3JSLA

Crystal structure of the adenylation domain of nad+-dependent dna ligase from staphylococcus aureus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the adenylation domain of NAD(+)-dependent DNA ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA ligase
total genus 107
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jslA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3jslA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jslA02
1A0IA 4JI5B 3L2PA 1I94B 2UUAB 4LFCB 4LFAB 4JI2B 4AQYB 4LH7A 4UCTA 3SGIA 4UCVA 2VQEB 4DV3B 4PZ6A 3TY8A 3NBYB 4JI3B 3BABA 5FPRA 1XNRB 4CC5A 1HR0B 1XDNA 4DR4B 1N34B 1N36B 4DR7B 5FPOA 1N33B 4LF5B 1IBMB 4UCOA 1HNZB 1CKNB 3T1HB 1XMOB 3T1YB 2UU9B 1N32B 5D1OB 1CKNA 4UCRA 4LF7B 3JSNA 4JI6B 4CC6A 4JI0B 4GKJB 4DR5B 4DV7B 4EFEA 4JYAB 2HIXA 3W5OA 4PZ8A 2UUBB 4DUYB 1FJGB 4YY3B 5LMNB 2HVSA 2E5LB 1HNWB 4DUZB 4DV4B 2VQFB 3NC0B 4X62B 5D1OA 2HIVA 4DV5B 2UXCB 4TOIA 1IBLB 2HHHB 3GB8B 1CKMA 1VS0A 4NXNB 1B04A 1ZAUA 4DR3B 4LF6B 1CKOA 4B3MB 4B3RB 4DR2B 4DV6B 2Q2UA 3OTOB 5BR8B 1XNQB 4DR6B 4UFZA 3GJXB 4X66B 2HVRA 3UQ8A 4DV0B 2F4VB 1TA8A 4X64B 4JI4B 4JI7B 4LF8B 3RTXA 2VUGA 2Q2TA 4EFBA 4JI8B 3KYHC 4B3SB 1XK5A 3QWUA 4JV5B 4B3TB 4E6NA 1DGSA 3BAAA 3NBZB 2HVQA 3GDEA 3PN1A 5D1PA 1FVIA 3W1BA 4LF9B 4PZ7A 5DISC 4DRFA 3TY9A 1V9PA 3BA9A 3VNNA 4NXMB 4LF4B 4UCSA 3RR5A 4EQ5A 1XMQB 1J5EB 4UCUA 3BA8A 4JI1B 1X9NA 1P16A 5LMUB 4DR1B 3JSLA 4OX9B 4K0KB 4KHPB 4LFBB 2CFMA 2OWOA 2UXDB 4GKKB 1IBKB 2UXBB 4DV1B 5IWAB 1P8LA 1S68A 3S24A 4GLXA 3TY5A 4LH6A 4DV2B 2ZM6B 1TAEA 4YHHB 4X65B 1HNXB 4EEQA 2UUCB 3W1GA
chains in the Genus database with same CATH superfamily
1V51A 3AG2C 2ODTX 1N8RW 4PDBA 1I94B 4LMYA 3OGIB 4J9MA 3K04A 4YXWG 2R8GA 2QYZA 5D5PA 3STZC 3TY8A 2HHHO 4LF7H 3QG5A 4DXWA 4K8ZA 3RBZA 4X62H 3W7XA 2EJ2A 4PD4F 1IBMB 4I55B 4GLWA 2VWKA 1XMOB 5DQGA 4RZQA 4UVAA 1N32B 5I47A 1T36A 2IA6A 1OCCB 2NLJC 4ECWA 2Y48A 2V4QA 3CRRA 3CD6V 3N43B 2Z0AA 4DR1H 1VQOV 4C5BA 4BY1G 3E8HA 2BSKA 2ITDC 4O3QA 4Y8VB 3CEBA 5EYPB 3B09A 5KMGA 1ZWIC 3VOUA 3ZN0A 3CMEV 5KS8A 3GWKC 1AP5A 4RAIA 2R72A 5DGHA 3KHRA 4DV5B 2EIJB 4RUCA 3PR4A 4KL1A 5EIBD 3HKZE 1BGYH 4A3EG 1N34O 3MWEA 2EIKC 3ETGA 4O3RA 4I50A 4DR3B 4BIZA 3OW2U 2Y0SA 2QKCA 4LFAO 2R92G 1SQPH 3H3VH 4O84A 4U6PA 4ABMA 3MHHC 5CM0A 1WB8A 5I5VA 4X89A 1S3JA 2R6FA 1KECA 1I08A 1VF5B 3B40A 3UQ8A 2F4VB 4BY7G 3GIMA 2Q2TA 1GK9A 2YZNA 5I60A 2PVPA 2YYAA 2PMZE 3SYAA 3I5DA 5IYCO 3RN4A 1HNWO 4JV5B 1N32O 4MVZA 2WLHA 2W9BB 4MVSA 2QF7A 4IR1A 1M90W 2Q7DA 3W1BA 2HGWA 1IOVA 2QGNA 3K5HA 5LOVA 3T1HH 5IT9W 2IW5A 4O3OA 4NZMA 3TY9A 4R8UB 3EPIA 5KFJA 2YIBD 4X65H 1S0OA 2JA7A 3D8CA 2ZT9B 3K08A 2P06A 4JTCB 4BR6A 5FLMG 2JEFA 1SZXA 3JRWA 2VOBA 3F8NA 5J9PC 1FFTB 2GV9A 5C1OA 2QB5A 4JGSA 4X1YB 4DL2A 1I7NA 3LWBA 2HG5C 4IRCA 2B5UA 5CN0A 2WAQA 1KQSU 5K1XA 3RFRA 2EIMB 4FLXA 4CS3A 2F66C 4O4LF 4X65B 1BQZA 1H2GA 1FXVA 3RFCA 5H6RA 4YY3O 4LFCB 4IRDA 3GILA 2ZM6H 4EB6B 4X1KB 3R9RA 4WBNF 5HNEA 1KBLA 1EKFA 2R7ZA 4X88A 1WB7A 3ZHQA 1YDXA 4QJFB 1R3IC 3ABUA 4HNAB 5IDJA 4JV5O 3JATA 3ML0A 3OAAG 5K1PA 3KAJA 3QO5A 3A8TA 2DABA 4DR7B 1TGOA 1KEEA 4MVUA 3JCUZ 4DR6O 1F4MA 3U0GA 2Q69A 3F7VC 4TQRA 5KFFA 1M4UA 2FLNA 2YWVA 2GTSA 1M0WA 3VPDA 4I55A 2P6JA 3TJTA 3EFFK 1RP3B 4JI0B 1V4YA 3U10A 4GKJH 5J2UA 4DV7B 2HDKA 2Q67A 4TUYF 3CYOA 1S10A 1I0HA 4E4EA 3CEIA 4PZ8A 1M7JA 1V55C 4MVMA 3UO3A 4Z1VA 5DQHA 2JS5A 1S5LZ 1BL8A 1FKAO 2VUMG 3R23A 4JI4H 3E8FA 5KFDA 4J9LA 1EZJA 3JD1A 3GB8B 1CKMA 4P2ZA 4YB8B 2VPSA 3ABKC 4N23A 5KT5A 4A2AA 3BJYA 1NT2B 4DV4H 2CKZB 4A3MG 5JVDA 5B66Z 4YR2A 4JI8O 5EDWA 3QQMA 2HVKC 5BWVA 3T1CA 4C7UA 1TA8A 4JI0O 2CTWA 4XZ3B 1OCOB 4DR5O 2VQFH 1K73W 2BCCH 2NN4A 4F6RB 5DMXA 4ICGA 3RYHA 5DG7A 2WWWA 2R7KA 1L1FA 1JQ0A 1DLBA 1I5XA 2EULA 3LUTB 4YJ2A 1NVPB 4XYLB 4ED8A 2I87A 2DN9A 1E4EB 3DTFA 1FXKA 2KSDA 3UFXB 1WCMG 2V58A 4J80A 4I4TA 4C5AA 4IHJF 1XL6A 4ECTA 4Q45A 4JI1B 1TUEB 1RYRA 2IH1C 5CR5A 2W70A 3JSLA 4LFBB 1M1KW 1KJQA 1RPRA 4O81A 2KQXA 1LUWA 1XQ8A 2QJ1A 2UXBB 2YEVB 3JAMN 3GV8B 3O9OA 2OH2A 4YR0A 4ZHQA 4FLZA 3FD9A 2FPGB 4B3MO 3HPLC 5F2VO 1XNRH 2QWRB 4UXNA 5EBWC 4LF8H 2MK3A 3WB1A 4EEQA 1HNXH 4IZOA 1KU9A 1A48A 4KUMA 2X6BA 1S76D 2C2DA 4R50A 4YIPA 4JYAO 3TCUA 4O7RA 1VARA 1SS3A 4MV9A 5FD5A 3ABMB 2VQEB 4FFBB 2WLLB 3ZHRA 5C4XG 2VA3A 4F6RA 1QU7A 1JKJB 2YCHA 1G6UA 2ASDA 3SPJA 3FKSG 3N2KB 4LF4H 2BOBC 2R8KA 2FJZA 1H8HG 5LL6b 4WHXA 3K5OA 5LXTB 2HJWA 5JQGF 2QWOB 1WLEA 2DYSB 1S0VA 1IOWA 3BCCH 1RJQA 2ZXWB 2W6QA 4I50B 2JEJA 3AW8A 4MVQA 1I50A 3OMIB 4JI1O 1K34A 1PP9H 2JGDB 5KG4A 2VS0A 4YAJB 3RAQA 3MR6A 2PUSA 2FKLA 4RAYA 5JH7A 1BS3A 1E1QG 1F4NA 1ZTEA 5L3GA 3FKIG 5KFLA 1XMQH 1H8EG 1EHIA 5KMGB 1ZLZA 4O7TA 4YJ3B 5I5XA 4XDLA 4PV1B 4JYBA 1P49A 2HVSA 3G6BA 4YIOA 3Q8PB 4DV4B 3FYIB 3M9NB 3LSSA 4RU9A 1ET0A 5D1OA 1S03G 1SC5B 1GAXA 3QZ7A 4EKWA 4WFEA 4JPRA 2FMAA 3HKEB 2XAFA 4QWCA 4CKCA 4FMTA 5ITZB 3T54A 4ED2A 4JASA 1N33O 1Q43A 3B77A 3R66A 2XIGA 1Y67A 5C8YF 3ABLB 1D2DA 4ZOLF 3K06A 4JYYA 5KUMA 5KX5A 3Q8RB 4JV5H 3JD2A 4X64B 2Q7HA 3RYCA 1GN3A 1YEWA 3H1IH 4WBNB 3QWUA 2V5AA 2EIJC 2G38A 2HKOA 4NR1A 1Z2OX 2EIYA 4LF4O 1AJPA 3BAAA 2XD4A 3H1KH 3G6EV 3LP8A 2V4RA 5LMUO 3E35A 4IGGA 2CE4A 1E4EA 2E2HA 2X0LA 4ZI7F 1H2SB 1ZX3A 5EC1C 4YAKB 1J5EB 1YCIA 3QZ8A 5KT3A 3H4DA 1C3OA 5KX5F 1FXKC 3KHGA 5L3BA 5HV6A 4Q6GA 3GIQA 5DQIA 1BNCA 1WP7A 1Y74A 4LNUB 3RJ0A 4PDRA 2Y4RA 1NI8A 1KJ8A 2WLIA 2LFSA 2DPJA 3E8BA 1NTKH 1R73A 4UV9A 2RCVA 5GW7A 3DXRB 1WR2A 4D6TH 4A3KG 3ASOC 2PYLA 5JVDB 1JVMA 4MT8A 4ECZA 1XNQH 3PO2G 1GN6A 5T14A 1FD9A 2GLTA 5I5UA 3ZHTA 4QWDA 1IZ3A 4BIOA 4H44B 4UB8Z 4R6ZA 5B3SB 1TWCA 1XUQA 2A0LA 5KT7A 2EINC 2W9CB 5CA0F 2UUAB 4UCTA 4FFLA 4DRXB 4UVBA 5EK0A 1J95A 3KREA 5KFPA 1CE8A 2WTFA 3S3WA 2EJRA 3BQ0A 4DL6A 4J9RA 2R93A 3MFHA 3WU2Z 1QBZA 3CCQV 4A3BG 1T5EA 4H0LB 3ZRSA 5KG3A 2CW7A 3BPZA 1GN4A 4J42A 1PPJH 4WF9V 1AUVA 3RAXA 2PF4E 3CC7V 5B1AB 3H0GA 1PKXA 3JARA 1MZFA 3JAKA 1VAJA 3B4SA 3WFVA 5A2QN 2IJKA 5LHIA 3QFFA 2YXHA 5BYBA 2L6LA 4NVPA 3KZIZ 4F50A 3Q4HA 1EYZA 4H13B 3WB0A 4JI6B 1VQKV 1M57B 4MTEA 4KFMA 2Z02A 2CAZC 5J2UB 3O65A 3G6YA 4B3RH 3G8CA 5LMNB 4DUZH 2DWCA 2LFRA 4GX2A 3CJHA 3VOTA 2HIVA 2R93G 1WH2A 2EILC 1LNQA 2LGWA 2JEXA 4CHIA 1NH2B 2Z5UA 3AEIA 2UUBH 4TQDA 4ECXA 1D5NA 4LF6B 4HNUA 4D7TA 2YICA 4LFBO 1QNMA 1K8AW 3P32A 1COWG 1W59A 3GTOA 5BR8B 3G4SV 1KD1W 3ZMVA 3KCYA 4DL5A 2HHHH 4LF7O 1SKVA 1V54C 2FPIB 3M99B 3DSQA 4YY3H 2WLIB 1NS1A 2GQSA 3OFNG 4JI6O 3G6XA 2ODMA 4XDKA 1EZVH 3SPIA 1IBMO 2CNUA 4DUYO 1AP6A 4O2AF 3ETEA 4RB3C 2Q68A 3TINA 1SESA 4JI1H 2AW9A 4R8UA 2UXDH 1L2ZA 1O9HA 2FKXA 2DZDA 1HNZH 4TSFG 2WE6A 4CKEA 1V9PA 4FS1A 1A9XA 3PR5B 1OCOC 3B8NA 4DQNA 4AYBA 1LR1A 4PDLA 4QIWA 3OMAB 3T9DA 1P7BA 2RJZA 4RZRA 1GYFA 4ZQIA 1VF6C 1DK1A 1N56A 1VQ7V 3CSXA 5TISZ 1IX9A 3GTPA 4U3JA 4HNVA 3LNMB 4HN2A 1JIHA 2XUMA 2D2CB 4JI4O 1ZSPA 2YL2A 2W7PA 3OMNB 5CBFA 1S72V 3MHSC 1F23A 1K4CC 3CX5F 1D5AA 4J9PA 4EYIB 4TV8A 2WLMA 5JVLA 1S77D 2ZIOA 1K9MW 1JLLB 2ZR3A 3TQ1A 2ZD9A 3UZBA 3CCEV 2J6UA 1R3JC 4FFMA 4RB1A 4JI8H 4FM9A 5IYDG 4CC5A 3R5XA 4QW8A 2PI5A 4BWSC 5I5SA 4ASUG 5LOVF 1VQNV 4FM0A 3SR2C 3JAWB 4X1IA 5L1IA 1S5HC 1K3EA 5CMUA 1H2KA 3G8DA 5D8DA 3T1YB 1YHQV 2JIZG 2E3CA 4A93G 3R5FA 1HNZO 1KC7A 2P22C 4DR4H 5EC2C 4UVCA 3NUAA 2CTRA 2HR3A 4J10A 5I5YA 3Q8QB 5L3EA 4NB5A 4LWSB 3W5OA 1AVMA 4YY3B 1GGOA 3NC0B 1G4YB 1Q90D 4JV0A 4DL3A 2AGPA 4C2MA 1E4GT 1B6RA 2W0XA 2NVXA 1OBGA 5KFYA 2E5LO 5FNVB 5BR8O 4ZI7A 5CA1B 1GLVA 2KB1A 1VBHA 1NH2D 2YW2A 4Z2WA 3FMAA 1FJGH 2YIAA 4NZNA 3W7WA 1G8MA 2ZE7A 3JASA 2NU8B 3RIZA 4EBEA 3GJXB 5JUMA 1AUXA 2CGOA 2FK1A 2B9ZA 3HOZG 3IGAC 5B1AC 3DGEA 5B1NA 1THZA 4H33A 3Q2OA 2V7QG 2F1MA 3M8AA 1DV1A 1YF2A 5KFWA 5KHIA 3T1YO 3PW5A 1EUDB 3CRAA 3FAVB 5IJ0A 3NBZB 2Q0OC 2C2EA 5BWWA 3OUSA 2W0FC 4ED6A 1XL4A 3OM3B 4DV6H 3MAQA 3I55V 4TV9F 4UCSA 2XCAA 3A0BZ 4WFBV 5E25A 4UCUA 5C8YB 4MSWC 4LR3A 4TT3G 5IYZF 3T9FA 2WB1E 1PX2A 3KTMA 4BAYA 4B3RO 3AG4B 4Q20A 