3DF7A

Crystal structure of a putative atp-grasp superfamily protein from archaeoglobus fulgidus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
305
structure length
301
Chain Sequence
SLKLFLFEFATCGERIEDSTAVEGLAMFKSAFDGFKNYYEITGFVRPEFSCLFTLPVDSMDSMEKYLEKSDAFLIIAPEDDFLLYTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRGEVQVPQTSLRPLDCKFIIKPRTACIGFSDEVPDGHIAQEFIEGINLSVSLAVGEDVKCLSVNEQIINNFRYAGAVVPARISDEVKREVVEEAVRAVECVEGLNGYVGVDIVYSDQPYVIEINARLTTPVVAFSRAYGASVADLLAGGEVKHVRRQMVRKSKSAEKPYVSVGDYTLEIIDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ATP-grasp superfamily protein
publication title Crystal structure of a putative ATP-grasp superfamily protein from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 83
structure length 301
sequence length 305
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
A PF18301 preATP-grasp_3 pre ATP-grasp 3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3df7A02
3.30.1490.350 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3df7A03
3.40.50.11770 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3df7A01
3TIGA 2XD4A 4NYEA 4XZ3B 4O7ZA 4WBNF 4MA5A 2DWCA 1A48A 4O4IF 1KBLA 3N8DA 1CS0A 4ZI7F 3GIDA 4E4TA 3QFFA 4FE2A 3MWEA 3V4SA 3I12A 3KALA 5LXTF 2W6OA 3WO0A 1I7NA 2YS6A 1Z2NX 2R7NA 1SCUB 2ZDHA 4FFRA 4XYLB 5JVLA 3KAKA 3KAJA 2CZGA 3U9TA 2V5AA 3RV4A 1JLLB 5JQWA 3VOTA 4FFMA 4FGRA 2FPIB 1DV1A 2R87A 5J2UF 2YL2A 3V4ZA 2FP4B 4YAKB 3K5IA 5FNVF 4O81A 5D8DA 4HNTA 1A9XA 1IOWA 5IYZF 5C1PA 4MV3A 4O4LF 3DF7A 1C3OA 4QSHA 1PK8A 2PN1A 2PVPA 5C8YF 3R5HA 3G8DA 2GQRA 4EGJA 3NUAA 5CB4F 4MV7A 2HGSA 1ULZA 1EZ1A 2VR1A 3MWDA 1M0TA 1KJ8A 4O2AF 1EHIA 5CA0F 5BMVF 3TW6A 4ZQIA 2R85A 1B6RA 1KEEA 1KJIA 4C5BA 2R7MA 2DZDA 4DIMA 4FFNA 1KC7A 4YBZB 1OBDA 2I80A 2Z04A 1E4EA 5CA1F 2YW2A 4RZQA 3R23A 2ZDQA 4Y8VB 4I4TF 2I8CA 2VQDA 2W6NA 2VPQA 2YWVA 4O4JF 1E4EB 2GQSA 2XCLA 4O7YA 4IHJF 2W6QA 4IZOA 1IOVA 3GLKA 5H80A 4O7LA 3TIIA 5BPHA 2R7KA 3VPBA 2P0AA 1CE8A 2J9GA 3WNZA 1M0WA 2YZLA 1EYZA 3AX6A 1GSAA 3TQTA 1EUCB 1PX2A 3RV3A 4MA0A 4ZOLF 2NUAB 4HR7A 2YS7A 3LWBA 1AUVA 2W6ZA 3AW8A 3JRWA 3HO8A 5LP6F 5JQGF 2DLNA 2GLTA 5BPFA 4DLKA 2WYOA 4MV6A 3HB9A 2YZNA 1T36A 1GSOA 3N6RA 5CAEB 2CNVA 3R5XA 2NU8B 3TINA 2W6PA 4ME6A 3ORRA 4MV8A 5DMXA 2GPWA 1EUDB 3UFXB 4XYMB 2CNQA 4HNUA 2PBZA 3R5FA 4O7RA 1BXRA 4FFLA 3U54A 2QK4A 4O84A 3ETHA 1CQJB 2IP4A 3JRXA 1CQIB 5JH7F 2CNUA 1KJ9A 1BNCA 4EG0A 2FPPB 2ZDGA 4O7WA 2R82A 3OUZA 4FFPA 4XX0B 1JDEA 3U55A 3ORQA 4TV9F 4O7TA 2GPSA 3MJFA 3E5NA 3RFCA 3G8CA 4C5CA 5EZYF 1W96A 3VA7A 2YZGA 2HJWA 1VBGA 4FFOA 3K3PA 2W6MA 4MV9A 4YJ2F 4YAJB 4HQ6A 4L1KA 4O2BF 5GONF 1JDBB 4M9UA 4O86A 3JZIA 1AUXA 1DIKA 1Z2OX 2V59A 3U9SA 3Q1KA 5JVDF 5KX5F 3K5HA 2NU6B 1KJJA 1DV2A 1VBHA 3BG5A 2X0SA 2W70A 4EGQA 1WR2A 2V58A 3OUUA 4YB8B 2DIKA 4I55F 2R7LA 3SE7A 4O82A 4IIJF 2R84A 2W71A 2Z02A 1KUTA 4YJ3F 1GGOA 2YZMA 4MAMA 3KREA 3Q2OA 5J2TF 5HBRB 2OLSA 1OBGA 1JKJB 2FPGB 5C1OA 2R86A 4O83A 3VMMA 1KJQA 2QF7A 1C30A 4FU0A 5HV6A 1B6SA 1W93A 4TV8F 1M6VA 1Z2PX 1GSHA 2I87A 2NU7B 4O7SA 4O4HF 3HBLA 3RUPA 3JZFA 2YRXA 2YRWA 2C00A 4MV4A 1GLVA 4ZHQF 5LOVF 2SCUB 4O7NA 4HNVA 4TUYF 1I7LA 4MV1A 4C5AA 5LYJF 2FB9A 2NU9B 5KKNB 3R9RA 1VKZA 4O7VA 4I50F 3LP8A 2YYAA 5LA6F 3ETJA 3VPCA 3WO1A
chains in the Genus database with same CATH superfamily
2ECPA 4RVHA 3M9MB 3F7TA 2IQIA 4PAGA 5AO9A 5HS4A 2AFIB 1ZPDA 2J5RA 4BVKA 5BW6B 1CUFA 5LXTF 3RI3A 4UZSA 2R7ZG 1Q1GA 3GPDG 5F4BA 3T3NA 2C2RA 2IYAA 3C3AA 2PZAA 2POCA 2VHTA 3WK8A 4FSHA 4RVFA 4MUKA 4PNEA 2WM8A 3HDTA 2IS6A 3FDSA 1PJ3A 1YZHA 4CT5A 3ACBA 4MK4A 3GTPA 3SZUA 1E69A 3CVJA 1C2YA 4D8YA 1ESCA 1Z2CA 5CPBA 1F2TB 3K5IA 1V5IA 1A9QA 3WK9A 3FKQA 3TTTA 2A9PA 2AN4A 3QWUA 2UXDH 5B53A 3HOVG 3I9KA 2PH5A 1SM4A 2UUOA 4Z0NA 3VC1A 1XYGA 3RR5A 5KFTA 4EGJA 4ZDWA 4RTRA 4BU0A 3CR7A 4NF2A 1BSVA 1SWVA 4U6QA 2ZAOA 4IIXA 4LZAA 1AQLA 4GR4A 3FM9A 1NI3A 3LT4A 2ZYIA 3L4SO 4UMDA 4JYAH 3QEOA 1FTQA 4FLEA 2VUIB 1EH5A 5JTUA 5HCNA 3RYFB 3ND6A 4LXGA 4YJHA 5JFOA 4C7BA 1T2CA 3DB2A 1FLAA 3TM5A 5KYTA 4HHEA 4AY3A 4V03A 4HWGA 4MRPA 3WBJA 2WK1A 5FD5A 2CMGA 2CXOA 3N8NA 2YFKA 4M9RA 1EK6A 1YAJA 2ZTLA 2C4HA 4HFRA 3GXOA 3K6JA 3WWEA 2FRXA 1VB3A 3BIOA 3UN1A 5BWUA 1IXSB 5BYBA 1HLDA 4Y2SA 2OKGA 4EA8A 1M0WA 5D5HA 4CQMB 4HEQA 2B3DA 2ZOSA 4LW8A 4H7EA 1QGUB 3SDZA 5IMBA 3DPIA 1D2HA 1ORTA 3NNNA 4DW8A 2R8BA 3FWZA 4CM4B 3KEMA 3CGWA 4XIJA 1ZOIA 2JHGA 2CW5A 1ZC4A 2RH8A 3AQ4A 1YHYA 2ZXUA 3AVPA 3BDIA 5KTMA 4ME6A 2PMEA 1GO2A 1T35A 3H1AA 4Z3DA 2EX0A 2O8BB 4YCCA 3AHFA 5F1OA 1KPIA 4DRXB 2C07A 4B3IA 4ZOEA 3UANA 3VNNA 4ITUA 4NL4H 3QBTA 3VAYA 3NHSA 3L06A 2I7VA 3DBRA 4AN0A 5HFJA 1DDGA 4JL8A 1XQVA 1JFLA 2ZB7A 4EIWA 1VPLA 4QX6A 1JIUA 1XSEA 4P38A 2RHMA 3SN6A 4G3IA 4PLTA 4DBLE 3WKAA 3LS2A 1AXRA 2H2GA 3I8OA 5BUCA 5IJ9A 1ZHFA 4ALNA 2FZ5A 1F2UB 1T29A 4DV2B 4C1NA 5A03A 1HDOA 3D6TB 1TT7A 2OSVA 1SCBA 1RRGA 1T8RA 3EXEA 4KWTA 1H2XA 4DV4H 3EQ6A 2JAPA 1LSSA 2E2HA 1LRLA 1LBQA 2LIPA 1ZJ5A 1NMXA 1EBBA 4DUGA 2PX0A 2XB9A 4FEYA 4LEIA 3H7IA 3IBTA 5JARA 3O2JA 1ECGA 3VH2A 2IFTA 2NVYA 1EXNA 4YJ3F 1GGOA 3G88A 1V9PA 2WFAA 1Q19A 4NE2A 4BWGA 1TMYA 4CF4A 1FDTA 1TVEA 1Y8CA 1UXIA 1W44A 4K1LA 5GZ3A 