3KREA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase from ehrlichia chaffeensis at 1.8a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
237
structure length
237
Chain Sequence
EKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKKLIDKGIKTHFISLLNQREQLVKKITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEFYYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILSELFFNVGIKLVDFKLEFGKLHNDEQSDLFLADEISPDTCRLWDISTNKRLDKDRYRLNLGNVIEGYREVAHKLNAIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase from Ehrlichia chaffeensis at 1.8A resolution
rcsb
source organism Ehrlichia chaffeensis str. arkansas
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 82
structure length 237
sequence length 237
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2009-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kreA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kreA02
4CMTA 3D5VA 2X6EA 2C3JA 4LYNA 4BCFA 2R84A 3LQ5A 3PLAE 2QHMA 2WU6A 4CFWA 4FVPA 1DV2A 2FB8A 5A9UA 5IEXA 4ANLA 2PYWA 3TQTA 4CMUA 5CF5A 5DLSA 3QGYA 3BX5A 1XBCA 4UALA 5M4IA 4L9IA 2BFXA 3ZUVA 2YFXA 1FPUA 2REIA 2XK4A 3ZO2A 4FKRA 2JITA 4U44A 4AN9A 4EK5A 3NUPA 1W82A 3UJGA 3OW3A 4RC4A 2R3GA 3LM0A 3H3CA 4FV0A 2GNIA 3ZOSA 3KQ7A 2G2IA 4TYHA 4EG0A 2BZHB 2V55A 4IX4A 3W1FA 3DLZA 3WF9A 2R64A 5FDPA 4MWIA 5LWMA 4CKIA 4OUCA 3D5UA 4EL9A 2VTMA 4Y85A 4I21A 5E90A 2NUAB 5JH7F 4KINA 4ZTNA 5CQWA 5FTQA 4ANMA 1M6VA 5DYJA 1H07A 3SQQA 3Q5IA 3LFCA 3PIXA 5AUXA 4DGMA 4RVLA 4FKSA 3KEXA 3PXYA 4IADA 3HRBA 3CE3A 4MD8E 3QC9A 4GK2A 3FDNA 4FIHA 4DG0E 4O91A 4IDVA 4O0TA 1AQ1A 3WZJA 5KKRC 5LOHA 3PE1A 4UY9A 4CVAA 4LGGA 4RX8A 5ETAA 5FBOA 4IE9A 5EQPA 5FXQA 4ZMEA 1G8AA 4U42A 5L8LA 2UW7A 4HCTA 4JG8A 2B1PA 4E6CA 3OHTA 4FGRA 5IQEA 3PUPA 3DK7A 2W1HA 1H1RA 5KMKA 4IB0A 3ORRA 4AXAA 2C1AA 4MQ2A 4EH3A 2YZNA 3VJNA 4LOPA 3GNIB 2A2AA 4CKJA 3OZ6A 2R2PA 3ACJA 3ATSA 2WMBA 1IOWA 5ANDA 4W8DA 5CXHA 1WVYA 4YZBA 2OG8A 3BEAA 3ORQA 4S31A 5L3AA 4DIMA 3IDPA 3RWQA 4GK3A 3E5NA 1ND4A 4PV0A 4Q9ZA 1QMZA 4J8NA 4AG8A 3MWDA 4HPUE 2HY81 2B54A 2PVJA 2W7XA 3A8XA 5M4CA 4CV9A 4JIKA 3ATTA 3CLYA 4FT3A 4ZTRA 4D0WA 5A4CA 2UZVA 5HTCA 2J9MA 4WUNA 3V4SA 2JAVA 3C4ZA 2C5NA 3LFFA 2YDKA 4KKEA 2UZUE 5IA5A 4XHKB 2Z7SA 3BELA 3HV6A 4HPTE 4EUTA 3BU3A 5C1QB 5I5ZA 2YIRA 3UIXA 3AMBA 4XV3A 3FZOA 3TIGA 4IB3A 2VTLA 3NIZA 3KRWA 1TQMA 4GRBA 3RM7A 2C30A 4EWHA 3Q2MA 3R9DA 5EZYF 5IDPA 3MGYA 3OOGA 4BZDA 3FPMA 5B7VA 2VWBA 4A9UA 4E6AA 2CPKE 3MN3A 1MUOA 4TYGA 3F3UA 3I1AA 4E4LA 2OGVA 5HBEA 3ZZWA 4FTUA 5FEEA 2W9ZB 1W0XC 2V7OA 3HV4A 3JRWA 3WE8A 3ZUUA 3QX4A 3G90X 3EMGA 2HXLA 3AD5A 3ITZA 3QTWA 4F9WA 4PNKA 3PJ8A 3QX2A 4MNEA 4XNEA 3WZDA 3ETHA 5CU0A 4XZ3B 3OCBA 2DWCA 4ACGA 2UZNA 2YRWA 5EW9A 4P2KA 4QMTA 3NYNA 4GG7A 3A60A 3E93A 2Y6MA 3GC8A 1YKRA 4LI5A 2OO8X 5M4FA 4I5MA 4MXOA 4EOLA 4AAAA 4X21A 3D2IA 4FKWA 3PDTA 3PJ2A 5E1EA 3TCPA 5EYKA 3SXRA 3R8VA 3TDWA 4I4TF 5M51A 3TTIA 2R82A 3ORNA 5BMMA 2NU7B 5DVRA 4AOIA 4FG7A 3Q4UA 5EM5A 3OXZA 2C6MA 2GNHA 3HRCA 4O0UA 3BRBA 1QPEA 3U4UA 4LRKA 3FC2A 5BVNA 3VS1A 4YLJA 5IA1A 2XNEA 2WMAA 3BHVA 1REKA 2WAJA 3CPCA 4FKOA 4IZYA 4OR5A 3VA7A 4C4FA 2OIBA 1GZKA 4BIEA 3TZ7A 3OEZA 5AMNA 5EKOA 5D7AA 2H8HA 4UEUA 2V58A 4N4SA 4O86A 3ZRKA 4JG7A 3F7ZA 1OL7A 2GSFA 3G6GA 3SA0A 3RV3A 2FUMA 4FEWA 3DGKA 3OCSA 5CT0A 3R5HA 2PHKA 4XYMB 4BYJA 4CQEA 2C0TA 4HNUA 2YAKA 3HB9A 4ZY4A 5AUVA 3F5GA 3VS3A 1YDRE 3QRKA 2GHMA 4WBOA 3RGFA 4JIAA 4FR4A 2OJJA 5IQBA 2R7IA 3NYVA 4TTHB 1ERKA 1PXOA 2DS1A 3BU6A 5CLPA 3LZBA 3UNKA 1Z2PX 4DFXE 2BCJA 4BBEA 3LCOA 1BI8A 3VBXA 4DCAA 2IJMA 2PVHA 5CVFA 4YGAA 3ZC5A 4H3PA 4F6SA 5JFVA 2Y7JA 3BI6A 3EIDA 4JG6A 3HRFA 4FT0A 1XO2B 4J97A 4P5ZA 4QPSA 5CI7A 3ZSGA 4R1YA 3AT3A 4MA0A 3C4XA 3DBCA 3NAXA 4BDAA 4R78A 2ETRA 3U87A 1ZMVA 3C0GA 3DAKA 3QLGA 4MV1A 1NA7A 5JQWA 3P7BA 2QODA 1VZOA 2R4BA 3MI9A 4U80A 5IH5A 4NTTA 5CVHA 5M4UA 4RA5A 1T46A 3FMEA 5JZJA 4KA3A 4EYJA 5JRSA 2OI4X 4WNPA 3EWHA 3PJCA 5LCJA 3QZHA 4LMNA 3R1YA 4KSQA 1OB3A 1WBSA 5C26A 5CANA 2HOGA 4FEUA 4JQ7A 3BYMA 4PMSA 4X6RA 4FEVA 4QYEA 2PBZA 4M15A 3LFEA 4B0GA 4MBIA 5KO1A 4L68A 4O7YA 3FPQA 2R0IA 4JS8A 4JVGA 3ENMA 2IZUA 2PPQA 4FC0A 2ITPA 4EHEA 3FEGA 3U8WA 3C1XA 3L9MA 3T3VA 4O2AF 2V7AA 4OBPA 4U5JA 4HVHA 4KUJA 1JSVA 3MH3A 4DE4A 2OIDA 5J1WA 4F9AA 2UW8A 2PVFA 5HNBA 5C8MA 4E26A 1XH5A 4FNYA 4AZEA 5KBQA 5C1OA 1BL7A 2JDTA 4O0XA 2C47A 3BYOA 3VBQA 1P5EA 4IFGA 3FZ1A 2QOCA 5J87A 4I50F 3CD3A 4AGUA 3ZH8A 4ZSGA 3I12A 3FI8A 5DH3A 1W7HA 3OMVA 3VJOA 5L8KA 3R8LA 3UZPA 2JDSA 1HOWA 4Q5HA 4QYHA 5EQYA 2GPWA 4IWQA 4I92A 3FC1X 4QMLA 5AM6A 4DEGA 4CRLA 2HAKA 4D4RA 4D9UA 4EOPA 1IRKA 1M2RA 1EUDB 4QMXA 3T9TA 2CKEA 1PF8A 2QO9A 3VQHA 1DM2A 4MD9E 4O4LF 4R77A 5J5SA 2X6DA 4YNEA 3GGFA 3K5IA 4KRCA 4RGJA 2VWUA 3GC9A 4O7ZA 3KRXA 4FTNA 5FEDA 5AX3A 2WHBA 3DNDA 4YC3A 1M14A 3Q9YA 4PP9A 3OT3A 3OVVA 3BEGA 2XP2A 4FT5A 3R8MA 3VS0A 3F3VA 3AMYA 4YP8A 4YHTA 3SOCA 4U6RA 3Q9ZA 3EHAA 3FZSA 2IG7A 4E7WA 4FSUA 3KULB 4WT6A 4FV1A 4LRMA 2LAVA 4FIJA 4HOKA 2CGWA 1Q3WA 2UZDA 2VO6A 4YB8B 2CN5A 3AC2A 2QF7A 4MV8A 3TXOA 3KMMA 3HUCA 4LG4A 2XK6A 2I87A 2DYLA 3AC5A 4DC2A 5JGAA 2R7MA 1PMVA 3LJ0A 4FL1A 4FV8A 2PZRA 5CI6A 4AW5A 