4DR2O 4KXRA 4DV3H 2WA3A 2IH3C 1XDCA 1TVKB 1GMGA 2YZLA 3T9BA 1PL4A 2YI9A 2UUBO 1MSDA 2UUAH 1WN7A 2PTMA 4NYKA 3RWRD 4PA3A 3UO2A 5BWTA 4J0MA 2PZSA 4GX0A 4JI7H 1HNXB 3EYYA 3ZHVA 1NTMH 3RUPA 3X2QC 3KHLA 1Q82W 5EWGA 1BJTA 4LFAB 2JA5G 4X8AA 3N44B 2XCLA 3OE7G 2QTSA 4FFRA 2DWDC 4DR5H 4ZIBA 3ASOB 1SA0B 3BHPA 5DAAA 1UNNC 2UXBH 1YITV 2H3OA 4LFCO 3R5HA 2E76B 2K1EA 4OX9O 2XHBA 3ZMTA 5L3DA 1IXMA 3PO3G 3JCZA 4DV2H 5FLXN 3JZFA 1YTFD 2UXXA 2XAHA 2ZDIC 4FZ1A 2R85A 2IJIA 4YJ2B 4OPAA 4JYCA 1MA1A 2Z04A 4O83A 3T1YH 3J7AK 1OCRB 1M6VA 3C3SA 4FIPC 1FPOA 2R86A 3A0RA 1Z5VA 1NR1A 4BW5A 3JAWA 1H38A 3CCMV 1Q6UA 4FM1A 2X0SA 2ZINA 2R8HA 2H94A 1SQBH 4X66H 3EHBB 2UUBB 3ORRA 3J80W 4WCEV 1EFRG 2YC0A 2E5LB 2VQFB 2BTOA 5IE9A 5LGUA 4FLWA 4B3MH 2YS7A 1XNRO 3KXYT 2XASA 3FB8C 4F4ZA 4A3JG 2EJ0A 1MZBA 4RNNA 1Q86W 1W93A 3SYOA 1PK8A 1VQPV 2NR5A 4O4HA 5BMVB 4BBSG 3J80N 4O2AA 3OUZA 4YJ2F 3ZMZA 3DF7A 2HVRA 3CWBH 1CP9A 1N0JA 2AZ0A 3AG1B 2AGQA 2IP4A 3TIGA 3IG0A 2C2RA 1PV0A 2HLDG 1RJPA 1B6SA 1GM8A 4FM2A 4M7EA 4ED1A 4K0KH 1JPXA 3AG7A 2ARHA 2F95B 1GTOA 2EZOA 3FKIA 1JJOA 3RF2A 3VNNA 2ZNIA 3PFFA 5FL7G 1VQ5V 4MVOA 3PW4A 1YVWA 1S5JA 5L9XA 4DV0H 4IT5A 1RSOA 4GC6A 1K7DA 1SERA 3GIPA 4RUEA 3WWJA 1WJZA 2OCCB 4GX5A 4JI3H 1SQGA 1CQJB 3GTJA 4ZOLB 1Q5OA 5BR8H 3K0DA 1FKAH 1FXKB 3RT3C 2ZM6B 1Q7YW 3TEKA 4ZKIA 2W6MA 1N33H 1TAEA 4GKKH 2BQUA 1AR1B 2XAGA 4QWAA 1U97A 2ZJTA 4JI5B 1J5EH 1BQ0A 1DAAA 3V6JA 4U7OA 3ZJZA 4CS2A 1I94H 3NGDA 1N48A 4X64O 1QR8A 4MV6A 2RGVA 4UUJC 2YZMA 4Q44A 3OHAA 1UC8A 4AI8A 2WLKA 2Z3YA 3N2GA 4ECSA 1N32H 2ADPA 4JI6H 4XYMB 3JZIA 1AROP 1QLNA 3T9EA 3U0ZA 4ECQA 4I0XA 2WAMA 1IBMH 3E89A 5JCOC 5C1PA 1YSCA 4RWUA 3NR7A 4DUYH 1GH6A 2QSAA 1NZ6A 3AG3B 3IJ4A 3WO0A 5FR9A 3FB7C 4UCRA 4LF7B 5H2FZ 4EGQA 2FYUH 3WB2A 2YIBA 3RV3A 2W71A 2CTPA 4LWSA 4MW8A 2ZGIA 5KAFZ 2CGNA 5LYJF 1AI7A 2JS3A 2HGSA 3LNNA 1H2MA 4DUYB 2Q9LA 5LA6B 3WWIA 4DUZB 2YZGA 1KKCA 4J9ZB 1Z5WA 3JAKB 4YR3A 2UXCB 3ICXA 4DV1O 2R7LA 3T4ZA 4L1KA 4A3IG 5EBLC 5KT2A 4RCNA 3PW7A 4B3MB 4DR2B 1WA8A 4HNAA 1XNQB 1MNGA 1JDEA 4GT1A 1VBGA 5B1BB 2B63A 1R6TA 2ATKC 2FK3A 2ZDIA 4OXSA 4Q8FA 4QPKA 5LP6F 2P5OA 1ZETA 3T99A 1TWAA 4TV8B 2EIKB 5DG8A 1SETA 1RSOB 1DV2A 1U96A 1YXBA 3K5NA 5LBQA 5KFZA 1JX4A 3VPBA 3MR2A 2Q7GA 1DGSA 4FS2A 3D3IA 2Q0AA 5LA6F 1V54B 1XEQA 4PI0A 5DISC 4DRFA 4P9PA 1ZL8B 2GDSA 3DXRA 4HBNA 4NXNO 4O4IB 5CE8A 5GTHZ 5KFHA 1GKFA 3BA8A 3U9TA 5IYCG 5LMUB 3SYPA 1XBLA 5KFRA 4IYIA 1IYDA 3QO7A 4O2BA 1OJHA 5KA5A 2V59A 4J11A 3N6XA 3RB6A 3GVMA 5H6QA 1M93A 1BHAA 5LP6C 5C44G 4O4HB 4AHCA 2R7ZG 2M05A 5I5WA 3K59A 1Y1WG 3HBLA 2YDEA 4APMA 5FNVA 1JR9A 3A2FA 3BEHA 2EIMC 2R9AA 4QE9A 5JQGA 4FLTA 4L8JA 5GONB 5CAEB 1W2BU 4C5CA 4BW9A 3DC6A 3MR3A 2O03A 5FNVF 3THOA 3AG1C 4EEYA 2R8JA 1TWHA 3N42B 3E8GA 3ZCCA 1YJ9V 2UXDO 3L70H 5ITZA 1RM1C 2EZPA 1AR4A 3GIKA 5A2QW 3ZRXA 2FMLA 1OCZB 3T1HB 3K3VA 3GWOA 4NKGB 4CH6A 2JK5C 4DAAA 3JALB 3J81N 1KUQA 2R7NA 1H2NA 4DV0O 5KFNA 5H9CA 4OGQB 1KP3A 4HNTA 3GTMA 3SPCA 4P9OA 3VBBA 4BBRG 4FFOA 4QWEA 2A7WA 4ZBMA 2HIXA 4AQYO 2M7WA 4J7JA 2W6JG 1EN4A 2F4VH 2X6AA 4TV9A 3I4NG 4G28B 3RBEA 5KFEA 3JARB 1XOUA 3ZRWB 5KG0A 1XNQO 2GBOA 1J5EO 4RB2C 3CP1A 4DW1A 2IM9A 3F5WC 4LBEC 4JI5H 1O9GA 3E22B 2R87A 4X64H 3N2KA 2Q2UA 5LP6A 1ROPA 3HB9A 1RFYA 3ZMUA 3FYEB 4I0XB 3RYIB 4JI7O 4DR6B 3B2EE 3TK1A 3NXSA 3TXSA 5CB4B 2YEVA 3H01A 3N2GB 4RQFA 4DV0B 5KFTA 3ZN1A 4GC7A 4UV8A 1KC8W 2NU7B 5DGIA 4DV7O 4CMFA 4NYEA 3ZBHA 4B3SB 2B63G 1EUCB 5IJ9A 1I3QA 5LGNA 5JVDF 4O3SA 1Z2NX 4HQ6A 1HP8A 4JZGA 1Q6HA 3AX6A 4GCZA 1RPOA 1P84F 3ASNC 4F4LA 3EVKA 4FBTA 4GX1A 4DR6H 3CVZA 1M57C 2XCPA 2DAAA 1G2WA 4EQ5A 2W6ZA 3RGZA 1OWTA 4K0KB 5DN6G 1SEIA 1ZHQA 5DEDA 1BGWA 3E83A 4LNUA 4FU0A 5BY1A 4U7NA 4LF5O 4TUYA 5IWAB 4YQWA 1S68A 2DQ3A 3AG4C 3RGXA 4NTXA 2UU9O 5IJ0B 2KG7A 4G3IA 2AU0A 1BMFG 4DL4A 3IFXA 3H20A 1PNMA 5CA1F 5CA1A 3H0GG 1AR5A 5CB4F 2R82A 1V55B 3GIIA 2P4KA 3AK3A 1ZHSA 4UCVA 4O82A 2RDIA 1BE3H 3QNEA 1ZUQA 4BWAA 3HR0A 1B06A 2W8LA 3JASB 1VQMV 4DYLA 3R65A 1XNRB 2R70A 3JYCA 5EWFA 1C30A 4JI0H 1N34B 5FPOA 1K92A 3K3WA 4RQEA 3T5KA 4DV6O 1FFXA 4UCOA 1HNZB 1I1LA 4W4KA 5JQWA 5F9NA 4I9WA 2UU9B 3MD0A 1P4RA 3RYFB 5KG2A 4BIUA 4QPJA 4R7CA 3OEEG 1AN7A 4B7EA 3GTKA 2P4VA 5DECA 1QQCA 4EFEA 3HKBA 2XGQA 3OUFA 1CS0A 1W0KG 1L0LH 4PA9A 5KFOA 4JI2O 2NNUA 2COIA 1HNWB 2DJVA 2VQEO 2J9GA 2PMZA 3MJFA 2C2AA 4MV1A 1WAZA 2F23A 2RDCA 4BXXG 3TW6A 1E1RG 4NXNB 5KG1A 5KG5A 1B04A 5FJ8G 5KHKA 2QDOA 2PYJA 1TWGA 3OR6C 2V9WA 3PW0A 4MS2A 1UPGA 4UFZA 3SPGA 3K5LA 1I2KA 1RK6A 1F51A 4O4HF 1DTOA 3VQVA 2HHFA 1NR7A 4NTWA 1SA0A 2JEIA 2YXYA 2YIDA 1XK5A 3H1LH 1XMOO 4NLGA 1ULZA 4Q4CA 3L4KA 2Q8VA 2QTOA 3P3NA 4HAMA 4HZ3A 4GYCB 3HKZA 5DLGA 3BA9A 2Y69C 4X20B 5IY5B 2Y0SE 5GTIZ 5KFXA 4ZHQB 4MTDA 2QM7A 2WLJA 5IWAO 2N74A 1MOFA 4NXMO 2UXDB 5EZYF 4LCUC 1QR9A 1EN6A 5BMVF 1IBLO 5KFUA 3ZMSA 2GPSA 3TY5A 4GLXA 3LDCA 5LOVB 4PJ0Z 4MTOA 4Q8EA 2JA7G 3U54A 2JEGA 2MW2B 5L3CA 3JAMW 4I4TB 3HOXG 2ZQMA 2Y0PA 1VQLV 4L87A 2K9PA 1Y76B 3OGCC 2WYOA 4DV1H 1SYXB 1S0MA 2E5LH 1A0IA 1O75A 4XBFA 2P7TC 1AJNA 1Q8IA 4JI3B 3SE7A 5FPRA 4KHPO 3JZ6A 5EOYA 1TUBA 1E79G 5KX5B 4DR4B 3S3XA 3T9CA 1EKVA 2E2IA 2WAQE 1Q81W 3PZPA 1FYJA 1QLEC 4FBUA 3N41B 2QEXV 3ZHUA 5AG2A 3JSNA 5A9GA 1RJRA 2IBKA 5LA6A 2Y4TA 4CE5A 1XREA 4DR5B 4NXNH 1DIKA 1OZ0A 2UUCO 2FTKA 4O7VA 5IYZA 5BPHA 4FLVA 3WO1A 4JUZA 3M7MX 2DE0X 5BPFA 1N36H 3JD4A 1K33A 1NJIW 2XGPA 2BTQA 4JTAB 4O4LB 4DLKA 4TQFA 3L75H 5IT9N 4CH5A 2QWNB 4IYHA 3J81W 2IU0A 1R3LC 3ABTA 3GB7C 1GRJA 2PY5A 2DWEC 4ECYA 2N04A 2RQ6A 5DGAA 1VQ9V 2I80A 3BVOA 3CCJV 2CH7A 3OTOH 1SQXH 5EIBC 3CE2A 2ZDGA 2NU9B 5L1KA 5KUKA 4W4LA 4TUYB 3C0FB 4EB6A 4QW9A 4K8XA 4OPHA 4LF8B 4O2BF 3RTXA 4CZZA 2AHYA 4H37A 3RYFA 4FFBA 3HOVG 5GONA 3H1JH 3RW0A 2UVUA 4PHZA 4KHPH 1Y76A 2VWJA 2YRWA 3N40P 2YU9A 4QNHB 5KAIZ 1EBOA 1NQTA 3HOUG 4LF9B 3M9MB 1Q6IA 3GIDA 2AQ4A 4ECUA 3TIIA 1BHBA 1VQ6V 4IIJA 3G6VA 2UVWA 5KG6A 4NXMB 3FAVA 3FB5C 4LF4B 3JD0A 4MV4A 4JF3A 2OCHA 4WFGA 2JA5A 3UT5A 2DYSC 1SRYA 4B3SH 2JA6A 1Y74B 4DR1B 1Z2GA 3RYHB 3GTGA 4N21A 2ZDHA 2R9IA 2VUMA 4IRKA 4JAAA 1FS0G 3L72H 2UUCH 5E1AC 4GZRB 1IBKH 3E5NA 2C22A 1I1MA 4X66O 3OUUA 2A79B 1WCMA 2B1IA 3OT7A 3G71V 5LXTF 4LH6A 1SQQH 3RB0A 3GLKA 4LFAH 4I5SA 3TW7A 1AI5A 2IBZH 4MTXA 1K1SA 1F7YA 5CBGA 3KCXA 3L2PA 4DL7A 1OCCC 4O7SA 2XOKG 4MV3A 4JI2B 4AQYB 4F6EA 1KP2A 2W57A 3X2QB 3L4JA 2ZE8A 4DV4O 4TV8F 4MTGA 4WFFA 1A0GA 4YJ3F 3PJSK 1YZBA 1XHXA 5IYZB 2CW8A 1KMIZ 2RN9A 4FJCC 2IMWP 2ASJA 5BYAA 4CMDA 3JRXA 4A3DG 1OCZC 5DM6V 2A9HA 2XAJA 3P30A 4LF9H 4LP8A 3JALA 2CZGA 2UVVA 4JV1A 4P30A 3SDLA 3TGUH 1BSMA 1MABG 5IJ9B 1WPBA 1PNLA 4IL6Z 1QVGU 5D1OB 3ZIAG 5JJEB 4X1IB 2LW7A 5IYDO 1BCCH 2DMXA 1K5QA 4DR2H 2PN1A 2V4DA 4CC6A 5KT6A 3PW2A 4GKJB 2W7OA 3F5TA 2BSKB 4B3SO 5BZBA 3WNZA 3CCLV 2B1GA 4I4TF 2VR1A 4X1KA 3CRCA 2A3QA 4NTYA 5I5TA 4TOIA 3WG7B 3GV5B 1PM9A 4MAMA 2NUAB 3N27A 3CCUV 2ILMA 3CXCU 3TETA 2UXCO 4MTFA 5J2TF 1EZ1A 4WFHA 2AHZA 1GM9A 1N4CA 3B8MA 4K35A 4LF8O 4M9UA 4LSAA 2FLPA 1RK5A 2N05A 3CPWU 4LFCH 2RNBA 4X1YA 3H1HH 2QKSA 1OCRC 2ITCC 2FB9A 2BOCC 3IN5A 2ADQB 2OT5A 1JFFB 3KYHC 3ZEDA 3EPGA 5KFKA 4ED7A 4EG0A 1A3GA 1Y66A 2LP7A 1M0TA 2C35B 3I4MG 4E6NA 3W7SA 3Q8SB 1PD3A 3K58A 1A32A 3GDEA 4RB0A 4X62O 3APQA 4FLUA 4PZ7A 1NVPD 2EJ7A 3HKCA 4JZ2A 2ABJA 2HJDA 4GKJO 2JDIG 2GQRA 1N0NA 2DW4A 2EX3A 3M9OB 2AXTZ 3JATB 3VQYA 1OBDA 2VPQA 2XT9A 4MW3A 3CS5A 4DR4O 3E86A 3ABLC 3BFRA 1G1XB 3VMMA 4GKKB 4Z1MG 1N36O 1UJWB 2AZ2A 3RGBA 4WFAV 1WRVA 2LGQA 2XC9A 2P90A 3UZOA 3OR7C 2QK4A 2JVDA 3K0GA 3OEHG 2OIEA 5JWPA 4YHHB 5KFGA 1OHHG 1B33N 3PVXA 1KB9F 2HG8A 3V6HA 4LH7A 4O2BB 4B08A 4Q0YA 3SJCC 1FJGO 4K3AA 4WBNA 2ZIMA 1JFFA 1WNSA 4QGPA 3T4DA 3D36A 2X7RB 1GSAA 4EGJA 1AILA 3ETQA 2BE3A 1XDNA 3ABKB 3K9AA 1JXLA 2YS6A 1N36B 3VQXA 1ENVA 3LMLA 4FZ0A 1JJ2U 2QM4A 3KALA 4PA7A 4XDJA 1HNWH 2EINB 4J9QA 3ZRWA 3T1HO 5LMUH 3AG3C 4WD3A 3ABMC 5JJNB 1R6NA 1FJGB 5K2MA 5IWAH 4ED3A 4K6NA 2ZNJA 2UU9H 2WDTA 5KFSA 3CCVV 3HKDB 