3DF7A

Crystal structure of a putative atp-grasp superfamily protein from archaeoglobus fulgidus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
305
structure length
301
Chain Sequence
b'SLKLFLFEFATCGERIEDSTAVEGLAMFKSAFDGFKNYYEITGFVRPEFSCLFTLPVDSMDSMEKYLEKSDAFLIIAPEDDFLLYTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRGEVQVPQTSLRPLDCKFIIKPRTACIGFSDEVPDGHIAQEFIEGINLSVSLAVGEDVKCLSVNEQIINNFRYAGAVVPARISDEVKREVVEEAVRAVECVEGLNGYVGVDIVYSDQPYVIEINARLTTPVVAFSRAYGASVADLLAGGEVKHVRRQMVRKSKSAEKPYVSVGDYTLEIIDLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ATP-grasp superfamily protein
publication title Crystal structure of a putative ATP-grasp superfamily protein from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 83
structure length 301
sequence length 305
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
A PF18301 preATP-grasp_3 pre ATP-grasp 3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3df7A02
3.30.1490.350 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3df7A03
3.40.50.11770 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3df7A01
3N8DA 1GSAA 5LOVF 4TUYF 4O7ZA 4FGRA 2CZGA 3K5IA 5HV6A 2QK4A 4YBZB 5LXTF 3LP8A 3KALA 4FE2A 4EGQA 4I50F 5CB4F 2NUAB 1KJQA 4O2BF 2YRXA 1BNCA 1GSHA 3TINA 5BMVF 3ETJA 3AW8A 2V59A 5JH7F 2DIKA 2I8CA 1E4EA 4DIMA 1KEEA 5CAEB 2GLTA 1CE8A 5KX5F 5BPFA 1IOVA 2FPPB 3VPBA 2R7NA 1EHIA 4ZI7F 2XD4A 1KBLA 1KJJA 1CQJB 2PVPA 2YZNA 2YL2A 3UFXB 3MWDA 3LWBA 1Z2PX 4YJ3F 4XYMB 4I55F 2R7MA 3WO0A 4YB8B 2WYOA 4QSHA 4O4IF 4O4LF 2NU7B 5HBRB 2YS7A 5JVLA 3R5HA 1W93A 4O81A 3TIIA 2ZDQA 2GPWA 3I12A 4DLKA 2OLSA 2GPSA 4E4TA 3VPCA 3JRWA 4MA0A 1KC7A 4TV8F 3E5NA 3U9SA 2W6MA 4O7WA 2CNQA 1KJ8A 2CNUA 2YZGA 3DF7A 3MJFA 2X0SA 2DWCA 3KAJA 2YS6A 2W6QA 1JDBB 5J2UF 4MV3A 4O4HF 4TV9F 1KUTA 5BPHA 1PK8A 4MV6A 4L1KA 4O7VA 2QF7A 3GIDA 4O4JF 2W6ZA 4ZHQF 2XCLA 2PBZA 4HNVA 1AUXA 5J2TF 1GGOA 1JLLB 3JZIA 5LA6F 4O86A 1Z2NX 3SE7A 1IOWA 3JRXA 2I87A 5H80A 3KREA 3G8CA 2NU6B 3OUZA 4C5CA 3QFFA 1M6VA 4YAJB 4FFRA 1A48A 3TIGA 2VQDA 3JZFA 3AX6A 4FFLA 4O7YA 4XZ3B 2GQSA 3HO8A 2Z04A 3TQTA 4HNUA 2YW2A 3BG5A 1WR2A 4YAKB 3V4SA 1B6SA 2YWVA 4O7TA 4IIJF 3K5HA 1A9XA 2VR1A 4RZQA 3ETHA 1Z2OX 4IHJF 3NUAA 2W6PA 3ORRA 3WO1A 3ORQA 4O7SA 5C8YF 2CNVA 1OBGA 1E4EB 3R23A 4Y8VB 1DIKA 1EZ1A 4ME6A 2FP4B 1CS0A 2IP4A 2W6NA 5JVDF 2HGSA 4C5BA 4FFNA 3MWEA 1EUDB 4YJ2F 1BXRA 2ZDGA 3OUUA 5C1PA 3VA7A 3N6RA 3WNZA 3KAKA 4HNTA 4HR7A 2Z02A 2NU9B 2FB9A 2C00A 5D8DA 4MV1A 3Q1KA 3VOTA 2YZMA 3G8DA 2DZDA 3RV4A 1CQIB 1ULZA 3GLKA 5KKNB 2W70A 1JDEA 1I7LA 1VBHA 3U9TA 3VMMA 5C1OA 2PN1A 4NYEA 2FPIB 4I4TF 1VBGA 1KJ9A 1C30A 2P0AA 1M0TA 1VKZA 5DMXA 1EYZA 4O7RA 4ZOLF 2HJWA 2YYAA 1C3OA 4O82A 1JKJB 2SCUB 2ZDHA 1M0WA 4FFPA 5CA0F 3TW6A 1B6RA 4EG0A 2YZLA 1EUCB 3HB9A 4ZQIA 2R87A 4O7NA 4EGJA 4M9UA 2V5AA 4O83A 4FU0A 1GSOA 2W6OA 2GQRA 3V4ZA 1DV2A 2R7LA 4XYLB 2J9GA 3R9RA 2R86A 2V58A 3HBLA 4MV4A 2I80A 3R5XA 4MV8A 3R5FA 3Q2OA 2R7KA 2R85A 4MV7A 5JQGF 5LYJF 5LP6F 1OBDA 2R82A 4O2AF 4O7LA 1KJIA 2VPQA 3RV3A 4MAMA 1W96A 4FFOA 4XX0B 2FPGB 5JQWA 1GLVA 4WBNF 5CA1F 2DLNA 1SCUB 2W71A 3U55A 4C5AA 5EZYF 3RFCA 3U54A 5GONF 2YRWA 1AUVA 4MA5A 1I7NA 1T36A 4HQ6A 2NU8B 3RUPA 4IZOA 1DV1A 4O84A 4MV9A 1PX2A 3K3PA 2R84A 5IYZF 4FFMA 5FNVF
chains in the Genus database with same CATH superfamily
3GJ3A 4MSUA 2IDZA 3I6MA 4EM6A 4OQ4A 2YKGA 4JV5B 2CXRA 1RYFA 1X6VA 4ED3A 2JGDB 5AESA 3QPBA 3BFVA 4UDOA 2VUSA 5E3IA 3HOVG 3SQDA 5HF8A 1JHXA 4DLUA 1U0EA 1Z6GA 3LC2O 2WB1E 4KPGA 4QWDA 1Y5RA 1UBHS 1MAAA 2I3DA 3V2UA 1JT2A 3PO2G 2C7BA 2FTKE 2HU5A 3OCUA 5AW7A 1Z7BA 3N0WA 1UKVY 2PUDA 5JSFA 4B7ZA 1JFSA 2IK8A 4W5QA 2WTBA 3DAFA 3S8MA 4BFXA 5CT9A 4QPZA 5HBRB 3W8EA 1XB2A 4G0VA 4OMDA 3HCOA 3Q0EA 2WJYA 3EARA 1WH2A 1ZJ4A 5KPJA 3A9UA 5ICMA 3AVPA 1PLJA 1T1IA 2YXNA 3GFVA 2AN9A 1RW4A 1JEQA 1T6XA 2HRCA 4JELA 4J4HA 5IYBG 2NVYA 2XT9A 2J6BA 3SHOA 3DF7A 5ALHA 1A0GA 1HURA 4HS4A 3TM4A 3SZOA 4PO9A 4EUNA 4KSCA 1CT9A 3WL4A 1RIFA 5I5YA 4YACA 4UTXA 4GSKA 3TMYA 4MV6A 4LGVA 2FUCA 1FJGH 2EZ9A 2QN3A 3W79A 3C1UA 4L0MA 5DG8A 4DIFA 4BNGA 3C74A 3F8SA 3LPNA 5B4UA 4RJIA 2B25A 3MXOA 4N9WA 4Q4JA 1JEDA 2ZR7A 1SUAA 3G7NA 4EJSB 1ARZA 1D1SA 3WL8A 2FGJA 2X0EA 1KL7A 1ZN9A 4YMUA 3CZCA 2QL6A 1TTQB 1VGRA 1VZ2A 2BEKA 3IKTA 3PL1A 2NQTA 3P9SA 1NJ1A 3TJZA 5KG6A 1OWPA 1LQTA 3NJRA 3KXPA 4C4YA 2OG2A 3DTVA 1VE6A 4GI1A 4MVWA 3C8DA 4HYKA 2CNVA 2AB0A 4TQGA 5IABA 3SF8A 2PV0A 2O1EA 2OVBA 1R6VA 4IDFA 4QNRA 2C84A 1M6EX 1U3TA 421PA 2YN4A 2WZCA 5DBHX 3WSTA 1KA9H 2IPAB 2N47A 5EWEA 4QQRA 4IIGA 1TUBB 5DOVA 5K3FB 4YCCA 3SJBA 3QRWA 4O8ZA 4IIEA 4JYCA 1W0KA 4NEQA 4HBGA 1N4DA 5HA5A 4N0DA 5BMVA 3PR2B 2AC2A 3SR3A 3GRVA 3B1VA 1XTBA 3ZDZB 1BA3A 1Q11A 1PR0A 3K4QA 2DC1A 3H0CA 1P80A 1C30A 2ZRJA 1XIVA 3UJ8A 3D6VA 5L3SA 1XU4A 1W30A 4BNUA 1DO0A 4EYOA 3COPA 2JW5A 4M22A 4MWDA 5KWVA 3DEJA 4CM4A 2VYVD 1QQ5A 4UBKA 4X65H 1BDMA 2GXSA 4IVPA 4JMLA 2HTEA 5JEDA 3TKAA 4E2XA 5EZ5A 2HHLA 3T1HB 3KKMA 3O84A 1ZGGA 2O7VA 5KBYA 4EFMA 5FOQA 2XA9A 3UVEA 4V0SA 4MPPA 1TJYA 4ZZ2A 2H5JA 3RC1A 3VC2A 2R7LA 1N4AA 4XD7D 4YJGA 2X5OA 5D87A 4B6JA 1JIKA 3K0FB 2R6FA 4XWKA 3L6EA 4O7LA 3EFEA 3GMTA 3KSBC 3AZOA 2YC2C 1G21A 