1AUXA

Structure of the c domain of synapsin ia from bovine brain with calcium atp-gamma-s bound
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
292
Chain Sequence
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSINSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLINQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAKYDVRIQKIGQNYKAYMRTLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SYNAPSIN IA
publication title Synapsin I is structurally similar to ATP-utilizing enzymes.
pubmed doi rcsb
source organism Bos taurus
total genus 85
structure length 292
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1auxA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1auxA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1auxA02
3V4ZA 1I7NA 4E4TA 2W6NA 2NU6B 2CQYA 2NU9B 5JH7F 1EHIA 2R86A 4L1KA 1C30A 2GPWA 1KBLA 3AX6A 4YAJB 3Q1KA 1JKJB 1B6RA 5LXTF 4RZQA 4EA8A 1KJQA 3ORQA 3TQTA 5HBRB 4WBNF 1GSHA 4DLKA 1Z2PX 1VBHA 2W71A 4MV7A 2X0SA 5LYJF 4C5BA 3U54A 1BNCA 4O7YA 2FPIB 4C5CA 1AUVA 2FPPB 2HJWA 4EG0A 3N8DA 1DIKA 4FFPA 4FFNA 4WD3A 4FFMA 5FNVF 5BPFA 2YW2A 4ZI7F 1OBDA 5BMVF 4I50F 1C3OA 3ORRA 3RV3A 4IWXA 2YZLA 4O84A 3WNZA 1KUTA 1M0WA 3E5NA 3TW6A 2CNVA 4HNTA 1UC9A 2IP4A 3BFPA 1ULZA 1W93A 1KEEA 4YJ2F 2CNQA 4M9CA 1KC7A 5J2TF 2NPOA 4O7SA 1SCUB 4M9UA 3RUPA 1M0TA 2R7LA 4HQ6A 3TIIA 2R84A 4MV4A 3HO8A 4I4TF 1AUXA 2DWCA 5K2MA 4MA0A 1GGOA 3MJFA 2WYOA 4O83A 5JQWA 1EUCB 4MV3A 4MA5A 3MWDA 2NU8B 4HNVA 4O4JF 3K5HA 2YZGA 3K5IA 4XYLB 2VPQA 3OUZA 4FE2A 3U9SA 4MV8A 3TIGA 1EYZA 4NYEA 3JRXA 3VOTA 3MWEA 3VMMA 2R82A 4O7LA 2PN1A 3N6RA 3VPDA 4HR7A 4EA7A 1W96A 2GQSA 5C8YF 5KX5F 1E4EB 3R5XA 2R87A 5GONF 2CNUA 3WO1A 1PX2A 4EA9A 2OLSA 2R7NA 5LA6F 2V58A 5CA1F 4XZ3B 2I80A 5BPHA 4XX0B 2XCLA 3R9RA 1A9XA 3OUUA 1CQIB 5C1PA 4O7RA 2YRWA 3QFFA 1KJJA 3BSYA 4O82A 1WR2A 2R7MA 2W6ZA 2YZNA 3TINA 4O81A 2W6QA 3VPCA 2FPGB 3SE7A 1CS0A 3RFCA 1CE8A 4IZOA 4O7ZA 4XYMB 2ZDHA 4ZHQF 2NU7B 1KJ9A 4EGJA 1DV2A 1KJ8A 2R85A 3JZIA 4QSHA 1Z2NX 1A48A 1Z2OX 2Z02A 2V59A 3G8CA 3JZFA 4FFRA 2Z04A 4I55F 4M99A 3HBLA 4TV8F 3UFXB 1DV1A 4TV9F 5D8DA 1GSAA 5H80A 2C00A 3BSSA 1CQJB 5LOVF 2GLTA 5LP6F 3GIDA 2J9GA 2FB9A 2P0AA 2PVPA 1IOVA 1B6SA 2YZMA 2DIKA 2XD4A 1E4EA 5C1OA 1UC8A 3R5FA 4ME6A 3JRWA 4TUYF 2CZGA 4EABA 4MV9A 4O7VA 4YBZB 4FFOA 3BG5A 5EZYF 4C5AA 2R7KA 4O2BF 2QK4A 4O2AF 3R5HA 4O7TA 1PK8A 3KREA 2SCUB 2GQRA 4IHJF 4YJ3F 1EUDB 1IOWA 3KALA 3DF7A 3ETJA 2NUAB 3R23A 4ZQIA 2W70A 5JVDF 2ZDGA 1T36A 2QF7A 4EGQA 2FP4B 2W6MA 5J2UF 3NUAA 4O7NA 2PBZA 3VA7A 3HB9A 2YWVA 2VR1A 5KKNB 1GSOA 4MAMA 3G8DA 4M98A 2I8CA 3ETHA 2YYAA 4GGMX 4O4IF 4FGRA 2DZDA 2I87A 5JVLA 3K3PA 4O86A 1JLLB 4O7WA 5CB4F 2W6OA 2HGSA 2YL2A 3U55A 4DIMA 2ZDQA 1VKZA 5IYZF 4YAKB 1OBGA 3KAJA 3VPBA 3LP8A 1JDEA 4ZOLF 1KJIA 5DMXA 3LWBA 2VQDA 1I7LA 2R6FA 4FU0A 4MV1A 4FFLA 3Q2OA 3BSWA 4O4HF 4O4LF 4MV6A 3RV4A 5CAEB 5I47A 3KAKA 4YB8B 4Y8VB 4IWYA 3V4SA 2GPSA 2YS7A 1BXRA 1JDBB 4IIJF 3U9TA 4HNUA 1M6VA 5HV6A 2VHEA 2YS6A 5JQGF 2DLNA 2V5AA 4EAAA 5CA0F 1EZ1A 4J6EA 3I12A 2W6PA 2YRXA 3GLKA 1GLVA 3WO0A 3AW8A 1VBGA
chains in the Genus database with same CATH superfamily
1I7NA 1OLSB 2JA6A 4FDUA 5BSEA 4OQPA 5GINE 2G0NA 3GIIA 3PNYA 5ALLA 4B45A 3KELA 1NLYA 3I92A 5FI3A 1KJQA 4YCJA 1N3IA 3RVKA 3DLTA 3IMKA 3CF6R 2NO4A 4A23A 2QYTA 1L5MA 1M7GA 3EF0A 1ZM3A 2WPDD 3GG2A 2RC6A 3HOWG 2H5JA 2HW8A 1FFBA 2HO5A 1GAWA 1XJQA 3U4DA 4KQGA 3OY7A 4FFMA 1UKYA 3FNRA 1H65A 3IAS1 2ANBA 3BA9A 821PA 1Z28A 4MK4A 1VL5A 2J5BA 5JBQA 1DB3A 1JB9A 2I2XB 3OZEA 4HFMA 1A7KA 1X1CA 1C7EA 3RS4A 2JBAA 3PEUA 5CCXA 1ECBA 2C9YA 2OWEA 4I4LA 4R83A 5IK2D 2WB1A 1Q3TA 4MP8A 4A82A 3UB2A 3SXUB 4YV7A 1JFTA 4WRRA 1RPTA 4KN9S 3T4PA 1M7HA 3HOYG 4P32A 2OQVA 3HP7A 2N42A 4DB4A 4YGXB 5GM2A 5TEWA 3WVNA 1D2HA 2WKQA 1DKUA 1XAIA 2FZKA 4CR6A 1WW3A 4ITRC 2ILTA 1U5AA 2J31A 1OH6A 1QG0A 4CG3A 4DL3A 2QDXA 2FSGA 1GY8A 3UOWA 1WRVA 4KXNA 1L1FA 4KMOA 3KEGA 4Q4CA 1R16A 5A4IS 4YFYA 4IVPA 3BBPA 4DUYH 3ZE9A 4G1UC 3H7IA 3ENZA 2R6ZA 1NC1A 1GUZA 3LOQA 3PC6A 7YASA 3RFXA 4MTLA 1LK7A 5IARA 2PUGA 3ZCXA 4X6UA 3KQUA 3IEUA 5K9ZA 1TA8A 2LD4A 3HEAA 4Z9AA 1O4WA 5EMMA 2R93G 4OXYA 4GKJB 2R97A 2A3NA 1HQCA 1RJ9B 5BUQA 1H93A 3KJZA 3EHEA 1OFUX 1YC5A 4UOZA 3BJRA 1Y8RB 2AC7A 2SBTA 5KQLA 1YB2A 2WDTA 1RBYA 1DHTA 1UOEA 1Z6PA 3F97A 4P38A 2V7QA 1A2OA 1BMDA 1TJ5A 4JC5A 4ON9A 4F71A 3UXYA 3UWKA 3H17A 4DVJA 1XQVA 1W49A 1P6QA 2W4MA 1U7DA 2JFZA 1FQOA 1C9KA 2QA5A 3P20A 2B8JA 4IDEA 3GUHA 4JLAA 1YXMA 2ABWA 3MJCA 3ZHTA 1SXJA 3JQQA 4BBRG 4O7TA 5ADUS 2IWHA 2ORWA 2WYUA 3RHFA 1ABEA 2V7EA 621PA 5FTLA 1EVQA 1X86B 3RIXA 2XVZA 3RTXA 4CIXA 3FYUA 1ZG3A 4LRXA 3MFQA 1SUCA 3VZDA 5F23A 3K0CC 3RSSA 3O4RA 4ZYXA 4EX6A 1PJLA 2HWKA 4CMIB 1YBFA 2HQOA 1JHAA 3SF8B 3ROMA 4N49A 4JQZA 1VOTA 3DCJA 1PD0A 1NDQA 1MEJA 4AQYB 1TVMA 1BD3A 4JUCA 4F3RA 3QX9A 2YXDA 3I73A 1QZTA 3DCYA 3ZDAA 4D9BA 4KR2A 2VF8A 2IS4A 4F5YA 3M83A 3LBYA 1FFGA 4BFXA 4ESVA 4H4DA 3UT6A 3GUVA 3MCZA 1R6VA 2HTFA 2FK1A 1GGMA 1W5SA 3DMHA 2I22A 3TQHA 2VHZA 4B3CA 3KUXA 3ECSA 4I50B 2R65A 5KJFA 1E3WB 3E2IA 3IUSA 2O1XA 4Y98A 4OIMA 1NNUA 1TCAA 2BP7B 3KUDA 4UUPA 2QP4A 2IPLA 