3DF7A

Crystal structure of a putative atp-grasp superfamily protein from archaeoglobus fulgidus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
305
structure length
301
Chain Sequence
SLKLFLFEFATCGERIEDSTAVEGLAMFKSAFDGFKNYYEITGFVRPEFSCLFTLPVDSMDSMEKYLEKSDAFLIIAPEDDFLLYTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRGEVQVPQTSLRPLDCKFIIKPRTACIGFSDEVPDGHIAQEFIEGINLSVSLAVGEDVKCLSVNEQIINNFRYAGAVVPARISDEVKREVVEEAVRAVECVEGLNGYVGVDIVYSDQPYVIEINARLTTPVVAFSRAYGASVADLLAGGEVKHVRRQMVRKSKSAEKPYVSVGDYTLEIIDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative ATP-grasp superfamily protein
publication title Crystal structure of a putative ATP-grasp superfamily protein from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
total genus 83
structure length 301
sequence length 305
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
A PF18301 preATP-grasp_3 pre ATP-grasp 3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3df7A02
3.30.1490.350 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3df7A03
3.40.50.11770 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3df7A01
3UFXB 4L1KA 2PN1A 2ZDGA 5CB4F 3RUPA 4O2BF 2FB9A 5D8DA 1IOWA 5CAEB 4XYMB 4XZ3B 4C5CA 1CS0A 2CNQA 4EGQA 2PVPA 4I55F 2YL2A 3LWBA 4MAMA 3KAJA 1DV1A 3DF7A 2CNVA 4ZOLF 1GGOA 3U54A 4O83A 2W71A 3WO0A 2GPSA 5HV6A 2GQSA 5CA1F 4HNVA 1GSHA 3RV4A 4FFOA 2YRWA 1PX2A 1DV2A 4IHJF 4DLKA 2R7NA 4FFPA 2R86A 4HNUA 3BG5A 4IZOA 4HNTA 5CA0F 4FFRA 4QSHA 1B6SA 4IIJF 1KJIA 2FPPB 2NU7B 3GIDA 1KEEA 2R7MA 2ZDHA 3VA7A 2DLNA 3R5HA 2HGSA 2P0AA 1IOVA 3E5NA 2DZDA 3G8CA 1A9XA 1JLLB 2YYAA 3U9SA 1GSAA 4MV3A 4MV6A 5C1PA 1SCUB 2DWCA 2NUAB 1KJQA 2W70A 2CZGA 2SCUB 3N6RA 4MV4A 2NU8B 3WO1A 3R5XA 4O7YA 1OBGA 3KAKA 1C3OA 3Q2OA 4O4HF 2YZMA 4ZHQF 2PBZA 3TINA 1A48A 3VPBA 1CE8A 4C5AA 1BNCA 4XYLB 4HR7A 3TIIA 5GONF 2YS7A 4O81A 3SE7A 3VMMA 5LP6F 1Z2OX 3JRXA 4MA5A 4MV7A 4O4LF 5C1OA 4FFLA 5JH7F 1GSOA 1KJ8A 1KBLA 2GPWA 5KKNB 3AW8A 2GQRA 4YB8B 1WR2A 3ORRA 1KC7A 4I50F 1M6VA 1PK8A 2R7KA 2YRXA 4Y8VB 5JVDF 1CQIB 1JKJB 5BPFA 4O7LA 1M0TA 2VPQA 1VKZA 4O84A 1AUVA 3K5IA 4O7ZA 2YWVA 5EZYF 4ME6A 1BXRA 3RV3A 2YZGA 4YAJB 5IYZF 4FE2A 1GLVA 3JZFA 3MWEA 3HO8A 4MA0A 4TV9F 1E4EA 3TQTA 1W96A 4FGRA 3GLKA 5LA6F 1B6RA 2R84A 3ETJA 5J2UF 2YS6A 1OBDA 3I12A 3MWDA 3RFCA 1EUCB 4ZQIA 5KX5F 5LOVF 3Q1KA 4TUYF 4TV8F 4I4TF 2C00A 3R9RA 2V5AA 4HQ6A 4YJ3F 2FP4B 3JZIA 3KREA 4M9UA 2QF7A 4WBNF 4O7VA 1Z2PX 3V4ZA 3KALA 3NUAA 4EG0A 2NU6B 3U55A 1EZ1A 3N8DA 4FFMA 2HJWA 4O7TA 3JRWA 5BPHA 1CQJB 2Z04A 2R85A 2NU9B 2IP4A 4E4TA 2Z02A 2YW2A 3U9TA 4MV1A 4MV8A 1DIKA 2W6QA 5LYJF 5BMVF 2I80A 1AUXA 2OLSA 2W6PA 4O4IF 5DMXA 1I7LA 3HBLA 2WYOA 1EUDB 4ZI7F 5JQGF 5FNVF 4YAKB 3ETHA 5H80A 4YBZB 3VOTA 2W6OA 4NYEA 2XCLA 3ORQA 2XD4A 3TIGA 2V59A 4O82A 3G8DA 3AX6A 2VQDA 3OUZA 4RZQA 4O2AF 2I87A 1I7NA 4O4JF 2YZLA 1C30A 1VBGA 4XX0B 2X0SA 4O7NA 3WNZA 4MV9A 2I8CA 4FU0A 2ZDQA 2QK4A 1VBHA 4C5BA 4O86A 1ULZA 1KJ9A 4O7WA 3QFFA 3K3PA 5C8YF 5JQWA 3OUUA 2W6ZA 3LP8A 1EYZA 3V4SA 2W6MA 2YZNA 3R5FA 2FPIB 5HBRB 1W93A 5J2TF 3HB9A 2DIKA 3K5HA 2GLTA 1M0WA 4YJ2F 4EGJA 2FPGB 1KUTA 2R7LA 2R82A 5LXTF 2CNUA 3R23A 3TW6A 1JDEA 1KJJA 1E4EB 4DIMA 2W6NA 1Z2NX 2R87A 1JDBB 4FFNA 2V58A 3VPCA 5JVLA 1T36A 4O7SA 4O7RA 2J9GA 3MJFA 1EHIA 2VR1A
chains in the Genus database with same CATH superfamily
4KUHA 4ZVKA 3WDLA 4FSXA 4C2TA 1XNGA 1E9DA 4OKIA 3Q5EA 4GQIA 3VNVA 4J7CA 3GFSA 1NX6A 1K8QA 2O7QA 5GGXA 3LP6A 1P3DA 3RIGA 5B6JA 2Q28A 1AHNA 1C0LA 3D3KA 1L2TA 3IUYA 3S68A 3GJTA 5KFVA 2GQSA 5GWXA 3PLRA 3Q6MA 1VL6A 4LSZA 1Y1RA 2R7NA 1IQPA 1QP8A 2XGPA 4YCLA 2FPPB 1QX4A 5B1IA 4IIXA 3ZIDA 5TY0A 2F4VB 1BYIA 4G81A 2PVCA 4YRTA 3U09A 1NV8A 1W36B 2N1BA 4MR9B 3TR0A 2OENG 4R51A 3G6YA 4MI3A 1TVKB 1P9OA 1N32H 2YQ4A 1KY4A 4F4ZA 3SLKA 2PUDA 1BDBA 4B4OA 3Q2OA 3STXA 3PUJA 2EQAA 4ZZ1A 2VBFA 1U8EA 1WMBA 1THMA 1VPWA 4FW8A 3ZU4A 2PPVA 1E9BA 4P93A 3ZGYA 3B9BA 1UDBA 2PA3A 4NBWA 4P86A 4O4LF 5IAEA 3C3AA 3SC4A 3BFJA 2COEA 5TQ0B 1HKHA 4IFIA 4EG7A 1FJ2A 3EDRA 4LBVA 4GI2A 3TI7A 3RB4A 3TY5A 1RLUA 3CVVA 1Z15A 3EXG2 3H0GA 4WGGA 3F5SA 1NW4A 2CYAA 3F90A 1XI2A 3KTAB 1UPBA 1ZUIA 3PTAA 3EDYA 1OIVA 4KYTA 5HKBA 4ZO8A 3ZC3A 1ECFA 3T7RA 2YNMA 4M9ZA 1DKLA 3SG0A 2RSLA 4OXNA 2RBEA 5EJ7A 2R00C 2UUOA 3OIUA 3L1HA 3FG9A 3B6JA 3FMOB 4FLEA 1KMCA 1RVDA 1NJ5A 1MQAA 4WHXA 2OCXA 2Q0HA 1BJTA 3KJXA 4KWTA 4YI3A 3VMFA 4GKJH 2JARA 1L5NA 1DAPA 4AN0A 1SHZA 2EP8A 4GUAA 1FFSA 2D4HA 3JQFC 3L93A 4X71A 1ESEA 5JNUA 2VP2A 3ZXIA 5C52B 3OQNA 3R7NA 2EKDA 1ZOLA 1I2AA 1NSTA 4PX2A 4M9QA 4MWSA 4M98A 4EQZA 3NHWA 3VSCA 2FK3A 5DNAA 4NJEA 5JAUA 2Q3CA 2Z5LA 2IQIA 3D4IA 1XMQB 1VHQA 2B1JA 1SCDA 1CEYA 2Q50A 3LBNA 1BDIA 3UB2A 1Q6ZA 3AKDA 5LKRA 4ISBA 5ISMA 4G1EB 2PKRA 2NU8A 4NYIQ 1YR7A 3QEMB 2WNHA 4DWWA 2ZBGA 2G1KA 3Q9LA 2GBPA 4ZAGA 3MLAA 2YHBA 4PTLA 3UK7A 2FUKA 4WHMA 2WR8A 3NC1C 7REQB 1A95A 3HYTA 3HXMA 2ACKA 3FB1A 2OZLA 3FFTA 4KQWA 2RGNC 3OIDA 4KQ6A 3UANA 4DDVA 1PK7A 3LP8A 2Y1DA 4JENA 5CJ2A 3UAGA 2O2XA 1CXZA 4CM7A 3K6KA 3HRIA 3GH1A 4KGXA 3DNMA 2OYSA 4OHKA 4URZR 2PZEA 3H2BA 3QTLA 3ESAA 4FPXA 1H6BA 4OMUA 3ESBA 4E2WA 4XIGS 2XUJA 5JNVA 4JCOA 2QTBA 1G6Q1 1I80A 1M2EA 5EZQA 4MUKA 