2LDBA 1BMDA 1TVMA 1MIOA 3A14A 1N2ZA 3IPAA 4QYIA 4JQSA 2XTZA 3CNNA 1J21A 1UJ2A 2GCEA 4QJFA 4YJFB 3KWFA 3BJYA 3QXSA 2HREA 2YDYA 4L0DA 5JNLA 3G0HA 2NU9B 1PAUA 2Z3WA 2RHTA 3JAWA 2HRZA 4DLTA 3BKXA 5IYBG 3U4GA 1VPWA 1MAVA 3IFSA 3U5ZB 2TS1A 3MNFA 1N2CB 5KEIA 1OWPA 4L2IA 2GM9A 2EJ0A 3CY6A 3IQFA 2IP1A 2NYAA 2OUKA 4WFKA 3H4IA 1A7KA 4AMVA 2EL9A 4P92A 2R7NA 5LWQA 4EYHB 2OCLA 3D8UA 3DQZA 3KKNA 2QAGB 3QX3A 2BTOA 5J47A 5FOSA 1CJUC 4LX0A 3T7EA 2EU8A 1WB4A 4DUPA 4C30A 1PWZA 1X42A 1XMIA 1SAYA 4K0RA 1YB4A 2X8WA 2NPOA 3UJ8A 2ZUCA 3QWHA 2MINB 3JQPA 3N5KA 3WGKA 1FLVA 1UAYA 1Q1ZA 4EPRA 4V0RA 4M76B 2XVZA 4G4JA 3ELYA 2FFJA 5G4KB 3FYCA 1ZIPA 3MC1A 5G0TA 2XE6A 1N4DA 3V42A 2GQRA 3V6MA 3HSSA 2HL6A 4U7TB 1TWHA 1ZINA 5MN5A 2P65A 1YFLA 5TF4A 1O1YA 4FNOA 3NTUA 2JGIA 3RSHA 3MWLA 1IBRA 1EEXB 2EFHB 2J0UA 2RGXA 2AD1A 1GTSA 1IWOA 5CCEA 1EQUA 2O1SA 2O3QA 4Y9UA 2MSDB 2VYVD 4G97A 1OBHA 5LA6B 4A5SA 1KEEB 4D9NA 5A4DA 2OLEA 1T5SA 4YRQA 4JI7B 3I1YA 1Z3IX 2VQDA 4Y9SA 5AVYA 4UPDA 1T2UA 1JHMA 4IMIB 2JL1A 4IS3A 4X7MA 4XA8A 5FULA 3RHZA 3G6VA 2XPCA 4F46A 2M6SA 2O8NA 2PS1A 5GJBA 3LC2O 2CNDA 4HAVA 4C21A 1QGDA 1Z35A 3P9RA 3BWDD 4ZYXA 3NT5A 5BO5A 4W7IA 2VS1A 3RK1A 1RYSA 4G2TA 5MN4A 3MS4A 2CV0A 3OESA 3Q6NA 3GA5A 4KDCA 4WOPA 5GM1A 3KR1A 3B9QA 4F85A 3DHWC 2WFMA 1WEKA 4J3NA 1QRSA 2RH5A 4TQRA 2E5LB 3HJCA 4JODA 3RARA 1I1HA 4I9HA 2J85A 2ZSKA 3ZIDA 2IHNA 1JG2A 1Z5ZA 2PBZA 3HADA 3V8VA 5KFUA 1WQ4A 3U16A 1KZ9A 5JNTA 3KSRA 1G1MA 2R97A 2IZOA 3JQDA 3WY9A 3R4VA 3OKAA 1H0HA 3INRA 2IV2X 4M0MA 2ZDGA 1I1MA 3GJTA 5LB2A 2HSZA 4OQLA 5JR3A 4HZUA 3C24A 1K0UA 2IZ7A 4J0EA 7ABPA 3GF4A 3ZWQA 2JFFA 5BVHB 1JKXA 3BJIC 2FXVA 1LWOA 2F6RA 4XR4A 5GONA 4LV8B 4NENA 2GEJA 1Z6YA 1RPAA 3E0XA 4QQNA 1CLEA 1IC6A 3VHQA 4RLFA 2ZB2A 3GBVA 5CH5A 2WKSA 2SNIE 2HMSA 1AB5A 1OIVA 4OLBA 3VDXA 3C8DA 1OYWA 1PT9A 2I9PA 2QKYA 2B7LA 1XCBA 2LUOA 1Y8QB 4ZMBA 3OIDA 4A6XA 5KG2A 3SDBA 4QO8A 1M7BA 1HTBA 3JWHA 4B47A 4P5PA 1G63A 2ZZKA 3U4HA 4FXPA 4F45A 3K71B 2WT4A 1NXXA 2JLRA 2OFOA 1RFLA 2F48A 5KFOA 4EPVA 1K7FB 2WG2A 1T2FA 5DCLA 5K0BA 4XAQA 5A2QA 2BYTA 1JKMA 2VQFB 4KJZA 4LF7H 5DWQA 4Y1EA 2XCPA 4Z1OA 2P4EA 2E3JA 3GJRA 1YMUA 1ZN2A 2BW0A 2ERXA 2DOKA 2YX1A 2H9IA 3MINA 1Y37A 1CR1A 2Q62A 5ALTA 2EJ2A 1E5QA 1K75A 3DUFB 1DTEA 3I9NA 3AL0C 3ONDA 1K6MA 1Q0SA 3LLUA 3IAUA 3OTOB 1BGXT 3I6YA 4D6PA 4PZYA 1MB2A 4DSTA 5ALYA 3ZE6A 2I7XA 4WESA 2H29A 1UZUA 1W5TA 3QF7A 4QXQA 4CGYA 1PVVA 4PTLA 2LWIA 4XWTA 5IKXA 3O31A 4XPZA 3B6JA 3U4QB 3WBKA 1FFYA 1M6WA 3AR5A 3PJFA 3ZHXA 5BWOA 4NJMA 2AOUA 4NULA 2FCAA 2QAGC 2VUSA 1B0PA 3QV1A 3M6WA 3INNA 4IX1A 1SCAA 2YVQA 1KIMA 3FNQA 3MELA 1R0BA 3GGCA 1QYDA 1H1TA 4DIOA 4JCCA 3KJEA 3DO8A 3SBOA 1YRYE 1FVIA 3OJFA 4TSKA 2C9BA 1YCHA 3TLGA 3OZEA 3A2LA 1T3LA 1ZKDA 1X80A 3FOEC 5K3SA 1U4SA 3CLRC 2R2AA 1U9IC 3PDIB 2IH5A 4CCYA 3VZRA 1MB9A 1XQYA 4L15A 3LUFA 3OCCA 4D43A 2NXNA 2VJOA 1RCFA 4EUKA 4FDTA 4AKHA 2AN1A 1T5LA 3U44B 4B4VA 1MRSA 4BAUA 1OBVA 3GARA 1W25A 5BW4A 1DKQA 4GM4A 1ZJ6A 3H20A 3N2EA 2JEGA 4Q39A 2XGOA 4MR7A 1N5DA 3N8IA 3OO0A 4C0SA 2GLXA 3CO0S 1DMRA 2E2WA 2DZDA 4DIMA 4Y6OA 4KR6A 1B23P 4EGAA 4BKRA 4MS3A 3U81A 2L0XA 1TZCA 3RJMA 4IP0A 3IA2A 4HN2A 3COYA 4IUCS 1UC5B 3WHIA 5BNTA 4HVTA 2YWVA 1YC2A 3WGYA 5AK6A 5ECDA 3AUYA 3H9EO 3GVIA 2XSZD 4X44A 3CCFA 3VGPA 5C4IA 5EEGA 3O4HA 1ZJ4A 3OSPA 1Z5PA 4HDSB 1QGOA 4BVHA 3CISA 3VVLA 4BMCA 3LXUX 4G0UA 2JLCA 2OM6A 3ET5A 4JJZA 5CNIA 2Y9MB 4Q7QA 1RRVA 1IK4A 1X77A 4P4UA 1W19A 3GAAA 4RA6A 2E6UX 4JJAA 4XJSA 1V1RB 4LDAA 4U7JA 3HDQA 4R83A 3L92A 3EEIA 1OZFA 4YECA 1KERA 2FETA 4OXRA 3FTNA 4LOHA 3GLHB 2PYZA 1C7FA 1RT9A 1L4FA 1VDMA 4QODA 1ZJJA 4HFNA 4QWMA 3GG9A 3LPMA 1KAEA 5KQGA 1AZLA 5DMHA 1E4VA 2Z57A 5LQRA 4G0ZA 3ADBA 3G9QA 1CQJB 1J56A 4FNAA 5F7OA 4UDNA 2BGJA 5KT7A 1IBLH 1VJRA 3SGIA 4IUYA 4M99A 2TRSB 4MMXB 1BEZA 4XX0B 1JS1X 1XJCA 1LK0A 2V9CA 2O3JA 3OZUA 1QLHA 2GYVA 1WABA 2OV4A 1SOAA 5F9LA 4DCCA 5AHXA 3SC3A 4XM2A 3M89A 3TSZA 1SC6A 4RKFA 1XKQA 1J1UA 4DZRA 4R1QA 2R1VB 5FPYA 5KJCA 1GDDA 1YBMA 4TQAA 4YV0A 4LJAA 1BHJA 3DDZX 2JLWA 1ZUHA 4GP7A 4HAWA 3ZV4A 1NW8A 3S40A 1SVKA 2QVLA 4LXHA 4YAGA 2DPYA 2A67A 1ECBA 2WB2A 4AO8A 3CMMA 2YVAA 3F6YA 5D1NA 3QOWA 3ZNNA 2PWYA 3RS5A 4EHHA 1VL8A 5DNAA 5EYPA 3KKQA 3ZJ5A 1JQAA 5LC1A 1SBZA 3PGA1 1GV0A 4N48A 4OYYA 5KTRA 3RYTC 4LCEA 2O8VA 2R2GA 1L5LA 2RG1A 2QQ0A 2SKDA 3NWBA 4CV2A 1D9XA 4P4GA 3ESBA 3GYGA 2X4IA 4L5YA 5IZCA 3EQ7A 3FBWA 4JT8A 3FCOA 3WIVA 2YYYA 1EE2A 1NPYA 1OY1A 2FP3A 2FF7A 4NJEB 4DM4A 3R6GA 3ZDRA 4BVJA 3N75A 1NYTA 1N75A 5A2GA 3EPHA 4Q3BA 3RG2A 3S1SA 2J3MA 4CMKA 4JAVC 1E7SA 5DSXA 3T5CA 3WMGA 2V96A 4ASUD 3LCMA 4IEIA 3RSLA 1ULBA 5J4HA 2ZRHA 1EEHA 2Q4BA 2CCKA 1VCMA 1I94H 1TUBA 5FWYB 2FEPA 3JD4A 3OSUA 4GMHA 1JV2B 2XSZA 1F4PA 1AKEA 3E8XA 4WLVA 5M7EA 3K6SB 4LJYA 2ACVA 2J3LA 2ZE7A 3LUHA 3LBNA 3CLKA 3TAHA 1Q12A 2X2EA 1QQ5A 1VHDA 2ASVA 3IP3A 3HJFA 5CJ2A 3GNLA 5FI0B 3EUWA 1A4UA 4GQAA 3LLCA 5IUNC 1QZUA 2PMDA 4QNNA 4S24A 5FR1A 1J97A 4I5DA 3ITEA 3GRCA 5CLGA 1A5TA 3R3UA 4R8KA 1RQNA 4O2AA 3DTNA 3FFBA 4QSMA 3MOIA 3MWDB 5FQNA 2KW5A 4H7JA 3TJRA 5KNCH 4F38A 3U4IA 3EDOA 2Z08A 3BL8A 4LMRA 1QPZA 2FGKA 4Q45A 2YHAA 3SX4A 5IG2A 4IJKA 4LRYA 2B6NA 4ZRNA 3RREA 3VKFA 4G0OA 3QFSA 3LK6A 