4OGFA 1GG8A 1SBCA 2CB9A 2FUNB 4MKZA 3RBXA 2V5AA 3D7MA 4R5HA 4JSRA 3WBJA 5G40A 5EJ2A 1ZETA 2OCXA 3BB3A 5IUJC 3MWDB 2GRAA 3JALB 4EMUA 3IXLA 3K71B 4AKHA 3V4ZA 3WMWA 1VTKA 4LNUB 1LSJA 1R10A 5JH7F 4HTAA 2CF6A 1NVMB 1V9SA 4JYZA 1HYBA 3KXIA 4QNNA 2GJ8A 1Y1VG 4J0DA 5JCJA 3TY9A 4X45A 3VKHA 1GIAA 2OR3A 2PS9A 4DNXA 3VVCA 3AFGA 2IPXA 5HBRB 1GT6A 2C03A 2DQ4A 2WMDA 4Q3CA 3T38A 4BBAA 4WESB 4MDFA 2JEJA 4F6RB 4L4XA 4QPCA 2CDRA 4DV1B 1RS0A 4YS6A 1AKUA 3THWB 2GZRA 5ELMA 2ZWIA 2MR5A 1NR7A 3UPTA 5KO2A 3RUCA 3Q1LA 1YHZA 3VYTB 2A78A 3C3EA 4JBXA 1H6AA 4JV2A 1Y8ZA 1SN7A 3ZJ4A 1L5YA 4CIDA 1YCDA 1H66A 1PDVA 5K8JB 1T5HX 4K5QA 3SF0A 1YF3A 2GF9A 4D4GA 9ATCA 4QLAA 4BO7A 5EQJB 1NUHA 1UDXA 3H9EO 1WTAA 4B09A 2PGOA 5EKXA 4P35A 1INLA 4AF8A 4IGKA 2JGDA 1E6WA 2BWJA 5HMLA 2QG4A 2QZZA 4BN0A 4COKA 2YRFA 1A0IA 4WNAB 2A33A 2YUIA 3A4VA 5ALWA 4KXUA 4RK5A 4MUKA 1F7VA 4M1KA 3W3AH 2QMEA 3LUHA 1UDAA 1GZ5A 2JDIA 4UU8A 1FJXA 1TZJA 1Z0DA 3PENA 3ANYB 4PZZA 4O63O 3GFTA 3HRKA 4ZRNA 1PS8A 3NT4A 3B51X 3VBEA 3FDZB 1JDVA 2WD9A 4AU1A 2ZIFA 5IVPA 2XJ9A 4IF4A 4RMJA 4BZWA 2W9BA 1EGQA 5LBTA 2OE2A 4O82A 1QJ4A 4NICA 1T3GA 4X64B 4EB6A 2FZGA 3CXUA 2WU8A 3IFSA 2XXAA 1D1QA 1HFEL 4PPQA 1TM4E 2GN1A 3DVAB 2EOAA 4M0KA 4ND3A 2JS7A 3ECCA 1TM5E 5LNK6 1D0SA 5IT0A 4ZT5A 1MT0A 2HQRA 3RODA 2Z04A 1CJUC 2PTGA 5IKEA 1PVOA 4RV5A 4YRPA 1V5FA 2BEVB 4P3NA 1GGJA 4D96A 2JATA 1M8FA 3ZHZA 1PW5A 3SJZA 3VDQA 4ERNA 1ONSA 4O5OA 5M2QA 3SHTA 3T5KA 1FDUA 3ONNA 4BQEA 3KFVA 3VU9B 3AERA 2XNSA 3WI7A 1YZVA 5F64A 4DJEC 1EKFA 1DFGA 5CLGA 4LWOA 2AOTB 2Q9UA 3T9AA 4M8SA 1R8YA 5JDIC 2JIMA 4EG8A 2VUMA 4EUSA 1F20A 1IVSA 1R0ZA 2PZ8A 4FUTA 4YJ3A 4UBKA 4Z7QB 3RK4A 2XXJA 4R7GA 3M4IA 2IYEA 2W2NA 4WCFC 4PBTA 3KQKA 2GOYA 3U37A 3EGDB 1V43A 2BLLA 3KYCA 5LZ5A 1ZGJA 4FNOA 2L69A 1XLTA 2IZ7A 1ECCA 1Y98A 1A71A 4BVAA 1EKXA 3OZCA 3AB8A 1W5TA 3JSNA 2HGSA 5ELXA 4YDRA 3K6SB 4RTJA 3OFKA 5T41A 1LRKA 2IX9A 4NV1A 1TUIA 3PHIA 4H0CA 3LWZA 4MR9A 3RJ0A 2E48A 4BQIA 3K72B 4CE6A 2XGGA 5ERYA 1KRXA 3L8ZA 1P81A 3ZVRA 2QZPA 2TRSB 1Q7EA 5BVHB 2YQ5A 4EGSA 5DTJA 3QY0A 3KXPA 5EE3A 2DPJA 4BUCA 4OOEA 4YRJA 4RZIA 2VPYA 3K4PA 4HN9A 4WX2B 3H0KA 5JQGA 3WLOA 4M9ZA 5SZJA 2HMYB 1A9YA 3QHAA 4DJDC 3O3MB 4V1CI 3C70A 1OWNA 3KB6A 1RI4A 3I01M 2HQ1A 4URVR 1CR2A 2PGLA 2YYYA 5K3DA 3IOEA 1A8HA 2W8BB 4EG5A 3WGJA 2IUSA 4CVNA 2OD9A 2A0KA 1ECPA 1NJ5A 3E5RA 3R20A 1I7DA 4WLEA 2V7QD 3HRHA 4JBWA 4OHRA 3MTJA 4HYTA 4NE7A 1T1EA 2FPMA 2Z8ZA 2AH5A 1SXIA 1RYYA 1JF8A 4FFBA 2EZ4A 2NNWB 5KG5A 1GKLA 4ZI7A 2H1FA 3ORRA 3RV3A 5KT5A 5BMVA 1PGNA 6GPBA 2O0HA 4GW3A 3N8GA 5TNXA 2O3RA 2RKBA 3KJXA 4U8HA 6NULA 3UC9A 5JFGA 3AVPA 1SXJD 4P31A 2W98A 1KI6B 3LKZA 3PHGA 4LF7H 1COWD 4YUYA 2PRZA 1NJFA 2VKTA 1V1RB 3OZXA 2HAEA 3CVWA 4M0MA 5BWOA 3BL6A 3BMOA 3I32A 2WTXA 2HXSA 2NWQA 1Y8CA 5LR6A 4UPDA 2YZGA 1GNVA 1Y5IA 1YZHA 3GB9A 1CTQA 1TYCA 2PJUA 3UT0A 5KDLA 3OEHA 4DE5A 5EA2A 4JP8A 1HLFA 1L5RA 2IK8A 2YIVX 3WO1A 4ZIRB 3UANA 4CKCA 3B2NA 3DDNA 4AXBA 3WLQA 3ZY4A 1OZ0A 3RC7A 5EXEA 2Z1MA 1B2RA 3GLFB 2HHFA 1CUGA 5AT1A 1SNYA 1AZTA 2IC5A 3AG6A 3GBVA 4J3NA 4U6PA 4DUZB 2WHPA 3OECA 4PSVA 2ECFA 1MKYA 2WM2A 2Q7DA 1QKJA 1CEEA 1VHJA 1KSJA 4DMKA 4MUFA 3U5ZB 2AHOA 1EKPA 1FF9A 1XN4A 3DFFA 1GITA 3KOOA 5C1IA 2JJQA 2FEOA 1E18A 4EVQA 2XRZA 4HQLA 4EBBA 3LUCA 2Z57A 4TV8F 2HEGA 3IUQA 1L6RA 2ADOA 3AI7A 5HCUA 5TSDA 2JA1A 1EE2A 4F92B 3QZ7A 1H3FA 1H8HD 1YE8A 3T1VA 3OPXA 5CW1A 4OQMA 4I7HA 2P9CA 3NBFA 4Z4FA 4L8LA 2BFCB 3IXMA 3U7JA 4NL4H 4C7XA 3EEYA 4EPVA 3MK31 2AI2A 1Y3HA 4KNVA 2GAAA 5INTA 4PHHA 4IRKA 4RTOA 2B7LA 4D74A 2NTJA 1KYWA 4HJRA 2XA2A 3LC0A 2J4FA 1IG3A 2X3YA 3NDIA 4MEBA 4BVJA 3HEBA 3QJ5A 1YNSA 2WJAA 1SEIA 3TLXA 3G2IA 4M55A 5KYGA 2ZUBA 1X7YB 4LF4B 1JNXX 1YMQA 2WWIA 3BE5A 3AZQA 2X9LA 4TS1A 2RIRA 4B74A 2HD4A 2J07A 4XASA 4HDNA 1C2YA 2JGKA 2R60A 3OZIA 1GZUA 1L7XA 5D7NA 4IXTA 2H1SA 3N39C 3NWPA 4UM9D 1PR2A 2H8GA 3G0IA 1WUHS 5GOTA 3WDLA 1RLJA 5FCDA 3I2HA 1GRCA 3ZWXA 3TH5A 5HOQA 3E9RA 4N3CA 2D6FA 1DBSA 1XAGA 3KQQA 4EHBA 1DLIA 5FNVB 2JDID 3QENA 3JD4A 1JX4A 3B85A 1DXQA 2IRWA 5CGZA 4RVNA 5L45A 3GLIE 3BE6A 4YRDA 4YJHA 2FA9A 1Z35A 4CKWB 1SVSA 5J2TB 2CJPA 1N7GA 1W73A 4R8VA 2D0OB 3BTSA 3KR2A 5CA0A 4N12A 1IYZA 4UE6A 3HSSA 3PEFA 1WY7A 1C4WA 1FP4A 1JBKA 3GIKA 3EUEA 3QMVA 4Z4GA 3Q8PB 1GGKA 3S99A 4LRUA 4ND7A 1VLLA 3HUTA 5E4TA 1CEYA 3HU2A 4DMCA 1PZFA 4Y9SA 1USIA 3ILXA 2F8SA 3R0ZA 5AVVA 1DEAA 3F6RA 2PKEA 3JTEA 1ZD9A 3WK4A 1I3QA 5LMNH 4W7IA 4ERXA 3NDRA 2TMYA 5CNJA 1F0KA 2IYYA 3PFKA 3SEQA 2JVKA 1IMJA 3CNHA 4JR0A 1P7VA 3V9AA 2VPXA 1Q0PA 3L04A 3VSBA 4YDHB 3EXHB 3JZAA 3H11A 4RL4A 4ZAXA 2DCMA 4DR5H 3F2VA 4YROA 5CLFA 2WF8A 1BTOA 5JMPA 2ATEA 1ULZA 1WMBA 5D6OA 2B98A 5DYYA 2P40A 2JAQA 4D1YA 1UXKA 4FEEA 3T12A 3KXLA 5C46F 5KEIA 2B0CA 3HO1A 2G1JA 1X7HA 4NBNA 1TJPB 3NCTA 3E7DA 1KC3A 1V96A 2IIVA 1U1DA 4N65A 3V2HA 3TIGA 2GX6A 4A16A 3LX5A 3SE0A 1YR8A 2HDHA 1DAEA 3GT4A 5FI0B 2QN7A 1KQNA 4Z2AA 3K5PA 1JEEA 1RKVA 5KQSA 3D6VA 4EA9A 4K0KH 3CHYA 5GONA 2UAGA 1O87A 2TECE 2R7NA 4NBUA 4YAEA 2MSKA 4IZHA 1JT2A 4L6AA 4FQ5A 2GYUA 5FPSA 2PJRA 5IKOA 3TVDA 2CXSA 1E9DA 3HVUA 4WCVA 1G17A 3NIBA 1COZA 3OZBA 3EVNA 4C4XA 2X40A 2GBLC 4EMSA 