3JSNA

Crystal structure of the adenylation domain of nad+-dependent dna ligase from staphylococcus aureus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
306
structure length
297
Chain Sequence
DLSSRVNELHDLLNQYSYEYYSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the adenylation domain of NAD(+)-dependent DNA ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA ligase
total genus 106
structure length 297
sequence length 306
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jsnA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3jsnA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jsnA02
2E5LB 1FVIA 4JI1B 3NBYB 1HNZB 4X62B 4LF5B 4DV4B 4DR2B 4B3TB 3W1GA 4E6NA 4DR7B 4UCOA 4DUYB 4X66B 2HHHB 4JI7B 1CKOA 4LFAB 3JSLA 2UXCB 2HIVA 4JI4B 4KHPB 4LH7A 4YHHB 4YY3B 3W5OA 4LF7B 4DV6B 4GKJB 4LF4B 4JYAB 1B04A 4PZ7A 1TAEA 1ZAUA 2HIXA 1CKNB 3OTOB 1XDNA 1N33B 5LMNB 4UCTA 2UXBB 1CKNA 2HVSA 1N32B 2UUBB 2ZM6B 3BA9A 5IWAB 4X64B 3NC0B 1XNRB 4AQYB 2VQEB 4LF8B 5LMUB 5FPOA 4UCSA 3KYHC 4UCUA 3GDEA 4UFZA 4CC6A 4X65B 1HR0B 3RR5A 1IBLB 4GLXA 4DV7B 4PZ8A 4NXMB 2HVQA 3L2PA 3TY8A 3PN1A 4B3RB 3W1BA 4JI5B 4EEQA 1XMOB 2Q2TA 4LFBB 1DGSA 1VS0A 4GKKB 5D1PA 4DV1B 3T1HB 4EQ5A 4JI3B 3BA8A 4LF6B 4JI6B 1IBKB 3S24A 5D1OB 1N36B 5FPRA 1XMQB 2UUAB 4DR3B 4LFCB 4DV2B 4PZ6A 2UXDB 1A0IA 1CKMA 4DR6B 1P8LA 2VUGA 2UUCB 3GB8B 3TY9A 2CFMA 1HNXB 4UCRA 5BR8B 3QWUA 1N34B 3T1YB 1V9PA 1FJGB 4NXNB 3BABA 4JV5B 4JI2B 1XNQB 4DR1B 4DV5B 3UQ8A 3GJXB 2OWOA 1TA8A 1IBMB 4DUZB 1S68A 1J5EB 2UU9B 4OX9B 2HVRA 2VQFB 1P16A 3BAAA 4DR5B 4LH6A 4K0KB 4CC5A 1X9NA 4DR4B 2F4VB 5DISC 2Q2UA 4LF9B 3RTXA 4TOIA 4JI8B 4DRFA 3VNNA 3SGIA 4DV3B 4UCVA 4B3MB 4DV0B 4B3SB 1HNWB 5D1OA 4JI0B 4EFBA 3NBZB 4EFEA 1XK5A 3JSNA 3TY5A 1I94B
chains in the Genus database with same CATH superfamily
2HP8A 2E5LB 4WBNB 4X64H 3E86A 4IAJA 3W1GA 1KP2A 1H2GA 1M5IA 2XD4A 2GHYA 3O65A 4TQSA 5IWAO 2CUGA 2QYZA 1Y1WG 4O4LF 3FKIA 4JI6H 4FIPC 4PJ0Z 5K1XA 2W6OA 4GX2A 2N05A 4PZ7A 2Q7DA 3ZRVA 2GUZA 2UXNA 4N23A 3CJHB 2E5LO 1V54C 5KX5F 2WA3A 2YW2A 5KFJA 1MZBA 2ZINA 3CCJV 5KFEA 3T1HH 3N44B 4IHJB 3TIIA 1R3JC 4JTDB 3OW2U 3PW7A 4RWUA 3UZBA 4K8XA 1ZETA 4W4LA 3T9FA 2ZNJA 2F43G 4MTEA 4PA6A 2JA5A 2F66C 4CC6A 3ETDA 1IVSA 1JJ2U 5BWXA 2EULA 4Q20A 2LP7A 3HR0A 2YSUB 1R6TA 4A3IG 1QVGU 2VWJA 2AZ2A 2GSMB 4B3RB 3G6BA 1XMOB 3GIQA 3SE7A 1IBMO 4GKKB 5KFOA 4ZOLB 3VBBA 4MSWC 2ZD9A 3L71H 1CS0A 3AG4C 4TV8F 1IBKH 1PKXA 1OWTA 1FXKA 5D1OB 4LF6H 2EZPA 2E76B 4GT1A 2XUMA 4RUAA 2MK3A 1QLEC 5KMGB 5C4XG 4DV2B 3JD0A 3M9OB 3ZRSA 3TETA 3WNZA 4I55B 2XGQA 3HO8A 3KHRA 1K83A 4O4JB 2C2EA 4R50A 4RAYA 3ZRWA 4JI2B 3TINA 1XL6A 4O4IF 2GQRA 3SYCA 1SKVA 3PW0A 4B7EA 3HKDA 2YUAA 1MSWD 2DWDC 4JI1H 2PMZA 2VQFB 1W0KG 3JCUZ 4DR5B 5FJ8G 3CJHA 4QWBA 4WBNF 4LWSB 5CA1B 2GQSA 4O2AB 4O7YA 4LWSA 5CA1A 2YXYA 3UCSC 4HNAA 3IG0A 2NN4A 4F6EA 3ICXA 2CTWA 3SGIA 5JH7A 4FU0A 2R93A 2N74A 4UCVA 2WDTA 3RBDA 1H2SB 5A2QN 4O3PA 2QM7A 1S76D 1RJRA 4F4LA 4GLWA 5H2FZ 5IJ0B 5EZYF 1M93A 4DL3A 2DQ0A 1I94H 3DXRB 3LSSA 5B1OA 5KFUA 5J2TB 3DXRA 4R6ZA 2Z04A 2EJ3A 4WHXA 3M9NB 1U97A 4DR7B 3U0ZA 4GKKH 1YCIA 3OD4A 4NZMA 2OCCC 3ABLB 2R8IA 1G2WA 2E74B 4Q0YA 4DV7H 2HG8A 2V9WA 3BRCA 3BY6A 3FAVA 2CNQA 4MV8A 3QZ8A 2JA6A 1YIJV 1N0JA 4NKGB 2R7KA 5B1BB 5IWAB 4I55A 1RJPA 1RPOA 3NC0B 4J7JA 2ILMA 5IY5B 3TK1A 4H37A 1DLBA 4W4KA 4MV3A 4AILC 5LYJF 2WLHA 3BQ1A 2P6JA 1Q8IA 3HKDB 5H6QA 3X2QC 2H8PC 1T36A 2NUAB 1I5YA 4FM0A 2OIEA 1S77D 3LDCA 3AG4B 2NVYA 3JCZA 5KUKA 2R86A 4PBCA 3ZHSA 4PA3A 1P49A 3PN1A 1KUQA 5K2MA 2IBZH 3OTOH 1YEWA 2W9CB 5B66Z 1BHBA 4BWAA 3HB9A 2EIKC 3RYCB 3JAMW 3ASNC 5EZYB 3ZS8C 3CCVV 4EEYA 2YZMA 3K08A 4K6NA 2RDCA 3RT3C 4CS3A 2NU7B 4J9ZB 2JA8G 2WLIA 3ZMTA 1UNNC 1S0MA 1KMIZ 1KYOF 1XMQB 3RB0A 1PL0A 4J11A 4QE9A 4DUZO 1XL4A 3U11A 1BS3A 3I56V 2HJWA 5KFAA 2ASLA 5J2TA 2PY5A 5BWWA 3D36A 1I1MA 3OMNB 2AW9A 4RAIA 2QA4V 4O4LA 3H1KH 3WU2Z 3W7WA 4M0JA 1LNQA 1K5SA 2QWQB 5DEDA 4CKEA 5HNEA 4JAAA 1D5AA 3CCLV 4JYAO 3BAAA 5KHIA 1NTZH 1MMMA 4CC5A 5C5JA 2G38A 1F7YA 3B4SA 2NU9B 4DR4B 4WF9V 2UVRA 4JV0A 5EBWC 3MR5A 3K3WA 1DF5A 3SR2C 1VQ9V 3PVXA 1WN7A 1RP3B 3L4KA 2Q5ZA 1GN6A 5BR8H 3K79A 4DV0B 4H33A 1XK5A 3G6VA 2F4VH 4QPJA 2COGA 1S0NA 5LOVF 1RK6A 1HNZB 4O2AF 2ZE8A 2IU0A 4UVAA 2VUMG 3Q2OA 3LNNA 1BJTA 1YJNV 2DN9A 1Y1WA 1CKOA 2VA3A 5A9GA 3DAAA 4LFAB 1GGOA 1VP7A 5IY5C 2Q69A 4C2MA 3V4SA 4DLKA 1SS3A 1KUTA 3ZEDA 4K0KO 2OH2A 3DC6A 1MZEA 4ZHQA 3RAQA 4K8ZA 4JGSA 1S72V 4TVIA 3C90A 2CTPA 3G6EV 1B6QA 3JYCA 4IRCA 4FM9A 3OSPA 3G8DA 1KJ8A 1QNMA 4DR2H 4JI2O 1H38A 1TWGA 4A3CG 4OXSA 2R87A 4CZZA 2JGDA 5IJ9A 5IE9A 4GYCB 4X9QA 3R9RA 5I5WA 4WFAV 3G6YA 3B09A 4UB8Z 5HFLA 3SYQA 3ZMUA 1GN4A 1NS1A 2YI8A 3H1JH 2DYSB 4DR1H 4EGQA 1KQSU 4Z2WA 2CW8A 4LSAA 1YXBA 4X20A 4M9UA 4RNMA 2EJ7A 1W96A 5GONF 1GN2A 4F6RA 1IBKB 4JAUA 4F4YA 1FFXA 4RNOA 4JYCA 2XAGA 5KT6A 2PTMA 4FGRA 2LO1A 2UXDH 3ABKB 4NZNA 5D5QA 4JV2A 5C44G 4DL6A 3DGEA 2WSSG 2K9PA 3W7SA 3JZFA 2OWOA 2OTJV 4O3NA 4F4WA 3EHBB 4PI2A 3GTMA 2ODTX 4NYEA 3KXYT 4IIJF 4PDVA 2R7ZA 4YY3O 2CKZB 3OUSA 3GB7C 2W57A 4DK1A 5IDJA 2CNVA 1RYRA 2AGQA 4GKKO 1M57C 4C5BA 1Q3EA 3CEBA 3TIGA 4C5AA 3OMAB 1IYEA 1M56C 5C8YB 4LF8H 2F23A 4EGJA 2R7LA 4NZOA 4E4EA 2Q7GA 3P32A 3STLC 1IBLO 1YTFD 3T7AA 1K4CC 1GM8A 2UXBH 5DGAA 3MR3A 1MG1A 3R5FA 3RUPA 2O03A 1VQKV 1ENVA 4DUYB 5IP9G 4JASA 2XAQA 5DLFA 1M57B 3OUUA 4A3FG 4L1KA 2WLMA 2OT5A 1HW7A 4O7SA 3M8AA 1VQMV 4KHPB 3B2EE 2V1DA 2V4DA 1F23A 4G2KA 4FLVA 2C28A 2FYUH 1OCRB 3F7YC 1TAEA 3CB2A 1FXVA 1N36O 4YR0A 4CE5A 2W7PA 2UXBB 4O2BF 3BCCH 4B7KA 2BQRA 5KT5A 2OCHA 1WJZA 5LL6Y 4HYKA 1GSAA 4TT3G 1XNRH 2KB1A 3TXSA 1VQOV 1OCOC 4B3RO 4QWCA 3AG2C 1I50A 2XHBA 5EWFA 2OIGA 4ECZA 4H0LB 1ZL8B 2UXDO 2EINB 3QF7A 4MV6A 1ET0A 4IYIA 3WB0A 1S5HC 4J9OA 3AG2B 4K35A 3KALA 2Y0PA 5K3WA 2R72A 1XEQA 1IBKO 3N2KA 1UPGA 5JQGB 2W70A 4A3EG 5AG2A 3HOYG 3SPCA 4EEQA 3T1YH 1VEWA 3N41B 4J9PA 2HR3A 3AK1A 4PELA 4QGPA 5L3CA 2FLLA 3U54A 1EKVA 2HGWA 2WAQA 4FFBB 2XASA 3LULA 3IGAC 2AZ0A 2DOSA 4PDBA 3J80N 2R92A 2IJIA 3EPGA 4UUGA 4DR3H 2JA6G 5CMUA 3QTCA 1OCCB 2ODMA 4QNHB 4FFLA 2J9GA 2O57A 1EUCB 2C35B 2R92G 3T1YB 4L8JA 1AN7A 3ABTA 5J9PC 4DR1B 3RGZA 5GTHZ 2Z3YA 1PPJH 4IL6Z 4RQFA 1L0NH 3L74H 2Y4UA 3I5DA 4I4TB 2P7TC 3FB5C 3Q8SB 4I4TA 1FS0G 2FK2A 3HOWG 5J2TF 1YJ9V 4JI6O 1Y76B 1YI2V 1CXZB 4BWSC 3L9DA 3RYFA 3TCUA 3ZHUA 3HBLA 1GO3F 3MFHA 3RYFB 2ZXWB 3AW8A 4GX0A 4NVPA 1MZFA 2VRZA 5GONA 2KG7A 2W0FC 3EVKA 2XCLA 4UVCA 1U96A 1BNCA 2HHFA 3DC5A 2JJ2G 1MOFA 3LNMB 3K3VA 4DV6H 4BIUA 2DLNA 4X64O 2NU6B 1FKAH 1AUXA 3DF7A 2BTQB 4FM1A 3CC4V 2VQDA 3JALA 5DGIA 5JQGA 4WD3A 1JDBB 3TQTA 3VMMA 4JI7H 1NU1H 4QWAA 5EOYA 2Y0IA 1AVMA 4JI4B 4ZOLF 2R9RB 3EFFK 2AHYA 2Z02A 4BR6A 2GV9A 3PR5B 2XAJA 1W59A 5KG7A 2B5UA 4LF4B 4JYAB 5KFXA 2IJKA 4JZ2A 4DV4H 5E25A 1H2KA 2JEGA 5KMGA 1D2DA 2W6IG 5F2VO 1CEZA 4JI3O 3B77A 2ZDGA 4JZGA 1JR9A 2HHHO 4ZI7B 1T5EA 4O4JA 1P84F 1E4FT 3RGXA 2E75B 3ZRWB 1DK1A 4FLTA 3M4IA 3GTKA 5LHIA 1WP8A 4O3SA 3L73H 1HR0B 1YZBA 2WPDG 4JI0O 4FLZA 4DV7B 2ABJA 1IBLH 5B1BC 2RGVA 4O4JF 2YC0A 1B33N 1LR1A 2ZE6A 5LXTA 2IMWP 2FPIB 1I7LA 2KKWA 2W9CA 1OCCC 3BQ2A 2PF4E 1A48A 1GMGA 1H8HG 4JXUA 5EK0A 2HG5C 2YCHA 2DYRB 4JTAB 2VQFH 4UV8A 5IYZF 3H4DA 2UUAB 4QPKA 3K0GA 2CQYA 4N21A 4LFCB 4F50A 1CKMA 1XNQO 4DR6B 4PA4A 2H94A 4DR6H 1K33A 4B3SO 1YVWA 3RBZA 5IYZB 5DM6V 4DV3H 2C22A 1V54B 3J81N 3CXHF 5LGUA 4DUYH 1XNQB 4DR6O 4B3SH 1AR5A 1AUVA 3GJXB 4X65H 1QCEA 4TQDA 2QJ1A 1I08A 5KA5A 3IC9A 3VOUA 2VS0A 4FZ1A 4D6TH 2NVXA 2PI4A 1GN3A 1AB3A 1TWHA 1RM1B 2W9AA 3JD2A 3DTUB 5LGTA 4HNTA 5L9XA 3CRQA 3CCEV 1UFIA 4UB6Z 5H9CA 1RJQA 1KC7A 4DR1O 4HYOA 5JCOC 4MVSA 4I0XB 2OTLV 5H6RA 1UC8A 4DV3B 1WAZA 4ECUA 5DG7A 1XHZA 2ZKOA 3ASOC 4O82A 5KHGA 4MTGA 5LA6B 3SPIA 4IGGA 5LP6C 4JI4O 3LUTB 3T4DA 4J9LA 2B1IA 1I2KA 2R8GA 2Y4TA 3GV8B 3JAWB 4LF4O 4FZ0A 3E89A 4X66B 4GCZA 5KFKA 2IH3C 4YJ2A 1E4EA 2W8KA 3SI8A 1OCOB 3KAKA 3MHHC 1E79G 2X0SA 2YYAA 3ETJA 4Q44A 1VF6C 