1AUXA

Structure of the c domain of synapsin ia from bovine brain with calcium atp-gamma-s bound
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
292
Chain Sequence
b'AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSINSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLINQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAKYDVRIQKIGQNYKAYMRTLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNAPSIN IA
molecule tags Transferase
source organism Bos taurus
publication title Synapsin I is structurally similar to ATP-utilizing enzymes.
pubmed doi rcsb
total genus 85
structure length 292
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1auxA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1auxA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1auxA02
5KX5F 2CNQA 1C30A 3G8DA 1B6RA 2W6OA 2W6QA 2CZGA 2YZLA 4XZ3B 3U9SA 2FPPB 5K2MA 5CA1F 1CQIB 1VBHA 1IOWA 2HGSA 4MV1A 4M9UA 4C5CA 4MV4A 2OLSA 2QK4A 2I87A 3U54A 4MV7A 5H80A 4O4HF 2NU6B 4L1KA 3AX6A 4Y8VB 5JQWA 4J6EA 2I8CA 3V4ZA 4MA5A 4IHJF 4ZOLF 4EA8A 2DIKA 2NU8B 2YW2A 3N8DA 5JQGF 1KJJA 1CE8A 4M98A 4O7RA 4O7LA 4C5AA 3ETJA 3U55A 4FFPA 4MAMA 1A9XA 4IZOA 2NPOA 4FU0A 4EABA 3R5HA 4IIJF 5LYJF 4FE2A 3U9TA 2XCLA 4GGMX 3MWDA 3DF7A 2J9GA 4O4IF 2YS7A 3KAJA 4TV8F 1SCUB 5BPFA 4ME6A 3VPBA 5C1PA 2W70A 1I7LA 5DMXA 2WYOA 4M9CA 2GQSA 2XD4A 4O7SA 4O2BF 5D8DA 2R7LA 5JVLA 3ORQA 1BNCA 4EGQA 2ZDQA 3JRXA 3OUUA 1C3OA 5LOVF 1GSOA 4QSHA 5CA0F 3RUPA 4MV3A 3VMMA 2R85A 2R6FA 5FNVF 3R9RA 5J2UF 1KBLA 4IWYA 1KUTA 4O2AF 3E5NA 4FFOA 4O7ZA 2NU7B 5I47A 3WNZA 3I12A 3VPDA 4O84A 5GONF 4YAKB 2VHEA 2VQDA 1I7NA 2YWVA 1CS0A 3BG5A 2QF7A 4MV8A 3TINA 2R87A 4O7NA 4FFRA 4HNUA 4O81A 1DV2A 2HJWA 1KJ9A 4ZHQF 2Z02A 4YJ2F 4C5BA 5C8YF 5LA6F 3WO1A 3WO0A 2V5AA 1EUCB 1W93A 4YJ3F 3UFXB 4YB8B 2PVPA 5BPHA 4HNTA 2FPIB 1OBDA 3N6RA 5CAEB 1UC9A 4YAJB 3BSWA 1KJQA 3ETHA 3QFFA 2DLNA 2YYAA 3JRWA 4O7TA 5BMVF 2CNUA 1Z2PX 2W6MA 4XYLB 4O7VA 1T36A 3VOTA 1KJ8A 3SE7A 2FP4B 4EA9A 2YZMA 3LWBA 3OUZA 3R5XA 1Z2OX 4DIMA 3LP8A 1EYZA 5C1OA 2SCUB 1GSHA 1VKZA 4XYMB 2YL2A 1Z2NX 1M0WA 2R7NA 4WBNF 4YBZB 5JVDF 3ORRA 4FFNA 1W96A 2CQYA 4O4JF 2YRXA 5J2TF 4I55F 4ZQIA 3VPCA 3BFPA 5JH7F 2VR1A 1A48A 3NUAA 3K5IA 3R23A 1KJIA 2C00A 3RV4A 4FGRA 2GPWA 3TQTA 2DWCA 1CQJB 4E4TA 2R84A 2W6ZA 3TIGA 3JZIA 2W6NA 3MJFA 1DIKA 2X0SA 2Z04A 4MA0A 1EZ1A 4WD3A 4ZI7F 1GLVA 5EZYF 3TIIA 4RZQA 2PBZA 3BSYA 3JZFA 1EHIA 4TUYF 4EGJA 1JDBB 3K5HA 4IWXA 1DV1A 1IOVA 2DZDA 4O7WA 1B6SA 5LP6F 4MV9A 1KEEA 1AUXA 1BXRA 3HB9A 5CB4F 2W6PA 3HO8A 2CNVA 5LXTF 2R86A 1JDEA 4FFMA 2YZNA 4I50F 3GIDA 4NYEA 1GSAA 4HNVA 3MWEA 2R82A 1JLLB 3Q1KA 1EUDB 2ZDGA 4TV9F 1M6VA 1E4EA 4EG0A 1ULZA 3VA7A 2IP4A 2VPQA 3KREA 3RFCA 2YRWA 3Q2OA 2FB9A 1AUVA 4O86A 3GLKA 2FPGB 3G8CA 2GPSA 2V59A 2YS6A 2GQRA 4HQ6A 2YZGA 3RV3A 4O4LF 2I80A 3V4SA 3BSSA 2PN1A 4O82A 3HBLA 1UC8A 1VBGA 1WR2A 2R7MA 2GLTA 4DLKA 2NUAB 1OBGA 1JKJB 4FFLA 4MV6A 4I4TF 3K3PA 1PK8A 2ZDHA 2V58A 1PX2A 4HR7A 4EA7A 5KKNB 4O7YA 2W71A 5HBRB 3KALA 1GGOA 4O83A 1M0TA 2P0AA 5IYZF 5HV6A 4XX0B 1KC7A 2NU9B 4EAAA 3KAKA 1E4EB 3AW8A 3R5FA 2R7KA 3TW6A 4M99A
chains in the Genus database with same CATH superfamily
3LJKA 5ER6A 4NMMA 1R5OA 4ZU1X 4IDGA 1L7NA 3HYTA 5EJIA 4BJ1A 4TYMA 1RQGA 4R6WA 4TQ9A 1CJVC 3GV8B 4K81B 1HNNA 3G2LA 1QKIA 1TJNA 4Y9DA 3BIXA 4IEEA 1TA9A 1XHEA 4YBZA 1JDUA 2XTJA 1MJHA 2GPBA 2WM9B 3CG0A 4GAEA 1ZMRA 4L76A 3K0CA 4P9NA 4HDNB 4QQRA 2YJZA 4IUYA 3VVCA 5DXAA 4JV5B 3DEJA 5FBHA 2P9YA 4YQFA 4IW3B 1QQAA 2QYZA 1SRRA 1N2IA 1YUNA 1Y5RA 4NWIA 5G3ZA 2YZLA 3ZCSA 2HYIC 1ECFA 3EBLA 5IVKA 3FZYA 2PUAA 1ZMXA 5GY7A 4EHBA 1VL6A 4LQCA 3WWHA 4J2TA 2IUUA 1ID1A 1MB9A 2P7IA 4XOIA 3TRDA 3PUHA 3O03A 1CR1A 2K4MA 2P3LA 3TUJC 5CVTA 4RACA 2JH8A 3N58A 2H0QA 2ZM6B 5DBOA 3K0HA 3VVMA 1OXKB 1PL8A 3TQHA 1JI0A 3AMVA 4Q3NA 2J32A 1G38A 2RIRA 2ZSHA 3JAKB 2NUBA 4GQIA 3PEYA 3GHHA 4DKJA 1PHRA 1ZVMA 3NAMA 1YA8A 4Y2YA 2G07A 3KYBA 5ALHA 1S3IA 3B12A 3UM9A 3ZBQA 5IT9A 1NUAA 3ANNA 5LZ9A 4OU4A 1RCFA 1UFOA 1HF3A 7MHTA 1JFSA 4FYJA 2CZQA 4E6PA 3NUZA 1A76A 2C1EA 3QU4A 3AM5A 4FOLA 5B6PA 4I8XA 2I6XA 2RCNA 4HLCA 2GJ8A 2O7SA 3GLFA 4CR6A 4BFSA 1N3YA 4DJFC 1T24A 2VAXA 2F43B 2DPIA 5K45A 2VYVA 2QTZA 4NI5A 2AHOA 4P3NA 5JBNA 3HZHA 4ZQFA 2FPSA 2FETA 2COEA 1ESDA 5JQGF 2XF8A 4FNOA 2IZ1A 4TSFD 2DQZA 2W6CX 5BVHB 1F2DA 3FFXA 4HD8A 3G9QA 4K8OA 5KWVA 4C2UA 2AGPA 1FDTA 2BAGA 2XKJE 2ERYA 4ZVUA 2PWAA 3RU9A 3W2EA 2HZBA 1X1RA 1AV6A 1XZPA 3JS5A 1Z63A 5LWQA 4LMPA 1FVOA 1PEDA 2I9PA 2J0UA 5GWXA 3RG2A 5CJPA 2AGQA 5DQIA 4MAMA 2PO5A 2CZCA 1K4KA 4J2OA 4B6SA 4DR2H 4IZOA 3OZEA 4HZIA 1X3LA 4ZODA 1CY1A 4DV7H 2VLIA 2FZ5A 1Q0QA 3BUSA 1JE0A 2GTPA 4TVKA 1AKRA 2O8VA 2R3SA 5LYJF 3VYUB 4B6OA 3FDXA 2RB4A 5BR7A 3B78A 1S2LA 1H2HA 1XQYA 2GBLA 2XZPA 4QA9A 3W5IA 2WM2A 3ZI0A 5JZMA 5LNK1 3W6ZA 3TLCA 4DTCA 5KOYA 5H82A 2KSWA 1K8QA 4AKEA 1ICIA 1P9NA 2J7PA 4D4IA 2YMMA 2NZXA 4MNTA 5ALXA 1JX6A 1XTJA 3VR5D 3K9FC 3GTGA 3MPUA 4JV1A 3L4BC 4KQFA 4RLFA 2C7BA 5GONB 1NW5A 4H1WA 1K4YA 2QN2A 1I6UA 2XPCA 2HJGA 1J24A 3PNYA 1VHDA 1E1KA 3RQIA 3OX3A 3UT5A 3LBNA 3NHZA 4OY3A 2XAAA 5FD6A 2WPDA 1JWAB 1MBZA 2IPNA 4LMRA 