2DOSA 5KA6A 2W6PA 4FFKA 1R9TA 5KFAA 2HHHB 2VRZA 4YHHO 4B7KA 1SCUB 4RNMA 1UFIA 4CS4A 4RNOA 3AK2A 5FLXW 3SJAC 1WSCA 1I94O 2JJ2G 2P67A 3L9DA 2KG7B 1YI2V 1KJJA 4QIWE 1EM1A 1HW7A 2YRXA 2FE3A 5H80A 4ZOLA 3HKBB 2YSUB 3CXHF 2LJ2A 1OV9A 3W7TA 4IWXA 3GV7B 2M6YA 1R1BA 2XAQA 4IIJF 3GQCA 1HR0H 1Q3EA 4J9KA 1MZEA 4DO2A 3HOWG 2VA2A 3CC2V 3VPCA 2DLNA 4U3JB 2W8KA 4HR7A 3RR5A 3E2EA 2JA8G 1VKZA 3BQ2A 3LULA 4J9YB 5JH7F 1KTAA 4KHPB 2DYRB 1RYSA 2E74B 3WG7C 2HHFB 3T9AA 3H9VA 2W9CA 4ECRA 5KHHA 1P8LA 1Z2PX 2F4VO 4O2AB 3AK1A 3T2MA 3ETHA 4DR3O 5F9LA 2LO1A 5LL6Y 1R3KC 1EKPA 3BACA 2CNVA 2C00A 1E4FT 3FDSA 1VEWA 3N8DA 3CHXA 2IJHA 1KKDA 2PGGA 3MFIA 3OTOO 1KT8A 5JCOA 4O3NA 2WSSG 3APOA 1N33B 1B6QA 1KJIA 3SYCA 1FAFA 2KSWA 4DV7H 1I7LA 3TXQA 2EBOA 2COJA 4O7NA 4RAZA 3T5JA 1HR0O 1K97A 1IDSA 3L74H 1CKNA 4DR7H 1B3QA 4PI2A 2YXLA 2ATLA 3RB3A 4NXMH 3Q1KA 3T5LA 1KJ9A 1IBLH 3CRMA 4IHJA 2CDYA 1VF7A 1KUTA 4QE7A 3RVZA 2WLLA 1SQFA 4X62B 1YIJV 1US6A 2HJFC 1IYEA 5HFMA 3QVNA 1IBKO 4JI3O 3BRCA 3U55A 1CXZB 3HKEA 1ZAUA 3QF7A 1MSWD 4FVMA 4HYOA 1GSHA 4PA4A 1W96A 4B3RB 1MMMA 2HGXA 4EBDA 2ZDQA 3OTOB 3DTGA 1HNXO 4PDMA 2OLSA 4J7KA 1GSOA 4F4YA 3T5HA 2FL4A 3WWHA 4JYAH 4QJFA 1HDJA 3H4BA 4DV2O 3SYQA 1JA8A 2GTAA 2IU3A 3UT5B 4IAJA 5DGBA 4QIWF 3MDSA 2V1DA 2CNQA 3G80A 3V4ZA 3GTLA 2FB5A 2NVYA 2JA6G 1URFA 1VIBA 4PELA 4FFPA 4JV2A 3UCSC 5IYBG 1YJNV 3VQWA 2QE7G 1I1KA 1P16A 4MA0A 4DIMA 2I8CA 4I55F 2LW1A 1P7GA 2FPPB 5HBRB 4YHHH 5CB4A 1L8DA 4J9NA 4D7SA 1VQ8V 3H40A 2JEUA 2J6SA 4E2LA 4DV2B 2VQEH 3RVYA 5LP6B 5BXZA 1LUVA 1NU1H 1W0JG 2DQ0A 5CA0A 1IVSA 1L0NH 4GUNA 4CBCA 3AYHB 5KT4A 4A3FG 2Q5ZA 3OSNA 4XX0B 1TVKA 1SFOA 5K3WA 3SI8A 4PZ6A 2RDJA 2WB1A 1Y6XA 4DV5O 3NBYB 3DTUB 4AILC 2NU6B 3UYYA 1Y4MA 2QR4A 4K0KO 1S9FA 2R84A 4O4IA 4IWYA 1HR0B 2RMKB 4ETSA 2W6IG 2L35A 2MCTA 4I7ZB 4LF5B 5CA3A 4A3LG 5JJJB 2QWQB 2EILB 5EBMC 3ZS8C 5KG7A 3OTFA 3GIJA 5KFMA 1XMOH 1SQVH 1FXHA 3SNOA 4DW0A 2BQRA 2J6TA 1BT8A 4TWKA 3LQSA 2GUZB 4J7ZA 5EZYB 4HYKA 3CJHB 1NKDA 2WA4A 1TUBB 5C3EG 2LQTA 2OYQA 3CMAV 1EN5A 2ZE6A 2CH7B 3LSUA 1R6KA 2F43G 4DV3O 1T94A 2Q4PA 5JQGB 2HEPA 4UB6Z 2ZE5A 3K79A 4U3FH 1Y1VA 1T3NA 1IBLB 2FK2A 5KHGA 2OTLV 1VS0A 2CQYA 2QWPB 1RM1B 1M9NA 3C3TA 1QCEA 1AI6A 1CKOA 3SJQC 4G27B 4LC1A 2UXNA 3LDEA 3CRQA 1FFXB 4A3CG 2Y69B 5IY5C 4CH4A 4E4TA 3CCSV 5BWUA 2JJ1G 3CCRV 2A1HA 2O57A 2DYRC 3D3QA 3DC5A 3CC4V 1VP7A 3W7UA 4J9OA 5GONF 4JI4B 2VUGA 4RUFA 2WPDG 4EFBA 5KHJA 4O7ZA 4DV5H 4JI8B 4FE2A 5IYBO 3ZX6A 4LF9O 4DRXA 2KKWA 4DK0A 5KKNB 1Y14B 4OX9H 1M56B 3RV4A 2H8PC 5KFVA 3CSWA 4DR7O 3PN1A 1ZL8A 1FVIA 3LDDA 3OD4A 3LSQA 4DR1O 1S97A 1SF9A 1AB3A 2W9BA 1K1QA 4U7CA 1K83A 2DPIA 4EYHB 1I6UA 2RF4A 3K9SA 3BG5A 2CFMA 2Y4UA 4TM5A 4JI2H 5CBHA 2ETNA 1BZKA 4J41A 1KYOF 2FLLA 5LHGA 4AQYH 1N34H 3L73H 5C8YA 1CPYA 5L1LA 5J2TB 2DIKA 2OTJV 4LF6H 3T7AA 3HOYG 2ALZA 1WPXA 5EWEA 1I5YA 2R8IA 2UUCB 4CKBA 1AJQA 3KKYA 2HP8A 4M0JA 5BWXA 4JAVA 3A0HZ 4YP3A 4ECVA 4LFBH 3K3PA 1Y1WA 2AGOA 3FX7A 3RYCB 1AI4A 2OCCC 5E79Z 4A2BA 2ASLA 2ZKOA 3P3PA 1IXBA 5B1BC 4MV8A 1GO3F 3L71H 4F4XA 3IC7A 1I2LA 2OIGA 3VA7A 3I56V 4QSHA 4IHJB 3HT5A 2R92A 2XTAA 3RB4A 2HFEC 3BQ1A 2UUAO 1QVFU 5BMVA 2FP4B 3ZRVA 3DAAA 3KHHA 3QTCA 4A5UB 5EZYA 2GUZA 3K03A 2CUGA 3HO8A 2ZXWC 4LF5H 5L1JA 2BR0A 1SZTA 3J7AU 2VQDA 3ZHSA 1WP8A 3FB6C 4FLYA 4FK5C 4AYBE 4DV6B 2P0AA 5B3SC 1YTFB 2W6NA 2F93B 4ZHQF 4EBCA 2UXBO 4X66B 4F4WA 3TQTA 1QLEB 2R7MA 4JI7B 3I12A 5IP7G 3MR5A 5D5QA 4Q43A 3CQZA 1JDBB 3SPHA 2QM8A 1QHTA 5J2UF 1VQ4V 4B3TH 1X4TA 5J2TA 4FFNA 3STLC 4LSXA 1NBMG 3EXAA 3K5MA 1K5SA 5HFLA 5LMNH 3ETJA 2HVJC 3GTQA 2Q73A 1X59A 4DUZO 4O4JA 4O3PA 1UC9A 2JRIA 2RGRA 1XMQO 1DF5A 4DV1B 3QO8A 1IURA 2UVRA 5LHHA 4PBCA 1ZQ7A 3N6RA 4JI5O 3UKMA 2W9AA 4NZOA 3E22A 2PBZA 1GO3E 4UUGA 3W1GA 3FFQA 2QA4V 4DK1A 4O4IF 1K4DC 4ME6A 5LGTA 3MWDA 5C5JA 2ZR2A 4KP4A 3SGIA 5LYJA 4JXUA 3JD3A 2VQFO 1M56C 2Y0IA 3AG2B 4DV3B 5FD6A 2YUAA 2X5RA 4PWQA 2XNDG 4YJ3A 3BABA 4RO2A 5KFQA 1M5IA 3F7YC 5JH7B 4IIJB 3HXLA 3HKCB 4O7YA 2D3OW 5IP9G 2EJ3A 4JAUA 3IAYA 1CKNB 4PDVA 3MWMA 2GHYA 1VF6A 4FPPA 1PNKA 4X9QA 4YBZB 3KAKA 1XHZA 4B3TO 4TQSA 4A3GG 4QWBA 3HKDA 4R7RA 4RUAA 1KBHA 2Q7EA 3V4SA 5EYPA 5KFIA 4O4JF 4G2KA 1JMKC 5LMNO 1Y1VG 5LXTA 4I9QA 2BQ3A 4X65O 4J9SA 4Q4DA 3OHBA 3G67A 2YS8A 4JYAB 3KG2A 3ASNB 2GPWA 1JOYA 3RYIA 2QKAA 1TWFA 1BXRA 4DR3H 2JGDA 4GKKO 4LF6O 2E75B 4PA6A 3Q4HB 1H2LA 4ZI7B 2W6OA 1XI1A 1JX9A 5DG9A 3D36C 4MA5A 2Q6AA 2BTQB 4O4LA 3U9SA 4MVRA 1VMGA 3U11A 2CK3G 1GN2A 5CA0B 3CB2A 4TV9B 3IC9A 2SCUB 5BWRA 2PI4A 1ORQC 1NTZH 3RBDA 5KFCA 3ETDA 1PL0A 5B1OA 4MV7A 2X6CA 2YI8A 4IR9A 3SJBC 5DLFA 2ZM6O 4JTDB 4O4JB 2A06H 3V6KA 1DF4A 4O7LA 4O86A 3K5IA 4O7WA 1CQIB 4B3TB 4R8CA 4I7HA 2GSMB 2HVQA 5D1PA 2C28A 4CH3A 5L3FA 1HWYA 3UM7A 2ZCEA 3K57A 1YJWV 3HB3B 1XMQB 1MG1A 1X9NA 1GM7A 1S0NA 1JCHA 3M4IA 4OX9B 2OWOA 3BY6A 5LYJB 1I7FA 1XILA 3ORQA 1IBKB 1CEZA 3C90A 3S24A 4ED0A 2JGUA 2R9RB 2IJJA 3OSPA 4TVIA 5H5NA 1WA8B 2UXCH 4X20A 5KLVH 5B5EZ 5C93A 2CTQA 2COGA 2AGAA 4I50F 5KFBA 2WLNA 4FGRA
chains in the Genus database with same CATH topology
1D5AA 1I94B 4PDBA 4LMYA 4TV8A 1E4FT 1ZHSA 3CHXA 4UCVA 2ZIOA 2PGGA 4BWAA 5D5PA 3TY8A 5JCOA 3JASB 4LF7H 4RB1A 4JI8H 3QG5A 1XNRB 4FM9A 2R70A 4CC5A 4K8ZA 4JI0H 1N34B 4BWSC 5FPOA 1N33B 4X62H 4FM0A 3SR2C 2KSWA 4DV7H 1IBMB 4I55B 3JAWB 1FFXA 4UCOA 4X1IA 1HNZB 4RAZA 2VWKA 1XMOB 3T1YB 2UU9B 4RZQA 1N32B 2E3CA 1CKNA 4DR7H 4PI2A 3RYFB 2P22C 2YXLA 4DR4H 3N43B 4DR1H 1AN7A 4NXMH 1QQCA 4EFEA 3HKBA 1IBLH 4IHJA 3W5OA 1VF7A 4YY3B 5EYPB 5KMGA 1HNWB 3NC0B 1SQFA 4X62B 2R72A 4DV5B 1E4GT 4KL1A 5EIBD 3BRCA 4NXNB 1B04A 5FNVB 3HKEA 1ZAUA 3QF7A 4ZI7A 5CA1B 5KHKA 2PYJA 4FVMA 4I50A 4DR3B 3FMAA 4B3RB 1FJGH 2YIAA 3OTOB 3JASA 3RIZA 3K5LA 4UFZA 3GJXB 4JYAH 3UQ8A 2F4VB 4Q0YA 3VQVA 1SA0A 2Q2TA 2F1MA 1XK5A 3UT5B 4IAJA 5KHIA 4JV5B 3L4KA 5IJ0A 3NBZB 4GYCB 3W1BA 5IT9W 5LOVA 3T1HH 4DV6H 3TY9A 3BA9A 3MAQA 4X20B 2YIBD 4X65H 4UCSA 4UCUA 4ZHQB 5C8YB 4LR3A 4MTDA 3VQWA 1P16A 2VOBA 2UXDB 3F8NA 4DV3H 1TVKB 2GV9A 4X1YB 4YHHH 5CB4A 1L8DA 4D7SA 2YI9A 3TY5A 4GLXA 2UUAH 5LOVB 1WN7A 2PTMA 5K1XA 4DV2B 5LP6B 3RFRA 2VQEH 3RWRD 3JAMW 4I4TB 5CA0A 4FLXA 2WYOA 2PZSA 4CS3A 4J0MA 2F66C 1SYXB 4DV1H 4X65B 4JI7H 1HNXB 3EYYA 2E5LH 1A0IA 1O75A 1TVKA 4LFCB 1BJTA 4LFAB 3N44B 2ZM6H 4DR5H 4EB6B 4X1KB 4ZIBA 4PZ6A 1SA0B 1Q8IA 3NBYB 3BHPA 4AILC 4JI3B 2UXBH 5FPRA 4HNAB 2XHBA 3JATA 4O4IA 1TUBA 5EOYA 1HR0B 5K1PA 5KX5B 4DR4B 3KAJA 4DR7B 4ETSA 1TGOA 2MCTA 4LF5B 4DV2H 5JJJB 3ZS8C 1XMOH 3OTFA 3J7AK 4YJ2B 3T1YH 3N41B 1M4UA 1Z5VA 1M0WA 3JAWA 3JSNA 4I55A 5LA6A 4FM1A 4JI0B 4GKJH 2ZINA 3U10A 5J2UA 4DR5B 4DV7B 4NXNH 5EZYB 1TUBB 5IYZA 4X66H 4PZ8A 2OYQA 2UUBB 3J80W 2JS5A 4FLVA 2E5LB 2VQFB 3M7MX 4JI4H 2BTOA 1N36H 4FLWA 5JQGB 4B3MH 2HEPA 2BTQA 4O4LB 1IBLB 3GB8B 4TQFA 3KXYT 5KHGA 4CH5A 1CKMA 1VS0A 3J81W 1MZBA 2VPSA 2PY5A 1CKOA 2RQ6A 4A2AA 1NT2B 1FFXB 4O4HA 4CH4A 5BMVB 3OTOH 4DV4H 5EIBC 5JVDA 4O2AA 3DF7A 4TUYB 2HVRA 4EB6A 3C0FB 4K8XA 1TA8A 3IG0A 4JI4B 2VQFH 4LF8B 3RTXA 2VUGA 4F6RB 5KHJA 3RYFA 4EFBA 4FFBA 4DV5H 3RYHA 5GONA 4JI8B 4DRXA 4FM2A 4M7EA 2KKWA 4DK0A 4PHZA 4OX9H 4K0KH 4KHPH 2VWJA 4YJ2A 3N40P 2F95B 3PN1A 1FVIA 1JJOA 4LF9B 3RF2A 4IIJA 3VNNA 4I4TA 2ZNIA 4NXMB 4LF4B 4JI1B 3UT5A 4B3SH 1S5JA 1I6UA 4DR1B 3JSLA 3RYHB 4LFBB 2CFMA 4JI2H 4DV0H 1RSOA 2UUCH 1XQ8A 2QJ1A 1IBKH 2UXBB 1SQGA 4JI3H 4AQYH 4ZOLB 1Q5OA 1N34H 5BR8H 5C8YA 4LH6A 4ZHQA 4FLZA 1FKAH 2ZM6B 1N33H 1TAEA 5J2TB 4LFAH 4GKKH 4LF6H 1XNRH 4LF8H 3WB1A 2ZJTA 4EEQA 2UUCB 1HNXH 1KU9A 4JI5B 1J5EH 3L2PA 1I94H 4CS2A 4JI2B 4AQYB 4LFBH 2W57A 4MV9A 5FD5A 2VQEB 2RGVA 4FFBB 3L4JA 4F6RA 3RYCB 2YCHA 1G6UA 1XHXA 4A2BA 5IYZB 3N2GA 2CW8A 1KMIZ 1N32H 3N2KB 4JI6H 4LF4H 5LL6b 3K5OA 5LXTB 3U0ZA 1IBMH 5JCOC 4LF9H 4DUYH 3JALA 4I50B 5IJ9B 1WPBA 5D1OB 4UCRA 5JJEB 4X1IB 4LF7B 3WB2A 2YIBA 2PUSA 4DR2H 2V4DA 4CC6A 4RAYA 4GKJB 4IHJB 5JH7A 1XMQH 5KMGB 2HGSA 3LNNA 4YJ3B 4DUYB 1P49A 5LA6B 5BMVA 2HVSA 4DUZB 4DV4B 3QTCA 