3JSLA

Crystal structure of the adenylation domain of nad+-dependent dna ligase from staphylococcus aureus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA ligase
publication title Structure of the adenylation domain of NAD(+)-dependent DNA ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 107
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jslA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3jslA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jslA02
4DV3B 4DV5B 4TOIA 1S68A 4DV1B 1N36B 4CC5A 2UUCB 4LF8B 4EFBA 5LMNB 2UUBB 4YHHB 1FVIA 4JYAB 1XDNA 4DUZB 2CFMA 3RTXA 4JI7B 4LF9B 1V9PA 1J5EB 1TA8A 3NBYB 3TY8A 4LF4B 1HNXB 5IWAB 3L2PA 4UCTA 2HIXA 1IBMB 2HVRA 4DV0B 4DR1B 2HIVA 3BAAA 4DUYB 3W1BA 3W1GA 4GKJB 1N34B 1XNQB 1N33B 4JI2B 4X64B 5FPRA 3GDEA 4K0KB 4PZ8A 1XNRB 1B04A 2VQFB 3TY9A 4DR6B 4UFZA 2UUAB 4JI8B 2UXBB 2OWOA 1CKMA 3GJXB 1I94B 4LH7A 4DR2B 5FPOA 1XMQB 1HNWB 4DR5B 4KHPB 3NC0B 1XMOB 4X62B 5D1OA 4UCVA 3VNNA 2HHHB 3S24A 4DR4B 3JSNA 1TAEA 2VQEB 4AQYB 1VS0A 4LFAB 1A0IA 1P16A 4NXNB 4JV5B 1CKOA 3KYHC 4UCSA 5BR8B 4CC6A 4YY3B 3TY5A 1IBLB 4DV6B 1HR0B 3UQ8A 4DV7B 4B3RB 2Q2TA 3JSLA 4EEQA 4DR7B 4PZ6A 3SGIA 3T1YB 4JI3B 2ZM6B 4JI0B 3GB8B 3W5OA 3T1HB 4DV4B 1DGSA 1P8LA 4LFBB 4B3TB 1ZAUA 2F4VB 1FJGB 4LF7B 4E6NA 4JI5B 5LMUB 4NXMB 2HVSA 2UXCB 3NBZB 4GLXA 4B3MB 4UCRA 4GKKB 4PZ7A 4EFEA 2UXDB 4DV2B 5D1OB 1N32B 2HVQA 1HNZB 4DRFA 4JI6B 1IBKB 1CKNA 4B3SB 3BA8A 3BA9A 4OX9B 2E5LB 3QWUA 4UCOA 4JI4B 1XK5A 4LFCB 1CKNB 4EQ5A 4X66B 4JI1B 2UU9B 5D1PA 4DR3B 4LF6B 3BABA 4X65B 3PN1A 3OTOB 1X9NA 2Q2UA 2VUGA 4LF5B 4LH6A 5DISC 4UCUA 3RR5A
chains in the Genus database with same CATH superfamily
1HR0H 5LL6b 4B3RH 1M7JA 3F7VC 3P32A 4DAAA 1J95A 3E8GA 4YHHB 3AG3C 3UFXB 1BMFG 4X20A 3T4DA 4QE9A 4O4JF 4FZ0A 1NR7A 4NXNO 2WLIB 1B6QA 1OCCC 4K8XA 4ECYA 1MSWD 1OV9A 1ROPA 3JD0A 4UCTA 5TISZ 3R5FA 4L1KA 5KS8A 5KT4A 2HVRA 4Z1VA 2QR4A 1K92A 4DRXA 1FPOA 3BFRA 5CMUA 4GKJB 4H33A 5BYAA 3QF7A 3W7TA 4ECWA 2EJ7A 1W96A 5B66Z 3DTFA 1QVFU 2R7NA 3T1YH 1I5XA 3TK1A 1TWGA 4JI3H 1SCUB 3QVNA 1BNCA 2W7OA 4EEYA 4JTCB 4ZOLB 2QKAA 4EYIB 2R7ZG 1ZL8B 1ET0A 5LP6C 2BOCC 4DR2B 3ETHA 4FMTA 4O82A 1AB3A 4QWAA 2JS5A 1HNZO 2E3CA 2R92A 2Q0AA 4UUGA 2CTPA 1M56B 2KSWA 1YSCA 1JOYA 2JEIA 2FKXA 1CKOA 3M4IA 1VQOV 2QDOA 2CH7A 4O4IF 2VUMA 2KKWA 1JPXA 4DV6B 4TVIA 3GV8B 1WLEA 4ED8A 4B3TO 4QWBA 5EWGA 1QHTA 3AG3B 1ZQ7A 2WA3A 2UU9H 2WB1E 4GX0A 1JJOA 1PKXA 5DGAA 4A3DG 4U3JB 1R6KA 3CCVV 1OCCB 2UUCO 3VMMA 2Q6AA 4IHJA 1BHBA 2WLNA 3JYCA 5LOVF 2PZSA 2F43G 1ZLZA 1WPBA 5FD5A 4PDRA 4UCRA 1R9TA 2A3QA 3ETDA 5GONB 3JCZA 2SCUB 3T99A 1V54B 3PW2A 3BACA 1J5EH 2JA7A 4R6ZA 2F66C 3OGIB 1K8AW 1XMQH 4LCUC 4JASA 3RN4A 2BQUA 3V6JA 4PV1B 1A48A 1Q81W 1GAXA 1F23A 4AHCA 2HLDG 4WFGA 1GO3E 1IYDA 3TGUH 5K3WA 4APMA 5KG0A 5IP7G 4LFCB 5LP6B 4TWKA 4L87A 5DMXA 5DQHA 3L4KA 4K0KH 1FFXA 2CTWA 2VQFH 2QA4V 4J7ZA 5EBMC 5EZYF 2RCVA 3PR5B 2CE4A 1OZ0A 3BG5A 1M93A 2B5UA 1WA8B 3R66A 4X9QA 4YR3A 1M0WA 1V9PA 1DF4A 2AU0A 5H6RA 1BXRA 4DYLA 2EIYA 4RCNA 2YZGA 1Z2PX 2HDKA 1HNXB 2JA5G 3K3PA 1V55B 1B33N 5BR8O 1VEWA 2HVJC 4JYBA 5GTIZ 1KBLA 3EXAA 3BAAA 4YJ3B 2WAQE 3KXYT 3G6YA 3FB5C 4EGQA 5DM6V 4DV7O 2FPIB 1IBLH 1QR9A 2AGAA 3GIDA 4XYMB 4YQWA 2I8CA 2R93G 2Q7HA 4O4JB 1XHZA 1XNRB 2ZE6A 1K97A 4LWSB 2X6BA 3N40P 1OWTA 1DTOA 1EZJA 1KYOF 3K5HA 5KT5A 4LF7H 1IDSA 2UXCH 2V58A 3H1KH 5DGBA 3ZBHA 4B08A 5D1OA 3OEEG 3S24A 4JUZA 3V6KA 4BIZA 5JWPA 1VS0A 1AI4A 4O3PA 3O9OA 4JZ2A 4A3BG 2BTQB 3K5LA 1K1QA 2JDIG 2OIEA 1R6NA 1HR0B 1AVMA 4FFBB 1AR4A 4B3RB 2ASLA 5E25A 1IBMH 2ABJA 1K7DA 3OM3B 5GTHZ 2R6FA 4P9OA 3M9NB 1RYSA 1VQ9V 1TWAA 2J6TA 3EPGA 5EWEA 3GV7B 4O4IB 5BPFA 4GLXA 4J9QA 2WB1A 5CBFA 3A2FA 4ZHQF 1YEWA 4MTGA 3OGCC 5LXTF 4JYAH 4YJ2F 4DV2B 3U9SA 4JI7H 5C3EG 1N32B 3ZMVA 4JI6B 4I50F 1QLEC 2J6UA 1GN2A 2B63G 3AEIA 5L1IA 2BCCH 5LOVB 5IYZF 2COIA 1XHXA 3FAVA 3LSSA 4DR1H 4IHJF 1FXVA 4BY7G 1FKAH 1NTMH 4TT3G 4DV5O 1JDEA 3BY6A 2ZDHA 4F6EA 1AR1B 4DV1O 4JI2H 3ML0A 3T54A 1KJIA 4DL3A 2FL4A 3JARA 2NU8B 1Y1VA 3SPJA 1PNMA 2O57A 1RSOA 1VF7A 5B1NA 1YJNV 1N36B 2IP4A 2R7LA 2RDIA 4WFFA 2VRZA 1Q6UA 2EBOA 3TIIA 1SQVH 2W57A 2HHFB 1O9HA 3K0GA 2DWEC 3VOUA 4GX5A 2GQRA 5DGIA 3OUZA 3C3SA 1SQGA 1JXLA 1K3EA 3J7AU 5E79Z 3RVZA 3IGAC 4NR1A 3FDSA 4ECVA 4FBUA 5EZYB 2ZNIA 2Y4UA 2HIVA 4CKBA 1YDXA 1QNMA 3W1BA 5KFAA 5IYBG 3UO2A 4YY3H 2W6PA 1BGYH 2CTQA 2VS0A 2EJ3A 5IT9N 1M5IA 4F4LA 3WB2A 4FLWA 3ETEA 1US6A 2Q0OC 2ADQB 5FPRA 3GDEA 5HBRB 1TVKA 4FBTA 4DR7H 4WF9V 3TY9A 4JI0H 2F23A 4HNTA 2HVKC 3RGBA 1XMOO 1QLEB 5JQGF 4EBEA 3BRCA 3ABUA 3MWEA 3T7AA 2Q68A 1XMQB 1N4CA 1X59A 4IGGA 2YRWA 2EIMC 5KHIA 4QW8A 2E2HA 3NC0B 5KT7A 4E2LA 2X6AA 5FR9A 4CH6A 3HT5A 2CKZB 1R3IC 5KFQA 4RUAA 3LUTB 4O3OA 3NUAA 1BT8A 4ECRA 3WG7B 5BPHA 2BR0A 5JCOA 4O7LA 1E79G 5AG2A 1GSHA 4TUYA 4FFKA 1XBLA 3ZCCA 3L73H 1C3OA 1GLVA 2JEXA 1W59A 1EM1A 4K6NA 4WFHA 5IJ9A 1URFA 3W5OA 3CCEV 2BSKB 4X65H 1GSAA 3HBLA 2RGRA 1MZBA 3UCSC 4ED3A 2EJ0A 2RDCA 4NTXA 4CZZA 5KAIZ 4LSXA 4RNMA 2UUAH 1VAJA 1J5EO 2YSUB 4TM5A 3MWDA 3STZC 2PI5A 3A0RA 3RGXA 4YP3A 2EIJC 4M7EA 1YF2A 3SPGA 3U0GA 1I94H 2AXTZ 4RQFA 2R9AA 1CKNA 5IDJA 3OTOO 2W70A 3K04A 5KMGA 3VQYA 4NLGA 1N34O 4QWEA 4ZHQB 4A3LG 5LXTB 1S0VA 4YJ2B 3L9DA 2PF4E 2EIMB 4X1KB 2VQFO 4I50B 5KFIA 3MR5A 2CNUA 4MTEA 4FPPA 5IYZB 3ZRWB 3I5DA 5ITZA 3ZEDA 3WU2Z 2YS8A 1Y14B 3L4JA 4IHJB 3HKDA 4A3FG 4Q44A 4BW5A 2CNQA 3GTQA 2WLIA 2IU3A 2LO1A 3ZN1A 5KKNB 1H8HG 3WWHA 3U55A 3CCRV 2WDTA 4KHPH 2HHHH 2HGSA 5LA6F 4EBCA 2W0XA 3TW6A 2W6OA 4IZOA 3JALB 1M4UA 4QW9A 1IBMB 2HJWA 5JVDF 3N41B 3H3VH 2NLJC 3FKSG 5EWFA 3MR6A 2QF7A 2XNDG 3W1GA 3CCUV 1W2BU 3DF7A 1COWG 1KECA 2UXBO 4R7CA 2GBOA 3IJ4A 4ZOLA 3DAAA 4MTDA 2QE7G 2ASJA 3WWJA 3AG4B 1ZL8A 1I3QA 5L1KA 1O75A 5A9GA 2F4VO 5HV6A 3T1HH 2QWQB 3M8AA 4X62O 4U6PA 5C4XG 5CA1F 3OHAA 4AQYO 2P06A 4DL7A 2BE3A 3RGZA 4Q8EA 4PA7A 3U11A 4U7NA 2ADPA 1GGOA 2MK3A 4FS1A 1EZVH 3GIMA 5D8DA 1FXHA 4EG0A 3FB6C 4AYBA 3SJQC 4LBEC 5JQGB 3LQSA 4XDJA 2DQ0A 5E1AC 2E5LO 5J2UF 4DV4O 3BQ1A 5KFYA 1BJTA 4N23A 4U3JA 2PMZE 2P4KA 3HOXG 3H1JH 4JYCA 5LMUO 4PZ6A 4X66H 4I4TF 2FTKA 3CP1A 4IIJF 3G8DA 4Q45A 5C5JA 1R3JC 4LF6H 2WLJA 4FFRA 4QE7A 5GONA 5BYBA 2XT9A 2JJ2G 2WE6A 3F8NA 4RAZA 1PL4A 3AW8A 1F51A 2KQXA 1RPRA 1RYRA 4JYAO 1EN6A 3OT7A 4B3MB 2EJRA 4DUZO 4GKKB 2R7KA 1ZSPA 4RZRA 2BQRA 4HN2A 3RFRA 2COGA 4YHHH 2R9RB 5EBWC 2I87A 5D1OB 2A1HA 4DRFA 3JD4A 2V7QG 4NTYA 5LP6A 3JZ6A 4DR1O 3EVKA 1A0GA 2XD4A 4K8ZA 3V6HA 4F50A 4UV9A 1AROP 3K9AA 2X0SA 2YS7A 1FYJA 1I50A 4EQ5A 4GKJH 5BXZA 2W6JG 1SFOA 3ASOC 1Q6HA 3SYAA 2YW2A 3ZMUA 4FM9A 1AILA 3CCSV 1I7LA 3DC6A 3SNOA 2ARHA 2QGNA 2Q73A 1WA8A 5CBHA 3MDSA 1BHAA 5KFNA 3Q8SB 4CC5A 4LF4O 4BIUA 2C00A 5KFXA 4DR5O 4DR2H 3H0GA 3O65A 1NVPD 3MR3A 4RNOA 5C8YF 2AGPA 2ZE8A 4LFAO 1O9GA 4FLXA 5I5YA 2L35A 1RPOA 4YY3O 3RB6A 3KALA 2KG7B 4O4JA 1WRVA 1TWHA 4LWSA 5B1AC 4J9PA 4LNUA 4DV6H 1RJRA 5DQIA 4O7RA 4QPJA 4JI0O 3IC9A 3E2EA 5LA6B 3RYIB 3GTOA 1XILA 1CQJB 1IXBA 2UUAB 1SRYA 2JRIA 3K59A 5BWTA 3E8BA 5JVDB 3ETGA 4DR4O 1OHHG 1RSOB 2DWDC 1I94B 4LH7A 4LF5H 3L75H 3DXRA 5IE9A 2BTQA 3SPIA 3ASOB 1TAEA 2VQEB 4HNAB 5KFSA 4UXNA 4H44B 1Z2OX 3TINA 4MV3A 4FFBA 5CA1B 3SYQA 3ZIAG 2P67A 3BQ2A 4ZKIA 2R8GA 2DPJA 4CC6A 1U97A 2QEXV 2EILC 4C5AA 2AZ0A 3RB3A 1YVWA 1FJGO 1I0HA 4X65O 4O3RA 4O4IA 2ZM6B 4GYCB 4NZOA 4R50A 5B5EZ 3M9MB 1E1QG 1I1KA 1NU1H 2PMZA 1L0LH 1AJNA 5J2UB 4RNNA 2IH3C 1UPGA 4MTFA 5LOVA 4A5UB 4I4TB 5DLFA 4F4YA 4IIJB 1SZTA 4QJFB 4XBFA 5IY5C 1CE8A 3MAQA 1A32A 1G4YB 3HKEB 4TSFG 5BZBA 3KKYA 1Y76B 1HNXH 3E22B 3N6RA 3A0HZ 3ZHUA 2Z3YA 4OX9B 5J2TF 4DK0A 2MW2B 1WCMG 3F5WC 3HR0A 4DV3O 4JI1B 1GYFA 5EBLC 1GH6A 2CTRA 3T2MA 3H01A 4DR6O 3APQA 2P4VA 2WPDG 2A79B 2YC0A 3ZHQA 2HHFA 1FFTB 4DW1A 5KHGA 1Z5WA 4LC1A 3CRCA 1JFFB 2J9GA 2Y0SE 3RJ0A 2QB5A 5LMNB 2UUBB 2DYSB 1N0JA 4O4HF 4KHPO 4M0JA 1KEEA 3SYOA 3CRMA 4RO2A 3G67A 5EZYA 1NVPB 2DAAA 3JD1A 1S77D 4BW9A 3NBYB 3GTMA 1AR5A 4MS2A 