2YS7A

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
419
structure length
413
Chain Sequence
HMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylglycinamide synthetase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
total genus 125
structure length 413
sequence length 419
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2ys7A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2ys7A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ys7A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2ys7A04
5LA6F 2W6MA 3HO8A 1WR2A 3G8DA 4C5BA 5HV6A 4FFLA 3WNZA 2GLTA 4O83A 4FFMA 2PBZA 2R7NA 5JH7F 1BNCA 4O7TA 2HJWA 1EYZA 2HGSA 4L1KA 4E4TA 3NUAA 2XCLA 1M0WA 1E4EB 2YL2A 1GSOA 2W6OA 3LWBA 5BMVF 5BPFA 2I8CA 1VBGA 3LP8A 3UFXB 2V59A 2CNUA 2NUAB 4EG0A 1KUTA 2WYOA 2DIKA 4O7WA 4FGRA 3JZFA 3BSWA 3TIIA 1JDEA 1PX2A 2W6PA 4ZOLF 2FPGB 2YZGA 2YZMA 3KAKA 3MWDA 1KBLA 4IWYA 2DLNA 1C3OA 4EAAA 4MAMA 3KAJA 2W6ZA 2X0SA 2YW2A 4DIMA 1KJQA 1GSHA 4EABA 1GGOA 3BSSA 1GLVA 1IOVA 3VMMA 4EA9A 1CS0A 4I55F 1M0TA 3R5XA 2VPQA 4IIJF 2R85A 2DZDA 3K5IA 2FPPB 5C1PA 3TQTA 3HB9A 2J9GA 1VBHA 2Z02A 2GQSA 3I12A 1B6SA 5GONF 1KJ9A 5LP6F 4O4LF 4QSHA 1KC7A 4I50F 4IHJF 2W6NA 4O82A 4ZHQF 4M99A 4TUYF 2R86A 4O4IF 2I87A 5C8YF 4M9UA 2GPSA 3MWEA 3JRXA 3ETJA 1BXRA 3BG5A 3ETHA 1M6VA 3N6RA 4IZOA 5CB4F 2CNVA 2R84A 5H80A 4O2AF 3BSYA 5C1OA 1CQIB 2QK4A 1Z2OX 3G8CA 4DLKA 4MV8A 2W71A 4FU0A 2SCUB 1EHIA 1SCUB 2NU7B 4YAKB 4MV4A 4EA7A 1JLLB 1AUVA 2C00A 4O7ZA 3VPDA 3JRWA 4XYLB 5JVDF 2R87A 3DF7A 5J2TF 3V4SA 1KJJA 5LYJF 5I47A 5BPHA 2I80A 5EZYF 3RUPA 2VQDA 1CE8A 5D8DA 1AUXA 2IP4A 4FFRA 3QFFA 3R5FA 4ZI7F 4J6EA 2R7LA 3HBLA 2V58A 3KALA 5CA0F 3BFPA 4ZQIA 3JZIA 1ULZA 1OBGA 2DWCA 3U54A 4C5CA 1EUCB 4WBNF 3OUUA 4O2BF 2W70A 3V4ZA 3VA7A 4M98A 3VOTA 5LXTF 4FE2A 3U55A 4IWXA 2W6QA 2PN1A 4MV6A 2VHEA 4O7VA 4EGJA 5J2UF 5K2MA 3TINA 3Q1KA 5CAEB 1E4EA 3OUZA 5IYZF 1VKZA 4O81A 4FFNA 3TIGA 3R9RA 3U9SA 1KEEA 5HBRB 2V5AA 4HNUA 2R6FA 2NU6B 4XYMB 5KX5F 2YZLA 2YRWA 3VPCA 5FNVF 3MJFA 1PK8A 2QF7A 2NPOA 5JQGF 5KKNB 3KREA 3N8DA 3WO1A 2FPIB 3GLKA 4O7YA 2ZDHA 1EZ1A 4YJ2F 1GSAA 2YZNA 3K3PA 4YB8B 4EGQA 1I7NA 4O7NA 3RV4A 4XZ3B 2YS7A 4O84A 2GPWA 5DMXA 1A9XA 1T36A 1B6RA 4O7SA 3RFCA 2GQRA 4O86A 2R82A 2ZDGA 3R5HA 1DIKA 4GGMX 1CQJB 1W93A 2FB9A 2R7MA 3K5HA 4WD3A 1W96A 3ORRA 4HNVA 4TV9F 2XD4A 1Z2NX 3GIDA 4FFPA 3AW8A 4O4JF 3ORQA 4ME6A 4MV9A 4XX0B 4RZQA 2NU8B 3E5NA 4MV1A 5LOVF 2CZGA 1C30A 4TV8F 3U9TA 2YYAA 5CA1F 4MV3A 3RV3A 3WO0A 3VPBA 4HR7A 3Q2OA 4M9CA 3R23A 1KJ8A 1JKJB 4O7RA 4YAJB 2OLSA 1UC9A 4O4HF 4C5AA 1KJIA 4I4TF 2R7KA 2CNQA 2FP4B 1Z2PX 3SE7A 1I7LA 2NU9B 2PVPA 1OBDA 4MA5A 4YJ3F 2YWVA 1JDBB 4FFOA 4HQ6A 4O7LA 2ZDQA 3AX6A 2Z04A 2P0AA 4YBZB 1DV1A 1IOWA 4Y8VB 5JQWA 3TW6A 4MA0A 2YRXA 5JVLA 2VR1A 4NYEA 2YS6A 4MV7A 1A48A 1DV2A 1EUDB 1UC8A 2CQYA 4EA8A 4HNTA
chains in the Genus database with same CATH superfamily
4DA6A 3FPAA 3I8SA 3L06A 4C5BA 4I6JA 2P69A 4F4DA 2I1WA 4AD8A 2WOOA 2O20A 1TAHA 3QA3E 1WEKA 5IFLA 1C8LA 1CJBA 1H1LB 1X9GA 4QLAA 1XFDA 4JI3B 2UUCB 1DAHA 2WA1A 3A9RA 3OMXA 1NZJA 3CLKA 5DTJA 2YUTA 1H65A 3NPAA 4RAQA 5FO1A 5KEIA 4G5QA 2GZAA 4PYOA 3FWPA 5KYXB 2DUUA 4GOLD 4C22A 5A2GA 2ZQ5A 3L84A 4UU7A 1VMAA 4IDDA 2QTRA 2IP2A 2WHXA 2C8LA 4JR0A 4GC9A 1XDUA 1M2NA 1HR0H 2EC5A 4C43A 4ZZIA 1XD8A 4EATA 4HQRA 1RWKA 4OB8A 2FVYA 3RIYA 5DLGA 2RMKA 3OKAA 1L5OA 4Q7EA 3GJ3A 1BWQA 1N77A 3D6MA 5KAPA 2RH8A 4Y9DA 4RB3C 5GGYA 4A2PA 2Z02A 5KAMA 3TZEA 3ILSA 2C2EA 1V7PC 3VYSB 3JCZA 2PH3A 4MS4A 1UKBA 3IEUA 3PNBA 2WF5A 3LIIA 2VUHB 4MP6A 1UAYA 4P54A 3I92A 3PEUA 1MV8A 1CS4C 3PJFA 3ZHTA 3DHWC 4BWVA 1SXJB 5FKJA 2OV6A 5KZMB 1WEHA 2VPTA 1XMJA 3DBLB 3CVVA 2FRXA 2XECA 2JZNA 5FBRB 2IY7A 4MW9A 1DQZA 4RVCA 5IH7A 4FR0A 3BIFA 3CKMA 3T7TA 1U7OA 3QP9A 2DQKA 3EA5A 2JCXA 5BWXA 4TMXA 3V7NA 5WRFA 5MF6A 3HKDA 4BE4A 2CBXA 3ICPA 3CRMA 3NM4A 1LKZA 1FFWA 2QORA 1FDOA 3RT9A 3SSOA 2C5EA 3WQHA 3NM5A 3RF6A 4C0LA 3J7AK 3E5HA 2JLAA 4KAFA 1U9JA 4I1UA 1OA0A 3L4SO 3X2SA 5L8VA 1ES9A 4WEQA 2OG2A 5AVZA 4GSLA 1U1DA 4J3NA 1H4TA 1RJ9A 3NWOA 3IDSA 1DEXA 1M1NA 3BFPA 3NAZA 3SC6A 2IA6A 5LUAA 1KEUA 2I4RA 5FJIA 2IDZA 2CBZA 3DCJA 1O1YA 2HPAA 2BEWB 3R0IA 4QWBA 1K6JA 4MTEA 4JJ8A 3EIXA 3O2QB 4L73A 1PUXA 1RYNA 1EJ2A 4JGBA 1BDMA 2M1XA 1UZMA 1U1CA 3LUAA 1EFPB 4U02A 2Q3JA 1UPCA 1PR6A 3M9OB 4ZAWA 1IWPB 3CYFA 1YAHA 4XFDA 1CUSA 4R83A 3I64A 4CMFA 3BX1A 1Q22A 1JECA 4A3IG 3V2IA 5ICSA 1RKQA 3X1DA 3PDWA 3K9LA 5E6SA 3GGCA 2ZIUB 4YPVA 2HXGA 4B6PA 3CF2A 1K7YA 3LYAA 5CCDA 1HH4A 4MLZA 2OYSA 4NHOA 1XQ1A 2ODBA 5IANA 3SHFA 1BGXT 3AVXA 3G2LA 3T5DA 2PXHA 1G2OA 5IF3A 2WT8A 2Z9CA 1DKNA 3YASA 5AT1A 2VJMA 4EECA 4XDGA 3HWSA 5K3WA 4P35A 4Y6PA 4RUKA 2RHGB 2C9MA 1R8XA 1XTQA 2FUEA 4MPTA 5HKKA 4PX9A 3HY4A 2FSPA 4ZCLA 1WVGA 3VVLA 2J6CA 5FOWA 5JXJA 1N32H 4E0BA 4YP0A 3FOAA 4RQAA 3PFNA 3NBYB 1PJ2A 4JEUA 3HGMA 3GTGA 3BWMA 4OAPA 1QPBA 4DV1B 3U60B 1I33A 1ZH2A 4XZ3A 3KFLA 1QBKC 4MJXA 4G2NA 4FHEA 1U1IA 1W2WB 3CPEA 1I5RA 3RKRA 3OZRA 1EQUA 1YQGA 3IOMA 4DSUA 4JBHA 1ULAA 4AMYA 3KPYA 2XMSA 4MW5A 1AA9A 3DQQA 3I5XA 4IY1A 2B1IA 3UK7A 4CM6A 1WUJS 