4X1KA 5EZYA 5D1OA 1S03G 1Z5WA 3JAKB 2UXCB 4TOIA 4LF5H 3ICXA 3HKEB 5ITZB 1Q43A 4FLYA 4B3MB 4DR2B 4DV6B 2XIGA 4HNAA 1XNQB 4LSAA 2F93B 4LFCH 5KX5A 4X66B 4X1YA 4JV5H 2P5OA 4X64B 2Q7HA 4TV8B 3RYCA 4JI7B 1JFFB 1YEWA 5D5QA 4WBNB 3KYHC 3ZEDA 3K5NA 3QWUA 1M0TA 1QHTA 1Z2OX 4E6NA 2Q7GA 4B3TH 1DGSA 1X4TA 3BAAA 5J2TA 3K58A 2Q0AA 3GDEA 4RB0A 4FLUA 4LSXA 4PI0A 3K5MA 4PZ7A 5DISC 4DRFA 3HKCA 5LMNH 4HBNA 2EX3A 3JATB 4O4IB 3VQYA 1H2SB 1J5EB 3BA8A 5LMUB 4Q6GA 4O4JA 4LNUB 4O2BA 4GKKB 3RJ0A 2RGRA 1M93A 4DV1B 5LP6C 3RGBA 1XNQH 2PYLA 5JVDB 4O4HB 4AHCA 2JVDA 3K59A 3E22A 4YHHB 4APMA 3W1GA 5FNVA 3FFQA 4DK1A 3A2FA 2R9AA 2UUAB 4LH7A 4O2BB 4UCTA 5LYJA 3SGIA 4L8JA 3SJCC 5JQGA 4B08A 4DRXB 5GONB 4DV3B 4FLTA 4WBNA 5FD6A 2ZIMA 1JFFA 1WNSA 4BW9A 4YJ3A 2O03A 3BABA 3THOA 1M5IA 3ETQA 1T5EA 1XDNA 5JH7B 4IIJB 2CW7A 3BPZA 3HKCB 3VQXA 1N36B 3HXLA 3N42B 3LMLA 5ITZA 3IAYA 2QM4A 5A2QW 3K3VA 1CKNB 3T1HB 3KALA 3MWMA 4CH6A 3JARA 1HNWH 3KAKA 1XHZA 3JAKA 3HKDA 3JALB 4R7RA 2Q7EA 4NVPA 5EYPA 5LMUH 1JMKC 3WB0A 5LXTA 4JI6B 4I9QA 5JJNB 4MTEA 4JYAB 2CAZC 5J2UB 2HIXA 1FJGB 3RYIA 5LMNB 5IWAH 2F4VH 4B3RH 2ZNJA 4DUZH 4TV9A 2WDTA 2UU9H 4DR3H 3HKDB 2HIVA 1WH2A 3JARB 2HHHB 4ZI7B 2UUBH 1XI1A 4CS4A 5FLXW 3SJAC 4TQDA 4RB2C 2IM9A 2BTQB 4O4LA 4LF6B 4JI5H 1O9GA 3E22B 4D7TA 4X64H 3U11A 5CA0B 3N2KA 3CB2A 4TV9B 2Q2UA 5LP6A 3N6XA 1HW7A 5BR8B 3RYIB 4DR6B 2FE3A 3B2EE 2HHHH 4ZOLA 1SKVA 5CB4B 3HKBB 4MV7A 3DSQA 3N2GB 4YY3H 4DV0B 2YI8A 3SJBC 4O4JB 4B3SB 5IJ9A 1HR0H 1Q3EA 1Z2NX 4RB3C 4B3TB 4I7HA 4JI1H 2HVQA 2UXDH 5D1PA 1L2ZA 1O9HA 1HNZH 4CH3A 2WE6A 4U3JB 1V9PA 4DR6H 3CVZA 3RR5A 2ZCEA 3K57A 4EQ5A 1XMQB 3RGZA 1X9NA 3M4IA 4OX9B 4K0KB 4KHPB 2OWOA 2RJZA 1GYFA 1SEIA 1ZHQA 5LYJB 1BGWA 1I7FA 3CSXA 4LNUA 1IBKB 5KHHA 4TUYA 5IWAB 4U3JA 1P8LA 1S68A 3S24A 1Z2PX 4O2AB 2JGUA 3RGXA 5IJ0B 2UXCH 4X20A 3H20A 5CA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0I A;  4JI5 B;  3L2P A;  1I94 B;  2UUA B;  4LFC B;  4LFA B;  4JI2 B;  4AQY B;  4LH7 A;  4UCT A;  3SGI A;  4UCV A;  2VQE B;  4DV3 B;  4PZ6 A;  3TY8 A;  3NBY B;  4JI3 B;  3BAB A;  5FPR A;  1XNR B;  4CC5 A;  1HR0 B;  1XDN A;  4DR4 B;  1N34 B;  1N36 B;  4DR7 B;  5FPO A;  1N33 B;  4LF5 B;  1IBM B;  4UCO A;  1HNZ B;  1CKN B;  3T1H B;  1XMO B;  3T1Y B;  2UU9 B;  1N32 B;  5D1O B;  1CKN A;  4UCR A;  4LF7 B;  3JSN A;  4JI6 B;  4CC6 A;  4JI0 B;  4GKJ B;  4DR5 B;  4DV7 B;  4EFE A;  4JYA B;  2HIX A;  3W5O A;  4PZ8 A;  2UUB B;  4DUY B;  1FJG B;  4YY3 B;  5LMN B;  2HVS A;  2E5L B;  1HNW B;  4DUZ B;  4DV4 B;  2VQF B;  3NC0 B;  4X62 B;  5D1O A;  2HIV A;  4DV5 B;  2UXC B;  4TOI A;  1IBL B;  2HHH B;  3GB8 B;  1CKM A;  1VS0 A;  4NXN B;  1B04 A;  1ZAU A;  4DR3 B;  4LF6 B;  1CKO A;  4B3M B;  4B3R B;  4DR2 B;  4DV6 B;  2Q2U A;  3OTO B;  5BR8 B;  1XNQ B;  4DR6 B;  4UFZ A;  3GJX B;  4X66 B;  2HVR A;  3UQ8 A;  4DV0 B;  2F4V B;  1TA8 A;  4X64 B;  4JI4 B;  4JI7 B;  4LF8 B;  3RTX A;  2VUG A;  2Q2T A;  4EFB A;  4JI8 B;  3KYH C;  4B3S B;  1XK5 A;  3QWU A;  4JV5 B;  4B3T B;  4E6N A;  1DGS A;  3BAA A;  3NBZ B;  2HVQ A;  3GDE A;  3PN1 A;  5D1P A;  1FVI A;  3W1B A;  4LF9 B;  4PZ7 A;  5DIS C;  4DRF A;  3TY9 A;  1V9P A;  3BA9 A;  3VNN A;  4NXM B;  4LF4 B;  4UCS A;  3RR5 A;  4EQ5 A;  1XMQ B;  1J5E B;  4UCU A;  3BA8 A;  4JI1 B;  1X9N A;  1P16 A;  5LMU B;  4DR1 B;  3JSL A;  4OX9 B;  4K0K B;  4KHP B;  4LFB B;  2CFM A;  2OWO A;  2UXD B;  4GKK B;  1IBK B;  2UXB B;  4DV1 B;  5IWA B;  1P8L A;  1S68 A;  3S24 A;  4GLX A;  3TY5 A;  4LH6 A;  4DV2 B;  2ZM6 B;  1TAE A;  4YHH B;  4X65 B;  1HNX B;  4EEQ A;  2UUC B;  3W1G A; 
#chains in the Genus database with same CATH topology
 1V51 A;  3AG2 C;  2ODT X;  1N8R W;  4PDB A;  1I94 B;  4LMY A;  3OGI B;  4J9M A;  3K04 A;  4YXW G;  2R8G A;  2QYZ A;  5D5P A;  3STZ C;  3TY8 A;  2HHH O;  4LF7 H;  3QG5 A;  4DXW A;  4K8Z A;  3RBZ A;  4X62 H;  3W7X A;  2EJ2 A;  4PD4 F;  1IBM B;  4I55 B;  4GLW A;  2VWK A;  1XMO B;  5DQG A;  4RZQ A;  4UVA A;  1N32 B;  5I47 A;  1T36 A;  2IA6 A;  1OCC B;  2NLJ C;  4ECW A;  2Y48 A;  2V4Q A;  3CRR A;  3CD6 V;  3N43 B;  2Z0A A;  4DR1 H;  1VQO V;  4C5B A;  4BY1 G;  3E8H A;  2BSK A;  2ITD C;  4O3Q A;  4Y8V B;  3CEB A;  5EYP B;  3B09 A;  5KMG A;  1ZWI C;  3VOU A;  3ZN0 A;  3CME V;  5KS8 A;  3GWK C;  1AP5 A;  4RAI A;  2R72 A;  5DGH A;  3KHR A;  4DV5 B;  2EIJ B;  4RUC A;  3PR4 A;  4KL1 A;  5EIB D;  3HKZ E;  1BGY H;  4A3E G;  1N34 O;  3MWE A;  2EIK C;  3ETG A;  4O3R A;  4I50 A;  4DR3 B;  4BIZ A;  3OW2 U;  2Y0S A;  2QKC A;  4LFA O;  2R92 G;  1SQP H;  3H3V H;  4O84 A;  4U6P A;  4ABM A;  3MHH C;  5CM0 A;  1WB8 A;  5I5V A;  4X89 A;  1S3J A;  2R6F A;  1KEC A;  1I08 A;  1VF5 B;  3B40 A;  3UQ8 A;  2F4V B;  4BY7 G;  3GIM A;  2Q2T A;  1GK9 A;  2YZN A;  5I60 A;  2PVP A;  2YYA A;  2PMZ E;  3SYA A;  3I5D A;  5IYC O;  3RN4 A;  1HNW O;  4JV5 B;  1N32 O;  4MVZ A;  2WLH A;  2W9B B;  4MVS A;  2QF7 A;  4IR1 A;  1M90 W;  2Q7D A;  3W1B A;  2HGW A;  1IOV A;  2QGN A;  3K5H A;  5LOV A;  3T1H H;  5IT9 W;  2IW5 A;  4O3O A;  4NZM A;  3TY9 A;  4R8U B;  3EPI A;  5KFJ A;  2YIB D;  4X65 H;  1S0O A;  2JA7 A;  3D8C A;  2ZT9 B;  3K08 A;  2P06 A;  4JTC B;  4BR6 A;  5FLM G;  2JEF A;  1SZX A;  3JRW A;  2VOB A;  3F8N A;  5J9P C;  1FFT B;  2GV9 A;  5C1O A;  2QB5 A;  4JGS A;  4X1Y B;  4DL2 A;  1I7N A;  3LWB A;  2HG5 C;  4IRC A;  2B5U A;  5CN0 A;  2WAQ A;  1KQS U;  5K1X A;  3RFR A;  2EIM B;  4FLX A;  4CS3 A;  2F66 C;  4O4L F;  4X65 B;  1BQZ A;  1H2G A;  1FXV A;  3RFC A;  5H6R A;  4YY3 O;  4LFC B;  4IRD A;  3GIL A;  2ZM6 H;  4EB6 B;  4X1K B;  3R9R A;  4WBN F;  5HNE A;  1KBL A;  1EKF A;  2R7Z A;  4X88 A;  1WB7 A;  3ZHQ A;  1YDX A;  4QJF B;  1R3I C;  3ABU A;  4HNA B;  5IDJ A;  4JV5 O;  3JAT A;  3ML0 A;  3OAA G;  5K1P A;  3KAJ A;  3QO5 A;  3A8T A;  2DAB A;  4DR7 B;  1TGO A;  1KEE A;  4MVU A;  3JCU Z;  4DR6 O;  1F4M A;  3U0G A;  2Q69 A;  3F7V C;  4TQR A;  5KFF A;  1M4U A;  2FLN A;  2YWV A;  2GTS A;  1M0W A;  3VPD A;  4I55 A;  2P6J A;  3TJT A;  3EFF K;  1RP3 B;  4JI0 B;  1V4Y A;  3U10 A;  4GKJ H;  5J2U A;  4DV7 B;  2HDK A;  2Q67 A;  4TUY F;  3CYO A;  1S10 A;  1I0H A;  4E4E A;  3CEI A;  4PZ8 A;  1M7J A;  1V55 C;  4MVM A;  3UO3 A;  4Z1V A;  5DQH A;  2JS5 A;  1S5L Z;  1BL8 A;  1FKA O;  2VUM G;  3R23 A;  4JI4 H;  3E8F A;  5KFD A;  4J9L A;  1EZJ A;  3JD1 A;  3GB8 B;  1CKM A;  4P2Z A;  4YB8 B;  2VPS A;  3ABK C;  4N23 A;  5KT5 A;  4A2A A;  3BJY A;  1NT2 B;  4DV4 H;  2CKZ B;  4A3M G;  5JVD A;  5B66 Z;  4YR2 A;  4JI8 O;  5EDW A;  3QQM A;  2HVK C;  5BWV A;  3T1C A;  4C7U A;  1TA8 A;  4JI0 O;  2CTW A;  4XZ3 B;  1OCO B;  4DR5 O;  2VQF H;  1K73 W;  2BCC H;  2NN4 A;  4F6R B;  5DMX A;  4ICG A;  3RYH A;  5DG7 A;  2WWW A;  2R7K A;  1L1F A;  1JQ0 A;  1DLB A;  1I5X A;  2EUL A;  3LUT B;  4YJ2 A;  1NVP B;  4XYL B;  4ED8 A;  2I87 A;  2DN9 A;  1E4E B;  3DTF A;  1FXK A;  2KSD A;  3UFX B;  1WCM G;  2V58 A;  4J80 A;  4I4T A;  4C5A A;  4IHJ F;  1XL6 A;  4ECT A;  4Q45 A;  4JI1 B;  1TUE B;  1RYR A;  2IH1 C;  5CR5 A;  2W70 A;  3JSL A;  4LFB B;  1M1K W;  1KJQ A;  1RPR A;  4O81 A;  2KQX A;  1LUW A;  1XQ8 A;  2QJ1 A;  2UXB B;  2YEV B;  3JAM N;  3GV8 B;  3O9O A;  2OH2 A;  4YR0 A;  4ZHQ A;  4FLZ A;  3FD9 A;  2FPG B;  4B3M O;  3HPL C;  5F2V O;  1XNR H;  2QWR B;  4UXN A;  5EBW C;  4LF8 H;  2MK3 A;  3WB1 A;  4EEQ A;  1HNX H;  4IZO A;  1KU9 A;  1A48 A;  4KUM A;  2X6B A;  1S76 D;  2C2D A;  4R50 A;  4YIP A;  4JYA O;  3TCU A;  4O7R A;  1VAR A;  1SS3 A;  4MV9 A;  5FD5 A;  3ABM B;  2VQE B;  4FFB B;  2WLL B;  3ZHR A;  5C4X G;  2VA3 A;  4F6R A;  1QU7 A;  1JKJ B;  2YCH A;  1G6U A;  2ASD A;  3SPJ A;  3FKS G;  3N2K B;  4LF4 H;  2BOB C;  2R8K A;  2FJZ A;  1H8H G;  5LL6 b;  4WHX A;  3K5O A;  5LXT B;  2HJW A;  5JQG F;  2QWO B;  1WLE A;  2DYS B;  1S0V A;  1IOW A;  3BCC H;  1RJQ A;  2ZXW B;  2W6Q A;  4I50 B;  2JEJ A;  3AW8 A;  4MVQ A;  1I50 A;  3OMI B;  4JI1 O;  1K34 A;  1PP9 H;  2JGD B;  5KG4 A;  2VS0 A;  4YAJ B;  3RAQ A;  3MR6 A;  2PUS A;  2FKL A;  4RAY A;  5JH7 A;  1BS3 A;  1E1Q G;  1F4N A;  1ZTE A;  5L3G A;  3FKI G;  5KFL A;  1XMQ H;  1H8E G;  1EHI A;  5KMG B;  1ZLZ A;  4O7T A;  4YJ3 B;  5I5X A;  4XDL A;  4PV1 B;  4JYB A;  1P49 A;  2HVS A;  3G6B A;  4YIO A;  3Q8P B;  4DV4 B;  3FYI B;  3M9N B;  3LSS A;  4RU9 A;  1ET0 A;  5D1O A;  1S03 G;  1SC5 B;  1GAX A;  3QZ7 A;  4EKW A;  4WFE A;  4JPR A;  2FMA A;  3HKE B;  2XAF A;  4QWC A;  4CKC A;  4FMT A;  5ITZ B;  3T54 A;  4ED2 A;  4JAS A;  1N33 O;  1Q43 A;  3B77 A;  3R66 A;  2XIG A;  1Y67 A;  5C8Y F;  3ABL B;  1D2D A;  4ZOL F;  3K06 A;  4JYY A;  5KUM A;  5KX5 A;  3Q8R B;  4JV5 H;  3JD2 A;  4X64 B;  2Q7H A;  3RYC A;  1GN3 A;  1YEW A;  3H1I H;  4WBN B;  3QWU A;  2V5A A;  2EIJ C;  2G38 A;  2HKO A;  4NR1 A;  1Z2O X;  2EIY A;  4LF4 O;  1AJP A;  3BAA A;  2XD4 A;  3H1K H;  3G6E V;  3LP8 A;  2V4R A;  5LMU O;  3E35 A;  4IGG A;  2CE4 A;  1E4E A;  2E2H A;  2X0L A;  4ZI7 F;  1H2S B;  1ZX3 A;  5EC1 C;  4YAK B;  1J5E B;  1YCI A;  3QZ8 A;  5KT3 A;  3H4D A;  1C3O A;  5KX5 F;  1FXK C;  3KHG A;  5L3B A;  5HV6 A;  4Q6G A;  3GIQ A;  5DQI A;  1BNC A;  1WP7 A;  1Y74 A;  4LNU B;  3RJ0 A;  4PDR A;  2Y4R A;  1NI8 A;  1KJ8 A;  2WLI A;  2LFS A;  2DPJ A;  3E8B A;  1NTK H;  1R73 A;  4UV9 A;  2RCV A;  5GW7 A;  3DXR B;  1WR2 A;  4D6T H;  4A3K G;  3ASO C;  2PYL A;  5JVD B;  1JVM A;  4MT8 A;  4ECZ A;  1XNQ H;  3PO2 G;  1GN6 A;  5T14 A;  1FD9 A;  2GLT A;  5I5U A;  3ZHT A;  4QWD A;  1IZ3 A;  4BIO A;  4H44 B;  4UB8 Z;  4R6Z A;  5B3S B;  1TWC A;  1XUQ A;  2A0L A;  5KT7 A;  2EIN C;  2W9C B;  5CA0 F;  2UUA B;  4UCT A;  4FFL A;  4DRX B;  4UVB A;  5EK0 A;  1J95 A;  3KRE A;  5KFP A;  1CE8 A;  2WTF A;  3S3W A;  2EJR A;  3BQ0 A;  4DL6 A;  4J9R A;  2R93 A;  3MFH A;  3WU2 Z;  1QBZ A;  3CCQ V;  4A3B G;  1T5E A;  4H0L B;  3ZRS A;  5KG3 A;  2CW7 A;  3BPZ A;  1GN4 A;  4J42 A;  1PPJ H;  4WF9 V;  1AUV A;  3RAX A;  2PF4 E;  3CC7 V;  5B1A B;  3H0G A;  1PKX A;  3JAR A;  1MZF A;  3JAK A;  1VAJ A;  3B4S A;  3WFV A;  5A2Q N;  2IJK A;  5LHI A;  3QFF A;  2YXH A;  5BYB A;  2L6L A;  4NVP A;  3KZI Z;  4F50 A;  3Q4H A;  1EYZ A;  4H13 B;  3WB0 A;  4JI6 B;  1VQK V;  1M57 B;  4MTE A;  4KFM A;  2Z02 A;  2CAZ C;  5J2U B;  3O65 A;  3G6Y A;  4B3R H;  3G8C A;  5LMN B;  4DUZ H;  2DWC A;  2LFR A;  4GX2 A;  3CJH A;  3VOT A;  2HIV A;  2R93 G;  1WH2 A;  2EIL C;  1LNQ A;  2LGW A;  2JEX A;  4CHI A;  1NH2 B;  2Z5U A;  3AEI A;  2UUB H;  4TQD A;  4ECX A;  1D5N A;  4LF6 B;  4HNU A;  4D7T A;  2YIC A;  4LFB O;  1QNM A;  1K8A W;  3P32 A;  1COW G;  1W59 A;  3GTO A;  5BR8 B;  3G4S V;  1KD1 W;  3ZMV A;  3KCY A;  4DL5 A;  2HHH H;  4LF7 O;  1SKV A;  1V54 C;  2FPI B;  3M99 B;  3DSQ A;  4YY3 H;  2WLI B;  1NS1 A;  2GQS A;  3OFN G;  4JI6 O;  3G6X A;  2ODM A;  4XDK A;  1EZV H;  3SPI A;  1IBM O;  2CNU A;  4DUY O;  1AP6 A;  4O2A F;  3ETE A;  4RB3 C;  2Q68 A;  3TIN A;  1SES A;  4JI1 H;  2AW9 A;  4R8U A;  2UXD H;  1L2Z A;  1O9H A;  2FKX A;  2DZD A;  1HNZ H;  4TSF G;  2WE6 A;  4CKE A;  1V9P A;  4FS1 A;  1A9X A;  3PR5 B;  1OCO C;  3B8N A;  4DQN A;  4AYB A;  1LR1 A;  4PDL A;  4QIW A;  3OMA B;  3T9D A;  1P7B A;  2RJZ A;  4RZR A;  1GYF A;  4ZQI A;  1VF6 C;  1DK1 A;  1N56 A;  1VQ7 V;  3CSX A;  5TIS Z;  1IX9 A;  3GTP A;  4U3J A;  4HNV A;  3LNM B;  4HN2 A;  1JIH A;  2XUM A;  2D2C B;  4JI4 O;  1ZSP A;  2YL2 A;  2W7P A;  3OMN B;  5CBF A;  1S72 V;  3MHS C;  1F23 A;  1K4C C;  3CX5 F;  1D5A A;  4J9P A;  4EYI B;  4TV8 A;  2WLM A;  5JVL A;  1S77 D;  2ZIO A;  1K9M W;  1JLL B;  2ZR3 A;  3TQ1 A;  2ZD9 A;  3UZB A;  3CCE V;  2J6U A;  1R3J C;  4FFM A;  4RB1 A;  4JI8 H;  4FM9 A;  5IYD G;  4CC5 A;  3R5X A;  4QW8 A;  2PI5 A;  4BWS C;  5I5S A;  4ASU G;  5LOV F;  1VQN V;  4FM0 A;  3SR2 C;  3JAW B;  4X1I A;  5L1I A;  1S5H C;  1K3E A;  5CMU A;  1H2K A;  3G8D A;  5D8D A;  3T1Y B;  1YHQ V;  2JIZ G;  2E3C A;  4A93 G;  3R5F A;  1HNZ O;  1KC7 A;  2P22 C;  4DR4 H;  5EC2 C;  4UVC A;  3NUA A;  2CTR A;  2HR3 A;  4J10 A;  5I5Y A;  3Q8Q B;  5L3E A;  4NB5 A;  4LWS B;  3W5O A;  1AVM A;  4YY3 B;  1GGO A;  3NC0 B;  1G4Y B;  1Q90 D;  4JV0 A;  4DL3 A;  2AGP A;  4C2M A;  1E4G T;  1B6R A;  2W0X A;  2NVX A;  1OBG A;  5KFY A;  2E5L O;  5FNV B;  5BR8 O;  4ZI7 A;  5CA1 B;  1GLV A;  2KB1 A;  1VBH A;  1NH2 D;  2YW2 A;  4Z2W A;  3FMA A;  1FJG H;  2YIA A;  4NZN A;  3W7W A;  1G8M A;  2ZE7 A;  3JAS A;  2NU8 B;  3RIZ A;  4EBE A;  3GJX B;  5JUM A;  1AUX A;  2CGO A;  2FK1 A;  2B9Z A;  3HOZ G;  3IGA C;  5B1A C;  3DGE A;  5B1N A;  1THZ A;  4H33 A;  3Q2O A;  2V7Q G;  2F1M A;  3M8A A;  1DV1 A;  1YF2 A;  5KFW A;  5KHI A;  3T1Y O;  3PW5 A;  1EUD B;  3CRA A;  3FAV B;  5IJ0 A;  3NBZ B;  2Q0O C;  2C2E A;  5BWW A;  3OUS A;  2W0F C;  4ED6 A;  1XL4 A;  3OM3 B;  4DV6 H;  3MAQ A;  3I55 V;  4TV9 F;  4UCS A;  2XCA A;  3A0B Z;  4WFB V;  5E25 A;  4UCU A;  5C8Y B;  4MSW C;  4LR3 A;  4TT3 G;  5IYZ F;  3T9F A;  2WB1 E;  1PX2 A;  3KTM A;  4BAY A;  4B3R O;  3AG4 B;  4Q20 A;  4DR2 O;  4KXR A;  4DV3 H;  2WA3 A;  2IH3 C;  1XDC A;  1TVK B;  1GMG A;  2YZL A;  3T9B A;  1PL4 A;  2YI9 A;  2UUB O;  1MSD A;  2UUA H;  1WN7 A;  2PTM A;  4NYK A;  3RWR D;  4PA3 A;  3UO2 A;  5BWT A;  4J0M A;  2PZS A;  4GX0 A;  4JI7 H;  1HNX B;  3EYY A;  3ZHV A;  1NTM H;  3RUP A;  3X2Q C;  3KHL A;  1Q82 W;  5EWG A;  1BJT A;  4LFA B;  2JA5 G;  4X8A A;  3N44 B;  2XCL A;  3OE7 G;  2QTS A;  4FFR A;  2DWD C;  4DR5 H;  4ZIB A;  3ASO B;  1SA0 B;  3BHP A;  5DAA A;  1UNN C;  2UXB H;  1YIT V;  2H3O A;  4LFC O;  3R5H A;  2E76 B;  2K1E A;  4OX9 O;  2XHB A;  3ZMT A;  5L3D A;  1IXM A;  3PO3 G;  3JCZ A;  4DV2 H;  5FLX N;  3JZF A;  1YTF D;  2UXX A;  2XAH A;  2ZDI C;  4FZ1 A;  2R85 A;  2IJI A;  4YJ2 B;  4OPA A;  4JYC A;  1MA1 A;  2Z04 A;  4O83 A;  3T1Y H;  3J7A K;  1OCR B;  1M6V A;  3C3S A;  4FIP C;  1FPO A;  2R86 A;  3A0R A;  1Z5V A;  1NR1 A;  4BW5 A;  3JAW A;  1H38 A;  3CCM V;  1Q6U A;  4FM1 A;  2X0S A;  2ZIN A;  2R8H A;  2H94 A;  1SQB H;  4X66 H;  3EHB B;  2UUB B;  3ORR A;  3J80 W;  4WCE V;  1EFR G;  2YC0 A;  2E5L B;  2VQF B;  2BTO A;  5IE9 A;  5LGU A;  4FLW A;  4B3M H;  2YS7 A;  1XNR O;  3KXY T;  2XAS A;  3FB8 C;  4F4Z A;  4A3J G;  2EJ0 A;  1MZB A;  4RNN A;  1Q86 W;  1W93 A;  3SYO A;  1PK8 A;  1VQP V;  2NR5 A;  4O4H A;  5BMV B;  4BBS G;  3J80 N;  4O2A A;  3OUZ A;  4YJ2 F;  3ZMZ A;  3DF7 A;  2HVR A;  3CWB H;  1CP9 A;  1N0J A;  2AZ0 A;  3AG1 B;  2AGQ A;  2IP4 A;  3TIG A;  3IG0 A;  2C2R A;  1PV0 A;  2HLD G;  1RJP A;  1B6S A;  1GM8 A;  4FM2 A;  4M7E A;  4ED1 A;  4K0K H;  1JPX A;  3AG7 A;  2ARH A;  2F95 B;  1GTO A;  2EZO A;  3FKI A;  1JJO A;  3RF2 A;  3VNN A;  2ZNI A;  3PFF A;  5FL7 G;  1VQ5 V;  4MVO A;  3PW4 A;  1YVW A;  1S5J A;  5L9X A;  4DV0 H;  4IT5 A;  1RSO A;  4GC6 A;  1K7D A;  1SER A;  3GIP A;  4RUE A;  3WWJ A;  1WJZ A;  2OCC B;  4GX5 A;  4JI3 H;  1SQG A;  1CQJ B;  3GTJ A;  4ZOL B;  1Q5O A;  5BR8 H;  3K0D A;  1FKA H;  1FXK B;  3RT3 C;  2ZM6 B;  1Q7Y W;  3TEK A;  4ZKI A;  2W6M A;  1N33 H;  1TAE A;  4GKK H;  2BQU A;  1AR1 B;  2XAG A;  4QWA A;  1U97 A;  2ZJT A;  4JI5 B;  1J5E H;  1BQ0 A;  1DAA A;  3V6J A;  4U7O A;  3ZJZ A;  4CS2 A;  1I94 H;  3NGD A;  1N48 A;  4X64 O;  1QR8 A;  4MV6 A;  2RGV A;  4UUJ C;  2YZM A;  4Q44 A;  3OHA A;  1UC8 A;  4AI8 A;  2WLK A;  2Z3Y A;  3N2G A;  4ECS A;  1N32 H;  2ADP A;  4JI6 H;  4XYM B;  3JZI A;  1ARO P;  1QLN A;  3T9E A;  3U0Z A;  4ECQ A;  4I0X A;  2WAM A;  1IBM H;  3E89 A;  5JCO C;  5C1P A;  1YSC A;  4RWU A;  3NR7 A;  4DUY H;  1GH6 A;  2QSA A;  1NZ6 A;  3AG3 B;  3IJ4 A;  3WO0 A;  5FR9 A;  3FB7 C;  4UCR A;  4LF7 B;  5H2F Z;  4EGQ A;  2FYU H;  3WB2 A;  2YIB A;  3RV3 A;  2W71 A;  2CTP A;  4LWS A;  4MW8 A;  2ZGI A;  5KAF Z;  2CGN A;  5LYJ F;  1AI7 A;  2JS3 A;  2HGS A;  3LNN A;  1H2M A;  