 A;  5LL6 b;  5IYB O;  2BQU A;  2UUB B;  4O4I A;  5CA3 A;  4DR3 H;  2HP8 A;  1US6 A;  1T5E A;  3WWI A;  1TAE A;  3FB6 C;  3ZIA G;  1FAF A;  1M56 B;  4OX9 H;  1NR1 A;  1S5J A;  3GV5 B;  2F43 G;  3STZ C;  5LA6 F;  3LNN A;  5LMU O;  4I4T F;  2Q7D A;  5JVL A;  3CC7 V;  3OTO B;  2M6Y A;  3D8C A;  2W9B A;  1UNN C;  3RYH B;  2ZIN A;  4DUY O;  4PZ7 A;  5CAE B;  3R5X A;  3S3W A;  2R9A A;  3ETE A;  4O83 A;  1V4Y A;  1Y67 A;  2A1H A;  1N32 O;  1LR1 A;  3OHA A;  1K1Q A;  5TIS Z;  2F23 A;  1H38 A;  3NBZ B;  4O2B B;  4QWE A;  5H2F Z;  2WE6 A;  4ZHQ A;  4FGR A;  5IYD G;  3PW4 A;  2QKS A;  3P3P A;  3DTG A;  1M0T A;  1J5E H;  4JI5 H;  3FYE B;  3N42 B;  1XI1 A;  5KG0 A;  1X9N A;  4HNA A;  4FFN A;  4TQF A;  1BHA A;  3T9C A;  1I5X A;  1PM9 A;  5J2T A;  2E2H A;  2F93 B;  1I5Y A;  1WPB A;  5EDW A;  5KFD A;  2QM7 A;  5GON A;  3ZN0 A;  2ZM6 B;  2YRW A;  4QJF A;  2R7K A;  2P67 A;  4CS4 A;  3C3S A;  3L72 H;  4HBN A;  4YY3 H;  2DYR B;  1KD1 W;  1XL6 A;  3IN5 A;  4A3I G;  4G3I A;  1KJI A;  1Y76 B;  1R1B A;  2WTF A;  2VPS A;  3RB0 A;  2RCV A;  1T36 A;  4ZOL A;  4JYY A;  1SET A;  1K4D C;  3FFQ A;  3ZHQ A;  2W0X A;  5LOV A;  4C5C A;  3ABT A;  3OTF A;  4RB1 A;  5H5N A;  2KB1 A;  2V4Q A;  1GYF A;  3OFN G;  4LF5 O;  3M9N B;  4APM A;  3HKD B;  5KFS A;  4ZBM A;  4J9S A;  4CH5 A;  1N0N A;  3N6X A;  2W9C A;  2AHY A;  3I5D A;  4LCU C;  4KUM A;  4NXM O;  1ZTE A;  4A3F G;  1XNR H;  2RN9 A;  1HW7 A;  1K7D A;  4DR1 O;  2W9A A;  3H1I H;  3ZJZ A;  4DV1 O;  2IA6 A;  2XCA A;  5KFQ A;  4LF4 B;  4MAM A;  4F4Y A;  2UU9 B;  5CBG A;  2HHH B;  3OR6 C;  4YHH B;  1N34 H;  1K5S A;  3OAA G;  4FLU A;  1VQM V;  2UXC B;  1FD9 A;  1L1F A;  3ETJ A;  3GTM A;  2GDS A;  1K4C C;  3SYQ A;  1SQQ H;  3LSU A;  2W6J G;  4MVQ A;  3HPL C;  3SJA C;  3WO1 A;  4UCT A;  2HGS A;  1TWF A;  3T1Y H;  2ZNI A;  2EIJ C;  3ETG A;  2GQS A;  4GX0 A;  2QGN A;  5I5W A;  1I3Q A;  1GK9 A;  2P06 A;  4BIO A;  4RWU A;  3CEI A;  1H2N A;  2Q9L A;  3ZRW B;  4CKC A;  2BSK A;  3WB1 A;  2A06 H;  5KFG A;  4EYI B;  4YBZ B;  1R3L C;  2W0F C;  2V59 A;  3DAA A;  5GW7 A;  1Y1V G;  4UCS A;  4BAY A;  4BR6 A;  3JD3 A;  3GIQ A;  4DK0 A;  3GTO A;  1HNX B;  2WB1 A;  1F7Y A;  1NH2 B;  4E4T A;  2N04 A;  2QWP B;  3JD4 A;  5B1B C;  3G71 V;  1PX2 A;  4X62 O;  1WA8 A;  2C00 A;  4IRD A;  5L3B A;  2DYS B;  3CCE V;  4PZ6 A;  3EPI A;  2RDJ A;  2F4V H;  4X66 H;  3A2F A;  1JJO A;  5CA0 A;  3CSX A;  1XQ8 A;  5IYZ B;  1JXL A;  5JVD A;  4U7N A;  1AB3 A;  