1AX9A 1N32H 1VMIA 3GGDA 2IZ6A 3LP6A 3TDKA 3JASB 4PVDA 4B46A 4YO8A 4NZZA 2JG3A 4W99A 4C05A 1NLYA 1C1DB 5ENVA 2BM8A 3I01M 3ELBA 4Q18A 4MV5A 4QDZA 4NONA 1GT6A 2C4UA 2PKCA 4RB2C 4NZMA 1NW3A 1QGZA 3F97A 3HBAA 3QLTA 3IPRA 5LP6A 5C1BA 4A3CG 3KEGA 1CVIA 4QFBA 2QNRA 1Y42X 4QDOA 3NAZA 1J9ZA 3EFOB 3DO5A 3C3PA 3B36A 1AA9A 1PR3A 1FQKA 2NSLA 3BWCA 5DM0A 2WHQA 4O2RA 3QMMA 3AFGA 3U3OA 5CDSA 1HKUA 1QFYA 1GGFA 4HH1A 3OM1A 2B2XA 4B33A 4Q34A 1XRQA 5PGMA 1UXGA 4OJKA 1UP6A 3PJRA 3ORQA 2VZEA 4Q4LA 4G4GA 1PJZA 2Q9BA 4N3BA 2DQKA 3PW7A 4DIUA 1ZJZA 2COJA 1SBIA 2GO7A 2DYKA 4EDFA 3LRXA 4ZQEA 3AYXB 1B2RA 2Z43A 1T9CA 4DSOA 3EZYA 5DG7A 3VXKA 1T8SA 5E3JA 2O2ZA 4GX1A 1OR8A 1HDGO 4M1WA 2WIFA 3FCUB 4N65A 2H1WA 5TR9A 4Z86A 1OXMA 1WU8A 1Q11A 1CHNA 3DBIA 3QWAA 4WXHA 1PTJA 4I4NA 3W8RA 4M37A 3A25A 5KTNA 4R31A 1WOYA 3U09A 1FA9A 3O4GA 1ITZA 1KS2A 1TYBE 4DJAA 1MO5A 1DQYA 4BWSC 6NULA 4V1CI 1GDTA 4D8WA 1AKNA 3EGXA 3KQUA 3QE4A 1I30A 4RCVA 1R74A 2Z83A 4EKNB 4BRZA 1W7AA 2I4LA 2NV2B 2QG4A 3Q7QA 3ZHOA 1V45E 3RYHB 2VJPA 1NVBA 4XPIB 1PG5A 3P2JA 2X0JA 3R75A 4D9KA 1N0WA 4B3TH 1JPJA 1W59A 2QX9A 3ZH9B 4IZHA 1C1YA 3NIBA 1RXEA 1W5AA 4U5QA 1LPBB 3WB9A 4EJSA 2QPTA 2VZLA 1FVXA 4W5QA 3M4IA 3VOSA 4R5HA 2PJZA 3CTPA 5L3QA 2C84A 2P41A 2FEWB 3KLPX 3MWGA 3VHLB 4X7BA 3PCXA 3PK0A 2AEJA 3QEMB 3T7CA 3EUAA 3ZVRA 1CJMA 2HBQA 2X2PA 1RZ3A 4RESA 2B5VA 5ALSA 4KFCA 3TOSA 2XQFA 5IANA 3ONFA 2IXBA 3VSAA 1Z33A 5K09A 4WT7A 1UPXA 2AS0A 3GZTB 3O8LA 2VYCA 2R1TB 4GXTA 4C4YA 2WQ7A 1P8JA 2VP0A 1NQOA 4D3FA 3Q3EA 1YJBA 5C3MA 2H4JA 1IY8A 3RT9A 2ZRCA 4GVXA 1T4CB 3GJ5A 2QD2A 4B6QA 1IVYA 2ZPTX 2DY0A 5CXUA 2B1RA 1Z0UA 1KIFA 1KP2A 3DVRX 4EB0A 3IYLW 4O02B 2RJOA 1H4SA 1ZD4A 4JD5A 1R8XA 2JEZA 4XFJA 4UNPA 3DV0B 2UVUA 5DLFA 4OY3A 3JZAA 4HB0A 1FP4A 1I7DA 4L9SA 1ORHA 2AUMA 2QX6A 1K6XA 4KYTA 4G4SO 2VKTA 2DFLA 2FI1A 4R2JA 1FUUA 1HX7A 3A9WA 5JAIA 5EY5B 1O57A 3ZWXA 4IXMA 4EW6A 1H9BA 1KO1A 1NVWQ 1L5HB 5EKSA 3B8HA 2ZJ1A 4TTTS 1DADA 3AIKA 1C0PA 2Z3VA 4KRYA 4WBSA 4XGQA 3DMYA 3EVTA 3UHFA 3CRMA 3B51X 5IJ0A 4P58A 3O92A 3D7MA 3O3NB 3W9UA 1I6LA 4MKXA 1Q0RA 2ICAA 3N2IA 2E5WA 1GCUA 2LDXA 5FNVB 2W8KA 4CLHA 3QJGA 1DHTA 3OWXA 1O0SA 2Z09A 4NU6A 3SSAA 3U31A 3WYGA 4XI9A 2O54A 4DWVA 1DOHA 4EUSA 3O8NA 4B9AA 5AHKA 3WJ7A 4XSGA 5YASA 3JVEA 1R7RA 3BXHA 3JQ8B 4CC5A 3TMYA 5FWXB 3HYLA 4Y30A 3C3WA 3EPKA 1TZMA 3P0EA 4QNRA 4TVSA 2R8HA 1R5JA 1UDCA 2N47A 1CQIB 4G01B 2VFAA 2NN3C 3B78A 4E08A 4XUDA 1GQOA 4CFYA 2MSNA 1CNMA 1UUFA 4F7WA 2I7CA 2P9YA 3H6GA 2GXAA 1WKVA 1VYHA 4MR8B 4BBSG 1R18A 2C57A 3MUOA 3M83A 5HS6A 3JZIA 4UUQA 4MKZA 3PRJA 2FR0A 1UJNA 1KC1A 1U02A 5MF6A 3WNDA 5DLQC 4PAQA 1GGMA 1LPAB 2XBMA 3A1NA 4EG1A 2QTVB 3DZCA 2IE8A 4Q1AA 5D6OA 4MB0A 3KYBA 1VFNA 4A2BA 4QYXA 4JUDX 5KTKA 5H82A 2OLJA 2X5JO 4RK1A 4NIMA 2QV0A 3ECSA 4EZIA 2AVDA 1UMBB 1VI6A 1KUTA 1SPXA 5I9BA 1AY0A 3E9CA 4R0VA 1S0NA 4J9NA 2Q1UA 2UVVA 3KVOA 4B4UA 1KXJA 1YR8A 4BB9A 3WLEA 2PFGA 4Z4FA 2V7XA 3RC9A 1XA3A 1WCXA 1ZCZA 4G9GA 4UUAA 1EIZA 1J7KA 2Y2UA 3PNVA 4AECA 4DT1A 1N0HA 2B61A 1WO8A 5IAEA 1NRWA 4MEBA 1NUQA 4ODIA 3GZJA 5G3ZA 4HXYA 1Z68A 3C15C 5LYJA 3HXTA 2VXOA 1K8ZB 3ZZTA 3OTGA 4XUEA 1DAKA 4HL6A 3ICOA 2RC6A 4C4XA 1D4ZA 3LX6A 1FJGH 2PLNA 4BU1A 4RD3A 3H5AA 1ISSA 1BFUA 4PV7A 3HYTA 2CY0A 1D03A 3FHLA 1XZEA 3S2SA 1A69A 2WKWA 4MKFA 1X19A 2VRNA 3T7KA 3QRWA 3DFUA 1FQOA 1AXGA 2HGXA 3HR4A 2IZZA 1ZNXA 4QIWA 4IMJB 1UEXC 1P5FA 5EWJB 2GD6A 3LDUA 4Q66C 5C5CA 1JFFA 4MUAA 4HVCA 2R60A 2QM3A 3X43A 1QH0A 3VISA 1ZIYA 1EP2B 1Y1WA 3UJ7A 3QENA 2I67A 1LUAA 4IRMA 1SCJA 2F1KA 4LOLA 4NFHA 1YK1A 3SEQA 3G2JA 1QTNA 2OCBA 5EOVA 5KINB 1MJGM 3L4BC 3ZGVA 1WZEA 3V80A 1M76A 3MCWA 2WA1A 4G63A 2XLCA 4BXOB 4XR9A 2VDQB 2FZVA 2P9ZA 1BVYF 3LBHA 1FFDA 2V7GA 2O14A 1XQ9A 5T67A 1X86B 3LC7O 3M9WA 4WKGA 4DV1H 3SYMA 3FIJA 1KYTA 2FLWA 2VHXA 3PR4A 3SIRA 1E3QA 4FD3A 1AB6A 3MJTA 3T1OA 4D9CA 1PNRA 4K05A 3B38A 1Z6AA 3PIDA 4MKIA 2ZETA 3FCXA 3OQ6A 2WUEA 3E7WA 1D2NA 2WG1A 4CC6A 5TQ2B 1VKOA 2WTAA 3CUWA 4BUJA 5AQ1A 3UKDA 4BPBA 5ENDA 4M0FA 1WY5A 4DR5H 3X2FA 4WK6A 4DOMA 1UK9A 4R0NA 4G8CA 1J9EA 2VWHA 4XEHA 3TQTA 3R6DA 2AC7A 1XEAA 4B4OA 4HNHA 3E9ZA 1H2FA 3I6MA 3ZR4B 2VJKA 2RG7A 1BWRA 1XDNA 1Y3FE 4WA7A 1BQ3A 3NFYA 1E1MA 2NYVA 4NP6A 3D6MA 1N6LA 2NU7A 4PTZA 4UQLA 3PE4A 4TYNA 5H68A 4COKA 4FNMA 4P98A 1QQ7A 3TLKA 5A3RA 1R12A 4U2EA 2BGKA 3P4XA 1GO3E 4MW0A 1UBUS 3PRKE 1KQNA 5KMGA 4K6MA 3W8EA 2MCFA 4X45A 1QO7A 4M9ZA 3ORFA 3IHWA 4HVAA 1UBNA 2IYLD 2YBDA 3SVZA 1T1GA 3CLTC 1ZL2A 3PRYA 4JKYA 3NUQA 2XA9A 5K2MA 4XCXA 1L5NA 1Q3TA 3QP9A 1BS1A 2G5GX 4D99A 5GAJA 2ZCUA 4XWOA 1XO1A 1RBMA 4Q12A 4BFTA 4KN5A 2PZ8A 2RSLA 1H0SA 3CHYA 3CCCA 4ILKA 3KSZO 3U19A 2ONKA 2GRUA 3M6IA 1TAEA 5JVDB 4G1FA 2A86A 3ENKA 3LF1A 4QG7A 2IBKA 2A88A 1N48A 2YC4C 4QGAA 2DPIA 1F8UA 4OUDB 2WF7A 3PHIA 2IDJA 1KH3A 3AILA 4WZAB 1IU9A 1WXEA 4ZDIA 3D1LA 4DV6B 3FRIA 3KREA 4B6PA 1YUMA 1PDWA 1NXVA 1SZDA 6ADHA 3DP9A 1XU4A 4DLVA 3E7XA 3N41B 1M1XB 1NDQA 4O4HF 4BIMA 3DBHB 4RMJA 5JHGB 1K5GA 3DKIA 4N49A 1AKTA 4CE5A 3KZOA 1JIIA 3QG1A 3MCAA 1C5KA 1M2WA 4PG6A 4WY8A 2C20A 3IEPA 1P1JA 4J2OA 4PSDA 4FCCA 2H2AA 1HY3A 3GRZA 4WTOA 3KTAA 2RBKA 4GIBA 1VL0A 3RHTA 2JD0A 4AJNA 1IY1A 3EMKA 5EXXA 1OLXB 4P4NA 1W76A 1QHSA 