1K3EA 5EC1C 1B04A 2YEVB 1CKNB 5CA0A 5KFZA 2F95B 3MFIA 3I4MG 4JI8O 1EN5A 1NH2B 4J9QA 3WO1A 4U7CA 1M1KW 1Z2PX 3MWMA 2RGRA 2FPPB 2B63A 2XT9A 2GTSA 3CQZA 1SETA 3RN4A 2JK5C 2W6ZA 3FB6C 2GPWA 5KHJA 4O4IA 3GDEA 2C2RA 2Z0AA 2CH7A 3L4JA 2DYRC 3ZN1A 1Z5VA 4ZBMA 3GTGA 2V5AA 4DV5O 2ZE7A 4FK5C 4O2BA 4F4ZA 2R8KA 4DR7H 3E8GA 2W6PA 3ZN0A 1OJHA 4PDRA 4J9MA 4I7ZB 4U3JB 2DPIA 1WLEA 5BYAA 4TWKA 1BHAA 1N0NA 5KT2A 4FFPA 4NXMO 2FK1A 1N36B 1HNWH 2UVUA 5KFNA 3ZJZA 1SFOA 1XMQH 3GWKC 5KG5A 3A2FA 1RPRA 3SPGA 5LOVB 4LFCH 5ITZB 3VQWA 1A0IA 3H1LH 4K3AA 4PV1B 1A32A 3JAMN 5LOVA 3OR6C 2WWWA 4CMFA 5JJNB 4NLGA 4B3MH 4FBTA 1BSMA 1K5QA 4LP8A 4FE2A 4JV5B 5C8YF 4RB1A 1E4EB 2UXCH 2EIMC 2R8JA 5CB4B 1N48A 3CD6V 4DUZH 2MW2B 2YEVA 3ZBHA 1VAJA 3DTGA 4DW1A 1MA1A 4K0KB 4MV9A 1VIBA 5L3FA 3K57A 4ZHQF 4GC6A 1EN6A 4A3KG 3MWEA 3RTXA 5CM0A 3A0HZ 2EILC 1M7JA 1SQFA 3RVYA 5IWAH 2YS6A 1Q5OA 1ZX3A 3K0DA 2GLTA 3R23A 4FPPA 1WH2A 4IT5A 2FPGB 3ZHRA 1VF5B 4JI0B 3N40P 4EFEA 1M90W 4TQRA 1VQNV 3R65A 2EIKB 5A2QW 4O2BB 3N8DA 4G27B 2RF4A 1M4UA 5CN0A 3JARB 4AQYH 4DV4B 2KSWA 2XIGA 4B3RH 4O7NA 3RYHB 1PX2A 2YXHA 4NXNH 2YZGA 3P3PA 2QM8A 3ZHVA 4YBZB 2BQ3A 5D8DA 1SQVH 2P4VA 4NR1A 2VPSA 3V6KA 4YY3B 4TUYB 4LF7B 1GKFA 1QVFU 3MR6A 1AR4A 3RVZA 3JD1A 5KG6A 1SQXH 1J5EO 4RU9A 5JCOA 3CP1A 2OLSA 4RZRA 5KFVA 1R3LC 3BA9A 2UXCO 3D3IA 1VQ6V 3T9DA 4FBUA 1QBZA 1GAXA 3HKCA 1R1BA 1WCMG 1JFFA 5CBGA 3CRCA 3UT5A 1NZ6A 2HVKC 3EXAA 3UT5B 3JZ6A 4EG0A 1XDCA 3K59A 1VBHA 2GUZB 4X65B 1GO3E 3E22B 5EC2C 5JVDA 3E83A 3ZIAG 3N2GB 4NXMH 4A3LG 1T3NA 4FJCC 4NYKA 3SJBC 2P90A 3T99A 4J9KA 2GDSA 4JI5B 3BJYA 5KFBA 3D8CA 2RDIA 1DGSA 1ZWIC 3LDEA 3OM3B 3GIDA 1G1XB 5L3GA 4DR4O 4BBSG 2JS3A 4YY3H 2XNDG 1QR8A 2A79B 3G4SV 1EUDB 1AI7A 5FPRA 2YDEA 5L3BA 4DL2A 4JI1O 3FDSA 1P4RA 4Q43A 5KG3A 2YI9A 2B1GA 1I7NA 4I7HA 5DGBA 2WB1A 3G6XA 4JI5O 1FD9A 3JD3A 5LMUH 1I2LA 2JA7G 2F93B 2PI5A 1NVPB 1TA8A 4O4HF 3B8MA 1ZHSA 1R3KC 3OMIB 5HV6A 1IOWA 4DRXB 1P16A 4JTCB 4WBNA 2UUAO 2Q0AA 4J9YB 4WFEA 3CEIA 4LF6O 1C3OA 5BWUA 3H20A 2E2HA 4I9WA 3Q8RB 3I4NG 4LMYA 5KFMA 4YJ3B 2E3CA 4XYMB 5HBRB 4FS1A 3N6RA 1KJ9A 1TGOA 3SDLA 3ETGA 4CH6A 3GTOA 2KSDA 1H2NA 3RIZA 2RN9A 2EBOA 2KG7B 5GONB 4DL4A 1Z5WA 1YTFB 4LF4H 3P3NA 1DV2A 1NI8A 4RAZA 4LC1A 1Y66A 2Y0SE 4KP4A 5LGNA 1I94B 1OCZC 2FTKA 4L87A 2QWOB 4QSHA 2UUBH 5GTIZ 2VPQA 2ZDQA 4YXWG 1Q6HA 2M05A 1P7BA 3QO5A 4E6NA 3WO0A 4BY7G 4O2AA 3AX6A 1XUQA 1PP9H 4YR2A 2HGXA 2CTQA 3RYIA 4QJFA 1R6NA 1EKFA 2WLNA 3K5LA 2ITDC 4LFBO 2HIVA 4IRDA 1S03G 2A06H 1EFRG 4FFBA 4ME6A 5I5SA 5DG8A 2BTOA 3IFXA 4DV6B 3JZIA 3M7MX 4NTWA 3UKMA 1VQ7V 3CPWU 3L75H 3VPCA 2FLPA 4LF7H 3S3XA 2RCVA 1JLLB 2LFSA 5CA3A 1PK8A 2UVWA 1S10A 1N32B 1URFA 4RUFA 4BBRG 5KX5B 2FMAA 1N4CA 4X62H 5KX5A 4ECQA 4OPAA 3KKYA 1M6VA 4DV3O 5JVDF 4LF8B 2HJFC 2IM9A 3OT7A 1PM9A 2GTAA 1XMOH 4ZKIA 3QQMA 1PNLA 2BSKB 3T1CA 1P7GA 1MABG 3VA7A 4OX9H 3RR5A 4DV2H 1JOYA 1JCHA 2DZDA 1Q90D 4BXXG 3PJSK 1Y76A 2R6FA 3H1HH 1KC8W 3LWBA 5IYDO 3EYYA 2Y69B 2PGGA 5LXTB 1VKZA 2Z5UA 3U0GA 4LFAH 3LSQA 3T1HB 3JAKB 3N42B 3JRWA 4UVBA 5EWGA 1RYSA 3WB1A 4JYAH 5KAIZ 1BT8A 3APOA 3B8NA 3BHPA 4EKWA 4JI0H 4ECVA 5KFPA 1EYZA 1Q82W 2ZDHA 3HKBA 1QR9A 3THOA 3HKBB 2QWPB 3TY9A 3CHXA 1S0OA 5GW7A 4MV1A 3RYCA 5LP6F 2ZDIC 5IT9W 5IYZA 4HNVA 3K5HA 2WLIB 1Q86W 1Q81W 2CGOA 1PL4A 4DV1H 1KU9A 4KUMA 4OX9B 4XX0B 1ULZA 3MD0A 4A2BA 3HB3B 1YHQV 2C00A 1HWYA 2R9AA 1X9NA 5EWEA 4ECXA 5BMVB 4LNUB 4XBFA 4ECWA 2EJ2A 3AYHB 2Q7HA 4JI8B 3K5MA 1C30A 2YU9A 1D5NA 5DGHA 2ITCC 3BFRA 4IZOA 4X1YB 1BMFG 3R5HA 1Y67A 2BSKA 4DYLA 5I5TA 1CQJB 4XDLA 5F9LA 2PMZE 5JVLA 3HT5A 2Y69C 1DTOA 4A3JG 3R66A 2JEFA 1Z2NX 1FYJA 4O3QA 5CR5A 4TV9B 4YAKB 3ABLC 4X1KA 1JJOA 1SF9A 4MVZA 4WFFA 2IP4A 1GTOA 4BIOA 5KFGA 2DIKA 2V58A 1F4MA 1NR7A 4YHHH 5BYBA 3UM7A 1GRJA 3JD4A 5EBMC 4GKJB 3P30A 2P22C 5E1AC 4KFMA 1DV1A 3H0GG 4B3TH 4DW0A 2WYOA 1Y1VG 3UZOA 1VBGA 4EB6A 3JAWA 1GSHA 1CKNA 5CA0B 3V4ZA 4ED6A 4MVQA 4TM5A 1K1SA 1BGYH 3ZHQA 5BPFA 2QR4A 3TW7A 3CCRV 2J6TA 3J7AK 1AJNA 1N8RW 4B3MO 1L8DA 3FYIB 4CKBA 3E35A 4QIWE 1JDEA 1QHTA 2BR0A 4UCSA 1X4TA 3FFQA 4LFCO 4Q4DA 2PVPA 5CBHA 4RQEA 4GLXA 3WWHA 4O3OA 1LUWA 2P0AA 3Q1KA 4NXMB 2JGUA 4ECSA 3WB2A 1FPOA 2WLJA 1TUBA 2UU9O 4X66H 3K3PA 2V7QG 4O4LB 1AP6A 1VS0A 1EN4A 3RAXA 3CYOA 4I0XA 5EIBD 4O4IB 3T5LA 2W9BA 1GSOA 2CH7B 4FS2A 2YIAA 4ICGA 4Q4CA 4O7WA 3DTFA 5KFFA 1S5LZ 3BACA 3OE7G 2JJ1G 4E2LA 1SERA 5EDWA 1AI5A 2NLJC 4ED2A 2JDIG 2VUGA 3CRAA 3VQYA 4E4TA 1EM1A 3PW2A 5JQGF 2VQEO 2ZT9B 3QWUA 1OCZB 1Y4MA 4O3RA 4JI5H 2NU8B 2R7MA 3GVMA 5B1AB 1EZ1A 4DUZB 1S3JA 1NQTA 5KFDA 4JI8H 1XBLA 5CB4A 3Q4HB 5JH7F 3BQ0A 3ABKC 5KS8A 1CPYA 1KBLA 2YXLA 4DR5H 4WFHA 4TV9F 2OCCB 4YQWA 3AG7A 3KREA 3ZCCA 1N33H 4J7KA 1BXRA 1ZSPA 3HKZA 4A2AA 2PZSA 2R85A 2QWRB 4FLYA 4X66O 3AG1C 1KJIA 1JIHA 1HP8A 4HAMA 4FLUA 4MA0A 2UU9H 2A9HA 2EIJB 1WPBA 1HNWB 1EHIA 3FMAA 3VPDA 2IJJA 4ABMA 2XAFA 4IRKA 2UXBO 3CCUV 3K9AA 3RWRD 3JRXA 1YJWV 2ZDIA 3E8BA 3R5XA 1VQ4V 2WAQE 4LF5O 3T1HO 3APQA 2IW5A 3CRMA 3RYHA 2W6QA 2LJ2A 2UXCB 4M7EA 2HJDA 2JGDB 5IJ9B 1PNMA 1IX9A 4YHHB 3K9SA 2HDKA 3W5OA 3HXLA 2FKXA 5B1AC 1SA0A 2W6MA 3SYAA 5KG1A 1K92A 3NGDA 5B1NA 2RNBA 2ALZA 4X64B 3GIKA 3HKCB 4ECTA 2QKAA 5KKNB 5LMUB 1JFFB 1BQZA 3TEKA 3KYHC 4HN2A 3AEIA 1FFXB 4UFZA 4Z1VA 2W7OA 5C1PA 4J42A 1F4NA 3KAJA 3L2PA 5KFWA 3KZIZ 2R82A 3HPLC 1FAFA 1KTAA 3T5KA 1QLNA 1NBMG 2ATKC 2ZR2A 1AP5A 3B40A 1K9MW 1EKPA 3VOTA 2Q2TA 2VOBA 3KHHA 4DXWA 4U6PA 3QO8A 2AGPA 3E22A 3S24A 4X1IA 2JVDA 3MAQA 5C1OA 2FLNA 1K4DC 5IT9N 3QG5A 4PZ6A 4IYHA 5EYPA 3U55A 1KJJA 2UUCB 2C2DA 5EYPB 2ZIMA 3RB3A 1HNXB 4GX5A 5HFMA 4DR2O 4NXNB 1BGWA 4I50A 4ZOLA 2HHHH 4J0MA 3PO3G 2UUCO 3V6JA 1Z2OX 2I80A 2Y48A 4JI3H 2CGNA 1M0TA 2IJHA 2K1EA 1K73W 3S3WA 4EBEA 4EYIB 1IXBA 1Y74B 2QTSA 5I47A 2LW7A 4X89A 1IURA 4U3FH 3BVOA 3RV4A 5DISC 4JYYA 5FD5A 3AK3A 1NJIW 4TOIA 2LGWA 5KFSA 3CMAV 3HKZE 3GV7B 1G8MA 1K7DA 5FD6A 4DR7O 1JQ0A 3T5JA 2LFRA 2XOKG 4O4HB 1ZTEA 4EFBA 5LBQA 1YDXA 1JPXA 2ADPA 2UXXA 3NBYB 3T9CA 4QWEA 1JX4A 4X62B 5B5EZ 4B3TB 2QK4A 4R7RA 2BE3A 1CQIB 1S9FA 4JV1A 4ED8A 4JV5H 5KHHA 4CH4A 1K97A 4X62O 2HHFB 2Q73A 3JSLA 3ZMSA 3STZC 2JEUA 5CB4F 4GX1A 1KP3A 3OGIB 2DE0X 4UXNA 1TVKB 1NVPD 4X1IB 3CRRA 2BTQA 3LSUA 4J10A 3OEEG 3TXQA 2PUSA 4QE7A 2D2CB 2XAHA 5FL7G 4TSFG 2HVSA 3CXCU 4HQ6A 4QIWA 1N56A 4YIOA 1XNRB 2EINC 1HDJA 4PD4F 4AHCA 1FJGH 2XGPA 2QDOA 2EJ0A 2XCPA 2DWEC 3OHAA 2UUBO 2PN1A 3UO3A 5I60A 4CHIA 4PZ8A 4NTYA 2VWKA 1ZHQA 4QW9A 3ASOB 4FLXA 5I5YA 4YJ3A 4IIJB 3CS5A 4BY1G 1O9GA 1WP7A 4DV1B 5JJEB 2J6UA 2CDYA 2ZE5A 1S97A 3FD9A 5B3SB 2DWCA 4ED3A 4LF6B 4YB8B 3JAKA 4U7OA 2N04A 4O4HA 4Q8FA 2C2AA 1Y6XA 4DR3B 1DF4A 3N43B 5BMVF 4HBNA 3GB8B 1VQ8V 4DV0O 3RF2A 1KB9F 3PW4A 4YIPA 5B3SC 1V9PA 4JF3A 3K58A 1E4GT 3N6XA 3K5OA 4FFKA 5JH7B 4DV5B 1FXHA 3H1IH 2JA5G 1HNZO 4LR3A 2JEXA 1S68A 1M56B 4IR1A 4RUEA 2W6JG 4ECYA 5CA1F 5KFRA 3FKSG 3JALB 2FL4A 2Y4RA 2WLKA 2V59A 1Q43A 1O75A 1WNSA 3H40A 1BCCH 1AJPA 5KFYA 4TQFA 3ZMVA 5H5NA 4O7ZA 4RUCA 4Q45A 1AI4A 1EZVH 2P4KA 2ZCEA 4WFGA 4U7NA 3GIJA 4DIMA 1ROPA 3O9OA 3FB7C 4RB0A 3IJ4A 1JKJB 3LDDA 1JX9A 2X7RB 1SCUB 2XC9A 4DL5A 4DR2B 2FB5A 1BQ0A 5FLXW 2E2IA 4X1KB 3T5HA 1TWFA 4JI7B 4CS2A 5L3DA 5J2UA 4FFNA 1N33O 5CAEB 1PD3A 4DV4O 2W0XA 2B9ZA 4FMTA 1ZAUA 3IAYA 2Q0OC 4HZ3A 1N33B 4TV9A 3WWJA 3CVZA 2UUBB 2DAAA 3J7AU 1KT8A 4J7ZA 4GZRB 4ZQIA 4NXNO 5EZYA 2JS5A 3M9MB 3D3QA 1TUEB 3H4BA 5DECA 4J9SA 2HVJC 2FK3A 4O7TA 1B06A 5JWPA 1XOUA 4PA7A 2PYLA 4YAJB 1BL8A 3W7XA 1DIKA 1Y14B 1PV0A 1V51A 1IBLB 2R7NA 4HNUA 1VF6A 1I0HA 1QQCA 3ASNB 3MR2A 3OUFA 4MA5A 5BMVA 4I55F 3W1BA 1K8AW 1K1QA 1AI6A 4A5UB 4FFMA 2A3QA 1RFYA 4MVRA 2YZNA 1VQPV 5BWVA 3ZRXA 5C93A 4ZIBA 4X1YA 2FE3A 5KUMA 3SYOA 3SYPA 2QTOA 3H01A 2JEJA 1K34A 3CE2A 3F5WC 2H3OA 5FLXN 3D36C 3CMEV 5I5UA 1RM1C 4OPHA 4YJ3F 2IBKA 4B08A 4PDLA 1NTMH 2EIYA 1I5XA 5IYBO 1HNXH 2CFMA 1QU7A 1IOVA 4LSXA 2QE7G 4PDMA 1EBOA 4JYBA 5L1KA 4DR3O 2P5OA 1I7FA 3PR4A 4EBCA 1XMQO 2QB5A 4K0KH 4UUJC 5ITZA 2ZJTA 1HNWO 2Y0SA 