4X89A 3LNMB 4F6RB 3K3VA 1XNQO 1M57B 4JAAA 1IVSA 3EHBB 5FL7G 4X1IB 3G6EV 4HZ3A 4BWAA 4ICGA 5DG7A 4IT5A 2Q7EA 5BY1A 1Z2GA 4O3SA 2ZKOA 4GCZA 3K06A 5C8YB 4CKCA 3CCMV 4XDKA 2IJIA 2NN4A 2V9WA 1LNQA 5IY5B 1HNWO 5T14A 2E74B 2ITDC 5KAFZ 2Y4TA 5ITZB 3HKDB 3UZOA 1EN4A 4JV2A 1YTFD 3U10A 3OD4A 4W4KA 2ZD9A 5I5SA 3CRAA 5LGNA 4DV2H 3JSNA 4P9PA 1XUQA 1T36A 1Y4MA 1A0IA 3JD3A 2Z04A 2JJ1G 4FM2A 4DLKA 1N32H 4JI6H 1V54C 1EZ1A 3CXHF 2OTLV 3KYHC 4GT1A 2BSKA 3T1CA 3Q8QB 2FP4B 1LUWA 1OCZC 4KXRA 4TV9A 3STLC 4GX2A 5KHKA 2AHYA 4DL6A 1K83A 1XREA 2Y4RA 4PDMA 3U0ZA 1KP2A 3PW4A 5IP9G 4B3TB 4CHIA 3N2KB 3TCUA 1XEQA 3OMIB 4NXMB 4ED1A 4HYOA 1N36H 5J9PC 4EFEA 1G1XB 3SDLA 5JUMA 2IM9A 2R92G 1THZA 3CEIA 1WH2A 4A2BA 4ECTA 2UVRA 5KG5A 2R7ZA 1MZEA 4ZHQA 4JI4O 5LXTA 1UFIA 4YJ2A 1I2KA 4TQRA 2P5OA 2VUMG 4X1KA 1ULZA 3VPBA 3BA9A 2NR5A 4GZRB 4I50A 4GKJO 1IOVA 3ABKB 1V55C 5IYZA 3HKBB 3L70H 3FD9A 3ZRWA 1H8EG 4BR6A 2ZDGA 4JV5H 4O84A 5KFLA 5KFVA 4J9KA 2W9AA 4LF5B 1SA0B 3ASNB 5DISC 3CMAV 3RR5A 2WWWA 2LFSA 5L9XA 3B8NA 5CE8A 3N42B 4DR2O 4E4TA 5J2TB 3N8DA 1DV1A 2FYUH 3LP8A 4MV9A 1C30A 2CFMA 2FK2A 4MW3A 3JALA 2W9CB 4Q8FA 5DAAA 2JA7G 1KJJA 4HNVA 1OCZB 1GTOA 1OCOC 4GC6A 5I60A 2Y0SA 2ASDA 2RQ6A 4Q6GA 3GLKA 3QNEA 3U54A 1NR1A 4PI0A 5KG6A 4O4HB 5I47A 1F4MA 2YU9A 1ZHSA 2XIGA 2BQ3A 4Z1MG 2HFEC 3J80N 4K35A 2K9PA 4PDBA 2HKOA 2P7TC 3LDDA 2UXNA 4D6TH 4FM0A 1JDBB 4QWCA 5IYCG 1NKDA 4UFZA 4A3JG 2UVWA 3HOWG 4ME6A 4JYYA 3KAKA 3RV3A 1BGWA 3H9VA 4O2AF 3RVYA 1PP9H 1JX4A 4IRDA 3GB7C 1YTFB 1F4NA 5JQGA 1L1FA 2UVUA 3HO8A 3DC5A 3JCUZ 1KC7A 2B1GA 5DG8A 4YR2A 4ASUG 5BMVF 1PNKA 3Q8PB 1PPJH 2IU0A 2NVYA 5F9NA 2WLKA 1GN4A 2HGWA 4NZNA 2DJVA 2NU9B 4DK1A 4ED6A 2IJHA 3CVZA 1CEZA 1CQIB 2FB9A 3Q1KA 3FKIA 4LFCO 3F5TA 4D7SA 5I5UA 5KFFA 3OTFA 4LNUB 2B1IA 2Q2TA 3CB2A 3D3QA 3RYFB 2R84A 4DV0H 1BQZA 3LDCA 1OCOB 5CA0F 4IR9A 4CMFA 3RIZA 3PO2G 1FAFA 1RFYA 3ZRVA 2ZCEA 1IBKO 4WBNF 4I7HA 1A3GA 2W7PA 3C90A 4TV9F 3DXRB 1YXBA 2WTFA 3AK3A 5A2QN 1JLLB 1AI7A 5KFTA 1AJPA 3QTCA 1NT2B 1I1LA 4J41A 4FFLA 5FNVF 2JA6A 4DR3O 1IOWA 4MVZA 1H2KA 1IYEA 1GM8A 1SF9A 2ZIOA 3WB1A 2YRXA 3GTJA 1EN5A 4H37A 3T9AA 1XNRO 3OMAB 3BABA 4J9OA 3Q2OA 3QZ7A 4UCUA 1U96A 4MW8A 4R8UB 3DTUB 4DV5B 4UVAA 3OEHG 2XGPA 2CQYA 4DV1B 1L2ZA 3WO1A 4UUJC 3Q4HB 2FJZA 1Y67A 4LFBH 2KG7A 3TY8A 4JI5H 3K5OA 3SJBC 2QK4A 2LGQA 3X2QB 5C1OA 2CDYA 3T9DA 2PYJA 1S97A 3GQCA 4CH3A 4A93G 3BPZA 2CUGA 2UXDH 5LA6A 3RYIA 2GLTA 2LFRA 2LJ2A 2Q67A 1HR0O 1BCCH 4B3RO 1JVMA 2CGNA 3HOVG 4JXUA 3WG7C 5JVDA 1MSDA 3UKMA 2ZR3A 4C7UA 1Y1VG 1SETA 2IH1C 2JGDB 4TQSA 4GX1A 4Z2WA 2PBZA 4HNAA 1KKCA 5IJ0B 3RAXA 4B3MH 4GKKH 1R1BA 5CA1A 1XMOB 3TJTA 1NI8A 4EBDA 1KKDA 1VARA 3ICXA 1N0NA 2R85A 4JV5B 4O2AB 5L3GA 3T1YO 4Q43A 3PW5A 4JI3O 1KU9A 2OCCC 4J9RA 5EK0A 1JKJB 1AI6A 3ZRSA 2WAQA 4ECXA 3J80W 1OJHA 2Q5ZA 2AW9A 4PDLA 3PW7A 2G38A 5KUMA 5J2UA 4DUYH 5BMVB 4QNHB 4CKEA 1ZHQA 2Q7GA 3CXCU 1P8LA 4ECSA 2WLLB 5KG7A 4I4TA 3BVOA 4IIJA 4QJFA 5B3SC 2A7WA 2FLPA 2XAJA 3HKEA 4O3QA 2GSMB 1QLNA 3JRWA 1Y76A 2NUAB 3E22A 1JCHA 3MWMA 4JI8H 4CS2A 3AG1C 5KFOA 2R8IA 3GIPA 2Q7DA 5KG2A 3D3IA 3RB0A 5H5NA 1CPYA 2JIZG 5CA0B 1B6SA 2UU9O 3V4SA 3WWIA 2XTAA 3FB8C 4B3SB 2YZLA 1EUCB 4QIWF 1FXKC 1T3NA 3BA8A 4WBNB 4CS3A 4UCOA 2DZDA 4O83A 5C1PA 3G6XA 1P7GA 4TV9B 3H1HH 5D1PA 1N8RW 3AG7A 3ZHTA 1JFFA 1H2LA 2GUZB 3OTOB 3I56V 2H8PC 1D5NA 2CW8A 5FNVB 3B4SA 3PFFA 3FX7A 5EYPB 5CA3A 1VBGA 1PD3A 3AG4C 3AK1A 2R9IA 4F6RA 1XMQO 5KT6A 3N2GB 3KHGA 4I5SA 2OCCB 1VQ5V 3K3WA 1YITV 2NU7B 1QVGU 2H3OA 3K5NA 1IURA 1QBZA 4X1IA 2JK5C 4GLWA 4YIOA 5A2QW 2XAHA 3P3NA 5DEDA 2VQEH 4ECUA 2MCTA 3L2PA 2ZNJA 5C8YA 4DV0B 4RZQA 4K0KO 1V51A 2IA6A 5B3SB 1AP6A 1S0MA 2VOBA 4JV0A 3AG2B 5L1JA 4X64B 2XCPA 2ZXWB 4PZ8A 5I5WA 3QO8A 2Z0AA 3AG1B 1K9MW 2ZM6H 3J81N 3C0FB 3MFHA 2OTJV 3TIGA 2UXBB 3TETA 2OWOA 2F95B 1E4GT 4BBSG 2W6ZA 1OBDA 4EGJA 1FXKB 3JASB 2QKSA 2QTSA 2V5AA 4X62B 4UCVA 4MA5A 3RYCB 4B7KA 1IBLO 4LF8H 4AQYB 1QU7A 3RAQA 1G2WA 3OUSA 3RWRD 3UYYA 1M9NA 3JAMN 4IRCA 3V4ZA 1NH2B 4LF9H 5JJNB 3T9EA 4OPHA 1PV0A 4WD3A 4OX9H 3I12A 1LUVA 5IWAH 4LF7O 1HP8A 3CSXA 3D36A 3N2KA 2AZ2A 3GTKA 4JTAB 4JI1H 1V4YA 2OIGA 4A3EG 3SGIA 2QWNB 1T5EA 2UXCO 3RFCA 5BWXA 3ABMC 1ZETA 4DV4B 2W9BB 1WN7A 4BAYA 4LFBB 1ZAUA 1HDJA 2LW7A 4JI5B 5LMUB 1XOUA 4IYIA 3R9RA 3GWKC 2ZGIA 5L3EA 2W6QA 1WNSA 1S10A 4PZ7A 3LMLA 1YCIA 3FYEB 5LMNH 4MV7A 2UUBH 2UXDB 4LP8A 5CBGA 1W0KG 4PI2A 1IBMO 5IT9W 2EZOA 1P7BA 3HKBA 3DGEA 2PN1A 1H2NA 5BWWA 4ECQA 1SA0A 2L6LA 3FMAA 4RB1A 2AQ4A 2QJ1A 1AI5A 4O81A 2W0FC 3PN1A 5J2TA 2JEFA 4LH6A 1DK1A 5IYCO 2W9CA 2IJKA 4JI7O 3J7AK 1S68A 2Q9LA 3VQXA 3VA7A 3ZRXA 3ZHVA 2PY5A 4TQFA 3GTLA 4PELA 1KJQA 3OFNG 2PYLA 4MV1A 2DN9A 2Q8VA 5D5PA 1NBMG 3RTXA 4HYKA 3BEHA 1MZFA 2XCAA 1FKAO 2GPWA 2NVXA 4LF4B 4O4HA 4MV4A 4CBCA 1K4DC 2DE0X 2YYAA 3EYYA 1WR2A 3PW0A 2ZQMA 3ABMB 4PA4A 4JI2O 4ZIBA 2HIXA 5CAEB 5KLVH 4NVPA 4ABMA 4NB5A 2AHZA 1DF5A 4DUYB 3E5NA 3AYHB 4K3AA 1Q7YW 1HNZH 5LHGA 3H40A 5KA6A 4A3KG 1L0NH 3JAWB 1FD9A 3ABTA 2V1DA 2OCHA 4YXWG 4CS4A 1Y1WA 4J11A 5KFGA 1S0NA 2M05A 2FMLA 4PWQA 1S5LZ 4MVOA 4JI8B 4X1YB 5L3BA 4B3TH 1B6RA 2FLNA 2PTMA 4NXMH 4J80A 5FPOA 3QO5A 5JVLA 1SQQH 2QTOA 3GTGA 2W6MA 4Q20A 3RT3C 4DR4B 1PX2A 5KFDA 3HKZE 1YI2V 4I0XB 2WLHA 2PGGA 3GIIA 4DR7O 3CYOA 4OGQB 1E4EB 3RYFA 5IYDO 2HJDA 5LYJF 3LULA 2X7RB 3TY5A 2RMKB 2P22C 1UC9A 4DIMA 2C28A 4F4XA 1VBHA 2PUSA 2FE3A 3WNZA 2FK1A 2RJZA 1B06A 3G80A 2IJJA 2H94A 1DGSA 4G2KA 1S03G 2W8KA 1S5HC 1FJGB 1HW7A 5KG4A 1W93A 4Q4DA 3OR7C 2C2AA 3N27A 1WJZA 4UVBA 3G71V 4CH5A 1H2SB 2D2CB 3KAJA 1NTZH 4EKWA 2DYSC 1RK6A 3OMNB 3TXQA 2FK3A 3JAMW 2YI9A 1K33A 3L74H 3PR4A 1M57C 3MFIA 2DQ3A 3KZIZ 4R8UA 4O86A 3R5HA 2ETNA 3A8TA 1M1KW 5BR8H 3VPDA 3UT5B 2UUAO 3Q4HA 2VUGA 3W7SA 2CAZC 2JEGA 4DV3B 3B40A 1RM1C 1KT8A 1I94O 4FLTA 1K34A 1I7FA 3VOTA 2UVVA 4LF8B 2V4DA 3QG5A 3WFVA 2FPPB 1KJ8A 1Q8IA 2Z5UA 4FLVA 4P30A 2YXHA 1XDNA 1BL8A 3QZ8A 3L71H 4ED7A 1AJQA 2JS3A 4LF9B 1I1MA 1KUTA 4DL2A 1Q5OA 1GKFA 3ZX6A 4YIPA 3HB9A 2E2IA 5CB4F 5IWAB 3T5JA 1WB8A 5LHHA 3PVXA 3CC2V 1XNQB 4HR7A 5KFZA 5HFMA 1N33B 3BJYA 3ZMSA 2JGDA 1YIJV 2ZM6O 1VIBA 1UJWB 1MA1A 4RUCA 5IJ0A 2HEPA 2HR3A 2C2DA 3HKCB 3JATB 3K57A 2HHHO 3P30A 1K5SA 4JTDB 4MV8A 1S72V 3IG0A 2A06H 4D7TA 3CJHB 2QM8A 2HG5C 3D36C 3CD6V 1HNWB 5JH7F 3VNNA 3UZBA 3JD2A 4A3GG 4O2AA 2ATLA 2FLLA 3GIQA 3OAAG 4XX0B 2J6SA 3RB4A 4MSWC 4NXNB 4B7EA 3RYHB 1Y66A 1WAZA 2A0LA 3T5HA 3DSQA 3ZHRA 1RM1B 5B1BC 4O7ZA 5BMVA 3T1HO 1GSOA 1VF6A 3IAYA 2WLLA 3UQ8A 1GMGA 1XL4A 4EEQA 2M7WA 4G3IA 3AX6A 3ABKC 3IFXA 1QQCA 2R87A 2P90A 1OCRC 4FLZA 4ZI7F 5LYJB 1PM9A 4DV5H 5KA5A 4FZ1A 3GTPA 2V4RA 2HVSA 4DV1H 3CX5F 3ASNC 3SR2C 2FMAA 2C22A 3GVMA 2M6YA 4UB8Z 5CA0A 3KG2A 3CHXA 4RUEA 4I9QA 4HQ6A 3K5IA 1Z5VA 3WB0A 5I5TA 5KX5F 2W71A 2EIKC 4YJ3F 1HNZB 4WBNA 5DLGA 4I7ZB 4DO2A 4X66O 4QIWE 2R70A 4WHXA 4RAYA 4IL6Z 4LF6O 1EUDB 2GUZA 4OXSA 4TV8F 4U7OA 3JRXA 5FNVA 1EKVA 2XGQA 4KP4A 4JI4B 5EIBD 1KD1W 2X0LA 4DL4A 5EYPA 5H9CA 5EC1C 5CM0A 5LGUA 2C2RA 3KREA 4YHHO 3N2GA 3K0DA 2QWOB 4R7RA 1SQPH 3CCQV 1XQ8A 2UUCB 1R73A 3RUPA 1M0TA 3E35A 4EFBA 3ZMTA 1NQTA 5B1BB 1EKPA 1I08A 4JAVA 3THOA 3E8HA 4I55A 1TA8A 4LSAA 3OR6C 1XMOH 2N05A 1AUVA 2EINC 2YIBA 1G6UA 3QFFA 4HBNA 1RJPA 1VP7A 1ZTEA 2HJFC 2FB5A 1TWCA 1OCRB 3G6BA 4J10A 4LR3A 5KFRA 2JEJA 1HWYA 3IC7A 5DQGA 3RBEA 3K5MA 3R5XA 2OYQA 4Q4CA 3Q8RB 4LMYA 3ZN0A 2ZINA 3K08A 4O2BF 3K79A 1FXKA 5CB4B 2EIKB 3JASA 4O4LF 4TQDA 2ILMA 4NXMO 4O7NA 5KFMA 3RYCA 3KCYA 2N04A 4NYKA 5EIBC 4PHZA 3T4ZA 2ZJTA 4M9UA 3ZHSA 3JZFA 3G8CA 2O03A 4WCEV 2R8KA 3JAKB 5KFHA 3BQ0A 3UM7A 4XZ3B 4FK5C 1L8DA 2QM7A 1A9XA 4O7SA 2RNBA 5FD6A 4DV6O 4PA3A 3PO3G 1LR1A 5C44G 1S9FA 4HAMA 2DWCA 1AP5A 2NU6B 3T9BA 4O7TA 3PJSK 5BR8B 4EB6B 3HPLC 4B3SH 3QQMA 2W9BA 5JH7B 4RU9A 4DV7B 1JJ2U 5JQWA 4RAIA 4RWUA 3HB3B 1YZBA 2X6CA 4LF5O 1Y74B 1I6UA 4RB2C 3OTOH 2BOBC 3SYCA 2XASA 2OT5A 2YZMA 1N34H 2EINB 1SC5B 1SYXB 3CMEV 1GK9A 4JZGA 4UV8A 5KFWA 3N44B 3JZIA 2ODMA 1SQFA 