3KREA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase from ehrlichia chaffeensis at 1.8a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
237
structure length
237
Chain Sequence
EKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKKLIDKGIKTHFISLLNQREQLVKKITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEFYYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILSELFFNVGIKLVDFKLEFGKLHNDEQSDLFLADEISPDTCRLWDISTNKRLDKDRYRLNLGNVIEGYREVAHKLNAIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase from Ehrlichia chaffeensis at 1.8A resolution
rcsb
source organism Ehrlichia chaffeensis str. arkansas
total genus 82
structure length 237
sequence length 237
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2009-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kreA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kreA02
2PMIA 3ZLYA 2QU5A 4RJ6A 4OLIA 3ZBXA 3QTWA 3WYXA 3ZYAA 4EEVA 3E88A 3R9RA 2OJGA 4FV0A 4OGRA 1GZNA 2A27A 2VWXA 3OT3A 4I6HA 5HZNA 4QMXA 3HX4A 3DB8A 3C50A 4Y85A 5L2TA 2Z7LA 1YOLA 4KBCA 5IQDA 3JRXA 4HYHA 1JWHA 3U6IA 4M0ZA 2OFVA 3FZPA 5LMBA 2ZDQA 2X8EA 1WBSA 3BE9A 4J99A 3WF6A 3K2LA 1KJIA 1H1RA 4HNVA 5D7VA 2WTWA 2E9UA 3TDWA 1W0XC 2XB7A 2YITA 4OW8A 3AD5A 3ORNA 2R86A 4JJRA 2ZJWA 5CEMA 2ZMCA 2ITVA 3ZLWA 2XBAA 1KJJA 5KMNA 5M08A 1XBBA 4DEIA 4CRLA 4HVGA 4F7NA 1RW8A 2PVRA 4GUBA 1KEEA 3EFWA 3HDMA 3P7BA 4C37A 2CKEA 2OF4A 3HLLA 4YAKB 4BI2A 2JDOA 2XNMA 4J53A 2QNJA 3PXZA 3C4ZA 3RFCA 5ACKA 4AA4A 1W93A 2XEYA 2H96A 3MFRA 2OXYA 3S3IA 4HJOA 1YOJA 2DWBA 2Y4IB 4BIBA 5AUZA 5B7VA 4TPTA 5CI6A 4ZMEA 2YM5A 4QP6A 4YURA 5AAFA 2UZVA 3FLZA 4RIYA 4L9IA 3ZM4A 4GIIA 3DZQA 2EWAA 3MW1A 3VN9A 1YXUA 2FB8A 3D5XA 3HV5A 3R9HA 4A4OA 1BL7A 4DG0E 3ZSGA 1ZZ2A 5BPYA 4I6BA 3R8UA 2UUEA 2XCLA 5AUWA 5HIEA 1R1WA 3MS9A 2XIXA 3QTRA 4K9YA 2XIZA 2F4JA 2JGZA 3EQFA 5E7RA 3FMNA 2R3RA 4WIHA 1Y8YA 2VO6A 4IE9A 1DAYA 4APCA 