1M34A 3GDWA 1OLOA 3ZDXB 4O2BA 1RWMA 3NC1C 4L74A 3Q5EA 4PG6A 3FI0A 1V43A 1L7OA 5A5GA 1WB9A 2F8TA 2ZK7A 2K5UA 3E03A 4UVGA 1A5SB 5BWWA 4TSKA 5B30A 2Y05A 4O7WA 2OPBA 2V03A 3D4LA 3DLIA 1HV8A 4DR3B 4ZEOA 3W3AA 4ZGBA 1PJSA 2ZIXB 3AHFA 3LP5A 1NRWA 5I7VA 3E6AA 4O1MA 2BM9A 1DRKA 4D56A 1ONNA 1QQ7A 3CLVA 1MQSA 4TTTS 4RTQA 3GZNA 2QVZX 3DOUA 1K2WA 2I6GA 1Y48E 3VSDA 4D9CA 3LYUA 4UCUA 1XHFA 4TVBA 1GZ6A 2R8IA 1ISGA 2AE1A 1DC5A 4IG4A 4JT9A 2DHDA 3AFMA 4O29A 1JBKA 3RR2A 3M9XA 3DTVD 3U3MA 3LOQA 1QKIA 1CY4A 3TG2A 4PHCA 3DAFA 2P2LA 4C9BA 1J5EB 4OFZA 3JSLA 2UUCH 1B8UA 3NIGB 5LZ5A 1JHUA 1RYYA 3MWEA 2BGIA 4JT8A 4LKOA 1W0KA 1NOJA 3ECCA 4ENUA 1P4RA 5HS4A 3AR6A 5L3RA 1K92A 3UMMA 4CQLB 2QK4A 2WWXA 2WSSD 2WWWA 5GOTA 3P4YA 4MV4A 1PEDA 3DR3A 4LTNA 1JFFB 1L5FA 5JSZA 2JW5A 1Z3IX 3S5UA 5AW0A 4P8RA 1G6KA 4P4NA 2BBWA 2C82A 2ZS7A 2R93A 4M54A 2WJPA 3D6HA 5JNRA 2VQDA 5HJ5A 3G0CA 4TMWA 4FZVA 2PFGA 5EI5A 4TXMA 1RACA 2DSTA 1W0JA 1XXHB 2XUAA 4H1HA 5K51A 4EY4A 3K05A 2VA8A 5GM1A 4LYEA 1VP3A 4KEAA 5J1TB 1M8JA 2BQRA 3K2BA 3SZLA 4BMPB 1K8ZB 3IV9A 3LCVB 1N6KA 4NFHA 4UCOA 3HOYG 2G9VA 2Q5CA 4I4IA 1LZKA 1K6XA 1DAFA 4JSYA 2V6IA 1DWPA 2VNHA 1HM5A 3E48A 1J2YA 2B9EA 4TQRA 5CFQA 1GV1A 1MC1A 3L7OA 3DL7A 2C7GA 3WICA 1SVOA 3WLHA 4N0QA 5EHQA 1EDOA 3GLKA 1I9CA 1IEQA 4NYJR 3A6EA 1S68A 2AF4C 4AXBA 4CR7A 4TYNA 3KE9A 4Y30A 4Q0MA 1E1NA 1BAPA 5FF9A 3AEKA 4PS1A 4JI6B 4ZANA 1MZBA 2Y0DA 1Z56C 4INZA 4DV6B 4P31A 2HC9A 4MEAA 4FJ0A 1EUCA 2FFRA 3OE4A 5MFZA 3WOHA 2JLXA 1TECE 3ZWYA 2PMZE 4ZI7B 2HIHA 3GAMA 2OHHA 1XEXA 3V6KA 4EG6A 3ELUA 4BFTA 4I50A 1TIKA 5KTKA 4EBCA 3FMGA 3FZNA 1T5TA 4D4HA 4I6GA 2NTVA 2PD3A 3PYLA 4YP5A 2Q4BA 5G4KB 1JYEA 1CKEA 1GYPA 1M7GA 3OC6A 4KHPH 5CBKA 1YK1A 5IXYA 1BW9B 4OH7A 3V00A 1W34A 3K16A 3W4KA 1GA4A 2VTBA 1ECBA 2EJWA 2W9BA 2OOKA 4TKUB 4BO6A 5H9WA 4Y0AA 4DC0A 3BACA 3A2MA 4YB8A 4J29A 3GLTA 3R9XB 1YNSA 3TGPA 4B45A 3KM0A 1FRFS 3W90A 1Y1RA 3LT2A 3AKCA 3G0HA 1F2UB 3UYLA 4US2R 1Y7LA 2J45A 4MVJF 3ZJYA 4GNRA 2EP7A 2I7VA 1WMBA 4DM3A 4OSEA 2Q2VA 2XE6A 4M4SA 2R6CA 3LFTA 5KFFA 5GZ1A 1L5YA 5BWRA 4BN5A 2IX3A 1IK6A 1Z22A 4XB6B 3E2PA 5DH9A 3H2YA 2ADMA 5F9MA 4QO8A 3GDFA 4LSXA 1FXSA 5FYQA 3QJGA 4X3PA 4DVGA 3S1LA 1MVLA 1N3YA 3TVYA 1QDUA 1JR4A 2Q6LA 2R6HA 4RTSA 2P3OA 1QM5A 3KEMA 1A7JA 1L7RA 1F0KA 3PUHA 4AS1A 2UYQA 4OQXA 2C8VA 1T8RA 2F4VB 5CCXA 1GUYA 4NMWA 2WHYA 1PJ3A 4OJYA 3FSGA 1PL8A 4D5GA 1SXGA 2O0JA 4JLNA 3OE7D 1MNQA 4RPCA 4TXJA 4QWCA 5FDFA 4Q9JA 1ECCA 3A9SA 5ICGA 1GGKA 2Q2NA 1TVEA 4QJ3A 1XT6A 4RZSA 4ZMSA 2EFEB 1QV9A 3OWOA 3G2QA 1GM5A 2R92A 1CRZA 1CHDA 1U8XX 4MVWA 4E03A 2Q3BA 3WLMA 3F8SA 4PLCA 3WHKA 5K5EA 2CCJA 4Q02A 4CDNA 4QVGA 1Z62A 2J9FA 4X62B 2VRBA 4BNTA 3MM4A 2CHEA 5F21A 3OA0A 5COQA 1XF1A 3AHJA 1D2NA 1ZVKA 1SHZA 2XCRB 3QNMA 4LRTB 4FYIA 2E5FA 1R6BX 4LHSA 3VVMA 4U4AA 1G0OA 1BFDA 1TUGA 4A8JC 4PO1A 5DT2A 2FZ4A 2SCUB 4PX3A 3M9NB 3GJZA 5JISA 4HAWA 5JVDF 2VXOA 1H5QA 1S2LA 3AB7A 3SP1A 3MCVA 4R8UA 4UMFA 1QLHA 3HCDA 4RGVA 1R18A 4ENWA 5T3YA 1WNFA 2OFWA 2KI5A 4M1EA 2PHZA 4X97A 3ZUPA 2RGNA 4G07A 3BTUA 3RRFA 4B3SH 4RQBA 1FRZA 3WWPA 1YULA 4G1EB 4OBXA 1PTKA 3K1AB 2PRKA 5KOYA 3I72A 2EF1A 3U3XA 5ISMA 3SBOA 2QD5A 3TR5A 5KWVA 1PF7E 4NENA 5JATA 4M98A 1HG1A 4LDPA 5BMVA 5KT4A 4RVNA 2HA2A 1L5RA 3C3PA 5CDTA 2C2HA 3Q2IA 3GFBA 3F5MA 3O94A 1E3WA 3T3MB 1KYXA 4YWHA 3KQOA 4YUZA 1J5EH 1GP2A 3C5WP 5DFAA 1QVWA 4D99A 4JYZA 2V65A 3AVQA 4JBLA 2HHAA 4E5MA 5HF8A 4B6FA 2NU6B 1L7BA 4Z1MD 2JHFA 1XZGA 3UJCA 5D3MA 3TZKA 4BQSA 4RJLA 5H81A 1H0HA 1EQ2A 4GGPA 3ASZA 2A57A 4J3JA 1T25A 3IJRA 1UT6A 2OP1A 4FCTA 2FGJA 5KTTA 5IBRA 1WP9A 3GL9A 3E8XA 3W1EA 4DMFA 4DUPA 1WMAA 3I6IA 5L1JA 5DGAA 3HYNA 3TYXA 1R8YA 3ZBTA 4QQNA 1KI6B 4EGCB 3EARA 1CLEA 4MQUA 4EYKA 1CFZA 5FXMA 3KSAC 1N6NA 4QC2A 1Z6XA 2X41A 1J2TA 4RPLA 2FPLA 4UAUA 4EJ2A 1E6WA 1ULBA 1NZFA 3PEWA 4UTRA 1E9CA 5EPOA 3HOUG 9ATCA 1KJ8A 1U1EA 4ZVMA 4JSTA 4LXUA 4FBLA 4LXTA 1K66A 2FUCA 3BWYA 4MA5A 3IPRA 3QPVA 1CXZA 3KJQA 3R9KA 1KQPA 3ESCA 4JI2H 2X9NA 2AJDA 4TYYA 1DV2A 3EAGA 1ZW1A 2JJ1D 1S9FA 2OLEA 2X3YA 5NLLA 4RGYA 3HRIA 3AGQA 3SQDA 4BCBA 1TT7A 5HDBB 2DSNA 1TADA 3Q12A 2P9EA 3AGPA 2P6UA 4LSGA 3R3VA 4PAQA 3LT4A 4EFDA 1D8TA 3FYUB 3ACBA 3UXEA 2ZQYA 4INJA 5BPFA 3F7NA 4UMEA 4MA4A 4XR4A 5JO0A 1KDOA 3COWA 4DQLA 3RBVA 5LR6A 2NXCA 1X7ZA 2XB6A 3BHIA 2CKZB 1Q44A 5FUYA 1LS1A 4A26A 4BX9A 2M6RA 4POAA 2O48X 1I36A 3AWIA 3AONB 1V1RB 3EYWA 5TGZA 3OM9A 3MMPA 1SC6A 2DY0A 1HA3A 1SZJG 3AF5A 4YAEA 3ORSA 4LF6B 2CLHB 3ZLUA 3EH1A 1M1YA 2RHCA 3GUZA 4OQLA 2PYZA 4CMAA 3USCS 1F12A 2VHXA 3WZMA 3ZJUA 3IOBA 1RLOA 3Q3VA 4MUKA 2ZRKA 4M87A 4KKXB 2AGOA 2QW1A 4EG3A 3P9PA 4O4IF 2WKWA 3IDOA 3CF0A 2FJ0A 3B8EA 3AINA 2OZLA 3JQRA 3ZJ5A 2IYLD 4YRRA 3UY4A 2CNBA 3ETHA 3LMKA 1HE3A 1I3LA 3V6JA 4EQ6B 3RGXA 3OOYA 4OMFG 1L6RA 4WKPA 4HGNA 2WZBA 1OW3B 1QRAA 3K2QA 3SNHA 3JYOA 3LUGA 4MUGA 4CLRA 3L01A 4Y0NA 2D1YA 2CGEA 1U80A 2DTXA 1KIAA 3LVQE 1SXJC 2ZYIA 4YLEA 2A5YB 2Z98A 3VKVA 1N2HA 2B8NA 3Q3IA 1OTHA 3UQ8A 3LXMA 3HP4A 4D3DA 4IYRA 1CHNA 4P32A 3JZAA 1G9TA 2YMMA 4J2TA 5C8VA 2WUFA 2JH3A 3QLUC 1KHHA 5JSQA 1KBZA 1AQ6A 5HF5A 3GG2A 4LOLA 2YJ3A 3KBBA 