3DF7A

Crystal structure of a putative atp-grasp superfamily protein from archaeoglobus fulgidus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
305
structure length
301
Chain Sequence
SLKLFLFEFATCGERIEDSTAVEGLAMFKSAFDGFKNYYEITGFVRPEFSCLFTLPVDSMDSMEKYLEKSDAFLIIAPEDDFLLYTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRGEVQVPQTSLRPLDCKFIIKPRTACIGFSDEVPDGHIAQEFIEGINLSVSLAVGEDVKCLSVNEQIINNFRYAGAVVPARISDEVKREVVEEAVRAVECVEGLNGYVGVDIVYSDQPYVIEINARLTTPVVAFSRAYGASVADLLAGGEVKHVRRQMVRKSKSAEKPYVSVGDYTLEIIDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative ATP-grasp superfamily protein from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Putative ATP-grasp superfamily protein
total genus 83
structure length 301
sequence length 305
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
A PF18301 preATP-grasp_3 pre ATP-grasp 3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3df7A02
3.30.1490.350 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3df7A03
3.40.50.11770 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3df7A01
2R7LA 1GLVA 4O86A 5BPFA 2R7MA 2YS6A 1PX2A 3TIGA 1CQIB 1JDBB 1A48A 1EUDB 3N8DA 1C3OA 4MAMA 3TW6A 1AUXA 2DLNA 5CA0F 1C30A 1GSAA 4HNTA 2R82A 4FFMA 4C5CA 2HGSA 4Y8VB 1OBDA 5JQGF 3WO1A 3LWBA 1KJIA 2ZDHA 5KX5F 2P0AA 3U54A 1B6SA 1KJ8A 1W93A 2V58A 4ZOLF 2W6ZA 3K5HA 3RV4A 3AX6A 1B6RA 1EUCB 2R84A 4ZHQF 1BXRA 1GSOA 3SE7A 5JH7F 4TUYF 5BPHA 4DIMA 1KUTA 2CNUA 4FFNA 2NUAB 4FFOA 4I50F 2CZGA 5IYZF 4FFLA 3E5NA 1OBGA 2OLSA 4XYLB 2YZMA 1BNCA 4O7NA 4TV9F 4XYMB 1Z2NX 2YWVA 1AUVA 2J9GA 2VR1A 2GQSA 1KJJA 3ETHA 3VMMA 2IP4A 3HBLA 1VKZA 2X0SA 1I7LA 2R85A 3R23A 3QFFA 1E4EA 2Z02A 4O7SA 3Q2OA 5CAEB 3U9TA 5JQWA 5J2UF 1JLLB 3WO0A 2W71A 4YAKB 2DIKA 2QK4A 4ME6A 4C5AA 4O7YA 1Z2PX 2XCLA 1EHIA 5HBRB 4O2BF 4M9UA 4TV8F 4XZ3B 4ZI7F 3HB9A 5JVDF 3R5HA 1E4EB 2R7KA 3TINA 3JRWA 3WNZA 4O7TA 2V59A 2R7NA 2FPPB 3HO8A 1IOWA 2W6NA 3VOTA 4MV3A 4E4TA 3TQTA 3K3PA 3G8CA 4DLKA 2YZLA 5LOVF 2PVPA 1I7NA 1IOVA 3RUPA 2PBZA 1KJ9A 3MWEA 4MV1A 1ULZA 3MJFA 4HR7A 4O81A 4RZQA 3OUZA 5EZYF 3N6RA 2V5AA 2W6MA 4IHJF 4MV8A 5LA6F 2YS7A 5CA1F 1VBGA 1Z2OX 3JZFA 2VPQA 3KAKA 4MV7A 4O4JF 5GONF 4YAJB 2FB9A 1CS0A 4HNUA 1KBLA 2FP4B 4O7VA 5C1OA 3R5XA 2R86A 5BMVF 5C8YF 1GSHA 4MA5A 2GPSA 4FE2A 2CNVA 3OUUA 2YZNA 1GGOA 4YJ2F 3AW8A 2I87A 3ORRA 2GPWA 4C5BA 1VBHA 3ORQA 2YW2A 5LYJF 1DIKA 5J2TF 3JZIA 3K5IA 4HQ6A 4MV9A 3TIIA 4WBNF 4O4LF 4EGJA 3GLKA 4YJ3F 3V4ZA 2ZDGA 4O82A 4I55F 4FFRA 4MV6A 1CE8A 2I80A 4EGQA 2FPGB 1JKJB 2W6OA 3G8DA 4FU0A 4MV4A 2YRWA 2FPIB 2W6QA 3LP8A 4XX0B 1PK8A 4ZQIA 5H80A 2NU9B 3R9RA 4IZOA 4FGRA 4L1KA 5FNVF 2QF7A 4O7LA 1T36A 3KREA 4O4IF 2CNQA 5LXTF 4EG0A 5KKNB 3JRXA 4YB8B 3BG5A 5LP6F 3VPBA 2GQRA 1KEEA 1M0WA 4I4TF 3U9SA 5HV6A 4O7RA 2PN1A 5DMXA 4O7ZA 3ETJA 2WYOA 1M6VA 2DWCA 3R5FA 2I8CA 2W6PA 3RFCA 1JDEA 3KAJA 2W70A 1WR2A 2NU7B 2NU8B 2YYAA 3UFXB 4IIJF 3NUAA 5D8DA 3RV3A 5CB4F 1KC7A 1M0TA 3I12A 3GIDA 2YL2A 2R87A 2Z04A 1A9XA 1W96A 3U55A 3VPCA 2YRXA 4FFPA 4NYEA 4O83A 3MWDA 3DF7A 1EZ1A 4QSHA 1KJQA 2VQDA 2YZGA 5JVLA 1EYZA 3Q1KA 5C1PA 1SCUB 3KALA 2C00A 2HJWA 3VA7A 2DZDA 2SCUB 2ZDQA 1DV1A 3V4SA 4O7WA 4O84A 2GLTA 4O2AF 1CQJB 2NU6B 4O4HF 2XD4A 4YBZB 4HNVA 1DV2A 4MA0A
chains in the Genus database with same CATH superfamily
1XN4A 4GKKH 2P90A 5IP5A 3SQXA 1XP5A 5BSWA 4BGVA 2FOIA 1YF3A 3GD5A 4L3OA 4I3FA 3TRJA 1RAFA 2DE0X 2FZGA 1WU7A 3MSXA 4CLRA 4EPRA 5IF9A 5JAHA 4YHHB 1CB7A 4ECSA 2H17A 5JEDA 3KE9A 5C18A 1PN3A 2DQKA 2XE6A 2VOBA 2Q8PA 4XPIA 2IPXA 1I33A 3PUVA 2X14A 4LNUB 1UCFA 1XZDA 3G7NA 4MVXA 4QUEA 1SQ0A 2QG9A 4ZEXA 4CEHA 4P4NA 2CSXA 2H1HA 4KR2A 1XZHA 2JGEA 4P9NA 2GMWA 3ASUA 4R2IA 1KOGA 1Y34E 3ZHUA 5IAJA 4D8TA 2E2WA 2YZMA 2BMVA 2VTKA 2P41A 1EGQA 3BMOB 2HCTA 1EGVB 3G3EA 1N1MA 5CHYA 2J45A 3BREA 4EBDA 4MPTA 3UEOA 4DLWA 5MDHA 4HFJA 3ZW7A 4E6NA 1JU4A 2X7XA 2P4EA 1JE1A 4R8MA 4HF7A 4BFTA 4GDMA 2CV2A 3T9AA 1NN3A 2P62A 3DPIA 4WZZA 4ZVOA 5CB0A 4YR3A 1DAKA 1M54A 4LYEA 1PT7A 2JD0A 5FI0B 3HY6A 3TINA 3N74A 4QATA 2WJIA 5TGZA 1SVKA 3B1KA 1FL9A 1Q92A 3TQTA 1M2VB 4Y9UA 4C4OA 3AM1A 5EUCA 2GDZA 2I67A 3AGPA 2DHCA 1C7QA 1Z33A 2BFPA 4W82A 1Z06A 2WVGA 2QV0A 2ZIUB 1L3IA 3T99A 2EL9A 4KI0A 4O4JB 3ZH9B 4MVJF 3RRFA 5KT7A 3MGGA 2HA5A 1FU4A 5B1EA 3CSDA 3WQSB 3H8WA 4BTEA 3VPAA 2BGRA 3SQOA 2O6HA 4YQZA 5BR4A 1EFDN 5LL6P 3AWDA 2KHZA 4Q1BA 1FP1D 4BFWA 1H2XA 2IXDA 2XH8A 4X1KB 4RU9A 4EP1A 2ZIAA 2Z2IA 4YALA 3S1LA 3IC5A 1MZPA 1ZESA 5K3SA 2AW3A 1UOOA 1X9GA 5DHSA 1Q12A 3ADKA 5JR3A 2I80A 1IY0A 2FPGB 2G3YA 2FE4A 3R3YA 4KQMA 1UZNA 4TWBA 2RI6A 1J0EA 3MMZA 4QE3A 4X0EA 2OD9A 1OWPA 4XPZA 2HHAA 4DT1A 5KSOA 1JL3A 5JS8A 3LF2A 4PTYA 4KTVE 4RK6A 3SBDA 1K0FA 3K96A 1S0MA 3HN2A 4LK3A 3K4PA 3LC0A 4MUEA 5DTMA 4CIXA 4GC7A 4H1TA 5LA6A 4IRKA 1CNMA 5T57A 5A06A 1EVIA 3MT0A 4LOJA 3HCEA 3DTFA 2KI5A 2GEJA 1G2IA 3P0RA 1DE0A 4B0PA 1VLVA 3H42B 3OEYA 3DKRA 2W2LA 3WK8A 4B9EA 4HS9A 1UBLS 3WLIA 2R93G 1SXGA 4A9AA 5L4SA 1KO4A 1VLMA 4DRFA 1GNSA 5IN5A 2QX8A 3QVXA 2ZUWA 1CUBA 4JBNA 1H2AS 4WFQA 3B7GA 4LPKA 1JPVA 4TQUS 5JPIA 1EZ1A 1QFSA 1QC5A 2V96A 4D4GA 1M0EA 1OAKA 3ABRB 4M86A 3ZBUA 1KI1A 1ZSYA 5DNWA 4J6EA 3HP4A 5LP6A 1DAGA 