4DUY B;  2Q9L A;  5LA6 B;  3WWI A;  4DUZ B;  2YZG A;  1KKC A;  4J9Z B;  1Z5W A;  3JAK B;  4YR3 A;  2UXC B;  3ICX A;  4DV1 O;  2R7L A;  3T4Z A;  4L1K A;  4A3I G;  5EBL C;  5KT2 A;  4RCN A;  3PW7 A;  4B3M B;  4DR2 B;  1WA8 A;  4HNA A;  1XNQ B;  1MNG A;  1JDE A;  4GT1 A;  1VBG A;  5B1B B;  2B63 A;  1R6T A;  2ATK C;  2FK3 A;  2ZDI A;  4OXS A;  4Q8F A;  4QPK A;  5LP6 F;  2P5O A;  1ZET A;  3T99 A;  1TWA A;  4TV8 B;  2EIK B;  5DG8 A;  1SET A;  1RSO B;  1DV2 A;  1U96 A;  1YXB A;  3K5N A;  5LBQ A;  5KFZ A;  1JX4 A;  3VPB A;  3MR2 A;  2Q7G A;  1DGS A;  4FS2 A;  3D3I A;  2Q0A A;  5LA6 F;  1V54 B;  1XEQ A;  4PI0 A;  5DIS C;  4DRF A;  4P9P A;  1ZL8 B;  2GDS A;  3DXR A;  4HBN A;  4NXN O;  4O4I B;  5CE8 A;  5GTH Z;  5KFH A;  1GKF A;  3BA8 A;  3U9T A;  5IYC G;  5LMU B;  3SYP A;  1XBL A;  5KFR A;  4IYI A;  1IYD A;  3QO7 A;  4O2B A;  1OJH A;  5KA5 A;  2V59 A;  4J11 A;  3N6X A;  3RB6 A;  3GVM A;  5H6Q A;  1M93 A;  1BHA A;  5LP6 C;  5C44 G;  4O4H B;  4AHC A;  2R7Z G;  2M05 A;  5I5W A;  3K59 A;  1Y1W G;  3HBL A;  2YDE A;  4APM A;  5FNV A;  1JR9 A;  3A2F A;  3BEH A;  2EIM C;  2R9A A;  4QE9 A;  5JQG A;  4FLT A;  4L8J A;  5GON B;  5CAE B;  1W2B U;  4C5C A;  4BW9 A;  3DC6 A;  3MR3 A;  2O03 A;  5FNV F;  3THO A;  3AG1 C;  4EEY A;  2R8J A;  1TWH A;  3N42 B;  3E8G A;  3ZCC A;  1YJ9 V;  2UXD O;  3L70 H;  5ITZ A;  1RM1 C;  2EZP A;  1AR4 A;  3GIK A;  5A2Q W;  3ZRX A;  2FML A;  1OCZ B;  3T1H B;  3K3V A;  3GWO A;  4NKG B;  4CH6 A;  2JK5 C;  4DAA A;  3JAL B;  3J81 N;  1KUQ A;  2R7N A;  1H2N A;  4DV0 O;  5KFN A;  5H9C A;  4OGQ B;  1KP3 A;  4HNT A;  3GTM A;  3SPC A;  4P9O A;  3VBB A;  4BBR G;  4FFO A;  4QWE A;  2A7W A;  4ZBM A;  2HIX A;  4AQY O;  2M7W A;  4J7J A;  2W6J G;  1EN4 A;  2F4V H;  2X6A A;  4TV9 A;  3I4N G;  4G28 B;  3RBE A;  5KFE A;  3JAR B;  1XOU A;  3ZRW B;  5KG0 A;  1XNQ O;  2GBO A;  1J5E O;  4RB2 C;  3CP1 A;  4DW1 A;  2IM9 A;  3F5W C;  4LBE C;  4JI5 H;  1O9G A;  3E22 B;  2R87 A;  4X64 H;  3N2K A;  2Q2U A;  5LP6 A;  1ROP A;  3HB9 A;  1RFY A;  3ZMU A;  3FYE B;  4I0X B;  3RYI B;  4JI7 O;  4DR6 B;  3B2E E;  3TK1 A;  3NXS A;  3TXS A;  5CB4 B;  2YEV A;  3H01 A;  3N2G B;  4RQF A;  4DV0 B;  5KFT A;  3ZN1 A;  4GC7 A;  4UV8 A;  1KC8 W;  2NU7 B;  5DGI A;  4DV7 O;  4CMF A;  4NYE A;  3ZBH A;  4B3S B;  2B63 G;  1EUC B;  5IJ9 A;  1I3Q A;  5LGN A;  5JVD F;  4O3S A;  1Z2N X;  4HQ6 A;  1HP8 A;  4JZG A;  1Q6H A;  3AX6 A;  4GCZ A;  1RPO A;  1P84 F;  3ASN C;  4F4L A;  3EVK A;  4FBT A;  4GX1 A;  4DR6 H;  3CVZ A;  1M57 C;  2XCP A;  2DAA A;  1G2W A;  4EQ5 A;  2W6Z A;  3RGZ A;  1OWT A;  4K0K B;  5DN6 G;  1SEI A;  1ZHQ A;  5DED A;  1BGW A;  3E83 A;  4LNU A;  4FU0 A;  5BY1 A;  4U7N A;  4LF5 O;  4TUY A;  5IWA B;  4YQW A;  1S68 A;  2DQ3 A;  3AG4 C;  3RGX A;  4NTX A;  2UU9 O;  5IJ0 B;  2KG7 A;  4G3I A;  2AU0 A;  1BMF G;  4DL4 A;  3IFX A;  3H20 A;  1PNM A;  5CA1 F;  5CA1 A;  3H0G G;  1AR5 A;  5CB4 F;  2R82 A;  1V55 B;  3GII A;  2P4K A;  3AK3 A;  1ZHS A;  4UCV A;  4O82 A;  2RDI A;  1BE3 H;  3QNE A;  1ZUQ A;  4BWA A;  3HR0 A;  1B06 A;  2W8L A;  3JAS B;  1VQM V;  4DYL A;  3R65 A;  1XNR B;  2R70 A;  3JYC A;  5EWF A;  1C30 A;  4JI0 H;  1N34 B;  5FPO A;  1K92 A;  3K3W A;  4RQE A;  3T5K A;  4DV6 O;  1FFX A;  4UCO A;  1HNZ B;  1I1L A;  4W4K A;  5JQW A;  5F9N A;  4I9W A;  2UU9 B;  3MD0 A;  1P4R A;  3RYF B;  5KG2 A;  4BIU A;  4QPJ A;  4R7C A;  3OEE G;  1AN7 A;  4B7E A;  3GTK A;  2P4V A;  5DEC A;  1QQC A;  4EFE A;  3HKB A;  2XGQ A;  3OUF A;  1CS0 A;  1W0K G;  1L0L H;  4PA9 A;  5KFO A;  4JI2 O;  2NNU A;  2COI A;  1HNW B;  2DJV A;  2VQE O;  2J9G A;  2PMZ A;  3MJF A;  2C2A A;  4MV1 A;  1WAZ A;  2F23 A;  2RDC A;  4BXX G;  3TW6 A;  1E1R G;  4NXN B;  5KG1 A;  5KG5 A;  1B04 A;  5FJ8 G;  5KHK A;  2QDO A;  2PYJ A;  1TWG A;  3OR6 C;  2V9W A;  3PW0 A;  4MS2 A;  1UPG A;  4UFZ A;  3SPG A;  3K5L A;  1I2K A;  1RK6 A;  1F51 A;  4O4H F;  1DTO A;  3VQV A;  2HHF A;  1NR7 A;  4NTW A;  1SA0 A;  2JEI A;  2YXY A;  2YID A;  1XK5 A;  3H1L H;  1XMO O;  4NLG A;  1ULZ A;  4Q4C A;  3L4K A;  2Q8V A;  2QTO A;  3P3N A;  4HAM A;  4HZ3 A;  4GYC B;  3HKZ A;  5DLG A;  3BA9 A;  2Y69 C;  4X20 B;  5IY5 B;  2Y0S E;  5GTI Z;  5KFX A;  4ZHQ B;  4MTD A;  2QM7 A;  2WLJ A;  5IWA O;  2N74 A;  1MOF A;  4NXM O;  2UXD B;  5EZY F;  4LCU C;  1QR9 A;  1EN6 A;  5BMV F;  1IBL O;  5KFU A;  3ZMS A;  2GPS A;  3TY5 A;  4GLX A;  3LDC A;  5LOV B;  4PJ0 Z;  4MTO A;  4Q8E A;  2JA7 G;  3U54 A;  2JEG A;  2MW2 B;  5L3C A;  3JAM W;  4I4T B;  3HOX G;  2ZQM A;  2Y0P A;  1VQL V;  4L87 A;  2K9P A;  1Y76 B;  3OGC C;  2WYO A;  4DV1 H;  1SYX B;  1S0M A;  2E5L H;  1A0I A;  1O75 A;  4XBF A;  2P7T C;  1AJN A;  1Q8I A;  4JI3 B;  3SE7 A;  5FPR A;  4KHP O;  3JZ6 A;  5EOY A;  1TUB A;  1E79 G;  5KX5 B;  4DR4 B;  3S3X A;  3T9C A;  1EKV A;  2E2I A;  2WAQ E;  1Q81 W;  3PZP A;  1FYJ A;  1QLE C;  4FBU A;  3N41 B;  2QEX V;  3ZHU A;  5AG2 A;  3JSN A;  5A9G A;  1RJR A;  2IBK A;  5LA6 A;  2Y4T A;  4CE5 A;  1XRE A;  4DR5 B;  4NXN H;  1DIK A;  1OZ0 A;  2UUC O;  2FTK A;  4O7V A;  5IYZ A;  5BPH A;  4FLV A;  3WO1 A;  4JUZ A;  3M7M X;  2DE0 X;  5BPF A;  1N36 H;  3JD4 A;  1K33 A;  1NJI W;  2XGP A;  2BTQ A;  4JTA B;  4O4L B;  4DLK A;  4TQF A;  3L75 H;  5IT9 N;  4CH5 A;  2QWN B;  4IYH A;  3J81 W;  2IU0 A;  1R3L C;  3ABT A;  3GB7 C;  1GRJ A;  2PY5 A;  2DWE C;  4ECY A;  2N04 A;  2RQ6 A;  5DGA A;  1VQ9 V;  2I80 A;  3BVO A;  3CCJ V;  2CH7 A;  3OTO H;  1SQX H;  5EIB C;  3CE2 A;  2ZDG A;  2NU9 B;  5L1K A;  5KUK A;  4W4L A;  4TUY B;  3C0F B;  4EB6 A;  4QW9 A;  4K8X A;  4OPH A;  4LF8 B;  4O2B F;  3RTX A;  4CZZ A;  2AHY A;  4H37 A;  3RYF A;  4FFB A;  3HOV G;  5GON A;  3H1J H;  3RW0 A;  2UVU A;  4PHZ A;  4KHP H;  1Y76 A;  2VWJ A;  2YRW A;  3N40 P;  2YU9 A;  4QNH B;  5KAI Z;  1EBO A;  1NQT A;  3HOU G;  4LF9 B;  3M9M B;  1Q6I A;  3GID A;  2AQ4 A;  4ECU A;  3TII A;  1BHB A;  1VQ6 V;  4IIJ A;  3G6V A;  2UVW A;  5KG6 A;  4NXM B;  3FAV A;  3FB5 C;  4LF4 B;  3JD0 A;  4MV4 A;  4JF3 A;  2OCH A;  4WFG A;  2JA5 A;  3UT5 A;  2DYS C;  1SRY A;  4B3S H;  2JA6 A;  1Y74 B;  4DR1 B;  1Z2G A;  3RYH B;  3GTG A;  4N21 A;  2ZDH A;  2R9I A;  2VUM A;  4IRK A;  4JAA A;  1FS0 G;  3L72 H;  2UUC H;  5E1A C;  4GZR B;  1IBK H;  3E5N A;  2C22 A;  1I1M A;  4X66 O;  3OUU A;  2A79 B;  1WCM A;  2B1I A;  3OT7 A;  3G71 V;  5LXT F;  4LH6 A;  1SQQ H;  3RB0 A;  3GLK A;  4LFA H;  4I5S A;  3TW7 A;  1AI5 A;  2IBZ H;  4MTX A;  1K1S A;  1F7Y A;  5CBG A;  3KCX A;  3L2P A;  4DL7 A;  1OCC C;  4O7S A;  2XOK G;  4MV3 A;  4JI2 B;  4AQY B;  4F6E A;  1KP2 A;  2W57 A;  3X2Q B;  3L4J A;  2ZE8 A;  4DV4 O;  4TV8 F;  4MTG A;  4WFF A;  1A0G A;  4YJ3 F;  3PJS K;  1YZB A;  1XHX A;  5IYZ B;  2CW8 A;  1KMI Z;  2RN9 A;  4FJC C;  2IMW P;  2ASJ A;  5BYA A;  4CMD A;  3JRX A;  4A3D G;  1OCZ C;  5DM6 V;  2A9H A;  2XAJ A;  3P30 A;  4LF9 H;  4LP8 A;  3JAL A;  2CZG A;  2UVV A;  4JV1 A;  4P30 A;  3SDL A;  3TGU H;  1BSM A;  1MAB G;  5IJ9 B;  1WPB A;  1PNL A;  4IL6 Z;  1QVG U;  5D1O B;  3ZIA G;  5JJE B;  4X1I B;  2LW7 A;  5IYD O;  1BCC H;  2DMX A;  1K5Q A;  4DR2 H;  2PN1 A;  2V4D A;  4CC6 A;  5KT6 A;  3PW2 A;  4GKJ B;  2W7O A;  3F5T A;  2BSK B;  4B3S O;  5BZB A;  3WNZ A;  3CCL V;  2B1G A;  4I4T F;  2VR1 A;  4X1K A;  3CRC A;  2A3Q A;  4NTY A;  5I5T A;  4TOI A;  3WG7 B;  3GV5 B;  1PM9 A;  4MAM A;  2NUA B;  3N27 A;  3CCU V;  2ILM A;  3CXC U;  3TET A;  2UXC O;  4MTF A;  5J2T F;  1EZ1 A;  4WFH A;  2AHZ A;  1GM9 A;  1N4C A;  3B8M A;  4K35 A;  4LF8 O;  4M9U A;  4LSA A;  2FLP A;  1RK5 A;  2N05 A;  3CPW U;  4LFC H;  2RNB A;  4X1Y A;  3H1H H;  2QKS A;  1OCR C;  2ITC C;  2FB9 A;  2BOC C;  3IN5 A;  2ADQ B;  2OT5 A;  1JFF B;  3KYH C;  3ZED A;  3EPG A;  5KFK A;  4ED7 A;  4EG0 A;  1A3G A;  1Y66 A;  2LP7 A;  1M0T A;  2C35 B;  3I4M G;  4E6N A;  3W7S A;  3Q8S B;  