3PQ8A 4UOEA 4J75A 1EFCA 2H4YA 1TJNA 1HDIA 3R0IA 2WYWA 3GPLA 4ARBA 3ADKA 4ZEVA 4DR7B 1MORA 2EBUA 2BQRA 3ELWA 3GNLA 5MN6A 2R8YA 2NM0A 4C2BA 4NY1A 1QHNA 1QYCA 1YDHA 1Z8FA 2COGA 4O3OA 2WMOB 1W4LA 2JJ8A 4DANA 1QKKA 1TD9A 3SVLA 2Q4RA 5LOVF 3GLRA 5LP6A 4CEHB 1C1DA 2QLBA 4OX9B 2P9QA 1YS7A 3O7WA 5HRAA 3K09A 1R4MB 1L5SA 4KQFA 3K0FA 3CUVA 5CHEA 1KGDA 3M3HA 1IN5A 3TMKA 2VDKB 4XGKA 4HUQB 3ITEA 4YRZA 5KCZA 5GP1A 1V8OA 1W85B 4LZOA 2PU5A 4AO6A 3AP1A 3G9XA 3RVRA 3TD6A 1BS2A 2BGTA 4LC1A 4BX0A 2FXVA 4PN3A 3G5LA 4DG8A 1TUEA 3SZLA 1CZOA 3FFXA 2PD4A 5FLEX 4LTNA 1YFKA 5F4ZA 2H4FA 1JA0A 4DR3B 1EEHA 4O7WA 5E1MA 5CIQA 5D5PA 3U81A 4EBEA 3WBFA 1BROA 3ST7A 1DQYA 2HBRA 3HR7A 1RJGA 5GV7A 3NC4A 4XEHA 3OEHD 2H8KA 5A3RA 3QU5A 2ZATA 3EK2A 3FLBA 2C97A 3PXGA 1YZFA 3TQSA 4A15A 2ACEA 4O4LA 5EIXA 4YO8A 3N74A 1O95A 1CKEA 4YEDA 3B13B 2GH1A 1OREA 4JX8A 3HADA 4CM6A 4JOSA 5KC9A 3GV8B 2JLSA 1RWQA 2J8ZA 1V6SA 2VJAA 1XTUA 3CM0A 2V8BA 1PNQA 3EDRA 5TQ0B 3UJCA 2G0TA 4XSVA 5KPDA 4NEGA 5JANA 1ZHSA 3OLQA 3MWFA 4FJ2A 1CR4A 1KI9A 1J8FA 3EZGA 4D02A 5CD9A 1H3NA 3PYLA 1DKLA 1CDEA 4UCUA 3QWIA 2FLKA 4YO7A 5TY0A 1A8PA 1Q84A 5BR1A 5DKFA 1EPUA 1MB4A 4LHVA 4OPMA 1YWGO 3AGPA 2FQXA 4BWVA 4J1NA 3KO8A 5EHIA 1MDBA 2FSVA 5KYYA 3PXAA 4WJKB 2CD7A 2XB6A 3PO2G 4MVJG 1K08A 2QD5A 2R9VA 4LJ4A 3RLIA 1DAGA 4R1QA 4RKWA 4AYTA 1W0KA 1QC5B 3UHFA 4KQCA 3TBHA 1LPPA 1PP4A 5IASA 2I4LA 1L3BA 2XGOA 3MJFA 2D7JA 4EG7A 2O8BB 1UBKS 2FWRA 3V46A 2B4QA 2VCEA 1RJDA 4F3TA 1J49A 5TV2A 3D6MA 1K8XB 4F8JA 2FPSA 1OBVA 3BRSA 4LVUA 5AESA 3HTXA 1BE1A 2JA8G 4TM8A 3DWFA 1WMDA 1BEUB 5I7FA 2ORVA 4JV1A 5LA6A 5NLLA 2ZS9A 1N6KA 2JLWA 4D4MA 3OUUA 2WWRA 3AHGA 4DV6B 5AKLA 1LDNA 1ZCZA 1VJ5A 4YRNA 3UV6A 5FULA 4Y2UA 2V7BA 1FMJA 1N6PA 3NBQA 1PNVA 4D43A 1K6IA 3HKCB 3FYTA 4W7SA 4LC0A 5KFFA 3RIEA 3OOWA 5PGMA 4ZAWA 3R74A 2ZSJA 1NUSA 4CUJA 2JEOA 4OH7A 2IVFA 1KDVA 4OYHA 4GGPA 3C7AA 3WV4A 4FGKA 4OHBA 5E3JA 1UINA 5KFTA 2W7PA 3IQGX 3HBAA 1PLJA 4LYHA 3P71T 1F5SA 4UJ5A 4LGYA 3IAS6 4IMPA 3ZLVA 3FGNA 2FB9A 4NNOA 1K8YB 3MELA 2EEPA 1IIBA 1D2GA 3HCFA 3JRWA 3EGWA 1G21E 4LF9B 2ZIUB 1K6EA 4ISBA 3BG5A 1SU4A 4BBSG 2EBWA 2C2GA 4GXRA 3A6HA 2E7ZA 4C7KA 4O2AA 3QOWA 2ADMA 4C4AA 4GF5A 4XQCA 1MB9A 3Q6IA 4B3RH 5KNDA 1K5PA 1AUPA 1IOWA 1L7MA 5DBOA 1GA1A 1DLJA 1MZPA 3PS9A 1FTWA 1OXUA 1T0JB 2O0MA 1QCDA 1EI9A 5TB5A 1BMQA 3MGAA 2EIYA 1JLHA 1R5JA 2Q27A 2O4CA 5GJCA 4C2TA 1XYVA 1FU7A 4O4IF 5EIEA 2KX7A 2ZUCA 4EHKA 4AS2A 3Q3CA 4KZPA 4KXXA 2OAGA 4JLUA 4CMCA 4EW3A 5EKUA 3T7AA 3IDSA 4DIMA 2HVQA 1U8XX 5K20A 3QEJA 4ER0A 4R7ZA 4GM4A 3UBMA 1O96A 2NZUG 2QV7A 3GOHA 3PGA1 3P45A 2WNSA 2WY2D 2Y1FA 2CUNA 2Q6KA 1XRNA 5DBHX 2UYHA 3A28A 1B4DA 1JI0A 4XX1A 5FUWA 3RUDA 4MRPA 4FWBA 2UV8A 3OT1B 4QOHA 3CH4B 1AMOA 5IBPA 2C3UA 2H4ZA 5KCMA 4Q4DA 1W44A 4OM8A 5JECA 3MT9A 3ZHSA 2D1QA 4CYMA 2A0WA 4R6WA 1RYZA 3LPNA 3M5DA 4KXLA 4LN1A 4Q9HA 3JWHA 4MHOA 4BQRA 2PMFA 4Q3EA 3PRYA 4DA0A 1P0CA 3KV1A 1T4CB 2B2NA 4XM1A 2R1VB 3IDAA 4Z3DA 3T3DA 4DCSA 5K8LA 4MV7A 1JUDA 4IO0A 5BYBA 3VH4A 3EVFA 2YBEA 4F3NA 2GERA 1EH5A 2GBCA 4J9RA 2Z2XA 4OEHA 3DDSA 1X9NA 4INJA 1PDOA 4R1PA 3DHVA 4GX1A 1EX1A 4WEQA 1TEZA 4Q3BA 1BWRA 4OP3A 3Q7PA 1XXLA 1E3MA 1C9YA 2IFTA 2DBRA 2AA3A 4M1EA 3IJ5A 2JKVA 3GROA 3KV3O 5KVAA 3CZ9A 2VPWA 4V2IA 3RAQA 1M5TA 3WHIA 4NEQA 4ROTA 4PZ6A 1W0JA 1TLFA 1WZEA 1USKA 2R00A 1K6MA 3R3WA 5C52B 2NVXA 3RTEA 3G2MA 4MYSA 1OY1A 3D5EA 3A05A 3A3PA 4WNCA 5E25A 1YL7A 4E4RA 3IR6A 4NABA 3K8ZA 4BNMA 5KT6A 1XU7A 4D0NA 2PSEA 1E5VA 3KTMA 4XUDA 3E7PA 2CV2A 3REQB 1X8KA 2HZBA 4AQDA 5IJ0A 1F4PA 4AJHA 1N5IA 3GU3A 1QV7A 4IHJB 5DI3B 4MLDA 3Q8LA 1PR5A 2HQSA 1QFSA 4B6GA 3RSCA 3AHEA 5AI9A 1R0RE 4E3WA 4K05A 1O95D 1X7ZA 2JEZA 1L1EA 3WGQA 2VHVA 4JJZA 5L4SA 4JQCA 3JR7A 3G1UA 4FMPA 4KYIB 4WLOA 3DBHB 4XDGA 5JNUA 5JCOC 2NUPB 5F7JA 5C3EG 4C78A 2RH5A 5JARA 1J1IA 2VL7A 5DF1A 3AM5A 4M99A 4HGZA 3AUYA 1LSSA 1YUMA 2OZLA 1GZ3A 4TXHA 1D6MA 1GNRA 3OF2A 3EOAI 1PSDA 2FFJA 1TK9A 1IATA 3MT8A 1FFEA 3KVYA 4A0SA 4A2BA 2H08A 4LOAA 2E2HA 1QZXA 4W8HA 3VAYA 2XCUA 3NG1A 3CKKA 2ZITA 3GX1A 3PXCX 1JXQA 4I5IA 2AUTA 3K9CA 5AJTA 1Z82A 7REQA 1W46A 5K2OA 3E81A 3K0KA 4PLFA 1OXMA 3ZHRA 5JVDF 2R92G 2A5JA 3FHCB 3TUJC 3ZJTA 3WYFA 3HP4A 1FRFS 1L2ZA 3T61A 4TXJA 4BO0A 1W0KD 1E3LA 3ESBA 5CT6A 1J0CA 4ECZA 1WHTA 4JYBA 5KOJB 1ADCA 3RT9A 5L3QA 1NBHA 5JC1A 4D3FA 1A9QA 2NQTA 2VDUE 1GG2A 1ZCFA 3VQTA 3DBIA 3HU5A 3KAJA 2SHKA 1W76A 1VGQA 2HWYA 7MHTA 4PLTA 1OX4B 3NBXX 1TZKA 4YP9A 1BQEA 4MV6A 4JKOA 4CV2A 3KC2A 2X7JA 4O8CA 1WF3A 1SKUA 2C07A 4M1WA 2PFGA 4LHEA 4GP6A 3W5HA 2JCBA 4HDKB 1F2VA 1PNOA 3TAHA 3AEZA 2CXQA 4HDSA 1GHTA 1T9HA 3KU1A 4Q1AA 2W2MA 3Q85A 3HB1A 5FBZA 1CK4A 1KYIA 3W9YA 1OF1A 2GCNA 4CT5A 5I5EA 3DFZA 5KBYA 5A3SA 2VYVA 3TFOA 3FNFA 2HNBA 4NBTA 3S5JA 2VG8A 4P5DA 1DG3A 3B3AA 5JAZA 1JKJB 2OZEA 2OXCA 3GPIA 5BRAA 4KLAA 5FV4A 3DMRA 1SBHA 1S0MA 4ABYA 5JXWA 4X66H 3A37A 5ENVA 2EW1A 2GEUA 4O2RA 4CF6A 4AQ7A 2UUAH 3P26A 2W2TA 4C5BA 4MGIR 1V95A 1UXIA 2FXIA 3G0DA 1FX0B 2OGUA 1ATZA 2P35A 2O8VA 2ZR0A 2CHEA 2OHXA 1TCBA 3IV7A 3ZV3A 3RE1A 4GYYA 1ZVVA 1GGFA 2AN4A 3GQBA 1MW9X 3FROA 1XA0A 3HN2A 4N4AA 1UIMA 2AUNA 4EI2A 1YZKA 1DT3A 2FHPA 1J09A 