4IMIB 1N2BA 3G5TA 4YR2A 4O4HF 3E1SA 2IDKA 5CX1B 3RNOA 1FMFA 1PFQA 5C81A 1M1ZA 4MK4A 1I2AA 4TLEA 2BUCA 3C5HA 3ICVA 5CIQA 4ABYA 3FOZA 5FYDA 4MH0R 1E63A 3QXSA 4JH0A 1JDBC 1H2RS 1KSFX 3EFOA 4KO3S 4X95A 4EG6A 4EYGA 1XZIA 3NWEA 5KBYA 3THWB 3K9QO 3WMRA 1IN4A 4ZZ3A 4PE5B 2FPRA 3L3BA 2VPPA 3PNBA 4N1AA 5LDHA 1LDMA 2BCJQ 2X5XA 2X6QA 3UYYA 2AE1A 3BRWA 3DEHA 4IILA 5K3WA 1A8PA 3KNZA 1RP7A 2ZCUA 2QE6A 2ZWVA 1MT3A 3PNVA 3P9RA 2HU8A 3NC4A 1DVRA 5HF9A 3PO2G 4IR1A 2EIXA 2PGLA 1WXQA 3OC6A 4NQRA 3VZQA 1VE6A 1QG2A 4MR9B 1ZCBA 2R1UA 3VSBA 5KFKA 2VDJA 2YUTA 3JR7A 5J5CA 1SCUA 2C2OA 3NM6B 3QBTA 3SXJA 2BDUA 3CA8A 3ROFA 5LMUH 4HEQA 2AFVA 3NH6A 4PXAA 5FLXW 3L84A 1Q5PA 2QK4A 1CSEE 2QHXA 2FFBA 4GQBA 4BNUA 2FK1A 1DRUA 1FKAH 1P75A 2ZI9A 3D6HA 3P9NA 5AKIA 4HAOA 1YE5A 5FTMA 1GPUA 4BJ3A 1G59A 4RGQA 1K89A 5A1TA 4AWBA 2VP4A 2V59A 2HDHA 2MSEB 4IX1A 2IE0A 4KV7A 3PEWA 5DHFA 4FWTA 3G8CA 1Z6AA 1XYYA 2V9PA 3L93A 3RB3A 2FX3A 2DECA 3ROMA 4OQMA 4WRRA 3F98A 3SDSA 1E1NA 1R5NA 1V2GA 2J6CA 1VBGA 1YBFA 5GONF 3LK7A 3M9MB 4IS2A 1GPYA 1IOZA 2B37A 1LZKA 2VCHA 3LBNA 4CDGA 3NGDA 2XYPA 5EIBC 2KSWA 2QTLA 3D6AA 1ACLA 2OSVA 3VSDA 1U6JA 4I2NA 1KMIY 4Y7CA 1GZVA 4YP1A 5KTKA 5H1YA 2EW8A 3EIEA 2B7LA 1MXHA 3FZYA 3TQQA 1QDLB 2J0UB 2Z2XA 3IA2A 3O9ZA 4EK9A 1DCKA 4F72A 1AN0A 4JP1A 2H4HA 4OXNA 4EUNA 1KMQA 5KNBD 3UQZA 3KRTA 2HO4A 3IYLW 1EGHA 1X6VA 3T41A 2ZIXB 1O77A 4CG0A 1KPIA 2IMWP 3W5OA 1P2UA 4JSYA 5REQA 4FSXA 3C6BA 4KPUB 1HEIA 1RYZA 3RPEA 2EP8A 4C4XA 5DPMA 3K70B 3LW8A 3UENA 3LQYA 1S3FA 5C0OE 2VKTA 4ZGWA 2IPLA 4KGZA 5IF3A 5AXAA 3H4DA 4JI8H 1UFVA 1QLWA 4K26A 2A1TS 2ZSFA 4TQSA 1QGDA 3IMKA 4A3LG 3ZCRA 2C5BA 2B2CA 5FPOA 1LBIA 4O3NA 3IP5A 3PFKA 4N5NA 2BYTA 2MR5A 5FBRB 3NHKA 1L1FA 5FA6A 1BE0A 4Q6BA 3FSEA 3LIIA 5B53A 3DWGA 1SPBS 1F51E 4ETWA 4BZXA 1L8XA 5DK6A 1UM9A 2XUPA 1U0EA 3I73A 3M1LA 3MJTA 4P2GA 4E4YA 4G1BA 4DR4H 4EM6A 4QDJA 3GEPA 3MUEA 4U5QA 3ZDRA 3GMTA 3QLJA 3ZDAA 1RJRA 1SBQA 4G1EB 3UMCA 1SUDA 3PUIA 4UEQA 3P52A 5ARCA 1CKNB 2ZI5A 4CR8A 1NW4A 3PYMA 1IMOA 1HFJA 2ANBA 2FEXA 3BF8A 2ZDQA 5ETJA 3TIFA 4QRDA 1X2EA 4BNVA 4RK1A 2QX9A 4HUQB 2FHSA 5C4MA 3FFTA 1GTSA 3Q1LA 1DARA 3CBQA 4IIDA 2JLBA 4YQEA 3F9CA 1OXKB 4H0NA 1O95C 2E37A 4Q1DA 5ABPA 4KG7A 2DH5A 1YL6A 4OHBA 3O3MB 4I50A 1OGIA 2XR1A 2J0VA 2XEDA 4IXMA 5AW7A 1V5FA 2JCGA 4ZVNA 1GSAA 3WNQA 2RH8A 3PDJA 4EAQA 1BHJA 4EJ0A 3WJ2A 1RZVA 3VSAA 3LWBA 4Q7MB 4P33A 2M2IA 2X2FA 1CQIA 1QO9A 3FJOA 1MX5A 2O0MA 1BXRA 1E9EA 1UPBA 2FWBA 3I64A 3ZJUA 1OI4A 2O14A 3NEPX 5J3JA 1QIHA 3ILVA 2VI5A 1Y1RA 5CK5A 2ERYA 5AXDA 3QPWA 3Q9LA 2HKIA 3ITKA 1IBRA 1JAIA 3LIPA 4UBNA 2YZ2A 5E9QA 5KZMB 3K16A 3E1GA 4UFOA 2XBLA 3VVLA 1E3WA 5CGQB 4LYGA 1ECGA 2QOEA 1CNEA 2ZYRA 3L7LA 5LYJB 4RHCA 1Y48E 2OAEA 1CJVC 2G04A 2ID7A 3IIJA 3DR3A 1C0PA 3HG7A 1YBMA 1CJCA 4TTIA 5FI3A 3ZJTA 2QV7A 1LPPA 1U11A 5H81A 5DI3B 1KA9H 2WHYA 4GLOA 2ATIA 4FOTA 3U39A 1GO2A 1OI2A 3BXFA 4JODA 2BFDA 2H1VA 2HRQA 2POCA 3JYNA 4DUGD 3CLTD 2EOAA 3OCZA 4X6LA 2VKQA 4ZI7B 4JJ4A 2NTYC 2OMKA 2Q29A 2WF6A 1V47A 2FLVA 3DZHA 4HQRA 4RORA 2HRCA 2GZ1A 4UU0A 3V7NA 4JL6A 2PCLA 3PZRA 2YFQA 1PJSA 4LXXA 2B94A 4L07A 4MUAA 4YC7A 4FEGA 1VJGA 4L9RA 3RS9A 3TLAA 5A5FA 2YQ4A 3N7AA 3UV3A 4COKA 3OUUA 2EATA 1MJHA 1I94B 1E7RA 3FIJA 4YMIA 4ENWA 1FS5A 1ZOIA 4MWGA 2GPWA 3MFIA 3EAFA 4OI1A 4CRWB 3DCIA 5C2JB 2ZIZA 3ZGNA 1Z88A 2LIPA 2A0YA 4HKTA 3CS3A 3IQEA 4QFCA 1EBFA 3R0JA 4U2EA 4NFHA 3ZZMA 2Y1FA 3AI1A 1XGKA 2B1GA 2CHQA 3JYHA 1IBMH 1K9SA 1OVGA 1SO8A 1EX6A 1PL8A 1XDDA 3W8FA 2I2WA 4PTLA 1CKMA 1CHNA 2O2JA 1FW8A 1DG9A 3UO8B 3KX2A 2B69A 2F1HA 4BB0A 1PX0A 3QXJA 4MS3A 5B3JC 3ZDZB 1VJDA 2LTAA 3OT1A 3PYLA 4MKFA 4ER3A 3UK7A 4WKCA 2VPTA 5DBIA 2J3HA 1KBOA 3A26A 3TZLA 1HYQA 2AN1A 4Y6SA 2D54A 3QVMA 4JQCA 1HL3A 1HG0A 1ZG3A 2NZXA 1XCLA 2PGAA 2R65A 2WWFA 2VSQA 2Y1KA 4RH0A 2G7MC 4LH7A 2NTEA 4Q4HB 3KHTA 4RGBA 4BFVA 3MS7A 4IWYA 1JJVA 4MJ3A 4CMJA 1XO1A 4YCSA 3ED5A 1JX6A 3TRFA 3UK1A 1WV0A 4B3SH 2VL7A 4O5AA 3WMWA 4A3CG 2H6EA 2VUSA 1BCRB 1IUOA 1NONA 1UXHA 5DCLA 3C98A 1L2TA 3BWXA 3H83A 3FNQA 7GPBA 3ZN2A 1N8SA 4J7AA 1HSZA 3KKZA 4L3WA 1P9LA 5FIUA 3V2UA 4EY5A 5I7EA 1BX1A 1DRKA 3MWGA 3AU9A 1GTL1 2ATVA 3CUKA 2R7MA 2A9RA 3SI8A 4XLLA 3HRKA 3QY0A 4JNKA 3ZQJA 4G0UA 4QX6A 1QS0A 4RPHA 4UD6A 1L5GB 3BILA 3L7CA 1GILA 3CN7A 2G4CA 2PBRA 1OH8A 4RBNA 4A6PA 5A9SA 5CA0B 2HHLA 4I9UA 3ZEIA 5L40A 4OFWA 2VHZA 2X77A 4EYOA 4ZEVA 5EHZA 1E2HA 5KG0A 3EPIA 1FUYB 2W6ZA 1I4TD 1QFJA 2X41A 3G85A 3IUEA 4MWEA 4Y6LA 2QN7A 1EH5A 3DOFA 3SE7A 3ZHYA 4AD8A 4BOYA 2JLRA 1FB5A 1RXIA 2H4FA 2PA3A 5E7QA 4I55B 2A4MA 3TECE 3P4YA 4DRXB 1NA5A 1UBRS 1BNCA 1BH2A 2G28A 2WDZA 3PNYA 1RJ9A 2OCLA 4YT2A 4GS5A 2VWGA 1H2EA 3HU5A 4TXNA 4C5AA 5HKAA 4KDCA 3JWEA 5ISMA 2CLOB 2ZTVA 2YVUA 1G6KA 2ZXEA 4E2FA 4R6XA 5H3LA 4XM2A 4UNRA 5AP9A 2IOHA 2IEBA 3BULA 2ZAIA 2JVIA 5DX8A 1AHPA 1PW5A 4HJXA 1TE2A 4BL5A 4TRRA 3ZV3A 1NHWA 2GS9A 1R7RA 4BFXA 1R6AA 2O2EA 2CK3D 4Q48A 2YU9A 4DLLA 5A3SA 1AT1A 3WYFA 1P31A 5CDGA 4UW9A 2FPSA 3MJCA 4XCQA 2IZ0A 4PCLA 3U4MA 3OF3A 1EESA 3AIMA 4BWVA 2GARA 3I0NA 1QHYA 4RCZA 1FU8A 1VP3A 4H3VA 2XGSA 4MA5A 4MB6A 4LGVA 3QX3A 3OMXA 1KY5A 4FS3A 3ZY5A 1UK9A 1SH7A 5GGYA 1T2UA 1WUYA 4MRMB 4KE6A 1D5CA 1FDVA 4RW0A 4WW0A 