3JSLA

Crystal structure of the adenylation domain of nad+-dependent dna ligase from staphylococcus aureus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structure of the adenylation domain of NAD(+)-dependent DNA ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 107
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jslA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3jslA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jslA02
4LH6A 2CFMA 3BA9A 1HNXB 1XK5A 4YY3B 4UCTA 4JI4B 3NBZB 1XMQB 1N34B 4UCOA 4CC5A 1IBKB 4DV0B 4DV6B 3BA8A 4DV2B 3TY9A 4JI2B 4LF7B 4OX9B 4EFEA 4LF8B 1N36B 4X65B 4DR4B 4E6NA 2UXBB 3W5OA 4JI0B 4DV4B 3W1BA 1CKOA 5D1OA 3SGIA 3OTOB 2UUAB 4DRFA 1A0IA 1IBMB 2VQFB 4JI1B 4LFCB 4EQ5A 4DR1B 4B3MB 3L2PA 4PZ8A 5FPRA 4CC6A 4LF6B 4DR3B 4UCRA 1VS0A 3BABA 4B3SB 3JSLA 2HIXA 2Q2UA 1TA8A 2UXDB 3S24A 1DGSA 3JSNA 4EFBA 3GB8B 1ZAUA 4JI5B 5LMNB 4LFBB 4AQYB 4EEQA 4JI3B 2UU9B 3GDEA 1V9PA 4KHPB 4UCUA 4UCVA 4DR6B 2F4VB 4X64B 4PZ7A 1P8LA 3QWUA 3UQ8A 2UUCB 3BAAA 1P16A 3NBYB 2HVRA 4UFZA 4DV1B 4JI8B 4NXNB 4JV5B 3T1HB 4LF4B 1TAEA 4YHHB 1I94B 3T1YB 1XMOB 4DR7B 1IBLB 1XDNA 4LF9B 2VUGA 5FPOA 3VNNA 1CKMA 4GLXA 5D1OB 3W1GA 4DUYB 1CKNA 5D1PA 2VQEB 5LMUB 4LH7A 2OWOA 1X9NA 1N33B 1FJGB 4DR2B 4X66B 2ZM6B 4JYAB 2Q2TA 4DV3B 1XNRB 2HIVA 4GKJB 4PZ6A 1HR0B 4B3RB 3RTXA 1FVIA 1CKNB 4DV5B 3RR5A 5IWAB 5DISC 4LF5B 1HNWB 2HVQA 4X62B 1XNQB 3KYHC 4NXMB 2HVSA 4DV7B 3TY5A 1S68A 1HNZB 1B04A 1J5EB 2E5LB 3TY8A 4TOIA 3NC0B 4B3TB 5BR8B 4DUZB 3GJXB 4DR5B 2UUBB 3PN1A 4LFAB 1N32B 4UCSA 4GKKB 4JI7B 4JI6B 2UXCB 2HHHB 4K0KB
chains in the Genus database with same CATH superfamily
3H1JH 2HG8A 3ETQA 4NXMH 1XMQH 5FJ8G 3R65A 3G80A 1RPRA 1NR7A 2W6PA 4QNHB 3CCRV 4JV1A 3BHPA 5J2UA 4K3AA 1KP2A 1MNGA 5FLXW 4DL2A 3Q4HB 4LF7B 3DTGA 4C5AA 5KFIA 4DV4H 1SQBH 3CCSV 4K8XA 4U3FH 2JA5A 1VQMV 2JK5C 4U7CA 2X6BA 5LOVF 4DR1H 4ZOLA 1SZXA 1IXBA 3JAMW 2A06H 1W96A 5KFUA 1HNXH 2CW8A 1GM9A 2W9AA 1GN2A 2WLNA 2QDOA 4AQYO 4B3SB 4Q4CA 4WBNB 3A0RA 3JSLA 4CH6A 2BCCH 3E35A 2LO1A 4O81A 4QSHA 4JAAA 1SCUB 4JI3H 1AR5A 2Q69A 1V51A 2QKSA 3TW6A 4WFBV 1KTAA 1I94O 5DQGA 1V9PA 1G2WA 2JEXA 2DW4A 5KMGA 1GSAA 3WFVA 3AG3B 1EN5A 3HT5A 3LP8A 4LFCH 4RAZA 4JI8H 2AW9A 4IYIA 5LL6Y 2AU0A 4PWQA 1N0NA 1K73W 3DGEA 3CRRA 1K34A 3KCYA 4TV9A 1IOWA 2FPPB 2A7WA 2QA4V 3OTFA 1XNRO 5IYBG 5L3DA 4F4YA 2CAZC 4I9WA 2QEXV 1FYJA 3RB3A 3H0GA 3LDEA 2ABJA 1J95A 2KG7B 2OWOA 1N33B 5ITZB 3Q2OA 2VS0A 4AILC 3CB2A 4FBTA 1TUEB 3H20A 4MAMA 1EUDB 1W59A 1L1FA 2JDIG 2YICA 1GM8A 2X6CA 3KHGA 1VF6C 4LSXA 3GTOA 1BCCH 2ZNIA 5KFBA 3H40A 5BPHA 5H80A 4YHHH 3D36A 4FIPC 3L4KA 2DLNA 2HGSA 3K08A 1Q8IA 3FFQA 2C2RA 3UT5A 1VQ6V 2GTSA 1J5EB 3WB0A 3RUPA 4CKEA 2UVVA 4RB2C 3EPGA 4X66H 4WCEV 4B3TB 4LFAH 3F7YC 3GJXB 4QWDA 3ZMUA 5AG2A 2IJKA 4YIPA 3PN1A 4NTXA 1N48A 3PO2G 5J2TF 1OBDA 5BYBA 4JI7B 1GTOA 4WD3A 4B08A 3GIIA 1Y76A 3T54A 3K5NA 2PZSA 4NZNA 2SCUB 1R6TA 4FS1A 4LMYA 4X65O 4DR4O 2NVYA 1SERA 2NU9B 5DGIA 1L8DA 5BMVB 5JJNB 3UFXB 1CQIB 2QM8A 2ZDGA 5I47A 1S5HC 1BZKA 3T9CA 2I8CA 2PYLA 5KAFZ 3IC7A 3PFFA 4RAYA 3OHAA 4EKWA 1A0IA 5KT4A 1KC8W 2HP8A 5CB4A 4EQ5A 2FP4B 1W93A 4KXRA 2UXDO 3FD9A 3RBDA 3CJHB 3T7AA 2Y0IA 3N6XA 2W7PA 4LF6H 1XREA 1KC7A 2YRXA 1E1QG 4DR3B 2YIAA 2ETNA 2HEPA 2Q68A 5K1XA 3CRQA 3G67A 3N2KA 5IJ9B 3LSSA 1X4TA 4X64O 1V55B 4FFLA 3AX6A 2JA6A 5LYJB 2VWKA 2V59A 2CH7B 1MSDA 4LFBB 5FD6A 5L1IA 2EULA 2F4VH 3TXSA 4O4IF 1XI1A 4PZ7A 4UVBA 4DV1H 4QW8A 3OD4A 1GRJA 3T1HH 5JQGF 2BQRA 1H2NA 3CSXA 4MT8A 4Q4DA 4FFOA 3HKBA 5J2UF 2XASA 2X0LA 3T1YB 4Q0YA 4DR7B 3H4BA 4ZI7B 4PI2A 5CA0A 4M7EA 3MFHA 4DUYB 2CZGA 1CKNA 4GLWA 2QM4A 1DTOA 5GTHZ 1F51A 2CNQA 1HR0H 3CEIA 4B3RH 2MK3A 4Q44A 2WB1E 1JKJB 4LNUB 4DV5H 1JJ2U 1AP6A 5GONF 4X62H 2OLSA 2YXYA 4CKBA 3N43B 1XNQB 4K35A 2WPDG 4ZKIA 4TUYF 4DR2O 2V58A 2ZM6O 3R23A 4DV7B 5I60A 1K1SA 2PMZA 1MZEA 5IP9G 1CP9A 4U7NA 5BR8H 3PW7A 2E75B 2WWWA 5LOVB 4FM0A 3R5XA 3GVMA 2IA6A 1EZJA 2W0XA 1DAAA 1KT8A 1QR8A 1MA1A 2QB5A 4PI0A 2ARHA 1VKZA 4JI6H 2IW5A 5KLVH 2W6MA 3DC5A 4IGGA 1UC9A 4EBEA 1Y6XA 4DV0O 3EYYA 4DV2O 1NZ6A 1DV2A 1GN6A 4JI2O 2YI9A 4GX2A 3JCUZ 1WPBA 4KP4A 4JI4B 1UFIA 2YIBD 4ED8A 2R7ZA 2UUAO 2QYZA 2VOBA 4LWSB 4UV8A 4GCZA 4APMA 4LF7H 3BQ2A 3N2GB 2QTSA 4TWKA 3G4SV 3J7AU 3WO0A 5JH7F 2WTFA 4B3MO 4ED1A 4JZGA 2COGA 1JX4A 3I4NG 4CHIA 2GTAA 4IHJA 4J9KA 1Z2OX 3RAQA 2R8KA 1KJ8A 1S10A 2QWQB 3ZRVA 1IBMB 2VQFB 4ME6A 1EN4A 3KREA 3LNNA 1PX2A 2CW7A 3ZRSA 1M4UA 1XUQA 1WA8A 4XX0B 4B3SH 4A2BA 5EYPA 5KFDA 5KG1A 2QK4A 2ASDA 4EYIB 2IH1C 4JV2A 1H38A 2PBZA 2K1EA 1ROPA 1F4NA 5E1AC 5B5EZ 5L3CA 3OHBA 1H2KA 5LMNB 5BY1A 2WAMA 5KX5B 3OM3B 2M7WA 5K2MA 2PF4E 2P90A 3TINA 1K92A 4ZBMA 5GTIZ 3GTGA 3FB7C 3CE2A 1S5LZ 5IYBO 5DG7A 4XDKA 5L3GA 5KHHA 1KB9F 3P3NA 3W7SA 2EILB 4QWAA 1ULZA 2YEVB 4IL6Z 5J2TB 1N33H 3K06A 2Z02A 2N74A 4WHXA 3U55A 3E2EA 3F5TA 4DO2A 4JV5O 2EIJC 2CTRA 2B5UA 3CVZA 3X2QB 5B3SC 2OT5A 4X64H 3HOXG 3S3XA 1FFXB 4JYBA 4QIWA 3RVZA 4O84A 5I5YA 1WCMG 2LQTA 3E8FA 3KYHC 4LF9H 1J5EH 4AYBE 1MZBA 2XHBA 2E5LB 3JAWA 3H1HH 4FZ1A 4FLUA 3G6BA 1A0GA 4MV8A 1SQPH 3GIQA 5EOYA 1BNCA 4RQFA 3N8DA 1JFFB 1QVGU 3CCMV 3B2EE 5DGAA 1VQ8V 3RB0A 4JI7H 4Z2WA 3SYAA 1DF4A 3E22B 5JWPA 2UXCB 5LP6F 1IBKO 3ZHRA 4O3NA 4F6RA 5I5WA 2Y69C 3ABLC 5KFXA 4BY1G 3L4JA 2EJ2A 5CA1F 5IJ0A 3CC2V 5F9NA 3ZHVA 4LF8O 1K4DC 3RV3A 4UCOA 3RYCA 1MMMA 2UUBO 1V54B 2DIKA 4RUEA 5CMUA 2ZE7A 2KKWA 5IYDG 1Y1WA 4O4IB 4B7KA 4O7TA 3V4SA 5C44G 2CTWA 4EFEA 5KFLA 2COJA 2ATKC 4BBRG 3KHRA 1RJRA 5JQGB 2A1HA 3V6JA 5BWWA 1XDCA 5J2UB 4ZHQF 3ZN1A 1JVMA 3P3PA 2FB5A 3JZIA 3ZMVA 5KHKA 4MTDA 1NVPB 4DR3H 3PO3G 3LSUA 4X88A 2HJDA 1Y1VA 4DV0H 2OYQA 3RYFA 4DR6O 1T3NA 2HIXA 4HZ3A 3THOA 3CC7V 2V4RA 4ZOLB 3R66A 3SYCA 5IE9A 4FM2A 4JTAB 1JDBB 2JRIA 5C5JA 4C2MA 3QZ8A 4LFBH 1H2LA 3GB8B 5FNVA 1I7NA 2UU9B 1H2MA 3ZHQA 5EIBC 1NJIW 2V4QA 2VRZA 5C8YA 1SC5B 4C5CA 3BAAA 3WO1A 2RGRA 5FLXN 3HOUG 2R93G 1R73A 4TUYB 3I56V 1HP8A 1WLEA 1XQ8A 3T1YH 4DR7H 2ZIOA 2IU0A 3SPGA 3RGBA 4Z1VA 2BOCC 1FJGO 3F8NA 4DW1A 2R87A 4YR0A 3CHXA 2YXLA 5H2FZ 4DUYH 5KMGB 3PW5A 1G8MA 4P9OA 2DYRC 3JAMN 5KHJA 4WFEA 3N44B 4MSWC 4DYLA 4FE2A 2LFRA 5IWAO 5DMXA 1RSOB 3TK1A 3VQYA 4DRXB 1G6UA 4GUNA 1V4YA 2IJIA 1KKDA 2HHFA 3RFRA 1S76D 2EJRA 2XCAA 3VA7A 1XNQH 5KFZA 3ZBHA 3QZ7A 2JGUA 4D7TA 4LF5B 1QU7A 2CGNA 4DV7H 3GTLA 3UZOA 1VARA 2IP4A 3R9RA 5I5SA 1OCZB 5JH7B 3J80W 3GV8B 3B8MA 1S0OA 1K5SA 1PP9H 4O4JA 2L6LA 3IC9A 2RJZA 2PI5A 5B3SB 4TM5A 4TV8F 3B77A 1SQFA 3MHSC 4NXMO 3UT5B 1XMQO 2RGVA 2W9BA 5DG9A 3L74H 1PPJH 3NR7A 2XGPA 1BQ0A 1NKDA 4JZ2A 2LFSA 4NVPA 1GH6A 3V6HA 3JARA 1TGOA 3TXQA 1S97A 1TWCA 4A3EG 4JI4H 4CBCA 1TWAA 4K6NA 1LUWA 2WA3A 3NBZB 1N34B 1CXZB 3LNMB 4DV4O 5KHIA 5C1PA 1PL0A 1VF6A 2NR5A 3OTOO 3K3PA 4DR1O 1AROP 3DTUB 1IDSA 1KBLA 1AILA 3H1IH 1R3JC 1A3GA 4J7JA 1Y66A 3RWRD 3CCVV 1Y14B 2ASLA 2R82A 2GPWA 4EGJA 2H8PC 5LGNA 2GPSA 1OHHG 3RAXA 5FPRA 3AK2A 5JVLA 4RUAA 2W6OA 5DQHA 2YUAA 4JI3O 2Q7GA 3MR5A 3GTMA 1I1MA 4RUFA 2E74B 3HBLA 2F1MA 1M57C 4CE5A 3U0GA 4Q8EA 5LMNH 1RK6A 2VWJA 1JQ0A 4JI8O 4BBSG 4HYOA 1BGWA 5L1KA 1GGOA 4FGRA 2EIKC 5KHGA 3W7TA 1W0JG 4HNAA 1XMOO 4JAUA 1IBLO 2EJ3A 4J7ZA 1SEIA 3VPBA 3MR6A 3N41B 3N2KB 1YF2A 3OUUA 1JX9A 1I1LA 3OW2U 3DXRA 3ABKC 1XOUA 3HPLC 4NXNB 2NN4A 2H3OA 3LMLA 3D8CA 1OCRB 4MTGA 4U7OA 3MDSA 2JIZG 3RVYA 1D5AA 1FXKB 2XCPA 1AJPA 2W7OA 5IY5B 4PDLA 2GBOA 5LMUB 2ODTX 1P4RA 4LH7A 4PDBA 1XBLA 2HG5C 5LP6B 2WLJA 1X9NA 4JYAB 4FZ0A 3WB2A 5HFLA 1EFRG 3RTXA 3G6YA 4HNTA 5CA1B 5EWFA 5H6QA 3TIGA 1CKNB 4ECTA 4IT5A 3K9AA 4O83A 5DISC 3JATA 1Q82W 2C28A 5LA6A 2NU8B 3CCLV 3SYQA 2E5LH 4X66O 2R6FA 3R5HA 4LFAO 1HNZB 3NUAA 4RCNA 3B09A 5FNVF 4H13B 4RNNA 5BWUA 1LUVA 4YJ2A 4K0KO 5IYZA 1VQOV 5C8YF 4ZHQB 4JXUA 2HR3A 1PNMA 3C0FB 2HKOA 1EZ1A 1WR2A 4RAIA 2UXCH 1KBHA 4ECRA 5EBLC 5FD5A 1KECA 3OGCC 5E79Z 4X1YA 4I55A 4H44B 3H3VH 3U9TA 5K3WA 1DK1A 1WAZA 4TT3G 4X89A 3J7AK 1C3OA 2V9WA 2UXBO 3M7MX 1I7FA 2FB9A 1KJQA 