4LHEA 4DPKA 1XMVA 3D43A 2FFBA 1TZMA 4JA2A 5GJCA 1UPBA 5TRTA 1TO1E 3GH1A 1V1MA 4F8JA 2X23A 3PJRA 1B43A 1FFGA 3H6HA 1N9GB 2QLTA 4Q43A 1M6WA 4OATA 4QYIB 3ORQA 2ZVQX 2DCUA 2BEVA 3PR2B 4J0QA 4OH1A 2PMDA 2XGQA 1A98A 1SBIA 1N5RA 5K51A 2PYIA 3THSA 4GZMA 3GC6A 3ZE9A 1DO2A 2FSVA 5B30A 1Y3IA 1DAKA 2QTHA 2WTXA 3KRTA 1TC2A 3L7BA 1CUZA 2B9VA 3QEOA 3SZUA 3AKDA 2GCOA 3AEYA 1R50A 3FJOA 4UHHA 2YTZA 4DTIA 3ICEA 2A30A 3IE2A 2ZUEA 4JT2A 2BYTA 5EZYB 4YMIA 3VKVA 4ARZA 1BMFD 2R85A 2HGZA 4B33A 1U6KA 3ZU6A 4EY4A 5HFNA 2R7ZG 3U7FB 1T1RA 5BWTA 2VBFA 1CP2A 3MR6A 2XQIA 3R44A 5AMXA 2E5WA 5EI5A 4GP7A 3DZJA 1TVKB 1K7CA 1N32H 1XI2A 3TD2A 1QRSA 1PK7A 2CNWD 1S2DA 4FZVA 4O1IA 3REQB 2PX6A 3UJHA 1AQJA 3Q3GE 1XRSB 2OHHA 2GO1A 4LMBA 1KSJA 1JQAA 4IR7A 1P72A 1XOIA 2EJTA 3L7LA 4YGXB 3WI7A 3WNZA 3JSXA 3B52X 3VNBA 2OK7A 2ABWA 4LECA 3TLEA 4K6KA 1FCJA 3JZ6A 4KV7A 5EQJB 4IXMA 4ENSA 3OWXA 3ZHQA 4O84A 5COAA 1J23A 2JFXA 1FFYA 2Y68A 2UZ1B 4UM9D 3FWPA 2XLCA 4HAYA 4OVKA 4B71A 3SBEA 3RS9A 3P52A 3IT2A 4KXLA 3E7DA 3FBGA 4PRLA 2DUNA 4Q00A 4IFBA 1P62B 2CFCA 2FHPA 2ZYUX 3CUVA 2FI1A 3EF0A 3QLVA 5LQRA 1Z17A 4B2PA 3HE3A 1HE2A 1IATA 2XGMA 5JG7A 5TQ0A 1N34H 1ZH6A 4KIWA 1X1QA 3G82C 1UM8A 2DOKA 2HTFA 1A5TA 4GO1A 3M1LA 5E3IA 3H20A 3GILA 1RVV1 4NU5A 1JFLA 3HCWA 1QIDA 5AO9A 2V0NA 3WY9A 4DQLA 3RVJA 5C8ZA 1Y7PA 2ZBEA 1SXQA 4GIBA 1QBGA 1Y6QA 1G7CA 2Z3WA 2NZWA 2GK3A 4QIWA 2IS4A 5ED0A 1TJ3A 3O2QB 2WTFA 1OFIA 3NIGB 3P1JA 4FZ3A 4BFCA 3EDMA 1XCPA 1YULA 1WZUA 2CDRA 2CL5A 2Q5JA 5H9WA 5AM3A 4N9WA 2FPIB 1W4CA 1YDWA 1ZVKA 2FPIA 4TXMA 5HKOA 5HQTA 1M5RA 4HLUC 4WCFA 1E1MA 3HGTA 4JEHA 1C7IA 4CHGA 1KZ4A 4JROA 2BLLA 1CLUA 1VPLA 2MHCA 3I8SA 2CVFA 4XB6B 2R8ZA 4Y0VA 3VPAA 4KHPH 2FOIA 1JZTA 3PW0A 3ZNNA 2ESRA 1GR1A 1XZCA 3CO0S 2F17A 3DDZX 1VB3A 3NWEA 3AP3A 1X7WB 2A0WA 3KKOA 1X7WA 3QPWA 4ID3A 4MVCA 2GM5A 5TSDA 3IA2A 1EXVA 1JHOA 3SDZA 4BFYA 5FHQA 2BW0A 3QVKA 1Z2PX 2W6MA 1K98A 2PJRA 2RAVA 3D5EA 1XA4A 1F6WA 4PQEA 1Z06A 2CWWA 4BVLA 3I9FA 4YUAA 3QYAA 1Y1VA 1P77A 3NHJA 1WTAA 2OUIA 3W7VA 2RARA 3P9KA 3VOTA 2IIVA 3IPLA 4KQ1A 4QGFA 1WAMA 1D6SA 5FXMA 1FU7A 5TQ0B 2WT4A 2MTBA 3Q0IA 5BOSA 3LWBA 1GPNA 1E66A 3B38A 4QYMA 1YGYA 3RRFA 4Y8VA 1SBTA 4FSDA 5JWOA 1NJFA 4Z0TA 2NSDA 3OLZA 4TWZA 3O1JC 1M0WA 3SF8A 1UCFA 2O1WA 3DC7A 4JUBA 5CEJA 4IDEA 4OGFA 2XVMA 3U4MA 2JIMA 4FFNA 2JLBA 1IZYA 2BDUA 4EHLA 2R0QC 1W96A 3GHYA 2VAMA 2XIQA 5M04A 1XHLA 1CUEA 4C7JA 1EEXB 5KVQA 2YRFA 4F5YA 5ILQA 2Y92A 3VZQA 2X4GA 2GXUA 4NABA 5A9SA 2XMPA 2EEPA 3GGCA 2CUZA 5L3ZA 3T7KA 5JH7F 1NZJA 1P91A 3BAFA 1M1NB 1OB2A 4OHXA 3ULKA 1N5DA 4I36A 1VFNA 2RBKA 2PSFA 3BCRA 5CPBA 2PUDA 5EIAA 3FCUB 3B9PA 3FYDA 3NVAA 5I5YA 3TSOA 1RWNA 3E58A 1KAGA 3NETA 3RANA 3MXTA 5JZ9A 5LQAA 2Z09A 4FHZA 3L82B 4LPKA 1POWA 4QUKA 3WL4A 3NC0B 2IXDA 1IG0A 3A14A 3A3KA 3DKKA 1T5BA 4HB4A 4KH0A 1QORA 1RHJA 3FW1A 2Z6UA 1ORHA 3GWZA 1Y1WA 1SVIA 5A5VA 2DBYA 1E4FT 3J81W 1SCIA 1U3CA 3CEAA 3FPSA 3BWEA 2DHQA 2VK2A 4MI6A 3VNVA 1WQ1R 1NJ1A 1JXOA 4E11A 3NTRA 2R48A 3PHHA 1AO3A 4AJ1A 2DR0A 4X66B 2PUBA 5K0BA 2G08A 3ZV4A 1UJ5A 2X42A 4EI9A 1K7EB 4GLLA 4AJKA 1KFEB 3NVMB 5FYQA 2W2MA 4PG8A 1P2GA 1QTIA 1N0WA 2HA6A 2ROQA 3HDVA 3AERB 3B6KA 1E2IA 1DDOA 1U81A 3LUHA 3QFHA 1EXWA 2VUSA 2F3RA 4B31A 4JFRA 1UBSB 3CNQS 4PONA 1MA3A 3QFRA 4L8FA 3QPVA 3RHSA 3OZGA 1S2GA 2JIDA 1SIOA 2OG1A 5DIZA 1G5TA 4HGRA 1JQLB 1KO7A 2IEBA 3A9VA 3NDPA 5ES3A 1CEYA 3P0RA 4WXMA 4A3JG 1M2OB 2EHDA 1M2OA 3ENVA 2QTNA 3DBRA 5FPHA 4L5AA 4LVOA 4IYJA 1JSCA 3SX4A 3K5PA 5JCPA 1F0NA 1U7ZA 1D2NA 1H4SA 2WYIA 3P0FA 4W5WA 1HTTA 4RZQA 3SXUB 3ZOZA 4AJPA 1SC9A 3AWIA 4PZYA 2B4TO 2XQKA 4B7ZA 5BMVB 2ECKA 4H17A 3QZ7A 1EK6A 4PZDA 1BFUA 4BE9A 2G9ZA 5A06A 4OQXA 3DZDA 4LHZA 1VJDA 4W5RA 1YMQA 4GOKA 4IOMA 2G1KA 1OYWA 4CKXA 1NOKA 4FFBA 4ROSA 4XWWA 2M6LA 1F5NA 5G0TA 2AJDA 2HI0A 3DTVB 3I6QA 4A0GA 4KPUA 3DXXA 4NJEB 3BDAA 1CUBA 1A3GA 4M1EA 1VI6A 2I4RA 3KOYA 4MMXB 4NQRA 1GNVA 1GXSA 3OLCX 3AIOA 4C7VA 1G8JA 1HE3A 2WWVD 5J2TA 4KR6A 4LKOA 4O7WA 2QR5A 2D59A 4QPJC 4EJ6A 2G1AA 3T3OA 3OU7A 4R2XA 3UICA 1TC1A 1RXSA 4RHUA 2XUDA 5CU7A 4Z4EA 4RB2C 2IUFA 1QE0A 4PGMA 1K0FA 2BSAA 1JS1X 2F59A 3OZTA 2XGGA 2H0AA 3DL4A 4B80A 4KO1S 4C30A 2GYWA 3FPGA 4CMHA 2ASDA 3TDKA 1L4EA 3EQ7A 4BVHA 3ORFA 2R86A 5TY0A 3GUUA 4AZ3A 4TWBA 1X7GA 4UJ3A 3GQBA 4ZQCB 1Q1NA 3RIGA 1QFJA 3HVRA 1Z82A 4B3BA 4B3MB 4U9IS 1RQLA 1CZLA 1K6MA 3CZCA 4MLPA 4ZIRB 3DOFA 1TDJA 2WAAA 5DGIA 3DEFA 4KAFA 4UHBA 4US2R 1MT3A 2PVSA 3UWPA 4XGRA 2H7YA 2O14A 5B53A 5AW0A 1AE1A 3MTQA 3INRA 3Q1KA 1IZ9A 3CJRA 2W2QA 2IEAA 3PEEA 3QVOA 2C96A 3F6EX 3MINB 3FDZB 4IICA 4NPAA 3I9LA 4DA8A 4GOXA 4UNNA 3T4PA 4OSOA 2R4TA 3K4HA 4X71A 4C20A 4HWTA 1VPVA 4UU7A 2O2YA 4UEWA 1BRMA 1OTHA 1DMRA 2WHEA 3AFMA 3NOVA 2FUNB 4JJAA 4QLBA 4Z1MA 1F8YA 1LUAA 3USZA 3O8OB 3PHJA 3T3HA 4S05A 1I30A 5F9LA 1BE8A 2PFSA 4JB2A 4RE5A 5DI9A 3GTJA 2K5UA 2CF6A 2M32A 2P77A 4JJGA 5TQ2B 1H42A 1R8YA 3RBEA 2QE7A 3OJWA 3RVMA 3T7JA 3GFOA 4B8YA 2ISCA 2WSMA 4JLVA 1P8AA 4FNAA 2RKOA 4KFCA 4P0PB 2GJAA 3AW9A 3D5TA 3QOFA 1VA5A 1I01A 4LIPD 2GPSA 6PFKA 2V59A 1NQ5A 4PYJA 1QHYA 4X0EA 1XA0A 4EVQA 5IT9W 4JQYA 2YINC 1CKOA 4RS4A 1X2EA 3F9RA 1FFEA 1R2QA 5T14A 2IJGX 