3DF7A

Crystal structure of a putative atp-grasp superfamily protein from archaeoglobus fulgidus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
305
structure length
301
Chain Sequence
SLKLFLFEFATCGERIEDSTAVEGLAMFKSAFDGFKNYYEITGFVRPEFSCLFTLPVDSMDSMEKYLEKSDAFLIIAPEDDFLLYTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRGEVQVPQTSLRPLDCKFIIKPRTACIGFSDEVPDGHIAQEFIEGINLSVSLAVGEDVKCLSVNEQIINNFRYAGAVVPARISDEVKREVVEEAVRAVECVEGLNGYVGVDIVYSDQPYVIEINARLTTPVVAFSRAYGASVADLLAGGEVKHVRRQMVRKSKSAEKPYVSVGDYTLEIIDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative ATP-grasp superfamily protein from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Putative ATP-grasp superfamily protein
total genus 83
structure length 301
sequence length 305
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
A PF18301 preATP-grasp_3 pre ATP-grasp 3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3df7A02
3.30.1490.350 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3df7A03
3.40.50.11770 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3df7A01
2QK4A 3BG5A 4O81A 3U55A 4L1KA 2R82A 3G8CA 4ZOLF 4O4IF 3N8DA 3DF7A 1KJ8A 3R9RA 2W70A 5BPFA 3TINA 5LA6F 1Z2NX 5CB4F 3U9TA 1EZ1A 1GLVA 1VKZA 3KALA 1GGOA 1OBDA 4MAMA 5LP6F 4O7TA 3N6RA 4ZI7F 1OBGA 4HNTA 1E4EB 1W96A 3JRWA 4O7YA 1T36A 2R7MA 2YZLA 4FFNA 1C3OA 2HGSA 2W6MA 3QFFA 2VQDA 2FP4B 3RV4A 2DZDA 3Q2OA 4IHJF 2ZDGA 3TIIA 4O7NA 1C30A 2W71A 3U54A 5C1OA 5CA0F 1KEEA 1Z2PX 2W6ZA 1SCUB 2DLNA 2YZMA 3ETJA 1W93A 3JZIA 3LP8A 4FFMA 2Z04A 3V4ZA 5C8YF 5BMVF 5J2TF 2FPGB 3E5NA 4HQ6A 1VBHA 1IOWA 4FFOA 2NU9B 3WNZA 2W6NA 3KAKA 5HBRB 3HBLA 4HNUA 3HB9A 2R86A 4ZHQF 4M9UA 4O86A 1DV2A 3VPCA 1A9XA 4NYEA 3V4SA 3R23A 5CA1F 4C5BA 3K3PA 2PN1A 5IYZF 2YZNA 1CE8A 4I50F 2FPIB 1CQIB 1KC7A 1EHIA 1B6RA 4EGQA 3ETHA 3OUZA 4YJ3F 4O4LF 1JKJB 4XZ3B 1EUDB 1M0TA 3I12A 3UFXB 4MV1A 1IOVA 2YWVA 3MWEA 2NU6B 4O7ZA 4C5AA 1E4EA 1Z2OX 3MJFA 3VA7A 4FU0A 4YAJB 5KX5F 1VBGA 2YZGA 3GLKA 3R5FA 4WBNF 2R7KA 2C00A 4O7WA 2W6PA 1ULZA 5LYJF 4MA0A 1WR2A 2YRXA 1I7LA 3AW8A 2Z02A 2YYAA 3K5HA 2XCLA 3ORRA 3OUUA 2P0AA 4XX0B 2QF7A 2XD4A 1JDBB 2ZDQA 4O4JF 5HV6A 5JH7F 4I55F 4E4TA 1GSOA 1PX2A 1KJ9A 2W6QA 3G8DA 4I4TF 4IIJF 4O2BF 3VOTA 3R5XA 4EG0A 2CNQA 3NUAA 2NU8B 5JVLA 5FNVF 2YW2A 2R87A 4FGRA 4QSHA 4HNVA 1DIKA 1KUTA 4FFPA 3RUPA 2ZDHA 4FFRA 2CZGA 2GQRA 1GSAA 4O7VA 2R7NA 3TIGA 1KJJA 2X0SA 4FE2A 4C5CA 4DIMA 5KKNB 1KBLA 2OLSA 3MWDA 5C1PA 1KJQA 2DWCA 2VR1A 3LWBA 4YB8B 2R85A 3KAJA 2NU7B 5LOVF 2I80A 2YS6A 1DV1A 2V5AA 1EUCB 1JDEA 2GLTA 2SCUB 1KJIA 4ZQIA 2NUAB 1BNCA 4FFLA 4MV4A 4DLKA 3TW6A 2I8CA 2VPQA 3JZFA 4O84A 3U9SA 2DIKA 4O4HF 1M6VA 4MV7A 4ME6A 5D8DA 2YL2A 1A48A 2FPPB 2YS7A 3ORQA 3RV3A 1BXRA 3K5IA 3R5HA 4YAKB 4MV9A 4MA5A 5H80A 5BPHA 5CAEB 5GONF 4YBZB 3TQTA 2PBZA 3VMMA 5JQGF 1B6SA 1M0WA 3JRXA 2R7LA 4MV3A 2GPSA 4O7SA 4Y8VB 4RZQA 1CS0A 4O7RA 5DMXA 1CQJB 5LXTF 2GQSA 5J2UF 1JLLB 1GSHA 3HO8A 3Q1KA 2IP4A 4XYLB 1PK8A 2HJWA 4TV8F 2FB9A 4HR7A 2CNVA 2WYOA 3GIDA 2J9GA 1EYZA 2R84A 4O7LA 3RFCA 4EGJA 2I87A 4XYMB 3WO1A 4MV6A 3AX6A 4YJ2F 5EZYF 4TUYF 5JVDF 4O82A 4IZOA 2YRWA 4O83A 1AUXA 1I7NA 2GPWA 2PVPA 3KREA 2V59A 4O2AF 3SE7A 5JQWA 2V58A 3VPBA 2W6OA 3WO0A 4MV8A 4TV9F 2CNUA 1AUVA
chains in the Genus database with same CATH superfamily
3FNHA 3DL4A 3VGJA 1LPNA 5ELMA 4I4LA 3FI0A 4LCEA 5JS8A 5D3MB 3V8EA 3O2QB 3ONWA 2OM2A 1T15A 3QBJA 5TR9A 1RYMA 2XOEA 1KVRA 1RPNA 2VF4X 2XYRA 3FLAA 4W5TA 3B38A 5JADA 1HXHA 4LV5B 1QORA 1ATZA 3CBQA 3MS7A 5E7IA 5AXBA 4LTNA 2HMAA 3MM4A 1IQPA 2JJ2D 4AJNA 1X1CA 1TTQB 4I1RA 4F12A 1EFLA 1A9YA 1MQSA 4EUHA 1UPXA 521PA 1FP6A 4EHBA 2HK7A 3NYRA 1BCSA 4FKMA 3GTOA 2VUGA 1ODFA 2QIPA 2X2PA 1T9ZA 3H1AA 3EZYA 3P0HA 4PX3A 3PCTA 4O4LB 1KMHA 4E2WA 1QFJA 3HKBB 1W93A 3PI7A 4RJTA 3ASVA 4KAXA 1YUBA 3E5NA 1ZOLA 1MOZA 1NJGA 3PDIA 1P0IA 4CHGA 5BVGA 4UMVA 2FPRA 2WG0A 3FJ1A 5FO1A 3UPTA 1H2XA 3ONFA 5LMNH 1DC5A 1PG5A 4ROSA 1D2GA 2CL7X 4ZDWA 4JL5A 1H0SA 3JQEA 2QRVB 3N2LA 4OHOA 5EGSA 3VRHA 2P1DA 1MNAA 3EVNA 3M83A 5EMMA 1UBKS 4OK5A 3Q8RB 2E1RA 2Q3BA 5JSZB 3HKEB 2ZYDA 3V8VA 2QTNA 2PWAA 3UZOA 1ZVVA 1EVJA 1YQXA 1FVFA 1LVHA 2A78A 4DSTA 5F73A 2ZS7A 2Q9BA 1J8FA 4I5IA 1Z2DA 2O0MA 3LAWA 3PSHA 1L5GB 3OQBA 4UUOA 2PZ8A 4ZVVA 5FWYA 1XDZA 1PZNA 2CLIB 5FI1B 4FM9A 4C4AA 2B30A 1HWYA 4ZU1X 4CU2A 1DQRA 1YBAA 3AIOA 2BGTA 4EK9A 3ESAA 3FD8A 5D7NA 1L1FA 3TFWA 1SHJA 1NUUA 2VPXA 4PBCA 3GFBA 3JQ9A 4QJ3A 4M7PA 1JQAA 1BA3A 1LF5A 3NIDB 3NCHA 3U1BA 1ONSA 2C7RA 4W5JA 4WHXA 3IOYA 4LXIA 4PNHA 5EHNA 3UHFA 4FHFA 1EWVA 1UJBA 4RVNA 5KHAA 1GYPA 1L5RA 5GWXA 4B3XA 4MWGA 4R7TA 1X3SA 2VHJA 1P1RA 4LFBB 1I1MA 4ONEA 4L75A 4U7FA 3MXOA 3IB3A 4HTAA 5EKXA 2JA6A 4EFMA 1PW7A 5DTMA 5DQGA 3O47A 3AJDA 3CF0A 4YRMA 3TD9A 5JQGB 3TIGA 5EZYB 2A1TS 1T1JA 3WDMA 5KBYA 1NRXA 1US8B 4BTEA 3MWDA 3GFOA 3BKXA 4RNDB 3WMGA 2CLMB 1NI3A 2ZJ3A 3HN2A 3IQEA 3FZYA 3O4JA 3UMMA 4PYNA 1DADA 2OENG 3OZSA 2ECQA 4Y6OA 3U44B 3PL5A 3VI4B 3P45A 4PNEA 1VCMA 4NK5A 2BR4A 4HVAA 1CHNA 2F3QA 1XNRB 5IN4A 3QLUC 1LJUA 4HF7A 4EH1A 5JPCA 1WZ2A 4FFVA 4WCFC 1TYEB 1AQUA 1UBCA 1XZPA 1KP9A 3I5AA 3G88A 4L22A 2DQYA 3DXFA 4RQTA 5JAUA 5FUBA 3PNBA 3ZS8A 3FHLA 1L4BA 