2YS7A

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
419
structure length
413
Chain Sequence
b'HMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylglycinamide synthetase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
total genus 125
structure length 413
sequence length 419
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2ys7A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2ys7A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ys7A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2ys7A04
4MA0A 3UFXB 3VPCA 3ORRA 4HNVA 3ORQA 4FU0A 5CAEB 5CA0F 3JRXA 2YRWA 4ZHQF 5HV6A 1E4EA 1DV2A 3RUPA 2PN1A 4RZQA 4HNTA 4MV3A 4J6EA 2CNUA 2J9GA 4I50F 4O4LF 1KBLA 1M0WA 2V5AA 1SCUB 4YBZB 4O7WA 2W70A 1DIKA 4O7NA 4HQ6A 4NYEA 3BSSA 3TQTA 4MV1A 3WO1A 2R7KA 1Z2NX 2R85A 3ETHA 1IOVA 3QFFA 3WNZA 4FFMA 3K3PA 4IZOA 1I7LA 4EAAA 5JH7F 2YRXA 2CNVA 4EA7A 2FPPB 1A48A 2R7MA 4MA5A 3U55A 1IOWA 1JLLB 2VQDA 3MWDA 5FNVF 3Q2OA 1Z2PX 2GQRA 3N8DA 2QF7A 3G8DA 4MV7A 2GPSA 1C30A 1OBGA 4MAMA 3HB9A 4XZ3B 3BFPA 2P0AA 1I7NA 3AW8A 1BXRA 2W6QA 2VR1A 2YZNA 4ME6A 3DF7A 5IYZF 4I55F 4IWXA 2NPOA 3VMMA 1M0TA 3TIIA 2W6MA 5D8DA 2NU9B 2IP4A 1KC7A 2YZMA 3KAKA 2C00A 2R6FA 1WR2A 4ZOLF 2I80A 4ZI7F 5BPHA 5BMVF 4YJ2F 2R7NA 3MJFA 4FGRA 1EYZA 1EUDB 2GQSA 4QSHA 1DV1A 4MV9A 4O7YA 5I47A 2ZDQA 3E5NA 1JKJB 4XX0B 5EZYF 2R7LA 1AUXA 4O4JF 1B6RA 3N6RA 1M6VA 4YB8B 5LA6F 2PVPA 2HGSA 3OUZA 1VBGA 4MV8A 1CE8A 2YYAA 3VOTA 2DLNA 3JZFA 5HBRB 2YZGA 1W93A 4O7LA 3KAJA 4FFRA 3RV4A 1T36A 4XYLB 2WYOA 1JDBB 2GPWA 5LOVF 2XD4A 1EUCB 1KJIA 2W6ZA 2CQYA 5C1PA 3I12A 4MV6A 2YW2A 2YS6A 1PX2A 4I4TF 3GLKA 5C8YF 4FE2A 4C5AA 3VA7A 3WO0A 1GLVA 3R5XA 1B6SA 2CZGA 4HR7A 1PK8A 1GSOA 2NU7B 5LP6F 1KJQA 2DWCA 5J2TF 4O7VA 3V4SA 2V59A 3NUAA 4Y8VB 1VKZA 1OBDA 3R5FA 4EGQA 4O7RA 4EG0A 5KX5F 4XYMB 3R23A 4C5BA 4FFLA 3MWEA 4FFNA 2W6PA 4O7ZA 4TV8F 4FFPA 3HBLA 4C5CA 5JQGF 3TIGA 2R84A 1EHIA 2GLTA 3U54A 4TV9F 4O81A 5KKNB 4O7SA 1Z2OX 2FPIB 4O2BF 4M98A 5LYJF 5JVDF 2NU6B 1A9XA 2DIKA 3TINA 1KJJA 2YL2A 1GSAA 3LWBA 3KREA 5JVLA 3HO8A 2R87A 4IHJF 3VPBA 2X0SA 2XCLA 1BNCA 1GGOA 1CQIB 2OLSA 3ETJA 4EA8A 5JQWA 4L1KA 3AX6A 1KJ8A 2W71A 2I8CA 3R5HA 3BG5A 3RV3A 1UC8A 2VPQA 3TW6A 3VPDA 1VBHA 1JDEA 3OUUA 5LXTF 3SE7A 1EZ1A 3U9SA 2ZDGA 4YAJB 2HJWA 3U9TA 2FPGB 2I87A 2YS7A 3R9RA 5C1OA 4IIJF 2W6NA 2VHEA 4O86A 2SCUB 3Q1KA 4MV4A 4O82A 1C3OA 3GIDA 3JZIA 2FB9A 4E4TA 4DIMA 2ZDHA 2YWVA 2R82A 2NU8B 1UC9A 3KALA 2R86A 5CA1F 3G8CA 4IWYA 4EA9A 2YZLA 2PBZA 1ULZA 1W96A 2V58A 4TUYF 5J2UF 5K2MA 2W6OA 4O4IF 3LP8A 4GGMX 4HNUA 3BSYA 2Z02A 4YAKB 5CB4F 4O7TA 2FP4B 2QK4A 1E4EB 1KJ9A 2CNQA 4EABA 4WD3A 3V4ZA 4O84A 4M99A 4EGJA 1AUVA 3K5IA 1CQJB 1GSHA 5DMXA 2NUAB 4WBNF 2Z04A 3K5HA 3BSWA 4M9CA 4YJ3F 4O83A 5BPFA 5GONF 1KUTA 4M9UA 3JRWA 4DLKA 4ZQIA 4FFOA 4O4HF 1CS0A 4O2AF 3RFCA 2DZDA 1KEEA 5H80A
chains in the Genus database with same CATH superfamily
4CF5A 4X8HA 1R0XA 2YIDA 1Q21A 4GKBA 5JISA 3NGMA 2B37A 4F3KA 2ZE7A 2QXYA 3O4GA 4L2IB 2H06A 3CSUA 1BMDA 3N0TA 3SS9X 2HIXA 4BP8A 1Z2AA 1OUMA 5TQ2B 2REQA 3ON5A 1P1JA 1NMZA 3E22A 4G9BA 1Y98A 3GA7A 3K30A 3ETHA 1OWOA 1W5EA 4XB6B 2AJLI 4G07A 1U7PA 1GFWA 2P6MA 2QLTA 2R3SA 4CQNA 3AR9A 2PL9A 3F6CA 2A3NA 3H20A 5T41A 4AMBA 4KPEC 3FYUB 1TJ4A 5GM1A 2Q2OA 2CE2X 3D8BA 4Q02A 2HHLA 4CTJA 3DE0X 1YBHA 1C7RA 1QVWA 2Z30A 3W3ZB 1NXOA 4MWSA 1P80A 4XZ3B 2YOHA 2QN1A 4L74A 1Y8RA 4GOJA 1TQ4A 1T35A 5TJHA 4WXRA 4AQYH 4JT9A 1MOPA 3GLHA 4PZ6A 1Y5IA 2RHWA 3IYLW 1KMCA 2YYSA 4YQFA 1C7QA 1EKVA 1FJ2A 2QTTA 3R7WB 3QWFA 4EKIA 4FI3F 4UHCA 1YA4A 1H2HA 2J0UA 4DNXA 2EFGA 3G2QA 4AJEA 4UMFA 3RTGA 1TKBA 3VNVA 3VKUA 1XQYA 3OF2A 3BN3A 4GM0A 1YKFA 4DREA 2ZUSA 4BO0A 4DJAA 3IUQA 2M6KA 2WKPA 1YCHA 4HTFB 4BXOA 3VKVA 2ZIVB 2FWNA 1EKPA 3H2KA 3U3JA 3X1MA 2R5FA 4AY2A 4Q05A 1S1CA 1IXSB 3T3DA 1BRMA 5BOVA 3P2OA 1E1RA 3KQNA 5DM0A 1R9GA 4O08A 2VRWA 2Q3MA 2JFNA 3K9LA 3IXMA 4JOCA 3FDZA 1FNMA 4BWYA 2GZMA 4WZBE 3X1ZA 4GE3A 1C3VA 3HADA 3SF0A 2IH5A 4BQSA 1KJQA 4G6ZA 3DE5X 1TTQB 1E0KA 2ZT8A 4CODB 4EYKA 1P60A 4H16A 3OCCA 4EGQA 2CNDA 3T5KA 3A6GA 2B82A 1DOHA 2YZ7A 3P0EA 2OLJA 4ECQA 1JAIA 3ETCA 4ZDWA 2IDZA 3LUGA 1CR2A 5JASA 4WBNB 4DVJA 4WCFA 3EEOA 4J1TC 1ZPDA 3HKCB 2G6BA 3W3AH 5AW7A 4QJBA 1AO3A 4RUKA 3F47A 1EDZA 2ASJA 2Y27A 2PXHA 4LFAH 1S2DA 3VPBA 1S89A 1RE0A 4LF9H 1Z5ZA 1T5OA 4L9WA 1XVLA 4MTLA 3AF0A 1XTTA 3Q7PA 1MCZA 3DMYA 5EMLA 5I5XA 3L8GA 4LNUA 3AM1A 3WX0A 1BEEA 5DVZA 3R7LA 4FEGA 2WABA 1IM5A 2R7AA 5FPKA 3DVSX 3ZV6A 2AEFA 4B3BA 2CT8A 1W2HA 5ILOA 4DHWA 3RS9A 3CVOA 4DIKA 2Z5LA 4KWCA 4TYWA 3OSNA 1X8JA 1OYWA 4FC7A 1UKYA 2XSZD 4QBGB 1WRVA 1FNSA 1CKNB 2JEGA 4M21A 1NVXQ 3T3OA 3NUQA 3JTEA 4MNTA 3VR6D 2YHIB 1UMBB 1EFUA 4R41A 4YJFA 2E5LB 3G8CA 1MA3A 4OQEA 3KO8A 5C0OE 4EB6A 1FUIA 4P4SB 3WYBA 4KXNA 1T94A 3CNHA 2AOTB 5DLQC 1NBWB 2FGKA 3KTOA 3TX2A 1R4NA 3E0XA 1FYEA 4EABA 3LUCA 2JJMA 4UPDA 1CQJB 2FW7A 4B4DA 2JA2A 3B1YA 3KBOA 4DV3B 3P9XA 4P82A 5IWAB 1MV8A 3EJ6A 2ZM6B 3UCEA 3OHAA 2CLSA 1NV9A 5K01A 5H80A 2PL3A 3M9OB 3VPCA 6REQA 1C7FA 2FUG1 3IIKA 3P5BA 4FHGA 4LYGA 1KI7A 4AKHA 4G8JA 2O8DB 3CW8X 1AD2A 