1PIWA 3N28A 4YCCA 3HZRA 1K1QA 1YZHA 3UCFA 5AVUA 3HUUA 2V7QD 3P2IA 5ALIA 1G1MA 1WP4A 4C08A 4L27A 2VA8A 4AX4A 1V5WA 2VBIA 1X1AA 1TF7A 3CN9A 3ZXIA 3FYUB 4Z3KA 2IOFK 4IH9A 3HXOA 2ZWAA 2YV2A 1L8LA 2QSUA 3A3PA 4PCVA 2Q4RA 2ZB8A 2QLFA 1BW9A 4I5EA 2QVCA 4NEQA 2ZJZA 5EPUA 3UJNA 3N39C 2UYHA 1PYGA 5H7XA 2F8MA 1YOBA 3PC3A 3Q3IA 1C0LA 1P4HA 2EXXA 3DULA 3W5VA 3GCZA 2XNDA 4CM8A 4M8KA 3NDRA 2J4CA 4O63O 1ISRA 5JEDA 4QFBA 1BHO1 4JKIA 3LLMA 5J4LA 1SKAA 3I9OA 3PU6A 1T6XA 3EF3A 3IPXA 4GI3A 4RZ2A 3R7WA 3ZDZB 2CXTA 4NMWA 4WOKA 2CYCA 4NOMA 4BNDB 4JLWA 2PMFA 2VK1A 1I2AA 2IEGA 2OENG 3UH0A 4ZU3A 1OSNA 5ARBA 3I9V6 3JQQA 2BH9A 3EDCA 4G9BA 1JEOA 4DS3A 3QK7A 4XQ0A 4F4JA 3O8CA 2BF4A 1E1RD 1Y80A 1ABFA 3GLVA 3KKLA 3MTGA 4XB1A 2X5KO 4N3BA 1FFBA 3GCGA 4NX2A 5FO1A 3ZE1B 1L4LA 3ON5A 1T3ZA 2JJ2D 3L7NA 3HDHA 4RD1A 3C8DA 4LGVA 4LXYA 4WH0A 1EJ6A 3VR4H 3VKHA 3WLEA 5DHFA 3D9QX 3IGFA 1GT6A 2MMGA 2HU8A 3IIKA 3IT1A 1YVPA 3WB2A 2RK6A 3NNNA 4ZT6A 1GZ4A 4DMUB 3CF6R 3RU3A 4EA6A 3OOSA 4MULA 1DIGA 4AK9A 2FRXA 1XNRB 3R5FA 2Y0CA 2VNHA 3DT8A 1OKKA 1U65A 1U5BA 4O2LA 2ZROA 4FLFA 1Y34E 3ESZA 2FK3A 2AMYA 3BBLA 1DNPA 5FA6A 3UT0A 1JPUA 4Q7JB 3ZK9A 3FKSA 1UR5A 1Y9DA 2XWSA 1VLHA 3TVTA 4OLAA 3ABRB 1H0HA 3HCOA 2QLBA 1SC6A 1V45E 3OA2A 3PXDA 4LDPA 3F6CA 3D8BA 4BDSA 4Z49A 1WEKA 4ESHA 4YPVA 1XZGA 5LZ4A 1V8ZA 2X22A 1IHOA 1B6RA 2HPAA 3GP5A 2C9OA 2QTVB 3HVJA 4JR2A 2HHLA 1H4VB 3LDUA 4HWGA 3HI4A 2ETVA 4O4LA 1OX4B 4Z4QA 1OX4A 1RXCA 3VTAA 3O0TA 4G4IA 3UPDA 2VNAA 4RD0A 1GNSA 3LKVA 1T2UA 3OOEA 4KRGA 3Q9SA 2FE1A 5ERXA 3U7IA 4ZI2A 3IVGA 1A97A 4GZ3A 2EIHA 1Y7IA 3P19A 3OCXA 3QLUA 4MGZR 3H9EO 1B3BA 1XDZA 5A4JA 1GY8A 4MMYB 1KKUA 1MUUA 2DH5A 1CUIA 3CLRD 3OUTA 4KK4A 1QCZA 4AWAA 2WJ6A 3FIJA 3DYVA 3EZ7A 4C6RA 1O0BA 2VHTA 3KEQA 3MOSA 3PFNA 4JV2A 1QO0D 4MTCA 4YAIA 4LX8A 1NR5A 4WOPA 4LHYA 3MJDA 2BP7A 2WR8A 4F60A 1QIEA 4JY7A 5LPNA 4PVCA 5K8LA 1RWMA 2IZ7A 2C57A 2BGRA 3DAHA 3DD1A 521PA 1GCUA 1KMMA 1UFQA 3D8UA 4GXQA 1WF3A 1XKQA 5D3MB 3WRWA 1U11A 4CPDA 3U39A 5KFGA 1NBMD 3BD6A 1KVUA 1MEJA 3R6LA 4QEDA 4TMFA 4ZOLA 5EJ7A 1XMQH 2ATEA 1GL6A 4UCVA 2QMHA 2JH3A 3FTPA 4RL4A 5F5XA 5LU8A 4KO3S 1GQRA 5D6OA 4HL6A 3SIWA 3TCKA 4TRJA 3TW7A 1R0XA 4I50A 3THYB 4PZ8A 2QMOA 2E4ZA 2BHRA 4ETIA 4JI8B 2IY7A 4FHEA 3RKSA 1KU0A 1Q7GA 3QFSA 4KL8S 4EHJA 3GJXB 3O4FA 1ANKA 4I2VA 2PTGA 4IRUB 1XVIA 1YZQA 1F2UB 2Y0PA 4ZI3A 2FSVC 4TRRA 3ZV7A 1A72A 5L7TA 3V6JA 3U55A 2P8JA 1A0OA 1E7QA 1KYYA 1TFRA 4Y30A 5GONA 1BCSA 3JQ7A 2F9FA 3K72B 2QYHA 3U48A 2BKAA 4QE3A 1CZKA 1PJ8A 3UT5B 1YQ9A 1JYSA 2GN6A 2Q1SA 2BFEA 1Y9ZA 4ND4A 3V80A 4A8TA 3WIVA 1C9DB 1PZEA 3VSBA 3BK2A 1Z88A 5K3FA 1T0IA 4CV1A 1Z22A 4YJFB 3ZW7A 3TTXA 3FNRA 4LJ9A 4F72A 5LQNA 3TMKA 1JT9A 1OYOA 3PWTA 2CF5A 1B8OA 1QYVA 1R18A 3NHMA 4OM7A 1GG9A 3KAJA 3OX1A 2P6MA 1LLFA 2VQEB 5MGBA 4OG2A 4GU5A 4CJXA 3JQ9A 4K26A 4B32A 4RIFA 2G63A 4MP6A 2CLCX 4F2HA 1CHNA 5CITA 4BQQA 3ZYZA 4M1TA 1UBLS 4I3GA 3WB0A 4YV1A 4ZV7A 1M0SA 1XMSA 2OSVA 3JWHA 1PWHA 3N7UA 3TLXA 2ACVA 1SELA 1RBZA 3RG8A 2VF5X 5BV1A 5HW0A 2LUOA 1XNHA 1MD9A 5J1SB 3O82A 5B58C 3EXIB 1PQ4A 4QWEA 1FRZA 4DDKA 4BO5A 4G84A 1E79A 1T26A 4M38A 3O7MA 3VR5A 4RIIA 3HXTA 4IDPA 2C2HA 1PKXA 3SQNA 1XA3A 3TJMA 5EIEA 2ZI4A 1SUIA 5BYJA 1Q1BA 1DAAA 2A5LA 2BZSA 3L1HA 4WY2A 1R9GA 2FEWB 3G1WA 5CYGA 3X1KA 3RBXA 4LMYA 2NO1A 1AGRA 1TQ8A 1EH5A 3LZ6A 5AW8A 2BFEB 2C95A 2GETA 5C5JA 4PZEA 3E7FA 1BDBA 1K97A 2FKLA 3ND6A 1I4EB 2Z5FA 1HFKA 2YDYA 4KE6A 4Z9XA 4QUGA 3W5BA 1KUTA 3IR6A 1LDEA 1OWLA 4CM7A 3V4OA 3F1KA 2QNIA 5LJIA 2TSYB 4RTSA 1NQTA 2X5JO 5DTRA 2WG1A 1AIPA 3ZJUA 3ZDDA 1GA6A 2Q1TA 2DB3A 1ZIOA 2ZYDA 1R5BA 4HLUA 1XZ8A 2W4QA 2D13A 3BFXA 3CLSC 3Q7EA 1N6IA 3FFTA 3HG7A 4ZD6A 3WISA 1AK1A 2I1QA 3GJ6A 3G2OA 3GGPA 1OLXA 4AF8A 5JJLA 4MS1B 3RF7A 1OZGA 2D3TA 1KDZA 4PG5A 3CURA 1EK0A 1KAQA 2DFTA 1XFAA 1QRAA 2AK2A 3IBFA 1A8SA 4FCVA 2JG3A 4W5NA 1YBMA 4LFAB 2X7JA 3QVMA 4ND2A 4BAZA 4RTPA 1E2JA 2R66A 3B9RA 5L3RA 4YRBA 2WB2A 3OQNA 4QYSA 5I5EA 1I3CA 4YAOA 1SHTX 1IUOA 2OBNA 1S3GA 3JY6A 1GZ7A 4X7RA 1F6DA 1D9XA 3PI7A 3VU3A 3A3NA 2GA8A 2QL5A 2OZLB 1KP3A 3W5HA 3ABZA 1WUKS 3ZTTA 3A1EA 4KR2A 4HN4B 3GDWA 2WWHA 1XU7A 3W3ZB 5CDYA 4LF7B 3GEGA 3DAFA 2W6ID 4H35A 2JJ2A 4LNHA 4Z5XA 1F9EA 4XIJA 3B60A 3PL5A 5U4XA 1HA3A 1OT3A 2VJKA 3JZAA 4L78A 1T9CA 1JR3D 1UFRA 3R5SA 4F5DA 3UFXB 4C7OA 3GV0A 1EBBA 1GPYA 2HRQA 4BO6A 3UA4A 3NO4A 2IDJA 4Y9RA 4R2HA 3PCTA 2A0FA 3WXMA 1WCV1 3U13A 1KSHA 1NM5C 3RGGA 1EXDA 1HV8A 1WF6A 3ESDA 3QKUA 5JRZA 1I2MA 3QW2A 2WIFA 3O1LA 4HGYA 1VJ0A 4YQYA 3TD9A 3J80A 3TRIA 5IF9A 1Z2EA 3HO1A 4YALA 4BN5A 2C2WA 2QTLA 3PYXA 3Q7SA 2YHSA 4NYJQ 1F48A 2ZZNA 2PIDA 2A3RA 3AZQA 2YYAA 1PT5A 3FPBA 2DFLA 1DXYA 4P3KA 1HFWA 4E2XA 4Y9UA 4D25A 5JSZB 3UPTA 1Z3CA 4PIVA 3WLPA 2QUJA 2ZYVX 4GKJH 3B1WA 3MUOA 5CHEA 1IJBA 3JV7A 3HYNA 5KQSA 2C4TA 5BWUA 3R4CA 3QEAZ 2PQ0A 4ECVA 5A6SA 1RI2A 3H7IA 2BMAA 4QJ4A 3UZOA 4D4HA 2ZEJA 4EGAA 1OWPA 3HXKA 3IMEA 1U90A 1MAUA 3RUDA 2Z1DA 1NVKA 3EXEA 4KFSA 1BXGA 5FWXA 1GFWA 4RZIA 3KZOA 3UC5A 3LPCA 3OM8A 2HC9A 3D0OA 4MUJA 4UBJA 3E81A 4PLVA 4QXQA 4JLJA 2COIA 1VSTA 4WK0B 3IP5A 1GYQA 5A2QW 1UJ2A 2P9HA 2BONA 5SZIA 5TDHA 4MP8A 2I54A 1VIMA 1SH7A 3HUFA 