3KREA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase from ehrlichia chaffeensis at 1.8a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
237
structure length
237
Chain Sequence
EKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKKLIDKGIKTHFISLLNQREQLVKKITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEFYYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILSELFFNVGIKLVDFKLEFGKLHNDEQSDLFLADEISPDTCRLWDISTNKRLDKDRYRLNLGNVIEGYREVAHKLNAIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase from Ehrlichia chaffeensis at 1.8A resolution
rcsb
source organism Ehrlichia chaffeensis str. arkansas
molecule tags Ligase
total genus 82
structure length 237
sequence length 237
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2009-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kreA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kreA02
4NM7A 3CQEA 2I0HA 2JDTA 4QP4A 4FV2A 3NPCA 4FKSA 3F3WA 4PL5A 3ATTA 4M7IA 2QHMA 3W16A 3MH3A 3HV4A 4FODA 3VBYA 4DG0E 2C30A 3AGMA 3IW6A 3FE3A 4TL0A 4N6YA 4RX8A 5M44A 4FSWA 4TZRA 2IW9A 2JIUA 1DM2A 2NNWB 5HIBA 4YC6A 3UVRA 5GINE 3LMGA 5EYMA 3UZTA 3EZVA 5IYZF 2XJ2A 4CKIA 2X4ZA 5B2LA 2W1ZA 3E7OA 1J7IA 1H1SA 2CKEA 2XNOA 4I6HA 3ZM4A 1U5RA 3U6HA 1C3OA 3RCDA 5AP0A 1Q5KA 1KOAA 4PY1A 3EYHA 4AS0A 3MVLA 3QL8A 3U54A 4FTTA 4ZTQA 5CALA 3KXGA 3WF9A 2JDOA 4HYHA 4M12A 4XX9A 4YLJA 4U0IA 4FKIA 3FI3A 3ZLYA 2DLNA 1NA7A 4WUAA 4FFRA 4EH7A 1IOWA 4FTRA 3TNQB 3UOHA 3GU5A 1CM8A 2UZVA 5K9IA 3AD6A 3BE2A 2I8CA 3D5XA 3H9OA 4KS7A 4C61A 2PVYA 2REIA 3COKA 4LRMA 2PHKA 2J0LA 3BQCA 4TTHB 2YHVA 5DEWA 4DFUA 4G3FA 4YR8A 5H80A 4I93A 4B8LA 5BNJA 3PLSA 4RA5A 4TW9A 2WU7A 3IDPA 4CGAA 1ZZ2A 2JBOA 4GT3A 4N0SA 3R1QA 3SKCA 3TINA 4W4WA 1XBAA 4FKWA 2QG7A 1JWHA 4IADA 4F7NA 3BCEA 3UZPA 2VWXA 1ZMVA 5IQBA 4BIBA 3KALA 3KCFA 5HG7A 2JITA 3VBVA 4C4HA 4E20A 4R3RA 5DT3A 4EH9A 1ZYDA 4GK2A 5C4KA 4HCTA 3H9RA 5JFXA 4EKLA 2OWBA 2BKZA 2WQBA 3NIZA 1Y6BA 5IUHA 4L68A 3VBTA 5T68A 4FV7A 5HKMA 3F5XA 4USEA 4WRGA 3R9HA 2WB8A 2W99B 4XHKB 3SXFA 4D4RA 2CN8A 3MIAA 2CN5A 4ERKA 5IDPA 2XNBA 4RWLA 1XH5A 4RX7A 4O0YA 4BDIA 1TQPA 4JRNA 5CEIA 4OGRA 2BALA 2IVVA 4F0IA 1Z2OX 4NJDA 5L2IA 1BLXA 2YM3A 2HIWA 4K18A 2I40A 3FL4A 3O50A 3HX4A 3KULB 2VWWA 3QAME 3V5JA 4ZQIA 3KREA 4YP8A 2XK7A 3PZEA 5EKOA 4YB8B 5M51A 2BZHB 3C0IA 3QALE 1WBNA 2PVKA 3HP2A 4FV8A 2C5YA 2VTAA 3KN6A 4CCUA 3LW0A 3R1NA 5E90A 2EVAA 4EBWA 5FBNC 2OGVA 3C5IA 4BBFA 1RE8A 2ZMCA 2JIIA 4QMMA 5JFSA 2W7XA 5LVMA 2V22A 2CNQA 3BBWA 2XF0A 3U9TA 4E4MA 2QOBA 4J71A 4DINA 2PYWA 3E87A 1WVWA 3F3TA 3L9PA 1R78A 4QQCA 5ANEA 5E8ZA 4C2VA 4EGQA 3ZC5A 4EG0A 1OMWA 2JKQA 2PPQA 2NU8B 4CD0A 2OIBA 2QCSA 4ME6A 2ZVAA 5KKRC 4L45A 4KIQA 4HYIA 3BGQA 1KE5A 1ZOGA 3DU8A 2PY3A 3BQRA 3DAEA 3NUAA 3QUEA 4QTCA 4BGQA 3HUBA 1PXOA 4TYJA 1WAKA 2WMQA 3OT8A 4XG7A 3IS5A 4QP3A 4R7IA 3OOMA 3UC4A 3KK8A 3QRUA 2R84A 1PMEA 3FPMA 4F7JA 2R82A 3BKBA 4YZDA 5FNVF 3NVKI 1R39A 3R7OA 2UVYA 3EOCA 3D14A 3VA7A 3AC3A 4EYMA 4ANMA 3QLGA 4IZAA 4LG4A 4CEGA 4RWKA 3MY1A 3DS6A 5I9XA 4UV0A 4ENYA 3IK3A 3VN9A 2IW6A 2JDRA 3ZLXA 3L8XA 3MJFA 1LUFA 4IM3A 3BPRA 5FTGA 5CY3A 1JSTA 5AA8A 2WELA 1UKIA 4QPAA 4XLVA 2DYLA 3DCVA 3G6GA 4BB4A 5GNKA 5HTCA 1H26A 2WTIA 4BDDA 4DTKA 4MBLA 3DKFA 4BCHA 2I7QA 5BPYA 2HAKA 3UIBA 5KX5F 2R85A 5HESA 2X1NA 4FSMA 4HYSA 5FEQA 3RPVA 3UMWA 4G6OA 2ITVA 2ONLC 1Y8YA 3R8UA 3FXWA 4XBUA 3ALOA 2XB7A 4ZY4A 3TIGA 2E9VA 5CEPA 3H0YA 3RWPA 4DA5A 2ITTA 1EUCB 4EONA 3K3IA 4MA0A 1VEBA 4X0MA 4XCUA 5IDNA 4O0UA 4HNVA 3QX2A 1K2PA 4NKAA 5H8BA 5CANA 4M0ZA 4EOJA 1CKIA 1GJOA 4QMQA 4F6UA 4FNXA 3VWAA 4MWHA 4YJQA 2NP8A 4RZWA 4EQCA 2OH0E 3CY2A 3ZXZA 3EN6A 5HE0A 2XNMA 3MS9A 3R8MA 5IQDA 1WVXA 3KXZA 4L3LA 3U6IA 1P5EA 2XCLA 2I0YA 2V62A 2FSMX 1JLLB 4IAIA 3V4SA 2WQEA 5AUXA 4AN3A 2YFXA 4A9TA 4QT1A 1IEPA 1CSNA 4E6QA 3BYMA 1U46A 2BRNA 5FP5A 1H01A 2Z2WA 3L9MA 4S30A 4B7TA 1M52A 1ZYCA 4QMSA 2WD1A 2EB2A 4YBKA 1M0WA 3FXZA 4IMYA 2Y7JA 3V04A 4DH1A 1ND4A 2XCKA 4PMMA 1WBOA 4YJSA 3MVMA 3RK7A 2B9HA 2UW0A 1G5SA 4I0RA 3C1XA 5IMEA 5AV4A 5HBEA 4ANBA 4BZNA 5AP5A 1ATPE 5EKNA 2R3GA 2WU6A 3L1SA 3F69A 2DZDA 5LVPA 4CXAA 3U55A 1DI8A 3KFAA 5D9HA 4WBOA 2RFDA 2JAVA 4FSTA 1XH9A 4DGLC 5BUEA 3UOLA 4DF3A 1ZYSA 4O0VA 4RIWA 4UBAA 4BDFA 5I9ZA 4AZSA 3TACA 2OF4A 3NAXA 2NU9B 1URWA 3EMGA 4KKGA 4MQ2A 4ZSAA 4FTLA 1CQIB 3SXSA 5BPFA 1HOWA 3Q6UA 5GJDA 4AP7A 4OTIA 5EI2A 3SD0A 5BVKA 2OLSA 4X2NA 1O6LA 3BGPA 3LAUA 4YO4A 5HVYA 4EOIA 4E4NA 3R1YA 1SYKA 3NUUA 3KXHA 3ZLWA 3QFFA 3DB6A 1YW2A 4Z9LA 3F66A 2R3PA 5CU2A 4C33A 3RPSA 3KRWA 2E2BA 2QLQA 3K5HA 3A8XA 4H05A 3UVPA 4CRSA 5DOSA 3ZFYA 1NXKA 2X8IA 1L8TA 4YBJA 1WFCA 3I79A 4A9SA 5BUIA 5G6VA 2YYAA 4IWPA 5JVLA 3FMDA 3QUPA 3FZPA 2GFCA 4QTBA 4FFOA 4ZS0A 2WMUA 5C03A 3B8QA 2OZAA 4U43A 4YU2A 3H4JA 3IECA 3IO7A 2ITNA 3FKOA 2QO2A 4MK0A 5AUWA 4XRLA 3R23A 2BIYA 3EWHA 4PTEA 2X6DA 1M17A 2W1FA 1FPUA 4QMPA 2XK3A 2RFNA 3Q9ZA 5IH6A 4ZP5A 4DTBA 3SXRA 4Q5HA 2UW4A 1H0VA 3IDCA 4I6QA 4D2SA 3AW8A 4G3GA 5DT4A 4WNPA 2XRWA 4APCA 1J1CA 3LFQA 4X2FA 1XH7A 3OW4A 4G16A 3SHEA 4JX7A 4LV8A 2RFEA 4YMJA 5I9YA 3PVWA 4EBVA 4M97A 4QMTA 1H0WA 3DBFA 3N9XA 3PE2A 3REPA 2R3IA 1M2PA 1UWHA 