3JSNA

Crystal structure of the adenylation domain of nad+-dependent dna ligase from staphylococcus aureus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
306
structure length
297
Chain Sequence
DLSSRVNELHDLLNQYSYEYYSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the adenylation domain of NAD(+)-dependent DNA ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA ligase
total genus 106
structure length 297
sequence length 306
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jsnA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3jsnA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jsnA02
4DRFA 4LF8B 1S68A 4JI2B 4UFZA 4K0KB 3NC0B 2VQFB 4DR3B 3TY9A 1I94B 4DV7B 4JV5B 2HIXA 3QWUA 3TY5A 3NBZB 1N36B 4JI4B 4JI0B 3S24A 4DUZB 3W1BA 3TY8A 5FPRA 1HNWB 1A0IA 2UXBB 2VUGA 4DV0B 3RTXA 4UCOA 4DUYB 3GDEA 4LH6A 4DR5B 3BABA 5BR8B 4TOIA 4GLXA 3RR5A 1DGSA 3GJXB 5IWAB 4LFAB 1XNRB 1CKNA 4DV5B 2HVSA 2UXDB 4DV3B 4UCTA 2UUCB 2ZM6B 4LFCB 4UCSA 1HNZB 5FPOA 3UQ8A 4DR4B 4X64B 5DISC 2VQEB 1B04A 4LF4B 1FVIA 4LH7A 2UU9B 1N33B 5LMNB 4UCRA 4AQYB 4DV1B 3GB8B 4PZ7A 4X66B 4PZ6A 1FJGB 3NBYB 4LF9B 1J5EB 4GKJB 1CKNB 3L2PA 2E5LB 1P8LA 4EQ5A 4OX9B 3BAAA 4CC5A 4B3TB 3T1YB 3JSNA 1P16A 2HHHB 4DR6B 4KHPB 3KYHC 3BA9A 4JYAB 1XMOB 1XMQB 1IBKB 3SGIA 4DR7B 4YY3B 1HNXB 4JI3B 4DV4B 4UCUA 2UUBB 1VS0A 1V9PA 3JSLA 1IBMB 4LF6B 2UUAB 3VNNA 4LFBB 2Q2TA 3W1GA 2Q2UA 3PN1A 4NXMB 4JI8B 4DR2B 4EFEA 2UXCB 4DV2B 2HIVA 5D1OB 1N34B 3T1HB 4PZ8A 4JI1B 2HVQA 4EFBA 4B3MB 2CFMA 5D1PA 4JI6B 4EEQA 4B3SB 1CKMA 1TA8A 1N32B 4JI5B 4LF5B 2OWOA 3BA8A 1XDNA 2HVRA 1IBLB 4NXNB 4CC6A 3OTOB 1HR0B 4DV6B 2F4VB 1ZAUA 4E6NA 5LMUB 4X62B 5D1OA 4X65B 4DR1B 3W5OA 1XK5A 4LF7B 1TAEA 4B3RB 4JI7B 1X9NA 1XNQB 4GKKB 4YHHB 1CKOA 4UCVA
chains in the Genus database with same CATH superfamily
4WFEA 3KAJA 1KKDA 5LHHA 1SA0A 3SJAC 4FMTA 3RB3A 3TXQA 2FL4A 2YICA 2ZXWC 2P7TC 2W9AA 3ZRSA 4KP4A 1Z2PX 3NBZB 5BYAA 4ZOLF 2QYZA 4ECSA 1VQPV 4JI4B 3E5NA 3ZMVA 5KT7A 3OUUA 3IN5A 1KU9A 2YZMA 4QWBA 3L4KA 2VUGA 3RTXA 2RN9A 3M8AA 3T9BA 3GIMA 4YHHH 3ZCCA 4MVRA 1KT8A 2ITCC 3JASA 2GSMB 1SCUB 1YTFD 3T9CA 2DPJA 4ZOLA 1BCCH 4X64B 3ABKB 3JD1A 5L3FA 2ZDHA 4JI6O 5I5XA 2J6TA 1R6TA 5GONA 4DK0A 2QWQB 1FXKA 1KJ8A 3BHPA 3CQZA 4O4JB 4O81A 4NVPA 3ETEA 1JFFB 1DV1A 3LSUA 4A3EG 3AG7A 2IH3C 1N56A 2AQ4A 1P8LA 4TQFA 4E4TA 2JA8G 2CGNA 4FPPA 1Q7YW 4JV1A 1EZVH 4X1IB 2Q67A 2QK4A 2F43G 5D5PA 2A0LA 4MV8A 4DUYH 1FXKB 4QIWE 3GTGA 4O4JA 1K3EA 4FM1A 1FD9A 4RO2A 1QLNA 2OTLV 1VBHA 5CAEB 4FM2A 1V4YA 3BQ2A 3E22B 3FB7C 5K3WA 2ADQB 4J9KA 2GUZA 2MW2B 3DTUB 1IBMO 4OPHA 1HDJA 1L0NH 1HW7A 4BIZA 4RZQA 2EIMB 3SYAA 3RB6A 3FMAA 2CH7B 1KUQA 3OAAG 4X1IA 2FLPA 3MAQA 2AHYA 2EJ2A 1VIBA 2UU9O 3IJ4A 4JTCB 3RGBA 4APMA 3FB6C 2HVKC 1Y66A 3D36A 5JQWA 3WU2Z 2R8HA 3ICXA 1QLEB 4O4LA 5J2UB 4K8XA 4DV6B 2F4VB 5DLFA 5KFFA 2QEXV 1XHXA 2LW7A 2B5UA 4GYCB 5B3SB 3GIPA 1BNCA 3WO1A 4DK1A 3N2GA 1FS0G 3J7AU 2EJRA 3K3WA 2COIA 2XGPA 3ZHVA 5LXTF 5IWAH 3Q8QB 3NUAA 3PO2G 1S68A 2XCPA 4TQRA 1ZSPA 3ZHTA 1W93A 4TT3G 1NTMH 3JD0A 2Y69C 3V6JA 3G4SV 4JI0B 5JVDF 5KT5A 3PR5B 2MK3A 5IYCG 2ZDIC 1JX4A 2V59A 4DL6A 1OWTA 1KTAA 1N34O 4WFBV 4R6ZA 4YY3H 2FK3A 2W9CA 3Q8RB 3RUPA 2HVSA 5CB4A 2UXDB 3RYCA 2ZDIA 4Q4CA 2KSWA 4EBDA 4LFCB 3B4SA 4ZIBA 1SQPH 5FLMG 4B3TH 2EIKB 3OW2U 4QIWF 5CBFA 5IJ9B 1J95A 1VQ4V 3CYOA 3H0GA 5KFQA 2V7QG 3ASOC 5BMVA 3CRRA 3LSSA 4O4HA 1MZBA 3N41B 1R9TA 4J9QA 4DIMA 3VQYA 1FYJA 3GTKA 3V4ZA 2XTAA 4MTOA 1UJWB 1MMMA 2QKCA 1F51A 4O4IF 3RYCB 4JI6H 4YBZB 5TISZ 3GQCA 5LMNO 3W7SA 2R6FA 2A3QA 3T1YB 1L1FA 2ZKOA 4K0KO 5JCOA 2EIJC 1PP9H 2B9ZA 4Q20A 2IA6A 4O4HB 3P3PA 4BWSC 4WD3A 1OCZC 4RUCA 2F23A 3GTPA 5JQGB 4JYAH 1YXBA 1JCHA 3GIDA 3I4NG 2HFEC 3ZHRA 4J9YB 3MD0A 4G28B 1IXBA 2DABA 5K1PA 5LXTA 3RWRD 1V54B 4O2AB 2WLLB 3TW6A 2LQTA 3LNNA 2WLIA 4NYKA 4J9SA 4FBUA 2OYQA 4IHJF 2PN1A 2BSKA 2GTAA 4KFMA 4YJ3A 5EWFA 1TWHA 3GTLA 4ED3A 1K92A 1KP2A 1UFIA 3J80N 3TINA 4J9MA 1ZQ7A 2JGDB 2XASA 5JJNB 3HKCB 1KYOF 1WJZA 2XCAA 1GRJA 3PW2A 3JARB 5JWPA 3CPWU 4MTFA 3LSQA 1KJIA 5I5UA 3CHXA 2WLLA 4GCZA 5KLVH 2D2CB 3H1JH 2AZ2A 4IIJF 3T1HH 1YDXA 5L9XA 5DECA 3CVZA 3JRXA 4Q8FA 4X64O 1HP8A 3JAMW 4Q43A 3UO3A 5KFTA 3ML0A 2KKWA 3TY5A 3Q2OA 4HNTA 2X0SA 3JD2A 1AR4A 4A5UB 3ZN0A 3D3QA 2YXYA 4CS3A 2X7RB 4WCEV 1WP8A 4X88A 4CKCA 4DUZB 1H2NA 4I4TF 4YJ2F 3HKCA 1A0IA 5JVDB 4NXNH 3VOUA 3O65A 3CEIA 2R8KA 1PL4A 3MR2A 2WAQA 4QWDA 3BABA 4LFBO 2CAZC 4LFAB 2ZE8A 2JEGA 4UUJC 3G67A 1Q81W 1XNRH 2PI4A 2DWCA 1HNXO 2ZM6B 5B1BB 3T99A 1I2LA 1M9NA 4K6NA 5CN0A 1FKAH 1NTKH 1H2GA 4XZ3B 1N33B 2FMLA 4AQYB 4X1KB 2P06A 1N0JA 3GB8B 5GONF 4C5CA 2Y4UA 5EWEA 3JYCA 5EDWA 1V55C 2ABJA 2WDTA 5CA1A 1G1XB 2X6BA 3L71H 4FFBB 1QCEA 4GKJB 3V6KA 3L2PA 4A3MG 1M0WA 2HLDG 2B1IA 3F8NA 5CE8A 4OX9B 2HJFC 3BAAA 1IYDA 4FFMA 5BWVA 3RV3A 3U54A 2D3OW 1Z2GA 2ZR2A 2LGWA 2HP8A 5IYZA 3A0BZ 3K06A 1ZWIC 3V4SA 1DF5A 4LBEC 3F7YC 3EXAA 1XQ8A 4LF6B 4YR0A 1MOFA 2JGUA 1VARA 3HOVG 4CH6A 4QPJA 3C0FB 3M99B 3K0GA 4FFBA 1XOUA 2HHFB 4Q44A 4FLVA 4RAYA 5H9CA 4C5AA 4DRXA 5CBHA 2VWKA 4DL7A 4LC1A 1YHQV 2BQ3A 3FYEB 4FBTA 1K8AW 4DR1H 5KFNA 2CNUA 2ZDQA 4R7CA 3QVNA 5BY1A 4DV7O 4MV3A 4GKKO 3BA8A 3CCRV 3K5IA 1S03G 1KB9F 1RSOB 3FAVB 2ZT9B 4GUNA 3IGAC 2J6UA 4LF5H 2YZGA 1IBKH 2PMZA 2DE0X 4E6NA 1YJWV 2YS8A 2HHFA 4RCNA 1M4UA 4J80A 1MSDA 5IP7G 3H40A 3GIKA 1N0NA 4DR1B 4FU0A 1BQZA 3TIGA 5KG7A 1IBLO 4DV5H 3IC7A 1XNQB 4J41A 1KECA 3TXSA 5DQIA 5DN6G 3DC5A 3EPIA 1B06A 1Q86W 2ATKC 2QR4A 2XC9A 4J7ZA 3CRAA 2HIXA 4MSWC 2DYSB 2UXXA 1YI2V 1RSOA 2ZE5A 4IYHA 5FNVA 4O4LB 5J2UA 2YWVA 3MFIA 1PNLA 3HO8A 2NU8B 3S24A 4YP3A 5LMUH 4JF3A 2GHYA 5L3CA 1DTOA 2DQ0A 1G8MA 5KT4A 3HKBB 2EINB 2CGOA 1TVKB 5A2QN 1Z2OX 4JV5H 4UCOA 4DR5B 2Q0OC 3H1HH 1YIJV 3RYHA 4UUGA 3PW4A 4FFLA 2AXTZ 5HFMA 4MVZA 1Y1WG 1VBGA 1S72V 4K35A 2UUAO 3E89A 1VP7A 4OX9H 2YU9A 4DR4B 4FGRA 2JK5C 1KP3A 4IR9A 1EZ1A 3OHBA 3M4IA 4BW9A 4HNAA 2PVPA 4UCRA 4DV5O 3AK1A 3HKBA 1AN7A 1TVKA 5FLXW 4I9QA 2W8LA 3OEHG 3KCYA 2ADPA 1N33H 2W71A 1Y14B 4MW8A 4TUYA 2FMAA 1Y76B 3WNZA 4EQ5A 2FLLA 4WFHA 2ODMA 1TGOA 1WPBA 3G8DA 2HHHB 2FB5A 5KKNB 5KAFZ 1H8EG 5B5EZ 4MV4A 5E79Z 2UUAH 2HGSA 2ZNIA 2CTQA 2XD4A 2ASDA 4O4HF 4JV2A 4FFRA 4DXWA 1XMOH 1GKFA 2UXBO 3K58A 4JI7H 5KHHA 4ECTA 1SETA 1KUTA 1D2DA 4NTYA 1SZXA 5D5QA 5I5TA 3SJCC 4JI6B 4A3DG 3S3WA 4I0XB 3ASNC 1YJ9V 4O3RA 1A0GA 2DLNA 1YTFB 3QQMA 4QW9A 3O9OA 2W6QA 2OIGA 5DEDA 4NXNB 3PR4A 1IBMH 2JS3A 5JQGA 3FD9A 4PDLA 1AILA 1SC5B 1S0VA 4DL5A 1HNXH 5LMUB 3R23A 4K3AA 3H1LH 4F4XA 4IRDA 4J9NA 3KTMA 3UT5B 5L1LA 1WB7A 4MVQA 1TAEA 3LDCA 5IY5C 2NU9B 2PY5A 5C44G 1UNNC 5KG0A 4JYAO 4F4YA 2BSKB 1I1MA 4YJ3B 3TY9A 1I94B 4CMDA 1QBZA 1TUEB 2R7NA 1G2WA 5H6RA 3H0GG 2C2EA 4E2LA 3NGDA 1NVPD 2JGDA 5FPRA 3ZRWB 1AUXA 2EJ0A 3SPGA 4JI8O 2F95B 5IWAB 2QWRB 1CKNA 1WAZA 2Q68A 3T9AA 4EBEA 4KHPH 1S0MA 2E76B 3CSWA 4PBCA 1QHTA 2Y4TA 1HNZB 3RYIA 2VUMA 5DISC 2QM4A 5EYPB 2YDEA 4QE7A 1W59A 3FB5C 4LF4B 4I55B 4GX0A 2W6OA 5LMNH 1TUBB 2KG7B 1DIKA 3TGUH 3AG2B 4LSXA 4I9WA 4UXNA 5BWTA 2R92G 1F4NA 3R5XA 4DV2O 4ZQIA 3LDEA 2C28A 5DGIA 2VS0A 5CA1F 4BW5A 1FXHA 4MT8A 3STZC 3GV8B 3VQVA 2EIKC 1RJPA 1BGYH 2DW4A 4JAAA 5EYPA 4LF5O 3G8CA 5H80A 1OCCB 5KFYA 5FD6A 3WWHA 5EIBD 4EGJA 1XMQB 3MJFA 4YHHO 2YUAA 4NB5A 3GTMA 5LHGA 3TW7A 2ZDGA 5BWWA 1WA8B 4C2MA 2X5RA 2AW9A 1OJHA 3VQWA 3SYCA 4JI8B 2Z02A 3HB3B 3CP1A 1GN6A 1VQNV 1YZBA 5KFGA 4CH4A 2WA4A 3E2EA 3AG4B 1K97A 1AI5A 4EFBA 4RU9A 4JI1H 2YIDA 4HNVA 2IJKA 5BPFA 4Q8EA 5KFLA 5KFSA 4F6RB 1Y1VA 1K5QA 1H8HG 3ZJZA 1SQQH 2ZGIA 1MZEA 2F66C 3DSQA 4ZBMA 1SESA 4HYOA 3RW0A 4NTXA 4DR7H 1C30A 4O84A 5C1PA 5KFDA 5IYDO 1WCMA 3K08A 4X65B 1I1KA 2YXHA 4HBNA 4DRXB 4ECVA 4H0LB 2JIZG 1IDSA 1RM1B 2GQSA 3VA7A 2P4KA 4I7HA 1R3IC 1AUVA 4JZ2A 4JASA 3T4DA 3CJHA 1K5SA 1CQJB 1ORQC 2ZNJA 3MHHC 4X89A 1Y74A 3DC6A 4DV1H 1XILA 5KG6A 1SQGA 2ITDC 2ZE6A 3T1HO 1ZLZA 1HNWB 3OUFA 2UXBB 1U96A 2FKLA 1IYEA 1I08A 3C3TA 2JEIA 1DGSA 3RYFA 1JVMA 4DV5B 1L0LH 