4XPIA 4N54A 4R6WA 5E6UA 4DG5A 5I7WA 1D0SA 2ZAYA 4F21A 3HKZE 2JIMA 4D80A 3THYB 1V8PA 4DSAA 3FSEA 2GBIA 2C1XA 1A97A 1CPYA 1P1RA 2ZSUA 2H4HA 1ZXXA 3RJ0A 2QJOA 3II6X 4OHUA 5I45A 3U4CA 1AG9A 5HOEA 3MCUA 4DXHA 3CNEA 2Y6VA 2FOXA 4JU9A 1KVQA 2CXPA 1VJRA 2NUTA 3BRWA 3HZRA 2XHEA 4BWFB 3LK7A 5AD1A 3NX4A 1JL3A 5KG6A 1TA0A 4MCIA 4UOZA 1FOEB 2J3KA 2MSWA 1ZQ9A 1AN7A 5JNVA 1KL7A 1ECLA 3B9BA 3WB2A 1G7SA 4TUYA 3K96A 3MCAA 3O3CA 3UMFA 5DG7A 2C5AA 4QLOA 2YJGA 5AVWA 4NXMH 5T6BA 5JC1A 3EOAI 1T9KA 3RV3A 1O6CA 4W5RA 1KRHA 1R8JA 3L7MA 3IUQA 4E6PA 1LLQA 1KFCB 4CMEA 4EB3A 3E1GA 3NOQA 4NFLA 1GT6A 1AK9A 3SEAA 2QTZA 5IULC 4JB0A 2G9ZA 3LUPA 3DFZA 5BO5A 2WB1E 1PD0A 5JRZA 3CEAA 1T0HB 3HJBA 3QNWA 1WSWA 2HREA 4JUDX 4MARA 5K8IA 4FGLA 2N1MA 3I04A 2XGQA 3CZAA 3G68A 4URUR 5JWRA 5CR9A 3NBYC 3COPA 4L0MA 3RUHA 4ZRNA 3NXSA 1BNCA 4ZT6A 4L02A 4TRRA 3DB2A 4NOMA 3N8GA 2WZQA 1FKAH 1W5FA 3M1IA 1UDWA 4IDQA 1EE9A 3LWBA 4UU1A 1TYEB 1YB7A 7ADHA 4BPRA 2JAWA 3O8LA 3G13A 4YMIA 5AKLA 4ENQA 4AROA 3QPDA 3FJOA 4KMRA 2GM3A 4YAGA 3SQOA 1P17A 1ZIYA 2IJGX 4IICA 1KK2A 4JKIA 5P21A 2HA4A 3SGLA 3AUXA 1DWQA 1I51A 2BR4A 1KF0A 4KVGA 3DHNA 3GTMA 3ENZA 4P08A 3V6LA 4YMSA 4UE6A 1XDWA 2Y9MB 3QWBA 2C2XA 1CV2A 1PR5A 2HL6A 4F45A 5JASA 4WDRA 1AKYA 3DE3X 2QVGA 3IVRA 4AI6A 5HZHA 4IHJB 2WBLC 3BIJA 1QTIA 5B37A 3S68A 5CP8A 4IDAA 3UC9A 1W2HA 1HTTA 3R44A 2HSDA 2H5JA 1WMEA 2B82A 3X1XA 3NM6B 1CY2A 4UHJA 5KYYA 1WP4A 1C9JA 4DB2A 3FMOB 1I1MA 3U0BA 3KYCB 4M9UA 4HUJA 1GCOA 5BW4A 2GD6A 1QFSA 2ZIZA 4PSKA 1MQAA 1YB4A 1NG9A 3AHIA 3PQ4A 2HDHA 1PKXA 5C1OA 2UVUA 5I3ZA 5KJ1A 5IDVA 5TR9A 4US0R 4A8PA 5ITZA 3TOVA 1JFSA 2UUBH 4WWHA 1NDHA 3GUHA 2QTHA 5FPSA 2Y1CA 4EFBA 3AI1A 5B1SA 1D2EA 4EJ6A 2VQSA 4QFDA 5HF6A 1NTRA 1XL0A 2ZT8A 4QYMA 3OJFA 1ONOA 2J09A 1XTJA 1MABB 5DX0A 1MHTA 3C7AA 2YY5A 5K01A 2BVNA 4Q1VA 2JCBA 3FNIA 2Q2QA 1R15A 3QKWA 3RVKA 2Z8ZA 1CQWA 3P9SA 3BQ2A 4OSPA 4HWKA 4OXXA 4PWYA 4PINA 4P38A 3B7PA 2X2OA 4WACA 4JBWA 1FUIA 3MMSA 3THWB 3OQ1A 3ZV3A 4X1IB 4ENSA 2FQQA 3AOEC 3KDAA 2BTOA 3ZGLA 1VZ2A 3FDZB 1L8QA 3HVUA 3H1FA 5FNVF 1J0AA 1U8AA 3WWDA 4V0LA 5KC8A 3N0XA 1Z7WA 1A4UA 1QE0A 1JLSA 2JFFA 1EX6A 4BMSA 1T5LA 4HEJA 2ZAMA 3VO8A 3BICA 4OK3A 4JMPA 3GLIE 3CVYA 3C6QA 1J0BA 4C7JA 1H2XA 4RANA 1NW7A 7YASA 3H16A 4KYTA 1L7PA 1A9PA 4F9EA 5F12A 3K09A 4RY9A 1RJQA 4GR5A 3CBQA 1E1RA 1XTSA 5GM2A 1SCJA 3AUJB 1LBHA 4ECEA 4NE2A 1TLFA 5CM2Z 3PIDA 5CLHA 3PX7A 3JZMA 4CC6A 3GA0A 3A14A 2JFBA 3DWEX 1ORVA 3SQXA 3MWGA 2DWQA 4PFJA 3G7SA 2VZLA 4UHDA 3RAPR 4S24A 1N3BA 4MYCA 4BXOA 3H2HA 3P2JA 3NGXA 3VC2A 5CW1A 5DM0A 4IJWA 1KAEA 1NW5A 2CVHA 3RQIA 2C4WA 3AIIA 1K5PA 1UC8A 3HDVA 3HB5X 1KYVA 4MIEA 1V2HE 1T3SA 2CNDA 3GJRA 4I99A 1U31A 4ZCRA 2WPNA 4V02A 3SSAA 2XKAA 4D9NA 3PNSA 1CDOA 5G0UA 4WBNA 3RTDA 3Q10A 4K6NA 4LGYA 1LX7A 3OCWA 1TAQA 3AKEA 3ETEA 3EIHA 1DXYA 2BKLA 1PS9A 4MS4B 4CT0A 3URKA 3RVNA 3N44B 3HEBA 2F4NA 3U7IA 3RT1A 3UXMA 3PSHA 3W2EA 2F1OA 3TBFA 1QYIA 1U3DA 4EKGA 4Y8VA 4PIVA 3EDYA 1C3JA 1N7HA 4FMCF 2CK3D 3QZUA 1BQ4A 3HKDB 1W85A 5T14A 4FXOA 1ZMRA 1OH5A 3COVA 2W6ID 1USVA 1C0IA 2YW9A 5A9SA 1K86A 1S8FA 2V0GA 1P1BA 1RQNA 4Y6RA 2GZ3A 2VAMA 2FN8A 4RXMA 5HVNA 4PC7A 3V7UA 2PX6A 3UYYA 1O4VA 1ZA1A 5EESA 2H0QA 2OCPA 1UWVA 1XPJA 3R77A 1GNTA 1K7SN 4DXAA 5DNUA 1M1NB 1EWRA 1VS0A 2QP9X 3IUYA 4JUZA 1VHJA 3DMFA 1L4FA 2A78A 1GU7A 3AL3A 2NZWA 2VDLB 3HCWA 5C8YF 1FRVA 4GLOA 3AEZA 3FB1A 3CH7A 3P2IA 1YFLA 4BFWA 2B61A 2TMGA 1M7BA 2E4AA 4R2XA 3BG5A 4JQSA 2A4KA 3GLHE 1LB1B 1PFKA 2YNMC 2Y1OA 2LXNA 4LDNA 1DKQA 4HX2A 2QLTA 2JCGA 3NATA 4HDAA 3WYAA 1N0UA 3PQDA 4TTPA 3P0EA 3VR5H 2ZTSA 3SG0A 5E6SB 5GQSA 4IWNA 1OVMA 2IKQA 3OJCA 2CHUA 1MW9X 1BVYF 1VA5A 2BEKA 2RE8A 3HSKA 5EINA 2YTZA 5H9VA 4REOA 2M05A 3I2JA 1I3OA 2RAFA 3AIOA 3ID6C 4N5IX 5AJVB 2GQ0A 4ZVNA 5B3KA 3VZBA 2VJMB 1NP3A 4B6SA 2HIXA 4B3MH 1BN7A 4MB0A 3IPAA 1D4ZA 3ZGNA 5KG7A 1OWLA 3SR3A 4Z4HA 1RYHA 1R8QA 2P4QA 4F1JA 4M0JA 2FSFA 2HQOA 2PG3A 2W2KA 3GLFB 4Q24A 1WY7A 2X2FA 4GD3Q 1QONA 1QKKA 5KFHA 4L8LA 4XZ3B 2W4QA 1WSBA 4QPZA 2IHZA 1SD1A 4M83A 3R0VA 1L5LA 3GV8B 1QXSA 3ITKA 2YWDA 2YH2A 2QRKA 3GP8A 2B1GA 2O0HA 4YIKA 5ILQA 2CLKB 4RLFA 1KI8A 3FG9A 2RJOA 1MO2A 2FQXA 4ZOEA 4C2UA 1M34B 4O2BB 5KVQA 4LPSA 4OL9A 3ORFA 1PR9A 5IK2A 3BMCA 1YCFA 1V3TA 3GJSA 4JASB 3IP7A 2KQUA 1VA4A 1QFMA 1U5BA 4FDMA 3DMPA 2Z8YA 1PU2A 1IXYA 3ROEA 4HR7A 3NBFA 4PO8A 4ZU3A 1BVUA 5A71A 3GDGA 2QM7A 4HAOA 2X8AA 2VNSA 1I5EA 4MWOA 3PW4A 4X44A 4ZI3A 1GWNA 3FCUB 4DR7H 1H3FA 2IHBA 4NC9A 3WLKX 4DT1A 3EXIB 3DOFA 4YLYA 3BH0A 5FBZA 5EJ2A 5JSKA 4P9NA 1II9A 2A9PA 5FWXA 1R0CA 3ZW9A 2X23A 3CLHA 4EYSA 2WM3A 3UTDA 3V1MA 1RBQA 2XMDA 3F8NA 4F06A 4IGKA 3I3SR 2AC7A 4EVIA 3KHGA 2H9IA 3VYRB 2R7NA 4YN3A 2BZ0A 2HSEA 2QUBA 3CR8A 3SGIA 1Z6GA 2XCLA 2W83A 2E4ZA 1KMCA 4CNBA 5I9BA 1M0WA 4M88A 3GT0A 4YT4A 4MDFA 1VYTA 3D2AA 2I8CA 2D8MA 1H6CA 3AKYA 1OASA 3MWEB 1AC5A 1U0BB 3WFJA 3JAMW 3GCDA 2PZBA 4UBNA 4BVHA 1JDJA 1UADA 1K6MA 1DTWA 3FYUC 3ZCXA 1SFOA 5C7YA 5B2EA 1YU6A 3UOGA 4BVLA 4O33A 1DSSG 3PPXA 2GO7A 4FQ7A 5KFTA 4PLWA 3JATB 5JSFA 1W48A 4D42A 1TTTA 2J41A 5JSZB 1ZP6A 2FLWA 3BERA 3PIRA 3EIUA 2R6GA 2QQEA 4HXGA 