3AM5A 1J0XO 4MUJA 4XSVA 1EFRD 3SLRA 3FKJA 3W6NA 3JYQA 2Q3CA 4YRIA 3HR8A 2V55B 4NMLA 1EKPA 2GM9A 3A25A 3B7PA 1KYVA 3TKAA 4YQFA 2XA2A 2Y27A 1KI8A 3GIDA 4MVJH 2BDUA 3I9MA 1G3RA 3I04M 1AS0A 3TJRA 3AX6A 4MRMB 1TM1E 1FFEA 4M1YA 4B0OA 2ZU6A 4JXJA 3S5JA 4BVGA 1E5LA 5GJBA 4IJ5A 2OD2A 2PO5A 4MGKR 1Z4MA 4EYSA 1HE5A 1HZJA 1HE8B 4KHPB 4AY6A 4MV8A 2V7QD 1U4OA 3JQAA 5AICA 1RHJA 3PNSA 1A5BB 1L7MA 3D3KA 1QH8A 1VHJA 1W0CA 2GPNA 4UTXA 3T1YB 3A6KA 4HUQA 3TNLA 1RQ7A 4J2OA 4WNAA 1TADA 2C7BA 2Q9AA 1LZKA 3QGMA 1JKJA 4DPMA 2PWYA 4X60A 3MQ4A 4HDMB 5DDIP 5ITSA 1QH0A 1RJ9A 1Y9JA 1E63A 1H0RA 5DKFA 2ZM6H 1BKDR 3DLBA 4OP3A 4FFNA 3FUVA 5GAJA 4JR1A 1Z18A 8ADHA 5H82A 1LRLA 4UREA 3VNBA 4BFYA 5HCUA 3IDSA 3KYDA 1XRMA 3M5CA 3R6TA 3OJ0A 2NUPB 5FL7D 5ARBA 1XJCA 4V38A 5DRYA 1E6KA 2C4UA 2PD3A 5C8YF 3WA6A 3RRJA 3RU7A 4URFA 4BKQA 3G1WA 1B41A 1MORA 3ITKA 5J2TF 3S2ZA 3ZWPA 4ZZ1A 3VAZA 2ADFA 1PO7A 4F6CA 3U60B 1EDOA 2A9FA 2GWRA 2QYHA 2ZB8A 3LO5A 4UMFA 2B8NA 4PZYA 2JLUA 1W4AA 3DFUA 4NQZA 3I8SA 2GN9A 2HRQA 1B0ZA 3RUAA 3S27A 3EODA 4AF8A 4JEIA 5EZYA 3ELWA 4I0WB 3NC0C 5BQFA 2ZUFA 4NDNE 2XXBA 1CQIB 3GARA 2EDCA 5IU6A 2CMGA 5KTTA 2VBIA 3W8RA 3VHXB 4NPHA 2ZRHA 3HCCA 2F3TA 3MCZA 5FI5A 4BQIA 4A1OA 3E1GA 4Q1EA 1ADBA 5REQA 3WNCA 4JFAA 1E6MA 3IBFA 4DMFA 2O07A 3H2JA 1G38A 4A36A 1XDDA 4DLAA 5HX7A 4F3KA 2Q99A 3D6FA 2WJPA 4ARCA 1GRRA 4K9NA 2FSSA 2QTHA 3KHLA 2ZPAA 3PPXA 5EKUA 1XCLA 4MS3A 3AFNA 2QT0A 4RKQA 4RNMA 2NNLD 2CNNA 3LP5A 4Q37A 1PGOA 1NMSA 2WINI 4JWKA 2C9DA 2QTAA 5CD1A 3OF3A 3FUXA 3CJQA 5AXDA 4DLTA 4JKOA 5CGQB 2VSYA 4PEVA 1Y5NA 1Y34E 4V0ME 4F56A 1XCOA 2WT9A 4Z9XA 4KO4S 2WV9A 4OMFG 4JYCA 2WTAA 6REQA 4PZZA 3FIJA 1C80A 3ADCA 4XGRA 1HKUA 1O95C 5KG3A 2BR5A 2FPIA 2W7TA 1FIUA 4P0QB 2PZLA 5DLPA 5DU2A 3WK4A 2FFAA 2A5FA 2WT4A 3WLIA 4ZK6A 1WXEA 2NVUB 1E2IA 4K6NA 1NDQA 3A1TA 3NGMA 4UULA 1HQDA 4KUGA 1IY1A 1PX0A 2I4IA 3VYTB 4E31A 1CUZA 421PA 2QL6A 1YOVA 3A3KA 4HDMA 5HOQA 3FPEA 4GXRA 2HA3A 5CAEB 1OWOA 4UZFA 2JGAA 3EQ7A 4X63A 4EI2A 2ZIAA 3U1TA 1UC4B 2Z5GA 4EYIB 2O7SA 1DG1G 5AVJA 1Q0TA 1E3JA 3WMFA 3ZHBA 1T0BA 4BLTA 2FA9A 2BGWA 3TUIC 2FI1A 5ENVA 1K1SA 3GVPA 3CVOA 3OM0A 5DHFA 2JFYA 3RF6A 3RRNA 2OVFA 4KIUA 3D7MA 4LNAA 2VRBA 3HDVA 1DAKA 1QR2A 3W4JA 2GPTA 3VTFA 1QLWA 3G8BA 4CKWA 2HH9A 2NN3C 4V2UA 4B3DA 2HBQA 3THYB 1Q7EA 1XXHA 3GBVA 2QJRA 2FZ5A 1OZ0A 1ZX1A 3I39X 5EJ5A 2CNUA 1GPKA 3AOEC 1PNTA 2Q2WA 2QD5A 4WY8A 2JJYA 1E98A 1G0NA 3O9ZA 1M1NB 3G7SA 4JY7A 5JAQA 3UT5A 3RGZA 1E1CB 2YV5A 2YWBA 1XSEA 5CB8A 1BDJA 4B3FX 3AZQA 4WK6A 3W9BA 1VQ1A 3UKOA 5HIKA 4NYJR 1BDBA 1X80B 3X1MA 1BXGA 4JI1H 5TLSA 2UUPA 1FL9A 1U5BB 1VRWA 3F0TA 3LVQE 3LXUX 4XRRA 3RYFB 3MN1A 1NUSA 4LBYA 5DBHX 1P16A 4ZHQA 3GR6A 2GVZC 1W5AA 3ZQ4A 1FTSA 3SC2B 5HGXA 3WWEA 4KR6A 1R0KA 3EUFA 2IDMA 4QOIA 4IJKA 3GFVA 1K83A 5EWLB 4ZYXA 1EWQA 2NSDA 1KZGB 5IT0A 3T1QA 5B1EA 4UMDA 3I2FA 3O8OA 3U13A 1M1YE 4PAQA 4PRZA 2WLSA 3L6DA 1AKMA 4QGSA 3KR2A 5ALXA 2XYQA 1RAIA 3N28A 3SFVA 4HLDA 1O4WA 1Y5RA 3KUDA 3UWOA 4E5KA 1AZLA 5EP2A 1ANKA 5JR3A 1ODKA 1V9LA 3BJZA 1TQ2A 1VLVA 3LFUA 4F38A 1A9OA 2JRLA 4NULA 1NNI1 3QE4A 4RU1A 3DGFC 2PO7A 1B6RA 1Z6QA 4YTEA 3S55A 4BO0A 1C0PA 3TRHA 4DG5A 1PGNA 1WCV1 2A2ZA 5KFPA 5FR1A 2GF9A 4MV1A 2VVTA 3KTOA 5K0EA 2FSIA 4GC5A 3SQOA 1ESEA 5ABPA 4E1AA 3N2GA 2FSGA 2E48A 3LTEA 4NJOA 4GQIA 4ZRNA 3CLSC 1IOLA 1UFKA 5JAOA 2FK1A 1UM9B 3K6SB 2X2EA 5GONB 4J9RA 4QJFA 3KQWA 2FW1A 3PXBA 4O4JF 4KR9A 4TWIA 2QXUA 3HYCA 4Y0VA 3D02A 3DBRB 1I80A 5AVOA 1XMOB 5HOEA 1E3TA 2VYQA 3X1ZA 1FFGA 4Z8YA 2EKQA 2C8KA 2WM3A 3GT7A 2CK3A 5JTUA 1WP9A 1XNQH 2CUZA 2N1BA 3RB6A 2OLSA 4Y2UA 3OTQA 4XYGA 3VJLA 1SEIA 3UPDA 4ZEVA 4G0MA 3BE8A 3MCVA 3RO7A 4MNTA 4LY6A 2YHAA 5AW6A 2D00A 4OAQA 2Q5IA 1BNCA 4FFLA 3EXIB 2C5FA 1JW9B 3KKOA 3O95A 4HZUB 4Q3OA 3U7FB 1A4RA 2G06A 1U04A 1MN6A 4N7BA 1PUXA 1H9BA 3PNMA 2GPYA 9LDBA 2X1MA 4CV2A 5JSFA 2VJLA 2AE1A 2IKQA 3KL4A 1T94A 1TTPB 2J0UA 2V6BA 2WFLB 3EZGA 3U3OA 1WSBA 3G6XA 3GT4A 5FPPA 3NT4A 1B8PA 2JFGA 1M0WA 1F2UA 5CJ2A 4F93B 2GN4A 4UHKA 2PSSA 7ABPA 5ALLA 4CEHA 1F3LA 4EO9A 4ZREA 3H4TA 3NMUF 1ZW1A 2R93A 1C3VA 2D0OB 2D2VA 2H8GA 2GPAA 3FG9A 4FUTA 1CUSA 3NORA 4LSMA 5AP9A 1HEYA 5E9QA 1CY8A 1IHUA 3TTWA 4L9SA 4OGWA 1WX1A 4FR2A 1P1FA 1VSQA 4L8GA 4C7XA 3VSCA 3GYGA 2WJHA 4JT9A 1VYHA 2Z56A 4AP6A 3Q3CA 2YYSA 5P21A 3HXLA 1G20B 3GPIA 4D0LB 1YJCA 5JWOA 4NBNA 2I7XA 1NMYA 2VDOB 2H5IA 3FFAA 3HJBA 4LDQA 1EM8A 2DBQA 3ZJVA 1JWLA 4BQQA 2FP3A 3DUFB 1U9JA 3GEEA 2PTGA 3QWUA 3ROZA 2C99A 4MKXA 1C9DB 4ZZIA 1BRTA 4HDOB 1W6RA 1E4GT 3I2HA 5T57A 4A0QA 4F84A 4DB4A 2YCBA 3C5HA 2EV9A 2G5GX 3IT0A 1USUA 4BB0A 2XF8A 3EDQA 5F21A 4C87A 4CIYA 4L9WA 5M3BA 2VTDA 4FWTA 1PZFA 4L74A 4BNWA 2W00A 3B1XA 3OEYA 1W4BA 3DOJA 4GI2A 1DKQA 3WJ2A 1TYZA 2R86A 1QKJA 4UATA 4O86A 2ID7A 4H6WA 3ZU5A 3PNKA 3KTDA 5FD8A 4Y2QA 2HJSA 2WPDA 4QUBA 1CV2A 1MQ9A 3VU9A 2I9PA 4G0OA 4JSRA 4YRQA 3A27A 5A6VA 3AHIA 1AZTA 1U8YA 4I50F 1UCFA 1YRAA 1UMBA 1WBJB 3O8QA 4L51A 5CW1A 2OD9A 4GRDA 1ZC3A 1P2UA 2XZDA 3VH3A 2KJQA 2ZAYA 3F47A 3STXA 2SCUA 1W4RA 5G1PA 3EXIA 1IOVA 1QHHB 2R1TB 2DJ5A 2OLEA 5H3CA 3ZGZA 2E1PA 2WEKA 4WL0A 4J3FA 1EWTA 1UUFA 2JGMA 2P6UA 3DE1X 4HQRA 4TTVA 3UQZA 3CVYA 6ABPA 1H1LA 3WMWA 3N8GA 3ZHOA 