1GPYA 5ESWA 3USES 3C6MA 2P7HA 3NS7A 3NM6B 4RJLA 4BS9A 1XIVA 2DBRA 3OT1A 2Y1XA 1H05A 4PYIA 1I2MA 4RMIA 2IODA 2W9BA 4QEZA 1DBSA 5FKJA 3C3CA 1K89A 2PZGA 1EM8B 3K0FA 3UHAA 2Z5GA 2JA6A 1HYEA 2QD3A 1U9ZA 2ID8A 4GI3A 4PLHA 3ZE1B 4HDCA 2HRBA 2R8JA 1V96A 1F3LA 3FFWA 4AZ3A 4YO7A 1GTZA 2OWOA 5B1IA 1NVEA 4WXEA 2VRBA 1MP0A 1Z2EA 2P6UA 2JAXA 1DE0A 3U40A 3R3YA 4ZVOA 2VJAA 3N0VA 3GH1A 3HA7A 4U7DA 5EGSA 1QGED 4ECSA 4R1PA 1ZM2A 4KQCA 1GN9A 3GLTA 2C77A 1RXUA 1ZJWA 3UCEA 3EXIA 2WUVA 1R00A 1PVDA 3IIKA 4FR5A 5D7BA 2X5XA 3M5DA 3VKWA 2IA5A 3KEOA 2CLDX 4Y6PA 3TIVA 3I09A 2GZ2A 4RYDA 2IITA 1THGA 4EB6A 3S2IA 3VUEA 1IPFA 1WZIA 4CEHB 2PQ6A 1X1CA 4PNZA 1A8PA 4DWJA 5EOYA 3TR5A 4NCAA 2PEYA 4GOOD 2LW7A 1W29A 4F3YA 4PSVA 4I1UA 3JYHA 3DQQA 2HAEA 1MVLA 2X4DA 2DLNA 1V95A 2W8BA 2A0WA 1DL5A 4WW0A 1MO3A 2NQ2C 4B84A 1GSOA 4R40A 2P6RA 5DHAA 4WN9A 4K0KH 1RI4A 2PR7A 4DDTA 1VHLA 2AC4A 2W6CX 3WC4A 3S29A 3HKBA 1F3OA 4YR0A 1W5BA 3LUKA 1Y33E 4WK4B 1FTNA 2O5EA 3GEBA 1AKWA 1QH1A 3CXUA 4P1ZA 5T14A 4X8HA 1IEVA 3TJMA 2G9RA 1TVKB 2HO4A 1WNFA 1FZQA 1C9DB 2FX2A 4HNSA 4IOJA 4HDKB 3LFHA 2JAHA 3LUGA 3HUEA 5JBNA 1VBGA 4ARBA 2AFHB 2Y4OA 2PRJA 1EE1A 2QUJA 2Q50A 5KVQA 5FUBA 4HDNB 3A9CA 3ZKAA 4AXXA 3MJVA 4XYLA 4DUGD 3GGPA 4Z0PA 4EECA 4DF3A 5BRAA 4GT1A 3U1VA 5COAA 1H6AA 3IEUA 4DNPA 3RVKA 2PIDA 3I8XA 3IBGA 2ZUFA 4IWXA 3THXB 1T3SA 4R68A 3PQEA 4U00A 3L7CA 3KTMA 1XNGA 5E9QA 1YONA 1XMJA 4M36A 4MLPA 1C29B 3LQ1A 5FYDA 1DXHA 2R8GA 3VR5H 4JXUA 3RD5A 3JXEA 2XCQA 2D1SA 2A5LA 4ISCA 3T0FA 3PT5A 3BL5A 3ZDZB 2AQIA 1TYDE 1M34E 1M2EA 3MJCA 1E1RD 2CNLA 4D4LA 6LDHA 1KAHA 3IMKA 2AXNA 4D46A 3LXMA 1AKVA 3QQ5A 4QWDA 1FB5A 5AJTA 2V4MA 4CT4B 1U4NA 2YVLA 1J90A 1OC4A 4IVRA 3QEAZ 5F1PA 5EMHA 3A1WA 4MI3A 5FL7A 2GUGA 3RCBA 3S81A 1EUYA 5HF5A 4OHMA 2R65A 1DCMA 2UVDA 3REQB 4JKOA 3BGOS 3PVCA 3C3JA 2FR8A 4D3SA 3SE0A 3NH6A 5BSVA 1RC1A 3PHBE 4DTIA 1TZKA 3ZC3A 1DSSG 3IESA 2VNSA 4D0NA 2FMAA 3COSA 4JROA 2P6NA 2ZUEA 1OA0A 4PGMA 1JJIA 3QVXA 4LOIA 3N2NA 1PW5A 2PSFA 5TQ0A 3M6MD 2B20A 2O3TA 3OZAA 4LYAA 2ESRA 4DQLA 1RRFA 4PXSA 3H9JA 1NUAA 2IBTA 2XY4A 3I4FA 5B7GA 4GUAA 1ULTA 3NNSA 1YOVA 1S02A 1GQ2A 3DEKA 3QEKA 1T5BA 3GUCA 2RGYA 3BMXA 3T9AA 1ZR4A 1R0RE 2C4TA 3TTVA 1M8GA 5DNDA 1RU3A 4AP5A 1CB7A 2QJWA 3KZXA 3QMVA 4BBRG 5DTEA 3ZW7A 5HFAA 1TVCA 3G3EA 3JQQA 5A6SA 2Q6OA 5AJYA 3G59A 2H17A 4UFNA 2RK3A 3TKAA 2YWGA 2AE1A 5BMVA 5LMUB 2VSQA 1W85A 1LK5A 3NBKA 4IJ5A 4YBRA 1H2ZA 1ZGZA 1L5YA 1PEKE 3FNBA 2YXNA 3B85A 4F9EA 4EI2A 4G0MA 3OQMA 3BXEA 1FYDA 1KZ7B 2HG8A 2YOGA 4MUHA 5KG5A 3WS7A 1W1UA 1MTZA 3WYNA 4FZJA 2JA2A 5KJ1A 2H9YA 3M8KA 4ZAXA 4OMFG 1GFIA 2OV8A 4F9FA 1CUBA 4QXAA 4IHJF 1JYFA 1XVUA 1XL1A 4KAJA 4F4WA 3CLSC 5E3IA 3WL8A 1SUIA 3IIJA 4OK6A 4MJ3A 3CNBA 1TGYA 3D54D 3EUEA 1GY8A 2HPZA 2JA5G 1SQ5A 4EHLA 3Q15C 3RWOA 4ECVA 4HLCA 3AVTA 5IDYA 4N5IX 2LNDA 2G36A 1QBKC 1F5SA 1UQRA 2BMDA 4UUOA 4MV6A 4C4AA 1AK2A 4ZDKA 3OCZA 5IYZB 3CM0A 1NJ5A 2AOWA 3HP1A 5AW0A 4AMGA 4URZR 1AQJA 4WWHA 5HW0A 1N3BA 3PYLA 5EP1A 4S1OA 1E1RA 2GBPA 721PA 3BGWA 3M6UA 4CIBA 3MFHA 1QO9A 3T1QA 3GHHA 5JY1A 3E22A 1DIHA 3O8DA 4EBBA 4JUAA 5A9SA 3N3BC 5H4HA 4OJTA 2Z1NA 4QUEA 4OHXA 4O3PA 2C59A 1C7ZA 3X1YA 2GPSA 3THOA 4L28A 4PX9A 1YQEA 2PUTA 1JWLA 2W93A 1U3UA 3K3PA 3FCAA 4DL4A 1A4IA 3NGLA 1REQA 1A3CA 4YQZA 1JG1A 2FU5C 5TRTA 1X9IA 2V59A 5JXJA 1J0BA 3GMTA 1BHQ1 3W5VA 3MTQA 3V7NA 4Z9FA 4G0NA 1UPTA 5CFLA 3RYCB 3TW8B 1CQWA 4US0R 3P45A 4AX8A 4HFMA 3PD7A 1GWNA 4IV0A 1MMFB 2JIQA 2JZNA 1QB7A 3QBVA 2DKFA 3HABA 4NESA 3ZK9A 1YS4A 2IV7A 4EMUA 1RYFA 1C30A 2VF5X 1BWQA 2COKA 2ZT6A 3UKJA 3GDFA 5CGQB 2QE7D 3NBFA 4GGMX 1TA9A 1I3OA 1YFJA 3TRIA 2PK3A 3TH5A 1P44A 3TW0A 1A9RA 1FDIA 4ZVKA 3UXHA 2L2QA 2OVFA 2ID4A 4WA8A 2EQAA 1SUDA 2HEIA 1XCLA 2OSBA 4WOCA 2UYOA 1RHKA 3HJHA 2WU0A 4DR4B 2D4AA 4RL4A 2I91A 3KQHA 5GINE 3OKCA 4TQGA 1VTKA 2I8LA 1Y5RA 4DEXA 2OMKA 1E2LA 5BN5B 4BATA 2ENUA 3KZ1E 3CVUA 4O4IA 4Y2JA 3GJQA 5F2OA 4W1PA 1TPYA 2CSXA 5F7XA 3OQ1A 5AFSA 2HZBA 2BP7A 2QEQA 2PMKA 4N0MA 4Q7JB 2DT8A 1YE5A 1X1BA 2YNMC 3MWMA 4ZIRA 1S4QA 4OQPA 2O0JA 3U9TA 3CLUC 3KFVA 1N9GA 4Q1DA 1DV1A 1RKVA 1ZVKA 1LSOA 3AKDA 1DRUA 1UCFA 3GU3A 4GLBA 1CYEA 4QICA 4GHWA 4OHOA 4CUJA 1C0LA 2VHJA 3WYDA 1PV1A 3RF7A 2G0NA 1SG0A 5JSUA 4MPJA 2NSHA 3A27A 1P1KA 1QG6A 5A4MS 4CHIA 2Z30A 2FUG6 4E2YA 2EHDA 1NXOA 4TV8B 5FTWA 2EJWA 1CY2A 1HETA 5L53A 4RZ3A 2FSFA 5B1EA 4JHLA 3F8TA 4R7RA 3SVLA 4ES6A 4ALKA 2ZIWB 2GZDA 1CUJA 5TY0A 1BW9A 4YMHA 1WNTA 4XWYA 1XNQB 1LD3A 1GEGA 4AVYA 3HJNA 4EW2A 1BX3A 4I4TA 1IBSA 2FW9A 1T15A 4AKSA 1B0AA 3U6BA 1MHTA 4Z0HO 1CC1S 4KO4S 3FNRA 2NZ2A 3H87A 4GZLA 2EF0A 1JG3A 4NX2A 5HWSA 5JFGA 3R09A 2ALZA 3FOFC 1NJ2A 1ODKA 1Y4AE 4OAPA 1QGYA 4BNMA 3NEPX 1M1ZA 6Q21A 4GDFA 4N5HX 1ZI6A 2PJRA 4ZOLB 4CTOA 1MOSA 3U9LA 1CJBA 4V0NA 5IXYA 4JJKA 1H3EA 1R8YA 3L8GA 3RC3A 3ZS8A 1P4GA 2EJBA 4J0FA 1JHXA 2PGXA 3A31A 2QN6A 1Z6TA 3QE2A 4BFYA 3WGIA 5K51A 4PYLA 3C8UA 2Q5EA 5F23A 1F6DA 2VUGA 3OQNA 3KK0A 3E4DA 2BRUC 1UH5A 1KI7A 4UHKA 1XRJA 3LL7A 3U62A 4NOJA 3S1AA 4FQ7A 3L43A 3Q72A 2QE7A 2K2WA 4QEDA 4PYJA 1SUCA 2PQ0A 5BSMA 3OEYA 2O2XA 3OUZA 4MW4A 3EGCA 2QRPA 2GXUA 1UFVA 2LBPA 5GIPE 2W00A 1DRJA 3ZWVA 3KZVA 5L3VA 4QO7A 2Z8ZA 2DH5A 1V8PA 4ZXPA 