3IE2A 4JUDX 1GZ5A 2RJNA 1G4HA 1Q1QA 2RHJA 3RAEC 4HAZA 4O7NA 3KYIB 1I6UA 4IHJA 3OO1A 1P33A 4GQBA 3EODA 2KBFA 4F72A 5LB2A 1UDAA 3FPJA 2YJNA 2Q27A 4N0PA 2RGEA 4C6TB 1S4MA 4QU0A 2VUMA 2OBXA 2GAAA 1DIBA 1RHJA 2R7MA 4BMZA 3VGPA 1NBHA 4EZIA 1WZUA 3ZGYA 2BAGA 2O8VA 4UCQA 3P45A 1R88A 1ORWA 1PP4A 5IAJA 5KFTA 3L4JA 4WLEA 5TQ2A 3ZS9A 4D9CA 2G1AA 2QE6A 1KOJA 4P2BA 3PL1A 5AKEA 4YAGA 2VP5A 3BIWA 3ZE8A 2IXTA 5BUSA 2BKVA 2FMHA 4BFLA 4F9GA 3O75A 4JC8A 4TLBA 3WRYA 1FVXA 4IDQA 5DHUA 3C4VA 1HXHA 4GAEA 1XJQA 2UYHA 5E25A 4U7FA 3FYUA 1P0FA 3MCVA 2QQ5A 5F4BA 1M0EA 1FFXB 3RB4A 1YMQA 4XGKA 2X8WA 5ALUA 4XZ3A 2IIVA 4KDCA 3RREA 5GIOE 3ZD8A 1FP2A 3LNTA 3PDCA 3PD7A 1J33A 4TTJA 5F21A 2G6TA 2HCJB 3R7WA 4PBSA 3IBGA 1RXYA 2WAYA 4JJAA 5L95A 2VJBA 2VAPA 3FFTA 1KJIA 3KL4A 3LMKA 4LZNA 1PZHA 1YS1X 5U9CA 4PLCA 1ZMOA 3CY6A 4DUZH 4BE4A 3CZ9A 4HXGA 1DAAA 1W9HA 5HIMA 2B8EA 1IIRA 1LBQA 2RGNA 4H7FA 1O77A 4HTFA 1LVUA 3ZCQA 4CIWA 4CXMA 3IE1A 4EW1A 3WIDA 3KZOA 3DFFA 2FLKA 2IYOA 1UC5B 1U99A 3G7UA 1N2CE 4HUQB 1U1EA 4EX6A 3MHPA 1XMQH 5KG5A 1I01A 3R6GA 3IAXA 4H7JA 1I1OA 3S28A 1COWD 1Z4JA 3T52A 1LK5A 1PZFA 4C2UA 2G25A 2Z2ZA 3KL2A 1JR2A 4HGYA 3L7LA 4S0ZA 1YS7A 5BR1A 4NMMA 4YMTA 3RRYA 3PC3A 3IB6A 4PYKA 1ZRNA 3ZD9A 1BEUB 3UVEA 3AILA 3GLVA 5FWXB 3DDCA 3HJCA 4ERNA 4PO9A 4WBNA 3OWHA 1S01A 1L7MA 1PX0A 1U6JA 3HKCA 5CDFA 1ZICA 2AMFA 2XQIA 4L0DA 4F06A 3CZPA 5I5VA 4ZALA 4WY2A 4QU9A 2C5FA 3W5OA 2I03A 1U4NA 5F12A 3WDSA 4F7WA 3A6DA 1I9CA 4RXUA 3SK0A 2ZJ5A 4Q9KA 3QVUA 1L4GA 3ZHVA 4Z4FA 5DGIA 1PVDA 1NVGA 1ZWKA 1PJRA 3NBFA 4WERA 3FPLA 3R9KA 3DL0A 4JQCA 1Z45A 4JNCA 5AI8A 4EBEA 3LKDA 4H60A 1QCDA 4QT4A 3K6KA 1DS6A 1E4VA 1RWPA 4IVNA 3DDHA 1B26A 5KT3A 2QL5A 4CV3A 4FTWA 3ND8A 1RXSA 2Q41A 4F2PA 2M6SA 1S0UA 1OHHD 2XMQA 1CKNA 2NSYA 2QTHA 3PEEA 1YFLA 1R6UA 2YR0A 2RONA 4R6XA 5B6JA 2O1WA 4WBNF 1E2HA 4FZJA 2YHIA 3SIRA 1UMBA 2UKDA 1NV8A 4XFJA 1X13A 2EFHB 5K5EA 3ADDA 1GTMA 1PS9A 2HRBA 5DOVA 5DH9A 3F49S 4P4SA 5EZYB 4AB1A 2AC7A 2CNBA 4GWLA 4YRJA 1CUSA 2HU8A 4MWBA 5DHRA 2AOTA 3NHKA 3DAAA 1F51E 4GWGA 2PX0A 2GJAA 2X0DA 1F17A 1XP8A 3TNDA 3E3MA 1RPZA 2CY0A 2E7ZA 1QVRA 2B30A 4HNSA 4HG2A 1JR3A 2WP0A 4RLQA 2ZCVA 1M2FA 4KYVA 1BXRB 2V97A 3VNUA 2Z4TA 2WSSA 1KO8A 1VE1A 4P2GA 1VL2A 1HNNA 4OQYA 5H83A 2C42A 1E3QA 1RJWA 4UPVA 4UU1A 2O8DA 1LBEA 2R68A 2G0TA 3D3KA 5CJ2A 2Z6AA 3LQSA 1XVTA 5AW9A 2CNLA 2NLOA 3QX8A 4LV8B 2Y4NA 2VQFH 5JBNA 2JCYA 3ZOZA 2BH2A 4WZ6A 5AVOA 4C2MA 4G67A 3AEUB 4KAXA 2PX4A 4RHTA 1I7NA 2YJ3A 2I1VB 5JIBA 4G01B 5DM4A 1G4UR 2ESRA 5IW8A 4C6TA 1KQGA 3BEOA 3FPCA 2D7DA 5EJFA 1GUYA 5B30A 1KC7A 2O8CB 3EDYA 2I6XA 1RJEA 1Z8DA 4PZAA 3PKIA 4BNMA 4ZO7A 5IVDA 2GXUA 1RAAA 4FS3A 4GOND 1K9VF 3R09A 5AHKA 1Y48E 3O7MA 3MYRA 4GRDA 3CNOA 1X1TA 2H1IA 1DX9A 5K0LA 2G8NA 3ZWVA 1GFZA 4BX2A 1ZI9A 5T67A 1TE2A 4RJKA 1QVVA 3T9AA 4CT0A 1ACMA 1FFXA 3F6RA 4BKPA 2Q5EA 4B4WA 4M60A 2QJWA 1WCIA 4HSEA 1JQLB 3BB3A 3STUA 5ARBA 3P0IA 3O8LA 4HR7A 2C9OA 3DTNA 4YO8A 4TMXA 2ODNA 3ORHA 5AW4A 1QP0A 3DVQX 2AMYA 3E5MA 3HABA 4E7PA 1WF6A 3BWEA 1RYFA 4BBPA 1NWHA 3ZDZB 1VYVA 4FHEA 1OD6A 1HZJA 2ZTLA 2IH4A 4DVGA 4LZWA 3FNFA 4RA6A 4FFPA 1Z0AA 2J9FB 10MHA 3ZG6A 4RJIA 4YJ3B 4PWQA 2AX3A 3W7BA 2PANA 3U09A 2D4AA 4IDDA 1AKWA 3HVJA 3ONVA 2FWPA 3TJZA 3W2TA 1NJFA 3PEWA 2O2GA 1KXJA 4HVTA 1ESCA 3F7NA 2X0SA 3E03A 1QYCA 4PANA 1U9ZA 3K5PA 4OHRA 4Q9LA 1RBQA 3LXXA 5IUNC 3E3OA 5IT5A 4O3MA 1C3OB 2CFSA 2E0IA 1RRGA 3DD1A 2X58A 4GLBA 4HO1X 4QFCA 4BNXA 2YVUA 3KKMA 4A6DA 1FVFA 2IIBA 3RPEA 4QAQA 4DR4B 1QLWA 1CFJA 1V25A 4RENA 4IR1A 5ALHA 5SZJA 4PICA 3ELYA 3MK31 1LRJA 4YR0A 1KO1A 3DWIA 2HTFA 3NHUA 2IIPA 2AW3A 3F4LA 1G5RA 3KTAA 2WYUA 2IUTA 1DO8A 2JW5A 3OLWA 1XNQH 3RFXA 3TQ1A 3H7IA 4KFTA 1Y7TA 5FWXA 1NLMA 3N76A 5FOVA 5TRTA 2O14A 4LJ5A 1BEZA 1IULA 2JDID 3NNNA 2AE1A 3R6LA 4GZMA 2AN4A 1SZDA 2GZHA 3LP5A 2XYVA 3QFSA 5L7TA 2ZAGA 3M1IA 3EVAA 4EELA 5CNJA 1JECA 3OTGA 3F5QA 3QA3E 3DEHA 5JNWA 2QMHA 1FU7A 3PX3A 1QHXA 2FJ0A 4OAPA 3H40A 2H5EA 5CB0A 2V7GA 3N0XA 5AJXA 3K5HA 4IDNA 3GJ3A 1VDZA 4BNVA 3K32A 2DQSA 4G9EA 4FYIA 1FNDA 3N0RA 1XTRA 3SXUB 4QHSA 5EWEA 4E51A 3A9TA 1NVFA 1U1FA 1RAHA 1TYZA 5ES4B 1WDTA 4OATA 4QG3A 1A76A 3L0PA 3PP8A 3UMMA 1RBYA 4HDAA 4AULA 2H9YA 3QLVA 3OCZA 2W22A 2PL1A 1LU9A 5KAPA 3HZRA 2NO5A 3HDJA 1V37A 3L02A 4DQNA 1UBEA 3QLTA 4REMA 3ONNA 3A1UA 5EZYA 3L4EA 1T25A 3WHKA 4MMZB 1BKYA 2JFYA 3RM3A 2FLPA 1X9NA 3H4IA 4XDHA 2MHCA 4P3NA 4MVJG 3AJ9A 3COVA 1NNUA 1A4RA 4R8UB 4ZO4A 3GT7A 3E05A 1DBSA 4YV2A 3BCRA 3JWJA 4E07A 1OBGA 1GQOA 2FEOA 1OH6A 1QDUA 3FFWA 3VVLA 3OQOA 1NX6A 5JSFA 5KTSA 2E4XA 3FNHA 1T9HA 1WSCA 4V0MA 1BXRA 5KYUB 3F96A 5D3KA 3IP7A 3GA0A 3II6X 3K3VA 4AG6A 1OC2A 1SD1A 3HNOA 1G7RA 4MCHA 4D7AA 2EGUA 1XROA 1GFIA 2YZMA 3CE6A 3WHIA 3WZLA 3KFVA 4GPIB 5KFCA 1O97C 4UFZA 2DULA 2JJQA 3S2GA 2VA8A 2R8BA 4ECYA 2Z0MA 2FP3A 2GK7A 3R0VA 3D2AA 3KR2A 4PLGA 5EZYF 4NNPA 4DDMA 2BFOA 4HADA 1NT2A 2XE4A 2PWAA 2ZBQA 1K5PA 4OAQA 5C3UA 4PO1A 4V0KA 5LLSA 3BTVA 4KRFA 3REGA 3FETA 4J3JA 4QRHA 3MPOA 1UPUA 2GPWA 1ADYA 3EBPA 1P3DA 1MC1A 2O8CA 1NVAA 3ESYA 4KQEA 2W6ZA 4LXTA 2ZXEA 5KDOA 3V34A 4URUR 2EZ8A 1PL7A 3BJRA 1KGSA 