2TMGA 4BIIA 1VSQA 4XSHA 4R8LA 4E2YA 1KKUA 3Q7EA 1S3SA 4BMVA 3P27A 2I4OA 1D2CA 4TQGA 2NU8B 1QH1A 2G9VA 1IBMB 3UAWA 5T5QA 2AK2A 1WUTA 4YK7A 3FPBA 1FJ2A 3ZWPA 3QJYA 2AF3C 4PRYA 4Y6PA 1TTHA 1YU6A 4ND5A 5DK6A 4NENA 3S24A 4QPJC 2XB4A 5F1YA 4RSMA 4YT8A 3KJHA 2GQSA 2V8OA 2LIPA 1ZNXA 3HGTA 3G23A 3IUJA 4JLJA 5KQGA 2ZRMA 3LCUA 5I9MA 2V7GA 1TYBE 1E98A 1K06A 4MGEA 3I4CA 2NO7A 3R3JA 2JA7A 2O8DB 4BB9A 1HFJA 4CKXA 4DR4B 2PQ0A 2R2AA 3AEUB 3V48A 1ZP6A 3T3OA 1CNFA 1TB4A 3KDSE 3NTLA 3BK7A 4ZHQA 2BYTA 4FBLA 1L5HB 1L4EA 1THMA 1C0LA 4QSHA 2WKWA 1X1TA 1T3SA 1E4YA 4KQHA 2D5AA 3TCNA 4BMPB 2RGUA 1LJLA 2BCGY 3HZHA 4P7JA 3WL8A 4D4JA 1J1UA 2XF8A 3OZVA 1GWNA 1D2RA 1J9ZA 2PLWA 2J5RA 4EJ2A 1KBOA 1XNRB 4NULA 4YHHB 3NOXA 1GPYA 1Y9DA 5SZHB 3R44A 4D5EA 1ZRSA 3PFGA 4P7FA 4S1TA 1P0IA 4MUGA 2N3ZA 4CIWA 1IBLH 2CYBA 1CFJA 5C8ZA 1V8BA 4TTAA 3K2EA 3WYGA 5JHHB 5FTMA 3VNAA 1ZBQA 3HL0A 1EDOA 5AW8A 5IBCA 5CXUA 1LLFA 3B53X 3O2QB 4DSAA 4EO9A 4F4ZA 1FNMA 1U8AA 2O8FA 4TLDA 4MW2A 2PK3A 3SD7A 1JSZA 1UCFA 2FPGA 1E66A 3FDSA 1XVAA 3I72A 1Z08A 5ALRA 2C99A 4RKYA 5K51A 1GZ6A 3GAZA 2H9YA 1XRSB 1KK2A 4CQNA 1JKFA 3NW9A 1VSVA 4KKVA 2FSSA 5CXXA 1Z4JA 2R1UA 3HKEB 1Y89A 2HOQA 4GMGA 1Y7IA 2JFHA 4OHFA 5JATA 4DCGA 2VATA 2YL2A 1S3GA 4YRLA 1RXVA 1W0JD 2ZI6A 2MU1A 2PKRA 4JYCA 1Z4KA 3VR6H 1MOSA 1KDZA 4IJKA 2X77A 3OPNA 4ETSA 1OXXK 3HCDA 2QMQA 4KYTA 3H1EA 5TPZA 2DWOA 1H0SA 3RB3A 2X1LA 4NMMA 4Q7KA 4AMBA 2UVPB 2GKGA 1TMOA 1OXVA 4EHAA 4G09A 2C58A 3L0OA 4IUDS 1V47A 3WRWA 1JSLA 4QUDA 1DNPA 3OX2A 3AESB 4E14A 4OHVA 1ZM9A 5LB2A 4B7XA 3I2FA 1K98A 3ND8A 3F5FA 3RT1A 1XLVA 4H59A 1J39A 4MV0A 5JYCA 3HK2A 2YMMA 4FMCF 1KBLA 3JTMA 4LZNA 4CM7A 3RS7A 2OK8A 3N2NA 4KE6A 5EWMA 4RJJA 3SLRA 1I4EB 1U02A 3D4OA 4IDFA 3F3MA 3N07A 4TWZA 2Y6VA 1IBRA 4F9FA 1RKXA 2P2DA 2V7PA 3HUUA 1BNCA 4ZO7A 5H16A 3PZRA 5I5XA 2BM1A 5DNCA 1UQTA 3SJAA 5KYWB 4ECVA 1IEXA 5HYVA 3MJRA 5EP4A 3QLUC 4IGFA 3BM5A 4ML3A 4JNCA 3BEOA 4ZGGA 3IKMB 4XYBA 3DO8A 4HADA 2GZSA 1G8PA 2ZWOA 1E5LA 1OJLA 4EI8A 3FPSA 5KJ6A 1Y82A 3M9OB 3CUUA 2XWJI 2DWCA 3MWLA 4X8OA 1USGA 2WAQE 1MAHA 4CFSA 2EJ2A 2JJ2A 4QIWA 4FX2A 2IPMA 4AP9A 4BV3A 2I1QA 4OHUA 4H6PA 2H1HA 2Y66A 3DT9A 5EMKA 4XWOA 1VSUA 2FPOA 2H4XA 2O2HA 4CNQA 3VPGA 4UQLA 1EFDN 1KIAA 10MHA 4ZVTA 4E5NA 1A9XA 13PKA 2CCJA 2BMFA 3MINB 5GADl 1HT1E 3EZLA 2I6TA 4OQEA 4X84A 4NBKA 3R09A 4HOYA 3OICA 3DKKA 4IFEA 1QGDA 5DNDA 2WM3A 1CUVA 1VCHA 1DP4A 2ZB4A 4A2QA 3VU8A 3QVOA 2HSEA 2GN8A 2ATIA 1J25A 1II8B 1C7QA 1YK0A 2GEDA 2AGVA 3OCCA 2VXOA 1WNTA 4JJ6A 1I4DD 3QGMA 3RQSA 4NXNH 1SQGA 2Z02A 4TQSA 2IEAA 1OA0A 5H9WA 4PC1A 1HNXH 5B3AA 4AY5A 3ZH2A 4M8KA 1HQKA 1E6KA 3QEKA 1OTXA 1SZDA 4ZOLB 3BGWA 4MWOA 1W94A 5AVKA 2VYVD 4PWZA 3MR2A 4L4SA 5GTDA 2X42A 4XOUA 2WHXA 3GCWA 4YACA 4QBIA 1JHPA 4J0JA 2BEWB 3H04A 1N6RA 4XIYA 4U8GA 4YUVA 2IIBA 4MMZB 5EINA 2QZ4A 3WNQA 3TNLA 4MDYA 3SI7A 3MNFA 3W05A 2Y0DA 3KQOA 4N3NA 4CETA 3HXTA 4OMUA 1KPHA 3OPYI 1V4YA 4J90A 5HGJA 4E1VA 3R4VA 1UBHS 1WE2A 2PNJA 4ZO4A 2Y1OA 1MAAA 1P2VA 2AKYA 4PF1A 2FFAA 3ZW7A 2NU7A 2V4RA 1Y1WG 1T6ZA 2E85A 4B6RA 4BJ3A 3FBGA 5KTRA 4NZPA 3CRQA 5G02A 5JWHA 4I6GA 3WP0A 1YC2A 3MF4A 3WNDA 5HVNA 2RGAA 2VS1A 5REQA 2P11A 3S2GA 1OBGA 1CY0A 2KM1A 2A9JA 2CXXA 5BWTA 2PIDA 1XCGB 2VJKA 4PTZA 3ESAA 3GJYA 3VZQA 3JYPA 1Z15A 1NHWA 2XRFA 1X2BA 1FXWA 3KWLA 4BLUA 3EZFA 1XDSA 4DQUA 1WG8A 4LY9A 1U2SA 2WIAA 3GFGA 1Y4ZA 4IY1A 3CA8A 3FRIA 5KYKA 3DFUA 1GZVA 4D81A 4K81B 2YU9A 5TQVA 2W6PA 2YWJA 5EJMA 4A5SA 3GF4A 5H5JA 3NHRA 2HRRA 1BEZA 5EIFA 3D3EA 5CPBA 1YJBA 2AFHA 3VZSA 3NWBA 5JRJA 3QUSA 5DE3A 2XE8A 4IFTA 1HNZB 3OE7A 2CFIA 2CLFB 4XFJA 1SELA 3D0RA 3O75A 3NEYA 4KRGA 3RASA 1Q6YA 1Y9AA 3L1VA 5ED4A 3WNVA 4HQNA 1CEXA 3OF3A 4YTEA 4JI4B 4KGDA 3GCGA 5J4VA 2HXYA 3H9JA 3G82C 4OHYA 2BIFA 4KBFA 4LYGA 1X87A 3GDWA 5JDIA 4KRXA 1Y8QB 5JLAA 4NC9A 3MRVA 1NVVQ 4F56A 3NAQA 2VT2A 4IRUB 2N47A 4LDAA 3OTHA 4HDCA 1J2EA 4WCFA 2WUFA 4XKJA 1M0TA 1Z17A 4WZBA 4ZZIA 4ED8A 1T2FA 1AKNA 3O6VA 3HO8A 5J5VA 1ATIA 3AO0B 4MA0A 4B44A 1EUCB 1G42A 5ERGB 1PBTA 3IN5A 5C4XG 3KVRA 2OKGA 4YHBA 1AQJA 1FC0A 2C42A 3SZRA 3DEAA 3GUCA 5KIAA 4RLQA 2D5BA 4MPDA 2NZ8A 3S2FA 1UPBA 3N6RA 3THXA 4NKRA 3UW3A 1KO7A 3JATA 3VNNA 1RMYA 3CLVA 1LWOA 1UMCB 1JEJA 5AW4A 3FJ1A 2HI0A 2XNCA 3PRJA 2RHBA 3OCYA 1JT9A 2B1GA 5F1KA 3IEVA 3UAZA 2DETA 3HXOA 2VEDA 2G08A 4X85A 4ZI2A 1UBGA 4PYLA 6ADHA 4GMHA 2IYWA 2PWPA 1JSRA 2C5HA 1KJJA 4BNFA 1MVOA 5AVRA 3R5SA 4H6VA 1ZDMA 4TTTS 5AUPB 2OO7A 4ABTA 5CJJA 3NNNA 1P62B 3DMYA 1KU6A 5TPZD 1UMDA 1Y63A 3UJ9A 4A3GG 3MUOA 2G1PA 3NWJA 4DCJA 5JJIA 2DTXA 3MHTA 1VZ3A 4X1YA 1MCZA 5FBWB 2QTVA 4L5AA 4X65B 2HJHA 1MX1A 1UDRA 3FWKA 1IN8A 1T94A 3MGBA 4C20A 4I55A 4P4GA 5C4IA 3E9NA 1SK9A 2YDXA 3KKLA 2N0SA 4JIMA 4PE5B 4E1BA 1PHPA 4XQEA 2X1HA 1C9EA 4BLWA 1KP3A 2NZWA 1YI8A 2ZEJA 1F2UB 4ECAA 1KZ1A 5IP5A 3FCUB 3D4LA 1FP6A 5AJUA 1ZLXA 3A1DA 1N3YA 1IZ0A 3LDUA 2ZUWA 5FL7A 2VYNA 3OC0A 1Z63A 2COUA 1RRCA 2JF0A 1DL5A 3IBFA 1M1NB 4INOA 4DRXA 2VHUA 2X8JB 1WEKA 2W6MA 3Q8WA 2AUMA 3GGGA 4EHFA 1E4OA 1ICIA 3PXEA 4DJAA 4I2VA 3EULA 4LNAA 4HSEA 3HJGA 2OG1A 3OHPA 4B3MB 2VUTA 1GUAA 3UM9A 4GKKH 4AAYA 3F0TA 1OI7A 4GGMX 4R31A 4QXOA 3DPIA 