4X65 B;  2G38 A;  3H1L H;  5C8Y F;  4LFC O;  1H8H G;  1AUV A;  4JI8 B;  4IIJ A;  4DV0 H;  1KJJ A;  1UFI A;  3I56 V;  3JAT B;  2BTQ A;  2AHZ A;  5L1I A;  3T7A A;  3GB8 B;  4TM5 A;  5DGI A;  4HNU A;  5BR8 H;  4N21 A;  4IWY A;  3MWD A;  1S5H C;  1WCM A;  1MMM A;  1IYE A;  2DWC A;  5I5V A;  2FKL A;  2XIG A;  5KFZ A;  3JZ6 A;  1I7N A;  4X20 A;  3MWE A;  2LP7 A;  5I5U A;  1I94 H;  4GKJ O;  5IWA B;  4DR6 B;  4DV2 O;  5LMN B;  1NTK H;  5K3W A;  2Q2U A;  1VQL V;  3VBB A;  3AG3 C;  3APO A;  4FLV A;  2Z0A A;  5A2Q N;  2QJ1 A;  1G8M A;  4E6N A;  4DRX B;  1K9M W;  3BQ1 A;  4RQE A;  3I4N G;  4MV7 A;  3OMI B;  2FML A;  2GSM B;  5JJJ B;  4DV5 H;  4PHZ A;  1B06 A;  3P32 A;  3UFX B;  1KJ9 A;  4FS2 A;  4GKK B;  3CRQ A;  4ASU G;  3FYI B;  1KP3 A;  3SGI A;  1MAB G;  4RUF A;  3CRR A;  4TT3 G;  4J9M A;  3MD0 A;  3GTJ A;  4J9R A;  2X6B A;  2E5L B;  2FPI B;  1MA1 A;  5IJ9 A;  1IXM A;  1SCU B;  3WB2 A;  3ZED A;  3MWM A;  1QHT A;  1YXB A;  2PZS A;  2HHF A;  1RK5 A;  3JRW A;  4TVI A;  2K9P A;  3CPW U;  3M9O B;  2DYR C;  2YI9 A;  4GLW A;  3VNN A;  3CJH B;  5KFN A;  5C8Y B;  3Q4H B;  4JI0 H;  5IDJ A;  1I1L A;  2PMZ A;  3LDC A;  4BIU A;  3GV7 B;  4FFR A;  4P30 A;  3PR4 A;  2ATL A;  1KMI Z;  2L35 A;  1WRV A;  2AQ4 A;  1VQN V;  4FFM A;  5FPR A;  4Q4D A;  1CEZ A;  2WWW A;  3SDL A;  3GIK A;  1BSM A;  1MSD A;  3F5W C;  4LF7 O;  3ZHU A;  4LFB B;  2RF4 A;  1WB7 A;  5BYA A;  3QZ7 A;  2IJJ A;  1XHZ A;  1KYO F;  3UZB A;  1I08 A;  4WHX A;  4FU0 A;  2CNU A;  3QVN A;  3T1C A;  1UJW B;  1KJQ A;  1H2L A;  5B1O A;  4I5S A;  1FXK C;  4XDL A;  2V58 A;  3J80 W;  1I2K A;  1E1Q G;  3CRM A;  4O4L F;  2UUB H;  2Q7G A;  4JI2 B;  2B63 G;  1GN4 A;  3KHG A;  3L9D A;  2UUA B;  3RV3 A;  4DV6 H;  1RFY A;  1PD3 A;  4JI6 B;  2QA4 V;  4B3T O;  2VRZ A;  1OV9 A;  3JYC A;  3HKC B;  4WFE A;  2JGD B;  5L3E A;  1TUE B;  4UXN A;  1IDS A;  2HG5 C;  4LWS B;  4LF9 B;  4O84 A;  4TV8 F;  4BY1 G;  4JYC A;  4O2B A;  1DTO A;  3WFV A;  1KC8 W;  4J9O A;  3PO2 G;  1BQ0 A;  1WNS A;  3UO2 A;  3FB5 C;  3Q8P B;  2Q4P A;  4L8J A;  3MAQ A;  3KHR A;  2IU3 A;  1Y4M A;  2CH7 B;  3E86 A;  3GB7 C;  2R8J A;  1NS1 A;  2HKO A;  2ZJT A;  1BT8 A;  3MR2 A;  3KAK A;  3TK1 A;  2JVD A;  2D2C B;  4MW3 A;  4YJ3 B;  4RAZ A;  2EIL B;  1CPY A;  4PD4 F;  1CKM A;  2Z3Y A;  4NXN B;  1B33 N;  4LFA B;  4FIP C;  4DR3 B;  2UUC B;  1XEQ A;  1Y76 A;  3PW0 A;  3PJS K;  1S72 V;  2R7N A;  4OX9 B;  4G27 B;  1S0M A;  1YIJ V;  3K3W A;  5LHG A;  