1F6WA 1ZN8A 3P9IA 3W34A 2XWSA 2I4MA 5FBHA 1TVMA 3KQUA 3WO0A 1BC5A 2QUHA 4C3ZA 3OT4A 3PA8A 1EZZA 1KAOA 3OEHD 3AM3A 2TMYA 4JJFA 4R3UC 1H23A 1KK3A 1OXMA 4BMDA 5CB4B 4LY9A 2H2AA 1JR4A 3HSYA 1X7DA 1KZHA 421PA 5DBIA 2NXEA 1KAEA 4TS1A 1USGA 4WA7A 1BFUA 2BBOA 2VTBB 1N2IA 1UJBA 5IUJC 4CF4A 4ZJUA 4EYHB 3BA1A 4PHGA 1M73E 4FWBA 5HR5A 2XB6A 1BNCA 1RPJA 2E5LH 5C1BA 5C8DA 2AHRA 5F5XA 4YQWA 3GNTA 2GFQA 3I30X 1GPDG 3AIIA 3KR0A 3NU1A 4ZCQA 1EAMA 1RCUA 1L5WA 3QBDA 2D5AA 2RMKA 4KRGA 2C4TA 3EOZA 2VDLB 4YJ3A 1T13A 4W6QA 2V55B 1BROA 3GUYA 2YY7A 4LY6A 3LWDA 3O2JA 1AKYA 5LBUA 3NHRA 4ZOEA 4DSTA 5D2CA 4I5EA 2AI1A 1C81A 4BB0A 1ZOIA 1JWAB 3RO7A 3ZQJA 5K8LA 4O82A 3HDTA 1C3OA 3GU3A 1X7XB 5LM3A 4D42A 3C3CA 3O74A 1OZGA 3BRQA 4BVGA 1CKMA 2AV6A 3OM0A 4MV5A 1SBZA 2QUJA 5AIBA 3EIHA 2APJA 3G8AA 5C52B 1CZNA 1TTPB 2C0PA 3I0MA 5AOAA 2IYRA 3S8EA 3QH4A 1FDWA 4OQFA 5IF3A 2AEMA 4JBNA 4F11A 4DA9A 4D4IA 2HXGA 4Q01A 5CCEA 3PEVA 1U8XX 4MW1A 3B89A 4G1BA 4YJ3F 1HZZA 1N25A 1PS8A 3FBTA 4YC7A 2ZLBA 3M5CA 4Y2SA 1T26A 2QBYB 3FLEA 3NAZA 4IIEA 2TECE 5ANRB 5KG4A 1BCSB 2BCEA 4DSZA 3H42B 3IQWA 2QRMA 2XNCA 4EHIA 2VJYA 2ZR0A 1V47A 1VBFA 3QHPA 3MLAA 3BJZA 5J9FA 1F0PA 2Q4BA 2WV7A 3WOHA 1BZYA 3TTXA 4UDOA 1L9KA 2JAWA 1VZ3A 2GI4A 1ADGA 4WZAE 2OL4A 3ILSA 4DV1B 2OCAA 2QD5A 3HOVG 3IXLA 3FWNA 1KY2A 1KEKA 1KDTA 5BVHB 3SDZA 2FKNA 2QOEA 3MWKA 2GPAA 5AVTA 2RG1A 4II3A 4MQEB 2EFDB 4KPUB 1XZLA 2RARA 3OF5A 4IIGA 3L3BA 2PWZA 3IPXA 1Y5MA 1KEVA 3AY6A 3DKVA 3WA6A 3PXDA 3O0TA 4HWSA 5AI9A 1J49A 1YO6A 3IQEA 4EFKA 4BN5A 2G04A 3QE2A 1E4YA 3TJMA 3FDFA 4ND1A 1XZJA 4R8UA 1SU6A 3UZUA 1YZHA 2W9XA 4CMEA 1ZMBA 2Q99A 3PICA 3OE7D 1NDQA 3LCJA 4IFTA 5E3IA 4J9LA 5IMBA 1N77A 3Q8QB 3ZJTA 3SR0A 2HSDA 3IPLA 4RZSA 5TPZA 4TM5A 1WD7A 4DG5A 1R15A 4IVQA 1U2PA 4V0LA 4D9BA 4ZK2A 2CMHA 2GCEA 5B2ZA 2C7QA 6GPBA 3U44B 4AXBA 4QDKA 4IR7A 2JHGA 3MUNA 3AHHA 4LSXA 5KDLA 2AXPA 2X9GA 2D74A 4UDYX 4F3CA 1JDTA 1RLIA 4B6SA 3OU7A 1YHZA 4JR1A 1HT2E 2IYAA 3HYNA 4W1SA 5DLPA 4ZT3A 5JG7A 5J4LA 4IQFA 2FLWA 3I52A 3IGFA 4BS9A 5BQFA 5B3JA 4NQZA 4N7RA 1LPAB 2W2KA 4LFBB 1MVLA 2O1EA 3VR2A 5EZ6B 4BWSC 3PUJA 4UE3S 5FKJA 3RKUA 4CWAA 2H2HA 3GLFE 1A9XA 4MVWA 2JK1A 5I7VA 4JXUA 2SNIE 4Q3AA 5EXTA 2R87A 3GFRA 4ZMBA 5CB4A 2IF2A 2BPOA 4ZVNA 2OLSA 1ENOA 3VKGA 2NZYA 3IHKA 5JPCA 3HYLA 4CQJA 4GPD1 3V8VA 3MWFA 4B73A 1ECCA 1GLGA 2ODQA 2WZCA 4MIEA 2R8KA 1II9A 2VTBA 4QJ5A 2R8GA 3VTZA 4RSMA 3SNHA 2FUKA 2ZRHA 2A88A 1GA6A 3ROGA 1OBVA 2OUIA 1X39A 4B8ZA 5F9HA 2EBHX 1VLLA 4HNGA 2V4RA 4U7TB 3M4NA 3TMAA 3FTPA 4B6FA 4P4NA 4CMDA 1GKUB 5ELXA 2A4KA 3JALA 2YQ5A 5G3ZA 4JLNA 1YGYA 4C4OA 5EXEA 3KV3O 2E89A 2VC2B 3TI9A 3DKPA 4BDTA 1XLUA 3CH5A 5CB4F 1WW2A 4LHXA 2PKCA 3ZVNA 2HM7A 5CT4A 4D98A 4TKVB 1C9DB 3WDKA 2XB9A 3L77A 2VZ8A 1X7XA 4GVPA 3G59A 3M4ZA 2IQIA 3IDFA 1AZSC 4J4HA 1GITA 2UVPB 4HB2A 5BPFA 2OCBA 4DTIA 4TTIA 4LXHA 3I6YA 1ZAUA 1T91A 4OB7A 3HWSA 3N8IA 1QG4A 3L04A 4KPYA 4MUBA 2WW8A 3HBJA 4FU0A 4Q4LA 1NPDA 1SUFA 2C5EA 4G8CA 3A4YA 3HJRA 5HMLA 4K46A 4N7MA 2OBMA 4BP1A 4LHVA 3ZBTA 1NQAO 3I0ZA 4U7HA 1UBCA 4W5HA 4LCBA 4Y2UA 2QN3A 4FDMA 3DFKA 5DGAA 4U8GA 2FLNA 2ZJ4A 3J81W 2QBYA 4Y1RB 4LHZA 3VPGA 1I1NA 2XQFA 4IDFA 3PPWA 3HRKA 1TU4A 1ZOOA 2IGBA 4CUKA 1O95C 4UD2A 1Y1LA 3QK7A 3HGTA 4C7JA 5K3BA 3K0CC 3AF5A 1GZ4A 2BZGA 3MRXA 5IDYA 2HBQA 1MDFA 3SVZA 4GLXA 3W8DA 5D51S 3WBBA 2PQMA 4DKXA 2OD7A 3ADOA 5LQJA 5IEJA 1E7SA 4DF3A 1SOVA 1I0LA 1NMXA 4HGQA 2L82A 2UZIR 3KJNA 3AIKA 2PSJA 5AKKA 5ELLA 1NUPA 1V4YA 1E9AA 3MERA 1MGOA 4E5UA 1H9CA 1FP4B 1UINA 3GCZA 4H31A 3FOZA 1J56A 3VR3D 4EGSA 5TS2A 4EY8A 2OM6A 3K05A 4JXJA 1GT6A 2LPMA 4YJKA 4MV9A 1QSGA 4F1JA 1P1KA 3ILXA 3E9EA 5HM8A 5HGXA 3ZVLA 4XUGB 4FFDA 3KZMA 5H3LA 1BQ4A 3OUZA 5KQRA 4PVDA 1UOEA 3HCAA 3ZV7A 5IBQA 4X95A 3PFCA 1TT7A 2WTAA 3WRXC 5REQB 4PF1A 2H2WA 3LW7A 1RQLA 2AUNA 3JVUA 3IX7A 1G8FA 2C2DA 4DCVA 1Y9EA 5IVHA 4ENUA 3AVXA 2OHGA 4PX9A 1SXQA 1QQ5A 1WZIA 4RH0A 5C7IO 4B3XA 3P9NA 5LJIA 3OJFA 1B3BA 3DMNA 3LU1A 3E23A 5LB4A 2OGTA 3AL3A 1I3LA 2OR3A 2VAMA 3RANA 5DI3B 1SKYE 3U44A 4DR4H 4D79A 2QTMA 3RROA 2LGJA 2OT3B 3TBFA 4QREA 3PWSA 3ZDCA 2HDOA 3TIXB 3U0VA 4MGIR 1RKVA 2Q28A 2HPZA 4HDMB 3WWCA 4FDAA 3P19A 4MUEA 2BM9A 2C4HA 4P0QB 3C5WP 4CMHA 3TL3A 2B4KA 4TMZA 1X8KA 3CSWA 1NY5A 2FFQA 2K87A 4EJ6A 1I14A 2IYWA 1ODLA 1KZYC 1SIBE 1JTEA 2VYVD 4L4ZA 9GPBA 5EJ5A 1CUEA 4Y2YA 4XWTA 3T4PA 3SYRA 1OU4A 1UPTA 2W4IA 3USZA 1U0BB 5K8UA 2I3AA 4N3AA 2WFMA 1K6XA 3UXEA 3CX7A 1D4OA 1YU6A 1B93A 3G5TA 4ER6A 1TLTA 4OGFA 3QE9Y 3KP1A 3IDAA 3HXPA 4YMLA 2FB9A 1MT3A 3ZDYB 4DJFC 1LV8A 1U2SA 4OHPA 4IXDA 2RD2A 1FU4A 4C76A 3CEAA 4GUDA 3CNEA 2HA0A 1DGQA 4IIBA 3CZ5A 5JNTA 2R7ZA 1LQ2A 3MIIA 3SY8A 2I1LA 2I9PA 1PFKA 1T43A 3BRWA 4Z1MA 5FOUA 4WLUA 1ES9A 4AUKA 5ILQA 1X0VA 3DLAA 1L5HB 3ZDBA 4C22A 3QQPA 1FNNA 5LVAA 3ZU6A 3BQ1A 1SHTX 5KTYA 4HZUA 4ZI3A 1RYDA 2H65A 2O20A 1IXRC 4L15A 2BRUC 1DKQA 4I46A 3RRXA 1HE8B 3A3OA 3VHLB 2LE0A 2ZYAA 1BA3A 2RHGB 1KETA 3MGKA 3E9CA 1CIVA 4ZYZA 5GY7A 1IY1A 5E6UA 2XV1A 4HLCA 2GBLC 5K0EA 5DTQA 5ALPA 3VBCA 1HK7A 3ZHYA 2AR7A 5HRUA 2YNMD 2IIQA 2NVOA 4N49A 3A6FA 2NGRA 3GZTB 2AQ8A 3TQTA 1BWPA 5F7OA 