4C5AA 5IA3A 1GIHA 4G31A 3C4XA 3PJCA 3AOXA 3ZU7A 3U6JA 2BRMA 4CLIA 3GC8A 2OWBA 2ITXA 3LJ1A 2FPIB 4FV6A 2VTOA 3LCKA 4FKRA 4G17A 4EZ3A 1XR1A 3BRBA 5DH3A 3CGOA 3UIUA 4DEBA 1W96A 4AGDA 2C69A 3FY2A 4S2ZA 3BBWA 4U45A 4V0GB 2JLDA 3WF9A 2NU9B 3FHIA 3LW0A 4FV5A 4FGRA 1RDQE 4LOQA 3SA0A 2CNQA 1Q61A 3KU2A 5DE2A 4ZTQA 2C5NA 2PYWA 2WU7A 3D5WA 3UNZA 5CI7A 2P0CA 5ETIA 4LOOA 4N70A 3ZO2A 3I0OA 3K5HA 3BELA 3ULZA 1NXKA 5JGDA 1FVTA 3PSDA 4HZRA 4RC4A 3RMFA 4AZTA 5K5NA 3Q2OA 4LMNA 3VW8A 2R85A 1KE7A 3L8XA 5M4UA 4RA5A 5HE3A 4HGSA 3A4PA 5C03A 2VU3A 4TWPA 5GHVA 1DIKA 1Y6AA 5AP2A 4E93A 4YAJB 3VQUA 1FOTA 1U54A 1KV2A 4XP3A 3CJFA 3FUPA 3QRTA 5AX9A 4XMOA 4TN6A 3DTCA 2W6QA 3F3VA 4JQEA 2ONLA 4L7SA 1F0QA 3RM7A 4USFA 3QGWA 4MF1A 3LFSA 3OT8A 2BPMA 2B1PA 1E4EA 5IQAA 4F0FA 3RPOA 3UOKA 4U43A 3EIDA 5EI2A 2HELA 1H4LA 3VS5A 3V4SA 5FBNC 3HEGA 3W33A 3POOA 4FTIA 2FH9A 5A54A 2YZGA 3QUEA 1WVWA 2QOQA 5EM5A 3AC2A 2X4ZA 4B99A 5E8XA 3FZRA 3UTOA 5KKRB 4OT5A 4FNXA 3DBCA 4MNFA 4DF3A 3D2KA 5IQCA 4IX6A 4WNKA 3ZM9A 2CSNA 2YISA 4FI1A 4RGJA 3UIBA 4GRBA 4ERWA 1BMKA 1I7LA 3GI3A 2ITPA 4GVJA 4X2FA 3FZ1A 1ZZLA 2ONLC 3GVUA 3LFFA 5J9ZA 3CIKA 3ZZEA 3PRFA 2WKMA 1REKA 4OTFA 3MPAA 3DJ6A 3OUZA 4X6RA 5GJDA 1IG1A 1MRYA 3C4WA 4XRJA 4EH4A 4WBNF 4IFGA 3K54A 3KXMA 4JNWA 4CV8A 2J9GA 1V1KA 5EHOA 3OTVA 1NT2A 3L9LA 1JDEA 4DEHA 3QZHA 2Q0BA 3SXFA 4O27B 4R77A 2I8CA 2R3KA 4QTEA 3NDMA 3MESA 3P0MA 4UYAA 3N51A 3E87A 2BIKB 2R4BA 1ZOHA 4OTHA 3GQIA 5JT2A 4HYIA 3O8TA 2OFUA 3RCDA 3KC3A 3QTIA 1WAKA 3PG3A 3FL4A 5IA5A 3H30A 3NR9A 3ZO3A 2JBPA 3RWQA 4ASZA 4XP0A 1M7NA 3G6HA 4DN5A 4L3PA 4AA0A 4MNEA 4EH3A 4IVCA 1F3MC 3H0YA 3TQTA 4Q9SA 2C4GA 3ATTA 3BEAA 4YZCA 1UV5A 1E9HA 1PMEA 3OY1A 4GU9A 4Z16A 4E6AA 5ETCA 2PU8A 2RG5A 2UW8A 3C9WA 5EQYA 3MIYA 5HE0A 3ET7A 5IU2A 5JH7F 1UNGA 2BZKB 3P86A 3SC1A 3VUGA 2H6DA 1DV2A 4I0SA 5JN2A 2VR1A 3FMEA 2ESMA 2GNGA 4FTRA 2XD4A 1GIIA 2WPAA 3BG5A 3R7VA 2XNPA 3II5A 3ULIA 