1TKBA 4YV7A 4DEVA 5EJAA 3TQOA 3I2KA 3SS7X 3DMGA 1TK9A 2VTDA 4PHCA 3FYUA 3VU0A 1YB5A 1VDZA 4ETMA 5JS7A 2A5DA 4JC0A 4LIPD 2A0XA 1ZOLA 3UGTA 4P7FA 4AY6A 4HQOA 3QSGA 5LKRA 4W6QA 5IVDA 4QBGB 3WLTA 3ROGA 3KVRA 3CZMA 4AO7A 1ICEA 1V4NA 1I4LD 4N7JA 3PEYA 2JFYA 5CYOA 5TGZA 4GX0A 2GBLA 5B3AA 4P3XA 2R66A 1JKJB 3DQPA 1OFIA 3K9WA 1U5AA 2D5AA 1WXXA 4GM0A 4RNOA 1JEAA 4TS4A 1MW8X 3BD6A 5JMTA 1EU1A 4U7WA 2EJCA 2WDTA 1UPCA 3T94A 3LQKA 4N5DA 2ZR9A 2OUIA 4MQUA 2ZI4A 2XBUA 2P9EA 1FNDA 4CKCB 2C2ZA 1WXIA 2KM1A 3E1KA 5ERGB 5DJ5A 4YUZA 2GCIA 3TIGA 3S2ZA 3I4LA 4ZYTA 5KFNA 1RBZA 3QXJA 1QOQB 1KBLA 1XJWA 3WL7A 2FZ4A 4FWTA 3GELA 1CS0A 2E85A 5KYUB 3NTLA 1RABA 4CIWA 4EUHA 4XDZA 1SULA 4JUFA 3D6JA 4X7RA 4EHIA 4WFIA 5JQWA 3M6FA 4PRZA 4CM8A 2B99A 3AR3A 4QIWE 3P2KA 4BZWA 5IKOA 3SK0A 1MU0A 4JEHA 4UHEA 2GASA 4NYMQ 2Z95A 1VGRA 2HDWA 3ABOB 3L6RA 2PUGA 1OZAA 5ALHA 4BNDA 2RJ3A 3IQZA 1IOWA 3GLGA 4MAAA 5KG6A 4KFSA 5GOZA 4RTPA 4BXXG 1L5RA 1ADFA 2ZEJA 3IOMA 1PP4A 1TC2A 5IN5A 3CRQA 3TAUA 1H5QA 2AR0A 4AZSA 1NVGA 1ULZA 1SKBA 1E2KA 1A5BB 2H1VA 3ZI4A 1J5EH 4TMWA 4LRXA 2NP7A 4M7WA 1ZK0A 5HRAA 2Z2KA 3P9QA 3E8MA 1G8FA 5ALWA 1I33A 4DR6B 1DPFA 3EXAA 3F5QA 2IBSA 2OBMA 4OP2A 1NVUQ 3HB0A 1WCV1 5LD2B 2QMEA 3K09A 3EMVA 3T5KA 3A1VA 4LJ4A 3CZCA 4TSRA 1OXVA 5FADA 4KIJA 1O7JA 3LYHA 2Q2TA 3Q0IA 1I4TD 3IAXA 3RU3A 1RZVA 3QHAA 4ICIA 4K1XA 3FXAA 4ZV4A 4QTTB 2PRIA 4KREA 1E3TA 4PCLA 2SHKA 2HVRA 4PC3A 3Q7EA 1KY2A 2BJVA 5EINA 5AVKA 3DCIA 1S1MA 2QLNA 3RIGA 3WNZA 2XMZA 2FK3A 2OPBA 4CKXA 1Y1VG 4R5MA 3L0CA 3EVAA 3AETA 2WHYA 2Y6VA 5D01A 1KMHA 3K0AB 4L5JA 2Y1DA 3OE4A 4UXIA 1TKAA 1N78A 1ORVA 1I14A 3RKRA 1F20A 1M34A 2Q9UA 4YCNA 5KI6A 1JA1A 1ZN8A 3GV7B 4IHQA 2HR1A 2IPLA 2LP4Y 4TTQA 2AMFA 2G08A 1MXHA 1GT91 5GZ1A 1QE5A 3RIMA 4BC0A 1OTXA 5L3ZA 4OM8A 4YQYA 9ATCA 2MR6A 1RQXA 3PENA 4CHGA 3ND5A 3JX9A 4RPGA 3HPRA 1U8XX 1P4SA 4BX3A 4JKIA 5TPZD 4O7WA 1WSCA 1M2HA 4F3TA 1Z74A 1WSBA 3W3ZB 2AMLA 2PFKA 2C5SA 2WB4A 5ERXA 4LH7A 2QUBA 3BBPA 1PK7A 2FKNA 4X7PA 1KMMA 2BUAA 4LVOA 4ZGGA 3SZRA 2FVXA 3OLCX 1FP1D 4QQFA 1XRMA 2JVJA 3AVUA 2W90A 2JGKA 4XARA 4S2UA 3B60A 4JK3A 1IZ0A 1GAWA 3N6VA 3FSEA 4LZWA 3PJDA 1GD1O 2PZBA 3ZWDA 2HRRA 4WQMA 2PUDA 1SUFA 1ZD8A 3TE7A 3GJ3A 1W4AA 3RRNA 1KEKA 2WILA 1OE0A 5CGZA 1XPRA 4IV8A 4J9RA 4S35A 2VK4A 2FFAA 4J3JA 1BAPA 5B1YA 4W6ZA 4KU4A 2XQJA 1FXWF 4W8GA 5A6VA 2RCNA 1CJCA 3OWHA 1FJ2A 1TL7C 5EXEA 1YDEA 1RC0A 2C7BA 4X65H 5ELLA 1CQZA 1GTL1 3IS3A 4YI5A 4MO2A 1UMDA 4E15A 9ABPA 2ZSJA 3FVTA 3P4YA 3IJRA 2HK8A 1ORWA 3WGTA 4YRBA 2Q46A 1WMEA 4TS9A 4G09A 3DPSA 3NIFB 4I0WB 5DBEX 2PL9A 3Q9LA 3X44A 1XVTA 2WWWA 2I2AA 2ODAA 2W2OA 3E8SA 2BEWB 1RJ9A 5COBA 3MUNA 1UDRA 4TV9B 3ESXA 1M6YA 3CIOA 1PG2A 4W8HA 1NVVQ 3F4KA 1I1QB 2ILVA 1K92A 5BVGA 2FLLA 5C37A 1ZYUA 3D7KA 3SMVA 3SXJA 3TS1A 4A6PA 3NP7A 4J1TA 2PGIA 2F1RA 1ODLA 1ZO8A 2JJQA 3M6XA 3X1JA 5A1JA 1YS9A 2VXYA 3BH6A 2CJYA 1L6RA 4B3RH 1GPH1 2BN4A 221PA 2R8RA 2KI5A 4NH0A 2X15A 5JRJA 3HLTA 5GQSA 3RVLA 5K8TA 1J8YF 4PYMA 2NVWA 3DOEA 3C6QA 2H1HA 2HMWA 4OA8A 1SC4A 3SR0A 3NDIA 3RKSA 3R3SA 2BZ1A 1K8XB 3ZKWA 3OZGA 3NGXA 3SHFA 4QVIA 5FB3A 3FPBA 1VSTA 4MPTA 1M2FA 1AHHA 1TM1E 3ITKA 2B21A 2J3KA 4OP1A 5FBVB 4TVBA 2PV7A 1C41A 3LU1A 3PIIA 3V7WA 5DM1A 4ECYA 4C0XA 5EFZA 1QV6A 4CHTA 3NYIA 3A4VA 2QROA 3JVUA 2F3PA 4BNWA 2VDWB 3HNPA 4KW7A 2W11A 1KMCA 1A7JA 1SUSA 1QO0D 3KOWA 1FFCA 4DLLA 3R3WA 3WOHA 3AINA 1YHNA 4U2DA 3GJSA 1SVOA 4BFSA 4P3PA 1EJ0A 3L0IB 1EBFA 5LD2C 4YV2A 3F4LA 5TT0A 5ABPA 3NWPA 1MNQA 2QJRA 2QPAA 4X20B 2EOAA 3RFFA 1AZTA 4ZP1A 2Z6AA 1TQDA 1L4NA 4NVRA 2F1OA 4G5FA 5TPZA 2WNIA 3QA9A 4KXVA 4LF8B 3WV4A 4MKHA 3GFSA 4A82A 4P93A 1KJZA 4KQ2A 4LWQA 1LQ2A 1XQ6A 3DCJA 1IMOA 3NCTA 4ZEVA 1E79D 2BHSA 2HTFA 4PC6A 4DZTA 4C0JA 3B3JA 4HLDA 2IV3A 3TLXA 2Q99A 3CH7A 1J2JA 3TMAA 3ACCA 1WSDA 5I60A 3NWEA 2QTLA 3MCZA 2HMUA 5E0OA 3Q98A 1QXSA 4LDQA 3AI2A 3TIFA 2J4CA 4GE0A 3W2IA 5DLPA 5CVVA 2YJ5A 3IULA 3I23A 1GZDA 1MT0A 3NBZB 4V39A 1LLCA 4RFSA 4GZ3A 4RLSA 4A8JB 4F4DA 1TX4B 1FFSA 2VXBA 2ASDA 3F78A 2OZLA 4O84A 2O8FB 4D9HA 1FFHA 1NRXA 1MPXA 3A9VA 2GD0A 1F6WA 1QQAA 3PL1A 3DYVA 2Z3ZA 1JEJA 5EP2A 5ICCA 3Q0EA 3K0BA 4LISA 3FTCA 2AKEA 5L1LA 3C4JA 1GGHA 1DI0A 3VU8A 2FN3A 2DERA 3GTMA 2X9QA 3IALA 2OTCA 1U2DA 4NCJA 1NVMB 2P4UA 3PGJA 5EJ9A 3DDNA 3LOPA 4UEWA 4A3BG 1JE1A 3E2IA 1RPJA 1Z0SA 2FSSA 3D4BA 2P2NA 3RGXA 2GERA 3IT2A 4MQBA 2CFIA 4YB8B 4W5JA 3U60B 5CJPA 5L6MB 4BEVA 3AOGA 3QUAA 5B6PA 3B1YA 4C76A 4WIAA 3HB4X 1M8FA 3SS9X 3VPXA 1N36B 1O9GA 1Y4UA 1YZKA 5NULA 3AHHA 4PZAA 4PDBA 4OSOA 2VCHA 5AKKA 1XTQA 4AIIA 1OZHA 3WYBA 4JYMA 4A0HA 3FWKA 2HJSA 1NI4A 4DVGA 1X9GA 2O5CA 4MCHA 3SR4A 4ER5A 4KVZA 1V4YA 3PGXA 5FQOA 1N0UA 4HB2A 1JMVA 3BMOB 2MDTA 2DHDA 621PA 3BM5A 3TTUA 2OWEA 1I2KA 3ZJVA 4ZK2A 1RLTA 2H48A 2Q49A 3B1XA 3V34A 4U6PA 1DG1G 3GLIE 1YDGA 1Q22A 4R1TA 3TOXA 2XVMA 4DDHA 3BD9A 4IINA 1QO0A 3MT8A 4L8YA 4TWIA 1H9CA 4ZVLA 4KCGA 1GL9B 4FILA 4TZKA 2DF8A 4BFUA 4EQ6A 4M54A 1XUOA 4RXTA 3U48A 1JECA 4L3VA 5LXTA 1NOIA 1UMCB 3VTFA 5I45A 1E3WA 3JWIA 4IXNA 4B3MH 1HV8A 3FJ1A 4G0YA 1GNTA 2GX6A 4KWEA 1LWNA 1NY5A 3MHTA 4HDRB 4YRKA 4PEVA 4EQ5A 1VGQA 3DAGA 3K8ZA 4UD6A 1HC7A 3ZWCA 1NI5A 4TQSA 4DLXA 1E79A 3CKLA 4IIJB 3OTIA 1ID8A 