4LH6A 2ZXWC 4IR9A 4EB6B 3F7VC 2R70A 1WB7A 4MVUA 4R8CA 5C3EG 3MDSA 5IP7G 3L72H 4MS2A 3KCYA 3SJQC 1ORQC 4CMDA 5KG4A 1RSOB 2AGAA 4JV5O 1CE8A 1W93A 1R3IC 1ZUQA 4DRFA 2Q9LA 4HR7A 4B3MB 4O83A 1PNKA 5TISZ 5LHGA 4B3SB 3SJAC 3C3TA 1YITV 3U10A 3NBZB 4ZI7F 3GV5B 3JSNA 2V4QA 2EIJC 5DLGA 2CTRA 1VF7A 5LYJA 1OHHG 4MW3A 1F51A 4ZHQB 4CKCA 1SQQH 5LL6b 1US6A 4UCOA 1JVMA 4TV8A 2ARHA 2COIA 5T14A 4CS4A 4I9QA 2WB1E 1L0LH 3HOUG 1THZA 3SNOA 2W9BB 3ETQA 3TW6A 3CC2V 1NKDA 4XDJA 4DO2A 3GIMA 1S5JA 3OAAG 1T94A 4GKJO 4J9NA 1SA0B 1DAAA 4FFRA 2EZOA 3SPJA 4EBDA 1O9HA 2MCTA 2ZM6B 3RV3A 4R7CA 2YS7A 3LQSA 3MJFA 4YR3A 5L1JA 2VQEB 1KKDA 3OSNA 3E2EA 2X5RA 4WFBV 3TGUH 1N34O 4O86A 5IYDG 3GLKA 3WFVA 4CH5A 5LP6A 3A8TA 4Q8EA 5I5XA 1FFTB 4ASUG 4TUYA 2IA6A 4C5CA 4RCNA 1GM7A 2YIDA 2R7ZG 3TY8A 4LF8O 3E5NA 4MTFA 3CWBH 3VQVA 1WB8A 2W8LA 2COJA 1OV9A 5JQWA 1RSOA 5EIBC 2VA2A 2A1HA 5FNVA 4EYHB 1J95A 3X2QB 2UVVA 4C7UA 3QO7A 2IU3A 2GPSA 4JI6B 2I87A 2SCUB 5DQIA 1UC9A 1NTKH 2L35A 3OUZA 4DV2O 3JASB 4OX9O 1VQ5V 1HR0O 2R8HA 1TWCA 5BWTA 4X65O 3N2KB 1XILA 3T54A 1XMOO 3PFFA 3ETHA 4IHJA 5BXZA 3MHSC 3KHLA 4TV8B 3BABA 3DSQA 4X8AA 2FJZA 4FVMA 1IDSA 1IYDA 3K06A 4YP3A 1SZXA 2HLDG 3QVNA 1IBMB 1COWG 2ASJA 4BW5A 3UYYA 5JUMA 3LMLA 1R9TA 2R84A 2JA7A 5KFIA 1XHXA 3BEHA 4DV7O 5BY1A 4BAYA 2ASDA 1VQLV 2F4VB 1BZKA 1KJQA 1OBGA 1JA8A 2RQ6A 5LA6F 2W71A 4WCEV 1OBDA 5KFQA 3K5IA 4ED0A 1GM9A 2A7WA 3C0FB 3VNNA 5BPHA 3GWOA 4RB2C 4XZ3B 5LP6B 2JEIA 2OYQA 2EX3A 4A93G 1Y74A 2CW7A 3AG3C 1R73A 2ZQMA 1SQBH 1SC5B 1WSCA 2AU0A 1N34H 1A9XA 4MV7A 1YF2A 3BPZA 1KBHA 3K04A 3GQCA 5K1PA 2HKOA 4DL7A 3VQXA 4O81A 4FFOA 2X6AA 3WWIA 2RJZA 3JATB 2FP4B 4CBCA 4AYBE 1TVKA 4GKJH 4RB3C 3JATA 4X88A 3OR7C 2X6CA 5JVDB 5FNVF 1ZL8A 1NH2D 2HIXA 1XDNA 3GILA 2ZR3A 3N2GA 2WTFA 4UCTA 5DN6G 2CE4A 4MTDA 3PZPA 2LQTA 2B63G 3RBEA 2XTAA 1OCRC 5CA0F 3G8CA 2PYJA 4KL1A 3U9TA 3RYIB 1X59A 4QJFB 4HNAB 4FLWA 4MTXA 2DW4A 2CZGA 3T4ZA 2VQEH 2R93G 5LHHA 5EBLC 4Q6GA 5FPOA 5F9NA 4TUYF 1SESA 4UCUA 4KXRA 5IJ0A 5JJJB 2RMKB 1FKAO 3W7TA 4DK0A 2YIBD 4DV6O 5BR8O 3MWDA 3G80A 4G3IA 4O7LA 4IIJA 2HFEC 5DMXA 5BZBA 1ZQ7A 1IBMH 4LF9O 3E8FA 5KA6A 2DJVA 1M0WA 1XREA 3J81W 2ETNA 3UFXB 3ZX6A 4AI8A 3NR7A 4Y8VB 4ED7A 3FAVB 3RFRA 2HGSA 2IH1C 2QSAA 3FX7A 3LP8A 4PWQA 1SQGA 1P8LA 2NNUA 3SJCC 2F1MA 5DQGA 2DPJA 4QWDA 1Q7YW 1FJGB 3A0RA 1HNXO 1BE3H 1AJQA 1TWAA 2A0LA 3GIIA 4D7SA 4A3BG 2Q68A 2YL2A 3GTJA 4PI0A 4LBEC 2HVRA 4YJ2F 4I50F 5L1IA 4O7VA 2YIBA 3I12A 4KHPO 3AG1B 2CK3G 3RW0A 5CE8A 3T9EA 4MVMA 1S0VA 4F4XA 4A3MG 2RDJA 3ZMZA 1H2LA 3KCXA 1B6RA 1B6SA 1IZ3A 4QW8A 2XCAA 3T1YO 4JAVA 3OTOO 2HEPA 4NTXA 4MW8A 4AQYO 2QF7A 3IN5A 1L1FA 3OHBA 3CX5F 5KLVH 3UO2A 5LXTF 1VARA 3HOXG 1FVIA 3ORQA 3FYEB 3CCMV 1A0GA 3HKEB 4PA9A 3BG5A 2YICA 4IWYA 2HHHB 2LGQA 1EZJA 1GH6A 2DQ3A 1XNRO 4ZI7A 5L1LA 3G67A 5KHKA 4LH7A 4KHPH 3Q8PB 5KAFZ 1JMKC 2P67A 2Q4PA 1N36H 3HOZG 3CCSV 2QWNB 5E79Z 3T9BA 3CSWA 3F8NA 5LMNB 4MVOA 3FKIG 3NXSA 4NB5A 2AHZA 4DV1O 2P06A 3OGCC 5IYCO 2R9IA 3RGBA 4G28B 4LF5H 5J2UB 2ZGIA 5KFHA 4YJ2B 3RB6A 4RNNA 1KEEA 5I5VA 4ETSA 1I94O 4MT8A 3E8HA 3NUAA 1G4YB 1SYXB 3N27A 5IYBG 2V4RA 2HVQA 4MAMA 4P2ZA 1E1RG 4QIWF 3CSXA 2VR1A 5BWRA 2I8CA 5D5PA 4LF9H 4LFBB 2FKLA 4I5SA 3PW5A 3TJTA 4P9PA 1Z2GA 4O84A 2Q67A 1JXLA 2JRIA 1I1LA 1WRVA 4MTOA 4EQ5A 3H3VH 3BA8A 1ZLZA 1V55B 1A3GA 4DR5O 3H0GA 4DV5H 1CP9A 1OZ0A 4IHJF 2BOCC 3RB4A 1AILA 2CAZC 2YZLA 1HNZH 3ABUA 1W0JG 3HKEA 1NR1A 2ZIOA 4A3GG 4LNUA 2AGOA 1VMGA 2PBZA 3RJ0A 1N34B 1SRYA 2DYSC 1WR2A 3QFFA 4DV0H 1AR1B 4PHZA 3HOVG 1KD1W 1J5EB 4O7RA 1QLEB 1Y1VA 2ADQB 3OFNG 4XDKA 5LA6A 4JUZA 5FLMG 3G71V 3K5NA 4RO2A 2Q8VA 3TQ1A 4LF7O 2ATLA 4J80A 2WLLA 3AK2A 3T9AA 1WCMA 4LFBH 2Q2UA 4LF9B 2WLLB 3F5TA 1B3QA 1H2MA 5DQHA 3J80W 3L70H 1XI1A 1L2ZA 3C3SA 4BIZA 4X20B 5L3EA 2LW1A 1Q6UA 4DAAA 2L6LA 3ZHTA 2DMXA 5KFLA 4GUNA 5J2UF 1GYFA 4FM2A 1I1KA 3KG2A 4JI4H 3Q4HA 5KT4A 1I3QA 1SZTA 4JI1B 2YRWA 3SPHA 3M99B 4D7TA 2EILB 4P9OA 4LF5B 1FJGO 5FR9A 4A3DG 3K03A 2W6NA 2BCCH 2M7WA 4OGQB 2GBOA 4JI2H 3ABMB 3WG7B 1V55C 2QGNA 3QNEA 3U9SA 2BOBC 4IWXA 3RFCA 2E5LH 2NR5A 4ED1A 2AQ4A 2QEXV 1R6KA 3AG3B 1I6UA 5LYJB 4B3TO 2UUAH 4R8UB 3ORRA 2M6YA 5DAAA 4R8UA 3OTOB 2QKSA 4YHHO 1TUBB 1H8EG 4DUYO 5LMUO 4AQYB 1MSDA 2QKCA 3CCQV 5KFTA 4RZQA 1SEIA 4U3JA 3KTMA 1LUVA 1MNGA 1XNQH 1AROP 1KECA 1V4YA 1RK5A 5KG2A 1HR0H 1SQPH 4F6RB 2F4VO 5DG9A 5LMNO 2J6SA 1FXKC 1YSCA 2Q7EA 4AYBA 4DQNA 2VQFO 3GTLA 3PO2G 2CNUA 3GIPA 4DR4H 3FB8C 4XYLB 3GTPA 2VUMA 4UV9A 2ZNIA 3W7UA 2ZM6H 1WA8A 2YRXA 5D1PA 2EIMB 1WA8B 3V6HA 2X0LA 5FNVB 4JI3B 2AXTZ 1NT2B 3Q8QB 3OEHG 4H13B 2JIZG 2KQXA 4CH3A 5KT7A 1IXMA 3ML0A 3KHGA 3T2MA 4Z1MG 5CBFA 2FMLA 3IC7A 1N32H 1UJWB 2DABA 3JASA 4P30A 3EPIA 3ETEA 2UXDB 3ABMC 3WG7C 2UUCH 1E1QG 1G6UA 5H80A 5KFCA 4UCRA 5BR8B 2Q6AA 3A0BZ 4ECRA 3GTQA 3I55V 4I4TF 3H9VA 3UQ8A 5IYCG 4J9RA 4J41A 4GC7A 2WA4A 5C8YA 2UU9B 1J5EH 5KG0A 1N32O 1KKCA 4JPRA 4H44B 4BW9A 2BQUA 2YS8A 2WE6A 2WAMA 1GLVA 1W2BU 4LFAO 1XQ8A 1WPXA 2X6BA 2ZM6O 3JARA 3VPBA 1M9NA 3CC7V 1Q6IA 4APMA 1GK9A 4JI7O 2EJRA 4I50B 4LCUC 2YWVA 5KT3A 3QZ7A 2FB9A 4MV4A 1FXKB 5D1OA 2QM4A 2D3OW 5LMNH 3OTFA 3TY5A 4DRXA
chains in the Genus database with same CATH topology
1VF7A 5LYJA 4FM1A 2E5LB 3JALA 4WBNB 4X64H 4ZHQB 1Z2NX 5JQGA 4IAJA 5LL6b 4TV9B 4X1KA 3W1GA 1M5IA 4JI7H 4UCOA 1JJOA 5EOYA 4TV8A 4CS4A 4I9QA 4JI4B 4YHHH 3ETQA 4JI6H 2GV9A 1S5JA 5K1XA 4GKJB 4LF4B 4JYAB 4PZ7A 2P22C 4DV4H 2WYOA 4B3TH 5KMGA 4EB6A 3JAWA 1SA0B 5CA0B 1CKNA 1O9HA 2MCTA 2ZM6B 1MZBA 2ZINA 4ZI7B 3T1HH 3N44B 1T5EA 4IHJB 4O4JA 3J7AK 2VQEB 1L8DA 1E4FT 3RGXA 4K8XA 4FLTA 3M4IA 4CH5A 5LP6A 1QHTA 2ZNJA 4UCSA 4MTEA 1X4TA 3FFQA 2F66C 4CC6A 1HR0B 4TUYA 4GLXA 4FLZA 4DV7B 1IBLH 2RGVA 4NXMB 2JGUA 3TY8A 3WB2A 2VWJA 4B3RB 3VQVA 5LXTA 1TUBA 1XMOB 2KKWA 4X66H 4O4LB 1RSOA 5EIBC 1VS0A 4GKKB 4ZOLB 5FNVA 5EIBD 4O4IB 2YCHA 4JI6B 2VQFH 1IBKH 2YIAA 5D1OB 4LF6H 2UUAB 3JASB 5KMGB 4LFCB 4DV2B 1CKMA 3N2KB 4DR6B 2VUGA 4DR6H 3VQYA 4I55B 3QWUA 5IYZB 4IHJA 4O4JB 4DV3H 4TV8B 4RAYA 4JI5H 3BABA 3DSQA 4B3SH 4FVMA 4JI2B 1XNQB 4DUYH 3GJXB 1SKVA 4X65H 3HKDA 4TQDA 4DUZB 1IBMB 2QJ1A 4JI8H 5CB4A 4JI1H 3LMLA 2VQFB 2YXLA 4DR5H 4DR5B 1XHXA 1N33H 2F4VB 5CA1B 4O2AB 2RQ6A 5CA1A 4A2AA 2PZSA 4HNAA 4FLYA 3IG0A 5JCOC 2UU9H 3ICXA 4FLUA 3C0FB 3VNNA 3SGIA 5JH7A 1WPBA 4UCVA 4DV3B 2WDTA 4RB2C 1H2SB 5LP6B 2OYQA 1XHZA 1HNWB 3FMAA 2EX3A 5IJ0B 5KHGA 5LA6B 5LP6C 2CW7A 1M93A 3RWRD 1I94H 5J2TB 3JAWB 1N34H 4MV7A 4DR7B 3U0ZA 4X66B 3BPZA 5K1PA 3RYHA 4GKKH 4YJ2A 2UXCB 4M7EA 3VQXA 5IJ9B 3KAKA 4Q0YA 4YHHB 3W5OA 2RJZA 3JATB 4DV7H 3HXLA 1TVKA 4GKJH 4RB3C 3JATA 1B04A 5JVDB 2HIXA 1SA0A 5CA0A 1CKNB 1XDNA 3BRCA 3N2GA 2F95B 4UCTA 4MTDA 1Z2PX 3MWMA 5IWAB 2RGRA 4I55A 2PYJA 4KL1A 4X64B 3RYIB 3NC0B 4HNAB 4FLWA 3HKCB 2VQEH 4AILC 5LMUB 4Q6GA 5FPOA 1JFFB 1Q8IA 3HKDB 3KYHC 4UCUA 5KHJA 4O4IA 1FFXB 5IJ0A 4UFZA 3GDEA 4FM0A 5JJJB 3L4JA 1Z5VA 4O2BA 4DK0A 2YIBD 3L2PA 3KAJA 1P49A 3PN1A 4DR7H 3OTOH 1YEWA 4BWAA 4IIJA 2Q2TA 3RYCB 3JAMW 2VOBA 5EZYB 3ZS8C 4U3JB 1IBMH 4CS3A 1M0WA 3E22A 3J81W 3S24A 4X1IA 1KMIZ 1N36B 1HNWH 1XMQB 2JVDA 1XMQH 3MAQA 3A2FA 3RFRA 3U11A 2HGSA 5LOVB 3QG5A 4LFCH 5ITZB 3VQWA 5EYPA 1A0IA 1SQGA 5J2TA 1P8LA 5LOVA 2PY5A 3SJCC 2UUCB 5EYPB 2ZIMA 2F1MA 1HNXB 5JJNB 4B3MH 4O4LA 1FJGB 4NXNB 1BGWA 4JV5B 4I50A 4ZOLA 2HHHH 4J0MA 4RB1A 2UXCH 4D7SA 1Z2OX 5CB4B 4JI3H 4DUZH 4PI0A 1M0TA 1D5AA 2HVRA 3BAAA 5KHIA 4K0KB 4CC5A 4MV9A 2YIBA 3K57A 4DR4B 5DISC 5FD5A 3RTXA 4TOIA 1SQFA 5IWAH 3SR2C 1Q5OA 1WN7A 3L4KA 5FD6A 5BR8H 2HEPA 1WH2A 4DV0B 4PZ6A 4JI0B 4O4HB 4EFBA 3N40P 4EFEA 1XK5A 2F4VH 1FVIA 5A2QW 3NBYB 4O2BB 1HNZB 4X62B 1M4UA 3HKEB 3JARB 4AQYH 4DV4B 3LNNA 4B3TB 1BJTA 2KSWA 2XIGA 4R7RA 4B3RH 3RYHB 2HHHB 1CKOA 4JV5H 4NXNH 5KHHA 4CH4A 4ZI7A 4LFAB 3JSLA 5KHKA 1TVKB 4LH7A 2VPSA 4YY3B 4KHPH 1JMKC 4TUYB 4X1IB 4LF7B 3ZEDA 1N36H 2BTQA 4ZHQA 2PUSA 4K8ZA 3F8NA 5LMNB 2HVSA 5JCOA 4FM9A 3BA9A 3HKCA 1XNRB 4DR2H 3RGBA 4LF5H 5J2UB 1JFFA 4YJ2B 4AHCA 1FJGH 