1I5YA 2CNUA 2GQRA 4DL3A 1S3JA 3G8CA 3CRAA 4ZI7F 4IIJA 3UYYA 3B40A 4MTXA 3VMMA 4UV9A 4LSAA 1Y74B 3U54A 1TWFA 1ZLZA 2R7KA 4LF6O 4A2AA 3SGIA 3QO8A 2HFEC 4JI1B 1C30A 1RYSA 2W6NA 3EPIA 2JEFA 2PMZE 5T14A 3KAKA 4CH4A 4PZ8A 3L9DA 1VQ7V 4O4LA 3QVNA 2R8GA 4JI5O 1R6NA 4O4JF 2XC9A 2ZXWB 2F4VO 4ED7A 4H33A 1JDEA 3C3TA 1GYFA 3SPCA 4DV1O 4U6PA 3SI8A 2UU9H 3GIPA 1ZAUA 5DN6G 4JGSA 3T1HO 4JI0H 5EYPB 4YR2A 3OTOH 5D5QA 3OMIB 1S72V 3ETEA 2ZDIC 4YXWG 5KG2A 3QWUA 1IX9A 1AVMA 1PV0A 4ZIBA 2PTMA 1QLEC 3K59A 3JALB 3ZMTA 3ETDA 1ZL8A 1FKAH 2EINB 1K5QA 5KG6A 2YZGA 1HR0O 1H2GA 4B3RO 4TV8B 1EKFA 2P7TC 2VQEB 3HB9A 2Q0OC 4DV5O 1TWHA 4KUMA 4L1KA 1JXLA 1IURA 2HJWA 4X62O 4CH3A 2HIVA 2J6TA 3ZMZA 3ZS8C 4DW0A 2DPJA 1N8RW 3RJ0A 1OCCC 4IRDA 4LF5H 4J9QA 5L9XA 1K9MW 1ORQC 3E8HA 5DEDA 4J9ZB 2AXTZ 1XMOH 4RO2A 3QTCA 5EZYA 1IBLH 1NT2B 5BR8O 4FLVA 3JCZA 3JD0A 5LHIA 3TY5A 2NU6B 5KFFA 1B04A 3ETGA 4JI6O 4TOIA 4QWCA 2A0LA 4O4HA 3HOYG 2JA7A 4NYEA 2JVDA 1Y67A 2ITCC 2R7LA 4A3KG 4A5UB 3BG5A 2V5AA 2VA3A 4DUZB 1VQLV 2AGQA 2FLPA 4QPJA 3AEIA 1O75A 2YC0A 5KKNB 5CBHA 1I3QA 5KFAA 2BTQA 4A3IG 1Q5OA 3JAWB 3JRWA 3E8BA 5GW7A 4LF7O 5KX5F 1N4CA 2FPIB 1N34H 3GWOA 2WAQE 2OCCC 3AG2C 5EC1C 5KFEA 2DQ0A 2XIGA 5KG3A 2Q6AA 2AGAA 3QG5A 1GAXA 3AG4B 3L73H 4MA0A 3TY9A 3ASOB 3HKDB 5IJ0B 5DAAA 1N36B 3JASA 2CTQA 5B1AC 3BRCA 3CC4V 2IH3C 5KFKA 4B3SO 3G6VA 1SETA 2JGDB 3SYPA 1M7JA 5LA6F 4K0KH 1B06A 3FB5C 4TQRA 3ML0A 4RZQA 4DQNA 5LHGA 4O3QA 4JF3A 1KU9A 2V1DA 4MVOA 4PJ0Z 4UCRA 1VS0A 1ZQ7A 3D3IA 3GTJA 3ZX6A 4YJ2F 3K58A 1HWYA 2CKZB 5LXTA 2XT9A 3STZC 3WWIA 1Z5VA 3OEHG 3VBBA 4IWYA 4CMDA 1FXHA 1THZA 2DN9A 3BFRA 3JSNA 1K1QA 1IXMA 4FLTA 2RN9A 2BOBC 3EFFK 2UXBH 1S03G 1EYZA 4I55F 2MW2B 5CBFA 2DAAA 2G38A 1NH2B 2EX3A 4BIZA 4NXNH 1B6QA 2W6QA 4LF4B 2B1IA 4Z1MG 5FNVB 1N33O 4MV4A 3HKZE 1YHQV 1LR1A 2VPSA 4NZMA 3AK1A 4P2ZA 3WU2Z 2PGGA 5C8YB 4IIJF 3CCUV 5LMUH 4FVMA 3T9BA 2JS3A 4ECQA 3GIMA 2QWNB 2HVJC 4JI5H 4JYAH 3GTQA 3T2MA 3HR0A 4U3JA 2ZM6B 4DR2B 3RB6A 2CDYA 5KA6A 2C35B 5A2QW 1YSCA 4K8ZA 4ETSA 4X1IA 4LF9O 3ZN0A 5EWGA 4O4LF 1J5EO 2XAQA 1WH2A 2CE4A 2X7RB 5JQWA 2BSKA 4D6TH 4B3TO 1HNZH 2E3CA 1S68A 3V6KA 2HHFB 4JI7O 1AUVA 4FFBB 4HR7A 5C93A 3OR6C 4ED3A 4O7LA 2CQYA 2E2IA 4O86A 4YR3A 1KMIZ 3I55V 4ZOLF 3NGDA 1GO3F 2PN1A 4NKGB 3UO3A 2KSWA 1VQ9V 4EB6B 3APQA 3CSWA 3KAJA 2R7NA 4QW9A 1S9FA 4O4JB 3LWBA 3TW7A 5DLFA 1M1KW 2RMKB 3BA9A 3K04A 5I5VA 1TVKA 2CUGA 2FMAA 4X20A 4DV6B 2QWRB 1P84F 1E1RG 1FD9A 4OX9B 3MHHC 3T4DA 2GQSA 3E8GA 2Y0SA 1B3QA 1QLNA 1EZVH 3JZFA 3ZJZA 1N32H 4JUZA 5H5NA 1TUBB 1NTKH 4PDVA 3J80N 4DR3O 2WYOA 1CKOA 5KG7A 1ZUQA 1SA0A 4TV9F 5KFJA 4JTDB 3SPJA 2WLIA 2R92G 1WB8A 4ECVA 5KG5A 4CC6A 1NS1A 1H8EG 3MD0A 4LFBO 3K0DA 4Q8FA 5JVDA 1E4GT 2ZJTA 4GZRB 2DOSA 1JMKC 1GM7A 5KUMA 2EJ7A 4EFBA 5KG4A 1OZ0A 1R3KC 3KCXA 1TWGA 2QTOA 4QJFB 4EEQA 3T1YO 4DR7O 4PA6A 3MJFA 1I6UA 2FK2A 4YB8B 2BQUA 2QWOB 5DQIA 1OCOC 2YIDA 3AK3A 2XAJA 3GB7C 5KUKA 2D3OW 3T9FA 4DUYO 1GSOA 3ASNC 2ZE5A 1U97A 4CS3A 4F4XA 2OTJV 4A3MG 4JV5B 3B8NA 4OPHA 5K1PA 3BPZA 4HNAB 4OPAA 2J9GA 4WFHA 2NU7B 5D1OB 3GIDA 4DL5A 4FLXA 1OBGA 4WFAV 5D1PA 1SYXB 2EJ0A 2ZD9A 2Z0AA 5L1LA 1PL4A 2FKXA 2P4KA 3JD3A 4FLYA 3H0GG 2RCVA 3HKEA 1XNQO 4ABMA 4DV3B 4GKJB 4R8UB 1D2DA 4PELA 4HAMA 4O2BA 4DV7O 3G71V 3SR2C 4ED6A 1XILA 3HOZG 3N42B 5A9GA 1Z2GA 1AP5A 5BWVA 1CS0A 3LQSA 1RJPA 1I5XA 1RK5A 3SPHA 3GTKA 5B1BC 3RIZA 1T5EA 3JZ6A 3TY8A 4G28B 4CMFA 1CQJB 5LGUA 4J9SA 3GTPA 5J9PC 3JATB 1VBGA 2DWEC 4Q45A 1RM1C 5LA6B 1RYRA 2UUBB 2ASJA 4EBDA 2DJVA 5KFVA 4WBNA 5CB4F 2EBOA 2L35A 4JI4O 4GKKB 2PI4A 4HNUA 1M0WA 2DZDA 3E86A 5C4XG 5KFRA 1K7DA 1GMGA 4YJ2B 3LSQA 5IYZB 1S5JA 1I1KA 2COIA 1R3IC 4NYKA 4YY3B 2R9RB 4WF9V 1WRVA 1X59A 3MFIA 4M9UA 4YP3A 1P49A 1IBMO 2VQFO 4MV1A 4BWAA 4I55B 4EG0A 4B3TH 2FLLA 4UVAA 1MSWD 2ZNJA 3SE7A 5BYAA 1DV1A 3W1BA 1L2ZA 5E25A 4I0XA 3K5HA 3SNOA 4UB8Z 4MTFA 1GSHA 4IIJB 2B63A 5ITZA 2WLLA 5CA0F 1GK9A 5LMNO 2VUMG 2DABA 3BABA 5KFHA 3OAAG 3EXAA 1H2SB 1TA8A 4L87A 1FPOA 4XYLB 3S24A 2Y4UA 2PY5A 4MVMA 1Q90D 3AG1C 4O4LB 3U10A 3TQ1A 5JCOC 3RYIA 1OWTA 4KHPB 5KT6A 4UCVA 2EZOA 3H1LH 4RB3C 3UQ8A 2UUCB 1P16A 1P7GA 1N56A 1JLLB 4LF4H 4UFZA 1KJJA 1NVPD 3C90A 4DL6A 3ZCCA 1TAEA 4BW9A 1JA8A 1A48A 2RNBA 1KQSU 3K3VA 2VR1A 4O3SA 4DXWA 3CYOA 1IYEA 4J9LA 2BTOA 2YU9A 4MTEA 3LDDA 1VIBA 1D5NA 4GX0A 1OCOB 2X5RA 3Q8RB 3VQWA 4J9OA 1B6SA 4NTYA 2R84A 2E5LO 4IRCA 1M56C 5JJJB 4A3FG 4E4EA 2QJ1A 2V7QG 1HNWB 1WP7A 5HNEA 5JVDF 5B1NA 1ZHSA 2C2DA 1L0LH 4NXMB 1OV9A 4BXXG 3FAVA 2EZPA 3RFCA 5I5UA 2JJ2G 2ZR2A 2FKLA 2ZDIA 3K5LA 4ED2A 5D5PA 3ZRXA 2UXCO 3OSNA 3B4SA 3CJHA 5I5TA 3H9VA 4LCUC 4IHJF 2OIEA 3SDLA 2GLTA 4UUGA 4CS2A 3CMEV 4TV9B 4DR5B 1GO3E 2XGQA 2ZR3A 3F5WC 1I2LA 2KSDA 4WFFA 2YS6A 1YTFB 3M9MB 5LYJA 2BE3A 2HHHB 4YQWA 3MWEA 3FB6C 1BGYH 2CFMA 1HNXB 3QO7A 3Q8PB 5B66Z 2YS7A 4J9NA 3RBZA 4DV6H 1K97A 3ZEDA 4YIOA 5TISZ 2N04A 4X9QA 4OX9H 3KKYA 2P0AA 1W0KG 5B1OA 2NVXA 5L3FA 2ADPA 1S77D 2JEIA 2DYSC 5DECA 1UC8A 4MV7A 4O2BF 4PD4F 4ECUA 2EIJB 4QGPA 4PDMA 1JOYA 1I08A 1M9NA 3M4IA 1ENVA 3FX7A 4OXSA 4NZOA 2ODMA 4KFMA 4GYCB 4LFCB 2IBZH 2YI8A 4FBUA 2UVRA 4J10A 1AI6A 1SS3A 3AG7A 2KQXA 2XAHA 3JASB 2Z3YA 4IYHA 2UU9O 4CS4A 4JI0O 4FK5C 2R9IA 4L8JA 1Y76B 4NTWA 4PV1B 3ZHTA 4QPKA 3WG7C 1NI8A 2GSMB 2OH2A 1K3EA 4QIWF 4UCUA 4PDRA 2LGQA 4A3GG 1IBMH 2VQFH 5EDWA 2YDEA 5LXTB 5IYCG 1R3LC 2Y69B 3ABLB 1FKAO 1AI4A 3TCUA 5LOVA 1M5IA 2ZIMA 4YHHB 4YJ3A 4ASUG 1CE8A 2ZDQA 3IFXA 2M6YA 3CCQV 3STLC 1W2BU 1WSCA 4DL7A 3VNNA 1Q3EA 5HBRB 4G2KA 3O65A 4A93G 2YXHA 5CB4B 1R9TA 2ITDC 4MW3A 1PNKA 4M0JA 4LF5O 4X66B 5KT2A 3GIJA 4DV3H 3G6XA 4AHCA 2JA8G 4GKJH 2Q8VA 2ALZA 1SRYA 3CPWU 2Q67A 1YCIA 1FVIA 3AYHB 2WDTA 2YIBA 5L1JA 2JJ1G 5HV6A 4A3DG 1ZWIC 5FR9A 3CRCA 4XBFA 1DLBA 3BY6A 4MV9A 2AGPA 1VBHA 4J7KA 3IAYA 1E79G 4RU9A 1AUXA 3K0GA 2JEUA 3FMAA 2BSKB 1B33N 1NR1A 3OEEG 3HKBB 4GKKH 3C3SA 2W71A 1KKCA 1N34O 5CA0B 2J6SA 3AG3C 4IZOA 1AR1B 2RDJA 2XNDG 3CCJV 2N05A 4YY3H 4MS2A 2AQ4A 2HDKA 4FM9A 5A2QN 3TETA 4PA3A 5DGBA 4BWSC 3BJYA 3W7UA 3MAQA 1S0NA 2Z5UA 2DYRB 2B1GA 1NU1H 2UVWA 5BXZA 2X6AA 3OUZA 4MV6A 1KJ9A 1TVKB 3W7XA 4YAKB 4J9RA 4O2AA 2F93B 4MTOA 4X20B 2IJJA 1SQVH 1IZ3A 2DQ3A 3SPIA 5J2TA 2W8LA 3G8DA 4EBCA 4PA7A 5JJEB 2VQDA 4FM1A 2QKAA 3DAAA 3JAKA 2YRWA 2Q5ZA 3QNEA 2B9ZA 1Y1VG 1PK8A 1BHBA 5BWXA 1EHIA 2WSSG 3DTFA 2DYSB 2RDIA 2WLIB 3JRXA 2W70A 3BQ1A 1WPXA 4NXNO 4E2LA 1EUCB 1EKPA 3R5FA 2ILMA 4AQYB 4I4TA 2UUCH 2W6ZA 5CE8A 5JVDB 3CXHF 3CRMA 4J42A 5IDJA 4OGQB 2PVPA 3ETJA 2YYAA 2HLDG 5LMUO 5BZBA 1I94B 1R1BA 4MVSA 3M9OB 4JYAO 1O9HA 2GUZA 4IHJB 4LR3A 4JYYA 1SF9A 5CA3A 2Q7DA 1Q81W 3KHHA 2Z04A 2UVUA 4ICGA 1KEEA 1QBZA 1WA8B 4J9YB 3SJQC 1M6VA 4A3BG 4O82A 2Q7EA 4FFRA 1XNRB 3BQ0A 1M0TA 1AI5A 2F95B 1HNZO 4FLZA 4O4IA 4DAAA 1HNWH 3RR5A 3I5DA 2LJ2A 4RQEA 2HVQA 4UUJC 5IT9W 3HKEB 2GDSA 5JQGA 2DMXA 2ATLA 3QQMA 2HVSA 1JCHA 4GT1A 4O2BB 2R7MA 3APOA 1UPGA 3A0HZ 1M57B 1V55C 2DWDC 3HO8A 3NC0B 3T5JA 3T5KA 2BQ3A 4R7RA 3N40P 1OJHA 5KFYA 3GIKA 1KUTA 4DR5H 2BR0A 3GILA 4FFNA 3I4MG 2EIKB 3EVKA 3Q8QB 2HHHH 4CZZA 5KFNA 2R92A 5F2VO 4YJ3F 3ABKB 2XCLA 2X0SA 5JUMA 4JYCA 3ABMC 4J11A 1VQPV 4TVIA 3WNZA 5GONA 3LDCA 1UNNC 4FJCC 4UB6Z 4IR9A 4UCTA 3I12A 1G1XB 2GHYA 2FYUH 1N32O 4TUYA 2QR4A 4W4LA 4JI1O 3KG2A 4MV3A 3J81W 1MABG 4X65B 3BCCH 4DR4B 3T5HA 3A8TA 1JJOA 2FJZA 1ZHQA 2P6JA 3PZPA 1BJTA 2FE3A 1H8HG 3K3WA 1R6KA 3BACA 2CTPA 1AJQA 1EBOA 1RSOA 1YEWA 4DRXA 3RB4A 3FYIB 3BEHA 4F4LA 4TQSA 4I0XB 1U96A 4F6RB 2UXDB 3FKSG 3A2FA 1DGSA 3K5OA 1GLVA 3ZHSA 2WLLB 4QIWE 2ZE6A 2IJHA 3NXSA 4JTCB 5JH7A 4C7UA 4X64B 5IYCO 4A3CG 3RYCB 1GN3A 2QWPB 3K5IA 3FKIG 3PR5B 1PKXA 2R70A 5LBQA 2QM7A 3RT3C 4WFGA 3RGXA 3M99B 1ZX3A 2VQEO 2YS8A 2W9CA 1I0HA 1T36A 5KFOA 3IN5A 4GC6A 3RYIB 4LF9B 4GX5A 3K79A 2ADQB 5LL6b 4NR1A 2Q7HA 1CKMA 3MR2A 4O7RA 3ZIAG 5IYZF 3W1GA 3H01A 3UO2A 3ORQA 1VF7A 4PHZA 4O2AF 1A9XA 2FK1A 1AI7A 3GWKC 3ABUA 1KP3A 3CMAV 4MVZA 3VPCA 2A79B 4D7SA 2UXXA 1NH2D 4FU0A 3RYFB 2PUSA 