5I9YA 4L67A 2VQDA 5BYZA 5BVFA 2C6IA 4S30A 3DS6A 4K6ZA 4ITIA 2HW6A 3NYXA 2R3IA 5L8JA 3WNZA 3QHRA 4NUSA 5AUTA 2IG7A 3E62A 3KF4A 3DBQA 3LMGA 4J97A 1PHKA 3UO5A 3HMNA 4MXXA 3JR1A 3VS1A 1LP4A 4EH5A 5CS6A 4Y5HA 5HO8A 5IZFA 4FKPA 3EOCA 5IA1A 3IOKA 4FKWA 4R1VA 4MD8E 4N0SA 4MA0A 3R5XA 3F5PA 2C6EA 1R0EA 2ZDUA 4QMWA 4ZSJA 5HBHA 5JFWA 2DS1A 3BYMA 2BFYA 5FUTA 5HEZA 3RPVA 2HAKA 2XNGA 5FM2A 4ZMFA 2ZM1A 5JFXA 5KCVA 5KBRA 1RQQA 3F3ZA 2R7KA 3DBFA 2YYAA 1KJ8A 4AW5A 4FBXA 2Z8CA 2VPQA 4XG7A 3UODA 3IW4A 3E8CA 3TZ9A 3THBA 5CEKA 2WOUA 4DLIA 4FSUA 4JBPA 2R3QA 3OMVA 3N8DA 2F7XE 3GOPA 4YO4A 4X2JA 4BIDA 2A2AA 4F0GA 3W2RA 4UYNA 5HD7A 3S0OA 3R8VA 1H1SA 1TQIA 3BU5A 3MV5A 4DEEA 4FV2A 4R7HA 5AV2A 3VIDA 4F65A 4QMNA 1OPKA 3E5AA 5BMVF 2BALA 3K3JA 1DV1A 1M2RA 2GNIA 3PSCA 2C0IA 3FKNA 4I5HA 4HVHA 5IH5A 2R3GA 4E6QA 2BRGA 3RM6A 2RFEA 4YZ9A 2A19B 2PE2A 3QQUA 4IZ7A 1KE8A 3MI9A 3QF9A 5CTPA 2QURA 4JG7A 5LCKA 1OUYA 4IADA 1UKHA 2XRWA 3DA6A 3EL7A 3H9RA 4HGTA 5DLSA 3TZ7A 4XG4A 5CYIA 1OGUA 2FSMX 4XJ0A 4FTOA 4JVGA 1IASA 3VAPA 5IPJA 3RTPA 2B9IA 4BYIA 2BILB 3BQRA 4CGAA 3QQJA 3F9NA 4ENYA 1YWNA 2RFDA 3HV4A 3PJ8A 4ZTRA 2SCUB 2C6KA 4AN9A 2DWCA 3V8TA 3VPBA 3IONA 2XMYA 2WMVA 1WFCA 2P3GX 5CSVA 2FB9A 3WZUA 5GJFA 3B8QA 4DITA 4ASEA 3ZONA 5K5XA 1I44A 2I40A 4QMMA 3K3IA 3I0QA 2WD1A 4NL0A 2Y7JA 3MIAA 4FZ6A 4TT7A 3HRCA 2G2HA 5TO8A 4DT8A 4BCJA 4IW0A 5HBJA 4YPDA 5J2UF 3NUAA 4IWPA 4YZMA 4DAWA 3LM5A 3OEFX 3R71A 3N9XA 4OT6A 4EOSA 2VTSA 4W8DA 4F9CA 5KMMA 2W6ZA 1JOWB 2ZM3A 2ZV9A 4BCHA 3ORTA 3HV7A 2YZAA 3FKLA 3R7IA 1ZWSA 2QKWB 3WZKA 4AX8A 3NW7A 4DH8A 4F1MA 5M09A 3WYYA 1J91A 4YZDA 4A9UA 1H0VA 4NKSA 3E64A 3DK3A 3OC1A 1UU9A 3TKIA 4AE6A 4A9RA 4ANLA 4D5KA 2VTJA 5AA8A 4PNIA 4I0TA 2IW8A 5CAQA 3ORZA 3KAKA 3L8VA 4KBKA 3RPYA 3FE3A 2YACA 4PMMA 2HWPA 3ZO1A 2IVVA 3R2BA 4W4YA 2WQEA 3CQWA 1CE8A 3UDBA 4AGCA 4JXFA 1ZAOA 2IVUA 4U97A 5BX0A 4XYLB 1CKPA 4WO5A 3NAYA 3FSFA 4MNEB 2IN6A 3G2FA 