4KNBA 3FKLA 4RWKA 4ZZOA 5IZFA 4LQMA 2UVZA 3ETJA 2BILB 3FI2A 4BVUA 4F1TA 1E4EA 5EYMA 3TNWA 5IQGA 2YS6A 3O8UA 1O6KA 3RK9A 2E9VA 4D1ZA 3MB6A 1PMEA 3OROA 4MNFA 1BMKA 2VTAA 4GV1A 3EH9A 3PA3A 4FKIA 3F82A 5EDQA 3T3UA 2ZAZA 4YHFA 5M07A 4AE6A 1ZY5A 4CFNA 2XBJA 4FIIA 4KKHA 4FSYA 4FX3A 5ACBC 3W55A 1RE8A 2DIKA 3EFJA 1JAMA 2Z8CA 1OIUA 4IB1A 2R3FA 2OICA 3K5VA 4EQUA 3EQGA 5D12A 4O7LA 4HQ6A 5FNVF 2W1EA 5A4TA 1I7LA 4FV7A 2Z2WA 3VPBA 1J1BA 4JDJA 2C6DA 4OTFA 2JLDA 2X0SA 3K3PA 4FV9A 5CF4A 2W1IA 2C3KA 5J7HA 3G8DA 2I7QA 4EGQA 1UA2A 4YO4A 4GW8A 1BL6A 2C6TA 3Q6WA 4TPTA 1OZ1A 3Q60A 3O0GA 4L3LA 4DF3A 2ETKA 3RAWA 5HVJA 4AZTA 5I0BA 3UPZA 1KWPA 3RFCA 4C2VA 3DZOA 4GS6A 4TYHB 2H6DA 5ANIA 1V0OA 2Q0NA 3KXGA 3NUSA 3HUBA 2UV2A 4MD7E 3VWAA 1MQBA 4R5SA 4BCQA 5FXRA 2XIXA 3QF9A 4BDBA 5DT3A 4O7WA 4BI1A 3DZQA 3MH1A 2J4ZA 3O7LD 5AAFA 2R7BA 4F7JA 5H80A 4FV5A 4AT4A 3OBGA 4ZI7F 5C1PA 3AC4A 2JAMA 4YMJA 3EJ1A 3DS6A 2OF4A 2ITTA 4E4MA 5HCZA 4AZSA 2FA2A 4MXXA 4ZS4A 3D4QA 3RTPA 2W70A 4YAKB 2QQ7A 5B0XA 2VNWA 1Y8YA 1JLUE 4IM0A 3I60A 3BHTA 2GNFA 2J0LA 4OGRA 4AWIA 4C2WA 4R3PA 4M12A 4A9SA 1WBOA 5CA0F 5J9ZA 3WO0A 4C4HA 3ACKA 4DFBA 3W2OA 4G3CA 3VO3A 4B8LA 2R3MA 2YA9A 3FXZA 5HG5A 1H1SA 4YJSA 4AZWA 2VTQA 3ULIA 4IHPA 4I41A 5HD7A 4CXAA 3D94A 4M7IA 3P5KA 2VTRA 5C03A 3Q04A 5HIDA 3ERKA 4EOJA 3GCVA 2WIPA 3QQJA 4G9CA 4X2GA 4DGGA 3GUBA 2JBOA 2ONLA 1WMKA 2W5BA 3UIBA 2VD5A 3F7WA 2HELA 1KV2A 3FMMA 2IW6A 2VAGA 4BTJA 4FFNA 5HV6A 3OBJA 1ZOGA 1UU9A 3OW4A 3ZC6A 5FP6A 5CS6A 2IW9A 2JIIA 3CP9A 4H1JA 3AMAA 4TT7A 1OKVA 4F7LA 2ACXA 2PMOX 3R02A 3PG3A 4HGEA 2X4ZA 4IX6A 2RFNA 3WF7A 4KB8A 4I94A 4YSJA 1H1QA 4I23A 5B2KA 3SKCA 2ONLC 4F09A 1PXKA 5JQ8A 4IBMA 5L8JA 2XCHA 3VRZA 3MVHA 4EH6A 4X6QC 3MPAA 1ZOEA 5H3QA 4BCOA 2R86A 2FSOX 2DZDA 4WD5A 4B6LA 2OZAB 1KJIA 3VULA 4GU9A 2VR1A 1KE6A 2ESMA 1UWHA 4F65A 4BCHA 1U4DA 4IZAA 5AP4A 4O84A 1H26A 3QYWA 4O0VA 3CSVA 2CGXA 2XRUA 4QMZA 4EK4A 1UNGA 2VTJA 3NCGA 4S32A 4BCGA 3HP5A 3EQHA 2VZ6A 5GJFA 1XKKA 2R87A 2UZEA 1SMHA 2VWYA 4D2SA 2ZDGA 4ZY6A 3JUHA 2HGSA 2PZYA 4N6YA 4RRVA 1CKJA 5LWNA 3DKFA 2XCLA 4FBXA 1YXXA 1CQJB 2YDIA 3FY2A 2W6MA 1WBWA 3EN7A 1OM1A 3TT0A 4WA9A 1WVWA 3DKCA 3FXXA 3ALNA 3KXMA 2YM6A 3NEWA 2WQNA 3CY2A 2JEDA 5LOVF 3L9PA 1W98A 2XYUA 3UOJA 2P0CA 3FL5A 4O27B 2UVXA 3DTWA 2WTDA 1MQ4A 1OL5A 1W96A 3U51A 5HNIX 4L00A 1A9UA 3HMNA 3HLLA 2P2HA 4Y72A 4U97A 4JDHA 4OTQA 4RC2A 3UO4A 1B39A 4PQNA 5KMJA 3JPVA 1XWSA 4ACDA 4IACA 4B7TA 3ENHA 3ET7A 3Q9WA 3F3ZA 1QPCA 3U9NA 4Y5HA 5C27A 1PHKA 3EN4A 2E9OA 2VGPA 3LMGA 3R1SA 5DEWA 2QD9A 3WZUA 4BCPA 4XUFA 2F57A 3FQSA 3CBLA 3IDBA 3KULA 3NUXA 4JDKA 4MH7A 3OTUA 3V51A 3WILA 1JDBB 1SM2A 3OWLA 4WOVA 5CU4A 4O4HF 4BI0A 2KTYA 1LEZA 3IW7A 3TNPC 3PY3A 2EB3A 3DBEA 1ZXEA 1UNHA 4DYMA 4ACMA 2JD5A 3QAME 4RBLA 3ZFXA 2P4IA 4A9RA 1E1VA 4YZNA 4TV9F 2YZMA 4UB7A 5ETCA 3VS5A 3IONA 3WF6A 5C4KA 3V6RA 3R7OA 2G15A 2W5HA 4FV4A 1BI7A 4QT1A 4QTAA 4YZDA 3QQFA 4O6LA 3FLWA 2BROA 4CCUA 3A61A 4DFLA 3G9NA 4DTAA 4QNAA 3F5XA 5JFXA 2UW6A 3R7IA 4MNEB 3R9OA 3NR9A 4RZQA 4KAOA 5CY3A 5AUZA 3BQRA 3KRJA 3NUAA 3RAIA 4JBVA 4IIRA 4E6DA 3OP5A 3C4FA 4PMMA 3E92A 4RMZA 4RVMA 4S2ZA 5LP6F 3OTVA 4EK8A 1FGIA 2C6IA 3TKIA 5HVKA 4F6UA 2PTKA 3PA5A 1KUTA 2F7EE 2Q83A 3GOKA 3FZTA 1GNGA 5CA1F 3C0HA 4EC8A 3IQ7A 3TV4A 1J7UA 1TQIA 4AACA 5I9XA 5DOSA 3FBVA 2X8IA 3HECA 2J0JA 4ERWA 1XR1A 2WFYA 2JFMA 4QMSA 5FDXA 5JKGA 3AW8A 1VR2A 3TI1A 3RJCA 4JRVA 4FTKA 2HCKA 4CGAA 4O0RA 3O50A 3A7IA 4O82A 1YHSA 2CDZA 4RG0A 5KX8A 1NXKA 1A06A 3VHEA 4E5WA 1YQJA 3DKGA 4OLIA 3UIUA 2X2KA 1VBGA 3TNHA 2J90A 5HG9A 2XK8A 1FINA 3DY7A 3SV0A 4DBXA 4DG3E 3FLSA 2OU7A 3MTFA 1JKLA 2LGCA 2QR7A 5FXSA 4GEOA 5BNJA 3MJFA 2JDVA 3RP9A 1JKSA 3E8DA 4FOCA 2JIUA 3N9XA 1KE7A 3FKOA 2Q0BA 4BB4A 3RINA 3EQCA 2XNOA 4G5PA 4DEEA 2OJFE 4GUBA 5CAEB 4FZFB 3H9FA 2WGJA 2W06A 5AIKA 2JKKA 3PP1A 4RIYA 2X81A 4B9DA 4EOSA 1F3MC 3NW5A 5T6KA 1YXVA 3TUDA 4IJPA 3GU8A 3A7HA 3B2TA 2CNQA 4FNZA 4J96A 5A14A 4UV0A 5ACKA 3MYGA 1SNXA 3I7CA 1KJJA 4JLCA 3P08A 2VTTA 2OW3A 3OC1A 4IAZA 5AP2A 4DEDA 5JQ5A 2R3QA 5KZIA 4YJQA 3E5AA 5DN3A 3C4CA 5DT4A 3I4BA 4QMWA 1PY5A 1RQQA 3AGLA 4GVJA 2VO7A 3EOCA 1MRUA 1SVGA 2GMXA 4QP3A 3QTXA 3CXWA 1CSNA 1P2AA 3U6IA 3P86A 3OFMA 4TL0A 5FM3A 2R3IA 2JGZA 3POZA 4UYNA 2VO3A 4ZAUA 2WNTA 3DQXA 4ZQIA 4A06A 4PL3A 4MKCA 5CSWA 4C62A 4FNWA 4OTGA 1FGKA 4ZP5A 5BPHA 4RX9A 3FLYA 3ZSHA 4G9RA 4ENYA 3LPBA 5LMKC 1KBLA 1WCCA 3UMWA 1TVOA 4X3JA 2C0IA 3PY0A 5FM2A 5FGKA 2GPSA 1P4OA 2PSQA 3R9HA 2WYOA 4JXFA 4GG5A 3V5LA 4DFZE 3BHHA 2RG5A 4YTFA 5K4IA 4FTOA 4P7EA 3VS4A 2UZLA 3FKNA 1UVRA 2C6KA 3R73A 4ZJVA 4E5AX 5CZHA 4J1RA 1O6LA 4NW5A 4EOMA 3V5TA 4MV4A 2Y6OA 2XNMA 4BCKA 4CNHA 4L53A 3VUIA 4EGJA 5HCYA 4P90A 4MAOA 3W32A 5KNJA 2WMSA 1YW2A 5HBHA 5LVOA 1JLLB 3JZIA 1EH4A 4J71A 5M44A 5DFPA 4ZXTA 4DEIA 2VWZA 4EEVA 4L46A 5CSHA 2F49A 5IQCA 2YM5A 3PSBA 4DBNA 3GENA 4E73A 2X9EA 1CS0A 3GU6A 4U43A 4R7HA 1MRVA 4IM3A 5FD2A 3AQVA 4L42A 3KGAA 4N6ZA 4FEXA 2F2UA 4HNTA 1YI3A 1PXLA 5F95A 4IWDA 2RFDA 4XRJA 5M55A 4MA5A 1KJ8A 2QURA 4NW6A 1QPJA 1ZZ2A 3ORMA 4GMYA 3CJFA 4YO6A 5BVEA 3VS2A 4Z7HA 5M09A 3I7BA 2VTPA 3ORLA 5F20A 3HBLA 4XG8A 4JT3A 3COHA 4UZHA 4J53A 3GLKA 3MA6A 4R3RA 