1TMYA 3PW2A 2PUFA 4X6LA 1SZJG 3L0OA 4HRXA 2ODNA 1EE9A 5CFLA 3CSSA 1DKOA 2VJNA 3JZDA 5CVUA 4ZVMA 4JI8H 3T5HA 4EG0A 2JAHA 1OI7A 5C51B 1PSZA 4M98A 2JLZA 4EEQA 1EFVA 1N2SA 1SUAA 3CQ9A 3V7WA 1S2NA 3DKRA 3MRTA 5AVKA 1KJJA 3IVXA 2I3BA 1B8UA 1QO0A 2ZROA 3TR6A 1P3Y1 4Q03A 1OIWA 2BKLA 4QQ8A 3TE6A 1GM5A 5I3CA 2YMMA 1BX0A 4UTNA 4ZTZB 3UH1A 2R5FA 5ENDA 1CS4C 4BAZA 3P9NA 5D3MA 1TW3A 4MWTA 1JJ7A 3LXMA 1NBHA 2IELA 5KFEA 3B3JA 1XUOA 3OZAA 3RR2A 8ABPA 1O7JA 2B8JA 4YV1A 1VBFA 5C3MA 5IVKA 1ST3A 1P6XA 1VXOA 4PX5A 5IX8A 4ZAWA 4RAOA 1P19A 5KNDA 1Q92A 4MV3A 5DLFA 2G09A 3EJ6A 2HXYA 4IV0A 4P80A 4PYOA 3IIIA 5EVJA 3ZBTA 2AU0A 1NZJA 4JBXA 5J9FA 4CXMA 1QE5A 2QVGA 3KJGA 1WCMG 1CR1A 3KUCA 5KFZA 2VP5A 2EJUA 2FN7A 4G1CA 3I6IA 4F7DA 3WHLA 1GUAA 1XPUA 3PHHA 1LFAA 2IZOA 2QDKA 2YFHA 4IIGA 1TEZA 3RKRA 3VDRA 2ANCA 4H27A 2Q6TA 3QKRB 4JU8A 4MI1A 4RMIA 4B46A 4BWGA 4C0JA 4QGGA 4QLOA 3DZ8A 4ZU3A 1KRXA 3RBVA 1UWCA 3I0ZA 4MYHA 2DLCX 1TECE 3W2HA 3RBEA 3PX7A 5J5CA 4NENA 5L4LA 4CL2A 3VZRA 2PDAA 3D8NA 3IBGA 1PDOA 2G0NA 3OHBA 1VCOA 4EQ5A 1UK7A 2W9BA 4RETA 4OO3A 3OTOB 3D8RA 3CUWA 1XVAA 4TWAA 3W5IA 3K0SA 2HU7A 2A4KA 3NJ8A 1Y9ZA 2Y67A 4HNTA 3F9CA 2FMAA 1LSJA 3L04A 2P9GA 3G0DA 3I9LA 3Q12A 5AK3A 4YH1A 4UCVA 1F5SA 4DOMA 2FKLA 1AKWA 1Q57A 2X6TA 4EA8A 5CA0F 2OUIA 4YV7A 1D2AA 1XTIA 2M6LA 2QI9F 2P6OA 1GYFA 3ZGYA 2GUGA 2EYUA 4HYKA 1MENA 2O2HA 3MINA 2XNDD 1NMXA 1ZZEA 2CJWA 3ZIUA 1JKMA 4ZJPA 1V35A 4QXOA 3QA9A 3UANA 3QFTA 4RSMA 4Y3UA 4JFRA 1GG8A 4IHKA 4QBIA 5FLKA 5KYUA 2PH5A 5CCBA 4LDAA 4KXFB 1RCFA 5IN5A 2GJSA 3TTSA 3DEHA 1TA8A 1PJ4A 2Z2KA 4HGNA 3OQIA 3PEUA 3PUXA 3AF6A 2OXTA 2GZRA 3H5LA 5C80A 2QSZA 2KB0A 5K9ZA 1YFJA 1IZ0A 1E2EA 2QW1A 5DN6A 1DKUA 4U7DA 1AY0A 5HCIA 4JROA 3NT5A 1QNFA 2QUHA 4BO8A 2ZUBA 1RMYA 3C6KA 3EIXA 3GJSA 1VI6A 4BB6A 1D1PA 3D6MA 3ND7A 3QX3A 1BX3A 1JX6A 1TA0A 1FBTA 1WB6A 3DMDA 5BV7A 2OCBA 4LJRA 3J81W 2RCNA 5HBGA 3WXBA 2RGWA 1TT5B 4UBIA 5EZQA 4I55F 3P2OA 4DRFA 4O4JA 4A26A 3JAMA 2QAGA 3M7IA 3M33A 4BBRG 2QRQA 3KJIA 5JVLA 3BA1A 2FPSA 4OXRA 1VHLA 4FFPA 5DSZA 2A1IA 3JWPA 3F8NA 4FYXA 4RIGA 5MDHA 2W90A 3NHBA 4YACA 4BP1A 4DIFA 3RRMA 4ZI2A 4AURA 1TM5E 1IBSA 1VTKA 2FFQA 4XYLA 3DZHA 3OTIA 5L7WA 3WL8A 3SKYA 2Y0SA 3I1IA 4ENTA 4WJZA 3M0EA 4NENB 3MRSA 1EA5A 1EKXA 1QRAA 1YTUA 1G20E 2NU6A 3IV6A 1IMJA 1X9HA 3NM6B 1YVEI 1VHWA 4GO1A 1X1BA 5IKEA 4MQLA 4LY9A 3HBJA 4ZYYA 1U90A 2ABWA 2XUHA 2XTAA 2PGOA 3PXUA 1JG6A 1AQIA 1B2RA 5L4NA 1R9JA 4NMHA 1U7PA 4YRGA 1GSHA 1V1RB 4KOAA 4RH0A 4WQMA 1N6NA 4M38A 4MULA 2CKDA 4FGSA 1H3NA 1OC4A 3L8DA 3HK2A 4BNYA 5LQCA 3L8YA 2CLOB 4PTLA 1ST2A 3S8EA 4JH0A 1Y7LA 3CUTA 3SVZA 4TVIA 1Q6ZA 3G23A 3KB8A 1UWKA 4Y67A 1AKQA 1RHRA 2WWHA 4XFKA 3KS9A 3L93A 2JI9A 3E81A 4Q7LA 1QX3A 3BIJA 4UCUA 5BSWA 3T3DA 2B35A 3LECA 3I9JA 2W8LA 5I45A 3P32A 4I99A 2ID8A 1L4MA 2VOBA 2LRHA 4GE3A 2IKSA 3GL9A 3BGWA 5DK6A 2G8LA 1HT0A 4BY1G 2EP5A 3HU2A 3ZDCA 1EZZA 1K3UB 1YR3A 4Z4FA 1CU1A 3RB0A 2YIDA 3E7FA 2FK8A 1SRRA 1VL2A 3KXIA 1USIA 1DO0A 2V6FA 3HU5A 5CMLA 5AVTA 1IOZA 4ED8A 2HLDD 2J9XB 1T36A 3AU9A 3P9ZA 4G97A 4CFSA 1HURA 4MR7A 1E4VA 1EX6A 3DONA 4H17A 3ZK9A 3T3IA 4F8JA 4DMMA 2VDUE 2Q9UA 3A04A 2VEDA 3RIXA 4XVRA 2YY6A 4B8WA 1C1YA 7REQA 4H9GA 2C7QA 3IP5A 3T7KA 2G7ZA 2H54A 2HNAA 1OGYA 1U2TA 1WB9A 4Q21A 3FYHA 4CTMA 5JJCA 2WJ4A 4TMFA 3BMXA 1LWOA 1ZOSA 2P2DA 4J94A 4M60A 3UV7A 2XA1A 1YNSA 3PR4A 2Q2OA 3CZPA 3RFFA 3FKSA 2H06A 1IBLB 1NJ1A 4ER0A 4JUDX 4IDAA 2B1GA 4CTOA 1G21B 2VYVA 3FY4A 3KR1A 2NU7A 5HZHA 3C45A 5LLTA 1YDFA 2CLFB 3LCRA 1ZL2A 4HEA6 3RC8A 1PLLA 4XASA 2H07A 1NI5A 2PX2A 5LZ7A 1NUQA 4Z3KA 1CERA 2HF2A 2BFOA 3ZR4B 2G1AA 1NLYA 1KK1A 2WHPA 2PWBA 4NSNA 3IAHA 1XEXA 1JLKA 2YJZA 4RKWA 5K6TA 4U9UA 3JYPA 3AM4A 1ZK4A 2CNBA 4K3UA 4J3JA 4NYMQ 4WGFA 3V33A 5CAEA 4W9MC 4QOFA 1IXRC 3LT1A 3WGMA 2PFGA 3H3FA 2I2CA 3PVSA 4B3HA 1Q7RA 2Y99A 3DAPA 5EPUA 4EL0A 4GI5A 4M0KA 5G0VA 4ZEXA 1ZGZA 3GA0A 1JF8A 3QU5A 4GPBA 3NUAA 3O3NB 2FHSA 1V71A 5E6RB 2R8RA 4W5WA 4B0PA 4FHGA 4TXHA 5J58A 1Z5UA 2J32A 4K5QA 1R15A 3NV7A 5GV8A 3LTNC 3A06A 2X0KA 1BQEA 3TW4A 5LWQA 2NYAA 1KBLA 2JFNA 1XXHB 1HSOA 3AF4A 4O3MA 1KIAA 5CXSA 5JY6A 1R6XA 1E6EA 1YS1X 2J9FB 3E05A 2WYWA 4RDCA 4OFWA 3AF1A 2BKEA 3QMMA 4BVAA 2FLLA 1SKYB 3IT2A 1KT8A 1W8IA 5FL7A 3T6KA 3W1EA 4YONB 1RJPA 1U3VA 3AUAA 3CUKA 3MFHA 1T34A 1RI4A 4E21A 1NNLA 1M1NA 3UT5B 2VT7A 3G49A 4HTFA 4N01A 3KQKA 4JI0H 2XGQA 1WCXA 1YHYA 3F5DA 4P7JA 2G1UA 2OTCA 3OETA 2IL1A 3QFRA 4MW2A 4J7UA 5H9VA 1T8UA 3FUUA 1Y9EA 4KMOA 2HNBA 1ECPA 4N7MA 4IFTA 2A86A 1QB8A 4PNZA 3RD5A 4YV2A 3GMIA 1VL5A 5E6SB 3EMKA 2Q07A 5EP1A 3LBFA 4CHIA 4QULA 3CZAA 3IIMA 4WOCA 2H5EA 1Z7BA 1ILWA 1WUHS 3PD0A 4X8MA 3K09A 3D7KA 4DYVA 4DDHA 3LT4A 1M1ZA 1XZAA 3DFIA 4ZOLA 3EWIA 1MPXA 2FPGA 4UFZA 2I1WA 2AFIA 3D2BA 1CKEA 3EY4A 4J03A 2B3DA 2FSVA 3IYLW 3VX3A 2II6A 1XHEA 4IF6A 4RW0A 4X7PA 1PEYA 3ITDA 1KQPA 1QBKC 3B85A 3KELA 1FSFA 2HK6A 4MLCA 1P8LA 5BWNA 4FOPA 1LRKA 1IBMH 1KFCB 1V6SA 3DBVO 3FKSD 1YL7A 3PNVA 3Q7RA 3UTCA 1VPLA 4NFLA 5L3QA 3OA0A 1NI4A 1YHZA 3SSOA 3JQ8B 3QM1A 3VC2A 2V8OA 4W4TA 1Z8DA 2WUWE 3KHKA 1NBMA 4LFCH 3EEBA 3P9KA 3E3LA 3N0RA 2PE5A 2AF3C 2M6RA 2QYSA 2GS9A 5K09A 3I04A 1E1QA 1Z4QA 1Y6FA 2R7AA 1UFRA 3VNUA 2CFRA 2XAUA 