2JKYA 1LDNA 3ZE7A 1PFQA 3UHAA 1XUOA 5A3VA 2PNJA 1ECLA 5C2JB 3NWEA 4KYIB 3HFGA 2JH8A 1XX6A 2PA3A 1L8AA 4FB5A 1CJBA 1I6LA 1N8NA 5JCPA 1K75A 4PYOA 4J16C 3SQXA 1TECE 1OH5A 3QXHA 4UEJA 4OQNA 2QAJA 3NYWA 5DGCA 3RT1A 3U39A 5JSZA 4MV7A 3DW1X 4L4UA 1I32A 3UGKA 4BQRA 3WZMA 4P8RA 1S9DA 1ZJ5A 1DU4A 5AKIA 4Y1RA 1NAIA 3SZUA 1A2QA 3HC7A 1FJXA 1BG6A 1IE3A 2CKMA 3AUKA 4WKOA 1H2EA 2XYQA 3TIFA 3VVCA 3U5ZB 2FMFA 4LXYA 1RP1A 3BIJA 4PC7A 3I5AA 1HDGO 4MI6A 2I67A 2HMUA 1K7YA 3VAYA 2M9MA 2ZR8A 1WBJB 1X86B 1V8BA 3ZHXA 1X74A 3TN7A 1M72A 1K88A 3JV7A 1SKBA 4CV0A 1UL1X 3RU2A 3FE2A 5IMSA 4MQMA 4B3SB 4TT8A 2Y76A 3HEMA 2D4HA 2WG2A 3Q8LA 1P8LA 1M1XB 1QO9A 1RHMA 1U8AA 1JA1A 4ARZB 3CF6R 3FXAA 4YI5A 2AEJA 1FP4A 2BKLA 3ZX4A 3PGKA 3UQZA 4NAHA 1AV6A 3Q3EA 1MPXA 4XGRA 2Q7OE 3GTLA 5I4CA 1NU8A 3G68A 1GLVA 2F3SA 3EXG2 4YQEA 3KU4A 3WKCA 1I2DA 3M6LA 3UAGA 5JJLA 1WB6A 1VKZA 1ZUWA 5REQA 2PZGA 3NQ41 5ENVA 3CH7A 3T7SA 3HR4A 4RAYA 1JXAA 1G98A 3W5SA 5B55A 4V38A 4TQSA 1WKVA 2O5CA 2B1RA 3BXPA 1T2FA 3N7AA 5AK0A 2D3TA 1QPGA 3ASVA 4UM5A 3G88A 4F3NA 3OG9A 1RHKA 5KFXA 1XHFA 3TO5A 3SZ3A 3AB8A 2Q50A 3ZIAA 2Y6VA 2FPMA 1MFPA 4Z4HA 1RLOA 3SFTA 5DI3A 3IKLA 1XLTC 1IYZA 2XYRA 4ND5A 4ZCPA 1L4LA 3VYWA 3BZBA 1MRZA 1LK0A 4CNBA 3ELDA 2HSJA 2B21A 3EGXB 4QD3A 1BXKA 1EGMB 4ER3A 1WRBA 2ZU0C 1QX3A 3QOFA 2QD4A 3FB4A 2G80A 1GM5A 5HCNA 1GDDA 4HDMA 1CUYA 3RF6A 4B32A 4RESA 2WA2A 5KFUA 3KYHC 3W7AA 5FL7D 3WYAA 5JNSA 4M1TA 2XMCA 5I7AA 1JBEA 3L05A 2ZJ2A 1EFKA 4CF7A 3OTOH 4E33A 1TZ2A 4UEOA 3DE1X 4BLUA 2JLVA 3A9CA 1KJYA 3MJEA 3ZQ4A 1RACA 3N5CA 4YPOA 4ZQCB 1ZBQA 4WIAA 1KVRA 5K0SA 2MSKA 1UOQA 2PD6A 1E0SA 5A3SA 3UANA 3ZE9A 5HJEA 4L5CA 1CFZA 3RGXA 5CG2A 1U1DA 1T9AA 5CIYA 4GZ3A 3SKVA 4DSOA 1WXWA 4E2XA 1TL7C 2DPXA 2HD4A 4GP7A 1ZAKA 5JXWA 3T9DA 3DL2A 4BVLA 4OLAA 4C03A 4RKFA 1E98A 4AMGA 1N5RA 3YASA 1VSUA 2LKDA 4L0CA 3OZIA 1RJDA 2RHTA 1EP9A 2UUPA 4FJ1A 1UJ5A 4PW0A 1LS1A 1Z39A 3DM5A 4FEYA 1L5HA 2YICA 4KJZA 1N2CB 1WVGA 3D7LA 3L8FA 3PC7A 3MGGA 4FR2A 1ZCBA 1E1DA 1NR7A 3IJEB 4IVPA 1N2ZA 3FUWA 4AC9A 3PU6A 4ABYA 3VC3A 4G25A 1XCJA 2PCLA 1W6RA 3E82A 2CB0A 4LXGA 1N78A 3ANLA 4EO4A 1MQ8B 3LVRE 5DTMA 1QO7A 3OFKA 4DIOA 2W7OA 7YASA 1XNRB 1MKYA 3C4QA 1MOQA 3HCFA 1RR6A 1UEJA 2BMWA 3FOFC 4XCXA 2IL1A 1AN0A 3IBSA 3GELA 4DLSA 2WNSA 3JQFA 3Q8XB 3KSBC 3JQBA 4F92B 121PA 4LZOA 4MYTA 1XU9A 3BORA 1L7EA 3RYFB 2KB0A 2XGMA 1UQUA 1G5FA 4MWCA 3ZE1B 3MT9A 2BN4A 3RAPR 2O50A 3L7KA 1T0BA 3PNVA 1G9XA 3KXLA 1IY2A 3ZW7A 4P54A 3UXYA 3FR7A 1NTRA 2XVMA 2G8LA 3ENWA 4YWHA 4BGVA 2DLNA 4RGYA 5J58A 4TTTS 1NNLA 1VJ5A 3EZ9A 4LFBH 2ZBPA 4D56A 4TMYA 4H4CA 3WYNA 5D5QA 2Y92A 1DLIA 4JP3A 2P4EA 4LRTB 2V1XA 1R6TA 1GUAA 4PGHA 4AMUA 1JIUA 1M6YA 1AHNA 4KAJA 1O9HA 2NZ2A 2ZE8A 3WGYA 1KS9A 1B0PA 2Z2KA 2ZJOA 2I2DA 1IWPB 4KGVA 2XCTB 1YA6A 3HXKA 3G8YA 1ISMA 3B78A 1U3WA 5F7XA 3R1IA 1IWOA 1AK1A 4P58A 3LPDA 2RI6A 3JQEA 1G16A 4B43A 1QKJA 2BWJA 5C32A 2PGOA 3RT9A 1P4AA 6NULA 4X65B 3OM1A 4HQNA 4IJ6A 3OQ6A 4PDBA 4OHUA 3ZWWA 1UK9A 5K05A 3U7HB 4Z3OA 5FPPA 3LRTA 1ONPA 4GMGA 3ZZ1A 1NR1A 3OJ0A 2EERA 5LZ5A 3PNBA 3FMVA 3MGBA 3T35A 4A3GG 3IVCA 1R18A 2GAJA 3PRYA 3SSMA 2PKRA 4Q44A 5ELMA 1NU6A 2FDRA 3D4PA 2I22A 2P6RA 2PZFA 4FEAA 2WIBA 1N6PA 3D8RA 5DISC 4A3EG 3GFBA 1KEPA 1EFAA 1LH0A 2ZETA 1P2BA 4A1OA 4KLNA 1XNHA 2ZYWX 1W1WA 1RKBA 1HNXH 2NYRA 3PUHA 3OCWA 3OC6A 4YA6A 3ESBA 4F5DA 3CZAA 1TIKA 2DC1A 3E9QA 5DYGA 3EGXA 4RJ2A 3FR8A 4YALA 4O33A 4D96A 1NQVA 3KU1A 5I5TA 4L2IA 1ZUHA 1GUFA 3HDYA 3DLHA 4G9GA 2CF5A 2JCGA 2AVDA 3UG6A 5LP1A 3HXTA 4DR5B 4AURA 4MUYA 1KOLA 3FX2A 2WICA 1HL3A 4OV6B 3LP6A 1X14A 3WMGA 3VJRA 3PX7A 1I4TD 2AN1A 2J0QA 3REFA 4WCFC 2P8JA 5E1OA 2K6GA 3CR3C 2Q5CA 4YYZA 1RZRA 3GBSA 3TQOA 2G0AA 2BHSA 2JVIA 5DK6A 3NBAA 5AJTA 1K92A 4RE6A 5KS8A 1I3NA 3SR3A 1DV2A 4JLAA 1UZLA 1SVSA 4JI6H 1EUYA 1ODIA 5ALSA 1QVAA 1ZK1A 3BERA 5FP0A 3MWDB 5ED4A 4B35A 2CXSA 4LJ4A 2W70A 1U9JA 2E18A 4B5KA 1J4AA 2HMSA 3RVBA 5EHZA 3GI1A 1KSFX 2AFHB 4FFMA 3VH4A 3CWQA 1KBOA 1YVEI 5KMGB 3TSZA 5I8PA 3PJEA 1ND5A 5BUZA 1N6RA 3GR6A 1NULA 2FDCA 2FGJA 4TM7A 4Q7LA 4N41A 3WXBA 3UB2A 2D0OB 2XPCA 3NJ8A 1W49A 1H69A 2FSPA 2XOKA 1R8YA 4AZ3B 1AXEA 3N2EA 1T3HA 4OU5A 4XM2A 1CG6A 1O08A 3E7PA 2JIOA 4D1YA 2XAUA 2JEJA 5H59A 5ITWA 3CUUA 4HFNA 4LHEA 5NULA 4ZEWA 1UZMA 1C4WA 4PZCA 1FU8A 2E82A 4I2NA 4BBZA 4UM9D 2FJZA 3ANMA 3PR3A 3AHEA 3O83A 3VNAA 4J6FA 3TAUA 2CBXA 2PMKA 4D3FA 3AZPA 3QUSA 2DWUA 1ISSA 3R40A 4QARA 3AP3A 4ZV4A 3IBCA 3GDWA 1UPXA 1R0CA 4KV9A 2C7PA 5B2EA 4IX9A 3HKZE 4B3RB 2ZZNA 4HYTA 4K5QA 1EVLA 3NUZA 1K97A 3WWPA 4LOAA 2FJUA 1B73A 1DKOA 5T4EA 1RSZA 4Q1DA 4NMHA 4GEGA 3AV3A 4DL2A 4XYLB 1MO6A 4X85A 5IXSA 5I51A 3NOXA 3QEKA 3RYFA 1FK8A 1TU3A 4MDHA 3JVVA 3PWKA 2E21A 1E32A 4JV0A 2PFGA 3GTQA 1EFRA 3DE7X 3KQSA 3NONA 5U1PA 1DIOB 4BVFA 1LLCA 3WS7A 1TJPB 5ALXA 3OTQA 2H2FA 3LUAA 5E9WA 3R23A 3LYHA 4EZEA 3PHCA 2J3MA 2FK8A 3S0JA 3VH3A 2LBPA 5JAQA 1VHLA 4UZEA 2ZZKA 2FW9A 2AZXA 5AXBA 1AM4D 3COZA 1CY1A 4PZPA 4P7GA 3SC4A 4U7CA 1H2XA 4IIXA 3WRYC 1DC8A 3U4QB 1VI5A 4RIGA 3UPTA 1PJAA 3SN6A 3WLRA 3SSNA 3JX9A 3FYUC 4AJHA 1WCV1 3TI7A 1A9OA 1C7JA 2ROQA 1QNLA 4DBLC 