3JD2A 1WCMA 4A3JG 3HKCA 3UKMA 4I9QA 4KL1A 4J80A 3M8AA 3CD6V 5JCOA 2CGOA 4DUZO 4DK0A 4B7EA 5KG0A 2FTKA 4JPRA 4MVRA 5KT5A 4J0MA 1K33A 3WWJA 4I4TF 4O7NA 5KS8A 5L3EA 2IM9A 2CK3G 3FAVB 3JD4A 1DF5A 4F50A 1SQXH 3FDSA 1K83A 1GN4A 4Q43A 4MVUA 2P06A 2JS5A 3Q8SB 3KXYT 2FLNA 4ED0A 3K03A 1SQGA 2VUMA 1QLEB 1HDJA 2P5OA 1EM1A 2W8KA 1YJ9V 2EIMC 1N36O 3MR3A 3RYHA 3RV4A 1FAFA 2W57A 4G27B 4DV0B 1K8AW 1QR9A 3CS5A 4DV2B 2EILC 4LBEC 2FPGB 4JI2B 2R8HA 5FL7G 1YDXA 1I7LA 1RPOA 3OMNB 1QVFU 3W5OA 5EC2C 3LULA 3X2QC 1VQ4V 2O57A 1FXKA 5KFTA 2UUAB 3CWBH 1OCCB 5CN0A 3ABMB 3OUFA 3RW0A 3RGZA 3Q1KA 3ETHA 1AJNA 4B3MB 5LP6A 2YZLA 1MOFA 1IVSA 2LGWA 5CA1A 2XAFA 2Q4PA 3T9AA 2W9BB 3KZIZ 5LGTA 3OUSA 3T1CA 1PNLA 4EYHB 1BL8A 4I50A 4AQYH 3T9EA 4H37A 3JARB 3AW8A 4LF4O 2XUMA 1E4EA 3LUTB 3CX5F 2F66C 2R93A 1YJWV 1F23A 5D8DA 4JI1H 5KFGA 3T4ZA 2JA5G 1YZBA 3SYOA 5EZYF 4CH5A 4LP8A 1I94H 2ZINA 1YIJV 1SZTA 4ZHQA 1JR9A 4O3RA 2C22A 2XOKG 2OCCB 4BY7G 3AG2B 2I80A 4TQDA 4O4HF 4TQFA 1V54C 1PD3A 1GKFA 4QWBA 4HQ6A 4BR6A 2HGXA 2NNUA 1XNRH 4YJ3B 2OTLV 2Q73A 5B1AB 4NLGA 3DSQA 2XTAA 2R86A 3PW2A 5CBGA 1DIKA 4X1KA 3S3WA 2W6JG 1SFOA 2F23A 2QSAA 1Y74A 2ZE8A 5KFMA 2ZDHA 5CR5A 3ZRWA 1M90W 4BIOA 1F4MA 1E4FT 3L75H 2VQEH 4O7YA 3DXRB 3IGAC 4QE9A 2P4VA 3ICXA 2JA7G 4FFKA 3H4DA 4I5SA 4RB0A 4UCSA 5EK0A 3KTMA 2NUAB 1Q6HA 4DV6O 2V4DA 1VQNV 3Q4HA 1MG1A 2OIGA 2Y4TA 3SJAC 1Q43A 4OX9O 1WJZA 2WA4A 5LXTF 1CPYA 1JIHA 5KFWA 3E89A 1O9GA 1IBKB 1Q7YW 5KFPA 3M9NB 1RJQA 4X65H 5L3BA 2DWCA 3JALA 4DUZH 4DR4H 3TGUH 4LF8B 4E4TA 4O7SA 1KUQA 2QGNA 5H9CA 4TV8A 1BE3H 2HJFC 4HYKA 5C1OA 3UCSC 2I87A 2EIMB 4F6EA 3U9SA 4O3PA 1VP7A 4YAJB 2ZKOA 1XHZA 4O2AB 1OCZC 4O7WA 4HNVA 3KALA 2UXDH 2AGOA 2WAQA 1LNQA 3D3QA 4X1YB 4DIMA 1KYOF 1N36H 3D36C 2J6UA 4BIUA 1AB3A 5DLGA 3VQVA 1QHTA 3GDEA 5BPFA 3JAKB 4DR6B 3CQZA 5KFCA 2H94A 1MZFA 3CCEV 2AZ2A 3NBYB 2HVRA 5KT3A 2D2CB 2LP7A 5KAIZ 2KG7A 4UVCA 4I4TB 2VUGA 2FMLA 4DV3O 4GKJO 4FFPA 4GLXA 4N23A 1BXRA 3CEBA 1P7BA 3ZMSA 5CAEB 3SJBC 3VQXA 1WN7A 2JA6G 2VPQA 1FJGB 3N6RA 1L0NH 4A3LG 4PA9A 2HVKC 2GUZB 4FLWA 1QCEA 3TJTA 4PZ6A 2CNVA 3KHLA 3K9SA 4J41A 3WB1A 5IWAB 3HKDA 4LC1A 2IBKA 2IU3A 1FS0G 1BSMA 1WNSA 1QNMA 4Y8VB 1JPXA 4I50F 5DG8A 4ECSA 2JGDA 3E83A 4GKKO 4XZ3B 2ZCEA 3E5NA 2Y4RA 3HKZA 1UJWB 2YW2A 2FL4A 4ECYA 2Q9LA 4BW5A 4DR2H 4XDLA 2ZM6H 4O7ZA 1EN6A 1XL4A 2QKCA 3OMAB 1ZL8B 3L71H 4YY3O 3W7WA 2C00A 3RBEA 3U11A 5BMVA 3N27A 1AN7A 1S0MA 4Q6GA 2YSUB 1F7YA 1PM9A 2YCHA 3ASNB 4GC7A 4F4ZA 1WP8A 2IMWP 1XK5A 4GX1A 1OCRC 4C5BA 1XMQB 4HBNA 1A32A 5EWEA 4DV2H 4N21A 4JI2H 1FXKC 3BA8A 2FK3A 1Z2NX 1SESA 5IY5C 3PW4A 4BAYA 3P32A 5IT9N 3EHBB 5GONB 5LP6C 5F9LA 5EZYB 5FLMG 4JI0B 4DV4B 3FYEB 1YTFD 4DLKA 2UUAH 1RFYA 1SQQH 4HN2A 5IJ9A 3OTOB 4DRFA 4IR1A 3V4ZA 3TEKA 2QF7A 4B3MH 1URFA 4DR1B 4O4HB 3L2PA 3TIIA 1QQCA 3JYCA 2KB1A 2LW1A 2WB1A 2CH7A 2YZMA 5DGHA 2Y0PA 3L70H 3OR7C 2RF4A 3MWMA 2JEGA 4KHPO 5B1BB 1YITV 1Q6IA 4FS2A 2EIYA 2BTQB 1KJIA 2UXNA 1ZSPA 2UUCO 3P30A 1VF5B 1BQZA 4FFMA 2R7ZG 1NTZH 1RM1B 1YXBA 1VEWA 4JI3B 3K57A 2MCTA 2A3QA 4ZI7A 3ABTA 3JD1A 1P8LA 4FFBA 1I2KA 3CP1A 4JV0A 4XYMB 1G4YB 4F4WA 3OGIB 3TQTA 4JI8B 3J81N 2O03A 3VOUA 1XMOB 1XDNA 1IBLB 1AR4A 4DK1A 3UZBA 1NQTA 4RUCA 4EB6A 2HGWA 4RNMA 4LNUA 2GV9A 3HOWG 3QF7A 2P67A 3BVOA 3SJCC 1BS3A 2E76B 4PA4A 1ZTEA 4Q20A 4WBNF 3ZHUA 3FB8C 4IAJA 2W9CB 1HNWO 4CKCA 4X8AA 2Q2TA 4EEYA 5CM0A 3HOVG 1KD1W 5HFMA 1S0VA 5KT7A 2ZGIA 3MWDA 3PW0A 1YJNV 4JV5H 4MVQA 1RP3B 4EGQA 4ZQIA 3GQCA 3PVXA 1BT8A 5EBMC 2RDCA 1TUBA 4DR5O 2ZXWC 4UXNA 5KA5A 1YVWA 1FFTB 3HXLA 4O3OA 3HKCB 2HHHO 3AG1B 4RB1A 1XHXA 3DC6A 1HNXO 3U0ZA 4LFAB 1ZETA 3G6EV 4TSFG 3IG0A 2WLHA 3QFFA 1IOVA 1WB7A 2AHYA 1US6A 4LWSA 4RWUA 4K0KB 1K4CC 3N2GA 4RZRA 4W4KA 4ECZA 4LH6A 2YWVA 4QJFA 2Q0AA 4G3IA 4U3JB 4RNOA 2M05A 1IBKH 2R8JA 1Z2PX 2EINC 4CC5A 5BWTA 4MW8A 2XD4A 4X1IB 4LFCO 3F7VC 4LF8H 4DL4A 1ET0A 2UUBH 4P30A 5EIBD 1VAJA 4P9PA 4E6NA 2UXBB 3VPDA 3RYHB 3FKIA 5H6RA 1CEZA 5LHHA 3VOTA 1I50A 5D1OA 1M56B 4FMTA 4FPPA 3GV5B 3ORRA 2JEJA 4JAVA 5KFQA 1XEQA 4LF6B 2B63G 1VQ5V 2YL2A 4R8UA 5KX5A 1M93A 2A9HA 2F43G 2AZ0A 4PBCA 3K5MA 4QWEA 2Q2UA 2ZQMA 2YZNA 3RN4A 3T9DA 4R50A 2R8IA 2AHZA 1NBMG 4I7HA 4R6ZA 2W0FC 4AYBA 2WLMA 5BMVF 4JI5B 4DR6H 1Y1WG 3UM7A 4YHHO 5KFSA 4J9PA 2F4VB 1BMFG 5IP7G 2R72A 2ZT9B 3T99A 2VA2A 4R8CA 3OE7G 4AI8A 1Z5WA 4DV1B 5BWRA 3IJ4A 2YEVA 4MA5A 4I50B 3T1HB 4ECXA 2R85A 1YI2V 1E4EB 1T94A 3OT7A 4NB5A 1VQKV 4H0LB 5FPOA 5I5XA 1FFXA 3L72H 1N0JA 3T5LA 3AG4C 1COWG 4XDJA 1SA0B 3WWHA 1FJGH 2C2EA 3CXCU 2QE7G 2W6IG 3ASOC 3RF2A 2K9PA 4KHPH 1IYDA 5LYJF 1HR0B 4B3RB 1B6RA 4YBZB 2OCHA 2LW7A 2RQ6A 3HB3B 1Q86W 5IWAH 1XL6A 2WLKA 4DV5B 1Q6UA 5DM6V 4IRKA 4O7VA 2DE0X 3PJSK 1JFFA 2C2AA 4X62B 1SKVA 4R7CA 3A0BZ 1FXVA 1VMGA 5IYDO 3E22A 4J9MA 4QE7A 2Y0SE 3H1KH 1NTMH 4X1KB 2P22C 2XAGA 5C3EG 4I7ZB 1EKVA 2NLJC 3QO5A 3OFNG 3WG7B 4IWXA 4JASA 1Y4MA 5BR8B 2PYJA 3GV7B 2Y48A 3ZRWB 1N32B 4JI6B 2DPIA 3O9OA 3DF7A 1HW7A 3PR4A 2R9AA 1BHAA 3OSPA 2WE6A 3GLKA 4ECWA 2E2HA 5EBWC
chains in the Genus database with same CATH topology
1S5JA 3ETQA 4NXMH 4JI4H 2P5OA 1XMQH 4YY3B 3NBZB 3RYHA 1N34B 2W57A 3BHPA 4DV0B 5J2UA 5KHIA 1P49A 5FLXW 4DV2B 4BWAA 4I55B 4JI2B 4LF7B 4B3TH 4DV4H 2ZNJA 4K8XA 3W5OA 3W1BA 3RWRD 1L2ZA 2UUAB 4DR1H 4ZOLA 3JAMW 3RGZA 4B3MB 5LP6A 4IIJB 2CW8A 5ITZA 1HNXH 5FPRA 3BABA 2Q7GA 5CA1A 4B3SB 4WBNB 3JSLA 4CH6A 2F1MA 1H2SB 1TA8A 3S24A 5LMNH 2PY5A 2VWJA 4I50A 4AQYH 4JI3H 3JARB 1BGWA 4O4LB 3U10A 5JCOC 5KHGA 3RYIA 1V9PA 4KHPB 4HNAA 1SEIA 4UCVA 5KMGA 2F66C 3N2KB 3N41B 4RB3C 4JI1H 4LFCH 3UQ8A 2UUCB 4RAZA 4JI8H 1P16A 4LF4H 4UFZA 4CH5A 1I94H 2ZINA 4NXNB 4ZHQA 1TAEA 4TV9A 3LMLA 4BW9A 3OTFA 4TQDA 4TQFA 1D5AA 2CAZC 3K3VA 5LMUB 4LH7A 4PDBA 2OWOA 5LP6B 1X9NA 1N33B 5ITZB 1XNRH 2BTOA 4YJ3B 4AILC 3CB2A 4JYAB 3H20A 3WB2A 4MTEA 3RTXA 3DSQA 5CA1B 3VQWA 4LSXA 1CKNB 5JJJB 4X1KA 2ZNIA 2QJ1A 4YHHH 5DISC 3JATA 1HNWB 3L4KA 2HGSA 1ZHSA 5LA6A 4NXMB 2E5LH 1Q8IA 3FFQA 3UT5A 1HNZB 3K5LA 1J5EB 5D5PA 3WB0A 1E4FT 2VQEH 4RB2C 4YJ2A 5IYZA 4X66H 3ICXA 4CS2A 4ZHQB 4B3TB 4LFAH 3GJXB 4TV9B 4DR5B 3C0FB 2UXCH 3PN1A 4RB0A 4UCSA 4JI7B 5FD5A 4B08A 5LYJA 4X1YA 2HHHB 2V4DA 4I55A 3K5NA 2PZSA 3SJAC 1Q43A 2CFMA 1HNXB 4LMYA 3J7AK 4DV6H 1O9GA 3M7MX 3ZEDA 1I7FA 1IBKB 1L8DA 5BMVB 5JJNB 4OX9H 4X65H 4DR4H 3JALA 4IIJA 4MV7A 4DUZH 4LSAA 4LF8B 2PYLA 3M4IA 4RAYA 4A2AA 4TV8A 3SGIA 1A0IA 4GYCB 4LFCB 4JI1B 2YI8A 5CB4A 4EQ5A 3KAKA 4CH4A 3N6XA 4PZ8A 4LF6H 4O4LA 3JASB 4DR3B 2YIAA 2HEPA 5K1XA 1XHZA 4O2AB 4CS4A 3N2KA 5IJ9B 3KALA 1X4TA 2UXDH 4L8JA 5LYJB 4X1YB 1GYFA 2VWKA 2UU9H 1N36H 1ZAUA 4LFBB 3VQVA 5FD6A 4JI0H 2F4VH 1QHTA 5EYPB 3GDEA 4UCUA 3JAKB 4DR6B 1XI1A 5D5QA 4PZ7A 3OTOH 1IBMH 2VQFH 4DV1H 5LXTB 3QWUA 3NBYB 2HVRA 3T1HH 5LOVA 4ZIBA 3CSXA 1M5IA 2PTMA 2ZIMA 3HKBA 3JALB 3K59A 4YHHB 4YJ3A 3T1YB 4Q0YA 4DR7B 4I4TB 2VUGA 4ZI7B 1FKAH 4PI2A 5CA0A 4M7EA 3VNNA 4GLXA 4TV8B 1Q3EA 4DUYB 1CKNA 3SJBC 2QM4A 3VQXA 5CB4B 2VQEB 1WN7A 1FJGB 4DV3H 4X66B 4GKJH 1HR0H 4AHCA 4B3RH 4CH3A 2HIVA 4FLWA 4PZ6A 1FVIA 4LNUB 4DV5H 2WDTA 3ZS8C 2YIBA 3RJ0A 4LF5H 4X62H 3WB1A 5IWAB 3HKDA 3N43B 1XNQB 1XMOH 3QTCA 5EZYA 1IBLH 1NT2B 1WNSA 4FLVA 4MV9A 4DV7B 3TY5A 1B04A 2ZCEA 4TOIA 3IAYA 4O4HA 5BR8H 3FMAA 2JVDA 5LOVB 4FM0A 4DR2H 2ZM6H 4DUZB 3HKBB 4GKKH 4PI0A 1O75A 4JI6H 2BTQA 5CA0B 3U11A 5BMVA 1AN7A 4Q6GA 1Q5OA 3JAWB 3EYYA 2YCHA 4YY3H 2YI9A 1N34H 1XK5A 4FM9A 4JI4B 1WPBA 1XMQB 4HBNA 2XIGA 4BWSC 2YIBD 4DV2H 3MAQA 3QG5A 4JI2H 2VOBA 3BA8A 4LF7H 4APMA 1Z2NX 3TY9A 3N2GB 3HKDB 5GONB 5LP6C 5IJ0B 1N36B 3JASA 5EZYB 4JI0B 4IHJA 4DV4B 2UUAH 1TVKB 3BRCA 1Z2OX 4O2AA 2F93B 5IJ9A 4X20B 3OTOB 4DRFA 1IBMB 4K0KH 2VQFB 4B3MH 5J2TA 4DR1B 3LNNA 2CW7A 4O4HB 4RZQA 3L2PA 1M4UA 1QQCA 5JJEB 3MWMA 4B3SH 4FM1A 4A2BA 1KU9A 5EYPA 4UCRA 1VS0A 3JAKA 3K58A 2BTQB 5LXTA 1Z5VA 3JSNA 4FLTA 5LMNB 2UXBH 1S03G 4AQYB 4JI3B 4I4TA 3K57A 2MCTA 4ZI7A 2UUCH 5KX5B 1P8LA 5JVDB 2EX3A 4FFBA 4NXNH 4JI8B 4LF4B 2O03A 1I94B 5FNVB 