2YICA 2ZIMA 1KP3A 3RV4A 3HOYG 2RN9A 1VQ7V 4XYLB 2YDEA 2ZR2A 3OUFA 3S3XA 3CCJV 4HNUA 4JGSA 5FLXN 1VQNV 2ZDQA 3FYIB 1IBKB 4ZI7B 2ZT9B 2JA5A 1AN7A 3OSPA 3FKIG 3X2QC 1KB9F 4F4WA 2IBKA 2E75B 2W6NA 3H4DA 3K58A 3B2EE 1XK5A 2WYOA 2EULA 3B09A 2BTOA 5KX5B 3M99B 4DR3B 4QIWA 2Q2UA 1X9NA 4X64H 1KUQA 2R93A 1CS0A 2DYRC 1FS0G 4EYHB 3OHBA 1WP8A 3E8FA 4CH4A 4F4ZA 4TV8B 2UXBH 2YEVB 1P4RA 1HNXO 3FB7C 2GTSA 4PA6A 2LP7A 4J9ZB 1FVIA 4DL5A 5KFEA 5IYDG 2Y48A 5EDWA 2F4VH 2IW5A 1SQXH 2E76B 2D3OW 4X62H 4BWSC 4FE2A 2JA6G 3W7XA 1I5YA 4U7CA 2Q69A 5KG1A 4AQYH 4ED0A 1SESA 3JAWA 2VQDA 3E89A 2JEUA 4MVMA 2WLMA 2B9ZA 3TQ1A 4OPAA 1EFRG 4FS2A 4X1YA 5LHIA 4I55F 2VA3A 3T9FA 1B04A 4PD4F 3PZPA 2C2EA 2E5LH 4DV4H 3ZS8C 4FJCC 2C35B 2ITCC 4JAUA 2QYZA 1YJ9V 2ZE7A 1PNLA 1QCEA 5KFJA 5LMUH 2YCHA 2Y69C 3M9OB 4I0XA 1N56A 2LQTA 2R82A 1VF6C 5L3DA 2QKCA 3R65A 2R8HA 1B3QA 2PVPA 4NYEA 2QM4A 1E4EA 1VQ4V 1Q82W 4O2BB 4KUMA 2R86A 4O4LB 1SS3A 3CPWU 2YIBD 1P16A 5F2VO 3E86A 3TW7A 3WO0A 4U3FH 4DUZH 4NTWA 2DYRB 2DIKA 4UCSA 3ZJZA 1Q43A 2VPSA 2B63A 1CP9A 4G27B 3HXLA 2YXYA 5LGTA 1JX9A 1Q3EA 4YBZB 1UNNC 3T1YB 4PDVA 4JI3B 2RGVA 1IX9A 3G4SV 4DV2O 2R7MA 2LGWA 1K73W 3LDEA 1N32O 2OLSA 4JI6O 3R23A 2FKLA 3CRQA 5I5XA 1GM9A 4MA0A 2RDJA 3CRRA 1VMGA 2KB1A 4CMDA 3P3PA 1IXMA 1OBGA 1NH2D 2R8JA 3M7MX 5B1OA 4FFOA 4LF4H 3MJFA 3APOA 4RB3C 1VKZA 2QWPB 3NR7A 4DR5H 1I7NA 5KT2A 2Q4PA 3UT5A 4YAJB 1KBHA 3QWUA 4LFAH 2Y69B 1MNGA 4G28B 5L3CA 2UU9B 3MR2A 1NJIW 1N36O 1EKFA 2JGUA 1RK5A 2YL2A 3ETJA 3AG2C 2GTAA 2ZXWC 3CQZA 1W0JG 3SPCA 1JIHA 4MVUA 3BHPA 3H1LH 4I9WA 4WFEA 1J5EB 2V4QA 4MAMA 2PI4A 1SERA 1T94A 4AYBE 5FLXW 2IMWP 4DR4H 3K03A 4J9MA 3T5LA 4JV5O 3RBZA 3KHRA 5K2MA 4X20B 3GIKA 3CS5A 4KFMA 2YIDA 4J42A 5C93A 1JR9A 1E4FT 4ETSA 1RP3B 2K1EA 1N34B 4QSHA 4QGPA 4P2ZA 3HKCA 3ZMZA 3JATA 4PBCA 2XUMA 4KL1A 2ATKC 4K0KB 2KSDA 2HGXA 5KFBA 1R3KC 4DRXB 2VQFB 4A2AA 3CCLV 3CJHA 1S5JA 3DTGA 1TUBA 4IRKA 4FFNA 4RB0A 1FJGH 1K4CC 3GJXB 3HOZG 4X8AA 4YR0A 3A0BZ 3RYHA 4BIOA 5KHJA 2VWKA 4I55B 3TXSA 3KHHA 5KHHA 2COJA 4BBRG 3W7WA 1WB7A 3TQTA 3LSQA 1RJQA 1VQLV 3FFQA 3SYPA 4ZQIA 3C3TA 2GPSA 4B3SO 3VQVA 4W4LA 2DLNA 2HP8A 1BZKA 4NKGB 3BCCH 1IBLB 2GV9A 5KFKA 2NNUA 4O7WA 1TUEB 4ZBMA 5LYJA 3LNNA 3VBBA 2XOKG 1ZUQA 4J9LA 1Z2NX 5BWRA 2CH7B 3GB8B 3SJCC 4Q0YA 3I4MG 1XL6A 1VQ6V 4J9NA 4XDLA 5LL6Y 3OE7G 2F4VB 4O7YA 4NZMA 4LF7B 4DV3H 2P6JA 5KUKA 3CSWA 4JV1A 2UXCB 5KFUA 1KQSU 4DR6H 3LWBA 1SQBH 1IZ3A 2DPIA 2UXXA 3T5KA 3OUUA 5CR5A 1PK8A 1D5AA 4DV0O 5BWUA 1YJWV 2F1MA 4FFPA 1Q6IA 2GHYA 4R8CA 4MVQA 1QR8A 4FLYA 4AI8A 2E5LB 1F7YA 4X64O 3TEKA 1GO3F 1XNQH 1ENVA 4DQNA 3B8MA 1N33H 5BWVA 5KFPA 1GN6A 2YWVA 5DG9A 2OH2A 4IWXA 1R3LC 2CZGA 2N74A 1XDCA 3ABLC 5HNEA 1Q86W 4AILC 1P84F 4TOIA 5EOYA 2QSAA 4PA9A 3OSNA 5CN0A 3N6XA 2EIJB 2DW4A 4J9YB 4IWYA 3L72H 1FFXB 2YIAA 4JYAB 1GM7A 4DUZB 4MTOA 1SZXA 1DIKA 4JI7B 1HNWH 4X88A 2ZDIA 1JQ0A 4Y8VB 5JJEB 4RQEA 3NGDA 1H2GA 5KT3A 1XI1A 4NXNH 2DABA 1DAAA 4DR1B 1I2LA 4MV6A 5CB4A 2VR1A 3IN5A 4JI2B 4GC7A 2I80A 2DMXA 4FGRA 3SJAC 1EYZA 1BQ0A 1EHIA 1E1RG 4LFBO 2CK3G 2VPQA 1WPXA 4JI5O 5F9LA 2WSSG 3JAKA 5L1LA 4N21A 3S3WA 1CKMA 2GDSA 1ZX3A 2Z02A 2Y0IA 2UXDO 1KC8W 4DR5B 1MMMA 4J9SA 4E4EA 4EB6A 1G8MA 3CE2A 1H2MA 3U9TA 3QO7A 4TUYF 4LFAB 3VQWA 5JH7A 3OW2U 3GWOA 2R72A 3ABLB 2LW1A 4O3NA 4DXWA 4YY3B 1Y74A 4GUNA 2ALZA 4FLUA 5JJJB 1TWFA 3RBDA 4JI4H 1Y1WG 3JSLA 4DR7B 3KTMA 2W8LA 5FJ8G 2GQSA 2CGOA 4JI0B 2IBZH 4B3MO 4GKKO 1WP7A 5GW7A 2VWJA 3H0GG 4BXXG 1Q90D 4YB8B 5I5VA 2YUAA 1JMKC 1CXZB 3MHHC 2QWRB 3H4BA 2UUCH 4J7JA 4DW0A 4ZI7A 4PJ0Z 5DN6G 2YZNA 1MG1A 2Y0PA 4H0LB 3GV5B 3CEBA 1KTAA 4MT8A 2HVQA 2X5RA 3T9CA 1BS3A 1NZ6A 3CWBH 2HG8A 1N48A 5KG3A 4C5BA 5KX5A 1Y6XA 4DUYO 3D8CA 1VQPV 2A9HA 4YJ3A 2ODTX 1S3JA 3SI8A 3H20A 3I4NG 1NTKH 5K1XA 1MOFA 1ORQC 3J81W 4FVMA 2EZPA 3GILA 1GRJA 4TV8A 4X65B 1BSMA 3FAVB 2YEVA 1VQ8V 1P49A 3E83A 4FIPC 1X4TA 4JI8O 2FPGB 4UB6Z 3EPIA 3RW0A 4A3IG 1WSCA 4A3CG 1GN3A 4C5CA 3MHSC 1KMIZ 2JA8G 3JARB 4FU0A 1VF5B 5JCOC 2AGOA 3CC4V 2XAFA 3ETQA 2EJ2A 5LBQA 3UO3A 4ZOLF 4RUFA 3N43B 2XAQA 3EFFK 3SPHA 3NXSA 4UVCA 2YI8A 2JVDA 2DOSA 1DV2A 5H80A 1VQMV 4DV7H 5EC2C 2VA2A 3H1IH 1AUXA 4H13B 4DR6B 2W6IG 1KJ9A 4LFCH 4MVSA 4O2BA 1TVKB 3CC7V 1D2DA 2VQEO 5KFCA 4CE5A 2WA4A 1EBOA 4O4LA 5DGHA 4O7VA 4IAJA 1YHQV 4KHPB 2V59A 5HFLA 4WFAV 2HHHB 3KHLA 1M90W 1DLBA 4WFBV 3F7YC 5B1AB 3I55V 1PL0A 1K1SA 1K5QA 1IBKH 4ED2A 1ZWIC 3ORQA 5K1PA 1BE3H 4JF3A 2CNVA 4FFMA 5L3FA 4MTXA 1VQKV 2CW7A 3LSUA 5GONF 4QPKA 1WCMA 2RF4A 4DR3H 4MVRA 4TUYB 5IYBO 3T1HB 5D5QA 4BY1G 3HOUG 1JA8A 3K9SA 1TUBB 3W7UA 4E6NA 4J0MA 4LF8O 1SEIA 3VPCA 4JPRA 4A3MG 5IJ9B 1XNRH 3NBZB 1S0OA 2XC9A 3AK2A 2XHBA 4ECZA 4YAKB 4LF9O 1M6VA 5LP6F 4C2MA 1MABG 3GIJA 1SKVA 3SE7A 4OX9O 5IWAO 4FM1A 2P0AA 2EILB 2XCLA 4JI1O 3HKZA 4IYHA 2AGQA 3ORRA 1S76D 3G6VA 4IR1A 2EX3A 5DECA 2YS6A 1TGOA 5FLMG 1UC8A 1N33O 3RF2A 1NS1A 1R6TA 2XAGA 5H6QA 1CKNB 2YXLA 4X66B 4J7KA 2WAMA 3KCXA 2ZDIC 3MD0A 5H2FZ 4LF6B 5KMGB 1M56C 2F93B 3B77A 5LMNO 2UUBO 4L8JA 2ZE5A 4QWDA 1H38A
chains in the Genus database with same CATH topology
1HR0H 5EYPB 5LL6b 4B3RH 4CH4A 4CC5A 4TV8B 2UXBH 4F6RA 3N2GB 4YHHB 1FVIA 4DR2H 4X20A 2F4VH 3K5NA 4X1IA 4X62H 5A2QW 4BWSC 1O9GA 4FLXA 4K8XA 2VQEH 4AQYH 2MCTA 3L2PA 4UCTA 3JAWA 2HVRA 2ZNJA 5C8YA 4DV0B 3KALA 4RZQA 4O4JA 4DRXA 4GKJB 4LNUA 2VOBA 4DV6H 3QF7A 4X1YA 4X64B 4PZ8A 5LA6B 1B04A 3RYIB 3T1YH 4JI3H 2ZM6H 2UUAB 3C0FB 2E5LH 4DV4H 3ZS8C 3K59A 4ZOLB 5JVDB 2UXBB 2OWOA 1I94B 2F95B 2YCHA 4LH7A 5LP6C 4DR2B 1E4GT 5LMUH 4LF5H 3JASB 2QM4A 4X62B 4UCVA 4O2BB 2BTQA 2JS5A 3RYCB 2E3CA 1TAEA 2Q0AA 4HNAB 2VQEB 4AQYB 4LF8H 1Z2OX 4O4LB 2YIBD 3RWRD 1P16A 2KSWA 4FFBA 5CA1B 4DUZH 1CKOA 3M4IA 4UCSA 2VPSA 1Q43A 4CC6A 4LF9H 5JJNB 2KKWA 3HXLA 4DV6B 4OX9H 1Q3EA 5IWAH 3CSXA 3N2KA 1QHTA 4JI1H 2UU9H 3SGIA 4O4IA 1T5EA 3T1YB 1JJOA 4JI3B 2ZM6B 2RGVA 4GYCB 4DV4B 1WN7A 4U3JB 5FNVB 1ZAUA 4LFBB 4IHJA 4JI5B 5LMUB 2PZSA 5J2UB 5FD5A 1WPBA 4UCRA 1WNSA 4PZ7A 3LMLA 5GONB 5LMNH 2UUBH 4MV7A 5LOVA 2UXDB 4I4TB 4IIJB 1J5EH 2F66C 3MAQA 3M7MX 3HKEB 4LF4H 4PI2A 1XMQH 1HNXH 5IT9W 4RB3C 3E22B 3HKBA 4DR5H 4AHCA 3UT5A 4OX9B 1SA0A 4DK0A 3QWUA 4LFAH 4APMA 4LFCB 5LP6B 4JI1B 3FMAA 2UU9B 4RB1A 1GYFA 2QJ1A 2JGUA 3PN1A 5J2TA 3L4KA 4K0KH 4LH6A 1FFXA 2VQFH 5KHGA 3J7AK 1S68A 1Z5WA 1JFFB 3VQXA 3RJ0A 2PY5A 4TQFA 3BHPA 5LMNB 2UUBB 1M93A 2PYLA 5EZYA 3RTXA 5D5PA 1M0WA 1V9PA 4BW9A 1J5EB 3NBYB 5FLXW 4F6RB 4LF4B 1Z2PX 4O4HA 4DR4H 1HNXB 3EYYA 3K3VA 4ZIBA 4X20B 2HIXA 4NVPA 4X1IB 4BWAA 3BAAA 4DUYB 4YJ3B 3KXYT 1HNZH 1E4FT 4ETSA 1IBLH 2Q7EA 1N34B 3HKCA 3JATA 3JAWB 5C8YB 4KL1A 2Q7HA 4O4JB 4K0KB 4CS4A 1XHZA 1XNRB 4DRXB 2VQFB 4A2AA 3N40P 1S5JA 1TUBA 4JI8B 4X1YB 4B3TH 4RB0A 1FJGH 4LF7H 5ITZB 3GJXB 2PTMA 4NXMH 3HKDB 5FPOA 2UXCH 3U10A 5KHJA 3RYHA 4B08A 5D1OA 2VWKA 4I55B 3S24A 4DR4B 5KHHA 3JSNA 4DV2H 1VS0A 3FFQA 1A0IA 1N32H 4FM2A 2PGGA 4JI6H 3VQVA 3KYHC 3RYFA 2BTQB 3K5LA 3TY5A 1IBLB 2P22C 2GV9A 1HR0B 4TV9A 4FFBB 4B3RB 5KHKA 5LYJA 2PUSA 3LNNA 2FE3A 1IBMH 1Z2NX 2RJZA 3GB8B 3SJCC 3U0ZA 4Q0YA 1DGSA 1S03G 4B3TB 2F4VB 3N2KB 1FJGB 4LF7B 1HW7A 4DV3H 4NXMB 4O4IB 2UXCB 1N36H 4GLXA 3A2FA 4EFEA 1YEWA 4DR6H 2IM9A 4CH5A 4JYAH 4DV2B 1H2SB 1WH2A 3KAJA 4A2BA 4JI7H 1N32B 4ZHQA 4JI6B 5LXTA 1D5AA 3JAMW 4YJ2A 5LOVB 2F1MA 2YI9A 2P5OA 1XHXA 4X1KA 3BA9A 4I50A 4FLYA 4DR1H 1FKAH 2E5LB 5IYZA 3HKBB 1XNQH 4JV5H 1N33H 4JI2H 5BR8H 3UT5B 2VUGA 4LF5B 2CAZC 3JARA 1SA0B 5DISC 3RR5A 4DV3B 4AILC 4TOIA 5EOYA 1RSOA 4FLTA 1VF7A 1N36B 3N42B 1I7FA 4LF8B 2V4DA 3QG5A 3N6XA 5J2TB 2W57A 1FFXB 1Q8IA 2YIAA 4JYAB 4FLVA 1XDNA 4DUZB 2CFMA 1O9HA 3JALA 4MV9A 4JI7B 4LF9B 1HNWH 1SQGA 1Q5OA 5JJEB 2RQ6A 1XI1A 5IWAB 5EZYB 2ZNIA 4NXNH 4Q6GA 4DR1B 2HIVA 4PI0A 3W1BA 4O4HB 4YY3H 5CB4A 1XNQB 1M5IA 3WB2A 4FLWA 4JI2B 1N33B 1ZHSA 2XIGA 5FPRA 3GDEA 1TVKA 3SJAC 4DR7H 4PDBA 4FM0A 3TY9A 5IJ0A 4JI0H 2HEPA 4UFZA 3RGBA 3HKCB 3JAKA 3JATB 3K57A 3KAKA 1CKMA 1BGWA 3BRCA 3IG0A 4D7TA 1XMQB 1HNWB 