4M0MA 5LPNA 2EBUA 2JGRA 1AH2A 4KXYA 1NVMB 3A9WA 2XR1A 4JI8H 3VPDA 1MO4A 5T3UA 3FMPB 4IHQA 3RRNA 5BRJA 1CQJA 2P0YA 1Y6QA 2Z57A 3WNVA 4PHCA 2QEQA 4YLEA 4J7UA 3ZVMA 2EHDA 2WSIA 4CE6A 3PNOA 2FPOA 1MDBA 4N82A 4U6PA 4AJOA 5KVAA 3CINA 2VDRB 4ZGBA 1F4PA 2ZTVA 1LDGA 3B7GA 1NXQA 2JIQA 3JYOA 2CVPA 3QG1A 5DE3A 3MBOA 3S8MA 1M6NA 3H1TA 2J3LA 5G1NA 4D99A 1XRPA 5IX8A 1R9MA 4PFKA 3PB3A 4EWLA 5FBRB 2RGNC 1M33A 3T12A 3CZCA 1TM3E 2JK0A 4YY3H 1U3CA 2B83A 5C9ZA 3NWOA 4CR6A 4P08A 3D43A 3G2MA 1QRSA 4FHZA 3JYPA 4UBIA 4JI4H 1EKXA 2XDAA 1QYRA 3FUXA 2O5EA 2MINB 1W5AA 4G0UA 1M7HA 5EJAA 2EJ2A 2JFBA 1KIFA 3W6UA 2P2GA 5KSWB 1VE9A 3ZE2B 4XPZA 3WGOA 1BX0A 4LF7H 3EOBI 2GVDC 4Y2GA 2NPFA 1NFQA 3NASA 1Q6YA 2JGKA 1GGKA 3C6BA 3BCHA 3WG9A 3SQOA 3C3YA 1JU9A 2WJIA 5A6VA 4ZZIA 4D25A 3KQOA 3O7WA 4XWYA 4MVCA 3VGJA 2QRQA 3RW9A 4B7XA 4RLFA 3QM1A 1J7KA 3WDMA 2R4TA 2ISQA 3W9YA 3PVSA 4XQ0A 1E2IA 3VI3B 2NSDA 2V7QA 3QNMA 3R6TA 1U3DA 4L5AA 4TQ9A 5KS2A 5AO9A 4U2GA 2YJ4A 4MYRA 1JHYA 4HAUA 3MWDA 2PTHA 1RM4A 3HY6A 2ZJYA 4RLHA 4RB0A 1DQNA 1P7YA 3PVXA 2AFHA 2BKAA 3SSOA 1VL5A 4YRZA 4F50A 1VL6A 4I0WB 5KMGA 4YFYA 4NH0A 3OLYA 4YQZA 1YVRA 2HTEA 8MHTA 1KSJA 5BWLA 3QMVA 1W94A 1S9FA 3BGDA 2P9EA 3QU4A 5KNBD 1EIZA 1C2YA 2XMSA 4AZ3A 2X5JO 2R7NA 2Y1CA 3G0IA 4R7ZA 3PYMA 4FGLA 5KNCD 4Z0PA 4LQDA 1COZA 1W1UA 2VQ6A 2PRJA 1SVMA 5IJXA 4HUQA 3QF7A 3ZDQA 1JU4A 3NRJA 1D8TA 4UCOA 3BF8A 4FQ8A 1WP9A 1JXOA 1NXTA 3K15A 5E7JA 1ZH8A 1CLEA 4WRRA 3LXUX 2GSDA 5GP1A 1O3YA 1ZMTA 5FLYA 1E0DA 1UDRA 3TZQA 5GWXA 2CDCA 2HMYB 4W5NA 1KFEB 3MLBA 4PYQA 4K2HA 1H8ED 1KNXA 1XTBA 4P0PB 3IAHA 4B3IA 2A0WA 5JJBA 3D2CA 3FYSA 4XYLA 5ECGC 4BZPA 4C2TA 3E4CA 1PEDA 4RGBA 2UZ4A 4JCOA 2ZS7A 3AV0B 2NVXA 5HJ2A 1VHWA 1UZAA 4ZQGA 2DUJA 3OCJA 5K6AC 3QITA 1SM4A 4WZAB 2FFBA 2H9AA 2CD7A 4PSDA 1HDYA 1VPLA 2GAFA 4MTCA 3UQ8A 3KB6A 1G1MA 2JAXA 3DQQA 3ZY3A 2KJQA 2VUSA 2MWMA 2G4LA 4PZUA 3TLGB 4B6OA 5DX1A 3FTEA 3R6WA 4NEHB 3M9WA 2Y71A 4OJTA 2VAXA 3N2IA 3DE3X 1QCCA 3PR1A 2CW7A 4YCBA 2HWXA 3JYQA 2DPIA 3W9SA 5GZ3A 5KVCA 2YS7A 3F9RA 3QMWA 3STHA 4HAOA 5BN5B 1RYRA 3SOPA 1QX4A 1IHOA 2VDMB 2A14A 4MQ5A 4YRGA 4HQLA 4AZWA 4QQ8A 3L7NA 4C4YA 3CF4A 3DLBA 1ABEA 2GASA 5EFOA 4A6PA 5CM2Z 5BSHA 4B17A 4IS2A 3T5CA 4F9EA 5GVSA 3G5UA 4CMFA 2E87A 5HEKA 2WJPA 1UJ6A 4ONEA 4WBXC 1EFLA 4BGDA 4UW9A 1SA0B 1QORA 4HN4B 2FP4B 1GAEO 4ETWA 1ZX1A 4RJJA 5JAIA 3RKRA 3TOCA 1L8LA 5DHPA 1J24A 2BMAA 2OFXA 2QJTA 1YC5A 3P2IA 2FV8A 1UBFA 3OE5A 4KIUA 4M9CA 5DNDA 2HA5A 2ZUFA 2O3JA 2PAAA 3TKAA 4PX5A 3EA0A 2ENUA 3QXSA 1USVA 1B76A 4Q4CA 4MTDA 1Y3AA 2WF9A 1TD1A 3ZWKA 4NJMB 5JZVA 3AEUA 1QYDA 3LQ2A 3TZKA 1XNRH 2WWVD 2IP1A 4JJKA 3BKXA 3NHWA 3FKSA 2JI8A 4MCAA 3JQAB 3ZZMA 3EZ7A 4QLAA 5FEUA 2OB1A 1Z7EA 4OXQA 1B00A 1JP7A 4KO3S 1PF7E 3JVDA 2R85A 3HO6A 3ZXYA 3GLFB 3KBBA 8AT1A 2ZAYA 4KLRA 5I9IA 1V8ZA 5F9NA 4Q48A 4RHYA 3D6HA 5DYTA 4DCCA 1OWPA 1TVEA 5JDIA 4CMKA 1Z0JA 4DJ5X 4I1IA 7MDHA 2A58A 4MGKR 4FJ2A 2UUOA 4DAOA 4ZI2A 4RZHA 2YTZA 1MMFB 2WAQE 5JQGB 1X38A 1OZ0A 3L07A 2NQ8A 4R8SA 1C1DB 2EGGA 1JV2B 1LLDA 4N48A 1XYVA 2HFKA 3SQLA 4ED0A 2PFKA 3GLRA 3DF7A 4RV5A 3UMFA 1G8MA 2QXTA 4JLUA 1NQWA 3TZBA 3WAGA 3PVCA 1CJMA 1JI3A 4JP5A 3RTAA 2PLAA 5JHHB 3EDRA 1Y6GA 3G0BA 3NTQA 2A6PA 4DDWA 2Q5IA 1JQAA 1VMEA 1D9XA 1O4VA 3H9CA 4OGLA 5AUNB 3ANSA 3U4HA 1VSVA 3F8NA 3G9TA 2VHYA 2IQ5A 3DOUA 4YRTA 1SVOA 4OHYA 1JDSA 3VX3A 2X4LA 3TVTA 1G18A 2J9FA 3UJ9A 3V4VB 2R11A 3QLVC 4EB8A 1NUHA 3LFTA 3V6HA 3TVYA 1IN5A 2HLHA 5L53A 1RYHA 3TK1A 3V42A 2EU8A 2XWPA 1Q16A 5EXSA 5B7QA 2Q0SA 2R48A 2PWPA 3TZHA 4EPVA 3SEZA 4X6LA 4DV3H 4ZODA 1RRKA 5K0NA 5IWAH 2ZM6H 3RVQA 2V9PA 4JXKA 5GQSA 1SY7A 4XOUA 4EUKA 3HB5X 1TWCA 1B6TA 5C7YA 3NUAA 3E2PA 4LJYA 1XZCA 2ZREA 4JD5A 3X1JA 3ZNPA 3MTDA 3EULA 4CMIB 2AI3A 3HTXA 5CD9A 2WJYA 2IYNA 5ALNA 3WFJA 2JF0A 1YI1A 2B5OA 4XPIB 3ZN2A 4OP1A 2JJYA 3W5UA 1N6OA 2QG6A 1XZBA 2UUAB 3H99A 4HB4A 1USUA 4K3UA 3B6KA 1PL6A 3Q0TA 3CT6A 1OXUA 3RC8A 1A5AB 1ZXXA 4BX0A 1L4NA 4RGVA 1C7ZA 4EW3A 1M2JA 1YQWA 1NW9B 3RUIA 1FS6A 1AVTA 3FLBA 1OI4A 1U28A 2GD2A 5GOTA 4DR5H 4WZAA 4ROSA 1WVIA 2ATCA 5C5EA 4N3NA 2EW2A 2C0CA 2IWHA 4QNRA 3EY4A 3SXUA 3EPKA 3SZRA 3TLGA 4FS8A 3V3TA 2Y6UA 4PR0A 4QYXA 3CLSC 3PXUA 4DMRA 3DBIA 4BECA 1G6Q1 1NATA 3FCEA 3OESA 3WL5A 3RJ0A 4TMFA 1EUZA 5LU8A 3B3FA 3V00A 1IBMB 4JVNA 3GPLA 1HF3A 4PTZA 2GZ2A 1XMSA 5AOBA 5JNLA 1SXJD 2F7SA 4LTDA 1KZ1A 2QB5A 4ZGGA 3GUCA 4J7CA 1NJ1A 3FHTA 1XLVA 1ST3A 1PQYA 1H93A 5KOJB 4EGJA 4KVZA 4OCZA 1QTNA 3RE1A 1KH2A 5HNKA 2HADA 2CUZA 2CLKB 1L4HA 4YMIA 1Q0UA 2B0CA 2OFWA 3IEKA 1ZHFA 4O8ZA 2ODTX 1Y4AE 4AECA 3L8CA 2O8FB 5CRIA 2FOIA 4AICA 3MZ0A 1TT5B 4IDCA 3FJ1A 1PGNA 5FA6A 4EX7A 4YQYA 3SI8A 3P2JA 3GIIA 1AKEA 2ORWA 4IZ6A 3CRW1 3RC9A 2FW1A 1SA0A 2GNPA 2QI9F 3GGPA 2FP4A 2ZUWA 3BX1A 3I9JA 4M8KA 3UH0A 4I5IA 1UBSB 4R2LA 1N36B 3K0HA 2JS7A 2ZBFA 5KYUA 2JZNA 1NPYA 2ZRKA 1DIKA 1XEWX 3OQVA 1E2PA 2GARA 4HQOA 2F55A 1EJBA 4IRCA 4GPEA 2FSIA 5BWOA 1FW8A 4GZ5A 1BJRE 2C7BA 1KDVA 2CJFA 4NJMA 3MA0A 4K6CA 1ONBA 3HJNA 1EVJA 3KWJA 2BP7B 4U63A 2AXQA 3BTUA 3FPFA 4OF4A 1ZD4A 4JX8A 1ZOPA 2FPKA 3CPHA 3JQAA 5DQGA 4JYAB 1WKCA 2XRYA 1YIAA 3NAMA 