5HTCA 4JR7A 3QXOA 4AAAA 3IK3A 3KVWA 5I5ZA 4DFNA 4G34A 3CPBA 1YW2A 3LMHA 4DBXA 2ERKA 2R7BA 3ATSA 3EQHA 4G9RA 5DIAA 1OKVA 3EFKA 4NWMA 1KE5A 2ZVAA 4EI4A 3PXKA 3BHVA 4ZK5A 3NVMB 5TKDA 3PA5A 3E8EA 1PRYA 2CMWA 2OJJA 2P33A 4ZLOA 2Z60A 4JIAA 4R3PA 5TF9A 2IZSA 2Z7SA 3JY9A 2QQ7A 3D5UA 3QTXA 4AT4A 4RQKA 3PVGA 5JGBA 5CU2A 5CEQA 5F1ZA 3UP7A 1NVSA 2G15A 2E9NA 2YEXA 3G0EA 3QLGA 4NH1A 4WA9A 4BGHA 4CV9A 3UOJA 3PLSA 2J90A 4HNTA 4O7ZA 5I9XA 3PWDA 5J2TF 1GNGA 5I9UA 5CA1F 4FKSA 4DLJA 3P4KA 4ZY5A 1YDTE 5CNOA 3B2WA 2YA9A 4RFYA 1JNKA 3WF8A 3GBZA 3HMOA 5H8EA 3ORMA 1WZYA 2OZAA 4C5BA 4TY1A 5M57A 3LXLA 2QD9A 3C5IA 1GSOA 3BI6A 3CTQA 1P5EA 4PL4A 4CZTA 1L8TA 1SM2A 4F9BA 4FL1A 3V3VA 3RP9A 1A9XA 1OECA 2R64A 4BDHA 3QRJA 3Q53A 4S33A 3ETHA 1OZ1A 3E3PA 4E4NA 4HOKA 4EL9A 4OR5A 4ALVA 1Q24A 3OOMA 3MB6A 4FIFA 4XV2A 1C3OA 5AADA 2P55A 2VO3A 5CSHA 4AZWA 5B2KA 4YTHA 2C6MA 4FUYA 4C62A 4G9CA 4FTLA 4EWQA 2JFMA 3BV2A 3HB9A 2C6TA 4GUEA 4KS7A 4XNEA 4BDJA 2XEZA 2WIHA 3FEGA 3QKLA 2Z7QA 5HTBA 3H3CA 3ZLSA 4MKCA 2WMUA 5IDPA 4K0YA 1FVRA 2BKKA 5FXSA 2ZDHA 2OO8X 2CGUA 3CPCA 5CAUA 1GZKA 1CMKE 4K18A 1TQMA 1YWRA 3V5JA 4QMZA 4D4SA 2GS6A 2I0HA 5I9ZA 4GH2A 5IEVA 4CFUA 1UWHA 5M53A 1YOMA 2QCSA 2XUUA 5CVGA 3G90X 4B0GA 4TYIA 3A7FA 2ZB1A 3MFTA 3QD4A 1IAHA 4USEA 2BRBA 2GU8A 4IFCA 2YM4A 1K2PA 2LGCA 3PIZA 5BUIA 3QKMA 4D2RA 1OI9A 3HYHA 4YBJA 5DYJA 1CKJA 4E6DA 3FMHA 5BUEA 3P1AA 5ACBC 4DIMA 3S95A 3FLNC 3F82A 4PMTA 5BMMA 5F4NA 4FKUA 4MV4A 1H28A 3C0HA 5HCXA 4RJ5A 3VQHA 1OL7A 1XH6A 4QMVA 3SQQA 1Z5MA 1H8FA 3OWJA 4E26A 2W1DA 3UGCA 2PL0A 1U59A 1EYZA 2OJFE 2ZYBA 3GT8A 3SGCA 4QP7A 5CALA 3W55A 1YKRA 2HW7A 4FFPA 4EK3A 4Z9LA 4EHZA 4CCBA 3VJNA 2BFXA 3HV3A 2CGWA 3V51A 4ACCA 2YW2A 2R87A 3K5IA 4H3BA 2P0AA 5CU0A 2X1NA 3I7BA 5E91A 1G8AA 3TW6A 5C4KA 4IEBA 5DT3A 4YJRA 3JRWA 3O8UA 4UWYA 4FT5A 4O7YA 2GNLA 4O7WA 5AUYA 4DINA 3KY2A 4QTBA 4TYHB 3F69A 3BYUA 2RFNA 3KRJA 2IVSA 5LVPA 3C4EA 3SAYA 