4DLLA 1UT6A 3K9BA 4MWCA 5J2TF 3LMLA 4TRNA 3OPQA 4QWWA 3VKWA 1FUEA 4F85A 3KXYT 2W4IA 4IFIA 5F23A 2JFUA 2R1TB 3R0IA 5AKHA 1E5XA 1CJMA 1P0MA 1YB2A 1NG1A 1WW3A 3OT4A 4G5QA 1EWYA 1MC8A 2HWXA 5H1YA 1PDVA 2OCBA 2YVLA 1KJIA 1LLCA 2WI8A 4ENQA 3P27A 4AB1A 1L2TA 5C4MA 4MDEA 3QMMA 4JIGA 1ZPDA 4LE2A 3W4KA 3WGMA 1FSSA 1M73E 3K6KA 3AFOA 5CVUA 5GM1A 2IYYA 1GUZA 4CEJB 2CFIA 2TYSB 3QPCA 4KWIA 1HMYA 4MJLA 3NHFA 2GPWA 8OHMA 2CB0A 1CY0A 5L45A 1QVWA 5ALSA 1W9MA 1UPFA 1NXOA 3I9NA 3OHPA 5DHRA 2IYNA 3I6MA 1VL2A 4WOBA 4ONEA 2Z8YM 3JVDA 3VHRA 3ZLUA 1U31A 3GLRA 5DX8A 1ZA1A 4G89A 3GVIA 4AKHA 2IEYA 1G6Q1 2Y6UA 4ESOA 4ECRA 4HDNA 2KLBA 3IPYA 5E7IA 2JI4A 5B3KA 4O3MA 2O1SA 4UUBA 5A2QA 3TPCA 2BM8A 4N0DA 4YJKA 1YSCA 1F38A 2TECE 1MU0A 1XYVA 5EHGA 3SE0A 4U2FA 3JZIA 4L3OA 5AI9A 4EGCB 1UKVY 2ZSEA 2PKWA 3R09A 5CYOA 3VYSB 2FAXA 2VHXA 4ED2A 2X0SA 2IHUA 4Q3DA 4Q19A 4URHA 1R9MA 1CULC 3DAPA 3F49S 1T5DX 2AL7A 3I32A 4O0LA 4ZPJA 1A5ZA 5EKTA 5BNFA 1FUKA 3T5DA 3PX2A 2EATA 5L4LA 1TAQA 2YVKA 2HBYA 1EJBA 1QFYA 4QNRA 3T9CA 3BCSA 2C7OA 4QFMA 1TYZA 3ACCA 5EZYF 4O4LB 4PWYA 1NMSA 1YDGA 5J47A 1Y5MA 1J25A 3BHJA 3EWIA 4MW4A 5DF1A 4C4YA 5J4KA 4DG9A 2IWRA 4LI3X 3QKIA 3TNJA 3G7NA 4JYAB 3DGEC 3E82A 4NVRA 3V34A 4ND6A 3KLMX 1ISMA 4X1YB 2OYRA 3U1BA 3MWLA 5DCWA 2P1DA 1AC5A 1EB9A 3ZZUA 3G2MA 4E2ZA 3VI3B 4CMKA 1NXQA 4XVHA 3AR7A 1JDPA 2NYRA 3VBCA 4BOYA 3GFQA 4JI2B 3A31A 3TQQA 1XVUA 1YIAA 3LZCA 3ZY3A 1M67A 1I4DD 5HGXA 4CKCB 1B0UA 4LXQA 4FR5A 4I9HA 3EH1A 2B78A 3FE2A 4RE6A 3I83A 1MW9X 5GM2A 4GX2A 3BA8A 4X1IB 3ZU3A 1TMOA 1YL7A 3DE7X 3S1SA 4OBBA 4UEJA 3PUJA 2X15A 4DR1H 1CIVA 1EVIA 1MGPA 2ARKA 2GAIA 2ORIA 3ND8A 4OQEA 4TTAA 5KQLA 4CEIB 2PV0A 3GDOA 4HH1A 3UAVA 5DXJA 3M4IA 5IVPA 3IMFA 3OP4A 4WGFA 1RJ9A 2ZJYA 1QTNA 1ZCBA 4HH3C 4MUIA 1B6GA 4H7PA 1Z18A 3NIBA 1FL9A 2V45A 1BD3A 1LQUA 3V33A 3ZZNA 3IDAA 1NULA 2ECQA 2X5XA 5L1IA 2VJMA 3ECCA 4W9NC 5BN4B 2XDYA 2QIPA 5I60A 2ZIZA 3GEMA 1WUIS 5FWAA 4Z4CA 3KAPA 3R0XA 4LTNA 2D8MA 3CF0A 2UV8A 2XTNA 1FP1D 2VJQA 3KSRA 1U2PA 5TQ2A 4DR5H 3BGWA 2XUAA 2GASA 1LNQA 3A2NA 5C2JB 4DDVA 3VA7A 3IV9A 4URYR 2ANBA 4PIPA 4XM0A 4BU0A 5BMOA 1N6PA 2PH7A 2LTAA 4C4TA 5DIFA 1W0KA 2RH9B 1N0HA 1NATA 2WHPA 3I4CA 4KN8A 3ZGZA 1ZGJA 4PG4A 3RC1A 2GTIA 3O0DA 4OJTA 1D2HA 3H3VH 1PJTA 3EG5A 4QOSA 4Y3UA 4EPWA 4GKKH 2FZGA 1DFIA 3KHTA 3KXDA 4FEYA 2O7VA 1J8DA 1UBRS 2DPXA 2FB9A 2GB4A 4HWRA 5EINA 3TKYA 3TSWA 3ZDBA 4GL2A 1BE0A 1NRWA 1TECE 3IBTA 3R3WA 1L5LA 3NAZA 4ARCA 3GLKA 4OUDB 2RH5A 2VDNB 4NP6A 3G0HA 1NYRA 4I1RA 2JFWA 5F7XA 5HIAA 1N6RA 1PUIA 1SHZA 2J3QA 3GFFA 3BJEA 4FGLA 3GPLA 2AN9A 2GRAA 3VKGA 4PYRA 3TW8A 2BFCB 5K99A 1XRRA 1GDHA 5AVRA 5MN6A 3ZVNA 4LFBB 5BP7A 2JCSA 3BD7A 4O4LF 5KTRA 4C7OB 1CJCA 4DMGA 1N6LA 4IR9A 3F3MA 1JAIA 4MZXA 3WMGA 5IBQA 1HO3A 2PH3A 4M4SA 4JBIA 3EMBA 4BLTA 3DMPA 3ANSA 1ZW6A 4RHTA 4WERA 1IFXA 3NDJA 1LVHA 3RADC 2PBLA 1UC4B 2GLTA 1FDWA 2YIJA 4C7KA 1SFOA 1M83A 1OASA 3TZEA 2M05A 4KXUA 4X63A 3COZA 4WLFA 3TPFA 1TYAE 2F3UA 3C8HA 4ZKDA 3CEMA 1SHLA 1UBCA 2NO4A 4EBEA 4N82A 4J9RA 2VUIB 3H3JA 4QC2A 1NLFA 1KY3A 1MIHA 2VNSA 1G9XA 3KOMA 2FX5A 4X00A 4BX0A 3GMDA 3LAWA 3PENA 3C97A 3ROXA 5KU1A 2HSEA 1M8PA 1Z5GA 3EDRA 4KI0A 4ZK6A 1PX2A 5TT0A 3E18A 4LKRA 3UXMA 3FPKA 1Z4OA 1XTQA 4XWYA 3OJFA 5KYVA 2CDAA 1LDYA 2IKQA 2PPLA 2VZEA 1P9OA 1QHIA 1JUDA 2GBGA 1KTAA 3DZIA 4NY1A 4F92B 2WAXA 1LRKA 1Q84A 1YUMA 1DKQA 1UEXC 1YR9A 4C78A 1HZJA 3VUFA 2IPMA 1GAQA 2O2IA 3T6KA 4MUBA 3JYPA 4DLNA 4DV5B 2CD7A 2OAP1 1RZVA 1GPJA 4ZOEA 5HV6A 4QQNA 3DOOA 1HYGA 3BORA 4QUDA 4BN4A 3KB8A 4PX9A 4AUEA 1QONA 4G9EA 2ZTVA 3OHMA 1SUFA 3E1GA 1RHUA 1IM2A 1IXSB 2J41A 2QKYA 2EJ3A 3CUUA 2DR2A 5SY9A 2A5DA 2OECA 2HAEA 4M99A 4WMLA 1GPWB 2ZQZA 4QUJA 5DISB 4MVJD 1YAJA 2HHAA 2MYPA 2P7HA 4PSDA 3TOSA 3K3VA 1Z8HA 3WFJA 3WZMA 1JAYA 4JVSB 4CQMD 4X65B 1ULUA 1EVYA 4TTSA 3KSBC 3NC0C 4QECA 4PO8A 1XAJA 4S1NA 1XVAA 2N75A 3LT5A 1R8JA 4RGYA 5M5BA 3NCTA 1MJNA 1D6MA 3R7BA 2ID7A 5ALNA 1V5FA 1C0PA 4MYUA 3TO5A 2HA2A 4NNJA 3WC4A 3HKCB 2G5TA 5M34A 1I3LA 1RP7A 3ASYA 1SOMA 2HHFA 2F55A 2BMWA 1KMIY 3KJGA 1CJSA 3WMXA 4AM8A 2Q50A 1QV7A 4HH4A 2VHCA 3R7FA 1XMOH 1TQ2A 3ZVKA 3RK1A 5CDHA 3AJ9A 3H05A 1ZRMA 3QSGA 1I10A 1NQXA 1UUFA 1PJ3A 1VJRA 3G3EA 2H11A 4A5OA 4J90A 4K9QA 5JCOC 5A7GA 3FROA 3GLUA 3GNSA 3MMXA 1L5KA 1G9TA 2O3QA 2Y66A 4DC0A 2PL1A 3FMAA 4YCDA 1YE5A 1XMPA 3UQ8A 2XTAA 3OE7D 1G3QA 1I0LA 4FOOA 4NEGA 1V51A 4F4CA 2DWQA 3FOEC 5CTAA 2O3TA 1CCWA 1HH4A 2GZ3A 1FYDA 2P68A 3NH9A 2RC5A 2PS9A 3KZCA 2NUPA 4JX8A 4CKEB 4UZEA 1ZAYA 5AJXA 4MV7A 1ZGZA 3DVAA 1E2MA 4KO4S 2B1RA 1E3EA 4Y8VB 2NSYA 4ZARA 4QHSA 3FX2A 3MCVA 5KOHA 5BYKA 3OLQA 3R76A 1H0KA 4W7IA 2WIBA 2F62A 3PNKA 2NXJA 4X8OA 4DAOA 4MA5A 3FMIA 3HY6A 4ZVQA 4YY3H 4NAUA 2EX4A 2FW7A 4QO7A 3LNTA 4WZAB 1E18A 3MWYW 5IM4A 2Q3JA 2X3YA 5JZVA 1DAIA 2Y2VA 3WNQA 2IUYA 2P90A 3D6JA 1IN6A 1FQWA 1YKFA 2XUZA 2QEQA 4KHZA 4BGVA 3G5TA 2AJBA 1MOZA 3INTA 1W94A 4YR0A 5K0JA 4BMSA 1R0WA 1A4XA 3M3DA 3OEYA 4FFPA 4YHHH 1XZMA 3FUVA 4F96A 3G0BA 3ZHYA 2IZ5A 3ZU2A 1I2KA 4OLBA 4UCXA 4ED0A 3WYNA 5EUCA 2WU4A 2AU0A 2NPOA 2XV1A 4TM8A 4URWR 5CB4A 4AMBA 1H93A 2QW0X 4EABA 1P2SA 2GVZC 1CY4A 2PX2A 1NJGA 1BYUA 