3JSLA

Crystal structure of the adenylation domain of nad+-dependent dna ligase from staphylococcus aureus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
308
structure length
308
Chain Sequence
b'ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structure of the adenylation domain of NAD(+)-dependent DNA ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 107
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jslA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3jslA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jslA02
4JI4B 1TA8A 4DV2B 1IBMB 1HNZB 1J5EB 4EQ5A 1CKMA 1X9NA 1S68A 2HVRA 4LFCB 4TOIA 4JI6B 1FVIA 4LF6B 1I94B 4X64B 4UFZA 5FPRA 5D1OA 5D1PA 4DR2B 3NC0B 2VUGA 5LMUB 4DV5B 4JI3B 4K0KB 4B3MB 4B3TB 1FJGB 2HIXA 2UXBB 4PZ7A 1CKOA 2UUBB 2UUCB 4DV3B 4YY3B 2HIVA 1IBKB 4JYAB 3S24A 2HHHB 3BA8A 3RTXA 4DV4B 5BR8B 4DV0B 3NBYB 4LF4B 2CFMA 4UCRA 4PZ6A 4JI0B 4DV7B 4AQYB 1TAEA 2Q2UA 1CKNB 4DV6B 4UCSA 3L2PA 3VNNA 3BA9A 5LMNB 4NXMB 4EFBA 1XNQB 2E5LB 3PN1A 5DISC 4JI8B 1B04A 4B3SB 4E6NA 4LFAB 1XNRB 4NXNB 3TY5A 1N36B 4DRFA 2HVQA 2UUAB 4UCVA 4LF7B 1CKNA 4DUYB 4LH7A 4JI2B 4OX9B 3T1HB 3NBZB 4YHHB 1XMOB 2VQEB 2UXDB 2OWOA 1N33B 3W1BA 2UU9B 3RR5A 2ZM6B 4DR1B 3GDEA 4UCOA 1DGSA 1N32B 2F4VB 5IWAB 4DR6B 4LF5B 4GLXA 4CC5A 4X66B 1VS0A 2UXCB 1IBLB 4DUZB 3W5OA 3SGIA 1XDNA 1XK5A 4EEQA 3BABA 4JI1B 4DR4B 3GJXB 4B3RB 3W1GA 1A0IA 4X62B 4EFEA 3TY9A 2VQFB 4CC6A 4DR3B 4LF8B 4PZ8A 3UQ8A 3T1YB 3QWUA 4GKJB 4LF9B 4DV1B 3JSNA 4DR7B 1XMQB 3GB8B 4LFBB 1P16A 1HR0B 4UCTA 1ZAUA 4JI7B 5FPOA 4GKKB 1HNXB 3KYHC 4X65B 1P8LA 4UCUA 1HNWB 4KHPB 4DR5B 4JV5B 3JSLA 4LH6A 2HVSA 1N34B 5D1OB 2Q2TA 3TY8A 3BAAA 1V9PA 4JI5B 3OTOB
chains in the Genus database with same CATH superfamily
1XNQH 1M56B 4B7EA 3AEIA 2HP8A 2Q67A 4O7NA 4HNAB 3VOTA 4I55A 4P30A 3Q2OA 1GN2A 3LQSA 1KEEA 1K1QA 1I94B 1TGOA 1JQ0A 4TQFA 5C8YB 3PW0A 4GYCB 2R7KA 3VPDA 1YEWA 3F5TA 5I5YA 4DV3O 3BQ0A 2ZINA 5CAEB 2EIJC 4H0LB 4FS2A 4O4JB 5BZBA 4M9UA 1NH2B 2YEVA 4OX9O 5T14A 1R6TA 4WBNA 3KHLA 4JYAB 2Y0PA 3HKZA 1GGOA 4QJFB 2I80A 3SNOA 4MTXA 4JV5H 2OCCB 5KFOA 1QVGU 2VA2A 2M7WA 1JJOA 1SA0B 3N2GB 3W7UA 1H2LA 4QGPA 2E5LO 4X88A 5IYBG 4ME6A 1KJ9A 2ATKC 2RN9A 1WNSA 4JXUA 4O7WA 3IC7A 2R8GA 2IA6A 1VF6A 1ZHSA 3E8HA 2VRZA 5J2TF 1AR1B 3T1YH 3OW2U 5L9XA 3KAKA 4NTXA 4CH5A 3UT5A 3WG7B 3LULA 4EGJA 4D7TA 5LOVA 3OEHG 2GV9A 2UUAB 5IYDG 4LF7B 5LYJB 3ETEA 2YIDA 1CS0A 4N23A 2UU9B 4CHIA 3CRAA 2HHHH 4C5BA 2ZIMA 1JKJB 3U0ZA 5B1OA 1U97A 5KUMA 4JI1O 3RYHA 1W2BU 2CNQA 2UXCB 1ZETA 2QTOA 3H1KH 5KFNA 1NS1A 4A3IG 4EEQA 4BWSC 4E2LA 5LXTB 5L3FA 4XZ3B 1VEWA 2E5LH 1YCIA 4O83A 5DGBA 3TY9A 4DV1O 4FFKA 4DR3B 3P3NA 3TQ1A 4X20A 3E35A 5C1PA 3H1JH 5LMUO 5C93A 3NGDA 3ZIAG 1GYFA 1PK8A 2Z0AA 4YHHH 5FPOA 4GKKB 3K5NA 5H80A 2EJ7A 4FU0A 3BEHA 4DR4O 1R3LC 1AUXA 1HNWB 1ROPA 3CSWA 4JI4O 4MA0A 3JSLA 2R85A 3PR5B 3QF7A 3RYIA 2COIA 2YC0A 1XILA 3WNZA 1GH6A 4Q8EA 3DC5A 1NH2D 2W9CB 3GTMA 1S5HC 4M0JA 4ETSA 4IYHA 2GHYA 4GUNA 3MJFA 4JI1H 2UVRA 2ZE5A 2QE7G 3RGBA 4TUYB 4HNVA 1RP3B 4O3OA 1Q82W 4JGSA 3SYQA 4MV8A 5JQGF 4R7RA 4QW8A 4EGQA 2W7OA 2IH3C 5DQGA 4UUGA 4Q0YA 2VUGA 4O4JF 2SCUB 1I0HA 5EC2C 1I7FA 3FYEB 2UXDH 3JASB 3L75H 4ZHQA 2W6MA 2CGNA 3CCQV 2WB1A 4RB2C 3OM3B 1OBGA 4DV1H 5KHGA 1SCUB 4RB0A 2JK5C 1MSDA 3RTXA 1WJZA 4MV1A 4DV0B 2Z04A 3CRRA 2DN9A 1KT8A 2YRXA 3B2EE 4NR1A 5KMGB 2GTAA 3I55V 2OH2A 4DR4H 4DV7B 4IAJA 4JI4H 3R9RA 4CS4A 3CMEV 2Q2UA 2B1GA 5CB4B 2EIMC 2BR0A 1MNGA 3QZ8A 3CC4V 5C4XG 4EFBA 4ED0A 2EJRA 1JA8A 4EEYA 5DMXA 2RF4A 1OJHA 5FNVA 3J7AU 2Y0SE 4R50A 5CA1A 4U3JA 4ECTA 3E89A 4KP4A 4A5UB 2FE3A 1CP9A 4ASUG 3WO1A 4QE7A 5D5QA 5H5NA 1M0WA 5EIBC 4J41A 1KECA 4CKCA 2V4RA 2OIGA 3CEIA 2V5AA 1LR1A 4O4HF 1URFA 1B6SA 2OWOA 2FKLA 2R8IA 4X64H 1R9TA 5BXZA 1I1MA 3SJBC 2P0AA 2FK1A 4DK1A 4YR3A 5J2UA 2VPSA 2AQ4A 1AN7A 1H2SB 2ZDIA 4BAYA 1JMKC 4F4XA 4IHJA 3C3SA 4RQFA 3GTJA 2BOBC 4AQYH 2BOCC 5C3EG 2YXYA 1B6RA 1NR7A 2YZGA 1GM8A 2P5OA 2Q7HA 1XK5A 2W6ZA 1AI7A 1F4MA 1FPOA 2QKSA 4DR2H 2Q69A 4ZOLB 2Z3YA 2WLIA 4H37A 1I94O 4A3FG 5LGTA 4BBSG 4DR7O 3T4DA 1GO3F 4JV2A 4K3AA 1JCHA 5H6QA 3QFFA 4LP8A 3QWUA 3N6XA 4I7HA 1I3QA 3CX5F 2RNBA 4AILC 4NYKA 3CRMA 5CA0B 4O4IB 1DV2A 3RVYA 2GPSA 3WB1A 2YRWA 3G6XA 3SPGA 3H3VH 2RMKB 4DR1H 3TW6A 3JYCA 4DR5B 2YSUB 1TWAA 1HDJA 2IJKA 1LUVA 1M4UA 4HNAA 5D1OB 3TIGA 1S0MA 1WLEA 2QWNB 3CD6V 3PVXA 3M9OB 3VQYA 2BQ3A 5C8YA 1Z2NX 1FAFA 4EQ5A 4O2BB 3CE2A 1MZBA 5L1IA 2PF4E 1CKMA 5KFCA 4PV1B 3ASNB 4JI6B 1GTOA 4NXNH 4Q44A 4YIOA 3H9VA 4CS3A 2WA4A 1KQSU 3JARB 2C28A 1YZBA 2R86A 3PJSK 4B3MB 2FYUH 4B7KA 4QJFA 4O3SA 2UUAO 4DR7H 2ODMA 2N05A 2LO1A 4U7NA 2ASJA 4ED8A 3T5HA 3BFRA 2X7RB 1SA0A 2DWEC 3N2GA 1IBKB 1VF5B 1GM7A 1Q6UA 4GZRB 2W6IG 3DC6A 2R72A 3UYYA 4HR7A 2EJ2A 4QE9A 4JI0B 3K06A 2UXCO 3IJ4A 2EBOA 4UUJC 1QQCA 4ECWA 1R3IC 4NXMB 2H3OA 1YSCA 1KU9A 4KXRA 2AHZA 2AGAA 5LYJA 3MR3A 2KG7B 4GKJH 1KKDA 1B04A 4DW0A 4QW9A 5BWRA 2MK3A 4YAJB 4DR3O 1EBOA 5L3BA 1OBDA 4HYOA 4ICGA 5L3GA 4JI7H 2RDJA 5JVLA 4LH7A 3HKBA 4DAAA 4LNUB 2F4VO 2XCPA 2J6UA 3RR5A 4GC6A 2HGXA 1V55C 4UCOA 4X1YB 5LXTA 4G28B 4BR6A 2QTSA 3ZHSA 4I7ZB 1SZXA 1FFTB 3HB3B 2LQTA 2VQFO 1PKXA 1N0NA 1H38A 2DMXA 1E4EB 1IURA 2QYZA 1KP3A 1XREA 4O4IF 3GV5B 4ECVA 2CW7A 3S3WA 5LP6F 4BW9A 2Q6AA 4O7SA 2P7TC 3AX6A 3KZIZ 5KA5A 5L3EA 1V54B 4JI5O 3OTOO 2NN4A 1QNMA 2W9CA 2OTJV 4DV2O 1N34B 3ORQA 4TV9F 4A3EG 3TY8A 4TUYA 2W8LA 3HKEB 2ZD9A 3ZHVA 1Z5WA 1KUQA 3BG5A 3KXYT 3ZMVA 1HNZB 4PI0A 2R8KA 3JASA 1CQIB 1S0NA 4K0KO 4PDBA 1AI5A 2VQFH 1SKVA 3LUTB 1VF6C 2JA8G 2FPGB 1BJTA 4RU9A 2FKXA 3OE7G 2XCAA 5IT9W 2EINB 4WFFA 4LF9H 2QWPB 4LBEC 1FJGB 4XX0B 3ZHUA 2YZNA 2JGDB 5EBLC 4I5SA 2DZDA 4C2MA 1K83A 5EYPB 1Q43A 5B66Z 3SPJA 4X66H 5CB4A 5KFTA 3G8DA 2E75B 5BR8B 4J9SA 1WH2A 4DV6O 4JI5H 3OTOH 2A9HA 1RM1C 2W0FC 4YIPA 4DW1A 3LNMB 5DAAA 1A32A 1I2LA 4DV2H 2DQ0A 1CKNB 2BQRA 1IBMH 3RFRA 2IU3A 2YICA 1XNQB 2R93A 3K79A 4LFCH 3GWOA 2DYRB 5DISC 3RB4A 2IJJA 4MV9A 1PNKA 3GIQA 3BQ1A 3W7TA 2CK3G 3KHGA 2L6LA 3SPHA 3G6EV 2VPQA 4RZQA 3BJYA 4K0KH 1SS3A 5KT4A 2FLLA 3EVKA 4K8ZA 4NZNA 1MABG 4DUYB 1JDBB 4ZQIA 2C22A 3KREA 2UUCH 4YY3H 1NZ6A 4J11A 1KC7A 3PO3G 4DL4A 3I5DA 5KLVH 4RUAA 1L2ZA 4MW3A 3OAAG 2CNUA 3UO3A 4DR5O 4FFNA 3OMAB 5DGHA 4ZOLA 4MVQA 4A3LG 3D36C 1L8DA 1DK1A 1K3EA 3CCSV 2JA6A 1XDNA 4DV6H 2X6CA 5F9LA 3FX7A 3GJXB 4FIPC 5IYCO 4LCUC 1BMFG 5CA0A 1GN4A 4EFEA 4X62B 2YXHA 4CC6A 2Y0SA 4B3SH 1F23A 3T4ZA 3LNNA 3N43B 3L4JA 4I4TA 4O86A 5JJNB 2F43G 3T1YB 3JD2A 3X2QC 5DGIA 1S10A 3SR2C 2WTFA 2PYJA 2WAQA 1W59A 4LSAA 1W93A 4FLXA 2VQEH 1TWGA 5GONB 2DOSA 4UCUA 2QKAA 4O2BA 4A3MG 4QSHA 3WB0A 2O57A 3SYCA 5B1BC 4JTCB 1VBHA 2AU0A 1TA8A 5IP9G 5KFUA 4LF6O 1XUQA 3D8CA 3TXQA 4DUZH 1J5EB 3JARA 2FMLA 1UC9A 2PI4A 2ITDC 2QEXV 4NXMO 4B3RH 4NYEA 4TOIA 3ABKC 4O3PA 2YS7A 1U96A 3RB0A 2RGRA 4X1KB 1QU7A 2UUBO 3T1HH 4JI3B 1IX9A 1WN7A 4YBZB 3PZPA 5CBHA 2UXBB 2O03A 1JX4A 2R92G 2E2HA 2Q4PA 1EN4A 1N32H 3CCJV 4GLWA 3ETQA 4R8UB 1M1KW 4LF5H 3S24A 2ZXWC 5LBQA 4MVRA 1OV9A 3NUAA 5BPHA 5IYDO 4UVCA 1KJQA 1YXBA 2GTSA 2Y69C 1GAXA 4O4LB 2KG7A 3RGZA 3ZS8C 5L1LA 1OWTA 2ZDIC 3UO2A 3LP8A 1E1RG 1NJIW 4RAIA 2NVYA 4A2BA 4G2KA 4EYIB 3DXRA 3I56V 4JZ2A 4R8CA 4FLZA 4JV0A 4EG0A 3KHHA 3CCLV 2EIKB 2Y48A 4CH6A 2C2EA 4A3DG 3G6VA 2FMAA 4X1YA 3AG2C 2BE3A 3F7VC 2UUBH 3JZ6A 3G71V 2A79B 5BPFA 1BQZA 3JAKB 4TWKA 2UXDB 3LDEA 3VPCA 5JUMA 2XGPA 3SDLA 3GIMA 2ZCEA 2Q7GA 4NTWA 1TWCA 1N34O 4O7LA 4Q43A 3CYOA 1DF5A 4GLXA 5KA6A 2YS6A 1ENVA 3CCRV 3GIJA 3WWJA 1RK5A 3H4DA 1E4EA 4DL6A 3N27A 2R93G 4DXWA 2ZNIA 1HNZO 4L8JA 5J2TB 3BABA 2DWDC 5LMNH 3E22B 1Z5VA 2DJVA 3JRXA 2GUZA 4NZOA 3R65A 4F4LA 2E76B 1I7LA 2Q8VA 4PZ8A 2CTQA 3K08A 2CE4A 5L3DA 4IRKA 5L1JA 3HOUG 3QZ7A 5AG2A 5EOYA 2IM9A 3KG2A 5GW7A 1FJGO 3RFCA 1P16A 2R7NA 4TT3G 1PM9A 3HKEA 4KHPO 5GONF 4EB6B 5DECA 1C3OA 1HNXB 2IBKA 2DYSC 2N74A 2ZM6H 1E4GT 3CC2V 3CB2A 2WE6A 4QWBA 2FK2A 4EBEA 3TEKA 2JA6G 3GIDA 4DR6H 4I50B 4X64B 1R1BA 3ZRVA 