5KHIA 4DR5B 3NC0B 5JQGA 3VNNA 4O2AA 4CH6A 4EB6A 4LFAB 3VQWA 5JH7A 4NXNB 3RYHB 2R72A 5JCOA 4DK1A 3CVZA 4YY3B 3DSQA 4TUYA 5BMVA 4D7SA 4FLUA 3IAYA 5JJJB 3UQ8A 3OTFA 4LNUB 2Q2TA 3CB2A 4JI4H 3JSLA 4EEQA 4DR7B 3RYFB 4DV0H 5IJ9A 4JI0B 3W5OA 1QQCA 4X65H 2VWJA 2RGRA 1MZBA 1JMKC 4FLZA 5LYJB 4DV5H 3RIZA 2HVSA 4DV1H 3SR2C 2UUCH 2ZCEA 4I7HA 5CA0A 3CHXA 4ZI7A 4LSXA 4I9QA 2UUAH 1Z5VA 3WB0A 3RGXA 2HVQA 4M7EA 1HNZB 1I94H 4WBNA 3QTCA 1NT2B 2R9AA 1CKNA 2R70A 4RAYA 5KX5A 4YJ3A 5KMGA 2ZIOA 3VQYA 3WB1A 4ZHQB 3H20A 5FNVA 5LXTB 4JI4B 5EIBD 5K1XA 3J81W 4YJ2B 4FVMA 5EYPA 4X1KB 4TV8A 3BABA 4X65B 4I50B 3N2GA 1P49A 4UCUA 4MTEA 1X4TA 4R7RA 5IYZB 4DV5B 5ITZA 4DV1B 3ZEDA 3L4JA 1XQ8A 1L2ZA 4IHJB 3HKDA 2UUCB 1M0TA 1KMIZ 4EFBA 3JARB 5JCOC 3THOA 4LFBH 4I55A 2WDTA 1TA8A 3TY8A 4JI5H 3K5OA 3SJBC 4LSAA 1XMOH 4KHPH 2HHHH 2HGSA 2YIBA 1G6UA 3ETQA 4HBNA 2PYJA 3JALB 1M4UA 1IBMB 4CH3A 2UXDH 3BPZA 3N41B 5LA6A 3N43B 3RYIA 4LR3A 3W1GA 2YI8A 2JVDA 3K5MA 2OYQA 3DF7A 4MTDA 4ZOLA 5JVDA 4LMYA 4DV7H 2ZINA 1O75A 4DR6B 5CB4B 3JASA 3T1HH 4TQDA 4LFCH 4O2BA 3RYCA 1TVKB 5EIBC 4HNAA 4PHZA 3RGZA 2ZJTA 4O4LA 5IJ0B 2O03A 3U11A 4IAJA 4B3MH 4GKKH 5CA1A 3JAKB 4KHPB 1XMOB 2HHHB 1L8DA 5FD6A 3ICXA 4JV5B 5JQGB 1IBKH 5BR8B 5K1PA 4O2AB 4EB6B 1KU9A 4B3SH 1BJTA 5JH7B 4DV7B 4U3JA 2CW7A 3J80W 4PZ6A 4X66H 5J2UA 4DR3H 4TUYB 1I6UA 4DUYH 5BMVB 4RB2C 3OTOH 4LF6H 3T1HB 5D5QA 1ZHQA 2Q7GA 1P8LA 5GONA 1N34H 2WE6A 1TUBB 4I4TA 4E6NA 3F8NA 4RAZA 1SEIA 4IIJA 1SYXB 4J0MA 5IJ9B 1XNRH 3NBZB 3N44B 1SQFA 3HKEA 4B3MB 4GKKB 2XHBA 2ZIMA 3RFRA 4YHHH 3E22A 3MWMA 4JI8H 4CS2A 1SKVA 5D1OB 4DRFA 4FM1A 5CA0B 1IBKB 4ZI7B 5LP6A 2EX3A 1AN7A 4B3SB 4K8ZA 3BA8A 1TGOA 4WBNB 4CS3A 3B2EE 3K58A 4UCOA 1XK5A 3RF2A 2WYOA 1CKNB 4EQ5A 2YXLA 4X66B 4GKJH 4TV9B 2BTOA 5KX5B 4DR3B 5D1PA 4LF6B 2Q2UA 1JFFA 3OTOB 5KMGB 1X9NA 4X64H 4FM9A 2F93B 2CW8A 4L8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 B;  4DV5 B;  4TOI A;  1S68 A;  4DV1 B;  1N36 B;  4CC5 A;  2UUC B;  4LF8 B;  4EFB A;  5LMN B;  2UUB B;  4YHH B;  1FVI A;  4JYA B;  1XDN A;  4DUZ B;  2CFM A;  3RTX A;  4JI7 B;  4LF9 B;  1V9P A;  1J5E B;  1TA8 A;  3NBY B;  3TY8 A;  4LF4 B;  1HNX B;  5IWA B;  3L2P A;  4UCT A;  2HIX A;  1IBM B;  2HVR A;  4DV0 B;  4DR1 B;  2HIV A;  3BAA A;  4DUY B;  3W1B A;  3W1G A;  4GKJ B;  1N34 B;  1XNQ B;  1N33 B;  4JI2 B;  4X64 B;  5FPR A;  3GDE A;  4K0K B;  4PZ8 A;  1XNR B;  1B04 A;  2VQF B;  3TY9 A;  4DR6 B;  4UFZ A;  2UUA B;  4JI8 B;  2UXB B;  2OWO A;  1CKM A;  3GJX B;  1I94 B;  4LH7 A;  4DR2 B;  5FPO A;  1XMQ B;  1HNW B;  4DR5 B;  4KHP B;  3NC0 B;  1XMO B;  4X62 B;  5D1O A;  4UCV A;  3VNN A;  2HHH B;  3S24 A;  4DR4 B;  3JSN A;  1TAE A;  2VQE B;  4AQY B;  1VS0 A;  4LFA B;  1A0I A;  1P16 A;  4NXN B;  4JV5 B;  1CKO A;  3KYH C;  4UCS A;  5BR8 B;  4CC6 A;  4YY3 B;  3TY5 A;  1IBL B;  4DV6 B;  1HR0 B;  3UQ8 A;  4DV7 B;  4B3R B;  2Q2T A;  3JSL A;  4EEQ A;  4DR7 B;  4PZ6 A;  3SGI A;  3T1Y B;  4JI3 B;  2ZM6 B;  4JI0 B;  3GB8 B;  3W5O A;  3T1H B;  4DV4 B;  1DGS A;  1P8L A;  4LFB B;  4B3T B;  1ZAU A;  2F4V B;  1FJG B;  4LF7 B;  4E6N A;  4JI5 B;  5LMU B;  4NXM B;  2HVS A;  2UXC B;  3NBZ B;  4GLX A;  4B3M B;  4UCR A;  4GKK B;  4PZ7 A;  4EFE A;  2UXD B;  4DV2 B;  5D1O B;  1N32 B;  2HVQ A;  1HNZ B;  4DRF A;  4JI6 B;  1IBK B;  1CKN A;  4B3S B;  3BA8 A;  3BA9 A;  4OX9 B;  2E5L B;  3QWU A;  4UCO A;  4JI4 B;  1XK5 A;  4LFC B;  1CKN B;  4EQ5 A;  4X66 B;  4JI1 B;  2UU9 B;  5D1P A;  4DR3 B;  4LF6 B;  3BAB A;  4X65 B;  3PN1 A;  3OTO B;  1X9N A;  2Q2U A;  2VUG A;  4LF5 B;  4LH6 A;  5DIS C;  4UCU A;  3RR5 A; 
#chains in the Genus database with same CATH topology
 1HR0 H;  5LL6 b;  4B3R H;  1M7J A;  3F7V C;  3P32 A;  4DAA A;  1J95 A;  3E8G A;  4YHH B;  3AG3 C;  3UFX B;  1BMF G;  4X20 A;  3T4D A;  4QE9 A;  4O4J F;  4FZ0 A;  1NR7 A;  4NXN O;  2WLI B;  1B6Q A;  1OCC C;  4K8X A;  4ECY A;  1MSW D;  1OV9 A;  1ROP A;  3JD0 A;  4UCT A;  5TIS Z;  3R5F A;  4L1K A;  5KS8 A;  5KT4 A;  2HVR A;  4Z1V A;  2QR4 A;  1K92 A;  4DRX A;  1FPO A;  3BFR A;  5CMU A;  4GKJ B;  4H33 A;  5BYA A;  3QF7 A;  3W7T A;  4ECW A;  2EJ7 A;  1W96 A;  5B66 Z;  3DTF A;  1QVF U;  2R7N A;  3T1Y H;  1I5X A;  3TK1 A;  1TWG A;  4JI3 H;  1SCU B;  3QVN A;  1BNC A;  2W7O A;  4EEY A;  4JTC B;  4ZOL B;  2QKA A;  4EYI B;  2R7Z G;  1ZL8 B;  1ET0 A;  5LP6 C;  2BOC C;  4DR2 B;  3ETH A;  4FMT A;  4O82 A;  1AB3 A;  4QWA A;  2JS5 A;  1HNZ O;  2E3C A;  2R92 A;  2Q0A A;  4UUG A;  2CTP A;  1M56 B;  2KSW A;  1YSC A;  1JOY A;  2JEI A;  2FKX A;  1CKO A;  3M4I A;  1VQO V;  2QDO A;  2CH7 A;  4O4I F;  2VUM A;  2KKW A;  1JPX A;  4DV6 B;  4TVI A;  3GV8 B;  1WLE A;  4ED8 A;  4B3T O;  4QWB A;  5EWG A;  1QHT A;  3AG3 B;  1ZQ7 A;  2WA3 A;  2UU9 H;  2WB1 E;  4GX0 A;  1JJO A;  1PKX A;  5DGA A;  4A3D G;  4U3J B;  1R6K A;  3CCV V;  1OCC B;  2UUC O;  3VMM A;  2Q6A A;  4IHJ A;  1BHB A;  2WLN A;  3JYC A;  5LOV F;  2PZS A;  2F43 G;  1ZLZ A;  1WPB A;  5FD5 A;  4PDR A;  4UCR A;  1R9T A;  2A3Q A;  3ETD A;  5GON B;  3JCZ A;  2SCU B;  3T99 A;  1V54 B;  3PW2 A;  3BAC A;  1J5E H;  2JA7 A;  4R6Z A;  2F66 C;  3OGI B;  1K8A W;  1XMQ H;  4LCU C;  4JAS A;  3RN4 A;  2BQU A;  3V6J A;  4PV1 B;  1A48 A;  1Q81 W;  1GAX A;  1F23 A;  4AHC A;  2HLD G;  4WFG A;  1GO3 E;  1IYD A;  3TGU H;  5K3W A;  4APM A;  5KG0 A;  5IP7 G;  4LFC B;  5LP6 B;  4TWK A;  4L87 A;  5DMX A;  5DQH A;  3L4K A;  4K0K H;  1FFX A;  2CTW A;  2VQF H;  2QA4 V;  4J7Z A;  5EBM C;  5EZY F;  2RCV A;  3PR5 B;  2CE4 A;  1OZ0 A;  3BG5 A;  1M93 A;  2B5U A;  1WA8 B;  3R66 A;  4X9Q A;  4YR3 A;  1M0W A;  1V9P A;  1DF4 A;  2AU0 A;  5H6R A;  1BXR A;  4DYL A;  2EIY A;  4RCN A;  2YZG A;  1Z2P X;  2HDK A;  1HNX B;  2JA5 G;  3K3P A;  1V55 B;  1B33 N;  5BR8 O;  1VEW A;  2HVJ C;  4JYB A;  5GTI Z;  1KBL A;  3EXA A;  3BAA A;  4YJ3 B;  2WAQ E;  3KXY T;  3G6Y A;  3FB5 C;  4EGQ A;  5DM6 V;  4DV7 O;  2FPI B;  1IBL H;  1QR9 A;  2AGA A;  3GID A;  4XYM B;  4YQW A;  2I8C A;  2R93 G;  2Q7H A;  4O4J B;  1XHZ A;  1XNR B;  2ZE6 A;  1K97 A;  4LWS B;  2X6B A;  3N40 P;  1OWT A;  1DTO A;  1EZJ A;  1KYO F;  3K5H A;  5KT5 A;  4LF7 H;  1IDS A;  2UXC H;  2V58 A;  3H1K H;  5DGB A;  3ZBH A;  4B08 A;  5D1O A;  3OEE G;  3S24 A;  4JUZ A;  3V6K A;  4BIZ A;  5JWP A;  1VS0 A;  1AI4 A;  4O3P A;  3O9O A;  4JZ2 A;  4A3B G;  2BTQ B;  3K5L A;  1K1Q A;  2JDI G;  2OIE A;  1R6N A;  1HR0 B;  1AVM A;  4FFB B;  1AR4 A;  4B3R B;  2ASL A;  5E25 A;  1IBM H;  2ABJ A;  1K7D A;  3OM3 B;  5GTH Z;  2R6F A;  4P9O A;  3M9N B;  1RYS A;  1VQ9 V;  1TWA A;  2J6T A;  3EPG A;  5EWE A;  3GV7 B;  4O4I B;  5BPF A;  4GLX A;  4J9Q A;  2WB1 A;  5CBF A;  3A2F A;  4ZHQ F;  1YEW A;  4MTG A;  3OGC C;  5LXT F;  4JYA H;  4YJ2 F;  4DV2 B;  3U9S A;  4JI7 H;  5C3E G;  1N32 B;  3ZMV A;  4JI6 B;  4I50 F;  1QLE C;  2J6U A;  1GN2 A;  2B63 G;  3AEI A;  5L1I A;  2BCC H;  5LOV B;  5IYZ F;  2COI A;  1XHX A;  3FAV A;  3LSS A;  4DR1 H;  4IHJ F;  1FXV A;  4BY7 G;  1FKA H;  1NTM H;  4TT3 G;  4DV5 O;  1JDE A;  3BY6 A;  2ZDH A;  4F6E A;  1AR1 B;  4DV1 O;  4JI2 H;  3ML0 A;  3T54 A;  1KJI A;  4DL3 A;  2FL4 A;  3JAR A;  2NU8 B;  1Y1V A;  3SPJ A;  1PNM A;  2O57 A;  1RSO A;  1VF7 A;  5B1N A;  1YJN V;  1N36 B;  2IP4 A;  2R7L A;  2RDI A;  4WFF A;  2VRZ A;  1Q6U A;  2EBO A;  3TII A;  1SQV H;  2W57 A;  2HHF B;  1O9H A;  3K0G A;  2DWE C;  3VOU A;  4GX5 A;  2GQR A;  5DGI A;  3OUZ A;  3C3S A;  1SQG A;  1JXL A;  1K3E A;  3J7A U;  5E79 Z;  3RVZ A;  3IGA C;  4NR1 A;  3FDS A;  4ECV A;  4FBU A;  5EZY B;  2ZNI A;  2Y4U A;  2HIV A;  4CKB A;  1YDX A;  1QNM A;  3W1B A;  5KFA A;  5IYB G;  3UO2 A;  4YY3 H;  2W6P A;  1BGY H;  2CTQ A;  2VS0 A;  2EJ3 A;  5IT9 N;  1M5I A;  4F4L A;  3WB2 A;  4FLW A;  3ETE A;  1US6 A;  2Q0O C;  2ADQ B;  5FPR A;  3GDE A;  5HBR B;  1TVK A;  4FBT A;  4DR7 H;  4WF9 V;  3TY9 A;  4JI0 H;  2F23 A;  4HNT