2DUJA 2EKZA 5DLPA 5EA2A 4YWJA 3IKTA 3RS0A 1KWKA 4R1MA 2QL6A 1YI1A 2YYYA 3KEGA 5A7FA 2ZTMA 1PRYA 4C0JA 4F9EA 3ADCA 1JB1A 2A9JA 2RGYA 3OSPA 1K5GA 4HWSA 1VM6A 4NDAA 5IZCA 5J43A 4FIZA 1IDOA 5LDGA 5GZ1A 4F38A 1UMDB 2AJ8A 3HJBA 4IGKA 3EGXA 4PVDA 3O3OB 4M9CA 1G55A 4YCNA 3G6WA 3IODA 3NC4A 4WK2B 3PPIA 1Z4NA 2YYSA 4GMDA 4ZEMA 1RZRD 1WG8A 1T8SA 3KQPA 3MYYA 1SIWA 3DT6A 3KKKA 3QPAA 4I0WB 4DJ5X 2ZZMA 3BOSA 1H4TA 3HJCA 5D8DA 1G20E 3NTUA 3FPLA 5SYAA 3ZCRA 1DBWA 3LO5A 5HUHA 2ZUBA 1JXMA 1O8CA 1D4ZA 2O0KA 5DSTA 3Q5GA 3IRUA 3S28A 1UPUA 4DG8A 2QY6A 2E5FA 1B1CA 2WQZA 3CKYA 3CWQA 3ET4A 3EY4A 4HEA6 3TEJA 3AVYA 1XL1A 5HXAA 4UEQA 1FEZA 4R6XA 2MSWA 1I8TA 3ENKA 4K6FA 1JA0A 5KTSA 3VH3A 4PNHA 3ITNA 1HT0A 4QSHA 2XUGA 1II8A 5JTTA 4R5HA 4V02A 3BMCA 5EJ8A 1W36B 1HEYA 2YH2A 2BWJA 4XR4A 1WEHA 3RYFB 4DUYH 2ZVJA 2LE0A 3KVVA 5KVSA 2VZLA 2NYUA 4TL9A 1TWHA 4IWYA 1NUUA 2AOTA 3BDVA 4O2AF 1OE0A 3ZHUA 5IC4A 5FBQB 4ED8A 2G6BA 2R1VB 1ZK0A 1WH2A 4EEXA 3H75A 4UHEA 1OAAA 4DL7A 2K87A 3SQLA 3UTCA 3IEKA 2O2GA 4QIHA 3FVWA 3NHRA 3OZSA 4V38A 4YP1A 1TB4A 4RZRA 1EE2A 2HO5A 3FBTA 3M33A 4LJRA 1UDRA 4CLRA 4JV5H 2Y3IA 4LJ7A 3ZGXA 5B5SA 1P5FA 4MRPA 1J06A 1PR6A 3S7ZA 2FUG1 3E1SA 5EL0A 2QVXX 4RQBA 3W6NA 1ZP6A 1RFLA 3MCTA 2NZ2A 1UPCA 1VYVA 2NTVA 3B9BA 4EBBA 4E3ZA 1LBSA 3UGTA 1T15A 3DE3X 1X7ZA 4W1SA 4BLPA 4QUHA 1ISSA 1R4NB 2LCFA 2B8EA 4J7UA 5B4TA 1G2WA 2VZ9A 3N2GA 3KAQA 4CKBA 3M6IA 4KN6A 3SBDA 2HJWA 1DXOA 1VE3A 4YT4A 3FB4A 4RGVA 5EEGA 1SXGA 3VYWA 4CR8A 3QHPA 4H15A 1N33H 1EUQA 4EHNA 4LSWA 3HA5A 3BZBA 2IOFA 2JHGA 4EPRA 3MEQA 1P1CA 1WPRA 5JEEA 1P7WA 1BW9B 5GQSA 1NVTA 4KVZA 1PNRA 2DRIA 4IKEA 1ABBA 1ZJWA 3RUEA 4WJZA 4LQ4A 5EZYA 4H6WA 2GLUA 5K09A 5BWBA 2NM0A 2EF0A 3P9ZA 4B9EA 1HORA 4BO4A 1BHJA 4II3A 1NI4B 1THGA 2ZAYA 4C7BA 5E1MA 1WABA 4PNZA 4Z0PA 3WGJA 3NHLA 3BRQA 3A58B 3H9CA 3BQ1A 5C5DA 1U8FO 3AEZA 3C1AA 4GUAA 4M9RA 3VH1A 2X9GA 3LT2A 5B1DA 2QUHA 3ZWBA 4B45A 1RJEA 1SBCA 3EIOA 2C3UA 4MIOA 4R3UC 2F3QA 3EGVA 4EFBA 5JDCC 4EW1A 4D43A 5TT1A 1X1CA 2XHEA 2FR1A 3NH6A 5KKAA 4EJSC 2GD2A 5K03A 1CUUA 1Y37A 4DV7B 2ZJ6A 3ZDXB 2G9VA 3IQXA 4RC9A 2IELA 3PXEA 2OCKA 2P41A 3QFFA 1I3QA 3DZ8A 3F2VA 1TPYA 3KYDA 4QPDA 3T5GA 4GYYA 3WK7A 4JYCA 1ZN2A 2HXYA 3A4VA 1KQNA 2VDPB 1J20A 3HS3A 1A9TA 1GVNB 2P6NA 1RYNA 2WM8A 4LSXA 1WUYA 4IXTA 1K27A 1VYHA 2M6RA 2PUJA 3HYSA 4IQGA 4B84A 3SM9A 4M86A 4C07A 3A06A 2VT6A 3ITDA 1SK9A 5AWFC 1GAEO 2WUDA 2JEJA 5BSHA 3UQZA 4E22A 3WGTA 5CG2A 4HDQB 1V8PA 4G1UC 4E5NA 1QVRA 5L3QA 2JRCA 5C1OA 4OQQA 2QGZA 2O2DA 4UNPA 5HF9A 5J59A 1XPOA 1RCTE 1S8OA 3ZQJA 1BDMA 1QR6A 3VO9A 1EHCA 2JA1A 2OESA 3TLGA 2FW1A 4JENA 4LRSB 3PBKA 2VPWA 4DRXA 2YV5A 2EKDA 2C1ZA 2AI2A 2G9QA 3E22A 3V55A 1KC1A 4X6UA 1VMDA 3M89A 1LX6A 1NBME 1ZVJA 4GBED 1UBUS 2G40A 1Z13A 4XTRA 2X6QA 5DBIA 4EO4A 3JVUA 4QQKA 4BV2A 2WUGA 5FP0A 2C2KA 3QLUC 4N6NA 4NBUA 3QLVC 1KFJB 2Y0EA 4XDZA 5IF3A 4E51A 2EARA 3H2SA 2JEFA 2GCNA 3PUXA 3Q8XB 1DBSA 4ZCMA 4CVNA 3OBIA 1NQOA 4M1KA 5F5LA 1MA0A 1G8KA 3ZCTA 1DVRA 3TDMA 1QIMA 3D02A 1RABA 2JCGA 3DEKA 4XLTA 4E33A 4F4HA 6ABPA 4BE7B 1P1KA 1U7XA 4G0UA 1V4NA 2Q3MA 3JD0A 1CYEA 4BFVA 3ZW8A 1XUOA 1GFIA 2BP7B 2QE6A 5KSOA 3I4NG 4RPKA 2X9VA 4GFDA 1P5ZB 3RSLA 3TKLA 5JC8A 1TEXA 1IBKB 1SXJD 2W2LA 1U0EA 1C81A 3BFVA 5EPEA 2CMGA 2Z95A 1C1YA 2QTAA 4CLOB 4EY8A 5I7UA 4NDZA 4HF7A 4MQEB 2IYTA 3BXXA 3EZFA 1AN0A 1L6RA 2DTEA 1T2VA 4EMUA 1C14A 2I2AA 4M37A 4XJTA 5KNBD 3TIGA 4NYIR 4ZO7A 1Z0JA 3T5KA 4J1TA 5KFAA 5TJ9A 2EFGA 3STWA 4L0CA 4CL3A 3PO3G 4KLCA 2W6NA 1XRLA 3Q1LA 2FA9A 2D0DA 4DR7H 4N01A 3P94A 4RTNA 2HNKA 2NXCA 4FN5A 1ET0A 2KW5A 2R6HA 4OKSA 4CG2A 3CG4A 4D9KA 3Q8RB 3JZDA 2IY9A 3MOIA 1LC0A 4K3UA 2JI8A 1XAGA 5AXCA 4EF4A 2R8EA 2FK2A 4O2RA 1V16B 4HTFA 3QNWA 5CNIA 1DKMA 1CZRA 2DAPA 2C8VA 3T4EA 1GAXA 3TIIA 1Z0SA 3TAHA 4RKQA 1OGJA 1SR8A 1L8AA 4O8CA 4B46A 2WHRA 4RPLA 2JFOA 2FEKA 1JDBC 5H16A 3OD5A 4M8LA 3L0OA 4RO0A 1K0UA 3TD6A 1BG6A 1PQUA 3KKNA 3V00A 1JIIA 2J6HA 4X8MA 3TR0A 3GNTA 1K6IA 3W9SA 5JISA 1HEIA 1LF5A 3C3AA 4IWXA 1JW9B 2A1TS 1J7JA 1K3UB 4L8GA 3TXXA 3OF2A 3PZRA 4PE5B 5FOTA 3TWOA 1IY9A 2FQYA 4D8XA 4Z2AA 3KUDA 3B85A 4G07A 5I5XA 3HOUG 2JGLA 4P08A 3KLNA 1U4NA 2AQHA 2W58A 2XD9A 3FMOB 4OUDA 5IT5A 1QMGA 2XTMA 4KPEC 2A0KA 3QHAA 3OLXA 5H3HA 5I7FA 1WLSA 1KO1A 3BJYA 4JI0H 1JQKA 2ZT5A 3WWZA 1BVUA 2DF8A 1AS0A 2NUPB 4OHBA 1SKYB 2O5RA 2OC9A 2YNMA 4G65A 4AC9A 1QPZA 4N0MA 2C4MA 1RLTA 4FMBB 3E0XA 4KPGA 3W1WA 4OREX 3PRJA 2CXPA 4QXAA 2JFVA 2LXNA 5E4TA 1PT9A 3UK7A 3KLBA 5T4BA 3SSAA 1W0KD 5FFFA 4UJ5A 3ZKWA 3D6FA 4LDNA 3BGIA 2D5LA 3A10A 4PHHA 2P4SA 3CLRC 1J56A 1FRQA 3PJDA 4P4NA 1D7AA 2OAQ1 3EIXA 4QFDA 1M8KA 3GFSA 3X0DA 4JUCA 1IUNA 4ALKA 4F7WA 1KWGA 5A5FA 1RM3A 5K3AA 5F4ZA 2YQ5A 1E2LA 4AMZA 1QV6A 4PWQA 5TQVA 3ANTA 1N2CA 4B7CA 1E4EA 1V7QA 3CLUD 4E03A 3EVEA 2L69A 4WASA 3LLCA 1WW8A 2BIFA 1UIRA 2Z3ZA 2WVGA 2VT2A 3EGWA 1I13A 4HGZA 5AOBA 5FQNA 1VHLA 3KB6A 1OA1A 1SCDA 1B23P 1MC1A 1J70A 1ISGA 3OCJA 2ZUWA 4CZ2A 1WM1A 1E6WA 2E1PA 3PQEA 1MN6A 4R9UC 3VHQA 3OFVA 2I78A 1U2QA 3ASVA 1EM8B 2H6EA 3Q8QB 1G20A 1IY1A 3A6DA 2JFPA 4RENA 3UWKA 5CDFE 4OX9Y 2UUBH 1G1AA 5FPYA 4O3SA 4F5ZA 1Q6ZA 1IHUA 1D2GA 1Z33A 1RI1A 2ORED 