3JZMA 4BASA 1W73A 1PQPA 2VF2A 3SC3A 1JT2A 3GLFA 3A4TA 2M6RA 5K1ZA 5T64A 2P0AA 5FYDA 3TQQA 1YV9A 4OFZA 2PS3A 4B74A 1M74A 5ALWA 4JITA 4RX1A 3HN2A 4CL8A 2J7KA 4ZAVA 3VUEA 1HZZC 3ND7A 2CL6X 3P20A 5IF9A 2UVUA 1VG0B 4YR9A 4W7IA 4RVSA 2QT0A 1XKXA 2HGWA 5CW2A 1MG5A 3ELUA 3NRCA 4RJLA 2Y2VA 1AHPA 4LQ4A 1YDEA 3RBAA 1C1DA 2QX8A 3TX6A 1Z38A 2VP2A 4R0NA 2PPLA 2P75A 4IVRA 4NU8X 4QAJA 4QDTA 3JZFA 5FOSA 5EP2A 3PGMA 5BSUA 4BMXA 1XFDA 4JJ7A 5JCXA 3H4VA 2XQJA 1FMJA 4JLDA 4BLRA 3LLCA 3M34A 3BFJA 2JIRA 3F97A 2LP4Y 3S7ZA 2PK3A 2OBLA 2XZPA 4LF4B 1ZLXA 3SLRA 2QM0A 4TRJA 1L5LA 2Y0SA 5BNWA 4TUYB 4RM2A 4MQFB 4Y8VB 4PLWA 2AGOA 1Z3IX 2WMNB 3LGAA 1VZ2A 4QXQA 3JVIA 1K4YA 2VSOA 3NBKA 1F2DA 2XWQA 1TB4A 4OXRA 4A0HA 1W2GA 2AE2A 1FSZA 4GICA 1A9QA 5JQGF 4N5HX 1H4TA 1D4FA 2XCSB 3CRRA 3OZEA 3K70B 2BGGA 2H1RA 2NX2A 3ZZUA 2YMLA 2CLOB 1I8TA 2B4RO 2DT8A 2CDNA 4C7XA 1I2BA 2BCGY 4TXMA 5IS2A 4M1QA 1F3OA 2G9VA 2HK8A 3T7DA 4CMEC 5DB4A 1WMDA 4Q82A 3KXIA 3MUFA 9ABPA 4CMIA 1F20A 4HLDA 3A1WA 2W71A 1MB4A 4O3OA 3WQQA 5J4HA 3KTDA 4Y18A 4DYDA 4PG7A 2QGFA 4AF7A 2D2EA 1JLRA 4P98A 3TDMA 1DBPA 4I4NA 3RLFA 3FM9A 3T6KA 3BB4A 5CTJA 3OPYI 1JHVA 4ZU6X 3GEMA 4YMVA 1BRTA 1NVUQ 2H4ZA 1V1MB 4QASA 1BCSA 5BSRA 4RMHA 1AKVA 5JXGA 2EDCA 2OSBA 5I7UA 2DBQA 4PSKA 4CM1A 4PFSA 1TUBB 2I6GA 3T5BA 2J7PA 4RMJA 4JL6A 3UUFA 3WGQA 3E7DA 1TZKA 4PLYA 2BMEA 5B3JC 2MTBA 4B3FX 3HUEA 3NVKI 3K9CA 4L7QA 3L6RA 1JE1A 3V2GA 2QMOA 3V7YA 2WIDA 2X0EA 5M29A 2HSZA 4DCNA 4JJ8A 2HZ7A 4UEQA 3TLMA 5AVVA 5BVHA 2BVNA 3EEQA 4HUJA 1T0HB 4TL9A 4MQEA 3A1VA 4KPUA 4EJFA 1EK1A 3RJTA 2UZ0A 3BQMB 4IUCS 1QJCA 2W2QA 2POQX 3OFNA 1GG5A 2YRWA 2ZRIA 2OHIA 5AESA 2Q7DA 5EA2A 1G20B 5KOJA 3DQZA 1BOOA 1AGRA 5HWSA 1ZSVA 3F3YA 4R31A 2O7NA 2GD0A 4ZT5A 3G2PA 2O8FA 4XJSA 1TT5A 1PT8A 3RRBA 5KT4A 3H9BA 3ZQKA 3ESDA 1E18A 1ML4A 5JHGB 1FUUA 2C07A 1ZNQO 3OA2A 3STVA 1CUVA 5JC8A 3F4BA 4X8OA 4MVJD 3FH0A 3AY3A 2P9TA 2ICAA 3EFHA 5LQDA 2WC1A 1VIVA 4MB0A 2YUTA 6ABPA 2IOYA 5DX0A 3KB2A 1UPFA 3CFYA 5KWIA 2FG5A 5I5GA 2EC5A 2VK4A 4ME6A 3S99A 4UNRA 2CVOA 1CE8B 3B3QA 1QRRA 4ZXFA 2GVZC 1OQAA 3EZ2A 4HPXB 2BP7A 1J0EA 1VHDA 3UJNA 1NN3A 4AUEA 4KNWA 4Q3EA 4FR0A 3VR5D 3HCCA 1NW6A 2WJ4A 1EUDB 1DMSA 4WUVA 1OH7A 4A0FA 4O7YA 3H5AA 1EP2B 2FOLA 1IDN1 3K2BA 1RJFA 1YONA 4A6EA 4IS3A 5HRAA 1ET0A 5LD2C 4LMYA 4AF6A 5F3WB 4HY3A 1NLYA 3FUCA 2HCFA 5CMLA 1NE7A 4JNKA 2RBGA 4ZAYA 1P7ZA 3FCXA 1JWBB 3EVZA 3SHTA 3KOOA 2IPAB 3GLKA 1XK6A 3IP1A 1H4QA 4OXYA 1E3IA 1ECPA 3X1KA 2QLNA 1C7IA 1Q0PA 4OK3A 1QBGA 4F6LA 3L0SA 4I14A 3HVKA 1B2RA 4TRNA 3FAKA 4LC0A 1QR6A 3C3XA 1C14A 4R71A 4NFSA 5SY6A 1XL1A 4K8OA 4DLRA 4R1UA 1TADA 4K6MA 3MCZA 5LQUA 3BD6A 2GUWA 3SZMA 1JHZA 4E0BA 2GOYA 2D0DA 4G4SO 3PK0A 4AN4A 4OYLA 4ZYWA 2Y3IA 3AVWA 4MQFA 4Y8VA 4KMMA 3R7AA 4WZBB 3R9IA 3LY7A 3KTMA 4HNQA 3AX6A 3KQMA 5H4GA 2EF1A 4HLNA 3MJSA 5F7ZA 4BKRA 3OMLA 4TYNA 3HVUA 3RB8A 2VL7A 1VKOA 4AG5A 4FNAA 1PWZA 2CJWB 3COYA 4TKVA 5LDHA 4X1KB 4WUTA 5AYVA 2A0FA 1XQ6A 2EIXA 2HNAA 4DNQA 4CI0B 2HDKA 3C5EA 1MB0A 1G2QA 3MG9A 4NFYA 3WMFA 2UVPA 1K98A 5FBWB 1VI2A 2FEPA 3FCOA 2CV2A 3LBAA 3H75A 4RF2A 5ERXA 5TF0A 1UJ4A 4MWEA 4QOJA 5LC1A 1NUQA 3P94A 1UBLS 4LTNA 4BNZA 2WMDA 2W2XA 1JKFA 4JI0B 4CM9A 3RF7A 1ZCAA 3O1HB 1ZG3A 2BGRA 3OZUA 4TUYF 1AJEA 2YC4C 4BLQA 2HYIC 1S2OA 3TQCA 4EGCB 3LUBA 5DRTA 4YV7A 3HB0A 3B1KA 2QK4A 4KI0A 4KMRA 1F38A 4KW7A 3V4ZA 3O3MB 4K9RA 2JA7G 5I5UA 1AZLA 1HOXA 1SFRA 2OV6A 1V1MA 2XKKA 3BWMA 4UNPA 5GJVC 3FCYA 1KMNA 1DUIA 2D1FA 1TUBA 2O2SA 1RADA 1GQ2A 2QP3A 1ECGA 5LQRA 2E85A 2J3HA 5JCZA 3GRPA 1WBDA 2ODWA 1P18A 3LLUA 3UQYS 3BGSA 4ZO6A 1EFHA 1FFYA 4JBYA 3M6WA 1P3Y1 1I1MA 2ID4A 2V65A 4EHKA 4FWTA 4K05A 2Q4RA 2ZIEA 3ORYA 3F6EX 1L4BA 4G63A 3MRSA 7GPBA 2IF0A 4I36A 5LN1A 3TFQA 5HE8A 3ED1A 4QUGA 3E48A 4F4UA 4RHCA 5A3RA 5ADVA 2W9AA 4IF6A 3G79A 5LDGA 1IB6A 5JS2A 4K9OA 3L93A 5BV7A 1I2LA 4G1FA 1K4KA 4B6PA 5BO5A 3MJVA 4DFDA 4JYBA 5CPFA 4ZDKA 2P3QA 4M8NE 3DBRB 2B9EA 2X14A 3OQHA 4DEXA 1G20A 2DHRA 3UK2A 1JX6A 1YRLA 2CXPA 1ODSA 3LCMA 5JZMA 3IAUA 1KEZA 3LCVB 1PTJA 2FPWA 2XB8A 2IZ6A 2VDOB 1WXXA 2B5WA 3HNPA 4YPFA 2AFIE 2C82A 1LSOA 4JOSA 4GX1A 2QD3A 4BKOA 5KFKA 4HS9A 4NOMA 1IMOA 5DXAA 2CXXA 1D9ZA 4CV1A 1J2TA 3ZDXB 1NZFA 4KWEA 3ND6A 4LJAA 4EYGA 4IIYA 3ICEA 1NF3A 4UARA 1XZDA 1UQRA 4FQ5A 4MJ7A 3RADC 5KFDA 2QL7A 3ZW9A 2KSWA 3ASYA 5FQNA 4BNYA 1MQAA 5I47A 4QOSA 2V4UA 3ROPA 3OQBA 2GYYA 3MD0A 1O6GA 5CU7A 2RG7A 2IJGX 3ZTWA 1CE8A 1LPBB 3VDQA 1ESEA 1C0EA 1QM5A 1POWA 3HZZA 2YZGA 4XIGS 1O87A 1NVBA 4EKYA 2WY2D 5E4JA 3RVDA 4UBKA 4JGIA 1Y3FE 1EUDA 4GW3A 1QR2A 1N8KA 4RHUA 2VATA 1YR2A 2R79A 5FEMA 2G1UA 2CFIA 1O7JA 3HHPA 2CL0X 2HBYA 4KO2S 1NL3A 3CKYA 3COJA 4EKGA 1LF5A 5A5DA 2JVKA 3M5PA 3MJRA 4Y0AA 4TL8A 3W2HA 2QX9A 2GCIA 4FFLA 1JALA 5DRYA 1NOKA 4MJXA 1FL9A 2NOAA 1Q95A 3AUJB 3L1HA 3BMQB 5DQHA 3DR5A 4MVJI 4IXWA 2UZAA 4NCKA 4MYSA 4PZ9A 4URZR 3GJRA 4O4HB 2VHXA 3EGDB 1KJJA 4WECA 4ARIA 4OM8A 1W88B 2E4YA 4DV1H 1KK0A 2BUAA 1JU3A 1PI3A 3UA3A 2P79A 3K53A 3G7SA 5G40A 3QKSB 2VSFA 2RGBA 3BYZA 2GCOB 3BXFA 5KVQA 3GZNB 1IBMH 2PS9A 3WGHA 5KWSA 3K5WA 2F8MA 5TXGA 1Z0KA 1XCGB 3IIJA 4Z54A 1XMOB 5T4HA 