2A0CX 4ORKA 5LVLA 5ANOA 3QQJA 3G8CA 3CIKA 3UNJA 3KAJA 2RG6A 5JVDF 3MTFA 3LXNA 3ZS5A 4BBMA 3UG1A 4HOKA 2VTPA 4C7TA 1CKPA 4HVDA 5J95A 5DPVA 1PHKA 5H3QA 4FEQA 3R02A 4YJTA 4O96A 3RMFA 3MH2A 2I80A 5KX8A 1F5QA 2W1IA 2O3PA 5LMKC 4LYNA 1KJJA 3O51A 3OEZA 3RAKA 3DV3A 2OKRA 4M68A 3HVCA 3LCKA 5CAOA 1YI4A 2YM6A 3I6UA 3LQ5A 4MXXA 5AV0A 4FUXA 4JRVA 2VX1A 2O65A 3G0EA 5DVRA 3ULZA 2BAQA 2WO6A 2R3HA 3LFAA 4MD7E 5DEYA 4ZOLF 4CFMA 1OIQA 2OFUA 1YHWA 3RPRA 4DEIA 1JKLA 2C0IA 3D5WA 4JOAA 4L67A 3CKXA 5FGKA 4UYAA 5HE3A 3TT0A 3E64A 5AP7A 1E4EB 3VBQA 4MV6A 1R0PA 1UU9A 2VWVA 4FKLA 5EQYA 4GFGA 5IQAA 4X2JA 4U6RA 4M9UA 2YRXA 5G1XA 4ACDA 1YDSE 5LXTF 5I4NA 3FMNA 4E6CA 3EKKA 4JDHA 4KBKA 4EK6A 3DAKA 3MIYA 3COMA 3GFWA 4PL3A 2OIQA 5EHYA 4MXOA 1EH4A 1PW2A 2ZV7A 2B54A 2IO6A 4O7SA 3WIGA 1OKZA 4GUEA 4RJ7A 3I12A 4HGTA 3DBEA 4O4HF 2VGPA 2VX3A 3UNZA 4AFJA 4FK3A 5AX9A 2C5OA 4AZFA 2OFVA 3MBLA 3CGOA 1ZMUA 3QU0A 5HQ0A 2OI4X 1OUYA 2R3NA 4IAYA 2O5KA 5KZIA 4EQMA 4C4GA 2WTKB 3BWFA 2FPGB 5DNRA 5T3QA 4BRXA 3PRFA 2NRUA 4K0YA 4U5JA 1OPKA 3UC3A 1XBBA 2I0VA 2YEXA 1B6CB 3QQHA 4FI1A 2WAJA 5DMXA 4IX6A 3VUDA 5K3YA 5KMLA 1Q41A 5KMIA 3GFEA 5J9YA 1NVRA 2UVXA 3B2TA 5TO8A 4XEYA 4AE9A 2IZUA 3LCDA 4A9RA 2HY81 2XMYA 2QONA 3QWJA 4IDTA 4PWNA 2HZNA 3A7GA 4Y5QA 3S1HA 3NX8A 4XV2A 2Y9QA 5JFWA 4OTWA 5M08A 2XNGA 2SCUB 4U3ZA 2R7MA 4BTJA 1Q62A 3CJFA 3P9JA 5FM3A 4L7SA 2VTJA 2X0GA 4PMTA 2FB9A 3LJ2A 2YCRA 1XKKA 4FKJA 1WBWA 4L43A 4R7BA 2E9PA 5HNBA 2C5VA 4CVAA 1BKXA 4BDKA 3ORXA 4KBCA 3A2CA 3DPKA 2XK9A 1VJYA 4PUZA 4QMVA 4F65A 2F49A 5C27A 5HG8A 2VO0A 2ZB1A 2OJ9A 4J8NA 1V0OA 3DB8A 3QLFA 4WIHA 5C8MA 4EI4A 5AAEA 5JQGF 3ZSIA 4WHZA 3MTLA 5A4CA 4G6NA 5C4LA 2WXVA 2X0SA 3I6WA 2ITYA 3GOKA 4IVBA 4Y95A 4YJ3F 3PLAE 3LLTA 3QTUA 3LFNA 3W33A 5L2WA 4WNKA 2DIKA 1J91A 5BX0A 2RFSA 1Z2NX 4FFLA 1NT2A 4IZ5A 4JBPA 4QYEA 3TKHA 1M7NA 3AQVA 4FR4A 2W5AA 3ORZA 4LM5A 5EK7A 1YKRA 3TNPC 1Q3DA 3HDMA 5EG3A 5AV2A 1XHAA 3MJ2A 2W6NA 4KS8A 5EYCA 5C8NA 3NUNA 4YNOA 4XNEA 1OVEA 2VTRA 2Z02A 4LL0A 5KUPA 5LCKA 2YS6A 2B9JA 3KMUA 3C50A 3KXMA 4GFOA 4DGOA 2R64A 4DG3E 2I1MA 3UOJA 3PJ3A 1LP4A 5CU0A 5F20A 4ZXTA 4W4VA 3VJOA 2Z7RA 3V5TA 5J2UF 3E93A 2GPHA 4DEEA 4Y85A 1HCLA 2ZM4A 2H34A 5AADA 2PVJA 2X9FA 2XK8A 4MWIA 4XG9A 4MD9E 4JIAA 3VQHA 5C01A 3C4ZA 2ZDQA 3UZRA 2YIYA 3ZEWA 5HLNA 2HOGA 3K5VA 4AA0A 4QTDA 3ETJA 3R0TA 3FMLA 5F95A 4AOIA 4YGAA 3DNDA 4DAWA 4ZTSA 1Z5MA 2BR1A 4O4LF 4HNFA 3D7TA 3ROCA 1OKWA 1FMOE 3GENA 3A7IA 3U51A 4RWIA 1LEZA 5CF4A 4RIXA 3E8NA 3LJ0A 3HL7A 4U97A 1OITA 5FQDC 2W1CA 4JJRA 3S3IA 3JVRA 5ETFA 4DEBA 4MV9A 2J5FA 2XCHA 5HE2A 4O7NA 3KRJA 4O82A 1V1KA 1IA9A 2X7GA 3DTCA 3A4OX 3QFVA 4NFMA 3RK9A 4CFNA 1VBGA 4YLKA 1W82A 1NW1A 3KKVA 3RPYA 3TM0A 5KMKA 2IPXA 4XG8A 4FL2A 4PQNA 2GNGA 4QTEA 2C1BA 1OUKA 3E88A 4AZTA 4BHNA 2WKMA 3IKAA 3JZIA 2FO0A 2CNVA 3MFSA 4FV4A 5IA1A 1GAGA 4F1OA 3IW4A 3TV7A 2VN9A 3DXPA 4YC3A 4E5AX 2YZGA 2XUUA 4RQVA 1QPJA 4U80A 4YJUA 3HECA 4G34A 1B6SA 1QMZA 4CZUA 3VUKA 4X21A 2OK1A 2XIKA 2NO3A 4RFZA 4EZ7A 4FNZA 3ORMA 3KEXA 2WGJA 3RI1A 3ZM9A 5H8GA 4B6LA 4FKPA 4JS8A 4RFYA 4HZSA 3UO5A 3ORLA 4LOQA 5A14A 4C3FA 1H25A 2CPKE 3PPZA 5HG9A 3VULA 3R63A 4L8MA 1YWVA 3SG8A 2BRBA 1YDTE 3F5UA 4X3JA 3QQUA 4J98A 3MGYA 3FLNC 5E8VA 4FTNA 4PNIA 2J9GA 5M06A 4USDA 2I0EA 3FKNA 4J99A 2GS6A 5EW9A 4ASZA 5CEOA 5FXQA 2ZDGA 5D41A 3CD8A 3CBLA 1AD5A 4XG2A 2PWLA 2R7IA 3T9TA 2YA9A 5DRBA 1ZOEA 2QU5A 4ZSEA 5IUGA 2BMCA 4ZSLA 3N4VA 2JC6A 3QHRA 1M14A 2X7OA 4OLIA 3BEGA 5IA5A 3TXOA 3FC1X 4B9DA 3FMJA 4WG3A 4F4PA 4LGGA 3QXOA 3OTUA 4MV1A 4FICA 2XKCA 3IGOA 4GT5A 4BR3A 4TWNA 2W0JA 5CLPA 5CEQA 4MQ1A 4HNIA 4BCJA 5LCJA 4P4CA 3G6HA 4FIFA 1QCFA 3G15A 2HCKA 3UPZA 4ZZOA 2XZSA 2C6IA 4IB0A 3DBCA 3TIZA 2YIWA 1E4EA 3BWJA 4IHJF 3AXWA 4Q9ZA 4DFZE 2QOFA 4RGJA 3TZ8A 3POOA 4IBMA 4NW6A 1E9HA 2WTWA 4A4XA 4C59A 5HD4A 3C4FA 4RJ4A 5I9UA 1PJKA 2BDWA 1SNXA 3JS2A 4QQ5A 2F4JA 4JAIA 2EXMA 4NZWB 4RT7A 4MXYA 3VO3A 4FZ6A 4O7WA 4PMSA 3WE8A 1T36A 2Y4IC 5JQWA 3CE3A 1YOMA 4FTQA 2GQGA 4C5BA 1F3MC 3R7YA 4D1ZA 2CGXA 2Z04A 1H07A 3LE6A 4JIKA 3SAYA 3RFCA 1KJ8A 1U54A 2UZTA 5AA9A 2FUMA 2H96A 3R9OA 2GHGA 2R7BA 4E1ZA 2JEDA 2JD5A 1JPAA 4KUJA 5AP2A 1K9AA 3UOKA 4JG8A 4L6QA 3EZRA 4XBRA 1AUVA 4FT0A 3QQGA 3K3PA 1PXPA 3KRLA 3OS3A 4EH6A 2YIQA 3DK7A 4V04A 3DBQA 1UKHA 2PUIA 4P5ZA 3NUPA 2CJMA 4C35A 3I5NA 3R8LA 4QP2A 4QYHA 3PWDA 3U9CA 4DH5A 3N8DA 4AW5A 5LWMA 1Q3WA 5JGDA 4FVQA 4GG5A 2W1GA 1NVSA 4KKHA 4X6RA 2QR8A 3ENHA 1OKVA 3QRKA 4IIRA 3A7FA 2BFYA 5EI6A 2J0KA 4IDVA 4JBVA 3FYJX 1JDBB 1SVGA 2NRYA 3Q32A 4ZAUA 2C6OA 5AP6A 1JVPP 4XJ0A 3FMKA 1OI9A 4FZ7A 3UQGA 4L42A 4AZVA 3HMIA 2VQDA 3NUSA 4BF2A 1DI9A 5AUVA 1UU8A 3I81A 4O91A 4CFVA 3TL8A 2J0MB 2XH5A 3LMIA 3OD6X 4AA5A 3C51A 2QOHA 3GC7A 4PDYA 1OIRA 3WF5A 3Q5IA 5CF5A 1ZYJA 3HMPA 2WOUA 3WZUA 3NYVA 3TG1A 4BCNA 3DZOA 3H10A 3HNGA 4EK3A 2ETRA 4A4OA 3R9RA 3VRZA 3D83A 5HIEA 3QZGA 3FQSA 4JR7A 3D0EA 3N51A 3QKLA 2PMNX 4O6LA 2HXLA 4EH2A 3PVBA 4AT4A 4ZLYA 3PIXA 1A9UA 2UVZA 5CTPA 3FL5A 3WYXA 4P2KA 3OCSA 2OBJA 5IZFA 4AN9A 2C3LA 4DLIA 3HEGA 1G3NA 1ZARA 3A60A 4RZVA 2G1TA 2GNHA 2HWOA 1W93A 4U41A 3MDYA 2P55A 2ZYBA 4O38A 5ANJA 5BVNA 3PP0A 1GSAA 3HZTA 5FEDA 4AT3A 2YIRA 3ZSGA 