3UT5A 5IJ9A 3UT5B 4ETSA 3K59A 4GYCB 4X65B 3E22B 1SYXB 5JVDA 4PZ8A 2VWKA 1ZHQA 5LMNH 3N2GB 4NXMH 2HVQA 4FLXA 3SJBC 4YJ3A 4IIJB 4JI5B 3CSXA 2YI8A 5D5PA 4LF9H 4LFBB 4DR1H 1DGSA 1O9GA 2CW8A 4LSAA 4DV1B 5JJEB 4X20A 4EQ5A 3BA8A 4LF6B 4F6RA 4YY3H 1IBKB 3JAKA 1FFXA 5FPRA 4O4HA 4DV5H 4DR3B 3N43B 2YI9A 2PTMA 2UXDH 4I7HA 2CAZC 1HNZH 3HKEA 5D5QA 2ZIOA 4HBNA 3GB8B 4LNUA 3RF2A 3RJ0A 1N34B 3K58A 1V9PA 5LMUH 1E4GT 3N6XA 4DV0H 3K5OA 5JH7B 2F93B 4DV5B 2OWOA 4LR3A 1TA8A 4PHZA 1S68A 4PI2A 1J5EB 1ZHSA 3KXYT 5LA6A 4DRXB 3K5NA 1P16A 3JALB 4WBNA 2Q0AA 3H20A 4LMYA 4YJ3B 1Q43A 2E3CA 4DK1A 2W57A 1O75A 1WNSA 4LFBH 2Q2UA 4LF9B 1TGOA 3J80W 4CH6A 1Q3EA 1XI1A 1L2ZA 4TQFA 4X20B 3RIZA 5C8YB 5GONB 4LF4H 1Z5WA 4LF8H 2ZCEA 4RAZA 1GYFA 4FM2A 2Q7GA 2UXBH 4JI4H 1I94B 4RB0A 2UUBH 4JI1B 4D7TA 4LF5B 4DR2B 2O03A 4E6NA 5FLXW 4O2AA 4X1KB 4DUYB 4JI2H 4JI7B 4CS2A 3RYIA 2HIVA 3K5LA 1S03G 5J2UA 1HW7A 4FFBA 4KHPB 2E5LH 3B2EE 2V4DA 2BTOA 4DV6B 1I6UA 3M7MX 5LYJB 4FLVA 2UUAH 4LF7H 1TAEA 1ZAUA 3CB2A 3IAYA 3OTOB 1N33B 4TV9A 3CVZA 2UXBB 1N32B 2UUBB 1TUBB 5KX5B 4X62H 1XNRH 5KX5A 5EZYA 4AQYB 2JS5A 4LF8B 2IM9A 1SEIA 4RZQA 1XMOH 4U3JA 2XHBA 1XNQH 2PYLA 3QF7A 1HR0H 4F6RB 4OX9H 3RR5A 4DV2H 1IBLB 3WB0A 3KALA 2R72A 1QQCA 2Q7EA 3N2KA 5JQGB 5BMVA 3W1BA 4DR4H 4EEQA 3T1YH 3EYYA 2PGGA 5LXTB 2ZNIA 3N41B 2ZM6H 4LFAH 5D1PA 3T1HB 5FNVB 4JI3B 3JAKB 4ZIBA 4FFBB 4X1YA 3N42B 1NT2B 2FE3A 4CH3A 3WB1A 4JYAH 4PDBA 3BHPA 4JI0H 1N32H 4DR3H 3JASA 3HKBA 2UXDB 4B08A 3THOA 3QTCA 3HKBB 2UUCH 3TY9A 1G6UA 1HNXH 2CFMA 3CHXA 4UCRA 5BR8B 3RYCA 3T1YB 5IT9W 5IYZA 4L8JA 1AN7A 4LSXA 4DR1B 3UQ8A 3RGZA 4DV1H 1KU9A 5C8YA 2UU9B 1J5EH 2P5OA 1I7FA 4OX9B 4I4TB 4A2BA 2ZJTA 5ITZA 4BW9A 4I4TA 4K0KH 4LH6A 4EB6B 2R9AA 1X9NA 2R70A 2WE6A 5BMVB 4BWSC 3RYFA 4LNUB 3RYFB 1XQ8A 3JARA 2Q7HA 4JI8B 4DRFA 4NVPA 3K5MA 4APMA 5GONA 4I50B 4B3MB 4X1YB 4DV6H 3K3VA 4B3SB 3SJAC 5D1OA 3U10A 3NBZB 1FKAH 2QM4A 3DF7A 3JSNA 2BTQB 3OTFA 3TY5A 4DRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L B;  1FVI A;  4JI1 B;  3NBY B;  1HNZ B;  4X62 B;  4LF5 B;  4DV4 B;  4DR2 B;  4B3T B;  3W1G A;  4E6N A;  4DR7 B;  4UCO A;  4DUY B;  4X66 B;  2HHH B;  4JI7 B;  1CKO A;  4LFA B;  3JSL A;  2UXC B;  2HIV A;  4JI4 B;  4KHP B;  4LH7 A;  4YHH B;  4YY3 B;  3W5O A;  4LF7 B;  4DV6 B;  4GKJ B;  4LF4 B;  4JYA B;  1B04 A;  4PZ7 A;  1TAE A;  1ZAU A;  2HIX A;  1CKN B;  3OTO B;  1XDN A;  1N33 B;  5LMN B;  4UCT A;  2UXB B;  1CKN A;  2HVS A;  1N32 B;  2UUB B;  2ZM6 B;  3BA9 A;  5IWA B;  4X64 B;  3NC0 B;  1XNR B;  4AQY B;  2VQE B;  4LF8 B;  5LMU B;  5FPO A;  4UCS A;  3KYH C;  4UCU A;  3GDE A;  4UFZ A;  4CC6 A;  4X65 B;  1HR0 B;  3RR5 A;  1IBL B;  4GLX A;  4DV7 B;  4PZ8 A;  4NXM B;  2HVQ A;  3L2P A;  3TY8 A;  3PN1 A;  4B3R B;  3W1B A;  4JI5 B;  4EEQ A;  1XMO B;  2Q2T A;  4LFB B;  1DGS A;  1VS0 A;  4GKK B;  5D1P A;  4DV1 B;  3T1H B;  4EQ5 A;  4JI3 B;  3BA8 A;  4LF6 B;  4JI6 B;  1IBK B;  3S24 A;  5D1O B;  1N36 B;  5FPR A;  1XMQ B;  2UUA B;  4DR3 B;  4LFC B;  4DV2 B;  4PZ6 A;  2UXD B;  1A0I A;  1CKM A;  4DR6 B;  1P8L A;  2VUG A;  2UUC B;  3GB8 B;  3TY9 A;  2CFM A;  1HNX B;  4UCR A;  5BR8 B;  3QWU A;  1N34 B;  3T1Y B;  1V9P A;  1FJG B;  4NXN B;  3BAB A;  4JV5 B;  4JI2 B;  1XNQ B;  4DR1 B;  4DV5 B;  3UQ8 A;  3GJX B;  2OWO A;  1TA8 A;  1IBM B;  4DUZ B;  1S68 A;  1J5E B;  2UU9 B;  4OX9 B;  2HVR A;  2VQF B;  1P16 A;  3BAA A;  4DR5 B;  4LH6 A;  4K0K B;  4CC5 A;  1X9N A;  4DR4 B;  2F4V B;  5DIS C;  2Q2U A;  4LF9 B;  3RTX A;  4TOI A;  4JI8 B;  4DRF A;  3VNN A;  3SGI A;  4DV3 B;  4UCV A;  4B3M B;  4DV0 B;  4B3S B;  1HNW B;  5D1O A;  4JI0 B;  4EFB A;  3NBZ B;  4EFE A;  1XK5 A;  3JSN A;  3TY5 A;  1I94 B; 
#chains in the Genus database with same CATH topology
 2HP8 A;  2E5L B;  4WBN B;  4X64 H;  3E86 A;  4IAJ A;  3W1G A;  1KP2 A;  1H2G A;  1M5I A;  2XD4 A;  2GHY A;  3O65 A;  4TQS A;  5IWA O;  2CUG A;  2QYZ A;  1Y1W G;  4O4L F;  3FKI A;  4JI6 H;  4FIP C;  4PJ0 Z;  5K1X A;  2W6O A;  4GX2 A;  2N05 A;  4PZ7 A;  2Q7D A;  3ZRV A;  2GUZ A;  2UXN A;  4N23 A;  3CJH B;  2E5L O;  1V54 C;  5KX5 F;  2WA3 A;  2YW2 A;  5KFJ A;  1MZB A;  2ZIN A;  3CCJ V;  5KFE A;  3T1H H;  3N44 B;  4IHJ B;  3TII A;  1R3J C;  4JTD B;  3OW2 U;  3PW7 A;  4RWU A;  3UZB A;  4K8X A;  1ZET A;  4W4L A;  3T9F A;  2ZNJ A;  2F43 G;  4MTE A;  4PA6 A;  2JA5 A;  2F66 C;  4CC6 A;  3ETD A;  1IVS A;  1JJ2 U;  5BWX A;  2EUL A;  4Q20 A;  2LP7 A;  3HR0 A;  2YSU B;  1R6T A;  4A3I G;  1QVG U;  2VWJ A;  2AZ2 A;  2GSM B;  4B3R B;  3G6B A;  1XMO B;  3GIQ A;  3SE7 A;  1IBM O;  4GKK B;  5KFO A;  4ZOL B;  3VBB A;  4MSW C;  2ZD9 A;  3L71 H;  1CS0 A;  3AG4 C;  4TV8 F;  1IBK H;  1PKX A;  1OWT A;  1FXK A;  5D1O B;  4LF6 H;  2EZP A;  2E76 B;  4GT1 A;  2XUM A;  4RUA A;  2MK3 A;  1QLE C;  5KMG B;  5C4X G;  4DV2 B;  3JD0 A;  3M9O B;  3ZRS A;  3TET A;  3WNZ A;  4I55 B;  2XGQ A;  3HO8 A;  3KHR A;  1K83 A;  4O4J B;  2C2E A;  4R50 A;  4RAY A;  3ZRW A;  4JI2 B;  3TIN A;  1XL6 A;  4O4I F;  2GQR A;  3SYC A;  1SKV A;  3PW0 A;  4B7E A;  3HKD A;  2YUA A;  1MSW D;  2DWD C;  4JI1 H;  2PMZ A;  2VQF B;  1W0K G;  3JCU Z;  4DR5 B;  5FJ8 G;  3CJH A;  4QWB A;  4WBN F;  4LWS B;  5CA1 B;  2GQS A;  4O2A B;  4O7Y A;  4LWS A;  5CA1 A;  2YXY A;  3UCS C;  4HNA A;  3IG0 A;  2NN4 A;  4F6E A;  3ICX A;  2CTW A;  3SGI A;  5JH7 A;  4FU0 A;  2R93 A;  2N74 A;  4UCV A;  2WDT A;  3RBD A;  1H2S B;  5A2Q N;  4O3P A;  2QM7 A;  1S76 D;  1RJR A;  4F4L A;  4GLW A;  5H2F Z;  5IJ0 B;  5EZY F;  1M93 A;  4DL3 A;  2DQ0 A;  1I94 H;  3DXR B;  3LSS A;  5B1O A;  5KFU A;  5J2T B;  3DXR A;  4R6Z A;  2Z04 A;  2EJ3 A;  4WHX A;  3M9N B;  1U97 A;  4DR7 B;  3U0Z A;  4GKK H;  1YCI A;  3OD4 A;  4NZM A;  2OCC C;  3ABL B;  2R8I A;  1G2W A;  2E74 B;  4Q0Y A;  4DV7 H;  2HG8 A;  2V9W A;  3BRC A;  3BY6 A;  3FAV A;  2CNQ A;  4MV8 A;  3QZ8 A;  2JA6 A;  1YIJ V;  1N0J A;  4NKG B;  2R7K A;  5B1B B;  5IWA B;  4I55 A;  1RJP A;  1RPO A;  3NC0 B;  4J7J A;  2ILM A;  5IY5 B;  3TK1 A;  4H37 A;  1DLB A;  4W4K A;  4MV3 A;  4AIL C;  5LYJ F;  2WLH A;  3BQ1 A;  2P6J A;  1Q8I A;  3HKD B;  5H6Q A;  3X2Q C;  2H8P C;  1T36 A;  2NUA B;  1I5Y A;  4FM0 A;  2OIE A;  1S77 D;  3LDC A;  3AG4 B;  2NVY A;  3JCZ A;  5KUK A;  2R86 A;  4PBC A;  3ZHS A;  4PA3 A;  1P49 A;  3PN1 A;  1KUQ A;  5K2M A;  2IBZ H;  3OTO H;  1YEW A;  2W9C B;  5B66 Z;  1BHB A;  4BWA A;  3HB9 A;  2EIK C;  3RYC B;  3JAM W;  3ASN C;  5EZY B;  3ZS8 C;  3CCV V;  4EEY A;  2YZM A;  3K08 A;  4K6N A;  2RDC A;  3RT3 C;  4CS3 A;  2NU7 B;  4J9Z B;  2JA8 G;  2WLI A;  3ZMT A;  1UNN C;  1S0M A;  1KMI Z;  1KYO F;  1XMQ B;  3RB0 A;  1PL0 A;  4J11 A;  4QE9 A;  4DUZ O;  1XL4 A;  3U11 A;  1BS3 A;  3I56 V;  2HJW A;  5KFA A;  2ASL A;  5J2T A;  2PY5 A;  5BWW A;  3D36 A;  1I1M A;  3OMN B;  2AW9 A;  4RAI A;  2QA4 V;  4O4L A;  3H1K H;  3WU2 Z;  3W7W A;  4M0J A;  1LNQ A;  1K5S A;  2QWQ B;  5DED A;  4CKE A;  5HNE A;  4JAA A;  1D5A A;  3CCL V;  4JYA O;  3BAA A;  5KHI A;  1NTZ H;  1MMM A;  4CC5 A;  5C5J A;  2G38 A;  1F7Y A;  3B4S A;  2NU9 B;  4DR4 B;  4WF9 V;  2UVR A;  4JV0 A;  5EBW C;  3MR5 A;  3K3W A;  1DF5 A;  3SR2 C;  1VQ9 V;  3PVX A;  1WN7 A;  1RP3 B;  3L4K A;  2Q5Z A;  1GN6 A;  5BR8 H;  3K79 A;  4DV0 B;  4H33 A;  1XK5 A;  3G6V A;  2F4V H;  4QPJ A;  2COG A;  1S0N A;  5LOV F;  1RK6 A;  1HNZ B;  4O2A F;  2ZE8 A;  2IU0 A;  4UVA A;  2VUM G;  3Q2O A;  3LNN A;  1BJT A;  1YJN V;  2DN9 A;  1Y1W A;  1CKO A;  2VA3 A;  5A9G A;  3DAA A;  4LFA B;  1GGO A;  1VP7 A;  5IY5 C;  2Q69 A;  4C2M A;  3V4S A;  4DLK A;  1SS3 A;  1KUT A;  3ZED A;  4K0K O;  2OH2 A;  3DC6 A;  1MZE A;  4ZHQ A;  3RAQ A;  4K8Z A;  4JGS A;  1S72 V;  4TVI A;  3C90 A;  2CTP A;  3G6E V;  1B6Q A;  3JYC A;  4IRC A;  4FM9 A;  3OSP A;  3G8D A;  1KJ8 A;  1QNM A;  4DR2 H;  4JI2 O;  1H38 A;  1TWG A;  4A3C G;  4OXS A;  2R87 A;  4CZZ A;  2JGD A;  5IJ9 A;  5IE9 A;  4GYC B;  