4I93A 1OBDA 3RPRA 5CAOA 4TV9F 5IQEA 5FBOA 2J0IA 3E63A 3QUPA 5EK7A 2FO0A 4K11A 4O6LA 2BAQA 4JRVA 1H07A 1LR4A 4IHPA 5CXHA 2VX3A 5CSWA 3VUKA 4F99A 4PRJA 4FR4A 2X0SA 3UO4A 3NUUA 3FMMA 4Z55A 1J7IA 5G6VA 3VULA 3AQVA 4O0TA 2W9ZB 3EQPA 2QVSE 4MV1A 4RVTA 4PF4A 5L6WL 4PL5A 5E1SA 3KREA 3WZEA 3ORPA 3R30A 4NW5A 3VBQA 3R6XA 1MQ4A 5AP5A 3ZMMA 1XWSA 2QO9A 5FP5A 4CT2A 1GOLA 3GCVA 2C00A 2DLNA 4JBQA 1LUFA 2QOBA 3NX8A 1IEPA 2JIVA 2YN8A 3QD0A 1SYKA 4D1ZA 3VJOA 3W10A 3RAHA 3EN9A 3KXNA 4R3RA 5IMEA 2ZAZA 2XK8A 5EM6A 2VX0A 2BZJA 5CF4A 1CQIB 3OUUA 4U44A 2OIBA 4Z3VA 2PN1A 1H24A 1PX2A 2CPKE 3E8DA 4D55A 1XBAA 3FAAA 4FT3A 3REPA 3EZRA 4IBMA 5JRSA 3QGYA 3TDVA 3PG1A 4FZDB 2NO3A 3HP5A 5DPVA 1OKZA 1H08A 1SMHA 1MUOA 3EN7A 3FSKA 4GG5A 2X9FA 4ID7A 3ZH8A 4QQTA 2J0LA 3R7EA 1Z2NX 3RV3A 3Q9WA 4CTCA 3ODZX 3OEZA 2BR1A 4TL0A 5M4FA 4Y83A 5KE0A 2OZAB 4OUCA 3I12A 4UN0C 5B2LA 1B6SA 1WVXA 3MJFA 2X7FA 3FQEA 4GV1A 4D4RA 2BROA 5KUPA 3PXFA 2XIYA 3AW8A 3MWDA 4IH8A 2XK4A 3DGKA 4L45A 3TNIA 4AACA 5C01A 1APME 2JDRA 2WOTA 3ZDIA 5DWRA 3KA0A 3FYKX 4F1OA 2FPGB 3L9NA 3LMIA 4G6NA 5LWNA 2C5YA 2Y4IC 1QMZA 2YZNA 4JS8A 4BZOA 2NPQA 3KVXA 3QA0A 4ARKA 5EYDA 3KQ7A 2WMAA 4QMLA 5KX5F 3U51A 4HGEA 5E8YA 5FP6A 4C02A 3NRMA 3O51A 5A3XA 3LLAA 3FXZA 4IDTA 4A7CA 2WTCA 4FSYA 1UNHA 1B6CB 5C8NA 4FT7A 5J7HA 4O7VA 5EDRA 3ZXTA 4ENXA 1Z57A 4FC0A 5CT7A 2HXQA 1U5RA 4J1RA 3S4QA 2V62A 1JKSA 2WXVA 3W8QA 4BTKA 4XUFA 1OBGA 3S2PA 4KSPA 3R73A 4FKJA 4KS8A 3BWFA 4XX0B 1PMNA 2GQSA 1KC7A 4BR3A 2FSOX 5C27A 3MWEA 3QQLA 3UG1A 4RA4A 4IX5A 4ZTHA 3TINA 5E8UA 2H34A 3TIZA 3QU0A 4Y72A 3KULB 3LFQA 1AUXA 3EQIA 4RC3A 4U80A 2X2KA 4CFVA 4O2ZA 2VAGA 5IUIA 1U5QA 2KTYA 4J71A 4FKOA 4R5SA 4ALUA 5C1QB 4RWKA 2JFLA 3RK7A 4IIRA 4K1BA 5BVDA 4XG3A 4DYMA 4CVAA 4EHVA 4A06A 1TVOA 4ANMA 3PY0A 2WQBA 1PJKA 3M2WA 4QMOA 3TTJA 4BCPA 4FV4A 4TWNA 2W1HA 3D5VA 2ETRA 2W17A 2CHLA 3LQ3A 4QPAA 2CN8A 1UVRA 3V5WA 4PDYA 2YFXA 3SV0A 1XO2B 