2I80A 3G6BA 4AI8A 3SI8A 1OV9A 4TV9B 5C8YF 4CS4A 1CXZB 3CJHB 3RAXA 3M7MX 2FPIB 2YS6A 1GN2A 4ZHQB 2GDSA 3ZHSA 1B6QA 3HKZE 4RB3C 4PZ7A 4WFFA 1THZA 2M7WA 5FNVF 4O3NA 5H2FZ 4RNNA 2ZE7A 1Z5WA 5CBGA 2X6CA 1VKZA 1G6UA 3W7WA 1KEEA 1BJTA 5LMUO 3LQSA 4JPRA 2FK2A 3SPJA 4KXRA 1ZX3A 4H33A 3JSNA 3QF7A 4YR3A 3R66A 2WLHA 2Q73A 3K5OA 1KD1W 5KT6A 4H37A 2VUMG 5EZYA 1PV0A 4EBCA 1HNXB 4UV9A 3RIZA 3SYQA 3KHHA 4EYIB 1E4EA 2UUBH 1IBMB 5H6QA 4O7ZA 5DG7A 3UZOA 4X20B 4WBNB 2Q2UA 3P30A 4PDMA 5KFOA 1AVMA 1Y76A 3TETA 4LF4H 5EK0A 1K34A 4B3MH 3R65A 2YIBD 3N27A 2CK3G 2BTQA 4L87A 1YITV 2O03A 4IRCA 3JZFA 3EFFK 4CBCA 2A79B 3UO2A 1S76D 1GAXA 1I2KA 2GPWA 1GM8A 3RJ0A 4PA6A 3BJYA 4LF5B 2OWOA 4OXSA 1XDNA 4LFBH 1IBLB 3D36C 4LF8O 2XAGA 2VQDA 4O7YA 1WSCA 4ECRA 1FFTB 4AQYH 3OUSA 4JI4H 2JRIA 2R86A 1ZAUA 4JI0H 2B63G 2K9PA 2P67A 4RUAA 1FKAO 4LF6O 4TVIA 1SQXH 3CX5F 4NZNA 2UUBO 4J9PA 1S0NA 1N32H 5C8YA 1X9NA 1XREA 3K03A 1I7LA 1CEZA 1XMOO 4DRFA 1IURA 4LF8B 3CMEV 4YY3O 3JZIA 3MWEA 4LF4O 5KFCA 4EB6B 5I60A 4UB6Z 3BRCA 5I5SA 5GONB 1VF6A 2A06H 4JGSA 4LF9O 3QO8A 1T36A 3W7TA 4DO2A 1R3KC 2H94A 4IT5A 2UXCO 1ZHQA 2BQUA 1SQVH 1I7NA 3SPCA 5C8YB 1M6VA 4KUMA 2R84A 4DV3B 5L3BA 4GKJH 3RBDA 3NR7A 1QNMA 2R85A 2YRWA 1PL0A 4PA9A 4UVBA 1XI1A 4FFPA 4IRKA 4BXXG 4QGPA 1K4DC 3BEHA 5EBMC 1FXKC 5KFPA 2RNBA 4I4TB 5K2MA 3Q8PB 3RBEA 4PDVA 4Q0YA 4X65O 2VQEH 4NKGB 5A9GA 1E4GT 5IJ0A 4FIPC 3ETJA 2EIYA 4CS2A 2YIBA 2UU9H 1CKNB 3UYYA 4M9UA 3A2FA 3ZMUA 4UVCA 3RYIB 4RB1A 4DR6B 3H4DA 5B1NA 4RWUA 3JCUZ 4JTAB 3TK1A 4EG0A 1AR5A 2UXCH 1BHBA 2R70A 3SGIA 2Y69B 5E1AC 1BXRA 3FKIA 5DQGA 1M56B 1XUQA 4I4TA 1V9PA 3HOZG 4O4JF 4LFBB 5KT2A 2VQFH 5DM6V 2PF4E 3WG7B 2HJWA 2UXCB 1B6RA 4B7KA 3T1HB 2OLSA 1WCMG 4CZZA 1M56C 2XNDG 4JI1B 4RUEA 2CFMA 1Q3EA 2ZM6H 2XAQA 2YEVB 2ZIMA 3RT3C 2E5LH 4X8AA 1AP5A 5KFZA 1N32B 1MABG 3RV4A 1OCRC 4JI5B 5BWRA 1FJGH 3OTOB 1V51A 1EUDB 3N42B 1PKXA 1CE8A 2ZIOA 1Z2NX 4YJ3F 1VF5B 3K59A 4DR2O 1K1SA 1JA8A 4X9QA 1S9FA 2IMWP 4DUYO 3L74H 3ORQA 1LNQA 3M9OB 3Q8SB 4LFCH 4HNUA 1MZFA 4B3RB 2A1HA 3HKEB 5CB4B 5J2TB 4LF9H 3KG2A 3H20A 3H4BA 2W8KA 1J5EH 2X0LA 1FPOA 1MNGA 4H13B 5KFWA 5KFVA 4X62H 1NBMG 4HQ6A 5L3EA 4JV0A 2QM7A 2FKXA 4FLZA 5BPHA 4CKEA 4K0KH 2GTSA 3OHAA 4O2BA 3ZS8C 3E8BA 3BVOA 2DMXA 1EUCB 1BZKA 2AGPA 1SRYA 3HKEA 3G6EV 4W4KA 1Y67A 2L35A 2PYLA 1NKDA 1SERA 2WE6A 4NXNO 3N8DA 1Y74B 3MHSC 4U7CA 3OM3B 3TQ1A 1XMQO 3AW8A 2WB1E 4JI7O 4GZRB 2NR5A 3HR0A 1K33A 3ZHQA 1SKVA 2CDYA 2A7WA 1Y1WA 5L1JA 4Z2WA 1DLBA 4TWKA 2A9HA 1H38A 3GV5B 3BG5A 4QSHA 3K3PA 3WWIA 3LNMB 1WRVA 1RJRA 4LF9B 1SS3A 1XEQA 4PDBA 3AX6A 2WLJA 2CQYA 3IG0A 5LBQA 1NU1H 3PZPA 4IWYA 2NN4A 3T1YH 4CC5A 4TQDA 2ARHA 1OHHG 2WLKA 2ZJTA 3ZRVA 4Y8VB 5KFIA 3X2QB 4O2AA 4MV1A 2VQEO 2FK1A 3KYHC 4X65H 5C4XG 3JALB 5DG8A 1JR9A 2C2RA 4O83A 2CE4A 4JI3B 1PNKA 2UXDO 3ASOB 1NH2D 1M57C 1QR8A 3PO3G 3VNNA 5CA0F 4KL1A 3CCUV 2IM9A 1A3GA 3FDSA 4MTXA 4DL4A 4TQSA 1E1RG 3N40P 3D3IA 1W0KG 5D1OB 4O2AF 2W6ZA 3KCXA 3NXSA 3BQ1A 4D7TA 4MTGA 2ZR3A 2WYOA 3CMAV 1V55B 1LUWA 2Y0PA 3E86A 5B1AC 5EZYB 3UKMA 2QSAA 1EBOA 3DXRA 4P2ZA 3KXYT 2AGQA 1VEWA 3OMAB 1H2SB 3K5MA 2YZLA 4JYCA 1WPXA 1WLEA 3G6VA 1HR0B 1W96A 4O7RA 1YF2A 1CQIB 1N36H 1WR2A 2HHHH 2R87A 1I1LA 1BE3H 1TWGA 2R9AA 2Y48A 1FJGO 5DG9A 4F4ZA 1VAJA 4YIPA 2IU3A 2EILC 2YS7A 3JASB 4DR7O 4YHHB 2NUAB 4FLYA 4J7KA 1JQ0A 3RFCA 4XDKA 2JVDA 5KFJA 2V1DA 2V4DA 3U9TA 1KBLA 1QLEC 4FFKA 3JAWB 4YR2A 4PD4F 4FM0A 3QG5A 3APOA 1LR1A 5DMXA 3EVKA 4DV3O 1M1KW 1HWYA 2OCCC 3TY8A 3F5WC 4QE9A 3T1CA 3F7VC 5A2QW 2FYUH 1I6UA 5CA1B 4YJ2B 4RAIA 4FZ1A 4AYBE 4UCTA 3K5HA 2W7PA 2NNUA 4ZI7B 3K3VA 1SA0B 1M0TA 2PUSA 3JAWA 4UVAA 4BY7G 4ED6A 4JV5O 1ZHSA 4MVSA 4B3SO 3RVZA 3DTGA 3QTCA 5FL7G 3HBLA 3SYOA 1N32O 1SQFA 2FE3A 4ETSA 1WN7A 2E74B 4PJ0Z 4JI5H 4IHJA 3RGZA 2J6SA 1J5EB 3E22A 3OT7A 2RDIA 5FD5A 1JMKC 2Q69A 1GO3E 4ECZA 1XMQH 2GUZB 4FZ0A 1AB3A 4ZI7A 4ED7A 3VBBA 3UCSC 5BMVF 4YAKB 2Y0SA 4QWAA 2RCVA 3T5KA 5HBRB 1KC8W 4DR6O 1S3JA 2PI5A 1F7YA 3GLKA 3L70H 5GTIZ 5KHGA 1Q90D 5KG3A 1S0OA 4UCUA 2LO1A 1VF7A 5IYCO 2EINC 2Q2TA 4LWSA 3FAVA 3PN1A 5IJ0B 5KAIZ 1M7JA 3CS5A 3KKYA 4EFEA 2FB9A 4ME6A 4DQNA 4CMFA 2DYSC 2B63A 1RPRA 4MA0A 2HVQA 3TIIA 4JI2H 4AQYO 5KHJA 3N2GB 3SNOA 3PW0A 3ABMC 4BBSG 5CB4F 3GIIA 4DV2H 5I5VA 4J42A 1N36O 2XT9A 1IX9A 5FR9A 3L75H 2XIGA 4DR5H 1QU7A 5DAAA 3OSNA 2PBZA 2ZXWB 4J11A 2ASLA 3T9EA 5I47A 4AYBA 4DW0A 4LMYA 2VA3A 4XDLA 3DAAA 4ZKIA 4O2BF 4C5BA 2W57A 1ZUQA 3ZIAG 2LW1A 3JAMN 5LOVF 1T5EA 4NXMO 3AYHB 1K4CC 4GX1A 4PELA 4YIOA 4GKKB 3I56V 5LA6A 3WG7C 4R8UB 2YXLA 2OCHA 4CH3A 2QGNA 4CHIA 2VOBA 4FM9A 5GTHZ 2Z3YA 4EKWA 5BZBA 3QWUA 3N43B 1YJNV 2E5LO 4CE5A 4FFNA 5J2UF 3BY6A 3LP8A 3T7AA 3P32A 2Y0SE 3WB2A 5KFKA 2BTOA 3CSXA 2AGAA 2HVJC 4UV8A 4GLXA 3U55A 3CCSV 2YSUB 2DWDC 5LOVB 4RNMA 5LA6B 3SPHA 4FS1A 3E35A 2VA2A 2QKAA 4TV8B 2VQEB 1B04A 4L1KA 5KX5F 1FVIA 4LH7A 2E3CA 4DUZH 3A0HZ 2UU9B 1A48A 4Q4DA 1N48A 2E2HA 4NXMH 5L3DA 4O4LF 4A93G 2P0AA 1XNRO 2VPQA 1SZTA 4AILC 2G38A 2BR0A 2DIKA 2VPSA 5EOYA 4DV0O 4NZOA 1FJGB 3SJBC 1XDCA 5BR8O 4PA4A 3OR7C 4PI0A 1YVWA 4B3SH 3VPDA 2DYRB 5EBLC 5KA5A 2ZCEA 1L8DA 3OR6C 4E4EA 3BA9A 5F9LA 2JJ1G 5BMVB 2IJHA 1IBKB 2BCCH 1SQBH 4DR7B 4BIOA 1WNSA 3B09A 2VRZA 5KFXA 3KHLA 5EC1C 3JSLA 2UUAB 1BS3A 3KALA 5KUKA 1K7DA 3AG3C 4B7EA 3JZ6A 1OBDA 1S97A 1AI6A 3ZHUA 2CNVA 4BR6A 4PZ8A 1P49A 4YB8B 5LL6Y 4BY1G 2QB5A 4FS2A 4IL6Z 3UT5A 2P6JA 3W7XA 1IBKO 3B8NA 2UXNA 3ZMZA 4DR3O 3OE7G 4J7JA 2CTPA 5LP6B 2GPSA 4JYYA 2UVVA 2HVRA 5KMGA 1WP7A 4B3RO 2AZ0A 4P9OA 4JI1O 3BFRA 4GX2A 1I7FA 2FTKA 4DR1O 3CCVV 1J5EO 2VR1A 3ETDA 1US6A 2XHBA 3ZEDA 2P5OA 4NYEA 2DPIA 3KAKA 1AP6A 4DV7H 1S5LZ 4X1YA 5LGUA 4JUZA 5KFUA 1JLLB 4RAZA 3AK2A 3RF2A 3T9FA 3GV7B 2LGQA 1RPOA 4I7ZB 4MV9A 1CKOA 2UVRA 2COJA 3HOWG 4F6EA 3DXRB 3G6XA 4JI2B 2ATLA 4DV7B 5KMGB 4JV5B 1FAFA 1PD3A 3WB0A 3RAQA 1R1BA 1OCRB 1DK1A 5FJ8G 1GSOA 4G27B 3Q4HA 3W1BA 4MTDA 2XGQA 4X1KA 4OX9O 4RB0A 1AJNA 3JD3A 3JARA 4RQEA 1RJQA 2EX3A 3OGCC 3GDEA 3RR5A 3DTFA 4F4WA 4LF8H 3OGIB 2Z04A 2LFRA 2EIJB 2HGXA 5I5WA 3RB0A 3VPCA 2JEUA 5FPOA 1ZETA 2FLNA 4FK5C 3T4ZA 1Q8IA 1N33O 2GLTA 2Y0IA 3SDLA 2ETNA 4RB2C 1PM9A 2QJ1A 2LP7A 5IYZB 1D5AA 2RMKB 3CCLV 2YW2A 4K8ZA 1R3JC 1AJQA 4TV9F 3TCUA 1M90W 5T14A 2XAJA 1F23A 1S10A 4DR5O 1NVPB 2C2AA 2UUCH 1VMGA 4GC6A 4DUZO 3N6RA 5JQGF 2W0XA 5AG2A 2SCUB 3K04A 3BQ0A 4ED0A 4LF7H 2XAHA 3TJTA 2WTFA 2UXBH 3CD6V 4CKBA 4J9OA 2YL2A 4W4LA 4J0MA 4U3JA 2H3OA 1Y6XA 1JKJB 4IWXA 1XL4A 4DV4B 1GGOA 1JFFA 1VS0A 5H5NA 2R7KA 2R7ZA 4DR3H 2C2DA 4IHJB 3DGEA 5DGAA 1JOYA 2NVYA 3U10A 4F50A 5I5YA 3HKDA 1N34B 1RM1C 4RZRA 5BWUA 4JI3O 3CRCA 3GWOA 1KQSU 4CH5A 4A3GG 1CKMA 4EEQA 2P4VA 1RK5A 1NR7A 4MAMA 3U11A 3L9DA 3H3VH 1IXMA 4A3JG 3V6HA 1B3QA 4A3LG 2RJZA 2JDIG 4A2BA 1XL6A 3WO0A 4DR6H 3R9RA 2DAAA 1HNZH 1OCZB 2IW5A 2YCHA 1I3QA 5B1OA 1NZ6A 3RYHB 1JXLA 3GIQA 2I8CA 1VQ5V 3PFFA 1GYFA 4JI4O 1I94O 4UCVA 1BSMA 5KFMA 3K0DA 4JI8H 4ECQA 4K0KB 2WLMA 4DR3B 1M5IA 1TWCA 5J2TF 3ABUA 4PI2A 1O75A 5B66Z 1EN6A 4JI3H 4ZI7F 4DV6H 4HNAB 2F4VH 3ZX6A 2DN9A 2HEPA 2JA5A 5LYJB 1EFRG 1UPGA 3T1YO 2N74A 4NTWA 1GO3F 2W6MA 4XX0B 3SPIA 3T5HA 5KA6A 2YI9A 5K1XA 3K57A 4LH6A 2FP4B 3VPBA 5BR8B 3B40A 3QNEA 3F5TA 3AEIA 2IH1C 4TUYB 4GT1A 4QNHB 5JCOC 2UXDH 2UUCB 1BL8A 2QA4V 5BWXA 1QR9A 1R6KA 4TSFG 2R93G 2JEXA 1NH2B 1MSWD 1XBLA 5C1OA 1MA1A 1VQ6V 1EKVA 4LF7O 4XYMB 4X66B 3LMLA 2CTWA 3CCQV 4X20A 4WBNA 4HAMA 1RK6A 2EULA 2FPPB 4ABMA 2WA3A 2Y4RA 2E5LB 4I50F 2E75B 4PDRA 3ABKC 5L1IA 2IJIA 4B3TB 3PJSK 3RFRA 5KFRA 2BTQB 2Q7EA 4KHPB 3JD4A 4I50B 3LULA 1GMGA 1E1QG 2HHHO 4I0XA 2WAQE 4WBNF 3UZBA 2R93A 4OGQB 3WWJA 3T9DA 2Q7GA 5HFLA 4JXUA 4O7WA 3J80W 1AROP 1OCOC 3QZ8A 3E8GA 4LCUC 3RBZA 1M57B 4M0JA 2CNQA 1VQ9V 4BIUA 2QDOA 3N6XA 1H2LA 5ITZA 3MWMA 2IJJA 4B3MB 4H44B 2W70A 4MA5A 1R3LC 1UC9A 3BCCH 3HKZA 2OT5A 3CCJV 2V4RA 2E2IA 4B3SB 1TA8A 3GVMA 4ASUG 5CMUA 2PGGA 1BT8A 2DOSA 2YC0A 1UC8A 5LGTA 2DYRC 1GK9A 3JATA 3WB1A 4A3IG 4DW1A 5IWAO 5DGHA 3ASNB 2ZM6O 2GQRA 3H01A 