4X9Q A;  3R9R A;  5I5W A;  4WFA V;  3G6Y A;  3B09 A;  4UB8 Z;  5HFL A;  3SYQ A;  3ZMU A;  1GN4 A;  1NS1 A;  2YI8 A;  3H1J H;  2DYS B;  4DR1 H;  4EGQ A;  1KQS U;  4Z2W A;  2CW8 A;  4LSA A;  1YXB A;  4X20 A;  4M9U A;  4RNM A;  2EJ7 A;  1W96 A;  5GON F;  1GN2 A;  4F6R A;  1IBK B;  4JAU A;  4F4Y A;  1FFX A;  4RNO A;  4JYC A;  2XAG A;  5KT6 A;  2PTM A;  4FGR A;  2LO1 A;  2UXD H;  3ABK B;  4NZN A;  5D5Q A;  4JV2 A;  5C44 G;  4DL6 A;  3DGE A;  2WSS G;  2K9P A;  3W7S A;  3JZF A;  2OWO A;  2OTJ V;  4O3N A;  4F4W A;  3EHB B;  4PI2 A;  3GTM A;  2ODT X;  4NYE A;  3KXY T;  4IIJ F;  4PDV A;  2R7Z A;  4YY3 O;  2CKZ B;  3OUS A;  3GB7 C;  2W57 A;  4DK1 A;  5IDJ A;  2CNV A;  1RYR A;  2AGQ A;  4GKK O;  1M57 C;  4C5B A;  1Q3E A;  3CEB A;  3TIG A;  4C5A A;  3OMA B;  1IYE A;  1M56 C;  5C8Y B;  4LF8 H;  2F23 A;  4EGJ A;  2R7L A;  4NZO A;  4E4E A;  2Q7G A;  3P32 A;  3STL C;  1IBL O;  1YTF D;  3T7A A;  1K4C C;  1GM8 A;  2UXB H;  5DGA A;  3MR3 A;  1MG1 A;  3R5F A;  3RUP A;  2O03 A;  1VQK V;  1ENV A;  4DUY B;  5IP9 G;  4JAS A;  2XAQ A;  5DLF A;  1M57 B;  3OUU A;  4A3F G;  4L1K A;  2WLM A;  2OT5 A;  1HW7 A;  4O7S A;  3M8A A;  1VQM V;  4KHP B;  3B2E E;  2V1D A;  2V4D A;  1F23 A;  4G2K A;  4FLV A;  2C28 A;  2FYU H;  1OCR B;  3F7Y C;  1TAE A;  3CB2 A;  1FXV A;  1N36 O;  4YR0 A;  4CE5 A;  2W7P A;  2UXB B;  4O2B F;  3BCC H;  4B7K A;  2BQR A;  5KT5 A;  2OCH A;  1WJZ A;  5LL6 Y;  4HYK A;  1GSA A;  4TT3 G;  1XNR H;  2KB1 A;  3TXS A;  1VQO V;  1OCO C;  4B3R O;  4QWC A;  3AG2 C;  1I50 A;  2XHB A;  5EWF A;  2OIG A;  4ECZ A;  4H0L B;  1ZL8 B;  2UXD O;  2EIN B;  3QF7 A;  4MV6 A;  1ET0 A;  4IYI A;  3WB0 A;  1S5H C;  4J9O A;  3AG2 B;  4K35 A;  3KAL A;  2Y0P A;  5K3W A;  2R72 A;  1XEQ A;  1IBK O;  3N2K A;  1UPG A;  5JQG B;  2W70 A;  4A3E G;  5AG2 A;  3HOY G;  3SPC A;  4EEQ A;  3T1Y H;  1VEW A;  3N41 B;  4J9P A;  2HR3 A;  3AK1 A;  4PEL A;  4QGP A;  5L3C A;  2FLL A;  3U54 A;  1EKV A;  2HGW A;  2WAQ A;  4FFB B;  2XAS A;  3LUL A;  3IGA C;  2AZ0 A;  2DOS A;  4PDB A;  3J80 N;  2R92 A;  2IJI A;  3EPG A;  4UUG A;  4DR3 H;  2JA6 G;  5CMU A;  3QTC A;  1OCC B;  2ODM A;  4QNH B;  4FFL A;  2J9G A;  2O57 A;  1EUC B;  2C35 B;  2R92 G;  3T1Y B;  4L8J A;  1AN7 A;  3ABT A;  5J9P C;  4DR1 B;  3RGZ A;  5GTH Z;  2Z3Y A;  1PPJ H;  4IL6 Z;  4RQF A;  1L0N H;  3L74 H;  2Y4U A;  3I5D A;  4I4T B;  2P7T C;  3FB5 C;  3Q8S B;  4I4T A;  1FS0 G;  2FK2 A;  3HOW G;  5J2T F;  1YJ9 V;  4JI6 O;  1Y76 B;  1YI2 V;  1CXZ B;  4BWS C;  3L9D A;  3RYF A;  3TCU A;  3ZHU A;  3HBL A;  1GO3 F;  3MFH A;  3RYF B;  2ZXW B;  3AW8 A;  4GX0 A;  4NVP A;  1MZF A;  2VRZ A;  5GON A;  2KG7 A;  2W0F C;  3EVK A;  2XCL A;  4UVC A;  1U96 A;  1BNC A;  2HHF A;  3DC5 A;  2JJ2 G;  1MOF A;  3LNM B;  3K3V A;  4DV6 H;  4BIU A;  2DLN A;  4X64 O;  2NU6 B;  1FKA H;  1AUX A;  3DF7 A;  2BTQ B;  4FM1 A;  3CC4 V;  2VQD A;  3JAL A;  5DGI A;  5JQG A;  4WD3 A;  1JDB B;  3TQT A;  3VMM A;  4JI7 H;  1NU1 H;  4QWA A;  5EOY A;  2Y0I A;  1AVM A;  4JI4 B;  4ZOL F;  2R9R B;  3EFF K;  2AHY A;  2Z02 A;  4BR6 A;  2GV9 A;  3PR5 B;  2XAJ A;  1W59 A;  5KG7 A;  2B5U A;  4LF4 B;  4JYA B;  5KFX A;  2IJK A;  4JZ2 A;  4DV4 H;  5E25 A;  1H2K A;  2JEG A;  5KMG A;  1D2D A;  2W6I G;  5F2V O;  1CEZ A;  4JI3 O;  3B77 A;  2ZDG A;  4JZG A;  1JR9 A;  2HHH O;  4ZI7 B;  1T5E A;  4O4J A;  1P84 F;  1E4F T;  3RGX A;  2E75 B;  3ZRW B;  1DK1 A;  4FLT A;  3M4I A;  3GTK A;  5LHI A;  1WP8 A;  4O3S A;  3L73 H;  1HR0 B;  1YZB A;  2WPD G;  4JI0 O;  4FLZ A;  4DV7 B;  2ABJ A;  1IBL H;  5B1B C;  2RGV A;  4O4J F;  2YC0 A;  1B33 N;  1LR1 A;  2ZE6 A;  5LXT A;  2IMW P;  2FPI B;  1I7L A;  2KKW A;  2W9C A;  1OCC C;  3BQ2 A;  2PF4 E;  1A48 A;  1GMG A;  1H8H G;  4JXU A;  5EK0 A;  2HG5 C;  2YCH A;  2DYR B;  4JTA B;  2VQF H;  4UV8 A;  5IYZ F;  3H4D A;  2UUA B;  4QPK A;  3K0G A;  2CQY A;  4N21 A;  4LFC B;  4F50 A;  1CKM A;  1XNQ O;  4DR6 B;  4PA4 A;  2H94 A;  4DR6 H;  1K33 A;  4B3S O;  1YVW A;  3RBZ A;  5IYZ B;  5DM6 V;  4DV3 H;  2C22 A;  1V54 B;  3J81 N;  3CXH F;  5LGU A;  4DUY H;  1XNQ B;  4DR6 O;  4B3S H;  1AR5 A;  1AUV A;  3GJX B;  4X65 H;  1QCE A;  4TQD A;  2QJ1 A;  1I08 A;  5KA5 A;  3IC9 A;  3VOU A;  2VS0 A;  4FZ1 A;  4D6T H;  2NVX A;  2PI4 A;  1GN3 A;  1AB3 A;  1TWH A;  1RM1 B;  2W9A A;  3JD2 A;  3DTU B;  5LGT A;  4HNT A;  5L9X A;  3CRQ A;  3CCE V;  1UFI A;  4UB6 Z;  5H9C A;  1RJQ A;  1KC7 A;  4DR1 O;  4HYO A;  5JCO C;  4MVS A;  4I0X B;  2OTL V;  5H6R A;  1UC8 A;  4DV3 B;  1WAZ A;  4ECU A;  5DG7 A;  1XHZ A;  2ZKO A;  3ASO C;  4O82 A;  5KHG A;  4MTG A;  5LA6 B;  3SPI A;  4IGG A;  5LP6 C;  4JI4 O;  3LUT B;  3T4D A;  4J9L A;  2B1I A;  1I2K A;  2R8G A;  2Y4T A;  3GV8 B;  3JAW B;  4LF4 O;  4FZ0 A;  3E89 A;  4X66 B;  4GCZ A;  5KFK A;  2IH3 C;  4YJ2 A;  1E4E A;  2W8K A;  3SI8 A;  1OCO B;  3KAK A;  3MHH C;  1E79 G;  2X0S A;  2YYA A;  3ETJ A;  4Q44 A;  1VF6 C;  1K3E A;  5EC1 C;  1B04 A;  2YEV B;  1CKN B;  5CA0 A;  5KFZ A;  2F95 B;  3MFI A;  3I4M G;  4JI8 O;  1EN5 A;  1NH2 B;  4J9Q A;  3WO1 A;  4U7C A;  1M1K W;  1Z2P X;  3MWM A;  2RGR A;  2FPP B;  2B63 A;  2XT9 A;  2GTS A;  3CQZ A;  1SET A;  3RN4 A;  2JK5 C;  2W6Z A;  3FB6 C;  2GPW A;  5KHJ A;  4O4I A;  3GDE A;  2C2R A;  2Z0A A;  2CH7 A;  3L4J A;  2DYR C;  3ZN1 A;  1Z5V A;  4ZBM A;  3GTG A;  2V5A A;  4DV5 O;  2ZE7 A;  4FK5 C;  4O2B A;  4F4Z A;  2R8K A;  4DR7 H;  3E8G A;  2W6P A;  3ZN0 A;  1OJH A;  4PDR A;  4J9M A;  4I7Z B;  4U3J B;  2DPI A;  1WLE A;  5BYA A;  4TWK A;  1BHA A;  1N0N A;  5KT2 A;  4FFP A;  4NXM O;  2FK1 A;  1N36 B;  1HNW H;  2UVU A;  5KFN A;  3ZJZ A;  1SFO A;  1XMQ H;  3GWK C;  5KG5 A;  3A2F A;  1RPR A;  3SPG A;  5LOV B;  4LFC H;  5ITZ B;  3VQW A;  1A0I A;  3H1L H;  4K3A A;  4PV1 B;  1A32 A;  3JAM N;  5LOV A;  3OR6 C;  2WWW A;  4CMF A;  5JJN B;  4NLG A;  4B3M H;  4FBT A;  1BSM A;  1K5Q A;  4LP8 A;  4FE2 A;  4JV5 B;  5C8Y F;  4RB1 A;  1E4E B;  2UXC H;  2EIM C;  2R8J A;  5CB4 B;  1N48 A;  3CD6 V;  4DUZ H;  2MW2 B;  2YEV A;  3ZBH A;  1VAJ A;  3DTG A;  4DW1 A;  1MA1 A;  4K0K B;  4MV9 A;  1VIB A;  5L3F A;  3K57 A;  4ZHQ F;  4GC6 A;  1EN6 A;  4A3K G;  3MWE A;  3RTX A;  5CM0 A;  3A0H Z;  2EIL C;  1M7J A;  1SQF A;  3RVY A;  5IWA H;  2YS6 A;  1Q5O A;  1ZX3 A;  3K0D A;  2GLT A;  3R23 A;  4FPP A;  1WH2 A;  4IT5 A;  2FPG B;  3ZHR A;  1VF5 B;  4JI0 B;  3N40 P;  4EFE A;  1M90 W;  4TQR A;  1VQN V;  3R65 A;  2EIK B;  5A2Q W;  4O2B B;  3N8D A;  4G27 B;  2RF4 A;  1M4U A;  5CN0 A;  3JAR B;  4AQY H;  4DV4 B;  2KSW A;  2XIG A;  4B3R H;  4O7N A;  3RYH B;  1PX2 A;  2YXH A;  4NXN H;  2YZG A;  3P3P A;  2QM8 A;  3ZHV A;  4YBZ B;  2BQ3 A;  5D8D A;  1SQV H;  2P4V A;  4NR1 A;  2VPS A;  3V6K A;  4YY3 B;  4TUY B;  4LF7 B;  1GKF A;  1QVF U;  3MR6 A;  1AR4 A;  3RVZ A;  3JD1 A;  5KG6 A;  1SQX H;  1J5E O;  4RU9 A;  5JCO A;  3CP1 A;  2OLS A;  4RZR A;  5KFV A;  1R3L C;  3BA9 A;  2UXC O;  3D3I A;  1VQ6 V;  3T9D A;  4FBU A;  1QBZ A;  1GAX A;  3HKC A;  1R1B A;  1WCM G;  1JFF A;  5CBG A;  3CRC A;  3UT5 A;  1NZ6 A;  2HVK C;  3EXA A;  3UT5 B;  3JZ6 A;  4EG0 A;  1XDC A;  3K59 A;  1VBH A;  2GUZ B;  4X65 B;  1GO3 E;  3E22 B;  5EC2 C;  5JVD A;  3E83 A;  3ZIA G;  3N2G B;  4NXM H;  4A3L G;  1T3N A;  4FJC C;  4NYK A;  3SJB C;  2P90 A;  3T99 A;  4J9K A;  2GDS A;  4JI5 B;  3BJY A;  5KFB A;  3D8C A;  2RDI A;  1DGS A;  1ZWI C;  3LDE A;  3OM3 B;  3GID A;  1G1X B;  5L3G A;  4DR4 O;  4BBS G;  2JS3 A;  4YY3 H;  2XND G;  1QR8 A;  2A79 B;  3G4S V;  1EUD B;  1AI7 A;  5FPR A;  2YDE A;  5L3B A;  4DL2 A;  4JI1 O;  3FDS A;  1P4R A;  4Q43 A;  5KG3 A;  2YI9 A;  2B1G A;  1I7N A;  4I7H A;  5DGB A;  2WB1 A;  3G6X A;  4JI5 O;  1FD9 A;  3JD3 A;  5LMU H;  1I2L A;  2JA7 G;  2F93 B;  2PI5 A;  1NVP B;  1TA8 A;  4O4H F;  3B8M A;  1ZHS A;  1R3K C;  3OMI B;  5HV6 A;  1IOW A;  4DRX B;  1P16 A;  4JTC B;  4WBN A;  2UUA