1AH2A 5ALSA 3JQ9C 2P78A 3ESXA 3UT5B 1DAHA 4CBVA 1LWNA 5JJCA 3CKYA 1E3SA 2IEGA 4ALIA 1JG2A 2JJ2D 4MYUA 3WLMA 1XZCA 1KFCB 4DHEA 1JLRA 1BXGA 2J09A 2QTMA 1O5IA 2G82A 1TKAA 5CYFA 2ALZA 3WTBA 1FDSA 1F8YA 4D8XA 5EIHA 3WZLA 4JI5H 5KYXA 1I14A 1UFQA 5LOVA 4X5OA 1Z6YA 3WHPA 3ON5A 1DJQA 4IIJF 1DFHA 4QJFA 1M6VA 1H4SA 3L8EA 1KAMA 2GNOA 5DI9A 4GSYA 4EAAA 3CJTA 1E2DA 2YBDA 5CURA 1H3EA 5CFRA 3PFIA 2EGUA 1J5EB 4UCRA 1A8SA 4DDKA 4AKSA 4CLDA 3F2IA 2FYTA 1V39A 3CVVA 3MGCA 1EVZA 2BR3A 2FZVA 1L4UA 5L40A 4H7KA 4BLQA 5CCBA 3U3KA 1S1MA 1B6RA 1OFUA 3OZUA 1ECFA 3ZE1B 1UZNA 2PL3A 2PMDA 3JVIA 4WBNF 3MBIA 4ID3A 5LJLA 3EDOA 2HNKA 2QBYA 3PQEA 4C2MA 2AYXA 1N34B 2HWWA 4QDJA 1B8NA 4S04A 2IHBA 3AL3A 1MV8A 1IULA 3B1YA 2GRJA 3T0IA 4J43A 3WLFA 4A92A 1KI1A 3MYRA 4O0LA 3DBOB 4QULA 2I65A 1YFLA 1KC7A 3VVBA 5EERA 4EW6A 3BWYA 3Q3JB 3CPSA 1NI4A 2ZM5A 2ENWA 4A26A 3S28A 5I7OA 1TU4A 5H81A 4HC4A 2RGRA 1HTBA 3NANA 3P0JA 1TU0A 2G77B 5A4AA 2NGRA 3VZBA 2ZZKA 2JCXA 4NYEA 5JCJD 3JRXA 3VI4B 4RM3A 4MTCA 3C8MA 3VZPA 1NR1A 3AIIA 1WZ2A 2IZ1A 3LUKA 3G5TA 2GKSA 4BHTA 1R0KA 2R87A 3IT1A 4EPYA 3DMGA 3AR5A 4TUYB 4ZCMA 4HNRA 1EB8A 2PANA 4ARZA 5JNWA 1Q11A 1VYUA 5IJXA 4KV7A 2OV2A 4HNSA 1VCNA 4KH1A 2AE1A 4QUBA 1SC6A 4UKDA 3CRW1 1JR6A 3R6WA 1FMTA 5IM4A 3RFFA 2HBQA 5JFTA 2F43B 1W36C 1G16A 4ZDJA 5K7SA 1EX7A 3M4YA 5DGAA 2FPUA 1KAGA 2PGIA 3OQOA 2EXXA 2VUIB 2FQYA 1L2TA 1QK5A 4J1QA 4LY0A 2UUCB 4EFKA 1D7OA 4A3BG 3UJNA 1DCFA 4D4LA 1H69A 2VSNA 2BCJQ 3L5KA 2FEAA 2WAAA 3MUFA 2P4EA 2BFAA 4RAYA 4R1TA 2AXNA 2OENG 3AUSA 1M5UA 2R7ZG 2DR3A 3OE7D 4EBFA 1CP2A 2YZMA 4YV1A 3VHLB 5K3FB 3R6GA 2OSVA 1JG4A 2G88A 4V3BA 1VLHA 2I6UA 2XA1A 2YWCA 2WFAA 3H2BA 1TFUA 1AV6A 3FETA 1I0LA 5EZQA 3KREA 3DEFA 5LSAA 4Q48A 2GD6A 1NVDA 4WW0A 4ED0A 1UJCA 4G8DA 4N7JA 3I52A 4CIVA 4EBCA 3H20A 3PIIA 2WJHA 4B43A 2A0UA 2AI1A 1DIRA 5JSFA 1M9NA 2D2XA 4RK1A 2POCA 2H1LA 3P19A 1XDGA 2X8AA 4PYQA 1ML4A 4UE3S 2QAGA 4URXR 3RJZA 3OJFA 4G9EA 3P9SA 3NDPA 3PEYA 2DFKB 5T3YA 3M9MB 4CV3A 3C16C 4BNIA 3RVNA 3PHLA 1RHMA 1AHPA 4BLTA 2C94A 1JKIA 5LDDC 1X74A 1Y37A 2GBLA 3WBBA 1USUA 1MV5A 2WR8A 2AJ8A 3MOIA 3Q9UA 1SQSA 2JBAB 1JQ3A 2OESA 2NOAA 2G06A 4NV0A 4HNUA 1EFUA 3X1MA 4II2A 2C4TA 4QICA 2KS6A 5FUXA 4DMFA 2XTJA 3LDAA 4L74A 1E7YA 2FLVA 5CT4A 1HRDA 1XVIA 2O5VA 4JS0A 5B6JA 2CDNA 3TL3A 4R1LA 1VC2A 1AUOA 1R4NA 1OJ7A 3GJZA 4D0RA 2FK7A 3MWGA 1W5FA 3U62A 3FAZA 1U2PA 3MFHA 3EZXA 1OKKA 1F2TB 4LWPA 5EJ6A 1ZX1A 2C2YA 3ROEA 1J23A 8ABPA 3D6UA 1LF0A 4HQFA 3V1NA 5K45A 3DE0X 1A04A 1SXPA 4Z7OB 2H1RA 1E7WA 4DIBA 3ZD6A 4QFBA 2B21A 4ED1A 3ZWYA 4CG0A 2Q21A 4QM6A 1G8GA 4CCYA 4GSKA 3PFBA 2QNIA 1JHXA 2I2CA 3HKBA 1RVDA 4AUNA 4JA2A 2CJFA 1H6BA 2OMEA 3BMCA 5FPQA 2HSZA 2A2ZA 4FVTA 3I09A 3TBKA 1CUEA 2Z1NA 1O8BA 1EVKA 2QVYX 3V8VA 3IO3A 2VYND 3GPDG 2YQ4A 4S0XA 1KZ6A 4DBVO 4IMJB 3A6ZA 2Q2OA 3RTCA 3GJXB 1SGWA 4B3DA 5KNCH 4RNMA 3W06A 2QYHA 2UZ0A 3L8GA 1I6KA 4EFNA 2W4QA 1LS6A 2DFLA 4AJKA 2VPQA 3EWNA 3YASA 5F73A 2TS1A 3GA0A 5BR8B 3VOTA 2R8GA 1L0BA 4FB4A 3MJHA 3WADA 2MMCA 3F3SA 3H84A 2DQYA 5KX5F 2L2QA 3KCNA 2ZYVX 3RB4A 3L7JA 4W5WA 3MSXA 1GL9B 3CS3A 4PZCA 2V58A 5CA1F 4NONA 2LBPA 3KAPA 1SXJB 2IY7A 5B4VA 3OM1A 3SHWA 1I1MA 3DS8A 2XVAA 1ZGCA 1KFEB 3WLIA 2IBTA 4C0QC 4WINA 1JDUA 4XWTA 1IPEA 4NCNA 4KQ1A 1VE6A 3FYUB 3LX6A 1QQ5A 5DTMA 1JLMA 1TT5A 1LPNA 4U6SA 1SCKA 4DQ0A 1SG0A 3L06A 1Q1NA 4DLBA 3UJBA 1NSYA 5ALYA 2ECPA 3I9V1 5AI0A 3G8YA 1DV2A 4ENUA 2J45A 3ZU4A 3L01A 3EQZA 4PRKA 4COOA 1OWMA 3AL0C 1P9LA 4RD0A 1U8ZA 3AVTA 4DDTA 1ZW1A 4US1R 3WMRA 3PDIB 1F38A 3E03A 4ZICA 1K7CA 4P4TA 2QMYA 3QUAA 2A5LA 4O1HA 3GB8B 4LDZA 3U40A 5LLDA 3GIDA 5IUNC 3FSEA 3R3ZA 3V1MA 1VPEA 5C1OA 1U7WA 4LZWA 2G0AA 4Y0VA 3QLVC 5K0CA 2EDCA 3VTKA 5CMLA 2HJGA 2O2GA 2R4TA 5JC8A 1N7JA 3WZ2A 2QXUA 1K2VN 1AOXA 1B1AA 4TS3A 1Z4LA 1XG5A 1DAMA 1U6KA 1PU2A 2I78A 3UMJA 1WMAA 5BUCA 4W1PA 4G25A 2RI0A 1JU3A 3RBVA 3LCJA 6YASA 3VGPA 3WRYA 2WM8A 3SIPA 1FVXA 4AWXA 4J3JA 3VHQA 4DMMA 4YRSA 4R9NA 4YPFA 1I2KA 1EK6A 4WVFA 1NVWQ 2H31A 4J7XA 2MR6A 3UWMA 1CW2B 3H8JA 4GECA 3ZZ0A 4LYEA 2OHFA 4BLVA 2ZE7A 4Y2TA 3B1KA 1KJIA 1AB6A 1C4OA 3LF2A 3HBNA 4G0XA 5IC4A 2PLNA 3F9CA 4ZV9A 3AR7A 4OSEA 4EEXA 2ZJYA 4UNIA 8GPBA 3TXAA 3N28A 4ZYWA 1RYNA 5E6UA 5I5VA 1IY8A 1MGOA 2JGDB 1YRAA 5HXAA 4LF5H 4FC7A 4TV9B 4NYJR 3K9QO 2FN8A 1ZD4A 4UM9B 4PYKA 3LV8A 1YIOA 4CLRA 1H9BA 2ZCJA 1Y7TA 2VYCA 2ZYTX 3NBYC 4HH1A 4JR1A 4KFTA 4HTFA 1QGUA 4OSPA 4JI3H 1IN1A 1ENYA 1J2TA 1NVBA 3THRA 5FNZA 3KQHA 3HG7A 5GM1A 1I7QB 5B12A 3DW1X 1QBKC 3S8YA 1VHTA 3V55A 3E70C 3U4HA 1NRIA 4CODB 3T9BA 2W9BB 3T3MB 4TKVA 4NMXB 4KMSA 1RHJA 3CTPA 3SHQA 3X2EA 4EB6B 3DFKA 4L75A 2WNIA 4ZPXA 1FUIA 4CF7A 4HZGA 1F7UA 1SOMA 1AGRA 4EZIA 1FY2A 3UKOA 3KKNA 2Y1GA 1OYVA 1WR8A 5JYBA 4P34A 5A6SA 1XQ1A 1MJHA 4HYQA 1Y5NA 2IZ6A 5JQWA 3TW8A 1TF2A 4WL0A 1UP6A 2IXTA 3F6CA 2LDBA 1SVIA 5BQFA 4X97A 4IDQA 1OU4A 3T06B 2JFXA 1M10A 1E1MA 3TZBA 2H2AA 3TTTA 3WWCA 2GXQA 2BEUB 3HJAA 4XXHA 3U56A 3L8MA 4EQ5A 4J1SA 2REBA 2E49A 1EK5A 1ZA2A 1F60A 2HLHA 2CC2A 1R8XA 4R8KA 2XGPA 2VDMB 3UMGA 2C84A 4AWAA 4YONB 4A3SA 3LW8A 3CH5A 2P75A 1T5TA 4U7PB 2XE7A 4BO9A 1L7DA 1GNLA 2EFEB 2AS0A 3BTVA 1KQ3A 3FVRA 3KYCB 