3ZHQA 2W9BB 3HOXG 2CUGA 2R8HA 3EXAA 3CCEV 1VQ9V 3UZBA 2JJ2G 2JGDA 3N44B 3WG7C 2XHBA 4QWEA 5D1PA 1VARA 5EYPA 4DR2B 1K34A 1NBMG 4LWSB 4IYIA 4U7CA 3CXCU 5CM0A 1QLNA 3ZMUA 2UXXA 1CKOA 4DUYO 4Q20A 5EC1C 5IY5B 5KS8A 1FFXB 4H13B 3CC7V 1K7DA 5JVDF 3HKCB 5IYCG 4DK0A 5B5EZ 2R7LA 2WAMA 3D3IA 4O4LF 3BPZA 1XHXA 2AXTZ 4FLUA 4QWDA 2ODTX 3F5WC 2R9RB 3DGEA 5KG7A 4RAZA 1TAEA 4WFHA 4ZI7F 4LFAO 2DIKA 5JQGB 2LP7A 4JI8B 3OMIB 3K5MA 1PNLA 3RT3C 4Z1VA 4CMDA 5LA6A 3TQTA 5DN6G 4NXNB 1N36B 5F9NA 1XI1A 3ASOB 3FYIB 4NKGB 2R7ZA 5B1NA 4DIMA 2C2AA 5KHIA 3PW2A 5HNEA 2UXNA 1RK6A 5HFLA 2XNDG 2CKZB 3AG4B 1IBLO 1DGSA 3GTKA 1BS3A 4A3JG 2ZDHA 1GO3E 4TQRA 2JEFA 1US6A 1FKAO 1PPJH 4IIJF 1RJRA 3OUZA 3MFIA 2YZMA 4F4ZA 1J5EO 5CBFA 3ZHTA 4FFMA 3QNEA 5KG2A 3UZOA 2GQRA 3FDSA 2HJFC 3HBLA 3GIKA 3T99A 1ZQ7A 3CPWU 3L9DA 2ZDGA 2YZLA 4J9OA 3QO5A 4LFAH 1JR9A 1RFYA 2V58A 3UQ8A 4DV3H 2YUAA 4DRXB 1IOWA 2V4DA 4GKJB 3KAJA 3GB8B 1XMQB 4LFBB 2UXBO 4O4HB 3D3QA 3FD9A 2QM7A 4OX9H 1PV0A 3VBBA 4JI7B 1SYXB 1A0GA 1KC8W 2QR4A 4X65B 2QSAA 1VQLV 1S77D 3APOA 2DE0X 3K3PA 4I50F 4MV4A 4MT8A 2W6QA 2QK4A 2ZT9B 5BYAA 3OUSA 1VQPV 1EM1A 3G4SV 3H1IH 3B40A 3ZRXA 2DQ3A 5EZYF 4OGQB 2RGVA 3G67A 5HFMA 3IC9A 1M90W 4NTYA 2FP4B 1FKAH 4F4WA 1O75A 4RQEA 1P4RA 1SQPH 3U9SA 2WLLA 4U3FH 3RJ0A 2LJ2A 2ZR2A 4ECRA 1QCEA 2F95B 4MVOA 2VWJA 4DV5B 4A93G 2VA3A 4B3TB 4ZKIA 1BXRA 1WP7A 4PZ7A 1BHAA 3C0FB 2XGQA 3THOA 5LHGA 4J9PA 2EULA 3ETDA 4JAUA 4J7ZA 4F6RA 1NTMH 3HOZG 2EIJB 3QO7A 5KUKA 5KHJA 1Q90D 2CNVA 1Y76B 2C00A 1SQQH 3OD4A 4ECSA 2CW8A 3RW0A 3F7YC 1T94A 4UCSA 3OSNA 1ZUQA 2V59A 1UFIA 3BA9A 4LR3A 3H1LH 4RWUA 1G8MA 3ABUA 4PA3A 3L73H 2FLPA 2F1MA 3JAWB 1SEIA 4JI2O 3OT7A 5LMUH 3TY5A 4YJ2F 5KFPA 2ADQB 4TVIA 5L1KA 1NVPB 2E2IA 4O7ZA 5CN0A 3MWDA 5KFGA 3TCUA 1XMOB 1VQ6V 1YF2A 4PDVA 5IWAO 1HNXO 1XDCA 5B1AB 3PW4A 3PW5A 5J2TA 4FK5C 1CEZA 2E3CA 2YU9A 1MG1A 1QR8A 2WDTA 3H4BA 4FLYA 3ML0A 4X66B 1H2KA 1TWFA 3GTLA 4J0MA 4ZBMA 1K4DC 1N56A 5KG3A 3E5NA 3ASNC 5KFDA 4J7KA 1Q3EA 3R5FA 2N04A 3SE7A 4O7VA 3W1GA 2CQYA 1H8EG 3I12A 1VQ5V 4EB6A 4LF8B 2DAAA 2NU8B 1Y1WA 1EUDB 2R7ZG 1XL6A 2XUMA 1JXLA 2PMZE 4ECZA 5K3WA 3H01A 3ABLB 2J6SA 2ZR3A 4YP3A 4UCTA 5DG8A 1Y1VA 3KCYA 3BACA 4YJ3B 3OFNG 4H44B 2A1HA 3T54A 1WPBA 2W9BA 5BWUA 2KKWA 5KG4A 3KHRA 2Q2TA 1DLBA 5IWAH 3HOWG 4J9MA 4JYBA 3K9AA 4O3QA 3R5HA 3Q8SB 3K0DA 3PO2G 4P9OA 4Q4DA 4PA7A 2WLKA 5BMVF 1HW7A 4LWSA 2LW7A 2PTMA 4MTDA 4ZIBA 4MTEA 2ZDQA 3L72H 4JI8O 2HVJC 1WA8B 5B3SB 3LDDA 4UFZA 4FLTA 1R6KA 1FFXA 3N40P 3GV8B 3HKCA 3FKSG 5LP6B 1NTKH 4U7OA 2PI5A 2A7WA 4A2AA 4JYAO 1FXHA 5CBGA 1S76D 4JAAA 3ETJA 3T2MA 1MZFA 3H1HH 1GSHA 4MVSA 4FE2A 1EZ1A 4PWQA 2WYOA 2VS0A 4O2AF 4TV9B 4LF4B 5JQGA 4JF3A 4QIWF 3ORRA 4UCRA 4O4JA 4J9ZB 3VNNA 4D7SA 3GV7B 4O7RA 3OEEG 1DAAA 3E8BA 1ZHQA 2F23A 5H2FZ 1I94H 2QM4A 3N2KB 3CVZA 5KG1A 4LF7O 2XAHA 1YIJV 4IT5A 1Y66A 3Q4HB 4HN2A 3M4IA 2LFSA 3K58A 2LGWA 5KG5A 4J9RA 3IAYA 2UU9O 1XMQO 4LFBO 2AW9A 3T1HB 2W6JG 3FB7C 1IVSA 1N33B 3GQCA 4XYLB 1QR9A 2PZSA 2QGNA 1N32B 2EX3A 2OTLV 1JX9A 4FZ0A 3TJTA 2ABJA 2JS3A 2HHFB 4HYKA 3BQ2A 4LF5B 3O65A 4O3NA 5KAIZ 4APMA 4HQ6A 1L1FA 3IN5A 5I5TA 2B63G 4DRXA 1XOUA 2ZQMA 1Z2GA 5EK0A 4AHCA 5I60A 2P67A 4O4HA 5KX5F 3CJHB 3K03A 2EINC 5JH7F 4QPJA 1H2NA 2CH7B 3FKIG 3GTOA 2EILB 5KFJA 4B3TO 4OPAA 4GKKO 2FPPB 5HV6A 5LHIA 3DAAA 1WRVA 3RAQA 4YJ3F 2UUAH 1HNWO 1OCOB 5I5XA 2OYQA 1HR0B 3WO0A 3T9BA 5EWFA 1R6NA 4RUCA 1A48A 1SQFA 5KFLA 3OMNB 2ZNJA 1VAJA 4MSWC 2R7MA 3MD0A 4FM1A 3RYFB 1K1SA 2BTOA 3ZN0A 5KG6A 5FJ8G 2UXCH 1YJWV 2J9GA 2GSMB 3DTUB 4RNMA 4L1KA 2MCTA 1VIBA 1X9NA 2YI9A 3ABMB 5L3CA 1S68A 3E2EA 1Y1WG 1SF9A 4TV8F 4O7TA 2ALZA 1S03G 4R6ZA 2HVKC 1SQVH 3ZN1A 3GIPA 1I50A 4DR3H 5FLXW 2BSKB 2NR5A 3RWRD 4ED7A 3CEBA 3MR2A 1Y1VG 1I1LA 3RBEA 2FTKA 1Y74B 1FXVA 1ET0A 5KT3A 1KKCA 2R92A 3CCUV 1Y76A 4DV0O 1I6UA 5BY1A 3J81W 2F4VH 1XMOO 4JZGA 1OCCB 4XDKA 4DV4B 4DV7O 4G27B 2CZGA 2HJWA 2F93B 1OHHG 2W6PA 2YWVA 4PZ6A 4J9KA 1E79G 3JAWA 4PHZA 5EBMC 1L0NH 1VQ8V 4X89A 3L4KA 2BQUA 4KL1A 4E6NA 1XNRB 5KMGA 4O84A 4FGRA 3MAQA 1IDSA 2YIBD 3HPLC 2FPIB 1LUWA 3KCXA 4RB1A 1SETA 3A2FA 1B6QA 1PD3A 4Q45A 1T3NA 4FM9A 2JJ1G 5IJ9B 3A0HZ 1M7JA 1T36A 4EYHB 3T1CA 2B5UA 2JGUA 1Z2OX 3T9DA 1XL4A 5FD5A 1GKFA 4BW5A 2X0SA 1VMGA 1MZEA 5I5VA 3H0GG 2PGGA 2JA7A 2W9AA 3WFVA 3RUPA 2IH1C 1A0IA 3UKMA 3HB9A 4IL6Z 5DQIA 3M9NB 5DGAA 4KUMA 3B77A 5ITZB 5KFEA 4I0XB 3HKDB 1OCRB 3U54A 1S97A 1VQ7V 1TUBB 5DLFA 1WB8A 3JD1A 4I55B 3JAMW 3G8CA 2QF7A 3CSXA 5JJJB 1AVMA 1I2KA 4JV5B 1R3KC 1MA1A 4JASA 1NR1A 2Q73A 4G3IA 3R66A 5BYBA 1BL8A 1WA8A 3NR7A 4XDJA 4JI6O 3SYPA 4C5CA 4O4IA 2MW2B 1WCMA 2VWKA 1VQNV 4MW8A 2YW2A 3HT5A 1R73A 3JD4A 5LP6A 3WWHA 3EPIA 4NVPA 1EZJA 4B3MO 3BCCH 4CKEA 3JALB 1AI4A 5D1OA 2DW4A 3WB2A 2M6YA 1IZ3A 3MHHC 2XAFA 3ZRSA 4TV9A 1IBKO 1S5LZ 2WLMA 1A3GA 2PMZA 2NLJC 5A2QW 4DV3B 5KHHA 2W7PA 1P7BA 2HIVA 2OCHA 1G1XB 3MR5A 1ZL8B 2GPWA 2VOBA 3Q8PB 1K73W 2HHHB 1N33O 3CQZA 4JI0O 3SI8A 4RUEA 4DR5H 5KFRA 2XAJA 3UT5B 1NU1H 3FB6C 1V4YA 1I5YA 5LOVB 5C5JA 3Q4HA 1Q5OA 2XD4A 2COJA 1EYZA 5KFBA 3HR0A 2E5LB 4P2ZA 2HEPA 4BIOA 1KUTA 2BTQB 4K8XA 3B09A 2EJ3A 3CS5A 3LMLA 5D8DA 3VQXA 5KKNB 2HHFA 3ZMZA 4MV3A 5GTIZ 5JVDB 2JA5A 2YIBA 4WFEA 1HR0O 4YHHB 3K3VA 3ZHRA 2WA3A 1EZVH 3W1BA 5FLXN 3PW7A 4JPRA 2CTRA 2EZPA 1P7GA 4F6EA 3V6HA 3V4SA 4BIZA 2EZOA 4C7UA 4CC5A 4JI0H 3CJHA 5IYZF 3J81N 1Y6XA 3LSQA 4LF6H 1EUCB 3W5OA 4ZI7B 2CH7A 4PD4F 3T9CA 3HOVG 4JI1B 4FS1A 4NXMH 3VPBA 3RBZA 4LNUA 3V6KA 3HOYG 5CMUA 4UVAA 3K0GA 5KFAA 5TISZ 5EWGA 3RYIB 3FB8C 1NQTA 4RB3C 1WSCA 4H33A 1FXKB 4DV1B 4HNUA 2RCVA 3B4SA 5IP7G 4ED3A 4I55F 5JJEB 2QA4V 4CZZA 3RYFA 2YYAA 5IT9N 4JYYA 5H9CA 3AW8A 2A0LA 3VOUA 5I5SA 1M56C 4BBRG 1BGYH 1AJQA 3GIIA 2P4VA 3AG3B 5FR9A 1UPGA 4DV4O 4FZ1A 2CDYA 1K5SA 2ZE8A 4IIJB 4DR4B 1BT8A 3ZCCA 2QB5A 2JA7G 4JI4B 2Z5UA 4ZHQB 1TUEB 2HLDG 4WBNF 2IJHA 5C44G 2BSKA 4DL2A 1K8AW 4IRDA 4MAMA 1VQ4V 1G6UA 2RDCA 2GBOA 4UV9A 1N48A 1QHTA 3JCZA 1W96A 4GX5A 1YJNV 1AUVA 3CCMV 4BY1G 3NC0B 2KSWA 1XNRO 4FM2A 2QWQB 2OCCC 3U0GA 1VP7A 2EIYA 2NU9B 2HR3A 1VQKV 4MV7A 3RF2A 5BR8O 3L70H 3LDCA 1BZKA 3ABTA 3MDSA 4ECUA 1KJ8A 1K4CC 1N8RW 4NZMA 5DLGA 3JZIA 1M6VA 5IJ0B 5LOVF 2PBZA 1N34H 1B06A 2K9PA 5EZYB 4RNNA 1WCMG 4AQYB 1XNQO 5KFVA 1YI2V 2DWCA 2JEJA 2ZXWB 1BQ0A 3WWIA 1AB3A 1HNZH 1UJWB 2HKOA 1UNNC 1M93A 4QWAA 1RPRA 1FS0G 3QO8A 4MV6A 3SJQC 3R23A 5IJ9A 4CS2A 5DM6V 1M57B 1S0OA 4O82A 1OCZB 1FJGH 4J9QA 1CKNA 4HZ3A 3T9FA 4KHPH 3NBZB 1IYEA 5CR5A 1EN5A 3QVNA 1FD9A 3E8GA 4KFMA 4Z2WA 4DR1B 4PA4A 1GN6A 3QG5A 4MVMA 1H2GA 2NNUA 4JV5O 4FFBB 4A3BG 3GVMA 5A2QN 2V4QA 5EWEA 4RZRA 4JV1A 3U9TA 2DPJA 5ITZA 3SGIA 2LGQA 5K1PA 4I0XA 4OPHA 4X62O 1GLVA 1ULZA 5KT5A 3CMAV 3S3XA 1MOFA 3T1YO 1TUBA 4YJ2B 5KHKA 1S3JA 3SPIA 2JA5G 3J7AK 3RGXA 1G4YB 4QWCA 1H8HG 3ETGA 4DR7B 4JYCA 1VQMV 2X5RA 4DUYH 3VMMA 3MFHA 4FJCC 4IR1A 1O9GA 2CTWA 3ETHA 1ZTEA 4EBCA 2X6BA 5KFSA 2HHHO 3AK2A 4LH6A 2B9ZA 3CWBH 4W4LA 4ZHQF 3K5IA 4FM0A 2WWWA 3ZX6A 1OZ0A 3JALA 2DYSB 3T7AA 2ARHA 4A3GG 5GONA 1DF4A 1I1KA 1EN6A 4JI3O 4X62H 5DG7A 4J80A 1WB7A 1HWYA 1ZL8A 4O3RA 3FAVB 4QIWE 2QDOA 3MWEA 2YIAA 3RV3A 1QLEB 2G38A 2KQXA 1IXBA 3K5HA 1SFOA 3W7SA 4ED2A 4PDMA 4HAMA 5B1AC 3UCSC 4YHHO 5FNVF 5CA1F 2Q7EA 3Q8RB 2Q7DA 3BA8A 1IBLH 4WF9V 2W71A 4X1KA 4ECXA 3SJAC 2XAGA 4FLVA 3AG1B 3N6RA 3TINA 2XCLA 4GCZA 1IYDA 2BTQA 5BMVB 2COGA 1KJJA 2GQSA 1B33N 2A3QA 1J5EH 3HKBB 3I4NG 2DABA 2FB9A 2H94A 4R8UA 4EKWA 2XOKG 5J2UF 2HG5C 3OTFA 5JVDA 4L87A 4IHJF 4UVBA 4O4LA 5CA3A 3RIZA 3ABLC 4JI3H 4FPPA 2W6OA 2UXDO 3EPGA 3Q8QB 2UXBH 2JEGA 5E25A 1VF7A 4LC1A 1AJNA 2JEUA 3N8DA 3BVOA 4O2AB 1JVMA 4PJ0Z 1K33A 3UM7A 4ZI7A 2LFRA 2UVUA 1K5QA 4J42A 4ECYA 3G6YA 4WCEV 1YTFB 2F4VB 4BWAA 2W6NA 1ORQC 3D36A 4E4TA 3OR7C 3TK1A 2P4KA 4W4KA 4DL7A 1EKPA 3UFXB 2RDIA 2B63A 3EYYA 3JAKA 1Q7YW 1WP8A 5B3SC 2YDEA 1FXKA 3K9SA 4PA9A 1BHBA 4GX2A 1COWG 2VQFB 5EBWC 4WFAV 4PELA 5LP6C 3RB6A 5EDWA 2WPDG 3FKIA 5C8YF 2D2CB 3JCUZ 1BGWA 4LF9B 4IGGA 3K04A 2E74B 3IFXA 