O;  2Q0A A;  4J9Y B;  4WFE A;  3CEI A;  4LF6 O;  1C3O A;  5BWU A;  3H20 A;  2E2H A;  4I9W A;  3Q8R B;  3I4N G;  4LMY A;  5KFM A;  4YJ3 B;  2E3C A;  4XYM B;  5HBR B;  4FS1 A;  3N6R A;  1KJ9 A;  1TGO A;  3SDL A;  3ETG A;  4CH6 A;  3GTO A;  2KSD A;  1H2N A;  3RIZ A;  2RN9 A;  2EBO A;  2KG7 B;  5GON B;  4DL4 A;  1Z5W A;  1YTF B;  4LF4 H;  3P3N A;  1DV2 A;  1NI8 A;  4RAZ A;  4LC1 A;  1Y66 A;  2Y0S E;  4KP4 A;  5LGN A;  1I94 B;  1OCZ C;  2FTK A;  4L87 A;  2QWO B;  4QSH A;  2UUB H;  5GTI Z;  2VPQ A;  2ZDQ A;  4YXW G;  1Q6H A;  2M05 A;  1P7B A;  3QO5 A;  4E6N A;  3WO0 A;  4BY7 G;  4O2A A;  3AX6 A;  1XUQ A;  1PP9 H;  4YR2 A;  2HGX A;  2CTQ A;  3RYI A;  4QJF A;  1R6N A;  1EKF A;  2WLN A;  3K5L A;  2ITD C;  4LFB O;  2HIV A;  4IRD A;  1S03 G;  2A06 H;  1EFR G;  4FFB A;  4ME6 A;  5I5S A;  5DG8 A;  2BTO A;  3IFX A;  4DV6 B;  3JZI A;  3M7M X;  4NTW A;  3UKM A;  1VQ7 V;  3CPW U;  3L75 H;  3VPC A;  2FLP A;  4LF7 H;  3S3X A;  2RCV A;  1JLL B;  2LFS A;  5CA3 A;  1PK8 A;  2UVW A;  1S10 A;  1N32 B;  1URF A;  4RUF A;  4BBR G;  5KX5 B;  2FMA A;  1N4C A;  4X62 H;  5KX5 A;  4ECQ A;  4OPA A;  3KKY A;  1M6V A;  4DV3 O;  5JVD F;  4LF8 B;  2HJF C;  2IM9 A;  3OT7 A;  1PM9 A;  2GTA A;  1XMO H;  4ZKI A;  3QQM A;  1PNL A;  2BSK B;  3T1C A;  1P7G A;  1MAB G;  3VA7 A;  4OX9 H;  3RR5 A;  4DV2 H;  1JOY A;  1JCH A;  2DZD A;  1Q90 D;  4BXX G;  3PJS K;  1Y76 A;  2R6F A;  3H1H H;  1KC8 W;  3LWB A;  5IYD O;  3EYY A;  2Y69 B;  2PGG A;  5LXT B;  1VKZ A;  2Z5U A;  3U0G A;  4LFA H;  3LSQ A;  3T1H B;  3JAK B;  3N42 B;  3JRW A;  4UVB A;  5EWG A;  1RYS A;  3WB1 A;  4JYA H;  5KAI Z;  1BT8 A;  3APO A;  3B8N A;  3BHP A;  4EKW A;  4JI0 H;  4ECV A;  5KFP A;  1EYZ A;  1Q82 W;  2ZDH A;  3HKB A;  1QR9 A;  3THO A;  3HKB B;  2QWP B;  3TY9 A;  3CHX A;  1S0O A;  5GW7 A;  4MV1 A;  3RYC A;  5LP6 F;  2ZDI C;  5IT9 W;  5IYZ A;  4HNV A;  3K5H A;  2WLI B;  1Q86 W;  1Q81 W;  2CGO A;  1PL4 A;  4DV1 H;  1KU9 A;  4KUM A;  4OX9 B;  4XX0 B;  1ULZ A;  3MD0 A;  4A2B A;  3HB3 B;  1YHQ V;  2C00 A;  1HWY A;  2R9A A;  1X9N A;  5EWE A;  4ECX A;  5BMV B;  4LNU B;  4XBF A;  4ECW A;  2EJ2 A;  3AYH B;  2Q7H A;  4JI8 B;  3K5M A;  1C30 A;  2YU9 A;  1D5N A;  5DGH A;  2ITC C;  3BFR A;  4IZO A;  4X1Y B;  1BMF G;  3R5H A;  1Y67 A;  2BSK A;  4DYL A;  5I5T A;  1CQJ B;  4XDL A;  5F9L A;  2PMZ E;  5JVL A;  3HT5 A;  2Y69 C;  1DTO A;  4A3J G;  3R66 A;  2JEF A;  1Z2N X;  1FYJ A;  4O3Q A;  5CR5 A;  4TV9 B;  4YAK B;  3ABL C;  4X1K A;  1JJO A;  1SF9 A;  4MVZ A;  4WFF A;  2IP4 A;  1GTO A;  4BIO A;  5KFG A;  2DIK A;  2V58 A;  1F4M A;  1NR7 A;  4YHH H;  5BYB A;  3UM7 A;  1GRJ A;  3JD4 A;  5EBM C;  4GKJ B;  3P30 A;  2P22 C;  5E1A C;  4KFM A;  1DV1 A;  3H0G G;  4B3T H;  4DW0 A;  2WYO A;  1Y1V G;  3UZO A;  1VBG A;  4EB6 A;  3JAW A;  1GSH A;  1CKN A;  5CA0 B;  3V4Z A;  4ED6 A;  4MVQ A;  4TM5 A;  1K1S A;  1BGY H;  3ZHQ A;  5BPF A;  2QR4 A;  3TW7 A;  3CCR V;  2J6T A;  3J7A K;  1AJN A;  1N8R W;  4B3M O;  1L8D A;  3FYI B;  4CKB A;  3E35 A;  4QIW E;  1JDE A;  1QHT A;  2BR0 A;  4UCS A;  1X4T A;  3FFQ A;  4LFC O;  4Q4D A;  2PVP A;  5CBH A;  4RQE A;  4GLX A;  3WWH A;  4O3O A;  1LUW A;  2P0A A;  3Q1K A;  4NXM B;  2JGU A;  4ECS A;  3WB2 A;  1FPO A;  2WLJ A;  1TUB A;  2UU9 O;  4X66 H;  3K3P A;  2V7Q G;  4O4L B;  1AP6 A;  1VS0 A;  1EN4 A;  3RAX A;  3CYO A;  4I0X A;  5EIB D;  4O4I B;  3T5L A;  2W9B A;  1GSO A;  2CH7 B;  4FS2 A;  2YIA A;  4ICG A;  4Q4C A;  4O7W A;  3DTF A;  5KFF A;  1S5L Z;  3BAC A;  3OE7 G;  2JJ1 G;  4E2L A;  1SER A;  5EDW A;  1AI5 A;  2NLJ C;  4ED2 A;  2JDI G;  2VUG A;  3CRA A;  3VQY A;  4E4T A;  1EM1 A;  3PW2 A;  5JQG F;  2VQE O;  2ZT9 B;  3QWU A;  1OCZ B;  1Y4M A;  4O3R A;  4JI5 H;  2NU8 B;  2R7M A;  3GVM A;  5B1A B;  1EZ1 A;  4DUZ B;  1S3J A;  1NQT A;  5KFD A;  4JI8 H;  1XBL A;  5CB4 A;  3Q4H B;  5JH7 F;  3BQ0 A;  3ABK C;  5KS8 A;  1CPY A;  1KBL A;  2YXL A;  4DR5 H;  4WFH A;  4TV9 F;  2OCC B;  4YQW A;  3AG7 A;  3KRE A;  3ZCC A;  1N33 H;  4J7K A;  1BXR A;  1ZSP A;  3HKZ A;  4A2A A;  2PZS A;  2R85 A;  2QWR B;  4FLY A;  4X66 O;  3AG1 C;  1KJI A;  1JIH A;  1HP8 A;  4HAM A;  4FLU A;  4MA0 A;  2UU9 H;  2A9H A;  2EIJ B;  1WPB A;  1HNW B;  1EHI A;  3FMA A;  3VPD A;  2IJJ A;  4ABM A;  2XAF A;  4IRK A;  2UXB O;  3CCU V;  3K9A A;  3RWR D;  3JRX A;  1YJW V;  2ZDI A;  3E8B A;  3R5X A;  1VQ4 V;  2WAQ E;  4LF5 O;  3T1H O;  3APQ A;  2IW5 A;  3CRM A;  3RYH A;  2W6Q A;  2LJ2 A;  2UXC B;  4M7E A;  2HJD A;  2JGD B;  5IJ9 B;  1PNM A;  1IX9 A;  4YHH B;  3K9S A;  2HDK A;  3W5O A;  3HXL A;  2FKX A;  5B1A C;  1SA0 A;  2W6M A;  3SYA A;  5KG1 A;  1K92 A;  3NGD A;  5B1N A;  2RNB A;  2ALZ A;  4X64 B;  3GIK A;  3HKC B;  4ECT A;  2QKA A;  5KKN B;  5LMU B;  1JFF B;  1BQZ A;  3TEK A;  3KYH C;  4HN2 A;  3AEI A;  1FFX B;  4UFZ A;  4Z1V A;  2W7O A;  5C1P A;  4J42 A;  1F4N A;  3KAJ A;  3L2P A;  5KFW A;  3KZI Z;  2R82 A;  3HPL C;  1FAF A;  1KTA A;  3T5K A;  1QLN A;  1NBM G;  2ATK C;  2ZR2 A;  1AP5 A;  3B40 A;  1K9M W;  1EKP A;  3VOT A;  2Q2T A;  2VOB A;  3KHH A;  4DXW A;  4U6P A;  3QO8 A;  2AGP A;  3E22 A;  3S24 A;  4X1I A;  2JVD A;  3MAQ A;  5C1O A;  2FLN A;  1K4D C;  5IT9 N;  3QG5 A;  4PZ6 A;  4IYH A;  5EYP A;  3U55 A;  1KJJ A;  2UUC B;  2C2D A;  5EYP B;  2ZIM A;  3RB3 A;  1HNX B;  4GX5 A;  5HFM A;  4DR2 O;  4NXN B;  1BGW A;  4I50 A;  4ZOL A;  2HHH H;  4J0M A;  3PO3 G;  2UUC O;  3V6J A;  1Z2O X;  2I80 A;  2Y48 A;  4JI3 H;  2CGN A;  1M0T A;  2IJH A;  2K1E A;  1K73 W;  3S3W A;  4EBE A;  4EYI B;  1IXB A;  1Y74 B;  2QTS A;  5I47 A;  2LW7 A;  4X89 A;  1IUR A;  4U3F H;  3BVO A;  3RV4 A;  5DIS C;  4JYY A;  5FD5 A;  3AK3 A;  1NJI W;  4TOI A;  2LGW A;  5KFS A;  3CMA V;  3HKZ E;  3GV7 B;  1G8M A;  1K7D A;  5FD6 A;  4DR7 O;  1JQ0 A;  3T5J A;  2LFR A;  2XOK G;  4O4H B;  1ZTE A;  4EFB A;  5LBQ A;  1YDX A;  1JPX A;  2ADP A;  2UXX A;  3NBY B;  3T9C A;  4QWE A;  1JX4 A;  4X62 B;  5B5E Z;  4B3T B;  2QK4 A;  4R7R A;  2BE3 A;  1CQI B;  1S9F A;  4JV1 A;  4ED8 A;  4JV5 H;  5KHH A;  4CH4 A;  1K97 A;  4X62 O;  2HHF B;  2Q73 A;  3JSL A;  3ZMS A;  3STZ C;  2JEU A;  5CB4 F;  4GX1 A;  1KP3 A;  3OGI B;  2DE0 X;  4UXN A;  1TVK B;  1NVP D;  4X1I B;  3CRR A;  2BTQ A;  3LSU A;  4J10 A;  3OEE G;  3TXQ A;  2PUS A;  4QE7 A;  2D2C B;  2XAH A;  5FL7 G;  4TSF G;  2HVS A;  3CXC U;  4HQ6 A;  4QIW A;  1N56 A;  4YIO A;  1XNR B;  2EIN C;  1HDJ A;  4PD4 F;  4AHC A;  1FJG H;  2XGP A;  2QDO A;  2EJ0 A;  2XCP A;  2DWE C;  3OHA A;  2UUB O;  2PN1 A;  3UO3 A;  5I60 A;  4CHI A;  4PZ8 A;  4NTY A;  2VWK A;  1ZHQ A;  4QW9 A;  3ASO B;  4FLX A;  5I5Y A;  4YJ3 A;  4IIJ B;  3CS5 A;  4BY1 G;  1O9G A;  1WP7 A;  4DV1 B;  5JJE B;  2J6U A;  2CDY A;  2ZE5 A;  1S97 A;  3FD9 A;  5B3S B;  2DWC A;  4ED3 A;  4LF6 B;  4YB8 B;  3JAK A;  4U7O A;  2N04 A;  4O4H A;  4Q8F A;  2C2A A;  1Y6X A;  4DR3 B;  1DF4 A;  3N43 B;  5BMV F;  4HBN A;  3GB8 B;  1VQ8 V;  4DV0 O;  3RF2 A;  1KB9 F;  3PW4 A;  4YIP A;  5B3S C;  1V9P A;  4JF3 A;  3K58 A;  1E4G T;  3N6X A;  3K5O A;  4FFK A;  5JH7 B;  4DV5 B;  1FXH A;  3H1I H;  2JA5 G;  1HNZ O;  4LR3 A;  2JEX A;  1S68 A;  1M56 B;  4IR1 A;  4RUE A;  2W6J G;  4ECY A;  5CA1 F;  5KFR A;  3FKS G;  3JAL B;  2FL4 A;  2Y4R A;  2WLK A;  2V59 A;  1Q43 A;  1O75 A;  1WNS A;  3H40 A;  1BCC H;  1AJP A;  5KFY A;  4TQF A;  3ZMV A;  5H5N A;  4O7Z A;  4RUC A;  4Q45 A;  1AI4 A;  1EZV H;  2P4K A;  2ZCE A;  4WFG A;  4U7N A;  3GIJ A;  4DIM A;  1ROP A;  3O9O A;  3FB7 C;  4RB0 A;  3IJ4 A;  1JKJ B;  3LDD A;  1JX9 A;  2X7R B;  1SCU B;  2XC9 A;  4DL5 A;  4DR2 B;  2FB5 A;  1BQ0 A;  5FLX W;  2E2I A;  4X1K B;  3T5H A;  1TWF A;  4JI7 B;  4CS2 A;  5L3D A;  5J2U A;  4FFN A;  1N33 O;  5CAE B;  1PD3 A;  4DV4 O;  2W0X A;  2B9Z A;  4FMT A;  1ZAU A;  3IAY A;  2Q0O C;  4HZ3 A;  1N33 B;  4TV9 A;  3WWJ A;  3CVZ A;  2UUB B;  2DAA A;  3J7A U;  