5M34A 2P9HA 1RWVA 3FKIA 2RHHA 1QHGA 2FLPA 1N75A 4MW0A 3D7LA 3HN6A 2FW0A 4XVRA 3E61A 1AXEA 1QF6A 1XTBA 2F8TA 5H80A 2BDEA 1VL2A 2BM0A 4LNHA 1X3LA 1XLUA 1TO1E 3M7IA 3LKDA 3RU2A 4MR9B 1ZNQO 1YVEI 5HM6A 2Q1YA 5G0VA 3GTOA 1I5RA 1QRRA 4TTVA 5JUWA 1JHDA 5DO9A 4FJ0A 4IJMA 5KAMA 5DZSA 2ID4A 3IPXA 3O4GA 3HH8A 1RKQA 4PG4A 2FKAA 1IXKA 5EJEA 3B1VA 4ZEXA 4F7WA 2IP1A 4F8YA 5FV7A 3TIFA 1L5LA 2A1UA 5JQGB 3EHDA 2JZOA 3WB1A 1YRLA 2JW5A 4LCEA 4X1IB 3QOXA 1B14A 3OE1A 3HS3A 5J4KA 2Z9BA 3NHWA 4UTVA 2P30A 4R3NA 2YMLA 2DHDA 3C4QA 5LN1A 1EJ2A 3DONA 5H4GA 4O7NA 4XUCA 3DUWA 1SB9A 3HYTA 1N9KA 1LI7A 1FW8A 2VRCA 2P6MA 1GRRA 4ZEMA 4R1UA 4KK4A 3QK7A 1KFKB 3K53A 5A5FA 2Q99A 2Z43A 2CLCX 4KAFA 4LHXA 3RREA 2C4UA 1Q2UA 6AT1A 3R3VA 5SYMA 1R66A 2AQKA 1T4GA 2GWRA 2WIDA 1I3MA 3O4JA 2XUZA 2INGX 1E0KA 3QH4A 2WVAA 2ATLA 3KKMA 5KMGA 3LM8A 1ISFA 5CDGA 4FFBB 1NUUA 3UPDA 4ZI7B 5FFFA 2B63A 4GBMA 4J91A 5BMVB 1I8TA 2REXB 3WLHA 4DR2H 4FFDA 3TOVA 3W5DA 1XTKA 1EK0A 5AJVB 1Z0UA 2PMEA 1QYDA 5M5BA 4BNHA 4X93A 1YGPA 4J0IA 3A9RA 3QBEA 1T0HB 1T2AA 3G79A 4AJIA 2BMJA 3T7RA 3DLHA 4DV4H 2PCJA 1AD2A 3ZHOA 3AW8A 3SU8A 1ET0A 1G7SA 4BWFB 3P8ZA 1YI0A 4PZ0A 2C2XA 2FHSA 5J47A 1YJXA 1PGOA 5T4BA 2DT8A 3LWDA 7ADHA 2Q2VA 2B1QA 3E7XA 3CUKA 4CKCB 3KHRA 2X8BA 2RAUA 2XZOA 4UFNA 1I3LA 2CLLB 3LO8A 2HHFB 1U81A 4MVJH 2KBEA 1G5FA 4YLEA 1DIKA 4LV5B 4NCHA 1GU7A 3EB9A 3UWSA 2WHPB 2XCIA 3FD8A 3RYIA 4IXWA 3RBAA 2GBFA 1W4ZA 2ZR9A 3H8WA 3PW2A 4V02A 4YAFA 2A9RA 5F21A 2OO5C 5BR7A 4M88A 3GIQA 5BSHA 1H5UA 1LPMA 1KJZA 4OKSA 3AVWA 2CXPA 2QLTA 1U63A 3PJGA 2JLAA 2HIHA 2YCBA 1G4HA 5ES3A 3OZDA 5DISB 4ZODA 1EGHA 2JGRA 5I7AA 1B16A 2I0FA 1BHO1 4EM6A 1SCNE 3HHEA 2CK3A 4IL5A 4Y1FA 3MTBA 3PT9A 3SZMA 1RXEA 3C0KA 4F6LA 2N1BA 4JJFA 1P80A 1ZK1A 3IAM1 4KGZA 1XEXB 1AQLA 3SZUA 3SOZA 1WSCA 1Y1TA 2ZJ6A 3OJLA 2JLQA 4HLCA 3U26A 1WSAA 1W2WB 3ADBA 1X6VA 3TR5A 5LWHA 4A10A 4DMUB 1JG3A 1UDCA 2TSYB 2V3CC 3LO5A 2NO5A 2BZSA 4MPPA 2JNWA 3IP8A 2EP8A 3GLGE 1PGJA 5A9SA 1D2MA 1PVVA 4E08A 4XJVA 4BEWA 3EXG2 1EFKA 2YOFA 1OLXA 2B35A 3BQMB 3AOEC 4HVTA 1BN6A 4HDNB 2PGDA 4JUAA 4A8JB 4RNCA 5CP8A 1LRJA 3STXA 3CFYA 2IODA 4CDGA 3KQPA 1FNSA 4DPMA 2CT8A 3UJ6A 4LXQA 4CLOB 1RWOA 3SBEA 3LW7A 1Y1LA 3WK6A 1U6JA 1LZLA 2CHQA 1MAWA 2ZAMA 3B3JA 2XE4A 1W0CA 2QENA 1U9ZA 3RAXA 1ZZGA 3S44A 1T0UA 3HDYA 5PNTA 4N3GA 2Q4DA 3IBTA 3EVEA 3KLBA 5DT9A 4ZT4A 3RYTC 3NALA 3GLHB 1P9WA 1WHSA 4N41A 1SIBE 3IUPA 4M0EA 3D0KA 5CEEA 4MQ5A 3PGLA 3QTTA 2Q62A 3K1YA 3IT2A 1KEKA 3RBEA 5LMUB 3QKRA 3HLYA 2P2YA 3S70A 4IW3B 3I8SA 4L08A 2GAIA 3OE5A 4RWZA 4KJXA 4JVLA 4HXFB 3EPRA 3KR9A 4IIGA 3M6VA 4J0KA 1DARA 1DC8A 3W4IA 4O86A 3LJKA 1V3UA 1RQLA 1WDTA 4DA9A 3FMGA 2IV2X 2EF0A 1FKAH 1Z7BA 1YJAA 3HN7A 2WQ6A 1IBSA 1QH9A 1QRTA 2IPOA 1UKAA 4E70A 2EL9A 2XUKA 1JHZA 2Y4RA 4P36A 1IN6A 3PC3A 3HJFA 2RGYA 4WZAB 3TLMA 1ACMA 2HX1A 2FF7A 3TRKA 3H11B 3WJAA 4LHWA 3D2LA 2PXAA 3ZV4A 4K9PA 4LF8H 4BVGA 5F2NA 2VWPA 4KI0A 1C7IA 1EBUA 1NYLA 1J22A 3LXRA 5KNDD 3R7FA 1EE1A 3OPMA 1RXIA 4CHIA 2HCRA 4M9SA 1JAIA 4J9VA 1ZCBA 3HDHA 2BGJA 3ROTA 1NFFA 1XTTA 3H5AA 2ZQYA 2VAVA 4GMFA 2EKQA 3JWGA 1PG2A 3TX2A 3A27A 5L53A 4I9UA 1NMZA 3U2QA 5KU1A 4W5QA 5JH7A 3VJRA 4FIDA 4FE4A 3AHJA 3NBUA 2BGIA 4QW8A 4DV0H 4WHMA 4R2WA 4F06A 1Z74A 4MKRA 5FUBA 3OOSA 4I36A 3HXPA 5GONB 7MDHA 2NZ2A 4FC6A 2AN9A 1B93A 4OVKA 3F8WA 3GGJA 3LUAA 2ZT6A 1A76A 5EI5A 3WY9A 3AJEA 3T7JA 4GUDA 3GXOA 1I3NA 4B9AA 1BC5A 1VRWA 1ZNYA 3O8CA 4L57A 2JI4A 3RR2A 1XZLA 2XCSB 2XQIA 3WWPA 2O9JA 1LQUA 3DZCA 3QM1A 2ZJ7A 4UNSA 1L6IA 1WCXA 2C35B 4I1PA 1QGYA 5HS4A 3L6RA 4RAOA 2Z09A 4PBSA 1Q0ZA 3LG2A 2F59A 4EF5A 3LTEA 4B81A 5L7TA 3TXXA 5DHRA 2G07A 3H97A 1GTMA 5JSYA 1F2DA 2OPHA 3UTDA 2ZJ1A 5LP6B 4KYVA 1C1DB 1O58A 2GF0A 3WAJA 4HPXB 1I1HA 4G85A 1M6NA 4ZCTA 1TC1A 3K0FB 3HYLA 1PFVA 2WW8A 1R5NA 4N5DA 2QW1A 4YRAA 2WTEA 2FX3A 4RDHA 3LXXA 2WJZB 4MWGA 3BJYA 2FLNA 3BJIC 2VCHA 5EGNA 5CDFA 2QR5A 3LT4A 2F6RA 4PZEA 3UCEA 3ZY6A 2ZPTX 3GP3A 1M34B 4RIGA 5LQNA 1RHQA 5DYIA 5E4FA 3CRRA 2XVMA 2BKXA 1CZLA 1RXCA 4CM5A 4AKIA 2WT8A 1LNZA 1WQ4A 4RTSA 1GPBA 2OAP1 1BXKA 5ICMA 5AVZA 2PSSA 1R7RA 3AJDA 1GSAA 3HUDA 3HB4X 3QLJA 3SEFA 1WBDA 1I33A 5B4TA 3I4NG 4UD2A 1OBFO 4E31A 1XD8A 5AKGA 2UYOA 2W8ZA 5AXAA 3KVVA 4N3AA 2IYVA 4O4LB 3GOQA 3RB0A 3QLUA 4HGPA 4Y6LA 4DR1H 1HORA 4JI1H 1YR3A 4KEAA 4U3JA 3KBBA 3QEBZ 1FLDA 4BKUA 3BACA 4PXSA 2DBZA 4M6WA 4BP9A 1PQ4A 4GIBA 3CF2A 3OP1A 2DCUA 1JKMA 1EBFA 4B2PA 1DIHA 2XUGA 1N5DA 3VYSB 1FQKA 3SX0A 1RK5A 4FYJA 2C1XA 4QRHA 1C0PA 1YB4A 2ZOSA 1JJ7A 1G5TA 4H16A 3NUGA 4DWOA 4JSTA 2CFMA 3ZDEA 2OLEA 1JHOA 1OR8A 1RJQA 2J08A 2CD9A 2CK3D 1X0VA 3DXZA 1NF8A 1ZY2A 3CO0S 4RDCA 4DYVA 3V4LA 3MTQA 5LQCA 1UDBA 5KYYB 3K0CA 3H2IA 3WKCA 4RELA 1G2WA 1FJHA 4BQFA 1ZC3A 4AFNA 4WT7A 4WXPA 1C9NA 1I9GA 2SCUA 4H6WA 4RD2A 4LYFA 5B1SA 2IS2A 4YR0A 5AP9A 2GVNA 2JLYA 1IH8A 2Q3HA 2CJWA 4XFDA 4A03A 5FH9A 4FSXA 2D7DA 2BISA 1FUUA 2ZWMA 1ISRA 1XDNA 3BWVA 4MVJM 5J1TB 3GHYA 1UT6A 4Z9BA 4KQXA 1RLUA 5TJHA 3ANXA 2MYTA 3H1AA 5ETJA 1PT8A 4PGHA 3PTAA 5TQJA 3KQVA 4G0VA 4TYMA 2ZUSA 4RMHA 3L40A 5DNWA 5JASA 2IUFA 1B15A 1AK9A 3FW1A 4EKDA 1UXOA 2HXGA 4OHCA 4FEAA 5LA6B 4RQAA 3HXQA 4KC0A 