1KJWA 2VT7A 1T9CA 4AG3A 4GXRA 3IEMA 5BR7A 3B6JA 4Q3KA 3B52X 5IHPA 2ZJ8A 3PUZA 1L1EA 4HZIA 2JFZA 3O1LA 1VSQA 3D8UA 4EEXA 4WZBA 2QQFA 3G7NA 5LQKA 2SCUB 4MV4A 2AG0A 1FTWA 1BGXT 2C2MA 4D92A 5KFNA 1IOLA 2DPMA 4XM0A 3LC2O 1B0UA 4JJIA 4NDZA 2G63A 1I5EA 3RVRA 1QWSA 1YRYE 3IT3A 3FDSA 4X1KA 1A98A 1B8NA 2P8SA 1NVVR 1Y1QA 1EVIA 4NV3A 3A6LA 3GHYA 2VHZA 5CFZA 3AI1A 5JZOA 2WTFA 2PMBA 4OLJA 4LYHA 3CKLA 4XJTA 3K5IA 4DC0A 5AKZA 5B1EA 3I3SR 1L5MA 1HFWA 5FLXW 4D0GA 1T2UA 2BE7A 4L28A 2C94A 4EARA 1H6DA 2WHRA 3S5UA 3LC1O 1G3RA 1DIRA 3KAQA 5A03A 2I2WA 5G02A 3O4JA 1OZAA 2IRWA 4JYAH 3MHTA 3JQ6A 1BU8A 4KN6A 3C6MA 4HNTA 1V1JA 2PRYA 1BDHA 2CKDA 2J9GA 3ESXA 2WV9A 4H0NA 1WXDA 2PSHA 2C31A 2EWWA 4C4RA 2Z4SA 3E3AA 1ESDA 2XA1A 4IIVA 5AM0A 4GYJA 3FN4A 2YCHA 5BY2A 4FI3C 1M10A 3U3ZA 4DR6B 3P9PA 4ZREA 3KB1A 2DFPA 2GEFA 3N7UA 2Y2UA 4ZMSA 2PE5A 2R1ZA 1LPOA 2I55A 2A7QA 3W4JA 1C2TA 3E15A 4OLBA 4INOA 5BNFA 2IODA 3N53A 3P1JA 3L0DA 5L3VA 1N2XA 5DTJA 4MHTA 5L7YA 4JYZA 2GS9A 3GJ4A 5CYFA 1QHGA 4ARZA 5A1TA 3UHOA 5HUJA 1ZGHA 2OGZA 2YC2C 3I9NA 4KI7A 5EWJB 4LV5B 3DCJA 1NHGA 1N2OA 2R65A 4HEQA 4BFWA 2GSWA 4P9NA 1PSDA 3GPIA 3MCWA 3VU9B 1ZGGA 2YWFA 3DBRA 3P2EA 5D8DA 2QXUA 4YUZA 3IIEA 1CF2O 4GPZA 1BIFA 4QBIA 4QIHA 2CBGA 1WQ3A 4C01A 3PDJA 4ILEA 4DY6A 3UNXA 2WUGA 2PH3A 4D9JA 4YAUA 3GB8B 2UUCB 4LYYA 3R77A 3V7FA 2GN4A 3CG4A 1XWWA 1RM0A 3URMA 3F8SA 2XWBF 1FTGA 3GIQA 1P0PA 4QA9A 4N8SA 3H5IA 3IELA 3MQ4A 3Q7TA 4OHVA 1U02A 2BSQA 2BKEA 1VJ1A 5IC6A 2WPDD 3GO4A 1CYEA 1PL8A 3U62A 3Q3GE 3ZXSA 1KO5A 4MV6A 1ZHSA 4OHBA 2JLXA 1IJKA 2XUFA 5KYNA 1G19A 2B1IA 1M8JA 4UHKA 2V59A 1Y4DE 1OBDA 2JLYA 2WA1A 2JAUA 4PG8A 4QFMA 4P36A 1H3FA 1JDVA 3I9MA 3WNBA 3HBLA 3WQBA 1KK2A 2ODPA 2X2PA 4LOIA 2NYUA 4JP8A 1MEEA 5KKNB 1JMKC 4UVEA 1NSYA 2I2AA 2O5RA 3PE6A 1ESZA 3TINA 4ZKEA 3UMJA 2PCJA 3VZDA 3JQFC 3JRNA 1F4VA 5KFIA 1F6DA 4JB0A 4OM7A 1TCUA 4HP8A 2V0GA 1YB4A 4ZVTA 1MD9A 4EB3A 4M8SA 3T3EA 1T1JA 1LDYA 1ORHA 5HZMA 1X2EA 2PGJA 3ZHCA 1USWA 4I50B 4DC1A 3CX6A 3LULA 2QV0A 3BMQA 4EVQA 3OIFA 1BD4A 3RBZA 3SE7A 3EGDA 2WTBA 3VSBA 1W88A 3E9DA 3RWBA 3WWYA 2JLUA 2PUTA 3GVCA 3U3RA 1ZM2A 3FNGA 1UEIA 2DPHA 5IN5A 3FDIA 3RB3A 2ZTUA 4E4TA 5CE8A 2Q1WA 2C3MA 4RK6A 3K8ZA 1IC6A 1O0SA 1BDJA 3IFSA 2AK2A 5AVYA 2V6IA 3AKZA 1N2CA 3CLRD 3K0AB 1WW3A 2YN0A 4RZ2A 2HF2A 3W05A 4ZV7A 3BSYA 2Q1TA 4TLCA 3KKQA 1YR1A 3QSGA 5BV1A 4WOJA 1QO0A 1EK5A 2BGNA 3VZSA 3H2GA 4NBNA 5BQOA 2P2CA 3T7AA 4M0JA 3ZLTA 1H6AA 3NKLA 1ZRMA 1I2MA 3PCXA 1AG9A 3W5AA 5KWJA 2RAFA 3N05A 2KE5A 2C2RA 3VO2A 4O4HF 4AWXA 2FEMA 3VOAA 2W00A 2BGWA 2OEPA 4UQPA 3V4OA 4GT1A 3ORRA 3NH6A 2WLTA 4CT5A 5C34B 3S70A 1T34A 5KG6A 3TTVA 1W19A 2XRZA 1N2BA 2DU8A 3FVRA 4LF6B 2H4WA 3HU1A 3O2NA 2RAVA 3M6MD 3NCTA 1JHPA 4FWIB 4UMEA 4JBHA 2WWYA 1EP1B 3C7TA 2HG8A 1YWGO 1J5XA 3LQ1A 3RSLA 3DP9A 1YHYA 1H5QA 2X4IA 1W75A 5JV5A 2LCFA 4NYJR 3DXFA 2VDUE 2LCIA 5B6IA 3SBXA 3LYAA 1V2GA 4JDUA 3W1WA 1DAEA 5EINA 4RO0A 5AMXA 3HMQA 1JHDA 2ST1A 3BREA 3KUUA 5JC1A 1GU1A 3VC7A 3OJEA 3Q7RA 4OA5A 1FSGA 1NQOA 3DMTA 1R0BA 5BN1A 2CVHA 3BGWA 3PCTA 5EIBD 4P5PA 4WCVA 4ITRC 3V80A 1RLTA 1RK5A 3RS5A 2VSNA 1G2PA 4KIFA 2C78A 2F67A 3P71T 2MDTA 3IT2A 4A3CG 5J5VA 1EYZA 3B12A 2GQ0A 4PO3X 1YI8A 3VDXA 3IEVA 5ALGA 1RCFA 4RB2C 4IUYA 3PCRB 2WJZB 4DJEC 1T9ZA 2QM3A 3SPXA 1VHQA 1Z8FA 3RB0A 2QSJA 1KHHA 1WF3A 4V0QA 4Q16A 4X0EA 5CXUA 5B1SA 2YASA 1I1KA 1MW9X 3VU9A 1DOAA 1NRJB 4M0DA 4DPLA 3CUEF 1S4QA 1Y6ZA 4JL8A 4ZP1A 4EHLA 4JJ4A 1AQNA 2F9MA 4PSAA 2VG8A 1G41A 2PVSA 1PFVA 1YA8A 4MLPA 4EI8A 2NUTB 2ONKA 4DDTA 1UBNA 2E2WA 3VVMA 3I1YA 5HFNA 4CM5A 2JLRA 4AMZA 2QZPA 3V4SA 4F5ZA 3FMGA 3MXTA 3AKCA 1RWMA 1GPYA 3RVJA 3OWXA 1OCEA 4QTXA 5EVCA 1HE4A 1T24A 2VAVA 4QYSA 1Q7RA 4WDRA 1QGZA 1FDUA 1ZNZA 4UCWA 3U54A 1J0CA 2BH9A 3KELA 2DHDA 3P7MA 4LXXA 1RS0A 3B3JA 1CUXA 1EVYA 5CJJA 1XTZA 3NW9A 1M0SA 1G7TA 1ATIA 3OQPA 1ZIOA 4D8TA 3P2MA 3KKKA 4IH4A 1NI4B 3OKFA 2XMPA 5LFAA 1MC5A 1IHXA 2H9IA 1VLZA 4TXJA 1VMDA 1X3SA 5CB8A 4INZA 3EUFA 4HWPA 4A27A 4QOGA 3FWZA 3WHPA 2R92A 5I9MA 3DF9A 1ZVKA 1FSSA 4M2LA 4U6NA 4AROA 4QVGA 1PFWA 4IOLA 2JZCA 1GPMA 1AUOA 5AW5A 3VC1A 1H66A 2C5HA 1NLFA 2Q8NA 3FPHA 2QNIA 2PT5A 3UWKA 2WWHA 1ULAA 3MMNA 3B2NA 2C54A 4ND7A 5JWRA 3EA4A 2V9ZA 4XUEA 3IMKA 4I50A 1P81A 5AM3A 1S9HA 5FNVB 4EM6A 3DTVB 5C7LO 4QPCA 4TVKA 2FRVA 5J40A 4E1VA 4GR5A 4B3SH 4TVIA 4ZV9A 4P4GA 1Y5RA 5L40A 2ID9A 1LZLA 3GLUA 1QF9A 4YAKB 1HLPA 1MN6A 1IIBA 1NN1A 2EG9A 5AJZA 2HJRA 3K2IA 2PZBA 4I6GA 1KJ9A 3F5FA 5DM70 4G97A 1ZRSA 1KDOA 4HJRA 1G7SA 1R0ZA 3WV5A 2XUKA 2E4UA 4DL9A 3NHYA 3GXBA 1EE9A 1IM2A 4AZSA 1CK4A 1AXGA 4DL4A 2FEWB 2IZ7A 3GAZA 5EVJA 1SVWA 1UOPA 2PGDA 5H81A 1PSWA 3AHJA 1FYXA 2EKDA 2JC3A 2AOUB 2B1JA 5JALA 4HC4A 3CWZA 3LO5A 1SD5A 1D7OA 1VRCA 5DXFA 2QUIA 2JANA 2DB3A 1ZONA 4I50F 2QJFA 1Z0FA 5A06A 4RU1A 1FMCA 3BGVA 3N2ZB 1XVIA 5LKRA 3R5KA 1X80B 5A02A 4CFZA 1WDWB 5AM4A 5JAOA 4NAVA 2WKRA 2Q46A 3ME5A 4RSGA 4HJXA 4AZVA 2P9BA 3C7DB 4RDXA 4I9FA 5C37A 1ZAYA 4ZVMA 2PUJA 1QGOA 5CT9A 4E46A 3N8GA 1VIMA 1UK6A 1YAJA 1ZNYA 2BFFB 3IR7A 1NQ5A 2UVVA 2PIAA 3SEAA 3WGUA 3SHFA 5HRCA 2GJKA 2ZVJA 5EZSA 1FFAA 2J9RA 4JROA 