A;  2HVK C;  3RGB A;  1XMO O;  1QLE B;  5JQG F;  4EBE A;  3BRC A;  3ABU A;  3MWE A;  3T7A A;  2Q68 A;  1XMQ B;  1N4C A;  1X59 A;  4IGG A;  2YRW A;  2EIM C;  5KHI A;  4QW8 A;  2E2H A;  3NC0 B;  5KT7 A;  4E2L A;  2X6A A;  5FR9 A;  4CH6 A;  3HT5 A;  2CKZ B;  1R3I C;  5KFQ A;  4RUA A;  3LUT B;  4O3O A;  3NUA A;  1BT8 A;  4ECR A;  3WG7 B;  5BPH A;  2BR0 A;  5JCO A;  4O7L A;  1E79 G;  5AG2 A;  1GSH A;  4TUY A;  4FFK A;  1XBL A;  3ZCC A;  3L73 H;  1C3O A;  1GLV A;  2JEX A;  1W59 A;  1EM1 A;  4K6N A;  4WFH A;  5IJ9 A;  1URF A;  3W5O A;  3CCE V;  2BSK B;  4X65 H;  1GSA A;  3HBL A;  2RGR A;  1MZB A;  3UCS C;  4ED3 A;  2EJ0 A;  2RDC A;  4NTX A;  4CZZ A;  5KAI Z;  4LSX A;  4RNM A;  2UUA H;  1VAJ A;  1J5E O;  2YSU B;  4TM5 A;  3MWD A;  3STZ C;  2PI5 A;  3A0R A;  3RGX A;  4YP3 A;  2EIJ C;  4M7E A;  1YF2 A;  3SPG A;  3U0G A;  1I94 H;  2AXT Z;  4RQF A;  2R9A A;  1CKN A;  5IDJ A;  3OTO O;  2W70 A;  3K04 A;  5KMG A;  3VQY A;  4NLG A;  1N34 O;  4QWE A;  4ZHQ B;  4A3L G;  5LXT B;  1S0V A;  4YJ2 B;  3L9D A;  2PF4 E;  2EIM B;  4X1K B;  2VQF O;  4I50 B;  5KFI A;  3MR5 A;  2CNU A;  4MTE A;  4FPP A;  5IYZ B;  3ZRW B;  3I5D A;  5ITZ A;  3ZED A;  3WU2 Z;  2YS8 A;  1Y14 B;  3L4J A;  4IHJ B;  3HKD A;  4A3F G;  4Q44 A;  4BW5 A;  2CNQ A;  3GTQ A;  2WLI A;  2IU3 A;  2LO1 A;  3ZN1 A;  5KKN B;  1H8H G;  3WWH A;  3U55 A;  3CCR V;  2WDT A;  4KHP H;  2HHH H;  2HGS A;  5LA6 F;  4EBC A;  2W0X A;  3TW6 A;  2W6O A;  4IZO A;  3JAL B;  1M4U A;  4QW9 A;  1IBM B;  2HJW A;  5JVD F;  3N41 B;  3H3V H;  2NLJ C;  3FKS G;  5EWF A;  3MR6 A;  2QF7 A;  2XND G;  3W1G A;  3CCU V;  1W2B U;  3DF7 A;  1COW G;  1KEC A;  2UXB O;  4R7C A;  2GBO A;  3IJ4 A;  4ZOL A;  3DAA A;  4MTD A;  2QE7 G;  2ASJ A;  3WWJ A;  3AG4 B;  1ZL8 A;  1I3Q A;  5L1K A;  1O75 A;  5A9G A;  2F4V O;  5HV6 A;  3T1H H;  2QWQ B;  3M8A A;  4X62 O;  4U6P A;  5C4X G;  5CA1 F;  3OHA A;  4AQY O;  2P06 A;  4DL7 A;  2BE3 A;  3RGZ A;  4Q8E A;  4PA7 A;  3U11 A;  4U7N A;  2ADP A;  1GGO A;  2MK3 A;  4FS1 A;  1EZV H;  3GIM A;  5D8D A;  1FXH A;  4EG0 A;  3FB6 C;  4AYB A;  3SJQ C;  4LBE C;  5JQG B;  3LQS A;  4XDJ A;  2DQ0 A;  5E1A C;  2E5L O;  5J2U F;  4DV4 O;  3BQ1 A;  5KFY A;  1BJT A;  4N23 A;  4U3J A;  2PMZ E;  2P4K A;  3HOX G;  3H1J H;  4JYC A;  5LMU O;  4PZ6 A;  4X66 H;  4I4T F;  2FTK A;  3CP1 A;  4IIJ F;  3G8D A;  4Q45 A;  5C5J A;  1R3J C;  4LF6 H;  2WLJ A;  4FFR A;  4QE7 A;  5GON A;  5BYB A;  2XT9 A;  2JJ2 G;  2WE6 A;  3F8N A;  4RAZ A;  1PL4 A;  3AW8 A;  1F51 A;  2KQX A;  1RPR A;  1RYR A;  4JYA O;  1EN6 A;  3OT7 A;  4B3M B;  2EJR A;  4DUZ O;  4GKK B;  2R7K A;  1ZSP A;  4RZR A;  2BQR A;  4HN2 A;  3RFR A;  2COG A;  4YHH H;  2R9R B;  5EBW C;  2I87 A;  5D1O B;  2A1H A;  4DRF A;  3JD4 A;  2V7Q G;  4NTY A;  5LP6 A;  3JZ6 A;  4DR1 O;  3EVK A;  1A0G A;  2XD4 A;  4K8Z A;  3V6H A;  4F50 A;  4UV9 A;  1ARO P;  3K9A A;  2X0S A;  2YS7 A;  1FYJ A;  1I50 A;  4EQ5 A;  4GKJ H;  5BXZ A;  2W6J G;  1SFO A;  3ASO C;  1Q6H A;  3SYA A;  2YW2 A;  3ZMU A;  4FM9 A;  1AIL A;  3CCS V;  1I7L A;  3DC6 A;  3SNO A;  2ARH A;  2QGN A;  2Q73 A;  1WA8 A;  5CBH A;  3MDS A;  1BHA A;  5KFN A;  3Q8S B;  4CC5 A;  4LF4 O;  4BIU A;  2C00 A;  5KFX A;  4DR5 O;  4DR2 H;  3H0G A;  3O65 A;  1NVP D;  3MR3 A;  4RNO A;  5C8Y F;  2AGP A;  2ZE8 A;  4LFA O;  1O9G A;  4FLX A;  5I5Y A;  2L35 A;  1RPO A;  4YY3 O;  3RB6 A;  3KAL A;  2KG7 B;  4O4J A;  1WRV A;  1TWH A;  4LWS A;  5B1A C;  4J9P A;  4LNU A;  4DV6 H;  1RJR A;  5DQI A;  4O7R A;  4QPJ A;  4JI0 O;  3IC9 A;  3E2E A;  5LA6 B;  3RYI B;  3GTO A;  1XIL A;  1CQJ B;  1IXB A;  2UUA B;  1SRY A;  2JRI A;  3K59 A;  5BWT A;  3E8B A;  5JVD B;  3ETG A;  4DR4 O;  1OHH G;  1RSO B;  2DWD C;  1I94 B;  4LH7 A;  4LF5 H;  3L75 H;  3DXR A;  5IE9 A;  2BTQ A;  3SPI A;  3ASO B;  1TAE A;  2VQE B;  4HNA B;  5KFS A;  4UXN A;  4H44 B;  1Z2O X;  3TIN A;  4MV3 A;  4FFB A;  5CA1 B;  3SYQ A;  3ZIA G;  2P67 A;  3BQ2 A;  4ZKI A;  2R8G A;  2DPJ A;  4CC6 A;  1U97 A;  2QEX V;  2EIL C;  4C5A A;  2AZ0 A;  3RB3 A;  1YVW A;  1FJG O;  1I0H A;  4X65 O;  4O3R A;  4O4I A;  2ZM6 B;  4GYC B;  4NZO A;  4R50 A;  5B5E Z;  3M9M B;  1E1Q G;  1I1K A;  1NU1 H;  2PMZ A;  1L0L H;  1AJN A;  5J2U B;  4RNN A;  2IH3 C;  1UPG A;  4MTF A;  5LOV A;  4A5U B;  4I4T B;  5DLF A;  4F4Y A;  4IIJ B;  1SZT A;  4QJF B;  4XBF A;  5IY5 C;  1CE8 A;  3MAQ A;  1A32 A;  1G4Y B;  3HKE B;  4TSF G;  5BZB A;  3KKY A;  1Y76 B;  1HNX H;  3E22 B;  3N6R A;  3A0H Z;  3ZHU A;  2Z3Y A;  4OX9 B;  5J2T F;  4DK0 A;  2MW2 B;  1WCM G;  3F5W C;  3HR0 A;  4DV3 O;  4JI1 B;  1GYF A;  5EBL C;  1GH6 A;  2CTR A;  3T2M A;  3H01 A;  4DR6 O;  3APQ A;  2P4V A;  2WPD G;  2A79 B;  2YC0 A;  3ZHQ A;  2HHF A;  1FFT B;  4DW1 A;  5KHG A;  1Z5W A;  4LC1 A;  3CRC A;  1JFF B;  2J9G A;  2Y0S E;  3RJ0 A;  2QB5 A;  5LMN B;  2UUB B;  2DYS B;  1N0J A;  4O4H F;  4KHP O;  4M0J A;  1KEE A;  3SYO A;  3CRM A;  4RO2 A;  3G67 A;  5EZY A;  1NVP B;  2DAA A;  3JD1 A;  1S77 D;  4BW9 A;  3NBY B;  3GTM A;  1AR5 A;  4MS2 A;  4X89 A;  3LNM B;  4F6R B;  3K3V A;  1XNQ O;  1M57 B;  4JAA A;  1IVS A;  3EHB B;  5FL7 G;  4X1I B;  3G6E V;  4HZ3 A;  4BWA A;  4ICG A;  5DG7 A;  4IT5 A;  2Q7E A;  5BY1 A;  1Z2G A;  4O3S A;  2ZKO A;  4GCZ A;  3K06 A;  5C8Y B;  4CKC A;  3CCM V;  4XDK A;  2IJI A;  2NN4 A;  2V9W A;  1LNQ A;  5IY5 B;  1HNW O;  5T14 A;  2E74 B;  2ITD C;  5KAF Z;  2Y4T A;  5ITZ B;  3HKD B;  3UZO A;  1EN4 A;  4JV2 A;  1YTF D;  3U10 A;  3OD4 A;  4W4K A;  2ZD9 A;  5I5S A;  3CRA A;  5LGN A;  4DV2 H;  3JSN A;  4P9P A;  1XUQ A;  1T36 A;  1Y4M A;  1A0I A;  3JD3 A;  2Z04 A;  2JJ1 G;  4FM2 A;  4DLK A;  1N32 H;  4JI6 H;  1V54 C;  1EZ1 A;  3CXH F;  2OTL V;  3KYH C;  4GT1 A;  2BSK A;  3T1C A;  3Q8Q B;  2FP4 B;  1LUW A;  1OCZ C;  4KXR A;  4TV9 A;  3STL C;  4GX2 A;  5KHK A;  2AHY A;  4DL6 A;  1K83 A;  1XRE A;  2Y4R A;  4PDM A;  3U0Z A;  1KP2 A;  3PW4 A;  5IP9 G;  4B3T B;  4CHI A;  3N2K B;  3TCU A;  1XEQ A;  3OMI B;  4NXM B;  4ED1 A;  4HYO A;  1N36 H;  5J9P C;  4EFE A;  1G1X B;  3SDL A;  5JUM A;  2IM9 A;  2R92 G;  1THZ A;  3CEI A;  1WH2 A;  4A2B A;  4ECT A;  2UVR A;  5KG5 A;  2R7Z A;  1MZE A;  4ZHQ A;  4JI4 O;  5LXT A;  1UFI A;  4YJ2 A;  1I2K A;  4TQR A;  2P5O A;  2VUM G;  4X1K A;  1ULZ A;  3VPB A;  3BA9 A;  2NR5 A;  4GZR B;  4I50 A;  4GKJ O;  1IOV A;  3ABK B;  1V55 C;  5IYZ A;  3HKB B;  3L70 H;  3FD9 A;  3ZRW A;  1H8E G;  4BR6 A;  2ZDG A;  4JV5 H;  4O84 A;  5KFL A;  5KFV A;  4J9K A;  2W9A A;  4LF5 B;  1SA0 B;  3ASN B;  5DIS C;  3CMA V;  3RR5 A;  2WWW A;  2LFS A;  5L9X A;  3B8N A;  5CE8 A;  3N42 B;  4DR2 O;  4E4T A;  5J2T B;  3N8D A;  1DV1 A;  2FYU H;  3LP8 A;  4MV9 A;  1C30 A;  2CFM A;  2FK2 A;  4MW3 A;  3JAL A;  2W9C B;  4Q8F A;  5DAA A;  2JA7 G;  1KJJ A;  4HNV A;  1OCZ B;  1GTO A;  1OCO C;  4GC6 A;  5I60 A;  2Y0S A;  2ASD A;  2RQ6 A;  4Q6G A;  3GLK A;  3QNE A;  3U54 A;  1NR1 A;  4PI0 A;  5KG6 A;  4O4H B;  5I47 A;  1F4M A;  2YU9 A;  1ZHS A;  2XIG A;  2BQ3 A;  4Z1M G;  2HFE C;  3J80 N;  4K35 A;  2K9P A;  4PDB A;  2HKO A;  2P7T C;  3LDD A;  2UXN A;  4D6T H;  4FM0 A;  1JDB B;  4QWC A;  5IYC G;  1NKD A;  4UFZ A;  4A3J G;  2UVW A;  3HOW G;  4ME6 A;  4JYY A;  3KAK A;  3RV3 A;  1BGW A;  3H9V A;  4O2A F;  3RVY A;  1PP9 H;  1JX4 A;  4IRD A;  3GB7 C;  1YTF B;  1F4N A;  5JQG A;  1L1F A;  2UVU A;  3HO8 A;  3DC5 A;  3JCU Z;  1KC7 A;  2B1G A;  5DG8 A;  4YR2 A;  4ASU G;  5BMV F;  1PNK A;  3Q8P B;  1PPJ H;  2IU0 A;  2NVY A;  5F9N A;  2WLK A;  1GN4 A;  2HGW A;  4NZN A;  2DJV A;  2NU9 B;  4DK1 A;  4ED6 A;  2IJH A;  3CVZ A;  1CEZ A;  1CQI B;  2FB9 A;  3Q1K A;  3FKI A;  4LFC O;  3F5T A;  4D7S A;  5I5U A;  5KFF A;  3OTF A;  4LNU B;  2B1I A;  2Q2T A;  3CB2 A;  3D3Q A;  3RYF B;  2R84 A;  4DV0 H;  1BQZ A;  3LDC A;  1OCO B;  5CA0 F;  4IR9 A;  4CMF A;  3RIZ A;  3PO2 G;  1FAF A;  