2R5TA 3FKOA 4YJNA 2YCSA 3SOCA 3TXOA 2G2FA 4E73A 4XH6A 3NW6A 2W1CA 1IA8A 3AMAA 2F57A 3R8ZA 4BBMA 5JQWA 3R1SA 2F9GA 4U79A 5HVJA 4P90A 4EOIA 1M0TA 3R22A 4IWOA 4WRSA 5EW9A 4IWDA 1GSAA 4O4IF 3BGPA 3FI8A 5GNKA 2RFSA 2UZLA 3JUHA 4QMUA 3G8DA 3VBXA 2V59A 3O50A 5AAGA 4F9WA 4FTTA 3TIYA 2A1AB 3PZEA 3VF8A 4H3PA 2W70A 4ZSGA 5ANOA 2PVFA 2UZNA 1B39A 3COMA 5AP7A 3F7WA 4E8AA 3DK7A 4LI5A 4LV8A 4DFUA 2PPQA 4JDHA 5AP1A 3TNWA 4EQMA 4IZOA 5FTGA 4G3EA 5H2UA 2YM8A 1BI8A 5A14A 4TV8F 3O2MA 3DXQA 4DH1A 2PUIA 2QOFA 4TTHB 2GLTA 4GW8A 5CX9A 1W98A 2W96B 4ZSAA 3FMLA 3ZEPA 4EZ7A 1YVJA 2VWBA 3CE3A 5EQPA 4I5CA 4CFWA 4IDVA 2ITYA 2P2HA 4IHJF 1A06A 4M69B 4YHFA 5KKRC 2PBZA 4O7RA 5HLPA 1ZXEA 4RJ3A 4EKKA 1PXLA 2BDJA 2REIA 3BKBA 3GC9A 1CSNA 1U4DA 4JQ7A 3RK5A 5L2IA 1YWVA 3RK9A 2GCDA 1ZMWA 4I1ZA 1J1CA 2VNWA 2YM7A 3VF9A 5DT0A 4BB4A 3BHYA 4TYJA 3NIZA 2J0MB 2QK4A 4I5MA 4EH9A 3HMPA 2PE1A 3MH0A 4DGMA 4NTTA 4YB8B 4JG8A 3PLAE 1BUHA 2YABA 2EU9A 4O84A 3TKUA 3A7GA 3VVHA 2HENA 4N4SA 4BIEA 1PXMA 2KULA 5CXZA 2V58A 3AC8A 4HR7A 3DFAA 2PWLA 3SXRA 3TM0A 3IW8A 1W7HA 5F94A 3SRVA 2FYSA 4FTCA 4JX3A 3UOLA 4EJ7A 5GINE 3E5NA 1V0BA 2BRHA 5E8TA 5L6PA 5JVDF 4FX3A 3V6SA 3QX4A 1PXJA 2BTRA 2WZJA 3NYNA 5HCZA 4ZZOA 3MDYA 2B4SB 4EOJA 4PTEA 1G5SA 2Z2WA 1OMWA 4JQ8A 5JRQA 2CGXA 4FK6A 4WRGA 3V5TA 4CXAA 3CKWA 4NM5A 2PHKA 3Q6UA 4MXCA 1P2AA 2UZOA 2GTMA 3F2NA 3MPMA 3PXYA 3R23A 4ZEGA 1EUCB 5JFVA 2OKRA 3FXXA 5HQ0A 4FOCA 2GTNA 3RAIA 4DH3A 4RZWA 4ZP5A 4DEGA 5KHXA 3QCXA 2YJSA 3Q9XA 4NJ3A 3UMWA 5BNJA 4Y5QA 2PULA 2GPWA 4GEOA 3VBTA 4CKRA 3JZFA 2HZ4A 1GY3A 2Y6OA 4YNEA 5CU3A 5J9LA 4V05A 5FXQA 4PP9A 3C5UA 5FEQA 2R7MA 2B0QA 4RX7A 4YO6A 2JKMA 3N6RA 3Q2MA 1FQ1B 2HZNA 2UVZA 5ETFA 3PE1A 2VNYA 5HKMA 3RVGA 4MAOA 5FDPA 4RFZA 4BDIA 4C58A 4X2NA 5CNNA 3FC2A 3P7AA 3P78A 4UXQA 3CTJA 1CTPE 2R3FA 3MA6A 3PP1A 4GKHA 4U3YA 4Q5EA 4XCUA 1FMKA 2UVYA 3ZHPC 4C7TA 4FKVA 4GU6A 4YLJA 3ZXZA 3EHAA 2IO6A 4EOMA 4A4XA 