1YQWA 1QQ7A 3PFIA 4RV9A 2Q1UA 1FNMA 1LI4A 3OPYB 1SU8A 3LCRA 1GJRA 1QFMA 3EXIA 3ND6A 1PGJA 2XTZA 3V2IA 4YASA 1A9TA 2FRVA 3DAHA 4IKOA 4DBVO 2X8WA 3SZUA 4ZOAA 4M8IA 2AA3A 2PZGA 3VGJA 3CM0A 3UUWA 3GLQA 3ZH9B 2YINC 4NEGA 3S5JA 3KJHA 3FFBA 5GV7A 2O7QA 4XGIA 4KRGA 3IPRA 3AEUB 1GUAA 3STWA 3KYJB 3IEKA 3T4PA 1F9AA 1KJQA 3OTHA 5BV7A 4JXXA 1V48A 3OTIA 4HGOA 4XCQA 4U0KA 3N53A 3VX3A 1Z8DA 4DSTA 4QODA 2EF0A 1EVEA 2Y99A 2HPAA 4KNYA 1IZ0A 4O4LB 2IH2A 1CZHA 4B3CA 2A7XA 5CURA 2I03A 2XIQA 4QYWA 3WBKA 3CLKA 2ZIEA 4J49A 3L8EA 2CZQA 2Z8YM 2GTIA 1WIWA 2V7BA 1KR2A 4XIGS 1W73A 3HRKA 1EWYA 1RLOA 3UUFA 4QWEA 1Z16A 2O48X 3E5RA 5DSZA 3RTBA 5HGJA 3HUFA 4TMTA 4ASUD 1J8MF 3PVSA 2IE8A 3ZJUA 3A4YA 2ZB7A 1R9TA 2VDUE 1D9XA 3V9PA 3PQ3A 3ZDXB 1SVSA 1XCJA 2PBZA 2JEGA 1G5RA 1GZDA 2NT4A 2G5GX 4ZO8A 1C81A 5FLEX 4UMVA 2A5LA 1IXSB 5AM1A 1MENA 1I10A 3M4JA 2OQVA 1W94A 3KOYA 3G8CA 4KITB 2GA9A 2G63A 5DNVA 4YJHB 1P1IA 3OT5A 2YCLA 1TZCA 3T6KA 1V7QA 2AK2A 2XVXA 3BMNA 3UT6A 4P3XA 1NN1A 5I7SA 1O57A 1R50A 3ROXA 3URMA 1LY1A 3ZDYB 4C4RA 2PRSA 5I5VA 3GLIB 1Y3BE 1E3TA 1ZNWA 1N8NA 4JI6B 2FPUA 5BNFA 3ZHZA 4UQPA 4Q7JB 4YPFA 4OHVA 2GM3A 4BPBA 2ZWAA 1ES9A 1ZRMA 4NZNA 5KU7A 1K68A 3BHIA 3DB2A 2I3BA 3H4VA 1DQSA 5LBTA 1PG0A 4NMLA 3NHUA 3CA8A 4OAOA 4URUR 3ZV6A 2ZSFA 3BREA 2QSUA 4C43A 4RE5A 2FMHA 5EXEA 3CMMA 4HPWA 1PX0A 1H8HD 4PXSA 5I7EA 5E9JA 2A9RA 1IPEA 5CYPA 3JAWA 3TTTA 3B3GA 1MIHA 2ZSBA 1MAVA 1LU9A 1NW7A 1V95A 1X80B 1Z7GA 2MSKA 2V4QA 1WDTA 1ZY2A 4NBLA 4EUFA 3ICQB 2F59A 3EUAA 3TRFA 4DQNA 4MJLA 4O82A 2HHCA 3U19A 3KUDA 3NIGB 1GKYA 2EAUA 1OHHD 1TF5A 1XXHE 2YXPX 3MRXA 4P4LA 1JFVA 2WY2D 5A9RA 3GCXA 4ZCTA 1R37A 3QHPA 2B98A 3Q12A 2LBPA 2WNIA 2Q2VA 3W2EA 1L1FA 4BX8A 2A1IA 5H70A 3WK5A 1NVUQ 4GLJA 2ORED 1P7YA 3NBYC 4RABA 4M1ZA 4ALNA 3ZVMA 1OGJA 1G2OA 1NOIA 3OT1A 4X8MA 5KMGB 1EFAA 1OC2A 2PZJA 4P7FA 1ONSA 1JR6A 1N8KA 2C2XA 2H59A 4K6KA 2Y1XA 4HWGA 4FTWA 1X1CA 2Z09A 4F1KA 4ZCIA 1U2DA 4LIPD 2JVKA 2JLAA 1U2DC 4ZRDA 3ZX5A 2HA0A 4PC7A 2A33A 4JROA 2X8BA 4CM6A 5CFOA 2DETA 3ANTA 4F5DA 2UXCH 2YUIA 1ZVJA 2R84A 1HE1C 4D0RA 4B3GA 2OAEA 1GSAA 4UCXA 3CS3A 2CUNA 3K9CA 3WIVA 1ZH8A 4B9AA 1BX1A 3X44A 4X95A 2Q2QA 2CB0A 1GAEO 3C7KA 1KAMA 3B8EA 4QUEA 2PYZA 1CUAA 2X4IA 3FPCA 3LOPA 5CXSA 3CUYA 3P52A 3TB6A 5ICSA 5FHQA 3PW2A 3OIUA 1RWWA 4CMEC 1DPFA 3FM9A 2BH9A 4C0WA 4FX5A 1FMCA 1MH1A 2H52A 1XD2A 2WIAA 4E0BA 4RIEA 3ELWA 4QDJA 4Y6PA 1VBKA 3MJ4A 3UMRA 1Y1KE 2WAYA 1TYAE 2XGGA 4XYMB 3RC3A 4AKIA 3KLNA 3W1EA 1K1EA 1O87A 2QD1A 3WIBA 1JG4A 4GMFA 3H1FA 5D84A 1M1NA 3HUDA 2B1QA 5IAJA 1GEEA 2E5LB 4OOEA 1XRNA 2HJVA 1SZJG 3WYFA 4CU2A 2OLJA 4XPIB 4TTQA 3EMVA 3IAS1 3IE2A 2YY5A 2FLKA 3W1BA 1D8TA 3UWSA 3UC9A 1UKEA 2ADMA 4X00A 3OQPA 2FZEA 4RA9B 1V37A 1JDBB 2R6GA 2PGXA 2EDCA 2JL1A 3UKDA 4WK4B 3AKCA 3F3KA 3CLHA 3WLSA 3GMDA 4GI2A 5BV0A 4LXXA 4CT5A 3IMGA 4IIBA 1T34A 4CW7A 1AU9A 3KB1A 2O1SA 3ZWCA 2J7PD 1TVKA 2AWNA 2GA8A 1MXFA 1S4QA 2NO1A 4HN2A 1EJ6A 1FMTA 3AKDA 1RJFA 4ACBA 1O0BA 3Q10A 2ZJ4A 4X8HA 1Y5NA 4ZDJA 1A9XA 2ZTLA 4P5EA 2R62A 1FNDA 3L7AA 3T1TA 5AR1A 4JI8H 1OUMA 5L4NA 1U90A 3WC4A 2M6SA 1ZHHA 1TA0A 1HM5A 3EIQA 1S02A 3BL6A 3P2EA 2VJDA 3IVMA 1VJTA 5GWXA 4ID3A 3CJRA 4E07A 4FFNA 2XCPA 3NM5A 4C0XA 3AHEA 5GOTA 3FPGA 2P9FA 4QQKA 1EGQA 3NP9A 5TS3A 3SVTA 1MVNA 2O3QA 4F3KA 5TPWB 4DEYA 5TVKA 2FUKA 3C8HA 1EEHA 2PZBA 4D9FA 2COGA 2VDJA 5D1OA 3AHDA 3QF7A 1P9NA 2AFIE 3LDGA 1VBHA 4BRWA 2C88A 3ASVA 2X9VA 5CJ2A 2X9QA 4KHPH 2YUTA 4MKXA 3KETA 2BTQB 5CM8B 1FPQA 3QF4A 3HJTA 5HR5A 2EBHX 4NBSA 1VP9A 3FGOA 4Q7KA 1Z74A 1WDMA 3H5TA 2WINI 2IHKA 3M3PA 1QGZA 1PVOA 5EOYA 3PHLA 3HACA 2GQRA 5KG2A 1WZ2A 4FLFA 1U2QA 2G9NA 4RFLA 3ZZ1A 1RTTA 4G9GA 4TV9A 2IHYA 3O75A 3HR8A 4QHYA 2UXBB 3M4YA 5ITZB 3CURA 1REQA 1E79A 3JQBA 3CVWA 4PAQA 1XYYA 3JQBC 3I8XA 3LXXA 4P5PA 5DNCA 4C76A 1EFRD 3DHYA 4TL9A 4FZRA 2JGJA 2HA7A 2VDWB 1E7WA 3HCAA 2Q5QA 3JASB 3QK7A 1YL7A 1UPXA 2G1UA 3LQSA 1BWQA 1SEPA 1YKSA 3RQSA 1EBUA 1OLXB 2BEVA 5IYZF 1FXUA 2KE5A 3NNNA 4RNOA 2AJ8A 4UNRA 2B2CA 2O3TA 2CDCA 2PUBA 3O1HB 3T7DA 1GRVA 3W4JA 1O3YA 1IY0A 4HLNA 3RLFA 2XGSA 3IO5A 2WEKA 2XBMA 2VJKA 2AKAB 1F20A 2NZVG 3PFKA 4NBWA 4FHCA 3HN7A 3HOUG 5EP4A 2I8CA 4CVNA 5DT2A 4N7BA 1E2EA 1HG0A 1QSGA 2GEUA 2J9RA 1SCBA 6NULA 3FNFA 5I5UA 1JYFA 4ZI7F 4PZZA 3HVJA 3OFVA 2QP9X 3MINB 4YCLA 3D3NA 4KVZA 3LZDA 3UB2A 4TM5A 1FNBA 1PKXA 3GJ7A 2QMHA 3DCNA 4EB8A 1VL8A 2YWGA 3DLTA 2OP0A 4U9HS 3CVVA 4PRLA 5BT8A 3IP6A 4IHKA 1FBNA 4E4TA 1SCAA 1KQNA 3WKAA 1KAEA 4LCEA 4QREA 4A82A 5I51A 1J5PA 1MV5A 1GDHA 4KXLA 4OBEA 1FDRA 3LS2A 3A6GA 5KSWB 3TIFA 5ENZA 3VZDA 1L5QA 3RRJA 3JSXA 4Q4LA 2V7QD 1MJFA 4JEUA 4LNHA 4P54A 4TLBA 3ZGZA 3K70B 2F1HA 2C42A 3D81A 2I2AA 3CUKA 4YMWA 1Y5IA 4EMUA 1U7WA 1M6VA 3VV3A 2OO5C 1QMPA 2C9OA 4XZ3B 2G0NA 1QDEA 4PEVA 2VOJA 3LVBA 2GPJA 3KQNA 4IJVA 1CF9A 4OHRA 3VPGA 2XEDA 2FEXA 3TLAA 2QHXA 3KT6A 2EKDA 2PWYA 1TPYA 5DK6A 5A5GA 1E1KA 3H0EA 3GZNB 2B4QA 1C8KA 4P81A 3U3KA 3QFTA 3O8QA 4ZKEA 1AN0A 3L3BA 4ZYTA 3TSWA 3KLBA 3D5EA 1M74A 4M21A 5MGNA 1SB8A 5TPZA 2Y3IA 4RMGA 3ZY4A 1EZ1A 4DA8A 3O8OA 2WT9A 3NCTA 4UUOA 3FIUA 5KNBA 1Y1RA 4WBNB 4O4JA 4M36A 3QHAA 2J0VA 3D4BA 4CN8A 3RRFA 3SEFA 2H1WA 5EIBC 2AXPA 5B64A 3RWOA 3QKUA 4Q8EA 4Y2YA 