4HGOA 1T5SA 3LX5A 2VLIA 3MWDB 3VJRA 5JZMA 1G38A 4PF1A 1WHTB 1CUVA 4D26A 4MW5A 2PN1A 3KHRA 1KAQA 1VSQA 2Z30A 5U1PA 5KJ6A 4ZVUA 3AFGA 4YJ3A 2FMHA 2WDPA 1JR3D 3VKUA 4URVR 3SS8A 1FFCA 2FVYA 5DGIA 4MW4A 4BP8A 2RAVA 4UCFA 1AJEA 3L5KA 2YC4C 5C5DA 5U4QA 3DWGA 3LY7A 1CUUA 4JL8A 3M6AA 5AJYA 1IZ0A 3HMQA 1U1EA 1KAEA 1UP6A 4OX9H 3OOSA 4FYMA 2R7MA 5JD3A 4AECA 4F86A 5IAGA 4EQ6B 3AUKA 3OT1A 4R98A 5KFYA 3DBRA 3TD9A 1CJCA 2B0CA 3U3OA 3DLAA 2Y77A 4RZIA 4WXYB 4Q93A 3R5JA 3GBSA 3FSGD 2EVWX 2B8JA 4KXQA 4FLFA 2BFNA 1RVV1 2MTBA 3VVMA 2J3MA 4HDKA 5SZIA 3PXDA 1T1SA 3PHJA 3N41B 5C8YA 1KDZA 1NW3A 4MI9A 4RB1A 5F21A 2WFAA 3NVKI 3OX1A 2DFDA 4CKEB 2Q1UA 3HP7A 3HXQA 3GFTA 2ZIXB 5B37A 1JYEA 3JSXA 4CMFA 3LW8A 1S68A 1SUEA 2CL6X 4FDLA 3VR0A 3WQHA 2R62A 4UCXA 4BZXA 4WNAA 2JIRA 5JPDA 2O59A 3FNGA 2MCTA 3RRJA 2REQA 4B5LA 1F51E 3WGJA 1Y1WA 3A1TA 3MT7A 2V45A 1T3NA 1PZGA 1W44A 1S1CA 3ZE6A 3R3JA 3LA6A 1B41A 5BYJA 3ONEA 2NO1A 5HQ3B 4W1QA 3TLGB 4DRFA 1XMOH 3CGGA 1XQXA 2NAFA 2VH5R 2QSYA 4GAEA 2O6LA 3GMIA 3HLKA 4MQFB 4KLNA 1LI4A 4MVJM 3RB3A 2RAFA 4G85A 5DTEA 2A2ZA 1V5FA 1DELA 5KFFA 5CA1A 4AW9A 4WN9A 1WM1A 5J63A 4BQPA 4FXOA 4XYMA 1Y6RA 4Y1RB 1TXGA 4ZAXA 1M5UA 3PSAA 2PM8A 1NV9A 3U48A 1VHDA 4IOKA 1XWIA 3VYSB 1GTRA 4AYWA 4MHTA 3AW9A 4J4HA 2VQEH 3DF9A 2C2WA 4YYZA 4PCLA 3TJZA 1TYEB 1UBGA 1NVKA 1D2CA 4MPDA 4TQRA 3LKZA 2J4DA 1RHJA 3BTSA 1I7QB 3H9BA 1W94A 2KBFA 1SUSA 1JJAA 1I2LA 5AJWA 4CKWA 2F7SA 1BRTA 2VATA 3Q1LA 5EXDA 4LQDA 1TECE 3OPXA 3VO8A 4S12A 3DVSX 4QATA 2WYOA 1KRHA 5LSAA 2R7AA 1XE3A 1O77A 5DYIA 4RFSA 4RQAA 5SY9A 3H0EA 4URWR 3F67A 3PDIB 1CBUA 1O57A 2R6DA 3MGGA 4DBLE 2F59A 1WCMA 4JT4A 1H2HA 3TZ6A 1TGYA 3D0OA 2AQ8A 4F8YA 2GZSA 2BZ0A 1ZWKA 4J0CA 2Z09A 2GX6A 3LTNC 1K7YA 3KOUA 5ALPA 3BK1A 1V1JA 3C4QA 1C8LA 1GZUA 3C5VA 3Q40A 4AQ7A 1X7WB 3J80A 3M6VA 2FPIB 1NWCA 1VOTA 4AL4A 4B6QA 3W4JA 1LVUA 3L40A 3VPGA 2HHFA 2BDTA 2XMZA 1JQKA 1U65A 4CR8A 5BR1A 3C3YA 3L1IA 1NBEA 1EG2A 2H18A 3W5CA 4J2TA 3RUHA 3E0XA 4J0DA 3V3KA 3HDGA 3MW8A 3IBTA 2VA2A 1L4BA 3P0JA 2QSUA 1VE3A 1OD6A 2XEXA 5EJ8A 1M34E 2OBNA 3KQTA 4DARA 3SX2A 2CY0A 4NE9A 1V25A 5BW4A 1IN7A 3AESA 3F1LA 2ENUA 4Q7KA 1LNQA 3ACCA 4CUJA 4JJGA 2PA0A 3RGWS 2ZJZA 4ID3A 1VSUA 1IAVA 2DB3A 2YXDA 2BGWA 5BR8H 4PWQA 3QVTA 1VIAA 4RENA 4DIBA 3GOQA 1SB9A 5DGAA 1XGKA 1ND5A 4RWZA 5EKSA 1DAGA 2JGFA 2R4TA 2D62A 5LZ7A 1Z7EA 1T2UA 2HA5A 4J1TA 4HN4B 5C3MA 2PEYA 1P2GA 3W6ZA 3VKHA 3NVMB 2IOQA 1X0VA 2IEDA 1O94D 4LCBA 1GRCA 5I5EA 3UNXA 4YJFA 5IFKA 2JAWA 1RMTA 4L0MA 4O0MA 1T5LA 3OOJA 3EARA 3I64A 3TUZC 5D87A 4DG9A 3JQAD 2GPYA 3WB9A 4RD1A 1G8PA 2O2CA 5DBOA 4NFHA 1VDZA 3F4BA 1NIPA 1FSPA 3ZY5A 4KC0A 3VO1A 1P8LA 2CFIA 3FPCA 4RACA 4ARZA 2LIVA 3WNQA 1MEEA 3CG0A 2BMEA 4HMOA 4FT4A 1Y3IA 1EVQA 1PYOA 2B2CA 1RZVA 1SQFA 1R3DA 4HVLA 4LWPA 4J29A 1XVLA 4M9SA 2RGGA 2P79A 1RXIA 3Q7PA 3PRJA 4DV4B 5D7BA 1EVLA 5J5CA 3SJAA 1SU8A 1CQZA 2DJ5A 3RYFB 5M7EA 2HI0A 1M34B 3BHJA 1I5RA 5BRAA 4M54A 3MIIA 3TB4A 1P1CA 3GEDA 2UYHA 5CJJA 1IHDA 1YBAA 3ZBQA 4LFBH 4LAFA 4H7HA 1BE0A 4PSCA 4J6EA 3NUZA 5EZ6B 1P81A 4HB3A 1A98A 4A6EA 5JAPA 2H1LA 5I8PA 3AEKB 4DQVA 5BWBA 4MUEA 5HX7A 1UXOA 4ZVNA 1R7RA 4H3SA 4CLEA 3A4TA 4I36A 2XOXA 4GX0A 3QKSB 3V1YA 1DKUA 3DOHA 2UXBB 4LHYA 3N8KA 3U4QB 2E4YA 4FCWA 4ZAVA 5DG9A 3KQNA 5EHXA 4U7TB 1QIFA 3B78A 4JUCA 2OFPA 5GZ6A 3OM0A 3WNCA 1C4WA 2FAXA 2Y0BA 4PV7A 4UVIA 4MJXA 2LPMA 1GG2A 1B3RA 2YN2A 3CQ9A 3VSDA 2JK0A 3GVPA 2R8HA 2OQ2A 4IR7A 2JLSA 1SVOA 2AK2A 4TYMA 3G82C 2AJLI 4GYYA 1W4LA 4EG6A 1WKVA 3B51X 1EFPA 3KKMA 3PC8A 4PZZA 1Q92A 2BBTA 1OYVA 1HC7A 1ZNWA 1AIPA 4BQEA 4INZA 2ISSD 3PKJA 1THGA 4TMZA 4HQRA 1Z0ZA 3UWMA 3IMGA 1J5EH 4XAQA 4OP2A 2DKFA 2AN5A 2WTAA 2WJJA 3A9CA 3WZLA 1AA6A 1D4FA 3O1IC 1Z7YA 3VNNA 3CWQA 4MCHA 3EDQA 4IBOA 3W05A 1LD3A 1E2HA 3AVVA 2IPOA 4XR9A 5I5YA 4QFMA 2XTJA 1XA0A 1MO4A 1XBTA 2HSEA 2ZK7A 4PXAA 3JVVA 4A93G 2UZ1B 1L4EA 1EX7A 4R8UB 3NT4A 1J42A 1D8TA 4M53A 1SXJD 2Y0EA 1L4GA 3C4VA 2QMUA 1UZNA 1QTIA 4V39A 3BFKA 3S2FA 1BMDA 2MYUA 5EMLA 1ND6A 2QENA 2P4HX 3MXTA 3QJGA 1R6TA 4DV3H 4L4RA 4MKZA 4PHFA 1FRFS 3FMAA 2C5GA 3PR3A 5D1NA 5L53A 4CFYA 5BSFA 3ICOA 3RBXA 3BQNB 1QGYA 4B3TB 1TT7A 3H3VH 1DV1A 3IEMA 2LGJA 4JKIA 2JJYA 2NQ2C 3EUEA 4O63O 1NXVA 1H2YA 3U62A 1G42A 3B1JA 2XUPA 5ARBA 4FMDF 1ML4A 2YIMA 5BXYA 4RKYA 3QVJA 4Y2HA 3BMXA 4TQAA 1NPYA 5B6IA 4AYBA 1Q7CA 3QKWA 1SM4A 4YDHB 3U7RA 5SZKB 5LP1A 5KFPA 4ZV9A 1Z7BA 2RI0A 3CEAA 3THOA 1HMYA 1X38A 1Z7GA 4HDQB 3M0EA 1YQTA 4QUDA 4LVCA 4D3DA 1BGWA 1U2GA 2X42A 2I62A 4KKXB 1WMFA 1SCNE 3VISA 1TKCA 2OO5C 4EBEA 5K8UA 2ERCA 5FFFA 2HK6A 3ROGA 4B34A 1H9CA 3PL5A 4KEAA 4Y0VA 2TMYA 3WLIA 1JG7A 3PNBA 2AFVA 1Z5ZA 3ONNA 3HI6A 3E9RA 1WCYA 1XFDA 2XB9A 1JIVA 2AOUB 1OTYA 1HSOA 1XK6A 2ZAIA 4LJLA 1P18A 5J5AA 4YAEA 4CMEC 2HNAA 1QP0A 4FILA 2OE2A 3QM1A 3VAZA 3RG2A 2VQ3A 2ACVA 3KHHA 2PUCA 1ZOSA 1FTWA 5AVJA 5BQPA 1NVDA 1OXXK 3VNBA 3W7VA 1QHGA 3UAOA 4EYQA 5ECDA 5C31A 3ZI7A 1TEHA 1IWOA 2WMDA 1JG6A 4ECZA 1G2IA 4G84A 4DL2A 3PD1A 4LWQA 3O21A 1NBMD 1XRMA 4XDHA 4DL3A 4EGAA 2CHQA 4Y1GA 2IY8A 3H6GA 1KI3A 3PEYA 2QTVB 1NYRA 2RC5A 4PE5B 2V4ZA 2GPTA 2R8YA 5LJLA 5HM8A 2QE6A 3QW4B 1DTEA 1BS1A 1B0ZA 2UVQA 3GCDA 1ZISA 2RK3A 3R0ZA 5TEWA 5IVKA 3CWCA 