1JDEA 2UVWA 4IIJA 4X9QA 3ZBHA 3PR4A 3E22A 4WD3A 2I8CA 2EJ0A 5KFXA 3U55A 1ZX3A 4X64O 1Q8IA 1SZTA 1W0KG 2OIEA 3MHSC 3K5LA 2JDIG 2HVSA 1RJPA 4JI5B 3OTOB 1BSMA 3RYCB 2ZE7A 4AQYO 2VQDA 4DV2B 2XC9A 1IBMB 3ZRWB 1WAZA 4ECQA 2V9WA 4DR2O 5KX5B 1CPYA 3GB7C 3M7MX 4LFCB 4CH3A 2HVRA 5LL6Y 4JUZA 2VR1A 5JH7B 4PDRA 5FPRA 4XYMB 2V7QG 4JI2H 3V6JA 4I50A 4IWYA 2HGWA 4K0KB 5LL6b 4BXXG 3BY6A 4XBFA 5DEDA 3TXSA 4DO2A 1IOVA 3B8MA 2HIXA 1CXZB 1D5NA 5IJ0A 1RYRA 2OT5A 2UUCB 5EZYA 1YHQV 2WSSG 4YY3B 1WR2A 5LYJF 4ED6A 1HNXH 5FL7G 1XBLA 3VA7A 3N41B 5KFMA 2WAQE 4I9WA 3Q1KA 4DR1O 3W7WA 3T5KA 2ASDA 2JVDA 1P84F 4LSXA 1E4FT 3P32A 5I5WA 3BHPA 1WPXA 1JFFB 5IE9A 3STZC 2PN1A 2Q9LA 3DTGA 4DV6B 2Y0IA 1E1QG 4RCNA 4TV8B 1Y4MA 2ZKOA 2ZJTA 4LMYA 2R9AA 1AR5A 3SJCC 4YR2A 5LXTF 4NXNO 1Y67A 1N36O 1BCCH 2EILC 3BRCA 3B8NA 3E83A 4B08A 1YTFD 4B3SB 3H20A 4DL3A 1BE3H 4BIUA 1Y14B 2Q0OC 4FFRA 4J9YB 1GMGA 1S0VA 1OCOC 3M99B 1D5AA 4UCVA 1XEQA 4FFBA 3GTGA 2W8KA 2J6TA 3RBDA 1T5EA 2VQEB 3SPCA 3K57A 2ZGIA 4UV8A 4MTOA 4U6PA 1NVPD 1TVKB 4FLWA 1SERA 3K3WA 5JQWA 1NKDA 2AZ2A 4K35A 2GLTA 5KT7A 3T5JA 4I4TB 2K1EA 4GT1A 4XDLA 2JS5A 4YJ2A 4DUZB 3RAXA 3ABMC 3H0GA 2FB5A 2R70A 3QTCA 4J7JA 1PX2A 1YITV 3E86A 4B3RB 2Z02A 3LWBA 1QBZA 1RPOA 2EIMB 5A9GA 5JWPA 2YCHA 3CP1A 4JI8H 4GKJO 3PFFA 5FLMG 4TUYF 1Z2PX 5E79Z 5JCOA 1V54C 2QWOB 4TQSA 4YAKB 4JI7O 1N36H 1SQXH 2JRIA 4JYAH 3O9OA 1JJ2U 4X65O 5IDJA 1ZAUA 1OCCC 3J80W 3DSQA 2QJ1A 3P30A 4MTGA 5KFKA 3W7XA 3KYHC 2Y4TA 2W70A 1PL0A 3ZMTA 2XIGA 3LSSA 4OXSA 4FFLA 3V4ZA 5D5PA 1SESA 4YQWA 5K1XA 5J9PC 3ZEDA 2QM8A 3MR6A 2KB1A 4Q6GA 5KFZA 1AR4A 3FAVA 3EHBB 5CB4F 4GC7A 4FBTA 4FFPA 1B3QA 4DV5O 4LF6B 1A9XA 3RN4A 1K9MW 4WFBV 3AK1A 4IRCA 1XHZA 1K92A 4LF7H 1MSWD 4AYBE 4WFGA 1UC8A 5I47A 2F66C 1JPXA 1NT2B 4X1IB 1JLLB 5I5UA 1GN3A 2UU9H 1AI6A 1XMQH 4LFBH 2UUBB 4WHXA 1NTZH 1Q6HA 2NU6B 2OLSA 3GLKA 3CCVV 5LHHA 3DXRB 2Q5ZA 5BMVA 4YB8B 4C5AA 5KG0A 4X65H 2M05A 1D2DA 2NU7B 3KTMA 1AILA 2IU0A 4RAYA 4DQNA 2DYRC 2CFMA 4K6NA 5F2VO 3FMAA 3I4MG 1EKFA 3M8AA 3L2PA 4J9NA 5LMNB 2IP4A 4TQDA 2P22C 1SRYA 1P49A 1N4CA 3AYHB 4ZOLF 3G80A 1EFRG 3OSPA 1OCRC 2ILMA 5DG9A 4O2AA 1ZLZA 1M5IA 4DV5H 2QKCA 4CKBA 3DTFA 1F7YA 2PY5A 3C90A 3GILA 1HP8A 4LF9O 4QIWA 4B3TH 4GKKH 1J95A 2UVVA 2FLNA 1HNWH 2AZ0A 5CA0F 5KAFZ 2ZM6B 3GDEA 2JIZG 4X66O 1XQ8A 2GUZB 3T9EA 1MMMA 4I4TF 1V51A 4DLKA 3KALA 4FFOA 2C35B 3L71H 4DR6B 1PL4A 1F51A 1VS0A 4IWXA 2ZIOA 3APQA 3JZFA 2XTAA 3JATB 1IBMO 3ZMSA 3IGAC 4EBDA 2C2RA 2BCCH 4LF8O 5EIBD 4PDLA 4O2BF 3K59A 4LFCO 3VQVA 1NI8A 5KT6A 3C3TA 1JOYA 4PA6A 3OGCC 1S9FA 4CE5A 4BY7G 1KBLA 4Q8FA 2FJZA 1ZSPA 4HNTA 1Q6IA 3T9AA 2DLNA 1GSOA 3OHBA 1SC5B 3RVZA 5BWVA 1K97A 4YXWG 3NXSA 3HXLA 1L0LH 4UB6Z 4TM5A 5KFQA 1RJQA 2ETNA 4DV0H 3U11A 2UUCO 1VKZA 1RSOB 4YY3O 3HKZE 4MTFA 3RYCA 1XMOH 3N42B 1F4NA 3EFFK 1P8LA 2CAZC 2Y4UA 3ZRWA 4DV7H 4KHPB 1H2MA 4CH4A 1KB9F 3TETA 5KX5A 1V55B 5IYZB 4Q4CA 3JSNA 5JH7A 3U10A 2WLNA 4TSFG 1GK9A 5FD6A 3OUFA 4RO2A 3QQMA 2YS8A 1C30A 4UB8Z 4YJ3A 2X0LA 1S5JA 2V1DA 2NUAB 3SYAA 1W0JG 1FVIA 1YDXA 1N0JA 3F8NA 3RB3A 1THZA 2B1IA 3FB5C 4LF8H 4B3SO 2RQ6A 2IJIA 4PI2A 4M7EA 4HBNA 4JAVA 2AGOA 4MVZA 4IR9A 1JFFA 1Q81W 4LF4O 2VQEO 2JEXA 2NVXA 1DTOA 2LW1A 3NBYB 2IW5A 4TV8A 4FBUA 2Y4RA 2YEVB 3OGIB 3CRCA 5LA6B 4WBNB 3J80N 3DF7A 2DPIA 1ZWIC 1AP5A 4DUZO 5K2MA 2VUMA 4R7CA 2EIKC 4I9QA 2AHYA 1X4TA 2HGSA 4B3RO 3PN1A 1GRJA 4UXNA 2QWRB 4LFAB 1FXKC 3OR6C 3T1HO 2ATLA 4DRFA 2JEIA 2HVQA 5DQHA 1CE8A 1TVKA 2WLHA 3ICXA 4OX9B 1EKVA 3AG3C 1VQOV 4AI8A 1N32O 2HJDA 4MA5A 4LF5O 1PP9H 3N2KA 4Y8VB 1AROP 2X6AA 4LF4H 3HO8A 3MWMA 5KFIA 1IBLB 4JI6H 1AP6A 1RM1B 2H8PC 2Q0AA 3AG7A 4N21A 3JRWA 5LGUA 3KKYA 3ZJZA 4A3CG 2R82A 2I87A 4B3MH 3RYHB 1RYSA 4P9PA 2WB1E 1M0TA 3GTQA 1IBKH 5IYBO 3T5LA 2P06A 4PBCA 5BWWA 4O81A 4X20B 1YJ9V 3TIIA 1N33H 4JTDB 1IXMA 2ITCC 2WLLB 3BAAA 1V9PA 1R3JC 3E8FA 5BWTA 1CQJB 2P6JA 3R5XA 2Q68A 3G6BA 4YR0A 3VQWA 2FK3A 1TWHA 4CBCA 5LMNO 4X1IA 5GTHZ 3STLC 2IMWP 4QPKA 3CXHF 3A0BZ 5KT2A 4F6RB 5IY5C 5E1AC 1M57C 3AK3A 1OCZC 1Q86W 5LMUB 2HDKA 1I08A 2D3OW 1DIKA 4DYLA 5C1OA 1O9HA 1HR0H 4D6TH 4GX0A 4DL5A 2WLJA 2CTPA 3X2QB 1AJPA 3OUUA 1S72V 5CE8A 5BWXA 2PUSA 2R87A 2ZM6O 4F50A 5LA6F 4GX1A 1KD1W 4CMFA 4MS2A 4MVUA 5KFHA 4DR6O 1KJIA 2A06H 1Y74A 3K5OA 2W0XA 4JTAB 4ED1A 5B1BB 2AGQA 1GM9A 3JD0A 3RV4A 4E4EA 2R84A 3A0RA 4J9LA 4RNOA 3ASOC 1JIHA 1KBHA 1QVFU 4Z1MG 2R8JA 4X8AA 1KYOF 2FL4A 4QNHB 1BNCA 5HBRB 2L35A 3ABKB 4A3KG 2HFEC 2XASA 5KFFA 1LNQA 4FVMA 2ZE6A 2XT9A 4AYBA 3AG4C 2YI8A 2HG8A 1X59A 2W57A 5KFYA 2P90A 5JCOC 2PYLA 5LGNA 5FNVB 4JI2B 5CA1B 4U3JB 4J10A 3CRQA 2PVPA 1EHIA 3JATA 3M9MB 4DV4H 3JAMN 3GTPA 5KFWA 5IWAB 4RUFA 1I5XA 3LSUA 2VUMG 3L74H 3CHXA 2Y69B 1SQBH 5H6RA 3TW7A 1G2WA 3SYOA 1KTAA 3IG0A 1DV1A 5J2UB 1FYJA 4FMTA 3H40A 1GSAA 2YL2A 2KSDA 4IHJB 4F4YA 2R6FA 1I7NA 2AGPA 2C2DA 1RSOA 4ABMA 1XNRH 1QLEC 3A8TA 2ADPA 1KP2A 4O7YA 1M9NA 2CGOA 1VBGA 3OHAA 2WLIB 4NB5A 2ASLA 5BR8H 5IYZA 3TGUH 2IBZH 3AG2B 4IZOA 3FFQA 2XAQA 2R9IA 3AG1C 3WU2Z 1PNMA 2RJZA 1YVWA 4NLGA 1KMIZ 2GDSA 3HKDA 3GWKC 3P3PA 1SQGA 3JD3A 2YXLA
chains in the Genus database with same CATH topology
3RYCB 1XNQH 2UXCH 1TA8A 4DV2B 1IBMB 4DUZH 1J5EB 3JARA 2MCTA 4HNAB 4I55A 1X9NA 2YI9A 5KX5B 4CH3A 3M7MX 4LFCB 1S68A 4TOIA 2HVRA 4B3RH 1I94B 5JH7B 1TGOA 1S03G 4TQFA 5FPRA 5C8YB 2RGRA 4X1KB 4DR3H 4GYCB 4JI2H 1YEWA 3RWRD 5FLXW 3T1HH 4I50A 2ZINA 4JI3B 4K0KB 5LL6b 1WN7A 4O4JB 2HIXA 2UXBB 5IJ0A 2O03A 2UUCB 5EZYA 1I6UA 4YY3B 1N32H 3J81W 4WBNA 2F4VH 3ETQA 1HNXH 4JYAB 3N41B 4LF5H 3S24A 4DV4B 2JVDA 4JV5H 4LSXA 1E4FT 2F93B 1JJOA 4PZ6A 1SA0B 3BHPA 3N2GB 1JFFB 4O4LB 3RGZA 3ZS8C 3JAWA 4PHZA 4DV6B 1WNSA 4TV8B 4A2BA 2ZJTA 4LMYA 1ZHSA 2R9AA 3SJCC 3T1YH 3KAKA 4FLZA 3L4KA 3BRCA 4KL1A 4B08A 4CH5A 4B3SB 1XNRB 3UT5A 5KMGA 4E6NA 3H20A 3MAQA 2YIBD 4CH6A 4D7TA 5LOVA 4RB1A 2GV9A 4X1YA 2UUAB 1D5AA 4UCVA 4FFBA 4LF7B 3A2FA 5LYJB 2UUBH 1T5EA 3JAKB 2VQEB 2UXDB 4FM9A 5IJ9B 3K57A 2UU9B 2HHHH 2ZIMA 2ZCEA 2Q7GA 1TVKB 3U0ZA 2JGUA 4FLWA 1Z2OX 5FD5A 4GLXA 4I4TB 3RYHA 2UXCB 2JS5A 4YJ2A 4DUZB 2ZNIA 4L8JA 4EEQA 2R70A 3QTCA 3BABA 2PGGA 5J2TB 4BWSC 5LXTB 5LMNH 3E22B 1Z5VA 4B3RB 2E5LH 1A0IA 2YCHA 4JI8H 3TY9A 1Z2PX 4DR3B 4PZ8A 5ITZB 5JCOA 4X20A 3HKDB 1N36H 5EOYA 2IM9A 4JYAH 1GYFA 1P16A 1TUBB 3HKEA 1ZAUA 3J80W 3DSQA 2QJ1A 4EB6B 4YHHH 4I55B 5FPOA 4GKKB 3K5NA 1HNXB 3KYHC 3JAMW 2ZM6H 1HNWB 1E4GT 3CSXA 5JJJB 4JV5B 3CB2A 3JSLA 3QF7A 2WE6A 2XIGA 3RYIA 5D5PA 4DR6H 4I50B 4X64B 5K1XA 3ZEDA 4O4IA 4Q6GA 2VWKA 4ETSA 4JI1H 5LP6A 3RGBA 4TUYB 4NVPA 4LF6B 3N44B 4R7RA 3JALB 1XHZA 2XHBA 4LF7H 5D1OA 5D1PA 5EYPA 4DR2B 4Q0YA 2VUGA 3WB2A 2F66C 1NT2B 1I7FA 4TV9A 4X1IB 2UXDH 3JASB 4ZHQA 4RB2C 4DV1H 2UU9H 1XMQH 4LFBH 1CKOA 2UUBB 5A2QW 4DV3B 5KHGA 5KHHA 1FFXB 2HIVA 2VOBA 3HKCB 5BMVA 2HHHB 4RB0A 4X65H 4DK0A 3RTXA 4DV0B 4DR5H 3BPZA 1XHXA 4FLUA 4RAYA 3B2EE 3UT5B 5KMGB 2CFMA 4DR4H 5LOVB 4DV7B 4IAJA 4RAZA 3FMAA 4JI4H 4CS4A 1TAEA 2Q2UA 5CB4B 3L2PA 1Q5OA 5LMNB 4TQDA 4EFBA 5JQGB 2E5LB 2P22C 4JI8B 1P49A 3K5MA 2HEPA 5FNVA 5CA1A 2BTQB 4U3JA 4K8XA 2FE3A 4O2AA 1M5IA 3LMLA 5LA6A 4DV5H 5D5QA 4NXNB 1N36B 2PY5A 4B3TH 1M0WA 4GKKH 1XI1A 5EIBC 3VQXA 1HNWH 5JVDB 2YIBA 4YHHB 5KHIA 3K3VA 2OWOA 3W1BA 4X64H 2ZM6B 3SJBC 3GDEA 1XQ8A 4DK1A 1DGSA 5J2UA 2VPSA 1AN7A 1H2SB 3KALA 1JMKC 4DR6B 4IHJA 4CC5A 4JI0H 1VS0A 2ZIOA 4AQYH 4LF6H 3JATB 3W5OA 4ZI7B 1XK5A 2P5OA 2Q7HA 4JI1B 4NXMH 4DR2H 5EIBD 4LNUA 4ZOLB 3K59A 3VQVA 4LFAH 3RYIB 4DV3H 3UQ8A 4DRXB 2V4DA 4RB3C 3QWUA 4GKJB 3N6XA 4I7HA 3KAJA 4DV1B 4AILC 3GB8B 1XMQB 3HXLA 4LFBB 4O4HB 5JJEB 5CA0B 4O4IB 3RYFA 4DV0H 3U11A 4OX9H 3WB1A 4JI7B 1SYXB 3RYCA 1XMOH 3N42B 4X65B 1P8LA 2CAZC 4DR1H 4DV7H 4KHPB 4DR5B 4HNAA 1M4UA 4CH4A 5D1OB 5KX5A 4IIJB 5IYZB 3JSNA 4DR4B 5JH7A 3U10A 4JI4B 3VQYA 4ZHQB 2RGVA 5C8YA 1Z2NX 5FD6A 4EQ5A 4O2BB 1MZBA 4YJ3A 1CKMA 1S5JA 1FKAH 1G6UA 1FVIA 4JI6B 3F8NA 1QHTA 1O75A 4NXNH 4CS3A 3RJ0A 4LF8H 2RQ6A 3NC0B 2F95B 3JARB 2KSWA 2VWJA 4DV5B 