3H1PA 3LUPA 1W44A 3ROZA 2HF9A 2BGIA 5C3UA 2GB4A 1I6MA 4TMVA 4GOMD 1Y7LA 2JATA 1DAIA 2Y1EA 5A4IS 2B7LA 1E32A 3TXYA 1NQAO 4P7JA 1DAMA 1G9SA 1RM5A 2IEAA 3N3BC 1BXZA 1WMDA 2AGVA 2HKIA 3OFND 3RJ9A 2M6KA 1M2GA 4XVQA 5DQHA 1W36C 2J3EA 4X6XA 1RQXA 2P1DA 2IYSA 5AK5A 4LXYA 2VTDA 3RYHB 2G82A 4CT4B 3KXLA 3QU2A 4FFPA 4RETA 4IPTA 1JG6A 3FJYA 2NVXA 5DLQC 4PRZA 2ZR9A 1N2EA 4P3YA 4MRPA 4NCNA 1EXMA 4BC1A 1P9WA 1QRAA 5LQSA 3FBGA 3ED5A 1QGUA 2I4RA 3FOAA 2R8EA 1KS2A 1MOPA 4BFCA 3KYCB 3W2GA 3RUDA 1XMQB 2LCIA 2KPOA 3DR3A 5LYJF 4M38A 5CA1B 4BFVA 1KJIA 5KSZA 1GA6A 1WVIA 1UBRS 3AK4A 3PN1A 2G0TA 4DCJA 1V3TA 2Q1WA 3OSPA 5TXGA 3AF0A 3VMFA 2PUAA 4ZZIA 3GNTA 3MWMA 1Q7GA 2FNAA 2E2IA 4S2UA 2VAMA 3EAFA 4JNKA 3FHJA 3U54A 4CWAA 2HF2A 2P6NA 4P80A 3BFPA 4I1SA 1EK6A 2JA1A 4DV2B 2QKYA 4EY6A 1S4MA 1Y4UA 5IJXA 4AY2A 3QFRA 4X66H 4MPJA 1KDPA 4GI7A 3LC0A 1VIYA 4YCJA 1BFUA 1NXOA 4BNXA 3VDQA 1EUYA 4IXNA 2EFJA 3G17A 4R8UB 9LDTA 3F6CA 3LUKA 1YZUA 1BU8A 1U7DA 1UDWA 2PLRA 3AEKA 1WUIS 2HPVA 1Z5OA 3QSYA 4OL9A 4R1LA 1T5SA 2ZSKA 1M67A 2MIIA 3RPEA 2HNAA 1Y1VG 4JT9A 1KIFA 2QZZA 4QJFA 2AJTA 4PPGA 4JL5A 4IY1A 1NV8A 3PRHA 4ARZA 1X1TA 4WFIA 4XAQA 2EKLA 2XQGA 3QPVA 1U1FA 1T8SA 3RRNA 1V3UA 2Y1FA 1MQ8B 4RV5A 3JRWA 1XYVA 3WGZA 5A9SB 1NW4A 4F7WA 3IULA 4MWCA 3EEFA 1X8XA 4B48A 2MSEB 1ADGA 2AOTA 1XHFA 2EX4A 2BEJA 2IHUA 4DV3B 4EYSA 3OHMA 3P9CA 2ZRQA 3DTTA 4EHNA 4HVCA 5CD1A 1WV0A 4RJJA 2P77A 3OQIA 4HDRB 1QWSA 2HMYB 4RD6A 2XGMA 4EZEA 2YY7A 2QXUA 4J2TA 4KBGA 4MVJA 1G8MA 4DV0H 3AUTA 2F3QA 4R40A 1TJ5A 1HT3A 4YUWA 3E1GA 2GK7A 4WFQA 4IMIB 4NDZA 2B9VA 1QAQA 4ZDKA 5FTKA 3ZJ5A 4YUXA 4Q3CA 3IAM6 4C6RA 4Z7NB 4TS1A 5EJEA 3RC7A 2V8OA 1E98A 2Q2TA 2CLMB 1XZIA 1TF7A 5MHTA 5L45A 3M9NB 1HLPA 3OKPA 2H63A 4EUEA 4QASA 2JEFA 4EH1A 1GG9A 1K4MA 2JLXA 2AE2A 1TO2E 4QWAA 4DMGA 1E2NA 3AESB 3AETB 3D3WA 1IUKA 2I67A 3DZ8A 3GEDA 2HGSA 4YAIA 3GPIA 1ACLA 4RIGA 1ABFA 1GAQA 3T0IA 1FX0B 2QEQA 3FWYA 3TTWA 4QBGB 3U7HB 3K4HA 1XLWA 1L7VC 1NT2A 5IAEA 4Q0YA 5KYWB 2ONYA 5ERGB 3NAQA 3ICVA 1TIBA 4NU8X 3I92A 2XQVA 1JAIA 4AUMA 2ECPA 3GQVA 2XQJA 1K0UA 2XQFA 3ACBA 4P82A 1N6LA 4F3NA 4DSZA 5DLEA 2OB1A 1GZ3A 5LDDC 2QPAA 2OUIA 3NMUF 2QS9A 3BERA 4K40A 3M2PA 1EUQA 3MTAA 4FDAA 3DZCA 2P5TB 5KFVA 2JAQA 1UEIA 4LOHA 4BUJA 1XL1A 1U0GA 4M53A 1I0ZA 4I3HA 5DMXA 3H9UA 4N8SA 1L8XA 3FTQA 2EW1A 5BWXA 1JG2A 4DA0A 4AKTA 2QN9A 3MCVA 2XOXA 3P94A 3SHQA 3HCRA 3DVLA 2W93A 3PLAE 4ECUA 1N5RA 4QTXA 1SUPA 4WH0A 2A1TR 4AN1A 2OM6A 2WJPA 4NBTA 2DTEA 1I2DA 1IULA 5FJIA 3II6X 1CRPA 2ECKA 1I1OA 4J0CA 4E1VA 3PA6A 3I9OA 1AX9A 4Q3DA 5JPCA 4ZP1A 5K3OA 2FEAA 3DAGA 2HLDD 5LA6A 1Q19A 2BZGA 1OW3B 2CVFA 1H22A 1T8PA 4MQFB 3M1LA 3QITA 3U4QB 4OP3A 4QUDA 4E2FA 4EY4A 1P6UA 2O2DA 4DA7A 2C9DA 1L8OA 3KRTA 1X42A 4L16A 4ZVKA 2CB9A 3PGMA 2R11A 2YWRA 4NMWA 1TTPB 1GEGA 2VDMB 4OGLA 2PJUA 2EG5A 4R0NA 4C89A 1BWSA 4GZ6A 2H00A 5EP1A 3PX2A 3WNVA 1BEZA 4D4JA 3MS7A 2HA6A 5CFNA 1OXBB 3S28A 3G8AA 5KSPA 4TRRA 5BURA 1Q17A 4W1PA 2CMKA 2P2SA 1QNFA 4N41A 5PNTA 2CNKA 1H42A 4DTCA 2Y9PB 4DIEA 2PUWA 5AKKA 1TM3E 4RS4A 1PLKA 1XPUA 5I9SA 4WZAA 4JLBA 4DMKA 2M6RA 4R8SA 1WXXA 1YUNA 2JF0A 4MTLA 4R6WA 3W9YA 5KYNA 3FMVA 2C8KA 3ETGA 4L8YA 3UG7A 4PZDA 2HRQA 5KJCA 3IE0A 1GRCA 4URFA 4I2VA 1OXKB 1W25A 4NNJA 1PR2A 4GX1A 4G86A 4J7UA 1E9FA 4QWMA 2ZITA 3QE2A 4I3GA 3L79A 2WILA 1R9GA 3ESDA 5TR9A 5ALTA 4N5IX 2GBGA 2JI9A 4CDRA 2DJIA 3TLGA 7AT1A 1ODIA 4QAQA 2VJOA 1BXGA 1THGA 3KUUA 5K05A 1EEXB 4MQEB 1VPTA 3CLTD 4QKQA 3LY7A 1PV4A 2C2MA 4HRAA 4CMKA 5C8ZA 1P29A 1OTHA 2GHRA 1EVQA 5DTJA 1SG6A 4CMJA 3LPLA 4J0QA 5CXUA 4YFVA 2IV2X 1E2FA 2C5LA 2Q2NA 1GGMA 4A8TA 2D0PB 3HSKA 2CXNA 4O08A 1E1YA 5KG7A 2AZXA 4CRWB 2FZWA 1NLMA 2VA3A 4UTVA 1WS6A 4TXNA 1UJBA 4ND5A 5J1SB 4GLLA 4B3FX 3MB5A 3IQZA 2AYZA 4BQQA 1R4ZA 1CX9B 1T2CA 3JQGA 3UXYA 2CLEB 2PX0A 2PMEA 5KG1A 1G64A 3RAGA 1YRQA 1DU4A 1AQNA 3T7EA 3F78A 2YHBA 1IFXA 5KI6A 4KMRA 1UT8A 3U62A 1H0HA 1KMCA 4E14A 2DVMA 3DE6X 4EG7A 2B8EA 1BXRA 2B8JA 2XB6A 4AY3A 1NN0A 4CQJA 4JKIA 4G0PA 3UCFA 4QYIB 4JA2A 2VRCD 4O33A 2AU0A 3PC6A 3KYDA 3EVZA 2XYRA 4HXEB 3L7YA 1X7DA 5DKFA 3NHZA 4AX8A 4TMKA 5LU9A 1GZ5A 2VPYA 2WK1A 3E9YA 1E2GA 3ZQUA 4PLTA 4TQRA 4HWTA 2OHHA 3CX4A 3LZ6A 3ZBPA 3Q6IA 1G4AE 2V6IA 5EXDA 1KK2A 2VSXA 5JNTA 4Y2XA 4EBFA 3F9CA 4H1WA 3L8DA 4KXXA 8ATCA 1Z4KA 4DR7H 1DCKA 2PMCA 1LI5A 3TR5A 2I2WA 4QQ8A 1CKNA 3L41A 3BKXA 4XEHA 4EPVA 2BGGA 4JJEA 1GL3A 1C7EA 1OIXA 2IKQA 5BOSA 3HKCB 4YGXB 5KHAA 4P32A 2EJBA 4F3TA 4CV1A 3E8SA 3M6LA 2R1ZA 1TTTA 1QIFA 3VDRA 2FPKA 3FCOA 1R5BA 4BE7B 1Y8QB 4U02A 1NXPA 3AJ9A 4PX2A 5F7OA 5GV8A 1L5NA 1UPBA 3CH5A 2NZ2A 3I1FA 3DE0X 3RE1A 2W9CA 2XMGA 5JQWA 1DDOA 1JTEA 1XE3A 1GLVA 2FWAA 3WMFA 3ZU3A 4J3NA 4XR9A 4C5AA 2EP7A 5EWMB 1PEAA 4F9GA 4LC9A 2DWOA 1XPRA 5L3RA 3K5WA 2POCA 5DYIA 4JHXA 3GYGA 2FQWA 3SJCA 3GT4A 3I0NA 4LGCA 1YL6A 1U5BA 4BVJA 4CDMA 2GKGA 4ED8A 1JSXA 1HZZA 3RF7A 2Z5FA 1IH8A 5JBNA 4RSMA 2X2PA 3UGKA 4JXKA 5KSOA 4K8OA 4Q8FA 5AKGA 5C1DA 4KMSA 3DL2A 3PUVA 4ETIA 4WKCA 2FZGA 5AMXA 3GLSA 5K0JA 2ZSHA 1W5SA 1Z2EA 1D5CA 4DNXA 4NBVA 2LCFA 2FEMA 1U28C 1J2YA 4FSDA 4PCLA 3ND5A 3RCBA 2HHJA 3VOAA 2VHJA 5LIPA 2PTGA 2AX4A 4FR2A 1CQJB 3G9XA 1BEEA 2R6ZA 1FTQA 3ZXUB 4WZBB 2AFHA 2O8FB 