1XMOB 1XDNA 1IBLB 4DK1A 2VPSA 1O9HA 4IHJB 4LR3A 2PGGA 4EB6A 5KHHA 5C8YB 4LNUA 2GV9A 5LMUH 3QF7A 4FVMA 3SJCC 1N33H 5J2TB 4JI5H 4JYAH 4IAJA 4DR2B 4U3JA 2ZM6B 3CVZA 2Q2TA 2Q7EA 4X64H 5A2QW 1XNRB 4K8ZA 1M0TA 4ETSA 4X1IA 1FFXB 2F95B 4FLZA 4O4IA 1HNWH 4JV5H 3RR5A 1WH2A 2HVQA 5IT9W 3HKEB 3KYHC 5JQGA 4LF9H 1HNZH 2E3CA 1TUBA 1J5EH 2HVSA 1S68A 4O2BB 1MZBA 2XHBA 2E5LB 4FFBB 3JAWA 3NC0B 3HXLA 3HKCB 4FLUA 4R7RA 3N40P 4DR5H 5EOYA 1JFFB 4RB1A 3B2EE 1XHXA 1KMIZ 4JI7H 3U0ZA 4LFAB 3IG0A 2KSWA 2HHHH 3E22B 2UXCB 4EB6B 3KAJA 4F6RA 4O4JB 4K0KB 3L4JA 3N2GA 4LH6A 5IJ0A 2Q0AA 3BA9A 5GONA 4U3JB 1IBKH 4UCTA 1Z2PX 1TVKA 4UCOA 3RYCA 4NVPA 4CC5A 4X20A 4X1IB 4DV6B 4TUYA 2KKWA 4O4IB 4LF8H 4OX9B 3J81W 4EFEA 2UUBH 5EIBD 4X65B 4DR4B 4E6NA 2UXBB 5JQGB 1N32H 3RYHB 1TUBB 2WYOA 1CKOA 1JJOA 5J2UB 5D1OA 1ZHQA 1BJTA 2FE3A 1SA0A 5IYZB 5KHKA 4MTDA 4DR3H 1RSOA 1YEWA 4CC6A 4LF6B 4DRXA 5KX5A 4DV0H 1M93A 2OYQA 3RYFA 3K5MA 5JVDA 2HIXA 1E4GT 3THOA 2Q2UA 2ZJTA 4ZOLB 4FM2A 4F6RB 1JMKC 2UXDB 3A2FA 1DGSA 4I7HA 4LFBH 3K5OA 4EFBA 3GB8B 4JI5B 4DR6H 5FNVA 4EEQA 2UU9B 5EIBC 1I6UA 5JH7A 2F4VB 4X64B 5C8YA 2R72A 3RYCB 2RGRA 3BAAA 2R70A 1Z5WA 4TUYB 4DV1B 3RGXA 4CS3A 4I50B 1XQ8A 4JV5B 3T1YH 4DR7H 3T1HB 2ZIOA 3RGBA 5K1PA 3BPZA 3F8NA 3RYIB 4LF9B 4HNAB 3CHXA 2YXLA 5LL6b 5FPOA 2Q7HA 5KMGB 4DUYH 1CKMA 1FFXA 5D1OB 3W1GA 4FLXA 5KHJA 1VF7A 5D1PA 1SYXB 4PHZA 1SA0B 3N44B 1FJGH 4FLYA 3RF2A 3HKEA 4KHPH 4D7SA 3VQYA 4DV3B 4GKJB 4DRXB 1HR0B 4B3RB 4O2BA 1G6UA 3RYFB 3SR2C 2PUSA 3RFRA 2RQ6A 5IWAH 3HKCA 4DV5B 1XNQH 4I9QA 4KL1A 2JGUA 4D7TA 1JFFA 4LF5B 3N42B 4X62B 1SKVA 4DV7H 5JCOA 4DK0A 5JH7B 3J80W 3RIZA 3E22A 1T5EA 4J0MA 3TY8A 4O4JA 4X1KB 2P22C 2RJZA 3JATB 2IM9A 5BR8B 5LA6B 2UUBB 2PYJA 1SQFA 4WBNA 1N32B 3UT5B 4GKKB 2RGVA 4JI6B 1M0WA 3DF7A 1HW7A 2JS5A 2R9AA 3KXYT 2WE6A 1SQGA 4YJ2B 3JARA 1TGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LH6 A;  2CFM A;  3BA9 A;  1HNX B;  1XK5 A;  4YY3 B;  4UCT A;  4JI4 B;  3NBZ B;  1XMQ B;  1N34 B;  4UCO A;  4CC5 A;  1IBK B;  4DV0 B;  4DV6 B;  3BA8 A;  4DV2 B;  3TY9 A;  4JI2 B;  4LF7 B;  4OX9 B;  4EFE A;  4LF8 B;  1N36 B;  4X65 B;  4DR4 B;  4E6N A;  2UXB B;  3W5O A;  4JI0 B;  4DV4 B;  3W1B A;  1CKO A;  5D1O A;  3SGI A;  3OTO B;  2UUA B;  4DRF A;  1A0I A;  1IBM B;  2VQF B;  4JI1 B;  4LFC B;  4EQ5 A;  4DR1 B;  4B3M B;  3L2P A;  4PZ8 A;  5FPR A;  4CC6 A;  4LF6 B;  4DR3 B;  4UCR A;  1VS0 A;  3BAB A;  4B3S B;  3JSL A;  2HIX A;  2Q2U A;  1TA8 A;  2UXD B;  3S24 A;  1DGS A;  3JSN A;  4EFB A;  3GB8 B;  1ZAU A;  4JI5 B;  5LMN B;  4LFB B;  4AQY B;  4EEQ A;  4JI3 B;  2UU9 B;  3GDE A;  1V9P A;  4KHP B;  4UCU A;  4UCV A;  4DR6 B;  2F4V B;  4X64 B;  4PZ7 A;  1P8L A;  3QWU A;  3UQ8 A;  2UUC B;  3BAA A;  1P16 A;  3NBY B;  2HVR A;  4UFZ A;  4DV1 B;  4JI8 B;  4NXN B;  4JV5 B;  3T1H B;  4LF4 B;  1TAE A;  4YHH B;  1I94 B;  3T1Y B;  1XMO B;  4DR7 B;  1IBL B;  1XDN A;  4LF9 B;  2VUG A;  5FPO A;  3VNN A;  1CKM A;  4GLX A;  5D1O B;  3W1G A;  4DUY B;  1CKN A;  5D1P A;  2VQE B;  5LMU B;  4LH7 A;  2OWO A;  1X9N A;  1N33 B;  1FJG B;  4DR2 B;  4X66 B;  2ZM6 B;  4JYA B;  2Q2T A;  4DV3 B;  1XNR B;  2HIV A;  4GKJ B;  4PZ6 A;  1HR0 B;  4B3R B;  3RTX A;  1FVI A;  1CKN B;  4DV5 B;  3RR5 A;  5IWA B;  5DIS C;  4LF5 B;  1HNW B;  2HVQ A;  4X62 B;  1XNQ B;  3KYH C;  4NXM B;  2HVS A;  4DV7 B;  3TY5 A;  1S68 A;  1HNZ B;  1B04 A;  1J5E B;  2E5L B;  3TY8 A;  4TOI A;  3NC0 B;  4B3T B;  5BR8 B;  4DUZ B;  3GJX B;  4DR5 B;  2UUB B;  3PN1 A;  4LFA B;  1N32 B;  4UCS A;  4GKK B;  4JI7 B;  4JI6 B;  2UXC B;  2HHH B;  4K0K B; 
#chains in the Genus database with same CATH topology
 3H1J H;  2HG8 A;  3ETQ A;  4NXM H;  1XMQ H;  5FJ8 G;  3R65 A;  3G80 A;  1RPR A;  1NR7 A;  2W6P A;  4QNH B;  3CCR V;  4JV1 A;  3BHP A;  5J2U A;  4K3A A;  1KP2 A;  1MNG A;  5FLX W;  4DL2 A;  3Q4H B;  4LF7 B;  3DTG A;  4C5A A;  5KFI A;  4DV4 H;  1SQB H;  3CCS V;  4K8X A;  4U3F H;  2JA5 A;  1VQM V;  2JK5 C;  4U7C A;  2X6B A;  5LOV F;  4DR1 H;  4ZOL A;  1SZX A;  1IXB A;  3JAM W;  2A06 H;  1W96 A;  5KFU A;  1HNX H;  2CW8 A;  1GM9 A;  2W9A A;  1GN2 A;  2WLN A;  2QDO A;  4AQY O;  4B3S B;  4Q4C A;  4WBN B;  3A0R A;  3JSL A;  4CH6 A;  2BCC H;  3E35 A;  2LO1 A;  4O81 A;  4QSH A;  4JAA A;  1SCU B;  4JI3 H;  1AR5 A;  2Q69 A;  1V51 A;  2QKS A;  3TW6 A;  4WFB V;  1KTA A;  1I94 O;  5DQG A;  1V9P A;  1G2W A;  2JEX A;  2DW4 A;  5KMG A;  1GSA A;  3WFV A;  3AG3 B;  1EN5 A;  3HT5 A;  3LP8 A;  4LFC H;  4RAZ A;  4JI8 H;  2AW9 A;  4IYI A;  5LL6 Y;  2AU0 A;  4PWQ A;  1N0N A;  1K73 W;  3DGE A;  3CRR A;  1K34 A;  3KCY A;  4TV9 A;  1IOW A;  2FPP B;  2A7W A;  2QA4 V;  3OTF A;  1XNR O;  5IYB G;  5L3D A;  4F4Y A;  2CAZ C;  4I9W A;  2QEX V;  1FYJ A;  3RB3 A;  3H0G A;  3LDE A;  2ABJ A;  1J95 A;  2KG7 B;  2OWO A;  1N33 B;  5ITZ B;  3Q2O A;  2VS0 A;  4AIL C;  3CB2 A;  4FBT A;  1TUE B;  3H20 A;  4MAM A;  1EUD B;  1W59 A;  1L1F A;  2JDI G;  2YIC A;  1GM8 A;  2X6C A;  3KHG A;  1VF6 C;  4LSX A;  3GTO A;  1BCC H;  2ZNI A;  5KFB A;  3H40 A;  5BPH A;  5H80 A;  4YHH H;  3D36 A;  4FIP C;  3L4K A;  2DLN A;  2HGS A;  3K08 A;  1Q8I A;  3FFQ A;  2C2R A;  3UT5 A;  1VQ6 V;  2GTS A;  1J5E B;  3WB0 A;  3RUP A;  4CKE A;  2UVV A;  4RB2 C;  3EPG A;  4X66 H;  4WCE V;  4B3T B;  4LFA H;  3F7Y C;  3GJX B;  4QWD A;  3ZMU A;  5AG2 A;  2IJK A;  4YIP A;  3PN1 A;  4NTX A;  1N48 A;  3PO2 G;  5J2T F;  1OBD A;  5BYB A;  4JI7 B;  1GTO A;  4WD3 A;  4B08 A;  3GII A;  1Y76 A;  3T54 A;  3K5N A;  2PZS A;  4NZN A;  2SCU B;  1R6T A;  4FS1 A;  4LMY A;  4X65 O;  4DR4 O;  2NVY A;  1SER A;  2NU9 B;  5DGI A;  1L8D A;  5BMV B;  5JJN B;  3UFX B;  1CQI B;  2QM8 A;  2ZDG A;  5I47 A;  1S5H C;  1BZK A;  3T9C A;  2I8C A;  2PYL A;  5KAF Z;  3IC7 A;  3PFF A;  4RAY A;  3OHA A;  4EKW A;  1A0I A;  5KT4 A;  1KC8 W;  2HP8 A;  5CB4 A;  4EQ5 A;  2FP4 B;  1W93 A;  4KXR A;  2UXD O;  3FD9 A;  3RBD A;  3CJH B;  3T7A A;  2Y0I A;  3N6X A;  2W7P A;  4LF6 H;  1XRE A;  1KC7 A;  2YRX A;  1E1Q G;  4DR3 B;  2YIA A;  2ETN A;  2HEP A;  2Q68 A;  5K1X A;  3CRQ A;  3G67 A;  3N2K A;  5IJ9 B;  3LSS A;  1X4T A;  4X64 O;  1V55 B;  4FFL A;  3AX6 A;  2JA6 A;  5LYJ B;  2VWK A;  2V59 A;  2CH7 B;  1MSD A;  4LFB B;  5FD6 A;  5L1I A;  2EUL A;  2F4V H;  3TXS A;  4O4I F;  1XI1 A;  4PZ7 A;  4UVB A;  4DV1 H;  4QW8 A;  3OD4 A;  1GRJ A;  3T1H H;  5JQG F;  2BQR A;  1H2N A;  3CSX A;  4MT8 A;  4Q4D A;  4FFO A;  3HKB A;  5J2U F;  2XAS A;  2X0L A;  3T1Y B;  4Q0Y A;  4DR7 B;  3H4B A;  4ZI7 B;  4PI2 A;  5CA0 A;  4M7E A;  3MFH A;  4DUY B;  2CZG A;  1CKN A;  4GLW A;  2QM4 A;  1DTO A;  5GTH Z;  1F51 A;  2CNQ A;  1HR0 H;  3CEI A;  4B3R H;  2MK3 A;  4Q44 A;  2WB1 E;  1JKJ B;  4LNU B;  4DV5 H;  1JJ2 U;  1AP6 A;  5GON F;  4X62 H;  2OLS A;  2YXY A;  4CKB A;  3N43 B;  1XNQ B;  4K35 A;  2WPD G;  4ZKI A;  4TUY F;  4DR2 O;  2V58 A;  2ZM6 O;  3R23 A;  4DV7 B;  5I60 A;  1K1S A;  2PMZ A;  1MZE A;  5IP9 G;  1CP9 A;  4U7N A;  5BR8 H;  3PW7 A;  2E75 B;  2WWW A;  5LOV B;  4FM0 A;  3R5X A;  3GVM A;  2IA6 A;  1EZJ A;  2W0X A;  1DAA A;  1KT8 A;  1QR8 A;  1MA1 A;  2QB5 A;  4PI0 A;  2ARH A;  1VKZ A;  4JI6 H;  2IW5 A;  5KLV H;  2W6M A;  3DC5 A;  4IGG A;  1UC9 A;  4EBE A;  1Y6X A;  4DV0 O;  3EYY A;  4DV2 O;  1NZ6 A;  1DV2 A;  1GN6 A;  4JI2 O;  2YI9 A;  4GX2 A;  3JCU Z;  1WPB A;  4KP4 A;  4JI4 B;  1UFI A;  2YIB D;  4ED8 A;  2R7Z A;  2UUA O;  2QYZ A;  2VOB A;  4LWS B;  4UV8 A;  4GCZ A;  4APM A;  4LF7 H;  3BQ2 A;  3N2G B;  2QTS A;  4TWK A;  3G4S V;  3J7A U;  3WO0 A;  5JH7 F;  2WTF A;  4B3M O;  4ED1 A;  4JZG A;  2COG A;  1JX4 A;  3I4N G;  4CHI A;  2GTA A;  4IHJ A;  4J9K A;  1Z2O X;  3RAQ A;  2R8K A;  1KJ8 A;  1S10 A;  2QWQ B;  3ZRV A;  1IBM B;  2VQF B;  4ME6 A;  1EN4 A;  3KRE A;  3LNN A;  1PX2 A;  2CW7 A;  3ZRS A;  1M4U A;  1XUQ A;  1WA8 A;  4XX0 B;  4B3S H;  4A2B A;  5EYP A;  5KFD A;  