2XAJ A;  2QTS A;  1JVM A;  2X7R B;  5B1A C;  2R85 A;  4QE9 A;  5LGU A;  2YUA A;  5KFX A;  2A0L A;  1M5I A;  4Y8V B;  5C1P A;  1AR5 A;  2JJ2 G;  4AYB E;  2R8I A;  3BQ0 A;  4JZG A;  3L73 H;  4O4L B;  3U11 A;  1YTF D;  3GTK A;  3HKD A;  4UB8 Z;  2VQE B;  4ECT A;  4UCR A;  3TY8 A;  3KCY A;  3AW8 A;  2CW7 A;  3G6B A;  1KT8 A;  1IYD A;  4LF8 O;  4TV9 F;  3EXA A;  3CS5 A;  4YJ2 F;  1W2B U;  3KXY T;  1OBD A;  4TV8 B;  1RYS A;  1GSA A;  1J5E B;  5EOY A;  1Z5W A;  3MHH C;  5BWW A;  1QQC A;  3FMA A;  1S03 G;  5J9P C;  4Q8F A;  3CXC U;  4DV4 O;  4Q20 A;  1N33 O;  1XMO B;  4FVM A;  4D7S A;  1B6Q A;  2KG7 B;  2P4V A;  2WLI B;  2Q0A A;  1PV0 A;  2E74 B;  5E1A C;  4FM9 A;  1SA0 A;  2RDC A;  3RN4 A;  3R23 A;  4PBC A;  4HYK A;  5LXT F;  4YY3 B;  2FPP B;  3ABK C;  2ZD9 A;  4YR0 A;  2PI4 A;  4Q6G A;  5I5S A;  2VA3 A;  4LF4 H;  4JI4 O;  4E4E A;  2UU9 H;  3KTM A;  3BAB A;  4DUZ O;  1TGO A;  3GTP A;  3RAQ A;  2Y0P A;  5J2T B;  2HHH H;  4YHH H;  1YHQ V;  1BL8 A;  2JS5 A;  2X0L A;  2UXC H;  4QJF B;  4RB2 C;  4LH7 A;  1QVG U;  3ASO B;  2VPQ A;  3UKM A;  3A0B Z;  2W6I G;  1KC7 A;  2EZO A;  1K5Q A;  2EIN B;  2EIK B;  1M90 W;  2ZKO A;  2ASJ A;  2O57 A;  4DL3 A;  4JV1 A;  4EYH B;  4O81 A;  1Q90 D;  4NTX A;  4CS3 A;  4B08 A;  3G6E V;  1EKV A;  3W7X A;  1NVP D;  5KG3 A;  2WB1 E;  4EEQ A;  2RDI A;  2OCC B;  4QWC A;  5LOV B;  3RR5 A;  2FLL A;  1IXB A;  2PYJ A;  1HWY A;  5IYZ A;  1HNX H;  2WAM A;  1JDE A;  2HVK C;  2R84 A;  4MS2 A;  3T9A A;  1BQZ A;  3OGC C;  5BWR A;  1GSH A;  5DG7 A;  3TW6 A;  1VS0 A;  3TY5 A;  5KS8 A;  4B7K A;  5BWX A;  5K1P A;  4FZ0 A;  3K5H A;  3JAT A;  2J6U A;  2HG8 A;  1N34 B;  2EJR A;  1AI7 A;  1QVF U;  4K0K B;  3H20 A;  2IJH A;  1EZV H;  1URF A;  4MVR A;  2ZE5 A;  4X65 H;  4IHJ F;  5BMV F;  3ZRV A;  2ADP A;  2P6J A;  2R7Z G;  4JI8 H;  3JCU Z;  4C2M A;  2UVU A;  3R66 A;  3BFR A;  5LXT B;  2YZN A;  2M05 A;  2ZGI A;  5H6Q A;  4AQY B;  3U0G A;  3DGE A;  4J41 A;  5JJE B;  4BW9 A;  1XMQ O;  4DRX A;  1V55 C;  3VMM A;  5IP9 G;  4QWA A;  2UVW A;  3DTU B;  2V1D A;  1P49 A;  4DR6 H;  3HKB B;  1XDN A;  2PYL A;  5KT4 A;  5EWG A;  4HQ6 A;  3T5J A;  4U6P A;  3TIG A;  3WNZ A;  1TWG A;  5C1O A;  3F5T A;  5KG6 A;  3VQY A;  3JCZ A;  3AK3 A;  3RB6 A;  1R73 A;  1FJG O;  1BZK A;  2CQY A;  3MR3 A;  5IT9 W;  1GN2 A;  2WLH A;  3SYO A;  1YI2 V;  2H3O A;  4NKG B;  4X89 A;  2VUG A;  3BJY A;  2V9W A;  4LF6 O;  2QTO A;  1S10 A;  4GKK H;  3CWB H;  5CA1 F;  1E4E A;  5KFI