2W9AA 3DXFA 4AU1A 5KFJA 2V6FA 2J3DA 2BEUA 3DR3A 2GCOB 4MVJM 1C4WA 3TO5A 5JD5A 2I5PO 2IOHA 4YRTA 2BM0A 2FKLA 2QD5A 3QEBZ 3SQXA 3MUEA 1R5NA 4YQWA 5EJ4A 2PMWB 3E1SA 1VKRA 1N2OA 3W5HA 3IAM1 4TT3A 4QD3A 3GI1A 3SYKA 1I7SB 2RF4A 1T3NA 1IUKA 5H3HA 1V5GA 5CK5A 1E4EA 1CR6A 3BFKA 4MJXA 4OL9A 4RTNA 2VC2B 3LQQA 5LNK6 4C6TA 4FQ5A 4U2BA 3BWBA 2OZKA 2DFTA 1BXKA 1ZM3A 4MXDA 2BFOA 4UHCA 1BJRE 3STHA 3ZCQA 2HQ1A 1V4BA 1KTAA 1Y63A 1UBHS 5EDWA 3DDUA 2IYQA 7REQA 3UT5B 1SCQA 2JI4A 1TC1A 4D4HA 1I32A 4GR9A 2YZLA 4RD1A 1L1FA 4JSRA 3CJQA 5FJIA 2DKNA 2JIRA 4JJGA 1MW9X 4UFPA 5IXJA 5FEMA 1FL9A 4MWCA 4RF3A 2IXGA 1AVTA 1Q74A 1WUHS 3DGFC 1DWQA 4H31A 2HF2A 4LYYA 3WI7A 4PYQA 2FK7A 4FFBA 3NBZC 1NQUA 1MXFA 1H65A 1FQJA 4Q9HA 4QUAA 1YAHA 3W2EA 2NIPA 4EHKA 3CUUA 1Z75A 3UFXB 4ILEA 5LR6A 1T8WA 3PNLA 3K5WA 4EQZA 3U0VA 1DC5A 5CIQA 1OH5A 4A8TA 4OYRA 3QMPA 2C4VA 5DYGA 3GFVA 4G1VA 1PJTA 5K0GA 4UEOA 3VKHA 3H05A 4XQCA 4E21A 2VQFH 2BKUA 5IRCD 3UT0A 5FT9A 4O7TA 2XLBA 4M9QA 3Q4GA 3NQ41 2P3SA 2Q6TA 2WVHA 3NVDA 1B4DA 3V6KA 2EKPA 2Y1GA 5EN4A 4GBGA 4RULA 5A0TA 1PUXA 3S7TA 3W5DA 3W6OA 2NSYA 3L5OA 2V98A 2HN9A 1LSJA 2WJ4A 1NVKA 3ME5A 2P5YA 1GL6A 3QXCA 5DWVA 1N56A 2VA3A 2YWFA 3QPWA 3BB3A 1ADGA 3REOA 4NXMB 4Y0AA 2NO4A 3L7AA 3VR2D 4L9RA 2CJWB 1L7QA 4FR2A 1HDEA 5JXHA 2H7CA 1E61A 3QX9A 2J32A 3G1UA 4YJ3A 3T06B 2F8MA 3R0VA 3OZIA 1BCSB 4KR7A 1R15A 4PZPA 3AJ9A 5J2TF 4CDGA 1PT6A 4ZVTA 1CF4A 5I7RA 2D3TA 4PW0A 2JZCA 2WDPA 1HNXB 2LR0A 3BTSA 4Q9JA 2RJNA 3DZKA 2O1EA 3NXSA 3RS4A 3OCWA 3HV2A 4WAUA 1ZN7A 3P71T 1E3LA 1LS6A 4Z9YA 4KRXA 5BN1A 1XHLA 1K3UB 5B64A 4R51A 2M05A 4B3FX 1IUPA 3E1GA 4UATA 2BI4A 1V16B 1W8DA 4FK8A 3EYWA 2HD4A 1A9OA 3T7JA 4BJ5A 4MA5A 1K5PA 3LQFA 5GY7A 3L8MA 2OFXA 4KRFA 1AV7A 1D8TA 4ZI7F 1QK5A 1R37A 4MP6A 1JAHA 4ZPXA 4IIUA 4OB6A 4MGIR 3KZNA 2A59A 3LHIA 4MIOA 1SUWA 3DV2A 4D82A 2E9SA 5BP7A 4EO7A 4OHRA 1UM8A 1R9JA 3VOTA 4I1SA 4X6YA 2WJ3A 5IKMA 2MYPA 1OFVA 4O6VA 4BLRA 1Q95A 2MWMA 2EX1A 4IIHA 2IUSA 2G71A 4JUBA 1DFHA 5EWLB 4IVQA 3AEKB 1NR5A 3QKSA 1LTKA 3FMGA 4TT8A 3L84A 4O4LF 2NU8A 4YAUA 5G0VA 3O0DA 4FT2A 5FOTA 4TWJA 1NVTA 3I2HA 3UCXA 3HA5A 1C3OA 4QSHA 4M1MA 3JQGA 4KB5A 1N4AA 2ZAYA 4PQEA 2HBZA 3UK2A 1Z06A 5E9WA 5JYCA 2OBLA 4K6HA 5DX1A 4EJFA 1BXGA 2GM5A 2G80A 1VSUA 1N3YA 2IXAA 4DDKA 4NU0A 5EZ5A 5KG4A 4UNNA 1W47A 1J5XA 3U2QA 5FWDA 1TA8A 2Q5HA 5LKAA 1QKKA 5HCUA 4D4JA 1EFLA 2JCVA 2P77A 1UC9A 5L7WA 3VHXA 1EKFA 3C6ZA 3T54A 2XE7A 3KKZA 4QJBA 1YI8A 2P40A 1QTRA 4CDNA 4RHXA 4BN0A 3R6TA 4MA4A 1M83A 4BVAA 3CZRA 3IIMA 4J9OA 4IICA 5CLJA 1Z25A 5AOAA 3UUGA 5I7EA 4JI2B 5HF9A 3SGLA 2BDTA 3EQ9A 3V7UA 2WUGA 2AOTB 2VBGA 5F3RA 4RKYA 4V0QA 3D6FA 2XNKA 3SQMA 1ULUA 3EIHA 1GFSA 2VP2A 4ZTZB 2Y27A 2H0RA 3DTGA 3BEOA 4PZ9A 4Y2TA 3ZHSA 1EM6A 2GJAA 1Z0KA 3IDFA 5I5GA 1S8OA 1IFXA 4YXFA 2AK3A 1II8A 4UTZA 2WJWA 1NUPA 1KDRA 4Z1MD 3AR7A 2OAP1 4J0MA 2A1TS 3VR2A 4FOSA 1BE8A 4BQRA 5GVRA 3SICE 3YASA 1LSUA 4JS0A 4FLFA 2Q1YA 5IULC 3U49A 5TEWA 2XCSB 4LTDA 2GVNA 1BVHA 1M6EX 3PFNA 2OFWA 1GPLA 1KQPA 4ENVA 4S2EA 2OK8A 1PSWA 3IB3A 5HEKA 2J9ZB 2IDZA 1E9EA 5CM0A 2XMCA 4QW9A 5DHRA 3HKCA 4Q9LA 3D2AA 1ML3A 1Y98A 3WIBA 1TIBA 5JALA 1S8FA 2W6MA 3IOBA 3PPXA 1O95A 5FPPA 3CVWA 3KR9A 1DIKA 4XGIA 1XDBA 3PTAA 3CLHA 3VRHA 4J9PA 4QBIA 2QVBA 4EK9A 2IF0A 1UJ6A 2FE1A 4ZOBA 2QL5A 2HJHA 2QT9A 4CG3A 5FA8A 1BDJA 2Q0XA 4YY3B 2ZRAA 1U2RA 1O5TA 4YAWA 2O6HA 5HX7A 1FIUA 4C7MA 1GL7A 3H6KA 1TF7A 1ZAYA 3S68A 4FMCF 4Q03A 2VXCA 3UZUA 2PKXA 4CRWB 1EINA 4FS8A 4NCIA 5FD8A 1RHUA 3R9IA 4BCDA 5KFSA 3TOVA 3H83A 3KE9A 5FL7D 2BH9A 1PBNA 4RPJA 5CEEA 3RS8A 2BZSA 5HBGA 2QW1A 5IJXA 2AR9A 4RDXA 1W1WA 1A9SA 3HYRA 4BNFA 4Q6WA 4ZHQB 5ITWA 4HGZA 1JLMA 4KBFA 3TTYA 5A3JA 2BY4A 2VAMA 4MVCA 2WAXA 2R62A 1KZ1A 1G9XA 3FFAA 5AHRA 3V8MA 5KDDA 4WBNF 2PKRA 4ARZA 4R2IA 1QANA 1GPDG 1I3KA 2C2DA 2P1ZA 4UCRA 3BAAA 2PPLA 4JZYA 1JPUA 3T5GA 1U2PA 4QJIA 3KJFA 2EW2A 3AM4A 5FPRA 2W2KA 2NUTA 4CM5A 3ZU6A 4LF9H 1F8YA 1RP1A 4GMFA 3V8EA 4DMHA 1JVNA 1R6VA 5FAKA 3LWNA 4CJXA 4KL8S 1F4LA 4BMVA 4LFAB 2BF4A 1WL8A 2GCGA 4D1YA 4KAXA 2VAWA 3ENQA 1GG9A 1PNOA 5I9TA 1WBJB 2F4VH 1QCYA 1KTVA 4F4UA 3AVQA 5GJCA 1CBUA 1FRNA 3COZA 3DC7A 3GLGE 1J49A 2IGTA 1OWMA 4BN5A 3VOBA 2ZLBA 5JCOA 1BMFD 1HQDA 1WOMA 4XVHA 4AJIA 1NMYA 1P7PA 4Z1MA 1HG0A 2GPTA 2ZGIA 4H9GA 2L17A 3FDZB 2O8DA 3ZQ6A 2D1QA 3V8PA 3KS9A 4M1SA 2R85A 1WCIA 2AJBA 3BTVA 2HWWA 3NHZA 3PHLA 1ADCA 4QAJA 1E8MA 1H66A 3ZZ1A 2CXRA 1T2NA 2HM7A 5AH0A 5FBKA 2HUPA 4YBZB 2OORC 3D2BA 2OAEA 2YINC 4YJDA 2Z1DA 4N5LA 3AJEA 3BIXA 1P7YA 2YRFA 1W8IA 3Q41A 4F4FA 4UU8A 1CIPA 3BJZA 5KT2A 3LLVA 2J48A 3OOHA 4DADA 3TGWA 5DYIA 1ZK4A 3KVNA 3SC2B 4OHZA 4EI7A 3NOQA 5J1SB 4KHPB 1PD0A 3AXTA 1FRFS 2F7SA 5JJ5A 2VJMA 1ICIA 4R9RA 4MVJG 2IS2A 1RAIA 1ABBA 3KE8A 5KFQA 1UPFA 1HDYA 3MMSA 1LFDB 2UUAB 4FMDB 1E9RA 2CUZA 3PX3A 2D1RA 4KFRA 1XEXA 3USZA 4KR2A 4YP6A 2VPTA 3FKIA 4AB1A 1I6UA 5LZ5A 2HX1A 3M9OB 3QH4A 3KHSA 1VZ2A 4YRZA 2XGJA 3TFWA 4UKDA 2ZAGA 4FFDA 1IDOA 4C14A 4YUVA 5KNDH 1R3DA 4OI0A 4K26A 4J0CA 5BWXA 2JAOA 2PA0A 2WP8J 3W7AA 1UOOA 1G5QA 2LGJA 1E3MA 4CN9A 2Q2QA 1JYEA 4QUKA 4B76A 1AHPA 2PJUA 2Z9CA 1JEYA 1ONOA 4CIYA 3GLIA 3DLHA 4INJA 2B0CA 1L7EA 1JDNA 5LQDA 4MRVA 1FF9A 2IXTA 1E0JA 5BSKA 