2QRPA 4WK4B 1EI9A 1RYMA 1Z68A 4HFNA 2VDVE 3WE7A 1PFQA 4R1OA 4KSCA 4UUGA 2QDXA 3KSDO 4RD3A 3GPDG 2ZWVA 3M82A 3ZD9A 5AVSA 3PHLA 1S68A 1BXZA 1H5UA 2V4ZA 4GPAA 2ZKIA 2HGWA 1W2GA 4AKTA 1W6UA 4LXXA 4CNQA 4D7AA 5JAUA 2GDJA 5HFAA 4DV6H 1CR6A 1V5IA 1WL8A 1XTIA 2OGUA 4AZ3B 5CFRA 5JD4A 4KDCA 1OT5A 3KTFA 4JD5A 5LA6B 2C8LA 2B2CA 1KI6A 3QVLA 4JQSA 4QWDA 1XLVA 2HEGA 2JEYA 5K8VA 4PW0A 1SIUA 3TNFA 2C5BA 2R5FA 2OXCA 4QARA 2PRZA 4EB8A 3DKRA 4IX9A 1HWYA 1NUHA 1TAHA 3DW1X 2ZIXB 3HB4X 4CHTA 3EOAI 5C3MA 4M1WA 4OJQA 5AJWA 5JDIC 1E61A 4PBRA 1N4AA 1JHRA 4N8SA 2CMHA 4YK7A 5K8CA 1B04A 5J5VA 4HXFB 4TLCA 1YTUA 2A9RA 4A8JA 5CFZA 1Q0HA 4JSRA 2YVAA 4H31A 4MHTA 2PUWA 1EGMB 1P4JA 4D99A 4U0KA 3EPLA 1F8UA 1Z39A 3NEAA 4MX8A 4XARA 4YLGA 1OV6A 4PEVA 1NZDA 1XCBA 4D9CA 4UOEA 1RQPA 3LW8A 3ZJTA 5FNVB 2IV2X 1UKEA 3LVQE 2H85A 1OFUX 4WW0A 4B7AA 4NDNE 2IBTA 3D8HA 4JLMA 4O83A 1J90A 1Y3DE 3T7RA 1IG3A 4X93A 2DU8A 1EFUA 1LK5A 1L8OA 3O4HA 4I6GA 2P0AA 2QR2A 1SZCA 3CE6A 3NT4A 1A71A 2IU0A 5JFOA 4DR5B 4JT8A 1NAIA 2WKSA 1W8DA 4N0PA 4Y2UA 1Y9AA 4XVUA 1I9GA 1SO8A 4S1VA 1RIIA 3L07A 5PNTA 5IT0A 4F93B 3A1FA 4R3NA 5FOUA 3GGSA 3FLAA 2XNCA 2EDCA 3TAXA 2PXXA 1XYGA 3U7QA 2BY4A 2REBA 3N2GB 3G13A 3N41B 1IYDA 1JQ5A 5HDQA 3P2YA 4UEKA 2HA3A 4FT4A 4YQWA 1Z0IA 2WJYA 5E0OA 2ZI6A 2JA5G 3ZQ4A 1P2TA 3D1JA 3RYIA 2W2TA 3TRKA 3K2EA 4CE5A 3UZBA 1JF8A 1TM5E 2PT5A 2QI9F 1PEKE 3OM0A 3CLSD 4IJQA 1DC5A 3OJLA 2PNFA 2UYOA 2NGRA 3W78A 1VJGA 2PX0A 4MQLA 1U99A 4QUEA 2NTNA 4B3GA 1O97C 1IQ0A 1OWOA 5AD1A 3K15A 1MJGA 5B55A 2WFZA 3TVYA 1FTGA 3FPCA 3BJIC 3I5YA 4TLDA 1Y3HA 2BVNA 5DTQA 4ER0A 3K20A 5JS7A 3T1YB 2RFLA 3C3JA 1ZL0A 4JBHA 4KYUA 4JGGA 4MPPA 3O8RA 1XDWA 4WECA 5JE8A 4C4AA 1ABEA 1KVRA 1SXJE 2RONA 2Q3LA 3B8EA 1Y1KE 3BRSA 4G37A 2ZSAA 4GHWA 3X3HA 5KOJB 1J5EH 1NQAO 1P73A 4CF7A 3ZVMA 4KLRA 2GD6A 5C4IA 2QL7A 1N8SA 1K5DA 3HMKA 2BSQA 4AN4A 3W4IA 1H9BA 4LYEA 1MVNA 1ZGGA 3L0ZA 4HXYA 3BF8A 1I1HA 1OC2A 4K1XA 4R0MA 3H11A 5DGHA 5BYBA 1LTQA 4IDNA 1BH2A 2XB9A 3EXG1 4CF5A 1UJNA 5I7VA 1H8EA 4I1VA 3E70C 3IAS6 2ZSDA 4AN1A 4R1QA 1NBMA 2V74B 1GPBA 4HWPA 2AIRA 1L7VC 3BSFA 2NVOA 3FNIA 3GLFB 5IVHA 4U7HA 4YWHA 1QWSA 3TLYA 4GYJA 1AMUA 3RAPR 5E9JA 1Y1TA 4INJA 4Z53A 4EPTA 1ZW1A 2BI8A 1ZN9A 4EK9A 2LRHA 1J49A 5F76A 5KAMA 1PTJC 2VJLA 4O7RA 2GZDA 4DRXB 4FBUA 3QX8A 3PLNA 4BNKA 1V26A 4TUYB 2Z8XA 2GN2A 3GDFA 1ZH0A 2E6KA 2XYRA 4KWEA 1IVYA 3EYYA 1Z36A 2Z8YA 3NM4A 2UZ0A 3IP7A 1K2VN 3KDPA 1JBQA 1H6BA 2EP5A 5K8IA 2F4VB 3LCUA 3IUEA 2OPHA 3UMRA 2ZJTA 1YR3A 2UU9H 1VI5A 1P9LA 3T34A 8ABPA 5L3SA 4LVUA 4KRFA 2I8LA 4PO1A 2OG2A 3ZBUA 1VP9A 3M5CA 4LYDA 1YAHA 3U4DA 3TQ1A 4IP0A 2BH2A 2CCGA 2YWJA 1S3FA 3DZCA 2A1UA 3MF4A 3UT6A 5JI2E 2CFTA 5H5JA 3ITEA 3JWJA 1F4VA 2QR3A 2WWGA 4IIEA 4KXQA 4RIHA 5GP1A 3FYSA 3IR7A 1IHXA 5FPQA 3LUAA 1SHKA 4QG7A 3RF2A 4NU8X 5F4BA 3HMQA 2V4QA 3NOOA 5C5IA 4LF8B 3VPBA 1H9AA 5FUWA 3OLVA 5IMBA 2HIHA 2F9MA 3A2LA 4NATA 3MHPA 3PITA 4H0CA 4YDSA 1NA5A 3QE3A 4EHHA 4BZZA 1HPLA 4IGAA 3WJ7A 2WYUA 3ZHCA 1IAVA 5CGQB 4MKFA 1G8HA 2GI4A 2XD4A 5T67A 4INOA 4I8DA 4HNAA 4J4HA 2UVPB 3FNBA 3NBUA 1M2EA 4OXNA 3L1IA 3FLEA 4R1UA 5C5CA 5LQMA 1XVLA 2PXHA 1T5OA 2GUWA 2R11A 1BH6A 3SPXA 3CSWA 3U0BA 4KX5A 3NANA 4D57A 1K66A 3ETDA 3RYFA 1LD3A 1JRLA 2IQIA 4L5CA 1TJ4A 2J3KA 4YIHA 2V3WA 4IGFA 2W37A 2A5FA 1NXTA 4ZV4A 5JSFA 1QFZA 5FEUA 1K88A 1CK4A 3TOCA 4J0GA 2XCOA 4DR3B 4FUQA 4KJXA 2FZEA 1KAMA 2R25B 4J0DA 4R2IA 4UMEA 1E96A 3SYKA 4YV7A 1GUBA 3FLBA 1IONA 2B0JA 1Z4MA 4URFA 4F9FA 2DPGA 3JVVA 3HRKA 4B7UA 5JNSA 1N7GA 1O9GA 1QCDA 1S5PA 4B6RA 2PT6A 2AOXA 3SXPA 2JD2A 1JLRA 4MWTA 4DL6A 1LZLA 3AXSA 3SXJA 2NLOA 3II6X 4IM7A 4N3NA 4OLJA 4PNPA 3T95A 4BLVA 1UDCA 3RC2A 1S9HA 4NQZA 3QUBA 1IUPA 3S5JA 1DXHA 4TYNA 5KFPA 2DFKB 1C7RA 3DMFA 1MO4A 5LC1A 2YXNA 2DQ4A 1QIHA 2K2WA 1Z12A 4KSYA 4AMGA 4TTVA 5IAJA 1N5KA 3K4PA 4OXKA 5AI0A 3H86A 5DASA 3UW1A 5HG0A 1YR8A 4YV2A 2KWIA 1FTWA 3FCEA 4OHPA 4TTIA 1E5DA 5KVAA 2GXQA 2AOVA 3M9LA 2Q4TA 1TZBA 2VQDA 4PQYA 1ZOLA 3ZLVA 1Q12A 2G88A 5AM5A 1ETUA 2IIQA 3E27A 2AG8A 1PT8A 3CGGA 2QJOA 3BS4A 3ILVA 1A0IA 3DOUA 3G7UA 1TLLA 1GUAA 4EUHA 4MV8A 4X66H 1QHHB 2VOJA 4YN3A 1PJRA 2G04A 5CYPA 4AROA 2IMWP 4KFTA 3I72A 1TK2A 4GP6A 3E7WA 4YR9A 3MAAC 2AMLA 2CNKA 4QGBA 3U4GA 1SOUA 2MSDB 5EWJA 2QHXA 3D2AA 3NVKI 2RGWA 4POAA 5IANA 4ZHQF 3TKAA 4ZICA 4UCRA 4F2GA 4ZO6A 4E6EA 2NYVA 3O92A 3OY7A 4CCWA 3VR5H 2J4FA 2J0EA 3RVBA 3ZI4A 4PXYA 3MFYA 1FSPA 3TLGB 4LCBA 3FDFA 2GRUA 2WJVA 4R16A 3ZCUA 2XNDD 1PL6A 1W88B 4EG8A 1ZO8A 3HVUA 2WIAA 1KEPA 1DFHA 3ND9A 3BXFA 4HK4A 5EIXA 5IJ0B 1KI9A 4K9RA 4G41A 4A1FA 2O20A 4KGZA 2E2IA 1AUQA 1JP7A 3OTHA 1JR3A 1ESEA 3HRIA 3QOWA 1LGYA 4C0QC 5BPHA 4QVIA 2DXIA 3TRHA 5L6MB 3D6NB 3UKJA 4OOFA 4QRIA 2OBFA 4LX0A 5AJTA 5CAEB 2QG9A 3H4BA 3K6SB 5FLYA 2RIPA 2OVBA 1UFKA 3ONEA 4H1TA 3B36A 2JJYA 3QJGA 5EP2A 2BQ3A 4KITB 2QX8A 3DKVA 4Q3AA 1VL5A 1X92A 2VP9A 2X8BA 3AM1A 1GZHB 3JRWA 3FHLA 3QTTA 2C5LA 3A2KA 2CNUA 3WGLA 3FOAA 5ALZA 1FTYA 1ZOSA 3JARB 4K1LA 4NSNA 4RJKA 3DUWA 5B6JA 4CLOA 1EHYA 1LBIA 1EEHA 2GVNA 2ZJ4A 3CJQA 4DADA 5C51B 3G2HA 2O8FA 3GTMA 1FY2A 5KJEA 4PF1A 3AYXB 1YCFA 4UHKA 1T6YA 5EWJB 3ZNOA 3ZV6A 2FLWA 4F9TA 4IHJA 