A;  1RJQ A;  1NTM H;  1PNM A;  1Z2G A;  2NU8 B;  4JYA B;  3P3N A;  2YIC A;  1JFF B;  5KG4 A;  4EB6 B;  2YDE A;  3N27 A;  2XD4 A;  1L0N H;  2JGU A;  1HR0 O;  3CJH A;  1FPO A;  4J10 A;  5C8Y A;  4KP4 A;  3R5H A;  4TUY F;  3Q4H A;  3H0G G;  5CA0 B;  1ULZ A;  5BR8 B;  1T94 A;  4JI3 B;  1QBZ A;  1S0N A;  5K1X A;  3TXS A;  4FFP A;  1M1K W;  5IYC G;  3B77 A;  4RB0 A;  1YJN V;  1XHX A;  2PMZ E;  2DWE C;  2HIV A;  1YSC A;  4IHJ B;  2HIX A;  4DL6 A;  4IZO A;  1V9P A;  2QSA A;  3EYY A;  2QWR B;  4W4K A;  2LGW A;  4K8Z A;  4CS2 A;  5EWE A;  3T9D A;  1VEW A;  2F95 B;  2Q8V A;  3PN1 A;  1UC9 A;  1NZ6 A;  2W6Q A;  4UB6 Z;  4X1K B;  5IYC O;  4ECQ A;  2C2D A;  1H2G A;  3E8F A;  2R87 A;  5J2U F;  4FM1 A;  3C0F B;  2ZIM A;  3O9O A;  4LFB H;  3MJF A;  3T1Y O;  3SJB C;  4EFE A;  1EFR G;  2PGG A;  5KLV H;  4JAU A;  1BNC A;  5LMU B;  4FS1 A;  3M8A A;  4UCV A;  1GKF A;  5LBQ A;  4FM2 A;  4NZM A;  4M0J A;  3L74 H;  1QLN A;  2WLN A;  2EIJ B;  1VQ6 V;  2L6L A;  3ZHS A;  4GX2 A;  5CA1 B;  3W1G A;  4RNM A;  1YEW A;  2XHB A;  4P9O A;  1N32 B;  4PDL A;  2C2A A;  2HEP A;  2NLJ C;  4ED1 A;  4JI6 H;  4TUY B;  4ZQI A;  4JV0 A;  3ZBH A;  4J9Q A;  3HOY G;  4E2L A;  3BCC H;  3DC5 A;  4CC5 A;  5KFL A;  5LGN A;  2C22 A;  2WAQ A;  2FB5 A;  4LF9 H;  3GIL A;  4NYK A;  2YID A;  5B1B B;  3JAM W;  3AG1 C;  1NH2 D;  1LUW A;  1VIB A;  3SPH A;  4F6R B;  3DF7 A;  3QFF A;  3H9V A;  4A93 G;  2RGR A;  2Q6A A;  1R3K C;  1WCM G;  4KL1 A;  2YXL A;  2ZE8 A;  3CRA A;  5FNV F;  2V5A A;  2JA8 G;  1D5N A;  5L1L A;  3P30 A;  4NXN H;  5BXZ A;  4QWD A;  5J2U B;  2QM8 A;  2JEX A;  4LFA H;  4MV1 A;  3LP8 A;  2UUC H;  4BBS G;  4X1Y B;  2FTK A;  1EHI A;  4DV6 B;  4O4L A;  4B3S O;  5EBM C;  1S0V A;  3AEI A;  1PPJ H;  4ED6 A;  4GUN A;  4EBE A;  2XT9 A;  4LF5 B;  4J7Z A;  3JRX A;  2AU0 A;  3L4K A;  3AG3 B;  1MSW D;  3GJX B;  1BGY H;  2JDI G;  5KX5 F;  4PZ8 A;  4PEL A;  4DR7 O;  4TV8 A;  4BIZ A;  4JTA B;  2ATK C;  3RGZ A;  2EBO A;  2JEJ A;  2UXD B;  2VQE H;  3ZHR A;  4NXM B;  2VQF H;  1NR7 A;  3AYH B;  2FPG B;  5KG2 A;  2WLL B;  5BZB A;  1AUX A;  1HNW B;  5FLX W;  1QCE A;  4GCZ A;  2JIZ G;  2R7Z A;  2KG7 A;  2WLI A;  4CBC A;  4WFB V;  2YSU B;  3TIN A;  1S77 D;  1DV2 A;  1N8R W;  3ZMV A;  4O4H F;  3K5M A;  2R7M A;  1PKX A;  1DF5 A;  4Q45 A;  4KHP H;  2W6P A;  1S3J A;  2GTA A;  4B3R B;  5KA5 A;  3PW2 A;  2RNB A;  5KUK A;  1XMO H;  3OM3 B;  4DR4 O;  4JI0 O;  4JI7 H;  1VMG A;  1I7L A;  4J9N A;  3OUS A;  