2I6FA 4XJTA 4BP8A 3MSCA 4O86A 3F7MA 5IHPA 6YASA 2BBSA 3WLLA 3GX1A 1GP2A 4D8XA 3NIDB 1QS0A 3H2BA 1JLLA 4OPMA 2XECA 4B43A 4R1UA 1S10A 2X8JB 1W4ZA 3HUTA 4PQYA 5DI3B 4TMYA 4ZZ2A 1HPLA 4UOZA 3EVZA 3WLRA 4DRZA 1Z4NA 3W5OA 3PA8A 3MFYA 3MJ4A 2ZJ7A 1PGJA 4EY5A 2O3UA 3BXOA 5T6BA 3WIEA 3VAAA 3WQSB 4ZKEA 3VBEA 2Y93A 3LGXA 3B52X 3A1CA 4I55B 3GVXA 3UHPA 3UY4A 1B8VA 3TE6A 4P32A 2XTMA 1K7YA 4DCPA 4O08A 4LSMA 2I87A 3C98A 1NPDA 4AYXA 2PNJA 3OZSA 4EM6A 4YP9A 4WD3A 3BCUA 3MA0A 2SCUB 4QQKA 3TXYA 1IRIA 1BMFA 2QZPA 3EUFA 3ZE8A 3TEMA 4B6EA 5KKNB 2CBGA 4TUYB 5EVCA 2JBAB 2ECOA 4J43A 5ED4A 2PM8A 4ND8B 2DU8A 4NEQA 3PXUA 3UGJA 1MZPA 2CLOB 1PEDA 1WLYA 1NBWB 5HIIA 4L9AA 2REQA 3UB4A 5E6SB 1V3VA 1C81A 5BT8A 5BWNA 4HAZA 4FYXA 1A1VA 1SC1A 2NYRA 3L41A 3WMEA 4IO0A 1FFGA 2BAGA 1F14A 5TARA 2R87A 3GD5A 2OEPA 3LVBA 2FOIA 3BRWD 4JI6H 5JO9A 4AJEA 3KD2A 2B5WA 2AFRA 3TD6A 5CITA 4ED2A 1EI9A 1P2SA 3V5NA 3DLPX 5B2ZA 3VJMA 5TMPA 2H54A 3L5KA 4Z3OA 2VI5A 2QVZX 5TPWA 3L6DA 4A2AA 4ZC1A 3C97A 4N3AA 3I42A 1UM9B 4G07A 3R5KA 4GOXA 4TLBA 5BQ3A 3H4MA 4LMAA 4WUTA 4ECQA 5K3OA 3MK31 3NDPA 3QVTA 4GU5A 1VI5A 5KG0A 1EQAA 3Q10A 5CB4B 2C3YA 3I05A 1JDUA 5ESXA 4J2TA 1O9BA 1GGNA 4BFZA 1EA5A 2OM2A 1YIOA 3ODGA 1X7WB 3C4VA 1DKNA 4HUTA 5CX1A 1QWSA 3HU5A 2PZMA 3KKEA 2WM3A 4BYMA 3OCJA 1HEYA 3DL7A 5KYKA 5BWBA 1ETUA 1O4WA 2GM4A 5ALDA 2GPJA 1XKXA 4G0PA 2FK1A 4IH4A 1GZ5A 1TQ6A 4DN6A 3ZEAA 3GJXB 4MMYB 2I34A 3F5MA 5HE8A 5KQSA 5IC6A 5LQKA 1IYEA 1NTOA 1UODA 4QECA 4LQLA 5K0FA 4BGDA 4JI0H 4DA7A 4F21A 1NVAA 3L49A 1N2EA 2HA5A 5JZBA 2ON6A 1EWYA 2P8JA 2GTPA 3OEED 5J43A 4JI8B 5A2QW 2D5BA 4TTVA 1TADA 3C5EA 4KBGA 3QGMA 6GPBA 5BN4A 1HDIA 5JATA 2CXUA 13PKA 4KHZA 4FLMA 3LCJA 3ERCA 3EGDA 2CK3D 4IGIA 5JCPA 4BFLA 4GEKA 3HYNA 2GTHA 1LI4A 2ZRGA 3NALA 3TVDA 4MI6A 1P73A 4JLUA 2VUTA 4X1KB 5ALEA 1B8OA 1UF9A 3KWJA 4TLAA 4Z53A 4L75A 4A16A 1KEZA 2B8WA 3RUCA 5K7SA 4ZHSA 3RASA 3ICVA 1OTYA 3TL6A 5C81A 3VSDA 4YRLA 3EQ8A 1K9VF 2YH2A 4CT0A 3L77A 2BHRA 5DFAA 1YUNA 5KX5F 4U7FA 3NTRA 2C9MA 1L0BA 3I37X 3K5HA 5F5XA 4BOYA 3NV7A 4MRMB 3V6HA 4OA5A 1YR1A 2YCBA 3TVYA 3UA4A 3PZPA 3QLUA 1J42A 1T94A 3MJDA 2H4WA 2O4UX 4XYEA 1QVWA 3A6EA 4R05A 3WRYA 4MAMA 3E03A 2YCLA 3BRWA 3T1YH 1X0XA 2OBNA 5B4UA 3JRNA 1F7UA 2RI6A 1Z2PX 4PO3X 4W8OA 3R1IA 2QRHA 2VK8A 2DLCX 2V54A 4H1UA 3M81A 1SKYB 1YZLA 2OXIA 2VH1A 1XF1A 2TSYB 3RTCA 3AERB 1KDOA 1R0SA 4FYHA 4QUHA 1HYBA 1DMSA 4RB0A 1JT2A 2X5NA 3KHKA 1GXSA 5J4VA 2GPYA 5AUQA 3TZCA 1DWOA 3HOZG 1Y7TA 2LD4A 4F06A 2H7VA 4PHHA 3QV2A 5B37A 4CODB 4H3KB 1QHHB 2NZJA 1MG0A 1OWTA 5I7SA 4U2CA 1Q1BA 3BWXA 4A2CA 3H9UA 5AT1A 2ZPAA 3CEBA 4MQEA 1BYUA 2R48A 5KFPA 4JN6B 4LZJA 1Z5VA 3UB2A 2XGSA 2Q0QA 5JNWA 4GYWA 3BWEA 1V2HE 3V4FA 3HUUA 2B2CA 2P11A 4CR8A 2NWQA 5AKIA 4X9XA 1J2RA 3W2GA 3M49A 4BB0A 1SHTX 1CCWA 1KEPA 4HNTA 1E9FA 1WMAA 1ZJYA 3BK2A 4EZEA 4JDUA 1LB1B 4TX1A 3OJCA 2XKAA 2D8MA 1JSZA 1FRZA 4AP6A 4IO1A 3UK6A 3EG9B 2EBUA 1A98A 3OEEA 3L79A 5LIRA 1R0KA 4DR3H 3GFBA 3OZDA 3PFWO 2D0OB 3FHOA 3AJ8A 4MUYA 3U7JA 4MQFB 1MB4A 3FD8A 3JALA 3PEUA 2CK3A 3D4PA 2NLOA 3ZHYA 3IBSA 1KGSA 3A8TA 4FYYA 2NP6A 1Z39A 3FZEA 4E31A 2PLWA 4EOGA 4ID3A 3ELWA 2XW6A 4HWRA 4IUBS 4YALA 4B71A 2BFEA 3EZ7A 1VMDA 2YVUA 4L5BA 1YGYA 2I2DA 4WKCA 4DUZB 3A6GA 3MWEB 2UAGA 2EIXA 4X41A 4ZI2A 2XTJA 1D04A 4QL3A 4K87A 4OGKA 1Z8DA 3MB8A 1CZUA 2VBFA 3DE6X 3N3AC 1G7CA 4B0OA 4F6RB 4FB4A 1EUCB 1GRNA 2FPOA 4BE4A 5J2UB 1RKXA 4MRSA 3RHSA 2R6CA 5B57C 4PICA 2NXCA 2AXEA 2NACA 3LIPA 4CEIA 2UUPA 2CUKA 4NDNE 2ZKIA 4MW7A 3A1SA 4HEA6 2X58A 4RB3C 1LVHA 3IUJA 4JCOA 3L0DA 1JALA 3OZ7A 4DV6H 4AUMA 4DABA 2VHZA 4O7RA 4RPHA 3FNFA 3INGA 3DJFA 3AB7A 1GJRA 2Y4NA 4QGHA 4ETWA 4S12A 1ZOOA 3SAJA 3R9WA 2ZQ5A 5AJUA 4JP8A 1OZ0A 3QUTA 3RSZA 3ROFA 1KF0A 1YKGA 2R92A 2HCJB 4RU9A 4O63O 2PGOA 3OC6A 2CCJA 4IIFA 1C4XA 1LLQA 4YJ2F 2Q6IA 2GTIA 1RMYA 3GMSA 3O2QB 3PVSA 2BFDB 5EWMA 1NQAO 1EHCA 2FN7A 1NQTA 5FBZA 4B87A 2EBHX 4L85A 2WWRA 4KKVA 2C61A 2EAUA 3GPCA 2P9CA 1U8CB 2X76A 1Y8RB 3BG5A 3IH5A 3LIIA 3ICPA 1QOZA 3JQAB 1QX4A 1RM0A 4BBZA 4BDTA 4XQ0A 2WIDA 1XTSA 2BH2A 4YPFA 3T52A 1LPNA 1QAQA 2Q1SA 3QI2A 4EYSA 2VP9A 4NE9A 3LX5A 4ERNA 3QU7A 1USVA 4GBJA 4PPQA 1JTVA 2A1UA 1ZUNA 5BSWA 2FLNA 2YQ5A 2CT8A 2FW0A 4PIVA 3Q8KA 4F4JA 1P4RA 5MN6A 4O25A 1DG3A 5SY4A 4P81A 2NTNA 4L78A 4YT5A 3L7BA 1V3QE 3SKXA 4RPLA 1WHTB 5I9SA 1OLOA 1U80A 2J6HA 3A9RA 3GFFA 3S2GA 3LP5A 3DM5A 2RHRA 4OIFA 4HXFB 3W06A 1SG6A 4O7ZA 2QSZA 3AR4A 3IEKA 1XAGA 2FEAA 3QXXA 3QUBA 1V0JA 3IAS1 4QYSA 2XYPA 2C9CA 5T4FA 3CPHA 3LLMA 2YIMA 3TDMA 4Y6GB 1YZQA 2X7XA 1V39A 3ZUPA 3UENA 1N33H 3G9XA 1Q44A 1E6EA 4QU8A 1B2LA 2BOVA 4K9DA 4PU0A 3KLBA 4MW1A 4LYEA 3WGZA 3WIOA 4NOLA 4G5HA 4UUPA 1G18A 2FWRA 1K6JA 4DFDA 4PN7A 4XLTA 3I5XA 2BCJQ 2JKZA 2EW8A 2P9TA 4ZANA 1ZD1A 3DMHA 2E4UA 1A9YA 1UBKS 4QGSA 4NAHA 1Z62A 4DANA 1KVQA 1QX3A 4EEYA 3THYA 2G72A 3PO2G 1UINA 4ZKDA 4UBIA 3BDVA 5F21A 3LMLA 1F38A 1RAFA 3ZZUA 4EJ6A 1G41A 2W9CA 5KTSA 2LVBA 3OFJA 4XUCA 3JD2A 2QLBA 3C5HA 5AVXA 1VCNA 1I8TA 4M3NA 3M4NA 4YYEA 1L7DA 5AK5A 3NPMA 3KAQA 4OU5A 2YUIA 5M5BA 2QORA 3UOGA 2ZSEA 4ZC8A 3A58B 4NSNA 4IXWA 3UG6A 1YTUA 5DX8A 3BQ2A 1JHVA 4DV7B 5C3EG 4JVMA 1LPOA 3OJ0A 1R0YA 1TIKA 5HF6A 2QMOA 3U3JA 