4PI2A 4FM2A 4B3MB 4B3TB 4M7EA 4HBNA 4PZ7A 3C0FB 4DR7H 4MV7A 3RF2A 3THOA 1SA0A 3N2GA 1JFFA 1IBKB 4F6RA 2R72A 3NBYB 5KHJA 4TV8A 5IJ0B 1N34H 5EZYB 5LA6B 4JI0B 4WBNB 3DF7A 4AQYB 2CW8A 1QQCA 1HNZH 4UCSA 1M93A 3BA9A 4I9QA 4NXMB 4LR3A 1X4TA 1KU9A 2HGSA 3PN1A 5LYJA 4GKJH 1B04A 2F1MA 3JAWB 4LFAB 1SEIA 5IJ9A 4CS2A 5LMUH 3TY5A 4DRFA 4JI7H 2HVQA 1FJGH 1TVKA 1CKNA 4LH7A 3HKBA 3ICXA 4OX9B 3NBZB 4KHPH 1XMOB 4LNUB 3RR5A 4DR1B 3QG5A 4UCOA 3N2KA 4X1YB 5J2TA 2E3CA 4FFBB 5LXTA 2WDTA 4LF4H 4FLYA 3MWMA 4X66B 1IBLB 4JI6H 4J0MA 5ITZA 3SGIA 5K1PA 1Q3EA 2Q0AA 3W1GA 4B3MH 3RYHB 1TUBA 4EB6A 4YJ2B 4LF8B 5KHKA 3J7AK 1M0TA 1IBKH 3RGXA 2CW7A 4DR7B 4DUYH 4BW9A 4UCTA 1O9GA 4YJ3B 4X20B 1WPBA 1N33H 2KKWA 4LH6A 1N34B 2Q2TA 3TY8A 4TUYA 3BAAA 1V9PA 3HKEB 4FM0A 5IWAH 1Z5WA 3KXYT 3JALA 1HNZB 4PI0A 3VQWA 1HW7A 4X1IA 2PTMA 4MTDA 3JASA 5GONA 4ZIBA 4MTEA 4F6RB 4PDBA 4X62H 4UFZA 4FLTA 2VQFH 1SKVA 1FFXA 3N40P 3HKCA 5LMUB 1BJTA 5LP6B 4A2AA 5IT9W 2YIAA 1FJGB 4LF9H 1O9HA 1HR0H 5EYPB 1Q43A 2WYOA 2Q7EA 2PUSA 4X66H 3BA8A 4TV9B 5CB4A 5BR8B 1IBLH 4X1KA 3SJAC 1WH2A 4LF4B 4FLVA 5JQGA 4UCRA 4JI5H 3OTOH 4O4JA 3K5OA 2BTQA 5BMVB 4DV2H 1IBMH 1CKNB 3RFRA 3VNNA 3HKBB 4D7SA 1J5EH 1XNQB 4LFCH 1ZHQA 5DISC 3OTFA 4MV9A 1I94H 5JVDA 2QM4A 3N2KB 3CVZA 4FVMA 4O4LA 3M4IA 4RZQA 3K58A 3RIZA 4JI3H 4K0KH 2YI8A 4K8ZA 2W57A 3IAYA 2UXBH 5JCOC 4DUYB 2PYLA 5FNVB 4JI2B 2UUCH 1VF7A 3T1HB 5CA1B 4YY3H 4U3JB 4O2AB 1N33B 1L2ZA 3JATA 4ZI7A 2PZSA 4DV4H 1N32B 2EX3A 2F4VB 5IWAB 4ZOLA 4BWAA 4LF5B 1L8DA 3CHXA 4APMA 1XDNA 4DV6H 3EYYA 3IG0A 5J2UB 4DRXA 3JAKA 3GJXB 4AHCA 4IHJB 4O4HA 5CA0A 4X62B 4EFEA 2VQFB 4CC6A 1RSOA 5LP6C 4B3SH 1XNRH 3LNNA 3N43B 3L4JA 4I4TA 5JJNB 3T1YB 1BGWA 4LF9B 2UUAH 3SR2C 2PYJA 2OYQA 4IIJA 5IYZA 1HR0B 5BR8H 3E22A 4LSAA 4FLXA 3FFQA 2VQEH 5GONB 1SQFA 1Q8IA 4UCUA 2ZNJA 4O2BA 3K5LA 2HVSA 2RJZA 1KMIZ 4FM1A 3RYFB 3WB0A 3HKDA 2BTOA 4JI5B 3OTOB 1SQGA 2YXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 B;  1TA8 A;  4DV2 B;  1IBM B;  1HNZ B;  1J5E B;  4EQ5 A;  1CKM A;  1X9N A;  1S68 A;  2HVR A;  4LFC B;  4TOI A;  4JI6 B;  1FVI A;  4LF6 B;  1I94 B;  4X64 B;  4UFZ A;  5FPR A;  5D1O A;  5D1P A;  4DR2 B;  3NC0 B;  2VUG A;  5LMU B;  4DV5 B;  4JI3 B;  4K0K B;  4B3M B;  4B3T B;  1FJG B;  2HIX A;  2UXB B;  4PZ7 A;  1CKO A;  2UUB B;  2UUC B;  4DV3 B;  4YY3 B;  2HIV A;  1IBK B;  4JYA B;  3S24 A;  2HHH B;  3BA8 A;  3RTX A;  4DV4 B;  5BR8 B;  4DV0 B;  3NBY B;  4LF4 B;  2CFM A;  4UCR A;  4PZ6 A;  4JI0 B;  4DV7 B;  4AQY B;  1TAE A;  2Q2U A;  1CKN B;  4DV6 B;  4UCS A;  3L2P A;  3VNN A;  3BA9 A;  5LMN B;  4NXM B;  4EFB A;  1XNQ B;  2E5L B;  3PN1 A;  5DIS C;  4JI8 B;  1B04 A;  4B3S B;  4E6N A;  4LFA B;  1XNR B;  4NXN B;  3TY5 A;  1N36 B;  4DRF A;  2HVQ A;  2UUA B;  4UCV A;  4LF7 B;  1CKN A;  4DUY B;  4LH7 A;  4JI2 B;  4OX9 B;  3T1H B;  3NBZ B;  4YHH B;  1XMO B;  2VQE B;  2UXD B;  2OWO A;  1N33 B;  3W1B A;  2UU9 B;  3RR5 A;  2ZM6 B;  4DR1 B;  3GDE A;  4UCO A;  1DGS A;  1N32 B;  2F4V B;  5IWA B;  4DR6 B;  4LF5 B;  4GLX A;  4CC5 A;  4X66 B;  1VS0 A;  2UXC B;  1IBL B;  4DUZ B;  3W5O A;  3SGI A;  1XDN A;  1XK5 A;  4EEQ A;  3BAB A;  4JI1 B;  4DR4 B;  3GJX B;  4B3R B;  3W1G A;  1A0I A;  4X62 B;  4EFE A;  3TY9 A;  2VQF B;  4CC6 A;  4DR3 B;  4LF8 B;  4PZ8 A;  3UQ8 A;  3T1Y B;  3QWU A;  4GKJ B;  4LF9 B;  4DV1 B;  3JSN A;  4DR7 B;  1XMQ B;  3GB8 B;  4LFB B;  1P16 A;  1HR0 B;  4UCT A;  1ZAU A;  4JI7 B;  5FPO A;  4GKK B;  1HNX B;  3KYH C;  4X65 B;  1P8L A;  4UCU A;  1HNW B;  4KHP B;  4DR5 B;  4JV5 B;  3JSL A;  4LH6 A;  2HVS A;  1N34 B;  5D1O B;  2Q2T A;  3TY8 A;  3BAA A;  1V9P A;  4JI5 B;  3OTO B; 
#chains in the Genus database with same CATH topology
 1XNQ H;  1M56 B;  4B7E A;  3AEI A;  2HP8 A;  2Q67 A;  4O7N A;  4HNA B;  3VOT A;  4I55 A;  4P30 A;  3Q2O A;  1GN2 A;  3LQS A;  1KEE A;  1K1Q A;  1I94 B;  1TGO A;  1JQ0 A;  4TQF A;  5C8Y B;  3PW0 A;  4GYC B;  2R7K A;  3VPD A;  1YEW A;  3F5T A;  5I5Y A;  4DV3 O;  3BQ0 A;  2ZIN A;  5CAE B;  2EIJ C;  4H0L B;  4FS2 A;  4O4J B;  5BZB A;  4M9U A;  1NH2 B;  2YEV A;  4OX9 O;  5T14 A;  1R6T A;  4WBN A;  3KHL A;  4JYA B;  2Y0P A;  3HKZ A;  1GGO A;  4QJF B;  2I80 A;  3SNO A;  4MTX A;  4JV5 H;  2OCC B;  5KFO A;  1QVG U;  2VA2 A;  2M7W A;  1JJO A;  1SA0 B;  3N2G B;  3W7U A;  1H2L A;  4QGP A;  2E5L O;  4X88 A;  5IYB G;  4ME6 A;  1KJ9 A;  2ATK C;  2RN9 A;  1WNS A;  4JXU A;  4O7W A;  3IC7 A;  2R8G A;  2IA6 A;  1VF6 A;  1ZHS A;  3E8H A;  2VRZ A;  5J2T F;  1AR1 B;  3T1Y H;  3OW2 U;  5L9X A;  3KAK A;  4NTX A;  4CH5 A;  3UT5 A;  3WG7 B;  3LUL A;  4EGJ A;  4D7T A;  5LOV A;  3OEH G;  2GV9 A;  2UUA B;  5IYD G;  4LF7 B;  5LYJ B;  3ETE A;  2YID A;  1CS0 A;  4N23 A;  2UU9 B;  4CHI A;  3CRA A;  2HHH H;  4C5B A;  2ZIM A;  1JKJ B;  3U0Z A;  5B1O A;  1U97 A;  5KUM A;  4JI1 O;  3RYH A;  1W2B U;  2CNQ A;  2UXC B;  1ZET A;  2QTO A;  3H1K H;  5KFN A;  1NS1 A;  4A3I G;  4EEQ A;  4BWS C;  4E2L A;  5LXT B;  5L3F A;  4XZ3 B;  1VEW A;  2E5L H;  1YCI A;  4O83 A;  5DGB A;  3TY9 A;  4DV1 O;  4FFK A;  4DR3 B;  3P3N A;  3TQ1 A;  4X20 A;  3E35 A;  5C1P A;  3H1J H;  5LMU O;  5C93 A;  3NGD A;  3ZIA G;  1GYF A;  1PK8 A;  2Z0A A;  4YHH H;  5FPO A;  4GKK B;  3K5N A;  5H80 A;  2EJ7 A;  4FU0 A;  3BEH A;  4DR4 O;  1R3L C;  1AUX A;  1HNW B;  1ROP A;  3CSW A;  4JI4 O;  4MA0 A;  3JSL A;  2R85 A;  3PR5 B;  3QF7 A;  3RYI A;  2COI A;  2YC0 A;  1XIL A;  3WNZ A;  1GH6 A;  4Q8E A;  3DC5 A;  1NH2 D;  2W9C B;  3GTM A;  1S5H C;  4M0J A;  4ETS A;  4IYH A;  2GHY A;  4GUN A;  3MJF A;  4JI1 H;  2UVR A;  2ZE5 A;  2QE7 G;  3RGB A;  4TUY B;  4HNV A;  1RP3 B;  4O3O A;  1Q82 W;  4JGS A;  3SYQ A;  4MV8 A;  5JQG F;  4R7R A;  4QW8 A;  4EGQ A;  2W7O A;  2IH3 C;  5DQG A;  4UUG A;  4Q0Y A;  2VUG A;  4O4J F;  2SCU B;  1I0H A;  5EC2 C;  1I7F A;  3FYE B;  2UXD H;  3JAS B;  3L75 H;  4ZHQ A;  2W6M A;  2CGN A;  3CCQ V;  2WB1 A;  4RB2 C;  3OM3 B;  1OBG A;  4DV1 H;  5KHG A;  1SCU B;  4RB0 A;  2JK5 C;  1MSD A;  3RTX A;  1WJZ A;  4MV1 A;  4DV0 B;  2Z04 A;  3CRR A;  2DN9 A;  1KT8 A;  2YRX A;  3B2E E;  4NR1 A;  5KMG B;  2GTA A;  3I55 V;  2OH2 A;  4DR4 H;  4DV7 B;  4IAJ A;  4JI4 H;  3R9R A;  4CS4 A;  3CME V;  2Q2U A;  2B1G A;  5CB4 B;  2EIM C;  2BR0 A;  1MNG A;  3QZ8 A;  3CC4 V;  5C4X G;  4EFB A;  4ED0 A;  2EJR A;  1JA8 A;  4EEY A;  5DMX A;  2RF4 A;  1OJH A;  5FNV A;  3J7A U;  2Y0S E;  4R50 A;  5CA1 A;  4U3J A;  4ECT A;  3E89 A;  4KP4 A;  4A5U B;  2FE3 A;  1CP9 A;  4ASU G;  3WO1 A;  4QE7 A;  5D5Q A;  5H5N A;  1M0W A;  5EIB C;  4J41 A;  1KEC A;  4CKC A;  2V4R A;  2OIG A;  3CEI A;  2V5A A;  1LR1 A;  4O4H F;  1URF A;  1B6S A;  2OWO A;  2FKL A;  2R8I A;  4X64 H;  1R9T A;  5BXZ A;  1I1M A;  3SJB C;  2P0A A;  2FK1 A;  4DK1 A;  4YR3 A;  5J2U A;  2VPS A;  2AQ4 A;  1AN7 A;  1H2S B;  2ZDI A;  4BAY A;  1JMK C;  4F4X A;  4IHJ A;  3C3S A;  4RQF A;  3GTJ A;  2BOB C;  4AQY H;  2BOC C;  5C3E G;  2YXY A;  1B6R A;  1NR7 A;  2YZG A;  1GM8 A;  2P5O A;  2Q7H A;  1XK5 A;  2W6Z A;  1AI7 A;  1F4M A;  1FPO A;  2QKS A;  4DR2 H;  2Q69 A;  4ZOL B;  2Z3Y A;  2WLI A;  4H37 A;  1I94 O;  4A3F G;  5LGT A;  4BBS G;  4DR7 O;  3T4D A;  1GO3 F;  4JV2 A;  4K3A A;  1JCH A;  5H6Q A;  3QFF A;  4LP8 A;  3QWU A;  3N6X A;  4I7H A;  1I3Q A;  3CX5 F;  2RNB A;  4AIL C;  4NYK A;  3CRM A;  5CA0 B;  4O4I B;  1DV2 A;  3RVY A;  2GPS A;  3WB1 A;  2YRW A;  3G6X A;  3SPG A;  3H3V H;  2RMK B;  4DR1 H;  3TW6 A;  3JYC A;  4DR5 B;  2YSU B;  1TWA A;  1HDJ A;  2IJK A;  1LUV A;  1M4U A;  4HNA A;  5D1O B;  3TIG A;  1S0M A;  1WLE A;  2QWN B;  3CD6 V;  3PVX A;  3M9O B;  3VQY A;  2BQ3 A;  5C8Y A;  1Z2N X;  1FAF A;  4EQ5 A;  4O2B B;  3CE2 A;  1MZB A;  5L1I A;  2PF4 E;  1CKM A;  5KFC A;  4PV1 B;  3ASN B;  4JI6 B;  1GTO A;  4NXN H;  4Q44 A;  4YIO A;  3H9V A;  4CS3 A;  2WA4 A;  1KQS U;  3JAR B;  2C28 A;  1YZB A;  2R86 A;  3PJS K;  4B3M B;  