2QYZ A;  3GII A;  4O2A F;  2ASD A;  3R9R A;  5IYD O;  5JQG F;  2KQX A;  2ZCE A;  5DEC A;  1FKA O;  2YIB A;  4I50 B;  5FNV B;  1BS3 A;  1TWC A;  4DQN A;  4X64 H;  5CE8 A;  4OPA A;  4H37 A;  3A0R A;  2Q5Z A;  1MZE A;  2I87 A;  4I7Z B;  4I9Q A;  2DMX A;  3WWJ A;  5EIB D;  1H2S B;  1DIK A;  2CK3 G;  4DYL A;  1BHB A;  1D2D A;  3MHS C;  1YIT V;  4I7H A;  5LA6 B;  4DIM A;  3H0G A;  4MV4 A;  2OTL V;  4I4T B;  5KKN B;  5KFV A;  3LSQ A;  2R9I A;  3E8G A;  5KG7 A;  3PW5 A;  4MTE A;  4TQD A;  4BWA A;  2XC9 A;  2DWD C;  1KP2 A;  3ZS8 C;  5KX5 B;  4IYH A;  4DV3 O;  5LGT A;  1HNZ B;  4MTF A;  4Z2W A;  1IOW A;  4BY7 G;  2Y4R A;  3PVX A;  2NU9 B;  4ECV A;  1ZL8 B;  2UUB O;  4O86 A;  2XAQ A;  4MVO A;  4HYO A;  4LFC B;  4RNO A;  4ZKI A;  1FXK B;  2YC0 A;  1EM1 A;  4FE2 A;  1RP3 B;  2RGV A;  5H6R A;  4R6Z A;  4QIW F;  2R93 A;  2ZR2 A;  1YJ9 V;  4RCN A;  5DIS C;  2Y0S E;  2UVV A;  2RMK B;  2PTM A;  2FP4 B;  4HNT A;  5LXT A;  3OTO O;  4DL4 A;  2ILM A;  4CC6 A;  4DAA A;  1PL4 A;  4PDR A;  2W6O A;  4K0K H;  4GKJ B;  1IX9 A;  2AXT Z;  1AJN A;  3K0G A;  4DR5 O;  1SA0 B;  4WBN F;  2DE0 X;  1Y74 B;  5CR5 A;  4WD3 A;  4XBF A;  4IR9 A;  3HKB A;  1GN3 A;  4X1I A;  2XAH A;  5K2M A;  1RK6 A;  3V6H A;  3IC9 A;  2QWO B;  1Q3E A;  2DIK A;  4J42 A;  4AQY H;  4A3J G;  1F51 A;  5H80 A;  3KZI Z;  3CC2 V;  4J80 A;  4B7E A;  2WLJ A;  4XYL B;  2HLD G;  2CTP A;  3STL C;  1XOU A;  5KMG B;  3SPG A;  1CQI B;  3B2E E;  2ZM6 O;  4PI0 A;  3T4D A;  3V4S A;  3VPB A;  3N43 B;  1JFF A;  1WH2 A;  4EB6 A;  3OSP A;  3JAS B;  3GWO A;  3M9M B;  1EN4 A;  3WG7 C;  4I55 F;  4DL7 A;  1VKZ A;  1EKF A;  3FB7 C;  4HAM A;  5GTH Z;  1IBK B;  4A3G G;  1NBM G;  5B1A B;  4FFB A;  5HNE A;  1OCO C;  2XAG A;  1VQO V;  4JYA H;  1IBL H;  4JV5 O;  3EHB B;  4IHJ A;  4DR2 B;  4A3D G;  3WWH A;  1AP6 A;  3ZMS A;  1I2L A;  4JI3 H;  1SQX H;  4LMY A;  1BE3 H;  3SJC C;  1FFT B;  1VQ4 V;  3W7S A;  3AK2 A;  3CD6 V;  2NN4 A;  1IUR A;  3QO5 A;  1SQG A;  2XCL A;  2IH3 C;  5L9X A;  3UT5 B;  4DL5 A;  5I5T A;  2KKW A;  5KHH A;  4LF7 B;  4WBN B;  4X1K A;  3K59 A;  4ED2 A;  3L75 H;  1B6S A;  3TCU A;  5IY5 B;  3T1H B;  2GBO A;  5E79 Z;  2HDK A;  1BJT A;  1K8A W;  3SR2 C;  4LR3 A;  3AG7 A;  1VQ5 V;  3RJ0 A;  5JQW A;  2PY5 A;  3ZN1 A;  3HO8 A;  4FBU A;  2UU9 O;  4RAI A;  2HHH O;  3K08 A;  3SYA A;  4YHH O;  3QF7 A;  5CM0 A;  2UXC O;  5D8D A;  5IJ0 B;  3ABK B;  4IR1 A;  2NNU A;  1ZLZ A;  4EBC A;  4Q8E A;  1SQF A;  3D36 C;  2OYQ A;  5CA1 A;  3IFX A;  4LC1 A;  3CSW A;  2DW4 A;  3F8N A;  4U7O A;  3KYH C;  4UVC A;  5LMU H;  5H9C A;  4TUY A;  1OBG A;  2CKZ B;  4J9P A;  4I55 B;  2JA6 A;  3BG5 A;  1E4E B;  4ZIB A;  3CE2 A;  3RUP A;  2BTO A;  4DUY H;  4UV8 A;  1JIH A;  4IYI A;  1SC5 B;  1AIL A;  2P4K A;  1S68 A;  4J11 A;  2BE3 A;  3KG2 A;  2YIB D;  1HNX O;  1L0L H;  2RJZ A; 