5COQA 1NY5A 4AIIA 2YY5A 2G40A 2DERA 1N3LA 1D9ZA 2HLPA 3OE5A 3PHBE 4G67A 5B7PA 4E5SA 2H65A 1Y48E 4G86A 3SGIA 1NASA 1POWA 1UM9A 2GXUA 4FKZA 4LDNA 4LYDA 5AK5A 3UXEA 1UBNA 3RGXA 4OB7A 4Q7QA 2HLDA 3Q4GA 3E03A 4RF4A 5DP2A 4KRGA 1DJNA 1P9LA 1QIEA 1U1CA 3DBRA 2XEDA 4LX8A 4B79A 4QDTA 3BIXA 4EI9A 2C8VA 1EGAA 4PW0A 4M0UA 3OFND 1ZM3A 1E1DA 2BW0A 2JANA 4ITVA 1V6AA 3RC1A 4Z51A 2AGPA 3NU1A 3REQB 5JXWA 1GFZA 3FDFA 1YHNA 4JJEA 2FMIA 5ALQA 3P96A 4Y6PA 2IVZA 2J6HA 4PR3A 2GBLA 3IPAA 4B33A 2BHSA 3KSUA 2SKCA 1WTAA 5KX5F 2QVYX 3HCWA 1KSGA 1R8SA 2C95A 1BN7A 1AG9A 3KYHC 4MJXA 3TAXA 1QYVA 3FBGA 4MDEA 1I1NA 1PJCA 2FLNA 3KPUA 5EQJB 1YJXA 1TA4A 4KUHA 5CBPA 2G9UA 1Q21A 4WDQA 1BVHA 1NW8A 4BIIA 4P3XA 5FUWA 4ASUA 1DRUA 4ZU6X 3UAVA 2HA4A 1V4BA 3V1MA 4KB5A 1HTWA 3B78A 4EMBA 4ZOAA 1D6JA 3NDIA 2KBFA 3MLBA 4GR4A 3LLVA 3R40A 3T8YA 3COSA 3MYRA 4MR8B 1ZCZA 2FR8C 2PHZA 4HAUA 3W3ZB 4D81A 1X1DA 3C5EA 1FFBA 3LOQA 5KMGB 4YMLA 4AYTA 1DOAA 1DV1A 4PYJA 2GZDA 3IHKA 4B31A 1AHNA 8GPBA 3UIEA 4V1CB 4OXQA 5DM0A 1T3HA 1W2HA 2DY0A 2Z1MA 3BMNA 4L7QA 4UVIA 5DOZA 3LXRA 5DJ5A 5HG0A 3GLIB 1KAMA 2ZVQX 5FLXW 3RSFA 3B51X 2X41A 1M74A 3QWHA 5JBQA 5ULLA 4P83A 2FCAA 2BGUA 3HVHA 3UA4A 4JA2A 1CQJB 2ZRGA 3O0TA 1Z2AA 1YGPA 1SBTA 2IX3A 5BXYA 3CVUA 3MWMA 3USES 4MRAA 4M53A 2ZRLA 1FJHA 4LF8H 3Q7PA 4NJMB 3H0KA 3HXQA 4LQLA 1I0IA 3UWKA 4HDKA 1QCDA 2ZUUA 4MQFB 2E5LH 1FXWA 3AF0A 4K81B 2VP4A 5CLGA 1CY4A 5K3FA 2XODA 2YRWA 2HREA 1VJCA 4KVZA 2BI4A 2RGNA 3TPZA 3WP0A 4F46A 3H7AA 4DDWA 1OZHA 3CX7A 3FMFA 5CHEA 4JXZA 5BSFA 4DL5A 4BCCA 2E37A 1Y33E 3CFYA 3T9AA 2X5JO 4O3OA 4W8GA 3GLFB 3O2NA 3KXDA 5EWFA 5G0UA 5C52B 2H6EA 2ZSFA 4CV0A 3U9TA 1MOQA 4PQRA 5CA0A 3ZD6A 1ODJA 5DNYB 2P2LA 2P75A 3MGGA 3PQDA 3RRYA 4DLWA 4MYCA 4F6RB 4YRZA 3UJ3X 2VCYA 5IT9A 1SRQA 2A0WA 1RQNA 4EX7A 4B4UA 3LCUA 1YFZA 3CSWA 3HUEA 4GDMA 4K6CA 3PCRB 3JQFA 5JAIA 1YR9A 3BHNA 3OU6A 1N5DA 1CUYA 2Q7DA 4ABYA 3HYNA 4ISBA 1O95D 1D9XA 3BAAA 2ZXUA 4BV2A 3RU2A 1VJ5A 1LDNA 1BOFA 1OXUA 4JIMA 4R1OA 1YR8A 1J9ZA 1W2GA 5FBQB 3SYKA 3VU0A 4E03A 4ABTA 2W2KB 1YQEA 4II3A 1A7KA 3I01M 2CNKA 1WSCA 1JQDA 4ZT7A 1M10A 1AXGA 4GM4A 4BIMA 3N87A 1BH2A 5EE0A 4JI6H 4LY3A 4J7AA 4KODA 2W93A 3WLKX 2QT9A 1JSXA 2ZCVA 2I3GA 1MDFA 3H8JA 2VZ8A 1K7CA 3L9WA 4N3NA 3VYWA 2RB5A 2WI8A 2WWGA 3UMRA 2PUCA 1QIJA 3OTOH 3CMMA 4CEIB 4XIJA 2ZWMA 4L08A 2HCFA 4CM1A 3TN7A 1P4RA 3ZGLA 4WNCA 2QN9A 4D4LA 1ZUWA 3EMDA 5KYYA 2E3JA 3BIFA 4MARA 3P2YA 3ESDA 1QU2A 1NRWA 1M66A 1H9AA 3WRYA 3EDYA 1E66A 3D6AA 4DNOA 5BQ5A 4O3FA 4DR3B 2HWUA 2XQIA 4LOKA 4W6ZA 4A03A 2R87A 4B17A 1NQAO 3FI9A 5FBKA 4DCGA 3DTNA 1H8HD 1RKBA 3PFHA 4LKOA 3SPXA 3K9CA 4M8LA 4RYDA 4PHFA 3AP3A 2R7NA 1QZTA 5EIBC 5FOVA 3SGLA 1HQYE 4OREX 3HMQA 4INPA 4X1OA 1ZH8A 4L0QA 3TDKA 3IP9A 3GLTA 3Q8PB 5LOVF 3EK2A 4H1VA 4PQYA 2XJ4A 1I3QA 3QEOA 4QAQA 1YSCA 4DWJA 3S1LA 2HRRA 2YNMA 3MS4A 2VWGA 2HW8A 4LOHA 2G77B 3K16A 1ZVQA 1U28A 3I2GA 2LV8A 5A4JA 2W9BB 4PX2A 1AHIA 4IW3B 4A4DA 4AXBA 2Q9CA 4D6PA 1XMSA 3KV1A 1UJ6A 2GT1A 1NRIA 1U8TA 4NF2A 2OZLB 1GJRA 3TNYA 5FHQA 1DXHA 3VMMA 2ZSIA 3ICWA 4NDAA 3S3TA 5G40A 3SQDA 4D43A 3GZJA 1U11A 4E70A 3AJEA 4ZPJA 3B7GA 3WGLA 2C59A 4G63A 5BWBA 5ADUS 2H2GA 5FXMA 1M8JA 3K8QA 3V46A 1IU9A 5CURA 5F9FA 1ZPDA 1SOVA 2J9GA 2GXSA 3OAAA 4FW8A 3ZJYA 4D3XA 1UP6A 2EHDA 2QM8A 3SQNA 3SU8A 4E11A 1U3WA 5T6BA 3HOYG 2XMCA 3DUWA 3ENQA 1B26A 1CY0A 1M6EX 2PPLA 3EUAA 1U7HA 4LX0A 4NOKA 1DRWA 4F2WA 1LB1B 5KHOC 2DR3A 1Z2CA 4ADSG 3GLHE 4IMRA 2QU8A 4ESEA 3H16A 3FJYA 3MB5A 4WTOA 5AM4A 5A6SA 4CLDA 1EZ1A 3QEMB 1IBRA 3HWSA 4HDSA 3ZCVA 2L2QA 3LC7O 1VIMA 3EZ6A 1R5OA 2IMWP 3N40P 3F1KA 4AD8A 3KZKA 2WDZA 5FD6A 1AKVA 1LX7A 1MZVA 3FPJA 4MEAA 1Z4NA 3VQTA 2YQ5A 3EZ7A 3RAPR 5AQ1A 1A71A 1JYFA 3IOCA 4ZODA 3RE1A 4HYYA 5FRDA 4D9NA 1I33A 4RPJA 4YQWA 5F76A 1C29B 3SWWA 1M75A 1HH4A 4DMUB 3LK7A 4RHFA 2IXGA 2XDQB 4DHEA 1WG8A 4WOJA 1RP7A 2I99A 2P4SA 2YMLA 5KFMA 3CM0A 3OD1A 1KY3A 4U63A 3VR4A 2WVGA 2JLAA 3RIZA 3MGBA 2FUCA 1FRFS 1IYEA 2F1RA 3U0GA 2NSHA 1L1RA 5CA1F 3EG9A 4A3IG 1Z75A 2KYRA 4KE8A 1U9CA 1DGSA 4WUTA 4FCWA 3WZMA 4J07A 4J9PA 5CGZA 3P26A 1IE3A 2YIMA 1U3CA 2BMJA 3GDGA 4OXIA 3ZZ1A 4CIDA 4CI9A 4V0SA 3RABA 1ZQ9A 1HR0B 1H9CA 4EMUA 2ZGVA 4ARIA 2JGLA 2BFNA 1V26A 2GZAA 4MB0A 3UXHA 2FJZA 1IUOA 2BY4A 4YCBA 1L5HA 4DQVA 4CIBA 4O7WA 4EHLA 3ZBUA 4E7OA 4KV9A 3QI2A 4UOQA 3DB2A 1CP3A 2AW3A 2F43B 3ELYA 1BSVA 2IQ5A 1NVUQ 2DTXA 2WJJA 4U7HA 1JR3A 2XMRA 2MMCA 5CK4A 1W49A 2WILA 4JV1A 2ZUWA 1QJ4A 2R8BA 4NATA 1XZ8A 4URYR 4XJSA 4EFBA 1SBCA 2FFHA 5TGZA 5AVXA 2HZBA 2QN6A 1GOTA 1E9VA 4PLCA 3PQCA 4UTRA 3OKCA 2ZKIA 4GKBA 3ZZUA 3WQHA 2DPHA 5SZKB 3A11A 1T24A 4K6GA 4WKCA 5E38A 4CQLA 1DLJA 2L69A 4EYEA 5I8ZA 1K8YB 2IGBA 1JG1A 1XKQA 4U2DA 3E0QA 1X1TA 1YU6A 5E8JA 1D1SA 3FX2A 2OFWA 4BKMA 4AAYA 4ZQIA 2LNDA 3I1YA 1YC2A 2YHSA 2Q6KA 3NTVA 4WJKB 1IYDA 3W2IA 4LSAA 1KP2A 3E7XA 4JUZA 3RRFA 4F4XA 3LOUA 2FWAA 2WTMA 2VYVD 2ZYVX 4FS8A 4MYSA 5DRTA 4Z0NA 2HIVA 2NQ2C 3WYEA 3ER8A 3DTVD 2BGIA 3I4CA 3BOSA 4TTRA 2V9WA 1WUJS 2AWNA 5IK2D 3WAKA 5JMOA 2EQAA 3W6UA 5KYWA 1Q3HA 5AK4A 2I33A 4EDFA 4NXNH 3CE6A 1A3CA 1NBEA 1AD2A 2R8JA 1TQDA 2FWNA 2DBVO 2C3PA 1DFIA 2D2IA 1XVLA 2QLFA 1KO1A 3HA2A 4H7DA 5D1PA 4PVCA 4O02B 3UMSA 