2FYU H;  4B7K A;  4QJF A;  4O3S A;  2UUA O;  4DR7 H;  2ODM A;  2N05 A;  2LO1 A;  4U7N A;  2ASJ A;  4ED8 A;  3T5H A;  3BFR A;  2X7R B;  1SA0 A;  2DWE C;  3N2G A;  1IBK B;  1VF5 B;  1GM7 A;  1Q6U A;  4GZR B;  2W6I G;  3DC6 A;  2R72 A;  3UYY A;  4HR7 A;  2EJ2 A;  4QE9 A;  4JI0 B;  3K06 A;  2UXC O;  3IJ4 A;  2EBO A;  4UUJ C;  1QQC A;  4ECW A;  1R3I C;  4NXM B;  2H3O A;  1YSC A;  1KU9 A;  4KXR A;  2AHZ A;  2AGA A;  5LYJ A;  3MR3 A;  2KG7 B;  4GKJ H;  1KKD A;  1B04 A;  4DW0 A;  4QW9 A;  5BWR A;  2MK3 A;  4YAJ B;  4DR3 O;  1EBO A;  5L3B A;  1OBD A;  4HYO A;  4ICG A;  5L3G A;  4JI7 H;  2RDJ A;  5JVL A;  4LH7 A;  3HKB A;  4DAA A;  4LNU B;  2F4V O;  2XCP A;  2J6U A;  3RR5 A;  4GC6 A;  2HGX A;  1V55 C;  4UCO A;  4X1Y B;  5LXT A;  4G28 B;  4BR6 A;  2QTS A;  3ZHS A;  4I7Z B;  1SZX A;  1FFT B;  3HB3 B;  2LQT A;  2VQF O;  1PKX A;  1N0N A;  1H38 A;  2DMX A;  1E4E B;  1IUR A;  2QYZ A;  1KP3 A;  1XRE A;  4O4I F;  3GV5 B;  4ECV A;  2CW7 A;  3S3W A;  5LP6 F;  4BW9 A;  2Q6A A;  4O7S A;  2P7T C;  3AX6 A;  3KZI Z;  5KA5 A;  5L3E A;  1V54 B;  4JI5 O;  3OTO O;  2NN4 A;  1QNM A;  2W9C A;  2OTJ V;  4DV2 O;  1N34 B;  3ORQ A;  4TV9 F;  4A3E G;  3TY8 A;  4TUY A;  2W8L A;  3HKE B;  2ZD9 A;  3ZHV A;  1Z5W A;  1KUQ A;  3BG5 A;  3KXY T;  3ZMV A;  1HNZ B;  4PI0 A;  2R8K A;  3JAS A;  1CQI B;  1S0N A;  4K0K O;  4PDB A;  1AI5 A;  2VQF H;  1SKV A;  3LUT B;  1VF6 C;  2JA8 G;  2FPG B;  1BJT A;  4RU9 A;  2FKX A;  3OE7 G;  2XCA A;  5IT9 W;  2EIN B;  4WFF A;  4LF9 H;  2QWP B;  4LBE C;  1FJG B;  4XX0 B;  3ZHU A;  2YZN A;  2JGD B;  5EBL C;  4I5S A;  2DZD A;  4C2M A;  1K83 A;  5EYP B;  1Q43 A;  5B66 Z;  3SPJ A;  4X66 H;  5CB4 A;  5KFT A;  3G8D A;  2E75 B;  5BR8 B;  4J9S A;  1WH2 A;  4DV6 O;  4JI5 H;  3OTO H;  2A9H A;  1RM1 C;  2W0F C;  4YIP A;  4DW1 A;  3LNM B;  5DAA A;  1A32 A;  1I2L A;  4DV2 H;  2DQ0 A;  1CKN B;  2BQR A;  1IBM H;  3RFR A;  2IU3 A;  2YIC A;  1XNQ B;  2R93 A;  3K79 A;  4LFC H;  3GWO A;  2DYR B;  5DIS C;  3RB4 A;  2IJJ A;  4MV9 A;  1PNK A;  3GIQ A;  3BQ1 A;  3W7T A;  2CK3 G;  3KHG A;  2L6L A;  3SPH A;  3G6E V;  2VPQ A;  4RZQ A;  3BJY A;  4K0K H;  1SS3 A;  5KT4 A;  2FLL A;  3EVK A;  4K8Z A;  4NZN A;  1MAB G;  4DUY B;  1JDB B;  4ZQI A;  2C22 A;  3KRE A;  2UUC H;  4YY3 H;  1NZ6 A;  4J11 A;  1KC7 A;  3PO3 G;  4DL4 A;  3I5D A;  5KLV H;  4RUA A;  1L2Z A;  4MW3 A;  3OAA G;  2CNU A;  3UO3 A;  4DR5 O;  4FFN A;  3OMA B;  5DGH A;  4ZOL A;  4MVQ A;  4A3L G;  3D36 C;  1L8D A;  1DK1 A;  1K3E A;  3CCS V;  2JA6 A;  1XDN A;  4DV6 H;  2X6C A;  5F9L A;  3FX7 A;  3GJX B;  4FIP C;  5IYC O;  4LCU C;  1BMF G;  5CA0 A;  1GN4 A;  4EFE A;  4X62 B;  2YXH A;  4CC6 A;  2Y0S A;  4B3S H;  1F23 A;  3T4Z A;  3LNN A;  3N43 B;  3L4J A;  4I4T A;  4O86 A;  5JJN B;  2F43 G;  3T1Y B;  3JD2 A;  3X2Q C;  5DGI A;  1S10 A;  3SR2 C;  2WTF A;  2PYJ A;  2WAQ A;  1W59 A;  4LSA A;  1W93 A;  4FLX A;  2VQE H;  1TWG A;  5GON B;  2DOS A;  4UCU A;  2QKA A;  4O2B A;  4A3M G;  4QSH A;  3WB0 A;  2O57 A;  3SYC A;  5B1B C;  4JTC B;  1VBH A;  2AU0 A;  1TA8 A;  5IP9 G;  5KFU A;  4LF6 O;  1XUQ A;  3D8C A;  3TXQ A;  4DUZ H;  1J5E B;  3JAR A;  2FML A;  1UC9 A;  2PI4 A;  2ITD C;  2QEX V;  4NXM O;  4B3R H;  4NYE A;  4TOI A;  3ABK C;  4O3P A;  2YS7 A;  1U96 A;  3RB0 A;  2RGR A;  4X1K B;  1QU7 A;  2UUB O;  3T1H H;  4JI3 B;  1IX9 A;  1WN7 A;  4YBZ B;  3PZP A;  5CBH A;  2UXB B;  2O03 A;  1JX4 A;  2R92 G;  2E2H A;  2Q4P A;  1EN4 A;  1N32 H;  3CCJ V;  4GLW A;  3ETQ A;  4R8U B;  1M1K W;  4LF5 H;  3S24 A;  2ZXW C;  5LBQ A;  4MVR A;  1OV9 A;  3NUA A;  5BPH A;  5IYD O;  4UVC A;  1KJQ A;  1YXB A;  2GTS A;  2Y69 C;  1GAX A;  4O4L B;  2KG7 A;  3RGZ A;  3ZS8 C;  5L1L A;  1OWT A;  2ZDI C;  3UO2 A;  3LP8 A;  1E1R G;  1NJI W;  4RAI A;  2NVY A;  4A2B A;  4G2K A;  4EYI B;  3DXR A;  3I56 V;  4JZ2 A;  4R8C A;  4FLZ A;  4JV0 A;  4EG0 A;  3KHH A;  3CCL V;  2EIK B;  2Y48 A;  4CH6 A;  2C2E A;  4A3D G;  3G6V A;  2FMA A;  4X1Y A;  3AG2 C;  2BE3 A;  3F7V C;  2UUB H;  3JZ6 A;  3G71 V;  2A79 B;  5BPF A;  1BQZ A;  3JAK B;  4TWK A;  2UXD B;  3LDE A;  3VPC A;  5JUM A;  2XGP A;  3SDL A;  3GIM A;  2ZCE A;  2Q7G A;  4NTW A;  1TWC A;  1N34 O;  4O7L A;  4Q43 A;  3CYO A;  1DF5 A;  4GLX A;  5KA6 A;  2YS6 A;  1ENV A;  3CCR V;  3GIJ A;  3WWJ A;  1RK5 A;  3H4D A;  1E4E A;  4DL6 A;  3N27 A;  2R93 G;  4DXW A;  2ZNI A;  1HNZ O;  4L8J A;  5J2T B;  3BAB A;  2DWD C;  5LMN H;  3E22 B;  1Z5V A;  2DJV A;  3JRX A;  2GUZ A;  4NZO A;  3R65 A;  4F4L A;  2E76 B;  1I7L A;  2Q8V A;  4PZ8 A;  2CTQ A;  3K08 A;  2CE4 A;  5L3D A;  4IRK A;  5L1J A;  3HOU G;  3QZ7 A;  5AG2 A;  5EOY A;  2IM9 A;  3KG2 A;  5GW7 A;  1FJG O;  3RFC A;  1P16 A;  2R7N A;  4TT3 G;  1PM9 A;  3HKE A;  4KHP O;  5GON F;  4EB6 B;  5DEC A;  1C3O A;  1HNX B;  2IBK A;  2DYS C;  2N74 A;  2ZM6 H;  1E4G T;  3CC2 V;  3CB2 A;  2WE6 A;  4QWB A;  2FK2 A;  4EBE A;  3TEK A;  2JA6 G;  3GID A;  4DR6 H;  4I50 B;  4X64 B;  1R1B A;  3ZRV A;  3ZHQ A;  2W9B B;  3HOX G;  2CUG A;  2R8H A;  3EXA A;  3CCE V;  1VQ9 V;  3UZB A;  2JJ2 G;  2JGD A;  3N44 B;  3WG7 C;  2XHB A;  4QWE A;  5D1P A;  1VAR A;  5EYP A;  4DR2 B;  1K34 A;  1NBM G;  4LWS B;  4IYI A;  4U7C A;  3CXC U;  5CM0 A;  1QLN A;  3ZMU A;  2UXX A;  1CKO A;  4DUY O;  4Q20 A;  5EC1 C;  5IY5 B;  5KS8 A;  1FFX B;  4H13 B;  3CC7 V;  1K7D A;  5JVD F;  3HKC B;  5IYC G;  4DK0 A;  5B5E Z;  2R7L A;  2WAM A;  3D3I A;  4O4L F;  3BPZ A;  1XHX A;  2AXT Z;  4FLU A;  4QWD A;  2ODT X;  3F5W C;  2R9R B;  3DGE A;  5KG7 A;  4RAZ A;  1TAE A;  4WFH A;  4ZI7 F;  4LFA O;  2DIK A;  5JQG B;  2LP7 A;  4JI8 B;  3OMI B;  3K5M A;  1PNL A;  3RT3 C;  4Z1V A;  4CMD A;  5LA6 A;  3TQT A;  5DN6 G;  4NXN B;  1N36 B;  5F9N A;  1XI1 A;  3ASO B;  3FYI B;  4NKG B;  2R7Z A;  5B1N A;  4DIM A;  2C2A A;  5KHI A;  3PW2 A;  5HNE A;  2UXN A;  1RK6 A;  5HFL A;  2XND G;  2CKZ B;  3AG4 B;  1IBL O;  1DGS A;  3GTK A;  1BS3 A;  4A3J G;  2ZDH A;  1GO3 E;  4TQR A;  2JEF A;  1US6 A;  1FKA O;  1PPJ H;  4IIJ F;  1RJR A;  3OUZ A;  3MFI A;  2YZM A;  4F4Z A;  1J5E O;  5CBF A;  3ZHT A;  4FFM A;  3QNE A;  5KG2 A;  3UZO A;  2GQR A;  3FDS A;  2HJF C;  3HBL A;  3GIK A;  3T99 A;  1ZQ7 A;  3CPW U;  3L9D A;  2ZDG A;  2YZL A;  4J9O A;  3QO5 A;  4LFA H;  1JR9 A;  1RFY A;  2V58 A;  3UQ8 A;  4DV3 H;  2YUA A;  4DRX B;  1IOW A;  2V4D A;  4GKJ B;  3KAJ A;  3GB8 B;  1XMQ B;  4LFB B;  2UXB O;  4O4H B;  3D3Q A;  3FD9 A;  2QM7 A;  4OX9 H;  1PV0 A;  3VBB A;  4JI7 B;  1SYX B;  1A0G A;  1KC8 W;  2QR4 A;  4X65 B;  2QSA A;  1VQL V;  1S77 D;  3APO A;  2DE0 X;  3K3P A;  4I50 F;  4MV4 A;  4MT8 A;  2W6Q A;  2QK4 A;  2ZT9 B;  5BYA A;  3OUS A;  1VQP V;  1EM1 A;  3G4S V;  3H1I H;  3B40 A;  3ZRX A;  2DQ3 A;  5EZY F;  4OGQ B;  2RGV A;  3G67 A;  5HFM A;  3IC9 A;  1M90 W;  4NTY A;  2FP4 B;  1FKA H;  4F4W A;  1O75 A;  4RQE A;  1P4R A;  1SQP H;  3U9S A;  2WLL A;  4U3F H;  3RJ0 A;  2LJ2 A;  2ZR2 A;  4ECR A;  1QCE A;  2F95 B;  4MVO A;  2VWJ A;  4DV5 B;  4A93 G;  2VA3 A;  4B3T B;  4ZKI A;  1BXR A;  1WP7 A;  4PZ7 A;  1BHA A;  3C0F B;  2XGQ A;  3THO A;  5LHG A;  4J9P A;  2EUL A;  3ETD A;  4JAU A;  4J7Z A;  4F6R A;  1NTM H;  3HOZ G;  2EIJ B;  3QO7 A;  5KUK A;  5KHJ A;  1Q90 D;  2CNV A;  1Y76 B;  2C00 A;  1SQQ H;  3OD4 A;  4ECS A;  2CW8 A;  3RW0 A;  3F7Y C;  1T94 A;  4UCS A;  3OSN A;  1ZUQ A;  2V59 A;  1UFI A;  3BA9 A;  4LR3 A;  3H1L H;  4RWU A;  1G8M A;  3ABU A;  4PA3 A;  3L73 H;  2FLP A;  2F1M A;  3JAW B;  1SEI A;  4JI2 O;  3OT7 A;  5LMU H;  3TY5 A;  4YJ2 F;  5KFP A;  2ADQ B;  4TVI A;  5L1K A;  1NVP B;  2E2I A;  4O7Z A;  5CN0 A;  3MWD A;  5KFG A;  3TCU A;  1XMO B;  1VQ6 V;  1YF2 A;  4PDV A;  5IWA O;  1HNX O;  1XDC A;  5B1A B;  3PW4 A;  3PW5 A;  5J2T A;  4FK5 C;  1CEZ A;  2E3C A;  2YU9 A;  1MG1 A;  1QR8 A;  2WDT A;  3H4B A;  4FLY A;  3ML0 A;  4X66 B;  1H2K A;  1TWF A;  3GTL