#chains in the Genus database with same CATH homology
 1N32 H;  3J7A K;  4YY3 B;  4LF6 H;  4DK1 A;  4F6R A;  4DV5 B;  4DR7 B;  3JAW B;  4Q6G A;  2EX3 A;  5D1O B;  4LF4 H;  4JV5 B;  2UU9 H;  3BAB A;  1TGO A;  1HR0 H;  1Q43 A;  3BHP A;  5J2T B;  2VWJ A;  4MV9 A;  4RAY A;  2HHH H;  4YHH H;  2JS5 A;  4U3J B;  5D5Q A;  2UXC H;  3M4I A;  4EQ5 A;  4RB2 C;  4LH7 A;  1FFX B;  2YI8 A;  4O4H B;  1E4G T;  5J2U A;  4DV2 B;  3M7M X;  3HKC A;  4CS3 A;  4B08 A;  1I6U A;  4X1Y A;  4DRF A;  4ZI7 A;  3CHX A;  5LP6 C;  2Q7H A;  4JI2 H;  4EEQ A;  1N33 H;  3QG5 A;  4GLX A;  4JI0 B;  4O2A B;  5LOV B;  3RR5 A;  5IJ9 B;  1M4U A;  3RYF B;  5JQG B;  2PYJ A;  2UUA H;  4FM9 A;  5IYZ A;  1HNX H;  5EZY B;  1X4T A;  3TY9 A;  2ZNJ A;  4A2B A;  4A2A A;  1NT2 B;  1VS0 A;  3TY5 A;  5KHJ A;  4JI4 H;  1BGW A;  5K1P A;  1TVK B;  2WYO A;  3JAT A;  4YJ3 A;  4CH4 A;  4LF8 B;  5A2Q W;  3RYI A;  5EYP A;  1N34 B;  4UCU A;  4K0K B;  4PI2 A;  4LF5 H;  2R70 A;  3E22 B;  3H20 A;  1KU9 A;  3L2P A;  4X65 H;  1XNQ H;  3ETQ A;  4DV4 B;  2R72 A;  1G6U A;  4Q0Y A;  4JI8 H;  2UXD H;  1Z2P X;  1IBM B;  4NXM H;  5LXT B;  4D7T A;  4AQY B;  5LL6 b;  1HNW H;  2UUB B;  4O4I A;  5JJE B;  3N41 B;  4DR3 H;  3HKE B;  4BW9 A;  4DV1 H;  4DRX A;  1T5E A;  5ITZ A;  1TAE A;  4RB3 C;  3ICX A;  1M0W A;  5BMV A;  1P49 A;  4DUZ B;  4OX9 H;  4DR6 H;  3HKB B;  1XDN A;  2PYL A;  4I50 A;  5FNV A;  1S5J A;  3BRC A;  4MTD A;  4O4J B;  2W57 A;  3LNN A;  4B3R H;  3OTO B;  3VQY A;  3RYH B;  2ZIN A;  4PZ7 A;  3N2K B;  5IT9 W;  2R9A A;  3CB2 A;  2VUG A;  5LA6 A;  5JH7 A;  4GKK H;  2CAZ C;  4I4T A;  3UQ8 A;  3RYC A;  4JYA B;  3NBZ B;  4O2B B;  1JFF B;  4DV7 H;  4EB6 B;  2HVS A;  2MCT A;  5KX5 A;  2WE6 A;  4ZHQ A;  1N36 H;  2JGU A;  2VQF B;  5C8Y A;  5CA0 B;  4LSX A;  5BR8 B;  1M0T A;  4JI3 B;  1J5E H;  4JI5 H;  5LP6 A;  3N42 B;  3BPZ A;  3JAW A;  1XI1 A;  1X9N A;  2O03 A;  4HNA A;  5K1X A;  4TQF A;  4B3T B;  2UXB B;  4R7R A;  4B3S H;  5J2T A;  3S24 A;  2F93 B;  1WPB A;  4RB0 A;  1XHX A;  2P22 C;  5GON A;  1A0I A;  2ZM6 B;  1HNZ H;  2HIV A;  1AN7 A;  4IHJ B;  4CS4 A;  1Z5V