2Q9LA 2ZINA 2AHZA 3G71V 2JJ2G 4R50A 2C00A 4A3CG 3W5OA 4DYLA 1C3OA 5ITZB 3IAYA 3I5DA 3ABTA 3OMIB 2HR3A 5LXTB 4I5SA 1CS0A 4HR7A 4EYHB 4NLGA 1XHZA 3I12A 4O86A 1W2BU 2FJZA 1V54C 5LP6A 4GX5A 1SEIA 1Y1VG 5KS8A 2R72A 3JATB 4LP8A 1ZL8A 3K5LA 1KBHA 3HXLA 2R9RB 4I55A 1I5XA 2XUMA 1N36B 2NU6B 3CWBH 3LUTB 3BACA 1IOWA 3HPLC 3N44B 5F9NA 2Q4PA 4DV0B 5J9PC 3JCZA 3CB2A 2R9IA 2OIEA 4TOIA 3CRMA 1TWAA 2C35B 1XNRB 3LDDA 4LFAH 3ETHA 4J9RA 4I55F 3MR5A 1EYZA 3RN4A 4DV0H 3UQ8A 2BQRA 3FX7A 1DF4A 1ZL8B 4M7EA 2EZOA 3OEEG 1N34H 2QTOA 4U6PA 3L4JA 1VQ7V 4C7UA 1XNQO 4FLTA 5EWGA 2ILMA 3Q4HB 2HG5C 2PTMA 4O82A 3ZRWA 5CA0A 4DV1B 5JVDA 1WA8A 4YQWA 2OH2A 3CC4V 3SR2C 4O4IA 1JX9A 1ROPA 2YIAA 3C3SA 1N4CA 2W9BB 3EHBB 2B1GA 3ZRXA 2XAFA 2O57A 1Q6HA 4DV3H 3EPGA 2AU0A 3LWBA 2C22A 2Q0AA 3DF7A 3SYPA 3JRWA 4MVOA 2R7MA 3PW5A 3AG2C 4F6RA 2HG8A 3ABMB 1ULZA 3FFQA 1ET0A 5CA0B 1FFXB 2JA6A 1G4YB 2EZPA 1VQLV 3M9MB 2ZD9A 5CR5A 4ECXA 4TM5A 2R92A 1IVSA 1AR1B 1XNQH 3B2EE 2QKSA 3B77A 3BPZA 4IZOA 3HOYG 2R8JA 4DV6O 2F4VO 3T54A 2KB1A 4ECUA 1GLVA 3CCEV 4PWQA 5KFAA 5J2TA 2PZSA 3TEKA 4U3JB 5KUMA 1RFYA 3VQXA 1JIHA 1L2ZA 1RYRA 2LJ2A 5JH7B 4ED2A 4CC6A 1X4TA 2EJ3A 3CEBA 4MV7A 3ABLC 3CC2V 5HNEA 4ECYA 3AG3B 3CE2A 1MG1A 1NR1A 3STLC 3GILA 2YI8A 3HKDB 1B6SA 2W6IG 1JPXA 1GN3A 2RDCA 4MVMA 4A2AA 1FXVA 3QO5A 3D8CA 1GN4A 3SE7A 3K79A 3RYFB 4WF9V 1JDBB 3U0GA 5IT9W 4WFGA 4PHZA 1ZTEA 1I5YA 3X2QC 3E83A 4ECWA 5KG4A 3J81N 1NI8A 4TV8F 3VMMA 4G2KA 4IGGA 4JAUA 4D6TH 3IC9A 1AI4A 2QWOB 2PYJA 4JI2O 1URFA 2R82A 1CPYA 4LNUB 4KHPO 1SF9A 5LP6C 1PX2A 1LUVA 3HOXG 3FB8C 4WHXA 3ETQA 3CCMV 3RB4A 2HDKA 4J10A 2V9WA 4FE2A 3MFHA 1I50A 1RYSA 1HNWO 1PNMA 2GV9A 2R7ZG 2QF7A 1SYXB 3U0ZA 1KMIZ 1Y4MA 3OTOO 4PV1B 5FLXN 4Q6GA 1COWG 4X66O 4U3FH 5DQHA 5KFHA 1B33N 1Q5OA 4UCSA 1K1QA 4JI5O 2YYAA 4PA7A 2RGRA 3FKSG 2JEJA 1KJQA 1HNZO 1AI7A 3I55V 3T5LA 3OD4A 5FNVB 5LYJA 2DJVA 1X59A 3P3NA 4NR1A 2WAMA 1I94H 4PZ6A 2H8PC 4QJFB 2DWEC 1QVGU 1QQCA 5F2VO 4MTEA 1VF6C 1I0HA 1YEWA 1SFOA 3AG1C 4IAJA 2HJDA 2V58A 1NS1A 5BYBA 1GSHA 2X6AA 2IU0A 1P16A 3GB7C 5IYZF 3MR6A 5B1AB 2RF4A 1WB8A 4PA3A 4ZHQA 4JYAB 1P7BA 4HYKA 1HNWH 1OZ0A 5KX5B 4FFOA 2Q5ZA 4HZ3A 2UUCO 4X66H 4QJFA 2LFSA 5B3SC 1EN5A 4R7RA 4IYIA 2OTJV 3W1GA 4P30A 1EKFA 2P22C 3MR3A 3HB9A 3GTOA 1AJPA 5IY5B 2M6YA 3ZN1A 3CXHF 1T94A 5D1PA 5DLGA 4QWCA 4BWAA 2R8GA 4I50A 3CC7V 5GW7A 1VQKV 2VQFO 1Z5VA 1A9XA 5KX5A 5BR8H 1A32A 2FPGB 4DLKA 5IDJA 5LGNA 3FKIG 4LFCO 3H1KH 4LSAA 1KJJA 2CW7A 1E4EB 4IIJA 2R7LA 2I87A 1Q6UA 3ORRA 2Z0AA 4YXWG 1K9MW 5JUMA 1HR0H 4Z1MG 5EBWC 2RGVA 2J9GA 4LR3A 2EJ7A 3QO7A 3L73H 2QE7G 3IFXA 2EBOA 3OFNG 4J9ZB 5JJJB 4YJ2A 3WFVA 3MDSA 4O7SA 1OCCC 4O3PA 2QWPB 4ZOLB 4DV4O 4L8JA 5KT3A 5C3EG 1WH2A 3NC0B 5LP6F 4IIJB 1IOVA 5LA6F 2CKZB 5IP9G 2NVXA 4FVMA 2COGA 3QFFA 2CZGA 2ODTX 3K5NA 3K9SA 1KKCA 4QPKA 4D7SA 5JVLA 3ZMTA 3M9NB 2M05A 3OSPA 3B8MA 2BOCC 2HKOA 5KG1A 1BGWA 2L6LA 3AG4C 1S5HC 2XOKG 1S77D 4DL2A 2AGOA 4GLWA 3RGXA 1BMFG 3J7AK 1HR0O 4A3KG 1JJ2U 1N8RW 1P7GA 2V4QA 5BXZA 2W0FC 2JA7A 1O9HA 1H2MA 3L72H 4EB6A 4DAAA 2KSDA 1VQ8V 2YZNA 3KHGA 5LMNB 4XYLB 5L3GA 5CA3A 1GTOA 4RQFA 3MWDA 1NT2B 1PPJH 5IYDG 3OTOH 2CTRA 5LL6b 3G80A 3ZBHA 4DV4H 1YSCA 2OCCB 4LWSB 4MV6A 5C93A 4EGQA 4N21A 3OUZA 1P84F 4U7NA 1E4FT 3GWKC 1GM7A 5KFBA 4ICGA 2VWJA 1CP9A 4ED8A 5CM0A 2YEVA 2W7OA 4AHCA 2CH7A 4FLXA 3EYYA 5L1KA 3CXCU 3KREA 3G6YA 1XMOB 1DV2A 1F4MA 4YY3B 1TUBA 2KG7A 3U9SA 2WSSG 3KHRA 5EC2C 4O4IB 2QM8A 1YCIA 4P9PA 5KG5A 4GC7A 2W9BA 3HT5A 4JYBA 4DR2B 3Q1KA 5B1BC 2DZDA 1M93A 2WLNA 2HIVA 4DV1O 4X62O 4JZGA 4U7OA 4O3QA 3PW7A 4G3IA 1W0JG 2Q6AA 4JI0O 2Q7DA 1NQTA 2CUGA 5HV6A 1BHAA 4R8UA 5EIBC 4LF6H 2UVWA 1FFXA 4N23A 3ZMSA 1EZJA 2HGWA 1EN4A 1P4RA 1D5NA 4XBFA 3GIJA 3OMNB 1R6NA 1OCOB 1GH6A 4O3OA 3ABLB 4X62B 1O9GA 3A8TA 1BQ0A 1OBGA 2EILB 4O2BB 2W9CB 4JTDB 4LF7B 2JA6G 2NLJC 3APQA 4JI7B 2QWNB 2UVUA 2RQ6A 2K1EA 5LOVA 2N05A 4IR1A 1E79G 2WPDG 4ED1A 1Q6IA 1ENVA 2BE3A 4UFZA 1NJIW 2GBOA 2VQFB 5JH7A 5IJ9A 1VQMV 1PK8A 4TV8A 1S5JA 2XCLA 3S3XA 3UFXB 2W6PA 3AG1B 2YRXA 4A3FG 2Z5UA 3RVYA 1H2KA 3E8FA 5KFEA 4Z1VA 1KC7A 3ETGA 2F93B 4J9LA 4X64H 4DUYB 5E25A 3K9AA 1VQOV 3N2KA 3R5FA 3UM7A 3GJXB 3VOTA 2IBZH 3T5JA 5D8DA 4TUYF 4UB8Z 4WFAV 3JALA 4QW8A 4LNUA 3JAKB 3A0RA 4YAJB 4B3MO 4LFAO 4B08A 2Q8VA 5IYBO 1RP3B 5LYJF 4OPAA 4NZMA 4O7VA 2JEFA 2EIMC 4RUFA 3NBYB 3C90A 2N04A 3N2KB 1R73A 2IP4A 1U97A 1JJOA 5IE9A 2ASJA 3GTJA 4O7LA 3PVXA 1EHIA 2R8IA 4TV9A 4B3RH 4DR4H 1EKPA 4R8CA 2ALZA 3OTFA 1TWFA 5KHIA 4JAVA 3THOA 3H1IH 3H9VA 4MVUA 5EZYF 5DGBA 2W6JG 3R5HA 1IZ3A 2V5AA 2W6NA 2CW8A 3JAKA 2WLIB 3SJQC 4ZHQF 1K73W 3T2MA 3QZ7A 4QIWA 1T3NA 4FLUA 2DQ3A 4FLWA 1K83A 2UUBB 5IYBG 1EM1A 4BAYA 4O7TA 4QWEA 3I4MG 4B3TO 4RNOA 4NXMB 5KG2A 2RDJA 2BOBC 2ZQMA 4MS2A 1QVFU 4DV2B 3FYIB 4GKKH 2WWWA 2JA5G 3GTQA 4MW3A 4X1YB 1Q43A 4BBRG 5JJEB 4O7NA 4DR2H 4A3BG 2QTSA 1NTZH 2JA7G 5JH7F 3J81W 4HN2A 2MCTA 3TQTA 4O3SA 4FJCC 4DR4O 5IT9N 1IBLH 3HOUG 2P90A 4Q45A 2Q7HA 1GM9A 4GKJO 4EEYA 2PMZE 5KHKA 1DAAA 5D1OA 1GSAA 4DL3A 1JDEA 5LHIA 2IBKA 1XK5A 3AK3A 4XDJA 3E8HA 4F4LA 1KJ9A 2KQXA 2WB1A 3KZIZ 2JS5A 2F1MA 3W7UA 1Q82W 2NU7B 3CRQA 5C5JA
chains in the Genus database with same CATH topology
5LP6A 1SEIA 3KAJA 2V4DA 1SA0A 3SJAC 4YJ3B 2R72A 3TY9A 3JATB 3JAWB 1I94B 3K5LA 4FM0A 3QG5A 3HXLA 1Z2PX 3NBZB 4I55A 1N36B 4JI4B 1KU9A 3TY8A 5FPRA 3L4KA 3N44B 2VUGA 4DV0B 3RTXA 2F95B 3CB2A 5A2QW 1I6UA 5CA1B 4TOIA 4YJ2B 4YHHH 5IWAB 1XNRB 1CKNA 3JASA 4LFAH 4KHPH 4UCTA 4ZOLA 4ZI7B 3K3VA 1QHTA 1HNZB 1SA0B 4DV0H 3RYIA 3UQ8A 4X64B 2PUSA 3JAWA 5DISC 2QM4A 5EYPB 1M0TA 4M7EA 4LF4B 1N34H 1ZHSA 3L4JA 4I55B 4FLTA 3QTCA 5GONA 4DK0A 2PTMA 1SQFA 5LMNH 1TUBB 3BHPA 5CA0A 4DV1B 5JVDA 4O4JB 2FE3A 4ETSA 4LSXA 4NVPA 1WN7A 3SR2C 1JFFB 4O4IA 2YIAA 4IHJA 4JI5H 3RGZA 1J5EB 3E22A 5FD5A 1JMKC 1XMQH 4DV3H 1P8LA 4TQFA 3VQVA 2Q0AA 3DF7A 4ZI7A 5EYPA 5FD6A 5EIBD 4X1IB 4F6RA 1XMQB 5D5PA 3FFQA 4DUYH 5CA0B 5KHGA 4O4JA 4UCUA 1FFXB 4FM1A 1VF7A 2Q2TA 4FM2A 3PN1A 5IJ0B 3VQWA 4JI8B 3E22B 4EFEA 1XNQH 3B2EE 4CH4A 3BPZA 2HVQA 4JI2H 4EFBA 5KHJA 3N2GB 1HW7A 4JI1H 4RZQA 3FMAA 4DV2H 4X1IA 5J2TA 4F6RB 3MAQA 2PZSA 4U3JB 2XIGA 4DR5H 3RGBA 3VQXA 1L2ZA 4APMA 2F66C 5JH7B 3DSQA 4CC6A 1X4TA 4MV7A 3ICXA 4DR7H 4O4LA 5J2UB 4K8XA 4DV6B 2F4VB 4LMYA 1XHXA 4GYCB 2YI8A 3HKDB 2W57A 4X65B 4A2AA 4HBNA 4DK1A 4DRXB 3N2GA 3RYFB 1T5EA 5IT9W 4PHZA 4I7HA 5IWAH 4GKKB 5LA6A 2YXLA 4CH3A 1S68A 2VOBA 2ZNJA 4FM9A 3QWUA 4DV1H 3N43B 2PYJA 4LNUB 1SQGA 4JI0B 5LP6C 1HNWB 3ETQA 2UXBB 3WB2A 2BTOA 3CSXA 4YY3H 4GLXA 1DGSA 3RYFA 2GV9A 1SYXB 3U0ZA 2HVSA 1KMIZ 4DV5B 5CB4A 5LOVB 2UXDB 4Q6GA 4TV9B 3RYCA 5LA6B 2KSWA 4CS4A 1Q5OA 4LFCB 4UCSA 4ZIBA 4B3TH 3M7MX 5IJ9B 4TV8B 2VQEB 2RGRA 1B04A 4ZHQB 1FVIA 4LH7A 2E3CA 5FNVB 4DUZH 5BMVA 2UU9B 4O4HA 4NXMH 1MZBA 3N41B 5LYJA 4RB3C 4PZ7A 4AILC 3VQYA 1I94H 4PZ6A 1QQCA 4MTEA 2VPSA 5EOYA 1FJGB 3SJBC 1YEWA 4PI0A 1Z5WA 4B3SH 4JI6H 3RYCB 1G6UA 1BJTA 4IAJA 2ZCEA 3T1YB 3JSNA 3QF7A 1P16A 1L8DA 3K5OA 4ZHQA 5JCOA 3BA9A 4JYAB 1HNWH 5BMVB 5EZYA 4O4HB 5KX5B 1IBKB 4DR7B 4BWSC 1HNXB 1WNSA 3RIZA 4X66H 2UUBH 3JSLA 1IBMB 2UUAB 3KALA 4R7RA 4X20B 4WBNB 5JQGB 3W1GA 2Q2UA 2P22C 4JYAH 4PZ8A 1P49A 4LF4H 4B3MH 2YIBD 5D1PA 3UT5A 5K1PA 5LXTA 2BTQA 3RWRD 2O03A 4BWAA 4I50A 4O2AB 3RJ0A 1Z5VA 3LNNA 5KX5A 5BR8H 2OYQA 4LF5B 5LP6B 2OWOA 4LSAA 4YJ3A 2CW7A 1XDNA 2HVRA 4LFBH 5KMGA 1IBLB 4IIJA 4AQYH 1I7FA 4JI4H 1HR0H 1ZAUA 4JI0H 5JJNB 2RGVA 3HKCB 4LR3A 2XHBA 3ZEDA 2P5OA 3JARB 3KAKA 4DV7H 4X1YA 5JJJB 4YJ2A 3CHXA 4RAZA 5C8YA 3T1HH 1X9NA 1N32H 3RF2A 4MV9A 1CKOA 3CVZA 4DRFA 4LF8B 4ZOLB 4L8JA 4JI2B 1WH2A 3NC0B 3JAMW 4DV7B 5KMGB 4JV5B 4IIJB 2KKWA 3TY5A 4EB6B 4FVMA 3BRCA 3WB0A 4CS3A 3K5NA 4DUZB 5GONB 3W1BA 4D7SA 4MTDA 4X1KA 3HKCA 1A0IA 5JVDB 4NXNH 4RB0A 3JARA 2EX3A 1BGWA 3GDEA 3BABA 3RR5A 1ZHQA 2CAZC 4LF8H 5C8YB 4LFAB 1XNRH 4DV3B 3RGXA 3J7AK 2ZM6B 4GKJH 5FPOA 1O9HA 1Q8IA 4RB2C 2QJ1A 1FKAH 4EB6A 1XI1A 1N33B 5LMNB 4AQYB 5IYZB 1D5AA 4X1KB 3OTOH 1NT2B 3GB8B 