A;  4J0M A;  4ZBM A;  1K4D C;  1N56 A;  5KG3 A;  3E5N A;  3ASN C;  5KFD A;  4J7K A;  1Q3E A;  3R5F A;  2N04 A;  3SE7 A;  4O7V A;  3W1G A;  2CQY A;  1H8E G;  3I12 A;  1VQ5 V;  4EB6 A;  4LF8 B;  2DAA A;  2NU8 B;  1Y1W A;  1EUD B;  2R7Z G;  1XL6 A;  2XUM A;  1JXL A;  2PMZ E;  4ECZ A;  5K3W A;  3H01 A;  3ABL B;  2J6S A;  2ZR3 A;  4YP3 A;  4UCT A;  5DG8 A;  1Y1V A;  3KCY A;  3BAC A;  4YJ3 B;  3OFN G;  4H44 B;  2A1H A;  3T54 A;  1WPB A;  2W9B A;  5BWU A;  2KKW A;  5KG4 A;  3KHR A;  2Q2T A;  1DLB A;  5IWA H;  3HOW G;  4J9M A;  4JYB A;  3K9A A;  4O3Q A;  3R5H A;  3Q8S B;  3K0D A;  3PO2 G;  4P9O A;  4Q4D A;  4PA7 A;  2WLK A;  5BMV F;  1HW7 A;  4LWS A;  2LW7 A;  2PTM A;  4MTD A;  4ZIB A;  4MTE A;  2ZDQ A;  3L72 H;  4JI8 O;  2HVJ C;  1WA8 B;  5B3S B;  3LDD A;  4UFZ A;  4FLT A;  1R6K A;  1FFX A;  3N40 P;  3GV8 B;  3HKC A;  3FKS G;  5LP6 B;  1NTK H;  4U7O A;  2PI5 A;  2A7W A;  4A2A A;  4JYA O;  1FXH A;  5CBG A;  1S76 D;  4JAA A;  3ETJ A;  3T2M A;  1MZF A;  3H1H H;  1GSH A;  4MVS A;  4FE2 A;  1EZ1 A;  4PWQ A;  2WYO A;  2VS0 A;  4O2A F;  4TV9 B;  4LF4 B;  5JQG A;  4JF3 A;  4QIW F;  3ORR A;  4UCR A;  4O4J A;  4J9Z B;  3VNN A;  4D7S A;  3GV7 B;  4O7R A;  3OEE G;  1DAA A;  3E8B A;  1ZHQ A;  2F23 A;  5H2F Z;  1I94 H;  2QM4 A;  3N2K B;  3CVZ A;  5KG1 A;  4LF7 O;  2XAH A;  1YIJ V;  4IT5 A;  1Y66 A;  3Q4H B;  4HN2 A;  3M4I A;  2LFS A;  3K58 A;  2LGW A;  5KG5 A;  4J9R A;  3IAY A;  2UU9 O;  1XMQ O;  4LFB O;  2AW9 A;  3T1H B;  2W6J G;  3FB7 C;  1IVS A;  1N33 B;  3GQC A;  4XYL B;  1QR9 A;  2PZS A;  2QGN A;  1N32 B;  2EX3 A;  2OTL V;  1JX9 A;  4FZ0 A;  3TJT A;  2ABJ A;  2JS3 A;  2HHF B;  4HYK A;  3BQ2 A;  4LF5 B;  3O65 A;  4O3N A;  5KAI Z;  4APM A;  4HQ6 A;  1L1F A;  3IN5 A;  5I5T A;  2B63 G;  4DRX A;  1XOU A;  2ZQM A;  1Z2G A;  5EK0 A;  4AHC A;  5I60 A;  2P67 A;  4O4H A;  5KX5 F;  3CJH B;  3K03 A;  2EIN C;  5JH7 F;  4QPJ A;  1H2N A;  2CH7 B;  3FKI G;  3GTO A;  2EIL B;  5KFJ A;  4B3T O;  4OPA A;  4GKK O;  2FPP B;  5HV6 A;  5LHI A;  3DAA A;  1WRV A;  3RAQ A;  4YJ3 F;  2UUA H;  1HNW O;  1OCO B;  5I5X A;  2OYQ A;  1HR0 B;  3WO0 A;  3T9B A;  5EWF A;  1R6N A;  4RUC A;  1A48 A;  1SQF A;  5KFL A;  3OMN B;  2ZNJ A;  1VAJ A;  4MSW C;  2R7M A;  3MD0 A;  4FM1 A;  3RYF B;  1K1S A;  2BTO A;  3ZN0 A;  5KG6 A;  5FJ8 G;  2UXC H;  1YJW V;  2J9G A;  2GSM B;  3DTU B;  4RNM A;  4L1K A;  2MCT A;  1VIB A;  1X9N A;  2YI9 A;  3ABM B;  5L3C A;  1S68 A;  3E2E A;  1Y1W G;  1SF9 A;  4TV8 F;  4O7T A;  2ALZ A;  1S03 G;  4R6Z A;  2HVK C;  1SQV H;  3ZN1 A;  3GIP A;  1I50 A;  4DR3 H;  5FLX W;  2BSK B;  2NR5 A;  3RWR D;  4ED7 A;  3CEB A;  3MR2 A;  1Y1V G;  1I1L A;  3RBE A;  2FTK A;  1Y74 B;  1FXV A;  1ET0 A;  5KT3 A;  1KKC A;  2R92 A;  3CCU V;  1Y76 A;  4DV0 O;  1I6U A;  5BY1 A;  3J81 W;  2F4V H;  1XMO O;  4JZG A;  1OCC B;  4XDK A;  4DV4 B;  4DV7 O;  4G27 B;  2CZG A;  2HJW A;  2F93 B;  1OHH G;  2W6P A;  2YWV A;  4PZ6 A;  4J9K A;  1E79 G;  3JAW A;  4PHZ A;  5EBM C;  1L0N H;  1VQ8 V;  4X89 A;  3L4K A;  2BQU A;  4KL1 A;  4E6N A;  1XNR B;  5KMG A;  4O84 A;  4FGR A;  3MAQ A;  1IDS A;  2YIB D;  3HPL C;  2FPI B;  1LUW A;  3KCX A;  4RB1 A;  1SET A;  3A2F A;  1B6Q A;  1PD3 A;  4Q45 A;  1T3N A;  4FM9 A;  2JJ1 G;  5IJ9 B;  3A0H Z;  1M7J A;  1T36 A;  4EYH B;  3T1C A;  2B5U A;  2JGU A;  1Z2O X;  3T9D A;  1XL4 A;  5FD5 A;  1GKF A;  4BW5 A;  2X0S A;  1VMG A;  1MZE A;  5I5V A;  3H0G G;  2PGG A;  2JA7 A;  2W9A A;  3WFV A;  3RUP A;  2IH1 C;  1A0I A;  3UKM A;  3HB9 A;  4IL6 Z;  5DQI A;  3M9N B;  5DGA A;  4KUM A;  3B77 A;  5ITZ B;  5KFE A;  4I0X B;  3HKD B;  1OCR B;  3U54 A;  1S97 A;  1VQ7 V;  1TUB B;  5DLF A;  1WB8 A;  3JD1 A;  4I55 B;  3JAM W;  3G8C A;  2QF7 A;  3CSX A;  5JJJ B;  1AVM A;  1I2K A;  4JV5 B;  1R3K C;  1MA1 A;  4JAS A;  1NR1 A;  2Q73 A;  4G3I A;  3R66 A;  5BYB A;  1BL8 A;  1WA8 A;  3NR7 A;  4XDJ A;  4JI6 O;  3SYP A;  4C5C A;  4O4I A;  2MW2 B;  1WCM A;  2VWK A;  1VQN V;  4MW8 A;  2YW2 A;  3HT5 A;  1R73 A;  3JD4 A;  5LP6 A;  3WWH A;  3EPI A;  4NVP A;  1EZJ A;  4B3M O;  3BCC H;  4CKE A;  3JAL B;  1AI4 A;  5D1O A;  2DW4 A;  3WB2 A;  2M6Y A;  1IZ3 A;  3MHH C;  2XAF A;  3ZRS A;  4TV9 A;  1IBK O;  1S5L Z;  2WLM A;  1A3G A;  2PMZ A;  2NLJ C;  5A2Q W;  4DV3 B;  5KHH A;  2W7P A;  1P7B A;  2HIV A;  2OCH A;  1G1X B;  3MR5 A;  1ZL8 B;  2GPW A;  2VOB A;  3Q8P B;  1K73 W;  2HHH B;  1N33 O;  3CQZ A;  4JI0 O;  3SI8 A;  4RUE A;  4DR5 H;  5KFR A;  2XAJ A;  3UT5 B;  1NU1 H;  3FB6 C;  1V4Y A;  1I5Y A;  5LOV B;  5C5J A;  3Q4H A;  1Q5O A;  2XD4 A;  2COJ A;  1EYZ A;  5KFB A;  3HR0 A;  2E5L B;  4P2Z A;  2HEP A;  4BIO A;  1KUT A;  2BTQ B;  4K8X A;  3B09 A;  2EJ3 A;  3CS5 A;  3LML A;  5D8D A;  3VQX A;  5KKN B;  2HHF A;  3ZMZ A;  4MV3 A;  5GTI Z;  5JVD B;  2JA5 A;  2YIB A;  4WFE A;  1HR0 O;  4YHH B;  3K3V A;  3ZHR A;  2WA3 A;  1EZV H;  3W1B A;  5FLX N;  3PW7 A;  4JPR A;  2CTR A;  2EZP A;  1P7G A;  4F6E A;  3V6H A;  3V4S A;  4BIZ A;  2EZO A;  4C7U A;  4CC5 A;  4JI0 H;  3CJH A;  5IYZ F;  3J81 N;  1Y6X A;  3LSQ A;  4LF6 H;  1EUC B;  3W5O A;  4ZI7 B;  2CH7 A;  4PD4 F;  3T9C A;  3HOV G;  4JI1 B;  4FS1 A;  4NXM H;  3VPB A;  3RBZ A;  4LNU A;  3V6K A;  3HOY G;  5CMU A;  4UVA A;  3K0G A;  5KFA A;  5TIS Z;  5EWG A;  3RYI B;  3FB8 C;  1NQT A;  4RB3 C;  1WSC A;  4H33 A;  1FXK B;  4DV1 B;  4HNU A;  2RCV A;  3B4S A;  5IP7 G;  4ED3 A;  4I55 F;  5JJE B;  2QA4 V;  4CZZ A;  3RYF A;  2YYA A;  5IT9 N;  4JYY A;  5H9C A;  3AW8 A;  2A0L A;  3VOU A;  5I5S A;  1M56 C;  4BBR G;  1BGY H;  1AJQ A;  3GII A;  2P4V A;  3AG3 B;  5FR9 A;  1UPG A;  4DV4 O;  4FZ1 A;  2CDY A;  1K5S A;  2ZE8 A;  4IIJ B;  4DR4 B;  1BT8 A;  3ZCC A;  2QB5 A;  2JA7 G;  4JI4 B;  2Z5U A;  4ZHQ B;  1TUE B;  2HLD G;  4WBN F;  2IJH A;  5C44 G;  2BSK A;  4DL2 A;  1K8A W;  4IRD A;  4MAM A;  1VQ4 V;  1G6U A;  2RDC A;  2GBO A;  4UV9 A;  1N48 A;  1QHT A;  3JCZ A;  1W96 A;  4GX5 A;  1YJN V;  1AUV A;  3CCM V;  4BY1 G;  3NC0 B;  2KSW A;  1XNR O;  4FM2 A;  2QWQ B;  2OCC C;  3U0G A;  1VP7 A;  2EIY A;  2NU9 B;  2HR3 A;  1VQK V;  4MV7 A;  3RF2 A;  5BR8 O;  3L70 H;  3LDC A;  1BZK A;  3ABT A;  3MDS A;  4ECU A;  1KJ8 A;  1K4C C;  1N8R W;  4NZM A;  5DLG A;  3JZI A;  1M6V A;  5IJ0 B;  5LOV F;  2PBZ A;  1N34 H;  1B06 A;  2K9P A;  5EZY B;  4RNN A;  1WCM G;  4AQY B;  1XNQ O;  5KFV A;  1YI2 V;  2DWC A;  2JEJ A;  2ZXW B;  1BQ0 A;  3WWI A;  1AB3 A;  1HNZ H;  1UJW B;  2HKO A;  1UNN C;  1M93 A;  4QWA A;  1RPR A;  1FS0 G;  3QO8 A;  4MV6 A;  3SJQ C;  3R23 A;  5IJ9 A;  4CS2 A;  5DM6 V;  1M57 B;  1S0O A;  4O82 A;  1OCZ B;  1FJG H;  4J9Q A;  1CKN A;  4HZ3 A;  3T9F A;  4KHP H;  3NBZ B;  1IYE A;  5CR5 A;  1EN5 A;  3QVN A;  1FD9 A;  3E8G A;  4KFM A;  4Z2W A;  4DR1 B;  4PA4 A;  1GN6 A;  3QG5 A;  4MVM A;  1H2G A;  2NNU A;  4JV5 O;  4FFB B;  4A3B G;  3GVM A;  5A2Q N;  2V4Q A;  5EWE A;  4RZR A;  4JV1 A;  3U9T A;  2DPJ A;  5ITZ A;  3SGI A;  2LGQ A;  5K1P A;  4I0X A;  4OPH A;  4X62 O;  1GLV A;  1ULZ A;  5KT5 A;  3CMA V;  3S3X A;  1MOF A;  3T1Y O;  1TUB A;  4YJ2 B;  5KHK A;  1S3J A;  3SPI A;  2JA5 G;  3J7A K;  3RGX A;  1G4Y B;  4QWC A;  1H8H G;  3ETG A;  4DR7 B;  4JYC A;  1VQM V;  2X5R A;  4DUY H;  3VMM A;  3MFH A;  4FJC C;  4IR1 A;  1O9G A;  2CTW A;  3ETH A;  1ZTE A;  4EBC A;  2X6B A;  5KFS A;  2HHH O;  3AK2 A;  4LH6 A;  2B9Z A;  3CWB H;  4W4L A;  4ZHQ F;  3K5I A;  4FM0 A;  2WWW A;  3ZX6 A;  1OZ0 A;  3JAL A;  2DYS B;  3T7A A;  2ARH A;  4A3G G;  5GON A;  1DF4 A;  1I1K A;  1EN6 A;  4JI3 O;  4X62 H;  5DG7 A;  4J80 A;  1WB7 A;  1HWY A;  1ZL8 A;  4O3R A;  3FAV B;  4QIW E;  2QDO A;  3MWE A;  2YIA A;  3RV3 A;  1QLE B;  2G38 A;  2KQX A;  1IXB A;  3K5H A;  1SFO A;  3W7S A;  4ED2 A;  4PDM A;  4HAM A;  5B1A C;  3UCS C;  4YHH O;  5FNV F;  5CA1 F;  2Q7E A;  3Q8R B;  2Q7D A;  3BA8 A;  1IBL H;  4WF9 V;  2W71 A;  4X1K