3MESA 1T45A 3LW0A 3PPKA 4G3FA 2CKQA 1H27A 1KSWA 2FSLX 5EM6A 3KREA 3VUHA 4HR7A 2GDOA 3WE4A 1G3NA 1OPJA 3SE7A 3WIKA 3L1SA 3SG8A 2ITOA 4AA5A 5DPVA 4YTHA 3LQ3A 2QOHA 3QRJA 4L7FA 4ANSA 4F7NA 2PVYA 4PDPA 5GJDA 3R7VA 2YN8A 2BKZA 2WQMA 2VTIA 4FTLA 4D4VA 1PW2A 4YTCA 4ACHA 2NU9B 2CHLA 2WXVA 4I1ZA 2OZAA 3P78A 4M8TA 4RWJA 3F2NA 1XJDA 4ZTLA 2HW7A 3S2PA 2YM8A 4ITIA 3GB2A 4IVAA 4IWPA 5L2TA 4RA4A 2PUUA 4XX9A 4FT9A 2A0CX 3PFQA 3BCEA 2IN6A 3ZCLA 4DCEA 3TINA 1YRPA 1Z5MA 5TR6A 2YRXA 3V5WA 5BQ0A 3OOMA 2V62A 3OY3A 4XYFA 3ZRLA 5AV4A 4TNBA 5ETFA 4I6HA 4K2RA 1WZYA 2F4JA 4UBAA 2X7GA 3UGCA 3ZU7A 2C4GA 2J0MB 4K11A 3ZONA 4YURA 1Z9XA 4ZLZA 5IDNA 4IAYA 1JSTA 3BGPA 2XK9A 2GQSA 3NLBA 4GKHA 4TYJA 4N0SA 4XG6A 3P7CA 4FFLA 5ANKA 1H00A 3F66A 2PE2A 4ENXA 3FSFA 1Q8YA 5M56A 2B4SB 2P55A 2YWPA 4RJ6A 4C37A 3FMHA 3L8SA 3KRRA 5CENA 5GHVA 3R5XA 4FZ7A 4Q9SA 5LVPA 5L2WA 5BMVF 1CDKA 3IGOA 4MXAA 3PWDA 4X3FA 3VHKA 4NM0A 1K2PA 2J0KA 5JRQA 1O9UA 4IMYA 4U9AA 1YOLA 3ORTA 3R01A 3JVSA 5HU3A 4XEYA 1YHWA 3RAHA 5EI2A 5KKNB 5DBXA 1KEEA 2OH4A 2YM7A 5D7VA 3PG1A 2BUJA 3GXLA 2C1BA 3FL4A 5EYDA 3OXTA 5A6OA 2PMLX 4ERKA 5CEOA 3R9NA 3QUEA 5LXTF 1ZMUA 3HMIA 2YAAA 3F69A 5IA0A 5GIOE 3F88A 2NU6B 4FUYA 3D14A 3U9SA 4GYIA 4V05A 4DFNA 4Q5EA 2YITA 4HNFA 4I5CA 2EUFB 2ZM1A 4L3PA 3ZDIA 2FB9A 4O6EA 4FFRA 4G34A 2E2BA 3VOTA 4FU0A 4NJDA 3TIYA 3R8UA 3SC1A 2WPAA 4WBBB 5IH4A 5EK7A 3VBVA 4L7SA 2UW3A 3QUDA 4BDEA 2X2MA 4JQ8A 3GC7A 4Y46A 3P7AA 3MB7A 4BCNA 4EH9A 2X0GA 3PXQA 3EFLA 3H4JA 4IH8A 2G01A 3DNEA 3MSSA 4F99A 3NGAA 4IAAA 3W2CA 5J9YA 3TJDA 4FSTA 4ZTSA 4ME6A 4FSQA 4N57A 3SOAA 3SRVA 2SCUB 4RIXB 4TY1A 3SX9A 5DR9A 4W4WA 3RVGA 4L52A 3RWPA 4NKAA 4FA2A 2O65A 4ZOLF 4O2PA 4OBQA 4EBVA 4BBMA 2YM4A 3GCQA 1FBNA 4BZNA 3BG5A 3JRXA 3KRLA 2Y4IC 4QNYA 4TWPA 4Y95A 5BPYA 5JFSA 5C8YF 3QKMA 1R78A 4I55F 3P4KA 4ZTQA 3UVRA 5CU2A 2QNJA 4D4YA 2G2FA 4NCTA 4J52A 3TZMA 2WKMA 4DH1A 3LVPA 2PMNX 3BIZA 3AD4A 3GI3A 4DTBA 3NNUA 4H36A 2FGIA 5G6VA 2HW6A 3PVUA 4WUAA 3W2SA 3D83A 5TKDA 5GNKA 2X8DA 4C34A 2W6ZA 4QO9A 4MXCA 4F9YA 3R2YA 4WKQA 2EVAA 3QKKA 3QQHA 2W4OA 5GJGA 3ZBXA 2EXCX 4KBCA 5G1XA 1ZYCA 5IUIA 3M1SA 1Y91A 4FV3A 5AJQA 1WR2A 2R3RA 3V04A 4MTAA 4F1MA 2IPXA 4ITHA 2HWPA 3QC4A 4XBUA 2RKUA 2ZMDA 4M14A 3ZBFA 3ZLYA 1Z2OX 4RFMA 4D0XA 3ORIA 4ZTHA 4U0IA 5M57A 2ITXA 4Q2AA 4CCBA 1G5SA 4RX7A 5EI8A 4M13A 4RJ3A 3SGCA 2F7ZE 4F6WA 5LMKA 1URWA 2V22A 5GINE 3FUPA 1E4EB 4YBZB 3LM5A 3R1NA 3ZFYA 3FHIA 4HVSA 4FVQA 4RQKA 5CYIA 4ZJJA 2YISA 5A54A 5KHXA 5HICA 4GCJA 3RMFA 3VC4A 2W9FB 3QU0A 2B53A 4BDGA 5CF6A 2E9PA 4E4NA 1OBGA 4FL2A 3BZ3A 3MVJA 1OIRA 5DIAA 1Q8UA 2O2UA 4Z55A 3WF5A 3C7QA 5HE1A 3O8PA 1CTPE 2GNJA 2X7FA 2EWAA 3UP7A 2ZDUA 3JYAA 5IU2A 4O2ZA 4YJPA 2VWWA 4D9TA 4QQCA 3TJCA 2WELA 2WTCA 3UO5A 1OKYA 2C0OA 2CGUA 2J0IA 3RPYA 4QMNA 5FP5A 3SDJA 1Y6AA 3COIA 4QTCA 4TN6A 3R7UA 4RIOA 1HCKA 1UKIA 5F1ZA 3KN6A 4H05A 4RT7A 4DH8A 3AT2A 2YABA 4EI4A 2C00A 3IW8A 2IP4A 3FZRA 1JSUA 3LFQA 3MY1A 2E9UA 3EQPA 3DOGA 5CT7A 2XYNA 2CMWA 3GOPA 4NFMA 2XKCA 3IW5A 4BDKA 5CNNA 2VX1A 3DDQA 5BVOA 5I9ZA 4AUAA 1PRYA 1Q8TA 4EK3A 3QYZA 3AXWA 5C8NA 2ZV9A 2FH9A 4K9YA 4A9TA 2FPGB 4RFZA 4YU2A 4AE9A 1YWRA 2GQRA 2YW2A 3MTLA 3OWPA 2YACA 3F61A 4KS8A 4TKSA 5DRBA 3QFVA 3R83A 5IA4A 1H4LA 1KE9A 2FSMX 3UYTA 5CEPA 4CFXA 2R3OA 3QUPA 4FODA 3CKWA 5FEQA 1Q4LA 1XH7A 4FGBA 2C6OA 3FLNC 5CVGA 4MV7A 4FSZA 2NP8A 3E8NA 2I40A 3UOHA 2WQOA 4CSVA 4GIHA 2I0EA 4NM3A 3NWWA 5EM8A 4IM2A 4PL4A 4II5A 1PK8A 4FIFA 3KU2A 3CTHA 3JY0A 4I4FA 1FVRA 1OKZA 4CTCA 1H8FA 3H30A 3IKAA 4GJ3A 4ASXA 3U6JA 3RV4A 1CKIA 3NDMA 3UP2A 2WOUA 4PDYA 2W1DA 5CTPA 3QTUA 2YIWA 4EBWA 4TZRA 2ZDQA 4MK0A 5CZIA 2OZOA 2JKOA 3NMUF 3S4QA 1AUXA 3K5HA 3VUKA 3UOLA 3UC3A 1JNKA 4O7VA 4AA4A 1KV1A 3VRYA 3EQFA 3VW6A 4NH1A 4F70A 3KKVA 2QCSA 3QWJA 3CQUA 3LFAA 1W93A 4NIFB 1AD5A 3FE3A 4MYGA 3WO1A 5LQFA 1GZOA 5IPJA 2BPMA 3E64A 3N4TA 3JXWA 1W84A 3GVUA 4NJ3A 2E9NA 1GAGA 4X7QA 4QYFA 4YJTA 4PTGA 2J5EA 1P4FA 2BRHA 3DU8A 3A7JA 3QZFA 3H9RA 3AT4A 2OLCA 3QCSA 5JVDF 3W33A 1ULZA 3RHKA 2G2HA 2OF2A 3D2KA 3NUUA 3UMXA 2H9VA 4GH2A 3TDVA 4AOTA 1LR4A 5AP3A 4BTMA 2O5KA 5HLNA 3GU4A 5IUHA 1U5RA 1E9HA 4E4TA 5T68A 1OL6A 1R1WA 4G6OA 5CSVA 3BE2A 3MFUA 4JAJA 5DI1A 5HG8A 3V8SA 4S30A 1ZARA 3MA3A 2XD4A 4M0ZA 3II5A 4L6QA 4RJ7A 5M53A 4Y5QA 4C38A 4TRLA 3UQCA 3DT1A 2BRGA 1IG1A 3JY9A 5HI2A 5KMMA 2VTHA 2WU7A 2GHGA 3DXPA 3I5NA 1QL6A 4RWLA 3B8QA 5HTBA 2O0UA 3F6XA 4QPAA 4TWCA 4G2FA 3OD6X 3PTGA 2VWXA 2WD1A 3FYKX 4TWNA 3F5UA 3QTSA 4YC8A 4KKGA 5A46A 2VQDA 5IQIA 3FI3A 4D2RA 3W16A 4RC3A 4IAKA 4LFIA 4JJRA 3E7VA 4ZZMA 4J7BA 1JWHA 3NNWA 4FMQA 4RVTA 5JGBA 3R7YA 2QU5A 1ATPE 3LFDA 4AS0A 5IUGA 4XLIA 1R3CA 3GEQA 2BMCA 2WMWA 4U45A 3Q3BA 2BIKB 3EQIA 4RZWA 3WYYA 4OTRA 3E62A 4FEQA 2BRBA 2YJRA 2WMUA 3DKOA 4EJNA 4R3CA 3K2LA 2XF0A 4L45A 3IG7A 4L44A 5CX9A 4IIJF 3D7ZA 3FMLA 2I0VA 1ZWSA 5CSPA 4NM7A 3NX8A 2XB7A 4EC9A 1LEWA 4FSRA 4F0FA 5D1JA 1JDEA 2R3KA 4YBKA 2PMIA 3G6HA 4NU1A 4O7RA 4AGWA 4IB5A 4S34A 5HVYA 4F0GA 1C30A 2OXYA 3D7TB 1YXUA 3UNJA 2QOIA 3ZTXA 4IZOA 3Q2OA 4F08A 2OXDA 3PJ3A 3RZBA 4CFFA 4AT5A 2P2IA 2QC6A 4GFMA 5ANEA 4FKPA 4QQTA 2Z7QA 3P79A 4WG4A 1SNUA 2XJ2A 3F3TA 5CU6A 3COKA 5BYLA 1B6RA 3DF7A 