4K8ZA 4I4TB 5LL6b 4Q0YA 2VQEH 4DV4H 2WDTA 1E4GT 5CA1A 5IJ0A 4CS2A 2YIBA 2UU9H 4FFBB 4GKJB 1CKNB 2UUCH 3L2PA 3A2FA 1M0WA 1E4FT 3F8NA 4OX9B 4LF7H 3BAAA 2VWJA 3RYIB 4RB1A 4DR6B 4AHCA 4FLXA 3EYYA 2UXBH 1XMOB 2UXCH 4J0MA 2R70A 4U3JA 3SGIA 4YY3B 5IYZA 1TUBA 4DV4B 4I4TA 1JFFA 1V9PA 4O4IB 1VS0A 1XQ8A 4LF6B 4LFBB 2JGUA 2VQFH 4DR3H 4IHJB 4CH6A 3C0FB 4FFBA 4DR2B 3U10A 2UXCB 1M93A 3HKDA 2HIVA 4FLVA 3T1HB 1N34B 4RAYA 4JI1B 4DRXA 2CFMA 2VWKA 1Q3EA 2ZM6H 2ZIMA 2E5LH 4CH5A 4DR1H 1CKMA 4EEQA 1N32B 4JI5B 3U11A 5EIBC 1FJGH 4LF6H 3BA8A 1FFXA 1S03G 3OTOB 3N42B 2ZIOA 1Z2NX 4LF5H 2RJZA 1IBKH 4E6NA 4X62B 1O9GA 3K59A 1M4UA 4A2BA 4DR6H 4DR1B 1HNZH 4LFCH 4O2BB 4LF7B 2YCHA 4B3RB 4JI7B 4DV5H 3HKEB 3RYHB 2RQ6A 5CB4B 5LOVA 1XNQB 1GYFA 5J2TB 4LF9H 4UCVA 3H20A 1J5EH 4JI8H 4UFZA 4K0KB 2VQFB 5JH7A 5IJ9A 4DR3B 1M5IA 4TV8A 1S5JA 2HIXA 4PI2A 1RSOA 4X62H 1O75A 5FNVA 4O4LB 5J2UA 4JI3H 4DV6H 4HNAB 3S24A 5LMUH 2F4VH 2HEPA 5LYJB 4FLZA 3HKBB 1TVKB 2YI9A 5K1XA 4K0KH 1Z2OX 2F93B 4JV5H 4UCOA 4X64H 4DUYB 3K57A 4LH6A 4DR5B 5BR8B 4O2BA 3ZS8C 3N2KA 3GJXB 4TUYB 3HKEA 3RYHA 5JCOC 2UXDH 2UUCB 2PYLA 4OX9H 2WE6A 4DR4B 3JALA 3M4IA 4LNUA 4BW9A 3JAKB 4HNAA 4UCRA 1SKVA 4B08A 3HKBA 4X66B 1AN7A 1TVKA 5FLXW 3LMLA 4I9QA 4X20A 4WBNA 3NBYB 1N33H 3N2KB 4LF9B 1JJOA 4PDBA 4TUYA 3IG0A 4TV9A 2E5LB 4EQ5A 4B3RH 4DR4H 1TGOA 3T1YH 4CC5A 3OTFA 4TQDA 5KHIA 1WPBA 3THOA 4B3TB 3RFRA 2ZJTA 2HHHB 2BTQB 2Q7EA 4KHPB 4I50B 4O2AA 4X65H 3KYHC 3JALB 2CW8A 3JAKA 4FLUA 4FLWA 4JI3B 2Q7GA 2UUBB 2UUAH 3VNNA 4KL1A 2ZNIA 2HGSA 2IM9A 4NXMB 3J80W 1XMOH 3N40P 4DV2B 3K58A 4GKKH 5D1OB 4JI7H 5KHHA 3N6XA 5ITZA 3MWMA 4B3MB 4X1YB 4D7TA 1Q43A 5D5QA 2WYOA 3SJCC 4JI6B 4B3SB 5JJEB 4DR2H 1TA8A 5EZYB 2PGGA 3J81W 3KXYT 2MCTA 3JATA 3WB1A 1H2SB 3K5MA 4NXNB 1IBMH 1IBLH 5JQGA 1HR0B 2Q7HA 1HNXH 5LMUB 5KHKA 2ZINA 1N36H 5D1OA 2HHHH 3W5OA 1XK5A 5ITZB 2R9AA 3IAYA 3UT5B 5LXTB 2JS5A 1TAEA 2F1MA 1XHZA 3JASB 4YHHB 2PY5A 4FLYA 2JVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRF A;  4LF8 B;  1S68 A;  4JI2 B;  4UFZ A;  4K0K B;  3NC0 B;  2VQF B;  4DR3 B;  3TY9 A;  1I94 B;  4DV7 B;  4JV5 B;  2HIX A;  3QWU A;  3TY5 A;  3NBZ B;  1N36 B;  4JI4 B;  4JI0 B;  3S24 A;  4DUZ B;  3W1B A;  3TY8 A;  5FPR A;  1HNW B;  1A0I A;  2UXB B;  2VUG A;  4DV0 B;  3RTX A;  4UCO A;  4DUY B;  3GDE A;  4LH6 A;  4DR5 B;  3BAB A;  5BR8 B;  4TOI A;  4GLX A;  3RR5 A;  1DGS A;  3GJX B;  5IWA B;  4LFA B;  1XNR B;  1CKN A;  4DV5 B;  2HVS A;  2UXD B;  4DV3 B;  4UCT A;  2UUC B;  2ZM6 B;  4LFC B;  4UCS A;  1HNZ B;  5FPO A;  3UQ8 A;  4DR4 B;  4X64 B;  5DIS C;  2VQE B;  1B04 A;  4LF4 B;  1FVI A;  4LH7 A;  2UU9 B;  1N33 B;  5LMN B;  4UCR A;  4AQY B;  4DV1 B;  3GB8 B;  4PZ7 A;  4X66 B;  4PZ6 A;  1FJG B;  3NBY B;  4LF9 B;  1J5E B;  4GKJ B;  1CKN B;  3L2P A;  2E5L B;  1P8L A;  4EQ5 A;  4OX9 B;  3BAA A;  4CC5 A;  4B3T B;  3T1Y B;  3JSN A;  1P16 A;  2HHH B;  4DR6 B;  4KHP B;  3KYH C;  3BA9 A;  4JYA B;  1XMO B;  1XMQ B;  1IBK B;  3SGI A;  4DR7 B;  4YY3 B;  1HNX B;  4JI3 B;  4DV4 B;  4UCU A;  2UUB B;  1VS0 A;  1V9P A;  3JSL A;  1IBM B;  4LF6 B;  2UUA B;  3VNN A;  4LFB B;  2Q2T A;  3W1G A;  2Q2U A;  3PN1 A;  4NXM B;  4JI8 B;  4DR2 B;  4EFE A;  2UXC B;  4DV2 B;  2HIV A;  5D1O B;  1N34 B;  3T1H B;  4PZ8 A;  4JI1 B;  2HVQ A;  4EFB A;  4B3M B;  2CFM A;  5D1P A;  4JI6 B;  4EEQ A;  4B3S B;  1CKM A;  1TA8 A;  1N32 B;  4JI5 B;  4LF5 B;  2OWO A;  3BA8 A;  1XDN A;  2HVR A;  1IBL B;  4NXN B;  4CC6 A;  3OTO B;  1HR0 B;  4DV6 B;  2F4V B;  1ZAU A;  4E6N A;  5LMU B;  4X62 B;  5D1O A;  4X65 B;  4DR1 B;  3W5O A;  1XK5 A;  4LF7 B;  1TAE A;  4B3R B;  4JI7 B;  1X9N A;  1XNQ B;  4GKK B;  4YHH B;  1CKO A;  4UCV A; 
#chains in the Genus database with same CATH topology
 4WFE A;  3KAJ A;  1KKD A;  5LHH A;  1SA0 A;  3SJA C;  4FMT A;  3RB3 A;  3TXQ A;  2FL4 A;  2YIC A;  2ZXW C;  2P7T C;  2W9A A;  3ZRS A;  4KP4 A;  1Z2P X;  3NBZ B;  5BYA A;  4ZOL F;  2QYZ A;  4ECS A;  1VQP V;  4JI4 B;  3E5N A;  3ZMV A;  5KT7 A;  3OUU A;  3IN5 A;  1KU9 A;  2YZM A;  4QWB A;  3L4K A;  2VUG A;  3RTX A;  2RN9 A;  3M8A A;  3T9B A;  3GIM A;  4YHH H;  3ZCC A;  4MVR A;  1KT8 A;  2ITC C;  3JAS A;  2GSM B;  1SCU B;  1YTF D;  3T9C A;  2DPJ A;  4ZOL A;  1BCC H;  4X64 B;  3ABK B;  3JD1 A;  5L3F A;  2ZDH A;  4JI6 O;  5I5X A;  2J6T A;  1R6T A;  5GON A;  4DK0 A;  2QWQ B;  1FXK A;  1KJ8 A;  3BHP A;  3CQZ A;  4O4J B;  4O81 A;  4NVP A;  3ETE A;  1JFF B;  1DV1 A;  3LSU A;  4A3E G;  3AG7 A;  2IH3 C;  1N56 A;  2AQ4 A;  1P8L A;  4TQF A;  4E4T A;  2JA8 G;  2CGN A;  4FPP A;  1Q7Y W;  4JV1 A;  1EZV H;  4X1I B;  2Q67 A;  2QK4 A;  2F43 G;  5D5P A;  2A0L A;  4MV8 A;  4DUY H;  1FXK B;  4QIW E;  3GTG A;  4O4J A;  1K3E A;  4FM1 A;  1FD9 A;  4RO2 A;  1QLN A;  2OTL V;  1VBH A;  5CAE B;  4FM2 A;  1V4Y A;  3BQ2 A;  3E22 B;  3FB7 C;  5K3W A;  2ADQ B;  4J9K A;  2GUZ A;  2MW2 B;  3DTU B;  1IBM O;  4OPH A;  1HDJ A;  1L0N H;  1HW7 A;  4BIZ A;  4RZQ A;  2EIM B;  3SYA A;  3RB6 A;  3FMA A;  2CH7 B;  1KUQ A;  3OAA G;  4X1I A;  2FLP A;  3MAQ A;  2AHY A;  2EJ2 A;  1VIB A;  2UU9 O;  3IJ4 A;  4JTC B;  3RGB A;  4APM A;  3FB6 C;  2HVK C;  1Y66 A;  3D36 A;  5JQW A;  3WU2 Z;  2R8H A;  3ICX A;  1QLE B;  4O4L A;  5J2U B;  4K8X A;  4DV6 B;  2F4V B;  5DLF A;  5KFF A;  2QEX V;  1XHX A;  2LW7 A;  2B5U A;  4GYC B;  5B3S B;  3GIP A;  1BNC A;  3WO1 A;  4DK1 A;  3N2G A;  1FS0 G;  3J7A U;  2EJR A;  3K3W A;  2COI A;  2XGP A;  3ZHV A;  5LXT F;  5IWA H;  3Q8Q B;  3NUA A;  3PO2 G;  1S68 A;  2XCP A;  4TQR A;  1ZSP A;  3ZHT A;  1W93 A;  4TT3 G;  1NTM H;  3JD0 A;  2Y69 C;  3V6J A;  3G4S V;  4JI0 B;  5JVD F;  5KT5 A;  3PR5 B;  2MK3 A;  5IYC G;  2ZDI C;  1JX4 A;  2V59 A;  4DL6 A;  1OWT A;  1KTA A;  1N34 O;  4WFB V;  4R6Z A;  4YY3 H;  2FK3 A;  2W9C A;  3Q8R B;  3RUP A;  2HVS A;  5CB4 A;  2UXD B;  3RYC A;  2ZDI A;  4Q4C A;  2KSW A;  4EBD A;  4LFC B;  3B4S A;  4ZIB A;  1SQP H;  5FLM G;  4B3T H;  2EIK B;  3OW2 U;  4QIW F;  5CBF A;  5IJ9 B;  1J95 A;  1VQ4 V;  3CYO A;  3H0G A;  5KFQ A;  2V7Q G;  3ASO C;  5BMV A;  3CRR A;  3LSS A;  4O4H A;  1MZB A;  3N41 B;  1R9T A;  4J9Q A;  4DIM A;  3VQY A;  1FYJ A;  3GTK A;  3V4Z A;  2XTA A;  4MTO A;  1UJW B;  1MMM A;  2QKC A;  1F51 A;  4O4I F;  3RYC B;  4JI6 H;  4YBZ B;  5TIS Z;  3GQC A;  5LMN O;  3W7S A;  2R6F A;  2A3Q A;  3T1Y B;  1L1F A;  2ZKO A;  4K0K O;  5JCO A;  2EIJ C;  1PP9 H;  2B9Z A;  4Q20 A;  2IA6 A;  4O4H B;  3P3P A;  4BWS C;  4WD3 A;  1OCZ C;  4RUC A;  2F23 A;  3GTP A;  5JQG B;  4JYA H;  1YXB A;  1JCH A;  3GID A;  3I4N G;  2HFE C;  3ZHR A;  4J9Y B;  3MD0 A;  4G28 B;  1IXB A;  2DAB A;  5K1P A;  5LXT A;  3RWR D;  1V54 B;  4O2A B;  2WLL B;  3TW6 A;  2LQT A;  3LNN A;  2WLI A;  4NYK A;  4J9S A;  4FBU A;  2OYQ A;  4IHJ F;  2PN1 A;  2BSK A;  2GTA A;  4KFM A;  4YJ3 A;  5EWF A;  1TWH A;  3GTL A;  4ED3 A;  1K92 A;  1KP2 A;  1UFI A;  3J80 N;  3TIN A;  4J9M A;  1ZQ7 A;  2JGD B;  2XAS A;  5JJN B;  3HKC B;  1KYO F;  1WJZ A;  2XCA A;  1GRJ A;  3PW2 A;  3JAR B;  5JWP A;  3CPW U;  4MTF A;  3LSQ A;  1KJI A;  5I5U A;  3CHX A;  2WLL A;  4GCZ A;  5KLV H;  2D2C B;  3H1J H;  2AZ2 A;  4IIJ F;  3T1H H;  1YDX A;  5L9X A;  5DEC A;  3CVZ A;  3JRX A;  4Q8F A;  4X64 O;  1HP8 A;  3JAM W;  4Q43 A;  3UO3 A;  5KFT A;  3ML0 A;  2KKW A;  3TY5 A;  3Q2O A;  4HNT A;  2X0S A;  3JD2 A;  1AR4 A;  4A5U B;  3ZN0 A;  3D3Q A;  2YXY A;  4CS3 A;  2X7R B;  4WCE V;  1WP8 A;  4X88 A;  4CKC A;  4DUZ B;  1H2N A;  4I4T F;  4YJ2 F;  3HKC A;  1A0I A;  5JVD B;  4NXN H;  3VOU A;  3O65 A;  3CEI A;  2R8K A;  1PL4 A;  3MR2 A;  2WAQ A;  4QWD A;  3BAB A;  4LFB O;  2CAZ C;  4LFA B;  2ZE8 A;  2JEG A;  4UUJ C;  3G67 A;  1Q81 W;  1XNR H;  2PI4 A;  2DWC A;  1HNX O;  2ZM6 B;  5B1B B;  3T99 A;  1I2L A;  1M9N A;  4K6N A;  5CN0 A;  1FKA H;  1NTK H;  1H2G A;  4XZ3 B;  1N33 B;  2FML A;  4AQY B;  4X1K B;  2P06 A;  1N0J A;  3GB8 B;  