2QNIA 4ETMA 3U81A 4RKRA 3ZCXA 4O3OA 3LQ2A 3DZHA 2BGNA 3LCUA 4G0WA 3V9AA 5E9QA 4X44A 4MB6A 5ECYA 2HBYA 3OTWA 3L0PA 4TVOA 2L0XA 1WUYA 4RTRA 1N6HA 3CLUC 2YTZA 1WDWB 5IS2A 4HN2A 2BBWA 4H3KB 1V26A 1HLFA 2HGWA 4BNKA 1R5OA 1IZ9A 1ZFNA 3G2KA 1ZIDA 4XJVA 4BLVA 1YONA 4KI7A 4BVAA 1GKIA 3SHTA 4MYDA 2DBYA 1W2WB 2GZHA 1HF3A 3E53A 2UYCA 3KVNA 1LPMA 1ZJ5A 1Z25A 4MRRA 1V8OA 2WVHA 2HADA 4C4XA 1J39A 1WB4A 1VBKA 1ODTC 5JUWA 4YGXB 5FBWB 2A86A 3R7LA 3GA5A 5KG5A 4ED3A 3R5TA 5K3EA 3OCCA 3O1HB 1AGPA 4YFYA 3TMKA 5LXTB 4XB6B 4ZI3A 5LJIA 3JSLA 1E61A 1BDJA 2Q2TA 1Y9JA 1M9NA 2YKGA 4JEHA 1K6MA 5H82A 4AKTA 2ZUTA 3KYBA 4E30A 3JALA 4GX5A 1JVSA 4Z0NA 1UFRA 5CDUA 1M8JA 2ZITA 4ND4A 2IXFA 3I5AA 2GLTA 5A62A 3QMWA 1G291 3TSCA 3OZXA 2K2WA 3W2GA 2R8PA 4LTNA 3HWSA 4CMIB 3Q9SA 4IRCA 1IEVA 5EIWA 5FBHA 4DVJA 4HLNA 1U8ZA 4F6RA 1VCIA 5HRAA 3EBLA 2EF1A 4G0NA 1YFZA 4LY3A 4Q01A 4DCGA 3LQQA 1WXIA 2VIIA 4P5DA 2Y1GA 4K9LA 4GVLA 1QV7A 4M8KA 1Q0RA 1WEKA 4ZFNA 4XD7D 4U7DA 1V8BA 5TQVA 3T1OA 4OV6B 4D3SA 1YKFA 3OJ0A 3UZOA 4X1IA 4OLFA 5EY5B 1AS3A 1B93A 4RF4A 5JCOA 3C15C 4CNQA 2MHCA 4UXHA 3MSCA 6Q21A 1QC5B 1YZHA 2VEOA 1V35A 4XDGA 2D2VA 2FFAA 2OG2A 4R41A 2GA8A 4YCJA 4L75A 4I1SA 4OEHA 1XMIA 4MVJI 2C5BA 2E21A 3EPGA 4BMDA 2ZIFA 2PNFA 3K4QA 1QCZA 2BKEA 3UJ7A 5C8VA 3KDSE 4ARCA 3NATA 3OBBA 2A0KA 2I8LA 4PZPA 2YHAA 1H0KA 4ZI7A 1OBCA 4QDJA 2OBFA 3LSTA 4JJAA 4QNNA 5I3CA 2UVUA 2OFWA 4WWHA 3NRCA 3RSCA 3KYDA 3T4EA 4IQ0A 1CJVC 1MU0A 4A6DA 3OFJA 1BNCA 2R6ZA 3K9GA 2QSZA 1UKEA 3O90A 2Y6UA 1EKVA 4CF6A 2ONZA 4DJJA 1VLMA 1CKOA 1AZWA 5KKNB 4OU5A 1K8YB 2DLCX 1PJSA 2H9YA 4KLCA 1M74A 1YS7A 4W9NA 2EW8A 4EO7A 1L6RA 3NB0A 4NZNA 3QIVA 1P2UA 1AB5A 4D8XA 4IL5A 5BV1A 2CN1A 1IY9A 3DZIA 4EYHB 3S1AB 3IVGA 2VJNA 5JPCA 5K9ZA 5DW3A 3MQFA 1T2CA 3EGXB 1T4CA 3PJDA 3RJZA 2I78A 4JXJA 5B30A 4M88A 1MVNA 1NVGA 1T9BA 1K89A 2PX8A 4BB5A 2CNBA 4GWGA 3U1VA 4EHHA 5KWIA 3AV3A 3HB5X 4ENPA 3N2GA 2P6RA 2II6A 2HBZA 3BKXA 3D8BA 3GRVA 1XJ5A 1SUDA 1TKAA 1Z6AA 2WG2A 1VI5A 2A0XA 2PFGA 1IPEA 3T9BA 1IXSB 4C03A 3CH6A 1A2QA 1V8DA 1JMKC 3PFHA 1WULS 5EDWA 4AKHA 1G8HA 2JIZA 3WHPA 3ZDEA 1A72A 1KWGA 3RB6A 3NUAA 4GR9A 4IICA 1XNQH 4K0KB 4FYXA 1ACMA 4P33A 1O96A 3SX4A 1U1DA 1VXRA 4QHSA 4CLRB 1NFRA 1H8EA 5EMJA 4X62B 1E3TA 5LWQA 3O7MA 5G4LA 1WD7A 4WCFA 2R8ZA 2ID9A 1IBKB 4AXBA 4BMVA 3UAZA 1Q19A 3WIEA 3VHXA 3UUGA 3JQ7A 1W85A 2I80A 5DHTA 3UENA 2GD0A 2ONKA 5K4AA 1Z0SA 3OOYA 4WY5A 1EVEA 3F49S 3B9PA 3K0AB 4QUEA 4JVMA 3MNFA 2QQFA 3BREA 2XUOA 4IILA 1P0CA 2YJ5A 3O83A 5FA6A 2ZJ2A 4HX2A 3CN7A 4JBGA 3HJBA 4V3BA 3FLMA 2XZLA 5BXQC 3BPSA 4FUQA 5DM4A 1ONPA 5LUBA 2ISCA 4XI9A 4DUGD 1EKFA 3D8RA 2QTTA 3KQUA 4BLPA 2B5VA 2PCLA 1EVKA 5DM1A 4CDGA 4B0PA 3FVRA 3EG9B 3OTOB 1DCKA 1GGFA 2GEDA 1K97A 3OPYA 1XCOA 2F8LA 1WLYA 3DVRX 4DMCA 1GNTA 4JU9A 4D9NA 3UT5B 3D5TA 4BFUA 2WMOB 1JALA 5KQPA 1U5BB 2XGGA 4QOSA 1G20A 1UJNA 3H8JA 4B6RA 1B16A 3SQOA 4HH0A 1M6NA 2F3UA 4IRXA 1GPLA 3C3XA 4R1OA 1XUOA 3G0BA 3TG8A 2NZUG 5EWFA 2AG5A 1PGOA 3OAAD 1MW9X 5KFRA 1X86B 1XZNA 3ORHA 4GI3A 4JH0A 3LPNA 1T9GS 2ZYWX 1Z22A 2VF7A 3RK0A 2AWOA 3D0KA 4UREA 1KGSA 3R76A 3K73O 4RVDA 1XRSB 5AKZA 3EIFA 1YU9A 5D51S 3H11A 3MOGA 1GN9A 4YR2A 5GJBA 4JODA 2ORYA 1QNFA 4FGWA 3V1NA 2WM3A 1L5KA 3BG5A 2FPRA 5LDHA 4C0JA 3MERA 2AD5A 2IHBA 3BQ2A 1T0HB 2OLJA 1U7UA 5ALNA 4DMHA 2CHUA 1I2BA 4JBWA 1QOQB 2QX4A 2C59A 3ZD9A 3QIAA 4INPA 1JBEA 4IGAA 3KBOA 2GESA 3IT3A 3VPBA 3A27A 2XMSA 3ZWPA 4W5RA 2HPAA 4Z3KA 1UR5A 3WK6A 4FMCB 2EBFX 3BHIA 2OCPA 3QG1A 1HG0A 3EA0A 2Q07A 1X80B 3KEQA 1X7XA 2DM6A 4DZRA 3O4HA 2HQOA 4G6ZA 1JKFA 1GUBA 4JUFA 1YI0A 4JQSA 5BT8A 2SHKA 4XW2A 4DKXA 1XTZA 5K7SA 4CHTA 1OLSA 2NSJA 2J3HA 2GFQA 4MCAA 1XYVA 4TSKA 1NVFA 5IM4F 1G63A 3O8NA 1RJRA 1SA0A 2ZAOA 1A5AB 1TD1A 4PHCA 4E2ZA 1BRMA 4ZIRA 4M0LA 1DDGA 1KNQA 2R1VA 4CQNA 1JZQA 3EEIA 3MLEA 4MP8A 3W79A 4UBOA 3ZCQA 1Z83A 4V0QA 2Q4EA 1MT3A 4JGIA 2JLVA 4AUMA 1N6RA 2G88A 1XD2B 2NNLD 3GEPA 2QL6A 2AN4A 4EGFA 1FFEA 4YXFA 3V2HA 2QLLA 1U9YA 1WZEA 2GBLC 1HYGA 4EUSA 3I05A 3SDZA 1M2HA 5BUZA 4AJIA 3LXRA 3PXCX 3GIJA 1V4YA 3DKKA 4MUFA 1KK1A 4RF3A 5TF0A 2C5LA 5AVOA 2BUAA 2P1DA 5JZSA 4ZEWA 3GAAA 1ODKA 1GKLA 3OI7A 2X23A 5BSWA 2G6TA 4ZO9A 4OQXA 2PQ2A 2NU6B 5KFEA 4PZ9A 3W8RA 3SXUA 3N8DA 2BF4A 4L5YA 4PBRA 4FFMA 3IDFA 2BN4A 4EGSA 2LCFA 4IXTA 1DXOA 3K2IA 5BW5A 2IYRA 2V8BA 3JAKB 1MG5A 4JN6B 4PRKA 1XNJA 5ALJA 3VC1A 2ZE5A 4KCGA 2FOLA 2BQ3A 3AFHA 1Z06A 2RJOA 4FHZA 2IWRA 3WRVA 3HDVA 1OZHA 4UXIA 2AZ4A 2R9VA 2VHCA 1IONA 3RRBA 1Y9ZA 4O4LA 2HJ9A 2EJCA 5FI5A 1HG1A 3TD6A 3HVIA 3ZQ4A 3NHYA 1PJ8A 2X14A 2K7ZA 4KQ9A 4CFSA 4LDNA 2IX9A 4GC7A 4DB2A 4KQXA 5D6OA 5HUJA 1Z82A 5AKYA 3AY6A 4BU1A 3AUXA 5E6RA 1WMEA 1CUAA 5I5XA 3L0ZA 4ED9A 3M70A 3QX9A 2WU8A 3JR7A 1UNNC 1QGOA 3UN1A 4IRDA 3W77A 2R82A 4N82A 3AZQA 1Q7TA 3WAGA 3REQA 2GOYA 4L9RA 1R37A 3ELWA 4JBIA 3U13A 4OREX 3QELB 3BFXA 2ZM6B 2HYIC 3AB3A 4FUTA 3A4NA 3IQGX 2P2NA 1JQDA 4L57A 4J9OA 2BQRA 4RKFA 3ELBA 5ELXA 3RVKA 2B78A 2VYQA 3BM5A 4XZ3B 4E5SA 4OLAA 5CR9A 4Q03A 4F1KA 1FFHA 4A3CG 2D8MA 4DYHA 1BH6A 1FS6A 3DEJA 2HTEA 1GL3A 2DX7A 5KYXA 4EKIA 3P0HA 2VK4A 4JUIA 4EHIA 3WR5A 1FP4A 1T13A 4HAWA 4ZYWA 2HDHA 4AT1A 1Y1VA 1DG1G 3L0OA 5CHYA 4PGAA 5JNWA 3F6CA 4XGKA 3PD0A 