1ZRNA 3HUUA 4IPTA 4RK0A 3HKBA 2EJ3A 1UXIA 2WAMA 4H1TA 1RWQA 2WIKA 1J21A 4Q43A 2ZYSA 1EBFA 3DZCA 4HGRA 4KAJA 2FZ4A 4REOA 4TS4A 5CFNA 1RKVA 2IW1A 1IUNA 1TK3A 3MMZA 3KK0A 4OH7A 3RIMA 3JAWA 4OOEA 3UJ7A 3VV2A 3DT9A 5D85A 4CUZA 1J09A 4HYQA 4BEBA 2BGNA 1DJLA 1A50B 1AUVA 1NQVA 2QRVA 2NUTB 4UKDA 5EKSA 4D0SA 1E18A 1R6DA 4ZOLF 2GK7A 2I66A 2O06A 1G42A 3G7UA 3KHUA 4LI3X 1CUUA 4EPRA 5C4MA 1F51E 4TTPA 1DRJA 2RI6A 2Q1WA 4KWCA 2CBGA 4S3MA 1GGMA 3TRFA 1GPDG 2R00C 4RTKA 3TB4A 3KALA 5BWRA 1FBNA 3G5MA 4GGMX 3A6HA 4GDFA 3C6BA 2HSDA 3HLKA 4FXOA 1GO3E 4GBMA 5GOZA 5B7NA 5FOXA 3QE0A 3R9XB 5ADVA 2FG6C 4WHMA 4JVNA 4LDJA 5KX5B 3TOXA 1Y1VA 5JARA 3KUKA 1PFVA 4L3WA 4ZCTA 1P1KA 2ET6A 3CHYA 5FR2A 1DJQA 3K31A 3T7IA 3WMEA 1FZTA 3EAQA 5BQOA 4LRUA 4LWZA 3BZWA 1EP1B 2R8XA 4HB0A 1MP0A 3DR3A 3PN1A 1P1CA 3IUPA 2OV4A 4PC2A 3C3MA 2IDJA 4C7KA 1QYRA 2QVZX 5I5YA 1PDWA 2VQSA 4PY2A 4YJFA 4AF7A 4DIUA 1WXGA 3G2PA 3I5XA 2HZ7A 3BEDA 2R6JA 5D7BA 4HN2A 5DNDA 1NPYA 1I10A 1Z0FA 2NNWB 2VZEA 3BHJA 3FRHA 2UYQA 4L8FA 4L6IA 3SZ3A 4CMIA 3PTLA 3GRUA 2O7NA 4DMKA 3VR4D 1W1WA 2VP6A 4KAAA 3IUSA 3NOVA 3QUSA 3JR3A 4MQEA 4NWIA 3OX4A 3WGGA 3VKHA 2CEKA 4D8TA 4X65H 2XGSA 4LE2A 5IC4A 1JA1A 4FNOA 2A0UA 2GAFA 1E2UA 1VI5A 3NANA 1XN4A 4RV4A 3SOPA 3ZTYA 5TQJA 4PBTA 4BUZA 2UYGA 3NH9A 1FKAH 1M2GA 4J0FA 3RQSA 3KPVA 4JB2A 2HTFA 2R6DA 3CW9A 1XTTA 1AN0A 2B0CA 2BFDA 1E2GA 1J23A 1VI2A 1X7HA 1CRLA 5JAHA 3PJRA 5KZMB 1JLSA 1H4QA 3IO5A 2M1ZA 5L7YA 2FVXA 2P4HX 4A6EA 2BUAA 2VAWA 2PAAA 2FUG1 4WZBA 2CXTA 1EHCA 2B21A 3DO5A 4ASUD 3HCAA 4DLLA 1FVXA 2OCKA 2AF4C 1NV9A 1NKVA 4RZUA 1U9YA 4QWEA 3QNWA 3GD7A 4ZI7A 4GL4A 2IITA 4MINA 4Q44A 4MRMA 3CONA 4OYHA 2ALJA 1X8KA 4QRDA 3H17A 5JEEA 4HNAB 2R85A 3PA8A 2UXCH 1PR9A 2CNLA 2J3LA 4AJPA 1EQAA 1E3WA 1PQUA 3JV7A 2ZJ1A 4G5YA 2WE8A 4UEJA 4XWGA 1NI4B 1A7UA 2B34A 5BWWA 1U8UA 1XTKA 2WA1A 1ZH0A 4YLEA 3E5RA 3KDSE 3BA8A 1E3IA 3NBZC 3K5PA 1JAYA 4ZOEA 1SC9A 3B1WA 4GLLA 3OIVA 1FY2A 2ZIVB 3DH0A 2AVDA 2Q5QA 4I6GA 1BG6A 2QJFA 3JQ7A 2P2GA 4FC6A 1UQUA 2IGTA 3E9ZA 3A6LA 5DNCA 3E70C 1TNDA 5E4JA 2FRDC 3V1UA 2HGXA 1TZJA 1XP8A 4K87A 2XCTB 1XQXA 1KVTA 2OSBA 3KYDB 1I14A 3Q11A 1IM8A 4Q1AA 5E2AA 5EMHA 5B2FA 1OY1A 3LH5A 4OAPA 2YHBA 3EVGA 3GJXC 3X2SA 4DLBA 3SBOA 4Q7EA 4O3PA 2QMEA 3RFVA 3VO1A 3WE7A 3CZCA 1RU3A 3E9CA 5KSWB 1GG5A 2JVJA 1B3BA 3EWNA 1XTSA 4FGUA 5UKDA 4PZ8A 3CV3A 1B8NA 4UBJA 3R75A 2YWFA 1XL1A 1E7QA 4D74A 1JQ3A 2OFXA 1SUFA 2PLAA 3BH7A 3REQA 4L07A 3KKQA 3SJAA 2BTQB 3H87A 3ZD7A 2O2JA 1JHOA 1PG0A 2IHTA 2ZXFA 3CLUD 4O4IA 3VHXA 1TEHA 2DPXA 3CCBA 1RQ2A 1C1DA 2TECE 3V7FA 4Q5IA 1OBDA 5DI3B 1Z83A 3ZWYA 3FWHA 4LQ4A 3ZU2A 2AFIE 5E0KB 1O9HA 1ZJYA 4JI5B 1T3NA 1L8LA 3QFFA 4K0RA 1LVUA 4YJ2B 2IC5A 4X66H 3ZDZB 3U3JA 3VNQA 5A3QA 4S0XA 2W6IA 4KLAA 1KYTA 3IMFA 1V5EA 1R9GA 1A8QA 2ZYHA 5GPBA 1UEXC 4WFQA 3S7ZA 3SOZA 1UKYA 4A2WA 2WTFA 1DOHA 4QT0A 4WASA 3DWEX 4MGEA 2JCYA 2CK3D 2MYNA 3HXKA 4NR0A 5GIPE 3N59A 4ITUA 3PKJA 4HVCA 3FKIA 4RXMA 4LYFA 3VVMA 3R3XA 2F9LA 5TRTA 2XIGA 4KR7A 1SQFA 2VP0A 3CVJA 2JHGA 4CKEB 3KQVA 4DXHA 5KMGA 4Y7CA 2PLWA 4UVDA 3W05A 9GPBA 3L8MA 3QVVA 1DO8A 1I4WA 1E7MA 4B80A 1A4IA 4KFCA 4YXWD 4QT4A 3GV0A 1H2ZA 1QRTA 4DMLA 1U0NA 4D92A 3ZU4A 3SI7A 4HB2A 4EJSA 3OBBA 2OK8A 3EQ2A 4UFNA 4XIGS 4E2ZA 1PSWA 2GYVA 4BTLA 4ZMRA 2XRZA 3ZC3A 4OPMA 4KG7A 3MYYA 1SC3A 2Q4DA 3VYUB 4AO7A 4X9XA 4A9AA 1JSZA 3KFVA 4Q18A 4BGUA 3PDUA 3M9NB 1N1MA 1Z6GA 2WUDA 3CWZA 4YAGA 2UXBH 1KPGA 3X44A 4JYMA 5I01A 4O6VA 3QUQA 3OHPA 4HQOA 5JRDS 1UQTA 1XZQA 2ADOA 5ARDA 4CTKA 2X5KO 1EB8A 2BFCA 1SG9A 4FGZA 4CMBA 5HZMA 1CE8B 1JE0A 1TIKA 1GNQA 2D62A 3GIPA 3NDBB 3RFXA 1HY3A 1F6DA 5KG6A 2I6XA 6CHYA 2AT1A 1X6VA 4IXDA 4MP3A 3M2TA 5KNCD 1KQ3A 2FR0A 8ATCA 2O57A 1WHTB 5IVHA 3MTAA 4JEMA 2H4HA 3L82B 3ZDYB 1S4QA 4Z7NB 1F9EA 3RHFA 2QMHA 1K9SA 3CPHA 3K5IA 4HNHA 2FEKA 2VRCA 4F6RA 1ISHA 2RMKA 4N5IX 1KFBB 4C3OB 2ZITA 2EX0A 5LXTF 1T2FA 4ARBA 4FCVA 4QHYA 3HKZE 4E2XA 2G67A 2P35A 2PH1A 1N33H 1NDHA 1RKUA 3ZTWA 3GPCA 5BNZA 2W0SA 3ABZA 3QOWA 5TNXA 2ZIXA 4LYEA 3TCKA 4CJXA 2WYUA 4P7KA 2E5FA 2VT3A 1DWUA 3KDPA 4J0DA 4R0NA 1RXEA 5K0SA 4BFSA 2VRNA 3LPLA 4R2XA 5I8PA 4OK3A 5E6UB 3KL2A 1PBNA 4PRYA 1OB5A 1LBTA 1UOEA 2V6IA 4CKEA 1J2UA 1OFVA 1HO3A 3L1IA 2Q2QA 1IN5A 1GP2A 2QN8A 4KPGA 4MS4B 2UVPA 2YWDA 4QRIA 4GMGA 1PFUA 2BFBA 1ZOIA 1WQ1R 1ZWLA 4LY0A 2H1CA 1IY8A 4S1OA 3NM4A 4DVGA 4LOJA 2JEGA 4OHZA 2PMWB 4K05A 3ORSA 4M99A 3BCUA 4AUMA 3U80A 1U81A 3NC1C 1Z6ZA 4NIMA 4U8HA 4QNMA 2QW8A 2JEYA 3MT9A 4EVRA 1IN1A 1CKNA 2YNMD 1KPIA 3H5AA 1QV7A 4QM6A 3K92A 4LWOA 1SUIA 3K6SA 1F12A 1Z62A 4POAA 4H3VA 3K0BA 3WL6A 4MCAA 4WN9B 4PAOA 2QN1A 3LIIA 2W4MA 1TJPB 3NP7A 1VBHA 1MDBA 2MMGA 3AT1A 2F1JA 4FR0A 4CRWB 5HE8A 4E5DA 1P2BA 1X1SA 4IRKA 1DUVG 1K92A 1T1IA 2GTIA 4BMDA 4L78A 3CEJA 1Q3TA 2IYVA 1K27A 2HO4A 3H9QA 4B34A 1R50A 3IJ5A 4Y0NA 1GGFA 1S03G 5KOJA 2J6IA 4ETMA 1VMIA 1IMOA 4Z86A 4J43A 1GXSA 2JEIA 2YC2C 5L6MB 5HRCA 3PFFA 2AVNA 5CDHA 4YRKA 4WZBE 5F23A 2EKDA 3DVAB 3GGPA 5LN1A 3GRZA 5AOAA 5EWMB 1E5XA 3MCTA 2H8KA 3DE3X 3M3PA 1KF0A 1K7XB 2IA6A 4F0JA 1P81A 2XCOA 1SXGA 1UDBA 3ZWOA 3OJOA 5DX0A 4RZ3A 1NJ8A 1ULZA 2FUEA 1ZUIA 4K6MA 3P9PA 1GNSA 3QJYA 2F64A 1H66A 2BKXA 4UM8B 2OZLA 2JRCA 2JIQA 