1RFY A;  3ZRV A;  2ZCE A;  1IBK O;  4WBN F;  4I7H A;  1A3G A;  2W7P A;  3C90 A;  4TV9 F;  3DXR B;  1YXB A;  2WTF A;  3AK3 A;  5A2Q N;  1JLL B;  1AI7 A;  5KFT A;  1AJP A;  3QTC A;  1NT2 B;  1I1L A;  4J41 A;  4FFL A;  5FNV F;  2JA6 A;  4DR3 O;  1IOW A;  4MVZ A;  1H2K A;  1IYE A;  1GM8 A;  1SF9 A;  2ZIO A;  3WB1 A;  2YRX A;  3GTJ A;  1EN5 A;  4H37 A;  3T9A A;  1XNR O;  3OMA B;  3BAB A;  4J9O A;  3Q2O A;  3QZ7 A;  4UCU A;  1U96 A;  4MW8 A;  4R8U B;  3DTU B;  4DV5 B;  4UVA A;  3OEH G;  2XGP A;  2CQY A;  4DV1 B;  1L2Z A;  3WO1 A;  4UUJ C;  3Q4H B;  2FJZ A;  1Y67 A;  4LFB H;  2KG7 A;  3TY8 A;  4JI5 H;  3K5O A;  3SJB C;  2QK4 A;  2LGQ A;  3X2Q B;  5C1O A;  2CDY A;  3T9D A;  2PYJ A;  1S97 A;  3GQC A;  4CH3 A;  4A93 G;  3BPZ A;  2CUG A;  2UXD H;  5LA6 A;  3RYI A;  2GLT A;  2LFR A;  2LJ2 A;  2Q67 A;  1HR0 O;  1BCC H;  4B3R O;  1JVM A;  2CGN A;  3HOV G;  4JXU A;  3WG7 C;  5JVD A;  1MSD A;  3UKM A;  2ZR3 A;  4C7U A;  1Y1V G;  1SET A;  2IH1 C;  2JGD B;  4TQS A;  4GX1 A;  4Z2W A;  2PBZ A;  4HNA A;  1KKC A;  5IJ0 B;  3RAX A;  4B3M H;  4GKK H;  1R1B A;  5CA1 A;  1XMO B;  3TJT A;  1NI8 A;  4EBD A;  1KKD A;  1VAR A;  3ICX A;  1N0N A;  2R85 A;  4JV5 B;  4O2A B;  5L3G A;  3T1Y O;  4Q43 A;  3PW5 A;  4JI3 O;  1KU9 A;  2OCC C;  4J9R A;  5EK0 A;  1JKJ B;  1AI6 A;  3ZRS A;  2WAQ A;  4ECX A;  3J80 W;  1OJH A;  2Q5Z A;  2AW9 A;  4PDL A;  3PW7 A;  2G38 A;  5KUM A;  5J2U A;  4DUY H;  5BMV B;  4QNH B;  4CKE A;  1ZHQ A;  2Q7G A;  3CXC U;  1P8L A;  4ECS A;  2WLL B;  5KG7 A;  4I4T A;  3BVO A;  4IIJ A;  4QJF A;  5B3S C;  2A7W A;  2FLP A;  2XAJ A;  3HKE A;  4O3Q A;  2GSM B;  1QLN A;  3JRW A;  1Y76 A;  2NUA B;  3E22 A;  1JCH A;  3MWM A;  4JI8 H;  4CS2 A;  3AG1 C;  5KFO A;  2R8I A;  3GIP A;  2Q7D A;  5KG2 A;  3D3I A;  3RB0 A;  5H5N A;  1CPY A;  2JIZ G;  5CA0 B;  1B6S A;  2UU9 O;  3V4S A;  3WWI A;  2XTA A;  3FB8 C;  4B3S B;  2YZL A;  1EUC B;  4QIW F;  1FXK C;  1T3N A;  3BA8 A;  4WBN B;  4CS3 A;  4UCO A;  2DZD A;  4O83 A;  5C1P A;  3G6X A;  1P7G A;  4TV9 B;  3H1H H;  5D1P A;  1N8R W;  3AG7 A;  3ZHT A;  1JFF A;  1H2L A;  2GUZ B;  3OTO B;  3I56 V;  2H8P C;  1D5N A;  2CW8 A;  5FNV B;  3B4S A;  3PFF A;  3FX7 A;  5EYP B;  5CA3 A;  1VBG A;  1PD3 A;  3AG4 C;  3AK1 A;  2R9I A;  4F6R A;  1XMQ O;  5KT6 A;  3N2G B;  3KHG A;  4I5S A;  2OCC B;  1VQ5 V;  3K3W A;  1YIT V;  2NU7 B;  1QVG U;  2H3O A;  3K5N A;  1IUR A;  1QBZ A;  4X1I A;  2JK5 C;  4GLW A;  4YIO A;  5A2Q W;  2XAH A;  3P3N A;  5DED A;  2VQE H;  4ECU A;  2MCT A;  3L2P A;  2ZNJ A;  5C8Y A;  4DV0 B;  4RZQ A;  4K0K O;  1V51 A;  2IA6 A;  5B3S B;  1AP6 A;  1S0M A;  2VOB A;  4JV0 A;  3AG2 B;  5L1J A;  4X64 B;  2XCP A;  2ZXW B;  4PZ8 A;  5I5W A;  3QO8 A;  2Z0A A;  3AG1 B;  1K9M W;  2ZM6 H;  3J81 N;  3C0F B;  3MFH A;  2OTJ V;  3TIG A;  2UXB B;  3TET A;  2OWO A;  2F95 B;  1E4G T;  4BBS G;  2W6Z A;  1OBD A;  4EGJ A;  1FXK B;  3JAS B;  2QKS A;  2QTS A;  2V5A A;  4X62 B;  4UCV A;  4MA5 A;  3RYC B;  4B7K A;  1IBL O;  4LF8 H;  4AQY B;  1QU7 A;  3RAQ A;  1G2W A;  3OUS A;  3RWR D;  3UYY A;  1M9N A;  3JAM N;  4IRC A;  3V4Z A;  1NH2 B;  4LF9 H;  5JJN B;  3T9E A;  4OPH A;  1PV0 A;  4WD3 A;  4OX9 H;  3I12 A;  1LUV A;  5IWA H;  4LF7 O;  1HP8 A;  3CSX A;  3D36 A;  3N2K A;  2AZ2 A;  3GTK A;  4JTA B;  4JI1 H;  1V4Y A;  2OIG A;  4A3E G;  3SGI A;  2QWN B;  1T5E A;  2UXC O;  3RFC A;  5BWX A;  3ABM C;  1ZET A;  4DV4 B;  2W9B B;  1WN7 A;  4BAY A;  4LFB B;  1ZAU A;  1HDJ A;  2LW7 A;  4JI5 B;  5LMU B;  1XOU A;  4IYI A;  3R9R A;  3GWK C;  2ZGI A;  5L3E A;  2W6Q A;  1WNS A;  1S10 A;  4PZ7 A;  3LML A;  1YCI A;  3FYE B;  5LMN H;  4MV7 A;  2UUB H;  2UXD B;  4LP8 A;  5CBG A;  1W0K G;  4PI2 A;  1IBM O;  5IT9 W;  2EZO A;  1P7B A;  3HKB A;  3DGE A;  2PN1 A;  1H2N A;  5BWW A;  4ECQ A;  1SA0 A;  2L6L A;  3FMA A;  4RB1 A;  2AQ4 A;  2QJ1 A;  1AI5 A;  4O81 A;  2W0F C;  3PN1 A;  5J2T A;  2JEF A;  4LH6 A;  1DK1 A;  5IYC O;  2W9C A;  2IJK A;  4JI7 O;  3J7A K;  1S68 A;  2Q9L A;  3VQX A;  3VA7 A;  3ZRX A;  3ZHV A;  2PY5 A;  4TQF A;  3GTL A;  4PEL A;  1KJQ A;  3OFN G;  2PYL A;  4MV1 A;  2DN9 A;  2Q8V A;  5D5P A;  1NBM G;  3RTX A;  4HYK A;  3BEH A;  1MZF A;  2XCA A;  1FKA O;  2GPW A;  2NVX A;  4LF4 B;  4O4H A;  4MV4 A;  4CBC A;  1K4D C;  2DE0 X;  2YYA A;  3EYY A;  1WR2 A;  3PW0 A;  2ZQM A;  3ABM B;  4PA4 A;  4JI2 O;  4ZIB A;  2HIX A;  5CAE B;  5KLV H;  4NVP A;  4ABM A;  4NB5 A;  2AHZ A;  1DF5 A;  4DUY B;  3E5N A;  3AYH B;  4K3A A;  1Q7Y W;  1HNZ H;  5LHG A;  3H40 A;  5KA6 A;  4A3K G;  1L0N H;  3JAW B;  1FD9 A;  3ABT A;  2V1D A;  2OCH A;  4YXW G;  4CS4 A;  1Y1W A;  4J11 A;  5KFG A;  1S0N A;  2M05 A;  2FML A;  4PWQ A;  1S5L Z;  4MVO A;  4JI8 B;  4X1Y B;  5L3B A;  4B3T H;  1B6R A;  2FLN A;  2PTM A;  4NXM H;  4J80 A;  5FPO A;  3QO5 A;  5JVL A;  1SQQ H;  2QTO A;  3GTG A;  2W6M A;  4Q20 A;  3RT3 C;  4DR4 B;  1PX2 A;  5KFD A;  3HKZ E;  1YI2 V;  4I0X B;  2WLH A;  2PGG A;  3GII A;  4DR7 O;  3CYO A;  4OGQ B;  1E4E B;  3RYF A;  5IYD O;  2HJD A;  5LYJ F;  3LUL A;  2X7R B;  3TY5 A;  2RMK B;  2P22 C;  1UC9 A;  4DIM A;  2C28 A;  4F4X A;  1VBH A;  2PUS A;  2FE3 A;  3WNZ A;  2FK1 A;  2RJZ A;  1B06 A;  3G80 A;  2IJJ A;  2H94 A;  1DGS A;  4G2K A;  1S03 G;  2W8K A;  1S5H C;  1FJG B;  1HW7 A;  5KG4 A;  1W93 A;  4Q4D A;  3OR7 C;  2C2A A;  3N27 A;  1WJZ A;  4UVB A;  3G71 V;  4CH5 A;  1H2S B;  2D2C B;  3KAJ A;  1NTZ H;  4EKW A;  2DYS C;  1RK6 A;  3OMN B;  3TXQ A;  2FK3 A;  3JAM W;  2YI9 A;  1K33 A;  3L74 H;  3PR4 A;  1M57 C;  3MFI A;  2DQ3 A;  3KZI Z;  4R8U A;  4O86 A;  3R5H A;  2ETN A;  3A8T A;  1M1K W;  5BR8 H;  3VPD A;  3UT5 B;  2UUA O;  3Q4H A;  2VUG A;  3W7S A;  2CAZ C;  2JEG A;  4DV3 B;  3B40 A;  1RM1 C;  1KT8 A;  1I94 O;  4FLT A;  1K34 A;  1I7F A;  3VOT A;  2UVV A;  4LF8 B;  2V4D A;  3QG5 A;  3WFV A;  2FPP B;  1KJ8 A;  1Q8I A;  2Z5U A;  4FLV A;  4P30 A;  2YXH A;  1XDN A;  1BL8 A;  3QZ8 A;  3L71 H;  4ED7 A;  1AJQ A;  2JS3 A;  4LF9 B;  1I1M A;  1KUT A;  4DL2 A;  1Q5O A;  1GKF A;  3ZX6 A;  4YIP A;  3HB9 A;  2E2I A;  5CB4 F;  5IWA B;  3T5J A;  1WB8 A;  5LHH A;  3PVX A;  3CC2 V;  1XNQ B;  4HR7 A;  5KFZ A;  5HFM A;  1N33 B;  3BJY A;  3ZMS A;  2JGD A;  1YIJ V;  2ZM6 O;  1VIB A;  1UJW B;  1MA1 A;  4RUC A;  5IJ0 A;  2HEP A;  2HR3 A;  2C2D A;  3HKC B;  3JAT B;  3K57 A;  2HHH O;  3P30 A;  1K5S A;  4JTD B;  4MV8 A;  1S72 V;  3IG0 A;  2A06 H;  4D7T A;  3CJH B;  2QM8 A;  2HG5 C;  3D36 C;  3CD6 V;  1HNW B;  5JH7 F;  3VNN A;  3UZB A;  3JD2 A;  4A3G G;  4O2A A;  2ATL A;  2FLL A;  3GIQ A;  3OAA G;  4XX0 B;  2J6S A;  3RB4 A;  4MSW C;  4NXN B;  4B7E A;  3RYH B;  1Y66 A;  1WAZ A;  2A0L A;  3T5H A;  3DSQ A;  3ZHR A;  1RM1 B;  5B1B C;  4O7Z A;  5BMV A;  3T1H O;  1GSO A;  1VF6 A;  3IAY A;  2WLL A;  3UQ8 A;  1GMG A;  1XL4 A;  4EEQ A;  2M7W A;  4G3I A;  3AX6 A;  3ABK C;  3IFX A;  1QQC A;  2R87 A;  2P90 A;  1OCR C;  4FLZ A;  4ZI7 F;  5LYJ B;  1PM9 A;  4DV5 H;  5KA5 A;  4FZ1 A;  3GTP A;  2V4R A;  2HVS A;  4DV1 H;  3CX5 F;  3ASN C;  3SR2 C;  2FMA A;  2C22 A;  3GVM A;  2M6Y A;  4UB8 Z;  5CA0 A;  3KG2 A;  3CHX A;  4RUE A;  4I9Q A;  4HQ6 A;  3K5I A;  1Z5V A;  3WB0 A;  5I5T A;  5KX5 F;  2W71 A;  2EIK C;  4YJ3 F;  1HNZ B;  4WBN A;  5DLG A;  4I7Z B;  4DO2 A;  4X66 O;  4QIW E;  2R70 A;  4WHX A;  4RAY A;  4IL6 Z;  4LF6 O;  1EUD B;  2GUZ A;  4OXS A;  4TV8 F;  4U7O A;  3JRX A;  5FNV A;  1EKV A;  2XGQ A;  4KP4 A;  4JI4 B;  5EIB D;  1KD1 W;  2X0L A;  4DL4 A;  5EYP A;  5H9C A;  5EC1 C;  5CM0 A;  5LGU A;  2C2R A;  3KRE A;  4YHH O;  3N2G A;  3K0D A;  2QWO B;  4R7R A;  1SQP H;  3CCQ V;  1XQ8 A;  2UUC B;  1R73 A;  3RUP A;  1M0T A;  3E35 A;  4EFB A;  3ZMT A;  1NQT A;  5B1B B;  1EKP A;  1I08 A;  4JAV A;  3THO A;  3E8H A;  4I55 A;  1TA8 A;  4LSA A;  3OR6 C;  1XMO H;  2N05 A;  1AUV A;  2EIN C;  2YIB A;  1G6U A;  3QFF