2VTOA 2CCHA 4YJNA 1GZNA 3F5PA 1FVTA 2V5AA 3EZVA 2VN9A 4XV1A 4CLIA 4IFCA 5AV0A 2ZM3A 3QCYA 2YCFA 2IZSA 4XOYA 3FLZA 1UWJA 3FMJA 4YLKA 2YYAA 5A4QA 3RPOA 5L6PA 3R8ZA 3WARA 3POOA 3DAJA 3NUYA 4YZ9A 1YWNA 3ANRA 1JBPE 2GHLA 1UV5A 3VNTA 3O17A 4MHAA 2OWBA 4I5PA 4BR3A 1V0BA 4ZLOA 4ASZA 4O21A 4M9UA 3KK9A 1ZLTA 5KZ0A 1OIYA 3BYVA 4MBLA 3TV6A 3QA8A 4XH6A 4MXYA 5BX0A 5IQFA 2VTSA 3BHUA 4FUXA 5M06A 1B6CB 3NRMA 4BKJA 4BY9E 1I44A 5AADA 5CEKA 4LM5A 3CD8A 4PNIA 4RIWA 2A27A 3O51A 2C3IB 2V0DA 5ANOA 5L2SA 3UODA 3TN8A 2J2IB 1KOAA 3CPBA 4GKIA 3ZRMA 4U40A 1DAWA 5ANJA 5B2LA 4ID7A 4KIPA 3PXFA 4P5QA 5E91A 1UNLA 2WEVA 4QMOA 4FFMA 4ZHQF 2ITQA 1MP8A 5KCVA 5E8WA 3GP0A 2VGOA 4HYSA 1WBTA 4E4XA 2BTRA 2Y8OA 3MY5A 4JQEA 5J2TF 3FZPA 2NNWB 1K3AA 1PXMA 4C58A 4WG5A 3HYHA 1OBDA 4PWNA 4E93A 3SAYA 1Q24A 5DR6A 1R0EA 5LVMA 3AC1A 3RK5A 1NY3A 2P33A 2B9JA 4NT4A 4ZSEA 1PKDA 3DK6A 4QP2A 3W2RA 4DEHA 4EH2A 4O7NA 5I4NA 3QRTA 2Z60A 3V5QA 4JX7A 4BC6A 3VUMA 4D58A 3BYUA 5D9HA 4C59A 3ZDUA 3ZHPC 1HCLA 4F4PA 2Y4PA 4IZ5A 4W4YA 1W83A 4FSNA 4TUYF 4C5AA 1LUFA 3N6RA 1SCUB 3WOWA 5DMXA 3LHJA 3IS5A 2J9GA 3VVHA 2R3PA 4OW8A 4X2JA 2BR1A 3MVMA 3VS7A 5H2UA 4LRJA 2F9GA 4I4EA 1W8CA 2PVNA 5EYCA 1YXTA 2PE1A 1SYKA 4KABA 3MJ2A 1JKTA 5L6OA 4NKSA 3MIYA 2GFSA 4DINA 4NTSA 4FNXA 1XBAA 5KMIA 4FKUA 2W6QA 3CY3A 4XS2A 4E8AA 2R3NA 3AC8A 3ZUTA 4K8AA 2IZTA 2ZB1A 3PA4A 2XIRA 3BYSA 4A4OA 3JVRA 4FT7A 3NNVA 2IWIA 1EHIA 1CMKE 4V04A 2XNPA 1WBPA 2P0AA 3QQLA 5H8GA 3HP2A 3V5PA 3FSKA 4L01A 4HVDA 2R7KA 2X4FA 1IA8A 2QHNA 2W96B 4PTEA 2XS0A 4ANQA 3HMMA 4X3FC 2DLNA 5HE2A 1J91A 1GIJA 2FYSA 3ZXZA 1Q3DA 1BLXA 2YS7A 4FSMA 3GCSA 5E8UA 5FG8A 4NK9A 1O6YA 2JDRA 3QHRA 2W1ZA 4KBKA 4AN2A 4RQVA 5BVWA 3AX6A 4O2BF 1WFCA 2YCQA 5AV2A 4A07A 4JDIA 3MPMA 3UZRA 3HAVA 3I0QA 4BHZA 5BUEA 3LJ1A 2VWIA 2R0UA 4N70A 1EYZA 4UWBA 3BE9A 1H01A 1KE5A 3BHYA 2B55A 2UZOA 2CLQA 3S95A 4FZAB 4GIIA 2JBPA 2OFVA 3KK8A 4YPDA 3PWYA 3HAMA 4QP1A 2C5YA 5CAVA 1V0PA 2BDWA 3R8PA 3R9RA 4IC8A 3GU7A 3K3JA 4AFEA 4I24A 3NVMB 5AAGA 5I9WA 3UG2A 5JGDA 2WIHA 4QP7A 2HENA 2XKEA 2WTKC 3NW6A 3AG9A 3NYXA 4JR7A 3TG1A 2C6EA 4A4XA 2UW9A 4HZRA 2QU6A 4F1OA 5E8VA 3EYGA 3QRUA 4AOJA 3L8XA 3LXKA 2PVLA 4C35A 4JBOA 4XG7A 2FPPB 4TV8F 3BPRA 3KVXA 3U9CA 4BGHA 4YJUA 2QG5A 4DAWA 3ORZA 2X1NA 3O7LB 1EZ1A 1B38A 1OKWA 4QP4A 4P4CA 1GIIA 3Q52A 1H08A 3UOKA 3G0FA 5M08A 4X0MA 2OIQA 5I9YA 2QOOA 1UU7A 4XP2A 4IHJF 4GFGA 4BDIA 2B9FA 3TM0A 3ZO1A 3ZS5A 3EKNA 4LUEA 3V3VA 3FMKA 3ZMMA 2WMTA 2HZ0A 2NRYA 2J51A 3LAUA 4BDFA 2VNYA 1NVSA 2B0QA 2GS2A 2VWVA 1J7IA 4AZVA 3KXZA 3MV5A 2CNVA 3MFRA 3R7EA 5EHLA 3VBWA 3ZM4A 3Q6UA 4DFYA 3A7FA 3E3BX 2I6LA 3G0EA 4HCUA 1J7LA 3COMA 5JEBA 5E92A 4DH7A 4M3QA 4ZTMA 5IMEA 3EL8A 3R00A 1M0TA 3KVWA 4OTHA 2F7XE 3N51A 1OPKA 3P9JA 4AT3A 3B8RA 3OEFX 2J6MA 4RLLA 5AM7A 1OIQA 2ITNA 3GQIA 3D0EA 3EN9A 4HGTA 3HV3A 2JIVA 4R6VA 4MXZA 5DHJA 5EHOA 3UQGA 3FY0A 3ZO3A 3UBDA 4XX0B 2ERZE 2O64A 4IVBA 1GSHA 1CKPA 4JBPA 4EH4A 4PP7A 3KFAA 4CT1A 3HVCA 4FZ6A 2R5TA 3V5JA 3TV7A 3LQ8A 2NRUA 4J99A 4BCIA 3CCNA 4APPA 3AGMA 2RL5A 4C33A 2OXXA 4APCA 5K5NA 3LFNA 1OI9A 4Y83A 2XNBA 4LMUA 1Q41A 4F9BA 2R9SA 3HDNA 4YJRA 2UZBA 2V5QA 4IW0A 5E8YA 1U54B 5FUTA 4ZSAA 2ITWA 3G9LX 2ZV8A 3HL7A 1ZYSA 4O22A 4H1MA 4J95A 4BF2A 3HV7A 4C3FA 1SVEA 5HESA 5AUUA 3ZEPA 4HYIA 5A3XA 1UKHA 2X8EA 3OT8A 2H34A 4RSSA 3QBNA 4TWOA 4D55A 3MDYA 2W1CA 5JSMA 4KSPA 2XM8A 3CR0A 1XH8A 1J3HA 3VN9A 2I8CA 4I6BA 5BVKA 4LV8A 2YWVA 3TW6A 3DJ7A 3RCJA 5D11A 5T3QA 4M84A 3U9TA 3QD0A 5IA2A 2QOQA 2JKMA 1GZ8A 4WIHA 4ANBA 4PMPA 5IQAA 1Q8WA 5H8EA 5TO8A 4EH5A 2QK4A 3NAYA 2DUVA 1UU3A 2PULA 2IVUA 2VV9A 5A4LA 4G1WA 5GONF 3IPHA 4EOOA 4R1VA 3TL8A 1Z57A 4AGCA 4BGQA 2OLSA 4UZDA 1ZAOA 2Z02A 3L8PA 5HX6A 3EFKA 3BBWA 2EXMA 4WNMA 2IVTA 1APME 2W1GA 1L8TA 2WTKB 3DQWA 2XUUA 3KF4A 3THBA 1CM8A 2PK9A 3PJ1A 3TKUA 4WNOA 3PYYA 3NVKI 3W8LA 3LXLA 4CKRA 5AP6A 3WF8A 2YIQA 3OUKA 4FK6A 3CS9A 4QTBA 4X2FA 2YDJA 3R30A 1FMKA 2C5VA 4QMUA 4ALWA 2X7OA 3FI4A 4F0IA 3GIDA 3F9NA 4FTIA 2BAJA 4RIWB 3CQWA 2Z7LA 4PF4A 3TNQB 5EOLA 3K54A 3AD6A 4WSYA 2WOTA 4LUDA 4MV9A 5D8DA 3IECA 3T9IA 4WG3A 5AUYA 4AGDA 3VUDA 3WYXA 4HVIA 5HBRB 4EUUA 1XQZA 4MCVA 2VX3A 3KMUA 3C50A 1FQ1B 2WB8A 2YCSA 1WVXA 4IDTA 2FSTX 2UVYA 2HIWA 3U55A 5CAOA 3OF0A 4QYYA 4FTTA 2XVDA 4J98A 4AA0A 4YBJA 5LARA 3RUPA 3C9WA 3QTRA 4G3DA 4B8MA 3RI1A 2XIZA 3UDBA 5CXZA 5IQHA 5KE0A 1ZYDA 3JR1A 2W4JA 4I0TA 4I22A 4DGNA 4OT6A 4FE2A 2AUHA 1ZMWA 4AF3A 5K9IA 1CE8A 4HNVA 3R0TA 2QI8A 2P3GX 2PUPA 4K18A 4FIGA 3W8QA 2C69A 4BDDA 2C6LA 4XOZA 2OJIA 5ETIA 5E8SA 5ITAA 3IDCA 5HIBA 3PIYA 4FZDB 3LCTA 1PJKA 3KCKA 4H3QA 4A4LA 5EH0A 2ITZA 4QMPA 2BRNA 3OUNB 5CQUA 4CRSA 4EYMA 3TIIA 4X2KA 3UPXA 4EWQA 5AP1A 1M17A 3VBYA 2X9FA 4IVDA 2VUWA 2YHVA 1WBNA 4TXCA 4YJVA 4YAJB 3PVBA 1KC7A 4PMTA 4UX9A 2YCRA 3QZIA 3ZEWA 5AA9A 1KJ9A 4FVRA 3ODYX 2Y4IB 3ZLXA 2ZYBA 4BCJA 1H25A 3EQDA 4USFA 3S0OA 3OUUA 3ELJA 2WMXA 2XRWA 3I6UA 3Q4ZA 3QXPA 2XMYA 3KCFA 3QLFA 5EG3A 2OSCA 2QOKA 4PY1A 5IISA 3VBTA 3UQFA 2OFUA 2W71A 2XEZA 3I0OA 4A7CA 2B52A 2YIYA 3R21A 5EDRA 2VX0A 4QSHA 3BU5A 3FJQE 4XCUA 4BDJA 1R39A 4D5HA 4CFVA 5EQEA 3C51A 1DI9A 4GVAA 4MAMA 3LCDA 5HU9A 1BUHA 2WMRA 1U54A 3B2WA 3FAAA 3KB7A 4S33A 