3WSVA 5FWYB 5B3KA 3UOGA 5AJHA 1ENOA 1K1EA 2YBEA 5FF9A 2P5UA 4WJKB 4PAOA 2OUKA 4FIDA 1MBZA 3U1VA 4KX3A 1FSSA 2Y0BA 1E77A 1OWLA 2NYAA 1TLLA 4Y6PA 4IV8A 2GBGA 4HLQB 1TD9A 4LJLA 3L6CA 5JV5A 3R8XA 2L0XA 4NBVA 2FZWA 3QU4A 1FVFA 5I8WA 1KDTA 3TEKA 3EIHA 4IBOA 1M8GA 1NT2A 2J6UA 2CL0X 5KNLA 4IZOA 4LC1A 3S40A 4EYQA 2OAQ1 2FMHA 1TO2E 2XY4A 4D4MA 3KKKA 4BE9A 1NE7A 1C8LA 3RGGA 1QRAA 2H51A 3MINA 1G4HA 3ON5A 3IVXA 3QJGA 2GT1A 4OQXA 4UXIA 3MGCA 1ZRSA 2H4WA 5H9VA 3CRW1 4D46A 1C3LA 3W05A 2QS9A 3IQDB 4Y0NA 3UAWA 3STYA 1BRTA 4BRWA 2JLXA 2ZRDA 3PEVA 4CTMA 3KOYA 2Z04A 4MDEA 2WFLA 4IR9A 5AW8A 3BJEA 1IEVA 2DFLA 2DY1A 1NU6A 2WIKA 3KOWA 1IY2A 4NESA 5DGCA 4MQUA 5FTWA 1U04A 1LWNA 3P4UA 1YFLA 3OG9A 4C08A 1MU0A 3GI1A 1W2WB 4FWBA 1S97A 2RGVA 1FQWA 2PQMA 3DR5A 3EXFA 3P2IA 4AS2A 4ZT3A 4MP8A 3PC6A 4CM9A 4D45A 2CMKA 1RK6A 1O5IA 4IQFA 2CDNA 2IH4A 2BI7A 2WYIA 1YS2X 3HWWA 4NULA 5JCZA 3L8DA 3U4IA 4HFMA 5AW0A 3TIVA 1ISMA 1L2ZA 2FVXA 2MHCA 4GAEA 4M3NA 3CVUA 1EA7A 2A59A 1EXWA 4TVIA 2X8JB 3EK2A 3FMOB 5EMNA 3T52A 3G2OA 4O2RA 3NDJA 3PC7A 1ZUNA 1UC4B 2MWMA 2OGZA 1GZHB 3THXA 2FMUA 4FMCF 3UKOA 3HUFA 4C76A 5FLEX 5EJ5A 1W52X 2CK3A 1P8JA 1NNI1 2GPTA 1KDOA 2IUTA 2Y2UA 3AOGA 3DDOA 4WKNA 2C2ZA 4X44A 4BCBA 2IYTA 2AH5A 1JSXA 4QJ3A 1Y9ZA 1WB9A 3OCCA 4I1PA 4HTFB 3AR4A 1AZTA 1FUKA 4P98A 1D2HA 4LNHA 3WK5A 2G72A 3EYYA 4IDOA 4C14A 5GV7A 4YAIA 3Q2OA 2W48A 3UT5B 4JI6H 1CJTC 1M73E 2ZBVA 3EVGA 3QXGA 5BW5A 3F5FA 3URMA 4IIEA 3T7KA 3ZY3A 1Y7TA 2E18A 3SS9X 2BGUA 2IU4A 5DW3A 5A2QA 1TQ6A 4L3VA 1JXLA 5KFVA 3O2JA 1O3YA 2NQ8A 2Y93A 3AONB 3D02A 4PHCA 2LVBA 3OPMA 4RF5A 4A2PA 4EB6B 5HYVA 1GFZA 2GBLC 5E1DA 3W8DA 4I9GA 2B83A 5TMDA 4EQ6B 4MUMA 2HLNA 2PUGA 1YKSA 5JG7A 1YOVB 3L7MA 4O08A 1ODSA 4PZDA 3RYFA 5JJIA 5C5DA 3IDZA 3ZLJA 3K6KA 3OFND 3IVAA 3UMMA 3A27A 3RSZA 4CKBA 2P9QA 5TB5A 3R1IA 2WUWE 3SEZA 1QR6A 3DE7X 4ZOAA 2ZUCA 5DRTA 3IE1A 1UJCA 4WZBE 2FW6A 5ALJA 3JYLA 4TMFA 5ERGB 4BBRG 4QULA 1VBMA 4KOEC 5JE8A 1JLKA 2W93A 4YDSA 2E5LH 1FMCA 3AKCA 4RSGA 4GMFA 3J7TA 1NBHA 2XB4A 3ZJYA 2B63A 4YR0A 1EKVA 1TYZA 2BRUA 2QZ4A 4GWGA 5DIFA 4LE0A 2IVFA 3KYIB 3CUUA 1ZUWA 1P3DA 3OIGA 2C61A 4S1PA 1L1RA 2G77B 5HKKA 3V32A 5KYYB 4ECEA 3N43B 3G1WA 1PNVA 4NV1A 3M4ZA 4ZCPA 2DCMA 3LX8A 1N92A 4LJAA 4MGZR 2QM8A 1LI5A 3UAYA 2A9FA 4Q93A 3VU9A 4C7KA 3AFIA 2FJUA 3KLMX 2H9AA 4QDOA 1E62A 1GD1O 2O05A 2PQ6A 4MIKA 1KIMA 2ZE8A 1U0BB 2FUG6 2QL6A 4O2AB 3DBIA 4DR3B 1VIYA 1VPDA 4BZQA 4CEIB 4FB5A 2M32A 1NQAO 5DTIA 1TUEA 3H4BA 2IZ5A 2IDJA 1LPBB 3JQGB 3EZGA 2ZUFA 4ZAZA 2GPNA 5IJWA 5FKJA 3RSHA 5F5NA 4PIVA 4OKIA 1K98A 1M8PA 4TQRA 3U55A 1XNGA 2QSJA 3FWHA 3H8JA 3HUEA 2PXHA 3LX6A 5IK2A 1L5HA 3VKWA 1V35A 3OE1A 3D3QA 1JXMA 4BKQA 1CF2O 1YD7A 5BWVA 2WIFA 3M4NA 1LRJA 1MJ5A 4RB3C 4F6LA 1T91A 2D1FA 1EKXA 1JKFA 3V4SA 2A0XA 2QVCA 2QMUA 3RT1A 3CNEA 1OIVA 1FQOA 2K6GA 4TT3D 4F3CA 4D3YA 4ZYZA 2G70A 2KSQA 5KKAA 4XWWA 1HLDA 1RXEA 1D2RA 3IV6A 2IIBA 2RGRA 1NATA 5KG4A 4H7KA 2Z43A 3ZJ4A 4BQPA 2GKOA 4H1WA 3VUFA 4LA4A 4PQFA 3SF8A 1HNNA 1J49A 4E0BA 3J80A 5CXQA 5AVUA 5JSKA 1B6TA 1ONPA 2ZDHA 4Z8YA 2CCKA 1U6IA 2GUGA 4RVDA 3N42B 3NKVA 1I30A 3NBQA 3TBHA 1B23P 1HZZA 5DP1A 2GFHA 4NYJR 3UKJA 3MJRA 5E0OA 13PKA 2IEYA 2X40A 3AFHA 4L8FA 4RMJA 3SC4A 4EKDA 3T61A 4EJFA 4G36A 1SURA 3I9LA 4MKRA 2LZ0A 3UIEA 4AZWA 3EEBA 3WGUA 3K8ZA 5E25A 1Y6QA 1ISIA 2OORC 2J9ZB 4AROA 2AJDA 3H2YA 3HVKA 4OREX 1TRKA 3EVNA 1O4VA 2FVYA 3JD1A 3OWOA 1NM5A 3NFRA 4WLNA 5EXXA 4CG1A 3DUWA 3TWOA 5TS3A 4F9EA 1DBSA 4XEHA 2Z3WA 4ACBA 3LY8A 3LFUA 3NCTA 2VF7A 2BFCB 4MVJG 3SDBA 3HEAA 4RAZA 2F3RA 3M3DA 3Q7RA 1IYDA 1F5SA 1QUFA 1YCFA 2V7QA 3ESRA 4TKUB 4ZAWA 1TLFA 3DBLB 2Q6VA 3OQJA 3VHXB 3FH0A 4AKEA 4XUEA 1KO8A 3AB7A 1NFQA 4D8YA 3FVQA 2YC2C 2OVFA 1TUBA 1VBKA 4A0FA 1VHLA 2IUSA 2UUOA 4WZBA 4PG7A 2IYEA 3FA2A 4GT1A 3TMYA 5IK2D 1H4TA 3Q3EA 3I5XA 1PG0A 3IOEA 4YUZA 3WB1A 3A04A 3SNHA 1ZVVA 2OBMA 5KYTA 3BL6A 3DGEC 1VL0A 1Y81A 4XGNA 2P30A 2I91A 4RAOA 5JUWA 2FQWA 2AKEA 5LIRA 4B3RB 3HGTA 3WWHA 1AZWA 4LXIA 4CQNA 1L7BA 3PE4A 4FZ5A 4Z4QA 1XR3A 1V8OA 5SICE 4XW2A 5GOTA 3DMGA 1T4GA 3DKKA 3AW8A 2DJIA 3ND8A 4F1JA 1RWXA 4D9JA 3HBFA 1CUEA 3MIZA 3OH8A 1GUYA 5LIPA 3KYHC 3LLUA 4XDZA 2GILA 1AQLA 1ZJWA 5CDSA 2VDWB 2JIZD 1Z5NA 4EGQA 5DWVA 2NVBA 1C3EA 2XQVA 4AZVA 4LFBB 2SHKA 4YLEA 4G3XA 4LV5B 2K7FA 4CFZA 4OUKX 3SE0A 3EHEA 3EGDA 1AKUA 3NONA 5IPFA 4NYIQ 1XNQB 4EKYA 4U4AA 3KQNA 3QZ7A 1PQYA 1PKEA 1JB9A 1UODA 3H3FA 4LBYA 3NO4A 5KNBH 4BO2A 3FWNA 1A5ZA 1A3CA 2AUTA 3IAUA 2Q6OA 4J07A 4D99A 2BMWA 2JI4A 3K5PA 1XJWA 3STVA 4D81A 1WRBA 5AVRA 2DR2A 1V7ZA 1HMPA 4LVNA 3ZX4A 1LPAB 3ZNOA 1X74A 4LF6B 2W70A 1M7BA 2Z6UA 2W00A 5TEVA 1D6SA 4NENA 1CF9A 4P4TA 2FXIA 4RHFA 4TMVA 1E92A 3FYCA 2GPJA 3OOSA 1M34E 4HI0E 4G0ZA 4U2KA 2FZEA 4I1RA 4QWMA 5AR1A 4DR7H 4ZCLA 1RI2A 3M82A 6LDHA 5EJEA 1Z12A 3T3EA 2CVFA 2CMFA 1NW5A 5JVLA 1Q1NA 2XE7A 3MMNA 4G1CA 1J5EB 3WNVA 4N5MA 5M04A 4IIXA 2I0FA 4PFSA 3U3JA 2HXYA 2OWDA 1FTNA 4RIFA 5TVKA 2OBLA 2D5LA 1QQTA 2OLJA 2BCEA 2I3AA 1AGRA 3GH3A 4IHJB 5KQRA 4WVLA 4RNDB 3AFGA 4M8SA 4F1WA 2W6JA 2I8LA 2C7RA 3J7AC 3DEYX 4TRNA 3UOAB 4GM0A 3G6KA 5SY6A 3RKRA 3UQ8A 4GZMA 3BIWA 1C41A 4X3PA 1OFIA 5FUYA 1UJMA 1XZJA 2EQAA 4NEHB 1UDXA 2QRPA 4HDKB 