5KG1 A;  2QK4 A;  2ASD A;  4EYI B;  2IH1 C;  4JV2 A;  1H38 A;  2PBZ A;  2K1E A;  1ROP A;  1F4N A;  5E1A C;  5B5E Z;  5L3C A;  3OHB A;  1H2K A;  5LMN B;  5BY1 A;  2WAM A;  5KX5 B;  3OM3 B;  2M7W A;  5K2M A;  2PF4 E;  2P90 A;  3TIN A;  1K92 A;  4ZBM A;  5GTI Z;  3GTG A;  3FB7 C;  3CE2 A;  1S5L Z;  5IYB O;  5DG7 A;  4XDK A;  5L3G A;  5KHH A;  1KB9 F;  3P3N A;  3W7S A;  2EIL B;  4QWA A;  1ULZ A;  2YEV B;  4IL6 Z;  5J2T B;  1N33 H;  3K06 A;  2Z02 A;  2N74 A;  4WHX A;  3U55 A;  3E2E A;  3F5T A;  4DO2 A;  4JV5 O;  2EIJ C;  2CTR A;  2B5U A;  3CVZ A;  3X2Q B;  5B3S C;  2OT5 A;  4X64 H;  3HOX G;  3S3X A;  1FFX B;  4JYB A;  4QIW A;  3RVZ A;  4O84 A;  5I5Y A;  1WCM G;  2LQT A;  3E8F A;  3KYH C;  4LF9 H;  1J5E H;  4AYB E;  1MZB A;  2XHB A;  2E5L B;  3JAW A;  3H1H H;  4FZ1 A;  4FLU A;  3G6B A;  1A0G A;  4MV8 A;  1SQP H;  3GIQ A;  5EOY A;  1BNC A;  4RQF A;  3N8D A;  1JFF B;  1QVG U;  3CCM V;  3B2E E;  5DGA A;  1VQ8 V;  3RB0 A;  4JI7 H;  4Z2W A;  3SYA A;  1DF4 A;  3E22 B;  5JWP A;  2UXC B;  5LP6 F;  1IBK O;  3ZHR A;  4O3N A;  4F6R A;  5I5W A;  2Y69 C;  3ABL C;  5KFX A;  4BY1 G;  3L4J A;  2EJ2 A;  5CA1 F;  5IJ0 A;  3CC2 V;  5F9N A;  3ZHV A;  4LF8 O;  1K4D C;  3RV3 A;  4UCO A;  3RYC A;  1MMM A;  2UUB O;  1V54 B;  2DIK A;  4RUE A;  5CMU A;  2ZE7 A;  2KKW A;  5IYD G;  1Y1W A;  4O4I B;  4B7K A;  4O7T A;  3V4S A;  5C44 G;  2CTW A;  4EFE A;  5KFL A;  2COJ A;  2ATK C;  4BBR G;  3KHR A;  1RJR A;  5JQG B;  2A1H A;  3V6J A;  5BWW A;  1XDC A;  5J2U B;  4ZHQ F;  3ZN1 A;  1JVM A;  3P3P A;  2FB5 A;  3JZI A;  3ZMV A;  5KHK A;  4MTD A;  1NVP B;  4DR3 H;  3PO3 G;  3LSU A;  4X88 A;  2HJD A;  1Y1V A;  4DV0 H;  2OYQ A;  3RYF A;  4DR6 O;  1T3N A;  2HIX A;  4HZ3 A;  3THO A;  3CC7 V;  2V4R A;  4ZOL B;  3R66 A;  3SYC A;  5IE9 A;  4FM2 A;  4JTA B;  1JDB B;  2JRI A;  5C5J A;  4C2M A;  3QZ8 A;  4LFB H;  1H2L A;  3GB8 B;  5FNV A;  1I7N A;  2UU9 B;  1H2M A;  3ZHQ A;  5EIB C;  1NJI W;  2V4Q A;  2VRZ A;  5C8Y A;  1SC5 B;  4C5C A;  3BAA A;  3WO1 A;  2RGR A;  5FLX N;  3HOU G;  2R93 G;  1R73 A;  4TUY B;  3I56 V;  1HP8 A;  1WLE A;  1XQ8 A;  3T1Y H;  4DR7 H;  2ZIO A;  2IU0 A;  3SPG A;  3RGB A;  4Z1V A;  2BOC C;  1FJG O;  3F8N A;  4DW1 A;  2R87 A;  4YR0 A;  3CHX A;  2YXL A;  5H2F Z;  4DUY H;  5KMG B;  3PW5 A;  1G8M A;  4P9O A;  2DYR C;  3JAM N;  5KHJ A;  4WFE A;  3N44 B;  4MSW C;  4DYL A;  4FE2 A;  2LFR A;  5IWA O;  5DMX A;  1RSO B;  3TK1 A;  3VQY A;  4DRX B;  1G6U A;  4GUN A;  1V4Y A;  2IJI A;  1KKD A;  2HHF A;  3RFR A;  1S76 D;  2EJR A;  2XCA A;  3VA7 A;  1XNQ H;  5KFZ A;  3ZBH A;  3QZ7 A;  2JGU A;  4D7T A;  4LF5 B;  1QU7 A;  2CGN A;  4DV7 H;  3GTL A;  3UZO A;  1VAR A;  2IP4 A;  3R9R A;  5I5S A;  1OCZ B;  5JH7 B;  3J80 W;  3GV8 B;  3B8M A;  1S0O A;  1K5S A;  1PP9 H;  4O4J A;  2L6L A;  3IC9 A;  2RJZ A;  2PI5 A;  5B3S B;  4TM5 A;  4TV8 F;  3B77 A;  1SQF A;  3MHS C;  4NXM O;  3UT5 B;  1XMQ O;  2RGV A;  2W9B A;  5DG9 A;  3L74 H;  1PPJ H;  3NR7 A;  2XGP A;  1BQ0 A;  1NKD A;  4JZ2 A;  2LFS A;  4NVP A;  1GH6 A;  3V6H A;  3JAR A;  1TGO A;  3TXQ A;  1S97 A;  1TWC A;  4A3E G;  4JI4 H;  4CBC A;  1TWA A;  4K6N A;  1LUW A;  2WA3 A;  3NBZ B;  1N34 B;  1CXZ B;  3LNM B;  4DV4 O;  5KHI A;  5C1P A;  1PL0 A;  1VF6 A;  2NR5 A;  3OTO O;  3K3P A;  4DR1 O;  1ARO P;  3DTU B;  1IDS A;  1KBL A;  1AIL A;  3H1I H;  1R3J C;  1A3G A;  4J7J A;  1Y66 A;  3RWR D;  3CCV V;  1Y14 B;  2ASL A;  2R82 A;  2GPW A;  4EGJ A;  2H8P C;  5LGN A;  2GPS A;  1OHH G;  3RAX A;  5FPR A;  3AK2 A;  5JVL A;  4RUA A;  2W6O A;  5DQH A;  2YUA A;  4JI3 O;  2Q7G A;  3MR5 A;  3GTM A;  1I1M A;  4RUF A;  2E74 B;  3HBL A;  2F1M A;  1M57 C;  4CE5 A;  3U0G A;  4Q8E A;  5LMN H;  1RK6 A;  2VWJ A;  1JQ0 A;  4JI8 O;  4BBS G;  4HYO A;  1BGW A;  5L1K A;  1GGO A;  4FGR A;  2EIK C;  5KHG A;  3W7T A;  1W0J G;  4HNA A;  1XMO O;  4JAU A;  1IBL O;  2EJ3 A;  4J7Z A;  1SEI A;  3VPB A;  3MR6 A;  3N41 B;  3N2K B;  1YF2 A;  3OUU A;  1JX9 A;  1I1L A;  3OW2 U;  3DXR A;  3ABK C;  1XOU A;  3HPL C;  4NXN B;  2NN4 A;  2H3O A;  3LML A;  3D8C A;  1OCR B;  4MTG A;  4U7O A;  3MDS A;  2JIZ G;  3RVY A;  1D5A A;  1FXK B;  2XCP A;  1AJP A;  2W7O A;  5IY5 B;  4PDL A;  2GBO A;  5LMU B;  2ODT X;  1P4R A;  4LH7 A;  4PDB A;  1XBL A;  2HG5 C;  5LP6 B;  2WLJ A;  1X9N A;  4JYA B;  4FZ0 A;  3WB2 A;  5HFL A;  1EFR G;  3RTX A;  3G6Y A;  4HNT A;  5CA1 B;  5EWF A;  5H6Q A;  3TIG A;  1CKN B;  4ECT A;  4IT5 A;  3K9A A;  4O83 A;  5DIS C;  3JAT A;  1Q82 W;  2C28 A;  5LA6 A;  2NU8 B;  3CCL V;  3SYQ A;  2E5L H;  4X66 O;  2R6F A;  3R5H A;  4LFA O;  1HNZ B;  3NUA A;  4RCN A;  3B09 A;  5FNV F;  4H13 B;  4RNN A;  5BWU A;  1LUV A;  4YJ2 A;  4K0K O;  5IYZ A;  1VQO V;  5C8Y F;  4ZHQ B;  4JXU A;  2HR3 A;  1PNM A;  3C0F B;  2HKO A;  1EZ1 A;  1WR2 A;  4RAI A;  2UXC H;  1KBH A;  4ECR A;  5EBL C;  5FD5 A;  1KEC A;  3OGC C;  5E79 Z;  4X1Y A;  4I55 A;  4H44 B;  3H3V H;  3U9T A;  5K3W A;  1DK1 A;  1WAZ A;  4TT3 G;  4X89 A;  3J7A K;  1C3O A;  2V9W A;  2UXB O;  3M7M X;  1I7F A;  2FB9 A;  1KJQ A;  1I5Y A;  2CNU A;  2GQR A;  4DL3 A;  1S3J A;  3G8C A;  3CRA A;  4ZI7 F;  4IIJ A;  3UYY A;  3B40 A;  4MTX A;  3VMM A;  4UV9 A;  4LSA A;  1Y74 B;  3U54 A;  1TWF A;  1ZLZ A;  2R7K A;  4LF6 O;  4A2A A;  3SGI A;  3QO8 A;  2HFE C;  4JI1 B;  1C30 A;  1RYS A;  2W6N A;  3EPI A;  2JEF A;  2PMZ E;  5T14 A;  3KAK A;  4CH4 A;  4PZ8 A;  3L9D A;  1VQ7 V;  4O4L A;  3QVN A;  2R8G A;  4JI5 O;  1R6N A;  4O4J F;  2XC9 A;  2ZXW B;  2F4V O;  4ED7 A;  4H33 A;  1JDE A;  3C3T A;  1GYF A;  3SPC A;  4DV1 O;  4U6P A;  3SI8 A;  2UU9 H;  3GIP A;  1ZAU A;  5DN6 G;  4JGS A;  3T1H O;  4JI0 H;  5EYP B;  4YR2 A;  3OTO H;  5D5Q A;  3OMI B;  1S72 V;  3ETE A;  2ZDI C;  4YXW G;  5KG2 A;  3QWU A;  1IX9 A;  1AVM A;  1PV0 A;  4ZIB A;  2PTM A;  1QLE C;  3K59 A;  3JAL B;  3ZMT A;  3ETD A;  1ZL8 A;  1FKA H;  2EIN B;  1K5Q A;  5KG6 A;  2YZG A;  1HR0 O;  1H2G A;  4B3R O;  4TV8 B;  1EKF A;  2P7T C;  2VQE B;  3HB9 A;  2Q0O C;  4DV5 O;  1TWH A;  4KUM A;  4L1K A;  1JXL A;  1IUR A;  2HJW A;  4X62 O;  4CH3 A;  2HIV A;  2J6T A;  3ZMZ A;  3ZS8 C;  4DW0 A;  2DPJ A;  1N8R W;  3RJ0 A;  1OCC C;  4IRD A;  4LF5 H;  4J9Q A;  5L9X A;  1K9M W;  1ORQ C;  3E8H A;  5DED A;  4J9Z B;  2AXT Z;  1XMO H;  4RO2 A;  3QTC A;  5EZY A;  1IBL H;  1NT2 B;  5BR8 O;  4FLV A;  3JCZ A;  3JD0 A;  5LHI A;  3TY5 A;  2NU6 B;  5KFF A;  1B04 A;  3ETG A;  4JI6 O;  4TOI A;  4QWC A;  2A0L A;  4O4H A;  3HOY G;  2JA7 A;  4NYE A;  2JVD A;  1Y67 A;  2ITC C;  2R7L A;  4A3K G;  4A5U B;  3BG5 A;  2V5A A;  2VA3 A;  4DUZ B;  1VQL V;  2AGQ A;  2FLP A;  4QPJ A;  3AEI A;  1O75 A;  2YC0 A;  5KKN B;  5CBH A;  1I3Q A;  5KFA A;  2BTQ A;  4A3I G;  1Q5O A;  3JAW B;  3JRW A;  3E8B A;  5GW7 A;  4LF7 O;  5KX5 F;  1N4C A;  2FPI B;  1N34 H;  3GWO A;  2WAQ E;  2OCC C;  3AG2 C;  5EC1 C;  5KFE A;  2DQ0 A;  2XIG A;  5KG3 A;  2Q6A A;  2AGA A;  3QG5 A;  1GAX A;  3AG4 B;  3L73 H;  4MA0 A;  3TY9 A;  3ASO B;  3HKD B;  5IJ0 B;  5DAA A;  1N36 B;  3JAS A;  2CTQ A;  5B1A C;  3BRC A;  3CC4 V;  2IH3 C;  5KFK A;  4B3S O;  3G6V A;  1SET A;  2JGD B;  3SYP A;  1M7J A;  5LA6 F;  4K0K H;  1B06 A;  3FB5 C;  4TQR A;  3ML0 A;  4RZQ A;  4DQN A;  5LHG A;  4O3Q A;  4JF3 A;  1KU9 A;  2V1D A;  4MVO A;  4PJ0 Z;  4UCR A;  1VS0 A;  1ZQ7 A;  3D3I A;  3GTJ A;  3ZX6 A;  4YJ2 F;  3K58 A;  1HWY A;  2CKZ B;  5LXT A;  2XT9 A;  3STZ C;  3WWI A;  1Z5V A;  3OEH G;  3VBB A;  4IWY A;  4CMD A;  1FXH A;  1THZ A;  2DN9 A;  3BFR A;  3JSN A;  1K1Q A;  1IXM A;  4FLT A;  2RN9 A;  2BOB C;  3EFF K;  2UXB H;  1S03 G;  1EYZ A;  4I55 F;  2MW2 B;  5CBF A;  2DAA A;  2G38 A;  1NH2 B;  2EX3 A;  4BIZ A;  4NXN H;  1B6Q A;  2W6Q A;  4LF4 B;  2B1I A;  4Z1M G;  5FNV B;  1N33 O;  4MV4 A;  3HKZ E;  1YHQ V;  1LR1 A;  2VPS A;  4NZM A;  3AK1 A;  4P2Z A;  3WU2 Z;  2PGG A;  