A;  4ECX A;  3SJA C;  2XAG A;  4FLV A;  3AG1 B;  3N6R A;  3TIN A;  2XCL A;  4GCZ A;  1IYD A;  2BTQ A;  5BMV B;  2COG A;  1KJJ A;  2GQS A;  1B33 N;  2A3Q A;  1J5E H;  3HKB B;  3I4N G;  2DAB A;  2FB9 A;  2H94 A;  4R8U A;  4EKW A;  2XOK G;  5J2U F;  2HG5 C;  3OTF A;  5JVD A;  4L87 A;  4IHJ F;  4UVB A;  4O4L A;  5CA3 A;  3RIZ A;  3ABL C;  4JI3 H;  4FPP A;  2W6O A;  2UXD O;  3EPG A;  3Q8Q B;  2UXB H;  2JEG A;  5E25 A;  1VF7 A;  4LC1 A;  1AJN A;  2JEU A;  3N8D A;  3BVO A;  4O2A B;  1JVM A;  4PJ0 Z;  1K33 A;  3UM7 A;  4ZI7 A;  2LFR A;  2UVU A;  1K5Q A;  4J42 A;  4ECY A;  3G6Y A;  4WCE V;  1YTF B;  2F4V B;  4BWA A;  2W6N A;  1ORQ C;  3D36 A;  4E4T A;  3OR7 C;  3TK1 A;  2P4K A;  4W4K A;  4DL7 A;  1EKP A;  3UFX B;  2RDI A;  2B63 A;  3EYY A;  3JAK A;  1Q7Y W;  1WP8 A;  5B3S C;  2YDE A;  1FXK A;  3K9S A;  4PA9 A;  1BHB A;  4GX2 A;  1COW G;  2VQF B;  5EBW C;  4WFA V;  4PEL A;  5LP6 C;  3RB6 A;  5EDW A;  2WPD G;  3FKI A;  5C8Y F;  2D2C B;  3JCU Z;  1BGW A;  4LF9 B;  4IGG A;  3K04 A;  2E74 B;  3IFX A;  1JDE A;  2UVW A;  4IIJ A;  4X9Q A;  3ZBH A;  3PR4 A;  3E22 A;  4WD3 A;  2I8C A;  2EJ0 A;  5KFX A;  3U55 A;  1ZX3 A;  4X64 O;  1Q8I A;  1SZT A;  1W0K G;  2OIE A;  3MHS C;  3K5L A;  2JDI G;  2HVS A;  1RJP A;  4JI5 B;  3OTO B;  1BSM A;  3RYC B;  2ZE7 A;  4AQY O;  2VQD A;  4DV2 B;  2XC9 A;  1IBM B;  3ZRW B;  1WAZ A;  4ECQ A;  2V9W A;  4DR2 O;  5KX5 B;  1CPY A;  3GB7 C;  3M7M X;  4LFC B;  4CH3 A;  2HVR A;  5LL6 Y;  4JUZ A;  2VR1 A;  5JH7 B;  4PDR A;  5FPR A;  4XYM B;  2V7Q G;  4JI2 H;  3V6J A;  4I50 A;  4IWY A;  2HGW A;  4K0K B;  5LL6 b;  4BXX G;  3BY6 A;  4XBF A;  5DED A;  3TXS A;  4DO2 A;  1IOV A;  3B8M A;  2HIX A;  1CXZ B;  1D5N A;  5IJ0 A;  1RYR A;  2OT5 A;  2UUC B;  5EZY A;  1YHQ V;  2WSS G;  4YY3 B;  1WR2 A;  5LYJ F;  4ED6 A;  1HNX H;  5FL7 G;  1XBL A;  3VA7 A;  3N41 B;  5KFM A;  2WAQ E;  4I9W A;  3Q1K A;  4DR1 O;  3W7W A;  3T5K A;  2ASD A;  2JVD A;  1P84 F;  4LSX A;  1E4F T;  3P32 A;  5I5W A;  3BHP A;  1WPX A;  1JFF B;  5IE9 A;  3STZ C;  2PN1 A;  2Q9L A;  3DTG A;  4DV6 B;  2Y0I A;  1E1Q G;  4RCN A;  4TV8 B;  1Y4M A;  2ZKO A;  2ZJT A;  4LMY A;  2R9A A;  1AR5 A;  3SJC C;  4YR2 A;  5LXT F;  4NXN O;  1Y67 A;  1N36 O;  1BCC H;  2EIL C;  3BRC A;  3B8N A;  3E83 A;  4B08 A;  1YTF D;  4B3S B;  3H20 A;  4DL3 A;  1BE3 H;  4BIU A;  1Y14 B;  2Q0O C;  4FFR A;  4J9Y B;  1GMG A;  1S0V A;  1OCO C;  3M99 B;  1D5A A;  4UCV A;  1XEQ A;  4FFB A;  3GTG A;  2W8K A;  2J6T A;  3RBD A;  1T5E A;  2VQE B;  3SPC A;  3K57 A;  2ZGI A;  4UV8 A;  4MTO A;  4U6P A;  1NVP D;  1TVK B;  4FLW A;  1SER A;  3K3W A;  5JQW A;  1NKD A;  2AZ2 A;  4K35 A;  2GLT A;  5KT7 A;  3T5J A;  4I4T B;  2K1E A;  4GT1 A;  4XDL A;  2JS5 A;  4YJ2 A;  4DUZ B;  3RAX A;  3ABM C;  3H0G A;  2FB5 A;  2R70 A;  3QTC A;  4J7J A;  1PX2 A;  1YIT V;  3E86 A;  4B3R B;  2Z02 A;  3LWB A;  1QBZ A;  1RPO A;  2EIM B;  5A9G A;  5JWP A;  2YCH A;  3CP1 A;  4JI8 H;  4GKJ O;  3PFF A;  5FLM G;  4TUY F;  1Z2P X;  5E79 Z;  5JCO A;  1V54 C;  2QWO B;  4TQS A;  4YAK B;  4JI7 O;  1N36 H;  1SQX H;  2JRI A;  4JYA H;  3O9O A;  1JJ2 U;  4X65 O;  5IDJ A;  1ZAU A;  1OCC C;  3J80 W;  3DSQ A;  2QJ1 A;  3P30 A;  4MTG A;  5KFK A;  3W7X A;  3KYH C;  2Y4T A;  2W70 A;  1PL0 A;  3ZMT A;  2XIG A;  3LSS A;  4OXS A;  4FFL A;  3V4Z A;  5D5P A;  1SES A;  4YQW A;  5K1X A;  5J9P C;  3ZED A;  2QM8 A;  3MR6 A;  2KB1 A;  4Q6G A;  5KFZ A;  1AR4 A;  3FAV A;  3EHB B;  5CB4 F;  4GC7 A;  4FBT A;  4FFP A;  1B3Q A;  4DV5 O;  4LF6 B;  1A9X A;  3RN4 A;  1K9M W;  4WFB V;  3AK1 A;  4IRC A;  1XHZ A;  1K92 A;  4LF7 H;  1MSW D;  4AYB E;  4WFG A;  1UC8 A;  5I47 A;  2F66 C;  1JPX A;  1NT2 B;  4X1I B;  1JLL B;  5I5U A;  1GN3 A;  2UU9 H;  1AI6 A;  1XMQ H;  4LFB H;  2UUB B;  4WHX A;  1NTZ H;  1Q6H A;  2NU6 B;  2OLS A;  3GLK A;  3CCV V;  5LHH A;  3DXR B;  2Q5Z A;  5BMV A;  4YB8 B;  4C5A A;  5KG0 A;  4X65 H;  2M05 A;  1D2D A;  2NU7 B;  3KTM A;  1AIL A;  2IU0 A;  4RAY A;  4DQN A;  2DYR C;  2CFM A;  4K6N A;  5F2V O;  3FMA A;  3I4M G;  1EKF A;  3M8A A;  3L2P A;  4J9N A;  5LMN B;  2IP4 A;  4TQD A;  2P22 C;  1SRY A;  1P49 A;  1N4C A;  3AYH B;  4ZOL F;  3G80 A;  1EFR G;  3OSP A;  1OCR C;  2ILM A;  5DG9 A;  4O2A A;  1ZLZ A;  1M5I A;  4DV5 H;  2QKC A;  4CKB A;  3DTF A;  1F7Y A;  2PY5 A;  3C90 A;  3GIL A;  1HP8 A;  4LF9 O;  4QIW A;  4B3T H;  4GKK H;  1J95 A;  2UVV A;  2FLN A;  1HNW H;  2AZ0 A;  5CA0 F;  5KAF Z;  2ZM6 B;  3GDE A;  2JIZ G;  4X66 O;  1XQ8 A;  2GUZ B;  3T9E A;  1MMM A;  4I4T F;  1V51 A;  4DLK A;  3KAL A;  4FFO A;  2C35 B;  3L71 H;  4DR6 B;  1PL4 A;  1F51 A;  1VS0 A;  4IWX A;  2ZIO A;  3APQ A;  3JZF A;  2XTA A;  3JAT B;  1IBM O;  3ZMS A;  3IGA C;  4EBD A;  2C2R A;  2BCC H;  4LF8 O;  5EIB D;  4PDL A;  4O2B F;  3K59 A;  4LFC O;  3VQV A;  1NI8 A;  5KT6 A;  3C3T A;  1JOY A;  4PA6 A;  3OGC C;  1S9F A;  4CE5 A;  4BY7 G;  1KBL A;  4Q8F A;  2FJZ A;  1ZSP A;  4HNT A;  1Q6I A;  3T9A A;  2DLN A;  1GSO A;  3OHB A;  1SC5 B;  3RVZ A;  5BWV A;  1K97 A;  4YXW G;  3NXS A;  3HXL A;  1L0L H;  4UB6 Z;  4TM5 A;  5KFQ A;  1RJQ A;  2ETN A;  4DV0 H;  3U11 A;  2UUC O;  1VKZ A;  1RSO B;  4YY3 O;  3HKZ E;  4MTF A;  3RYC A;  1XMO H;  3N42 B;  1F4N A;  3EFF K;  1P8L A;  2CAZ C;  2Y4U A;  3ZRW A;  4DV7 H;  4KHP B;  1H2M A;  4CH4 A;  1KB9 F;  3TET A;  5KX5 A;  1V55 B;  5IYZ B;  4Q4C A;  3JSN A;  5JH7 A;  3U10 A;  2WLN A;  4TSF G;  1GK9 A;  5FD6 A;  3OUF A;  4RO2 A;  3QQM A;  2YS8 A;  1C30 A;  4UB8 Z;  4YJ3 A;  2X0L A;  1S5J A;  2V1D A;  2NUA B;  3SYA A;  1W0J G;  1FVI A;  1YDX A;  1N0J A;  3F8N A;  3RB3 A;  1THZ A;  2B1I A;  3FB5 C;  4LF8 H;  4B3S O;  2RQ6 A;  2IJI A;  4PI2 A;  4M7E A;  4HBN A;  4JAV A;  2AGO A;  4MVZ A;  4IR9 A;  1JFF A;  1Q81 W;  4LF4 O;  2VQE O;  2JEX A;  2NVX A;  1DTO A;  2LW1 A;  3NBY B;  2IW5 A;  4TV8 A;  4FBU A;  2Y4R A;  2YEV B;  3OGI B;  3CRC A;  5LA6 B;  4WBN B;  3J80 N;  3DF7 A;  2DPI A;  1ZWI C;  1AP5 A;  4DUZ O;  5K2M A;  2VUM A;  4R7C A;  2EIK C;  4I9Q A;  2AHY A;  1X4T A;  2HGS A;  4B3R O;  3PN1 A;  1GRJ A;  4UXN A;  2QWR B;  4LFA B;  1FXK C;  3OR6 C;  3T1H O;  2ATL A;  4DRF A;  2JEI A;  2HVQ A;  5DQH A;  1CE8 A;  1TVK A;  2WLH A;  3ICX A;  4OX9 B;  1EKV A;  3AG3 C;  1VQO V;  4AI8 A;  1N32 O;  2HJD A;  4MA5 A;  4LF5 O;  1PP9 H;  3N2K A;  4Y8V B;  1ARO P;  2X6A A;  4LF4 H;  3HO8 A;  3MWM A;  5KFI A;  1IBL B;  4JI6 H;  1AP6 A;  1RM1 B;  2H8P C;  2Q0A A;  3AG7 A;  4N21 A;  3JRW A;  5LGU A;  3KKY A;  3ZJZ A;  4A3C G;  2R82 A;  2I87 A;  4B3M H;  3RYH B;  1RYS A;  4P9P A;  2WB1 E;  1M0T A;  3GTQ A;  1IBK H;  5IYB O;  3T5L A;  2P06 A;  4PBC A;  5BWW A;  4O81 A;  4X20 B;  1YJ9 V;  3TII A;  1N33 H;  4JTD B;  1IXM A;  2ITC C;  2WLL B;  3BAA A;  1V9P A;  1R3J C;  3E8F A;  5BWT A;  1CQJ B;  2P6J A;  3R5X A;  2Q68 A;  3G6B A;  4YR0 A;  3VQW A;  2FK3 A;  1TWH A;  4CBC A;  5LMN O;  4X1I A;  5GTH Z;  3STL C;  2IMW P;  4QPK A;  3CXH F;  3A0B Z;  5KT2 A;  4F6R B;  5IY5 C;  5E1A C;  1M57 C;  3AK3 A;  1OCZ C;  1Q86 W;  5LMU B;  2HDK A;  1I08 A;  2D3O W;  1DIK A;  4DYL A;  5C1O A;  1O9H A;  1HR0 H;  4D6T H;  4GX0 A;  4DL5 A;  2WLJ A;  2CTP A;  3X2Q B;  1AJP A;  3OUU A;  1S72 V;  5CE8 A;  5BWX A;  2PUS A;  2R87 A;  2ZM6 O;  4F50 A;  5LA6 F;  4GX1 A;  1KD1 W;  4CMF A;  4MS2 A;  4MVU A;  5KFH A;  4DR6 O;  1KJI A;  2A06 H;  1Y74 A;  3K5O A;  2W0X A;  4JTA B;  4ED1 A;  5B1B B;  2AGQ A;  1GM9 A;  3JD0 A;  3RV4 A;  4E4E A;  2R84 A;  3A0R A;  4J9L A;  4RNO A;  3ASO C;  1JIH A;  1KBH A;  1QVF U;  4Z1M G;  2R8J A;  4X8A A;  1KYO F;  2FL4 A;  4QNH B;  1BNC A;  5HBR B;  2L35 A;  3ABK B;  4A3K G;  2HFE C;  2XAS A;  5KFF A;  1LNQ A;  4FVM A;  2ZE6 A;  2XT9 A;  4AYB A;  3AG4 C;  2YI8 A;  2HG8 A;  1X59 A;  2W57 A;  5KFY A;  2P90 A;  5JCO C;  2PYL A;  5LGN A;  5FNV B;  4JI2 B;  5CA1 B;  4U3J B;  4J10 A;  3CRQ A;  2PVP A;  1EHI A;  3JAT A;  3M9M B;  4DV4 H;  3JAM N;  3GTP A;  5KFW A;  5IWA B;  4RUF A;  1I5X A;  3LSU A;  2VUM G;  3L74 H;  3CHX A;  2Y69 B;  1SQB H;  5H6R A;  3TW7 A;  1G2W A;  3SYO A;  1KTA A;  3IG0 A;  1DV1 A;  5J2U B;  1FYJ A;  4FMT A;  3H40 A;  1GSA A;  2YL2 A;  2KSD A;  4IHJ B;  4F4Y A;  2R6F A;  1I7N A;  2AGP A;  2C2D A;  1RSO A;  4ABM A;  1XNR H;  1QLE C;  3A8T A;  2ADP A;  1KP2 A;  4O7Y A;  1M9N A;  2CGO A;  1VBG A;  3OHA A;  2WLI B;  4NB5 A;  2ASL A;  5BR8 H;  5IYZ A;  3TGU H;  2IBZ H;  3AG2 B;  4IZO A;  3FFQ A;  2XAQ A;  2R9I A;  3AG1 C;  3WU2 Z;  1PNM A;  2RJZ A;  1YVW A;  4NLG A;  1KMI Z;  2GDS A;  3HKD A;  3GWK C;  3P3P A;  1SQG A;  3JD3 A;  2YXL A; 