5BSGA 1RWPA 3GIWA 1RWKA 6YASA 2DHCA 4DIMA 3LP8A 3ZE0B 1K9VF 4HUJA 1EYZA 1R5NA 2HSDA 4M9ZA 4PSCA 2YHBA 1GSHA 2GN0A 2OV3A 3IBCA 1ES9A 2LZ0A 4XQEA 3EWNA 5CMLA 1Z2NX 1EIZA 3RRYA 1N3LA 4P22A 1CJBA 3I61A 2UXDB 1GU0A 4BFXA 4KAAA 5KOIA 2NOAA 2BFFB 1R0ZA 3ICQB 4Q66C 4DCNA 3DB1A 1X7YA 3A25A 1BDJA 3B70A 4Z7QB 4J0KA 1SPBS 4MS3B 4DMHA 2VDJA 2VNJA 3OC6A 4X41A 5K6AA 1QAOA 5KT3A 1E5QA 2HLPA 3OIFA 1IOZA 2QZPA 2H5EA 5A9SB 1GYPA 1UP6A 2XZDA 4EKNB 2G06A 1YR2A 3OPVA 2JD0A 4GG1A 4UUOA 2AHRA 1GQQA 2J3JA 2QW8A 4JOBA 4LV5B 4XH9B 2IS2A 2HVQA 1WY7A 1A8UA 3H5LA 2W57A 2I55A 4NH4A 4IEFB 3LGSA 5A9RA 1TTQB 5TF0A 4MO2A 4I7HA 4N7JA 4ATNA 1JHXA 1AKTA 4BECA 2EGGA 2R6DA 2DPYA 2H48A 3GTOA 3QG1A 2QN3A 4INAA 3CKKA 4BCCA 4AKSA 2D2FA 5JO0A 2CWDA 3GJ5A 3U3OA 2Q6KA 2IYEA 1G2QA 1EP9A 3AI7A 1ZI6A 1SHJA 2FK7A 4OOEA 1SWVA 4CKZA 5CBPA 4DR4H 1LFDB 2JKYA 2HRDA 4QWMA 4PGAA 1UOOA 1WZIA 1YH3A 2VK8A 2WG2A 2ZPTX 1GQ2A 1ZOIA 3H1FA 3G79A 1TU3A 2BN4A 3WDLA 1YI8A 3CN7A 3ZGOA 2BFWA 3DDNA 1PSWA 3SMQA 1YZ3A 2RGDA 4BNVA 1GKYA 1N2OA 4P84A 4C6HA 1U3UA 4EEZA 1S7CA 2EWWA 3B53X 4BKPA 1IQUA 3WRYC 4BVKA 3IBGA 1B0AA 1T3HA 4BWFB 4COOA 1ODTC 5FJ8G 3ESQA 5I9TA 1GNPA 4IMIB 4ZI7F 1OBHA 1QOPB 2FX2A 2AEMA 2BR5A 4FB4A 4QASA 4PN7A 3R7SA 5KSZA 3KD3A 1BE6A 4N7BA 3RUFA 3V1YA 3CUYA 1IN4A 2KB0A 2HHFB 1DEAA 3BXZA 3DS8A 4LVCA 2ZAGA 4X7MA 5KPDA 4BNWA 1G0OA 1E9EA 4NCNA 4UZSA 1RHRA 1IULA 1DEHA 4G36A 4JNCA 2FJZA 2EJWA 2GX6A 3ASUA 3C3BA 3EMDA 2VDLB 3I9JA 5ALVA 1EVJA 1IB6A 2QUKA 2YQ4A 3T9FA 1OI7A 3P45A 4C4SA 3PQ7A 4RK6A 4DJAA 4EO7A 5D86A 1QQBA 1EFHA 2VL7A 3W5AA 1NW6A 5LP6B 4DV1B 3K1YA 3PRYA 2O0HA 2B34A 1RQNA 3TMYA 4DE5A 1T0HB 1F7VA 2WFMA 1DC6A 1K6JA 5IKMA 1M0EA 5DBHX 3WQHA 4FYVA 3N44B 2XT0A 5C53B 1NVWQ 2X76A 1I94B 1MTZA 2H31A 2PUTA 4W9NA 3RIHA 1B6SA 3GMTA 4JJFA 2PO7A 3RS7A 1FIUA 4A8HA 3LBIA 1R7RA 3R3XA 1Z6YA 3FBWA 2E4XA 2HK8A 1GPLA 4EVIA 1AGYA 2N47A 2IIBA 2NG1A 4EWLA 4E5PA 3IAAA 1Z2AA 1C50A 3A0UA 3C74A 1UBEA 4GVPA 4HN9A 2J5XA 5E9QA 4H7HA 5KTTA 1GPH1 1DKPA 1YBVA 2GN4A 3RRMA 3N2KA 4UCUA 1P6QA 1WS6A 4MGHA 3DFFA 2YZNA 1C3OB 1U0OC 2OHGA 2YHAA 4MKRA 2IBMA 3Q8KA 4FFBB 1EK2A 5K9ZA 3AEXA 2WKQA 4EDHA 3EUFA 4KIJA 1CXZA 3AB7A 1N6KA 1NDQA 4G56A 4NBWA 1WHSB 4DC1A 1GDDA 1NNI1 5HWSA 5JY1A 1YJQA 2WSBA 3MWJA 4NJEA 5T4EA 4X90A 1PWEA 1EDDA 1FX1A 1W73A 3FSEA 4DNFA 1M7HA 3T3EA 1M6VA 1P0PA 2JI7A 3GRUA 2CNBA 2X86A 5IP7G 1RQ2A 4WKGA 4N1AA 1TMGE 5CTJA 3V32A 3KUXA 4BQFA 4WN3A 1CF2O 5B2ZA 5C7IO 2PYZA 1MVLA 1XDDA 3IALA 3GH3A 3CBQA 4GLFA 5DM1A 4HGNA 3HK2A 4RETA 4I1OA 5JYBA 3HRHA 1E0DA 1HYBA 3H2JA 3HWX1 4UM8B 3Q85A 3V8VA 2ZR7A 3PW2A 4DREA 2YXDA 2JDIA 1HNZB 4Y1GA 4UPVA 2I7VA 3OTIA 4N54A 2UXCB 3MT0A 4OH7A 5BSFA 4PAQA 3TIFA 3GRYA 1KRHA 1J9ZA 1C1XB 3URMA 4IQ0A 5ABPA 2GJSA 3PO2G 4FEAA 2PZKA 1UAYA 3R8CA 1QJ4A 5EAIA 3W5CA 3TG8A 4DBLC 1J0AA 2EJVA 2VSOA 5NLLA 1XCOA 4RKRA 2OSBA 1E64A 3HB1A 3P8ZA 3QV1A 1TEVA 2GN1A 1I1QB 2X1MA 5DN9A 4MTLA 2PN1A 3BEOA 3N2KB 3OQBA 3E9CA 1DP4A 2H4WA 2JIBA 2Z4TA 1RKBA 4P35A 3TJZA 4MAFA 4CEIA 4A8JB 2AZXA 4JVLA 1QZTA 3HBLA 2COKA 4X45A 2Y99A 1ADYA 3JQGB 4R2WA 5BO5A 4F2PA 3D59A 4RVHA 3GELA 3OSUA 3OWOA 1XTVA 3GIPA 1FQOA 4DQDA 5KT4A 2VPIA 1PT6A 2SKDA 2Z1MA 1D2MA 3IESA 4JI8H 3M6UA 1P31A 1U8ZA 3MJTA 2J0VA 1RAHA 1CERA 3A4LA 3IUNA 1XDGA 3GVPA 3WLMA 1CLEA 4WL0A 3F8TA 1OBCA 2GCEA 4NNOA 2HHHH 4MV6A 4W5JA 1FNSA 4FC6A 4CKWA 1MLDA 4CM8B 4X91A 3RHZA 4D9JA 5K8JB 3WYAA 4HR7A 1ZEMA 3VKFA 3EIQA 1KK3A 2JAQA 3RBAA 1X1SA 4RNDB 1VLJA 1QKKA 4LF5B 3GPBA 5I7SA 3CO5A 1ZAUA 4YFYA 2A4KA 2V3VA 1XCMA 3RJ9A 5E3HA 3M4ZA 4JJKA 4P0TA 2RHWA 1FF9A 1KO5A 4QREA 4WLOA 2ZR0A 1CETA 2VHJA 4FW8A 2L18A 2R79A 3DKIA 4JLKA 4Q7MB 3VVBA 4BZXA 2HT1A 4L9WA 3I9MA 2Q29A 1CPYA 4GWKA 3MTAA 3VO8A 1Z4LA 2G9RA 2K7ZA 3QEBZ 4KNWA 4C04A 2RHHA 1WD7A 3EVDA 3MJVA 5ALRA 5EE0A 2FR8A 4Z51A 4MVJE 2XGSA 1GWNA 3K9WA 2P91A 4JBGA 5EHIA 3EUAA 3AW8A 3SEZA 1MCZA 2ETXA 3DBLB 4UAJA 4BFLA 3U1TA 2N9UA 4AQDA 2G83A 3L6RA 2VDWB 3K8YA 5BXYA 2QTRA 5KFOA 2PX4A 5GV7A 3MD0A 3PW7A 4MJ7A 4OX9H 1DQZA 1HC7A 2XVXA 2AFHE 4DM4A 2FPRA 2GH1A 3GMSA 1OH7A 2DP4E 3AETB 5TPWB 1B26A 1VMKA 3MT9A 1W35A 3PUWA 4MDFA 3DFUA 3GEEA 4LZWA 4KQCA 4Q8FA 2R00C 3TXAA 1OLUA 3X2FA 5IAAA 2NW6A 3GUYA 1UMKA 3EBOA 2QN8A 3RK0A 1FUYB 4G01B 1EIWA 1FFXB 2J67A 2FQWA 1C0KA 4J7AA 1ZN7A 1DQYA 4P6VF 3C6ZA 3MGBA 3VGJA 1TADA 2J6TA 1FXWA 1Q3KA 4U1RA 5DNAA 5H9VA 5CRIA 3VAYA 1QGDA 2PL3A 4ZI7A 1GR0A 2KQUA 3LBHA 2O07A 2R6JA 4YRTA 1V9PA 2IPXA 1SQ6A 2WT8A 1V0JA 1B14A 3PTZA 1GP2A 1U80A 3NW9A 3IUPA 3S99A 3B1KA 4X95A 1PS9A 1ST2A 1T9AA 2FUKA 4CFYA 5C8YB 5JY6A 1RS0A 1U3FA 3NBQA 1EMDA 2ZOSA 1DHRA 2QAGA 2WJGA 1FDUA 2XLBA 3BERA 3EARA 3T1OA 3ZWAA 4B4KA 2MSCB 4PQRA 3W6OA 1YU9A 4UCOA 2G7MC 3GJ7A 4AO8A 4MKZA 1W4ZA 5FOWA 2D7JA 3RRJA 4PZPA 1W76A 4EJ0A 4JUZA 3FWNA 4BBRG 2A84A 1D8TA 5C7LO 3RYCA 3W5OA 3HM9A 4A1OA 1OFHA 3M5DA 1EVLA 3SK0A 3PUYA 1SVWA 5I9MA 3SYLA 3KCNA 1MG0A 4AF7A 1EUCA 3AOEA 3HKDA 5AUNB 1UWLA 4RKEA 4HFJA 4OAPA 2VP3A 3PR5B 4Y2RA 2AFHB 5JMPA 3SIXA 5IJAA 1N5JA 1LXCA 3BA1A 3U7RA 2QD5A 1H2WA 3I42A 4YP3A 2VHYA 3HPQA 2DE0X 3BGOS 1SBZA 1UDBA 3FFBA 4H6XA 1XTKA 2IZOA 5EFZA 2Q1XA 3OFKA 4ISCA 3A27A 5C3UA 1L5NA 