2PEYA 1V3QE 2FE4A 5TARA 5AK3A 1HDXA 2VSQA 2CJYA 1BVHA 2CLEB 4Y1GA 4XUGB 3S81A 5HE9A 1Y9AA 4NS4A 3LDHA 3FBWA 4IGIA 1S5PA 5A02A 1YK0A 3NAGA 4YBRA 5K0LA 2AXPA 1WQ3A 1V48A 3UTCA 4TYPA 2WNIA 3E23A 3E53A 1WBBA 2J5QA 3BIOA 1ZG3A 4AJ9A 1L7AA 1TWCA 1G8AA 2FMUA 3IH5A 4DL7A 3PKZA 4DR6H 3MFHA 3CEBA 5JYDA 5CJPA 3A37A 4QDXA 5F78A 4BFLA 1Z5ZA 2DFVA 1SBHA 4K6MA 3UWDA 2IBMA 2R25B 4DNOA 3OF3A 2ORWA 4ZZ1A 4AIIA 3W77A 3I3OA 4YDQA 4D3XA 3GP3A 4QICA 3LIPA 5FD6A 4JV0A 4B79A 1PBNA 3WK8A 3HKZA 1EUCB 4X94A 2D0DA 5FULA 4P5EA 1HEYA 4Y3UA 4R2LA 4LGMA 1XEXB 1BVRA 1Z7YA 1U0NA 5DTQA 3SZGA 4YRZA 1JQ3A 2HYIC 5LXTF 3WISA 4I50B 2IU6A 5KFNA 4NYIR 3M9WA 1OPRA 3GCWA 2O8BB 1SD2A 3DKKA 2PX4A 4TMYA 1TU4A 2VOJA 3U09A 1M8KA 4Y2VA 4F8JA 4A3JG 3OZSA 4M7EA 1ZHSA 3E1SA 2J8ZA 4EF5A 5CXUA 2ID7A 1N0HA 3RW9A 2PKEA 5AK6A 3BIWA 2FNAA 4QPNA 1Z5WA 3OZCA 4UDXX 3H5NA 4NJMB 3OESA 2VTBB 2LUOA 4PSDA 2QZ4A 1I1NA 4YB8B 3W34A 1ZBQA 5AKJA 5CMLA 5AVKA 3WL5A 1DIRA 1MF7A 1B6RA 3QXSA 2XNCA 4S2UA 2WYWA 1PJCA 1Q0ZA 3UJ3X 3T1QA 1MC8A 1MOZA 4BMCA 1VLHA 2WMDA 1W44A 4H6WA 4WVFA 2X19A 1TQHA 3VNRA 1ZINA 5KT7A 2P3LA 1IUPA 2XUFA 4JEMA 1UKAA 3N0VA 1ENOA 1J4AA 1VTKA 3H9GA 1K7FB 3HKCA 5AOBA 2LR0A 1LTKA 1WPXA 2J5XA 2NZ2A 3SDBA 4KFUA 1NQUA 1D5WA 4WINA 2PDAA 3UK1A 4UEKA 1G2WA 2Y6UA 4KIWA 1ZXLA 4P6VF 1HOXA 1A7KA 4N7BA 4AKHA 1P4AA 1H0KA 2JG3A 3L77A 4JUFA 2Q46A 1R74A 3G17A 1XA4A 1IRIA 3GGOA 3I6YA 5AW9A 5LMNB 3CNBA 1T6YA 2X1HA 2NT4A 4WGFA 4F86A 2LCQA 4KXWA 4DRYA 4DPKA 1NLFA 3BA6A 1CUBA 4NL4H 5HHTA 4GOKA 4ZYXA 2GERA 1Y6JA 2G8NA 1WDLA 5HCNA 2EZ8A 4GRAA 2WSIA 5JC8A 3AHHA 2W2XA 3VR1A 2Y68A 1U0OC 1JTVA 2P9YA 4IJQA 2J9FB 5M5BA 4JYAB 3W8FA 4IIXA 2OZEA 1NC3A 3ZKAA 3H05A 4UM5A 4Y67A 1DQNA 5CK5A 2R6AA 2UKDA 4GZ3A 5M34A 1QJ4A 1KUTA 5KQRA 1ZD4A 4UFPA 1KDPA 5JSHA 4TTJA 3Q85A 2QSYA 1QCZA 3F9CA 3RVJA 2V3CC 2CDBA 1TW3A 1XZQA 2WFZA 1ZIXA 4H15A 2P91A 3RSHA 1SN7A 4YRJA 5DP1A 4RO0A 1JMVA 2XD9A 5FADA 5FORA 1NF3A 4YRIA 3LC0A 4LJYA 4IDHA 5ESDA 4R8UB 1MOSA 5E9JA 1A8IA 1CZHA 2FE1A 3BJRA 4C7BA 2QYSA 2YJTD 4IIFA 4DUGD 2FY8A 5C1DA 2P5UA 2V9CA 4XM1A 1TNDA 3SR0A 1LSSA 2XOKA 1MB2A 1Q7TA 1RRVA 5KNBA 3WQBA 4GMKA 1HDEA 3MEQA 3LL7A 1L7QA 1S9DA 4NENB 1E1QD 3CIOA 5BMVB 1L6IA 4G1CA 1E3WB 1WQ1R 3CZ5A 3E9CA 1HO3A 2OP0A 4AICA 3MTDA 4FT2A 3TCXB 1HNXB 3VGPA 4DARA 3IEVA 3F8WA 4YCAA 3K8QA 5JS1A 3OX1A 1X1RA 1TJYA 2D2EA 3STTA 2WTXA 2UYHA 4OGWA 4D8TA 3EVGA 4WKCA 5I47A 4C2MA 1F2TA 2VBCA 4ZXPA 2OGTA 3PGKA 2BHTA 4L9RA 1DPGA 1I7DA 3QH4A 2ADFA 2VJAA 3DBVO 3GOQA 3CX8A 4R9SA 1E2MA 1FFXA 4HO1X 1GAQA 2XX3A 2DWCA 5EJIA 2J4DA 3X44A 5DAAA 4Z7OB 3VNAA 1YBVA 2LWIA 4BVFA 3LBFA 3ZHVA 5BSWA 5J2UF 4ER7A 2HMUA 3TAUA 4IM7A 1Y8AA 2P8JA 1GUZA 3BCSA 4DTIA 1EG2A 2VH5R 3UJHA 2REBA 3B1WA 1S9HA 5DEOA 1YB5A 7AT1A 1Z4LA 3GLIA 3UHJA 4G0QA 3IBFA 2I54A 3NNNA 3PE3A 4ZJZA 3PRKE 3VKWA 2J87A 2BL4A 1H8HD 2VQ6A 4QRIA 5DM60 4MI1A 5FP0A 3H4IA 5DMXA 1JR3D 1BEZA 3F0TA 1EH5A 1I1OA 5EIBC 1G18A 5J58A 4Z49A 2E6UX 4RA6A 3TKLA 3UT6A 3WYGA 1I4DD 2NV2B 2E82A 1ST2A 3SKYA 4EKIA 5K4HA 2HQSA 4N9WA 4H6PA 2CZGA 5DNCA 1WB4A 1B2RA 1NJFA 2IRWA 5B2ZA 1KAOA 2GVDC 4JDUA 1U4NA 5T6MA 1V37A 3IXMA 1QDEA 1JQDA 1E3QA 4AP6A 2B6NA 3D4OA 4OFWA 3WK4A 2DWPA 1X7ZB 3SIXA 1X8LA 5JQWA 3L07A 3LBIA 1RXSA 3V3KA 2PGIA 2FG7C 4NYEA 3RYHA 2IDKA 2AB0A 2VP0A 2XY4A 5AW1A 4PAMA 1P33A 2EFDB 2RHTA 4Y2UA 2WP0A 3LY5A 1H2AS 3DB1A 1LDEA 1C0EA 1G19A 3Q0TA 3IC5A 4OBWA 1YIDA 4OI1A 1TPZA 4DADA 5HV6A 3RFTA 3PCXA 3AY7A 4JI3H 4ED3A 4R8RA 1IVYA 3UB4A 2PNFA 3K2EA 2BJHA 1M1YB 3EF3A 3OCUA 4DCUA 4BB6A 2R7AA 3DNMA 2PLWA 5AK4A 1KZYC 1AE1A 4BEJA 3LHSA 2C2MA 4MVJP 2IYTA 2IEYA 1PR0A 1GU0A 4G0YA 3MLEA 4CLHA 1PNOA 1OYWA 4FI3F 2A4MA 2HH9A 3T4EA 2OZLB 1U8UA 4A3LG 1W19A 1B0ZA 1BHJA 2R00A 4RB0A 3IUNA 5TVKA 3NOXA 4X8OA 3MR2A 1TK2A 1GZUA 1FFCA 3PR3A 5EIXA 1UEIA 2OWOA 2FSUA 4CLRB 1L4MA 4C0KA 3EEBA 3NHUA 1VL0A 5AW8A 4EMUA 2GDZA 1VLJA 3GTJA 2V54A 2WSBA 4R3UC 2H6EA 2W7OA 1PLLA 3HB9A 2IW1A 2E1RA 3EA0A 4ZT3A 4NX2A 3SF8A 1SQGA 4Z7NB 5AUPB 4WCDA 3PXGA 5JMTA 3PUVA 2DKNA 3TPCA 5D3KA 3TDMA 2LIPA 4HNHA 2BGRA 1L3BA 4JOBA 4XOUA 4JYAH 3KJIA 5K3FA 1M6VA 2POQX 3GMIA 3E05A 2NO4A 4XPIB 1DX9A 2C42A 2AQ8A 4Y2TA 5E6UB 2Y1KA 1FSFA 4L3WA 2CLOB 2QN8A 5AVRA 3K92A 4QAJA 4R41A 1R0KA 3GFGA 3A3PA 4YO7A 3FNFA 1Y33E 1VFNA 2Q6TA 3FBGA 4N8SA 2PLRA 1GNQA 2YWGA 3PW5A 1E99A 5DBOA 5F3DA 1PN3A 3PFHA 5HIKA 3SI8A 3OTOB 5FR9A 4TKVA 1PD1A 1SB9A 4J9KA 1VJGA 2F59A 3IA2A 3BF8A 2ZUBA 3JQGB 3BXEA 3PGVA 3Q98A 3FDFA 2VSYA 1FLNA 2NUTB 4MHOA 5IPFA 4UUPA 4FR2A 5IHXA 3OUUA 4DMCA 2V7XA 3R0XA 4RKRA 4GMFA 2TS1A 1YSCA 1KAGA 1JQBA 3VZDA 2PXCA 2LTAA 3STVA 2JL1A 4NMXB 3WB1A 1U7TA 5IJAA 5IYZF 2Q3EA 3ZY2A 4PZ7A 3OSNA 3A27A 1A9TA 2R8GA 2BSXA 5D84A 2ONJA 1NMYA 2OHXA 1R0XA 1BA2A 4ETSA 4BQPA 4I5DA 4XH9B 2ZTVA 3Q9LA 2VTEA 4AT1A 4QG7A 1GSAA 1NMZA 5G2OA 3CNHA 3DOHA 2VYND 1SK9A 2H0RA 5FUMA 3JQAA 3WIDA 1Q0TA 2H2AA 5KYUA 4ZICA 3RRYA 1TMKA 2Q3LA 3H5OA 1PYOA 1VE7A 5JTTA 1CSEE 4GYWA 3CZRA 2UYOA 1XN1A 3SBXA 5KG0A 2FJPA 1W96A 1X7WA 2DVMA 5AKGA 4YR0A 4ME6A 1U94A 2DF8A 5BSVA 4RCNA 1NUSA 4GC6A 4XTCS 2QTNA 1IN8A 2O8FA 1UMDA 3M6WA 4AN1A 4L78A 