4XG4A 5CALA 2ZV2A 5HG7A 4E5BA 3D15A 1OUKA 4K77A 5DNRA 5TOZA 3PXZA 5J2UF 2PU8A 3G8CA 5AP0A 4W8EA 2I1MA 4M69B 3A4OX 3LXNA 3PSCA 4GL9A 4ACCA 4QQJA 1M2PA 3UC4A 2ITUA 1Q62A 4FTQA 3V8TA 3ORPA 3LWBA 3BV2A 1X8BA 3PRFA 5HZNA 5LJJA 3C5IA 4NM5A 4U7ZA 3GC0A 5LCKA 3ZXTA 4DA5A 4GT3A 1DV1A 3BLHA 3Q53A 4PL5A 3I5ZA 3TZ8A 2W99B 4C3RA 5KMLA 5AEPA 4O4JF 4KS7A 4XBRA 2JDOA 3SD0A 2HY0A 3ROYA 4PTCA 4EOQA 2RF9A 2FVDA 3CQEA 3NIEA 3UIMA 3SLSA 1NVRA 1TKIA 3W18A 3LCSA 2CN8A 4I5HA 3IOKA 3RKBA 2RFSA 3IK3A 4I0SA 4DGOA 3Q32A 4KWPA 5JH6A 1DIKA 4O4IF 3VF9A 5BVFA 2W5AA 2GS6A 2HK5A 2QLUA 4ZK5A 2YZGA 2BKKA 4YNOA 4ALUA 3ID6C 4PDOA 2J7TA 5E1SA 3A99A 2AYPA 4FTJA 5DR2A 3MFTA 2R3HA 4B4LA 3EN6A 3HNGA 3NZ0A 4R7BA 2XNNA 3FWQA 3OWJA 3V01A 1DI8A 1VBHA 1A48A 4IX5A 3VMMA 3REPA 3DAEA 2B7AA 2X39A 2ZDTA 3I79A 2R7LA 4G6LA 1F0QA 4D1SA 4NL0A 2C5OA 2BFYA 3SW7A 3MIAA 4H3BA 5DE2A 1T36A 4JOAA 1C3OA 3DJ5A 2YEXA 3R28A 5AP7A 3EKKA 4RFYA 1BKXA 4WO5A 3RPVA 2PN1A 4ZSLA 2QKWB 4ORKA 5LVLA 1VKZA 4HGLA 4YJ3F 4LV5A 4EONA 2GTMA 4EZ7A 1BXRA 2VPQA 1VYWA 2W1FA 4YUQA 3V4ZA 2W4KA 2X2LA 3LE6A 3SRVB 2YL2A 2XCKA 3R5FA 3AOXA 4FG8A 1M7QA 2XKFA 3FQEA 5CWZA 5LYJF 3DB8A 3KL8A 4XMOA 4O96A 5EDPA 3HV5A 3P23A 3ANQA 3R04A 5LVNA 1PMUA 3H10A 2J5FA 4RJ5A 1YOJA 3RNIA 4U8ZA 4FKVA 3UE4A 5GIPE 2O63A 4TW9A 2C3LA 1DS5A 3FXWA 3KMWA 4GYGA 4UYAA 2VO0A 3SHEA 5IG1A 1NW1A 4Y8VB 3DXQA 5A4EA 1XH9A 4RLKA 5EFQA 4D1XA 4AZFA 3PRIA 4YLLA 4GK4A 4A9YA 5H8BA 1H24A 3ZM9A 2WTIA 4CD0A 3QKLA 5LMBA 2HXQA 4ZLYA 3DK3A 3HA6A 4C0TA 5J1VA 4HCVA 5IA3A 1GY3A 3Q96A 3QZGA 5EHYA 2ZVAA 3QQUA 2KULA 3QTIA 1PXIA 2BDFA 3MW1A 3DFAA 5HEZA 1OECA 3C13A 3LP8A 3ZZEA 4I6QA 4E1ZA 3GFEA 3ZO4A 3ZSIA 3C0IA 3NW7A 3MVLA 3RM6A 4FKLA 1U59A 4GU6A 4R7IA 3DBFA 1UU8A 1BX6A 5L6WL 2Y9QA 2H96A 4TNDA 3GBZA 4PX6A 1QPDA 3QA0A 4Y8DA 5E4HA 3H0ZA 4U81A 5CU3A 4Z16A 1A9XA 5DA3A 4DH5A 4C5BA 3HDMA 4D28A 4O81A 3TACA 3A7GA 3KAJA 2UUEA 4QMQA 4QP8A 3H9OA 4BN1A 3A2CA 4O0WA 1PYEA 4BGGA 5KX5F 3QWKA 4JNWA 4HYHA 2PZ5A 2A1AB 2BVAA 2ITYA 2UW4A 3D5XA 2CKOA 3PLSA 3SG9A 4L67A 3W10A 4FI1A 3OS3A 1M52A 4DFUA 1EUCB 2O3PA 1ZRZA 2RGPA 2GQGA 4KD1A 3P0MA 3Q5ZA 2PVPA 3DA6A 4KBAA 2BTSA 2C68A 5CNOA 3R6XA 4DG2E 2NO3A 3LCKA 4XJ0A 3RPSA 3QQGA 3BLQA 4DHFA 4F64A 4F7SA 1U5QA 4FYOA 4ALVA 2Y0AA 3CEKA 5C8KA 2B9IA 4XRLA 3KA0A 4CZTA 4BBFA 2I0HA 4FTRA 4MF1A 5D10A 4AW2A 4BIBA 5HE3A 4L1KA 3VS6A 4DGLC 5IQDA 1YHVA 3BWFA 4EK6A 4RIXA 2XJ0A 3LMIA 4MX9A 4NCTC 1JKJB 4O7TA 1H0VA 4Z7GA 4O38A 3WNZA 4CV8A 4I3ZA 2SRCA 4QMVA 3F2AA 5BMSA 1K9AA 4UWYA 4WHZA 4USDA 2A19B 2CGVA 2ZJWA 4IQ6A 2PZIA 1ZOHA 2GPHA 4XP0A 3R63A 4KRDA 3TTJA 2OBJA 2OJ9A 3QQKA 2HZNA 3NUNA 4V0GA 5J95A 1FOTA 3NCZA 3DJ6A 2XBAA 3QD2B 5JT2A 4CEGA 5CEIA 5JMSA 4EZ3A 4YZCA 1REJA 2ZOQA 4CFUA 4ASEA 3R1QA 4QOXA 3GCPA 3MJ1A 2IZRA 5HBJA 5HLPA 5IH6A 2QLQA 2QO7A 2JFLA 4C4GA 4GJ2A 4WRGA 5AFVA 3BGQA 1LP4A 4C4EA 3HEGA 2GCDA 2R3LA 2IVVA 2GNLA 3DV3A 3LKMA 5C01A 4CT2A 3U6HA 3AC3A 3PY1A 3DFCB 4NSTA 4K6ZA 4ZEGA 3UG1A 4FG9A 4XP3A 3G2FA 5BPFA 2CSNA 3IO7A 3WI6A 4L3JA 4DLJA 3DLSA 4M97A 5KKRB 3M2WA 3MH2A 3C4WA 4L43A 4XG9A 2R3JA 3F2RA 3L9LA 4I93A 4RJ4A 5DWRA 2VU3A 1OGUA 3V6SA 2GFCA 1FVVA 3VAPA 3G15A 2GNGA 4LGHA 4IX3A 5L2IA 2XA4A 3CKXA 3VQUA 2NPQA 5LA6F 3PZHA 5I9UA 3D5WA 3E7OA 2IO6A 3LLAA 3G51A 3EQRA 4IAIA 4LL0A 5FQDC 3GCUA 3TNIA 5F9EA 3LFSA 3QRIA 4AQCA 2QOLA 3T8OA 3JS2A 4ZMFA 2QO2A 4EOIA 3OY1A 4GFOA 3OXIA 5EOBA 1NVQA 2PE0A 3NYOA 4EQMA 5D41A 5CEMA 3PXKA 1YXSA 2XEYA 4ZS0A 4CZUA 1PMNA 4FICA 4FSWA 5JN2A 3Q4CA 4AW1A 4EORA 3NS9A 5CASA 5AA8A 3RK7A 2W6PA 5JZNA 2YIXA 4C4JA 5CAQA 4EH8A 3FHRA 5K5XA 4JL9A 4G17A 4BCMA 2WTJA 1JKKA 3DPKA 5IYZF 3A62A 3GFWA 3OCGA 2VRXA 4RIYB 1E1XA 2CLXA 2G9XA 2GTNA 2QVSE 4RJ8A 2JC6A 5AUTA 4BIDA 1CQIB 4EH7A 1YI6A 4KIQA 4MWHA 3N8DA 4BDHA 2YZLA 2UW5A 3DXNA 3EB0A 3C4EA 2PVRA 3CGOA 3N4UA 3ETAA 3QGWA 2WTVA 4QYGA 5FRIA 4CFMA 1YDSE 4D5KA 4FTCA 4I0RA 3UNZA 4AU8A 3UZTA 3P1AA 2R7NA 2XJ1A 3TKHA 3FMDA 1F5QA 4K33A 2I0YA 4FKTA 1JPAA 4TYIA 2IW8A 2R85A 3FQHA 3VF8A 1PYXA 4G3EA 3CC6A 3KF7A 1IAJA 2PVMA 4MEDA 2ERKA 5EW8A 3UVQA 2W0JA 3TWJA 2BZIB 3I81A 3OCTA 2Z7RA 4BTFA 3RHXA 5JK3A 4XV2A 2W05A 4EQCA 3PXRA 1JOWB 2F2CB 1RJBA 2BAQA 4ZSJA 1WAKA 4Z9LA 2BALA 3HX4A 1B6SA 3QALE 4RWIA 3KAKA 5LXMA 3GT8A 4WNKA 4YC6A 3TIZA 2EB2A 5HORA 5J9LA 1Z2NX 3LMHA 2WMQA 5DRDA 5C4LA 1YWVA 4JR3A 2W6NA 2ZDHA 2PWLA 4IWOA 2BAKA 3CTQA 2J50A 3KXHA 1KE8A 4QMMA 4DH3A 3LIJA 5AV1A 3ROCA 3S00A 4H58A 3HA8A 5I9VA 1BNCA 2XH5A 1VYZA 2BHHA 3E63A 1YDTE 2QOFA 4CTBA 4AFJA 4U3YA 1Y6BA 2OK1A 3O23A 5AV3A 3DCVA 4NYEA 5CSXA 3ORKA 1Q97A 1ZZLA 5BYYA 4HZSA 1OL2A 4C61A 4HGSA 4GSBA 2UZWE 3W2PA 1XHAA 2WQEA 5AP5A 1AUVA 1ZYJA 3UYSA 3I6WA 4K1BA 4FV6A 5AWMA 4ZIMA 1U46A 3IW6A 4C36A 2ITVA 4EKKA 2DWBA 3D7TA 5C9CA 4Z3VA 2CNUA 2PZPA 4IJ9A 1XH6A 3PPJA 2XIKA 4PUZA 5K3YA 3UO6A 1GIHA 3PE2A 2CZGA 5BUIA 4BHNA 4XG2A 1I09A 3BQCA 5FTGA 1PXJA 2W6OA 3KXNA 3WBLA 3BV3A 5IMXA 2RG6A 4V01A 1IAHA 3BKBA 4FOBA 4M0YA 2G1TA 3NNXA 5FTOA 3QCXA 1BYGA 3O71A 4UWCA 1GGOA 3R23A 4E20A 3LFBA 2ZV7A 2OKRA 4NFNA 3G5DA 3OWKA 4JRNA 4FKGA 3K5UA 4QTDA 3PVGA 3W2QA 4K0YA 3ULZA 4YHJA 5IEVA 3FYJX 3WIGA 4EHVA 2ZB0A 3KY2A 5F94A 1H0WA 5ANGA 4GT5A 5E9EA 1H1PA 