4CM3A 2I1QA 3MC1A 1CZLA 3WV4A 2BWJA 1MZPA 1EESA 5CDSA 4KL8S 3LF1A 1BMFD 1E3QA 3UKJA 3QPCA 5ANRB 1R64A 4MV6A 1NBAA 4JHLA 1KJQA 2JIQA 2E6KA 4B6GA 3T3DA 3GJRA 4MR8B 2VHYA 1C3OA 1ATIA 2HSJA 1SOVA 2OV3A 1L4MA 1KPGA 3L6BA 4IFBA 1Z6TA 1JQJC 5EYPB 4RTLA 3VU8A 3UKDA 4P35A 1R5NA 2O3JA 3IAEA 1VGVA 2O2DA 2WAMA 1UZLA 1TIBA 4IH4A 1QU3A 2NVUA 2GCOB 1LRJA 1N3BA 3LLUA 4PBTA 4WLNA 3CJRA 4WKNA 1T5BA 3PO2G 2R47A 2Z5VA 2I54A 4F2PA 4EKGA 3DMFA 3O4RA 1O95D 4Y6QA 1DRJA 1NG1A 5KFOA 4WL0A 3T5AA 2E5LH 2GVZC 4ALIA 1Z63A 1ID1A 3FUCA 1G9XA 1LK0A 4Z7QB 3LRTA 1F5NA 1F8XA 1OFGA 2AG0A 1QBKC 3KTMA 3OC0A 5JWOA 3TSOA 3I4FA 3PGMA 2H2IA 3K71B 4X3PA 4J2HA 2Z2XA 4QHTA 2DHCA 4MQMA 2RGRA 4PW0A 2ZRFA 4WKGA 2GDJA 4FWTA 5I7RA 1NR7A 3LKVA 3GRRA 1KVTA 4QPPA 2QT1A 3AVYA 3PEEA 2FRDC 3M9LA 3EQ9A 2H4JA 2IP2A 3AKYA 4UMEA 3PGLA 4YB8A 2EC5A 4P80A 2QD3A 4LK3A 1GILA 5BWLA 3TCXB 1PR2A 4NYMQ 3T9AA 2WVAA 1KJWA 1JR3A 3HKEB 3V8BA 5EIFA 2MR6A 3G2PA 3VNAA 1JIUA 4U6SA 2OV4A 5C1IA 4GLFA 4Z4FA 3FKJA 4YJKA 2HK9A 1QONA 1OA1A 3LBAA 3IAAA 1HY3A 2NU7A 2X2EA 3F78A 1NA5A 1J2JA 3PB3A 4RNCA 4HX9A 1QF6A 4KLRA 4V0NA 4HATA 4V03A 2DETA 2OLSA 1CR0A 1TZCA 3O7WA 2JKYA 4U2BA 3NPAA 3BGVA 4QU9A 3M9WA 3ECCA 3DGFC 4A73A 4H4DA 2V7WA 3VVBA 5B3KA 1ARZA 1EXNA 3W06A 1S97A 4HD8A 2MCFA 4HAIA 1TCUA 2XECA 1OWMA 3LHIA 2FN9A 3WK5A 3TW7A 3GXBA 5L1IA 3TVDA 5LQAA 4L8YA 4RYDA 3BIJA 4EOGA 3QHQA 5D5QA 2DPHA 4JJIA 4GX2A 2EW1A 4Q15A 1ZHHA 2AG6A 3U44B 3HB9A 3W0LB 3AVPA 1PYDA 4MRSA 2OH2A 1ZVQA 1TWHA 3IT2A 2HK8A 1HURA 3TRDA 4JV2A 3L8DA 1KA9H 4UUGA 2HA4A 1E92A 4GLLA 4DIEA 1WE2A 1E3LA 2ABWA 3KP1A 2EZ9A 2VPXA 3VZDA 1UMKA 5COAA 3KEFA 2FWMX 2NZWA 4QTYA 1ACJA 5EUBA 5J47A 2C2KA 2FJ0A 3PYMA 1KQOA 1PJTA 5EEHA 2CWDA 3GHHA 2D0IA 1SG0A 2EGGA 4R69A 3LV8A 1Y4DE 5CITA 5JBNA 5AVRA 4JYAB 3A6DA 4Q21A 2D2EA 5JJCA 5IWAH 4GEGA 2FNAA 4NJMB 4YJ2B 4CR6A 3W90A 3PVZA 2C95A 4B81A 3PPXA 3OBIA 2GTPA 4S05A 2X0RA 4QIWA 3E5NA 2WJVA 1TWCA 3HABA 2EKQA 4MW9A 3WOHA 3LZDA 4QWMA 3I53A 1LPBB 2AC2A 4TT3A 2QN2A 4TQGA 2LUOA 1Q1GA 2DJIA 1AF4A 1QQTA 1YOVB 3ESCA 3ZW7A 1N5OX 4OQ4A 3E3LA 2C7PA 5KFKA 3A7DA 2SNIE 2C5SA 4OJMX 5CLIA 4ENWA 1UT5A 4JAVC 1ECCA 1BHJA 3PWTA 3OOHA 4AKSA 1UBFA 4BNGA 2I91A 5JH7F 1FDSA 1QHFA 1UP4A 4Q1FA 5JBIA 4N3BA 1Y82A 2W0MA 3X3HA 3DPIA 1NONA 4P3NA 1REQB 4PR0A 1G2WA 1XO1A 4D3ZA 5C5JA 4DNFA 1YVRA 3BEDA 4JOSA 2O8DA 4BBAA 4B4UA 1V37A 2V7GA 1LRKA 1URPA 3CHYA 4G5SA 1W87A 2DHRA 2C5FA 1JKJB 3H9CA 4KE7A 1MKYA 1X2BA 4L6CA 3HE3A 5EI5A 4RJKA 2RBKA 1ECLA 1IFXA 3AUSA 4PG7A 4CC6A 1F4LA 1YA4A 2HUPA 3FPSA 4P7KA 2YWVA 2H1FA 2ZWPA 4Q7LA 3EF0A 3R7FA 1N1MA 1TAHA 3IVAA 1RU3A 4DTCA 5YASA 4ARUA 1B6RA 4QT0A 4MZDA 1MB9A 4LSWA 2Q41A 4F4IA 3LT1A 4TV8F 4KUGA 4X97A 4C0AC 5KFLA 2PLNA 5BQFA 3SJ7A 4GKKH 1FMCA 1FP6A 4HXYA 5K0BA 4CETA 1A5ZA 1C8BA 4EKDA 1B73A 5LWHA 3ZE0B 3M6IA 1JDVA 1EGVB 2DE0X 3RD5A 1G21B 4RA9A 9ABPA 3H9GA 1LI7A 1ST2A 1OQAA 2CJFA 2JKVA 3U4DA 1XZDA 4KYVA 1HDGO 1U90A 3MGCA 4YACA 3A9RA 2XY4A 3CGWA 3UJBA 2CNLA 4QOGA 2B9VA 1SB8A 1RKQA 2G9RA 5JZ9A 1AKYA 2OOSA 5T3YA 1QF9A 3BMOB 3USCS 4QBFA 2VOJA 3C3EA 1ISHA 1A8PA 1QJCA 1AMUA 3RUAA 4MRMA 4Q16A 3ZE8A 4H1VA 3H2KA 1PR3A 3CPEA 4UD2A 1Q57A 2KWIA 1O94A 4HYEA 2P4EA 2R8RA 3BQ0A 2FQ1A 2V59A 5TQ2A 3PI6A 3WGYA 4EY6A 4YT2A 3QVMA 3KWFA 2I7XA 1C30A 3U0GA 3GJ6A 1UKVY 2VPIA 1JRLA 3JARA 3ZGOA 5IJ9A 2HF2A 4PPFA 1ZZGA 2HSZA 1TKBA 3H2YA 3LUHA 2AXQA 3KB2A 4UZFA 4C1NA 2ZWOA 4EA8A 5B53A 1UXKA 5A0TA 3VTZA 2CL5A 1H4VB 2YW9A 1I2DA 3MGKA 1EE9A 3B85A 2GZRA 2ZYAA 4O2BB 2XTMA 3I2IA 1RZRD 3PIIA 4TN1A 1CW2B 4MH0R 1N6OA 2I67A 4PWYA 3T8YA 3NBUA 5H7XA 4OAPA 4B3SB 1OC2A 1YCGA 3UC5A 1IIBA 3V4VB 4P8RA 2JKZA 4ZZIA 3L4KA 3MWKA 5DM60 1SUPA 4MIYA 1WBJB 1A71A 3SEAA 1JTFA 3L82B 2FQWA 3QXCA 1GV0A 2XVXA 4YP3A 1ZJYA 4DNXA 1WRBA 5L7TA 2HLPA 1TLTA 1Y8CA 4A23A 1GEEA 4UKDA 4KR9A 2OMKA 4D6PA 2MSWA 2EBWA 1QK4A 4KQ1A 3LLSA 4LNAA 1NXSA 2FXVA 3AINA 3SEFA 2CW5A 4HDSA 1PWEA 4FZJA 4YR3A 3BWVA 3AIMA 3UAYA 1I1MA 2E48A 4ZHQB 2X86A 5EWMB 3JVDA 3RIEA 2G63A 3T7TA 4NOKA 2YCBA 1EGMB 3OIYA 5A5FA 3H5OA 2VQFB 5LP6B 1QAOA 2FZKA 4YR9A 1US8A 3HGQA 2WSMA 2EQBA 5ICEA 5HF8A 1TZMA 2JIPA 1H2FA 3I8OA 5EIBC 1ZAUA 4C0QC 4JLUA 2JHFA 3D4OA 1OR8A 1YIOA 1O97D 1JDUA 3L1KA 1E4OA 3CF4G 2WLTA 2O8NA 3FGNA 3OQOA 5DV9A 1R0XA 4IIVA 1KDPA 4BLWA 5IJZA 4U9IS 1I0IA 1FYXA 3T4XA 2Z98A 4RSGA 4FWIB 2UYQA 1MX3A 3C24A 4YAOA 1QH1A 2ZIWB 5T7BA 2RHJA 3FBWA 1FJGH 2R1TB 1MRZA 4JI5B 3ROFA 1QPZA 4F5WA 1FVHA 1C1XA 1AQIA 3H8VA 5D6NA 3AM4A 5DYYA 3A10A 1G18A 4KWHA 4E03A 3OD5A 2ZVQX 1R6DA 4RE5A 2P68A 1BHO1 1E2JA 2QAIA 4WXPA 4MQUA 2RDMA 4GC9A 2HMAA 2C4HA 2VYVD 3N0RA 3DG9A 4G3XA 1JFSA 4AJ1A 2A9VA 3VH2A 3K9WA 2VJKA 2ODEA 1B8UA 1T2AA 4E5UA 5IYZF 4CEHA 2AB0A 4IINA 1RXYA 2BIFA 3EXG1 4MB0A 4HUTA 1SXJA 4L72A 3OZVA 1EWQA 3QFTA 4A3JG 4TUYF 5J58A 4JZYA 2IIVA 3JZIA 1WY5A 4NYJR 2QF7A 1XALA 3UF0A 2MYNA 4QJIA 4FGKA 4LSXA 4OFXA 3OF5A 2D7JA 5JAIA 5K0FA 3KWJA 2XCOA 4BKRA 2WB1E 5LYJB 3JQDA 1HNXH 2XKBA 4ND7A 1Q0QA 1NI3A 1JSZA 2FZ5A 2W8BA 1CY8A 5AQ1A 2QX9A 3TPZA 4FZVA 1GAEO 1ORDA 5G4KB 4ZT5A 3T94A 3BB3A 5LMZA 4MVCA 3BB1A 3SHVA 1WZUA 3G9ZA 1ZG3A 2GKGA 2DPJA 2QTWB 1O89A 2JHCA 1F2UB 5AI5A 1OROA 4I3HA 3D1LA 1SG6A 4WOCA 4B2IA 5D5HA 5F4BA 