3MHTA 2GHRA 4HSGA 2C3OA 4IQFA 4J7AA 5AIBA 1EVYA 1I3KA 3A6PC 4Q7MB 2Z04A 5HEKA 4DV1H 5EJAA 4CU2A 4B2YA 3FRHA 2V7VA 3VR0A 3EEOA 5ENZA 4GVXA 5K3CA 1P7ZA 3UHPA 1FSZA 1ETUA 1A96A 3HPRA 3IUMA 3H20A 1IWBB 5EKSA 3HXLA 2IXTA 3I9NA 2ENUA 1CJVC 2DPXA 3RJMA 3PWKA 2JD1A 4IHAA 4AZ3A 3G5AA 3WL8A 5ER6A 2RFLA 3VX4A 3KQUA 4NDAA 2HCBA 2R48A 2REXB 4G5OA 4WX2B 2XVAA 2DBVO 4W99A 1PQPA 4BEBA 1N5MA 2BFMA 5BNTA 3DDNA 2B8EA 4DR3H 1YTLA 2RGWA 4ADSG 2CHVA 3BB4A 3L0CA 4PXSA 2ODNA 1MQ8B 4K8RB 4BZXA 3PDHA 2FZWA 4RKWA 1F6DA 4EW1A 1TT5A 1J7KA 1NTOA 3C8DA 4B83A 2OORA 1OWNA 3DUWA 2HF8A 1A4RA 1HNNA 3A0RB 2B4KA 1EUDA 1PWEA 2HT6A 3LQSA 3GY0A 3VO9A 1MLDA 1L5MA 1U8CB 3LX8A 3EZ7A 4E2ZA 3F5FA 1TLTA 3BE5A 3ESYA 1J0DA 4YJGA 1NPDA 2R65A 1JFRA 4ZU6X 4PPYA 1NKTA 3B3FA 5C5JA 3FKIA 2O6LA 4X00A 2OCLA 5I4KA 3QA9A 4FOSA 3GUYA 2PK3A 3L4JA 3I58A 3G8AA 1YT5A 3R3WA 3U5ZB 4TMZA 2ZJ6A 4W1RA 5EUBA 4CZ2A 1EJ0A 1RC1A 4YAFA 1W581 3SMQA 3WGKA 5B4UA 4A15A 4B7UA 3C16C 1NZDA 3DLAA 1V9CA 2BOVA 4QEDA 3EZ6A 2XCTB 2W2QA 2R47A 3KUDA 3D8SA 3MWYW 4WLVA 3CPHA 4N47A 1EVQA 5KFYA 2VHQA 5IDQA 4REQA 3J7AC 5CIQA 4YA6A 1S0OA 3L6EA 5B3AA 1DB3A 2BONA 5DVZA 2AN4A 4MTCA 3FA2A 1NJ5A 4E11A 2HDWA 1Y1PA 2B35A 3R0QA 2W8LA 4F9GA 1PFGA 1Y9JA 4OAOA 3QVUA 5L6LB 4D5EA 1IHUA 5JDCA 5DV9A 2REQA 1E1YA 3OTGA 4U9IS 4AS2A 1SVWA 1O95C 4I1IA 2Q7DA 4KBYA 4AYBE 2R6R1 5AW6A 3VC1A 2VJQA 2XUQA 3PW2A 3KWMA 4MIOA 2PH7A 3LBAA 1SIOA 4K6HA 5LD2B 4FE2A 5FOQA 4IINA 4BP3A 1UANA 1XN4A 3MT7A 3RS5A 5I5YA 1KI9A 1OXKB 4JC4A 1DJOA 2MMGA 1SBCA 2PL1A 2WF9A 1NPYA 2G80A 1MORA 1UKZA 5KFMA 2OXRA 3H6KA 3W79A 2IYOA 3NH9A 3FI9A 4WSOA 1HL7A 3ZYCA 3GLUA 4ENRA 5PGMA 1T3ZA 4EELA 4Q1FA 4BFUA 1WF6A 5JNLA 4JI6H 1RAGA 4N5MA 4MGHA 2JB9A 4HWTA 3NZEA 4YYZA 4DV6H 5A5VA 4QIWE 1YB1A 3LDGA 4O86A 3ND9A 3GLRA 4ZK2A 4LQ4A 1C9MA 3JD0A 4OCZA 4JP1A 5A3QA 3RODA 3M6XA 4KQ9A 1NE7A 5A1TA 5G0SA 3K5HA 4MW7A 5FWNA 4CFZA 1QYRA 1Z2NX 2V7UA 4WBNB 1XDNA 4P80A 3BWEA 1QHIA 2ATXA 1X74A 3IAXA 3GEMA 4EDFA 1C30A 4G1MB 5JZVA 1PJ4A 2JA6G 3GLGB 2B5OA 3TL6A 221PA 3ILHA 3A25A 4CDRA 1U2ZA 3DE4X 4D4LA 4KH1A 3SFVA 4TWBA 4DCOA 3T34A 1WW3A 1U65A 3E70C 4Y8VB 3E35A 3TW6A 1P7CA 2E89A 1E98A 3KTFA 1WZUA 1GRRA 3M3DA 3WGZA 4RE6A 3RVMA 5JE8A 2G83A 4PZZA 1W85B 3TTTA 2W43A 3RH0A 4KPUA 4QASA 3EBPA 1GT91 1V51A 2EW1A 5CH5A 1XNGA 4YCSA 4AJ4A 5A9SB 4KDFA 1C7FA 2ZRGA 3VO1A 3JQCA 4ARZA 2GRJA 3N59A 2WR8A 2P6PA 4C1BA 4RVGA 3QQPA 3AM4A 4D0GA 1MJ5A 1Q0PA 3EY9A 4PGGA 5EMKA 3LUJA 2MSCB 2WDZA 4RUCA 4B4KA 2C99A 2CJFA 2UUAB 2XNJA 3RAEC 5IJ9A 1Q3TA 1I01A 2EEZA 3GVHA 1MENA 3F67A 3P7MA 4TTSA 3ZWBA 2WTAA 1CWUA 4D9BA 4QYXA 2HMSA 2F4VH 5CDUA 4ZEMA 1NBEA 2DIKA 4GVLA 2HMAA 4KE9A 5FT9A 3RT7A 1R3UA 2G70A 5EP3A 1YVRA 2EZ4A 5EPUA 2QNBA 3LRTA 1RJDA 2QMOA 4CKWB 5KS2A 4FCCA 4BFXA 2GJ4A 2PMEA 4KLCA 1VL2A 1LQTA 2CLFB 2VBFA 1SBQA 4AY4A 3UO8B 1DRVA 4OP1A 3IXLA 3V4FA 3ZD6A 2KBFA 4OIFA 2FPOA 1Y81A 1KDZA 1RK5A 2Q62A 1PT5A 1AH2A 5D1PA 2Q9CA 4X62H 2G63A 5ILGA 2OFPA 2C4UA 3ETGA 4S0ZA 1ZWKA 3WXMA 3E8SA 3OJLA 3TECE 2EX1A 2P40A 3GX1A 1L1QA 4DLAA 2V7GA 2BKXA 1HMYA 2PU5A 3G9TA 2A0YA 1QK4A 1D6SA 3DT6A 3HN2A 2AQKA 1YAJA 4D97A 1P39A 4CGYA 3KLBA 1EXNA 1Z0DA 1KTVA 3EXAA 1C80A 4GI7A 1NVXQ 2RGNC 2ZRAA 3U3ZA 4NIMA 2GPJA 2ZTLA 4IMPA 2ZBFA 4ABYA 2ZI4A 4KNYA 1MJGA 5AI4A 1TAGA 3MG9A 2MCFA 4OKSA 3PHLA 3WZ2A 2W2KB 1NI5A 4OATA 4BNKA 3Q7TA 1F51E 3GTKA 1UCFA 1DO8A 2DKOA 1Y0BA 5AI5A 2J3HA 5FLYA 4BE7B 1R0LA 5DTEA 4A3SA 3W5AA 2PIDA 1EX9A 5IARA 1LXCA 4R54A 4B84A 3K8YA 2ZT6A 1V8OA 4HEA6 2ENWA 4X8MA 2FDXA 2H4YA 2HI0A 1DRUA 5AKEA 1SCBA 2UZ3A 5LN1A 3A8TA 4K3UA 3RSOA 4R1PA 1U0JA 5BN4A 3L0IB 5I8PA 4DWOA 3BMCB 4F92B 2XRYA 4DSZA 1XMIA 1U5BB 2QM3A 3WK7A 3VR6H 2XCOA 2YFKA 4YJHA 3BD8A 5KTMA 3WIEA 2HR1A 1SCUA 4WXRA 1HFEL 3EQZA 4XWOA 1NJ8A 1N8TA 4L5AA 3N58A 3L8ZA 2P9QA 4IDCA 5KG3A 5E1BA 1KBOA 2JIOA 3ZI0A 2J85A 1FY2A 1B42A 5FWXB 2R97A 4HHEA 4O3FA 2BFPA 3RBZA 2ECPA 1D7OA 4LFCB 2UYCA 1TZJA 4LF4B 4TV9F 1YBMA 3PNPA 3TSWA 2Q27A 4I8XA 4UZFA 4LV5B 4XX0B 3QELA 4YRAA 4R4JA 1WPGA 3TQ1A 1NVUQ 1P6QA 5EHZA 3WSWA 2VH1A 3U80A 4IMJB 4W7SA 2GXQA 4GIBA 5KJEA 3VR4A 4DDVA 4QLBA 1M8PA 5BXYA 2Z5GA 3HCOA 4FQ5A 3V9PA 1ZBDA 1KO8A 2ZVJA 3PPYA 2IYRA 3W8DA 2GEUA 3JSAA 3SVTA 3TLJA 4BZWA 2GPTA 2C35B 1VMDA 2IPMA 4A10A 4GUDA 3HO8A 3DDSA 2QL6A 4J9VA 3LLCA 1BMTA 1L4HA 1NXXA 1DZIA 1T8TA 2C7BA 3CS3A 2ZPAA 3DEYX 3NUAA 4NBWA 5JJKA 4CL2A 4M8IA 1LGYA 4P5DA 1Y6RA 3M0EA 1XROA 5AHWA 4D92A 3CHYA 4QQKA 4BRUA 4I3FA 2ZRPA 3TTWA 3UBTA 1KXZA 2J67A 3BE4A 5HJ2A 3T7SA 5CUQA 1MX5A 3UIEA 2I1VB 5C3UA 1D04A 4UTNA 5A4JA 1OXMA 1D5CA 1V95A 1KETA 1GGOA 1KDTA 2OQVA 3IP5A 3P0FA 4LF6H 4QFBA 2OGZA 4JJEA 4WFJA 1P74A 2QMHA 3CRVA 1GXSA 3T7JA 3RARA 1OT3A 3SWWA 4KH0A 5EXEA 2NO0A 1LBEA 2O3RA 2EQAA 1PT8A 1QIEA 5FOSA 5K6AA 2X76A 3ICVA 1QP8A 1QH8A 4UEOA 2BFBA 4S35A 5ETJA 4QARA 5KFRA 3OQOA 1ZD5A 3DZ8A 5CLIA 1J8YF 2PMZA 4C6RA 1XVTA 5SYNA 3LDUA 3N2IA 2VBIA 4ZOCA 1TTQB 2H11A 1UBCA 4ZI5A 2E37A 3NANA 2WM9B 5K0CA 1FA9A 3UGQA 4EPVA 1OR8A 1WV0A 1HLPA 4B3DA 1ZOSA 2WHPA 5ALDA 4HCJA 3SKXA 1TAUA 5IAKA 4LE0A 1Z5GA 2KB0A 3KVYA 3PF8A 2WM8A 2OO3A 3KTOA 1IG3A 1U6IA 1JILA 