2UZ1A 4CMEC 5IANA 4Y2VA 3JQAD 3TFOA 4JI2B 1E7YA 3Q7QA 2Y8EA 3ZIAA 3LXRA 1E89A 1S8NA 2CGEA 5H5JA 5E1OA 3QX7A 1AK2A 2VK8A 5JDIA 4KQ2A 5JI2E 4IXDA 1TECE 3VZRA 2GTHA 5JAZA 3EIFA 2P7IA 4YUYA 1DIHA 4YP7A 1P17A 4RVSA 2B36A 4LMYA 2QTCA 4PYQA 4QDUA 4NJOA 5C34B 1EWRA 3YASA 3BB4A 5I48A 3H9CA 3BWCA 2OM2A 3FMGA 3OLVA 4FYKA 3D5TA 3GTOA 1CJBA 2W6ID 2MMCA 2QJTA 3KJEA 3KR9A 4ZC8A 4I4TB 4WPGA 3L7BA 2ICAA 1RJ9B 2W2XA 5I7FA 2XCQA 3K9WA 3PA8A 3E15A 4G2NA 3TLBA 3ANSA 3VVBA 4DA4A 4FOSA 3UH0A 1C80A 1MQ8B 5A62A 3S44A 4O7TA 5LBTA 3WRYC 4ED0A 2FHPA 1R66A 1VG8A 4Y0VA 1N5DA 1QX4A 2TYSB 4XIJA 3DOJA 1KAOA 4LSZA 2WKQA 4NIMA 4ZREA 4FN4A 4P7KA 4JZYA 2GB4A 3OD5A 1R74A 3LFHA 4E5SA 1QB7A 3DM9B 4CU2A 1TI7A 5CXUA 2M1ZA 3LUFA 1SC9A 4WV3A 1SD1A 4C05A 3LQFA 4ECQA 1EDOA 5E2AA 4WGFA 3Q15C 5EGNA 3SSNA 1ZJYA 3P27A 1L7VC 4YJ2F 3RK0A 3NOXA 5KFBA 1P1CA 1DOHA 4TMWA 3QU5A 4I6EA 1U80A 2P68A 4XX0A 2YW2A 3AR5A 1I50A 2ODPA 3IJRA 4ZWNA 3DL0A 3DHYA 3H5LA 9ATCA 4R8UB 1N48A 4XSHA 4AG6A 3GJ3A 2Y1WA 3GC6A 521PA 4BB6A 1W4CA 4LYFA 2J4FA 2ORVA 1GJRA 1FP4B 3D5EA 5DM4A 5KYWA 1ZAUA 2E0IA 1O2DA 1R8YA 2QLTA 3PQ6A 5A9RA 1Z4OA 2V03A 1G20A 2H85A 1INLA 1O5TA 4DV2H 1WQ3A 4WI1A 3RVJA 2ZR8A 2OXIA 4OI4A 4A0QA 5BN3A 4D42A 2WUDA 3DTGA 4UBLA 5C7YA 4GR4A 3I61A 5IYZB 3UT6A 2VAXA 2LKDA 2R8OA 4XJSA 4DDUA 3REQB 3RGWS 1DP4A 4EB8A 1RXCA 1Q7GA 2DQZA 3OCYA 3OJCA 4YXWA 3FN4A 3GFGA 3HOWG 2QGNA 3VU1A 4RZUA 3KTFA 3REFA 2WQ7A 1Z83A 3ULKA 3TE6A 5KNCA 3KHSA 3HYTA 1XTUA 3INGA 3AZPA 2H1OA 1ZR4A 1Y98A 4M37A 2Y92A 1VXOA 1JBKA 1M0TA 1H4VB 3D0KA 1W96A 3D6NB 4GC5A 1EVKA 3HJAA 1UXKA 4YDRA 4U2FA 4TKVA 2OQIA 3TKLA 3AB3A 3F96A 4A8PA 2IITA 1QYDA 3HKBA 2FFAA 4BCCA 4MQMA 4QJFA 3EGVA 1PQPA 3LO5A 1G291 3CX7A 1YTUA 2HK6A 4GYKA 5KTRA 5LJIA 1DPGA 3NDIA 4OQEA 1CQJB 4X65B 1SXJD 1O75A 3DHNA 4L57A 1NASA 1SOAA 4J1TC 4O86A 3BGSA 5FNVA 3W2EA 4KXNA 5BP7A 5ALKA 4DMKA 2WPDA 3KC2A 4IGFA 1CQWA 3KJZA 1IN7A 1WH2A 2Y0EA 1MRNA 1KI3A 5GJVC 1NI3A 4F8EA 4XSGA 4HPWA 1ZA2A 2WV9A 3CNNA 3DQPA 3KQWA 3V8PA 2FSHA 1ZY2A 2X6RA 1DAOA 5ARBA 3T1TA 1EGMB 4II2A 5EE9A 1ITZA 2X4GA 2WU1A 2XYRA 1BFUA 3BS4A 2X8JA 3ZWYA 1P74A 2EFHB 4CWAA 3STTA 3M4JA 3CM0A 2FMXA 4BX8A 3S55A 1J09A 1WETA 1JYSA 1IEQA 1NQTA 1N1DA 1SVSA 2QGZA 4IP0A 1AXGA 3ETHA 2BBTA 1NBMD 2YMLA 3R23A 2R8HA 3Q7IA 3GGGA 2QKYA 5L1LA 3DVSX 2DIKA 4Y2JA 5HOEA 1XD2B 4IIFA 4I5IA 4AS3A 3TD2A 3WIVA 1IONA 5HCUA 2EKDA 3HB9A 1QH1A 3UA3A 1MGOA 4PLCA 1HE8B 2R751 4N0QA 1JG6A 1H9BA 3SCZA 2DR3A 4B3GA 5DNAA 3HO8A 1JQKA 2W6NA 3VOTA 1ZH6A 2G1KA 3KVNA 4ENTA 2HXGA 3I01M 3ILSA 2EWMA 4OL0A 1M83A 3T38A 1MCZA 1NDUA 4EZBA 1IC6A 2ZS8A 4YX9A 3D5QA 1QO0D 1CYDA 4YASA 3FDZB 2H2IA 3PP8A 2ZRBA 2PL9A 1NX9A 2PX3A 1KO7A 2VSFA 2AOVA 1IMJA 4MI9A 3Q40A 4CQJA 1II8B 4EB6A 4F56A 3R7AA 2V45A 4J9NA 2X3YA 3PHJA 3Q7EA 1KDZA 5K0JA 1XA3A 3H5AA 3UJDA 1A97A 4NAUA 4A3IG 1LSUA 3KYDB 1YR6A 4EJ6A 4C5BA 3JAKB 3TRHA 5E6RB 3IV7A 4FZJA 4RJLA 3MR5A 4P3PA 4CTJA 4F04A 5K0FA 4EHAA 2FLLA 4RAQA 4EGJA 1H94A 1TO1E 1MO3A 3EQ2A 3HJNA 4DY4A 3WMGA 3V1TC 3PT9A 1PE0A 1XQ1A 2RHJA 3TLEA 5DYYA 3SC2B 5A5DA 5FV4A 3IPCA 3RYIA 3TOZA 1BWSA 5KPJA 1EIWA 1ECPA 1M76A 4M7OA 4K0KB 1KQPA 3BCHA 2H2HA 4D4KA 4X1OA 2VAVA 2JGAA 4YRQA 1ST2A 4S2EA 5AK0A 5L3VA 4HAYA 1HI9A 1DAAA 1IXZA 2LBPA 4U2CA 3I5YA 4I5FA 4NZZA 2DLDA 3KR2A 4X20B 5LL6b 1QAOA 2OCPA 1LTHR 4MWTA 3U9LA 5L51A 2ZREA 2UVWA 1KEZA 4GOOD 2Z3ZA 1YMVA 5T5QA 1GQOA 4QYIB 2PL1A 5AXCA 3BAZA 1CY8A 4P4UA 4GX2A 3HMKA 6AT1A 5J5VA 3PHIA 2IRWA 1NLYA 1RI1A 1DT5A 1MO5A 3C8DA 5ADVA 2F9MA 1P5JA 3A1WA 4GICA 4U5XA 1PWHA 3HSYA 5EWLB 1IPEA 3RSOA 4AYTA 4MVJP 5CB4F 2EL7A 1LBSA 3UMFA 4Q4JB 5HNKA 4JU9A 2OZPA 4REOA 3CUSA 2QW8A 4MS4B 2WUVA 3ROPA 3PV0A 3QX8A 4IRCA 1TW2A 2E4YA 4FCCA 4RTLA 3L43A 4X3OA 1LPMA 2C8JA 2JRLA 2VHYA 2VP3A 4IEEA 1FVOA 4K3VA 1ETHA 3C3JA 2LCQA 5LXTA 5I9SA 2X0KA 5KT2A 1AS2A 2O0HA 4I36A 4U7WA 1FNNA 5HTKA 3UC9A 1XU7A 3C8HA 3UM9A 4BX9A 5JZVA 1QU3A 1BX3A 4RWZA 1GLVA 4YXWD 2UZ4A 3O4GA 4M36A 4K1XA 3AKYA 1I4DD 4Z86A 2EKLA 4JV2A 4M1EA 1KMNA 1YB7A 2EKQA 2HFKA 3M4YA 4L5AA 3TDNA 1MJGM 3V5NA 3ZHRA 1SHTX 5EGSA 4K03A 7AT1A 1ILEA 3A1NA 1SHZA 1J2JA 1JRLA 1AUPA 1ZX1A 2AK2A 2VDKB 2XRMA 5T4HA 1FF9A 3UXYA 2OGSA 2H2DA 1QB8A 3QKIA 3AHFA 3OLWA 2Q5LA 2HVRA 3TNDA 2FZ4A 5BRJA 4YHBA 2IX3A 1YMQA 3PDWA 1UBHS 5BSKA 3W5IA 5EJ2A 1II0A 1XJ0A 4WCFB 1Q3TA 3OEED 1CY1A 4P4LA 1EFAA 1WB5A 3PFIA 1S9HA 4G9GA 2YCBA 1JJIA 4N65A 4WN9B 1D4ZA 1R6TA 3QELA 3BX1A 1KGDA 1TZCA 1TU0A 3BHMA 4FX5A 2VJKA 1QU2A 1MB2A 3RBVA 3VDRA 4EFDA 3WO0A 2IYOA 3R0VA 4YGYA 5KNDD 4UCRA 4P84A 1JAXA 2QEQA 4TMTA 1RKUA 4JD5A 1VIAA 4QFBA 4WEQA 1DMSA 2QVGA 3G0OA 3JVVA 3U4GA 1UT5A 3WLTA 1S9FA 2C2BA 4HZIA 3JRWA 3WNZA 1EVLA 2O0JA 1RM3A 2I4OA 2FPPB 1YDEA 1ZK4A 4H7IA 1M2NA 3BTVA 3OFVA 2IPAB 3AIOA 3UJCA 3P26A 1RE1A 3TZ6A 5CBKA 1RJDA 2LKCA 3W04A 3B8HA 3OBBA 4IIYA 3W8RA 4E5DA 1ODIA 5JNUA 2R5WA 1S4QA 3O1HB 4V39A 3SQNA 1KZGB 1RRFA 4DUGA 4HP8A 4OHFA 3RQSA 1OBVA 2VPIA 1YZTA 5I7UA 4BB9A 3NH9A 3ZV4A 2CNLA 4BNXA 2D2FA 4A2AA 1EUZA 3C4VA 1KKMA 5I5UA 1WX1A 3BFJA 3Q85A 3T7CA 1MB3A 2EJTA 1SZCA 5L95A 1IU9A 1JFLA 2EIHA 4ZARA 3W5UA 1MQSA 4GKVA 4YAWA 3V4FA 2AW5A 2QRVA 4EZIA 3KQPA 3A1SA 3LXUX 3PQ5A 4HS4A 1QC5B 2W6CX 5KT5A 