2WMSA 5IISA 2R7NA 3E8DA 1KC7A 1H08A 3AD5A 3LFSA 2ACXA 3KVWA 3PTGA 4RC2A 2QR7A 3OCBA 2W4JA 4IIJF 4NIFB 3V5WA 3WI6A 1O6KA 1XWSA 3TDWA 4QP6A 4IAAA 4IVDA 4DFBA 1Q61A 2PE2A 2R4BA 3R00A 2YM4A 3UTOA 3TTIA 2JFLA 1UU3A 4GFMA 2ZMDA 4GVJA 4O21A 3VS5A 3ZHPC 4C58A 4RZQA 2OW3A 2ETMA 3C5UA 3D2KA 4L46A 4AAAA 3CTQA 2P4IA 5A4EA 4RIWB 3PZHA 3VNTA 2XJ1A 4XP0A 4OTRA 2B4SB 4ZY5A 2WYOA 4BDEA 2PUPA 3UO6A 5EDPA 1W0XC 5KNJA 2W1EA 4HCUA 4GVAA 3QZFA 3W2RA 4O86A 3SLSA 4GJ3A 4RVLA 1YXTA 3PDTA 4RLLA 5DBXA 2XNPA 2YWVA 5EQPA 3SGCA 5AAGA 3ORRA 5D11A 1SMHA 5AEPA 3BBTB 5B0XA 3VPCA 2VNWA 3VW6A 4ZS4A 4PTCA 4RC4A 3D5UA 3AT2A 4O84A 4GKIA 3HMNA 2OZAB 4MBIA 5M53A 4DFXE 2YRWA 4D4VA 3NNXA 5EDRA 5F94A 4QRCA 3ENMA 5IF1A 1PXLA 4TUYF 1OL2A 5IEXA 4MD8E 3EQRA 1TKIA 5KMMA 3NUYA 2W9FB 2IW8A 2YWPA 4HR7A 2QLUA 4FEWA 4CMOA 4X3FC 3QA8A 4G2FA 4ASXA 4PTGA 4L44A 4EORA 4F70A 4UX9A 4O4JF 3MYGA 4DH3A 1VKZA 1URCA 4O7VA 4G3CA 4DHFA 2XK4A 5DE2A 3ODYX 5GIOE 3RV4A 1WBVA 2GQSA 4FIJA 4YUQA 3SVVA 3MPAA 4CMTA 3CGFA 2PVMA 2YAAA 3FHRA 3OBJA 4FKUA 4O7TA 2NPQA 1FGKA 5JGAA 3O0GA 3DKCA 3VS4A 2XNEA 3A4PA 5EYDA 3UFXB 4BDGA 1ZLTA 4Z3VA 4IX3A 2GPSA 5EM8A 5EHLA 3ZU7A 4DGMA 5CF6A 1R0EA 1GIIA 2BILB 4NFNA 3EH9A 1UWJA 3PE1A 4JBOA 3EJ1A 1GIHA 2QC6A 3K2LA 1ZXEA 2PMLX 3Q52A 3FQEA 5DLSA 3WO0A 4PV0A 3UYSA 3TN8A 4BZDA 3NGAA 5CU4A 4ZZNA 5F9EA 1FINA 4BCQA 5J9LA 3ANQA 4AA4A 2IG7A 2R9SA 1GSOA 2PN1A 5BPHA 4PDSA 1QPCA 3NZ0A 1JAMA 5T6KA 3VQUA 3JZFA 1ZY4A 3OF0A 3GVUA 5C1PA 3DXQA 2B53A 2CMWA 2J0IA 2QOOA 5TR6A 2A27A 3KB7A 4OTDA 1Q4LA 5J87A 3MSSA 4QMZA 3LP8A 4XX0B 5BVWA 3SC1A 1KJIA 1KE7A 2XKFA 4FV3A 4FL1A 4YHTA 4DFNA 4EZ5A 1WBTA 3UG2A 4DIMA 3QA0A 4K11A 3JR1A 4YZBA 4UXLA 3BHVA 2C47A 3LXLA 5M57A 4N70A 3PY1A 3BLHA 1EYZA 3TZMA 3U9NA 1KJQA 3TEIA 3RP9A 3PJ8A 4EWHA 4IFGA 3PIYA 2WMAA 3DKGA 5FXSA 4QMUA 1UU7A 4DEGA 5JZJA 2C0TA 3GU4A 5IQCA 2UZWE 4I4EA 5HI2A 3A62A 4OR5A 3DAJA 4A7CA 4FFPA 1H1QA 3CP9A 4CT1A 3TUDA 3TNHA 5KKRB 2VTHA 3GOPA 2VV9A 2RL5A 3HMOA 4C2WA 5KO1A 4FIGA 5H8EA 2F7EE 3BLQA 4NCTA 5CVFA 2YJSA 4AG8A 2C3JA 3SV0A 3CY3A 2JGZA 3ZCLA 3CTJA 3D15A 1FGIA 3LCTA 3A99A 5ETIA 3D2IA 3UIXA 3IONA 5AUYA 4C36A 4YTFA 3EQGA 4YZ9A 3DJ6A 3E92A 5DGZA 1GZ8A 5IA4A 2EWAA 1KE6A 2JKKA 4CFWA 3LMHA 2H9VA 2C3KA 4XYFA 4HW7A 3MH1A 3V8TA 2A2AA 3FV8A 3Q60A 4D5KA 4CFFA 5FTOA 4IAFA 4F08A 5IA0A 3BYUA 3PSCA 4IWOA 4EOKA 4RJ8A 4JL9A 4WKQA 5HO8A 1UVRA 4ACHA 3JPVA 2C4GA 3KCKA 3MPMA 5LOVF 3C4CA 1OB3A 2C68A 2OICA 1PXKA 4KNBA 4LUEA 3WZJA 4GK3A 3UO4A 4DT9A 4W4XA 2R86A 3D7ZA 4O6EA 4C4JA 4ZY6A 3CS9A 2FH9A 3L8SA 2CKOA 3FZOA 3NCGA 4HGSA 4I5PA 2F9GA 2W9ZB 4ZIMA 4R7HA 3LOKA 4AN2A 2CLXA 2R5TA 3W8QA 4AZWA 4V0GA 2BZJA 2IP4A 5A46A 4N57A 4R77A 3PVGA 3CCNA 4E6DA 2P2IA 3M1SA 3R21A 3EN5A 5KBQA 1OZ1A 3T3VA 2P33A 4I21A 2Y4PA 3VJNA 3KMMA 4PL4A 3F9NA 3DZQA 1AQ1A 4EUUA 4NT4A 3P7CA 5TT7A 4CQEA 3OWJA 4F6WA 3NMUF 3Q9YA 3SG9A 5CSPA 4MHAA 3TIIA 4HPUE 2A19B 2YN8A 1XJDA 2IVSA 2JKMA 3M42A 2H8HA 2VWBA 3PA5A 3PXZA 3QRJA 4BDAA 4HNTA 3PA4A 4ITHA 4TN6A 5B7VA 2BUJA 3Q53A 5DR2A 3TUBA 4A4LA 3NR9A 4F63A 1PY5A 2JIVA 1OL6A 2F2CB 4AX8A 2QOQA 2OLCA 4RVMA 3U87A 4ITJA 3VIDA 5CU6A 3NS9A 4ANQA 4AGUA 4HVHA 5LYJF 1ZOHA 4FTUA 1Y8GA 4MAMA 5CNOA 1OM1A 5HV6A 3JRXA 3CJGA 3PG3A 3ZLSA 3BV3A 2O63A 3SRVA 3U8WA 2UW8A 2C69A 3CQUA 3QBNA 3RAIA 2W6PA 5CQWA 1XH4A 3UMXA 2CCIA 3HV5A 4FT9A 2VWUA 3D7TB 3VUMA 4AWIA 1A9XA 4IW0A 4KB8A 3E5AA 5HNGA 2BTSA 3HV3A 4RIXB 5HNIX 3R71A 1GSHA 4BDBA 5ANGA 5CA1F 5CEMA 3FHIA 2CNUA 3ORNA 3QTRA 3DK6A 4KSQA 5J8IA 3WZKA 3WO1A 3PFQA 4YJOA 4KA3A 2PVRA 2WQOA 2R3JA 4O4IF 5HBHA 4DH8A 2GLTA 4EHGA 3ATSA 5HZNA 4FSRA 4NW5A 1PKDA 5CI6A 1ULZA 4HNUA 2YS7A 2PVFA 4QMLA 3C9WA 4BDCA 1JNKA 5IA2A 1C30A 5ETAA 4MVFA 1EHIA 5M4CA 3PP1A 4FBXA 4HJOA 4G31A 2ITPA 4JNWA 2YDJA 2YJRA 4PP9A 3QTWA 3DDQA 4ZEGA 2J2IB 3P7BA 3VVHA 4KIOA 4USFA 2VAGA 3KC3A 3FEGA 5IQFA 4E8AA 4FSZA 3BYOA 1G8SA 5FXRA 3VF9A 2V59A 4RLKA 4TYGA 4GL9A 2BZIB 3S00A 5E9EA 4FIEA 3VAPA 1CDKA 1KOBA 2CGUA 1ERKA 2VTMA 3FMMA 2VPQA 5F4NA 5IPJA 4C5AA 3QQKA 2YABA 2PVHA 4U44A 2NU7B 4IAKA 3LFFA 1KWPA 1FVVA 3C13A 3BRBA 4FNWA 3MN3A 1Z9XA 4CKRA 1V0BA 3FLQA 4YAJB 2G2IA 1KSWA 2QQ7A 4LRKA 4E26A 4C62A 2UZDA 3BYSA 3KF7A 3QCXA 4YO6A 4JQ7A 4BDHA 4O7YA 2ZDTA 4K77A 4ZTMA 5HTBA 3O2MA 4D28A 2VUWA 3MWUA 1GLVA 3R5XA 2HELA 3NNVA 3ZUUA 3FMEA 5KMOA 3FJQE 3HMMA 2ZB0A 1W8CA 3ALNA 4Y46A 5E8YA 3VC4A 3C4EA 5AP3A 3UGCA 4XZ3B 3JXWA 1MP8A 2JDVA 2Z7QA 3R6XA 2O8YA 4GH2A 5IEVA 3DFAA 1XQZA 3BELA 4GKHA 4PDPA 4Z16A 3W2OA 5L8JA 3BYVA 3R22A 4QQTA 4YJRA 4EH4A 5JKGA 2FPPB 4FSNA 1AUXA 3OC1A 1Q8WA 3UJGA 1WBPA 2YZMA 1SCUB 4FU0A 3I7BA 4O2BF 4F9BA 5LQFA 2W96B 2GTNA 4AE6A 4EOPA 4I4FA 4BN1A 2VWZA 3MFRA 2HENA 5FP6A 3AT3A 1KV1A 5CI7A 1Q8ZA 2GFSA 3VS6A 3UIUA 4CFUA 3NW5A 2XVDA 3N4UA 3EB0A 4FEXA 1OECA 4I5CA 4JAJA 2Q0BA 2CKPA 4JT3A 2J50A 3G8DA 5AV1A 2YCFA 3MA3A 5EOLA 3WZEA 5B2MA 5K4JA 4C5CA 5AV3A 4FEVA 4APPA 2B0QA 3ORPA 5JGBA 1QL6A 4O7ZA 3E63A 3WYYA 1KEEA 5HVKA 4V01A 5FD2A 4EOLA 5HORA 1U54B 4I20A 1X8BA 2XM9A 3FYKX 4J7BA 4FTOA 5JEBA 5M4IA 2PZ5A 4ARKA 4F7LA 3EFJA 4MV7A 3HB9A 3TV4A 2W4KA 3A61A 2WPAA 1YXUA 4TWCA 3UQFA 2QNJA 4XG3A 3RZBA 5CT0A 2VTSA 2O0UA 4U81A 1M2RA 1BMKA 2IVTA 