3IBSA 5F1PA 4B43A 3JR3A 4A0QA 1QR2A 5BWNA 4BBZA 3FI9A 4NFYA 3OPQA 3OSZA 2WZDA 4ZVLA 1YZGA 5IDVA 4YH1A 3WKDA 1IB6A 2XZDA 4JJ8A 4PC1A 2I4IA 3N5CA 2IZOA 3D6MA 4HDNA 1ZUD1 2RGUA 1OU4A 3MRSA 4JI3H 4F9TA 2BTOA 4FNMA 1ADJA 4TN1A 2W6QA 4Y6OA 1MVOA 2WVHA 2I8LA 1R00A 4EZIA 3ENZA 4H1TA 4PZPA 4MCIA 4Q12A 1DRJA 4HYEA 5KT2A 2HC9A 3I23A 1Z5ZA 4JUAA 2ZTVA 4GLBA 3IIEA 1FVOA 2IYUA 1MU0A 3RASA 3OEWA 1K0FA 4CEJA 2ZRLA 1UDBA 1RFGE 5JMOA 2ZRGA 1H2XA 5AO9A 4NPAA 1QV9A 1P1RA 3R75A 4UARA 1D4ZA 4G1CA 1U8XX 2FHSA 4Z4EA 1LPMA 4JBXA 3LVRE 3F8TA 2VNJA 3PGVA 3UJNA 1QP0A 1U8YA 1F5NA 5B3JC 5ECYA 2FOLA 2Y92A 1R6XA 4I1OA 1ESNA 2WTEA 4CM9D 5JATA 2BN4A 4IHJF 1I2AA 4FCWA 5C32A 1MV8A 3WO1A 1USVA 1OBVA 3I05A 1EM8A 3C87A 4AZ0B 6REQA 3PXUA 2EDAA 3Q3EA 1NW6A 1BSVA 3RYIB 1I2MA 2RGEA 5EA2A 5HK8A 2VVTA 4OA5A 4B81A 2PSSA 3T99A 4X5OA 2JFYA 1LXCA 2WC1A 1ULUA 4TWZA 1LTKA 3Q15C 4DV1B 1FE8A 2JFQA 4G89A 5A5VA 5ALUA 1LFDB 1ZVMA 3W6OA 4O2BA 3I5YA 2P7IA 1MA3A 1QNLA 3LK6A 3RUCA 3ZYCA 4U63A 2I99A 2OCPA 3GFFA 5ESXA 2DU8A 5BR4A 3B2EA 4JXZA 2Z08A 5DNAA 1G9TA 3ASUA 3BQ9A 1U9CA 3JCZA 4ZOLF 4KB5A 4BLRA 3KZCA 2ZBPA 1EFPA 3LCJA 2GBIA 4AICA 5FA6A 1PJ8A 3FBTA 3I3SR 1YQEA 1VE9A 5EIFA 4O1MA 5DN6D 3WBFA 3DC7A 3SJUA 2R68A 4GQAA 3UUEA 3TBFA 5SZIA 1UBKS 3EGOA 3KZMA 4YRKA 4GXQA 1R0LA 1H2YA 4JLSA 1IYEA 4YV1A 4QDXA 4N6GA 3AXSA 4HH3C 1I7DA 3I5UA 1NW8A 3ND9A 3AG5A 4JI5B 4BGEA 2PH5A 3GJ6A 1XZ8A 3LT2A 3WNDA 3X1MA 4IR9A 1WNFA 2L17A 7MHTA 4PCUA 3D3QA 4MWGA 5F2NA 3E2IA 2HUNA 2Z3WA 3GLHE 3TL2A 2W71A 1HLFA 1GRQA 1DAHA 3D7KA 3BWDD 3TH5A 2HO5A 1QYRA 5GONF 3A2NA 4Q4DA 3HNRA 3VISA 4DHWA 4U0JA 4FQ5A 1IRXA 3TD6A 3T0FA 5AXBA 4FKMA 5JOQA 2IXBA 5HQTA 1IK6A 1EVLA 4NKRA 1KC7A 4JA0A 3OJLA 2AMFA 2DLCX 1JQLB 4UUBA 5LU8A 4OUDB 3KALA 3HKEB 4X41A 1G8JA 3ESAA 4FFBA 4X90A 3CE6A 3GFRA 1G8PA 4D3XA 1R6UA 3U3MA 3X1KA 2KLHA 2GAJA 2CDNA 4WNYA 2QTCA 3C85A 4Z86A 1DJMA 3M1YA 4TMWA 3U3ZA 4C7MA 2XXAA 2GTHA 3D2CA 4BKPA 3U7QB 2R7MA 1FNCA 2FHPA 4LDAA 4FMDF 4QQFA 1ZKMA 1D0IA 4X1OA 2IHBA 3V1KA 3NIWA 2XW6A 2VP0A 2ZAIA 5FI0B 2TRSB 2B5WA 2ODNA 2QTVA 3WOHA 2WZBA 1KVSA 2FRXA 1F2DA 4K46A 2IYNA 5B6IA 5J2UF 3WHIA 3ROTA 1KMHB 2ZBVA 4OJQA 3RJTA 4TTVA 5F5XA 4OXXA 1GRRA 5FBKA 4DM7A 1YUBA 1DINA 3Q3IA 2C22A 1ZRHA 4RTJA 5FBVB 2QRZA 3JRXA 3BBLA 1G5FA 3A4VA 2WJHA 2IODA 2PE5A 4JXUA 4PBRA 1II8A 2IITA 3MLEA 4Y2RA 2IEIA 4EAQA 1QU3A 4E5VA 4MINA 3DZKA 4YP1A 3VRHA 4JI4B 4NICA 3K0SA 5C8XA 1FYWA 2HK7A 4Q66C 4S1NA 3LQRA 2HBRA 2DHDA 1XRRA 5TQ2A 3A3PA 2CYCA 5DMHA 1Z2AA 1Q6YA 3LDFA 1E7YA 2WSSA 1FUUA 1NI3A 3GJQA 3FCEA 1SHZA 1MTOA 2BMEA 4PYJA 3NHKA 1LPSA 4RAZA 1SXJA 3VJRA 1RYYA 4RF5A 3KWLA 1HT0A 2ZB4A 3HYSA 1P0QA 3UV7A 3TQCA 3JXEA 3G0CA 4HNTA 2UVPB 4Z49A 1FZQA 1Y6QA 1NVVQ 2BEUA 1ZC4A 3CFYA 4IJ5A 1G4HA 3D6JA 5L4LA 3G8DA 4DV4B 2Q9CA 3VR6H 4BNVA 3E22A 5J43A 2WIGA 3QKIA 3X43A 3OD5A 1Q0QA 4HS9A 3NHMA 5NULA 2C97A 2WUGA 3KCNA 4GYYA 4R3UC 1Z18A 2WHQA 3U7GA 2M05A 3WRYA 1TI7A 5LOVB 4MW2A 2TMKA 4Y2QA 2YHSA 2EBWA 3V1NA 3WRYC 5E4FA 4BNLA 4F85A 4AO7A 5CMLA 1UKAA 3IESA 3WGMA 4LYJA 4QQNA 2HK6A 2OWOA 1MFZA 5E3HA 1D9ZA 4RWZA 2J33A 2QX9A 3DM9B 1G59A 3PPVA 4DRYA 5CA0F 4A2PA 3I62A 4QUJA 2JFXA 2GRUA 4EGJA 1GN9A 5DB4A 1D4FA 1NF8A 2VHWA 4RTSA 2NVBA 4KQGA 5KFAA 1CYEA 3OX3A 3PQ4A 2QD4A 2PVCA 5IBCA 2PCJA 3AU9A 1AN9A 1FS4A 2FYTA 2A9VA 3EXFA 3BXXA 1GYFA 4DG8A 4NXNB 1NVDA 2D5LA 3VHLB 3FOZA 1B26A 4NZOA 1KYVA 1QRSA 3KZXA 3NUGA 5JNUA 1V1MA 3HB5X 4ALIA 2XBLA 2ZUWA 2X6TA 5EFOA 3FF4A 3OHSX 3QX9A 2CXSA 5KFBA 1AK2A 3KZKA 1SUCA 5IYZB 2D1TA 3O92A 3L0SA 3H2BA 1NMYA 2VHTA 3QFCA 2ZCJA 5JJBA 3L9WA 2A3NA 2DOKA 4PZAA 3EIHA 1EZZA 5AW8A 4MH0R 3AHJA 1CIJA 5CB4F 3OY2A 4XDZA 3H99A 4F97A 4ZI7B 4H7IA 5CAEB 2LDXA 3TR0A 3R0IA 3TS1A 3Q0IA 4FD3A 2GXQA 4D3DA 2C31A 4QULA 3TNYA 2XD4A 1YACA 3ZZ0A 1R4MB 1Z63A 4N65A 2Z57A 2HU8A 3ZCVA 1LFAA 4YB8B 1JZSA 4R2XA 2WYOA 1FW8A 5EHXA 4XJXA 5IW8A 2W57A 5HWSA 2VJNA 3KTAB 1ZP6A 3PBKA 2XNSA 3OETA 2GPSA 1BCRA 3AEYA 3GRKA 3ROQA 3LBNA 2O03A 2ZXUA 5HXAA 1LTHR 3UQ8A 4LHZA 3M4ZA 2WNHA 1R74A 1XJCA 2MU1A 5KFNA 1DX9A 4JBHA 4UATA 3ZHXA 4JLKA 5KNDH 1IG0A 3GLFB 2CHQA 2BFBB 3ET4A 4KU4A 2JI6A 4KE7A 1ZESA 5JFGA 4C22A 2WQ7A 1THZA 1L9KA 4ZHQF 3T52A 4I5EA 1JJVA 1C9DB 3LHKA 1LPBB 2O3RA 3KT0A 4XASA 5CLLA 4QDOA 1PIWA 1AUOA 4F46A 4YGYA 2AYYA 4G9EA 2E37A 1K5PA 3QI2A 2I65A 5FTMA 3W5UA 4IEEA 4ZVOA 1FQKA 4F9EA 1Q0RA 1ECFA 2FF5A 4K9PA 4MI6A 4Q3NA 4M37A 3A3YA 3KT8A 4FGUA 5LQMA 1ZOLA 3FOWA 3L0DA 2WNSA 3R41A 4ZVVA 3RROA 3B48A 1B73A 2FZ5A 1FLDA 1BH6A 1F8GA 2IA5A 4NMMA 2DH6A 1LPOA 3PNPA 4PIMA 3RFXA 1PRYA 1A3GA 3SXUA 3EC2A 3LUDA 3OF2A 1UOEA 2XMRA 1NLYA 4DLTA 3ZHRA 4HMPA 4YMLA 4LZOA 4Z6KA 2AE1A 4H6WA 5KQRA 3ZU4A 4UOZA 4G9BA 1CWUA 3FPKA 4KN5A 2AC4A 2CY0A 3TI9A 1UMBA 1NI4A 1QYVA 2CVOA 5IF9A 1NQOA 5DW0A 1VKOA 4FYPA 2A94A 4OIFA 3ZCPA 4ZALA 1DTWA 3WYGA 3AJRA 2H9IA 8AT1A 2NM0A 4GKKB 1QZUA 4EX6A 3WKEA 4MDFA 1FDIA 3QNUA 4LF5B 2Y0DA 1I6KA 3FYUA 2E4YA 3L7LA 5EE0A 4EENA 5CIWA 2Q21A 1B23P 4B6RA 5LSAA 1OV4A 1DX4A 4TXJA 1IZYA 2B30A 4P53A 4YQEA 2I4OA 4M9SA 4OV6B 3MT7A 2XADA 1SNYA 5FTLA 3CUEF 3FOBA 4FIDA 3DOFA 2BM0A 2EKZA 4AULA 4TT3A 1KFBB 2A9OA 3Q3HA 3RSFA 2GH1A 2VJMB 3KD3A 1XZJA 3NW9A 1JGTA 1I3NA 4O1IA 2X6RA 4G8CA 