2F43B 4KX3A 3QM1A 3LY8A 4TMXA 2JIDA 5H81A 3I1FA 1TOAA 3KUDA 4D0RA 3GRYA 2J9FB 1TU3A 2IHJA 3M1IA 4V0KA 5E7MA 5E1BA 3U13A 2BJHA 2IIQA 2A78A 2ODEA 3MMZA 4P83A 4M9CA 4FWIB 1V51A 1G5FA 3ACDA 3N43B 1OFUA 3SG0A 2ZSIA 2WMNB 3N6RA 5C35A 3GPLA 2W7OA 4UHJA 1Q15A 3W5SA 3EFHA 3WIUA 4YXWD 3WNBA 2IYZA 1U1FA 4B6OA 3QYFA 3VH1A 1P6UA 3V3KA 1UDWA 3ZQ4A 2V65A 1LDNA 5F3DA 2I8AA 1TM7E 1J6UA 1O96B 4CEJA 4BMPB 3UT6A 1LI7A 4ZZ3A 1EWQA 3WAGA 1KQ3A 4R6XA 4L0CA 4V1CB 4IKPA 2MHCA 3UW3A 2IQ5A 3OTWA 1MT3A 2EC5A 4LECA 1G8PA 4BZQA 5AESA 4EW3A 1NBOA 2IYYA 2M32A 4WLNA 5AM3A 1XZQA 3H7AA 2O06A 2Q5QA 4AS3A 5ALFA 3BE5A 3AFIA 1CVRA 4B80A 4GLJA 2JGLA 2FG7C 1ZHHA 5LL6b 2FP4A 1WR2A 5AVZA 2OBYA 2VT6A 3E9RA 4M8LA 1DEAA 4AMYA 1ZMBA 2H00A 3PA6A 5EIWA 1NWHA 4NBTA 4DJ5X 2A4MA 4Z3KA 3JSLA 2B9VA 2V3VA 2X3FA 4FGLA 3ZYZA 3W5UA 3KQVA 1MJFA 3HVKA 5ADHA 1NVVR 4ROSA 4KH0A 1XLWA 1DO0A 2WTUA 3H2HA 4NNPA 3O2SB 4O4HA 2B63G 1THMA 2FA9A 3BIJA 1ZHQA 2UYGA 2J5BA 2Y1WA 5CCXA 2IS4A 1QFXA 2QM0A 2IKQA 4C0WA 4JU8A 1KYIA 2C8VA 1F48A 2ZBEA 1MTOA 4RHFA 4I5EA 3HXKA 1M66A 3L40A 3C6BA 3S0JA 3OIYA 4EEXA 4CUKA 1G8KA 3BA1A 1U9CA 3KUXA 2Q6KA 4WASA 5D6NA 4K9NA 4DCSA 1FYEA 2DBVO 4IG9A 1OXKB 4Q48A 4RDIA 3PUIA 5B3JC 4ZYZA 2G9QA 3QG5A 4X62B 2CGEA 3NNDA 5JG7A 5EJFA 3GDWA 3LTNC 4G26A 3ENNA 4U9UA 2V8BA 3LO8A 3VI4B 2O8CA 3MEQA 4MEAA 1R9MA 4J91A 3W3AH 3ZDDA 3U7HB 3UJPA 2XXBA 4DV2H 3CN9A 4MZXA 3GJ4A 1EVJA 4TGLA 2WA2A 2J0SA 1DB3A 3TY9A 1S5PA 5AMXA 3HWSA 2DGDA 1ZD5A 3HO1A 4LV6A 2OECA 4RUAA 5KREA 3Q8MA 2ODNA 3A04A 2WJZB 3PSAA 4IHKA 3ORYA 2GA8A 2XTNA 1RDFA 5DP2A 4POOA 1F9AA 2CF6A 1YE3A 4TT3D 3W8FA 3PNYA 3EBPA 4FHFA 1D0IA 2DG2A 1XOIA 4PZ8A 3QF4A 3BTOA 4YXWA 4I9GA 1RHQA 4A1OA 3HS3A 5B58T 4K9QA 1SJ9A 3W1BA 1C7RA 1S2GA 4BQQA 4HGOA 4TLDA 1RPNA 4KH1A 5JXGA 2ZBGA 1BYIA 1UFOA 3HEAA 3OU2A 1GQQA 4CKBB 1BU5A 2HMYB 2B8JA 1E1DA 4JJ6A 3A4IA 3LCVB 3LK7A 3PZBA 1SR8A 5I4CA 1I1NA 3USCS 4AD8A 4UAUA 4OHFA 4X63A 3UV6A 3W6NA 5I9LA 1QU2A 2JCGA 1G5TA 2ES4A 3V2GA 3QUSA 3RVQA 4M1KA 1O97D 3OFVA 2ZRFA 4LNUB 3ZDEA 3WX0A 2NO6A 3UXEA 1Z34A 3P0RA 3JRWA 1H4QA 4A2WA 2IWHA 3SEFA 2FPGA 2QT1A 4URHA 5GM2A 4U9HS 3ES9A 3ESZA 4I8DA 1XTJA 1WXGA 3SR3A 1TKCA 4OLAA 5AI8A 3MR6A 3IJ5A 2CLKB 4XYMB 4FI3C 1T5DX 5I5TA 2ZWMA 3L8YA 1M8PA 4N7BA 3PUVA 4ZCTA 1MF7A 2M6LA 3HCCA 2ZYWX 1XQXA 2JLAA 2YUTA 1XLTC 4X60A 2GXQA 4M4SA 2PX5A 1D4FA 2XXAB 3GVCA 3MWYW 1WF3A 3FCYA 4EKIA 4TTSA 3N2KB 1TI7A 5DGAA 2HJWA 4FFOA 1DKMA 5FBWB 4EABA 3VYVA 4GXNA 5EZYB 4I3HA 1XHEA 2DTXA 2G9NA 4CPDA 3PC7A 5JUWA 3ZDCA 3D6AA 1D0SA 3OHAA 3FOZA 4RAQA 5DIZA 3O47A 4JI7H 4MTEA 4JV2A 1E5DA 2W2LD 2VPZA 3SZLA 3A1DA 1YL6A 2CXQA 1W46A 5JANA 1EJ2A 2JHPA 4B6JA 1P7CA 3CKYA 2P7IA 1FP7A 2QX4A 2X1VA 5CYFA 3KYCA 2ZT7A 2NT4A 1S2LA 3HR7A 4UTNA 3ZDQA 3NRBA 2O9JA 4LDPA 1PZEA 1KKMA 3HWRA 2CFSA 4A8HA 1PD1A 4JBWA 5IBRA 4P53A 1IAQA 4Y7DA 1YU6A 1GNRA 2POQX 3EIUA 2G76A 5LQCA 4PLPA 2D2FA 1N7IA 2VDVE 4RMHA 2GNAA 2H4HA 3O3CA 3SZGA 1WY7A 1B33N 3RUDA 4KR9A 4JB3A 4OXIA 2FX5A 2E5LH 4BP3A 2QDXA 3EPGA 5L4NA 1Y1KE 1VE6A 3HWX1 1I7LA 4IR1A 4HNQA 2HLPA 2JD1A 2FMUA 4DMRA 2VTBA 2RHLA 3BWMA 1IQPA 3T0GA 5DNCA 3MGAA 1U98A 1YB2A 2DFNA 4WGGA 4RY0A 3NDRA 2Z58A 5J4LA 1SB8A 5EWEA 2VDJA 4U39A 1CETA 1COZA 3TZQA 1XMXA 4JNKA 3W1WA 2RAPA 1QVRA 1LBSA 1YZYA 4I4IA 5B1HA 2IXEA 1SKQA 1XTZA 4BFXA 2HB6A 1VE7A 2EARA 5T41A 3OU6A 3RT7A 1FUYB 1UNNC 2YXDA 3FLAA 2BEVA 4KXNA 4RUKA 3PO3G 3DZGA 2ZU6A 1NBME 5KFKA 1CERA 2O7VA 3GN2A 1CUWA 1T0UA 4QELA 4BO3A 5CNKA 3EF1A 2V7VA 1ZFNA 2O1XA 1ZIDA 1SXIA 4ZCSA 4L8FA 3NVAA 5KYWA 4F93B 2FQYA 2ZANA 4HUJA 5LJLA 3ZDBA 4AKEA 3A4TA 3QPBA 1UBOS 4PSAA 4A8JC 3P9KA 1M6VB 1EK0A 2R751 3F8SA 3D5TA 4Q4AB 5CFOA 5FO1A 1GZ6A 3R41A 4LGYA 3Q8QB 5D3KA 1KVRA 2YY7A 4NPAA 3SNKA 3R9XB 5C0OE 4K9KA 2FV8A 2BGIA 4O1IA 4HN9A 4WCFB 4GSLA 1RWBA 5AVVA 3G0DA 4H6VA 2HHJA 3G6YA 3HP7A 3HZZA 4H77A 1YR7A 3WZLA 2BWJA 3ZCPA 2IUTA 4HGPA 2ZW9A 4K8RB 3G0CA 1RXIA 1QHFA 4IHJA 2ZUSA 3K70D 3ZD8A 2CC2A 4HYTA 2CXTA 1N7GA 4A6EA 3OTOH 5H80A 1UBEA 5FTLA 1IHUA 4RPCA 1NVXQ 1DC3A 1GAEO 5T8KA 1G5HA 5EIXA 4JELA 3NASA 4Z7NB 1S3GA 2SKCA 3OJEA 2MSKA 1MZVA 3GK3A 2ZXEA 3K2IA 1Q16A 4QVGA 4I1YA 1W73A 3ZDFA 1PEAA 1E9DA 1OIWA 5CVEA 1E2QA 4II3A 2W2LA 1LNZA 2GLTA 3NDJA 4JYBA 3BMNA 2JLXA 2CNVA 4DDMA 2IUEA 3WYFA 4JJ4A 2J0VA 4DSZA 2A1HA 1RWWA 4II2A 3I5YA 5K99A 1ZCJA 2FPPA 3LNCA 3AFOA 3FVQA 4OX9Y 2O59A 1W4LA 1WE2A 2OGTA 4M7OA 1YS2X 1D8AA 2XMBA 3JW8A 1UOQA 2RAUA 3LQYA 5ESRA 2C04A 1A8QA 3FGPA 5I5WA 2BI8A 4L08A 1O95D 2WTNA 1EZ4A 3MJSA 4ZTUB 3A0UA 1ZI9A 5FL3A 3H4VA 1QQTA 4Q3AA 1DCFA 1GV1A 3ZGYA 1ZH0A 2ID7A 3P2YA 3P52A 2VDKB 2PEZA 1IDN1 1GNVA 3Q9SA 5KT5A 1VJDA 2Q45A 2OXCA 5A7GA 3GFQA 5LIPA 3S99A 1GPKA 3DTFA 2RGNC 3E70C 5KYYA 1IXZA 1KKUA 1ZP6A 1DTWB 2AG0A 1P6XA 1MX5A 2H3HA 3ELUA 1UR5A 5LL6P 4DLUA 4J4BA 1I4DD 4CF7A 4NOMA 3WK6A 2JFHA 3PD1A 3URMA 5F7ZA 1DCKA 3SP1A 1E9BA 3DAFA 4O83A 1SXPA 3C8ZA 3WQRA 3G68A 3FTFA 2AGPA 4XEUA 4FOOA 3HK2A 3DE1X 2D0PB 3AZPA 4KE8A 4KXXA 1X1TA 1PQUA 3WKCA 2OAQ1 1Q92A 4DNOA 4A3KG 4RO0A 2D54A 2BQRA 1LJ8A 2ZUBA 5EIBD 1VJ1A 5ES3A 3AJDA 3F3YA 5AKHA 5DSTA 1TWAA 1DX6A 3KDPA 5DBOA 1QZZA 4EG6A 3T9EA 2IEDA 4MIKA 4J29A 2H08A 4NZPA 3LUPA 3HM9A 1SHLA 4KFTA 4TXLA 3C0KA