5FEUA 1D2HA 2FSSA 1LTQA 2OQIA 2AHOA 1JE0A 1Y1WG 2AX3A 4E13A 3D5QA 4C03A 4UAJA 3ETDA 4B3XA 1PS0A 4ALJA 3ZU3A 4Z2AA 2FA9A 2J0UA 5ALOA 3HFJA 5B58C 2B5WA 2Y1LA 2OYCA 3KOOA 3I5AA 3HKCB 1X1EA 4RV9A 2OM2A 1YKGA 3R75A 3MFYA 1VPLA 4C7OA 2JFZA 4PZEA 1YA8A 5LQRA 4GEKA 5BQPA 4YHBA 3PFWO 1U04A 4RSGA 2YY6A 2OWDA 5KX5F 1LH0A 4IH9A 1BE6A 5JXWA 3S5JA 4A23A 2VSNA 3O0TA 5K0NA 4G63A 2XDAA 5K0JA 4W6QA 3PTZA 3L4BC 4JL5A 3K6KA 3HEAA 4N0EA 3NPMA 3ZY5A 2G7MC 3RJ5A 1OROA 3BQ9A 3FD8A 2V6JA 4FKMA 4QQRA 3LWZA 1ZRNA 3OE5A 3RRNA 3JD1A 1R88A 3CINA 4CMEC 5KTPA 4IR1A 2ANCA 5JO9A 2QRQA 1AVTA 4BLTA 3HUTA 2AMYA 3KOZA 4HNVA 3KT3A 3AEUA 3IBCA 1OH7A 4EVQA 3OQBA 3M3HA 1JIUA 4LVUA 1JN0A 3TOCA 4AJJA 3QLVA 4BV2A 1CETA 2IZ6A 4BRWA 3Q8LA 2XLCA 3NEJA 2VHVA 1N2IA 2AOXA 3USES 4HAVA 4B6GA 2R4QA 4R1TA 4G8JA 3D5EA 2ZWMA 5IKEA 3GJ5A 3C43A 2C3PA 2I66A 1ODFA 4CM7A 5A7FA 1YS4A 3NVAA 3ITEA 4D8WA 4EGAA 4M1QA 1RJ9B 2EDCA 1QOZA 4L28A 1LPMA 4IEEA 2QU8A 2C7VA 5DBIA 5L7WA 4DHEA 4PZUA 3FNHA 4EFEA 2XOEA 3SIRA 4E4TA 3HUDA 3GT4A 3E9YA 3IQZA 2HLNA 4ISBA 1DAIA 1Z0IA 3OD1A 3WFIA 5FUBA 2B8WA 4QBGB 1V5FA 2DXIA 4DDUA 4MRMA 5IW8A 4WXMA 1S89A 1U7DA 4ON9A 1E3DA 4L3OA 3MMNA 4F85A 4Z8YA 2A14A 3DBHA 1NA5A 5ECDA 1YA6A 2A5FA 1QO7A 3MILA 2YJ6A 4CHIA 3EW9A 4W7IA 1I10A 2WJHA 1KJQA 4R9RA 4YDRA 1E2KA 4EZBA 1BFUA 1MDBA 4K1XA 2OG1A 2IHYA 1THMA 1YZTA 3EDRA 4P7KA 5AVOA 4MINA 1F2TB 2CXNA 4INAA 1BRMA 3D0RA 3OKFA 1FFXB 2AWNA 2QRVA 4DS3A 4PLPA 4IS3A 3VYVA 1QK5A 3WWOA 3IKTA 3G85A 2HWWA 5KG1A 2G1UA 2Y77A 4P4LA 1YGYA 1GDHA 4ZTUB 2LCIA 4QXPA 1DG1G 3P2OA 5IJ0A 4XPZA 1MOPA 3GOHA 5M7EA 3V7FA 3ETCA 1J8QA 3HZHA 4IOKA 3V8MA 1V7QA 2PKQO 3FWYA 3NOVA 1VHLA 1Z16A 1F5NA 4HJRA 1G2QA 2WW8A 3VDQA 3KJFA 2P6RA 4C05A 4AYBA 3A05A 3K4QA 4KGXA 1ZI6A 3EXG1 4C07A 4I5IA 3DLTA 5D01A 4DW8A 2EFJA 3C97A 4PPGA 5CE8A 1WETA 1B73A 5KDLA 5KFWA 4N3CA 4BP9A 2NNWB 2WHQA 4IUDS 2IX9A 2AFHE 3M5DA 4OL0A 4Q4LA 1SUBA 3TLBA 2C4MA 1GARA 1SU4A 2IYVA 13PKA 2MCTA 4TTVA 4IJUA 4R84A 1X0XA 2J0VA 1AQYA 3H0CA 3FVRA 3RB0A 2FK7A 4RA6B 4RJKA 3TGWA 4BWSC 5JCJA 4JU8A 2BGLA 4RVHA 3KHSA 1X7HA 5BMOA 3WYEA 3OT4A 2B98A 3A28A 3HR4A 4BNHA 4L6CA 3AKDA 4XCQA 4DBLC 4YAUA 1RR6A 3DTTA 2ZTUA 4G0WA 1W1UA 4YMTA 3GZNB 3BKXA 2JLRA 3BHMA 4AULA 4G1FA 5LD2C 4LJ5A 3K09C 1XDGA 4DQUA 2F9FA 3ZLTA 4Z6KA 1Q0QA 5AHRA 4LHWA 2Z43A 3ZWCA 4XB1A 1Z68A 2RGRA 4EB8A 4JWKA 1NQ5A 2Y4OA 3N0WA 1ETHA 2HBYA 4Q9HA 1V2GA 3V6MA 4KZPA 2AN3A 3OAAD 5KFSA 5TPZA 1G8FA 3DP7A 4EEXA 1NKSA 4QXOA 3ZH2A 3B6IA 3H8SA 2C5GA 2JGFA 2CDCA 3HZOA 5F2OA 2FEWB 1JSCA 3LF1A 2ERXA 1NRJB 3ZWWA 1DHRA 2XVMA 3CPJB 3T1NA 4ENTA 3OM8A 3UJPA 5H4GA 2NMVA 3SE0A 3WMEA 5LJLA 4D98A 4IXWA 2F6RA 4CIYA 2GOYA 4JVSB 4O2AA 4Y0VA 3IERA 4AW9A 3TSZA 1TZKA 3EULA 2MSEB 1JFTA 3AVYA 3OSUA 3UMBA 5CT8A 3C4VA 3JWPA 2BGUA 1WULS 4BN0A 2YRXA 1KO4A 3TOSA 2ZE8A 2C5SA 5K3DA 3GDEA 5LYJA 1S7GA 3ENNA 3D1VA 3N2KA 4IGFA 4EF6A 3NKFA 5FJJA 1GA1A 1E2UA 4I9NA 2IEZA 1V1MA 2PH1A 4OD0A 4W6ZA 1UXGA 2VJNA 1O9HA 4PGMA 3DG9A 1PWXA 3QKSA 1WD7A 1E4FT 1G21E 4IGEA 2WWRA 4HAIA 4CMHA 4PHTA 2NSHA 2QGFA 3TZHA 4YV0A 1VECA 4OJMX 3SF8B 4CG2A 3PS9A 1PVOA 4KX3A 4PO3X 4AJ1A 4C88A 3KEQA 3GUUA 1QGOA 4KR7A 4RNCA 1XL1A 3AYXB 4M1OA 1U4SA 4URVR 1XNQB 2IGBA 1SXIA 3RKSA 1M6VB 3I62A 3SHOA 1WCWA 2W6PA 4WQMA 4FDVA 3JYNA 4FBTA 1XX6A 1LQ2A 2JGRA 2VRWA 3AEKB 4KRXA 1I6MA 3GQVA 4RYLA 3WGOA 2VHJA 1K83A 1CUZA 4B6QA 3GB9A 1O94D 4LSZA 5CFLA 3SOPA 1A4XA 4TS1A 4TKVB 2Q2UA 5HWSA 2PZLA 3NV9A 3H84A 4REMA 4FQ8A 4EL5A 4R16A 3KTAA 4M9QA 4HDRA 4DLLA 2XYGA 4A6PA 4NCAA 2MT9A 4PHHA 4O4LF 1F14A 4QSHA 3HVIA 2H7XA 4IO0A 1R0RE 1U8FO 1NP7A 4B46A 4KAAA 2Z4SA 1CQXA 4WJLA 1DWOA 3HB7A 2G1PA 2WSMA 1WDKA 4J75A 3LUCA 3QJ5A 4JOSA 4XD2A 4I36A 3V9AA 2XNKA 3IAEA 2W9BB 4OP2A 1WCXA 3GPCA 2H8KA 1A9QA 3VU3A 3Q0IA 4R1UA 3SM3A 4F0JA 1COWD 3FFTA 2X7HA 4H7JA 1J56A 3UZOA 5AW5A 2WWIA 3G89A 1ZM2A 2FLLA 1V8BA 4O1IA 3GJ7A 3DZBA 1KAHA 4LWZA 5BPHA 1BXZA 5AM2A 2XV1A 4LPKA 2PH5A 2FW6A 7REQA 3PGA1 5EQJB 3JQAB 2H5EA 4FNAA 2CDAA 2CSUA 3R40A 2OC4A 1AN9A 4YRCA 3TJMA 1NBIA 3D7MA 1N0WA 1Y6ZA 3WE7A 2Y76A 3KYJB 3OHSX 5SYMA 3AILA 2WB1A 4X3CA 2F3UA 1MO5A 3U02A 3TW8A 5EIAA 4MWDA 1MB4A 2VP3A 1YJ5A 1M83A 1X7WB 3DKVA 4K9NA 1KAMA 5JTUA 3PXAA 3SX0A 3CJRA 5L3ZA 2PO5A 3SC2A 1C3LA 2VSFA 4V0QA 3TRIA 5IDXA 2XF2A 1R0WA 2ZSIA 1UMDB 2WRZA 2RHWA 5C80A 2BN4A 2FLNA 3PD0A 2FXVA 2IOHA 4EPRA 3O03A 4ILKA 3RVPA 3A1WA 4IOLA 2FUG6 2D7CA 3D02A 1GVHA 3A1UA 2P9FA 4YGXB 2VQEB 3O92A 3OUTA 3QU7A 1TCVA 4UHBA 5LBTA 4LYFA 5HRUA 1Z4PX 3X1ZA 3IOEA 3ZLJA 3H9CA 1NXOA 3PXCX 5HYVA 5IWAB 2H00A 1Y4DE 2WE7A 1NBAA 2ZJAA 2VEDA 4DGSA 4NS1A 4M8SA 2Z5FA 5MN6A 3QUCA 2IEIA 4HDCA 2HVQA 3LUDA 2PR2A 1H94A 2PLAA 1AHHA 1ND6A 2B4YA 1P5JA 4AZ3B 3QEMA 1R9GA 3CISA 1X7XA 3H04A 1X38A 4B7XA 4DV7B 3Q3HA 5A2QA 1BS2A 2JA2A 5E1DA 3W9YA 1KI3A 1W1WA 3W3AH 5J47A 4OSOA 5EKUA 3NYQA 3EGDA 4BMVA 2P35A 1TJ3A 4A03A 1RWOA 5KVCA 2BDEA 5ALZA 3EH2A 1C8KA 3QHAA 1TT5B 3MLBA 5E7IA 1K4MA 3QPWA 3T35A 4UASA 2RB4A 3T5PA 1HDGO 4LS3A 1XTIA 1BOFA 1EUDB 4EJ0A 3K9HA 5FTKA 4JHLA 5F73A 3SJUA 4DV3B 1BYIA 3KPJA 4YJGB 3EVTA 2JEZA 1LLUA 4IJMA 4TT3D 1PDVA 3Q7RA 5ICFA 