A;  4KHP B;  1P16 A;  2HIX A;  4B3M B;  1V9P A;  4HBN A;  4YY3 H;  4LNU B;  4O4H A;  3EYY A;  2Q7E A;  4DR7 H;  4LFC H;  4JI7 B;  4K8Z A;  3QWU A;  4CS2 A;  4FLZ A;  3RGX A;  2F95 B;  3JAR A;  3JAL A;  2VPS A;  3PN1 A;  4ZOL A;  2E3C A;  2QM4 A;  4X1K B;  4X64 B;  3FFQ A;  3RF2 A;  5JCO C;  5LOV A;  1XMQ B;  4FM1 A;  3N44 B;  5JQG A;  3OTF A;  2RQ6 A;  4JI1 B;  4RB1 A;  3C0F B;  2ZIM A;  4LFB H;  4GKJ H;  1GYF A;  3K3V A;  1O9H A;  4M7E A;  3SJB C;  3HKD B;  4APM A;  4EFE A;  2PGG A;  5KMG A;  5LMU B;  1WN7 A;  1TVK A;  4UCV A;  4CH5 A;  4DR4 H;  3N6X A;  2WDT A;  4FM2 A;  1FJG B;  1XNR H;  2VOB A;  5CA1 B;  1HW7 A;  3RWR D;  3W1G A;  1FKA H;  1YEW A;  3JAS A;  2XHB A;  3K57 A;  1N32 B;  5LYJ A;  4LF6 B;  4JI6 H;  2HEP A;  4TUY B;  4LF4 B;  2UU9 B;  3JAK B;  4CC5 A;  1HR0 B;  2HHH B;  1P8L A;  4YHH B;  1N34 H;  4FLU A;  4TV9 B;  2UXC B;  4LF9 H;  4YJ2 B;  2GV9 A;  3HKE A;  3JAM W;  5FD6 A;  3U0Z A;  3SJA C;  4F6R B;  4UCT A;  2HGS A;  3DF7 A;  3T1Y H;  3BA8 A;  2ZNI A;  2RGR A;  4DV3 H;  1IBK H;  2IM9 A;  2HVQ A;  3WB1 A;  3UT5 A;  5KHI A;  4J0M A;  4PDB A;  4KL1 A;  1N33 B;  2YXL A;  1TUB A;  4WBN A;  3RTX A;  4UCS A;  3RYH A;  3CVZ A;  4DR2 H;  5FD5 A;  4DK0 A;  3K5O A;  1L2Z A;  1HNX B;  3K5L A;  3VQW A;  3LML A;  4NXN H;  1XK5 A;  4DR1 H;  5J2U B;  4LFA H;  2UUC H;  1O75 A;  4UFZ A;  4X1Y B;  4AIL C;  4ZI7 B;  4O4L A;  4DV6 B;  4JI4 B;  1FVI A;  3OTO H;  4X1I B;  4PZ6 A;  4LF7 H;  2F4V H;  4X66 H;  3A2F A;  1JJO A;  3THO A;  5CA0 A;  3CSX A;  1XQ8 A;  3NBY B;  5IYZ B;  4DR5 H;  5JVD A;  5CB4 B;  5IJ0 A;  5JJN B;  4LF5 B;  3T1H H;  3L4K A;  2CW8 A;  3NC0 B;  4X65 B;  5JCO A;  1XNQ B;  3GJX B;  4PZ8 A;  4GYC B;  4TV8 A;  3W5O A;  3RGZ A;  4JI8 B;  4IIJ A;  4DV0 H;  2UXD B;  1DGS A;  1L8D A;  2VQE H;  3JAT B;  4NXM B;  2VQF H;  4FLT A;  3RYI B;  2CFM A;  2BTQ A;  2F66 C;  4I55 A;  3GB8 B;  1CKO A;  5EYP B;  5BR8 H;  1HNW B;  5FLX W;  3N2G A;  1IBL B;  1CKN A;  2XIG A;  4X20 A;  1I94 H;  5IWA B;  4CH3 A;  4DR6 B;  3JSL A;  5LMN B;  1Z2N X;  2Q2U A;  2ZM6 H;  3K5M A;  3DSQ A;  4X62 H;  5D1O A;  4KHP H;  4FFB B;  4FLV A;  4B3R B;  3N40 P;  2QJ1 A;  4FLX A;  1XMO H;  4O4I B;  4U3J A;  4E6N A;  4JI7 H;  4DRX B;  5BMV B;  4MV7 A;  4IAJ A;  1FFX A;  1Q5O A;  4AHC A;  2ZCE A;  5JJJ B;  2YIB A;  4DV5 H;  4I50 B;  4PHZ A;  5FNV B;  4X64 H;  4GKK B;  4JV5 H;  3SGI A;  1RSO A;  4DV7 B;  1I7F A;  3GDE A;  4I9Q A;  1N36 B;  3K5N A;  2E5L B;  