A;  4HBN A;  1RJP A;  1VP7 A;  1ZTE A;  2HJF C;  2FB5 A;  1TWC A;  1OCR B;  3G6B A;  4J10 A;  4LR3 A;  5KFR A;  2JEJ A;  1HWY A;  3IC7 A;  5DQG A;  3RBE A;  3K5M A;  3R5X A;  2OYQ A;  4Q4C A;  3Q8R B;  4LMY A;  3ZN0 A;  2ZIN A;  3K08 A;  4O2B F;  3K79 A;  1FXK A;  5CB4 B;  2EIK B;  3JAS A;  4O4L F;  4TQD A;  2ILM A;  4NXM O;  4O7N A;  5KFM A;  3RYC A;  3KCY A;  2N04 A;  4NYK A;  5EIB C;  4PHZ A;  3T4Z A;  2ZJT A;  4M9U A;  3ZHS A;  3JZF A;  3G8C A;  2O03 A;  4WCE V;  2R8K A;  3JAK B;  5KFH A;  3BQ0 A;  3UM7 A;  4XZ3 B;  4FK5 C;  1L8D A;  2QM7 A;  1A9X A;  4O7S A;  2RNB A;  5FD6 A;  4DV6 O;  4PA3 A;  3PO3 G;  1LR1 A;  5C44 G;  1S9F A;  4HAM A;  2DWC A;  1AP5 A;  2NU6 B;  3T9B A;  4O7T A;  3PJS K;  5BR8 B;  4EB6 B;  3HPL C;  4B3S H;  3QQM A;  2W9B A;  5JH7 B;  4RU9 A;  4DV7 B;  1JJ2 U;  5JQW A;  4RAI A;  4RWU A;  3HB3 B;  1YZB A;  2X6C A;  4LF5 O;  1Y74 B;  1I6U A;  4RB2 C;  3OTO H;  2BOB C;  3SYC A;  2XAS A;  2OT5 A;  2YZM A;  1N34 H;  2EIN B;  1SC5 B;  1SYX B;  3CME V;  1GK9 A;  4JZG A;  4UV8 A;  5KFW A;  3N44 B;  3JZI A;  2ODM A;  1SQF A;  2YIC A;  2ZIM A;  1KP3 A;  3RV4 A;  3HOY G;  2RN9 A;  1VQ7 V;  4XYL B;  2YDE A;  2ZR2 A;  3OUF A;  3S3X A;  3CCJ V;  4HNU A;  4JGS A;  5FLX N;  1VQN V;  2ZDQ A;  3FYI B;  1IBK B;  4ZI7 B;  2ZT9 B;  2JA5 A;  1AN7 A;  3OSP A;  3FKI G;  3X2Q C;  1KB9 F;  4F4W A;  2IBK A;  2E75 B;  2W6N A;  3H4D A;  3K58 A;  3B2E E;  1XK5 A;  2WYO A;  2EUL A;  3B09 A;  2BTO A;  5KX5 B;  3M99 B;  4DR3 B;  4QIW A;  2Q2U A;  1X9N A;  4X64 H;  1KUQ A;  2R93 A;  1CS0 A;  2DYR C;  1FS0 G;  4EYH B;  3OHB A;  1WP8 A;  3E8F A;  4CH4 A;  4F4Z A;  4TV8 B;  2UXB H;  2YEV B;  1P4R A;  1HNX O;  3FB7 C;  2GTS A;  4PA6 A;  2LP7 A;  4J9Z B;  1FVI A;  4DL5 A;  5KFE A;  5IYD G;  2Y48 A;  5EDW A;  2F4V H;  2IW5 A;  1SQX H;  2E76 B;  2D3O W;  4X62 H;  4BWS C;  4FE2 A;  2JA6 G;  3W7X A;  1I5Y A;  4U7C A;  2Q69 A;  5KG1 A;  4AQY H;  4ED0 A;  1SES A;  3JAW A;  2VQD A;  3E89 A;  2JEU A;  4MVM A;  2WLM A;  2B9Z A;  3TQ1 A;  4OPA A;  1EFR G;  4FS2 A;  4X1Y A;  5LHI A;  4I55 F;  2VA3 A;  3T9F A;  1B04 A;  4PD4 F;  3PZP A;  2C2E A;  2E5L H;  4DV4 H;  3ZS8 C;  4FJC C;  2C35 B;  2ITC C;  4JAU A;  2QYZ A;  1YJ9 V;  2ZE7 A;  1PNL A;  1QCE A;  5KFJ A;  5LMU H;  2YCH A;  2Y69 C;  3M9O B;  4I0X A;  1N56 A;  2LQT A;  2R82 A;  1VF6 C;  5L3D A;  2QKC A;  3R65 A;  2R8H A;  1B3Q A;  2PVP A;  4NYE A;  2QM4 A;  1E4E A;  1VQ4 V;  1Q82 W;  4O2B B;  4KUM A;  2R86 A;  4O4L B;  1SS3 A;  3CPW U;  2YIB D;  1P16 A;  5F2V O;  3E86 A;  3TW7 A;  3WO0 A;  4U3F H;  4DUZ H;  4NTW A;  2DYR B;  2DIK A;  4UCS A;  3ZJZ A;  1Q43 A;  2VPS A;  2B63 A;  1CP9 A;  4G27 B;  3HXL A;  2YXY A;  5LGT A;  1JX9 A;  1Q3E A;  4YBZ B;  1UNN C;  3T1Y B;  4PDV A;  4JI3 B;  2RGV A;  1IX9 A;  3G4S V;  4DV2 O;  2R7M A;  2LGW A;  1K73 W;  3LDE A;  1N32 O;  2OLS A;  4JI6 O;  3R23 A;  2FKL A;  3CRQ A;  5I5X A;  1GM9 A;  4MA0 A;  2RDJ A;  3CRR A;  1VMG A;  2KB1 A;  4CMD A;  3P3P A;  1IXM A;  1OBG A;  1NH2 D;  2R8J A;  3M7M X;  5B1O A;  4FFO A;  4LF4 H;  3MJF A;  3APO A;  4RB3 C;  1VKZ A;  2QWP B;  3NR7 A;  4DR5 H;  1I7N A;  5KT2 A;  2Q4P A;  3UT5 A;  4YAJ B;  1KBH A;  3QWU A;  4LFA H;  2Y69 B;  1MNG A;  4G28 B;  5L3C A;  2UU9 B;  3MR2 A;  1NJI W;  1N36 O;  1EKF A;  2JGU A;  1RK5 A;  2YL2 A;  3ETJ A;  3AG2 C;  2GTA A;  2ZXW C;  3CQZ A;  1W0J G;  3SPC A;  1JIH A;  4MVU A;  3BHP A;  3H1L H;  4I9W A;  4WFE A;  1J5E B;  2V4Q A;  4MAM A;  2PI4 A;  1SER A;  1T94 A;  4AYB E;  5FLX W;  2IMW P;  4DR4 H;  3K03 A;  4J9M A;  3T5L A;  4JV5 O;  3RBZ A;  3KHR A;  5K2M A;  4X20 B;  3GIK A;  3CS5 A;  4KFM A;  2YID A;  4J42 A;  5C93 A;  1JR9 A;  1E4F T;  4ETS A;  1RP3 B;  2K1E A;  1N34 B;  4QSH A;  4QGP A;  4P2Z A;  3HKC A;  3ZMZ A;  3JAT A;  4PBC A;  2XUM A;  4KL1 A;  2ATK C;  4K0K B;  2KSD A;  2HGX A;  5KFB A;  1R3K C;  4DRX B;  2VQF B;  4A2A A;  3CCL V;  3CJH A;  1S5J A;  3DTG A;  1TUB A;  4IRK A;  4FFN A;  4RB0 A;  1FJG H;  1K4C C;  3GJX B;  3HOZ G;  4X8A A;  4YR0 A;  3A0B Z;  3RYH A;  4BIO A;  5KHJ A;  2VWK A;  4I55 B;  3TXS A;  3KHH A;  5KHH A;  2COJ A;  4BBR G;  3W7W A;  1WB7 A;  3TQT A;  3LSQ A;  1RJQ A;  1VQL V;  3FFQ A;  3SYP A;  4ZQI A;  3C3T A;  2GPS A;  4B3S O;  3VQV A;  4W4L A;  2DLN A;  2HP8 A;  1BZK A;  4NKG B;  3BCC H;  1IBL B;  2GV9 A;  5KFK A;  2NNU A;  4O7W A;  1TUE B;  4ZBM A;  5LYJ A;  3LNN A;  3VBB A;  2XOK G;  1ZUQ A;  4J9L A;  1Z2N X;  5BWR A;  2CH7 B;  3GB8 B;  3SJC C;  4Q0Y A;  3I4M G;  1XL6 A;  1VQ6 V;  4J9N A;  4XDL A;  5LL6 Y;  3OE7 G;  2F4V B;  4O7Y A;  4NZM A;  4LF7 B;  4DV3 H;  2P6J A;  5KUK A;  3CSW A;  4JV1 A;  2UXC B;  5KFU A;  1KQS U;  4DR6 H;  3LWB A;  1SQB H;  1IZ3 A;  2DPI A;  2UXX A;  3T5K A;  3OUU A;  5CR5 A;  1PK8 A;  1D5A A;  4DV0 O;  5BWU A;  1YJW V;  2F1M A;  4FFP A;  1Q6I A;  2GHY A;  4R8C A;  4MVQ A;  1QR8 A;  4FLY A;  4AI8 A;  2E5L B;  1F7Y A;  4X64 O;  3TEK A;  1GO3 F;  1XNQ H;  1ENV A;  4DQN A;  3B8M A;  1N33 H;  5BWV A;  5KFP A;  1GN6 A;  2YWV A;  5DG9 A;  2OH2 A;  4IWX A;  1R3L C;  2CZG A;  2N74 A;  1XDC A;  3ABL C;  5HNE A;  1Q86 W;  4AIL C;  1P84 F;  4TOI A;  5EOY A;  2QSA A;  4PA9 A;  3OSN A;  5CN0 A;  3N6X A;  2EIJ B;  2DW4 A;  4J9Y B;  4IWY A;  3L72 H;  1FFX B;  2YIA A;  4JYA B;  1GM7 A;  4DUZ B;  4MTO A;  1SZX A;  1DIK A;  4JI7 B;  1HNW H;  4X88 A;  2ZDI A;  1JQ0 A;  4Y8V B;  5JJE B;  4RQE A;  3NGD A;  1H2G A;  5KT3 A;  1XI1 A;  4NXN H;  2DAB A;  1DAA A;  4DR1 B;  1I2L A;  4MV6 A;  5CB4 A;  2VR1 A;  3IN5 A;  4JI2 B;  4GC7 A;  2I80 A;  2DMX A;  4FGR A;  3SJA C;  1EYZ A;  1BQ0 A;  1EHI A;  1E1R G;  4LFB O;  2CK3 G;  2VPQ A;  1WPX A;  4JI5 O;  5F9L A;  2WSS G;  3JAK A;  5L1L A;  4N21 A;  3S3W A;  1CKM A;  2GDS A;  1ZX3 A;  2Z02 A;  2Y0I A;  2UXD O;  1KC8 W;  4DR5 B;  1MMM A;  4J9S A;  4E4E A;  4EB6 A;  1G8M A;  3CE2 A;  1H2M A;  3U9T A;  3QO7 A;  4TUY F;  4LFA B;  3VQW A;  5JH7 A;  3OW2 U;  3GWO A;  2R72 A;  3ABL B;  2LW1 A;  4O3N A;  4DXW A;  4YY3 B;  1Y74 A;  4GUN A;  2ALZ A;  4FLU A;  5JJJ B;  1TWF A;  3RBD A;  4JI4 H;  1Y1W G;  3JSL A;  4DR7 B;  3KTM A;  2W8L A;  5FJ8 G;  2GQS A;  2CGO A;  4JI0 B;  2IBZ H;  4B3M O;  4GKK O;  1WP7 A;  5GW7 A;  2VWJ A;  3H0G G;  4BXX G;  1Q90 D;  4YB8 B;  5I5V A;  2YUA A;  1JMK C;  1CXZ B;  3MHH C;  2QWR B;  3H4B A;  2UUC H;  4J7J A;  4DW0 A;  4ZI7 A;  4PJ0 Z;  5DN6 G;  2YZN A;  1MG1 A;  2Y0P A;  4H0L B;  3GV5 B;  3CEB A;  1KTA A;  4MT8 A;  2HVQ A;  2X5R A;  3T9C A;  1BS3 A;  1NZ6 A;  3CWB H;  2HG8 A;  1N48 A;  5KG3 A;  4C5B A;  5KX5 A;  1Y6X A;  4DUY O;  3D8C A;  1VQP V;  2A9H A;  4YJ3 A;  2ODT X;  1S3J A;  3SI8 A;  3H20 A;  3I4N G;  1NTK H;  5K1X A;  1MOF A;  1ORQ C;  3J81 W;  4FVM A;  2EZP A;  3GIL A;  1GRJ A;  4TV8 A;  4X65 B;  1BSM A;  3FAV B;  2YEV A;  1VQ8 V;  1P49 A;  3E83 A;  4FIP C;  1X4T A;  4JI8 O;  2FPG B;  4UB6 Z;  3EPI A;  3RW0 A;  4A3I G;  1WSC A;  4A3C G;  1GN3 A;  4C5C A;  3MHS C;  1KMI Z;  2JA8 G;  3JAR B;  4FU0 A;  1VF5 B;  5JCO C;  2AGO A;  3CC4 V;  2XAF A;  3ETQ A;  2EJ2 A;  5LBQ A;  3UO3 A;  4ZOL F;  4RUF A;  3N43 B;  2XAQ A;  3EFF K;  3SPH A;  3NXS A;  4UVC A;  2YI8 A;  2JVD A;  2DOS A;  1DV2 A;  5H80 A;  1VQM V;  4DV7 H;  5EC2 C;  2VA2 A;  3H1I H;  1AUX A;  4H13 B;  4DR6 B;  2W6I G;  1KJ9 A;  4LFC H;  4MVS A;  4O2B A;  1TVK B;  3CC7 V;  1D2D A;  2VQE O;  5KFC A;  4CE5 A;  2WA4 A;  1EBO A;  4O4L A;  5DGH A;  4O7V A;  4IAJ A;  1YHQ V;  4KHP B;  2V59 A;  5HFL A;  4WFA V;  2HHH B;  3KHL A;  1M90 W;  1DLB A;  4WFB V;  3F7Y C;  5B1A B;  3I55 V;  1PL0 A;  1K1S A;  1K5Q A;  1IBK H;  4ED2 A;  1ZWI C;  3ORQ A;  5K1P A;  1BE3 H;  4JF3 A;  2CNV A;  4FFM A;  5L3F A;  4MTX A;  1VQK V;  2CW7 A;  3LSU A;  5GON F;  4QPK A;  1WCM A;  2RF4 A;  4DR3 H;  4MVR A;  4TUY B;  5IYB O;  3T1H B;  5D5Q A;  4BY1 G;  3HOU G;  1JA8 A;  3K9S A;  1TUB B;  3W7U A;  4E6N A;  4J0M A;  4LF8 O;  1SEI A;  3VPC A;  4JPR A;  4A3M G;  5IJ9 B;  1XNR H;  3NBZ B;  1S0O A;  2XC9 A;  3AK2 A;  2XHB A;  4ECZ A;  4YAK B;  4LF9 O;  1M6V A;  5LP6 F;  4C2M A;  1MAB G;  3GIJ A;  1SKV A;  3SE7 A;  4OX9 O;  5IWA O;  4FM1 A;  2P0A A;  2EIL B;  2XCL A;  4JI1 O;  3HKZ A;  4IYH A;  2AGQ A;  3ORR A;  1S76 D;  3G6V A;  4IR1 A;  2EX3 A;  5DEC A;  2YS6 A;  1TGO A;  5FLM G;  1UC8 A;  1N33 O;  3RF2 A;  1NS1 A;  1R6T A;  2XAG A;  5H6Q A;  1CKN B;  2YXL A;  4X66 B;  4J7K A;  2WAM A;  3KCX A;  2ZDI C;  3MD0 A;  5H2F Z;  4LF6 B;  5KMG B;  1M56 C;  2F93 B;  3B77 A;  5LMN O;  2UUB O;  4L8J A;  2ZE5 A;  4QWD A;  1H38 A; 