4EGCB 2C5FA 3CCFA 4WD3A 3ST7A 1E9VA 2NAFA 4BY7G 5B1DA 1SVKA 3BF7A 2DBRA 3ZCRA 2ZRFA 1E61A 5IJZA 5A3RA 4IGEA 3BORA 3OD1A 3MQ4A 1FDSA 3ZE0B 1UAAA 2XLCA 1AKMA 3P9ZA 3SKVA 1RHUA 3A25A 3E3LA 4RTOA 2FZKA 3V6JA 3L18A 4F6LA 3BCUA 2WJAA 4V38A 3ZE8A 5SY4A 1S3FA 4HGQA 5FTNA 1JDTA 5FUBA 5C4MA 3IP1A 2YMPA 1E2LA 3RVQA 1T0PA 3B2QA 5COQA 4MX8A 3SDZA 4BO6A 3RVSA 3IP8A 5ER9A 5I7WA 4G2NA 2GZSA 1GL9B 2VYND 2EC5A 3ETJA 5KCZA 3AI2A 5FORA 1T3LA 3PFWO 3PQDA 3RFFA 3FE2A 3BGDA 4FQ8A 5IU6A 3W0LB 4BFSA 1Q0SA 2A5YB 4L2IB 1JFFA 1E7RA 1C29B 5F7ZA 3EF0A 4OHBA 5L7WA 5IZ4A 3LLMA 4XUGB 1EVZA 3G6WA 3A37A 4U7TB 3E18A 4YJ3F 3ICOA 1T2AA 3JD1A 1SQ0A 2OECA 1GTZA 1KMNA 3TEKA 4MS3A 2EZ4A 3FOCA 3ET5A 2QY6A 3WWHA 3D59A 3RHFA 2WFZA 1OX4B 4UD6A 3BD6A 1SEIA 2H11A 5AM3A 1G17A 1PSZA 3SP1A 3CE9A 3RS8A 2NX2A 1OI4A 1EFHA 2V7WA 1D4AA 3ADBA 4TRJA 1E0SA 4II3A 1Y3AA 3QBDA 3UGJA 3ASYA 1JQJC 4E5YA 4X45A 2SCUA 3LHDA 2H4ZA 2BE7A 1ZM7A 1FVIA 3GHYA 1UPAA 4Z9FA 3CQZA 1WR8A 4YRZA 3TW8A 1TZKA 3G13A 4X94A 4ED9A 5H9VA 1E89A 1MABB 1Y5LA 1ZRSA 4EVIA 2V0NA 2ZKLA 4TQUS 5CM2Z 4HEHA 2Q3HA 2K2QB 3UAOA 4F11A 4UTPA 2WKPA 1KPIA 3HS3A 1H4SA 3VAZA 3BTUA 4NCIA 3NJ8A 3ETHA 3A32A 3L1HA 4BLTA 4RJ2A 4ZAZA 3WKBA 3CZPA 3ZCUA 3EEOA 4INAA 4I5DA 5EXPA 1A95A 1FW6A 1CE8B 4I1UA 1WDWB 2X0KA 3TLYA 4JXJA 1JFRA 1OZFA 4IICA 1DOHA 4AK9A 2BMJA 2BJHA 2ZJ6A 2OAQ1 3DMHA 4F91B 2FQXA 1UPCA 4DREA 2VDPB 2WMYA 2MDTA 5IXJA 4U1RA 1C7IA 4Y18A 1WMBA 3CXRA 3HO1A 5J4KA 2EKPA 2GBFA 2GF0A 5I8ZA 4Z0HO 4YPVA 1T6ZA 1M7JA 2VDRB 3BWBA 5LR6A 1YR1A 1YZ3A 4KX3A 2VATA 5BR8B 2I9PA 1FSGA 3KDAA 4ROSA 2L69A 1WXDA 4BNKA 1ORDA 3RGGA 3PUWA 5EE3A 3RSLA 2WPNA 2YYAA 3C16C 4U2DA 5HFNA 4AJPA 5G3ZA 1PWZA 4OYRA 2H85A 3VTAA 1KI1A 3RBZA 3NYIA 5LQDA 1KZ1A 4YR3A 1OLOA 5D3KA 5KFTA 5AVZA 4RAYA 2HLHA 2IZ0A 5ELXA 2GCOB 5DJ5A 4QEKA 4FYHA 4WECA 1JR3E 3BA6A 5TT0A 1W581 3SHWA 5KWJA 3M70A 4NESA 1PJ2A 3IPAA 4HOYA 1YS9A 1HMYA 1KAGA 5C31A 2ZPTX 1SOUA 1NZJA 1ZLXA 3SHVA 4JZYA 3PK0A 3NIFB 4PQRA 3CB2A 2WKWA 2JIDA 4HPXB 2R8GA 1RRVA 4JKYA 3L6RA 4K05A 3DEZA 3WLRA 3J81A 1S2IA 5A3VA 1ZXXA 4TX1A 3E2MA 2XB9A 1NNLA 4PYQA 2VSQA 2WABA 2ZT5A 1YFLA 2HFKA 3X1YA 2YVUA 3SIXA 3T1OA 2ODTX 2WRZA 1HFKA 3DVQX 3ZGNA 3SI7A 4OQYA 5E1MA 4CR7A 3FGNA 3NU1A 4X1IB 4P4SA 6YASA 3GGPA 1J5EB 4RHXA 1L7OA 1E63A 1KHHA 2BP7A 4M83A 2GFIA 4KCGA 1PGQA 4CCSA 5BV2P 1Z5VA 1KO1A 9GPBA 4JI1B 1TVCA 3B3FA 5CCBA 1X92A 1CY7A 2NVUA 2ZJBA 4CF3A 4ZJYA 4YXFA 3CIOA 3LUJA 5L3VA 3U40A 5DHPA 4DR4B 2XTMA 4GC9A 2O1WA 5I45A 1JIVA 5AVYA 3P9QA 1I6LA 3HCWA 3G0BA 4B3XA 3OBIA 1SVWA 1L7QA 1TX4B 1F5SA 1U5CA 3DAPA 4X71A 3ELUA 1RYBA 3LFUA 2ZOSA 1NR7A 4JVOA 3OBBA 1KK0A 3ZEIA 3H5IA 3HCCA 2F3TA 1WCMA 3CRMA 5K6TA 3HVRA 1XZHA 2O59A 3DV0B 5CCEA 1JSLA 4REQA 3D5TA 1D2RA 3MBOA 3J80A 3H84A 1E3SA 2P2ZA 1N0WA 4BO7A 3SYRA 3PC2A 3LXUX 1MG0A 4JJ6A 2O8EB 1YD7A 3QFFA 2ZS8A 4N6NA 1C9EA 4Q1BA 4KKVA 5IANA 6LDHA 1P3JA 2R48A 4D8UA 2COJA 4KWCA 2DQ4A 1QGDA 2A92A 5JCPA 4JB2A 5CVEA 4I1VA 3C3MA 1T2UA 2QVXX 4YT5A 1RM0A 2QNBA 2VNIA 3JQAB 1M2HA 2W00A 3RIXA 4FKZA 1X7WA 2VBFA 1L7DA 2V9ZA 1XTJA 4IFEA 4MRAA 4JGGA 4L4RA 4XX0A 4YLEA 5K09A 4MDHA 1F38A 4UHFA 2BFEA 3AVYA 5HJEA 4AMGA 1P4GA 4LZLA 2CW8A 1PR5A 4Y2TA 1QTIA 3PW7A 1YF3A 3RSGA 4C2BA 2D06A 1FEZA 1COWD 1PWXA 2ON6A 1TRKA 4CM7A 2RGYA 2XH8A 4DPMA 5BV8A 2ZI7A 5JDCA 4JYMA 2D7DA 5EN4A 3X2SA 3T38A 1P2VA 5LXTA 4EEYA 2ATVA 4HN4B 1VMIA 3B13B 1ZONA 4FCTA 4LVUA 2WIKA 3IDFA 1ULZA 5JZBA 4YBZA 2G8LA 4YXWA 1EE1A 1U31A 3TPZA 1AA9A 4H7HA 1M2OB 1DKQA 2TSYB 2OHOA 3SQMA 3MPOA 1ZH6A 2Z6QA 3V55A 1UK9A 4H27A 3WLMA 4G1EB 5KYXB 4P31A 1ZXLA 3P4YA 2FCRA 4L3VA 3L7OA 3KVRA 3ZD9A 3QE3A 3K1AB 5AW5A 2VQEB 4OI0A 1L5VA 4XVUA 1OKKD 1OA1A 5BQ5A 1O89A 1W35A 3C5VA 4GKJH 1XCPA 4U4AA 3UJ6A 3R77A 2CNWD 5PGMA 1TJ4A 4FLMA 1IAQA 4XH9B 2HADA 2V58A 1Y9DA 3RR2A 3A04A 4M0UA 3RF6A 1TZ2A 4H3VA 4X84A 3WDSA 1K6IA 4HNQA 4O2AF 1JPJA 4IMRA 4DMLA 3JD3A 3N75A 3OPNA 3R0XA 2DT8A 1MO4A 4R8LA 3WYAA 5LPNA 2AH5A 5LD2B 2RHJA 2JFNA 2FUNB 1SQFA 1XJWA 4KK3A 3O2NA 3OM0A 5DIFA 2AZMA 2WQZA 1FVFA 5CCXA 1BMDA 4DUYB 2BTEA 3C6YA 4F6RB 1JKIA 4K86A 4HQ6A 4MW7A 2KLBA 2PKRA 2YV4A 1DIAA 1KBZA 2GCGA 1P91A 1ODCA 3ABSB 3OQVA 1UBUS 4UHKA 4MV9A 5FUVA 2B8NA 2PMZE 3ZXSA 5LQKA 1Z75A 2XCAA 1BG6A 2Q50A 1M9NA 1GSIA 2FFQA 2FWBA 3VU8A 3MEQA 1T36B 4JH0A 3L7KA 1MHPA 4MEAA 4JGIA 4QGSA 3AR9A 3GFBA 4F2WA 2XA2A 3ZNPA 4ITUA 1RE1A 4NPHA 2FP4A 2VRNA 2CLOB 2KS6A 3VI4B 5HILA 4LGYA 1YRAA 1BS9A 1GUBA 2RGBA 4GG1A 1WX1A 4BO5A 3DWGA 2ZBFA 4BECA 4D4GA 4RLHA 4TTPA 4KR7A 1LWOA 4BX9A 2OWDA 3P9PA 1R0YA 4IVQA 4IINA 4DR6H 2FY8A 5E6UA 2C99A 5IF3A 1KXJA 4Q9DA 5K03A 4GC5A 2IUSA 2ABJA 3PQ5A 1NSYA 3G0IA 3IIJA 2A7QA 3TXXA 3H5LA 2FPIA 1RWOA 3PYXA 1OJLA 3PHHA 3REGA 1W19A 3CXUA 3DEYX 3LX5A 5GVRA 1HRDA 4DR5B 3SQLA 3V8BA 4MGHA 5EWJA 4OYYA 1WZIA 1IQ0A 4GC6A 2QE6A 2JDID 4MVXA 3FTDA 2ZJ1A 2LWIA 3D8HA 2VYVA 5HYVA 2PL1A 2D0OB 2JGLA 4S0XA 1IOWA 1J2RA 1PFGA 2GN1A 2O8DB 4Q45A 1UQUA 1L4BA 4U9UA 2BFPA 4UM7A 5EWGA 2R6CA 4CDNA 3BK7A 4V0ME 2VZ8A 4BATA 4ZYXA 3BIXA 5IEBA 5DISC 4FJ1A 4PAGA 4KRXA 4Q9HA 1CPYA 2IIQA 4KXUA 3SFZA 3MOGA 3PD0A 1LZKA 3GNQA 4F93B 4XD7A 4IHJB 2PWAA 1CJTC 1H4QA 2E9SA 3E2PA 2O0KA 4L95C 3OICA 4RVDA 3PO3G 4KQXA 1NVVR 