4YMLA 3I1JA 4N12A 5LJIA 1X1SA 3V1UA 3RO7A 3ITDA 2ZUWA 3TN7A 1ZQ1A 4CT4B 2NP6A 2BWJA 4ZVTA 1FLVA 1PSDA 4HBGA 1HKUA 4BWGA 5DNEA 1EFAA 2WYOA 4AO6A 5D3MB 3IVAA 4XQ9A 2JZOA 4UEJA 3OZDA 4QU9A 3N43B 1RP1A 4H08A 3I34X 1E60A 3MGAA 1XA3A 2VK2A 2ZXFA 5K0SA 2RHMA 5K8VA 4DYDA 4NXNB 4REQB 2VF5X 1XQWA 2W2VA 3K30A 3CUVA 1Z12A 5A5DA 2LVBA 4D82A 3PQ2A 3M7IA 2HLDD 2XBUA 1W5AA 3BWCA 2D0IA 2XMRA 4YFVA 5FAXA 3IP9A 2CMHA 1VOTA 1R64A 4CG1A 5JAMA 2IDJA 2AFIE 3WLAA 3GXBA 5A04A 3U7JA 4DIUA 4NAVA 4BVKA 3WRWA 3AERA 5ANRB 2IMWP 2ZYUX 3IDZA 4YTEA 2FWAA 4F5ZA 1KOGA 2AZ4A 3KB1A 4K26A 1NU6A 3R09A 5JS7A 1RYRA 3V42A 1XTUA 4Q3OA 2X86A 1A82A 4EBEA 2AI2A 4JQYA 3FY4A 3CLUC 3F1KA 4F3NA 2DBYA 1AGRA 3SQNA 1SU8A 2KSWA 5IKXA 3ET4A 1T4MA 1ZJYA 2PGJA 2PKRA 4ETWA 4WOKA 4UDOA 2VPYA 1SA0A 1F60A 5A4AA 1DKUA 1WXHA 4KRYA 2UXCB 3UPUA 2B4RO 1YJBA 1X42A 3QHQA 1TEZA 1EBBA 2OZPA 3QXJA 1J42A 1TF7A 3UJDA 2GJAA 1ZN7A 4QOJA 3NBAA 3RSLA 4YMGA 2BMJA 2EW8A 3PXDA 1HDYA 3VA7A 2WIFA 1JHPA 1OF1A 5I5GA 4RQUA 2PN1A 1BS1A 9MHTA 3AJRA 1USGA 4FYHA 4IVQA 2NT3A 5TQ0A 1VPEA 4BGIA 1C30B 2PS9A 2ZJ8A 2BEVA 1QIFA 4FDTA 3EISA 4QPCA 4LMAA 3R6TA 5KHAA 1JBEA 3M4NA 2Y1XA 1V1JA 5FWAA 4DR4B 2QF7A 4CIBA 1TM2A 1IN7A 3O95A 3V5NA 5F23A 2VP2A 3N1UA 5F9LA 1VDZA 4S1TA 3Q6IA 2DRIA 2D5AA 3RGWS 4U2FA 3GCXA 4TS4A 3K1YA 2ZDGA 1AQIA 2WAYA 3A4NA 4KPUB 3A3YA 1CYDA 4A8TA 3K0EA 1ESCA 5CTJA 2HIGA 1PEKE 1G9XA 4G0MA 4RD4A 4ARZB 3FYTA 2XD4A 1S6YA 3GRUA 4MYRA 3BL8A 1LLDA 3U7GA 3CF6R 4S3MA 4TTIA 1GZVA 1IHXA 5A6SA 1O5IA 3EUFA 5IJ9B 3CRRA 2WAXA 4UEWA 5BYJA 1W6RA 4G5XA 4X85A 2IU4A 2ZRDA 5KYNA 2FJUA 4QECA 4X3OA 3UAGA 4O3MA 4O4HF 3NHWA 1DJNA 2D2IA 2FZLA 5EC8A 1U3FA 5LMNH 4LSWA 4K86A 1DKOA 1FP4A 4URFA 2BQ3A 4V2UA 3GFRA 1L9XA 2V4UA 4QDKA 1E3EA 1RLUA 2BSAA 4RTKA 1LFDB 5DYGA 3GLHA 4K3VA 5ALNA 3NTXA 1XLVA 1P3Y1 4RNDB 2VQEH 2OGUA 1LNQA 3P2MA 3HBMA 5AM0A 2YVKA 1RJFA 3D54D 3D6VA 2EWMA 3QU5A 2V7PA 3D31A 2WIJA 1EFTA 1J2EA 4MR7A 1GGNA 4LTDA 2L2QA 2CFIA 3IP8A 2HK6A 2X9LA 2Z58A 3L7KA 3L05A 4HZUA 3IVGA 2A9JA 5CVJA 4XWGA 5FTWA 2RH5A 2CVFA 4Z0TA 1C41A 5B1IA 4FUTA 3ZXYA 1JXAA 3CX6A 1N8SA 4IKOA 1IQ0A 1TUBA 2BKUA 2LE0A 2QE6A 1WR8A 1LX6A 1VLQA 1Q19A 3MWDA 4DNFA 3NWPA 5DHRA 2RARA 4QWAA 4DL9A 5DGDA 2X42A 1IQUA 3WWZA 4QWDA 5BWOA 3T3GA 1WZ2A 1Z0SA 2DUMA 3RPEA 3IR6A 3AJEA 4CF6A 3DTGA 4XGNA 1A9OA 3C3YA 1ZD3A 2FX5A 1J2RA 1CUCA 3I01A 4RHTA 2QD2A 3B9PA 3UZBA 2WINI 1M33A 4IIJF 2QPLA 4L57A 4MR9A 5LIPA 3C3MA 3D0OA 4G8CA 2BY4A 5DOZA 3TEFA 2M98A 2P7HA 3R3SA 4KDRA 3T9BA 1K6EA 2RONA 2Z8XA 1JH9A 4TUYB 4N1AA 4DMMA 3NKLA 4DV3H 5F33A 5DIFA 1QQTA 4S04A 3ED5A 5KFAA 3GAAA 2O07A 2R4TA 4O4JA 3A6HA 2O2CA 3S44A 2VF8A 4YUAA 3IEMA 4HB0A 4HF7A 1UBMS 4HB3A 5HGJA 5KOHA 3H86A 2Y27A 3MJHA 4LX8A 1FQWA 5KBYA 4QW9A 4OQPA 2ODPA 1NWHA 1BKDR 3NV7A 3OZUA 1MO3A 4TQGA 1ODTC 1HNXH 1C5KA 5BN4B 3ZPXA 2BCEA 2OBNA 3J80A 3C6BA 2R7ZG 1FUKA 3NYWA 4YJHB 1Z5PA 3KR0A 4MKGA 1SCUB 2EHJA 1DFGA 2Y1FA 4QT0A 4EI2A 3IBTA 1BXKA 1EMDA 1EK0A 4F4HA 4NXNH 1Z17A 1I24A 4I2VA 1KYIA 2A1TS 2KE5A 2R8OA 3UG6A 3GQBA 4J7CA 1NVTA 1WDWB 5LBIA 5BNWA 3KFVA 2B20A 3GBVA 4J6EA 1PJAA 1DHTA 1JQKA 5AM1A 2ODWA 1M3SA 4N3GA 4GKJB 3PZPA 5I5SA 2VT3A 1JKMA 3LUFA 2HAEA 1UJ6A 3A4VA 3ME5A 2XMBA 3G02A 3DCNA 3RFUA 3PX2A 2C9BA 3PA6A 1ARZA 2A33A 3AVWA 2QS9A 3QELB 2AJ8A 1JIQA 2P2YA 4OUDA 4C0WA 3HFGA 4M0DA 1VB3A 5ALRA 4RABA 2R44A 2VN8A 1EFDN 1IIBA 1YCHA 2IE8A 1VE1A 3BXFA 3C2QA 3IB3A 2AUTA 4JOQA 3STHA 1RKUA 2GPWA 3MVEA 1T36A 3EFEA 2WYHA 5EAIA 1LC3A 3N07A 4X0EA 1T9DA 5EP1A 5KYYB 1HNZB 1ML3A 3R5KA 4Y2SA 1K98A 3OH8A 2H4ZA 1W4ZA 3EVZA 2QXYA 4UMDA 1T9GS 4FN5A 4GQAA 4J0QA 2GLXA 3FWZA 3UFBA 1NAIA 1YUNA 5LOVF 1WWKA 2C5FA 3O8OA 5ITZB 3V97A 4EI8A 4RHEA 2R8ZA 1YC5A 3S3TA 1H8ED 4MXDA 1XV5A 3DKIA 1VLZA 1BZYA 1ZR2A 1M9NA 5DTMA 2FF7A 2PFSA 3QTTA 1SB8A 3OICA 2P9BA 1L4LA 3GP5A 1JDTA 1PP4A 1LLCA 3UMSA 1Z4KA 5LQAA 3LAWA 4QWMA 3BMQA 4DR4H 4X71A 2QDKA 1NN0A 3PTAA 5HQTA 1J1IA 3QKUA 1UBFA 2KMLA 3FF1A 2EKLA 5EGSA 2QSJA 2R00C 4K9PA 4YI5A 3ICWA 1GXSB 3EIWA 3NMUF 3I9OA 3PDJA 4BC0A 4N0MA 3BYZA 2E4VA 3AP1A 2VOEA 2C2OA 1ZAKA 2NG1A 1GRCA 3QX3A 2E0IA 4NPAA 1Q83A 1QH8B 1YS1X 4EG0A 4MAAA 3ZUGA 2BFBB 1SZCA 1XRJA 5A3JA 4CTMA 1RM0A 3AR4A 3QSYA 1MX9A 1BEEA 1G1MA 4EHFA 1Z0UA 2VJOA 1C1YA 4C87A 4BU1A 3C87A 1O9GA 2JS7A 3QYFA 5KDDA 4K81B 3AEQA 3RVLA 2HJGA 1ORWA 1H69A 2XZDA 2P7IA 2G06A 3FH0A 4YJ2A 4LWPA 1CUWA 2C98A 3GWGA 2WNHA 3WBFA 3C5EA 1MJHA 2YHBA 2WHPB 3EPLA 5I51A 4RC9A 3EOZA 3WMRA 5CT4A 1VSTA 4ALNA 3L46A 4IRKA 5AI9A 2Q5LA 5HR5A 5AOVA 2DUNA 2GQSA 1F17A 3HCBA 1V8ZA 2VF4X 3P19A 2WTMA 4RZXA 1NW9B 4H7EA 3RTGA 3LCUA 4QJ5A 4A0RA 4UAVA 4R9VA 2R8RA 4KLAA 1NL3A 2C2YA 1I8TA 3GC6A 2FZKA 2XE8A 3BEOA 4FEEA 3Q3GE 4IAOA 4LQDA 1VG9B 4LBWA 2J0UB 1R4MA 4G41A 4BXOB 1SWWA 4XGIA 4JXUA 1LUAA 2VDUE 1S02A 4NEGA 4PCVA 3F7TA 1LRLA 4M8KA 2Q6VA 2YU9A 1DRJA 4I1VA 5JARA 4C7OB 4QHSA 1NKVA 5C0OE 3TQRA 4BQRA 2H2IA 4QUDA 2EJ3A 1JJFA 3OTOH 1DOHA 5JAUA 3V4SA 1F3OA 3HABA 3MBOA 4RHXA 5K8LA 1U3VA 4CW7A 2Z83A 1CC1S 3QBDA 2PZAA 3GB8B 3CCCA 3FM9A 3WGHA 3OX2A 3OX3A 1ULZA 3ZGOA 4GPIB 4MZXA 2IU0A 1Q57A 3VOTA 2HEGA 3AEUB 3NHAA 