1FP1D 5H02A 2R6JA 2PUFA 1NN3A 4I2NA 4C05A 1EFLA 3EVBA 3UOAB 2ZLBA 3QKRA 2YDXA 4ETIA 4KI0A 3OJXA 4M0DA 4MICA 2JHGA 3RUCA 3U40A 3FNQA 2ZBDA 4PGFA 2DUNA 2YN0A 4CV0A 2YOFA 1C7ZA 1MB4A 1PNRA 3CXUA 3LCRA 1ML3A 4BO6A 3K70D 4OXRA 1C29B 3PNPA 3LPMA 1LQ2A 1QRAA 1WQ3A 1XEWY 3VSEA 3OJCA 3VU9A 3TZEA 2MMGA 4X6LA 5KYYA 1A9XB 5K6RA 5E2AA 2WYVA 5DE3A 1M83A 4OHXA 3K9HA 1JFFB 2FJZA 4RH1A 1U4NA 1G98A 4JITA 1EB8A 3JQBA 4RD2A 1HE3A 7MDHA 4ZHSA 2G28A 5IZCC 4WOBA 4OI1A 3CRQA 4D1YA 5IJ0B 1M2WA 4U7WA 4I55F 2OLKA 3P71T 4R1SA 2XW6A 4HB2A 3AV0B 1NBMA 5KFBA 2QVYX 3L7AA 4J9QA 1DAOA 3F7MA 4WBSA 1OMOA 1D5CA 4LYDA 4YRCA 1GCGA 5T6MA 4XVQA 1WZ2A 5ETJA 2VTBB 4EB0A 2AE2A 3D7RA 2J3DA 3X1YA 4BB0A 5CB0A 4QSHA 2G82A 3NDIA 1N34B 3D3NA 4ZO4A 3DWEX 3R0JA 1K2VN 3JQ8B 1MX9A 1XZGA 2FLWA 1T1JA 2P2CA 2ASVA 1VLJA 1IN1A 1D9XA 2E55A 1JG3A 5KOJB 3IV7A 5AKEA 3EVAA 1OAKA 3LUFA 4CQMB 1NXTA 4J9RA 3PNQA 5IDXA 1N9KA 1OYYA 3NAMA 1FTGA 3DKPA 5H16A 3V46A 4D6XA 1PV2A 2V96A 4WZAA 2LD4A 2PS1A 4DR5H 3ZY6A 1CHDA 3W5SA 2W9BB 3FF1A 2IXDA 3JSAA 1Z4NA 2QZSA 3CNOA 3RTEA 4LF5B 1A8UA 1RC0A 5L4SA 1DBRA 3EA5A 2V9ZA 2XMDA 3AIIA 3BIWA 2EBUA 3I9LA 5KFIA 5FTJA 2VZ8A 1OY1A 3OICA 4KHPB 1Z5VA 4KVGA 3LUDA 5JS8A 4GL4A 4Y18A 5G0TA 2FZEA 1ZM4A 3NAZA 1QLJA 4A3GG 1TM1E 1PF7E 4WK2B 1QYCA 1EFTA 1R4AA 3FM9A 5J9FA 1J22A 1TTPB 1WCV1 4RW0A 3GD7A 3SDSA 4BO7A 3D7KA 1NF2A 3H9UA 1OBDA 4AROA 3EPKA 4U7PB 1YD7A 2TMGA 4H59A 1KC1A 4OPMA 3GGSA 5BSHA 3GDFA 4WCVA 2O2EA 3NCTA 4WBNF 1BJKA 4QXMA 4CLOB 4CV2A 1P7WA 3FNFA 1ENZA 5BWTA 3MAAC 4LQLA 2JH9A 2I1LA 3TZKA 5IZ4A 5HKKA 2ZPTX 1T5IA 4WT7A 2Y6VA 2RJ3A 1AV7A 4XD7A 3URMA 4D9BA 3U4MA 1S0NA 3FVQA 2OA0A 2WJIA 2NLOA 4MUXA 3R9KA 3ED5A 2C4NA 4JI7B 4HAZA 1KMNA 1UFQA 1SUCA 3NBYC 4DLRA 2QTFA 5K2MA 4EHKA 2PX2A 2XODA 2ZULA 3D3JA 3D6TB 5CCEA 1GHTA 4BKUA 3MCWA 3N39C 3IT1A 1FX0B 1H1LB 4P9NA 5K3WA 4KZPA 4JI2B 3QKTA 2H00A 4P4NA 1OYOA 1TA0A 4KBFA 1AC5A 4Q3KA 5JAMA 3I04M 4ND8A 3D6MA 4KRGA 1E0AA 2NO9A 3NHPA 4HFNA 4A8HA 2KLHA 4XDYA 2UUPA 3KQYA 3PXBA 4MK4A 4OKNA 3CZQA 4Q4JB 5TVGA 2BW0A 4YQEA 1F8FA 4I9NA 1XEXA 2FSFA 1ECBA 4NU6A 4FDMA 2XKKA 2PMDA 2ODBA 4J1SA 2XEDA 2RGYA 4LVNA 2GAFA 4K9SA 4ZCIA 5HFJA 2PX5A 3D4PA 2PKQO 1CT9A 4F6CA 1E2MA 2RB4A 2PXCA 1UOEA 4F2WA 4GM1A 3N44B 3UOWA 4J94A 5CFOA 3ZK7A 2VNHA 3CW9A 4RAYA 3BTVA 2FPWA 4CL3A 2XCTB 5KT3A 1GFZA 2P41A 2CXUA 4QWAA 2A1TS 4JVNA 1TQ6A 1QO0A 4NCJA 4QL3A 2Q6OA 2ZJTA 4PAGA 3VH4A 3IN5A 3V55A 3R6DA 5CAEB 4KWEA 2IW1A 5HP4A 1TQHA 1UMBA 1LJLA 3ZXSA 4ZQHA 3FYTA 2PZJA 2IZ7A 4DV6B 4X1KB 4MKGA 5GVRA 1F0YA 1BCRA 2B34A 3CUYA 5CIQA 3PK0A 3V6JA 2ZM5A 2PIAA 3AU8A 2PZFA 1V7PC 4BCCA 4R83A 5J3JA 5HVNA 1QR2A 1SOAA 1DFGA 3CUTA 1JAXA 4JUDX 4TLAA 3E3OA 1G41A 3RABA 1C50A 3S70A 1RYYA 2J59A 5JBQA 1UBHS 2AMJA 3GFRA 4EP1A 1FA9A 1CY2A 4O7YA 1JFTA 1PR4A 5F12A 4N18A 1I10A 3DYBA 1N1EA 2OPHA 1R00A 3V33A 3E6AA 1ETHA 1CJBA 3GNSA 4EHAA 1R0CA 1VL5A 3P2OA 1MA3A 2VDUE 4G5FA 2BEVB 1RMQA 2XWPA 4G5YA 3PX7A 4EFBA 2BF7A 4WLEA 3VPSA 3WLLA 1D0SA 3QF7A 2E37A 3W5OA 3RWOA 4A9AA 1PBTA 3KT0A 4F5YA 2EG5A 1DC3A 1ZBDA 2BGUA 2XNKA 2XVAA 1IG3A 1LLUA 3HUTA 1CVRA 5AMXA 5AXCA 3FZEA 4Z8YA 3GFGA 1TU0A 5HCNA 2FKNA 3B82A 1RWNA 1Q0PA 2CHGA 1W9HA 3GRAA 1LW6E 2PX6A 4JKYA 1ATZA 1S5PA 2WUWE 2DPMA 1E8MA 1HNWB 1TO2E 5CIYA 4EATA 4B71A 1XK7A 4DUGA 4A4DA 2H6EA 1NQVA 1SC4A 5LZ8A 4DRZA 2AYZA 5L6LB 1M7HA 1DMRA 1CQWA 2V9PA 1EEXB 1GGHA 4ZVPA 4LXQA 1UAGA 2XBLA 5HBGA 2ZBRA 4HDRB 4WNIA 1L5FA 2V0GA 2A9QA 2LDBA 1VBMA 2Z3ZA 4PZEA 1FS5A 1MABA 1SVLA 1YWGO 3ICEA 1TF7A 2P69A 1EHCA 4Q9LA 1JB1A 4RPLA 2AZDA 3RU9A 3HJFA 4UVDA 1BA3A 1UPUA 1NU6A 3NHKA 4G26A 2I65A 2ZOSA 1ZNYA 1Z2PX 2ZRDA 3T1VA 2AMLA 1Z4QA 3NR2A 2XXAA 5D5PA 3OAAA 4UCUA 3N0TA 4PFSA 4DRXB 4BLOA 5E6UB 2BHLA 4PX3A 4G5OA 3CLRC 2B1IA 4OYYA 3W3AH 2H0QA 1AN9A 5EZYB 1IMOA 2DQKA 4X64B 1ZNZA 4KQCA 5HZHA 1DEAA 3MFHA 4JI8H 1XLTC 3KJQA 4NPCA 3N2IA 4R9VA 4JBYA 1XT6A 1Y8RB 2LZ0A 4EA7A 3I2FA 3R0IA 4NAHA 5KTTA 4ARIA 2ZPAA 4TTQA 3WWDA 3NV9A 4N1AA 3PGJA 3EBPA 3AX6A 1NJ6A 1C7IA 2Y1EA 4YY3B 4V2UA 1CTQA 1MJHA 1TI7A 1C9EA 1COWD 4FHCA 1ODIA 3R7SA 1DBWA 4EVQA 5IM4A 3EXIB 1Z62A 4PLTA 3GCXA 4BNZA 3UCEA 1UFOA 3CH7A 3C6MA 1JAHA 3B60A 4BVJA 3VYVA 2PL1A 3MCUA 3N74A 2ASLA 4N12A 1DAHA 4BV3A 4CM4A 1ZD9A 1MTZA 1QMPA 1SVUA 2FPGB 3ZEIA 1NURA 5BWWA 3LQ4A 2TS1A 3C3CA 1W88A 3WGLA 1HORA 2WJHA 4WJZA 3B6IA 3ZNOA 5K2OA 1IC6A 5CBPA 5LVAA 3NRJA 5I5SA 4G5QA 4YRPA 3M6FA 3NIWA 4BGIA 4RESA 2WI8A 5HFAA 1M1UA 3T1HB 3LE8A 3QPVA 4EI9A 1RJFA 3E9QA 1IYDA 4U8GA 4MRVA 4RZHA 2XYHA 2FLLA 2QTAA 1VG0B 3CUUA 1S8AA 4HVCA 3ZVRA 3A2KA 2Q3JA 1Y1SA 1J8DA 2CLKB 3GIKA 3EASA 1ETUA 2EZ4A 2IIQA 3WGOA 2B69A 2DHEA 2OESA 3RSOA 3WJ7A 2JLXA 4B8WA 1F9AA 3PWZA 3I8SA 1WKCA 2HWWA 5EMKA 3WYEA 5TX7A 3QVUA 1I50A 1Q84A 2A9KA 3M83A 1SYXB 3RCBA 2QN7A 4LF4B 2JGMA 2OZKA 1QIGA 2HO5A 4K9RA 2DWCA 2XUIA 3E22A 4L08A 4YRZA 3KOYA 2VUHB 1LSSA 3NTLA 5BY2A 1E2NA 5C1BA 3HBAA 2A5GA 4QVGA 3NNDA 4XDZA 1J2EA 3PFCA 3AB7A 4O3NA 5B58T 4QGHA 1SCQA 3EHDA 4HPJB 1YB2A 1H66A 4RFVA 4I19A 3IOBA 4YAWA 2W8KA 4CHIA 3DZBA 2P27A 1L0BA 2WVJA 3FFAA 3LC1O 4LFCB 3Q8MA 2ZWMA 4HLQB 2Z2KA 2JLZA 4J9LA 3CRVA 3I9V1 1FPMA 1Q1BA 1YE8A 3LLVA 2FZGA 1Y5RA 3SCZA 5F5XA 3D2LA 1XJWA 5A1JA 3DPSA 