1X8LA 3O9VA 4Q45A 1E0AA 2R1VA 1P5RA 1AK1A 2GI4A 2J3LA 2R1TB 4DA8A 4E15A 1JG4A 2ZCVA 1XZ8A 1Y4ZA 5E3IA 4G5FA 1YK1A 4ASUA 4LNAA 3PI7A 5CX1A 2FRXA 3QUSA 2H4ZA 3KZOA 5TF4A 1C50A 2GAJA 1BKYA 4B2IA 3RWMB 2VDWA 5CT5A 3D81A 2Q7XA 1UEJA 5CNJA 3LOQA 1L4YA 1YQWA 4I81A 3AF4A 3TD6A 5CM0A 3VJMA 2PX0A 1BHO1 1QIGA 2NG1A 3F6BX 2BDTA 4KH0A 2QTMA 3EGDB 4NV0A 4WIAA 1TCUA 3KPVA 3T12A 4CDRA 3SHTA 3N8HA 1ZN8A 3HYLA 1NZFA 3N05A 4IGIA 1U2QA 4BXOB 3AVVA 1I1QB 1JHMA 2VATA 2OFXA 2IZZA 1TRHA 3LWDA 3CZQA 1JHXA 2Y0PA 2NO1A 1ZINA 3VPDA 3M7IA 3GLGB 2XUJA 3RJTA 2KLBA 2UVVA 1CEQA 2ALJA 3B13B 3H5WA 4N49A 4NX2A 4EITA 5A3QA 4P92A 1DWPA 2H52A 3WLOA 5KU7A 1G2QA 5LP1A 4A4DA 3P19A 1PW7A 1XG5A 1A2QA 1MKYA 2CVOA 2HQOA 4Z7OB 3WSTA 4L51A 5CDTA 1ZC3A 4N0EA 4FYWA 4QPCA 1OPRA 3B2NA 1V8ZA 1OZAA 2Q1SA 1KJWA 3NBFA 2HWKA 5DTQA 1WNFA 3EPLA 1PEKE 3GIQA 1WSCA 4DCOA 4MA0A 1ZM7A 2ZJAA 4LCBA 4LOLA 2IBTA 1CUYA 4F86A 5KOJA 3BWBA 2WAXA 3UPTA 4PYJA 1M2JA 1ADCA 2QZSA 3X2EA 2VOJA 2CVPA 3FCSB 1OBDA 3WO1A 3GT4A 4NBWA 1Z6TA 5DF1A 3TR5A 5GM2A 3BUSA 1I3OA 2PJZA 2Z8YA 2H1SA 1KEVA 3MTIA 4OOEA 1Y5NA 4PGAA 2FWRA 2IIPA 1XEFA 1GY8A 1W94A 2J6SA 3KQQA 4DBLC 2OHGA 3L7YA 4FFLA 3R3HA 1UQRA 3WKCA 4EWLA 2Y66A 3PKZA 4EVQA 3Q10A 3FYUA 1CC1S 2VRCA 1C8KA 1B73A 3LP5A 4MQLA 5B1HA 3RTDA 3KZCA 1SVMA 3SBXA 3TLKA 2J0UA 1FFXA 3HBLA 5EZYA 5SV2A 1Y8AA 4JLUA 5CEFA 5JAQA 4WXPA 2VYNA 3ZY6A 2PTHA 4ZMRA 1RQLA 4DWWA 4PZPA 4RTSA 4Z3DA 3KXDA 1QHSA 2YV1A 5JXGA 4DL6A 3DJYA 4FOPA 1FUIA 2APJA 2YN2A 4DR5H 3F1KA 1Z17A 4K6OA 5ER9A 2L19A 3LULA 3ZQ6A 4AURA 3ZCQA 1SOWA 5KVQA 1DL5A 1DFHA 3K6SB 3A4TA 1T1SA 1L4UA 1EKFA 1ZEJA 3W7AA 2OXTA 4RY2A 1EVQA 1P4GA 1QMPA 1ONNA 1QF7A 4BV3A 2RB4A 5I51A 1ACJA 3HY4A 1WSDA 4YQFA 2M6RA 1HE3A 2CDBA 3KZMA 5FHRA 2PFKA 5JIBA 5I4BA 1RPNA 4L76A 1G8HA 1G8MA 4IHJF 3PXUA 5HDQA 3S1AB 3ZXSA 2CLIB 4QEDA 4H3KB 3RYCA 1R4NA 2RK3A 3FG9A 2QVXX 3A6LA 3NORA 4Y30A 1W76A 5AH0A 3O21A 4BEJA 5FP0A 2JAPA 2XMDA 1R8JA 1FXWF 3V1UA 1N78A 3ETDA 2P2ZA 5B6JA 1A2OA 3KKMA 4KO4S 4KQIA 4Q6WA 3TRDA 2VWQA 4JJGA 4X94A 2AOUB 3C39A 4WXRA 1JS1X 3RYTC 1QNLA 1OLUA 2JFBA 1GVNB 3PGKA 1IN6A 4TZTA 5H3CA 1RCTE 4YJ3F 1PBNA 3SPXA 5L8VA 4B80A 5J4HA 1CKNA 2C35B 3G2PA 4MV6A 3TNJA 2FFRA 3T1HB 3VHQA 1U8XX 4CF4A 1GAJA 4AM8A 1CUXA 1SKBA 1VMKA 2VTBA 2GKSA 3KJXA 1R0RE 3P96A 4HUQA 3KWJA 3WHIA 4RU1A 2DPJA 1D9XA 2GBIA 4MWZA 4WCVA 4NFSA 4URXR 1XTPA 2W2LD 4OIMA 3MC1A 4BPBA 5EE0A 1Z68A 1UBNA 5ENZA 4R2LA 1MG5A 4A92A 4ZFNA 1K08A 1JDEA 4TWRA 4B8WA 2Q2NA 1WO8A 3GDGA 2YWDA 3IODA 3PR1A 5JAOA 3Q9SA 4MW9A 4FP9A 5I9MA 4OV6B 3ZK7A 3H40A 2Z3VA 3IAFA 4QJBA 3UK2A 3C3WA 4BFSA 4UCOA 1N6OA 2CD9A 2FEKA 4MPPA 1EUQA 2J3EA 1RW4A 1KC3A 4W99A 3L2OB 2WT4A 1NNUA 4WOBA 4D97A 1P4SA 1LQTA 4ETSA 1Q1BA 4KQFA 2P5SA 4ID3A 4Q03A 4YDQA 2FWPA 4TYWA 4I14A 3O7WA 2CVHA 2W57A 3JQ8A 2FPIA 3CZMA 3PHCA 2VDNB 4GECA 3AESB 4DN6A 4YY3H 3FCAA 3L0SA 4ZVTA 3F5DA 1ZL2A 1Q2UA 3HLTA 2CE7A 4XUDA 2MCFA 1TL7C 3FMAA 3DFUA 4HWOA 4PHTA 4JLWA 3EODA 4QBIA 4TTQA 1N57A 1H65A 4A2QA 4RPIA 5FPYA 3IELA 4LPSA 4LFBH 3CUVA 4OHPA 1H0SA 1DJPA 1K3FA 1ZVJA 2RAUA 4HGPA 4IQGA 4E7OA 1ESCA 1HDOA 3T35A 5KCZA 2C2RA 5JCJD 2Q3EA 4FX2A 1YUMA 4Q7QA 3DEZA 4C03A 1YJ8A 1GGEA 2P4QA 2XOKA 3KSDO 1PDVA 1YK0A 1N0VC 2YFYA 4G5XA 4UUGA 1WCMA 4I0WB 3GVCA 4FFBB 1JHQA 4JBGA 1C8BA 1WTCA 1N5LA 3TZHA 3OPNA 4DAOA 1UPTA 4KR6A 4TMKA 4Y2YA 2ZJ8A 1JA0A 1NDQA 2J30A 4I4IA 2GQSA 3HR8A 5T6BA 2O5RA 5CTAA 2W8KA 1V3UA 5KO2A 2P4UA 1YR9A 2WPNA 1RM5A 5F7JA 2NUPB 2JIMA 3DNFA 4W7IA 4DJTA 3FHTA 4L7VA 5EXEA 3DDNA 2AVDA 4FOOA 4WUVA 3PDCA 4O2BF 4YRFA 4P0QB 2EJ3A 1NLUA 3NU1A 3LO8A 3O4FA 5AW5A 3I28A 3TQRA 1E3IA 3B12A 1YJBA 2YZKA 1UPCA 3GRUA 4UTRA 2Q0HA 3GWGA 4W8GA 3OM1A 4QHSA 4D0RA 2NU9A 2C5HA 4LRQA 4WXYB 3VO2A 3SR4A 4F60A 1RQNA 1GOTA 1UJ2A 1V11B 1XC7A 3K35A 3FMIA 5EE5B 1VE7A 4OYYA 3WHPA 1M6YA 3OJXA 4IMRA 3VOBA 1T2FA 5LA6F 2WFAA 3CXRA 1WUIS 1X1CA 4RDCA 4JLNA 1D5WA 4J3NA 4E94A 2QLBA 4Z9BA 1H5NA 1A71A 5EIHA 5EJAA 4EGAA 4DLAA 3COZA 4P53A 4AX8A 3UV7A 2Q2VA 4MIEA 5DEOA 3AEQA 1NOKA 2J3JA 3L1VA 2O07A 2N75A 3QE2A 5FAXA 4AG5A 9LDBA 9MHTA 1WDLA 5AVZA 5FWAA 3LKZA 1RJFA 3EW7A 2ZB8A 5F5XA 2RDIA 3UMRA 4PQRA 4A0HA 5EZQA 3AOEA 3TTXA 3OAAA 1VHTA 5AM3A 1UAGA 1PFVA 2JGRA 1ODTC 3CZ5A 4BTVA 4E46A 2DR0A 3F6SA 3GN2A 3O4RA 2Y6UA 1N7IA 4FFSA 2VLBA 4RJIA 3MJSA 4U3JA 4MYSA 4B73A 4UHFA 1ULHA 1JFTA 4UQPA 3R6DA 1HNZB 1AXRA 4K6CA 5LMUB 1B1CA 1BKSB 3OQHA 1FP2A 1I14A 5CXSA 3ZWKA 1KP9A 4KN6A 4Y2GA 1QDEA 5BWXA 2JIOA 1IQUA 4G25A 1DBWA 3OSUA 3G6XA 1Q0PA 5JYEA 2F3TA 1TAUA 1NL3A 2CJWB 5BSMA 5BW4A 1EG7A 1NLZA 1K7XB 4PRLA 2EZ8A 3SKXA 2WWWA 3FPCA 1HDCA 2OWOA 5IVIA 3NNDA 5KOYA 1I4WA 2DH6A 4DW8A 2ZIGA 3H86A 3HKCA 4OJQA 4DOMA 2QP9X 1Y7IA 1HNZH 2QTBA 2Z5GA 1RHKA 3M89A 2ZM5A 1PBTA 4NYEA 3DNPA 4D4IA 4MR8B 4RS4A 4DL3A 3AQIA 1SOUA 4DNXA 1GG9A 1HT0A 3AEKB 2G07A 1MGPA 5EWFA 2E55A 2CJXA 1IUNA 5D5QA 4LSWA 5ESRA 2I3ZA 2DZDA 3F78A 3T9DA 4B3XA 1MABA 2JGLA 1OWNA 2WFZA 1ZIYA 3N5KA 4MZXA 5FA8A 3VC2A 1SKUA 3R44A 1G9TA 2XSZD 2PZFA 4RUAA 4JYPA 4G0YA 5E4YA 5DM60 4D44A 4ZYVA 1G38A 4OOFA 2P2YA 5KYVA 1NUSA 2OCKA 3SJBA 1YRYE 3ZCPA 3DWEX 3CLRC 1Y7PA 3L6BA 4PO8A 3A6HA 4LRYA 4A73A 3AYXB 1NVVR 1A9YA 1XQXA 1U7UA 1XVAA 2JFOA 