1KT8 A;  4J7Z A;  4GZR B;  4ZQI A;  4NXN O;  5EZY A;  2JS5 A;  3M9M B;  3D3Q A;  1TUE B;  3H4B A;  5DEC A;  4J9S A;  2HVJ C;  2FK3 A;  4O7T A;  1B06 A;  5JWP A;  1XOU A;  4PA7 A;  2PYL A;  4YAJ B;  1BL8 A;  3W7X A;  1DIK A;  1Y14 B;  1PV0 A;  1V51 A;  1IBL B;  2R7N A;  4HNU A;  1VF6 A;  1I0H A;  1QQC A;  3ASN B;  3MR2 A;  3OUF A;  4MA5 A;  5BMV A;  4I55 F;  3W1B A;  1K8A W;  1K1Q A;  1AI6 A;  4A5U B;  4FFM A;  2A3Q A;  1RFY A;  4MVR A;  2YZN A;  1VQP V;  5BWV A;  3ZRX A;  5C93 A;  4ZIB A;  4X1Y A;  2FE3 A;  5KUM A;  3SYO A;  3SYP A;  2QTO A;  3H01 A;  2JEJ A;  1K34 A;  3CE2 A;  3F5W C;  2H3O A;  5FLX N;  3D36 C;  3CME V;  5I5U A;  1RM1 C;  4OPH A;  4YJ3 F;  2IBK A;  4B08 A;  4PDL A;  1NTM H;  2EIY A;  1I5X A;  5IYB O;  1HNX H;  2CFM A;  1QU7 A;  1IOV A;  4LSX A;  2QE7 G;  4PDM A;  1EBO A;  4JYB A;  5L1K A;  4DR3 O;  2P5O A;  1I7F A;  3PR4 A;  4EBC A;  1XMQ O;  2QB5 A;  4K0K H;  4UUJ C;  5ITZ A;  2ZJT A;  1HNW O;  2Y0S A;  4LH6 A;  2ZXW C;  4IR9 A;  4EB6 B;  3F7V C;  2R70 A;  1WB7 A;  4MVU A;  4R8C A;  5C3E G;  3MDS A;  5IP7 G;  3L72 H;  4MS2 A;  3KCY A;  3SJQ C;  1ORQ C;  4CMD A;  5KG4 A;  1RSO B;  2AGA A;  4JV5 O;  1CE8 A;  1W93 A;  1R3I C;  1ZUQ A;  4DRF A;  2Q9L A;  4HR7 A;  4B3M B;  4O83 A;  1PNK A;  5TIS Z;  5LHG A;  4B3S B;  3SJA C;  3C3T A;  1YIT V;  3U10 A;  3NBZ B;  4ZI7 F;  3GV5 B;  3JSN A;  2V4Q A;  2EIJ C;  5DLG A;  2CTR A;  1VF7 A;  5LYJ A;  1OHH G;  4MW3 A;  1F51 A;  4ZHQ B;  4CKC A;  1SQQ H;  5LL6 b;  1US6 A;  4UCO A;  1JVM A;  4TV8 A;  2ARH A;  2COI A;  5T14 A;  4CS4 A;  4I9Q A;  2WB1 E;  1L0L H;  3HOU G;  1THZ A;  3SNO A;  2W9B B;  3ETQ A;  3TW6 A;  3CC2 V;  1NKD A;  4XDJ A;  4DO2 A;  3GIM A;  1S5J A;  3OAA G;  1T94 A;  4GKJ O;  4J9N A;  1SA0 B;  1DAA A;  4FFR A;  2EZO A;  3SPJ A;  4EBD A;  1O9H A;  2MCT A;  2ZM6 B;  3RV3 A;  4R7C A;  2YS7 A;  3LQS A;  3MJF A;  4YR3 A;  5L1J A;  2VQE B;  1KKD A;  3OSN A;  3E2E A;  2X5R A;  4WFB V;  3TGU H;  1N34 O;  4O86 A;  5IYD G;  3GLK A;  3WFV A;  4CH5 A;  5LP6 A;  3A8T A;  4Q8E A;  5I5X A;  1FFT B;  4ASU G;  4TUY A;  2IA6 A;  4C5C A;  4RCN A;  1GM7 A;  2YID A;  2R7Z G;  3TY8 A;  4LF8 O;  3E5N A;  4MTF A;  3CWB H;  3VQV A;  1WB8 A;  2W8L A;  2COJ A;  1OV9 A;  5JQW A;  1RSO A;  5EIB C;  2VA2 A;  2A1H A;  5FNV A;  4EYH B;  1J95 A;  3X2Q B;  2UVV A;  4C7U A;  3QO7 A;  2IU3 A;  2GPS A;  4JI6 B;  2I87 A;  2SCU B;  5DQI A;  1UC9 A;  1NTK H;  2L35 A;  3OUZ A;  4DV2 O;  3JAS B;  4OX9 O;  1VQ5 V;  1HR0 O;  2R8H A;  1TWC A;  5BWT A;  4X65 O;  3N2K B;  1XIL A;  3T54 A;  1XMO O;  3PFF A;  3ETH A;  4IHJ A;  5BXZ A;  3MHS C;  3KHL A;  4TV8 B;  3BAB A;  3DSQ A;  4X8A A;  2FJZ A;  4FVM A;  1IDS A;  1IYD A;  3K06 A;  4YP3 A;  1SZX A;  2HLD G;  3QVN A;  1IBM B;  1COW G;  2ASJ A;  4BW5 A;  3UYY A;  5JUM A;  3LML A;  1R9T A;  2R84 A;  2JA7 A;  5KFI A;  1XHX A;  3BEH A;  4DV7 O;  5BY1 A;  4BAY A;  2ASD A;  1VQL V;  2F4V B;  1BZK A;  1KJQ A;  1OBG A;  1JA8 A;  2RQ6 A;  5LA6 F;  2W71 A;  4WCE V;  1OBD A;  5KFQ A;  3K5I A;  4ED0 A;  1GM9 A;  2A7W A;  3C0F B;  3VNN A;  5BPH A;  3GWO A;  4RB2 C;  4XZ3 B;  5LP6 B;  2JEI A;  2OYQ A;  2EX3 A;  4A93 G;  1Y74 A;  2CW7 A;  3AG3 C;  1R73 A;  2ZQM A;  1SQB H;  1SC5 B;  1WSC A;  2AU0 A;  1N34 H;  1A9X A;  4MV7 A;  1YF2 A;  3BPZ A;  1KBH A;  3K04 A;  3GQC A;  5K1P A;  2HKO A;  4DL7 A;  3VQX A;  4O81 A;  4FFO A;  2X6A A;  3WWI A;  2RJZ A;  3JAT B;  2FP4 B;  4CBC A;  4AYB E;  1TVK A;  4GKJ H;  4RB3 C;  3JAT A;  4X88 A;  3OR7 C;  2X6C A;  5JVD B;  5FNV F;  1ZL8 A;  1NH2 D;  2HIX A;  1XDN A;  3GIL A;  2ZR3 A;  3N2G A;  2WTF A;  4UCT A;  5DN6 G;  2CE4 A;  4MTD A;  3PZP A;  2LQT A;  2B63 G;  3RBE A;  2XTA A;  1OCR C;  5CA0 F;  3G8C A;  2PYJ A;  4KL1 A;  3U9T A;  3RYI B;  1X59 A;  4QJF B;  4HNA B;  4FLW A;  4MTX A;  2DW4 A;  2CZG A;  3T4Z A;  2VQE H;  2R93 G;  5LHH A;  5EBL C;  4Q6G A;  5FPO A;  5F9N A;  4TUY F;  1SES A;  4UCU A;  4KXR A;  5IJ0 A;  5JJJ B;  2RMK B;  1FKA O;  3W7T A;  4DK0 A;  2YIB D;  4DV6 O;  5BR8 O;  3MWD A;  3G80 A;  4G3I A;  4O7L A;  4IIJ A;  2HFE C;  5DMX A;  5BZB A;  1ZQ7 A;  1IBM H;  4LF9 O;  3E8F A;  5KA6 A;  2DJV A;  1M0W A;  1XRE A;  3J81 W;  2ETN A;  3UFX B;  3ZX6 A;  4AI8 A;  3NR7 A;  4Y8V B;  4ED7 A;  3FAV B;  3RFR A;  2HGS A;  2IH1 C;  2QSA A;  3FX7 A;  3LP8 A;  4PWQ A;  1SQG A;  1P8L A;  2NNU A;  3SJC C;  2F1M A;  5DQG A;  2DPJ A;  4QWD A;  1Q7Y W;  1FJG B;  3A0R A;  1HNX O;  1BE3 H;  1AJQ A;  1TWA A;  2A0L A;  3GII A;  4D7S A;  4A3B G;  2Q68 A;  2YL2 A;  3GTJ A;  4PI0 A;  4LBE C;  2HVR A;  4YJ2 F;  4I50 F;  5L1I A;  4O7V A;  2YIB A;  3I12 A;  4KHP O;  3AG1 B;  2CK3 G;  3RW0 A;  5CE8 A;  3T9E A;  4MVM A;  1S0V A;  4F4X A;  4A3M G;  2RDJ A;  3ZMZ A;  1H2L A;  3KCX A;  1B6R A;  1B6S A;  1IZ3 A;  4QW8 A;  2XCA A;  3T1Y O;  4JAV A;  3OTO O;  2HEP A;  4NTX A;  4MW8 A;  4AQY O;  2QF7 A;  3IN5 A;  1L1F A;  3OHB A;  3CX5 F;  5KLV H;  3UO2 A;  5LXT F;  1VAR A;  3HOX G;  1FVI A;  3ORQ A;  3FYE B;  3CCM V;  1A0G A;  3HKE B;  4PA9 A;  3BG5 A;  2YIC A;  4IWY A;  2HHH B;  2LGQ A;  1EZJ A;  1GH6 A;  2DQ3 A;  1XNR O;  4ZI7 A;  5L1L A;  3G67 A;  5KHK A;  4LH7 A;  4KHP H;  3Q8P B;  5KAF Z;  1JMK C;  2P67 A;  2Q4P A;  1N36 H;  3HOZ G;  3CCS V;  2QWN B;  5E79 Z;  3T9B A;  3CSW A;  3F8N A;  5LMN B;  4MVO A;  3FKI G;  3NXS A;  4NB5 A;  2AHZ A;  4DV1 O;  2P06 A;  3OGC C;  5IYC O;  2R9I A;  3RGB A;  4G28 B;  4LF5 H;  5J2U B;  2ZGI A;  5KFH A;  4YJ2 B;  3RB6 A;  4RNN A;  1KEE A;  5I5V A;  4ETS A;  1I94 O;  4MT8 A;  3E8H A;  3NUA A;  1G4Y B;  1SYX B;  3N27 A;  5IYB G;  2V4R A;  2HVQ A;  4MAM A;  4P2Z A;  1E1R G;  4QIW F;  3CSX A;  2VR1 A;  5BWR A;  2I8C A;  5D5P A;  4LF9 H;  4LFB B;  2FKL A;  4I5S A;  3PW5 A;  3TJT A;  4P9P A;  1Z2G A;  4O84 A;  2Q67 A;  1JXL A;  2JRI A;  1I1L A;  1WRV A;  4MTO A;  4EQ5 A;  3H3V H;  3BA8 A;  1ZLZ A;  1V55 B;  1A3G A;  4DR5 O;  3H0G A;  4DV5 H;  1CP9 A;  1OZ0 A;  4IHJ F;  2BOC C;  3RB4 A;  1AIL A;  2CAZ C;  2YZL A;  1HNZ H;  3ABU A;  1W0J G;  3HKE A;  1NR1 A;  2ZIO A;  4A3G G;  4LNU A;  2AGO A;  1VMG A;  2PBZ A;  3RJ0 A;  1N34 B;  1SRY A;  2DYS C;  1WR2 A;  3QFF A;  4DV0 H;  1AR1 B;  4PHZ A;  3HOV G;  1KD1 W;  1J5E B;  4O7R A;  1QLE B;  1Y1V A;  2ADQ B;  3OFN G;  4XDK A;  5LA6 A;  4JUZ A;  5FLM G;  3G71 V;  3K5N A;  4RO2 A;  2Q8V A;  3TQ1 A;  4LF7 O;  2ATL A;  4J80 A;  2WLL A;  3AK2 A;  3T9A A;  1WCM A;  4LFB H;  2Q2U A;  4LF9 B;  2WLL B;  3F5T A;  1B3Q A;  1H2M A;  5DQH A;  3J80 W;  3L70 H;  1XI1 A;  1L2Z A;  3C3S A;  4BIZ A;  4X20 B;  5L3E A;  2LW1 A;  1Q6U A;  4DAA A;  2L6L A;  3ZHT A;  2DMX A;  5KFL A;  4GUN A;  5J2U F;  1GYF A;  4FM2 A;  1I1K A;  3KG2 A;  4JI4 H;  3Q4H A;  5KT4 A;  1I3Q A;  1SZT A;  4JI1 B;  2YRW A;  3SPH A;  3M99 B;  4D7T A;  2EIL B;  4P9O A;  4LF5 B;  1FJG O;  5FR9 A;  4A3D G;  3K03 A;  2W6N A;  2BCC H;  2M7W A;  4OGQ B;  2GBO A;  4JI2 H;  3ABM B;  3WG7 B;  1V55 C;  2QGN A;  3QNE A;  3U9S A;  2BOB C;  4IWX A;  3RFC A;  2E5L H;  2NR5 A;  4ED1 A;  2AQ4 A;  2QEX V;  1R6K A;  3AG3 B;  1I6U A;  5LYJ B;  4B3T O;  2UUA H;  4R8U B;  3ORR A;  2M6Y A;  5DAA A;  4R8U A;  3OTO B;  2QKS A;  4YHH O;  1TUB B;  1H8E G;  4DUY O;  5LMU O;  4AQY B;  1MSD A;  2QKC A;  3CCQ V;  5KFT A;  4RZQ A;  1SEI A;  4U3J A;  3KTM A;  1LUV A;  1MNG A;  1XNQ H;  1ARO P;  1KEC A;  1V4Y A;  1RK5 A;  5KG2 A;  1HR0 H;  1SQP H;  4F6R B;  2F4V O;  5DG9 A;  5LMN O;  2J6S A;  1FXK C;  1YSC A;  2Q7E A;  4AYB A;  4DQN A;  2VQF O;  3GTL A;  3PO2 G;  2CNU A;  3GIP A;  4DR4 H;  3FB8 C;  4XYL B;  3GTP A;  2VUM A;  4UV9 A;  2ZNI A;  3W7U A;  2ZM6 H;  1WA8 A;  2YRX A;  5D1P A;  2EIM B;  1WA8 B;  3V6H A;  2X0L A;  5FNV B;  4JI3 B;  2AXT Z;  1NT2 B;  3Q8Q B;  3OEH G;  4H13 B;  2JIZ G;  2KQX A;  4CH3 A;  5KT7 A;  1IXM A;  3ML0 A;  3KHG A;  3T2M A;  4Z1M G;  5CBF A;  2FML A;  3IC7 A;  1N32 H;  1UJW B;  2DAB A;  3JAS A;  4P30 A;  3EPI A;  3ETE A;  2UXD B;  3ABM C;  3WG7 C;  2UUC H;  1E1Q G;  1G6U A;  5H80 A;  5KFC A;  4UCR A;  5BR8 B;  2Q6A A;  3A0B Z;  4ECR A;  3GTQ A;  3I55 V;  4I4T F;  3H9V A;  3UQ8 A;  5IYC G;  4J9R A;  4J41 A;  4GC7 A;  2WA4 A;  5C8Y A;  2UU9 B;  1J5E H;  5KG0 A;  1N32 O;  1KKC A;  4JPR A;  4H44 B;  4BW9 A;  2BQU A;  2YS8 A;  2WE6 A;  2WAM A;  1GLV A;  1W2B U;  4LFA O;  1XQ8 A;  1WPX A;  2X6B A;  2ZM6 O;  3JAR A;  3VPB A;  1M9N A;  3CC7 V;  1Q6I A;  4APM A;  1GK9 A;  4JI7 O;  2EJR A;  4I50 B;  4LCU C;  2YWV A;  5KT3 A;  3QZ7 A;  2FB9 A;  4MV4 A;  1FXK B;  5D1O A;  2QM4 A;  2D3O W;  5LMN H;  3OTF A;  3TY5 A;  4DRX A; 