2NU9A 4CYMA 5KJ6A 2W6PA 2EXXA 4ECWA 1B0UA 2WMNB 3TAXA 4O7SA 4YRJA 2QRVB 4UHDA 4JX8A 1NFQA 4MI1A 4YYEA 1VHLA 3E1SA 4KP7A 5JNLA 1YB5A 1DKUA 3Q5GA 5COBA 2JLVA 4KR2A 1TLFA 2AEMA 1KOFA 4NZYA 1CV2A 3NGDA 2XCOA 3H5OA 3K6SB 1T3ZA 5JUMA 1IK4A 4MQ6A 1MEEA 1PS8A 2UUAH 1EESA 2XGQA 1GILA 3UTCA 2O2EA 4U8GA 1NKTA 2XUQA 2Q2WA 3PE6A 1KC1A 1YFZA 3JVEA 3N07A 5CT8A 2WUWE 1RBMA 2I3AA 3QQ5A 4JYBA 2OMEA 2IW3A 4Z9AA 2EARA 4AU1A 3FDXA 3U5ZB 1P2UA 1ZGAA 5TJHA 1B42A 1WY5A 4DL2A 1KYQA 3USCS 1J06A 2HYDA 1CRWG 4BJ3A 4HX5A 1Y34E 2Z2YA 5DTRA 4EG1A 1EUCB 2OAP1 5B7GA 5DWQA 4EHDA 4OQDA 1M33A 1YZHA 1X15A 1H2EA 2JVJA 4F5WA 3L7CA 4ML3A 5GOZA 1WXHA 1CDEA 1F4LA 5K8LA 4DNOA 4FOPA 2ZQZA 2QE7D 2MCFA 4AKHA 4ZA2A 3F5QA 1D6NA 4MV8A 4UXJA 5AJZA 2W2XA 5DU2A 3I9MA 4TYQA 4K2AA 2W98A 2WU1A 3A31A 3GLGA 4KPYA 3W8RA 1W96A 4HFMA 3NI2A 4HB0A 1AKRA 3DO8A 5GONB 4B4VA 3L8FA 4GPD1 1U8TA 1FFXA 4HB2A 5G02A 7REQA 4MB2A 1IVSA 4KQKA 3GIMA 1HFWA 4N5HX 3HDTA 3V7NA 3VO2A 1EDEA 4MWOA 1O97C 2NADA 4TKUB 3SLGA 4OHYA 1MX1A 3HDHA 5C4GB 1WLSA 3IDAA 2X5NA 2PIDA 4EKGA 5A4JA 2ACKA 4IGKA 2F67A 1MAWA 1YL5A 4RZSA 1K3TA 3H4DA 3O1LA 1D1TA 5BSTA 3O5AA 1H6CA 2M9MA 2X14A 2HJHA 2VUIB 1XA3A 1VSBA 4DQLA 4DIMA 2W9XA 4DM4A 4ILKA 2X77A 2ZIZA 3NANA 2PGLA 1KSFX 3CVXA 4MPDA 4Y1EA 2ZI9A 3FSGD 2QN8A 3EGXB 3AM5A 5AH0A 3FNRA 1HEUA 3MWDA 3LO5A 1RWMA 4FMDB 5K0TA 4KZPA 1NUPA 1ZW1A 4A92A 1IEQA 2X4DA 5ALDA 2CZCA 3B9QA 4LRYA 3AI7A 2H2HA 5CTJA 2L18A 1N5LA 1SHTX 3QP9A 4BL5A 2E89A 5LQRA 5G4KA 5LKRA 2H5EA 3PXBA 5C37A 1QG6A 2C4NA 5EJGA 4IJWA 3V97A 2AZTA 4AS3A 3R5KA 4DCCA 1ECJA 1IMOA 1QMGA 3E5MA 3U7RA 1B2LA 1UZNA 1JVSA 1XN4A 1VPDA 1C3EA 4Z9XA 3GIDA 4KO2S 2QQEA 1KJZA 3LLCA 1GD1O 5DLFA 4J7CA 1WXFA 4Z4CA 3H0KA 1SU6A 2H2AA 1TA9A 2CFTA 2SKEA 1EA5A 1OHHA 4HKTA 3E03A 1PL0A 2JIBA 3I6BA 3FWZA 3A7EA 3BWYA 4QXMA 4LYYA 3HM2A 2GESA 3PUZA 3FPJA 5A4FS 1I2CA 4MVJM 5GP1A 3ZWNA 3Q9SA 3I73A 3V4SA 3I4NG 3ZE2B 3AP2A 2FCAA 4OOFA 2LGJA 3SFVA 1SA0A 1M34B 1PJ3A 4GRIA 1P16A 1TD9A 4MS1B 1NNUA 2H29A 2PSDA 4EA9A 3UANA 5LCXA 3DDCA 2A5DA 3ORRA 1WUJS 1ZINA 4JLNA 3NGLA 2QP3A 3SC2B 4AZ3B 4PG6A 1N7IA 4CI0B 1A8PA 2J5XA 3JVDA 3PIIA 2FPLA 1NUQA 3P0RA 221PA 2ZKIA 4UMEA 3J80W 2ZJ5A 4BQNA 2ATEA 3MFQA 4DYHA 2JGAA 3H4MA 1VXOA 1GPH1 1VS0A 1G20E 1NAHA 1RLUA 2W2KB 3MWGA 4ZVRA 3UJ9A 1GCGA 1J2UA 3PQ6A 4E15A 1QH9A 4ZYLA 1JE0A 5F5NA 2CFCA 3BZWA 3HCBA 1Y6RA 4AXBA 3PDHA 1HZZC 3JYPA 3WADA 1ZVQA 1ZVKA 3RBXA 2IPNA 1GPYA 3GK3A 1SBIA 2C9MA 1Y1QA 3LBFA 3S8YA 3UAXA 3AUSA 5DSTA 2EW8A 5CK5A 5BN3A 5BSGA 3HUTA 4O4IA 4YA6A 1U6KA 2A3RA 4YCMA 2WSIA 3KWFA 3VR4H 2V7GA 2VDVE 2ZVDA 5TQ0B 3BDAA 1ESDA 1UZMA 4GHWA 2H2FA 1NHGA 2FK3A 3PUJA 1BU5A 5DNWA 2EGHA 3D6TB 3BDIA 4GMKA 1OYWA 4M0LA 1OLSB 5GZ3A 2RHTA 1G7CA 1KERA 2PY6A 4PO1A 1B1CA 2PU7A 2IIBA 3M6WA 2QX8A 2X3YA 3OQ1A 3EODA 2XNDD 2KSQA 1KU6A 3PQEA 1TAQA 4KDFA 4A6XA 3QXCA 2ZULA 2AZ4A 3JW8A 4TZ6A 1TM4E 1WKCA 3H8WA 5MGBA 2FPSA 1J7KA 1ONBA 3WGUA 3TFOA 5LMUH 4JUDX 1GWNA 4DC9A 2GN0A 3OM9A 3Q6MA 4JQSA 2R47A 3RS5A 3DLAA 4CLOA 2J7PA 4HDKB 4P58A 3B7WA 1E3WA 5JUWA 3OMXA 3DPSA 2YQ5A 2PKYX 4RK5A 4O84A 3CNBA 2OGSA 3K1YA 4MKIA 4TTAA 3AH8A 3IR6A 1KAHA 1LW7A 5I4BA 3LQKA 1KYTA 2L42A 5CB4B 1QK5A 2AMVA 1GZSA 1UFOA 1XAJA 4RVCA 3K5IA 4KTVE 1JDJA 3KKKA 3W3AH 1E0AA 3NM4A 1W48A 2PS3A 2P40A 3C6BA 2YRXA 2VP2A 1MX9A 3GTPA 1IDN1 4NJEA 4GM0A 4OFXA 4YUYA 4PV7A 2GASA 4YJ2A 5A06A 4C08A 4UXHA 3WL5A 2KI5A 4A16A 4IIUA 1D2CA 5EKTA 2V98A 3UT5B 4NK4A 4K6FA 1AUQA 3VSBA 4IV5A 2QTMA 3SM3A 3O26A 2BKLA 4IDEA 1EDOA 1YDGA 5DRTA 2Y1CA 2X3FA 1U1GA 2R8JA 5JO0A 3FUTA 3RIGA 2R4UA 4HGYA 2HGXA 1UJCA 3PHCA 3T7CA 1DXYA 4ITRC 3CR8A 4B3MB 3L5KA 4GMXA 5KT3A 1EFDN 1S01A 2AYXA 1K08A 1V43A 4OB8A 4B3TB 2RHWA 3AERA 4ZHQB 1Z0DA 1I36A 3BFXA 2PKCA 4IVNA 1T5BA 5HJ7A 3T7JA 3K70D 1VHQA 3C45A 4EB6A 2GO7A 4Q1VA 5J4LA 1PNTA 4U7JA 4LYEA 3G7SA 3MS4A 4CNQA 4QU0A 1A5ZA 4JB8A 3I6QA 1KSJA 1BQ4A 1ECCA 4EUSA 1UADA 2JD2A 3A14A 3DFZA 4RAOA 2W6CX 1NXQA 1W46A 3JZFA 3BRWA 1T0JB 4HNUA 2JFFA 1M76A 4GBED 3A3NA 1XTIA 4WOBA 4EFEA 1VG9B 2XYPA 2V5VA 4J9UE 2CGEA 2XF8A 4PYKA 1Z0ZA 1YA4A 5KOIA 3P97A 4V1CI 3I4CA 4XRGA 1DJQA 4DDTA 4FYXA 1I1LA 2Z9DA 2W6ID 1JILA 1NNSA 4WCDA 3ORQA 2DKNA 3PC7A 3TZ6A 3GRYA 1K7XB 4A36A 3DNMA 4U2BA 3DTYA 4OQZA 1EFRA 2ABWA 3DOIA 5FRDA 1AB6A 4H08A 4PQYA 1V2GA 2O57A 2HRRA 1FQJA 2QSJA 2X5KO 3VA7A 3KUCA 1DB3A 1W4BA 3HKZA 4EOGA 4JQOA 1JIQA 4MV1A 5BN1A 4A1OA 1DHTA 2ZR0A 4QOSA 1KJWA 4L0CA 2H51A 3JQFA 5BQ3A 3WYNA 1IVNA 4RCVA 3OPMA 2BBWA 2CNBA 3NHYA 1LBHA 3KJGA 5F2EA 2IX3A 1XNRB 3D31A 4EO7A 4E22A 4ZCPA 1RWBA 5EC8A 5E6SA 5I9TA 2OP1A 3QUBA 2VOBA 1U3FA 1DUVG 1QDUA 3UK6A 4ER5A 3KDSE 4D9MA 3KSMA 4M0DA 3H8SA 2WWGA 2XGOA 3M9OB 5JD4A 4UBMA 1YASA 5LZ9A 3RS9A 2BSXA 1XMVA 2CVPA 2PRJA 1YJXA 2QAIA 3G5UA 5E9WA 2F55A 4CV2A 1R0BA 1P3Y1 1CZOA 3TX2A 1QVZA 2V5AA 1A5SB 5ALWA 1H5QA 1F8YA 3T9BA 3FPHA 1WABA 1DTEA 1PHPA 5K1ZA 1JBQA 1TM1E 1KORA 4W1QA 1P5JA 4J03A 4DGQA 2XQIA 1J0DA 5LP6F 2IOFA 4D45A 1VSTA 3UOWA 4M4SA 3RSZA 4CQNA 3WLTA 3K30A 3S2FA 4Q3LA 2G67A 5I4IA 4Q7EA 3ANNA 3EGVA 2MMGA 1BE0A 4GLXA 3FWNA 4YCSA 2QSYA 4G0ZA 2V7QA 5KUTA 4UNIA 1MB3A 1N6NA 1YQ9A 3AF1A 4X6UA 1MCZA 1WUYA 3AB8A 1NDUA 2ZIFA 2CVHA 1PFVA 2ZI3A 5IN4A 