2UZNA 3GC9A 3QTIA 2P0AA 2W6MA 4OBOA 4D9TA 3HA8A 4O0SA 3PPKA 4NTTA 1Q8UA 3OOGA 5EDQA 4C4IA 1VYWA 4AOJA 3QD4A 5HICA 3PXYA 3CLYA 3F7WA 4PMPA 3C0GA 3HA6A 3SX9A 4O0TA 3DFCB 1KUTA 4ID7A 4FV1A 3O8PA 1APME 4EZ3A 4S34A 4IAZA 4MXZA 1Y57A 4GT4A 3O71A 4ALWA 4O27B 2W6ZA 4I6BA 5JFVA 4ZSJA 4JI9A 4FG9A 4AACA 2A1AB 5CVHA 3W55A 5HGIA 2GNLA 2FYSA 3Q96A 3V6RA 5HX6A 4FG8A 4KINA 4MH7A 4AFEA 2PVPA 5FLFA 1YDRE 3ZSHA 1Q97A 3LM5A 3SW7A 1P4FA 4O7LA 1OIYA 2QOIA 3MFUA 4E4XA 2VX0A 4QMOA 4UXQA 2WIPA 2C5NA 2PK9A 4IH8A 3MVJA 1UNHA 4D1SA 4DEHA 3KU2A 5HVJA 1HCKA 2HGSA 2ONLA 4ACMA 2R3LA 4FT5A 4TKSA 5CAUA 2PVLA 3GP0A 4M0YA 4IX4A 5IQHA 4FUYA 5BVDA 3F6XA 3GC0A 4BTMA 2XYUA 4AT5A 4HPTE 4L00A 4J96A 2HY0A 3LCOA 5CB4F 3VUHA 2LGCA 4R6VA 4X2GA 4CTBA 1H24A 3RAHA 4MAOA 4I4TF 5IU2A 3RM7A 1VR2A 4X6QC 3H0ZA 3WILA 4M14A 4K33A 2R7LA 2R3QA 4DC2A 4Z7HA 4ACGA 4QSHA 1VYZA 1ZWSA 2BFXA 2HK5A 3ANRA 3HAMA 3QD2B 3G9LX 3F7ZA 5BYYA 3SA0A 4MYGA 2RF9A 1FMKA 4ASDA 2R3KA 2DWBA 2GHLA 2PZPA 1CE8A 1M2QA 3JRWA 3SE7A 4BGGA 2PUNA 2WEVA 3KA0A 4O2PA 4ASEA 4E7WA 4R1YA 4MTAA 4WNMA 3OXIA 3G33A 3JYAA 3OXZA 1UA2A 2WOTA 5GHVA 3OG7A 4L53A 3LCSA 2J7TA 2X8EA 3F2NA 4FKQA 3OWLA 3FLSA 3ODZX 3O96A 2XK6A 4AW1A 3NVMB 4PNKA 1PRYA 4RA4A 3OCTA 4TV9F 4H3BA 2GNFA 5ANDA 2Z7LA 5BYLA 3ROYA 4DG2E 1IRKA 3EHAA 5F1ZA 2OF2A 2UW3A 4F64A 2BAJA 4BCGA 1QPDA 5K5XA 5LA6F 3KAKA 4F9AA 4P5QA 3HDNA 4AGDA 3GEQA 1YVJA 4QNAA 3CSVA 4L01A 4BYJA 4QP1A 4UWBA 2AYPA 3PJ1A 5JRQA 3ITZA 3PY3A 5L6OA 2OXXA 5EFQA 1BI7A 1P2AA 3BX5A 4QYGA 1TVOA 4NYEA 3MJ1A 4ZTNA 2RIOA 1LR4A 4KSPA 1MRYA 4YJNA 3EQIA 4DCAA 4D55A 4NJ3A 3FY0A 3U4UA 5AMNA 3MWEA 5BQ0A 3RALA 3GT8A 4TYHB 3NNUA 5K5NA 1I09A 3QGWA 2AUHA 2J90A 2QKWB 3E3BX 2WZJA 4FYOA 3QC9A 4XYMB 4C4EA 1KE8A 2ZV2A 2EU9A 3ELJA 1IG1A 3P86A 3QYWA 4F6SA 3JVSA 4RFMA 5L3AA 1REJA 1JDEA 2V5AA 3FPQA 4RIYA 3ORTA 3ZEPA 2BRMA 3WE4A 4BTKA 4H1MA 4M15A 4EYJA 3IW7A 2V7OA 3R1SA 5D10A 2ESMA 4L3PA 5E4HA 1DV2A 3CKWA 1IR3A 1GNGA 4MF1A 4ONAA 1OL5A 2PZRA 3C7QA 3HUCA 4QO9A 5EI8A 2QOCA 5LJJA 2DUVA 4A06A 4TWPA 2O2UA 3D5VA 3A8WA 4EH8A 2PMIA 2P3GX 4Q9SA 5FG8A 3S95A 2DWCA 4QPSA 3WF7A 1BYGA 4B0GA 3DA6A 4QYYA 4OUCA 4RX5A 5LMKA 3LQ8A 4I23A 3HO8A 3ACKA 1CKJA 2ZM3A 3VW8A 4L3JA 3ZO3A 4M8TA 4NUSA 5C1QB 3GGFA 4EC9A 3DK3A 2UV2A 4CLJA 5GJFA 3EFLA 3EN7A 4FKOA 2AC5A 3QD3A 2R0IA 1PXMA 1GOLA 5D7AA 5BMMA 2HZ4A 3FI4A 4FZFB 2YCQA 4FE2A 2X39A 3IQ7A 2Q83A 3RAWA 4EOMA 4MNEB 5ICPA 2UW5A 3FI2A 4G5JA 1T46A 2CZGA 5ACBC 1FBNA 4WBNF 1DS5A 5LOHA 3DXNA 1EZ1A 5BVEA 3IOKA 3TCPA 4JQ8A 4I0TA 2VU3A 4E4LA 3DTWA 2Y8OA 3NYNA 4LGHA 2BAKA 4LOOA 1Q24A 3TNIA 4NM5A 2UZOA 5CENA 4FVRA 3BHTA 3FAAA 3SOAA 2QOKA 3MY0A 2E9NA 3ZFXA 5LVOA 4MEDA 4AUAA 4EK4A 5FDPA 3VS0A 4MV3A 3IG7A 4Y5HA 3RV3A 4P90A 3G2FA 1SNUA 4F9WA 1B6RA 2HZ0A 3O23A 3PVUA 3W2PA 4UB7A 3AT4A 3HRFA 4F99A 2RG5A 3QHWA 3V5LA 3LIJA 4J1RA 4CZTA 2EXCX 3KXXA 4FKRA 2R3OA 4NL0A 1PXIA 4BCIA 4J97A 1L3RE 3PXQA 2BRHA 4G6LA 3Q1KA 4WOVA 3O8UA 3D4QA 3MV5A 4X2KA 4AW0A 2VRXA 3BHUA 4RJ5A 3OUKA 5EW3A 3I5ZA 4WG5A 4EL9A 3CPBA 2YAKA 4YTHA 3VMMA 3G0FA 3VUIA 4D1XA 4IM2A 2X81A 5DG5A 5EM6A 3TQTA 4GIIA 1P4OA 4YJVA 3DQXA 3WF6A 4ZJJA 2CLQA 3PJ2A 2LAVA 2YL2A 4MV8A 3GXLA 4IJPA 3ZDIA 2DQ7X 3WZDA 5J2TF 5BUJA 2VTTA 4O7RA 4IZ7A 3HBLA 4G5PA 5CSHA 1VBHA 4C0TA 3KVXA 2YCSA 1H1RA 3IDBA 4RMZA 3MY5A 3OUZA 1JOWB 3P7AA 3N6RA 4EJ7A 2GS2A 3OWPA 5A9UA 5HLWA 2YZLA 5TOZA 2R3MA 5JH6A 1LPUA 4QP8A 3GQLA 3OXTA 4QQJA 5FBOA 2YW2A 2GU8A 2UZUE 3FLZA 3LFDA 3HV6A 2XKEA 4CKJA 1BX6A 2NU6B 4DLJA 2F7ZE 4V05A 4IEBA 3SW4A 3R7EA 4BI0A 2VO7A 2R3FA 4S32A 4F9CA 3OVVA 4GS6A 1W98A 1BL7A 4V0GB 4EHEA 3OT3A 4W8EA 2EB3A 3BG5A 4D58A 3OROA 2G01A 2WMTA 4WD5A 3HKOA 4UY9A 4YNEA 2OH4A 5M56A 4F7SA 3V5PA 4YJPA 4XV3A 2W6QA 4CFXA 1SZMA 4ZOGA 1SVEA 3CD3A 3AC5A 2R3RA 4DFLA 4EK5A 5AP1A 2W17A 1QPEA 3DT1A 4O2ZA 3Q3BA 3UVQA 4GYIA 1JKJB 3NW7A 1PMUA 3Q4CA 2JKOA 4AXAA 2I6LA 4WG4A 2BROA 2Z8CA 2J4ZA 3OY3A 4FSQA 1CS0A 3I0QA 2X8DA 1YI3A 4MCVA 3UBDA 5KBRA 4BY9E 3I60A 4R3PA 2OJJA 5DWRA 4PP7A 2HWPA 3LZBA 3PSDA 2VWYA 4E6AA 4D0XA 5HLPA 3BU6A 1OL1A 3UP7A 2FSTX 5H9BA 5TF9A 4A9UA 5C8KA 3W1FA 4C3PA 3FZRA 3FBVA 3FWQA 3I0OA 1PKGA 3SRVB 1GZNA 4S33A 2ITOA 4Z7GA 1CMKE 4AGWA 3NRMA 4HVGA 4FZAB 5JQ8A 2CHLA 4FSYA 4XV1A 4O0WA 4TYEA 4MNFA 3A7HA 1CQJB 2YZNA 4R3CA 1IASA 2C00A 2J51A 3QCYA 4N4SA 5CZIA 2YZAA 4GCJA 1WMKA 2PU8A 3G90X 4I24A 4XH6A 5D7VA 4ZLOA 3CTHA 4F0GA 1ZZLA 1E1XA 4O81A 1RW8A 3ZBFA 5ETCA 4IZOA 2V7AA 3KXNA 3TJDA 1WCCA 3EN9A 2OXDA 4GU9A 4XRJA 4MXAA 3LHJA 5GJGA 5HU9A 2R87A 3VBXA 4K2RA 5KMJA 5BVFA 3QX4A 2PE0A 2G2HA 1LEWA 1RQQA 1IA8A 2E9OA 4WA9A 4DT8A 5BVOA 4EK8A 2W6OA 5C8YF 2PMOX 2YITA 2WIHA 2GDOA 2JBPA 3HAVA 2UW7A 4ZZMA 3RVGA 4MV4A 4BCKA 4DITA 5J1VA 2YM8A 4TYHA 4FKVA 5GONF 3R5FA 1YRPA 4W8DA 4IVCA 3M2WA 2PE1A 4FTMA 4M84A 2FP4B 2GNIA 4D0WA 2F7XE 2QOLA 2W05A 1GZKA 3EQFA 4EH3A 4O83A 2J6MA 4IACA 3VRYA 4JDJA 4WNOA 3FSKA 3FZ1A 3AGLA 3LJ1A 2XIYA 3DKOA 5E8SA 3CEKA 2HZIA 3PWYA 4FV5A 2VWIA 4ITIA 4A07A 5DR6A 1M7QA 3PJCA 4BVUA 3KMWA 3P4KA 5JMSA 4FA2A 4DGGA 4FX3A 2C6DA 4L9IA 4X3FB 5L6WL 3OBGA 4IC7A 3JY9A 3JY0A 4M67A 3QZIA 1OBDA 3V4ZA 2B1PA 1A06A 5BMVF 3AC2A 4JR3A 4J53A 4O2AF 1PXNA 1J1BA 2VTQA 