5C8Y B;  4IIJ F;  3CCU V;  5LMU H;  4FVM A;  3T9B A;  2JS3 A;  4ECQ A;  3GIM A;  2QWN B;  2HVJ C;  4JI5 H;  4JYA H;  3GTQ A;  3T2M A;  3HR0 A;  4U3J A;  2ZM6 B;  4DR2 B;  3RB6 A;  2CDY A;  5KA6 A;  2C35 B;  5A2Q W;  1YSC A;  4K8Z A;  4ETS A;  4X1I A;  4LF9 O;  3ZN0 A;  5EWG A;  4O4L F;  1J5E O;  2XAQ A;  1WH2 A;  2CE4 A;  2X7R B;  5JQW A;  2BSK A;  4D6T H;  4B3T O;  1HNZ H;  2E3C A;  1S68 A;  3V6K A;  2HHF B;  4JI7 O;  1AUV A;  4FFB B;  4HR7 A;  5C93 A;  3OR6 C;  4ED3 A;  4O7L A;  2CQY A;  2E2I A;  4O86 A;  4YR3 A;  1KMI Z;  3I55 V;  4ZOL F;  3NGD A;  1GO3 F;  2PN1 A;  4NKG B;  3UO3 A;  2KSW A;  1VQ9 V;  4EB6 B;  3APQ A;  3CSW A;  3KAJ A;  2R7N A;  4QW9 A;  1S9F A;  4O4J B;  3LWB A;  3TW7 A;  5DLF A;  1M1K W;  2RMK B;  3BA9 A;  3K04 A;  5I5V A;  1TVK A;  2CUG A;  2FMA A;  4X20 A;  4DV6 B;  2QWR B;  1P84 F;  1E1R G;  1FD9 A;  4OX9 B;  3MHH C;  3T4D A;  2GQS A;  3E8G A;  2Y0S A;  1B3Q A;  1QLN A;  1EZV H;  3JZF A;  3ZJZ A;  1N32 H;  4JUZ A;  5H5N A;  1TUB B;  1NTK H;  4PDV A;  3J80 N;  4DR3 O;  2WYO A;  1CKO A;  5KG7 A;  1ZUQ A;  1SA0 A;  4TV9 F;  5KFJ A;  4JTD B;  3SPJ A;  2WLI A;  2R92 G;  1WB8 A;  4ECV A;  5KG5 A;  4CC6 A;  1NS1 A;  1H8E G;  3MD0 A;  4LFB O;  3K0D A;  4Q8F A;  5JVD A;  1E4G T;  2ZJT A;  4GZR B;  2DOS A;  1JMK C;  1GM7 A;  5KUM A;  2EJ7 A;  4EFB A;  5KG4 A;  1OZ0 A;  1R3K C;  3KCX A;  1TWG A;  2QTO A;  4QJF B;  4EEQ A;  3T1Y O;  4DR7 O;  4PA6 A;  3MJF A;  1I6U A;  2FK2 A;  4YB8 B;  2BQU A;  2QWO B;  5DQI A;  1OCO C;  2YID A;  3AK3 A;  2XAJ A;  3GB7 C;  5KUK A;  2D3O W;  3T9F A;  4DUY O;  1GSO A;  3ASN C;  2ZE5 A;  1U97 A;  4CS3 A;  4F4X A;  2OTJ V;  4A3M G;  4JV5 B;  3B8N A;  4OPH A;  5K1P A;  3BPZ A;  4HNA B;  4OPA A;  2J9G A;  4WFH A;  2NU7 B;  5D1O B;  3GID A;  4DL5 A;  4FLX A;  1OBG A;  4WFA V;  5D1P A;  1SYX B;  2EJ0 A;  2ZD9 A;  2Z0A A;  5L1L A;  1PL4 A;  2FKX A;  2P4K A;  3JD3 A;  4FLY A;  3H0G G;  2RCV A;  3HKE A;  1XNQ O;  4ABM A;  4DV3 B;  4GKJ B;  4R8U B;  1D2D A;  4PEL A;  4HAM A;  4O2B A;  4DV7 O;  3G71 V;  3SR2 C;  4ED6 A;  1XIL A;  3HOZ G;  3N42 B;  5A9G A;  1Z2G A;  1AP5 A;  5BWV A;  1CS0 A;  3LQS A;  1RJP A;  1I5X A;  1RK5 A;  3SPH A;  3GTK A;  5B1B C;  3RIZ A;  1T5E A;  3JZ6 A;  3TY8 A;  4G28 B;  4CMF A;  1CQJ B;  5LGU A;  4J9S A;  3GTP A;  5J9P C;  3JAT B;  1VBG A;  2DWE C;  4Q45 A;  1RM1 C;  5LA6 B;  1RYR A;  2UUB B;  2ASJ A;  4EBD A;  2DJV A;  5KFV A;  4WBN A;  5CB4 F;  2EBO A;  2L35 A;  4JI4 O;  4GKK B;  2PI4 A;  4HNU A;  1M0W A;  2DZD A;  3E86 A;  5C4X G;  5KFR A;  1K7D A;  1GMG A;  4YJ2 B;  3LSQ A;  5IYZ B;  1S5J A;  1I1K A;  2COI A;  1R3I C;  4NYK A;  4YY3 B;  2R9R B;  4WF9 V;  1WRV A;  1X59 A;  3MFI A;  4M9U A;  4YP3 A;  1P49 A;  1IBM O;  2VQF O;  4MV1 A;  4BWA A;  4I55 B;  4EG0 A;  4B3T H;  2FLL A;  4UVA A;  1MSW D;  2ZNJ A;  3SE7 A;  5BYA A;  1DV1 A;  3W1B A;  1L2Z A;  5E25 A;  4I0X A;  3K5H A;  3SNO A;  4UB8 Z;  4MTF A;  1GSH A;  4IIJ B;  2B63 A;  5ITZ A;  2WLL A;  5CA0 F;  1GK9 A;  5LMN O;  2VUM G;  2DAB A;  3BAB A;  5KFH A;  3OAA G;  3EXA A;  1H2S B;  1TA8 A;  4L87 A;  1FPO A;  4XYL B;  3S24 A;  2Y4U A;  2PY5 A;  4MVM A;  1Q90 D;  3AG1 C;  4O4L B;  3U10 A;  3TQ1 A;  5JCO C;  3RYI A;  1OWT A;  4KHP B;  5KT6 A;  4UCV A;  2EZO A;  3H1L H;  4RB3 C;  3UQ8 A;  2UUC B;  1P16 A;  1P7G A;  1N56 A;  1JLL B;  4LF4 H;  4UFZ A;  1KJJ A;  1NVP D;  3C90 A;  4DL6 A;  3ZCC A;  1TAE A;  4BW9 A;  1JA8 A;  1A48 A;  2RNB A;  1KQS U;  3K3V A;  2VR1 A;  4O3S A;  4DXW A;  3CYO A;  1IYE A;  4J9L A;  2BTO A;  2YU9 A;  4MTE A;  3LDD A;  1VIB A;  1D5N A;  4GX0 A;  1OCO B;  2X5R A;  3Q8R B;  3VQW A;  4J9O A;  1B6S A;  4NTY A;  2R84 A;  2E5L O;  4IRC A;  1M56 C;  5JJJ B;  4A3F G;  4E4E A;  2QJ1 A;  2V7Q G;  1HNW B;  1WP7 A;  5HNE A;  5JVD F;  5B1N A;  1ZHS A;  2C2D A;  1L0L H;  4NXM B;  1OV9 A;  4BXX G;  3FAV A;  2EZP A;  3RFC A;  5I5U A;  2JJ2 G;  2ZR2 A;  2FKL A;  2ZDI A;  3K5L A;  4ED2 A;  5D5P A;  3ZRX A;  2UXC O;  3OSN A;  3B4S A;  3CJH A;  5I5T A;  3H9V A;  4LCU C;  4IHJ F;  2OIE A;  3SDL A;  2GLT A;  4UUG A;  4CS2 A;  3CME V;  4TV9 B;  4DR5 B;  1GO3 E;  2XGQ A;  2ZR3 A;  3F5W C;  1I2L A;  2KSD A;  4WFF A;  2YS6 A;  1YTF B;  3M9M B;  5LYJ A;  2BE3 A;  2HHH B;  4YQW A;  3MWE A;  3FB6 C;  1BGY H;  2CFM A;  1HNX B;  3QO7 A;  3Q8P B;  5B66 Z;  2YS7 A;  4J9N A;  3RBZ A;  4DV6 H;  1K97 A;  3ZED A;  4YIO A;  5TIS Z;  2N04 A;  4X9Q A;  4OX9 H;  3KKY A;  2P0A A;  1W0K G;  5B1O A;  2NVX A;  5L3F A;  2ADP A;  1S77 D;  2JEI A;  2DYS C;  5DEC A;  1UC8 A;  4MV7 A;  4O2B F;  4PD4 F;  4ECU A;  2EIJ B;  4QGP A;  4PDM A;  1JOY A;  1I08 A;  1M9N A;  3M4I A;  1ENV A;  3FX7 A;  4OXS A;  4NZO A;  2ODM A;  4KFM A;  4GYC B;  4LFC B;  2IBZ H;  2YI8 A;  4FBU A;  2UVR A;  4J10 A;  1AI6 A;  1SS3 A;  3AG7 A;  2KQX A;  2XAH A;  3JAS B;  2Z3Y A;  4IYH A;  2UU9 O;  4CS4 A;  4JI0 O;  4FK5 C;  2R9I A;  4L8J A;  1Y76 B;  4NTW A;  4PV1 B;  3ZHT A;  4QPK A;  3WG7 C;  1NI8 A;  2GSM B;  2OH2 A;  1K3E A;  4QIW F;  4UCU A;  4PDR A;  2LGQ A;  4A3G G;  1IBM H;  2VQF H;  5EDW A;  2YDE A;  5LXT B;  5IYC G;  1R3L C;  2Y69 B;  3ABL B;  1FKA O;  1AI4 A;  3TCU A;  5LOV A;  1M5I A;  2ZIM A;  4YHH B;  4YJ3 A;  4ASU G;  1CE8 A;  2ZDQ A;  3IFX A;  2M6Y A;  3CCQ V;  3STL C;  1W2B U;  1WSC A;  4DL7 A;  3VNN A;  1Q3E A;  5HBR B;  4G2K A;  3O65 A;  4A93 G;  2YXH A;  5CB4 B;  1R9T A;  2ITD C;  4MW3 A;  1PNK A;  4M0J A;  4LF5 O;  4X66 B;  5KT2 A;  3GIJ A;  4DV3 H;  3G6X A;  4AHC A;  2JA8 G;  4GKJ H;  2Q8V A;  2ALZ A;  1SRY A;  3CPW U;  2Q67 A;  1YCI A;  1FVI A;  3AYH B;  2WDT A;  2YIB A;  5L1J A;  2JJ1 G;  5HV6 A;  4A3D G;  1ZWI C;  5FR9 A;  3CRC A;  4XBF A;  1DLB A;  3BY6 A;  4MV9 A;  2AGP A;  1VBH A;  4J7K A;  3IAY A;  1E79 G;  4RU9 A;  1AUX A;  3K0G A;  2JEU A;  3FMA A;  2BSK B;  1B33 N;  1NR1 A;  3OEE G;  3HKB B;  4GKK H;  3C3S A;  2W71 A;  1KKC A;  1N34 O;  5CA0 B;  2J6S A;  3AG3 C;  4IZO A;  1AR1 B;  2RDJ A;  2XND G;  3CCJ V;  2N05 A;  4YY3 H;  4MS2 A;  2AQ4 A;  2HDK A;  4FM9 A;  5A2Q N;  3TET A;  4PA3 A;  5DGB A;  4BWS C;  3BJY A;  3W7U A;  3MAQ A;  1S0N A;  2Z5U A;  2DYR B;  2B1G A;  1NU1 H;  2UVW A;  5BXZ A;  2X6A A;  3OUZ A;  4MV6 A;  1KJ9 A;  1TVK B;  3W7X A;  4YAK B;  4J9R A;  4O2A A;  2F93 B;  4MTO A;  4X20 B;  2IJJ A;  1SQV H;  1IZ3 A;  2DQ3 A;  3SPI A;  5J2T A;  2W8L A;  3G8D A;  4EBC A;  4PA7 A;  5JJE B;  2VQD A;  4FM1 A;  2QKA A;  3DAA A;  3JAK A;  2YRW A;  2Q5Z A;  3QNE A;  2B9Z A;  1Y1V G;  1PK8 A;  1BHB A;  5BWX A;  1EHI A;  2WSS G;  3DTF A;  2DYS B;  2RDI A;  2WLI B;  3JRX A;  2W70 A;  3BQ1 A;  1WPX A;  4NXN O;  4E2L A;  1EUC B;  1EKP A;  3R5F A;  2ILM A;  4AQY B;  4I4T A;  2UUC H;  2W6Z A;  5CE8 A;  5JVD B;  3CXH F;  3CRM A;  4J42 A;  5IDJ A;  4OGQ B;  2PVP A;  3ETJ A;  2YYA A;  2HLD G;  5LMU O;  5BZB A;  1I94 B;  1R1B A;  4MVS A;  3M9O B;  4JYA O;  1O9H A;  2GUZ A;  4IHJ B;  4LR3 A;  4JYY A;  1SF9 A;  5CA3 A;  2Q7D A;  1Q81 W;  3KHH A;  2Z04 A;  2UVU A;  4ICG A;  1KEE A;  1QBZ A;  1WA8 B;  4J9Y B;  3SJQ C;  1M6V A;  4A3B G;  4O82 A;  2Q7E A;  4FFR A;  1XNR B;  3BQ0 A;  1M0T A;  1AI5 A;  2F95 B;  1HNZ O;  4FLZ A;  4O4I A;  4DAA A;  1HNW H;  3RR5 A;  3I5D A;  2LJ2 A;  4RQE A;  2HVQ A;  4UUJ C;  5IT9 W;  3HKE B;  2GDS A;  5JQG A;  2DMX A;  2ATL A;  3QQM A;  2HVS A;  1JCH A;  4GT1 A;  4O2B B;  2R7M A;  3APO A;  1UPG A;  3A0H Z;  1M57 B;  1V55 C;  2DWD C;  3HO8 A;  3NC0 B;  3T5J A;  3T5K A;  2BQ3 A;  4R7R A;  3N40 P;  1OJH A;  5KFY A;  3GIK A;  1KUT A;  4DR5 H;  2BR0 A;  3GIL A;  4FFN A;  3I4M G;  2EIK B;  3EVK A;  3Q8Q B;  2HHH H;  4CZZ A;  5KFN A;  2R92 A;  5F2V O;  4YJ3 F;  3ABK B;  2XCL A;  2X0S A;  5JUM A;  4JYC A;  3ABM C;  4J11 A;  1VQP V;  4TVI A;  3WNZ A;  5GON A;  3LDC A;  1UNN C;  4FJC C;  4UB6 Z;  4IR9 A;  4UCT