3UKJA 1P18A 1KE2A 1PWHA 4G0OA 1R7RA 3RVOA 4JHLA 2BUCA 1RRGA 3M6MD 2XT0A 2JKVA 1XQ6A 1YI8A 1XDBA 4DG9A 3QFSA 3FVQA 1G63A 4R5HA 4LWOA 1Z5UA 4K6HA 1SVIA 2RGWA 2QAJA 2QUIA 4ZICA 2HMTA 2JJYA 5COAA 3TBKA 5KVSA 5AHRA 1ZOSA 1W88B 5CFPA 2D2XA 4W63A 4YJ3B 5B6JA 2EYUA 1LSOA 4Z4QA 1D1PA 5EJFA 3A4MA 5KDOA 3A6KA 1YSCA 3AF2A 5K2OA 2QTFA 2RH5A 4NOKA 4YPOA 3TFQA 4WLVA 4DN6A 1KY2A 1K8QA 1HLGA 2V03A 4PRKA 2JVIA 3TIIA 4DCTA 1TNDA 2CFOA 4IV8A 5G3YA 1P2DA 3BAAA 3CZMA 2NG1A 3PXAA 1SXJC 1N77A 4JSRA 4UEJA 3W7BA 4B3IA 2XT6A 3OAAD 2B3DA 3IR7A 3OPVA 4DYDA 1WZNA 3OWOA 1Q16A 2B4TO 1W6RA 1S5PA 1DUIA 3OIGA 3VBCA 3UTDA 4MO9A 4OD0A 2UZAA 3HE3A 3L04A 3AR4A 4EJSA 3C48A 4TQSA 2Y0SE 2OGWA 3UUGA 3EW7A 3VDXA 2Q4OA 4Q4HB 1KKLA 3HCFA 4BKUA 3DAOA 5BSMA 2B4RO 4D0LB 1QB7A 3NDPA 2BUAA 4TQAA 1D2MA 3UJHA 1GGVA 4KAFA 1QOZA 2N0SA 5GJBA 3TDMA 1ADYA 4M7WA 1N1MA 3KKQA 4LDJA 4R0MA 3MUOA 2QJOA 5FOTA 4H7EA 1TWFA 2MSLA 1BKSB 2DQYA 4CKWA 1E1CA 3BMOA 5D7NA 4F5ZA 1S9HA 3LYAA 3U4AA 2IOQA 3KELA 3N9IA 3U56A 3EX7C 3KHKA 3HFRA 4IJUA 2E4VA 2ZATA 2P2NA 2HXGA 4M1SA 3BHMA 2D4HA 3D0QA 2XOEA 4DC1A 3PCRB 2C9YA 3U44B 5A2QA 1LDGA 5GAJA 2PQ6A 3VSCA 1XU9A 3EG9A 3YASA 4KR9A 3KAKA 4FHFA 1YO6A 1EP3B 2QAGB 4KPFC 4J0MA 3HA7A 2Q6IA 5EMNA 3K09A 2A1UA 5LL6P 4Z51A 5KNCD 3K09C 1GXSA 2OO3A 3E9NA 1I50A 2GF9A 2VA9A 4B74A 3COYA 4D9JA 1JZQA 1JJBA 3SN6A 2GN4A 5ICCA 1I4TD 5JXJA 3V4RA 4G1FA 3RIZA 5KQPA 4LF8B 2WUDA 2Y66A 4IIJA 4N76A 5HG0A 3DV2A 3RAQA 2P9GA 1K7SN 3QTTA 1YZFA 5DGXA 4X20A 2ET6A 4X7BA 3GUVA 3RR5A 3UFXA 1WPGA 1H0KA 4R4JA 4JJIA 3PL5A 1WB4A 4H4EA 2DFDA 4R2WA 4AJ9A 1E3MA 3K32A 1K92A 2ZI4A 1ZQ1A 5IBPA 1YXMA 1S3GA 4TTJA 1G5HA 3USZA 2WB2A 3JPWA 3N6VA 3SWWA 2XE6A 5LVAA 2QQ5A 5IK2D 4NE9A 2WYHA 2GCPA 3DE3X 2O5VA 2PTHA 3C7TA 2M98A 3JQPA 1KKUA 4G4SO 1N33B 3QX7A 4S04A 3ITEA 3H20A 2C8VA 1GPLA 5IDYA 1S9FA 1RLJA 3U55A 2GO1A 1P1BA 1TKAA 4EHKA 1IZ9A 2XUJA 2JA6G 2NXNA 3E8MA 4LSMA 4OYHA 5A3QA 3SYKA 5JD5A 1N5MA 1P1HA 4HJRA 5H68A 4KYTA 1WCV1 3A6LA 5AJUA 1BS2A 1Y7PA 2FSIA 4NZ9A 4MWEA 3DOJA 5HJ5A 1PD1A 4WE3A 5IHXA 1TCVA 1NLZA 4C1BA 1QCYA 1NKSA 2J6CA 4B6QA 4YX9A 1RXCA 3JAMA 2XNCA 1YQQA 3OY7A 4Q7MB 4WEOA 4V2IA 3ROEA 2IYWA 3BCRA 5IKOA 1G3RA 3AKYA 3JQ8A 2OZPA 1ATZA 1PT6A 5JC1A 1SVLA 1VHDA 4KOAA 3R3VA 1JEJA 1Y7IA 2VF2A 3BTSA 4N5DA 3KB6A 5CM9C 3BJYA 3FNHA 4LXGA 4IS3A 4C2TA 4I8XA 3AL2A 2IH4A 3ILVA 3R7FA 4RKQA 3TZLA 3TUIC 1T8RA 2WWIA 3NBQA 3DZHA 3LKZA 3VJMA 4KHZA 2DKFA 4MA0A 1RYSA 3BOSA 5E2BA 2VWGA 4EBDA 4EAAA 5I47A 3W34A 4MGEA 4ZVUA 4KPEC 5H4GA 4AKEA 4JC8A 4ZAVA 2FJZA 3MR6A 4COOA 3DVRX 4CMAA 1UMCB 1CJBA 2R66A 1QHXA 4MRMA 4B3BA 2VHVA 4BQSA 4QTUB 3GTKA 3RABA 2W6ZA 3THYA 1QUFA 1IDOA 1E5LA 3GLIA 4BQRA 4DZRA 2C4UA 1SIOA 1U2TA 4L8LA 1AKUA 2OCDA 1TVMA 4MJ3A 4LHSA 2QW8A 4A0HA 4IDPA 4F4CA 1FS6A 2YHUA 1QCZA 2HIVA 1HXHA 3DZBA 3MMXA 3FYUC 4XYLA 3DD5A 1W8DA 1V5GA 4N0PA 1Z0SA 4BO3A 3I9V1 4BZQA 4UFPA 5LN1A 2DGDA 2JGKA 1P3DA 1ZMXA 1KI6A 4DW8A 3GT3A 3I64A 1I01A 3ABRB 4CTKA 3W1VA 5F9FA 1L6IA 2HLDA 5LYJB 4I1PA 4PS1A 1E4EB 3DT8A 3IOYA 5AVWA 3R9WA 3IIMA 2GEBA 4FMBB 4ZVPA 1R3DA 2WTUA 3LDUA 3VNSA 4GWGA 3ELDA 1KTVA 4RLQA 2B3TA 2DFPA 1DLJA 2BSQA 4RTPA 2YQZA 2VP6A 2E5WA 3V3TA 5BN4B 1HNWH 2VYCA 3D8SA 3MJDA 5EIAA 2Q0HA 3TUJC 5EJ5A 2NXJA 5JE8A 1A9YA 3KHLA 2NXEA 2AMJA 1RAEA 3KYIB 4OJKA 3PX7A 1YVRA 4MIYA 3SYMA 4JN6B 4KYIB 3EUEA 1YC5A 4BB0A 1OB5A 3RBDA 2IHJA 1L4GA 2BI4A 1IM8A 4DMRA 2OE2A 4CHIA 4YMVA 1APBA 4QWCA 1RRCA 2BEWA 4UDXX 4HQFA 4XKJA 4JLPA 2UZ1A 3DUFB 5LJLA 4JFRA 3V8RA 1DIGA 4HP8A 3HV0A 1ZEJA 1P6XA 2FN3A 1GTG1 4OQFA 3LBAA 3HMQA 2D3TA 1EK1A 3OLCX 5DH9A 3NVDA 3K6JA 1M0WA 4S0ZA 3AFMA 2QW0X 5FTJA 3K53A 1N34B 3FB1A 1RZRA 3SX0A 1M1UA 4D9GA 4Q43A 1MOZA 2VFAA 5DHQA 2IYXA 5F98A 3P4UA 2PUHA 4ED6A 1RS0A 3CLSD 4DCVA 4O2AB 3CPSA 2R86A 4FS8A 3PHGA 3GGJA 3OLVA 3M49A 4WCFB 2O0MA 1MP0A 3ND7A 1ZHSA 1GIAA 2Q6KA 1F06A 5D3MA 4R98A 3HFGA 1QGYA 1NUSA 5EHZA 1SUIA 2H6EA 5C8DA 5ILQA 2HJRA 3FMPB 3GFPA 3U7JA 2Q99A 2X8JA 1EG2A 1IWPB 3EA0A 4E32A 1L4HA 2Q41A 2D1QA 3F6EX 4KAAA 5DX0A 1RM4A 5GIOE 3V4OA 4ZIRA 1WF3A 3LVQE 2WOOA 1XEWY 3RUPA 4HZUB 1L7EA 4BVKA 2E85A 5IUKC 1RD4A 2IYZA 4L5BA 4NG5A 1C0PA 5K3DA 2AN3A 4D6XA 1K8YB 1NMXA 5L9XA 4BGVA 1Z45A 4HDQB 4Y0NA 4BRSA 2Z3ZA 1J42A 3CKYA 1Z13A 4EW2A 4KH0A 3T5MA 3U3JA 1MJNA 2GX6A 1FDOA 1R2QA 4JB0A 1TK2A 1QZXA 3JWIA 1QJ4A 3GRUA 5K2MA 3PSHA 5KNLA 4I1RA 5FLMG 2PH3A 1SQGA 3P7MA 4KW7A 5ALNA 4HWKA 5AI8A 4WK0B 4AY5A 4EMBA 1GITA 4D3FA 1EA7A 2I54A 4N4AA 1AM4D 2HZ7A 1OH6A 2PKWA 1SWWA 4BVAA 1W4RA 1Y1WG 2IP1A 1LLQA 4O1HA 2QLBA 2Q7OE 4AX4A 3L7MA 2J5BA 5FQOA 2C28A 1GZVA 1TM5E 3BWCA 1OYOA 1XALA 4QU8A 3A9WA 2ENWA 4RNMA 1I0LA 3NZEA 4ZVQA 4ECAA 2P62A 2HK9A 1FQOA 2CE7A 1XU7A 4WLOA 3AF5A 1T5DX 1JH8A 5BN5B 1RAIA 5EIEA 1YS6A 5EHQA 4OXNA 1UFRA 5ISMA 4TKLA 2YWJA 1M5RA 4V2UA 1H1LB 1CLEA 1P2BA 3W9SA 1GL6A 3IQIX 2JAHA 4Y9RA 4EELA 4INZA 5EEHA 5CEFA 1AV7A 1C4WA 4MR8B 4WY8A 5JO9A 3O4VA 1MC5A 4LG1A 2UVQA 3AM3A 2ZJ2A 5DT9A 4YAKB 3GZTB 1ZH0A 1OWTA 2G5TA 1RJPA 1KR5A 2OSVA 3HBNA 3BHJA 1VCNA 3KHSA 2P7HA 3GUUA 4MUIA 1E1LA 3K0BA 2SICE 1BKDR 2OORA 3H4IA 1PO7A 4LSZA 4RBNA 5A6SA 1E2PA 1ESEA 1OT5A 3U26A 3IVXA 2WWYA 3KSRA 1YFJA 3QVGA 3GLVA 1U9YA 2QWXA 4R2IA 4XQEA 