1PD3 A;  3K58 A;  1A32 A;  3GDE A;  4RB0 A;  4X62 O;  3APQ A;  4FLU A;  4PZ7 A;  1NVP D;  2EJ7 A;  3HKC A;  4JZ2 A;  2ABJ A;  2HJD A;  4GKJ O;  2JDI G;  2GQR A;  1N0N A;  2DW4 A;  2EX3 A;  3M9O B;  2AXT Z;  3JAT B;  3VQY A;  1OBD A;  2VPQ A;  2XT9 A;  4MW3 A;  3CS5 A;  4DR4 O;  3E86 A;  3ABL C;  3BFR A;  1G1X B;  3VMM A;  4GKK B;  4Z1M G;  1N36 O;  1UJW B;  2AZ2 A;  3RGB A;  4WFA V;  1WRV A;  2LGQ A;  2XC9 A;  2P90 A;  3UZO A;  3OR7 C;  2QK4 A;  2JVD A;  3K0G A;  3OEH G;  2OIE A;  5JWP A;  4YHH B;  5KFG A;  1OHH G;  1B33 N;  3PVX A;  1KB9 F;  2HG8 A;  3V6H A;  4LH7 A;  4O2B B;  4B08 A;  4Q0Y A;  3SJC C;  1FJG O;  4K3A A;  4WBN A;  2ZIM A;  1JFF A;  1WNS A;  4QGP A;  3T4D A;  3D36 A;  2X7R B;  1GSA A;  4EGJ A;  1AIL A;  3ETQ A;  2BE3 A;  1XDN A;  3ABK B;  3K9A A;  1JXL A;  2YS6 A;  1N36 B;  3VQX A;  1ENV A;  3LML A;  4FZ0 A;  1JJ2 U;  2QM4 A;  3KAL A;  4PA7 A;  4XDJ A;  1HNW H;  2EIN B;  4J9Q A;  3ZRW A;  3T1H O;  5LMU H;  3AG3 C;  4WD3 A;  3ABM C;  5JJN B;  1R6N A;  1FJG B;  5K2M A;  5IWA H;  4ED3 A;  4K6N A;  2ZNJ A;  2UU9 H;  2WDT A;  5KFS A;  3CCV V;  3HKD B;  2DOS A;  5KA6 A;  2W6P A;  4FFK A;  1R9T A;  5KFA A;  2HHH B;  2VRZ A;  4YHH O;  4B7K A;  1SCU B;  4RNM A;  1UFI A;  4CS4 A;  4RNO A;  3AK2 A;  5FLX W;  3SJA C;  1WSC A;  1I94 O;  2JJ2 G;  2P67 A;  3L9D A;  2KG7 B;  1YI2 V;  1KJJ A;  4QIW E;  1EM1 A;  1HW7 A;  2YRX A;  2FE3 A;  5H80 A;  4ZOL A;  3HKB B;  2YSU B;  3CXH F;  2LJ2 A;  1OV9 A;  3W7T A;  4IWX A;  3GV7 B;  2M6Y A;  1R1B A;  2XAQ A;  4IIJ F;  3GQC A;  1HR0 H;  1Q3E A;  4J9K A;  1MZE A;  4DO2 A;  3HOW G;  2VA2 A;  3CC2 V;  3VPC A;  2DLN A;  4U3J B;  2W8K A;  4HR7 A;  3RR5 A;  3E2E A;  2JA8 G;  1VKZ A;  3BQ2 A;  3LUL A;  4J9Y B;  5JH7 F;  1KTA A;  4KHP B;  2DYR B;  1RYS A;  2E74 B;  3WG7 C;  2HHF B;  3T9A A;  3H9V A;  2W9C A;  4ECR A;  5KHH A;  1P8L A;  1Z2P X;  2F4V O;  4O2A B;  3AK1 A;  3T2M A;  3ETH A;  4DR3 O;  5F9L A;  2LO1 A;  5LL6 Y;  1R3K C;  1EKP A;  3BAC A;  2CNV A;  2C00 A;  1E4F T;  3FDS A;  1VEW A;  3N8D A;  3CHX A;  2IJH A;  1KKD A;  2PGG A;  3MFI A;  3OTO O;  1KT8 A;  5JCO A;  4O3N A;  2WSS G;  3APO A;  1N33 B;  1B6Q A;  1KJI A;  3SYC A;  1FAF A;  2KSW A;  4DV7 H;  1I7L A;  3TXQ A;  2EBO A;  2COJ A;  4O7N A;  4RAZ A;  3T5J A;  1HR0 O;  1K97 A;  1IDS A;  3L74 H;  1CKN A;  4DR7 H;  1B3Q A;  4PI2 A;  2YXL A;  2ATL A;  3RB3 A;  4NXM H;  3Q1K A;  3T5L A;  1KJ9 A;  1IBL H;  3CRM A;  4IHJ A;  2CDY A;  1VF7 A;  1KUT A;  4QE7 A;  3RVZ A;  2WLL A;  1SQF A;  4X62 B;  1YIJ V;  1US6 A;  2HJF C;  1IYE A;  5HFM A;  3QVN A;  1IBK O;  4JI3 O;  3BRC A;  3U55 A;  1CXZ B;  3HKE A;  1ZAU A;  3QF7 A;  1MSW D;  4FVM A;  4HYO A;  1GSH A;  4PA4 A;  1W96 A;  4B3R B;  1MMM A;  2HGX A;  4EBD A;  2ZDQ A;  3OTO B;  3DTG A;  1HNX O;  4PDM A;  2OLS A;  4J7K A;  1GSO A;  4F4Y A;  3T5H A;  2FL4 A;  3WWH A;  4JYA H;  4QJF A;  1HDJ A;  3H4B A;  4DV2 O;  3SYQ A;  1JA8 A;  2GTA A;  2IU3 A;  3UT5 B;  4IAJ A;  5DGB A;  4QIW F;  3MDS A;  2V1D A;  2CNQ A;  3G80 A;  3V4Z A;  3GTL A;  2FB5 A;  2NVY A;  2JA6 G;  1URF A;  1VIB A;  4PEL A;  4FFP A;  4JV2 A;  3UCS C;  5IYB G;  1YJN V;  3VQW A;  2QE7 G;  1I1K A;  1P16 A;  4MA0 A;  4DIM A;  2I8C A;  4I55 F;  2LW1 A;  1P7G A;  2FPP B;  5HBR B;  4YHH H;  5CB4 A;  1L8D A;  4J9N A;  4D7S A;  1VQ8 V;  3H40 A;  2JEU A;  2J6S A;  4E2L A;  4DV2 B;  2VQE H;  3RVY A;  5LP6 B;  5BXZ A;  1LUV A;  1NU1 H;  1W0J G;  2DQ0 A;  5CA0 A;  1IVS A;  1L0N H;  4GUN A;  4CBC A;  3AYH B;  5KT4 A;  4A3F G;  2Q5Z A;  3OSN A;  4XX0 B;  1TVK A;  1SFO A;  5K3W A;  3SI8 A;  4PZ6 A;  2RDJ A;  2WB1 A;  1Y6X A;  4DV5 O;  3NBY B;  3DTU B;  4AIL C;  2NU6 B;  3UYY A;  1Y4M A;  2QR4 A;  4K0K O;  1S9F A;  2R84 A;  4O4I A;  4IWY A;  1HR0 B;  2RMK B;  4ETS A;  2W6I G;  2L35 A;  2MCT A;  4I7Z B;  4LF5 B;  5CA3 A;  4A3L G;  5JJJ B;  2QWQ B;  2EIL B;  5EBM C;  3ZS8 C;  5KG7 A;  3OTF A;  3GIJ A;  5KFM A;  1XMO H;  1SQV H;  1FXH A;  3SNO A;  4DW0 A;  2BQR A;  2J6T A;  1BT8 A;  4TWK A;  3LQS A;  2GUZ B;  4J7Z A;  5EZY B;  4HYK A;  3CJH B;  1NKD A;  2WA4 A;  1TUB B;  5C3E G;  2LQT A;  2OYQ A;  3CMA V;  1EN5 A;  2ZE6 A;  2CH7 B;  3LSU A;  1R6K A;  2F43 G;  4DV3 O;  1T94 A;  2Q4P A;  5JQG B;  2HEP A;  4UB6 Z;  2ZE5 A;  3K79 A;  4U3F H;  1Y1V A;  1T3N A;  1IBL B;  2FK2 A;  5KHG A;  2OTL V;  1VS0 A;  2CQY A;  2QWP B;  1RM1 B;  1M9N A;  3C3T A;  1QCE A;  1AI6 A;  1CKO A;  3SJQ C;  4G27 B;  4LC1 A;  2UXN A;  3LDE A;  3CRQ A;  1FFX B;  4A3C G;  2Y69 B;  5IY5 C;  4CH4 A;  4E4T A;  3CCS V;  5BWU A;  2JJ1 G;  3CCR V;  2A1H A;  2O57 A;  2DYR C;  3D3Q A;  3DC5 A;  3CC4 V;  1VP7 A;  3W7U A;  4J9O A;  5GON F;  4JI4 B;  2VUG A;  4RUF A;  2WPD G;  4EFB A;  5KHJ A;  4O7Z A;  4DV5 H;  4JI8 B;  4FE2 A;  5IYB O;  3ZX6 A;  4LF9 O;  4DRX A;  2KKW A;  4DK0 A;  5KKN B;  1Y14 B;  4OX9 H;  1M56 B;  3RV4 A;  2H8P C;  5KFV A;  3CSW A;  4DR7 O;  3PN1 A;  1ZL8 A;  1FVI A;  3LDD A;  3OD4 A;  3LSQ A;  4DR1 O;  1S97 A;  1SF9 A;  1AB3 A;  2W9B A;  1K1Q A;  4U7C A;  1K83 A;  2DPI A;  4EYH B;  1I6U A;  2RF4 A;  3K9S A;  3BG5 A;  2CFM A;  2Y4U A;  4TM5 A;  4JI2 H;  5CBH A;  2ETN A;  1BZK A;  4J41 A;  1KYO F;  2FLL A;  5LHG A;  4AQY H;  1N34 H;  3L73 H;  5C8Y A;  1CPY A;  5L1L A;  5J2T B;  2DIK A;  2OTJ V;  4LF6 H;  3T7A A;  3HOY G;  2ALZ A;  1WPX A;  5EWE A;  1I5Y A;  2R8I A;  2UUC B;  4CKB A;  1AJQ A;  3KKY A;  2HP8 A;  4M0J A;  5BWX A;  4JAV A;  3A0H Z;  4YP3 A;  4ECV A;  4LFB H;  3K3P A;  1Y1W A;  2AGO A;  3FX7 A;  3RYC B;  1AI4 A;  2OCC C;  5E79 Z;  4A2B A;  2ASL A;  2ZKO A;  3P3P A;  1IXB A;  5B1B C;  4MV8 A;  1GO3 F;  3L71 H;  4F4X A;  3IC7 A;  1I2L A;  2OIG A;  3VA7 A;  3I56 V;  4QSH A;  4IHJ B;  3HT5 A;  2R92 A;  2XTA A;  3RB4 A;  2HFE C;  3BQ1 A;  2UUA O;  1QVF U;  5BMV A;  2FP4 B;  3ZRV A;  3DAA A;  3KHH A;  3QTC A;  4A5U B;  5EZY A;  2GUZ A;  3K03 A;  2CUG A;  3HO8 A;  2ZXW C;  4LF5 H;  5L1J A;  2BR0 A;  1SZT A;  3J7A U;  2VQD A;  3ZHS A;  1WP8 A;  3FB6 C;  4FLY A;  4FK5 C;  4AYB E;  4DV6 B;  2P0A A;  5B3S C;  1YTF B;  2W6N A;  2F93 B;  4ZHQ F;  4EBC A;  2UXB O;  4X66 B;  4F4W A;  3TQT A;  1QLE B;  2R7M A;  4JI7 B;  3I12 A;  5IP7 G;  3MR5 A;  5D5Q A;  4Q43 A;  3CQZ A;  1JDB B;  3SPH A;  2QM8 A;  1QHT A;  5J2U F;  1VQ4 V;  4B3T H;  1X4T A;  5J2T A;  4FFN A;  3STL C;  4LSX A;  1NBM G;  3EXA A;  3K5M A;  1K5S A;  5HFL A;  5LMN H;  3ETJ A;  2HVJ C;  3GTQ A;  2Q73 A;  1X59 A;  4DUZ O;  4O4J A;  4O3P A;  1UC9 A;  2JRI A;  2RGR A;  1XMQ O;  1DF5 A;  4DV1 B;  3QO8 A;  1IUR A;  2UVR A;  5LHH A;  4PBC A;  1ZQ7 A;  3N6R A;  4JI5 O;  3UKM A;  2W9A A;  4NZO A;  3E22 A;  2PBZ A;  1GO3 E;  4UUG A;  3W1G A;  3FFQ A;  2QA4 V;  4DK1 A;  4O4I F;  1K4D C;  4ME6 A;  5LGT A;  3MWD A;  5C5J A;  2ZR2 A;  4KP4 A;  3SGI A;  5LYJ A;  4JXU A;  3JD3 A;  2VQF O;  1M56 C;  2Y0I A;  3AG2 B;  4DV3 B;  5FD6 A;  2YUA A;  2X5R A;  4PWQ A;  2XND G;  4YJ3 A;  3BAB A;  4RO2 A;  5KFQ A;  1M5I A;  3F7Y C;  5JH7 B;  4IIJ B;  3HXL A;  3HKC B;  4O7Y A;  2D3O W;  5IP9 G;  2EJ3 A;  4JAU A;  3IAY A;  1CKN B;  4PDV A;  3MWM A;  2GHY A;  1VF6 A;  4FPP A;  1PNK A;  4X9Q A;  4YBZ B;  3KAK A;  1XHZ A;  4B3T O;  4TQS A;  4A3G G;  4QWB A;  3HKD A;  4R7R A;  4RUA A;  1KBH A;  2Q7E A;  3V4S A;  5EYP A;  5KFI A;  4O4J F;  4G2K A;  1JMK C;  5LMN O;  1Y1V G;  5LXT A;  4I9Q A;  2BQ3 A;  4X65 O;  4J9S A;  4Q4D A;  3OHB A;  3G67 A;  2YS8 A;  4JYA B;  3KG2 A;  3ASN B;  2GPW A;  1JOY A;  3RYI A;  2QKA A;  1TWF A;  1BXR A;  4DR3 H;  2JGD A;  4GKK O;  4LF6 O;  2E75 B;  4PA6 A;  3Q4H B;  1H2L A;  4ZI7 B;  2W6O A;  1XI1 A;  1JX9 A;  5DG9 A;  3D36 C;  4MA5 A;  2Q6A A;  2BTQ B;  4O4L A;  3U9S A;  4MVR A;  1VMG A;  3U11 A;  2CK3 G;  1GN2 A;  5CA0 B;  3CB2 A;  4TV9 B;  3IC9 A;  2SCU B;  5BWR A;  2PI4 A;  1ORQ C;  1NTZ H;  3RBD A;  5KFC A;  3ETD A;  1PL0 A;  5B1O A;  4MV7 A;  2X6C A;  2YI8 A;  4IR9 A;  3SJB C;  5DLF A;  2ZM6 O;  4JTD B;  4O4J B;  2A06 H;  3V6K A;  1DF4 A;  4O7L A;  4O86 A;  3K5I A;  4O7W A;  1CQI B;  4B3T B;  4R8C A;  4I7H A;  2GSM B;  2HVQ A;  5D1P A;  2C28 A;  4CH3 A;  5L3F A;  1HWY A;  3UM7 A;  2ZCE A;  3K57 A;  1YJW V;  3HB3 B;  1XMQ B;  1MG1 A;  1X9N A;  1GM7 A;  1S0N A;  1JCH A;  3M4I A;  4OX9 B;  2OWO A;  3BY6 A;  5LYJ B;  1I7F A;  1XIL A;  3ORQ A;  1IBK B;  1CEZ A;  3C90 A;  3S24 A;  4ED0 A;  2JGU A;  2R9R B;  2IJJ A;  3OSP A;  4TVI A;  5H5N A;  1WA8 B;  2UXC H;  4X20 A;  5KLV H;  5B5E Z;  5C93 A;  2CTQ A;  2COG A;  2AGA A;  4I50 F;  5KFB A;  2WLN A;  4FGR A; 