4HCVA 2FSLX 4JXFA 3T8OA 3BE9A 5AUZA 3L8PA 4DE4A 5AUTA 2WTCA 4DFYA 5CSWA 2FGIA 4IZYA 3R8VA 4KRCA 5EOBA 4H58A 3W2CA 3T9IA 4EWQA 3TV6A 4OBPA 4PDOA 4IJ9A 4MKCA 3GI3A 2HJWA 2V58A 4MBJA 3UIMA 2R7KA 3Q2MA 5IH4A 1ZY5A 1I7NA 2OZOA 5KCVA 5CYIA 4MNEA 4F1MA 1IAJA 3RM6A 3NNWA 5CT7A 3CXWA 3PXFA 5HCZA 5M4UA 5M07A 1IOVA 2GHMA 1XR1A 5EHOA 3BI6A 4XG4A 3GCVA 2GNJA 3R9NA 5AUUA 2BHEA 1RJBA 1YXVA 2C3IB 4G1WA 4K1BA 4L7FA 4BCMA 1JLUE 3QYZA 2ERKA 3ZOSA 2ETKA 4QMWA 3QWKA 4IM0A 3FZTA 3R73A 4FTKA 4YURA 4NM3A 5FUTA 3K5IA 5A6NA 1DAYA 3C0HA 3FKLA 1ZMWA 2ZV8A 3MW1A 3Q2JA 4NWMA 4X7QA 4Y8DA 5IQEA 2VZ6A 3DY7A 5HO7A 5K4IA 3MB7A 4BC6A 2GTMA 4IVAA 5AM6A 3TJCA 4ANSA 3AG9A 4FFMA 3TZ7A 5ANKA 4YSJA 2OJIA 1W84A 2VTNA 5HIDA 2GQRA 1FOTA 1NY3A 4IB1A 4CMUA 1W83A 4OTGA 5L6PA 4I50F 4ZHQF 5CXZA 3TUCA 4CLIA 4U3YA 2XIZA 4RRVA 3WNZA 3TWJA 3Q4TA 4WO5A 1U59A 4HGEA 2XM8A 2C1AA 3BHYA 3II5A 5CSXA 4YPSA 3Q4ZA 3BGZA 3ZRMA 4L1KA 3P1AA 3H9FA 4F9YA 4JX3A 1XO2B 4J8MA 3HYHA 4TY1A 5H2UA 3W18A 3ZYAA 3PIZA 3VOTA 4KAOA 3F5GA 3AD4A 2CGVA 2WTVA 2GMXA 4U79A 5DIAA 3QUDA 4RJ3A 4EOOA 5EM5A 2X2LA 1GZOA 5DHJA 2XJ0A 4GSBA 4CG8A 2IZSA 3CQWA 4DH7A 3COIA 4P7EA 2HXQA 3QQLA 3R5HA 3TI1A 1U5QA 3Q9XA 3E3PA 1BL6A 2XNNA 4EQUA 3R8ZA 5LARA 4KIPA 4FZDB 3ORQA 4M3QA 1JKTA 3BLRA 2WHBA 2ZM1A 3K5UA 4GYGA 4H39A 3FMHA 4FNYA 4UWCA 1BI8A 3BV2A 2JAMA 2WQNA 2XKDA 2XS0A 2VNYA 3EQHA 4U8ZA 5AWMA 3TNWA 2BIKB 5L8KA 2A4LA 5IMXA 5HCXA 3AMBA 3P78A 4GG7A 4R5YA 1WR2A 3AMYA 2BPMA 2CGWA 3IOPA 4JVGA 5LMAA 4BKJA 4CSVA 3RUPA 1OPJA 3HLLA 1OBGA 1S9IA 1R1WA 3QXPA 2C5XA 3CR0A 1YOJA 1Z57A 5CAQA 5CASA 4QNYA 5DA3A 4TXCA 3C4WA 3DJ5A 2ZV9A 1XH8A 3OZ6A 1WZYA 4IWDA 3FZSA 4RVTA 4EH5A 2OSCA 2XBJA 4ZMFA 5JH7F 5C26A 2YDKA 4UEUA 2CCHA 1H00A 2IZTA 2FB8A 2GSFA 3EQDA 2BRGA 2ZDUA 3LQ3A 3MB6A 3QQFA 3PXKA 3R28A 4I94A 4OW8A 3NAYA 4FGBA 3RJCA 2I87A 4EGJA 5IH5A 5L2TA 4FTJA 2ITWA 3V5QA 4EEVA 5JSMA 2IN6A 2YM5A 1KV2A 3KGAA 4LUDA 2BTRA 3TIYA 4C3RA 3S0OA 1IAHA 5A4LA 3LFBA 1YI6A 2JLDA 3Q5ZA 3B2WA 2XRUA 4JQEA 1VZOA 2QO9A 3MVHA 2F2UA 4DTAA 1XH6A 3EYGA 3UPXA 1SVHA 3ORIA 3QTQA 4Y8VB 4C02A 3QZHA 5LVNA 5E1EA 3GU8A 3KL8A 5LMBA 2UW9A 3F3VA 5HHWA 3UODA 3LXKA 4BICA 2Y6OA 3PRIA 3B8RA 4ZMEA 5I9VA 4ALVA 2PZYA 3EL8A 4RPVA 4BGHA 3SQQA 3E7VA 3QKKA 4LL5A 4G9RA 2FA2A 2VD5A 2WNTA 4RVKA 3K54A 3NSZA 5FTQA 2B55A 3QTXA 4NM0A 5M55A 3GCPA 5FEEA 2PSQA 4CV8A 1Y6AA 1PYXA 2QODA 2O64A 1MQBA 1JKSA 3AC1A 4YC8A 5A3XA 1Z2PX 2C6LA 1OKYA 2WMBA 3NCZA 3UP2A 1STCE 2BKKA 5C9CA 3ETAA 3CC6A 3EFWA 4HVIA 3RWQA 5AX3A 2G2FA 2W06A 3W8LA 5KMNA 1UNGA 2J5EA 3ZXTA 4EJNA 4EUTA 3U6JA 1I7LA 4GEOA 3GUBA 4CNHA 4LQMA 5E91A 3F3UA 4E73A 5KZ0A 4TT7A 3FQHA 3TW6A 3PXRA 3IGGA 2W5HA 3UE4A 4GMYA 3KRXA 4FTIA 5CZHA 4UYNA 1OGUA 3ZO2A 1NVQA 4YHJA 5J7HA 1S9JA 4IX5A 3E5NA 3W10A 5AAFA 3GQIA 4N6ZA 1K3AA 2QU6A 2BZKB 3ZRKA 4PF4A 4IQ6A 4YHFA 4XV9A 3DBDA 4U9AA 2F57A 5DYJA 5KHXA 4OTFA 4X3FA 1Q99A 3QTZA 4RIYB 5HU3A 2QK4A 3MWDA 4FOCA 2C6EA 2BDJA 3NDMA 4QP9A 2AC3A 3HV7A 3GC8A 1O9UA 5EYKA 3RHKA 1MUOA 5AIRA 2JFMA 2IZRA 4FTCA 3WOWA 4BDJA 4BCFA 2PVNA 4BBEA 4ZLZA 4EOQA 2PZIA 4RX9A 5EH0A 2R2PA 2OJFE 3V3VA 1Y91A 4ZJVA 3EN4A 3H30A 2KTYA 3ORKA 3AC8A 1H1WA 5ITAA 5JT2A 3HRCA 3RCJA 3TZ9A 4XMOA 5D8DA 3DJ7A 4GW8A 4B8MA 3U9SA 4FG7A 4UZHA 2VTOA 4FK6A 5BYZA 3RK5A 4CT2A 4D5HA 4HYUA 4S2ZA 3GB2A 2FSOX 4DN5A 1MRUA 3QCSA 3S2PA 4KRDA 3WBLA 4C37A 4IFCA 4CV9A 2X2MA 5E92A 3P5KA 1DV1A 3RTPA 4ZSGA 3KULA 3R8PA 5I5ZA 4Y73A 3R2YA 2PBZA 3IW5A 3NW6A 3UQCA 3KRRA 3KQ7A 5ACKA 3LPBA 1TQMA 3ZO1A 4JG7A 1AGWA 2UZEA 1PMVA 4FMQA 2WMVA 5J5SA 1PX2A 3I7CA 4NKSA 4I55F 3BHHA 4YLLA 5JRSA 4IC8A 4KBAA 3GLKA 4YZNA 5DT0A 1EUDB 2FVDA 4TNDA 5E8UA 3FI8A 3I4BA 5C1OA 4IANA 2PULA 5EZYF 4G9CA 1R3CA 2QO7A 3F88A 3QRTA 3RGFA 1H8FA 4R78A 3OTVA 4XP2A 3MESA 4RJ6A 3FY2A 4QMYA 1WVYA 2XIXA 1FQ1B 1YXXA 4U40A 2Y0AA 3QD0A 3Q04A 4YJ2F 4IB3A 5A6OA 3ZMMA 3OMVA 3W2SA 2C0OA 4H3PA 2WTKC 3FDNA 1A48A 3L9LA 3DDPA 3FLYA 4D2RA 2FPIB 2X7FA 4H1JA 3O7LD 4FSUA 3VS1A 4W4YA 4I0SA 3BU3A 4ERWA 4B4LA 4FFNA 4AW2A 4DGNA 3EFKA 4GIHA 1TQIA 3EIDA 3ZC6A 4ACCA 3HP5A 4QMNA 2B9FA 1J7UA 2ZOQA 3GIDA 4MX9A 2W1DA 1CTPE 5CX9A 5CEKA 2X2KA 3ET7A 3UDBA 4HZRA 3GCSA 3PY0A 3NIEA 2ITZA 4OTQA 4NTSA 1YWRA 1JSVA 1WBSA 2YIXA 5D12A 3DLSA 4IHPA 3VF8A 3R7VA 4G3EA 4YTCA 4WSYA 4F0FA 3R04A 1H1PA 3R7IA 3RKBA 3F2RA 2XYNA 4UWYA 4FC0A 3V51A 5DN3A 3MH0A 3MPTA 1MQ4A 2CKQA 4LFIA 4G17A 3NUXA 2B52A 1GIJA 4MXCA 2OU7A 4U45A 4XS2A 3OUUA 4ZK5A 4IWQA 4QOXA 3QF9A 3R2BA 4HGLA 3V8WA 5KKNB 4MA5A 2PTKA 3ZDUA 4EHVA 4UN0C 4YAKB 1JSUA 4JDKA 4BTFA 4IB5A 5IA3A 3LFEA 1ZAOA 2RKUA 2Z7SA 3POZA 5CXHA 4H36A 4E4TA 3PPJA 1BNCA 5CAVA 4E93A 3C4XA 1PF8A 4YZCA 4ZJIA 5DI1A 1YHSA 1YXSA 4OTHA 1PMNA 2VO6A 1PK8A 3U4WA 2XBAA 3VHKA 4LMNA 2UZBA 2IVUA 5L2SA 2UW6A 3V01A 3P23A 4K8AA 3NWWA 1H27A 3L9NA 4TPTA 4R1VA 1ZRZA 5E7RA 3HGKA 4FT3A 4I41A 5A4TA 3QCQA 4FV6A 5D1JA 2UUEA 3SOCA 3OY1A 4FEUA 3QKMA 2YERA 4I6FA 3ZZWA 5CF8A 1FVRA 2W1HA 4I22A 2IJMA 2XEYA 3F82A 5CSVA 5HEZA 3TDVA 2VTLA 3TKIA 5KHWA 1REKA 4AU8A 4QMXA 3F2AA 4ZTHA 3WF8A 4UZDA 5DR9A 3Q9WA 3ZZEA 1MRVA 4LOPA 1B38A 5A4QA 3EQCA 1FVTA 2QHNA 3CPCA 4H3QA 4YSMA 3PA3A 5IQGA 3KF4A 3EKNA 3DNEA 3F5PA 1T45A 3KY2A 4L52A 