5GON F;  4C5C A;  2Y4U A;  5EWE A;  3JYC A;  5EDW A;  1V55 C;  2ABJ A;  2WDT A;  5CA1 A;  1G1X B;  2X6B A;  3L71 H;  4FFB B;  1QCE A;  4GKJ B;  3V6K A;  3L2P A;  4A3M G;  1M0W A;  2HLD G;  2B1I A;  3F8N A;  5CE8 A;  4OX9 B;  2HJF C;  3BAA A;  1IYD A;  4FFM A;  5BWV A;  3RV3 A;  3U54 A;  2D3O W;  1Z2G A;  2ZR2 A;  2LGW A;  2HP8 A;  5IYZ A;  3A0B Z;  3K06 A;  1ZWI C;  3V4S A;  1DF5 A;  4LBE C;  3F7Y C;  3EXA A;  1XQ8 A;  4LF6 B;  4YR0 A;  1MOF A;  2JGU A;  1VAR A;  3HOV G;  4CH6 A;  4QPJ A;  3C0F B;  3M99 B;  3K0G A;  4FFB A;  1XOU A;  2HHF B;  4Q44 A;  4FLV A;  4RAY A;  5H9C A;  4C5A A;  4DRX A;  5CBH A;  2VWK A;  4DL7 A;  4LC1 A;  1YHQ V;  2BQ3 A;  3FYE B;  4FBT A;  1K8A W;  4DR1 H;  5KFN A;  2CNU A;  2ZDQ A;  4R7C A;  3QVN A;  5BY1 A;  4DV7 O;  4MV3 A;  4GKK O;  3BA8 A;  3CCR V;  3K5I A;  1S03 G;  1KB9 F;  1RSO B;  3FAV B;  2ZT9 B;  4GUN A;  3IGA C;  2J6U A;  4LF5 H;  2YZG A;  1IBK H;  2PMZ A;  2DE0 X;  4E6N A;  1YJW V;  2YS8 A;  2HHF A;  4RCN A;  1M4U A;  4J80 A;  1MSD A;  5IP7 G;  3H40 A;  3GIK A;  1N0N A;  4DR1 B;  4FU0 A;  1BQZ A;  3TIG A;  5KG7 A;  1IBL O;  4DV5 H;  3IC7 A;  1XNQ B;  4J41 A;  1KEC A;  3TXS A;  5DQI A;  5DN6 G;  3DC5 A;  3EPI A;  1B06 A;  1Q86 W;  2ATK C;  2QR4 A;  2XC9 A;  4J7Z A;  3CRA A;  2HIX A;  4MSW C;  2DYS B;  2UXX A;  1YI2 V;  1RSO A;  2ZE5 A;  4IYH A;  5FNV A;  4O4L B;  5J2U A;  2YWV A;  3MFI A;  1PNL A;  3HO8 A;  2NU8 B;  3S24 A;  4YP3 A;  5LMU H;  4JF3 A;  2GHY A;  5L3C A;  1DTO A;  2DQ0 A;  1G8M A;  5KT4 A;  3HKB B;  2EIN B;  2CGO A;  1TVK B;  5A2Q N;  1Z2O X;  4JV5 H;  4UCO A;  4DR5 B;  2Q0O C;  3H1H H;  1YIJ V;  3RYH A;  4UUG A;  3PW4 A;  4FFL A;  2AXT Z;  5HFM A;  4MVZ A;  1Y1W G;  1VBG A;  1S72 V;  4K35 A;  2UUA O;  3E89 A;  1VP7 A;  4OX9 H;  2YU9 A;  4DR4 B;  4FGR A;  2JK5 C;  1KP3 A;  4IR9 A;  1EZ1 A;  3OHB A;  3M4I A;  4BW9 A;  4HNA A;  2PVP A;  4UCR A;  4DV5 O;  3AK1 A;  3HKB A;  1AN7 A;  1TVK A;  5FLX W;  4I9Q A;  2W8L A;  3OEH G;  3KCY A;  2ADP A;  1N33 H;  2W71 A;  1Y14 B;  4MW8 A;  4TUY A;  2FMA A;  1Y76 B;  3WNZ A;  4EQ5 A;  2FLL A;  4WFH A;  2ODM A;  1TGO A;  1WPB A;  3G8D A;  2HHH B;  2FB5 A;  5KKN B;  5KAF Z;  1H8E G;  5B5E Z;  4MV4 A;  5E79 Z;  2UUA H;  2HGS A;  2ZNI A;  2CTQ A;  2XD4 A;  2ASD A;  4O4H F;  4JV2 A;  4FFR A;  4DXW A;  1XMO H;  1GKF A;  2UXB O;  3K58 A;  4JI7 H;  5KHH A;  4ECT A;  1SET A;  1KUT A;  1D2D A;  4NTY A;  1SZX A;  5D5Q A;  5I5T A;  3SJC C;  4JI6 B;  4A3D G;  3S3W A;  4I0X B;  3ASN C;  1YJ9 V;  4O3R A;  1A0G A;  2DLN A;  1YTF B;  3QQM A;  4QW9 A;  3O9O A;  2W6Q A;  2OIG A;  5DED A;  4NXN B;  3PR4 A;  1IBM H;  2JS3 A;  5JQG A;  3FD9 A;  4PDL A;  1AIL A;  1SC5 B;  1S0V A;  4DL5 A;  1HNX H;  5LMU B;  3R23 A;  4K3A A;  3H1L H;  4F4X A;  4IRD A;  4J9N A;  3KTM A;  3UT5 B;  5L1L A;  1WB7 A;  4MVQ A;  1TAE A;  3LDC A;  5IY5 C;  2NU9 B;  2PY5 A;  5C44 G;  1UNN C;  5KG0 A;  4JYA O;  4F4Y A;  2BSK B;  1I1M A;  4YJ3 B;  3TY9 A;  1I94 B;  4CMD A;  1QBZ A;  1TUE B;  2R7N A;  1G2W A;  5H6R A;  3H0G G;  2C2E A;  4E2L A;  3NGD A;  1NVP D;  2JGD A;  5FPR A;  3ZRW B;  1AUX A;  2EJ0 A;  3SPG A;  4JI8 O;  2F95 B;  5IWA B;  2QWR B;  1CKN A;  1WAZ A;  2Q68 A;  3T9A A;  4EBE A;  4KHP H;  1S0M A;  2E76 B;  3CSW A;  4PBC A;  1QHT A;  2Y4T A;  1HNZ B;  3RYI A;  2VUM A;  5DIS C;  2QM4 A;  5EYP B;  2YDE A;  4QE7 A;  1W59 A;  3FB5 C;  4LF4 B;  4I55 B;  4GX0 A;  2W6O A;  5LMN H;  1TUB B;  2KG7 B;  1DIK A;  3TGU H;  3AG2 B;  4LSX A;  4I9W A;  4UXN A;  5BWT A;  2R92 G;  1F4N A;  3R5X A;  4DV2 O;  4ZQI A;  3LDE A;  2C28 A;  5DGI A;  2VS0 A;  5CA1 F;  4BW5 A;  1FXH A;  4MT8 A;  3STZ C;  3GV8 B;  3VQV A;  2EIK C;  1RJP A;  1BGY H;  2DW4 A;  4JAA A;  5EYP A;  4LF5 O;  3G8C A;  5H80 A;  1OCC B;  5KFY A;  5FD6 A;  3WWH A;  5EIB D;  4EGJ A;  1XMQ B;  3MJF A;  4YHH O;  2YUA A;  4NB5 A;  3GTM A;  5LHG A;  3TW7 A;  2ZDG A;  5BWW A;  1WA8 B;  4C2M A;  2X5R A;  2AW9 A;  1OJH A;  3VQW A;  3SYC A;  4JI8 B;  2Z02 A;  3HB3 B;  3CP1 A;  1GN6 A;  1VQN V;  1YZB A;  5KFG A;  4CH4 A;  2WA4 A;  3E2E A;  3AG4 B;  1K97 A;  1AI5 A;  4EFB A;  4RU9 A;  4JI1 H;  2YID A;  4HNV A;  2IJK A;  5BPF A;  4Q8E A;  5KFL A;  5KFS A;  4F6R B;  1Y1V A;  1K5Q A;  1H8H G;  3ZJZ A;  1SQQ H;  2ZGI A;  1MZE A;  2F66 C;  3DSQ A;  4ZBM A;  1SES A;  4HYO A;  3RW0 A;  4NTX A;  4DR7 H;  1C30 A;  4O84 A;  5C1P A;  5KFD A;  5IYD O;  1WCM A;  3K08 A;  4X65 B;  1I1K A;  2YXH A;  4HBN A;  4DRX B;  4ECV A;  4H0L B;  2JIZ G;  1IDS A;  1RM1 B;  2GQS A;  3VA7 A;  2P4K A;  4I7H A;  1R3I C;  1AUV A;  4JZ2 A;  4JAS A;  3T4D A;  3CJH A;  1K5S A;  1CQJ B;  1ORQ C;  2ZNJ A;  3MHH C;  4X89 A;  1Y74 A;  3DC6 A;  4DV1 H;  1XIL A;  5KG6 A;  1SQG A;  2ITD C;  2ZE6 A;  3T1H O;  1ZLZ A;  1HNW B;  3OUF A;  2UXB B;  1U96 A;  2FKL A;  1IYE A;  1I08 A;  3C3T A;  2JEI A;  1DGS A;  3RYF A;  1JVM A;  4DV5 B;  1L0L H;  2I80 A;  3G6B A;  4AI8 A;  3SI8 A;  1OV9 A;  4TV9 B;  5C8Y F;  4CS4 A;  1CXZ B;  3CJH B;  3RAX A;  3M7M X;  2FPI B;  2YS6 A;  1GN2 A;  4ZHQ B;  2GDS A;  3ZHS A;  1B6Q A;  3HKZ E;  4RB3 C;  4PZ7 A;  4WFF A;  1THZ A;  2M7W A;  5FNV F;  4O3N A;  5H2F Z;  4RNN A;  2ZE7 A;  1Z5W A;  5CBG A;  2X6C A;  1VKZ A;  1G6U A;  3W7W A;  1KEE A;  1BJT A;  5LMU O;  3LQS A;  4JPR A;  2FK2 A;  3SPJ A;  4KXR A;  1ZX3 A;  4H33 A;  3JSN A;  3QF7 A;  4YR3 A;  3R66 A;  2WLH A;  2Q73 A;  3K5O A;  1KD1 W;  5KT6 A;  4H37 A;  2VUM G;  5EZY A;  1PV0 A;  4EBC A;  1HNX B;  4UV9 A;  3RIZ A;  3SYQ A;  3KHH A;  4EYI B;  1E4E A;  2UUB H;  1IBM B;  5H6Q A;  4O7Z A;  5DG7 A;  3UZO A;  4X20 B;  4WBN B;  2Q2U A;  3P30 A;  4PDM A;  5KFO A;  1AVM A;  1Y76 A;  3TET A;  4LF4 H;  5EK0 A;  1K34 A;  4B3M H;  3R65 A;  2YIB D;  3N27 A;  2CK3 G;  2BTQ A;  4L87 A;  1YIT V;  2O03 A;  4IRC A;  3JZF A;  3EFF K;  4CBC A;  2A79 B;  3UO2 A;  1S76 D;  1GAX A;  1I2K A;  2GPW A;  1GM8 A;  3RJ0 A;  4PA6 A;  3BJY A;  4LF5 B;  2OWO A;  4OXS A;  1XDN A;  4LFB H;  1IBL B;  3D36 C;  4LF8 O;  2XAG A;  2VQD A;  4O7Y A;  1WSC A;  4ECR A;  1FFT B;  4AQY H;  3OUS A;  4JI4 H;  2JRI A;  2R86 A;  1ZAU A;  4JI0 H;  2B63 G;  2K9P A;  2P67 A;  4RUA A;  1FKA O;  4LF6 O;  4TVI A;  1SQX H;  3CX5 F;  4NZN A;  2UUB O;  4J9P A;  1S0N A;  1N32 H;  5C8Y A;  1X9N A;  1XRE A;  3K03 A;  1I7L A;  1CEZ A;  1XMO O;  4DRF A;  1IUR A;  4LF8 B;  3CME V;  4YY3 O;  3JZI A;  3MWE A;  4LF4 O;  5KFC A;  4EB6 B;  5I60 A;  4UB6 Z;  3BRC A;  5I5S A;  5GON B;  1VF6 A;  2A06 H;  4JGS A;  4LF9 O;  3QO8 A;  1T36 A;  3W7T A;  4DO2 A;  1R3K C;  2H94 A;  4IT5 A;  2UXC O;  1ZHQ A;  2BQU A;  1SQV H;  1I7N A;  3SPC A;  5C8Y B;  1M6V A;  4KUM A;  2R84 A;  4DV3 B;  5L3B A;  4GKJ H;  3RBD A;  3NR7 A;  1QNM A;  2R85 A;  2YRW A;  1PL0 A;  4PA9 A;  4UVB A;  1XI1 A;  4FFP A;  4IRK A;  4BXX G;  4QGP A;  1K4D C;  3BEH A;  5EBM C;  1FXK C;  5KFP A;  2RNB A;  4I4T B;  5K2M A;  3Q8P B;  3RBE A;  4PDV A;  4Q0Y A;  4X65 O;  2VQE H;  4NKG B;  5A9G A;  1E4G T;  5IJ0 A;  4FIP C;  3ETJ A;  2EIY A;  4CS2 A;  2YIB A;  2UU9 H;  1CKN B;  3UYY A;  4M9U A;  3A2F A;  3ZMU A;  4UVC A;  3RYI B;  4RB1 A;  4DR6 B;  3H4D A;  5B1N A;  4RWU A;  3JCU Z;  4JTA B;  3TK1 A;  4EG0 A;  1AR5 A;  2UXC H;  1BHB A;  2R70 A;  3SGI A;  2Y69 B;  5E1A C;  1BXR A;  3FKI A;  5DQG A;  1M56 B;  1XUQ A;  4I4T A;  1V9P A;  3HOZ G;  4O4J F;  4LFB B;  5KT2 A;  2VQF H;  5DM6 V;  2PF4 E;  3WG7 B;  2HJW A;  2UXC B;  1B6R A;  4B7K A;  3T1H B;  2OLS A;  1WCM G;  4CZZ A;  1M56 C;  2XND G;  4JI1 B;  4RUE A;  2CFM A;  1Q3E A;  2ZM6 H;  2XAQ A;  2YEV B;  2ZIM A;  3RT3 C;  2E5L H;  4X8A A;  1AP5 A;  5KFZ A;  1N32 B;  1MAB G;  3RV4 A;  1OCR C;  4JI5 B;  5BWR A;  1FJG H;  3OTO B;  1V51 A;  1EUD B;  3N42 B;  1PKX A;  1CE8 A;  2ZIO A;  1Z2N X;  4YJ3 F;  1VF5 B;  3K59 A;  4DR2 O;  1K1S A;  1JA8 A;  4X9Q A;  1S9F A;  2IMW