#chains in the Genus database with same CATH homology
 3RYC B;  1XNQ H;  2UXC H;  1TA8 A;  4DV2 B;  1IBM B;  4DUZ H;  1J5E B;  3JAR A;  2MCT A;  4HNA B;  4I55 A;  1X9N A;  2YI9 A;  5KX5 B;  4CH3 A;  3M7M X;  4LFC B;  1S68 A;  4TOI A;  2HVR A;  4B3R H;  1I94 B;  5JH7 B;  1TGO A;  1S03 G;  4TQF A;  5FPR A;  5C8Y B;  2RGR A;  4X1K B;  4DR3 H;  4GYC B;  4JI2 H;  1YEW A;  3RWR D;  5FLX W;  3T1H H;  4I50 A;  2ZIN A;  4JI3 B;  4K0K B;  5LL6 b;  1WN7 A;  4O4J B;  2HIX A;  2UXB B;  5IJ0 A;  2O03 A;  2UUC B;  5EZY A;  1I6U A;  4YY3 B;  1N32 H;  3J81 W;  4WBN A;  2F4V H;  3ETQ A;  1HNX H;  4JYA B;  3N41 B;  4LF5 H;  3S24 A;  4DV4 B;  2JVD A;  4JV5 H;  4LSX A;  1E4F T;  2F93 B;  1JJO A;  4PZ6 A;  1SA0 B;  3BHP A;  3N2G B;  1JFF B;  4O4L B;  3RGZ A;  3ZS8 C;  3JAW A;  4PHZ A;  4DV6 B;  1WNS A;  4TV8 B;  4A2B A;  2ZJT A;  4LMY A;  1ZHS A;  2R9A A;  3SJC C;  3T1Y H;  3KAK A;  4FLZ A;  3L4K A;  3BRC A;  4KL1 A;  4B08 A;  4CH5 A;  4B3S B;  1XNR B;  3UT5 A;  5KMG A;  4E6N A;  3H20 A;  3MAQ A;  2YIB D;  4CH6 A;  4D7T A;  5LOV A;  4RB1 A;  2GV9 A;  4X1Y A;  2UUA B;  1D5A A;  4UCV A;  4FFB A;  4LF7 B;  3A2F A;  5LYJ B;  2UUB H;  1T5E A;  3JAK B;  2VQE B;  2UXD B;  4FM9 A;  5IJ9 B;  3K57 A;  2UU9 B;  2HHH H;  2ZIM A;  2ZCE A;  2Q7G A;  1TVK B;  3U0Z A;  2JGU A;  4FLW A;  1Z2O X;  5FD5 A;  4GLX A;  4I4T B;  3RYH A;  2UXC B;  2JS5 A;  4YJ2 A;  4DUZ B;  2ZNI A;  4L8J A;  4EEQ A;  2R70 A;  3QTC A;  3BAB A;  2PGG A;  5J2T B;  4BWS C;  5LXT B;  5LMN H;  3E22 B;  1Z5V A;  4B3R B;  2E5L H;  1A0I A;  2YCH A;  4JI8 H;  3TY9 A;  1Z2P X;  4DR3 B;  4PZ8 A;  5ITZ B;  5JCO A;  4X20 A;  3HKD B;  1N36 H;  5EOY A;  2IM9 A;  4JYA H;  1GYF A;  1P16 A;  1TUB B;  3HKE A;  1ZAU A;  3J80 W;  3DSQ A;  2QJ1 A;  4EB6 B;  4YHH H;  4I55 B;  5FPO A;  4GKK B;  3K5N A;  1HNX B;  3KYH C;  3JAM W;  2ZM6 H;  1HNW B;  1E4G T;  3CSX A;  5JJJ B;  4JV5 B;  3CB2 A;  3JSL A;  3QF7 A;  2WE6 A;  2XIG A;  3RYI A;  5D5P A;  4DR6 H;  4I50 B;  4X64 B;  5K1X A;  3ZED A;  4O4I A;  4Q6G A;  2VWK A;  4ETS A;  4JI1 H;  5LP6 A;  3RGB A;  4TUY B;  4NVP A;  4LF6 B;  3N44 B;  4R7R A;  3JAL B;  1XHZ A;  2XHB A;  4LF7 H;  5D1O A;  5D1P A;  5EYP A;  4DR2 B;  4Q0Y A;  2VUG A;  3WB2 A;  2F66 C;  1NT2 B;  1I7F A;  4TV9 A;  4X1I B;  2UXD H;  3JAS B;  4ZHQ A;  4RB2 C;  4DV1 H;  2UU9 H;  1XMQ H;  4LFB H;  1CKO A;  2UUB B;  5A2Q W;  4DV3 B;  5KHG A;  5KHH A;  1FFX B;  2HIV A;  2VOB A;  3HKC B;  5BMV A;  2HHH B;  4RB0 A;  4X65 H;  4DK0 A;  3RTX A;  4DV0 B;  4DR5 H;  3BPZ A;  1XHX A;  4FLU A;  4RAY A;  3B2E E;  3UT5 B;  5KMG B;  2CFM A;  4DR4 H;  5LOV B;  4DV7 B;  4IAJ A;  4RAZ A;  3FMA A;  4JI4 H;  4CS4 A;  1TAE A;  2Q2U A;  5CB4 B;  3L2P A;  1Q5O A;  5LMN B;  4TQD A;  4EFB A;  5JQG B;  2E5L B;  2P22 C;  4JI8 B;  1P49 A;  3K5M A;  2HEP A;  5FNV A;  5CA1 A;  2BTQ B;  4U3J A;  4K8X A;  2FE3 A;  4O2A A;  1M5I A;  3LML A;  5LA6 A;  4DV5 H;  5D5Q A;  4NXN B;  1N36 B;  2PY5 A;  4B3T H;  1M0W A;  4GKK H;  1XI1 A;  5EIB C;  3VQX A;  1HNW H;  5JVD B;  2YIB A;  4YHH B;  5KHI A;  3K3V A;  2OWO A;  3W1B A;  4X64 H;  2ZM6 B;  3SJB C;  3GDE A;  1XQ8 A;  4DK1 A;  1DGS A;  5J2U A;  2VPS A;  1AN7 A;  1H2S B;  3KAL A;  1JMK C;  4DR6 B;  4IHJ A;  4CC5 A;  4JI0 H;  1VS0 A;  2ZIO A;  4AQY H;  4LF6 H;  3JAT B;  3W5O A;  4ZI7 B;  1XK5 A;  2P5O A;  2Q7H A;  4JI1 B;  4NXM H;  4DR2 H;  5EIB D;  4LNU A;  4ZOL B;  3K59 A;  3VQV A;  4LFA H;  3RYI B;  4DV3 H;  3UQ8 A;  4DRX B;  2V4D A;  4RB3 C;  3QWU A;  4GKJ B;  3N6X A;  4I7H A;  3KAJ A;  4DV1 B;  4AIL C;  3GB8 B;  1XMQ B;  3HXL A;  4LFB B;  4O4H B;  5JJE B;  5CA0 B;  4O4I B;  3RYF A;  4DV0 H;  3U11 A;  4OX9 H;  3WB1 A;  4JI7 B;  1SYX B;  3RYC A;  1XMO H;  3N42 B;  4X65 B;  1P8L A;  2CAZ C;  4DR1 H;  4DV7 H;  4KHP B;  4DR5 B;  4HNA A;  1M4U A;  4CH4 A;  5D1O B;  5KX5 A;  4IIJ B;  5IYZ B;  3JSN A;  4DR4 B;  5JH7 A;  3U10 A;  4JI4 B;  3VQY A;  4ZHQ B;  2RGV A;  5C8Y A;  1Z2N X;  5FD6 A;  4EQ5 A;  4O2B B;  1MZB A;  4YJ3 A;  1CKM A;  1S5J A;  1FKA H;  1G6U A;  1FVI A;  4JI6 B;  3F8N A;  1QHT A;  1O75 A;  4NXN H;  4CS3 A;  3RJ0 A;  4LF8 H;  2RQ6 A;  3NC0 B;  2F95 B;  3JAR B;  2KSW A;  2VWJ A;  4DV5 B;  4PI2 A;  4FM2 A;  4B3M B;  4B3T B;  4M7E A;  4HBN A;  4PZ7 A;  3C0F B;  4DR7 H;  4MV7 A;  3RF2 A;  3THO A;  1SA0 A;  3N2G A;  1JFF A;  1IBK B;  4F6R A;  2R72 A;  3NBY B;  5KHJ A;  4TV8 A;  5IJ0 B;  1N34 H;  5EZY B;  5LA6 B;  4JI0 B;  4WBN B;  3DF7 A;  4AQY B;  2CW8 A;  1QQC A;  1HNZ H;  4UCS A;  1M93 A;  3BA9 A;  4I9Q A;  4NXM B;  4LR3 A;  1X4T A;  1KU9 A;  2HGS A;  3PN1 A;  5LYJ A;  4GKJ H;  1B04 A;  2F1M A;  3JAW B;  4LFA B;  1SEI A;  5IJ9 A;  4CS2 A;  5LMU H;  3TY5 A;  4DRF A;  4JI7 H;  2HVQ A;  1FJG H;  1TVK A;  1CKN A;  4LH7 A;  3HKB A;  3ICX A;  4OX9 B;  3NBZ B;  4KHP H;  1XMO B;  4LNU B;  3RR5 A;  4DR1 B;  3QG5 A;  4UCO A;  3N2K A;  4X1Y B;  5J2T A;  2E3C A;  4FFB B;  5LXT A;  2WDT A;  4LF4 H;  4FLY A;  3MWM A;  4X66 B;  1IBL B;  4JI6 H;  4J0M A;  5ITZ A;  3SGI A;  5K1P A;  1Q3E A;  2Q0A A;  3W1G A;  4B3M H;  3RYH B;  1TUB A;  4EB6 A;  4YJ2 B;  4LF8 B;  5KHK A;  3J7A K;  1M0T A;  1IBK H;  3RGX A;  2CW7 A;  4DR7 B;  4DUY H;  4BW9 A;  4UCT A;  1O9G A;  4YJ3 B;  4X20 B;  1WPB A;  1N33 H;  2KKW A;  4LH6 A;  1N34 B;  2Q2T A;  3TY8 A;  4TUY A;  3BAA A;  1V9P A;  3HKE B;  4FM0 A;  5IWA H;  1Z5W A;  3KXY T;  3JAL A;  1HNZ B;  4PI0 A;  3VQW A;  1HW7 A;  4X1I A;  2PTM A;  4MTD A;  3JAS A;  5GON A;  4ZIB A;  4MTE A;  4F6R B;  4PDB A;  4X62 H;  4UFZ A;  4FLT A;  2VQF H;  1SKV A;  1FFX A;  3N40 P;  3HKC A;  5LMU B;  1BJT A;  5LP6 B;  4A2A A;  5IT9 W;  2YIA A;  1FJG B;  4LF9 H;  1O9H A;  1HR0 H;  5EYP B;  1Q43 A;  2WYO A;  2Q7E A;  2PUS A;  4X66 H;  3BA8 A;  4TV9 B;  5CB4 A;  5BR8 B;  1IBL H;  4X1K A;  3SJA C;  1WH2 A;  4LF4 B;  4FLV A;  5JQG A;  4UCR A;  4JI5 H;  3OTO H;  4O4J A;  3K5O A;  2BTQ A;  5BMV B;  4DV2 H;  1IBM H;  1CKN B;  3RFR A;  3VNN A;  3HKB B;  4D7S A;  1J5E H;  1XNQ B;  4LFC H;  1ZHQ A;  5DIS C;  3OTF A;  4MV9 A;  1I94 H;  5JVD A;  2QM4 A;  3N2K B;  3CVZ A;  4FVM A;  4O4L A;  3M4I A;  4RZQ A;  3K58 A;  3RIZ A;  4JI3 H;  4K0K H;  2YI8 A;  4K8Z A;  2W57 A;  3IAY A;  2UXB H;  5JCO C;  4DUY B;  2PYL A;  5FNV B;  4JI2 B;  2UUC H;  1VF7 A;  3T1H B;  5CA1 B;  4YY3 H;  4U3J B;  4O2A B;  1N33 B;  1L2Z A;  3JAT A;  4ZI7 A;  2PZS A;  4DV4 H;  1N32 B;  2EX3 A;  2F4V B;  5IWA B;  4ZOL A;  4BWA A;  4LF5 B;  1L8D A;  3CHX A;  4APM A;  1XDN A;  4DV6 H;  3EYY A;  3IG0 A;  5J2U B;  4DRX A;  3JAK A;  3GJX B;  4AHC A;  4IHJ B;  4O4H A;  5CA0 A;  4X62 B;  4EFE A;  2VQF B;  4CC6 A;  1RSO A;  5LP6 C;  4B3S H;  1XNR H;  3LNN A;  3N43 B;  3L4J A;  4I4T A;  5JJN B;  3T1Y B;  1BGW A;  4LF9 B;  2UUA H;  3SR2 C;  2PYJ A;  2OYQ A;  4IIJ A;  5IYZ A;  1HR0 B;  5BR8 H;  3E22 A;  4LSA A;  4FLX A;  3FFQ A;  2VQE H;  5GON B;  1SQF A;  1Q8I A;  4UCU A;  2ZNJ A;  4O2B A;  3K5L A;  2HVS A;  2RJZ A;  1KMI Z;  4FM1 A;  3RYF B;  3WB0 A;  3HKD A;  2BTO A;  4JI5 B;  3OTO B;  1SQG A;  2YXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...