5H83A 2QRUA 1GNPA 4ND1A 3BXZA 5K0NA 4GEKA 5HF6A 1ZA1A 3I4LA 2J59A 1S3IA 1ZIYA 4F9TA 3FDIA 2H4HA 2YJ4A 4P2GA 5M04A 3TW6A 5L7WA 5A2GA 2G7MC 2CNOA 2YASA 2O06A 1T8YA 5H9VA 4M9UA 2PKQP 1KXJA 4X8LA 3FXAA 2KLBA 2RFLA 2GFHA 2Y27A 4MV3A 3HCWA 3HCNA 2BGLA 1E2NA 3E7WA 4CKBB 3CW2A 5IX8A 4G5HA 5DM0A 3E27A 1Z5PA 4BLPA 3O3CA 4RK0A 3MYYA 4G4IA 2XWBF 3U6BA 3PB3A 4PX5A 1V6AA 3AG5A 3JQBC 5HZGA 4TVIA 5KVVA 4XIGS 5C7YA 4UUOA 5KTYA 3ZIAA 3QG5A 1PFGA 2GBGA 4ED9A 4ETIA 3M4NA 5B6PA 1DT5A 5CEFA 1K4MA 3N53A 4P3YA 4ENQA 1S97A 2R2GA 4O2AB 4I1UA 3USES 1N78A 4DCCA 4WBNA 3CUWA 4KO1S 1Z6TA 4PZ7A 4RPHA 1DIGA 4P83A 1GYRA 4G3IA 3ILVA 2G7ZA 3DOOA 3G59A 3ER6A 4HAXA 3PE6A 4O0MA 2B7CA 4L0CA 2PKCA 2WV7A 3PHCA 2H3EA 3OZSA 4ED2A 4JUZA 4QYWA 5CVCA 1Z2NX 1Z7GA 5FQOA 3GT0A 3I6QA 2H1VA 4JI6B 1OA1A 3DOHA 5K6RA 2QTCA 3KJFA 2PUCA 1SIOA 1KYYA 1L3CA 4HRVA 4NHOA 1TW3A 2ODAA 4BXOB 3CUEF 4BO2A 4G24A 5HQTA 3WK5A 4TV8A 4XB6B 1QU2A 2XT6A 4QAJA 2ZT5A 3DDWA 4F21A 1ST3A 1O96B 4C0HA 3D02A 3S3TA 4C1BA 3A14A 3D8HA 4BBZA 1W4BA 1WB5A 4TSFA 3JPWA 4W6ZA 4XH9B 1O77A 2OVBA 1YTUA 3HRIA 1WXQA 3BRQA 2WJJA 3D8NA 1SEVA 1PQUA 3R0XA 2IYFA 5KFUA 1JHUA 3OTQA 4ZEWA 2JH9A 1CKNB 3IL2A 3EEIA 3UOAB 4AZSA 4F46A 3JYHA 4OFBA 4PC3A 1DC6A 1HLPA 2FP3A 3F7OA 3PIDA 2H1IA 3PE3A 1YDEA 2J4DA 2YXLA 1QGED 1H2YA 2N9UA 1W4CA 4JC4A 1FPMA 3NRBA 4CMBA 1ND5A 3ZLTA 1Q95A 3EXG1 4EYSA 3VM6A 3KEQA 3ND9A 4H4EA 1WH2A 2L0XA 3GRRA 2Z4TA 3BIOA 4JV5H 1PNTA 3V7YA 4P5EA 4IYJA 5JCXA 3BDVA 5KG4A 1PSZA 1N2JA 4RVFA 1ZMOA 4LDNA 3BH0A 2LTAA 1MB3A 5G4KA 1U28C 4KG7A 1PJAA 1ORWA 5IT9A 1PO7A 2BGKA 4CM4A 4E2ZA 2PTHA 3PXBA 4LSMA 3RIYA 1NP3A 1PRYA 3IULA 5DH9A 3JWJA 4WFIA 1G5PA 2J30A 1TWCA 2VLBA 1A4XA 1KRHA 1H1DA 4L4RA 2C8VA 1IHYA 1DIAA 2QPLA 4IOKA 2Y76A 1OZHA 3O4VA 2F64A 1WXIA 1ML3A 4E0BA 2PUTA 1W48A 3GRAA 5IPFA 1HETA 1TTQB 2HTEA 5A7GA 4L85A 4D0GA 4MVJI 3S6JA 4G23A 2WOJA 3S2EA 2G4CA 1WV1A 4YASA 4MYRA 1L4FA 2PMZE 2GEFA 3VR5A 3G3EA 4RK4A 3L4SO 3PUJA 4KBGA 1RK6A 3DR3A 4U4AA 3ZE0B 5A6VA 5JSZA 2ZRNA 2FW8A 5SY9A 5IC6A 4R7RA 2JFWA 2F3PA 5IJ0B 1Y1PA 221PA 1N0IA 1AIPA 2I6XA 4Q9KA 1KZ4A 5AW2A 4DLTA 4B46A 3ZKWA 2B94A 2FE3A 1BA2A 1NBAA 2NVUA 4HDOB 4YB8A 2CNVA 2HKIA 5CT9A 2ZRFA 3V8MA 3PHBE 1X7ZB 2ADFA 3QTLA 2CCGA 5D1PA 4PEVA 1FTGA 5E1DA 1EFVA 2R66A 4WZZA 1A96A 1P5RA 2NADA 4A3MG 2BOVA 3DLCA 3NIGB 1KIMA 3O83A 2R79A 3KETA 2FZWA 3WLEA 4N5LA 3PPVA 1KPGA 2B61A 3JQ9A 3C6YA 4HCJA 3SBDA 3MR3A 4ROSA 5LU8A 5LVAA 1RT9A 1U3UA 2DFDA 2OZLB 1CB7A 4Z0TA 4EO7A 4A93G 2AW5A 3HJRA 3IAXA 4XVUA 5KTSA 5DAAA 2JHFA 2UUBH 3R5XA 1TIKA 2BTEA 4EP1A 4EG3A 1NG1A 5BOVA 2CY0A 4RCNA 1TM7E 1CUFA 3C6BA 1M33A 2ETVA 3ESDA 1JZSA 7REQB 1WDLA 3AYZB 3E3OA 1V7QA 2I76A 1NXPA 3Q8KA 1S2GA 2XUOA 2CFOA 1KERA 3PK0A 2HHHH 2Y0SE 1YS6A 1B8VA 1DQZA 3T5GA 4AS3A 1O6BA 2GARA 1OAAA 4Z49A 5AI4A 2F1JA 2Q3FA 2PA3A 5CAEA 5JNSA 5EZ5A 1YDWA 1DX4A 5HJEA 1A4UA 3MBKA 4P0PB 2OQIA 2H07A 4G36A 1P1FA 5B58T 1WHTB 3HXKA 3VOSA 3NBKA 3PR1A 4QWEA 4PC6A 5L3QB 3QYJA 3S40A 4TM7A 4A3DG 4ZCQA 3M6FA 4LYYA 4NJOA 4CFYA 4JB0A 5A4KA 3T7KA 3PZPA 4UEOA 1ZOPA 2DIKA 1OZGA 1DAAA 4D97A 3SSAA 4HK4A 2ZBRA 3GQCA 1JIJA 5EKDA 3AUTA 1TC2A 4QNMA 4QZVA 4HDSB 5DU2A 3SYNA 3VMFA 1YONA 4EHIA 5B2ZA 4RMGA 1T25A 1VFPA 3NI2A 3FLMA 1CJMA 4MQBA 2DF8A 5B30A 3AI1A 5I9BA 4MGZR 3WDSA 2E3JA 3I2YX 3H16A 2BTOA 3CC8A 2XOKA 2C7PA 3CCBA 9ABPA 5AFSA 2CDBA 2I1VB 4EARA 1KYQA 4FWTA 2XY4A 4M83A 4Y1GA 3CQ9A 1ZOSA 4PSUA 3OD1A 2XIJA 3JVEA 4BNVA 4CC5A 4K3UA 2GN0A 1ILEA 2ASEA 3WSTA 1OGIA 1RVV1 4N7BA 2XX3A 2XGJA 4UEWA 3JSLA 3AYHB 1SD5A 4Y2RA 2IJGX 4J7UA 5BOSB 5AD1A 5JWRA 2GRUA 3GQBB 1JPVA 4IWYA 3ZIAD 1RAGA 4RAZA 1W4RA 5ALZA 4OB7A 3OTOB 3BK1A 4RH3A 3E4DA 1Z5WA 3HJNA 5I6DA 1AA6A 1KZ7B 3BTOA 4LFCB 4ONEA 4PS0A 5BSTA 1R0YA 2YKGA 3M6UA 1KAHA 3FWZA 3VTZA 2PH1A 4MVJE 3RH0A 1QH1B 1KT8A 3KRTA 3U7RA 2FRXA 4XW2A 1LNSA 2DLCX 1V16A 1UBFA 1XXHE 2ON6A 3LE8A 2QUKA 3RKUA 1RYFA 2E5FA 3ROQA 1TD1A 2YJTD 2ZSHA 5JAIA 5CM0A 2H57A 4NENB 2BI8A 2P1DA 1OAOC 4U2DA 2X4IA 2D62A 5DM1A 1WNFA 1KMNA 2KHZA 5EVCA 3SKVA 3IGFA 2AVDA 2W83A 2ONKA 4UUNA 1FLVA 2BKAA 2BFDA 4F2GA 5EE5B 1W88A 1C7ZA 3FSRA 5C34B 3IP3A 5A0TA 4QBGB 3ME5A 2C5SA 1JFRA 4Q3AA 3E2PA 3AETA 4RV4A 4NK4A 1PK9A 2ZVDA 4HB3A 4D8UA 4TSFD 3HR4A 4UUBA 3ASVA 4GZ6A 1VLZA 4DVGA 4FKMA 1T34A 1ZZEA 4ZHQB 2ECKA 1Q3HA 2ODNA 5D85A 1E1CA 4PLCA 3DO5A 1D07A 3ROFA 4QVGA 4YRMA 3ED1A 2YQZA 4JI0B 3ELYA 5KYVA 3WWDA 4P8RA 2WJ3A 1TCCA 1PZMA 2OUIA 4LZPA 1AU9A 4GICA 4IJ6A 5ARBA 1SMKA 3WRVA 1YIAA 3RIMA 4RMNA 1FMFA 3QVGA 3KD3A 3R0VA 5EIAA 2C2DA 1RM4A 1X1DA 1KOFA 2VNSA 4ND8A 3PQCA 4ZYUA 2WT9A 3FNQA 3HWX1 2BM9A 4UCFA 5CG2A 1NVXQ 3FNHA 4UTRA 5EY5B 2QP3A 1VBNA 2Q0SA 3ZJ5A 3DFIA 3RKRA 4WV3A 4XUEA 4QQ8A 3A2KA 4AW9A 3NAZA 1ULUA 2AFIE 4EZBA 2WU0A 5E6RA 3AUJB 4DCUA 4UAUA 2O8FB 3CZPA 3WR5A 4G5YA 4G2TA 5CJPA 1R3UA 2FPGB 3QWHA 3BXGA 4HS4A 2XRMA 2DWUA 4F2WA 1CJSA 2EKDA 2CXUA 1SQFA 5IF3A 4IOLA 4GI2A 4S3MA 1TO6A 2GSWA 1DRVA 5FWAA 1B2LA 2JBWA 1Z2OX 4OHOA 1DBWA 3CZRA 2I3GA 3RGXA 2BE9A 5EIOA 3BL8A 4PYOA 1GGEA 3EW9A 1E8MA 3FOBA 1UBNA 2I6QA 4ANFA 1DC5A 4HL6A 1AG9A 4A3FG 3QXJA 1NLUA 1NNSA 2Q2QA 2PFKA 4I1OA 3IT3A 2IU0A 4FQ8A 3OQHA 4K1LA 