1BYUA 4Q82A 2J6UA 1SG6A 4IOMA 4JBYA 4UUQA 2A5LA 1SC3A 4QOFA 1YRAA 2HU5A 4CR8A 5BR7A 1GAWA 1S3GA 1CP2A 3KS9A 5ALTA 5EJ4A 3UC5A 2AOTA 4WOJA 4AKEA 1GGJA 4AB1A 4QATA 4G01B 2CE2X 2HHJA 1RPTA 3RSZA 3FKSD 1N1MA 5JDIA 1DAEA 1NN5A 1U8TA 3AJ9A 2C3MA 5ALPA 1C7ZA 3V4RA 1MVOA 4C4ZA 3KELA 4L4RA 2R2AA 3UXHA 1QGAA 4ERXA 3VDNB 4YV7A 3IPLA 3DVRX 1Z6TA 4M8LA 4CYMA 4DR1B 3H0GG 3ZHBA 4Y9TA 2QNRA 4JP2A 1T2NA 4LXHA 4AN4A 1EEHA 1P8JA 2X0IA 2YYSA 2Q4RA 3VR3D 2RK3A 2YY7A 4DCSA 1ZXBA 3AI3A 2GD0A 4L5IA 4Y6GB 5EE1A 2X2PA 3SEQA 3V1LA 4PZ8A 1SIWA 2YCHA 1K97A 2C7PA 2E85A 4R2WA 3ZX4A 1NLYA 4RD3A 1SXHA 2OCKA 4Y1FA 4Q7LA 1PV2A 1F8GA 2UXBB 1JFLA 4NDZA 4MRMB 3NWJA 3K70B 5FWDA 3HV0A 3P9IA 3EFOA 4WPGA 4KG7A 1JT2A 4TZTA 3W05A 2ANBA 3BN3A 3DBHB 4LJKA 5H70A 3RVRA 4ZGGA 1NUAA 2YV4A 4PC1A 1N6IA 4ZALA 2IGTA 1UMCA 3NDRA 3WL6A 2QJTA 5BUQA 1WR2A 2QVCA 3OZ7A 2XKBA 5EUQB 4BZZA 3TRDA 2IVFA 4UHFA 1NY6A 5FBVB 2QHXA 1JIHA 2OORC 1TCAA 1DNPA 3TSOA 5FWYA 1UINA 3H1AA 2PMBA 3SSMA 3TSAA 2I55A 2QRVB 4QBKA 1IEVA 1XI2A 2ROQA 5L7TA 2G1KA 1U3UA 1IBCA 3KQKA 3PQCA 4GLFA 3QTLA 4C06A 5IJ0B 4KO8A 2XLBA 3RC2A 3WMXA 2YXBA 2QZSA 3BULA 1RI3A 1VYUA 1XQYA 3F7MA 4B09A 3UATA 2CMFA 1WMFA 2GA9A 2IV7A 2K4MA 4BQFA 1EK1A 5KT6A 3FZGA 4DCMA 3NHMA 5LUBA 3WLLA 1WLYA 4DRZA 4D0RA 2NIPA 3VR2A 3STUA 5I8ZA 1BE1A 2JLBA 4RSMA 3O21A 4H1WA 2AFIA 1Q3HA 1WXDA 1ZVQA 4JCOA 2A9VA 1UDXA 5KYVA 5IM4A 2DZDA 5FO0A 2SKDA 1A95A 1I4WA 4CKEA 2FZCA 4UCFA 1IY0A 2PJUA 5D51S 1U2GA 1EBFA 2J9GA 1VBHA 2FZEA 2W98A 2ZI6A 1USIA 3P5SA 3QUQA 1DG3A 4GHWA 3M6IA 4LYJA 3C7TA 1DJQA 2RBKA 2ZI3A 1W4LA 3BSFA 1PFWA 3SLGA 4YT2A 1HLDA 4HUQA 3B2EA 1EKVA 2VATA 2GPSA 3WL4A 5JDCC 4M46A 3QLJA 4ROSA 1XTRA 2G4LA 5EIHA 4OV6B 4NYMR 3UJ9A 3PUIA 5HMMA 1VMIA 4LDQA 4DT1B 3BWXA 3OP4A 3P20A 2XB2A 3LT5A 2VRNA 4FYYA 5T4BA 1ZM3A 4EA7A 3FVTA 4ZDWA 4RMHA 3KJXA 1AGYA 4X7RA 4DLZA 2XCUA 1E9VA 3GF4A 2VDNB 2B1QA 3IAS6 3NDBB 4ZRMA 1HT1E 1KFKB 4EB0A 3VNBA 1VE3A 5ABPA 2ON6A 4WW0A 3GN1A 5LB2A 3R5FA 3DKPA 2QG6A 4HN4B 3KEOA 3GJ4A 1GTL1 1Z7BA 1E7MA 5JBNA 4Z5XA 3VOBA 1B04A 3R6WA 1RJWA 1NDUA 3QVXA 5I9LA 3AIKA 2GWRA 2YWJA 4EUNA 4BCDA 1BEUB 1P6XA 2A30A 2FKLA 3DPIA 1A8SA 5BY2A 5TPWA 3B38A 3F90A 4QQFA 4NBLA 1KK1A 4A3MG 3SHVA 2GCIA 4RIHA 2I2XB 3ND5A 1DTWB 5IAEA 5KQMA 4Q7QA 3IV7A 2OZKA 2ZUUA 4XDYA 1I6WA 3V8RA 3ELDA 2HJSA 1XP5A 4JJ7A 5I5EA 3KXPA 2HGWA 1FTGA 5G0VA 2G9QA 4N40A 5KC9A 4MUJA 1XCOA 5I9TA 1SKUA 2FVXA 1E59A 3OZTA 2JEOA 2IPLA 3RV4A 4OQMA 4ZWNA 4O3RA 2WU8A 4TKMA 1OYVA 2IYEA 4JI4B 1H9BA 3N2KB 4WK4B 4C0SA 5IS2A 3E2MA 3ZQJA 4CIXA 1TCBA 5JEDA 1UFRA 4M7OA 4G56A 5KUTA 2W58A 1RZVA 2HK8A 2WVAA 3QKSB 3R8FA 2VJPA 3TUZC 5IC4A 3Q8MA 2WUVA 4WFIA 2D00A 1O0CA 4BAGA 3I53A 1HTBA 4B5LA 2RSLA 1ILWA 3K53A 1H1DA 3FLBA 4Z7JA 2GB4A 2GS9A 2X8BA 1LWOA 2QRPA 1TJ5A 3H1BA 3WHPA 1LI5A 2R60A 2BF4A 1P3JA 4TMKA 2Z9BA 2I4TA 5EMJA 4XD7A 1JAIA 2G3YA 4OI0A 2G8LA 1XJCA 1A9ZA 1NFRA 4F2PA 5IJXA 2IVZA 2A59A 3BGDA 2QRGA 3K6JA 5FA6A 4HV4A 5B12A 4EHAA 4GL4A 2A7XA 3ADCA 2VUUA 5G1PA 2E6KA 3U7HB 1XWIA 3KSUA 4GUAA 5KVSA 1OH6A 3PLRA 4BO2A 4DR1H 2UUAH 4P34A 3KTAB 1KZ4A 2YDYA 4YRQA 4HDRB 4G5FA 2CNKA 3HDTA 5G02A 1SFRA 4LY6A 1Z8HA 3GVPA 1FU7A 5J1SB 3P97A 1RHQA 8ABPA 3DMHA 1ZVVA 3LCRA 2ERYA 4B0OA 5CFMA 4JEHA 1WIWA 2IH2A 2UXBH 1CEYA 1AZLA 2QLNA 5KWIA 5JT1A 2ORVA 3GPLA 2R5WA 3KWFA 4D9HA 4HVCA 2BHRA 4D9IA 4BY7G 3DYBA 2DCUA 2QTFA 4MW4A 4IDOA 3L8MA 3RK1A 2ZSJA 4RMGA 4O3PA 4DQVA 2QRHA 3ROZA 1W30A 1RMQA 7REQB 3D8RA 1N6HA 4YXWA 2J3IA 2O5EA 1O2DA 1CR6A 5DTRA 1UQRA 3FYHA 2F9MA 4YVFA 5BYBA 1LI7A 2JK0A 2ONKA 1DIOB 4MPPA 3LXRA 4JJ4A 3TX6A 1KP2A 3TW8B 2WSYB 4M60A 1CF9A 5AJZA 2H2GA 3E9ZA 3FTFA 4I4TA 3NC0B 4DWVA 4F46A 3RUCA 2ZYVX 3DKRA 3IALA 1F9EA 3SC2B 5CVTA 1Y7PA 1WXFA 3ZIDA 1T6XA 1D0VA 2VHUA 3CO5A 2QR5A 2O2SA 4F97A 4BFVA 3VM6A 4TZ0A 2I8AA 1XDDA 1HDZA 3V4VB 5DKFA 2EEPA 1WJGA 2Z2JA 3GZ4A 2W2LD 5FYDA 3TGLA 4UE2A 2HO4A 5AJUA 5EKXA 4IAJA 4CG3A 3WAJA 1KI1A 1J2UA 3WLRA 4RE5A 2JDIA 1IYZA 1UPXA 2QI9C 2Z6QA 4FYVA 2IH5A 1CNFA 3EGWA 3ZV4A 1PJRA 1GPAA 2GFIA 3H1EA 1T9ZA 3KQMA 3RC1A 1RHKA 2H1SA 2G17A 1WKBA 1RAHA 1A8HA 1LTHR 1ZJJA 5CYOA 3ANXA 1X7XB 1C0PA 2Q0SA 4XCXA 2VP4A 5G3ZA 1K5DA 4IH1A 2O7NA 5J9FA 3O4VA 1GZ4A 2NYUA 3JQ9A 1ZI9A 2XMCA 4BNGA 5JMPA 5F5NA 5T57A 2QN2A 3LCJA 3EGDB 2WIKA 5F7JA 5E4TA 3WGUA 1T5HX 4HQOA 2AKAB 4O7YA 1NJ2A 7MHTA 1FRNA 1I4EB 3PSAA 2H9YA 2V96A 1M2FA 4OOFA 4AG6A 3B3GA 1W87A 3MOGA 5KPJA 1U0SY 1MAAA 2FXIA 4QODA 3CR7A 2VLIA 4LFCH 3EODA 4MW0A 3KKNA 4LF4H 3ZHYA 2WJ6A 5D1OA 2Y93A 4IIDA 4PLYA 1TVMA 3TKYA 1NHWA 4FMDB 2PR7A 1Q1EA 2EBFX 4LJAA 4CM5A 3IAUA 2WVHA 3SYMA 4BQIA 2FFQA 4IUBS 2JGEA 4Y9SA 2AEJA 3C7CB 2C57A 4DB4A 1OIXA 3K6SA 1IBRA 4P7FA 3C6ZA 2HA7A 1XZKA 1LBQA 4X6LA 1KK3A 4IXDA 2C2ZA 4WESA 1JNXX 2ZRHA 4JYBA 2XYVA 1PZMA 4M21A 1KJNA 5AJWA 1M72A 1D3AA 3I1YA 3HXQA 2ONZA 4WCFA 5J2TA 1EJ6A 1ZJWA 4LGVA 4Q4HA 1XELA 3N3BC 4HTFA 3R8XA 2V7EA 5CFPA 4A3CG 1I1QB 3BTSA 4FFLA 5DHAA 1NVKA 2HKIA 4BEWA 3U4AA 1EGHA 4JI4H 4NG4A 1PT6A 1AKUA 2P9TA 1SQSA 2UVWA 3ILVA 1HE4A 3KVVA 1RFGE 4F6LA 1WABA 3IUPA 5GOZA 4KREA 3AERB 3U2QA 1ZFNA 1TKBA 3GLIB 5CG1A 4EVRA 3C8MA 3NNDA