4D4SA 2SRCA 4FV9A 4RIOA 1JKKA 2YM7A 3FLWA 4LV5A 4NSTA 5JN2A 2OG8A 2X6EA 5AM7A 3DF7A 3Q4UA 3OEFX 4JLCA 2C6TA 3VS2A 4NU1A 5IEYA 4D9UA 3RINA 3KN5A 3UYTA 3N4TA 4PX6A 3MFTA 4WT6A 4F09A 5I0BA 4YPDA 1F0QA 3EQBA 3OP5A 4JG6A 5FDXA 2W70A 1Q8YA 3L8VA 2PL0A 2QG5A 4NH1A 5LWNA 2UZLA 4M69B 5HBJA 2R0UA 2QKRA 4DEDA 4FV0A 3QC4A 3RHXA 3V6SA 3MA6A 3ZUVA 5J9ZA 4YBZB 5DRDA 5E8TA 3THBA 4I1ZA 5HG5A 4XOYA 5DH3A 5HD7A 2QURA 3AOXA 3VHEA 2G15A 3VBWA 5HE1A 2E9UA 2GS7A 4DBXA 4RBLA 4EC8A 5M09A 4S31A 2XD4A 5CA0F 2C6KA 4ANLA 3ZO4A 5CAPA 5J1WA 4QTAA 2HYYA 5CS6A 1GGOA 4QYFA 3AX6A 3GBZA 4FYNA 3WIKA 3QTSA 2OIDA 4ALUA 4AQCA 2GPWA 3V8SA 3DGKA 3P0MA 4U7ZA 3ZFMA 3NYOA 4F1TA 3OFMA 3KK9A 3G9NA 3JUHA 4FKGA 4Y83A 1W96A 5JQ5A 3W32A 2B7AA 5L8LA 3ZONA 1OL7A 3NYXA 3LM0A 4LMUA 3R01A 1GY3A 3F61A 1SM2A 1KE9A 2V0DA 3GCUA 1O6YA 3H3CA 5AFVA 1XBCA 3IW8A 3GCQA 3VS7A 4BYIA 4XP3A 2RGPA 4AOTA 5KE0A 2Z60A 2W4OA 4AGCA 5E8WA 4KABA 5E8XA 2HW7A 4I5MA 2VR1A 4WUNA 1UV5A 4HQ6A 3OUNB 2IWIA 3MI9A 2P0CA 3IPHA 3OW3A 3RNIA 4DYMA 1J3HA 2HW6A 4K9YA 4DBNA 5CWZA 3OWKA 3PUPA 4FVPA 4FIIA 3VUGA 3QGYA 3ZTXA 4FOBA 2V5QA 3DOGA 4J52A 5AP4A 5LXMA 4TNBA 2QI8A 3ZH8A 2BCJA 2GCDA 1DIKA 2PUUA 4CG9A 4DEAA 2KULA 4DLKA 3ULIA 4OT6A 4LRJA 5CU3A 2ITQA 4BI1A 3LXPA 1U4DA 3A7JA 1OPLA 4R5SA 2P2HA 4II5A 4UALA 4CCBA 4C34A 4FL3A 4RQKA 4TYIA 4WRSA 1H28A 5EQEA 4ZTLA 5TKDA 1RDQE 3LFCA 4U42A 3PSBA 2X4FA 4QP7A 5I9WA 3ERKA 4XYLB 3AMAA 4TRLA 2H6DA 3Q6WA 2ERZE 3FSFA 4E5WA 4HVSA 2QVSE 3FC2A 2VO3A 4KD1A 2Y6MA 3HRBA 5IG1A 3E8CA 4RWJA 3COHA 3DLZA 3RPOA 1M6VA 2Y4IB 2XA4A 2WQMA 5DFPA 3ACJA 3GU7A 1J7LA 2BDFA 2W5BA 1I44A 1Q8TA 4PRJA 1BXRA 1JBPE 2WMXA 4FGRA 4J95A 3LWBA 3NLBA 1E1VA 1YWNA 4CTCA 5GIPE 4I5HA 2WTDA 3AC4A 4JDIA 1PXJA 2CDZA 4GUBA 4BCPA 2OXYA 4GV1A 5CNNA 4YTIA 4CRLA 4K6ZA 3K3JA 5ANIA 3ZRLA 2J0JA 3BU5A 3LVPA 1YOLA 3I1AA 1W7HA 4E5BA 5B2KA 3R30A 2DS1A 4OBQA 2XP2A 4GK4A 4NCTC 3F3ZA 3P08A 3E62A 4WBBB 4Y72A 3R83A 3QRIA 2NUAB 2YISA 2VGOA 4AF3A 4RSSA 2XIRA 4O22A 4EKKA 5AIKA 2ZJWA 3DQWA 2XEZA 3ID6C 2VTIA 3R7UA 2YACA 4Q2AA 5EM7A 2BHHA 4GJ2A 1PYEA 4KWPA 4C38A 3PYYA 5M4FA 2WEIA 2OO8X 3O17A 3P79A 4XG6A 4A9YA 4XOZA 4AZEA 4BHZA 3PG1A 3TTJA 4YZMA 3D9VA 5JK3A 1P14A 2WMWA 5BMSA 3ZBXA 1YHVA 3O8TA 3ETHA 3SDJA 2ZDHA 4ZI7F 4DCEA 3LKMA 1M0TA 5CVGA 2ZAZA 3G51A 4BIEA 2WTJA 5IQIA 3S4QA 3BIZA 1G8AA 2G9XA 2JDSA 3M11A 5FM2A 1V0PA 5IUIA 4KKEA 4EOSA 2Q0NA 2QD9A 2WFYA 2WMRA 2QF7A 3VPBA 3GU6A 4GRBA 4O0RA 5AJQA 4ZTRA 4FTAA 2V55A 3BZ3A 3FXXA 4OT5A 4FT7A 5FRIA 4RG0A 5JZNA 3FUPA 3NEWA 4BIDA 5LP6F 5HBRB 3D94A 2J9MA 3G5DA 2EUFB 4GU6A 4FKTA 4IE9A 3LLAA 5E1SA 1DAWA 2CSNA 1KJ9A 3OCGA 4G3DA 4M13A 3T3UA 3O7LB 4TV8F 2ITXA 5HX8A 1H4LA 3EQPA 4Q5EA 5HCYA 3TKUA 4BCOA 4XLIA 3VS3A 2B9IA 2C6MA 1BUHA 1UNLA 4O0XA 4D4YA 4TWOA 4FIHA 3OHTA 4EHZA 4C4FA 3E8EA 4RC3A 2BVAA 3R9DA 4BZOA 4ENXA 1KBLA 4NK9A 3WARA 4I92A 3W2QA 3UNKA 3Q2OA 5CAEB 4I3ZA 1OIUA 2YDIA 2W71A 2X9EA 1B39A 2ITUA 4XUFA 2OJGA 1YQJA 3ZUTA 4B99A 3GNIB 3BEAA 4LI5A 4BI2A 3EL7A 5EW8A 5CQUA 1JQHA 4JBQA 4Z55A 5A54A
chains in the Genus database with same CATH superfamily
4NM7A 3CQEA 2I0HA 2JDTA 4QP4A 4FV2A 3NPCA 4FKSA 3F3WA 4PL5A 3ATTA 4M7IA 2QHMA 3W16A 3MH3A 3HV4A 4FODA 3VBYA 4DG0E 2C30A 3AGMA 1S68A 2Q2UA 3IW6A 3FE3A 4TL0A 4N6YA 4RX8A 5M44A 5E25A 4FSWA 2Q2TA 4TZRA 2IW9A 2JIUA 1DM2A 2NNWB 5HIBA 4YC6A 3UVRA 5GINE 3LMGA 5EYMA 3UZTA 3EZVA 5IYZF 2XJ2A 4CKIA 2X4ZA 5B2LA 2W1ZA 3E7OA 1J7IA 1H1SA 2CKEA 2XNOA 4I6HA 3ZM4A 1U5RA 3U6HA 1A0GA 1C3OA 5I5WA 3RCDA 5AP0A 1Q5KA 1KOAA 4PY1A 3EYHA 4AS0A 3MVLA 3QL8A 3U54A 4FTTA 3W0MA 3UZBA 4ZTQA 5CALA 3KXGA 3WF9A 2JDOA 4HYHA 4M12A 4XX9A 4YLJA 4U0IA 4FKIA 3FI3A 3ZLYA 2DLNA 1NA7A 4WUAA 4FFRA 4EH7A 1IOWA 4FTRA 3TNQB 3UOHA 3GU5A 1CM8A 2UZVA 5K9IA 3AD6A 3BE2A 2I8CA 3D5XA 3H9OA 4KS7A 4AXEA 2PVYA 4C61A 2REIA 3COKA 4LRMA 2PHKA 2J0LA 3BQCA 4TTHB 2YHVA 5DEWA 4DFUA 4G3FA 4YR8A 5H80A 4I93A 4B8LA 5BNJA 3PLSA 4RA5A 4TW9A 2WU7A 3IDPA 4CGAA 1DGSA 1ZZ2A 2JBOA 4GT3A 4N0SA 3R1QA 3SKCA 3TINA 4W4WA 1XBAA 4FKWA 2QG7A 1JWHA 4IADA 4LV7A 4F7NA 1ET0A 3BCEA 3UZPA 2VWXA 1ZMVA 5IQBA 4BIBA 3KALA 2OWOA 3KCFA 5HG7A 2JITA 3VBVA 4C4HA 4E20A 4R3RA 5DT3A 4EH9A 1ZYDA 4GK2A 5C4KA 4HCTA 3H9RA 5JFXA 4EKLA 2OWBA 2BKZA 2WQBA 3NIZA 4DHZA 1Y6BA 4UCRA 5IUHA 4L68A 3VBTA 5T68A 4FV7A 5HKMA 4LDTA 2EJ2A 3F5XA 4USEA 4WRGA 3R9HA 2WB8A 2W99B 4XHKB 3SXFA 4D4RA 2CN8A 3MIAA 2CN5A 4ERKA 5IDPA 2XNBA 4RWLA 1XH5A 4RX7A 4O0YA 4BDIA 1TQPA 4JRNA 5CEIA 4OGRA 2BALA 2IVVA 4F0IA 1Z2OX 4NJDA 5L2IA 1BLXA 2YM3A 2HIWA 4K18A 3TMOA 2I40A 3FL4A 3O50A 3HX4A 3KULB 2VWWA 3QAME 3V5JA 4ZQIA 3KREA 4YP8A 2XK7A 3PZEA 5EKOA 4LH6A 4YB8B 2ZGIA 5M51A 4JXUA 2BZHB 3C0IA 3QALE 1WBNA 2PVKA 3HP2A 4FV8A 2C5YA 2VTAA 3KN6A 4CCUA 3LW0A 3R1NA 5E90A 2EVAA 4EBWA 5FBNC 2OGVA 3C5IA 4BBFA 1RE8A 2ZMCA 2JIIA 4QMMA 1I2LA 5JFSA 2W7XA 5LVMA 2V22A 2CNQA 3BBWA 2XF0A 3U9TA 4E4MA 2QOBA 4J71A 4DINA 2PYWA 3E87A 1WVWA 3F3TA 3L9PA 1R78A 4QQCA 5ANEA 5DGHA 5E8ZA 4C2VA 3NBZB 4EGQA 3ZC5A 4EG0A 1OMWA 2JKQA 2PPQA 2NU8B 4CD0A 2OIBA 2QCSA 4ME6A 2ZVAA 5KKRC 4L45A 4KIQA 3PN1A 4HYIA 3BGQA 1KE5A 1ZOGA 3DU8A 2PY3A 3BQRA 3DAEA 3NUAA 3QUEA 4QTCA 4BGQA 3HUBA 1PXOA 3TW7A 4TYJA 