1TWGA 1I3QA 3SM3A 1HE3A 3RAFC 5FR1A 2PGXA 2Q3FA 2C57A 3RSSA 3UMBA 4R4JA 3UXHA 7MHTA 1EQ2A 4CG3A 1GGMA 2Q3HA 3KJGA 3IO3A 5KVSA 1LPMA 5G1PA 1PZEA 4TVOA 4GHWA 3PW2A 5KQGA 4PYIA 1QCZA 3W8NA 1S6YA 3W78A 2QRVB 2QYZA 2FVXA 4OMUA 3HJGA 4BC1A 3G1WA 1DC3A 4TSFA 1YASA 4OBEA 2H7CA 4C4XA 4DA7A 4FUTA 2V7EA 3ABOB 4MHSA 1QZZA 4ZCTA 2PH7A 3GV0A 3K8OE 2VYCA 3KFXA 3AJAA 2VWGA 4BO7A 1Z2DA 1WLSA 2PUDA 4Z7OB 2ORIA 4M76B 3UFBA 3STTA 2LKCA 2ZUCA 4F2DA 5C8XA 1VMAA 3QJ5A 2RKOA 4DARA 4WTOA 3U4QA 2Q4OA 5BWXA 1UXGA 1E9VA 1LNSA 1QQAA 4QQKA 3INTA 1CZLA 2R8EA 3DCNA 5IT0A 2WTUA 3A4MA 3EZGA 2CFOA 4XI9A 2F3PA 3A9VA 1OX5A 2PUHA 3WGTA 4Q3OA 1JTVA 4H3VA 3WL3A 1R27A 2IEAA 4HXEB 4ZZ1A 5C4XG 4N9QA 2CMDA 3F3KA 3OETA 4JQZA 5EESA 3TG8A 4J9SA 5M04A 2GRJA 4RK4A 4C0SA 1JBKA 3D7MA 2VK1A 4PIVA 4K9QA 1EHIA 5K0TA 3WLMA 4CCAA 1J39A 3VSDA 1N0WA 3DTFA 1ZD1A 2A59A 2OGSA 1ESMA 4P84A 3GYGA 4LZZA 3ELWA 5EMKA 1NC1A 2O59A 4QDJA 3IKTA 3M3HA 2G77B 2R6DA 4MUKA 1PQWA 3NEJA 1ILEA 2GN0A 5LQNA 4M8LA 4NK5A 5KKAA 2R93A 2XVXA 4BO9A 4ZANA 4DLZA 3PNQA 5KNDA 2B7LA 2MINA 3L6BA 3PD0A 3C3EA 3TY5A 2D7CA 2PS0A 2FPGB 1XGKA 2IU3A 1NI4A 1KRWA 1KTIA 5A2QA 4GDFA 4UTVA 2VPXA 4I1RA 2HU2A 4V2UA 5KFBA 2NACA 3EFBA 2ZG6A 2OXIA 4R2HA 2XRFA 1L5RA 1SQGA 1G0OA 4AWBA 1UC9A 5BN3B 3QFHA 4BAZA 5A6SB 3M81A 1Y42X 3RIMA 4JA2A 5CBPB 2VXCA 1GG8A 2Y1FA 3BSFA 4MS1B 5HOQA 1D6NA 2G88A 1YMUA 1NDHA 3I23A 4EPRA 1VSBA 1ICEA 3GH3A 3DVLA 2ZWMA 3EOAI 3RK4A 4D4HA 4B4KA 5K3AA 1KY5A 2V6MA 4DR6H 4GI3A 5FNVA 1K8ZB 2GD1O 3DTVA 2WK1A 1JAXA 4GOKA 1JVBA 3TEKA 1WX1A 3OIWA 3ZWMA 1GNVA 2WU8A 4PN3A 1N33B 4M9SA 3G23A 3S2ZA 1CVIA 5AUQA 4FS2A 4LQCA 2NQTA 4DCPA 1S0MA 4YAKA 1W76A 3O4IA 1WZNA 3ROEA 4F4YA 4F86A 2BFAA 4YPVA 1V6AA 5CR5A 3N41B 2XUDA 5TVGA 3CX8A 2C9YA 4B84A 3DCYA 4X65H 5JMWA 1RC1A 4W6ZA 3U6BA 2NZVG 5HIJA 5AI5A 1EX6A 2K5UA 1YAHA 2AOUA 1C9YA 1N2GA 4HSGA 5LP6B 3OT1B 3O8OB 2V7TA 2P9CA 2Q49A 1J2YA 4H1WA 2UUCH 5CDTA 3U55A 2SKCA 2VNHA 4QX6A 5FNVF 4WL0A 1PJ2A 2EAUA 3HVHA 2NO6A 1X80A 5FA8A 3ANTA 1V43A 2I62A 1RI4A 3LT1A 3SBEA 3L7IA 4QBHA 3HUFA 3C45A 3GJTA 4LC1A 1LVHA 1T9KA 1NUAA 3EPPA 1ZD9A 3ENKA 2BFFA 1PJ4A 2RAPA 3V4LA 1FA9A 5B7GA 3CH6A 2YV2A 3KQLA 3B2QA 4WK4B 3EVDA 1FFWA 1P2TA 2GUGA 3OZ7A 4BO4A 4O3FA 1E2UA 1CLUA 3AUTA 4Q3BA 5HZGA 3RBVA 3WL8A 1ZQ1A 3NH9A 1O5TA 3GEPA 1JIQA 1X1BA 1MJGM 3ETGA 2O2IA 2QRVA 1VKJA 1E58A 1PT7A 3CYFA 3LSYA 3SR4A 3D1VA 1RAEA 5JAHA 2AGQA 4LZJA 4MW9A 2O7VA 5ALEA 3WIEA 1E2MA 4A0GA 3BBLA 3RYTC 3AI7A 3N5KA 1SKAA 3CR8A 3LUPA 2HBZA 4NXMB 5JDIC 5TF4A 2EX1A 3JVEA 4QOIA 2B8TA 3T94A 1V39A 3OQJA 3QVXA 5BN5A 1Q22A 3Q9NA 4RW0A 3AY0A 4RS3A 4ZO9A 2R84A 1X92A 5FUXA 5LNK1 2VDQB 5MF6A 5D1PA 2FW8A 5IC4A 3A2KA 3HOWG 1VPTA 1E7QA 3AEXA 3R7SA 1PV4A 3F90A 3A3YA 3QU7A 3KCNA 3HO8A 2J9ZB 3GIWA 5A4IS 5KHLB 2J30A 3L01A 1ZEJA 1KE1A 2GYUA 5I7RA 2ODAA 4AO6A 4QJ4A 2QNRA 3H3XA 2C83A 3T54A 5KFEA 1RTKA 2QZ4A 2IHJA 1EBFA 4C6HA 5EP1A 4P33A 4MI9A 2VPWA 1SKYB 2WHEA 3FPKA 1H9AA 3LGXA 4JXZA 1HDOA 3UJHA 4KITB 4ZCLA 1I4EB 4LH6A 2EJ0A 2FZVA 4F2WA 4U0JA 1SZJG 3TVDA 3CRNA 4QXMA 1X1CA 1MRSA 4UHHA 2A84A 2ZSJA 2IPLA 3FVTA 1Z12A 4B2PA 2Y0BA 4D8YA 1GV0A 2ZYIA 5AICA 2BFNA 9LDTA 4B3RH 3OSPA 4EA9A 3E9ZA 3WK5A 4LN1A 3A0UA 5FTKA 2DCMA 1F8XA 3OOSA 3V7NA 3BAFA 1XG5A 4UASA 4GGMX 2D8MA 2GEUA 4UDXX 4RZIA 5KPDA 5LU9A 2ZIFA 1OGIA 1TYDE 4TXNA 3DZIA 3KFLA 1E2LA 1RLMA 5JYBA 3Q15C 1YS2X 1XXHE 1IG0A 3OBBA 1WSDA 3E53A 4O83A 3UYYA 4LJ7A 2XC9A 1Z0SA 3ZVRA 5BN3A 5KU1A 2R5NA 4YWJA 4LECA 5CBPA 3JQQA 1CT9A 3GH1A 3JAMW 4O4JB 1XDZA 3I2GA 5JQGA 1G7CA 1A88A 4KE8A 2ERCA 2PX6A 3H3JA 1JFLA 1GJRA 2WWGA 2NG1A 1J20A 1VJRA 4NU0A 1P9LA 1LEHA 1ZVQA 1JMVA 1U28C 2H1LA 2VYND 4RU9A 1KFCB 2KI5A 1XTVA 1V71A 5KO2A 1BN7A 5DTRA 1NI5A 1TRKA 4EY6A 4C3UA 5JSHA 3CZ4A 2AJCA 2J6TA 5GZ1A 4MLCA 8GPBA 1H8HA 5H02A 4N1AA 1A7KA 2CFMA 1P1CA 4TKMA 1U98A 2BM8A 5ALFA 5BYKA 1WPXA 2QR5A 4MUHA 1KYWA 4YONB 1U1CA 2R66A 2Q0XA 1THTA 4NTZA 4HF7A 3HJFA 5EYPB 1WY5A 4RIHA 1ZXBA 1EAYA 3O5AA 4ISBA 1YZKA 2C29D 1ZHQA 3MUOA 2GERA 3AHFA 3OT1A 5AKXA 3O8OA 1YCFA 3GAFA 2TSYB 2UYGA 2I78A 1U8YA 2EJUA 5IBCA 5IH7A 4JU9A 9ATCA 4RH3A 3IJ5A 4D8UA 2G5TA 1G8HA 1GNTA 2H48A 2HSGA 3ZWNA 5EIAA 2I2XB 4UOQA 2R8ZA 1P44A 1X42A 3LG2A 4CLRB 2ZWOA 4DC9A 3FRJA 5K0BA 2WVJA 1JILA 2WWIA 2OGWA 1DP4A 4LDPA 4LJ8A 1RHQA 3HLYA 3JQGB 4DLNA 1RRCA 3LXRA 4L6IA 3U7GA 2O19A 4XPIA 2QL9A 4KKVA 3KOXA 1MUUA 3OQ1A 3V5NA 1HOTA 3VR4A 1OGYA 5KNDH 1ZHOA 2OP0A 5DCLA 3IODA 3PZBA 3SDSA 4QUEA 3SX0A 3BD7A 1WB4A 4I9GA 5HQTA 1HQCA 3UC9A 2ZKIA 1KT8A 2BOVA 2CZCA 1KVUA 2BGUA 2W37A 3T3MB 5LP6F 3HWWA 3MD9A 2COKA 2P69A 2V3CC 3GPBA 1PJZA 4YAFA 3WJ2A 3DLCA 1MO3A 2JIZA 1Q7BA 5HCIA 4W5JA 2HK6A 3KKNA 1DJQA 5BW6B 1XE3A 4A2PA 3V2HA 1IPFA 5A04A 2NV2B 2Z9CA 4ARBA 4RF5A 1B04A 3TIVA 1DRKA 1CEYA 3L6OO 4G5GA 3FF4A 1EA5A 4XARA 4DV7B 2PJUA 1MJHA 2R96A 1XB2A 1UCFA 4CR8A 2BBTA 2UUBB 1LK7A 4RACA 2HHJA 4Q3DA 3SLKA 1D2NA 2IDMA 2PH5A 2G9RA 2IKQA 1WIWA 4EBDA 4CM7A 1W36B 5EN4A 1WXFA 1EI9A 1V9LA 3NVMB 5AW0A 2XUIA 5CVVA 1ULHA 4LMBA 2YWHA 1SBTA 4Q7EA 3H2IA 1VBHA 2RH4A 2IBMA 1AKNA 3S7TA 5FI0B 2JPDA 1MAWA 3FLMA 4WOBA 1D8AA 1Z25A 3W5VA