#chains in the Genus database with same CATH homology
 1HR0 H;  5EYP B;  5LL6 b;  4B3R H;  4CH4 A;  4CC5 A;  4TV8 B;  2UXB H;  4F6R A;  3N2G B;  4YHH B;  1FVI A;  4DR2 H;  4X20 A;  2F4V H;  3K5N A;  4X1I A;  4X62 H;  5A2Q W;  4BWS C;  1O9G A;  4FLX A;  4K8X A;  2VQE H;  4AQY H;  2MCT A;  3L2P A;  4UCT A;  3JAW A;  2HVR A;  2ZNJ A;  5C8Y A;  4DV0 B;  3KAL A;  4RZQ A;  4O4J A;  4DRX A;  4GKJ B;  4LNU A;  2VOB A;  4DV6 H;  3QF7 A;  4X1Y A;  4X64 B;  4PZ8 A;  5LA6 B;  1B04 A;  3RYI B;  3T1Y H;  4JI3 H;  2ZM6 H;  2UUA B;  3C0F B;  2E5L H;  4DV4 H;  3ZS8 C;  3K59 A;  4ZOL B;  5JVD B;  2UXB B;  2OWO A;  1I94 B;  2F95 B;  2YCH A;  4LH7 A;  5LP6 C;  4DR2 B;  1E4G T;  5LMU H;  4LF5 H;  3JAS B;  2QM4 A;  4X62 B;  4UCV A;  4O2B B;  2BTQ A;  2JS5 A;  3RYC B;  2E3C A;  1TAE A;  2Q0A A;  4HNA B;  2VQE B;  4AQY B;  4LF8 H;  1Z2O X;  4O4L B;  2YIB D;  3RWR D;  1P16 A;  2KSW A;  4FFB A;  5CA1 B;  4DUZ H;  1CKO A;  3M4I A;  4UCS A;  2VPS A;  1Q43 A;  4CC6 A;  4LF9 H;  5JJN B;  2KKW A;  3HXL A;  4DV6 B;  4OX9 H;  1Q3E A;  5IWA H;  3CSX A;  3N2K A;  1QHT A;  4JI1 H;  2UU9 H;  3SGI A;  4O4I A;  1T5E A;  3T1Y B;  1JJO A;  4JI3 B;  2ZM6 B;  2RGV A;  4GYC B;  4DV4 B;  1WN7 A;  4U3J B;  5FNV B;  1ZAU A;  4LFB B;  4IHJ A;  4JI5 B;  5LMU B;  2PZS A;  5J2U B;  5FD5 A;  1WPB A;  4UCR A;  1WNS A;  4PZ7 A;  3LML A;  5GON B;  5LMN H;  2UUB H;  4MV7 A;  5LOV A;  2UXD B;  4I4T B;  4IIJ B;  1J5E H;  2F66 C;  3MAQ A;  3M7M X;  3HKE B;  4LF4 H;  4PI2 A;  1XMQ H;  1HNX H;  5IT9 W;  4RB3 C;  3E22 B;  3HKB A;  4DR5 H;  4AHC A;  3UT5 A;  4OX9 B;  1SA0 A;  4DK0 A;  3QWU A;  4LFA H;  4APM A;  4LFC B;  5LP6 B;  4JI1 B;  3FMA A;  2UU9 B;  4RB1 A;  1GYF A;  2QJ1 A;  2JGU A;  3PN1 A;  5J2T A;  3L4K A;  4K0K H;  4LH6 A;  1FFX A;  2VQF H;  5KHG A;  3J7A K;  1S68 A;  1Z5W A;  1JFF B;  3VQX A;  3RJ0 A;  2PY5 A;  4TQF A;  3BHP A;  5LMN B;  2UUB B;  1M93 A;  2PYL A;  5EZY A;  3RTX A;  5D5P A;  1M0W A;  1V9P A;  4BW9 A;  1J5E B;  3NBY B;  5FLX W;  4F6R B;  4LF4 B;  1Z2P X;  4O4H A;  4DR4 H;  1HNX B;  3EYY A;  3K3V A;  4ZIB A;  4X20 B;  2HIX A;  4NVP A;  4X1I B;  4BWA A;  3BAA A;  4DUY B;  4YJ3 B;  3KXY T;  1HNZ H;  1E4F T;  4ETS A;  1IBL H;  2Q7E A;  1N34 B;  3HKC A;  3JAT A;  3JAW B;  5C8Y B;  4KL1 A;  2Q7H A;  4O4J B;  4K0K B;  4CS4 A;  1XHZ A;  1XNR B;  4DRX B;  2VQF B;  4A2A A;  3N40 P;  1S5J A;  1TUB A;  4JI8 B;  4X1Y B;  4B3T H;  4RB0 A;  1FJG H;  4LF7 H;  5ITZ B;  3GJX B;  2PTM A;  4NXM H;  3HKD B;  5FPO A;  2UXC H;  3U10 A;  5KHJ A;  3RYH A;  4B08 A;  5D1O A;  2VWK A;  4I55 B;  3S24 A;  4DR4 B;  5KHH A;  3JSN A;  4DV2 H;  1VS0 A;  3FFQ A;  1A0I A;  1N32 H;  4FM2 A;  2PGG A;  4JI6 H;  3VQV A;  3KYH C;  3RYF A;  2BTQ B;  3K5L A;  3TY5 A;  1IBL B;  2P22 C;  2GV9 A;  1HR0 B;  4TV9 A;  4FFB B;  4B3R B;  5KHK A;  5LYJ A;  2PUS A;  3LNN A;  2FE3 A;  1IBM H;  1Z2N X;  2RJZ A;  3GB8 B;  3SJC C;  3U0Z A;  4Q0Y A;  1DGS A;  1S03 G;  4B3T B;  2F4V B;  3N2K B;  1FJG B;  4LF7 B;  1HW7 A;  4DV3 H;  4NXM B;  4O4I B;  2UXC B;  1N36 H;  4GLX A;  3A2F A;  4EFE A;  1YEW A;  4DR6 H;  2IM9 A;  4CH5 A;  4JYA H;  4DV2 B;  1H2S B;  1WH2 A;  3KAJ A;  4A2B A;  4JI7 H;  1N32 B;  4ZHQ A;  4JI6 B;  5LXT A;  1D5A A;  3JAM W;  4YJ2 A;  5LOV B;  2F1M A;  2YI9 A;  2P5O A;  1XHX A;  4X1K A;  3BA9 A;  4I50 A;  4FLY A;  4DR1 H;  1FKA H;  2E5L B;  5IYZ A;  3HKB B;  1XNQ H;  4JV5 H;  1N33 H;  4JI2 H;  5BR8 H;  3UT5 B;  2VUG A;  4LF5 B;  2CAZ C;  3JAR A;  1SA0 B;  5DIS C;  3RR5 A;  4DV3 B;  4AIL C;  4TOI A;  5EOY A;  1RSO A;  4FLT A;  1VF7 A;  1N36 B;  3N42 B;  1I7F A;  4LF8 B;  2V4D A;  3QG5 A;  3N6X A;  5J2T B;  2W57 A;  1FFX B;  1Q8I A;  2YIA A;  4JYA B;  4FLV A;  1XDN A;  4DUZ B;  2CFM A;  1O9H A;  3JAL A;  4MV9 A;  4JI7 B;  4LF9 B;  1HNW H;  1SQG A;  1Q5O A;  5JJE B;  2RQ6 A;  1XI1 A;  5IWA B;  5EZY B;  2ZNI A;  4NXN H;  4Q6G A;  4DR1 B;  2HIV A;  4PI0 A;  3W1B A;  4O4H B;  4YY3 H;  5CB4 A;  1XNQ B;  1M5I A;  3WB2 A;  4FLW A;  4JI2 B;  1N33 B;  1ZHS A;  2XIG A;  5FPR A;  3GDE A;  1TVK A;  3SJA C;  4DR7 H;  4PDB A;  4FM0 A;  3TY9 A;  5IJ0 A;  4JI0 H;  2HEP A;  4UFZ A;  3RGB A;  3HKC B;  3JAK A;  3JAT B;  3K57 A;  3KAK A;  1CKM A;  1BGW A;  3BRC A;  3IG0 A;  4D7T A;  1XMQ B;  1HNW B;  5KHI A;  4DR5 B;  3NC0 B;  5JQG A;  3VNN A;  4O2A A;  4CH6 A;  4EB6 A;  4LFA B;  3VQW A;  5JH7 A;  4NXN B;  3RYH B;  2R72 A;  5JCO A;  4DK1 A;  3CVZ A;  4YY3 B;  3DSQ A;  4TUY A;  5BMV A;  4D7S A;  4FLU A;  3IAY A;  5JJJ B;  3UQ8 A;  3OTF A;  4LNU B;  2Q2T A;  3CB2 A;  4JI4 H;  3JSL A;  4EEQ A;  4DR7 B;  3RYF B;  4DV0 H;  5IJ9 A;  4JI0 B;  3W5O A;  1QQC A;  4X65 H;  2VWJ A;  2RGR A;  1MZB A;  1JMK C;  4FLZ A;  5LYJ B;  4DV5 H;  3RIZ A;  2HVS A;  4DV1 H;  3SR2 C;  2UUC H;  2ZCE A;  4I7H A;  5CA0 A;  3CHX A;  4ZI7 A;  4LSX A;  4I9Q A;  2UUA H;  1Z5V A;  3WB0 A;  3RGX A;  2HVQ A;  4M7E A;  1HNZ B;  1I94 H;  4WBN A;  3QTC A;  1NT2 B;  2R9A A;  1CKN A;  2R70 A;  4RAY A;  5KX5 A;  4YJ3 A;  5KMG A;  2ZIO A;  3VQY A;  3WB1 A;  4ZHQ B;  3H20 A;  5FNV A;  5LXT B;  4JI4 B;  5EIB D;  5K1X A;  3J81 W;  4YJ2 B;  4FVM A;  5EYP A;  4X1K B;  4TV8 A;  3BAB A;  4X65 B;  4I50 B;  3N2G A;  1P49 A;  4UCU A;  4MTE A;  1X4T A;  4R7R A;  5IYZ B;  4DV5 B;  5ITZ A;  4DV1 B;  3ZED A;  3L4J A;  1XQ8 A;  1L2Z A;  4IHJ B;  3HKD A;  2UUC B;  1M0T A;  1KMI Z;  4EFB A;  3JAR B;  5JCO C;  3THO A;  4LFB H;  4I55 A;  2WDT A;  1TA8 A;  3TY8 A;  4JI5 H;  3K5O A;  3SJB C;  4LSA A;  1XMO H;  4KHP H;  2HHH H;  2HGS A;  2YIB A;  1G6U A;  3ETQ A;  4HBN A;  2PYJ A;  3JAL B;  1M4U A;  1IBM B;  4CH3 A;  2UXD H;  3BPZ A;  3N41 B;  5LA6 A;  3N43 B;  3RYI A;  4LR3 A;  3W1G A;  2YI8 A;  2JVD A;  3K5M A;  2OYQ A;  3DF7 A;  4MTD A;  4ZOL A;  5JVD A;  4LMY A;  4DV7 H;  2ZIN A;  1O75 A;  4DR6 B;  5CB4 B;  3JAS A;  3T1H H;  4TQD A;  4LFC H;  4O2B A;  3RYC A;  1TVK B;  5EIB C;  4HNA A;  4PHZ A;  3RGZ A;  2ZJT A;  4O4L A;  5IJ0 B;  2O03 A;  3U11 A;  4IAJ A;  4B3M H;  4GKK H;  5CA1 A;  3JAK B;  4KHP B;  1XMO B;  2HHH B;  1L8D A;  5FD6 A;  3ICX A;  4JV5 B;  5JQG B;  1IBK H;  5BR8 B;  5K1P A;  4O2A B;  4EB6 B;  1KU9 A;  4B3S H;  1BJT A;  5JH7 B;  4DV7 B;  4U3J A;  2CW7 A;  3J80 W;  4PZ6 A;  4X66 H;  5J2U A;  4DR3 H;  4TUY B;  1I6U A;  4DUY H;  5BMV B;  4RB2 C;  3OTO H;  4LF6 H;  3T1H B;  5D5Q A;  1ZHQ A;  2Q7G A;  1P8L A;  5GON A;  1N34 H;  2WE6 A;  1TUB B;  4I4T A;  4E6N A;  3F8N A;  4RAZ A;  1SEI A;  4IIJ A;  1SYX B;  4J0M A;  5IJ9 B;  1XNR H;  3NBZ B;  3N44 B;  1SQF A;  3HKE A;  4B3M B;  4GKK B;  2XHB A;  2ZIM A;  3RFR A;  4YHH H;  3E22 A;  3MWM A;  4JI8 H;  4CS2 A;  1SKV A;  5D1O B;  4DRF A;  4FM1 A;  5CA0 B;  1IBK B;  4ZI7 B;  5LP6 A;  2EX3 A;  1AN7 A;  4B3S B;  4K8Z A;  3BA8 A;  1TGO A;  4WBN B;  4CS3 A;  3B2E E;  3K58 A;  4UCO A;  1XK5 A;  3RF2 A;  2WYO A;  1CKN B;  4EQ5 A;  2YXL A;  4X66 B;  4GKJ H;  4TV9 B;  2BTO A;  5KX5 B;  4DR3 B;  5D1P A;  4LF6 B;  2Q2U A;  1JFF A;  3OTO B;  5KMG B;  1X9N A;  4X64 H;  4FM9 A;  2F93 B;  2CW8 A;  4L8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...