2HIVA 1WAKA 2WMQA 3OT8A 4XG7A 3IS5A 4QP3A 1UC8A 4R7IA 3OOMA 3UC4A 3KK8A 3QRUA 2R84A 1PMEA 3FPMA 4F7JA 2R82A 3BKBA 4YZDA 5FNVF 3NVKI 1R39A 3R7OA 2UVYA 3EOCA 3D14A 3VA7A 3AC3A 4EYMA 4ANMA 3QLGA 4IZAA 4LG4A 4CEGA 4RWKA 3MY1A 3DS6A 5I9XA 4UV0A 4ENYA 3IK3A 3VN9A 2IW6A 2JDRA 3TY5A 5BYBA 3QQMA 3ZLXA 3L8XA 4PZ8A 3MJFA 1LUFA 4IM3A 3BPRA 5FTGA 5CY3A 1G2WA 1JSTA 4AXFA 5AA8A 2WELA 1UKIA 4QPAA 4XLVA 5BWRA 2DYLA 3DCVA 3G6GA 4BB4A 5GNKA 5HTCA 1H26A 2WTIA 4BDDA 4DTKA 4MBLA 3RNYA 3DKFA 4BCHA 2I7QA 5BPYA 2HAKA 3UIBA 5KX5F 2R85A 5HESA 2X1NA 4FSMA 4HYSA 5FEQA 3RPVA 3UMWA 4G6OA 2ITVA 2ONLC 1Y8YA 3R8UA 3FXWA 4XBUA 3ALOA 2XB7A 4ZY4A 3TIGA 2E9VA 5CEPA 3H0YA 3RWPA 4DA5A 2ITTA 1EUCB 4EONA 3K3IA 4MA0A 1VEBA 4X0MA 4XCUA 5IDNA 4O0UA 4HNVA 3QX2A 1K2PA 4NKAA 5H8BA 5CANA 4M0ZA 4EOJA 1CKIA 1GJOA 4QMQA 4F6UA 4FNXA 3VWAA 4MWHA 4YJQA 2NP8A 4RZWA 4EQCA 2OH0E 3CY2A 3ZXZA 3EN6A 5HE0A 2XNMA 3MS9A 3R8MA 5IQDA 1WVXA 3KXZA 4L3LA 3U6IA 1P5EA 1A3GA 2XCLA 2I0YA 2V62A 2FSMX 1JLLB 3AKJA 4IAIA 3V4SA 2WQEA 5AUXA 4AN3A 2YFXA 4A9TA 4QT1A 1IEPA 1CSNA 4E6QA 3BYMA 1U46A 2BRNA 5FP5A 1H01A 2Z2WA 3L9MA 4S30A 4B7TA 1M52A 1ZYCA 4QMSA 2WD1A 2EB2A 4YBKA 1M0WA 3FXZA 4IMYA 2Y7JA 3V04A 4DH1A 1ND4A 2XCKA 4PMMA 1WBOA 4YJSA 3MVMA 3RK7A 2B9HA 2UW0A 1G5SA 4I0RA 3C1XA 5IMEA 5AV4A 5HBEA 4ANBA 4BZNA 5AP5A 1ATPE 4AXCA 5EKNA 2R3GA 2WU6A 3L1SA 3F69A 2DZDA 5LVPA 4CXAA 3U55A 1DI8A 3KFAA 5D9HA 4WBOA 1XMMA 2RFDA 2JAVA 4AAYA 4FSTA 1XH9A 4DGLC 5BUEA 3UOLA 4DF3A 1ZYSA 4O0VA 4RIWA 4UBAA 4BDFA 5I9ZA 4AZSA 3TACA 2OF4A 3NAXA 2NU9B 1URWA 3EMGA 4KKGA 4MQ2A 4ZSAA 4FTLA 1CQIB 3SXSA 5BPFA 1HOWA 3Q6UA 5GJDA 4AP7A 4OTIA 5EI2A 3SD0A 5BVKA 2OLSA 4X2NA 1O6LA 3BGPA 3LAUA 4YO4A 5HVYA 4EOIA 4E4NA 3R1YA 1SYKA 3NUUA 3KXHA 3ZLWA 3QFFA 3DB6A 1YW2A 4Z9LA 3F66A 2R3PA 5CU2A 4C33A 3RPSA 3KRWA 2E2BA 2QLQA 3K5HA 5BWVA 3A8XA 4H05A 3UVPA 4CRSA 5DOSA 3ZFYA 1NXKA 2X8IA 1L8TA 4YBJA 1WFCA 3I79A 4A9SA 5BUIA 5G6VA 2YYAA 3BA8A 4DQNA 4IWPA 5JVLA 3FMDA 3QUPA 3FZPA 3DTGA 2GFCA 4QTBA 4FFOA 4ZS0A 2WMUA 5C03A 3B8QA 2OZAA 4U43A 4YU2A 3H4JA 3IECA 3IO7A 2ITNA 3FKOA 2QO2A 4MK0A 5AUWA 4XRLA 3R23A 5I5VA 2BIYA 3EWHA 4PTEA 2X6DA 1M17A 2W1FA 1FPUA 4QDEA 2XK3A 2RFNA 3Q9ZA 4QMPA 5IH6A 4ZP5A 4DTBA 3SXRA 2HHFB 4Q5HA 2UW4A 1H0VA 3IDCA 4I6QA 4D2SA 3AW8A 4G3GA 5DT4A 4WNPA 2XRWA 4APCA 1J1CA 3LFQA 4X2FA 1XH7A 3OW4A 4G16A 3SHEA 4JX7A 4LV8A 2RFEA 4YMJA 5I9YA 3PVWA 4EBVA 4M97A 4QMTA 1H0WA 3DBFA 3N9XA 3PE2A 3REPA 2R3IA 1M2PA 1UWHA 2A0CX 4ORKA 5LVLA 5ANOA 3QQJA 3G8CA 3CIKA 3UNJA 3KAJA 2RG6A 3T7AA 5JVDF 3MTFA 3LXNA 3ZS5A 4BBMA 3UG1A 4HOKA 2VTPA 4C7TA 1CKPA 4HVDA 5J95A 5DPVA 1PHKA 5H3QA 4FEQA 3R02A 4YJTA 4O96A 3RMFA 3MH2A 2I80A 5KX8A 1F5QA 2W1IA 2O3PA 5LMKC 4LYNA 1KJJA 3O51A 2HVRA 3OEZA 3RAKA 3DV3A 2OKRA 4M68A 3HVCA 3LCKA 5CAOA 1YI4A 2YM6A 3I6UA 3LQ5A 4MXXA 5AV0A 4FUXA 4JRVA 2VX1A 2O65A 3G0EA 5DVRA 3ULZA 2BAQA 2WO6A 2R3HA 3LFAA 4MD7E 5DEYA 4ZOLF 4CFMA 1OIQA 2OFUA 1YHWA 3RPRA 4DEIA 5BV3A 1JKLA 2C0IA 3D5WA 4JOAA 4L67A 3CKXA 5FGKA 4UYAA 5HE3A 3TT0A 3E64A 5AP7A 1E4EB 3VBQA 4MV6A 1R0PA 1UU9A 2VWVA 4FKLA 5EQYA 4EQ5A 4GFGA 5IQAA 4X2JA 4U6RA 4M9UA 2YRXA 5G1XA 4ACDA 1YDSE 5LXTF 5I4NA 3FMNA 4E6CA 3EKKA 4JDHA 4KBKA 4EK6A 3DAKA 3MIYA 3COMA 3GFWA 4PL3A 2OIQA 5EHYA 4MXOA 1EH4A 1PW2A 2ZV7A 2B54A 2IO6A 4O7SA 3WIGA 1OKZA 4GUEA 4RJ7A 1IYEA 4HGTA 3DBEA 3I12A 4O4HF 2VGPA 2VX3A 3UNZA 4AFJA 1EKFA 4FK3A 5AX9A 2C5OA 4AZFA 2OFVA 3MBLA 3CGOA 1ZMUA 3QU0A 5HQ0A 2OI4X 1OUYA 2R3NA 4IAYA 2O5KA 5KZIA 3W0QA 4EQMA 1I2KA 4C4GA 2WTKB 4DHJA 3BWFA 3LQSA 2FPGB 5DNRA 5T3QA 4BRXA 3PRFA 2NRUA 4K0YA 4FJVA 4U5JA 1OPKA 3UC3A 1XBBA 2I0VA 2YEXA 1B6CB 3QQHA 4FI1A 2WAJA 3UDZA 5DMXA 4IX6A 3VUDA 5K3YA 5KMLA 1Q41A 5KMIA 3GFEA 5J9YA 1NVRA 2UVXA 3B2TA 5TO8A 4XEYA 4AE9A 2IZUA 3LCDA 4A9RA 3VPDA 2HY81 3U0GA 2XMYA 2QONA 3QWJA 4IDTA 4PWNA 2HZNA 3A7GA 4Y5QA 3S1HA 2HVSA 3NX8A 4XV2A 2Y9QA 5JFWA 4OTWA 5M08A 2XNGA 2SCUB 4U3ZA 2R7MA 4BTJA 1Q62A 3CJFA 3P9JA 5FM3A 4L7SA 2VTJA 2X0GA 4PMTA 2FB9A 3LJ2A 2YCRA 1XKKA 4FKJA 1WBWA 4L43A 4R7BA 2E9PA 5HNBA 2C5VA 4CVAA 1BKXA 4BDKA 3ORXA 4KBCA 3A2CA 3DPKA 2XK9A 1VJYA 4PUZA 4QMVA 4F65A 2F49A 5C27A 5HG8A 2VO0A 2ZB1A 2OJ9A 4J8NA 1V0OA 3DB8A 3QLFA 4WIHA 5C8MA 4EI4A 5AAEA 5JQGF 3ZSIA 4WHZA 3MTLA 5A4CA 4G6NA 5C4LA 2WXVA 3RR5A 2X0SA 3I6WA 2ITYA 3GOKA 4IVBA 4Y95A 4YJ3F 3PLAE 3LLTA 3QTUA 3LFNA 3W33A 5L2WA 4WNKA 2DIKA 3T9BA 1J91A 5BX0A 2RFSA 1Z2NX 4FFLA 1NT2A 4IZ5A 4JBPA 4QYEA 3TKHA 1M7NA 3AQVA 4FR4A 2W5AA 3ORZA 4LM5A 5EK7A 1YKRA 3TNPC 1Q3DA 3HDMA 5EG3A 5AV2A 1XHAA 3MJ2A 2W6NA 4KS8A 5EYCA 5C8NA 3NUNA 4YNOA 4XNEA 1OVEA 2VTRA 2Z02A 4LL0A 5KUPA 5LCKA 2YS6A 2B9JA 3KMUA 3C50A 3KXMA 4GFOA 4DGOA 2R64A 4DG3E 3T9FA 2I1MA 3UOJA 3PJ3A 1LP4A 5CU0A 5F20A 4ZXTA 4W4VA 3VJOA 2Z7RA 3V5TA 5J2UF 3E93A 2GPHA 4DEEA 4Y85A 1HCLA 2ZM4A 2H34A 5AADA 2PVJA 2X9FA 2XK8A 4MWIA 4XG9A 4MD9E 4JIAA 3VQHA 5C01A 3C4ZA 2ZDQA 3UZRA 2YIYA 3ZEWA 5HLNA 2HOGA 3K5VA 4AA0A 2A1HA 4QTDA 3ETJA 3R0TA 3FMLA 5F95A 4AOIA 4YGAA 3DNDA 4DAWA 4ZTSA 1Z5MA 2BR1A 4O4LF 4HNFA 3D7TA 3ROCA 1OKWA 1FMOE 3GENA 3A7IA 3U51A 4RWIA 1LEZA 5CF4A 3PUFC 4RIXA 3E8NA 3LJ0A 3HL7A 4U97A 1OITA 5FQDC 2W1CA 4JJRA 3S3IA 3JVRA 5ETFA 