1KK3A 4ED6A 2E4VA 3HA3A 2RDJA 4EBEA 2VWQA 3L0SA 4H4CA 4L5CA 5DGTA 1E62A 1ZD3A 2GCGA 2DC1A 3KX2A 4QO8A 1TCBA 4RLQA 2HMVA 4E4TA 3I9KA 3NHFA 3G8DA 5ALYA 1CZNA 3JD3A 4LXYA 4XAQA 4CM8A 3GLGA 4IR9A 2N75A 2PKWA 1ZN8A 1DIAA 2PKRA 3RYHA 2MSKA 1MF7A 1W7AA 2Q4RA 1WVIA 5FL3A 3FGPA 4O8ZA 3C4JA 1S5PA 5KFUA 1OF1A 2GBLC 3EAGA 3ILYA 4TTJA 4D8WA 5JZ9A 1NZFA 1ISIA 1B43A 1LFDB 1U8ZA 1ECGA 4FTWA 4C0QC 3FTEA 3U26A 1GPNA 2VZ9A 3P2IA 2IUUA 1RABA 4O5OA 4KEAA 3V5NA 3ODGA 5KWVA 2JFFA 2OGUA 4BBAA 2AEMA 2WLTA 3MC1A 4M0EA 4V0RA 4QZVA 5FWNA 5JTTA 1MFPA 1I3KA 3RLIA 4MGYR 1QP0A 4QGFA 1G7TA 3B1JA 4LSWA 4U7CA 3VO9A 5CVDA 4BNDB 3DV9A 4GE0A 1KDPA 3O3MB 2Z9CA 3CINA 2OZEA 1UOPA 3ICPA 4N8DA 1QX4A 1B6SA 1ORDA 1Z74A 2A0KA 3KIPA 3D59A 1CUAA 1XRRA 2R6GA 1Y7HA 2O7RA 5BW4A 4QLBA 2B63A 4R98A 1N3IA 2FR8A 1NVKA 2NZJA 4HAVA 3FPGA 3WZ2A 5BV2P 3QYPA 4X92A 3BBPA 3IE1A 4QX6A 2OORA 3AR3A 4MDFA 1JA9A 5HW0A 2XDQA 1KZYC 1HV8A 1TFRA 2XOKA 3Q41A 2EYQA 3IIJA 3D0KA 1T9BA 4HH4A 4KQ1A 4TMWA 5KFHA 5A5VA 4ND8A 3AHDA 4IG9A 3T3HA 5KFAA 1EFUA 4EGSA 2GX6A 3K96A 3HOUG 4KSCA 5G02A 5IYZF 1IHOA 1LLFA 3TS1A 1SUCA 2QMUA 4ED1A 4TM7A 2IU0A 4RTSA 1N77A 4ED7A 2V4ZA 1BWRA 4MPRA 5FUVA 1C8LA 3T1OA 3UJ6A 5A3RA 3PA6A 4U7GA 2GCNA 4CM6A 5BN1A 2REBA 4C6TA 3B6IA 3QFCA 4BLQA 4YRSA 1AK1A 4MZXA 3QLTA 2CKZB 5FWYB 2D3WA 4YLYA 3KO8A 3RJZA 2IQIA 1C50A 1VMKA 2MINA 2JA5G 3QVXA 4MTLA 1AVTA 4D9GA 3TIIA 1N56A 2D1RA 2GN2A 2Y6UA 2ZPTX 4K2HA 1CUFA 1B16A 3KKNA 1UM8A 1SCUB 2WHRA 1QYIA 3AXTA 4CC6A 4X45A 1XMQH 3H04A 4OQMA 3NEJA 2ODAA 1NTRA 1UXKA 1T2AA 4NBLA 4ZRMA 2X0RA 3QFSA 4A8PA 5JZVA 2REXB 1ZISA 1M2EA 1ZJ4A 4GPAA 3W7VA 4HNUA 4R3UC 5ERYA 5C81A 1GGNA 5K03A 1XELA 2WM2A 3R3VA 4LYAA 4WLUA 1Z7GA 4W5OA 3BD8A 3TZEA 1D5WA 1G8YA 3TW8A 1YR1A 3CKKA 3ENNA 4S1WA 1R3DA 2LE0A 4Z9YA 1KDOA 1P0CA 4IJQA 2NTNA 2R8PA 3CF2A 3RS2A 1D2HA 2FQQA 3TFQA 1XEAA 5JZMA 4HD8A 3OOWA 2VDWB 1VPDA 3WLHA 1XFAA 2NXNA 2YASA 3KSBC 3VA7A 1PE0A 4M49A 1VG0B 4Y18A 3MT7A 1QRDA 1XVVA 4P38A 1Y4AE 3ZV3A 3T1YH 2MSLA 3DEZA 3ZCSA 2FVYA 3IUJA 5EOYA 4J0GA 5JNVA 3QZ8A 3PQ2A 3QYFA 5KNDH 3G85A 4I8XA 3ZH9B 3N7TA 3NRCA 1XT6A 1L8AA 2ZZMA 4AYBA 3H11B 1WQ4A 1CBUA 821PA 2AJBA 2CNQA 3ACCA 4ZGBA 4LV8B 3A4NA 2WR8A 5EXDA 4RCZA 3V7UA 3Q8KA 4F4UA 2HAEA 3QTBA 3TEJA 2EP7A 2W8BB 4I81A 4LXUA 4R8MA 2I6GA 1XD2B 1JEYA 2VAMA 4IJVA 4KZPA 2DPLA 3BXGA 4BU1A 4RVUA 4BN5A 2PR7A 1KJQA 2VQ6A 1Q1QA 4TZTA 3V4RA 1J97A 1TWFA 2XB8A 4DCTA 1UFOA 1YUMA 3BXHA 1ODIA 2EJBA 3HNPA 3WLAA 3ZYZA 2O0JA 4O1MA 2CMDA 4COKA 4F4FA 2C8LA 4JDPA 4HUQB 5BRNA 1WKVA 5AI4A 3VH2A 2EEZA 4CKXA 4DYDA 5BSVA 2D4HA 2IBTA 2W42A 1VS0A 1E2JA 5I5UA 4L8WB 3VDNB 3GEBA 4RCYA 4C6TB 3C3AA 3GLFE 4OI0A 1RJ9B 4EB6B 4PLFA 1PTJC 4G1VA 2W2PA 1TUGA 4R2JA 5GJCA 5K0ZA 3QLEA 2XXAA 4ZI3A 4LCJA 2A7QA 1GA6A 3ANYB 2O52A 2R7LA 4PWZA 4O7SA 5EXTA 3BQ1A 4OQFA 2PKCA 1Q0QA 3KOXA 4JLPA 3ZXXA 3LPAA 5ALVA 4AQ7A 3HOVG 3DLIA 4TL8A 5KQLA 3AB7A 3ILXA 4EHIA 2WM8A 5BQXA 3ILVA 1LGYA 3EGXB 2FEXA 3NRJA 5SV2A 3WLTA 3HM9A 5FI3A 5GV7A 1VJDA 1CNMA 5AKEA 3U3KA 1ET0A 3NDPA 1V25A 2DFLA 3A2NA 3A9SA 5CHYA 3LI2A 3I83A 3IQIX 3WKDA 1OILA 2XUDA 5KYUB 2DUNA 3T1HB 2A9KA 4KMMA 5EZSA 1RZVA 5AVYA 3W2FA 5HCNA 4DJAA 3M1YA 1XK5A 2WDPA 3IQZA 4K40A 3W4KA 1NTOA 1Q15A 5EC8A 3G9XA 1TJ4A 4XZ3A 2NYRA 2QX8A 4LRQA 3OJLA 2ZI3A 4HH0A 1HEIA 2P62A 2BI8A 2WSYB 3T0FA 3UFBA 4TZ0A 1RVDA 3PIIA 3GIQA 1RK6A 1IK4A 3AI3A 5JVDB 3EXHC 5KVCA 5DGHA 3DKPA 4ND6A 2O8CA 4IO1A 1XPJA 1X1QA 1S9FA 5E2IA 1HTTA 4FHCA 3TM5A 2K87A 2F8MA 1GDTA 1E3EA 1X92A 2PMDA 4NCIA 1WKBA 5TSDA 1SKMA 2PUEA 3FMAA 2QAGB 1DL5A 4MYTA 2F6RA 4PRKA 4XLLA 2R79A 4KI7A 1V7CA 1N2HA 4GG1A 4NFSA 5E9WA 3T9DA 1K8RA 4BFWA 5E3JA 4DRZA 4YR2A 4DJDC 1BE6A 2FMHA 3WFJA 5IK2A 3GGSA 3H4MA 1EXMA 3QBTA 4O2LA 5JG7A 1LK7A 1XRLA 3GUHA 1MIOB 4RFVA 2QSYA 1L4GA 1LPPA 5J40A 5TE9A 4IGEA 3VVCA 4GKKH 3BFJA 1W87A 5IM4A 4M0CA 4Z9FA 1FSZA 4URUR 4BVLA 1PQWA 1HNNA 4JLVA 3SY8A 1RWKA 1TKAA 2H1IA 4ALNA 2BEVB 1FX1A 2X7JA 3FOFC 4G0VA 2HBRA 4NXMH 2AG1A 3I61A 4U5QA 1D5CA 5GGYA 3IIKA 4ZT6A 4AZ3B 1URPA 4A3EG 3K9LA 3KPYA 2C00A 1OCEA 1N8TA 2GHTA 4UCTA 3VOBA 3D4OA 2Z2XA 1QO7A 1JR3D 1TZKA 1O58A 5ALZA 1EFCA 3M1LA 1SUWA 1YZYA 1E4OA 3QA3E 5ESRA 4Y7DA 3RRXA 4BV8A 5IRCD 3C39A 5BORA 1VE3A 1Y80A 5HMMA 1WSAA 2EERA 3GRKA 4MQ6A 5HVNA 4MKFA 2GESA 1SVMA 2WIGA 1MX3A 3SIPA 1LJ8A 2COKA 2Y68A 1J2JA 2E49A 3NR2A 4KGZA 3OU2A 1QE3A 1JYEA 2PPVA 3THYA 1RXSA 1CW2B 1IG0A 3AR5A 1QFXA 1R0XA 2FUKA 3VHQA 4B3MB 4S1NA 4A73A 3EVCA 2FMXA 4MW0A 2ASEA 1VE1A 2GQ0A 3G1TA 5G0SA 3TTUA 2VXOA 4X66B 2R5WA 2IDZA 2Y2VA 3F8TA 2QVCA 4X8OA 4X64B 3U49A 1FYXA 5HM8A 2IYEA 3L7KA 1YB7A 3B20A 4MQUA 2JH8A 4TTQA 2WB1E 4ZICA 4K46A 3F67A 2AFHE 5K3BA 4YR0A 3MGCA 3OC6A 1Q7GA 4QVIA 3VDQA 1R8JA 2NT4A 3R6GA 1ZN7A 2QPLA 4OVKA 5EZ5A 3LUPA 1T2UA 3JRXA 2UUCH 2B5OA 4LHWA 3MK31 2JFUA 4LJAA 3A0RB 4JBGA 4EPWA 3CTMA 1N6IA 2GGSA 3WZLA 1IN6A 2GZHA 3QE2A 4DR4B 4PBRA 4UXJA 2F3RA 2P4EA 4LK3A 3E2MA 4FFBB 1R00A 4I5FA 5DHAA 5EUCA 1UMKA 2AE2A 2V65A 2HVSA 1E94E 4JUBA 5ERXA 1KEEA 4I14A 2EKPA 4FMPA 1KTIA 2VTBA 2XD9A 3VR6D 4YT4A 1R0YA 2IYAA 2LDXA 2VFAA 2YHIA 3OHMA 4GMKA 4Z4CA 4X62B 2IS4A 4KYUA 1FJGB 1THMA 1L5KA 3LULA 4CT4B 2PKEA 3ZLBA 4BLSA 2SNIE 5LA6A 1ZD4A 4PAWA 