P;  4DUY O;  3L74 H;  3ORQ A;  1LNQ A;  3M9O B;  3Q8S B;  4LFC H;  4HNU A;  1MZF A;  4B3R B;  2A1H A;  3HKE B;  5CB4 B;  5J2T B;  4LF9 H;  3KG2 A;  3H20 A;  3H4B A;  2W8K A;  1J5E H;  2X0L A;  1FPO A;  1MNG A;  4H13 B;  5KFW A;  5KFV A;  4X62 H;  1NBM G;  4HQ6 A;  5L3E A;  4JV0 A;  2QM7 A;  2FKX A;  4FLZ A;  5BPH A;  4CKE A;  4K0K H;  2GTS A;  3OHA A;  4O2B A;  3ZS8 C;  3E8B A;  3BVO A;  2DMX A;  1EUC B;  1BZK A;  2AGP A;  1SRY A;  3HKE A;  3G6E V;  4W4K A;  1Y67 A;  2L35 A;  2PYL A;  1NKD A;  1SER A;  2WE6 A;  4NXN O;  3N8D A;  1Y74 B;  3MHS C;  4U7C A;  3OM3 B;  3TQ1 A;  1XMQ O;  3AW8 A;  2WB1 E;  4JI7 O;  4GZR B;  2NR5 A;  3HR0 A;  1K33 A;  3ZHQ A;  1SKV A;  2CDY A;  2A7W A;  1Y1W A;  5L1J A;  4Z2W A;  1DLB A;  4TWK A;  2A9H A;  1H38 A;  3GV5 B;  3BG5 A;  4QSH A;  3K3P A;  3WWI A;  3LNM B;  1WRV A;  1RJR A;  4LF9 B;  1SS3 A;  1XEQ A;  4PDB A;  3AX6 A;  2WLJ A;  2CQY A;  3IG0 A;  5LBQ A;  1NU1 H;  3PZP A;  4IWY A;  2NN4 A;  3T1Y H;  4CC5 A;  4TQD A;  2ARH A;  1OHH G;  2WLK A;  2ZJT A;  3ZRV A;  4Y8V B;  5KFI A;  3X2Q B;  4O2A A;  4MV1 A;  2VQE O;  2FK1 A;  3KYH C;  4X65 H;  5C4X G;  3JAL B;  5DG8 A;  1JR9 A;  2C2R A;  4O83 A;  2CE4 A;  4JI3 B;  1PNK A;  2UXD O;  3ASO B;  1NH2 D;  1M57 C;  1QR8 A;  3PO3 G;  3VNN A;  5CA0 F;  4KL1 A;  3CCU V;  2IM9 A;  1A3G A;  3FDS A;  4MTX A;  4DL4 A;  4TQS A;  1E1R G;  3N40 P;  3D3I A;  1W0K G;  5D1O B;  4O2A F;  2W6Z A;  3KCX A;  3NXS A;  3BQ1 A;  4D7T A;  4MTG A;  2ZR3 A;  2WYO A;  3CMA V;  1V55 B;  1LUW A;  2Y0P A;  3E86 A;  5B1A C;  5EZY B;  3UKM A;  2QSA A;  1EBO A;  3DXR A;  4P2Z A;  3KXY T;  2AGQ A;  1VEW A;  3OMA B;  1H2S B;  3K5M A;  2YZL A;  4JYC A;  1WPX A;  1WLE A;  3G6V A;  1HR0 B;  1W96 A;  4O7R A;  1YF2 A;  1CQI B;  1N36 H;  1WR2 A;  2HHH H;  2R87 A;  1I1L A;  1BE3 H;  1TWG A;  2R9A A;  2Y48 A;  1FJG O;  5DG9 A;  4F4Z A;  1VAJ A;  4YIP A;  2IU3 A;  2EIL C;  2YS7 A;  3JAS B;  4DR7 O;  4YHH B;  2NUA B;  4FLY A;  4J7K A;  1JQ0 A;  3RFC A;  4XDK A;  2JVD A;  5KFJ A;  2V1D A;  2V4D A;  3U9T A;  1KBL A;  1QLE C;  4FFK A;  3JAW B;  4YR2 A;  4PD4 F;  4FM0 A;  3QG5 A;  3APO A;  1LR1 A;  5DMX A;  3EVK A;  4DV3 O;  1M1K W;  1HWY A;  2OCC C;  3TY8 A;  3F5W C;  4QE9 A;  3T1C A;  3F7V C;  5A2Q W;  2FYU H;  1I6U A;  5CA1 B;  4YJ2 B;  4RAI A;  4FZ1 A;  4AYB E;  4UCT A;  3K5H A;  2W7P A;  2NNU A;  4ZI7 B;  3K3V A;  1SA0 B;  1M0T A;  2PUS A;  3JAW A;  4UVA A;  4BY7 G;  4ED6 A;  4JV5 O;  1ZHS A;  4MVS A;  4B3S O;  3RVZ A;  3DTG A;  3QTC A;  5FL7 G;  3HBL A;  3SYO A;  1N32 O;  1SQF A;  2FE3 A;  4ETS A;  1WN7 A;  2E74 B;  4PJ0 Z;  4JI5 H;  4IHJ A;  3RGZ A;  2J6S A;  1J5E B;  3E22 A;  3OT7 A;  2RDI A;  5FD5 A;  1JMK C;  2Q69 A;  1GO3 E;  4ECZ A;  1XMQ H;  2GUZ B;  4FZ0 A;  1AB3 A;  4ZI7 A;  4ED7 A;  3VBB A;  3UCS C;  5BMV F;  4YAK B;  2Y0S A;  4QWA A;  2RCV A;  3T5K A;  5HBR B;  1KC8 W;  4DR6 O;  1S3J A;  2PI5 A;  1F7Y A;  3GLK A;  3L70 H;  5GTI Z;  5KHG A;  1Q90 D;  5KG3 A;  1S0O A;  4UCU A;  2LO1 A;  1VF7 A;  5IYC O;  2EIN C;  2Q2T A;  4LWS A;  3FAV A;  3PN1 A;  5IJ0 B;  5KAI Z;  1M7J A;  3CS5 A;  3KKY A;  4EFE A;  2FB9 A;  4ME6 A;  4DQN A;  4CMF A;  2DYS C;  2B63 A;  1RPR A;  4MA0 A;  2HVQ A;  3TII A;  4JI2 H;  4AQY O;  5KHJ A;  3N2G B;  3SNO A;  3PW0 A;  3ABM C;  4BBS G;  5CB4 F;  3GII A;  4DV2 H;  5I5V A;  4J42 A;  1N36 O;  2XT9 A;  1IX9 A;  5FR9 A;  3L75 H;  2XIG A;  4DR5 H;  1QU7 A;  5DAA A;  3OSN A;  2PBZ A;  2ZXW B;  4J11 A;  2ASL A;  3T9E A;  5I47 A;  4AYB A;  4DW0 A;  4LMY A;  2VA3 A;  4XDL A;  3DAA A;  4ZKI A;  4O2B F;  4C5B A;  2W57 A;  1ZUQ A;  3ZIA G;  2LW1 A;  3JAM N;  5LOV F;  1T5E A;  4NXM O;  3AYH B;  1K4C C;  4GX1 A;  4PEL A;  4YIO A;  4GKK B;  3I56 V;  5LA6 A;  3WG7 C;  4R8U B;  2YXL A;  2OCH A;  4CH3 A;  2QGN A;  4CHI A;  2VOB A;  4FM9 A;  5GTH Z;  2Z3Y A;  4EKW A;  5BZB A;  3QWU A;  3N43 B;  1YJN V;  2E5L O;  4CE5 A;  4FFN A;  5J2U F;  3BY6 A;  3LP8 A;  3T7A A;  3P32 A;  2Y0S E;  3WB2 A;  5KFK A;  2BTO A;  3CSX A;  2AGA A;  2HVJ C;  4UV8 A;  4GLX A;  3U55 A;  3CCS V;  2YSU B;  2DWD C;  5LOV B;  4RNM A;  5LA6 B;  3SPH A;  4FS1 A;  3E35 A;  2VA2 A;  2QKA A;  4TV8 B;  2VQE B;  1B04 A;  4L1K A;  5KX5 F;  1FVI A;  4LH7 A;  2E3C A;  4DUZ H;  3A0H Z;  2UU9 B;  1A48 A;  4Q4D A;  1N48 A;  2E2H A;  4NXM H;  5L3D A;  4O4L F;  4A93 G;  2P0A A;  1XNR O;  2VPQ A;  1SZT A;  4AIL C;  2G38 A;  2BR0 A;  2DIK A;  2VPS A;  5EOY A;  4DV0 O;  4NZO A;  1FJG B;  3SJB C;  1XDC A;  5BR8 O;  4PA4 A;  3OR7 C;  4PI0 A;  1YVW A;  4B3S H;  3VPD A;  2DYR B;  5EBL C;  5KA5 A;  2ZCE A;  1L8D A;  3OR6 C;  4E4E A;  3BA9 A;  5F9L A;  2JJ1 G;  5BMV B;  2IJH A;  1IBK B;  2BCC H;  1SQB H;  4DR7 B;  4BIO A;  1WNS A;  3B09 A;  2VRZ A;  5KFX A;  3KHL A;  5EC1 C;  3JSL A;  2UUA B;  1BS3 A;  3KAL A;  5KUK A;  1K7D A;  3AG3 C;  4B7E A;  3JZ6 A;  1OBD A;  1S97 A;  1AI6 A;  3ZHU A;  2CNV A;  4BR6 A;  4PZ8 A;  1P49 A;  4YB8 B;  5LL6 Y;  4BY1 G;  2QB5 A;  4FS2 A;  4IL6 Z;  3UT5 A;  2P6J A;  3W7X A;  1IBK O;  3B8N A;  2UXN A;  3ZMZ A;  4DR3 O;  3OE7 G;  4J7J A;  2CTP A;  5LP6 B;  2GPS A;  4JYY A;  2UVV A;  2HVR A;  5KMG A;  1WP7 A;  4B3R O;  2AZ0 A;  4P9O A;  4JI1 O;  3BFR A;  4GX2 A;  1I7F A;  2FTK A;  4DR1 O;  3CCV V;  1J5E O;  2VR1 A;  3ETD A;  1US6 A;  2XHB A;  3ZED A;  2P5O A;  4NYE A;  2DPI A;  3KAK A;  1AP6 A;  4DV7 H;  1S5L Z;  4X1Y A;  5LGU A;  4JUZ A;  5KFU A;  1JLL B;  4RAZ A;  3AK2 A;  3RF2 A;  3T9F A;  3GV7 B;  2LGQ A;  1RPO A;  4I7Z B;  4MV9 A;  1CKO A;  2UVR A;  2COJ A;  3HOW G;  4F6E A;  3DXR B;  3G6X A;  4JI2 B;  2ATL A;  4DV7 B;  5KMG B;  4JV5 B;  1FAF A;  1PD3 A;  3WB0 A;  3RAQ A;  1R1B A;  1OCR B;  1DK1 A;  5FJ8 G;  1GSO A;  4G27 B;  3Q4H A;  3W1B A;  4MTD A;  2XGQ A;  4X1K A;  4OX9 O;  4RB0 A;  1AJN A;  3JD3 A;  3JAR A;  4RQE A;  1RJQ A;  2EX3 A;  3OGC C;  3GDE A;  3RR5 A;  3DTF A;  4F4W A;  4LF8 H;  3OGI B;  2Z04 A;  2LFR A;  2EIJ B;  2HGX A;  5I5W A;  3RB0 A;  3VPC A;  2JEU A;  5FPO A;  1ZET A;  2FLN A;  4FK5 C;  3T4Z A;  1Q8I A;  1N33 O;  2GLT A;  2Y0I A;  3SDL A;  2ETN A;  4RB2 C;  1PM9 A;  2QJ1 A;  2LP7 A;  5IYZ B;  1D5A A;  2RMK B;  3CCL V;  2YW2 A;  4K8Z A;  1R3J C;  1AJQ A;  4TV9 F;  3TCU A;  1M90 W;  5T14 A;  2XAJ A;  1F23 A;  1S10 A;  4DR5 O;  1NVP B;  2C2A A;  2UUC H;  1VMG A;  4GC6 A;  4DUZ O;  3N6R A;  5JQG F;  2W0X A;  5AG2 A;  2SCU B;  3K04 A;  3BQ0 A;  4ED0 A;  4LF7 H;  2XAH A;  3TJT A;  2WTF A;  2UXB H;  3CD6 V;  4CKB A;  4J9O A;  2YL2 A;  4W4L A;  4J0M A;  4U3J A;  2H3O A;  1Y6X A;  1JKJ B;  4IWX A;  1XL4 A;  4DV4 B;  1GGO A;  1JFF A;  1VS0 A;  5H5N A;  2R7K A;  2R7Z A;  4DR3 H;  2C2D A;  4IHJ B;  3DGE A;  5DGA A;  1JOY A;  2NVY A;  3U10 A;  4F50 A;  5I5Y A;  3HKD A;  1N34 B;  1RM1 C;  4RZR A;  5BWU A;  4JI3 O;  3CRC A;  3GWO A;  1KQS U;  4CH5 A;  4A3G G;  1CKM A;  4EEQ A;  2P4V A;  1RK5 A;  1NR7 A;  4MAM A;  3U11 A;  3L9D A;  3H3V H;  1IXM A;  4A3J G;  3V6H A;  1B3Q A;  4A3L G;  2RJZ A;  2JDI G;  4A2B A;  1XL6 A;  3WO0 A;  4DR6 H;  3R9R A;  2DAA A;  1HNZ H;  1OCZ B;  2IW5 A;  2YCH A;  1I3Q A;  5B1O A;  1NZ6 A;  3RYH B;  1JXL A;  3GIQ A;  2I8C A;  1VQ5 V;  3PFF A;  1GYF A;  4JI4 O;  1I94 O;  4UCV A;  1BSM A;  5KFM A;  3K0D A;  4JI8 H;  4ECQ A;  4K0K B;  2WLM A;  4DR3 B;  1M5I A;  1TWC A;  5J2T F;  3ABU A;  4PI2 A;  1O75 A;  5B66 Z;  1EN6 A;  4JI3 H;  4ZI7 F;  4DV6 H;  4HNA B;  2F4V H;  3ZX6 A;  2DN9 A;  2HEP A;  2JA5 A;  5LYJ B;  1EFR G;  1UPG A;  3T1Y O;  2N74 A;  4NTW A;  1GO3 F;  2W6M A;  4XX0 B;  3SPI A;  3T5H A;  5KA6 A;  2YI9 A;  5K1X A;  3K57 A;  4LH6 A;  2FP4 B;  3VPB A;  5BR8 B;  3B40 A;  3QNE A;  3F5T A;  3AEI A;  2IH1 C;  4TUY B;  4GT1 A;  4QNH B;  5JCO C;  2UXD H;  2UUC B;  1BL8 A;  2QA4 V;  5BWX A;  1QR9 A;  1R6K A;  4TSF G;  2R93 G;  2JEX A;  1NH2 B;  1MSW D;  1XBL A;  