4DEBA 4MV9A 2J5FA 2XCHA 5HE2A 4O7NA 3KRJA 4O82A 1V1KA 1IA9A 2X7GA 3DTCA 3A4OX 3QFVA 4NFMA 3RK9A 4CFNA 1VBGA 4YLKA 1W82A 1NW1A 3KKVA 3RPYA 3TM0A 5KMKA 2IPXA 4XG8A 4FL2A 4PQNA 2GNGA 4QTEA 2C1BA 1OUKA 3E88A 4AZTA 4BHNA 2WKMA 3IKAA 3JZIA 2FO0A 2CNVA 3MFSA 4FV4A 5IA1A 1GAGA 4F1OA 3IW4A 3TV7A 2VN9A 4CC5A 3DXPA 4YC3A 4E5AX 2YZGA 2XUUA 4RQVA 1QPJA 4U80A 4YJUA 3HECA 4G34A 1B6SA 5BYAA 1QMZA 2HHFA 4CZUA 3VUKA 4X21A 2OK1A 2XIKA 2NO3A 4RFZA 4BJJB 4EZ7A 4FNZA 3ORMA 3KEXA 2WGJA 3RI1A 3ZM9A 5H8GA 4B6LA 4FKPA 4JS8A 4RFYA 4HZSA 3UO5A 3ORLA 4LOQA 5A14A 4C3FA 1H25A 2CPKE 3PPZA 5HG9A 3VULA 3R63A 4L8MA 1YWVA 3SG8A 2BRBA 1YDTE 3F5UA 4X3JA 3QQUA 4J98A 3MGYA 3FLNC 5E8VA 4FTNA 4PNIA 4DDIA 1OGYA 2J9GA 5M06A 4USDA 5BWTA 2I0EA 3FKNA 4J99A 2GS6A 5EW9A 4ASZA 5CEOA 5FXQA 2ZDGA 5D41A 3CD8A 3W0SA 3CBLA 1AD5A 4XG2A 2PWLA 2R7IA 3T9TA 2YA9A 5DRBA 1ZOEA 2QU5A 4ZSEA 5IUGA 2BMCA 4ZSLA 3N4VA 2JC6A 3QHRA 1M14A 2X7OA 4OLIA 3BEGA 5IA5A 3TXOA 3FC1X 4B9DA 3FMJA 4WG3A 4F4PA 4LGGA 3QXOA 3OTUA 4MV1A 4FICA 2XKCA 3IGOA 4GT5A 4BR3A 4TWNA 2W0JA 5CLPA 5CEQA 4MQ1A 4HNIA 4BCJA 5LCJA 4P4CA 3G6HA 4FIFA 1QCFA 3G15A 2HCKA 3O5AA 3UPZA 4ZZOA 2XZSA 2C6IA 4IB0A 3DBCA 3TIZA 2YIWA 1E4EA 3BWJA 1TA8A 3AXWA 3KYHC 4Q9ZA 4IHJF 4DFZE 2QOFA 4RGJA 3TZ8A 3POOA 4IBMA 4NW6A 1E9HA 2WTWA 4A4XA 4C59A 5HD4A 3C4FA 4RJ4A 5I9UA 1PJKA 2BDWA 3UQ8A 1SNXA 3JS2A 4QQ5A 2F4JA 4JAIA 2EXMA 4NZWB 2NYAA 4MXYA 4RT7A 4FZ6A 4O7WA 4PMSA 3VO3A 3WE8A 2Y4IC 5JQWA 3CE3A 1YOMA 4FTQA 2GQGA 4C5BA 1F3MC 3AKKA 3R7YA 4D1ZA 2CGXA 2Z04A 1H07A 3LE6A 4JIKA 3SAYA 3RFCA 1KJ8A 1U54A 2UZTA 5AA9A 2FUMA 2H96A 3R9OA 3BA9A 2GHGA 2R7BA 4E1ZA 2JEDA 2JD5A 1JPAA 4KUJA 5AP2A 1K9AA 3UOKA 4JG8A 4L6QA 3EZRA 4XBRA 1AUVA 4FT0A 3QQGA 3K3PA 1PXPA 3KRLA 3OS3A 4EH6A 2YIQA 3DK7A 4V04A 3DBQA 1UKHA 2PUIA 4P5ZA 3NUPA 2CJMA 4C35A 3I5NA 3R8LA 4QP2A 4QYHA 3PWDA 3U9CA 4DH5A 3N8DA 4AW5A 5LWMA 1Q3WA 5JGDA 4FVQA 4GG5A 2W1GA 1NVSA 4KKHA 4X6RA 2QR8A 3ENHA 1OKVA 3QRKA 4IIRA 3A7FA 2BFYA 5EI6A 2J0KA 4IDVA 4JBVA 3FYJX 1JDBB 1SVGA 2NRYA 3Q32A 4ZAUA 2C6OA 5AP6A 1JVPP 4XJ0A 3FMKA 1OI9A 4FZ7A 3UQGA 4L42A 4AZVA 3HMIA 2VQDA 3NUSA 4BF2A 1DI9A 5AUVA 1UU8A 3I81A 4O91A 4UUGA 4CFVA 3TL8A 3CSWA 2J0MB 2XH5A 3LMIA 3OD6X 4AA5A 3C51A 2QOHA 3GC7A 4PDYA 1OIRA 3WF5A 3Q5IA 5CF5A 1ZYJA 3HMPA 2WOUA 3WZUA 3NYVA 3TG1A 4BCNA 3DZOA 3H10A 3HNGA 4EK3A 2ETRA 4A4OA 3R9RA 3VRZA 3D83A 5HIEA 3QZGA 3FQSA 4JR7A 3D0EA 3N51A 3QKLA 2PMNX 4O6LA 2HXLA 3BL9A 3PVBA 4AT4A 4EH2A 4ZLYA 3PIXA 1A9UA 2UVZA 5CTPA 3FL5A 3WYXA 4P2KA 3OCSA 2OBJA 4E6NA 4CKBA 5IZFA 4AN9A 2C3LA 4DLIA 3HEGA 1G3NA 1ZARA 3A60A 4RZVA 2G1TA 2GNHA 2HWOA 1W93A 4U41A 3MDYA 2P55A 2ZYBA 4O38A 5ANJA 5BVNA 4UCTA 3PP0A 1GSAA 3HZTA 5FEDA 4AT3A 2YIRA 3ZSGA 2WMSA 5IISA 2R7NA 3E8DA 1KC7A 1H08A 3AD5A 3LFSA 2ACXA 3KVWA 3PTGA 4RC2A 2QR7A 3OCBA 2W4JA 4IIJF 4NIFB 3V5WA 3WI6A 1O6KA 1XWSA 3TDWA 4QP6A 4IAAA 4IVDA 4DFBA 1Q61A 2PE2A 2R4BA 4CMDA 3R00A 2YM4A 3UTOA 3TTIA 2JFLA 1UU3A 4GFMA 2ZMDA 4GVJA 4O21A 3VS5A 3ZHPC 4C58A 4RZQA 2OW3A 2ETMA 3C5UA 3D2KA 4L46A 4AAAA 3CTQA 2P4IA 5A4EA 4RIWB 3PZHA 3VNTA 2XJ1A 4XP0A 4OTRA 2B4SB 4ZY5A 2WYOA 4BDEA 3JSNA 2PUPA 3UO6A 5CM0A 5EDPA 1W0XC 5KNJA 2W1EA 4HCUA 4GVAA 3QZFA 3W2RA 4O86A 3SLSA 4GJ3A 4RVLA 1YXTA 4K6NA 3PDTA 4RLLA 5DBXA 2XNPA 2YWVA 5EQPA 3SGCA 5AAGA 3ORRA 5D11A 1SMHA 5AEPA 3BBTB 5B0XA 3VPCA 2VNWA 1B04A 3VW6A 4ZS4A 4PTCA 4RC4A 3D5UA 3AT2A 3W5OA 4O84A 4GKIA 3HMNA 2OZAB 4MBIA 5M53A 4DFXE 2YRWA 4BJJA 4D4VA 3NNXA 5EDRA 5F94A 1P8LA 4QRCA 3ENMA 5IF1A 1PXLA 4TUYF 1OL2A 4QDVA 1ST4A 5IEXA 4MD8E 3EQRA 1DAAA 1TKIA 5KMMA 5FPRA 3NUYA 2W9FB 2IW8A 2YWPA 3W0NA 2HG8A 2QLUA 4FEWA 4CMOA 4HR7A 4X3FC 3QA8A 4G2FA 4ASXA 4PTGA 4L44A 4EORA 4F70A 4UX9A 4O4JF 3MYGA 4DH3A 1VKZA 1URCA 3JSLA 4O7VA 4G3CA 4DHFA 2XK4A 5DE2A 5I5SA 3ODYX 5I5UA 5GIOE 3RV4A 1WBVA 2GQSA 4FIJA 4YUQA 3SVVA 3MPAA 4CMTA 3CGFA 2PVMA 2YAAA 3FHRA 3OBJA 4FKUA 4O7TA 2NPQA 1FGKA 5JGAA 3O0GA 3DKCA 3VS4A 2XNEA 3A4PA 5EYDA 3UFXB 4BDGA 1ZLTA 4Z3VA 4IX3A 2GPSA 5EM8A 5EHLA 3ZU7A 4DGMA 5CF6A 1R0EA 1GIIA 2BILB 4NFNA 3EH9A 1UWJA 3PE1A 4JBOA 3EJ1A 1GIHA 2QC6A 3K2LA 1ZXEA 2PMLX 3Q52A 3FQEA 5DLSA 3WO0A 4PV0A 3UYSA 3TN8A 4BZDA 3NGAA 5CU4A 4ZZNA 5F9EA 1FINA 4BCQA 5J9LA 3ANQA 4AA4A 2IG7A 2R9SA 1GSOA 2PN1A 5BPHA 4PDSA 1QPCA 3NZ0A 1JAMA 5T6KA 3VQUA 3JZFA 1ZY4A 4HN2A 3OF0A 3GVUA 5C1PA 3DXQA 2B53A 2CMWA 2J0IA 2QOOA 5TR6A 2A27A 3KB7A 4OTDA 1Q4LA 5J87A 3MSSA 4QMZA 3LP8A 4XX0B 5BVWA 3SC1A 1KJIA 1KE7A 2XKFA 4FV3A 4FL1A 4YHTA 4F78A 4DFNA 4EZ5A 1WBTA 3UG2A 3PFYA 3QA0A 4K11A 4DIMA 3JR1A 4YZBA 4UXLA 3BHVA 2C47A 3LXLA 5M57A 4N70A 3PY1A 3BLHA 1EYZA 3TZMA 3U9NA 1KJQA 3TEIA 3RP9A 3PJ8A 4EWHA 4IFGA 3PIYA 2WMAA 3DKGA 5FXSA 4QMUA 1UU7A 4DEGA 5JZJA 2C0TA 3GU4A 5IQCA 3GJXB 2UZWE 4I4EA 5HI2A 3A62A 4OR5A 3DAJA 4A7CA 4FFPA 1H1QA 3CP9A 4CT1A 3TUDA 3TNHA 5KKRB 2VTHA 3GOPA 2VV9A 2RL5A 3HMOA 4C2WA 5KO1A 4FIGA 5H8EA 2F7EE 3BLQA 4NCTA 5CVFA 2YJSA 4AG8A 2C3JA 3SV0A 3CY3A 2JGZA 3ZCLA 1CKNB 3CTJA 3D15A 1FGIA 3LCTA 3A99A 5ETIA 3D2IA 3UIXA 3IONA 5AUYA 4C36A 4YTFA 3EQGA 4YZ9A 4GLWA 3DJ6A 3E92A 5DGZA 1GZ8A 5IA4A 2EIYA 3L2PA 2EWAA 1KE6A 2JKKA 4CFWA 3LMHA 2H9VA 2C3KA 4XYFA 4HW7A 3MH1A 3V8TA