1JLKA 3VR5D 5CH5A 3BTUA 3RDPA 1N6NA 1YBHA 4EABA 1MFZA 1Q1AA 3F4KA 4U7JA 3VPSA 2SKDA 4I81A 2EP5A 4L5IA 4JH0A 4GC9A 3DHYA 3ZTTA 4IMRA 1Z47A 4AX8A 2NXWA 1E3DA 1ZI9A 3MUEA 1WBJB 3IEKA 3DFMA 4QREA 1YZQA 2H4JA 4GC5A 3SSMA 3IAEA 4H0NA 1ZOOA 1GSOA 4EFEA 5EE1A 3I04A 1P61B 3C7TA 1BE6A 2I9PA 2QUHA 4Q9LA 1G18A 5AKHA 2Y6UA 4O4IA 2AEFA 5J9FA 3BXEA 5EWMB 2WSIA 2MTBA 4E30A 1RQNA 1I94H 3PW7A 1B3BA 1AQNA 1SUWA 3QBTA 1Z2DA 5CFQA 4Y2XA 3RU7A 5EVJA 4BY1G 2H6EA 3EIUA 3GNQA 4QFDA 3SZOA 5E9QA 3B9QA 1I7LA 4QLOA 2ACKA 5FL7D 2DB3A 1DTEA 2FLLA 2YY7A 2ZBDA 1PJZA 1PJ4A 4F4FA 1VL6A 1OB5A 5EIWA 1S4MA 3VSEA 3ZV6A 4B75A 2LWIA 3GY0A 2EJ3A 2OV1A 5LBIA 5A5DA 4OM7A 3W2TA 4N1AA 4C87A 4LISA 1ND6A 4X62B 4RVCA 2H54A 4LRWA 1S8FA 3OURA 2HU2A 1L5NA 3IX7A 3RB6A 3F7MA 1M2VA 4P3KA 3WLJA 4QJIA 4DR6B 4X7RA 1U1GA 2WD7A 3SCZA 2WUEA 3K9BA 2R86A 4KODA 4D41A 4L9RA 1IQ0A 2XNHA 1ESMA 2OM6A 4D3SA 4YDQA 2ZZMA 1HXHA 1FQJA 2JFFA 3VH2A 3NASA 1U8CB 3ZWKA 1IBKH 3WMFA 1PYDA 3CVUA 2BBSA 1PSWA 1GPJA 1P8AA 1ECLA 2JK1A 4KN6A 4ARSA 3KQTA 3E8SA 3MGKA 4K28A 4DTCA 3VYWA 1CYEA 3T8YA 2IHVA 4O84A 1XMOH 4H3SA 5KWEA 4Y8VA 2BGWA 2Q2TA 1V9PA 4LDRA 4G63A 2PGNA 2LRHA 2OXIA 2DPLA 4DV3H 4YC7A 3PT5A 4MKFA 3ZK7A 2ZRCA 4EX7A 1L7EA 3KJEA 3VTAA 4RQUA 3MFIA 4EVIA 2W37A 2J5XA 4OAPA 2IXFA 1O97C 1JQBA 4AROA 4UBLA 4MTDA 1V1MA 4B3JA 1XTVA 1DJMA 2V74B 1CXZA 3U17A 1ORTA 1GEGA 2OHJA 5LB4A 4ZOCA 4PIVA 3NFRA 4MUHA 2FMTA 3W2GA 4FIZA 1Q7GA 1IY1A 1HOXA 2XOKD 3OLCX 2O6HA 5IT9W 3GHHA 2E18A 1Y6FA 3T5CA 1XR3A 3H0GG 3PI6A 1RQ7A 4M89A 4F45A 4NYMR 3NBMA 3RS2A 3DKRA 3TTUA 1YI1A 4MAFA 2CV0A 3F8NA 1NHGA 2YWHA 2DUNA 4HWTA 4A3EG 2RG1A 4Q24A 3PRHA 4GYWA 1H8EA 2NU7B 1WU7A 2XKKA 1QVRA 4ZQHA 1Y5LA 1KOLA 1BAPA 1EWRA 5I4BA 5FYQA 4BUJA 1DBIA 1WZIA 4UVHA 3VNSA 3ZQKA 2G72A 4NOJA 4RHCA 5REQB 2AEJA 4Q43A 2CNDA 4JHLA 3MQ4A 5BQ5A 1TA4A 3GV7B 4B7ZA 1OZAA 5SV2A 4F60A 3OKCA 2A5FA 2C7VA 3O84A 4CN9A 5KFIA 4IKEA 1PJ2A 3PA6A 4ME6A 1BVUA 4A0FA 3ESQA 5L1JA 5AKZA 1GT91 1EVJA 1U1CA 1XRLA 2EQ5A 4YIKA 1CQIA 5J4LA 2MYPA 2RKOA 2FE4A 2V1UA 4R3UC 1YIDA 1VMAA 5SY4A 4C2AA 1B73A 3GLTA 5JVDA 1WJGA 3QMPA 4K40A 2J6CA 3MMXA 5DHTA 2Q0HA 4E6EA 2WJWA 2VR1A 2V7WA 5EIBC 2J3MA 1NDUA 2Q5IA 5K3CA 2C2KA 2VWHA 4WASA 3UHOA 4UBMA 2B78A 1CUWA 1VE9A 5TXGA 5BYJA 4Q34A 5IXYA 1CRWG 2KB0A 3FPJA 8MHTA 5J40A 4OGKA 3EDYA 2YZ7A 2ANCA 2HQBA 3TLAA 2CLIB 4JCOA 2UXBB 1PV4A 5IZ4A 1EGAA 2BPOA 2XXAB 5AK0A 3QVMA 5HE8A 3RWBA 1RJFA 2ROQA 4TYNA 4J9QA 3IE1A 5IYDG 5B58C 1JPUA 1DXYA 4RTKA 3H3JA 3PX7A 1TM2A 4C0JA 1X9IA 3AIKA 3UMRA 3H4MA 1LLDA 1C7FA 2RB4A 3OM9A 4WZBB 1TYDE 4RZ3A 5EXXA 1BHSA 1PZHA 1CT9A 3ZWVA 2FU5C 2BR4A 4JBGA 5K3SA 2JFVA 4FN5A 4IIYA 3W7BA 2PRYA 5F76A 5DVZA 2AYYA 1KH3A 3QX8A 4LOLA 4M4SA 3ZE8A 4AG5A 4E32A 2OZPA 5C51B 2NO1A 3EZYA 1M8GA 2BMEA 2NVWA 4JEMA 1TAQA 3THXB 3WWOA 2H2GA 2CKDA 3AERB 3JATB 3LRTA 3TSOA 4R2KA 1K7SN 2Z5LA 1ZMTA 1E0DA 5HQJA 1V41E 3WL4A 4Z86A 2EBHX 3RTAA 1CUIA 5CFMA 2VPPA 1OBCA 2BGNA 3D59A 4GQAA 5DCYA 4DHWA 4YJ3B 2WYIA 1OGYA 3JAWA 3M1LA 4QXPA 5I9TA 5EN4A 1J90A 4RUAA 3TAXA 4Z1MA 1JL3A 2Q6TA 2AD1A 4BMYA 1M2OA 4G0ZA 4EKNB 4BTEA 5THXA 1WD7A 1G60A 5A2QA 1BFDA 4U1RA 5ARCA 3L6BA 4GKAA 2XDAA 1BJRE 4R05A 1VL1A 2KJQA 4YUAA 2YXNA 4B33A 4MRAA 2QTVB 3ZZMA 2IF0A 3CONA 1E4GT 3L1HA 2WYOA 4ZVMA 3T1HB 1YT5A 4Q1EA 4HNVA 4GOLD 4QNRA 1T1GA 3LBFA 1OKKD 4I55B 3S7TA 2FWPA 2YWGA 3KT8A 1CY7A 1JYFA 4M49A 4FYKA 1EUDA 3FUWA 2ZIGA 5BN3A 2Z08A 1NF9A 1N2SA 2XZPA 2C5AA 3A1UA 2HMAA 3BQ0A 1LPSA 5CK5A 1PX2A 4LSZA 3LCRA 2BGUA 4MUEA 4KNWA 4GU5A 1W9HA 4FR5A 2GN9A 3UUGA 3DAHA 4LWQA 4N47A 4MICA 3SIWA 2FF5A 2YXEA 3R76A 9LDTA 4Z0PA 1Q17A 1QG6A 4CLHA 3GRYA 3T3NA 5IAOA 2WUWE 3WDKA 2YRWA 2GPNA 5BN1A 3C3PA 2EYUA 2VAXA 3PFFA 3PP8A 4YAOA 1JIHA 4XE5A 5I5GA 2YJ5A 4BS9A 3VR0A 2PO5A 3HDQA 1ACJA 5JZ9A 2XTZA 3P9QA 2OAQ1 4I14A 4FS8A 4C2UA 3P0RA 3UW1A 3A1TA 5CHYA 1A4IA 4PYJA 2Z3VA 2DE0X 2GPJA 1IQUA 2VAPA 1G5RA 4S0ZA 3CURA 4IV5A 5DNUA 2A3RA 5AKIA 5I5YA 2XVYA 4JVNA 3MTEA 1R9TA 5KYXB 1N25A 4B35A 1HX7A 4FFVA 5ALGA 3ISTA 2IHUA 2EZ8A 4CMDA 2ZPUA 1UPXA 3V3KA 3BMOB 3MJSA 2OO5A 3BWBA 3TW0A 5F7ZA 5HF9A 5JCOA 1G291 3A8TA 8ATCA 4Y6SA 4FZRA 1E5QA 2IOFA 3P9RA 3UQ8A 2Z6QA 4UTOA 4QWDA 3V1UA 2I71A 4HZUA 3HB9A 1KNQA 3ZPXA 3HVRA 3EX7C 1VSTA 5FFMA 4Q0MA 4BQPA 3R3XA 2J4CA 2EWVA 4YA6A 1QH0A 1ZH0A 3TB4A 2WC1A 1EFAA 1PR0A 5IVHA 1DS6A 2E37A 4UDXX 3QIAA 3O0TA 1KY2A 3QUCA 4Q9AA 3QYPA 4HH0A 3M6IA 4V1CA 3ELUA 4Q8FA 1JAZA 3LULA 3MCUA 1PLLA 4KMMA 1K27A 1LW7A 2XEXA 1LDBA 5TEVA 4D9HA 4P4UA 3DOUA 4KXVA 3TQIA 3HVHA 5L1LA 4EYIB 5E1OA 3A2NA 4W5TA 3GZJA 2GA8A 5BVGA 1Z4IA 5KQPA 1IYEA 3EIQA 1NI4B 2PH7A 1DWOA 3R7BA 1U65A 4UXJA 1B8OA 3H9GA 1GZ7A 2JJYA 4EUHA 1M2WA 3QY9A 5FI5A 1H8ED 3ABQB 5EPEA 4RFLA 1BYIA 3MVEA 4O25A 2DULA 1DTSA 1F8GA 1YRWA 1FU8A 2V3VA 2GZ3A 3TQTA 4UPEA 2UZ3A 2ZXFA 4N3BA 1HYHA 3ASUA 2Q49A 1QMPA 3GEEA 4RJ2A 2NPFA 4BB6A 4ARZB 2BHTA 2WTFA 4REMA 3N1UA 2A88A 4WD3A 2BW0A 3SQMA 3TIXB 1J00A 2QN9A 1N2BA 2WZDA 1UXHA 5B36A 3HEMA 2D1YA 4I99A 2WI8A 1P5JA 3RROA 1QONA 4AN4A 4YJ2F 3IP7A 1D5WA 2X0FA 2HM7A 1L4GA 3JQDA 3L0PA 2C4WA 3S2UA 3EFEA 2QG6A 1AKWA 2FOLA 5HZHA 2FW1A 3GN2A 5TMEA 4I4TF 1GUBA 3LX4A 3RGG