4IDHA 5THKA 3S1SA 2ZRHA 1L5KA 1Z4JA 2MJLA 4XRRA 1C30A 1YS1X 1XMIA 5JS7A 2HW8A 2YWGA 1G7RA 1G8KA 4IR7A 4XVRA 1KJ8A 1WCV1 3CISA 3ESBA 1JW9B 4O0LA 4DADA 4EW1A 1WVMA 5EIOA 1QX3A 1GCGA 3C7DB 3GTQA 5F1YA 3OLYA 3SC6A 2C8KA 1BS2A 4EABA 1XMQB 1SUWA 1HRKA 3CUEF 2CNUA 2AE2A 2EHJA 2NUAB 1NN0A 5KFUA 1NX6A 1Y8QA 2AZTA 5EIBD 4BPRA 4Y1EA 4BNKA 4CL0A 4XYMB 3OHAA 3CRVA 3WWYA 4DFDA 2WT9A 2A57A 3HKZE 3T1HH 1XN1A 1B2RA 1ZM9A 2E82A 2P9TA 4EATA 2BP7B 3VHLB 4UAJA 1RWWA 4XOUA 3OHSX 2O4UX 3WX0A 1E6MA 1YJQA 1W0KA 3JZAA 3ZZ1A 3RROA 1DB3A 1U0RA 4N82A 4CMIB 3BCUA 4R1UA 3FMFA 3C3AA 1ZD1A 1NM5C 4E1AA 1XZEA 1V8PA 3PRHA 5CW1A 2E4AA 1KYYA 1ZHHA 4LMBA 1E4YA 3QVKA 4ERXA 4EVRA 3RUIA 3IOCA 5EYPA 2YVKA 1IOWA 2RHMA 3GK3A 1YAHA 3PQ8A 3RGZA 1KRXA 2IBKA 2K2QB 1K86A 2JHGA 2FDXA 2PCJA 3GJXB 1VHDA 3BWEA 1Z6YA 4GNKA 5D84A 3V34A 3W8NA 1X13A 1I2MA 2CQYA 2JGDB 3OZTA 4ED9A 1T5LA 1CUVA 2ZYSA 4DDMA 2V6IA 4YAFA 1WHTA 1WF3A 4N5IX 3ZIUA 4J76A 5A71A 4Z4EA 2ACKA 4CMHA 4M0UA 5FFMA 3VO8A 3K0EA 2BFEB 5KG7A 5TQ0A 3H4VA 4WX2B 5TX7A 5DTEA 3RE1A 2ZVQX 3SM3A 2ZYTX 3B3FA 3HI4A 3BZUA 2FWNA 4PW0A 2VA2A 1OXUA 4CT5A 4OQQA 3T7EA 4B32A 3HB7A 4O4LA 2Q7DA 4DABA 4Q1EA 3OZVA 5KG1A 2H18A 3O03A 3EXFB 1V6SA 2JFVA 1K66A 4OPMA 3UMGA 2O2HA 3HL0A 2ZJFA 5LUBA 1P1BA 3S5UA 3WWDA 3ZS8A 4BWFB 5K6AC 3M6VA 3ZD7A 2OKGA 4I5EA 3B3JA 1S7GA 2VBCA 1N0HA 4DV0B 1R1DA 4GSKA 4NEQA 1EGAA 4DSZA 2PUFA 3WP0A 3RR5A 2MYTA 3AFMA 3TTWA 2VP6A 1X1BA 4D0GA 1V71A 3Q8KA 3K30A 4TYPA 5E4JA 3HOYG 2XE8A 3AKZA 1M66A 2MYUA 1T2DA 1ZUD1 1M2WA 1Y5LA 4CVNA 4TS3A 5CYPA 2I7VA 1WR2A 5KYGA 5JZOA 3MTJA 3EEQA 4IH4A 3U4QB 2J3DA 3OQ1A 3ANNA 5EHIA 1GCOA 1SPXA 3MM4A 1COWD 2ORWA 2CUZA 3MWDA 3C3DA 1PQUA 1IN1A 1ADBA 1BXKA 3WL5A 4N5LA 3JQAB 2R92A 1GTVA 1A9XB 3DE0X 2G17A 1HEUA 3LHKA 4FR0A 4Q47A 1AZLA 1OFUA 4DQXA 1SHJA 5BW6B 1U7HA 2QR5A 2I65A 3DPSA 4BIIA 5LJLA 3RREA 4QU0A 2HIHA 4PONA 4ZAXA 1T3SA 3IDOA 2AMVA 3KV1A 5K0ZA 4OXRA 3PHLA 1F8UA 4IRDA 2BI4A 2E4ZA 1V9LA 5KJ1A 4UUBA 2JEFA 2ORED 1XRLA 1NJ1A 1KI6B 1SHKA 1TZJA 2HWXA 3FFXA 4U2GA 4Q4CA 4OH7A 2QUAA 4F12A 5HMMA 1YQUA 2V58A 4AUNA 4EQ6A 1KKLA 2ISSD 5C8YB 4G07A 2B2XA 2L17A 3GZJA 3NOVA 3VR5A 1DWUA 4MUNA 3ZDYB 5HS4A 2HIGA 3V2IA 3ZHQA 5KTSA 1V1MA 3AVTA 4FFNA 1I1MA 4K28A 5IYBG 4ECVA 2YJZA 4U1RA 4YK7A 4P6VF 3LQ2A 4Y9TA 2QTWB 3G9UA 4AZ0A 3GAMA 3VV3A 4ESOA 2ZYWX 3S8EA 2FR1A 4Z6KA 2DFNA 3DE5X 4BMSA 2A84A 3FCXA 1XU4A 1EX9A 3EB9A 1FP7A 1SVNA 3BGIA 3ELUA 3IP1A 4ISCA 3V7WA 4DLNA 2I29A 3EG9A 3ROKA 5KQLA 1CZRA 4DC1A 1C1YA 4KFCA 4KR7A 2I2FA 2PKYX 4JV5B 1QIJA 2Q3DA 2MYPA 3BSWA 5EUQB 5HM8A 3PC2A 5CLJA 1EB8A 1BU5A 1OOEA 3BMCA 4FE3A 2VQEH 4JT4A 1SUAA 5ULLA 2VUGA 3A28A 4DANA 4ED1A 2UZ3A 4O3QA 1IEXA 4QQFA 4G1FA 4WESB 4TYNA 1FA9A 1SRQA 4ARIA 1P72A 3QK7A 4C7BA 4O81A 2IPNA 5LZ9A 3U1BA 2PRZA 2Z30A 3Q3IA 1JX4A 1AKMA 5GVSA 1PDOA 2FMIA 2RC5A 2FZVA 4XDGA 1NNEA 4LH6A 3FF1A 1ZK1A 4F4FA 2IYZA 1LDBA 5C8YF 2XLBA 3ZWVA 2GPSA 3R5JA 3D3NA 1MXFA 2ACWA 1GDTA 1IBKB 1G21A 4E5YA 5EP1A 3ESYA 1T3LA 2ECPA 3SX2A 4L4XA 1X7WA 1ONOA 1GA1A 3ORQA 1Q3KA 2DFKB 3ITEA 2ZJ6A 1L5RA 1OA0A 1SZDA 3IAHA 3PA6A 3PPIA 4RUKA 4YXFA 1ODCA 2FCAA 4F85A 5BV8A 5FI1B 2HT6A 2Z1MA 1RRCA 2NV6A 2BBWA 2FFJA 4YP9A 1MAUA 3TYXA 4BP1A 1ZWKA 1G6Q1 4DV3H 3DD5A 3IUYA 1L4GA 4OHXA 4U2DA 4DWJA 3BACA 3NEYA 1IE3A 5K6RA 3OJ0A 1N56A 3C97A 1MC1A 5FWNA 1TKAA 2AI2A 2XX3A 1U90A 4J7CA 1ISHA 1TCVA 3IULA 1REQB 1SKYB 3O95A 4V0ME 2NNLD 5L45A 2HXSA 1OREA 1ZK3A 3PR2B 1JEDA 3HVUA 4JB3A 1NBWB 1N1GA 4AP5A 2EJBA 3KJFA 3CN9A 5C1BA 2FX2A 5B6IA 3O38A 4JQOA 4ZVMA 1T9DA 3H84A 3L8EA 4GWLA 2GYWA 3MB5A 1Z4QA 2R2AA 2GFIA 3TNLA 3VR4H 3M4XA 5JI3E 3QNWA 3N40P 2FUNB 4AWXA 3A4LA 4UUQA 4ZI2A 1N2CB 2EJWA 3W5JA 1GN9A 1ZO8A 5KB3A 3OCXA 2PXXA 5AW1A 3VA7A 2I4IA 4D6PA 3E0QA 4ESHA 4ZIRA 4RY0A 5T3YA 2HIXA 2FLPA 1Z38A 2FX5A 3B5EA 3BQNB 1ZD4A 3RB0A 2N3ZA 2ZROA 4TLCA 1JIJA 2AFIE 3OF5A 5EP2A 4RHEA 3T5MA 1M1YA 2CLMB 5KS2A 2FWJA 1NV9A 3JQ8B 1KKUA 1TUBB 2R6AA 2KM1A 5IBCA 3H1PA 1L5NA 1JKIA 1LTQA 1KHHA 2YJ4A 4Q34A 3E9RA 2R5FA 4K7JA 5FDFA 3E22A 4OJKA 4DDHA 1E6EA 5EHNA 1XVUA 1B3RA 1LBHA 4P3YA 1ODJA 3A1CA 4E03A 2WINI 2DPMA 3V1KA 4AJ9A 1J0DA 4BV2A 4DCMA 3CPSA 4MUYA 3OQPA 1F1JA 3QEKA 4R1NA 5JBQA 2CE2X 2Q6KA 3C3KA 4ZCMA 5HGXA 1XMPA 4IZHA 4UPDA 1YTLA 4IXNA 3ZHCA 2QRNA 5A4JA 3GLFB 3CIFA 3DMRA 3R8FA 1OXBB 4IWXA 3NETA 3O73A 3PWZA 2Z8XA 3KT8A 1FLDA 3AIKA 1XA0A 2H08A 4GC9A 3DVLA 3TIXB 4RA6B 3IJEB 4FNOA 4FM9A 1UEXC 3GRPA 1L4BA 1PL6A 4UEWA 2PXCA 5TJHA 1OI3A 1UADA 1XTZA 3DOEA 3X43A 3CRRA 2Z8ZA 5COBA 4JWKA 4BVBA 4Z4HA 2CL6X 1T8RA 3CQZA 3FUCA 4XXHA 3SHQA 2HA0A 3WXMA 3GUYA 3WBFA 3RJZA 1BHSA 2QY9A 1NRJB 4IDAA 3SK0A 1IZ0A 1NMYA 2JDID 2QJWA 1PIWA 4GKBA 2Z2KA 1WPRA 3IOYA 3PITA 4K8OA 2PBZA 2I6SA 2R2GA 3AI7A 3SR0A 5IBPA 5FT9A 5COAA 1H1LB 1Z39A 2C77A 1J2UA 1G7SA 3Q11A 2UUAH 2NU9B 1SC3A 2OXEA 2PUJA 2ATEA 5AVWA 1PS8A 5ALFA 4GX0A 2VPSA 2QTHA 4PNPA 2E3JA 5AHKA 3VVMA 3P71T 4J8PA 1FU7A 4HAIA 2AOWA 2CFIA 2QX6A 1FPMA 1KOJA 4UCSA 1MENA 2KYRA 3BE4A 4TYYA 2QJFA 4WCDA 1TW3A 1WHSA 1XOIA 4DXHA 5EKSA 4BDSA 1BEUB 5T4FA 3RB6A 1GFSA 2Q3FA 1LC0A 3AUYA 1GKLA 4AULA 4I9FA 3A1UA 2C4NA 3GJ6A 3ROEA 1BA2A 4FBTA 2OD2A 2XIQA 4J9MA 1W36D 2QTNA 3RFTA 2JHCA 4CEJB 2NAPA 2VRBA 