4DLAA 5FR2A 2RG7A 2ZIVB 2GLXA 3H5RA 1ZH8A 5KHAA 2ZRKA 3TFOA 1W85A 4E4YA 3NAGA 3KD2A 2FWRA 4IIXA 1P0QA 2XOKD 3A6EA 4G6ZA 1BCRA 4HHEA 2WZDA 3ETJA 1IBSA 1XVVA 2BELA 4BNFA 3BE4A 2BGUA 2WOJA 1KEUA 4H2DA 3ST7A 5FIUA 3SZGA 1SA0A 1JBKA 1NJ5A 2LCIA 4N4AA 4ENUA 2QT9A 3BWYA 2GZ1A 3AEQB 3JD3A 3T1TA 1V35A 4Z86A 4RQTA 1DOZA 1T8UA 1ZIDA 2B1JA 1IK4A 2C78A 3PDHA 3QELA 3P9YA 3QM1A 4JOSA 5C1IA 1T3GA 5FWNA 1AKMA 3SNOA 1CTQA 3EXHA 1WDKA 4L75A 3L3BA 3N8IA 3OD1A 3UK0A 4AMUA 4JB0A 3SYNA 3Q7TA 5EOVA 3W5SA 1A7AA 1FDOA 4RZXA 2A86A 1VL0A 1JMVA 2OOSA 1FVFA 4JUIA 3MBOA 4OKNA 5CB0A 3VTKA 5IMSA 4BE4A 3U6BA 4NXMH 4G2NA 1WVMA 5A02A 4JVNA 2W70A 2XCAA 1SXJC 2ZQYA 4FJ0A 4PY2A 2VZ8A 2WDTA 1DE0A 1T36B 3TTUA 4A2AA 3HCDA 4O4IA 5JS6A 3H4IA 3CF4G 3LYHA 1I1OA 2LVBA 2DUWA 4D6YA 5KG4A 2X0DA 2ZWIA 5CM0A 1KTVA 3N74A 4IR1A 1OU0A 4NF2A 1U94A 3PD7A 4I46A 3OQMA 4MK4A 4MLCA 3RVPA 2D7DA 1MFZA 1I1LA 2AKEA 3BGDA 4D46A 4N3GA 3RIMA 3M6XA 1VCNA 3RAFC 5IHXA 1CF9A 4EGQA 3E5MA 2H1CA 3K5WA 4QEZA 2WKPA 2QB5A 2Q2NA 1ZVVA 3WMEA 2C7PA 5FTMA 3UUGA 1ZHSA 3G0DA 4PFKA 4Z4HA 4Q3CA 4NMXB 4A10A 7YASA 4B75A 4F5EA 4YCSA 3TY5A 5EMKA 5TPZD 2V6GA 2RGUA 2OEPA 5HE9A 4Q3KA 4NMLA 5BQ5A 4YRPA 5FAXA 4U6SA 2ZIWB 3LHFA 5GVRA 1GYRA 3OCVA 1X19A 2UUAB 4TYWA 2P2SA 2IGTA 4UU8A 4P3PA 4C29A 4Y2GA 2F1JA 1JXAA 3WLQA 3ENQA 3TUIC 1SUDA 1Z5OA 3BABA 4E7PA 2CNWA 3DPSA 3I64A 1S0UA 3JPWA 4LE0A 4RXUA 3KWJA 5G4KB 3RTXA 1XXLA 1L5GB 3SJ7A 4NCBA 1THMA 2G1UA 2V6MA 4ALJA 3IP1A 1UOQA 4HDAA 3RB8A 4V39A 3U44A 4ZCSA 3UKDA 1MMFB 3QJ5A 4H59A 4PC7A 4DHEA 4XWKA 2H57A 1T9DA 2B7BA 5K3CA 2FGKA 3NTLA 3HFGA 4GVXA 4RVUA 4FTWA 4E7OA 5AVVA 1I32A 1JAXA 1XZFA 4B3HA 4J76A 4R1SA 2WF8A 4CN9A 3P9NA 5I4CA 4DB2A 5E8RA 2QT1A 4I4NA 1E9AA 1V4VA 4DV6B 2QLLA 3LXMA 4FP9A 4JLSA 4KWTA 1UADA 4NPHA 4NH0A 4EY3A 3KLPX 5B1IA 2BMDA 4AQ7A 3FF4A 3PDIB 3P0EA 3MCAA 1U0LA 2PMWB 3CSUA 3S8MA 1QVAA 4G25A 1U02A 3GTLA 1J8FA 3AGQA 4NZ9A 5IYZB 4A9AA 4GC7A 1KXZA 4QBGB 4HNUA 5B1EA 3DDCA 1T2FA 3ESCA 1JSLA 3WA6A 3I0MA 2MOKA 1JEDA 2YWGA 1COWD 3QF7A 3HLTA 4ND7A 4ZXPA 5H3CA 3WSWA 1ZD3A 4D9GA 3WLJA 4EX6A 3CVUA 1G98A 2GZMA 3U3DA 2QJWA 5SICE 4CWAA 2TMGA 3QTLA 2CXNA 3SCZA 1SU8A 3DTFA 4QGGA 4D92A 2X8JB 2X9NA 1QYWA 1MX5A 1R3DA 5KSYA 2XCSB 3FHTA 1NW7A 1YDEA 4J16C 5EP4A 1QIJA 1I6WA 4OI4A 3IQWA 3LFUA 1W93A 3MQ2A 5I48A 4YJ3F 4HPXB 4C1BA 2X2OA 4TKUA 2VQFH 2ZT6A 3GROA 3L1VA 1VJ1A 4TV9A 2PVPA 1ZM9A 2YICA 5D2CA 5JD3A 5L7WA 2MINA 3C70A 3EH2A 4EEKA 3WR5A 3DONA 3ZOKA 2Y0DA 3EZ2A 3IR5A 1OBDA 3M70A 3DJYA 1YOVA 3OFNA 4JJIA 4W82A 2BTOA 4N6OA 2C3OA 2B63G 5CDSA 1W47A 3KHRA 2LIPA 3R0ZA 4DV0B 3CB2A 3GT4A 3ZWQA 3RC7A 2PU7A 1JA1A 2Q0HA 2DQSA 4GKVA 1FFDA 5DM2A 3U16A 1OBOA 5EIBC 1W7AA 2BM0A 2AJLI 4JUFA 3EC7A 4GLXA 2XCRB 3FUWA 3MTJA 3GLGA 3GVHA 1PO7A 4NMHA 3TK1A 5BUZA 2GVDC 5THKA 3JAWB 2OLKA 1E77A 3MUEA 3C5CA 4NOLA 5IXJA 1NUPA 5C81A 3P2KA 3KXKA 4O2BA 4G85A 1ZR4A 4NULA 4CT0A 2MSNA 1KJ8A 1SRQA 3NVDA 1PR5A 1TF5A 3R5KA 3ZY5A 3L9XA 2AQKA 5A4MS 2WZQA 2E4WA 1AURA 2M1ZA 3QOYA 4MVXA 5KMGB 1V11B 5CXQA 3PGMA 1BIFA 4OHYA 4AJ9A 3L6CA 3BJMA 5CX1A 5JNVA 2IUTA 4G0PA 5ECDA 3BMQA 1L2ZA 2PUFA 2XC9A 5I4IA 4X60A 5AHWA 2FF7A 4WXRA 4Z9FA 4ENWA 5D5HA 1USIA 4JQOA 4Y9TA 1YRLA 2C2RA 2DFPA 4P5PA 3V4RA 2RGCA 1FA9A 3K2IA 4LTDA 4ZKEA 1B8PA 2CSUA 2PZ8A 1QUEA 1XTPA 1Z7EA 2IODA 4H7IA 4N65A 3ONFA 4OP2A 4B47A 5K6RA 1PJSA 5E7QA 1W5TA 1ML3A 1Q0UA 3DFIA 1FE8A 2V7XA 1J21A 4RAOA 4ASUA 4CRWB 4DA0A 1E5TA 4HN2A 5JXWA 3BK7A 4IDBA 1Z5VA 4IOLA 1ZIPA 4RWEA 5MHTA 1Q0LA 1QLHA 3KR0A 2WD8A 2Z6AA 4BV9A 1PJBA 2CBGA 3QYJA 3HCNA 4RFSB 1G63A 1WCWA 2HF7A 3UZUA 1Y8ZA 4F4IA 4RHXA 3CISA 3FUCA 4FMPA 2AN1A 1WA5A 2C82A 2WYWA 2L42A 4TSRA 1TUBA 4K9DA 5CCDA 1JEEA 1XDUA 2ZYTX 4WZZA 2CJXA 2IW3A 2XF2A 1I4OA 2DWCA 2ZYIA 4PCLA 3EDQA 3OQIB 3AV3A 4Y1EA 5T5QA 3SR3A 2CL7X 3ZC3A 5EQDA 5GOTA 2RE8A 2RH8A 3AFIA 3DLPX 4E4TA 3I2JA 4KGDA 1KC3A 3NHPA 1G5PA 4LN1A 3Q3EA 1OIVA 2CJYA 1G21E 1NN1A 2VHVA 4ZT7A 5G0WA 3T7TA 5KNBA 2NXWA 1OGIA 3HSKA 4HRYA 1R1DA 3WLRA 3ZI7A 4BEWA 4MJ3A 2WEKA 4UTXA 2CK3A 1X80B 5E4FA 4YRJA 4AZVA 3CT4A 2O50A 3FGPA 3I8OA 3ZGNA 5K2OA 2FWNA 2H06A 1G42A 3V7WA 3F90A 3E1KA 1ZGCA 3G9UA 4HQNA 4L95C 1VECA 3JATA 5ALMA 1VIYA 3U4QB 2XR1A 1HLDA 1BC5A 1ESMA 1YCHA 1IBRA 3P5SA 4L51A 3RLFA 3RTDA 3V4VB 4BL5A 5HJ5A 4P4SB 4IQ4A 2XWJI 1JG2A 2C9CA 1A9RA 4DIOA 4FN4A 2JIPA 3HL0A 4YXFA 4CETA 1HKUA 5CG1A 1RDFA 3E15A 2C2XA 3KOOA 3L8YA 4RSGA 2IW1A 1C9YA 3AUXA 1X39A 3QKRB 4W99A 2JJ1A 4F4XA 1H5QA 5ESDA 4W8HA 5IRCD 1U63A 2R8PA 5GGYA 2CBXA 1UM9A 4KU4A 1SJ9A 1BCRB 1QMPA 2C2BA 2W00A 5I3CA 1C1XA 1NVGA 1V6CA 3LPLA 4BTLA 2ZTLA 1AZWA 3O91A 4UVGA 4QELA 1XRJA 1D4FA 4WX2B 2OV4A 3GA7A 5IAEA 1UPAA 2BKUA 3OJ0A 1GOTA 1NKTA 1U28A 2KE5A 2Q5CA 1L7BA 3INNA 4HAOA 3SXUA 4B79A 5AVXA 4CI0B 5K6AC 1JXLA 4I1IA 2JVKA 3EXHB 4WJKB 2NU9A 3V1NA 4CM5A 2HF9A 2O03A 2VXBA 3I3OA 1C4KA 5MF6A 2JEZA 4JJ7A 2QX6A 4BFZA 4N76A 5AR1A 1I24A 4JLOA 4JC0A 1V39A 2DECA 1IJFA 4S1PA 3OA0A 2J3IA 4YO7A 1DDGA 1LBQA 2BKLA 2X8LA 1YQTA 1V9CA 2AYXA 4REMA 3VYVA 5ESWA 4BX2A 1N8TA 4X64B 1RD4A 4R41A 1Q16A 3IURA 4ZYXA 1Y6RA 3CPHA 1LW6E 3OZBA 1AMNA 4L50A 1MW8X 3RSCA 2E18A 1J2JA 4X9XA 4BP1A 3PXBA 2PUEA</