A;  3I12 A;  1G1X B;  2GHY A;  2FYU H;  1N32 O;  4TUY A;  2QR4 A;  4W4L A;  4JI1 O;  3KG2 A;  4MV3 A;  3J81 W;  1MAB G;  4X65 B;  3BCC H;  4DR4 B;  3T5H A;  3A8T A;  1JJO A;  2FJZ A;  1ZHQ A;  2P6J A;  3PZP A;  1BJT A;  2FE3 A;  1H8H G;  3K3W A;  1R6K A;  3BAC A;  2CTP A;  1AJQ A;  1EBO A;  1RSO A;  1YEW A;  4DRX A;  3RB4 A;  3FYI B;  3BEH A;  4F4L A;  4TQS A;  4I0X B;  1U96 A;  4F6R B;  2UXD B;  3FKS G;  3A2F A;  1DGS A;  3K5O A;  1GLV A;  3ZHS A;  2WLL B;  4QIW E;  2ZE6 A;  2IJH A;  3NXS A;  4JTC B;  5JH7 A;  4C7U A;  4X64 B;  5IYC O;  4A3C G;  3RYC B;  1GN3 A;  2QWP B;  3K5I A;  3FKI G;  3PR5 B;  1PKX A;  2R70 A;  5LBQ A;  2QM7 A;  3RT3 C;  4WFG A;  3RGX A;  3M99 B;  1ZX3 A;  2VQE O;  2YS8 A;  2W9C A;  1I0H A;  1T36 A;  5KFO A;  3IN5 A;  4GC6 A;  3RYI B;  4LF9 B;  4GX5 A;  3K79 A;  2ADQ B;  5LL6 b;  4NR1 A;  2Q7H A;  1CKM A;  3MR2 A;  4O7R A;  3ZIA G;  5IYZ F;  3W1G A;  3H01 A;  3UO2 A;  3ORQ A;  1VF7 A;  4PHZ A;  4O2A F;  1A9X A;  2FK1 A;  1AI7 A;  3GWK C;  3ABU A;  1KP3 A;  3CMA V;  4MVZ A;  3VPC A;  2A79 B;  4D7S A;  2UXX A;  1NH2 D;  4FU0 A;  3RYF B;  2PUS A;  3JD2 A;  1WCM A;  4A3J G;  3HKC A;  3UKM A;  4I9Q A;  4KL1 A;  4J80 A;  3M8A A;  3CD6 V;  5JCO A;  2CGO A;  4DUZ O;  4DK0 A;  4B7E A;  5KG0 A;  2FTK A;  4JPR A;  4MVR A;  5KT5 A;  4J0M A;  1K33 A;  3WWJ A;  4I4T F;  4O7N A;  5KS8 A;  5L3E A;  2IM9 A;  2CK3 G;  3FAV B;  3JD4 A;  1DF5 A;  4F50 A;  1SQX H;  3FDS A;  1K83 A;  1GN4 A;  4Q43 A;  4MVU A;  2P06 A;  2JS5 A;  3Q8S B;  3KXY T;  2FLN A;  4ED0 A;  3K03 A;  1SQG A;  2VUM A;  1QLE B;  1HDJ A;  2P5O A;  1EM1 A;  2W8K A;  1YJ9 V;  2EIM C;  1N36 O;  3MR3 A;  3RYH A;  3RV4 A;  1FAF A;  2W57 A;  4G27 B;  4DV0 B;  1K8A W;  1QR9 A;  3CS5 A;  4DV2 B;  2EIL C;  4LBE C;  2FPG B;  4JI2 B;  2R8H A;  5FL7 G;  1YDX A;  1I7L A;  1RPO A;  3OMN B;  1QVF U;  3W5O A;  5EC2 C;  3LUL A;  3X2Q C;  1VQ4 V;  2O57 A;  1FXK A;  5KFT A;  2UUA B;  3CWB H;  1OCC B;  5CN0 A;  3ABM B;  3OUF A;  3RW0 A;  3RGZ A;  3Q1K A;  3ETH A;  1AJN A;  4B3M B;  5LP6 A;  2YZL A;  1MOF A;  1IVS A;  2LGW A;  5CA1 A;  2XAF A;  2Q4P A;  3T9A A;  2W9B B;  3KZI Z;  5LGT A;  3OUS A;  3T1C A;  1PNL A;  4EYH B;  1BL8 A;  4I50 A;  4AQY H;  3T9E A;  4H37 A;  3JAR B;  3AW8 A;  4LF4 O;  2XUM A;  1E4E A;  3LUT B;  3CX5 F;  2F66 C;  2R93 A;  1YJW V;  1F23 A;  5D8D A;  4JI1 H;  5KFG A;  3T4Z A;  2JA5 G;  1YZB A;  3SYO A;  5EZY F;  4CH5 A;  4LP8 A;  1I94 H;  2ZIN A;  1YIJ V;  1SZT A;  4ZHQ A;  1JR9 A;  4O3R A;  2C22 A;  2XOK G;  2OCC B;  4BY7 G;  3AG2 B;  2I80 A;  4TQD A;  4O4H F;  4TQF A;  1V54 C;  1PD3 A;  1GKF A;  4QWB A;  4HQ6 A;  4BR6 A;  2HGX A;  2NNU A;  1XNR H;  4YJ3 B;  2OTL V;  2Q73 A;  5B1A B;  4NLG A;  3DSQ A;  2XTA A;  2R86 A;  3PW2 A;  5CBG A;  1DIK A;  4X1K A;  3S3W A;  2W6J G;  1SFO A;  2F23 A;  2QSA A;  1Y74 A;  2ZE8 A;  5KFM A;  2ZDH A;  5CR5 A;  3ZRW A;  1M90 W;  4BIO A;  1F4M A;  1E4F T;  3L75 H;  2VQE H;  4O7Y A;  3DXR B;  3IGA C;  4QE9 A;  2P4V A;  3ICX A;  2JA7 G;  4FFK A;  3H4D A;  4I5S A;  4RB0 A;  4UCS A;  5EK0 A;  3KTM A;  2NUA B;  1Q6H A;  4DV6 O;  2V4D A;  1VQN V;  3Q4H A;  1MG1 A;  2OIG A;  2Y4T A;  3SJA C;  1Q43 A;  4OX9 O;  1WJZ A;  2WA4 A;  5LXT F;  1CPY A;  1JIH A;  5KFW A;  3E89 A;  1O9G A;  1IBK B;  1Q7Y W;  5KFP A;  3M9N B;  1RJQ A;  4X65 H;  5L3B A;  2DWC A;  3JAL A;  4DUZ H;  4DR4 H;  3TGU H;  4LF8 B;  4E4T A;  4O7S A;  1KUQ A;  2QGN A;  5H9C A;  4TV8 A;  1BE3 H;  2HJF C;  4HYK A;  5C1O A;  3UCS C;  2I87 A;  2EIM B;  4F6E A;  3U9S A;  4O3P A;  1VP7 A;  4YAJ B;  2ZKO A;  1XHZ A;  4O2A B;  1OCZ C;  4O7W A;  4HNV A;  3KAL A;  2UXD H;  2AGO A;  2WAQ A;  1LNQ A;  3D3Q A;  4X1Y B;  4DIM A;  1KYO F;  1N36 H;  3D36 C;  2J6U A;  4BIU A;  1AB3 A;  5DLG A;  3VQV A;  1QHT A;  3GDE A;  5BPF A;  3JAK B;  4DR6 B;  3CQZ A;  5KFC A;  2H94 A;  1MZF A;  3CCE V;  2AZ2 A;  3NBY B;  2HVR A;  5KT3 A;  2D2C B;  2LP7 A;  5KAI Z;  2KG7 A;  4UVC A;  4I4T B;  2VUG A;  2FML A;  4DV3 O;  4GKJ O;  4FFP A;  4GLX A;  4N23 A;  1BXR A;  3CEB A;  1P7B A;  3ZMS A;  5CAE B;  3SJB C;  3VQX A;  1WN7 A;  2JA6 G;  2VPQ A;  1FJG B;  3N6R A;  1L0N H;  4A3L G;  4PA9 A;  2HVK C;  2GUZ B;  4FLW A;  1QCE A;  3TJT A;  4PZ6 A;  2CNV A;  3KHL A;  3K9S A;  4J41 A;  3WB1 A;  5IWA B;  3HKD A;  4LC1 A;  2IBK A;  2IU3 A;  1FS0 G;  1BSM A;  1WNS A;  1QNM A;  4Y8V B;  1JPX A;  4I50 F;  5DG8 A;  4ECS A;  2JGD A;  3E83 A;  4GKK O;  4XZ3 B;  2ZCE A;  3E5N A;  2Y4R A;  3HKZ A;  1UJW B;  2YW2 A;  2FL4 A;  4ECY A;  2Q9L A;  4BW5 A;  4DR2 H;  4XDL A;  2ZM6 H;  4O7Z A;  1EN6 A;  1XL4 A;  2QKC A;  3OMA B;  1ZL8 B;  3L71 H;  4YY3 O;  3W7W A;  2C00 A;  3RBE A;  3U11 A;  5BMV A;  3N27 A;  1AN7 A;  1S0M A;  4Q6G A;  2YSU B;  1F7Y A;  1PM9 A;  2YCH A;  3ASN B;  4GC7 A;  4F4Z A;  1WP8 A;  2IMW P;  1XK5 A;  4GX1 A;  1OCR C;  4C5B A;  1XMQ B;  4HBN A;  1A32 A;  5EWE A;  4DV2 H;  4N21 A;  4JI2 H;  1FXK C;  3BA8 A;  2FK3 A;  1Z2N X;  1SES A;  5IY5 C;  3PW4 A;  4BAY A;  3P32 A;  5IT9 N;  3EHB B;  5GON B;  5LP6 C;  5F9L A;  5EZY B;  5FLM G;  4JI0 B;  4DV4 B;  3FYE B;  1YTF D;  4DLK A;  2UUA H;  1RFY A;  1SQQ H;  4HN2 A;  5IJ9 A;  3OTO B;  4DRF A;  4IR1 A;  3V4Z A;  3TEK A;  2QF7 A;  4B3M H;  1URF A;  4DR1 B;  4O4H B;  3L2P A;  3TII A;  1QQC A;  3JYC A;  2KB1 A;  2LW1 A;  2WB1 A;  2CH7 A;  2YZM A;  5DGH A;  2Y0P A;  3L70 H;  3OR7 C;  2RF4 A;  3MWM A;  2JEG A;  4KHP O;  5B1B B;  1YIT V;  1Q6I A;  4FS2 A;  2EIY A;  2BTQ B;  1KJI A;  2UXN A;  1ZSP A;  2UUC O;  3P30 A;  1VF5 B;  1BQZ A;  4FFM A;  2R7Z G;  1NTZ H;  1RM1 B;  1YXB A;  1VEW A;  4JI3 B;  3K57 A;  2MCT A;  2A3Q A;  4ZI7 A;  3ABT A;  3JD1 A;  1P8L A;  4FFB A;  1I2K A;  3CP1 A;  4JV0 A;  4XYM B;  1G4Y B;  4F4W A;  3OGI B;  3TQT A;  4JI8 B;  3J81 N;  2O03 A;  3VOU A;  1XMO B;  1XDN A;  1IBL B;  1AR4 A;  4DK1 A;  3UZB A;  1NQT A;  4RUC A;  4EB6 A;  2HGW A;  4RNM A;  4LNU A;  2GV9 A;  3HOW G;  3QF7 A;  2P67 A;  3BVO A;  3SJC C;  1BS3 A;  2E76 B;  4PA4 A;  1ZTE A;  4Q20 A;  4WBN F;  3ZHU A;  3FB8 C;  4IAJ A;  2W9C B;  1HNW O;  4CKC A;  4X8A A;  2Q2T A;  4EEY A;  5CM0 A;  3HOV G;  1KD1 W;  5HFM A;  1S0V A;  5KT7 A;  2ZGI A;  3MWD A;  3PW0 A;  1YJN V;  4JV5 H;  4MVQ A;  1RP3 B;  4EGQ A;  4ZQI A;  3GQC A;  3PVX A;  1BT8 A;  5EBM C;  2RDC A;  1TUB A;  4DR5 O;  2ZXW C;  4UXN A;  5KA5 A;  1YVW A;  1FFT B;  3HXL A;  4O3O A;  3HKC B;  2HHH O;  3AG1 B;  4RB1 A;  1XHX A;  3DC6 A;  1HNX O;  3U0Z A;  4LFA B;  1ZET A;  3G6E V;  4TSF G;  3IG0 A;  2WLH A;  3QFF A;  1IOV A;  1WB7 A;  2AHY A;  1US6 A;  4LWS A;  4RWU A;  4K0K B;  1K4C C;  3N2G A;  4RZR A;  4W4K A;  4ECZ A;  4LH6 A;  2YWV A;  4QJF A;  2Q0A A;  4G3I A;  4U3J B;  4RNO A;  2M05 A;  1IBK H;  2R8J A;  1Z2P X;  2EIN C;  4CC5 A;  5BWT A;  4MW8 A;  2XD4 A;  4X1I B;  4LFC O;  3F7V C;  4LF8 H;  4DL4 A;  1ET0 A;  2UUB H;  4P30 A;  5EIB D;  1VAJ A;  4P9P A;  4E6N A;  2UXB B;  3VPD A;  3RYH B;  3FKI A;  5H6R A;  1CEZ A;  5LHH A;  3VOT A;  1I50 A;  5D1O A;  1M56 B;  4FMT A;  4FPP A;  3GV5 B;  3ORR A;  2JEJ A;  4JAV A;  5KFQ A;  1XEQ A;  4LF6 B;  2B63 G;  1VQ5 V;  2YL2 A;  4R8U A;  5KX5 A;  1M93 A;  2A9H A;  2F43 G;  2AZ0 A;  4PBC A;  3K5M A;  4QWE A;  2Q2U A;  2ZQM A;  2YZN A;  3RN4 A;  3T9D A;  4R50 A;  2R8I A;  2AHZ A;  1NBM G;  4I7H A;  4R6Z A;  2W0F C;  4AYB A;  2WLM A;  5BMV F;  4JI5 B;  4DR6 H;  1Y1W G;  3UM7 A;  4YHH O;  5KFS A;  4J9P A;  2F4V B;  1BMF G;  5IP7 G;  2R72 A;  2ZT9 B;  3T99 A;  2VA2 A;  4R8C A;  3OE7 G;  4AI8 A;  1Z5W A;  4DV1 B;  5BWR A;  3IJ4 A;  2YEV A;  4MA5 A;  4I50 B;  3T1H B;  4ECX A;  2R85 A;  1YI2 V;  1E4E B;  1T94 A;  3OT7 A;  4NB5 A;  1VQK V;  4H0L B;  5FPO A;  5I5X A;  1FFX A;  3L72 H;  1N0J A;  3T5L A;  3AG4 C;  1COW G;  4XDJ A;  1SA0 B;  3WWH A;  1FJG H;  2C2E A;  3CXC U;  2QE7 G;  2W6I G;  3ASO C;  3RF2 A;  2K9P A;  4KHP H;  1IYD A;  5LYJ F;  1HR0 B;  4B3R B;  1B6R A;  4YBZ B;  2OCH A;  2LW7 A;  2RQ6 A;  3HB3 B;  1Q86 W;  5IWA H;  1XL6 A;  2WLK A;  4DV5 B;  1Q6U A;  5DM6 V;  4IRK A;  4O7V A;  2DE0 X;  3PJS K;  1JFF A;  2C2A A;  4X62 B;  1SKV A;  4R7C A;  3A0B Z;  1FXV A;  1VMG A;  5IYD O;  3E22 A;  4J9M A;  4QE7 A;  2Y0S E;  3H1K H;  1NTM H;  4X1K B;  2P22 C;  2XAG A;  5C3E G;  4I7Z B;  1EKV A;  2NLJ C;  3QO5 A;  3OFN G;  3WG7 B;  4IWX A;  4JAS A;  1Y4M A;  5BR8 B;  2PYJ A;  3GV7 B;  2Y48 A;  3ZRW B;  1N32 B;  4JI6 B;  2DPI A;  3O9O A;  3DF7 A;  1HW7 A;  3PR4 A;  2R9A A;  1BHA A;  3OSP A;  2WE6 A;  3GLK A;  4ECW A;  2E2H A;  5EBW C; 