3COPA 1SG0A 2BEUA 1T0UA 1VA4A 5JXGA 1GLVA 4X20A 1FXSA 1GGOA 1F8XA 1R0BA 4GX0A 3D8UA 5KG0A 4WXRA 3GWGA 4MR9B 5CH8A 5HDBB 2YX1A 4ZCRA 2QD2A 3MTDA 2CMFA 4Z5XA 1FUIA 1NW9B 1PUIA 4MUHA 3CZ5A 1FLDA 5TS3A 3SQXA 3SJBA 4O2AB 5JJIA 3CR3C 4U1RA 2FEMA 1F6BA 3F3YA 3NPAA 4RVOA 5C5EA 1Q0PA 3AVQA 4OA5A 2O6HA 4YUAA 1MX9A 2I34A 4Q6WA 2JK0A 2BBWA 2O2SA 2QKYA 4J29A 4ZAXA 2QX9A 3UWMA 3IXQA 4B2IA 1S4MA 3A3OA 5DXFA 3SQLA 1JU4A 1S7GA 1JR3E 1KORA 3DBLB 3OIUA 4FXPA 4Q93A 5E3IA 5L8VA 1WNTA 3SXUB 2PBFA 3VTZA 1R0CA 2RHRA 3DMNA 3LYLA 4COOA 2B4KA 1KYZA 3RSGA 5E0OA 3BRWA 2XMQA 5J47A 1KEVA 2DR0A 3M5DA 1BQ3A 2B4QA 3F90A 5JXIA 1IQRA 1GTZA 3W5HA 4OGKA 2V7BA 2VJBA 3EASA 3NS7A 2J31A 5WRFA 1WUYA 4BQEA 5JAZA 1VLHA 1AZWA 4AS2A 4L4ZA 3OX1A 2P2NA 3ZWCA 1B7GO 5DHPA 1DAGA 2R48A 5K4AA 3GDEA 2DHRA 1KNQA 5HIJA 1MJHA 3W5AA 4Z4GA 3B1FA 4PZDA 2I1VB 2AFHB 1S7CA 4MUNA 4UTZA 1EKFA 1IM5A 2ZW9A 1QVWA 3UK6A 4EG5A 4FZ5A 3CXRA 4DJ5X 4KQGA 5EIEA 1N4DA 1H23A 3HJTA 2W6CX 4FYIA 3G8AA 2YYZA 4W1QA 1WAMA 4RIFA 3JXEA 2X9NA 3MJHA 4XFDA 1YBHA 3N44B 1YS4A 2PUHA 5AXCA 3PLAE 1RJDA 2R1ZA 4KQKA 4M7EA 4FINA 4NNOA 4QE3A 3HYTA 3RQIA 3V34A 1TWGA 5J5VA 1QGOA 3JPYA 3NRBA 2QRHA 3EGOA 3PV0A 4GHWA 1YI8A 5ALNA 1L4LA 2JHPA 3GUCA 3MWEB 4K0KB 1EM8B 2BBOA 3NTQA 1Q91A 2GBFA 1BGWA 2YXLA 1OFHA 4XSGA 3UUGA 4DCPA 5MFZA 5E4FA 2PLFA 4JJZA 3LVFO 3ORFA 5KQSA 2CXXA 4L4XA 4ETWA 2ODWA 5TDHA 2AWOA 4CVNA 1JN0A 2P5UA 1E2BA 1Q74A 2D5AA 4N1AA 3NIFB 4RABA 4JI7B 1FRNA 1ZK1A 3MJVA 1YIAA 4RZQA 5T8KC 4TMYA 1VBNA 2GF0A 1SUSA 1TF5A 4JQZA 5AR1A 3SC3A 3V3KA 3MUNA 1O95A 1M2JA 4KXWA 1C7QA 1NUTA 3B12A 2JCGA 5DQHA 1L2ZA 2NSJA 1L5FA 1ORTA 1WB4A 4IH1A 5AJUA 4P31A 5KNBD 3BTSA 1VG9B 5KOYA 1K2VN 2DBZA 3GQVA 4IAOA 3ZLUA 5LLDA 2VDJA 3ETEA 2OCDA 4I50A 4XQGA 4XPIB 3GX1A 1X8LA 4TMXA 5C46F 1BXZA 3UWPA 1SH7A 1W36C 2NTEA 3I0MA 1KETA 5J63A 3T0GA 4D4GA 1CIPA 4W9NC 2B82A 1EGVB 4UNSA 2CNWD 5GOTA 4B8ZA 2NGRA 3FDSA 3BB4A 3O8QB 3ZCUA 5BPFA 2ZYGA 4B6GA 4HAIA 4IFBA 3OE7A 4DR1B 1TA9A 2VUHB 3PDJA 2UUBH 1V39A 4JMPA 5BWXA 1GDDA 2H7CA 2AZXA 3GTMA 1B8OA 1SOWA 3I42A 3ND8A 5F3WB 4LZJA 5AD1A 1B14A 4KNYA 2EFJA 1HT2E 2XB4A 1N6OA 5K99A 4C88A 2OO5C 3CCCA 2C1EA 1GQFA 1Y8RB 1JT2A 1NU6A 3AMVA 1Y0BA 2XWJI 4OLHA 3WWDA 4EELA 2BQ3A 1NVXQ 2X23A 1KMCA 4IRXA 1C7EA 2H00A 2CWWA 2JJ1D 1RQXA 2EJWA 4IZHA 4MWZA 5AVZA 4PZUA 4V24A 4ILKA 4TS9A 2FOLA 1IY9A 1NF2A 2FFBA 4MYRA 5LQNA 2OGTA 3DHNA 4RTOA 1TAUA 4QG7A 1M1YB 2AN3A 2WOOA 4TQSA 1YRWA 1OAOA 3G0BA 2EBHX 4DR6H 3KJQA 4IKEA 4PS0A 4LBVA 3OZUA 4JXUA 4BEJA 5HUHA 4CG1A 4ZCLA 1JG7A 4KXXA 4OUDA 1INLA 4B5KA 5E1OA 1A9RA 2QL5A 3RYIB 2AYYA 1E58A 2NVYA 1ORVA 2JLBA 4Z1MD 5LU8A 1EEHA 1IXSB 2J87A 2Y0DA 3EIWA 3AK4A 3A32A 4J6EA 4WEQA 2WRZA 1FP1D 4Q16A 4EY7A 2JH3A 3GZNB 5FNVA 1K3TA 1ZHQA 1FRZA 3KLMX 1NXOA 1YKSA 2FSFA 3U0BA 3KSRA 1NQUA 1FU7A 1ZIYA 4FFDA 4G0PA 4CMHA 2YFKA 3WYDA 3BERA 1G5TA 1WQ3A 3BABA 5FNVF 1U1DA 4X00A 3BE6A 4ZYTA 1NJ2A 5AJZA 4HNVA 4LF9B 2JFXA 3BMOA 1WXXA 2Y4NA 4INOA 4MQFA 2Q2VA 5F5LA 3TGWA 3VBEA 1KOGA 1G17A 1I3CA 3CLSD 1FQJA 4PC3A 1EQ2A 2B9VA 4DIMA 1Q2UA 3LBIA 4LWPA 1NXSA 2WJGA 4HS9A 3HTXA 8LDHA 1UDCA 1Y7TA 2EW2A 2ZT7A 5BXQC 1M2VB 5JPIA 3RJMA 3HY6A 5EN4A 3U40A 1NW7A 4MIEA 2FF5A 2J30A 1LS6A 2GFQA 3B5JA 2TMYA 5K6AC 4FCCA 4AJOA 4Q48A 2Z5VA 5CJPA 3T9CA 2AG0A 1UIMA 1BXRA 3G13A 5H70A 4AP5A 1FX0B 1BWSA 4PZ7A 2CXNA 3ER9A 1G7RA 1LH0A 3ANNA 1EX9A 4D3SA 1QTRA 1UADA 2LWIA 2YDXA 1P9WA 4J91A 4AJ2A 2XDWA 2RAPA 4DCNA 1F1JA 4XM0A 4DV4B 1BDMA 1BU5A 4UHFA 1W76A 1GUZA 1UBGA 2JFZA 1J2TA 4FT4A 1G59A 1S96A 3R4CA 3PVCA 4HDQB 2XSZA 4DSAA 3EEYA 4B3BA 4AG3A 4IWNA 1JXQA 4PLZA 5MN5A 5DHSA 5KAMA 1ODLA 3IT3A 3T4EA 3KKPA 5KKCA 4EW3A 2P78A 4LOIA 3HGQA 3KSMA 1M1YA 2QS9A 3GRAA 3MBKA 3H9EO 3OPXA 3A1EA 3W78A 3QYJA 3V4PB 1QAMA 4HPXB 1GAEO 5HILA 5DM70 2J3KA 3SX2A 3TOSA 1CUEA 5ICMA 3GZ4A 3LWDA 2O8FB 2KQUA 2C2BA 2FYTA 2L42A 3QW4B 4H16A 3SBEA 5J2UB 1QZXA 3IX7A 5ECYA 4OIFA 4TYQA 2PFSA 4MV0A 3VU3A 2XADA 3L9XA 4PAGA 5IVPA 1Q0UA 4NCHA 4YY3B 5CCXA 5C7OO 3LC0A 1I32A 1RM4A 4OIMA 1XR3A 3GIIA 3EF0A 1SIWA 3OE7D 4DC9A 4JI2H 3WGQA 3OHAA 2YC4C 2VNKA 1LZLA 5KYYB 2FK2A 4C01A 5K3OA 2LUOA 1J39A 1T6BY 4XYMA 1U1GA 1BU8A 1YT5A 1ML4A 4TGLA 3OIWA 3MVEA 2P41A 3PPIA 4PN7A 3UBTA 1SHLA 2I4TA 1YV9A 2P6NA 3JASA 1V45E 2INGX 2Y92A 4HDRA 2CB0A 2PXXA 3EF1A 4EUNA 1O0BA 2P9YA 5JYBA 2QPOA 2R8EA 3GFTA 4Z2AA 1IZ9A 1M2VA 2E9SA 2XW6A 1SVIA 5C8VA 5LOVB 4TV8A 3BRSA 1CG6A 3IQDB 2PMKA 2NU6B 1R8XA 1E2HA 2RGAA 2XCIA 4EFKA 4X65B 3LBHA 1L7XA 3AXSA 4PC7A 1ZQ1A 1TM2A 1DQZA 1KEPA 2ZBGA 2Q0XA 1H42A 1EFRA 2OFPA 4CI0B 1VPVA 2QYZA 1YZFA 4G56A 5D5PA 5JLJA 1JXMA 3PWTA 4EYOA 3ES9A 3KQSA 4E94A 4E3ZA 1H6DA 2RK3A 4ZEMA 1JEQB 2WT8A 2DTEA 4I4TF 3DE5X 2RIRA 3GGJA 2XPCA 1EKVA 3OLQA 1GTG1 5THQA 2PCLA 1WH2A 1TTHA 2CFSA 1U0SY 2GILA 2Z3ZA 3NHJA 3QX8A 5H81A 3IGFA 5EE9A 5ALWA 1ADGA 2G8NA 3VYRB 3IAEA 5FOWA 1HQKA 3OD5A 4BE9A 4ZEOA 1GN9A 4LF7H 3TE7A 3QEAZ 3NTRA 1JS1X 1NJSA 5EXXA 2WNHA 3FMOB 3EDRA 2Y3IA 1YOBA 2R11A 3DMGA 4EX6A 5K6RA 4N76A 4JQYA 4TSFA 1N48A 2PYIA 4NEGA 3WXMA 2OGZA 3QSGA 4OLBA 1CULC 4TKLA 5A6SB 4RTJA 1J2RA 1HDRA 3FRIA 3TQFA 3QEMA 1QLJA 4IVRA 4J2HA 1JHMA 1PT9A 3E9EA 4BX9A 1MB9A 2DLDA 3KVYA 4BOYA 5A04A 2OT3B 