5C1O A;  1MA1 A;  1VQ6 V;  1EKV A;  4LF7 O;  4XYM B;  4X66 B;  3LML A;  2CTW A;  3CCQ V;  4X20 A;  4WBN A;  4HAM A;  1RK6 A;  2EUL A;  2FPP B;  4ABM A;  2WA3 A;  2Y4R A;  2E5L B;  4I50 F;  2E75 B;  4PDR A;  3ABK C;  5L1I A;  2IJI A;  4B3T B;  3PJS K;  3RFR A;  5KFR A;  2BTQ B;  2Q7E A;  4KHP B;  3JD4 A;  4I50 B;  3LUL A;  1GMG A;  1E1Q G;  2HHH O;  4I0X A;  2WAQ E;  4WBN F;  3UZB A;  2R93 A;  4OGQ B;  3WWJ A;  3T9D A;  2Q7G A;  5HFL A;  4JXU A;  4O7W A;  3J80 W;  1ARO P;  1OCO C;  3QZ8 A;  3E8G A;  4LCU C;  3RBZ A;  1M57 B;  4M0J A;  2CNQ A;  1VQ9 V;  4BIU A;  2QDO A;  3N6X A;  1H2L A;  5ITZ A;  3MWM A;  2IJJ A;  4B3M B;  4H44 B;  2W70 A;  4MA5 A;  1R3L C;  1UC9 A;  3BCC H;  3HKZ A;  2OT5 A;  3CCJ V;  2V4R A;  2E2I A;  4B3S B;  1TA8 A;  3GVM A;  4ASU G;  5CMU A;  2PGG A;  1BT8 A;  2DOS A;  2YC0 A;  1UC8 A;  5LGT A;  2DYR C;  1GK9 A;  3JAT A;  3WB1 A;  4A3I G;  4DW1 A;  5IWA O;  5DGH A;  3ASN B;  2ZM6 O;  2GQR A;  3H01 A;  2Q9L A;  2ZIN A;  2AHZ A;  3G71 V;  2JJ2 G;  4R50 A;  2C00 A;  4A3C G;  3W5O A;  4DYL A;  1C3O A;  5ITZ B;  3IAY A;  3I5D A;  3ABT A;  3OMI B;  2HR3 A;  5LXT B;  4I5S A;  1CS0 A;  4HR7 A;  4EYH B;  4NLG A;  1XHZ A;  3I12 A;  4O86 A;  1W2B U;  2FJZ A;  1V54 C;  5LP6 A;  4GX5 A;  1SEI A;  1Y1V G;  5KS8 A;  2R72 A;  3JAT B;  4LP8 A;  1ZL8 A;  3K5L A;  1KBH A;  3HXL A;  2R9R B;  4I55 A;  1I5X A;  2XUM A;  1N36 B;  2NU6 B;  3CWB H;  3LUT B;  3BAC A;  1IOW A;  3HPL C;  3N44 B;  5F9N A;  2Q4P A;  4DV0 B;  5J9P C;  3JCZ A;  3CB2 A;  2R9I A;  2OIE A;  4TOI A;  3CRM A;  1TWA A;  2C35 B;  1XNR B;  3LDD A;  4LFA H;  3ETH A;  4J9R A;  4I55 F;  3MR5 A;  1EYZ A;  3RN4 A;  4DV0 H;  3UQ8 A;  2BQR A;  3FX7 A;  1DF4 A;  1ZL8 B;  4M7E A;  2EZO A;  3OEE G;  1N34 H;  2QTO A;  4U6P A;  3L4J A;  1VQ7 V;  4C7U A;  1XNQ O;  4FLT A;  5EWG A;  2ILM A;  3Q4H B;  2HG5 C;  2PTM A;  4O82 A;  3ZRW A;  5CA0 A;  4DV1 B;  5JVD A;  1WA8 A;  4YQW A;  2OH2 A;  3CC4 V;  3SR2 C;  4O4I A;  1JX9 A;  1ROP A;  2YIA A;  3C3S A;  1N4C A;  2W9B B;  3EHB B;  2B1G A;  3ZRX A;  2XAF A;  2O57 A;  1Q6H A;  4DV3 H;  3EPG A;  2AU0 A;  3LWB A;  2C22 A;  2Q0A A;  3DF7 A;  3SYP A;  3JRW A;  4MVO A;  2R7M A;  3PW5 A;  3AG2 C;  4F6R A;  2HG8 A;  3ABM B;  1ULZ A;  3FFQ A;  1ET0 A;  5CA0 B;  1FFX B;  2JA6 A;  1G4Y B;  2EZP A;  1VQL V;  3M9M B;  2ZD9 A;  5CR5 A;  4ECX A;  4TM5 A;  2R92 A;  1IVS A;  1AR1 B;  1XNQ H;  3B2E E;  2QKS A;  3B77 A;  3BPZ A;  4IZO A;  3HOY G;  2R8J A;  4DV6 O;  2F4V O;  3T54 A;  2KB1 A;  4ECU A;  1GLV A;  3CCE V;  4PWQ A;  5KFA A;  5J2T A;  2PZS A;  3TEK A;  4U3J B;  5KUM A;  1RFY A;  3VQX A;  1JIH A;  1L2Z A;  1RYR A;  2LJ2 A;  5JH7 B;  4ED2 A;  4CC6 A;  1X4T A;  2EJ3 A;  3CEB A;  4MV7 A;  3ABL C;  3CC2 V;  5HNE A;  4ECY A;  3AG3 B;  3CE2 A;  1MG1 A;  1NR1 A;  3STL C;  3GIL A;  2YI8 A;  3HKD B;  1B6S A;  2W6I G;  1JPX A;  1GN3 A;  2RDC A;  4MVM A;  4A2A A;  1FXV A;  3QO5 A;  3D8C A;  1GN4 A;  3SE7 A;  3K79 A;  3RYF B;  4WF9 V;  1JDB B;  3U0G A;  5IT9 W;  4WFG A;  4PHZ A;  1ZTE A;  1I5Y A;  3X2Q C;  3E83 A;  4ECW A;  5KG4 A;  3J81 N;  1NI8 A;  4TV8 F;  3VMM A;  4G2K A;  4IGG A;  4JAU A;  4D6T H;  3IC9 A;  1AI4 A;  2QWO B;  2PYJ A;  4JI2 O;  1URF A;  2R82 A;  1CPY A;  4LNU B;  4KHP O;  1SF9 A;  5LP6 C;  1PX2 A;  1LUV A;  3HOX G;  3FB8 C;  4WHX A;  3ETQ A;  3CCM V;  3RB4 A;  2HDK A;  4J10 A;  2V9W A;  4FE2 A;  3MFH A;  1I50 A;  1RYS A;  1HNW O;  1PNM A;  2GV9 A;  2R7Z G;  2QF7 A;  1SYX B;  3U0Z A;  1KMI Z;  1Y4M A;  3OTO O;  4PV1 B;  5FLX N;  4Q6G A;  1COW G;  4X66 O;  4U3F H;  5DQH A;  5KFH A;  1B33 N;  1Q5O A;  4UCS A;  1K1Q A;  4JI5 O;  2YYA A;  4PA7 A;  2RGR A;  3FKS G;  2JEJ A;  1KJQ A;  1HNZ O;  1AI7 A;  3I55 V;  3T5L A;  3OD4 A;  5FNV B;  5LYJ A;  2DJV A;  1X59 A;  3P3N A;  4NR1 A;  2WAM A;  1I94 H;  4PZ6 A;  2H8P C;  4QJF B;  2DWE C;  1QVG U;  1QQC A;  5F2V O;  4MTE A;  1VF6 C;  1I0H A;  1YEW A;  1SFO A;  3AG1 C;  4IAJ A;  2HJD A;  2V58 A;  1NS1 A;  5BYB A;  1GSH A;  2X6A A;  2IU0 A;  1P16 A;  3GB7 C;  5IYZ F;  3MR6 A;  5B1A B;  2RF4 A;  1WB8 A;  4PA3 A;  4ZHQ A;  4JYA B;  1P7B A;  4HYK A;  1HNW H;  1OZ0 A;  5KX5 B;  4FFO A;  2Q5Z A;  4HZ3 A;  2UUC O;  4X66 H;  4QJF A;  2LFS A;  5B3S C;  1EN5 A;  4R7R A;  4IYI A;  2OTJ V;  3W1G A;  4P30 A;  1EKF A;  2P22 C;  3MR3 A;  3HB9 A;  3GTO A;  1AJP A;  5IY5 B;  2M6Y A;  3ZN1 A;  3CXH F;  1T94 A;  5D1P A;  5DLG A;  4QWC A;  4BWA A;  2R8G A;  4I50 A;  3CC7 V;  5GW7 A;  1VQK V;  2VQF O;  1Z5V A;  1A9X A;  5KX5 A;  5BR8 H;  1A32 A;  2FPG B;  4DLK A;  5IDJ A;  5LGN A;  3FKI G;  4LFC O;  3H1K H;  4LSA A;  1KJJ A;  2CW7 A;  1E4E B;  4IIJ A;  2R7L A;  2I87 A;  1Q6U A;  3ORR A;  2Z0A A;  4YXW G;  1K9M W;  5JUM A;  1HR0 H;  4Z1M G;  5EBW C;  2RGV A;  2J9G A;  4LR3 A;  2EJ7 A;  3QO7 A;  3L73 H;  2QE7 G;  3IFX A;  2EBO A;  3OFN G;  4J9Z B;  5JJJ B;  4YJ2 A;  3WFV A;  3MDS A;  4O7S A;  1OCC C;  4O3P A;  2QWP B;  4ZOL B;  4DV4 O;  4L8J A;  5KT3 A;  5C3E G;  1WH2 A;  3NC0 B;  5LP6 F;  4IIJ B;  1IOV A;  5LA6 F;  2CKZ B;  5IP9 G;  2NVX A;  4FVM A;  2COG A;  3QFF A;  2CZG A;  2ODT X;  3K5N A;  3K9S A;  1KKC A;  4QPK A;  4D7S A;  5JVL A;  3ZMT A;  3M9N B;  2M05 A;  3OSP A;  3B8M A;  2BOC C;  2HKO A;  5KG1 A;  1BGW A;  2L6L A;  3AG4 C;  1S5H C;  2XOK G;  1S77 D;  4DL2 A;  2AGO A;  4GLW A;  3RGX A;  1BMF G;  3J7A K;  1HR0 O;  4A3K G;  1JJ2 U;  1N8R W;  1P7G A;  2V4Q A;  5BXZ A;  2W0F C;  2JA7 A;  1O9H A;  1H2M A;  3L72 H;  4EB6 A;  4DAA A;  2KSD A;  1VQ8 V;  2YZN A;  3KHG A;  5LMN B;  4XYL B;  5L3G A;  5CA3 A;  1GTO A;  4RQF A;  3MWD A;  1NT2 B;  1PPJ H;  5IYD G;  3OTO H;  2CTR A;  5LL6 b;  3G80 A;  3ZBH A;  4DV4 H;  1YSC A;  2OCC B;  4LWS B;  4MV6 A;  5C93 A;  4EGQ A;  4N21 A;  3OUZ A;  1P84 F;  4U7N A;  1E4F T;  3GWK C;  1GM7 A;  5KFB A;  4ICG A;  2VWJ A;  1CP9 A;  4ED8 A;  5CM0 A;  2YEV A;  2W7O A;  4AHC A;  2CH7 A;  4FLX A;  3EYY A;  5L1K A;  3CXC U;  3KRE A;  3G6Y A;  1XMO B;  1DV2 A;  1F4M A;  4YY3 B;  1TUB A;  2KG7 A;  3U9S A;  2WSS G;  3KHR A;  5EC2 C;  4O4I B;  2QM8 A;  1YCI A;  4P9P A;  5KG5 A;  4GC7 A;  2W9B A;  3HT5 A;  4JYB A;  4DR2 B;  3Q1K A;  5B1B C;  2DZD A;  1M93 A;  2WLN A;  2HIV A;  4DV1 O;  4X62 O;  4JZG A;  4U7O A;  4O3Q A;  3PW7 A;  4G3I A;  1W0J G;  2Q6A A;  4JI0 O;  2Q7D A;  1NQT A;  2CUG A;  5HV6 A;  1BHA A;  4R8U A;  5EIB C;  4LF6 H;  2UVW A;  1FFX A;  4N23 A;  3ZMS A;  1EZJ A;  2HGW A;  1EN4 A;  1P4R A;  1D5N A;  4XBF A;  3GIJ A;  3OMN B;  1R6N A;  1OCO B;  1GH6 A;  4O3O A;  3ABL B;  4X62 B;  1O9G A;  3A8T A;  1BQ0 A;  1OBG A;  2EIL B;  4O2B B;  2W9C B;  4JTD B;  4LF7 B;  2JA6 G;  2NLJ C;  3APQ A;  4JI7 B;  2QWN B;  2UVU A;  2RQ6 A;  2K1E A;  5LOV A;  2N05 A;  4IR1 A;  1E79 G;  2WPD G;  4ED1 A;  1Q6I A;  1ENV A;  2BE3 A;  4UFZ A;  1NJI W;  2GBO A;  2VQF B;  5JH7 A;  5IJ9 A;  1VQM V;  1PK8 A;  4TV8 A;  1S5J A;  2XCL A;  3S3X A;  3UFX B;  2W6P A;  3AG1 B;  2YRX A;  4A3F G;  2Z5U A;  3RVY A;  1H2K A;  3E8F A;  5KFE A;  4Z1V A;  1KC7 A;  3ETG A;  2F93 B;  4J9L A;  4X64 H;  4DUY B;  5E25 A;  3K9A A;  1VQO V;  3N2K A;  3R5F A;  3UM7 A;  3GJX B;  3VOT A;  2IBZ H;  3T5J A;  5D8D A;  4TUY F;  4UB8 Z;  4WFA V;  3JAL A;  4QW8 A;  4LNU A;  3JAK B;  3A0R A;  4YAJ B;  4B3M O;  4LFA O;  4B08 A;  2Q8V A;  5IYB O;  1RP3 B;  5LYJ F;  4OPA A;  4NZM A;  4O7V A;  2JEF A;  2EIM C;  4RUF A;  3NBY B;  3C90 A;  2N04 A;  3N2K B;  1R73 A;  2IP4 A;  1U97 A;  1JJO A;  5IE9 A;  2ASJ A;  3GTJ A;  4O7L A;  3PVX A;  1EHI A;  2R8I A;  4TV9 A;  4B3R H;  4DR4 H;  1EKP A;  4R8C A;  2ALZ A;  3OTF A;  1TWF A;  5KHI A;  4JAV A;  3THO A;  3H1I H;  3H9V A;  4MVU A;  5EZY F;  5DGB A;  2W6J G;  3R5H A;  1IZ3 A;  2V5A A;  2W6N A;  2CW8 A;  3JAK A;  2WLI B;  3SJQ C;  4ZHQ F;  1K73 W;  3T2M A;  3QZ7 A;  4QIW A;  1T3N A;  4FLU A;  2DQ3 A;  4FLW A;  1K83 A;  2UUB B;  5IYB G;  1EM1 A;  4BAY A;  4O7T A;  4QWE A;  3I4M G;  4B3T O;  4RNO A;  4NXM B;  5KG2 A;  2RDJ A;  2BOB C;  2ZQM A;  4MS2 A;  1QVF U;  4DV2 B;  3FYI B;  4GKK H;  2WWW A;  2JA5 G;  3GTQ A;  4MW3 A;  4X1Y B;  1Q43 A;  4BBR G;  5JJE B;  4O7N A;  4DR2 H;  4A3B G;  2QTS A;  1NTZ H;  2JA7 G;  5JH7 F;  3J81 W;  4HN2 A;  2MCT A;  3TQT A;  4O3S A;  4FJC C;  4DR4 O;  5IT9 N;  1IBL H;  3HOU G;  2P90 A;  4Q45 A;  2Q7H A;  1GM9 A;  4GKJ O;  4EEY A;  2PMZ E;  5KHK A;  1DAA A;  5D1O A;  1GSA A;  4DL3 A;  1JDE A;  5LHI A;  2IBK A;  1XK5 A;  3AK3 A;  4XDJ A;  3E8H A;  4F4L A;  1KJ9 A;  2KQX A;  2WB1 A;  3KZI Z;  2JS5 A;  2F1M A;  3W7U A;  1Q82 W;  2NU7 B;  3CRQ A;  5C5J A; 