4RX5A 3LXPA 4DTKA 3E3PA 3LOKA 4G6NA 1PXNA 5HNGA 4IVCA 4TYEA 3HO8A 3VW8A 2HZIA 3JZFA 3KC3A 2HWOA 5EI6A 3DB6A 1M7NA 3PVWA 1Q5KA 3SVVA 3Q9XA 1GOLA 3MPTA 4ZY5A 3QCQA 3QFFA 1H1WA 3GQLA 4MBJA 4AX8A 5K4JA 1WBVA 4C4IA 3R22A 2YM3A 2XNGA 4NUSA 2HJWA 4FKQA 4JI9A 1GSAA 4WBNF 1Q8ZA 2QONA 3ZFMA 2V59A 1MRYA 3PP0A 3G33A 3U54A 5JFWA 4PDSA 2EU9A 4QRCA 4YSMA 4O0YA 3M42A 4ZOGA 4DT9A 1LPUA 2IVSA 3PIZA 4HYUA 1OVEA 4YJOA 5DEYA 5KBRA 4HVGA 4OBOA 4QP9A 1IOVA 2PY3A 5E8TA 4YZMA 4IC7A 1J1CA 3BGZA 1M2QA 4G5JA 5CAPA 3UFXB 1AGWA 3HZTA 4MQ1A 4OTDA 3HKOA 2W17A 3N4VA 5TT7A 4I20A 5AAEA 1URCA 4HJOA 1YI4A 4DEBA 3EZRA 5HE0A 4NWMA 4C02A 4XYLB 2DQ7X 3TUCA 3K3IA 1I7NA 4NZWB 2O8YA 3FV8A 1L3RE 3MY0A 1P14A 4FV2A 4YR8A 1S9JA 1KJQA 3EL7A 5E8XA 3IW4A 4AP7A 4C7TA 4YJ2F 3UTOA 5F4NA 4ZJIA 3RAKA 3BBTB 2CKPA 5KMNA 3ORXA 4G16A 5AUWA 2I80A 1GJOA 4B99A 4QTEA 5IEYA 1G8SA 5H9BA 4BYIA 3C5UA 3L8VA 1SVHA 2YERA 4UXLA 5HO8A 1Y8GA 1OL1A 3SXFA 4BRXA 3MFSA 4IEBA 4DLKA 4W4XA 3QHWA 3CJGA 3E88A 5BVDA 1XBBA 2YJSA 4XG3A 4DLIA 3ZYAA 4QMYA 2BZKB 2PUNA 4XV9A 3U4WA 3WZKA 4IZ7A 3DBQA 4JX3A 3BLRA 3SW4A 4EJ7A 3S3IA 2B9HA 1M0WA 4LOOA 1Q99A 1IR3A 3QTQA 3NSZA 4CMOA 4J8MA 3DBDA 2AC3A 4QP6A 3HMOA 4JAIA 1ZY4A 4LOQA 3R71A 2CCIA 5HQ0A 3PSDA 2GS7A 3Q4TA 2BRMA 2BIYA 3EYHA 3NPCA 4XLVA 2CJMA 2HZ4A 1TQPA 4AN3A 2XK7A 5BYZA 4MV6A 4ARKA 4EHGA 3MS9A 5DT0A 5HKMA 3ALOA 4FIEA 5J8IA 4E6QA 5HX8A 3BWJA 4RZVA 4YPSA 3R2BA 3CGFA 4HW7A 5FBNC 2WZJA 3E8EA 3TUBA 1QCFA 5HCXA 4BI2A 4PRJA 4D4SA 3A4PA 2BDJA 3EN5A 3OUZA 3CTJA 1DAYA 3S1HA 1IASA 4KIOA 1IA9A 3EFWA 2Z04A 3KALA 4FFPA 1FMOE 3QL8A 3LLTA 3M11A 2QG7A 4EHZA 1YVJA 1VEBA 1OPLA 2XM9A 2YZAA 2WTWA 4ITJA 5A6NA 3ODZX 2QOBA 3MWUA 1IEPA 2A4LA 2ZM4A 3O96A 4OTIA 5E8ZA 3DDPA 5EW3A 2XZSA 4Y73A 4BDCA 1GSOA 5HIEA 2BZJA 4L8MA 4X3FB 1RDQE 3PZEA 3E87A 5HHWA 3D9VA 2NU8B 4FYNA 4V0GB 4U79A 4HNIA 2C5XA 3LJ2A 5ICPA 1S9IA 2FPIB 1XH4A 5CB4F 4EOKA 1Q61A 3VIDA 4U41A 4DT8A 3ZLWA 1V1KA 4CG8A 5KUPA 4USEA 2GLTA 1PKGA 3HGKA 4MVFA 4M67A 3V8WA 2QKRA 4R5YA 2QR8A 3FMNA 2PUIA 2WMVA 3RCDA 4F63A 4CLJA 3KXXA 4UXQA 5FLFA 4WRSA 1STCE 5AX9A 4DN5A 3Q1KA 4FL3A 4IANA 2PVKA 3H0YA 4FTAA 2OJGA 4BZOA 5EKNA 1PX2A 3IOPA 5BUJA 5HD4A 4EZ5A 3MWEA 1JVPP 5HLWA 4BICA 5JQGF 3QTZA 2FO0A 5HO7A 2XKDA 4M68A 2UZTA 4C5CA 4ASDA 4X2NA 5CEQA 4DITA 3VUGA 1RW8A 3F3WA 4YTIA 2WQBA 3TZ9A 5EM7A 4AW0A 4OTWA 3ZLSA 3FLQA 2OH0E 3WZEA 1GLVA 4G3GA 1H28A 2RFEA 5DGZA 4O83A 4BTKA 3EQBA 4GT4A 4MV3A 4IAFA 4JBQA 2PL0A 5TF9A 4ZZNA 2FP4B 4EKLA 3MH0A 3RALA 2RIOA 5DG5A 1OUYA 4LL5A 5E7RA 2ETMA 4C3PA 4O7SA 4H39A 3DTCA 3UVPA 5B2MA 1NT2A 5KHWA 3VPCA 3HMPA 5LMAA 4RPVA 2VTNA 4U3ZA 4I6FA 3IGGA 4DEAA 4UN0C 5CF8A 1KOBA 1YOMA 2GU8A 1JQHA 1VJYA 4FFOA 3OG7A 4G31A 3GU5A 4FTMA 4FKJA 4O0SA 1PXPA 2WEIA 3A8WA 4W4VA 4RVKA 3RPRA 5CAUA 1OMWA 4OT5A 3SXSA 3TEIA 3QD4A 3O8TA 5IF1A 3QD3A 2XIYA 3MBLA 3QXOA 2BHEA 1OITA 2XK3A 4FK3A 2AC5A 5JVLA 1Y57A 1SZMA 3L9NA 5KMOA 2WO6A 3KN5A 3CIKA 2JKQA 4ONAA 3Q2JA 3PPZA 2ZMCA 3O2MA 4F9CA 1R0PA 2UW0A 3E8CA 4GUEA 4QQ5A 2HYYA 5AIRA 5HGIA 4CG9A
chains in the Genus database with same CATH superfamily
4CMTA 3D5VA 2X6EA 2C3JA 4LYNA 4BCFA 2R84A 3LQ5A 3PLAE 2QHMA 2WU6A 4CFWA 4FVPA 1DV2A 2FB8A 5A9UA 5IEXA 4ANLA 2PYWA 3TQTA 3BA9A 2XALA 4CMUA 5DLSA 5CF5A 3QGYA 3BX5A 1XBCA 4UALA 5M4IA 4L9IA 2BFXA 3ZUVA 2YFXA 1FPUA 2REIA 2XK4A 3ZO2A 4FKRA 2JITA 4U44A 4AN9A 4EK5A 3NUPA 1W82A 3UJGA 3OW3A 4RC4A 2R3GA 3LM0A 3H3CA 4FV0A 2GNIA 3ZOSA 3KQ7A 2G2IA 4TYHA 1CKMA 4EG0A 2BZHB 2V55A 4IX4A 3W1FA 3DLZA 3WF9A 2R64A 5FDPA 4MWIA 5LWMA 4CKIA 4OUCA 3D5UA 4EL9A 2VTMA 3S24A 4Y85A 4I21A 5E90A 2NUAB 5JH7F 4KINA 4ZTNA 5CQWA 5FTQA 4ANMA 1M6VA 5DYJA 1H07A 3SQQA 3Q5IA 3LFCA 3PIXA 5AUXA 4DGMA 4RVLA 4FKSA 3RNYA 3KEXA 3PXYA 4IADA 3HRBA 3CE3A 4MD8E 3QC9A 4GK2A 3FDNA 4FIHA 4DG0E 4O91A 4IDVA 4O0TA 1AQ1A 3WZJA 5KKRC 5LOHA 1EKFA 3PE1A 4UY9A 4CVAA 4LGGA 4RX8A 3AKJA 5ETAA 4IE9A 5EQPA 5FBOA 5FXQA 4ZMEA 1X9NA 1G8AA 4U42A 5L8LA 2UW7A 4HCTA 4JG8A 2B1PA 4E6CA 3OHTA 4FGRA 5IQEA 3PUPA 3DK7A 2W1HA 1H1RA 5KMKA 4IB0A 1TFFA 3ORRA 4AXAA 2C1AA 4MQ2A 4EH3A 2YZNA 3W0PA 3VJNA 4LOPA 1EKPA 1I1KA 3GNIB 2A2AA 4CKJA 3OZ6A 2R2PA 3ACJA 3ATSA 2WMBA 1IOWA 5ANDA 4W8DA 5CXHA 1WVYA 4YZBA 2OG8A 3BEAA 3ORQA 4S31A 5L3AA 4DIMA 3IDPA 3RWQA 4GK3A 3E5NA 1ND4A 4PV0A 4Q9ZA 1QMZA 3T9BA 4J8NA 4AG8A 3MWDA 4HPUE 2HY81 2B54A 2PVJA 2W7XA 3A8XA 5M4CA 5HNEA 3UQ8A 4CV9A 4JIKA 3ATTA 3CLYA 4FT3A 4ZTRA 4D0WA 5A4CA 2UZVA 5HTCA 2J9MA 4WUNA 5FR9A 3V4SA 2JAVA 3C4ZA 2C5NA 3LFFA 2YDKA 4KKEA 2UZUE 5IA5A 4XHKB 2Z7SA 3BELA 3HV6A 4HPTE 4EUTA 3BU3A 5C1QB 5I5ZA 2YIRA 3UIXA 3AMBA 4XV3A 3FZOA 3TIGA 4IB3A 2VTLA 3NIZA 3TEKA 3KRWA 2HVRA 1TQMA 4GRBA 3RM7A 2C30A 4EWHA 3Q2MA 3R9DA 1CKNA 5IDPA 3MGYA 3OOGA 5EZYF 3AKLA 4BZDA 3FPMA 5B7VA 2VWBA 4A9UA 4E6AA 2CPKE 3MN3A 1MUOA 4TYGA 3F3UA 3I1AA 4E4LA 2OGVA 5HBEA 3ZZWA 4FTUA 5FEEA 2W9ZB 1W0XC 2V7OA 3HV4A 3JRWA 3WE8A 3ZUUA 3GDEA 3QX4A 3G90X 3EMGA 2HXLA 3AD5A 3ITZA 3QTWA 4F9WA 4PNKA 3PJ8A 3QX2A 4MNEA 4XNEA 3WZDA 3ETHA 5CU0A 4XZ3B 3OCBA 2DWCA 4ACGA 2UZNA 2YRWA 5EW9A 4P2KA 4QMTA 3NYNA 4GG7A 3A60A 3E93A 2Y6MA 3GC8A 1YKRA 4LI5A 2OO8X 5M4FA 4I5MA 4MXOA 4EOLA 3WWIA 4AAAA 2Q2UA 4X21A 3D2IA 