5EIB D;  1H2S B;  4O2A A;  4JI5 B;  5IJ9 A;  3RYF A;  3U10 A;  1M93 A;  3WB2 A;  4I7H A;  3ZED A;  5EZY A;  5LA6 B;  3MWM A;  4DV2 H;  1QHT A;  5JH7 B;  2PZS A;  4I4T B;  4B3S B;  3RYC B;  3VQX A;  4MTE A;  4TQD A;  4BWA A;  3ZS8 C;  5KX5 B;  2YI9 A;  4ZHQ B;  1HNZ B;  3VNN A;  5C8Y B;  4JI0 H;  1VF7 A;  5LP6 B;  4DUY B;  4LFC B;  3J81 W;  4HNA B;  3E22 A;  2RGV A;  1KMI Z;  3RGB A;  5DIS C;  3KAJ A;  5GON B;  2PTM A;  5FPR A;  4LF8 H;  5LXT A;  3BAA A;  4FLY A;  4CC6 A;  3KAL A;  1E4F T;  4K0K H;  4LFB B;  4GKJ B;  2YCH A;  1SA0 B;  3JSN A;  1XHZ A;  1D5A A;  3JAR B;  3JAL B;  2HVR A;  4ZOL B;  4EFB A;  4DV4 H;  5EIB C;  3HKB A;  4X1I A;  4DR4 B;  2KSW A;  1IBM H;  4O4J A;  1Q3E A;  3J80 W;  3RFR A;  5CB4 A;  4AQY H;  1XNR B;  2V4D A;  2UUB H;  1O9G A;  2Q7G A;  4JI2 B;  5KHK A;  5D5P A;  3QTC A;  4DV6 H;  3N2K A;  2UUA B;  5KMG B;  4JI6 B;  4DUZ H;  3BA9 A;  3B2E E;  3HKC B;  4FM0 A;  4LF9 B;  4PI0 A;  3IG0 A;  3N43 B;  4O2B A;  1JFF A;  1WH2 A;  4EB6 A;  5KHG A;  3JAS B;  4RZQ A;  5LYJ B;  1WNS A;  4LSA A;  3T1Y B;  4L8J A;  3MAQ A;  4DV3 B;  1IBK B;  5FPO A;  4FFB A;  2ZJT A;  2P5O A;  3RIZ A;  4JYA H;  4UCO A;  1IBL H;  5D1P A;  3KAK A;  2Q2T A;  2JVD A;  4IHJ A;  4YJ3 B;  4CH6 A;  4DR2 B;  4RAZ A;  3IAY A;  1CKM A;  5IWA H;  4NXN B;  4JI3 H;  4LNU A;  5LMN H;  4DR1 B;  4LFA B;  2UUC B;  4DR3 B;  4LMY A;  3SJC C;  4DV1 B;  4B3T H;  4BWS C;  2UXB H;  1SQG A;  3UT5 B;  4OX9 B;  2KKW A;  2PUS A;  5KHH A;  1TUB B;  4WBN B;  4LF7 B;  4X1K A;  3VQV A;  2F4V B;  4X66 B;  3K59 A;  2FE3 A;  1ZAU A;  1SYX B;  4DR5 B;  4B3M H;  4K8X A;  1JMK C;  3T1H B;  1M5I A;  1B04 A;  1BJT A;  5ITZ B;  3SR2 C;  4LR3 A;  4ETS A;  3RJ0 A;  1Q8I A;  3K58 A;  4O4L B;  1MZB A;  3U11 A;  2PY5 A;  3HKD A;  4DV0 B;  2VQE B;  2OWO A;  4UCR A;  3TY8 A;  2E5L H;  3QF7 A;  2F1M A;  1Z2O X;  2CW7 A;  1XMQ H;  5JVD B;  5IJ0 B;  2VWK A;  4JI1 H;  1ZHQ A;  1SQF A;  2YIA A;  1ZHS A;  2OYQ A;  1SEI A;  5CA1 A;  3KXY T;  4NVP A;  3HXL A;  1I94 B;  4TV8 B;  1SKV A;  3F8N A;  1J5E B;  5EOY A;  1Z5W A;  4IIJ B;  4LH6 A;  3KYH C;  5LMU H;  4X62 B;  4TUY A;  1QQC A;  3FMA A;  1S03 G;  2ZIO A;  2BTQ B;  4I55 B;  3WB0 A;  4ZIB A;  3JAK A;  1XMO B;  1FJG H;  2BTO A;  4FVM A;  4D7S A;  3N2G B;  4DUY H;  4TV9 A;  1CKN B;  1S68 A;  3W1B A;  4YJ2 A;  1TA8 A;  2Q0A A;  4TOI A;  2YIB D;  4X20 B;  4FLW A;  3L4J A;  1SA0 A;  2RJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...