2VTPA 2XM9A 3R04A 4WOVA 4A9TA 3M42A 2QOCA 3JS2A 4HYUA 4TNDA 3A2CA 1WBWA 5KKNB 2EXMA 5AV1A 4FZFB 2ACXA 5EOLA 3TT0A 3QC4A 4ZJVA 5A4CA 4I94A 2UW9A 4FV8A 5HG9A 1B38A 4ZJJA 4I4FA 1FPUA 1W8CA 3LCTA 4XHKB 2HCKA 5HNGA 4CMTA 3MJ2A 4M7IA 5G1XA 4CFFA 4O7TA 5CAVA 4FFNA 4PY1A 1JLUE 2YAKA 4FIGA 2GHMA 4GIHA 4JI9A 5H3QA 4RX5A 5L8LA 2R9SA 4AOIA 4QMSA 2QI8A 4U3ZA 2I1MA 4YPSA 3FQSA 4EQCA 5IEXA 1EHIA 3AC1A 4DGLC 3TV7A 2QODA 3LFDA 2WU6A 3R02A 4FV7A 5AV3A 2OLSA 4QYGA 5HIDA 3R8MA 4TKSA 4CFMA 3FJQE 5HX8A 5DT4A 3IKAA 4I22A 4NW6A 3HVCA 4B7TA 5T6KA 4IACA 3TV6A 2B54A 4LOPA 1Y8GA 2OI4X 4CQEA 4O0UA 2YIRA 3QCYA 3A99A 3FBVA 2WMXA 3ORLA 3OY3A 4GYIA 5DNRA 2YWVA 5BQ0A 4QSHA 4NM3A 5D10A 2I87A 1JSVA 4XLIA 2FPPB 4APPA 3BGZA 3DQXA 3OFMA 3VO3A 2X9EA 2UZUE 3N4UA 2GMXA 3I6UA 4O0RA 2ZM4A 2Z02A 1CDKA 3BX5A 4MD7E 3VBYA 4B8MA 4RIWA 3LJ0A 4DGNA 3FMKA 1OIRA 4E6CA 4O4HF 4WG5A 3KKVA 1MRUA 2NU6B 4S32A 4O7SA 3ZC5A 2LAVA 4UY9A 3ROCA 5DG5A 4OBPA 3HUCA 1HCKA 5FTQA 3TACA 2PSQA 4BCGA 4D0WA 4YC6A 4BCQA 1UNLA 3GU8A 3NZ0A 4YTFA 1MP8A 1BI7A 4FICA 4Q5HA 2BAJA 2OXDA 5LP6F 1PXOA 1NW1A 1STCE 3UZPA 1CS0A 5E8WA 3MTFA 2QR7A 5DR6A 3SD0A 4OTRA 1YI6A 4FKQA 1SNXA 3FWQA 1KSWA 3VWAA 2OGVA 2PTKA 3EQDA 2WGJA 3V6RA 5LQFA 2WAJA 2W4JA 3JVRA 1ZARA 5DOSA 2BVAA 4BBEA 4EBVA 3MVJA 2JD5A 3JPVA 3KMMA 1O9UA 3Q3BA 3ETJA 3F2AA 4D9UA 4O4LF 4WNOA 4LRMA 3BYOA 3D4QA 4F09A 1FINA 1SZMA 2FVDA 3KCKA 2XK6A 2QG7A 3D0EA 4EHEA 1WBVA 3F61A 3U55A 5A4QA 3SRVB 4J96A 3EN6A 5DRBA 2XF0A 5CVHA 3VRZA 4BCOA 3GENA 2GFSA 3VS0A 1JQHA 3GCQA 3R1QA 4FMQA 2JAVA 4L3LA 4OBQA 2RF9A 3IG7A 3D15A 3G9NA 3IW7A 4DE4A 3UE4A 1YQJA 2PK9A 2OU7A 2X39A 3GB2A 2J0JA 2G9XA 4E7WA 1J1BA 3A61A 3ID6C 4NFNA 5KBQA 2HK5A 3ZUUA 2CCHA 1YDRE 3ACJA 4MH7A 1IOVA 2E9PA 5TOZA 3TUDA 2C6LA 3RPSA 3WBLA 4AW1A 1Q99A 4BDBA 4KAOA 2V22A 4Z7GA 2VTMA 1UU7A 4XRLA 3TNQB 4U41A 2Y0AA 3MFUA 4XV1A 4PWNA 5K9IA 3Q5IA 4AT3A 3PP0A 2XS0A 4MEDA 5LVNA 4MV7A 3EZVA 