#chains in the Genus database with same CATH homology
 1VF7 A;  5LYJ A;  4FM1 A;  2E5L B;  3JAL A;  4WBN B;  4X64 H;  4ZHQ B;  1Z2N X;  5JQG A;  4IAJ A;  5LL6 b;  4TV9 B;  4X1K A;  3W1G A;  1M5I A;  4JI7 H;  4UCO A;  1JJO A;  5EOY A;  4TV8 A;  4CS4 A;  4I9Q A;  4JI4 B;  4YHH H;  3ETQ A;  4JI6 H;  2GV9 A;  1S5J A;  5K1X A;  4GKJ B;  4LF4 B;  4JYA B;  4PZ7 A;  2P22 C;  4DV4 H;  2WYO A;  4B3T H;  5KMG A;  4EB6 A;  3JAW A;  1SA0 B;  5CA0 B;  1CKN A;  1O9H A;  2MCT A;  2ZM6 B;  1MZB A;  2ZIN A;  4ZI7 B;  3T1H H;  3N44 B;  1T5E A;  4IHJ B;  4O4J A;  3J7A K;  2VQE B;  1L8D A;  1E4F T;  3RGX A;  4K8X A;  4FLT A;  3M4I A;  4CH5 A;  5LP6 A;  1QHT A;  2ZNJ A;  4UCS A;  4MTE A;  1X4T A;  3FFQ A;  2F66 C;  4CC6 A;  1HR0 B;  4TUY A;  4GLX A;  4FLZ A;  4DV7 B;  1IBL H;  2RGV A;  4NXM B;  2JGU A;  3TY8 A;  3WB2 A;  2VWJ A;  4B3R B;  3VQV A;  5LXT A;  1TUB A;  1XMO B;  2KKW A;  4X66 H;  4O4L B;  1RSO A;  5EIB C;  1VS0 A;  4GKK B;  4ZOL B;  5FNV A;  5EIB D;  4O4I B;  2YCH A;  4JI6 B;  2VQF H;  1IBK H;  2YIA A;  5D1O B;  4LF6 H;  2UUA B;  3JAS B;  5KMG B;  4LFC B;  4DV2 B;  1CKM A;  3N2K B;  4DR6 B;  2VUG A;  4DR6 H;  3VQY A;  4I55 B;  3QWU A;  5IYZ B;  4IHJ A;  4O4J B;  4DV3 H;  4TV8 B;  4RAY A;  4JI5 H;  3BAB A;  3DSQ A;  4B3S H;  4FVM A;  4JI2 B;  1XNQ B;  4DUY H;  3GJX B;  1SKV A;  4X65 H;  3HKD A;  4TQD A;  4DUZ B;  1IBM B;  2QJ1 A;  4JI8 H;  5CB4 A;  4JI1 H;  3LML A;  2VQF B;  2YXL A;  4DR5 H;  4DR5 B;  1XHX A;  1N33 H;  2F4V B;  5CA1 B;  4O2A B;  2RQ6 A;  5CA1 A;  4A2A A;  2PZS A;  4HNA A;  4FLY A;  3IG0 A;  5JCO C;  2UU9 H;  3ICX A;  4FLU A;  3C0F B;  3VNN A;  3SGI A;  5JH7 A;  1WPB A;  4UCV A;  4DV3 B;  2WDT A;  4RB2 C;  1H2S B;  5LP6 B;  2OYQ A;  1XHZ A;  1HNW B;  3FMA A;  2EX3 A;  5IJ0 B;  5KHG A;  5LA6 B;  5LP6 C;  2CW7 A;  1M93 A;  3RWR D;  1I94 H;  5J2T B;  3JAW B;  1N34 H;  4MV7 A;  4DR7 B;  3U0Z A;  4X66 B;  3BPZ A;  5K1P A;  3RYH A;  4GKK H;  4YJ2 A;  2UXC B;  4M7E A;  3VQX A;  5IJ9 B;  3KAK A;  4Q0Y A;  4YHH B;  3W5O A;  2RJZ A;  3JAT B;  4DV7 H;  3HXL A;  1TVK A;  4GKJ H;  4RB3 C;  3JAT A;  1B04 A;  5JVD B;  2HIX A;  1SA0 A;  5CA0 A;  1CKN B;  1XDN A;  3BRC A;  3N2G A;  2F95 B;  4UCT A;  4MTD A;  1Z2P X;  3MWM A;  5IWA B;  2RGR A;  4I55 A;  2PYJ A;  4KL1 A;  4X64 B;  3RYI B;  3NC0 B;  4HNA B;  4FLW A;  3HKC B;  2VQE H;  4AIL C;  5LMU B;  4Q6G A;  5FPO A;  1JFF B;  1Q8I A;  3HKD B;  3KYH C;  4UCU A;  5KHJ A;  4O4I A;  1FFX B;  5IJ0 A;  4UFZ A;  3GDE A;  4FM0 A;  5JJJ B;  3L4J A;  1Z5V A;  4O2B A;  4DK0 A;  2YIB D;  3L2P A;  3KAJ A;  1P49 A;  3PN1 A;  4DR7 H;  3OTO H;  1YEW A;  4BWA A;  4IIJ A;  2Q2T A;  3RYC B;  3JAM W;  2VOB A;  5EZY B;  3ZS8 C;  4U3J B;  1IBM H;  4CS3 A;  1M0W A;  3E22 A;  3J81 W;  3S24 A;  4X1I A;  1KMI Z;  1N36 B;  1HNW H;  1XMQ B;  2JVD A;  1XMQ H;  3MAQ A;  3A2F A;  3RFR A;  3U11 A;  2HGS A;  5LOV B;  3QG5 A;  4LFC H;  5ITZ B;  3VQW A;  5EYP A;  1A0I A;  1SQG A;  5J2T A;  1P8L A;  5LOV A;  2PY5 A;  3SJC C;  2UUC B;  5EYP B;  2ZIM A;  2F1M A;  1HNX B;  5JJN B;  4B3M H;  4O4L A;  1FJG B;  4NXN B;  1BGW A;  4JV5 B;  4I50 A;  4ZOL A;  2HHH H;  4J0M A;  4RB1 A;  2UXC H;  4D7S A;  1Z2O X;  5CB4 B;  4JI3 H;  4DUZ H;  4PI0 A;  1M0T A;  1D5A A;  2HVR A;  3BAA A;  5KHI A;  4K0K B;  4CC5 A;  4MV9 A;  2YIB A;  3K57 A;  4DR4 B;  5DIS C;  5FD5 A;  3RTX A;  4TOI A;  1SQF A;  5IWA H;  3SR2 C;  1Q5O A;  1WN7 A;  3L4K A;  5FD6 A;  5BR8 H;  2HEP A;  1WH2 A;  4DV0 B;  4PZ6 A;  4JI0 B;  4O4H B;  4EFB A;  3N40 P;  4EFE A;  1XK5 A;  2F4V H;  1FVI A;  5A2Q W;  3NBY B;  4O2B B;  1HNZ B;  4X62 B;  1M4U A;  3HKE B;  3JAR B;  4AQY H;  4DV4 B;  3LNN A;  4B3T B;  1BJT A;  2KSW A;  2XIG A;  4R7R A;  4B3R H;  3RYH B;  2HHH B;  1CKO A;  4JV5 H;  4NXN H;  5KHH A;  4CH4 A;  4ZI7 A;  4LFA B;  3JSL A;  5KHK A;  1TVK B;  4LH7 A;  2VPS A;  4YY3 B;  4KHP H;  1JMK C;  4TUY B;  4X1I B;  4LF7 B;  3ZED A;  1N36 H;  2BTQ A;  4ZHQ A;  2PUS A;  4K8Z A;  3F8N A;  5LMN B;  2HVS A;  5JCO A;  4FM9 A;  3BA9 A;  3HKC A;  1XNR B;  4DR2 H;  3RGB A;  4LF5 H;  5J2U B;  1JFF A;  4YJ2 B;  4AHC A;  1FJG H;  3UT5 A;  5IJ9 A;  3UT5 B;  4ETS A;  3K59 A;  4GYC B;  4X65 B;  3E22 B;  1SYX B;  5JVD A;  4PZ8 A;  2VWK A;  1ZHQ A;  5LMN H;  3N2G B;  4NXM H;  2HVQ A;  4FLX A;  3SJB C;  4YJ3 A;  4IIJ B;  4JI5 B;  3CSX A;  2YI8 A;  5D5P A;  4LF9 H;  4LFB B;  4DR1 H;  1DGS A;  1O9G A;  2CW8 A;  4LSA A;  4DV1 B;  5JJE B;  4X20 A;  4EQ5 A;  3BA8 A;  4LF6 B;  4F6R A;  4YY3 H;  1IBK B;  3JAK A;  1FFX A;  5FPR A;  4O4H A;  4DV5 H;  4DR3 B;  3N43 B;  2YI9 A;  2PTM A;  2UXD H;  4I7H A;  2CAZ C;  1HNZ H;  3HKE A;  5D5Q A;  2ZIO A;  4HBN A;  3GB8 B;  4LNU A;  3RF2 A;  3RJ0 A;  1N34 B;  3K58 A;  1V9P A;  5LMU H;  1E4G T;  3N6X A;  4DV0 H;  3K5O A;  5JH7 B;  2F93 B;  4DV5 B;  2OWO A;  4LR3 A;  1TA8 A;  4PHZ A;  1S68 A;  4PI2 A;  1J5E B;  1ZHS A;  3KXY T;  5LA6 A;  4DRX B;  3K5N A;  1P16 A;  3JAL B;  4WBN A;  2Q0A A;  3H20 A;  4LMY A;  4YJ3 B;  1Q43 A;  2E3C A;  4DK1 A;  2W57 A;  1O75 A;  1WNS A;  4LFB H;  2Q2U A;  4LF9 B;  1TGO A;  3J80 W;  4CH6 A;  1Q3E A;  1XI1 A;  1L2Z A;  4TQF A;  4X20 B;  3RIZ A;  5C8Y B;  5GON B;  4LF4 H;  1Z5W A;  4LF8 H;  2ZCE A;  4RAZ A;  1GYF A;  4FM2 A;  2Q7G A;  2UXB H;  4JI4 H;  1I94 B;  4RB0 A;  2UUB H;  4JI1 B;  4D7T A;  4LF5 B;  4DR2 B;  2O03 A;  4E6N A;  5FLX W;  4O2A A;  4X1K B;  4DUY B;  4JI2 H;  4JI7 B;  4CS2 A;  3RYI A;  2HIV A;  3K5L A;  1S03 G;  5J2U A;  1HW7 A;  4FFB A;  4KHP B;  2E5L H;  3B2E E;  2V4D A;  2BTO A;  4DV6 B;  1I6U A;  3M7M X;  5LYJ B;  4FLV A;  2UUA H;  4LF7 H;  1TAE A;  1ZAU A;  3CB2 A;  3IAY A;  3OTO B;  1N33 B;  4TV9 A;  3CVZ A;  2UXB B;  1N32 B;  2UUB B;  1TUB B;  5KX5 B;  4X62 H;  1XNR H;  5KX5 A;  5EZY A;  4AQY B;  2JS5 A;  4LF8 B;  2IM9 A;  1SEI A;  4RZQ A;  1XMO H;  4U3J A;  2XHB A;  1XNQ H;  2PYL A;  3QF7 A;  1HR0 H;  4F6R B;  4OX9 H;  3RR5 A;  4DV2 H;  1IBL B;  3WB0 A;  3KAL A;  2R72 A;  1QQC A;  2Q7E A;  3N2K A;  5JQG B;  5BMV A;  3W1B A;  4DR4 H;  4EEQ A;  3T1Y H;  3EYY A;  2PGG A;  5LXT B;  2ZNI A;  3N41 B;  2ZM6 H;  4LFA H;  5D1P A;  3T1H B;  5FNV B;  4JI3 B;  3JAK B;  4ZIB A;  4FFB B;  4X1Y A;  3N42 B;  1NT2 B;  2FE3 A;  4CH3 A;  3WB1 A;  4JYA H;  4PDB A;  3BHP A;  4JI0 H;  1N32 H;  4DR3 H;  3JAS A;  3HKB A;  2UXD B;  4B08 A;  3THO A;  3QTC A;  3HKB B;  2UUC H;  3TY9 A;  1G6U A;  1HNX H;  2CFM A;  3CHX A;  4UCR A;  5BR8 B;  3RYC A;  3T1Y B;  5IT9 W;  5IYZ A;  4L8J A;  1AN7 A;  4LSX A;  4DR1 B;  3UQ8 A;  3RGZ A;  4DV1 H;  1KU9 A;  5C8Y A;  2UU9 B;  1J5E H;  2P5O A;  1I7F A;  4OX9 B;  4I4T B;  4A2B A;  2ZJT A;  5ITZ A;  4BW9 A;  4I4T A;  4K0K H;  4LH6 A;  4EB6 B;  2R9A A;  1X9N A;  2R70 A;  2WE6 A;  5BMV B;  4BWS C;  3RYF A;  4LNU B;  3RYF B;  1XQ8 A;  3JAR A;  2Q7H A;  4JI8 B;  4DRF A;  4NVP A;  3K5M A;  4APM A;  5GON A;  4I50 B;  4B3M B;  4X1Y B;  4DV6 H;  3K3V A;  4B3S B;  3SJA C;  5D1O A;  3U10 A;  3NBZ B;  1FKA H;  2QM4 A;  3DF7 A;  3JSN A;  2BTQ B;  3OTF A;  3TY5 A;  4DRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...