4ECRA 1XVTA 2VRWA 1G8JA 1O58A 1CUSA 3AYXB 3FTNA 2BRUC 4GBMA 3K1ZA 3LWDA 1AUVA 3C3DA 3B1WA 4Q02A 3YASA 3RWBA 1JU4A 2YVQA 1BXRA 1CUWA 4YO8A 2VPPA 4PC7A 1W52X 1E2LA 3T7DA 1YRHA 3EGEA 1XYGA 5E2BA 3DBOB 4UNNA 1XA3A 2WJWA 1V6AA 4C6TA 5CM8B 4ZQIA 2W2NA 1TA4A 5PGMA 5IP5A 1USGA 1L5MA 1ZDMA 3FYUA 2FEAA 3QBDA 2VRNA 5JMTA 2X7JA 1SFRA 3S55A 5JDIA 2QQ0A 2QL9A 5BSTA 3WLKX 5L45A 2AFIA 3JWIA 3OQMA 1JUDA 3ZVLA 4YS6A 3TCKA 1ZLYA 1U98A 3PEWA 3K94A 5AP9A 3PDWA 3P9IA 2BDUA 5HIKA 3JAWB 4LRUA 1OTXA 2HCFA 2HSWA 2AXNA 2FRVA 4EA6A 4OQZA 3X43A 1Y1TA 3D2AA 3ZI4A 3IQDB 1RWXA 3IAS6 4BLUA 5G41A 2P11A 1H2AS 3JTMA 3KB6A 2QXTA 2Q6LA 5C8XA 4O4IF 2P91A 1IXRC 4I1UA 1WLSA 1RSZA 4FJ2A 1AQJA 2CXHA 4W7SA 4RHYA 3G0IA 3L6DA 2VQ6A 3PW2A 1ZESA 1HK7A 2Z9DA 1SKMA 3E8XA 3BXEA 4BQQA 2YBEA 1VPLA 2RHHA 3AP1A 1IOLA 4OJKA 3ACDA 3TL6A 1NX9A 4P92A 5I7VA 4K9MA 1W5TA 4I9UA 4L76A 2W2PA 4CBVA 2GAJA 2ZUVA 3H3JA 5A6VA 3FCCA 2IYAA 4DCJA 2JGDB 3K2BA 3G89A 4Y7DA 3ASUA 3AMVA 5AVVA 5E9JA 2VI5A 4PGHA 3VKWA 3HWWA 5FO1A 2CXTA 1Q12A 1JXOA 2OWOA 3OE5A 5EEGA 4FBMA 1EAYA 4LRXA 2YWCA 1XPOA 1NQAO 2Y05A 1CVLA 3LUKA 4N48A 4YJDA 3UICA 2P8JA 3EZFA 3KPWA 1O95A 2NTVA 4RXTA 2Z4SA 2BP7B 2VHVA 4FX5A 2QYZA 5CXUA 4M0EA 2Q29A 2J3QA 2PLWA 1P5HA 2BFAA 2VTKA 4PLVA 1TLLA 3QPDA 1HOXA 1I33A 3RNOA 3EPIA 4BFCA 3W3AD 2YL2A 4ZOEA 2BFEA 3K53A 4V0KA 3CONA 3CBQA 2YXLA 5KFGA 4TM8A 4FIZA 2FP4A 1Z3IX 4IUDS 1QS0B 3GWGA 4YP6A 2A3NA 4M0KA 4OGLA 4A1OA 3UCFA 2MJLA 4RTSA 3A1UA 3GNLA 3T54A 3L1VA 5JY1A 3EGOA 3R9IA 2VAPA 2LKDA 3FD8A 5ALQA 3CZMA 4IG9A 621PA 1TJ5A 1ZXLA 4TTJA 1YHZA 4UHCA 2AT1A 5DOVA 5DHQA 4DQNA 2C3YA 1QYIA 1MHTA 2PTGA 2ZJBA 4NHOA 3WMGA 5F7JA 4Y9DA 5HMLA 1VFPA 3C0KA 2P30A 3ZH9B 1JLMA 4AMBA 4X1YB 4HB0A 3CRMA 3E15A 1R0SA 1SHKA 1YH3A 2ZPUA 4QEZA 2IUYA 3BGDA 1L5RA 2XI4A 3U5TA 2GXQA 3R6LA 3UYKA 4P0PB 3T7IA 1B6TA 1XMPA 2VWPA 1Z34A 1G7TA 2PKEA 2YCHA 4TLEA 1XQ9A 1DT5A 1KK3A 1GSOA 4RMJA 4NONA 4K3UA 4MUJA 4LMBA 1ZRNA 1M6YA 5KHAA 1ZHSA 1NXOA 1JG1A 1HEIA 1YGYA 4IMPA 4M0FA 1YV9A 4LNUA 3F4LA 4JJ6A 4UOZA 3RS7A 4QDXA 1E64A 1OLXA 4ZCSA 1BA2A 1C1YA 4AD8A 1ZS9A 1J24A 1KMQA 2QAGA 3BK2A 3H16A 4G4JA 3P2JA 4A03A 2BMVA 2GZMA 5HYVA 3EAQA 1CJTC 2QTZA 2IOYA 2LRHA 2XE8A 4DSNA 1Z88A 3GLTA 1E20A 1DO8A 4CKCB 4P3KA 4EW3A 3E5MA 2YINC 3SIXA 1CEQA 4O3MA 4RQBA 1NVMB 4X8HA 3RAPR 2DSTA 5FF9A 3T1NA 3WC4A 3I52A 1FKAH 4IIDA 3HTXA 1GPMA 4JNCA 4D9JA 2YC2C 1IU9A 2H9AA 1XF9A 2TYSB 2NACA 3X2EA 4F9EA 5T4EA 5C1DA 3N6VA 3PRHA 1ORTA 4XASA 1Z7WA 2RHOA 3MWFA 1H6AA 1C2YA 2F1RA 2QPLA 4W5WA 3MBOA 3LK7A 1R4MA 1Z6YA 1K27A 1X9GA 4IDGA 4NKRA 3JD4A 3R9WA 2EHJA 3WLSA 4LF6H 2WFLA 1XCLA 1CERA 4TVKA 3RT7A 4LYGA 4LC1A 3NC0B 2ZRBA 2VSOA 5L7YA 3MPUA 4P7GA 5H59A 5AKHA 2MDTA 4OL0A 1DI0A 3OFND 2OHIA 2Y1FA 1TCBA 1WWKA 1A8SA 1S2IA 5KWJA 2H17A 4F4YA 1ZJWA 2XT6A 3LWZA 5JH7A 2YFHA 1K83A 4YV2A 2CF6A 1SBTA 3COPA 1NR5A 1F7UA 4A6PA 3QF4A 3GPLA 2JFZA 2CYBA 4YONB 3I73A 3GA7A 4BTEA 4XTRA 3KOMA 1P1RA 5LQSA 5ESWA 3RAGA 1QBGA 3E9NA 3FH0A 3JQ9A 3QUAA 4MGHA 1MT0A 3VSBA 5CW1A 5DISB 2ZRQA 3OG9A 2NSLA 5EN4A 1WSWA 3MUNA 1GKYA 3SXJA 5DSXA 3AUAA 2BELA 4ZJPA 1UBEA 2DGDA 4JP3A 1YCFA 3W9YA 3AUTA 3A2NA 3MMPA 1E4EB 1LSJA 2D2XA 3FHLA 2CLDX 4Q8EA 3KQOA 1Y34E 1IN5A 4Q9DA 4HNHA 3TR5A 2HZ7A 3H5TA 3UJCA 4TV8A 1T4DA 4PAOA 3GIQA 2CT8A 1HX7A 2J6CA 4YRIA 3S99A 2ZR9A 3QWBA 2FP3A 4IIJB 3IESA 4M1MA 2CEKA 3QUSA 1SKUA 1ZL0A 1XPRA 1HT2E 5DDIP 1E7MA 1WSCA 3BT7A 3EJWA 3IIJA 3CZRA 1TYCA 1XCBA 1KZYC 4IF4A 4MCIA 3KR1A 4K9DA 1P45A 4D9KA 1AD2A 1L7QA 3ETNA 4J8PA 4DCOA 4IQ8A 1SUBA 1PWHA 1ADGA 3UBMA 3F7NA 3DBHB 3Q8RB 2FCRA 2ZJ1A 3MTIA 5IHPA 1IZ7A 2YV4A 3MEQA 5DQGA 4MV4A 5AI6A 1TJ3A 2ORIA 3RBEA 5DRYA 4PLYA 2V4UA 4U6PA 4LF9B 3JQGA 2GTHA 1JEAA 1XXHA 3C3WA 2QLJA 2WHXA 4G41A 2JD1A 1AKVA 3A4YA 2A67A 1IBMH 1LSUA 1VJ0A 3WDSA 4D43A 4B3XA 1B2LA 3OSNA 1NUPA 5C8ZA 4ENTA 3TIVA 3VSAA 3TWOA 5COQA 2DABA 4GR4A 2YRXA 4X6UA 3RLFA 5E9WA 2PUTA 1ZUD1 3IJ5A 1IPFA 1F4VA 4PPNA 4JKOA 3ZOKA 5EIXA 2XDYA 3BMCA 1EP9A 4A3IG 4ZXFA 2IUFA 2FPOA 4JA0A 4R2JA 1K0FA 1WAMA 1PT8A 3RRFA 2CJYA 3OCUA 1YUMA 1VKOA 3F3SA 3VTAA 1FQJA 1L7AA 4NECA 2KS6A 4F7DA 4Z9YA 2QLFA 4DQLA 4OB8A 2VSNA 1RZRA 3FSGA 1JJ7A 1W29A 1OU4A 2DTXA 3BIOA 3JASA 5BN3B 3L3BA 2RMKA 1OJ7A 1LDGA 4JMPA 3BDVA 4AZ0A 1KMHB 3P45A 1WVGA 3LO8A 5A3JA 3B5JA 3I9OA 1PJ2A 4PLZA 2IU0A 1LNSA 1C9NA 2VRCD 1VG8A 2PGAA 2PRIA 5BN5B 1K8XB 2DUUA 3TAUA 2RHCA 4PLCA 4PRZA 1CQPA 2CUNA 5AOVA 4DANA 2ZIUB 4XM1A 3MK31 2E4VA 4UOQA 3WY9A 3OZUA 3EFEA 3QE3A 1ZK3A 2XMBA 4RD0A 3VDQA 4S1WA 2A3RA 2VZLA 3K16A 2ZRHA 4XYGA 4GI1A 1Z75A 1R9TA 4C7XA 4N3GA 1MGPA 5MN4A 3OM8A 5I9BA 5BNIA 1NUTA 3SF8A 2KYRA 3ND6A 2AHOA 2VYND 3O73A 1JYSA 4U3JA 3MMZA 2UYYA 3L6CA 4Y6SA 1S01A 2UYOA 1DADA 3V4OA 3ZZMA 1RAFA 2F3RA 2Y8EA 4D4JA 3HACA 4RUAA 3LPAA 4MEBA 4EG4A 4JSYA 5IFLA 2NT4A 4GBJA 4DRYA 5CNKA 1IM2A 2QIOA 3V4SA 3SYNA 3PEFA 3CCFA 1W1WA 4FYIA 3A4LA 3RFTA 1U0JA 4DR3B 4ND5A 4CQJA 1I3NA 1XDBA 2VDVE 4YV1A 1G21E 5IYZA 1NTRA 4CW7A 2H59A 4X54A 1WG8A 3KHLA 3LS2A 3VPCA 4OJQA 4DV5B 3IERA 2GO7A 3KSDO 4ZOLB 2R8EA 3FJ1A 4I3GA 4JI4H 4LBYA 4TPKA 4RV4A 4TUYA 1IHUA 3C4JA 4HUQA 2W6CX 2FZ4A 2WY2D 4ZCMA 3WWJA 3FDJA 3Q87B 1OAOC 2VYVA 2H3HA 2FH5B 1G66A 1PQ4A 2PVPA 1B43A 