1DMRA 5B2EA 3HADA 4RPCA 1DLIA 1SKQA 4RTQA 3OZGA 1LK5A 2DP4E 3NUQA 4NYJQ 3WMRA 4UQLA 4EL5A 4U2FA 2YVLA 3UCEA 3WGIA 2A14A 3EPKA 2C04A 3BFPA 3DP9A 2W22A 5T4EA 5HYVA 4RMGA 4RB2C 4M9SA 4BKRA 3VZCA 1DIHA 1K08A 3NXKA 1MVOA 2GZ3A 4HDNA 2M6KA 1JHYA 1JIVA 1SCIA 3P2JA 4RLHA 3HDYA 4KPFC 3NHAA 4DSUA 5LKAA 1ENOA 4TTTS 1F1BA 2Q27A 3OKAA 5A2GA 1B04A 1ZU5A 3HEAA 4C4XA 3GPLA 4QECA 2W7OA 1JSRA 1ORIA 5K8LA 1JPJA 2RKBA 4YJ3A 1J07A 3OM8A 4NU5A 1OIVA 5KQGA 3D4BA 4ZTBA 3HVRA 2ZR9A 4TT3A 1KKLA 3KOYA 4HV4A 3PTZA 3ULKA 4JHLA 1Y8AA 5IBRA 3CO5A 3HYLA 4DPKA 5IXSA 5HNKA 3RVLA 3VVLA 2BONA 3AEUA 1O94D 3D7SA 1KR2A 3H8VA 1GO2A 3ISVA 4EZBA 1SUDA 2QP9X 3ZCPA 1F17A 3A9WA 3PEEA 2XKBA 5AUPB 2XMDA 3M34A 2C5HA 1NMZA 1M2WA 4PPNA 4QXQA 5DTRA 3ZYCA 2FGKA 4CBVA 1IIRA 4DKXA 5BR1A 4A3FG 2W6ZA 2WJIA 4GC6A 2X8JA 1Z63A 4JI7H 4FR5A 4TZ6A 3AILA 4AO6A 4J0KA 4NH0A 1C1XB 2WK1A 2JIPA 4IFIA 3DSRA 1QUEA 2NO4A 3KOUA 1QGAA 4Q1VA 2VK4A 4ENQA 2ZYWX 1ZO8A 3R3SA 3ZI7A 3GNSA 2IHZA 5DHQA 1KE1A 3L7YA 2WSIA 1SD1A 3QITA 3DVQX 4F5YA 1VL8A 3Q8QB 1T4CB 1S2DA 4TQGA 1GAQA 4Q7MB 3ORYA 1XMQB 1NVWQ 3EWAA 3JAKA 2J3HA 1YQWA 2ZJAA 2DUWA 4QSMA 3MXTA 3OFNA 5AJVB 1ZI9A 2R92G 4YB8A 3P1JA 3VM6A 1P39A 1X19A 3KJFA 1HC7A 2QAIA 3OFSA 4OHRA 4QYSA 5BWVA 1SPBS 1HF3A 4N7RA 4PPQA 3VJKA 2ETXA 4ENPA 2GB4A 4HTFB 3H3XA 3LW8A 1NWCA 1N2BA 3B9RA 1VSBA 3I9NA 1RHQA 4DA4A 4Q1FA 1B0PA 3DNPA 2OO7A 1N5IA 1VSTA 2O5CA 1DNPA 1XJ0A 3PC2A 4UEWA 4FOOA 1AMUA 5JSKA 1KBZA 3I2KA 4QICA 2PGDA 3L8FA 4L4SA 1GNLA 5GIOE 5FADA 2CWDA 2G5TA 5I5WA 4RELA 5FLXA 3PQ5A 1D4AA 3EPGA 3GG9A 1S9HA 2D7JA 3W8FA 3KQNA 5B36A 4JI4B 2AN9A 4I7EA 3C3EA 3VOSA 4A8JB 4WKGA 1SXQA 3LVRE 4C6SA 3K9BA 2HG8A 1C7IA 2M98A 4BX2A 2V54A 2OHJA 4RO0A 1SG6A 1SU4A 4DMCA 2HGWA 4Q4HA 1TVKA 4C2UA 3FNRA 4QPNA 4QTZA 4WGGA 5FV7A 4CQNA 2E2HA 3BRQA 4JP5A 2FX5A 3PBKA 2DUUA 2PUBA 5I5VA 3D4LA 4FYPA 2UUAB 1ZFNA 4AZSA 4DWOA 2FHPA 2C3UA 3I4MG 1FP7A 2QUIA 2IIVA 4I3FA 4FX5A 3PZBA 1SC1A 4XWAA 4DR2H 3UQ8A 2BEUB 4FDMA 1DJPA 1XROA 4PYLA 3RVBA 2FAXA 5F5NA 2FPPB 4EJ2A 1RI5A 5TVKA 2R8YA 1LDBA 2QAGC 4RY8A 4FB4A 3TLYA 5I60A 4U2EA 1I6LA 4KLRA 4GMFA 1W75A 1SA0B 3CO0S 1FU8A 4Y8VB 1OA0A 4D9CA 1JE1A 2CF6A 2COGA 5JECA 2UXCB 3FZEA 4JOQA 1Q1AA 2TS1A 1V96A 4OHVA 4R1NA 2ZJ4A 1THZA 2O2ZA 1XKLA 3W2TA 3UBMA 3VZQA 2JFOA 1RYBA 2VIIA 4MUEA 5K0JA 4EGJA 1THTA 5HP4A 1IJKA 1CR0A 1KZ7B 1MO6A 5HK9A 4EYHB 4OL0A 1YFLA 1M33A 2AC2A 1ZP6A 5ELXA 1JSCA 3Q3EA 4TMVA 3ROKA 1PLKA 4G85A 3HFRA 3OF2A 3HH8A 3Q15C 1E4FT 2OBFA 3JVEA 2JCVA 1M7JA 3RTGA 4QG3A 4YCLA 4MHOA 4L1KA 3IP7A 4TV9A 1PTJA 1T91A 3SXUA 3ZHVA 2V7GA 3LRTA 2WY2D 1RRCA 3SIWA 3G9ZA 3PW5A 1S10A 1CT9A 1WHSB 2QRNA 1YQDA 2IPOA 4H7EA 4XVHA 3TLJA 1WV1A 3G0GA 4EY8A 5CDUA 1TQ8A 4LMRA 1OFUA 4M1OA 2JGFA 4EYGA 1L1QA 4WRRA 5BRJA 5IMSA 5JH7A 1CJMA 3JWEA 4QU5A 1U7WA 4PGAA 3T3OA 1XA0A 3RVJA 2BRUA 1D4FA 3AG6A 1GAXA 4TTAA 1XO1A 2ASVA 4WLEA 3JD0A 3JSAA 2BM9A 2OSVA 4V03A 1P61B 3TDMA 5A3JA 2JLRA 2HMSA 1CVRA 3WGTA 5IZ4A 4Y9TA 3DL7A 2HHHB 2AFHA 5CPBA 1K4YA 3TJMA 2AI2A 4DXAA 4XUEA 2VYND 4H3KB 4EG6A 2VSXA 4ZI7B 2C2KA 2HXGA 5CJJA 2MTBA 1ODSA 2VF2A 1CEQA 1QHYA 4JUCA 5EGNA 3EXHA 5HKOA 1PJBA 3A1UA 1AKRA 3TFOA 1EUYA 5FCDA 3FWNA 3IMCA 5C5IA 1TUEA 1E7YA 2D7CA 4J1TA 5BV1A 4MW4A 3BMNB 5DG8A 1SBZA 2OLKA 1R4AA 2CFMA 4B74A 1NP6A 3EVDA 1I30A 3C8MA 4MLDA 4QGHA 1RAFA 1A27A 3FZNA 2JD0A 3C5WP 1LW6E 1ULBA 4RV9A 5AW3A 1GWNA 1MB2A 1IJEA 4G0QA 3ISJA 1DXQA 3O03A 2H5JA 4L9AA 4MICA 4B3JA 1L5VA 4CG2A 5AW1A 4I08A 4LF4B 4PHHA 1Z47A 3LIPA 5JATA 1JJFA 4A16A 3F3SA 2YICA 3DVLA 1KEUA 3CPSA 3E9NA 3G2MA 1SBHA 3C7CB 1WBBA 4G25A 2JAOA 3V2HA 3PC8C 4EP1A 4IILA 4D0RA 4P3KA 1QZUA 1ICIA 2D2EA 3OQVA 4XTCS 1Z7EA 5EHIA 4Y6GB 3CLTC 4I50B 1UFVA 3BE5A 3IQGX 4XVCA 4P92A 3K5WA 3MR3A 4PVDA 3RUCA 1LW7A 1AUOA 3OTGA 1SIBE 4EFDA 1KS9A 3ID6C 4JOSA 1G2IA 1HEUA 3GMSA 1F2TB 1E61A 3QQ5A 4O8CA 4MO9A 3VHRA 1K1EA 2ZWAA 3U81A 4B47A 1Q0ZA 4K9QA 4YYZA 2F4VB 3WJ7A 4DDVA 5JJ5A 5ALEA 1G19A 4E6PA 2VHUA 3PYMA 2Q4BA 3SF0A 4HT3B 4GYWA 1OVGA 2B8WA 4NE2A 4PANA 4PZ0A 5FORA 3O8DA 3TAUA 4PE5B 5CFPA 3RADC 1AUPA 1QO0D 1DBPA 4YIHA 1OH5A 3WGUA 4R9NA 5LXTA 1ULSA 1N4AA 1U8CB 5ESWA 2NP7A 3CKYA 2O8VA 2E4UA 2CJXA 3E2IA 3EE6A 2VBCA 1V5IA 3MWLA 5ALIA 5EKTA 2FU5C 4LF7B 2JBAA 4MQ5A 1DTEA 1TVCA 4HL6A 4IJUA 5LC1A 4RE5A 4CKCA 2EFDB 3M9WA 5T5QA 3TTYA 4ZV7A 5B4VA 1ARZA 1AGPA 4RHTA 1V4NA 5B4TA 1XRSB 2BP7A 5IJWA 1RAHA 3FWPA 1Y7IA 3LPMA 2ZJ0A 4DUZH 4BXOA 1JWAB 1EE1A 1W73A 1ZIOA 2D5BA 2OG2A 2D3TA 2Q7XA 1RBQA 2VF7A 3ELBA 4PONA 4RA6A 5LZ5A 1BO6A 1Z4KA 2BYTA 1RI1A 3ZIDA 4NX2A 2IUFA 1CRPA 1V47A 3N8DA 1A9PA 5JD5A 2ZRNA 4W5QA 3G6YA 2QGNA 4HMQA 3LUKA 4MMXB 5K7SA 1YA8A 3DCIA 3EMBA 4J8PA 1EUDA 1QFYA 1G3UA 4RD4A 3VPHA 3TNDA 4RH1A 1AKYA 2DOKA 2NX2A 3AI2A 3F6CA 1O5IA 2VDQB 2YV4A 2FG5A 4IF4A 2REQA 1ZNXA 1WXHA 1FW8A 2ID9A 4I55A 4JAVC 2VT6A 1JXOA 4FSHA 4FWBA 3DEYX 4P0TA 4RD6A 5LB4A 5IKPA 5FNZA 5K45A 4P36A 2I9KA 4DMGA 4CZ2A 4K9RA 2IF0A 3WQBA 2ZREA 4J16C 3EYAA 2ATVA 2J6BA 1QZZA 1RQLA 4ZCIA 3GV5B 1WNFA 3RS4A 3LDFA 2GM4A 1LI7A 4O5AA 1JHRA 1FDRA 3DPUA 3RGGA 3PUYA 1SXHA 2XGPA 3UYYA 1GUYA 3E61A 2OVBA 2R8ZA 2RHTA 2OFOA 4HP8A 3RWBA 3U7JA 4LXXA 5KFIA 3RSOA 5FPYA 3TWOA 4H7IA 2BFCB 1OLSA 2V74B