3RU9A 2VJYA 2RMKA 2JFPA 4M1EA 3J7TA 3FRIA 4QWWA 4WNCA 3HOYG 1NU6A 1UWVA 2R7AA 1PNRA 2ZVQX 4PLZA 2KYRA 2V7TA 5E3JA 2R8BA 3QUSA 4V0QA 2QVLA 2PPLA 4XSVA 2RGAA 2J9FA 1R0CA 1ZNYA 5J5VA 5I5SA 5J40A 1JU4A 5DEOA 2ZXFA 4KO1S 4FSXA 1GRNA 1RHRA 1FFAA 5DQGA 1Z28A 1N2IA 2QVZX 3AC0A 5D00A 3NH9A 3QTBA 4YECA 4QBTA 1CVLA 4BKQA 2CLLB 1EGMB 4Q9NA 5LZ8A 5ITZA 5JD3A 3K2IA 5IYDG 2IUYA 3OI7A 4LXUA 3KLPX 1UK8A 4Y7CA 1QC5B 2C35B 3UG6A 3THRA 4ND8A 2W9BB 2J1LA 4DSNA 1CXZA 2R82A 1BZYA 1R18A 3KU4A 3ZCQA 1KQPA 2NYRA 3RV3A 2NYAA 1NPYA 5ADHA 2O0HA 4B35A 4YEDA 3K9GA 2V7VA 3IUYA 3AINA 3FETA 4I1YA 1QVRA 4DF3A 2IYOA 1CULC 3UYLA 3OPXA 3DPIA 3ER9A 2EVWX 4MA5A 1GA1A 2Y2UA 1NYRA 2X41A 2IDMA 4TL6A 1EFKA 2NU8B 3DFUA 1U8FO 1OH8A 3IL2A 3WDKA 4DDWA 1QOPB 5IWAB 4DJ5X 3RIYA 3PR4A 2ZBEA 3DFFA 3PE3A 5BNTA 1K3UB 3E3MA 1P7VA 3ANLA 1MJGA 1QU2A 4BZZA 1ZC3A 3KLOA 3C4VA 1UOQA 2GJ9A 1N6OA 1GSHA 3H1EA 3WXBA 1J2JA 4CM9A 4Q03A 4WNIA 3H4TA 3QU9A 4IDCA 1RQ7A 4Q15A 3T3GA 3W5BA 1ZWKA 4BU1A 3CRQA 1DAGA 1IEWA 5G0TA 1YRHA 2QUZA 3N05A 1Z2PX 2ZWOA 3T9DA 2DRIA 2NQ8A 4ZANA 1SCKA 4IZIA 3LRPA 4BVLA 5BWOA 1ZHFA 5KOJB 1VE5A 2W6MA 5TE9A 2JA5A 2WV9A 3ITNA 3VKWA 4ZJPA 3JAMW 5ALGA 4RIHA 5H8WA 3ZDFA 5JDCC 3H7AA 1J97A 4LJ9A 4MARA 2R1TB 1N1GA 1F2UB 4JLMA 2HIGA 2NSJA 1Q6ZA 4XZ3A 4QFMA 2W2VA 3IVCA 3I01A 3KWJA 3COSA 3OE1A 1LVUA 5L1JA 5THXA 3FXAA 3WYBA 2FK8A 4FFVA 1IE3A 1QZ3A 3ODPA 5LIRA 2H06A 5DN6A 1TCAA 1IN5A 4R71A 1G2PA 2LNDA 1CY0A 5BVGB 3A11A 1YB2A 2ICAA 4XTRA 1P2SA 3KHRA 1R9JA 4Q4AA 4OB6A 2GCIA 1NJSA 4WBNA 1FJGB 2C2RA 3QKTA 2A9QA 1SUWA 2XDYA 3ESZA 1WW2A 4E3ZA 5JLAA 1S68A 3G2LA 1X7GA 4HX9A 1B14A 4J43A 4CUJA 1UFVA 1G2QA 2QV7A 4G0UA 4P98A 1X8JA 5JVDF 1WHTA 2O06A 3CUWA 5BYBA 2ZANA 3LQ1A 3DCYA 2H08A 1TYCA 2ZIXA 4WHMA 1P0IA 2VP5A 4U3JB 5K0FA 3Q8MA 1YI1A 1P1FA 2OCKA 1QO9A 3QY0A 4BVBA 1L7XA 4E1BA 2C98A 1CB0A 5D1HA 4P7KA 3MF4A 1T5OA 5HQ3A 4YR9A 4AN0A 2AOWA 1TK3A 1A82A 4DJJA 3TMKA 2ODQA 1YB1A 3G8YA 4BO8A 9MHTA 4HMOA 5B1IA 4KNWA 3TQOA 1K5HA 4WZAE 3ZLTA 4DRXB 2HDKA 1UEJA 4QPJC 1PEDA 2CEKA 4FXPA 4E1AA 1F3OA 1UDXA 2Z5LA 5JJLA 3RFTA 4HYYA 4CUKA 4CUZA 1PSDA 4G84A 5TGTA 1EYZA 4Q21A 2Z43A 2C20A 4ON9A 3GPCA 2JHCA 3UMJA 2QYTA 4A73A 4M9ZA 2HJWA 4F3CA 4F06A 1V5IA 1PZFA 3KYCA 2QVCA 1KZHA 1XA0A 1XVIA 1EHCA 4RA6A 2P69A 2JAWA 4LFAH 5DNUA 2Q8QA 3IDQA 1N2CE 5L3QA 1J70A 3HN2A 1WD5A 1TZJA 3AVQA 3PQFA 4Q9AA 4ESEA 3R9RA 5AVUA 3H8VA 5KOHA 1VIAA 5JD6A 2B37A 4GZMA 4EUKA 1SU4A 4NJMB 3PWSA 1RR6A 1RIIA 3DL7A 3GJ8A 1T3NA 3RFVA 5TEVA 1A7JA 3HL0A 4BKOA 3JSLA 1C8BA 5H1YA 2QRQA 3HUEA 3TY5A 4HNAB 4X65B 1CUYA 2CFSA 3W8NA 4GKAA 4C0KA 4D9CA 1PN3A 3AVOA 4R7TA 4HAXA 2F90A 1PDWA 5C5CA 2OHFA 4R8UA 4H1HA 3KSZO 2JAXA 3KEQA 4JCCA 2Q3EA 1VBNA 1LC3A 3TCXB 3TOCA 2J0EA 2G17A 3N5KA 4GYJA 4RD4A 5CVJA 3L84A 4UQLA 1N9GB 2IV7A 5F7XA 4KACA 2GBLA 3GTMA 5HV6A 3OZCA 2GBLC 3NAGA 1Y7TA 1HKHA 1S6YA 1BMFD 4MVYA 4A3LG 3GMIA 4YP3A 3EFHA 3HDJA 1YCFA 2HG8A 2XVYA 2G9UA 2QUHA 5KHLB 3UM9A 2IRWA 5MDHA 1TPZA 3SGLA 3MJCA 3FI0A 3VTFA 4RULA 4N3CA 5CPBA 2YZNA 2RC6A 4HVLA 5C1IA 2WTNA 1SC4A 3BILA 3W5SA 4G1BA 1JHYA 3BMQB 1CUJA 2J3JA 3IVRA 2IWHA 3Q4GA 4YQZA 1NXWA 1OBHA 2Y4OA 3VPCA 1UMDB 2COKA 3JALB 2Q5OA 1U7PA 2I9KA 3GEMA 3O90A 2H1CA 3M9LA 4BFYA 1T9CA 2XTAA 2EU8A 2IC5A 1U04A 2VS1A 4IAOA 3WGVA 2VK8A 1SKQA 4EVRA 5DNDA 3RKSA 4P3NA 3WLLA 1VB3A 3T4UA 2XA1A 4KVAA 2YV1A 1V6CA 2CL5A 2CCJA 2X9LA 3MWJA 3GCGA 3KTFA 4V02A 5KWSA 1XSEA 4BNYA 2H31A 2H4FA 3KEMA 5ITVA 4ZOLB 5DYNA 4OXQA 5J63A 1QLWA 2V7EA 2SKCA 5BOVA 1HRKA 3HVHA 3SD7A 2G83A 2FUG6 5AOVA 3U0VA 4QOJA 5IEJA 5J4VA 5JT1A 4KUHA 2PEZA 2X42A 4Q24A 3JATB 3L0CA 1YTUA 4ZRMA 5L1IA 3AUJB 2JLCA 2VO1A 5IJWA 3HBAA 4O7TA 1I2BA 1KYZA 3D4LA 1Q5PA 2FMTA 4GSYA 1T0IA 1WP9A 3S44A 3AP1A 5KYWA 2V9WA 4DIBA 4D97A 4WKBA 4LF9H 4IOJA 1QRRA 2VCYA 3ZK9A 4Y8VB 4AY4A 3U4MA 1C9KA 3CGGA 1ZQ7A 5LZ5A 3KS9A 2C3UA 4E2ZA 1SVUA 5HF9A 1NSFA 2JFGA 3INTA 4FM9A 4ASUA 3WGIA 3BGWA 1K4YA 5BYJA 4UPDA 4KQWA 1AKVA 1RYEA 1ECLA 2C00A 5EMJA 1ET0A 3ZI0A 2VBIA 1FVHA 4G0WA 2YNMD 4M1KA 4BHTA 4WVFA 4WX2B 4DV5H 3S2SA 4NWIA 1QP8A 1O03A 5JTTA 1CRQA 1DLIA 4QOGA 4ZMBA 2C54A 3QBTA 4TLLB 1T1GA 1BS1A 1AQLA 1VTKA 3DVAA 4D7AA 5FULA 5KFPA 1F6WA 4UM8B 2CXQA 4QO8A 1XD9A 2VHCA 5FH9A 2AFHE 4PSAA 4POAA 1AGPA 4G07A 1XR3A 2GR9A 3OEED 1CU1A 5ALQA 1E69A 1GPKA 2XMQA 1XZCA 2GBCA 1Z38A 5SV2A 1N8TA 4BZXA 4PN7A 5IM4F 2ZB2A 5AW9A 2JJQA 1FK8A 2F6RA 1C8LA 1NMSA 4L3WA 2Q5EA 1WQ3A 1DBIA 5LP6B 3IJPA 1SWVA 3CN9A 1XQVA 3HRIA 4DBLC 4YMHA 1J8QA 5CIQA 4LF7H 3GDGA 2JEOA 1KFEB 3J81W 2G40A 4R9NA 4NATA 5JJ5A 3KE8A 2X4LA 4Q6BA 3G6KA 3PA8A 1TRHA 1H8HA 2BY4A 4NCAA 2R6AA 4CLRA 3IAUA 2DTXA 2JD0A 4B6SA 1TT7A 4Q6WA 1KEUA 4RMIA 4RKYA 5FI3A 5J2UB 5GQSA 1UPTA 1N2ZA 4K9SA 1ZN7A 2RHGB 4NZPA 3PJGA 4GOND 1KY5A 1QFXA 3HOZG 3S24A 1LJLA 2RGNA 1FUEA 3JU3A 1Q57A 4JI7H 1V45E 2HT1A 1W75A 4DDHA 1PX2A 3PJRA 4C0HA 1A5AB 4CQLB 2CHFA 4ER3A 1DWUA 3SJ7A 1N6IA 1L4MA 1XTTA 3COVA 2YN0A 4GR9A 4BX3A 3ENWA 1KJNA 5K0LA 4E2YA 3PR3A 3U31A 3UATA 4G1VA 3GG2A 3VFDA 1HOXA 2ACEA 3N2KA 1M83A 1D03A 1CUEA 3L4EA 3NYRA 3NM6B 3HJRA 2G04A 2GZ2A 1WPQA 2C1EA 4DCOA 1PJRA 1R6BX 3R2JA 3IBCA 3R6GA 1CEYA 3UK2A 2RK3A 1XMPA 1HBJA 1JS1X 1G291 3SBDA 1T9BA 3AJAA 2UXC