1GA4A 4UHBA 4EHFA 4E1AA 2AJTA 5HK8A 4HYYA 4ON9A 2P2YA 4U8HA 3PV0A 4DMLA 1XTUA 2BBSA 3VKVA 1SVNA 1CLUA 4QUJA 3UM9A 3ZH2A 1ISPA 2FFQA 5HJ7A 4JSRA 5BN1A 1RFGE 4QPJC 1KEEA 2ZJ4A 3NHRA 3FWPA 4B3MB 1P77A 3K92A 4RBNA 3HU1A 4APMA 3PRKE 4UPDA 2HMVA 4G5HA 2OB2A 5BQ5A 1HMPA 5C1PA 1CQJA 1DIHA 5J4YA 3U3DA 4RA6B 2VSXA 1KQNA 3TI9A 2BFFA 1QH8B 1Q1QA 4LZOA 1EFVB 1XCPA 2I6SA 2P65A 4KRYA 4UDOA 2J5RA 3L07A 4K03A 1N8KA 1WCWA 3P2IA 2JCYA 4G9GA 1KYVA 3E3AA 1AM4D 1LLCA 1C4OA 1XAHA 1U7HA 4EF6A 2ZXUA 3LXMA 5CDGA 2F3PA 2NO6A 1KORA 2M1XA 4GNKA 2WSIA 4EFMA 1XMXA 4X6YA 3ZKAA 4AJPA 3HCCA 3D59A 1E5LA 2VHWA 1V4VA 5I5WA 4B4KA 1LFDB 2B1QA 2V6JA 2BHNA 2GEFA 3A7EA 3HUEA 2HOQA 3L49A 2F43A 4KDEA 1XRNA 5K09A 2NV6A 1N0IA 4LC9A 5IF9A 1SAYA 3NVAA 4BNDB 2C3PA 4ED2A 1UBSB 1J0AA 1W36C 1IUPA 3QLVA 4Y2UA 1S8FA 3TLJA 4GNRA 1WDTA 1NNEA 5JJLA 2TECE 4EVIA 4KQFA 3U31A 1C80A 4I55A 3JQAA 4JLOA 3F6RA 1DEHA 1K1QA 1GCIA 1YS6A 2HN9A 2ASDA 1K9VF 4EB6A 1M2VB 3OZBA 1XN1A 1WVMA 1JQ5A 3U7HB 1Z0FA 5TXGA 4MYCA 2F4NA 3H83A 3HO6A 5THQA 4KMSA 1Q17A 3TOZA 1IJBA 4HBGA 1ZUWA 3BL6A 1V16B 3AJAA 1CUGA 4BNHA 3IEUA 4J0QA 1U63A 3THYB 4OCZA 4F3RA 2FW9A 3M5DA 2NW6A 4QUHA 3GJ8A 1ADCA 1SQSA 3HVUA 5M04A 2F00A 4RK0A 3HDQA 1KZHA 5K1ZA 2AGOA 2X5XA 3NTVA 2UYGA 4KV7A 1UT6A 4ARSA 3H9EO 1J70A 4BC0A 1E1CB 3C6QA 2A14A 2EYUA 2IOFK 2ZEJA 1KGDA 4QD3A 5ADUS 3OQJA 5JAHA 1XEFA 2Y66A 3NTXA 3VQTA 2Q8NA 3LL4A 3PIRA 3UWDA 2G6BA 3FCSB 1T8UA 1V43A 1U7TA 1RYDA 4Y9UA 2WKSA 3VBEA 1QG0A 1ESNA 1U8FO 5FOWA 3FY4A 3VC2A 1R9JA 4FINA 4JLNA 3OCVA 3F6PA 4EPYA 1SQ6A 4MITA 1H85A 2C2DA 4ATNA 3OECA 1IY0A 2MSLA 4QAJA 3BE8A 3AHDA 4NCHA 4MVJP 4E6EA 1FTYA 4RANA 2JFOA 3A70A 4XH9B 3NHJA 3VNRA 1J8YF 4H7DA 2ZRLA 4RLQA 4S1VA 2NXCA 4GMHA 2WD9A 1N2XA 3RJMA 4K9PA 4E88A 4W7IA 1JDBB 3ZJ4A 3TNFA 5DULA 3EODA 2GN0A 4PICA 3RVNA 1OB5A 4MGYR 3OE7D 1X7DA 5REQB 5HTOA 4WBNA 1Y1QA 1R16A 4KIGA 1X7GA 2NV2B 3W9UA 2EJBA 1T0PA 3ET5A 1CUIA 4ZA2A 5I7AA 2Q5OA 2CV2A 2AFRA 2P9ZA 3KAJA 3FYDA 2O9JA 4G0XA 5L4NA 5CH5A 1KE1A 3JX9A 4KBYA 1EZ4A 2QNBA 3O3OB 5HR5A 4WN3A 2OZEA 4IZOA 3AJEA 4LYEA 4RKQA 3QJ5A 3UJ9A 3N5CA 1O0SA 1R9GA 2JBHA 1P7PA 3NBMA 3D0QA 2RAPA 3HOWG 2FKLA 2X2FA 3PLAE 4BU0A 1AUOA 2NUAB 2ZS8A 1P0MA 1VCHA 3M9NB 5L40A 1YR3A 1A2BA 5FUBA 4LBWA 1T8SA 2PBZA 2ECKA 2PL3A 2I7CA 1UCFA 1LQUA 2Y2VA 2BDEA 5FWYB 2PMZA 1N2BA 4O33A 1FIUA 1EQUA 4J3NA 2GN6A 1M1XB 4MA5A 4PLPA 3FOWA 3OKCA 5G1PA 3T0GA 5K4GA 5K0SA 1E0KA 5E38A 1WOMA 3T12A 2WUGA 4QOHA 4Z4IA 4CXMA 3ORRA 1MO5A 4QG3A 2AJDA 3QE0A 3E7WA 4OXQA 3PO3G 1J9GA 4KR0A 3FTEA 4Z5XA 5DG7A 1UDWA 1E3WA 5JXGA 4GD3Q 3FPAA 1XRLA 4HNAB 1TUEA 5L3QA 2P4SA 4UUBA 2QD4A 3IBFA 4E5NA 4KKVA 1VG1A 3AETB 2Z8XA 3V7FA 1O54A 1HT3A 1YZUA 2FEWB 4X84A 4DQ0A 1AK1A 3H99A 3NM6B 2ZUUA 3ZQKA 3RUEA 3DMTA 3RKRA 4JI1H 2YZKA 5KCMA 3GMDA 4G5RA 4N0PA 3DTVD 1RJQA 2RGEA 3ENWA 4ZU3A 4RGVA 4CF7A 4OB6A 1G19A 4EVRA 5DWQA 5A5VA 2OHGA 4O7VA 1N57A 1RWVA 3L5OA 3AL3A 2C03A 2DCMA 3EHEA 5EXPA 4QJ3A 2Y1XA 5C2JB 1J33A 5AW4A 2JFPA 4URYR 4E5YA 4ZV4A 4CN9A 1X42A 4PZ7A 3GNTA 3QQPA 4U2GA 2BE7A 4OGGA 4I99A 1AQNA 4CWAA 3RC3A 2VC2B 5LZ5A 4KH0A 4QHYA 4CM8B 4AJLA 3LWNA 3K9CA 4KH1A 5I9TA 1Z5NA 3E3MA 2XYGA 2Q8PA 4MW6A 3RYHA 1XTIA 1KP9A 3HKDA 3QXSA 4ROSA 5HF6A 3BJEA 3C0FB 4RIIA 1M6EX 1D8AA 1USKA 5BVGA 4QUAA 3PXEA 5IUJC 1Y89A 5C81A 1RW4A 3OQ1A 2BFCA 2GR9A 4MPPA 2RAUA 4JIMA 5CVEA 2CXOA 4GGOA 3N1UA 4TWBA 1N7JA 4I6GA 1XZHA 1VI2A 1Q7RA 3ZVNA 3BTUA 5LB4A 2GHQA 1V7ZA 1TTQB 5TC4A 3AF6A 4ZI2A 1UK8A 4BRUA 5JD6A 2Z43A 3MFIA 4DL5A 1E8NA 4YCSA 4MHOA 2QGNA 5B5SA 1EGAA 2CE7A 1PHRA 4OSEA 2W6ZA 4P3XA 1ID8A 5F77A 2C92A 3GQBA 3UK2A 2LNDA 16PKA 4IWXA 4ZN6A 4B80A 3IQIX 4Z9BA 2Q62A 3CZAA 3DOEA 4C9BA 2FE3A 1GNSA 3OIVA 3VDNB 3RTGA 1GWNA 2BI8A 4L28A 4K46A 4Q48A 2J3KA 2E85A 4G4GA 4R8KA 1DCMA 4QTZA 4B1FA 1NWHA 2IGBA 3N0XA 3JWJA 2J9GA 2I2FA 3GEMA 1VI6A 3SEZA 1DAAA 4TSRA 1BG6A 2QMZA 1AX9A 2EKZA 4PINA 5GM2A 1E94E 1GKUB 3TE6A 4A2BA 1RWWA 1YFKA 3NX4A 1U9IA 3RVLA 4EJSB 2ACWA 1TMYA 4OHPA 2QB5A 1CZHA 1VCMA 1P73A 2CCGA 3UB3A 3X1KA 1WHSB 3WLQA 3RSFA 1NUQA 2K5UA 2LXNA 3IKTA 3HSSA 3H2GA 3ZJYA 3W5VA 2H2AA 3IR6A 3K8ZA 4FDVA 2PZKA 4HNVA 4LSAA 3IOEA 3BTOA 5JTUA 1FFXB 3IKJA 1RJWA 4KN9S 2IYEA 2QRGA 2WD7A 1N33H 2HGSA 3MS7A 3L1JA 3FF4A 1J00A 4YRFA 3BIXA 5DQHA 4ZVOA 3JAMW 3G88A 3BHNA 1OWLA 3WO1A 3D4LA 3SICE 1Z07A 3B7WA 1HETA 2OD7A 4YR7A 3OJEA 2C5AA 3QXXA 3ASVA 2HJSA 1L8QA 4I50B 2NZVG 3FTDA 4NICA 1OVMA 3JRXA 1G1MA 4DA6A 5JVDB 3DAGA 2JB9A 2AX3A 1TVMA 4ESOA 4OHUA 1RI4A 2G1AA 1KH3A 2YASA 4F3TA 2RD2A 4GOND 1WXEA 1S7CA 4XX0A 3VX4A 3GH3A 4KK3A 1EDBA 2KMLA 1V5IA 5A3QA 3UZUA 2OORA 2FE4A 5KFSA 1Q11A 4OHYA 4Q3CA 4LJSA 3HJCA 1COWA 3BF7A 3NYWA 1XTSA 4QGBA 4NDZA 4IDOA 5EKXA 4DBLC 2TSYB 3K6SA 2PDAA 3FROA 4K6FA 2HDWA 1T0BA 1KEUA 1M7JA 4I14A 5KG0A 2DUMA 2V4QA 3CNBA 1SBZA 4MGKR 1AGXA 4BMSA 3SN6A 4MJ3A 3UGQA 5DX8A 2I3ZA 4GPIB 3KYHC 2B6NA 1XZQA 1RPAA 2VH2A 4GI5A 1KFEB 4ZT2A 1UQTA 3IV6A 3PUVA 4H1HA 2IHZA 1CP2A 3UJ8A 3DEAA 5JYEA 4F12A 3CQZA 1MDFA 1F5SA 2PRKA 1U4OA 2YIVX 3WGIA 2JA8G 4F60A 2M1ZA 4NH4A 1W6UA 2QG9A 5COBA 2DY0A 2ZT5A 3PEUA 1JTVA 3VZRA 2C9CA 1E9CA 4Z99A 1A96A 1NC3A 1ZX1A 2ATLA 1GNQA 3H4VA 1KP3A 3ZW8A 3QFCA 1YDHA 1F3OA 2JBAB 3AONB 