3C6YA 3RODA 4ETMA 4EY6A 4GYYA 1SXJC 2JI9A 5FPHA 1CQXA 4A2CA 5E9JA 4EHKA 3OQVA 1RAIA 1T36A 2JB9A 3EGIA 1Z25A 4FC6A 2ACVA 5IKOA 3WDLA 1JQDA 1QXSA 5CCXA 3B9QA 1GNQA 3R0XA 3MJ4A 1GRQA 1W19A 4HDKA 3U3XA 3GJXC 3OJWA 3IO3A 4OHKA 2OZKA 4RV9A 1YVPA 1M10A 2HUNA 1I3LA 1UBKS 3OTGA 1MFZA 2VXYA 2AL7A 3B6EA 4CM9D 3QJYA 4PLHA 2O1SA 4QECA 2IL1A 2AFIB 4RL4A 1HZJA 2NMVA 4W9NA 1R5OA 4J0CA 4C4RA 1NVTA 2BBOA 4H2DA 4Q01A 5C8DA 3W5SA 5HIMA 3Q1KA 5F7ZA 3J80W 3JZDA 1T6ZA 3EARA 4GI1A 3RTBA 3FAKA 4TV9A 3K9BA 3V9PA 4O02B 1SBTA 1V5EA 1YKGA 1QOPB 3ZXIA 4GG1A 5JMPA 3A1TA 4U7HA 4XQ0A 3N2ZB 4UU1A 3TZKA 2J07A 4J49A 3MXTA 4EG7A 5BWOA 4YJHB 4TM7A 4B1FA 1JXAA 4UOZA 3IFSA 3G0GA 4X6YA 5EWJA 1ISRA 2WQ6A 1FTSA 3PIIA 3SVTA 3GNTA 4DRXA 1LRKA 2O57A 5E3JA 2GNAA 2QT9A 1Y8ZA 3RAJA 4B3TH 5HEKA 4DQDA 4WBNA 4YUVA 1CR1A 2OFWA 3E0XA 3GLQA 3PJEA 1TT7A 5BN4B 2RK4A 5IXJA 3LKDA 4YAKA 4DR3H 5BQOA 1F0KA 2BMJA 3ZWDA 3V6MA 3FWZA 1LS1A 1QCDA 4ER0A 5AVVA 4AYBA 1EJ0A 1LW6E 2XB6A 5C1IA 4HQ0A 1FUUA 1KK1A 2OAP1 4PWZA 1Y8QB 3A6DA 3AY6A 4KH1A 3AEUA 4OBXA 5EIWA 2PUEA 3ZHBA 2JA8G 3TY8A 5LQAA 1Z63A 4PHHA 4HYEA 2GZ2A 2GBPA 1ESDA 5HBRB 5JECA 3PFFA 1MC8A 1U2GC 5JISA 3B9PA 4A2WA 4BP8A 3GXBA 3QBVA 5EZSA 4QLAA 5IJXA 2DETA 2ZJ1A 4O5OA 3UJ7A 3TSWA 2BSQA 5F9MA 2C2MA 4H7JA 5JALA 2GZAA 1PWEA 3WKBA 2PVPA 3PW0A 2FF7A 3MGAA 4INZA 4H18A 1VA4A 4M7PA 3N8GA 2A9QA 2FQXA 1HT3A 1NE2A 2OA0A 2IBSA 1P2SA 1PDWA 4O4JF 2LIVA 1VG9B 2OCDA 2R6CA 3OE7D 4J9KA 3WRYA 3WSWA 3EGOA 3FUUA 1SOVA 2VTDA 1Z0JA 4UFNA 4CPDA 5TSDA 1VRVA 2HNAA 2WVAA 1P61B 1UFQA 4TROA 3NJ8A 4B6FA 1K1SA 1SNYA 1XUOA 1WPGA 2I2CA 1K5HA 3B9RA 4HH4A 3B1JA 5HFAA 2K7ZA 4DUYH 2PRKA 5D85A 4CGZA 1ZN7A 5FUWA 1MPTA 2QYSA 3OWXA 1J2YA 3ADPA 3HXOA 1PD0A 3NRBA 5JSUA 4QGSA 4F8JA 1CFJA 1QZTA 1NXVA 3BB1A 3OJOA 4MRRA 5DO9A 3W8EA 4C29A 1VJCA 1YZYA 2GZSA 1YC5A 3DAGA 4KWHA 5AJUA 2BEVB 2C54A 1PV2A 4QTUB 2BC9A 1YQTA 2F1RA 4OI2A 4CIDA 3JSAA 4HRXA 2R96A 3TTSA 1P73A 3RB8A 3R8CA 1G18A 1NBME 3F6EX 3FHJA 4YTEA 2VJDA 1BCSB 2WICA 5ADUS 1OBFO 3N44B 2C2HA 2IYYA 1QR2A 1Z07A 2JFHA 2LXNA 3KVRA 3P0IA 4DA6A 1OYOA 2YJNA 1LU9A 4RY9A 1SELA 2R48A 1NBMA 3CKKA 2CFSA 4F6CA 1X7HA 3GLHA 4G6ZA 4AJOA 3A9RA 2P6MA 3OWHA 2P6RA 4MGHA 5LQNA 2X3UA 2GAFA 1WEHA 3DL7A 4PLVA 3LKVA 4L8YA 4GQAA 2D1TA 4RDIA 5K03A 4WA7A 4I4LA 1B7GO 3ESXA 2CEAA 3CGGA 3E3LA 1LF5A 2F3SA 3H2JA 5JFGA 4JJFA 2X2PA 4YIKA 3SYKA 4MQ4A 4KR0A 3VR0A 2DTDA 1VYTA 3QM1A 3I39X 3B89A 3JQAA 3P2KA 4GEKA 3IHWA 2QU8A 3EWIA 1QH1B 2FLNA 2H06A 3PL1A 3EXHC 3JWPA 1YA4A 3PRJA 1JNXX 2X7JA 4NCXA 2Q3HA 2PX6A 4OF4A 3PT5A 4HGZA 2WEKA 4EL0A 4BS9A 1W34A 5SZJA 2OCAA 2OZLA 4XVCA 3IQFA 1P1IA 2ZI6A 3ZD9A 3PK0A 4QIWE 1Z4NA 3NVAA 4HDNB 4IDFA 4PWQA 1NOIA 4P22A 4XQCA 2Q0SA 4B82A 2IYPA 4UVDA 1PT6A 3V2HA 4F4CA 1L7EA 3QBJA 3LDAA 4GOXA 3PGXA 2OK8A 2VA9A 3ENVA 4RLFA 4D4JA 3KETA 4XRGA 2ZYUX 2W58A 2WB4A 4UZEA 2BR3A 5DVZA 3ZW8A 4YR7A 3A2NA 1FXUA 3CIOA 2YIMA 5C5JA 2ST1A 1MRSA 4ECZA 2QENA 4X6XA 1T0PA 2VUMG 2F3UA 2N46A 4FKMA 4JYMA 5H9WA 3IRVA 2V4UA 5HOQA 3AVYA 2YOHA 1DEKA 5AJYA 4EFBA 4K9KA 2IYLD 3ZGYA 2J3IA 2I8AA 1WOYA 1LNQA 1QTRA 1X80B 2TS1A 3GGJA 4ZCRA 5L3SB 4FJ0A 4HV4A 4CUJA 5H8WA 2XT0A 5FFFA 3K09A 2PXAA 2VBFA 5HM6A 1U5AA 5BWMA 4JR2A 1DRWA 4HX5A 1G63A 4O2BA 2PBFA 4F4UA 3I9KA 3WBJA 4R2XA 2WB2A 3Q7SA 4PSCA 4O8ZA 5IX8A 4GGMX 3KAQA 1W4AA 3OPQA 2WA2A 3THRA 4RZQA 3ZWQA 1GTG1 1TO6A 4B87A 4Z1OA 2IEGA 1THTA 3EZLA 5CR9A 3GFOA 5FH9A 1ABFA 1F2TA 2KLHA 4ZODA 2PZBA 4ARUA 1B6GA 1YZKA 4KXVA 4I6JA 1QTNA 1AN7A 2W2KA 4M22A 2BBSA 2XWQA 4R01A 4QKQA 4NRDA 2HHHH 1P7YA 2EKBA 4JLKA 3F5QA 4NE2A 5G3YA 2OYRA 2AZXA 1GKKA 4FDLA 1O6FA 4JMPA 4YREA 1S2NA 3PS9A 4KBGA 1DDGA 1P0QA 4E5NA 2ZDGA 1N75A 3M9LA 4IG4A 4EL5A 3TGWA 5HQ3A 3PGJA 4QQNA 4OLAA 1QHFA 1X1AA 3ED1A 4BVKA 1GNVA 3H1GA 1TJPB 1XZAA 1FQJA 1JXQA 3EBOA 3NG1A 2BHRA 5IM5A 1FDSA 3VNQA 5J43A 5K3CA 4NQZA 3ZLTA 3IQIX 2ADFA 3BG5A 4QSMA 1Q0TA 2JKYA 4RTJA 2D00A 2P6NA 1M0WA 2PQ0A 3LV8A 3UXHA 1EDDA 1ZCZA 4MTEA 2Z4TA 4WSOA 1MDFA 3SZMA 2WFMA 2XT9A 3QH4A 1PCXA 4FXOA 2VG8A 5AI8A 4P80A 3ESCA 1PGJA 2X86A 1ZOLA 1ZGAA 3CFYA 4JJEA 2DX7A 2BJWA 1G66A 4U7PB 3G89A 5FFNA 4OHZA 4EJSA 4UEJA 3H6HA 1ULTA 5FBQB 4Z0TA 4HNRA 4Z9AA 2BFMA 5AW2A 1I2LA 3KPUA 4MJXA 1FMLA 2HAEA 3I6QA 1KEKA 2QP3A 5L6LB 3UYLA 3S2FA 3EBPA 4AXBA 2Q9UA 1A95A 4MQ6A 1B04A 2LPMA 4BNYA 1TVCA 4JGIA 4FE7A 3BDAA 1AM4D 4NPCA 2X2EA 1Y4UA 3AI2A 5EPOA 5IJ0B 5KYUB 3FX2A 2WIGA 5AKGA 4C30A 3VPSA 5JHGB 1VRWA 5IRCD 2QBYB 3VYSB 1K63A 1VJRA 3PQ2A 4PSKA 3MINB 3F46A 3VZDA 1BMFA 1W30A 1WUKS 2XEXA 3NHUA 4P35A 1AMOA 3G0HA 4HTAA 4ZOLA 2OC4A 3BZBA 4BVHA 3M8KA 3RFFA 1N6KA 3FZGA 1Q0QA 3WGTA 3WRXA 4AJ1A 5D1HA 4AQYH 4PDBA 2GR9A 2B8WA 2XVMA 3RC1A 2FPKA 2XYGA 3R7NA 3IT0A 4RLQA 2R84A 4LC9A 3RO7A 2R8JA 1X19A 1FDOA 4YRGA 3E22B 1XTSA 4WERA 1OH7A 1DBVO 1J90A 3HDTA 4V0SA 2ZAOA 4RS3A 5EXDA 3NBYB 1C14A 1LS6A 3B6KA 1OQAA 1XNJA 4DMUB 3PEFA 2MIIA 2HGXA 4A5OA 4MHTA 4J9OA 4XSVA 4FS1A 3O3OB 3K0SA 3LECA 1UWLA 4PWYA 3IUBA 3ZTYA 5JATA 3MRVA 2FKAA 2IXFA 3DVAA 4B74A 5ITZB 4HEHA 1XCPA 4O33A 5TPWB 5FOTA 4HWRA 1SOMA 4TM8A 3OUTA 3RM3A 2HZ7A 2HIAA 4ITUA 2PX2A 2XMRA 1KH1A 2VF5X 3T9FA 5E4FA 1EWVA 3F2VA 1V45E 3QYPA 2PZ8A 3H5OA 4C7OA 2PMFA 1T3HA 