4FKWA 3PDTA 3PJ2A 5E1EA 3TCPA 5EYKA 3SXRA 3R8VA 3TDWA 3GJXB 5M51A 3TTIA 2R82A 4I4TF 3ORNA 5BMMA 2NU7B 5DVRA 4AOIA 4FG7A 3Q4UA 5EM5A 3OXZA 2C6MA 2GNHA 3HRCA 4O0UA 3BRBA 1QPEA 3U4UA 4LRKA 3FC2A 5BVNA 3VS1A 4YLJA 5IA1A 2XNEA 2WMAA 3BHVA 1REKA 2WAJA 3CPCA 4FKOA 4IZYA 4OR5A 3VA7A 4C4FA 2OIBA 1GZKA 1P16A 4BIEA 3TZ7A 3OEZA 5AMNA 5EKOA 5D7AA 2H8HA 4UEUA 2V58A 4N4SA 4O86A 3ZRKA 4JG7A 3F7ZA 1OL7A 2GSFA 3G6GA 3SA0A 1XK5A 3RV3A 2FUMA 4FEWA 3DGKA 3OCSA 5CT0A 3R5HA 2PHKA 4XYMB 3BL9A 4BYJA 4CQEA 2C0TA 3TY9A 4HNUA 2YAKA 3HB9A 4ZY4A 5AUVA 3F5GA 3VS3A 1YDRE 3QRKA 2GHMA 4WBOA 3RGFA 4JIAA 4FR4A 2OJJA 5IQBA 2R7IA 3NYVA 4TTHB 1ERKA 1PXOA 2DS1A 3BU6A 5CLPA 3LZBA 2Q7DA 3UNKA 1Z2PX 4DFXE 2BCJA 3W0NA 4BBEA 3LCOA 1BI8A 3VBXA 4DCAA 2IJMA 2PVHA 5CVFA 4YGAA 3ZC5A 4H3PA 4F6SA 5JFVA 2Y7JA 3BI6A 3EIDA 4JG6A 3HRFA 4FT0A 1XO2B 4J97A 4P5ZA 4QPSA 5CI7A 3ZSGA 4R1YA 3AT3A 4MA0A 3C4XA 3JZ6A 3DBCA 3NAXA 4BDAA 4R78A 2ETRA 3U87A 1ZMVA 3C0GA 3DAKA 3QLGA 4MV1A 1NA7A 5JQWA 3P7BA 2QODA 1VZOA 2R4BA 3MI9A 4U80A 5IH5A 4NTTA 5CVHA 5M4UA 4RA5A 1T46A 3FMEA 5JZJA 4KA3A 4EYJA 5JRSA 2OI4X 4WNPA 3EWHA 3PJCA 5LCJA 3QZHA 4LMNA 3R1YA 4KSQA 1OB3A 1WBSA 5C26A 5CANA 2HOGA 4FEUA 4JQ7A 3BYMA 4PMSA 4X6RA 4FEVA 4QYEA 2PBZA 3RR5A 4M15A 3LFEA 4B0GA 4MBIA 5KO1A 4L68A 4O7YA 3FPQA 2R0IA 4JS8A 4JVGA 3ENMA 2IZUA 2PPQA 4FC0A 2ITPA 4EHEA 2HHFB 3FEGA 3U8WA 1G2WA 3C1XA 3L9MA 3T3VA 4O2AF 2V7AA 4OBPA 4U5JA 4HVHA 4KUJA 1JSVA 3MH3A 4DE4A 2OIDA 5J1WA 4F9AA 2UW8A 2PVFA 5HNBA 5C8MA 4E26A 1XH5A 4FNYA 4AZEA 3O5AA 5KBQA 5C1OA 1BL7A 2JDTA 4O0XA 2C47A 3BYOA 3VBQA 1P5EA 4IFGA 3FZ1A 2QOCA 5J87A 4I50F 3CD3A 4AGUA 3ZH8A 4ZSGA 3I12A 3FI8A 5DH3A 1W7HA 3OMVA 3VJOA 5L8KA 3R8LA 3UZPA 2JDSA 1HOWA 4Q5HA 4QYHA 5EQYA 2GPWA 4IWQA 4I92A 3FC1X 4QMLA 5AM6A 4DHZA 4CRLA 4DEGA 2XANA 4K6NA 2HAKA 4D4RA 4D9UA 4EOPA 1IRKA 1M2RA 1EUDB 4QMXA 3T9TA 2CKEA 1PF8A 2QO9A 3VQHA 1DM2A 4MD9E 4O4LF 4R77A 5J5SA 2X6DA 4YNEA 3GGFA 3K5IA 4KRCA 4RGJA 2VWUA 3GC9A 4O7ZA 3KRXA 4FTNA 5FEDA 5AX3A 2WHBA 3DNDA 4YC3A 1M14A 3Q9YA 4PP9A 3OT3A 3OVVA 3BEGA 2XP2A 4FT5A 4UCVA 3R8MA 3VS0A 3F3VA 3AMYA 4YP8A 4YHTA 3SOCA 4U6RA 3Q9ZA 3EHAA 3FZSA 2IG7A 4E7WA 4FSUA 3KULB 4WT6A 4FV1A 1ET0A 4LRMA 2LAVA 4FIJA 4HOKA 2CGWA 1Q3WA 2UZDA 2VO6A 4YB8B 2CN5A 3AC2A 2QF7A 4MV8A 1ST4A 3TXOA 3KMMA 3HUCA 4LG4A 5DGHA 1DGSA 2XK6A 2I87A 2DYLA 3AC5A 4DC2A 5JGAA 2R7MA 1PMVA 3LJ0A 4FL1A 4FV8A 2PZRA 5CI6A 2DAAA 4AW5A 4KNBA 3FKLA 4RWKA 4ZZOA 5IZFA 4LQMA 2UVZA 3UDTA 2BILB 3FI2A 4BVUA 4F1TA 1E4EA 3ETJA 5EYMA 3TNWA 5IQGA 2YS6A 3O8UA 1O6KA 3RK9A 2E9VA 4D1ZA 3MB6A 1PMEA 3OROA 4MNFA 1BMKA 2VTAA 4GV1A 3EH9A 3PA3A 4FKIA 3F82A 5EDQA 3T3UA 2ZAZA 4YHFA 5M07A 4AE6A 1ZY5A 4CFNA 2XBJA 4FIIA 4KKHA 4UFZA 4FSYA 4FX3A 5ACBC 3W55A 1RE8A 2DIKA 3TY8A 1JAMA 3EFJA 2Z8CA 1OIUA 4IB1A 2R3FA 2OICA 3K5VA 3AKKA 3EQGA 5D12A 4O7LA 4EQUA 4HQ6A 4UCUA 5FNVF 2W1EA 5A4TA 1I7LA 4FV7A 2Z2WA 3VPBA 1J1BA 4JDJA 2C6DA 4OTFA 2JLDA 2X0SA 3K3PA 5KS8A 4FV9A 5CF4A 2W1IA 5DGIA 2C3KA 5J7HA 2HIXA 3G8DA 2I7QA 4EGQA 1UA2A 4YO4A 4GW8A 1BL6A 2C6TA 3Q6WA 4TPTA 1OZ1A 3Q60A 3O0GA 4L3LA 4DF3A 2ETKA 3RAWA 5HVJA 4AZTA 5I0BA 3UPZA 1KWPA 3RFCA 4C2VA 3DZOA 4GS6A 4TYHB 2H6DA 5ANIA 1V0OA 2Q0NA 3KXGA 3NUSA 3HUBA 2UV2A 4MD7E 3VWAA 1MQBA 4R5SA 4BCQA 5FXRA 2XIXA 3QF9A 4BDBA 5DT3A 4O7WA 4BI1A 3DZQA 4BJJA 3MH1A 2J4ZA 3O7LD 5AAFA 2R7BA 4F7JA 5H80A 4FV5A 4AT4A 3OBGA 1S68A 4ZI7F 3AC4A 2JAMA 4YMJA 2OF4A 3DS6A 2ITTA 3EJ1A 4E4MA 5HCZA 4AZSA 2FA2A 4MXXA 4ZS4A 3D4QA 3RTPA 2W70A 4EFEA 4YAKB 2QQ7A 5B0XA 2VNWA 1Y8YA 1JLUE 4IM0A 3NBZB 3I60A 3BHTA 2GNFA 2J0LA 4OGRA 4AWIA 4C2WA 4R3PA 4M12A 1VS0A 5I5YA 4A9SA 1WBOA 5CA0F 5J9ZA 3WO0A 4C4HA 3ACKA 4DFBA 3W2OA 4G3CA 3VO3A 4B8LA 2R3MA 2YA9A 3FXZA 5HG5A 1H1SA 4YJSA 4AZWA 2VTQA 3ULIA 3BA8A 4IHPA 4I41A 5HD7A 4CXAA 3D94A 4M7IA 3P5KA 2VTRA 5C03A 3Q04A 5HIDA 3ERKA 4EOJA 3GCVA 2WIPA 3QQJA 4G9CA 4X2GA 4DGGA 3GUBA 2JBOA 2ONLA 4LDTA 1WMKA 2W5BA 3UIBA 3TY5A 2VD5A 3F7WA 2HELA 4PBCA 1KV2A 3FMMA 2IW6A 2VAGA 4BTJA 4FFNA 5HV6A 3OBJA 3CSWA 1ZOGA 1UU9A 3OW4A 3ZC6A 5FP6A 5CS6A 2IW9A 2JIIA 3CP9A 4H1JA 3AMAA 4TT7A 1OKVA 4F7LA 2ACXA 2PMOX 3R02A 3PG3A 4HGEA 2X4ZA 4IX6A 2RFNA 3WF7A 4KB8A 4I94A 4YSJA 1H1QA 4I23A 5B2KA 3SKCA 2ONLC 4F09A 1PXKA 5JQ8A 4IBMA 5L8JA 2XCHA 3VRZA 3MVHA 4EH6A 4X6QC 3MPAA 1ZOEA 5H3QA 4BCOA 2R86A 2FSOX 2DZDA 4WD5A 4B6LA 2OZAB 1KJIA 3VULA 4GU9A 2VR1A 1KE6A 2ESMA 1UWHA 4F65A 4BCHA 1U4DA 4IZAA 5AP4A 4O84A 1H26A 3QYWA 4O0VA 3CSVA 3L2PA 2CGXA 2XRUA 4QMZA 4EK4A 1UNGA 2VTJA 3NCGA 4S32A 4BCGA 1EKVA 1P8LA 3HP5A 3EQHA 2VZ6A 5GJFA 1XKKA 2R87A 2UZEA 1SMHA 4GLXA 2VWYA 4D2SA 2ZDGA 4ZY6A 3JUHA 2HGSA 2PZYA 4N6YA 4RRVA 1CKJA 5LWNA 1I2LA 3DKFA 2XCLA 5CM0A 4FBXA 1YXXA 1CQJB 2YDIA 3FY2A 2W6MA 1WBWA 3EN7A 1OM1A 3TT0A 3CEBA 4WA9A 1WVWA 3DKCA 3FXXA 3ALNA 3KXMA 2YM6A 3NEWA 2WQNA 3CY2A 2JEDA 5LOVF 3L9PA 1W98A 2XYUA 3UOJA 2P0CA 3FL5A 3TW7A 4O27B 2UVXA 3DTWA 4NZNA 2WTDA 1MQ4A 1OL5A 1W96A 3U51A 5HNIX 4L00A 1A9UA 3HMNA 3HLLA 2P2HA 4Y72A 4U97A 4JDHA 4OTQA 4RC2A 3UO4A 1B39A 4PQNA 5KMJA 2EIYA 3JPVA 1XWSA 4ACDA 4IACA 4B7TA 3ENHA 3ET7A 3Q9WA 3F3ZA 1QPCA 3U9NA 4Y5HA 5C27A 1PHKA 3EN4A 2E9OA 2VGPA 3LMGA 3R1SA 5DEWA 2QD9A 