1VSTA 2PJUA 3TQ1A 1CF4A 1R6UA 3KM0A 2QBYA 5C18A 2I7VA 4NDAA 4D9GA 1BXGA 4YMGA 3S24A 3CG4A 3R74A 4Q9JA 3C6XA 4UUNA 1N8SA 3UZBA 4UCOA 3BMQA 1MMFB 3INRA 1J2TA 5D85A 5JTTA 1CJUC 2HRCA 2XE6A 1RRCA 2VNKA 4G0QA 1O6GA 3QBTA 1CPYA 1RCUA 2VJOA 4KJXA 4KNWA 1B0PA 4N9WA 3GDGA 2FN7A 4N7BA 5DWDA 3OHSX 5CM0A 2XSZD 4CCSA 4C7MA 3WKEA 1HYBA 1VP9A 2ASJA 4YCCA 2JANA 3D8UA 1RYRA 2Z08A 1GGMA 3HJHA 4KR6A 3TUIC 1BH2A 4RZXA 4ZEXA 5A4IS 3EGDA 1WZCA 1N5MA 1QP4A 3EWAA 5FPYA 1PR5A 3KJNA 4RHCA 2WIKA 1UFKA 3KKLA 1DJLA 3OZEA 3A11A 1G8GA 3SXPA 1UKZA 3N7UA 3VR6H 2ZJYA 4W9MC 3ZJTA 2FJPA 3DSRA 2IF0A 4OQEA 3QV1A 2GJ9A 1P29A 1W5EA 1S10A 1EUCA 3QW2A 4WKPA 3U3ZA 4IJQA 2IFTA 4MGIR 5KFWA 1RRFA 3WO0A 2R92A 1QFZA 2EJWA 2JFGA 3TXAA 7AT1A 1GADO 4HN9A 2JZOA 2NADA 4BWYA 5JC1A 3ZWWA 4KAAA 4X24A 4NMHA 4CM9D 5H83A 4XM0A 2K4MA 4K1LA 5SY4A 1ENOA 2A7QA 2CL0X 5JSZB 5KSYA 2Q6KA 2G5TA 3M89A 3L8ZA 1S1MA 4O4IA 3QXJA 4CT5A 3M9OB 1RE0A 3BFPA 1SCUB 2J7PD 3DO8A 3AY7A 4B7UA 1CUCA 4GC5A 1QRDA 2CD9A 1N8NA 2WAQA 1GLNA 3DXYA 1VIVA 2OR3A 3WLPA 2HAEA 5A2GA 2VJCA 1YR6A 3C7AA 4KFTA 8MHTA 1IB0A 2HVSA 1PR0A 4LXTA 1Z2OX 3GROA 1U0SY 4IQFA 4WXEA 1S7GA 1WA5A 1S8OA 3ZU6A 3VZCA 3VHRA 2N42A 4LY9A 3DZFA 3IVCA 3QPAA 1DXQA 3BMNB 1QRTA 3L1UA 2LTAA 5JJBA 2HSGA 2E6UX 4K86A 1F2TA 4I9HA 1T0IA 1YXMA 4CE5A 1PZHA 3W5IA 2JI8A 3JD3A 2ZSHA 3NTRA 4Z4GA 2LP4Y 2G76A 4JX9A 1ZD5A 5FULA 4BQOA 3OM9A 3EXAA 3RV3A 1SVWA 4WKCA 3OCJA 3FCOA 3NH6A 2VP4A 5I5GA 4DTIA 3E9CA 3IKVA 2RONA 1YL7A 4II3A 3FDXA 1PTJC 4K2AA 2Q9UA 1ZW1A 5DLPA 3A6KA 1LBIA 2XB4A 4PN7A 4IR1A 4P2GA 5IXSA 5LMUH 3TW8B 1Y81A 1PL0A 1JHZA 4ZVTA 1AK2A 4I1IA 5B2FA 1JHYA 1TT5A 2ARKA 3RARA 3QG5A 1P4JA 2BTQB 4B48A 4XGQA 4MKIA 1C4XA 4ZT6A 2REBA 1KTAA 3CLUD 4XM2A 3N43B 2YHUA 1JZSA 3G9XA 3W3AA 1QFJA 2F62A 4GXQA 5B4UA 4Y7CA 4YRBA 1ESZA 4WKBA 2N9UA 2DP4E 2FR1A 1KC3A 5AJHA 5T8KA 4FKZA 3EY4A 2QM7A 3P0FA 1DUIA 1P61B 1RYBA 1CIVA 3EFOB 3LD9A 1B8NA 3EULA 5CLQA 2IEYA 1WP4A 4PYKA 5H80A 1IMJA 2ZRNA 3D2BA 3M5CA 3IOCA 4YJ3B 1TZKA 4P81A 3HKBA 4BE9A 1J0CA 2CLSA 4V2IA 4BWVA 1L8AA 4EJ0A 4PHGA 3TGPA 1GJRA 5KFNA 2PIDA 4M6WB 3C5HA 2Y0CA 1P1BA 1U28C 3PBKA 2ZVJA 4M7OA 4MMZB 3OQPA 5ELMA 5LQDA 2VXBA 1PR1A 3R3ZA 1JG4A 1SWWA 2Q3HA 3F71A 4B6SA 3HGMA 4X6XA 1F12A 2A9RA 3GT3A 3GLHA 3DWIA 4WKOA 5CDFE 1JXMA 3G7NA 2FEOA 1NVVQ 2P4QA 4W9RA 1X2EA 2WF9A 4OO3A 1OFUA 3BIFA 1Y63A 1OILA 1ZP6A 3AUJB 2YJTD 3N42B 3H2IA 2P9JA 2YHIB 2CXRA 4ANFA 2PR2A 2HIHA 5D1HA 1N6PA 2IS1A 2VR1A 7ADHA 5I7EA 4RTJA 3P9XA 1OREA 1XJQA 4XEUA 2DTDA 2FK7A 3A58B 1GFWA 4GMGA 3M8KA 5D8DA 3L7NA 3VAYA 3QBEA 2Q2UA 1BKYA 3DHEA 5I9NA 3U7QA 5L1JA 2EX0A 2CBGA 1RQGA 4KDFA 2XWBF 2O8FA 1VRWA 1VC2A 1V5WA 2VNJA 4JFRA 1M33A 1KI8A 2M6RA 4POAA 4HADA 5F23A 4BQRA 4ZALA 4BDSA 3S8MA 3RHFA 2J6HA 3A2MA 4HAVA 2BGTA 4HNUA 4IOLA 4ENVA 1LC3A 1MC4A 5CA0F 3EXHC 4G86A 2AWNA 3VA7A 3IR5A 1IJEA 3ANNA 4TKUA 3EVZA 4BWGA 1WXQA 3GZNA 5D3ZA 3KPYA 3PNKA 2W70A 2HCBA 3K31A 3N6RA 3R5XA 4LF8H 4XSVA 3EISA 1TMOA 1XROA 1TEVA 3VDRA 4F38A 3BULA 2XPCA 1LEHA 1E79D 2PAAA 1N36H 3KEGA 3WTCA 3LMKA 2HPVA 1C4KA 4IDDA 1U0NA 3RH0A 2HWKA 1E7RA 4ASUD 1JBQA 2R4UA 4MGZR 1G64A 5FJIA 3FMPB 3GZTB 1Z6PA 5BVHB 3FLAA 2H4XA 1G8AA 4DR4B 3OFNA 1IQUA 2V0CA 4BAGA 3WGHA 1EXVA 4LHZA 5JALA 3CE9A 4L15A 4W5NA 5BWMA 1UC4B 3F5FA 5A02A 3SNOA 3E18A 4HT3B 3ADKA 3VR6D 1H3FA 4QUKA 3EQ7A 3HCOA 2D0DA 4MXDA 5H4GA 2HNBA 1Z2AA 2OAEA 4HXGA 4HQKA 1TMKA 2HXSA 4DPMA 4WA7A 4O7ZA 1KI4A 1DRKA 4ME6A 5L9AA 1BMFA 3KG2A 4KO2S 4FE2A 2JJMA 5EKDA 3JQCA 1ZK1A 1O4WA 1X1DA 4FKMA 4IF6A 4M9CA 3QE4A 4K6GA 4QBTA 5LA6F 2DAAA 1JJIA 1R8XA 4CDRA 4DC9A 2X5KO 4BZQA 2JF0A 3BAFA 4D0GA 1BE1A 4ZZ2A 1YK0A 4CTJA 3ZHYA 4JLMA 2Y1OA 1AB6A 2WLSA 5FTKA 2OYRA 3ANLA 2ZJ3A 4FYHA 4RK4A 4TM7A 5CYPA 1GDTA 2WSLA 5EPEA 5F9HA 4KFRA 1GP2A 4GDFA 1JSLA 2VA9A 3RBZA 4JBXA 1G3MA 4I4LA 4G8BA 1Y48E 4RNDB 4ADSG 2E4XA 3ZHBA 3L77A 3JAMA 5DX0A 1L3BA 5IKMA 2PBRA 4JI6B 5LDDC 2BFDB 4DLSA 2ZVPX 1DIBA 1K7XB 4EARA 4A0FA 2W6PA 2BGIA 3FPBA 1U0GA 1HL3A 1S9HA 2OGZA 2OB1A 5L6MB 2JH3A 4YCBA 1LUAA 2PBLA 2AC4A 5EQJB 2EWVA 5DLEA 1JMVA 4XGNA 4B4DA 3DV0B 2O2GA 2AI3A 4AQYH 2F90A 4XYLA 1R4ZA 1U02A 3K72B 2RHTA 2VTEA 1JE1A 1SOMA 3RVOA 3DR5A 5HOQA 2P40A 3SSNA 4EAAA 5KVCA 2JIMA 1NKVA 4GDMA 2UXDB 3CT6A 3L02A 1NQ5A 1ZIOA 3ZEAA 5AJZA 4G0VA 2ZR0A 4BNWA 3TQOA 4K6HA 1W4AA 3P97A 3C45A 4UPVA 3MB8A 1II8A 1KOJA 3B3JA 2V7TA 4HDNA 3RF6A 2C2OA 1M2OA 2BEUB 4DR6B 1RMYA 3T41A 2HBQA 2ODQA 3DYVA 1L5HA 3Q88A 4IWNA 1YZ3A 2XKJE 2OCKA 3K1AB 4MKXA 1LPNA 1V8ZA 2EL7A 3LYLA 3ZDBA 5FHRA 4R5MA 3L7DA 3NC4A 1XQYA 5BO5A 2PH3A 3WFIA 1H9AA 3IVXA 3IIMA 2M05A 1QCCA 1R4NA 3LQRA 1OKKD 1PZXA 3SI8A 4U4AA 1DEKA 2UUCH 4GYWA 4B8ZA 5EJGA 2LV8A 3RS5A 3IRVA 1XYYA 2WYHA 1RWPA 2CMGA 2PGLA 1JPVA 4N03A 4LJAA 5JJKA 1QG6A 4P4UA 1ZIYA 5AD1A 5ALDA 3AB8A 3O4VA 1HE5A 3GJ0A 2Q0QA 3NOQA 1S2LA 1ZRMA 2ZI9A 1TYDE 5D1OA 5FKJA 3OU2A 1TIPA 4UUPA 4EY5A 5KG2A 1OH5A 2DZDA 1D9ZA 4TL9A 3MWMA 3MA0A 4E6PA 4G01B 3O0DA 3ESRA 4YNBA 2QJTA 2AI1A 2GEVA 2UVDA 4D98A 4PRLA 2VT3A 3L04A 3NNNA 2ERYA 3A6GA 5KC8A 3D5QA 1I30A 2R93A 2ZROA 2E87A 3CF2A 2GRJA 3LT0A 1Z39A 3C3BA 2IYTA 2J9FA 1PFGA 4D9FA 3SE7A 5LLTA 5DP1A 4C7OB 3BVPA 3FTCA 3KLNA 3F8WA 1AK9A 3VZBA 1ZETA 1Y42X