#chains in the Genus database with same CATH homology
 5LP6 A;  1SEI A;  3KAJ A;  2V4D A;  1SA0 A;  3SJA C;  4YJ3 B;  2R72 A;  3TY9 A;  3JAT B;  3JAW B;  1I94 B;  3K5L A;  4FM0 A;  3QG5 A;  3HXL A;  1Z2P X;  3NBZ B;  4I55 A;  1N36 B;  4JI4 B;  1KU9 A;  3TY8 A;  5FPR A;  3L4K A;  3N44 B;  2VUG A;  4DV0 B;  3RTX A;  2F95 B;  3CB2 A;  5A2Q W;  1I6U A;  5CA1 B;  4TOI A;  4YJ2 B;  4YHH H;  5IWA B;  1XNR B;  1CKN A;  3JAS A;  4LFA H;  4KHP H;  4UCT A;  4ZOL A;  4ZI7 B;  3K3V A;  1QHT A;  1HNZ B;  1SA0 B;  4DV0 H;  3RYI A;  3UQ8 A;  4X64 B;  2PUS A;  3JAW A;  5DIS C;  2QM4 A;  5EYP B;  1M0T A;  4M7E A;  4LF4 B;  1N34 H;  1ZHS A;  3L4J A;  4I55 B;  4FLT A;  3QTC A;  5GON A;  4DK0 A;  2PTM A;  1SQF A;  5LMN H;  1TUB B;  3BHP A;  5CA0 A;  4DV1 B;  5JVD A;  4O4J B;  2FE3 A;  4ETS A;  4LSX A;  4NVP A;  1WN7 A;  3SR2 C;  1JFF B;  4O4I A;  2YIA A;  4IHJ A;  4JI5 H;  3RGZ A;  1J5E B;  3E22 A;  5FD5 A;  1JMK C;  1XMQ H;  4DV3 H;  1P8L A;  4TQF A;  3VQV A;  2Q0A A;  3DF7 A;  4ZI7 A;  5EYP A;  5FD6 A;  5EIB D;  4X1I B;  4F6R A;  1XMQ B;  5D5P A;  3FFQ A;  4DUY H;  5CA0 B;  5KHG A;  4O4J A;  4UCU A;  1FFX B;  4FM1 A;  1VF7 A;  2Q2T A;  4FM2 A;  3PN1 A;  5IJ0 B;  3VQW A;  4JI8 B;  3E22 B;  4EFE A;  1XNQ H;  3B2E E;  4CH4 A;  3BPZ A;  2HVQ A;  4JI2 H;  4EFB A;  5KHJ A;  3N2G B;  1HW7 A;  4JI1 H;  4RZQ A;  3FMA A;  4DV2 H;  4X1I A;  5J2T A;  4F6R B;  3MAQ A;  2PZS A;  4U3J B;  2XIG A;  4DR5 H;  3RGB A;  3VQX A;  1L2Z A;  4APM A;  2F66 C;  5JH7 B;  3DSQ A;  4CC6 A;  1X4T A;  4MV7 A;  3ICX A;  4DR7 H;  4O4L A;  5J2U B;  4K8X A;  4DV6 B;  2F4V B;  4LMY A;  1XHX A;  4GYC B;  2YI8 A;  3HKD B;  2W57 A;  4X65 B;  4A2A A;  4HBN A;  4DK1 A;  4DRX B;  3N2G A;  3RYF B;  1T5E A;  5IT9 W;  4PHZ A;  4I7H A;  5IWA H;  4GKK B;  5LA6 A;  2YXL A;  4CH3 A;  1S68 A;  2VOB A;  2ZNJ A;  4FM9 A;  3QWU A;  4DV1 H;  3N43 B;  2PYJ A;  4LNU B;  1SQG A;  4JI0 B;  5LP6 C;  1HNW B;  3ETQ A;  2UXB B;  3WB2 A;  2BTO A;  3CSX A;  4YY3 H;  4GLX A;  1DGS A;  3RYF A;  2GV9 A;  1SYX B;  3U0Z A;  2HVS A;  1KMI Z;  4DV5 B;  5CB4 A;  5LOV B;  2UXD B;  4Q6G A;  4TV9 B;  3RYC A;  5LA6 B;  2KSW A;  4CS4 A;  1Q5O A;  4LFC B;  4UCS A;  4ZIB A;  4B3T H;  3M7M X;  5IJ9 B;  4TV8 B;  2VQE B;  2RGR A;  1B04 A;  4ZHQ B;  1FVI A;  4LH7 A;  2E3C A;  5FNV B;  4DUZ H;  5BMV A;  2UU9 B;  4O4H A;  4NXM H;  1MZB A;  3N41 B;  5LYJ A;  4RB3 C;  4PZ7 A;  4AIL C;  3VQY A;  1I94 H;  4PZ6 A;  1QQC A;  4MTE A;  2VPS A;  5EOY A;  1FJG B;  3SJB C;  1YEW A;  4PI0 A;  1Z5W A;  4B3S H;  4JI6 H;  3RYC B;  1G6U A;  1BJT A;  4IAJ A;  2ZCE A;  3T1Y B;  3JSN A;  3QF7 A;  1P16 A;  1L8D A;  3K5O A;  4ZHQ A;  5JCO A;  3BA9 A;  4JYA B;  1HNW H;  5BMV B;  5EZY A;  4O4H B;  5KX5 B;  1IBK B;  4DR7 B;  4BWS C;  1HNX B;  1WNS A;  3RIZ A;  4X66 H;  2UUB H;  3JSL A;  1IBM B;  2UUA B;  3KAL A;  4R7R A;  4X20 B;  4WBN B;  5JQG B;  3W1G A;  2Q2U A;  2P22 C;  4JYA H;  4PZ8 A;  1P49 A;  4LF4 H;  4B3M H;  2YIB D;  5D1P A;  3UT5 A;  5K1P A;  5LXT A;  2BTQ A;  3RWR D;  2O03 A;  4BWA A;  4I50 A;  4O2A B;  3RJ0 A;  1Z5V A;  3LNN A;  5KX5 A;  5BR8 H;  2OYQ A;  4LF5 B;  5LP6 B;  2OWO A;  4LSA A;  4YJ3 A;  2CW7 A;  1XDN A;  2HVR A;  4LFB H;  5KMG A;  1IBL B;  4IIJ A;  4AQY H;  1I7F A;  4JI4 H;  1HR0 H;  1ZAU A;  4JI0 H;  5JJN B;  2RGV A;  3HKC B;  4LR3 A;  2XHB A;  3ZED A;  2P5O A;  3JAR B;  3KAK A;  4DV7 H;  4X1Y A;  5JJJ B;  4YJ2 A;  3CHX A;  4RAZ A;  5C8Y A;  3T1H H;  1X9N A;  1N32 H;  3RF2 A;  4MV9 A;  1CKO A;  3CVZ A;  4DRF A;  4LF8 B;  4ZOL B;  4L8J A;  4JI2 B;  1WH2 A;  3NC0 B;  3JAM W;  4DV7 B;  5KMG B;  4JV5 B;  4IIJ B;  2KKW A;  3TY5 A;  4EB6 B;  4FVM A;  3BRC A;  3WB0 A;  4CS3 A;  3K5N A;  4DUZ B;  5GON B;  3W1B A;  4D7S A;  4MTD A;  4X1K A;  3HKC A;  1A0I A;  5JVD B;  4NXN H;  4RB0 A;  3JAR A;  2EX3 A;  1BGW A;  3GDE A;  3BAB A;  3RR5 A;  1ZHQ A;  2CAZ C;  4LF8 H;  5C8Y B;  4LFA B;  1XNR H;  4DV3 B;  3RGX A;  3J7A K;  2ZM6 B;  4GKJ H;  5FPO A;  1O9H A;  1Q8I A;  4RB2 C;  2QJ1 A;  1FKA H;  4EB6 A;  1XI1 A;  1N33 B;  5LMN B;  4AQY B;  5IYZ B;  1D5A A;  4X1K B;  3OTO H;  1NT2 B;  3GB8 B;  4K8Z A;  4I4T B;  5LL6 b;  4Q0Y A;  2VQE H;  4DV4 H;  2WDT A;  1E4G T;  5CA1 A;  5IJ0 A;  4CS2 A;  2YIB A;  2UU9 H;  4FFB B;  4GKJ B;  1CKN B;  2UUC H;  3L2P A;  3A2F A;  1M0W A;  1E4F T;  3F8N A;  4OX9 B;  4LF7 H;  3BAA A;  2VWJ A;  3RYI B;  4RB1 A;  4DR6 B;  4AHC A;  4FLX A;  3EYY A;  2UXB H;  1XMO B;  2UXC H;  4J0M A;  2R70 A;  4U3J A;  3SGI A;  4YY3 B;  5IYZ A;  1TUB A;  4DV4 B;  4I4T A;  1JFF A;  1V9P A;  4O4I B;  1VS0 A;  1XQ8 A;  4LF6 B;  4LFB B;  2JGU A;  2VQF H;  4DR3 H;  4IHJ B;  4CH6 A;  3C0F B;  4FFB A;  4DR2 B;  3U10 A;  2UXC B;  1M93 A;  3HKD A;  2HIV A;  4FLV A;  3T1H B;  1N34 B;  4RAY A;  4JI1 B;  4DRX A;  2CFM A;  2VWK A;  1Q3E A;  2ZM6 H;  2ZIM A;  2E5L H;  4CH5 A;  4DR1 H;  1CKM A;  4EEQ A;  1N32 B;  4JI5 B;  3U11 A;  5EIB C;  1FJG H;  4LF6 H;  3BA8 A;  1FFX A;  1S03 G;  3OTO B;  3N42 B;  2ZIO A;  1Z2N X;  4LF5 H;  2RJZ A;  1IBK H;  4E6N A;  4X62 B;  1O9G A;  3K59 A;  1M4U A;  4A2B A;  4DR6 H;  4DR1 B;  1HNZ H;  4LFC H;  4O2B B;  4LF7 B;  2YCH A;  4B3R B;  4JI7 B;  4DV5 H;  3HKE B;  3RYH B;  2RQ6 A;  5CB4 B;  5LOV A;  1XNQ B;  1GYF A;  5J2T B;  4LF9 H;  4UCV A;  3H20 A;  1J5E H;  4JI8 H;  4UFZ A;  4K0K B;  2VQF B;  5JH7 A;  5IJ9 A;  4DR3 B;  1M5I A;  4TV8 A;  1S5J A;  2HIX A;  4PI2 A;  1RSO A;  4X62 H;  1O75 A;  5FNV A;  4O4L B;  5J2U A;  4JI3 H;  4DV6 H;  4HNA B;  3S24 A;  5LMU H;  2F4V H;  2HEP A;  5LYJ B;  4FLZ A;  3HKB B;  1TVK B;  2YI9 A;  5K1X A;  4K0K H;  1Z2O X;  2F93 B;  4JV5 H;  4UCO A;  4X64 H;  4DUY B;  3K57 A;  4LH6 A;  4DR5 B;  5BR8 B;  4O2B A;  3ZS8 C;  3N2K A;  3GJX B;  4TUY B;  3HKE A;  3RYH A;  5JCO C;  2UXD H;  2UUC B;  2PYL A;  4OX9 H;  2WE6 A;  4DR4 B;  3JAL A;  3M4I A;  4LNU A;  4BW9 A;  3JAK B;  4HNA A;  4UCR A;  1SKV A;  4B08 A;  3HKB A;  4X66 B;  1AN7 A;  1TVK A;  5FLX W;  3LML A;  4I9Q A;  4X20 A;  4WBN A;  3NBY B;  1N33 H;  3N2K B;  4LF9 B;  1JJO A;  4PDB A;  4TUY A;  3IG0 A;  4TV9 A;  2E5L B;  4EQ5 A;  4B3R H;  4DR4 H;  1TGO A;  3T1Y H;  4CC5 A;  3OTF A;  4TQD A;  5KHI A;  1WPB A;  3THO A;  4B3T B;  3RFR A;  2ZJT A;  2HHH B;  2BTQ B;  2Q7E A;  4KHP B;  4I50 B;  4O2A A;  4X65 H;  3KYH C;  3JAL B;  2CW8 A;  3JAK A;  4FLU A;  4FLW A;  4JI3 B;  2Q7G A;  2UUB B;  2UUA H;  3VNN A;  4KL1 A;  2ZNI A;  2HGS A;  2IM9 A;  4NXM B;  3J80 W;  1XMO H;  3N40 P;  4DV2 B;  3K58 A;  4GKK H;  5D1O B;  4JI7 H;  5KHH A;  3N6X A;  5ITZ A;  3MWM A;  4B3M B;  4X1Y B;  4D7T A;  1Q43 A;  5D5Q A;  2WYO A;  3SJC C;  4JI6 B;  4B3S B;  5JJE B;  4DR2 H;  1TA8 A;  5EZY B;  2PGG A;  3J81 W;  3KXY T;  2MCT A;  3JAT A;  3WB1 A;  1H2S B;  3K5M A;  4NXN B;  1IBM H;  1IBL H;  5JQG A;  1HR0 B;  2Q7H A;  1HNX H;  5LMU B;  5KHK A;  2ZIN A;  1N36 H;  5D1O A;  2HHH H;  3W5O A;  1XK5 A;  5ITZ B;  2R9A A;  3IAY A;  3UT5 B;  5LXT B;  2JS5 A;  1TAE A;  2F1M A;  1XHZ A;  3JAS B;  4YHH B;  2PY5 A;  4FLY A;  2JVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...