3WZUA 4BCPA 3DTFA 4XUFA 2F57A 3FQSA 3CBLA 3IDBA 3KULA 3NUXA 4JDKA 4MH7A 3OTUA 3V51A 3WILA 1JDBB 1SM2A 3OWLA 4WOVA 5CU4A 4O4HF 4BI0A 2KTYA 1LEZA 3IW7A 3TNPC 3PY3A 2EB3A 3DBEA 1ZXEA 1UNHA 4DYMA 4ACMA 2JD5A 3QAME 4RBLA 3ZFXA 4M0JA 2P4IA 4A9RA 1E1VA 4YZNA 5BWUA 4TV9F 2YZMA 3JSNA 4UB7A 5ETCA 3VS5A 3IONA 3WF6A 5C4KA 3V6RA 3R7OA 2G15A 2W5HA 4FV4A 1BI7A 4QT1A 4QTAA 4YZDA 3QQFA 4O6LA 3FLWA 2BROA 4CCUA 3A61A 4DFLA 3G9NA 4DTAA 4QNAA 5BWXA 3F5XA 5JFXA 2UW6A 3R7IA 4MNEB 3R9OA 3NR9A 4RZQA 4KAOA 3W0MA 5CY3A 5AUZA 3BQRA 3KRJA 3NUAA 3RAIA 4JBVA 4IIRA 4E6DA 3OP5A 3C4FA 4PMMA 3E92A 4RMZA 4RVMA 4S2ZA 3T54A 5LP6F 3OTVA 3W0RA 4EK8A 1FGIA 2C6IA 3TKIA 5HVKA 4F6UA 2HIVA 2PTKA 3PA5A 1KUTA 2F7EE 2Q83A 3GOKA 3FZTA 1GNGA 5CA1F 3C0HA 4EC8A 3IQ7A 3TV4A 1J7UA 1TQIA 4AACA 5I9XA 3T99A 5DOSA 3FBVA 2X8IA 3HECA 2J0JA 4ERWA 4AXFA 1XR1A 2WFYA 2JFMA 4QMSA 5FDXA 5JKGA 3AW8A 1VR2A 3TI1A 3LQSA 3RJCA 4JRVA 4FTKA 2HCKA 4CGAA 4O0RA 3O50A 3A7IA 4O82A 1YHSA 2CDZA 4RG0A 3UYYA 5KX8A 1NXKA 1A06A 3VHEA 4E5WA 1YQJA 3DKGA 4OLIA 3UIUA 2X2KA 1VBGA 3TNHA 2J90A 5HG9A 2XK8A 1FINA 3DY7A 3SV0A 4DBXA 4DG3E 3FLSA 2OU7A 3BL7A 3MTFA 1JKLA 2LGCA 2QR7A 5FXSA 4GEOA 5BNJA 3MJFA 1KTAA 2JDVA 3RP9A 1JKSA 3E8DA 4FOCA 2JIUA 3N9XA 1KE7A 3FKOA 2Q0BA 4BB4A 4UCTA 3RINA 3EQCA 2XNOA 4G5PA 4DEEA 2OJFE 4GUBA 5CAEB 4FZFB 3H9FA 2WGJA 2W06A 5AIKA 2JKKA 3PP1A 4RIYA 2X81A 4B9DA 4EOSA 1F3MC 3NW5A 5T6KA 1YXVA 3ML1A 3TUDA 4IJPA 3GU8A 3A7HA 3B2TA 2CNQA 4FNZA 4J96A 5A14A 4UV0A 4CKBA 5ACKA 3MYGA 1SNXA 3I7CA 3W0SA 1KJJA 4JLCA 3P08A 2VTTA 2OW3A 3OC1A 4IAZA 5AP2A 4DEDA 5JQ5A 2R3QA 5KZIA 4YJQA 3E5AA 5DN3A 3C4CA 5DT4A 3I4BA 4QMWA 1PY5A 1RQQA 3AGLA 4GVJA 4FJVA 2VO7A 3EOCA 1MRUA 1SVGA 2GMXA 4QP3A 3QTXA 3CXWA 1CSNA 1P2AA 3U6IA 3P86A 3OFMA 4TL0A 5FM3A 2R3IA 2JGZA 3POZA 4UYNA 2VO3A 4ZAUA 2WNTA 3DQXA 4ZQIA 4A06A 4PL3A 4MKCA 5CSWA 5E25A 4C62A 4FNWA 4OTGA 1FGKA 4ZP5A 5BPHA 4RX9A 3FLYA 3ZSHA 4G9RA 4ENYA 3LPBA 5LMKC 1KBLA 1WCCA 3UMWA 1TVOA 4X3JA 2C0IA 3PY0A 5FM2A 5FGKA 2GPSA 1P4OA 2PSQA 3R9HA 2WYOA 4JXFA 4GG5A 3UDSA 3V5LA 4DFZE 3BHHA 2RG5A 4YTFA 5K4IA 2EJ3A 4FTOA 4P7EA 3VS4A 2UZLA 3FKNA 1UVRA 2C6KA 3R73A 4ZJVA 4E5AX 5CZHA 4J1RA 1O6LA 4NW5A 4EOMA 3V5TA 4MV4A 2Y6OA 2XNMA 4BCKA 4CNHA 4L53A 3VUIA 4EGJA 5HCYA 4LH7A 4P90A 4MAOA 3W32A 5KNJA 2WMSA 1YW2A 5HBHA 5LVOA 1JLLB 3JZIA 1EH4A 4J71A 5M44A 5DFPA 4ZXTA 4DEIA 2VWZA 4EEVA 4L46A 5CSHA 2F49A 5IQCA 2YM5A 3PSBA 4DBNA 3GENA 4E73A 2X9EA 1CS0A 3GU6A 4U43A 4R7HA 1MRVA 4IM3A 5FD2A 3AQVA 4L42A 3KGAA 4N6ZA 4FEXA 2F2UA 3WWJA 4HNTA 1YI3A 4WHXA 1PXLA 5F95A 4IWDA 2RFDA 4XRJA 5M55A 4MA5A 1KJ8A 2QURA 4NW6A 1QPJA 1ZZ2A 3ORMA 4GMYA 3CJFA 4YO6A 5BVEA 3VS2A 4Z7HA 5M09A 3I7BA 2VTPA 3ORLA 5F20A 3HBLA 4XG8A 4JT3A 3COHA 4UZHA 4J53A 3GLKA 3MA6A 4R3RA 3MESA 1T45A 3LW0A 3PPKA 4G3FA 2CKQA 1H27A 1KSWA 2FSLX 5EM6A 3KREA 3VUHA 4HR7A 2GDOA 3WE4A 1G3NA 1OPJA 3SE7A 3WIKA 3L1SA 3SG8A 2ITOA 4AA5A 5DPVA 2QB5A 4YTHA 3LQ3A 1I1LA 2QOHA 3QRJA 4L7FA 4ANSA 4F7NA 2PVYA 4PDPA 5GJDA 3R7VA 2YN8A 2BKZA 2WQMA 2VTIA 4FTLA 4D4VA 1PW2A 4YTCA 4ACHA 2NU9B 2CHLA 2WXVA 4I1ZA 2OZAA 3P78A 4M8TA 4RWJA 3F2NA 1XJDA 4QEBA 2HW7A 4ZTLA 3S2PA 2YM8A 4ITIA 3GB2A 4IVAA 4IWPA 5L2TA 4RA4A 2PUUA 4XX9A 4FT9A 2A0CX 3PFQA 3BCEA 2IN6A 3ZCLA 4DCEA 3TINA 1YRPA 1Z5MA 5TR6A 2YRXA 3V5WA 5BQ0A 4JXUA 3OOMA 2V62A 3OY3A 4XYFA 3ZRLA 5AV4A 4TNBA 5ETFA 4I6HA 4K2RA 1WZYA 2F4JA 4UBAA 2X7GA 3UGCA 3ZU7A 2C4GA 2J0MB 4K11A 3ZONA 4YURA 1Z9XA 4ZLZA 5IDNA 4IAYA 1JSTA 3T7AA 3BGPA 2XK9A 3BAAA 2GQSA 3NLBA 4GKHA 4TYJA 4N0SA 4XG6A 3P7CA 4FFLA 5ANKA 1H00A 3F66A 2PE2A 4ENXA 3FSFA 1Q8YA 5M56A 2B4SB 2P55A 2YWPA 4RJ6A 4C37A 3FMHA 3L8SA 3KRRA 5CENA 5GHVA 3TYKA 3R5XA 2HVSA 4FZ7A 4Q9SA 5LVPA 5L2WA 5BMVF 1CDKA 3IGOA 4MXAA 3PWDA 4X3FA 3VHKA 4NM0A 5I5VA 1K2PA 2J0KA 5JRQA 1O9UA 4IMYA 4U9AA 1YOLA 3ORTA 3R01A 4QDEA 3JVSA 5HU3A 4XEYA 1YHWA 3RAHA 5EI2A 5KKNB 5DBXA 1KEEA 2OH4A 2YM7A 5D7VA 3PG1A 2BUJA 3GXLA 2C1BA 3FL4A 5EYDA 3OXTA 5A6OA 2PMLX 4ERKA 5CEOA 3R9NA 3QUEA 5LXTF 1ZMUA 3HMIA 2YAAA 3F69A 5IA0A 5GIOE 3F88A 2NU6B 4FUYA 3D14A 3U9SA 4GYIA 4V05A 4DFNA 4Q5EA 2YITA 4HNFA 4I5CA 2EUFB 2ZM1A 4L3PA 3ZDIA 2FB9A 4O6EA 4FFRA 4G34A 2E2BA 3VOTA 4FU0A 4NJDA 3TIYA 3R8UA 3SC1A 2WPAA 4WBBB 5IH4A 5EK7A 3VBVA 4L7SA 2UW3A 3QUDA 4BDEA 2X2MA 1IYEA 4JQ8A 3GC7A 4Y46A 3P7AA 3MB7A 4BCNA 4EH9A 2X0GA 3PXQA 3EFLA 3H4JA 4IH8A 2G01A 3DNEA 3MSSA 4F99A 3NGAA 4IAAA 3W2CA 5J9YA 3TJDA 4FSTA 4ZTSA 4ME6A 4FSQA 4N57A 3SOAA 3SRVA 2SCUB 4RIXB 4TY1A 3SX9A 5DR9A 4W4WA 3RVGA 4L52A 3RWPA 4NKAA 4FA2A 2O65A 4ZOLF 4O2PA 4OBQA 4EBVA 4BBMA 2YM4A 3GCQA 1FBNA 4BZNA 3BG5A 3JRXA 3KRLA 2Y4IC 4QNYA 4TWPA 4Y95A 5BPYA 5JFSA 5C8YF 3QKMA 1R78A 4I55F 3P4KA 4ZTQA 3UVRA 5CU2A 2QNJA 4D4YA 2G2FA 4NCTA 4J52A 3TZMA 2WKMA 4DH1A 3LVPA 2PMNX 3BIZA 3AD4A 3GI3A 4DTBA 3NNUA 4H36A 2FGIA 5G6VA 2HW6A 3PVUA 4WUAA 3W2SA 4E6NA 3D83A 5TKDA 5GNKA 2X8DA 4C34A 2W6ZA 4QO9A 4MXCA 4F9YA 3R2YA 4WKQA 2EVAA 3QKKA 3QQHA 2W4OA 5GJGA 3ZBXA 2EXCX 4KBCA 5G1XA 1ZYCA 5IUIA 3M1SA 1Y91A 4FV3A 5AJQA 1WR2A 2R3RA 3V04A 4MTAA 4F1MA 2IPXA 4ITHA 2HWPA 3QC4A 4XBUA 2RKUA 2ZMDA 4M14A 3ZBFA 3ZLYA 1Z2OX 4RFMA 4D0XA 3ORIA 4ZTHA 3SNOA 4U0IA 5M57A 2ITXA