#chains in the Genus database with same CATH homology
 1D5A A;  1I94 B;  4PDB A;  4LMY A;  4TV8 A;  1E4F T;  1ZHS A;  3CHX A;  4UCV A;  2ZIO A;  2PGG A;  4BWA A;  5D5P A;  3TY8 A;  5JCO A;  3JAS B;  4LF7 H;  4RB1 A;  4JI8 H;  3QG5 A;  1XNR B;  4FM9 A;  2R70 A;  4CC5 A;  4K8Z A;  4JI0 H;  1N34 B;  4BWS C;  5FPO A;  1N33 B;  4X62 H;  4FM0 A;  3SR2 C;  2KSW A;  4DV7 H;  1IBM B;  4I55 B;  3JAW B;  1FFX A;  4UCO A;  4X1I A;  1HNZ B;  4RAZ A;  2VWK A;  1XMO B;  3T1Y B;  2UU9 B;  4RZQ A;  1N32 B;  2E3C A;  1CKN A;  4DR7 H;  4PI2 A;  3RYF B;  2P22 C;  2YXL A;  4DR4 H;  3N43 B;  4DR1 H;  1AN7 A;  4NXM H;  1QQC A;  4EFE A;  3HKB A;  1IBL H;  4IHJ A;  3W5O A;  1VF7 A;  4YY3 B;  5EYP B;  5KMG A;  1HNW B;  3NC0 B;  1SQF A;  4X62 B;  2R72 A;  4DV5 B;  1E4G T;  4KL1 A;  5EIB D;  3BRC A;  4NXN B;  1B04 A;  5FNV B;  3HKE A;  1ZAU A;  3QF7 A;  4ZI7 A;  5CA1 B;  5KHK A;  2PYJ A;  4FVM A;  4I50 A;  4DR3 B;  3FMA A;  4B3R B;  1FJG H;  2YIA A;  3OTO B;  3JAS A;  3RIZ A;  3K5L A;  4UFZ A;  3GJX B;  4JYA H;  3UQ8 A;  2F4V B;  4Q0Y A;  3VQV A;  1SA0 A;  2Q2T A;  2F1M A;  1XK5 A;  3UT5 B;  4IAJ A;  5KHI A;  4JV5 B;  3L4K A;  5IJ0 A;  3NBZ B;  4GYC B;  3W1B A;  5IT9 W;  5LOV A;  3T1H H;  4DV6 H;  3TY9 A;  3BA9 A;  3MAQ A;  4X20 B;  2YIB D;  4X65 H;  4UCS A;  4UCU A;  4ZHQ B;  5C8Y B;  4LR3 A;  4MTD A;  3VQW A;  1P16 A;  2VOB A;  2UXD B;  3F8N A;  4DV3 H;  1TVK B;  2GV9 A;  4X1Y B;  4YHH H;  5CB4 A;  1L8D A;  4D7S A;  2YI9 A;  3TY5 A;  4GLX A;  2UUA H;  5LOV B;  1WN7 A;  2PTM A;  5K1X A;  4DV2 B;  5LP6 B;  3RFR A;  2VQE H;  3RWR D;  3JAM W;  4I4T B;  5CA0 A;  4FLX A;  2WYO A;  2PZS A;  4CS3 A;  4J0M A;  2F66 C;  1SYX B;  4DV1 H;  4X65 B;  4JI7 H;  1HNX B;  3EYY A;  2E5L H;  1A0I A;  1O75 A;  1TVK A;  4LFC B;  1BJT A;  4LFA B;  3N44 B;  2ZM6 H;  4DR5 H;  4EB6 B;  4X1K B;  4ZIB A;  4PZ6 A;  1SA0 B;  1Q8I A;  3NBY B;  3BHP A;  4AIL C;  4JI3 B;  2UXB H;  5FPR A;  4HNA B;  2XHB A;  3JAT A;  4O4I A;  1TUB A;  5EOY A;  1HR0 B;  5K1P A;  5KX5 B;  4DR4 B;  3KAJ A;  4DR7 B;  4ETS A;  1TGO A;  2MCT A;  4LF5 B;  4DV2 H;  5JJJ B;  3ZS8 C;  1XMO H;  3OTF A;  3J7A K;  4YJ2 B;  3T1Y H;  3N41 B;  1M4U A;  1Z5V A;  1M0W A;  3JAW A;  3JSN A;  4I55 A;  5LA6 A;  4FM1 A;  4JI0 B;  4GKJ H;  2ZIN A;  3U10 A;  5J2U A;  4DR5 B;  4DV7 B;  4NXN H;  5EZY B;  1TUB B;  5IYZ A;  4X66 H;  4PZ8 A;  2OYQ A;  2UUB B;  3J80 W;  2JS5 A;  4FLV A;  2E5L B;  2VQF B;  3M7M X;  4JI4 H;  2BTO A;  1N36 H;  4FLW A;  5JQG B;  4B3M H;  2HEP A;  2BTQ A;  4O4L B;  1IBL B;  3GB8 B;  4TQF A;  3KXY T;  5KHG A;  4CH5 A;  1CKM A;  1VS0 A;  3J81 W;  1MZB A;  2VPS A;  2PY5 A;  1CKO A;  2RQ6 A;  4A2A A;  1NT2 B;  1FFX B;  4O4H A;  4CH4 A;  5BMV B;  3OTO H;  4DV4 H;  5EIB C;  5JVD A;  4O2A A;  3DF7 A;  4TUY B;  2HVR A;  4EB6 A;  3C0F B;  4K8X A;  1TA8 A;  3IG0 A;  4JI4 B;  2VQF H;  4LF8 B;  3RTX A;  2VUG A;  4F6R B;  5KHJ A;  3RYF A;  4EFB A;  4FFB A;  4DV5 H;  3RYH A;  5GON A;  4JI8 B;  4DRX A;  4FM2 A;  4M7E A;  2KKW A;  4DK0 A;  4PHZ A;  4OX9 H;  4K0K H;  4KHP H;  2VWJ A;  4YJ2 A;  3N40 P;  2F95 B;  3PN1 A;  1FVI A;  1JJO A;  4LF9 B;  3RF2 A;  4IIJ A;  3VNN A;  4I4T A;  2ZNI A;  4NXM B;  4LF4 B;  4JI1 B;  3UT5 A;  4B3S H;  1S5J A;  1I6U A;  4DR1 B;  3JSL A;  3RYH B;  4LFB B;  2CFM A;  4JI2 H;  4DV0 H;  1RSO A;  2UUC H;  1XQ8 A;  2QJ1 A;  1IBK H;  2UXB B;  1SQG A;  4JI3 H;  4AQY H;  4ZOL B;  1Q5O A;  1N34 H;  5BR8 H;  5C8Y A;  4LH6 A;  4ZHQ A;  4FLZ A;  1FKA H;  2ZM6 B;  1N33 H;  1TAE A;  5J2T B;  4LFA H;  4GKK H;  4LF6 H;  1XNR H;  4LF8 H;  3WB1 A;  2ZJT A;  4EEQ A;  2UUC B;  1HNX H;  1KU9 A;  4JI5 B;  1J5E H;  3L2P A;  1I94 H;  4CS2 A;  4JI2 B;  4AQY B;  4LFB H;  2W57 A;  4MV9 A;  5FD5 A;  2VQE B;  2RGV A;  4FFB B;  3L4J A;  4F6R A;  3RYC B;  2YCH A;  1G6U A;  1XHX A;  4A2B A;  5IYZ B;  3N2G A;  2CW8 A;  1KMI Z;  1N32 H;  3N2K B;  4JI6 H;  4LF4 H;  5LL6 b;  3K5O A;  5LXT B;  3U0Z A;  1IBM H;  5JCO C;  4LF9 H;  4DUY H;  3JAL A;  4I50 B;  5IJ9 B;  1WPB A;  5D1O B;  4UCR A;  5JJE B;  4X1I B;  4LF7 B;  3WB2 A;  2YIB A;  2PUS A;  4DR2 H;  2V4D A;  4CC6 A;  4RAY A;  4GKJ B;  4IHJ B;  5JH7 A;  1XMQ H;  5KMG B;  2HGS A;  3LNN A;  4YJ3 B;  4DUY B;  1P49 A;  5LA6 B;  5BMV A;  2HVS A;  4DUZ B;  4DV4 B;  3QTC A;  4X1K A;  5EZY A;  5D1O A;  1S03 G;  1Z5W A;  3JAK B;  2UXC B;  4TOI A;  4LF5 H;  3ICX A;  3HKE B;  5ITZ B;  1Q43 A;  4FLY A;  4B3M B;  4DR2 B;  4DV6 B;  2XIG A;  4HNA A;  1XNQ B;  4LSA A;  2F93 B;  4LFC H;  5KX5 A;  4X66 B;  4X1Y A;  4JV5 H;  2P5O A;  4X64 B;  2Q7H A;  4TV8 B;  3RYC A;  4JI7 B;  1JFF B;  1YEW A;  5D5Q A;  4WBN B;  3KYH C;  3ZED A;  3K5N A;  3QWU A;  1M0T A;  1QHT A;  1Z2O X;  4E6N A;  2Q7G A;  4B3T H;  1DGS A;  1X4T A;  3BAA A;  5J2T A;  3K58 A;  2Q0A A;  3GDE A;  4RB0 A;  4FLU A;  4LSX A;  4PI0 A;  3K5M A;  4PZ7 A;  5DIS C;  4DRF A;  3HKC A;  5LMN H;  4HBN A;  2EX3 A;  3JAT B;  4O4I B;  3VQY A;  1H2S B;  1J5E B;  3BA8 A;  5LMU B;  4Q6G A;  4O4J A;  4LNU B;  4O2B A;  4GKK B;  3RJ0 A;  2RGR A;  1M93 A;  4DV1 B;  5LP6 C;  3RGB A;  1XNQ H;  2PYL A;  5JVD B;  4O4H B;  4AHC A;  2JVD A;  3K59 A;  3E22 A;  4YHH B;  4APM A;  3W1G A;  5FNV A;  3FFQ A;  4DK1 A;  3A2F A;  2R9A A;  2UUA B;  4LH7 A;  4O2B B;  4UCT A;  5LYJ A;  3SGI A;  4L8J A;  3SJC C;  5JQG A;  4B08 A;  4DRX B;  5GON B;  4DV3 B;  4FLT A;  4WBN A;  5FD6 A;  2ZIM A;  1JFF A;  1WNS A;  4BW9 A;  4YJ3 A;  2O03 A;  3BAB A;  3THO A;  1M5I A;  3ETQ A;  1T5E A;  1XDN A;  5JH7 B;  4IIJ B;  2CW7 A;  3BPZ A;  3HKC B;  3VQX A;  1N36 B;  3HXL A;  3N42 B;  3LML A;  5ITZ A;  3IAY A;  2QM4 A;  5A2Q W;  3K3V A;  1CKN B;  3T1H B;  3KAL A;  3MWM A;  4CH6 A;  3JAR A;  1HNW H;  3KAK A;  1XHZ A;  3JAK A;  3HKD A;  3JAL B;  4R7R A;  2Q7E A;  4NVP A;  5EYP A;  5LMU H;  1JMK C;  3WB0 A;  5LXT A;  4JI6 B;  4I9Q A;  5JJN B;  4MTE A;  4JYA B;  2CAZ C;  5J2U B;  2HIX A;  1FJG B;  3RYI A;  5LMN B;  5IWA H;  2F4V H;  4B3R H;  2ZNJ A;  4DUZ H;  4TV9 A;  2WDT A;  2UU9 H;  4DR3 H;  3HKD B;  2HIV A;  1WH2 A;  3JAR B;  2HHH B;  4ZI7 B;  2UUB H;  1XI1 A;  4CS4 A;  5FLX W;  3SJA C;  4TQD A;  4RB2 C;  2IM9 A;  2BTQ B;  4O4L A;  4LF6 B;  4JI5 H;  1O9G A;  3E22 B;  4D7T A;  4X64 H;  3U11 A;  5CA0 B;  3N2K A;  3CB2 A;  4TV9 B;  2Q2U A;  5LP6 A;  3N6X A;  1HW7 A;  5BR8 B;  3RYI B;  4DR6 B;  2FE3 A;  3B2E E;  2HHH H;  4ZOL A;  1SKV A;  5CB4 B;  3HKB B;  4MV7 A;  3DSQ A;  3N2G B;  4YY3 H;  4DV0 B;  2YI8 A;  3SJB C;  4O4J B;  4B3S B;  5IJ9 A;  1HR0 H;  1Q3E A;  1Z2N X;  4RB3 C;  4B3T B;  4I7H A;  4JI1 H;  2HVQ A;  2UXD H;  5D1P A;  1L2Z A;  1O9H A;  1HNZ H;  4CH3 A;  2WE6 A;  4U3J B;  1V9P A;  4DR6 H;  3CVZ A;  3RR5 A;  2ZCE A;  3K57 A;  4EQ5 A;  1XMQ B;  3RGZ A;  1X9N A;  3M4I A;  4OX9 B;  4K0K B;  4KHP B;  2OWO A;  2RJZ A;  1GYF A;  1SEI A;  1ZHQ A;  5LYJ B;  1BGW A;  1I7F A;  3CSX A;  4LNU A;  1IBK B;  5KHH A;  4TUY A;  5IWA B;  4U3J A;  1P8L A;  1S68 A;  3S24 A;  1Z2P X;  4O2A B;  2JGU A;  3RGX A;  5IJ0 B;  2UXC H;  4X20 A;  3H20 A;  5CA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...