2CMHA 4HADA 3WV4A 5IT0A 4ASUD 2AG5A 3F4BA 4CN8A 4QJ4A 3ONFA 4FGKA 3VR2A 5M34A 4ARCA 1AB5A 2JFNA 1BWQA 3RS4A 1S0UA 4BX3A 1XMSA 2RIPA 1KHTA 2XIJA 3GBPA 4LWPA 2CUTA 3EIOA 4IJ6A 2Q62A 2JL1A 5K3FB 4Z99A 1YRWA 4BKPA 4LSGA 1RQXA 5AOVA 4BXOA 2J9FA 3E6AA 1T10A 1KK0A 4HTFA 3SJ7A 3EXIA 3GA5A 3PF9A 2Y4NA 4KXXA 3SHWA 1U0NA 1R18A 2BHTA 1E6LA 3FNIA 2OPHA 1CY4A 4EGFA 5BVGA 1DZIA 2IP1A 4YJGB 1NUUA 1DUIA 3BK7A 1QIIA 3DFZA 3EVEA 3SQLA 2PX8A 4JL5A 2GQ0A 3QQPA 4NBTA 2SCUA 3K1TA 1PL0A 4MEBA 4YYZA 2C2DA 1A8SA 1AO3A 3VKVA 2X6TA 5CFOA 2P1DA 1JIXA 1V0JA 3E4CA 2A0KA 1DELA 2IODA 3PE3A 1PT5A 5EQJB 4C2BA 4CIWA 4BWGA 1YMUA 2FN8A 2GZMA 5AI6A 4EPVA 3RSGA 1VLLA 5HF5A 1WSWA 2OBXA 4JV5H 3HEMA 3RVQA 5F3WB 2ZPTX 1BS1A 1LGYA 5DBEX 4ZPJA 4BO8A 3A4NA 5HF6A 1GPH1 4EPWA 4HT3B 4Q4AA 3B5JA 4OM8A 1R0KA 5A3JA 3U17A 1XCBA 4PVCA 2JRCA 1NC1A 1ADGA 4FT2A 2CNOA 3CX4A 2C8LA 3OPXA 4EBCA 1UFRA 1W36C 2GD2A 9LDTA 1ZCFA 2AUNA 3DTYA 3ZUGA 4Q7KA 2W83A 2R00A 3VPCA 3CEPB 4O83A 4O0MA 3ZNQA 3FKQA 4FNAA 1YUNA 3TQOA 4GC6A 1T5DX 1EYZA 5BOSB 1CB0A 3LPLA 5LWHA 1FFXB 1YS4A 3K6RA 3DM5A 4YV1A 1JSZA 3USZA 1LBEA 3GN1A 2ZULA 5I9IA 2XCTB 2XUAA 3LD9A 3O92A 1YONA 1LV8A 3GEBA 1ZGGA 2YMMA 5GZ3A 1ZZGA 3L18A 1QTQA 3AGQA 3WOVA 4F96A 5K3EA 3HWSA 3KPJA 3KELA 3OLZA 2H0AA 3BE8A 4RA9A 1CDDA 1TF7A 2OENG 4LQLA 1DKPA 5AIAA 5HZKA 2JG3A 3MHTA 2XHZA 3G6YA 1W0KD 1WCWA 4YFVA 3PUYA 4JT2A 2EJUA 2WNSA 2PWBA 1RPZA 4EARA 2J0QA 3UTCA 3QEMA 1GZ6A 2ZZNA 5LKRA 2CKDA 3DZDA 4NARA 3W3AA 4ERNA 3EVCA 4JHLA 1GEGA 1PJRA 3ZE8A 2W4QA 2IYWA 1E5VA 5WRFA 1W44A 2C5AA 3ZK9A 5AI5A 3QG1A 2QMYA 5ERYA 3LQRA 1DS6A 3LYUA 5CFZA 5EFOA 3WGYA 1E7WA 2JAWA 3AV0B 1J1UA 2B99A 3U9TA 6CHYA 4NLGA 4YAKB 3ICCA 1BYIA 3M49A 3HVIA 3O94A 3DO6A 4FINA 4XGKA 2RHWA 5L1IA 4EVIA 4K6GA 3OA2A 4G37A 3HOVG 1JDJA 4N9QA 5LQRA 2ZIVB 3K70D 4FSDA 4MYRA 1KBZA 1Q7TA 1OXXK 2Y1GA 3W4JA 2VTBB 2VNHA 4LWOA 2AXNA 4MUGA 3AVXA 4M0JA 4YJFB 4CM5A 5J63A 3TTTA 4A27A 4HR7A 3N9IA 4FEEA 3SWWA 4PC2A 4JQSA 4MV8A 1U2ZA 3NVDA 1C1DA 1XZNA 1PO7A 2OO5A 4DCVA 3A6KA 4HNUA 4E33A 4BMVA 1WXWA 4NE7A 3FYTA 1TAEA 1VKOA 3M9WA 4WL0A 1BVYF 4KDFA 4P4SB 3LUBA 4R1QA 4RVHA 1OFHA 4QWCA 1IPHA 3KXLA 1SG9A 1RYEA 3DE1X 3LCMA 5T4EA 3UGKA 1DOAA 5IAGA 1DTEA 5TDHA 3ONWA 3ZGZA 1X0XA 4YAEA 3V1LA 3T5LA 3I2IA 5L1KA 2PMBA 2E48A 1D2MA 1M2OA 4LHYA 3EZXA 4MRPA 4DSNA 5KSWB 2B6NA 4AQ7A 4INAA 3UZOA 4WY2A 1L0BA 3U09A 3VPXA 5CBPA 1RJPA 2H5EA 2FKNA 3G8DA 1SIOA 1TF5A 4U00A 1U1EA 1GAEO 3PLRA 1WDMA 4YP5A 3WI7A 4K9NA 1OU0A 1Z4PX 4QHYA 3TJRA 3HVRA 2XCAA 2J59A 5I7SA 3R3JA 2GJ4A 4LX8A 3JRNA 1QCCA 3V1YA 1MEEA 3WWCA 1UT8A 1Z8NA 3PQ7A 4OLFA 5KI6A 4CIVA 4TRJA 3SQWA 1MV5A 1DXOA 4G97A 3IT2A 4JN6B 3DWIA 5E4TA 3M4IA 4EKEA 3DUFA 1FZTA 1Z5VA 3MQ4A 2M6SA 1S02A 3RT9A 4M60A 1DLIA 1CNFA 3LGAA 4NP6A 4NYMQ 4YUXA 3GMSA 3OZWA 1FDIA 2MINB 5CDFA 1TWFA 3PJGA 3G68A 2PKRA 4DQUA 2YVLA 1K8QA 5IUNC 5JBNA 2YNMD 2YW9A 4H6VA 5B36A 2VQDA 4ALNA 1FJHA 1IG0A 3HVHA 4KV9A 3RTGA 1OAOC 1RCFA 3AHDA 4OAOA 1XZMA 4MITA 3Q0EA 4NAVA 2O8EA 4QRIA 2CC2A 4UVEA 2HTEA 1A50B 2R11A 2GSDA 3CH5A 1R8SA 2CFOA 3EFOB 3O93A 1NJ2A 2QYTA 2R60A 4QQKA 3A6ZA 4GZLA 4OHWA 4LSAA 4MR7B 4FBGA 2FRDA 4LC0A 4EUSA 1I80A 1Q11A 1Z2CA 4OLBA 4YLGA 2BZ1A 2J6HA 1C3JA 2BEWB 4JASB 5IWAH 3E9EA 5ALHA 1G4AE 3QW2A 1IZZA 4LTDA 1V43A 3DMHA 3P9KA 5DIZA 3FPGA 1JVSA 5GJWC 4GZ6A 4L4UA 5AIBA 4MR9A 1PNQA 3IT1A 3O1LA 1XDBA 4H6WA 3HM9A 4B17A 2DHEA 3PD0A 1XDNA 1I1HA 4G5SA 4UQOA 3E9QA 1PJLA 3H9UA 4OBBA 5CA0A 2WBLC 1EFRD 1MOSA 3QWHA 1JT9A 5EJ6A 4BO7A 4IVPA 5K09A 5C3MA 1YR3A 3IQZA 4RZSA 3G2LA 3LPAA 4OGLA 1KNXA 1LJUA 1IJFA 3VV2A 4KREA 5TPZD 2FJ0A 5KCMA 2I1QA 3NALA 1B8OA 1L5ZA 1WPQA 2G82A 3HNOA 3K4QA 3PNKA 5DCYA 4PC6A 3Q2KA 5B4TA 5BN5A 1TZBA 2QTZA 2P8SA 4IHJA 5ALSA 5CCBA 1L7OA 2XRZA 4GL2A 2IS2A 1WTAA 3EQ7A 3PZBA 5E6UA 4ODIA 4TV8F 1EP3B 3D8UA 3GV0A 2A9VA 1T9KA 4B0OA 1WLSA 4GKAA 4EW6A 2ZRNA 3A1VA 3GNSA 5KTYA 4JI7H 1O6GA 2RIRA 1UINA 3OPYB 3GIIA 3L2PA 1WB6A 3FPBA 4HEA6 4V0NA 4AZ3A 4A0GA 3WKEA 1T0JB 4MVJM 3RUPA 3TQHA 1HL7A 2EFEB 3GCXA 4M9CA 4R7TA 3WR5A 1RM4A 1GRVA 2GYYA 1WKCA 4NSNA 5IS2A 1A7UA 4QOGA 4W7HA 2FUG1 2I1LA 1U5CA 3G17A 1WP4A 2GGSA 2CW5A 2R86A 2GPYA 2W9AA 2O8NA 2VTVA 5I8PA 4ZYTA 1MVOA 3QNUA 4DC0A 4J7UA 1TIPA 1ZRMA 2JC3A 3EGWA 3LVFO 5CT8A 4B76A 2JLYA 3GAZA 1AO0A 2C3OA 2WABA 1NQ5A 3BJMA 4PR0A 3FRHA 4M7WA 4RHTA 3B6IA 1A9RA 4RK5A 4HQ6A 1KTAA 4XWTA 2IHVA 5ICSA 1UT6A 2WE6A 4KBYA 2OGTA 3TTVA 4JZKA 1KZHA 3URKA 5B2EA 1SHLA 3P0JA 3MB8A 4KMRA 3IXQA 4MWBA 4QUBA 1SVOA 2I03A 4ZYXA 1PI3A 1RS0A 4DCJA 1E3TA 2GA8A 4FHGA 1CRLA 3DDUA 3I4NG 3HLYA 4Z7JA 3G7UA 3ZI4A 3L4KA 2VWPA 3LBIA 4IVNA 1OY1A 1JTVA 4RNMA 4B6PA 5C80A 2J3MA 1CZKA 3KQSA 4Q44A 1VMDA 2PN1A 3PNMA 3O0TA 1ZYUA 3FAZA 1NJFA 1T3NA 2W6IA 3O8OB 3V42A 4E51A 2GCIA 2OEPA 4BO4A 4KR3A 1S2GA 2C2WA 4CBVA 1RYRA 2A78A 4WKOA 3UGTA 4AK9A 4DV3B 1R9NA 1EWKA 1F6BA 3TPFA 1ARZA 2I5PO 3KDAA 1XJCA 1HYHA 4F5ZA 3V4LA 4CETA 4B3MB 4F5YA 1RIIA 3GJ0A 3PX2A 1JSLA 2ZRQA 1IM8A 2QRKA 3DTTA 1Z0SA 5TVGA 4F91B 1UBGA 1P7ZA 2RCNA 3L7IA 4MTDA 1K7YA 5JWOA 4KQ9A 4JVSB 4NXMH 4P81A 1DKOA 4YI5A 3EZFA 5EHGA 1TYEB 1M1XB 1U8ZA 2PK3A 2WSSA 3DB1A 1KAEA 3FLEA 3FPAA 1D7OA 5AKJA 2W2QA 5JLJA 5CLQA 2Q1UA 1RAGA 3DDSA