#chains in the Genus database with same CATH homology
 1S5J A;  3ETQ A;  4NXM H;  4JI4 H;  2P5O A;  1XMQ H;  4YY3 B;  3NBZ B;  3RYH A;  1N34 B;  2W57 A;  3BHP A;  4DV0 B;  5J2U A;  5KHI A;  1P49 A;  5FLX W;  4DV2 B;  4BWA A;  4I55 B;  4JI2 B;  4LF7 B;  4B3T H;  4DV4 H;  2ZNJ A;  4K8X A;  3W5O A;  3W1B A;  3RWR D;  1L2Z A;  2UUA B;  4DR1 H;  4ZOL A;  3JAM W;  3RGZ A;  4B3M B;  5LP6 A;  4IIJ B;  2CW8 A;  5ITZ A;  1HNX H;  5FPR A;  3BAB A;  2Q7G A;  5CA1 A;  4B3S B;  4WBN B;  3JSL A;  4CH6 A;  2F1M A;  1H2S B;  1TA8 A;  3S24 A;  5LMN H;  2PY5 A;  2VWJ A;  4I50 A;  4AQY H;  4JI3 H;  3JAR B;  1BGW A;  4O4L B;  3U10 A;  5JCO C;  5KHG A;  3RYI A;  1V9P A;  4KHP B;  4HNA A;  1SEI A;  4UCV A;  5KMG A;  2F66 C;  3N2K B;  3N41 B;  4RB3 C;  4JI1 H;  4LFC H;  3UQ8 A;  2UUC B;  4RAZ A;  4JI8 H;  1P16 A;  4LF4 H;  4UFZ A;  4CH5 A;  1I94 H;  2ZIN A;  4NXN B;  4ZHQ A;  1TAE A;  4TV9 A;  3LML A;  4BW9 A;  3OTF A;  4TQD A;  4TQF A;  1D5A A;  2CAZ C;  3K3V A;  5LMU B;  4LH7 A;  4PDB A;  2OWO A;  5LP6 B;  1X9N A;  1N33 B;  5ITZ B;  1XNR H;  2BTO A;  4YJ3 B;  4AIL C;  3CB2 A;  4JYA B;  3H20 A;  3WB2 A;  4MTE A;  3RTX A;  3DSQ A;  5CA1 B;  3VQW A;  4LSX A;  1CKN B;  5JJJ B;  4X1K A;  2ZNI A;  2QJ1 A;  4YHH H;  5DIS C;  3JAT A;  1HNW B;  3L4K A;  2HGS A;  1ZHS A;  5LA6 A;  4NXM B;  2E5L H;  1Q8I A;  3FFQ A;  3UT5 A;  1HNZ B;  3K5L A;  1J5E B;  5D5P A;  3WB0 A;  1E4F T;  2VQE H;  4RB2 C;  4YJ2 A;  5IYZ A;  4X66 H;  3ICX A;  4CS2 A;  4ZHQ B;  4B3T B;  4LFA H;  3GJX B;  4TV9 B;  4DR5 B;  3C0F B;  2UXC H;  3PN1 A;  4RB0 A;  4UCS A;  4JI7 B;  5FD5 A;  4B08 A;  5LYJ A;  4X1Y A;  2HHH B;  2V4D A;  4I55 A;  3K5N A;  2PZS A;  3SJA C;  1Q43 A;  2CFM A;  1HNX B;  4LMY A;  3J7A K;  4DV6 H;  1O9G A;  3M7M X;  3ZED A;  1I7F A;  1IBK B;  1L8D A;  5BMV B;  5JJN B;  4OX9 H;  4X65 H;  4DR4 H;  3JAL A;  4IIJ A;  4MV7 A;  4DUZ H;  4LSA A;  4LF8 B;  2PYL A;  3M4I A;  4RAY A;  4A2A A;  4TV8 A;  3SGI A;  1A0I A;  4GYC B;  4LFC B;  4JI1 B;  2YI8 A;  5CB4 A;  4EQ5 A;  3KAK A;  4CH4 A;  3N6X A;  4PZ8 A;  4LF6 H;  4O4L A;  3JAS B;  4DR3 B;  2YIA A;  2HEP A;  5K1X A;  1XHZ A;  4O2A B;  4CS4 A;  3N2K A;  5IJ9 B;  3KAL A;  1X4T A;  2UXD H;  4L8J A;  5LYJ B;  4X1Y B;  1GYF A;  2VWK A;  2UU9 H;  1N36 H;  1ZAU A;  4LFB B;  3VQV A;  5FD6 A;  4JI0 H;  2F4V H;  1QHT A;  5EYP B;  3GDE A;  4UCU A;  3JAK B;  4DR6 B;  1XI1 A;  5D5Q A;  4PZ7 A;  3OTO H;  1IBM H;  2VQF H;  4DV1 H;  5LXT B;  3QWU A;  3NBY B;  2HVR A;  3T1H H;  5LOV A;  4ZIB A;  3CSX A;  1M5I A;  2PTM A;  2ZIM A;  3HKB A;  3JAL B;  3K59 A;  4YHH B;  4YJ3 A;  3T1Y B;  4Q0Y A;  4DR7 B;  4I4T B;  2VUG A;  4ZI7 B;  1FKA H;  4PI2 A;  5CA0 A;  4M7E A;  3VNN A;  4GLX A;  4TV8 B;  1Q3E A;  4DUY B;  1CKN A;  3SJB C;  2QM4 A;  3VQX A;  5CB4 B;  2VQE B;  1WN7 A;  1FJG B;  4DV3 H;  4X66 B;  4GKJ H;  1HR0 H;  4AHC A;  4B3R H;  4CH3 A;  2HIV A;  4FLW A;  4PZ6 A;  1FVI A;  4LNU B;  4DV5 H;  2WDT A;  3ZS8 C;  2YIB A;  3RJ0 A;  4LF5 H;  4X62 H;  3WB1 A;  5IWA B;  3HKD A;  3N43 B;  1XNQ B;  1XMO H;  3QTC A;  5EZY A;  1IBL H;  1NT2 B;  1WNS A;  4FLV A;  4MV9 A;  4DV7 B;  3TY5 A;  1B04 A;  2ZCE A;  4TOI A;  3IAY A;  4O4H A;  5BR8 H;  3FMA A;  2JVD A;  5LOV B;  4FM0 A;  4DR2 H;  2ZM6 H;  4DUZ B;  3HKB B;  4GKK H;  4PI0 A;  1O75 A;  4JI6 H;  2BTQ A;  5CA0 B;  3U11 A;  5BMV A;  1AN7 A;  4Q6G A;  1Q5O A;  3JAW B;  3EYY A;  2YCH A;  4YY3 H;  2YI9 A;  1N34 H;  1XK5 A;  4FM9 A;  4JI4 B;  1WPB A;  1XMQ B;  4HBN A;  2XIG A;  4BWS C;  2YIB D;  4DV2 H;  3MAQ A;  3QG5 A;  4JI2 H;  2VOB A;  3BA8 A;  4LF7 H;  4APM A;  1Z2N X;  3TY9 A;  3N2G B;  3HKD B;  5GON B;  5LP6 C;  5IJ0 B;  1N36 B;  3JAS A;  5EZY B;  4JI0 B;  4IHJ A;  4DV4 B;  2UUA H;  1TVK B;  3BRC A;  1Z2O X;  4O2A A;  2F93 B;  5IJ9 A;  4X20 B;  3OTO B;  4DRF A;  1IBM B;  4K0K H;  2VQF B;  4B3M H;  5J2T A;  4DR1 B;  3LNN A;  2CW7 A;  4O4H B;  4RZQ A;  3L2P A;  1M4U A;  1QQC A;  5JJE B;  3MWM A;  4B3S H;  4FM1 A;  4A2B A;  1KU9 A;  5EYP A;  4UCR A;  1VS0 A;  3JAK A;  3K58 A;  2BTQ B;  5LXT A;  1Z5V A;  3JSN A;  4FLT A;  5LMN B;  2UXB H;  1S03 G;  4AQY B;  4JI3 B;  4I4T A;  3K57 A;  2MCT A;  4ZI7 A;  2UUC H;  5KX5 B;  1P8L A;  5JVD B;  2EX3 A;  4FFB A;  4NXN H;  4JI8 B;  4LF4 B;  2O03 A;  1I94 B;  5FNV B;  1XMO B;  1XDN A;  1IBL B;  4DK1 A;  2VPS A;  1O9H A;  4IHJ B;  4LR3 A;  2PGG A;  4EB6 A;  5KHH A;  5C8Y B;  4LNU A;  2GV9 A;  5LMU H;  3QF7 A;  4FVM A;  3SJC C;  1N33 H;  5J2T B;  4JI5 H;  4JYA H;  4IAJ A;  4DR2 B;  4U3J A;  2ZM6 B;  3CVZ A;  2Q2T A;  2Q7E A;  4X64 H;  5A2Q W;  1XNR B;  4K8Z A;  1M0T A;  4ETS A;  4X1I A;  1FFX B;  2F95 B;  4FLZ A;  4O4I A;  1HNW H;  4JV5 H;  3RR5 A;  1WH2 A;  2HVQ A;  5IT9 W;  3HKE B;  3KYH C;  5JQG A;  4LF9 H;  1HNZ H;  2E3C A;  1TUB A;  1J5E H;  2HVS A;  1S68 A;  4O2B B;  1MZB A;  2XHB A;  2E5L B;  4FFB B;  3JAW A;  3NC0 B;  3HXL A;  3HKC B;  4FLU A;  4R7R A;  3N40 P;  4DR5 H;  5EOY A;  1JFF B;  4RB1 A;  3B2E E;  1XHX A;  1KMI Z;  4JI7 H;  3U0Z A;  4LFA B;  3IG0 A;  2KSW A;  2HHH H;  3E22 B;  2UXC B;  4EB6 B;  3KAJ A;  4F6R A;  4O4J B;  4K0K B;  3L4J A;  3N2G A;  4LH6 A;  5IJ0 A;  2Q0A A;  3BA9 A;  5GON A;  4U3J B;  1IBK H;  4UCT A;  1Z2P X;  1TVK A;  4UCO A;  3RYC A;  4NVP A;  4CC5 A;  4X20 A;  4X1I B;  4DV6 B;  4TUY A;  2KKW A;  4O4I B;  4LF8 H;  4OX9 B;  3J81 W;  4EFE A;  2UUB H;  5EIB D;  4X65 B;  4DR4 B;  4E6N A;  2UXB B;  5JQG B;  1N32 H;  3RYH B;  1TUB B;  2WYO A;  1CKO A;  1JJO A;  5J2U B;  5D1O A;  1ZHQ A;  1BJT A;  2FE3 A;  1SA0 A;  5IYZ B;  5KHK A;  4MTD A;  4DR3 H;  1RSO A;  1YEW A;  4CC6 A;  4LF6 B;  4DRX A;  5KX5 A;  4DV0 H;  1M93 A;  2OYQ A;  3RYF A;  3K5M A;  5JVD A;  2HIX A;  1E4G T;  3THO A;  2Q2U A;  2ZJT A;  4ZOL B;  4FM2 A;  4F6R B;  1JMK C;  2UXD B;  3A2F A;  1DGS A;  4I7H A;  4LFB H;  3K5O A;  4EFB A;  3GB8 B;  4JI5 B;  4DR6 H;  5FNV A;  4EEQ A;  2UU9 B;  5EIB C;  1I6U A;  5JH7 A;  2F4V B;  4X64 B;  5C8Y A;  2R72 A;  3RYC B;  2RGR A;  3BAA A;  2R70 A;  1Z5W A;  4TUY B;  4DV1 B;  3RGX A;  4CS3 A;  4I50 B;  1XQ8 A;  4JV5 B;  3T1Y H;  4DR7 H;  3T1H B;  2ZIO A;  3RGB A;  5K1P A;  3BPZ A;  3F8N A;  3RYI B;  4LF9 B;  4HNA B;  3CHX A;  2YXL A;  5LL6 b;  5FPO A;  2Q7H A;  5KMG B;  4DUY H;  1CKM A;  1FFX A;  5D1O B;  3W1G A;  4FLX A;  5KHJ A;  1VF7 A;  5D1P A;  1SYX B;  4PHZ A;  1SA0 B;  3N44 B;  1FJG H;  4FLY A;  3RF2 A;  3HKE A;  4KHP H;  4D7S A;  3VQY A;  4DV3 B;  4GKJ B;  4DRX B;  1HR0 B;  4B3R B;  4O2B A;  1G6U A;  3RYF B;  3SR2 C;  2PUS A;  3RFR A;  2RQ6 A;  5IWA H;  3HKC A;  4DV5 B;  1XNQ H;  4I9Q A;  4KL1 A;  2JGU A;  4D7T A;  1JFF A;  4LF5 B;  3N42 B;  4X62 B;  1SKV A;  4DV7 H;  5JCO A;  4DK0 A;  5JH7 B;  3J80 W;  3RIZ A;  3E22 A;  1T5E A;  4J0M A;  3TY8 A;  4O4J A;  4X1K B;  2P22 C;  2RJZ A;  3JAT B;  2IM9 A;  5BR8 B;  5LA6 B;  2UUB B;  2PYJ A;  1SQF A;  4WBN A;  1N32 B;  3UT5 B;  4GKK B;  2RGV A;  4JI6 B;  1M0W A;  3DF7 A;  1HW7 A;  2JS5 A;  2R9A A;  3KXY T;  2WE6 A;  1SQG A;  4YJ2 B;  3JAR A;  1TGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...