3GU6A 3OXIA 3OXZA 2PVNA 3ZLXA 2XYUA 1WVYA 4BICA 5HV6A 2HZIA 1NVQA 2O5KA 4G5PA 1V0PA 2OXXA 4RC2A 3AD4A 3FLWA 1Q5KA 3HP2A 2JEDA 2Q83A 3O23A 2HIWA 3RNIA 4RWJA 3Q32A 2X7GA 4LYNA 4DCAA 3MFSA 4Q2AA 3TIIA 2OF2A 4YUQA 3BPRA 2ITNA 2RIOA 3BGQA 4O86A 3SG9A 5CZHA 4IM0A 4ZLYA 4L6QA 4MWIA 2VWWA 3R9OA 5I4NA 2FA2A 3UO6A 2F2UA 3E7VA 5AUVA 3VS3A 4X3FB 1J3HA 2FSTX 4GCJA 4M13A 1Q3WA 4LRJA 3UQCA 1A9UA 2I0VA 4WBBB 2YS7A 3QTSA 4YU2A 3BU3A 4PP7A 1OPLA 3O7LB 4FEUA 3Q1KA 4FKIA 1UWJA 1YXVA 4B9DA 4E4TA 4QMPA 4EOLA 4FTQA 1PXIA 2QONA 3QCSA 3W16A 3BYSA 4CLJA 1IA9A 1AGWA 2IVTA 3KCFA 1OIUA 3PJ3A 3QQHA 5M06A 1FVVA 3VS2A 4NZWB 4WHZA 5CU6A 2YDIA 4I3ZA 1JLLB 1JBPE 4WSYA 4BGQA 3PRIA 4RPVA 5H9BA 2R0UA 3BHTA 4UV0A 4FSWA 2YL2A 5E1EA 3FYJX 3OWLA 4RQVA 1PXPA 3W18A 2HYYA 1E1XA 1KJQA 3JYAA 4CG9A 1KWPA 3DLSA 4FYOA 2XK9A 4II5A 4A9YA 1Q97A 3KGAA 4EOKA 2GHLA 5BYLA 5BVOA 5LCJA 2XNOA 2WTVA 5BVKA 4AN3A 3PA3A 3V04A 2EUFB 1H0WA 5HLNA 5BMSA 5J1VA 2W1GA 2DQ7X 3BIZA 5DVRA 2R3OA 3Q4ZA 4YJPA 5LVMA 4FG8A 3WOWA 4ANQA 4BZNA 4ZXTA 1BXRA 3WO0A 4ZI7F 5LYJF 5T68A 4I55F 1YI3A 5HIBA 4EORA 3QTUA 5EYMA 4L01A 5HICA 2IZTA 4RIWB 3UPXA 2FUMA 5FM3A 3V8WA 5LA6F 3P9JA 1NY3A 4NM0A 4IZ5A 3SX9A 4Q9ZA 3LAUA 5D11A 5BVEA 3ZS5A 1WBOA 3A8XA 3C51A 1GJOA 3AC5A 4FE2A 1O6LA 2UZWE 4HCUA 3R1YA 4EC8A 3ORKA 2C6DA 3NWWA 4RT7A 3ZUVA 3EFLA 4RX8A 5CEOA 4FVPA 4OBOA 4RLKA 4TYHA 4EWHA 1PXKA 5L2WA 1M7QA 2HXLA 3IDCA 2YRXA 5ICPA 3ERKA 3UYTA 4AP7A 3KL8A 3FMJA 4QTCA 4OTGA 4ACDA 3NYOA 5KMIA 2YS6A 4IX3A 5BVWA 3HRFA 3B2TA 3GU5A 4D4YA 3QD2B 5JKGA 4J52A 4O0YA 4TUYF 3GOKA 4UX9A 2EVAA 2PMOX 2AC3A 3A7HA 3I7CA 4YJOA 4IAKA 1YDSE 1B6RA 3G8CA 4HZSA 3VBWA 2PZRA 4JBVA 3HAMA 4RMZA 4EH7A 3ZOSA 4IAIA 2PVHA 4E5BA 1DS5A 3T8OA 2C30A 4F0IA 2QU6A 3MY0A 1Q4LA 3ENHA 5DFPA 3U9CA 1RJBA 5FEDA 5HVYA 5EKOA 4QP8A 1ZYDA 2C0OA 2CLXA 3F6XA 4U42A 3WILA 5AP4A 4DC2A 5ANGA 5CLPA 3KALA 2WTKB 4M3QA 1Z9XA 4V04A 4EBWA 4RJ4A 3MVLA 2B9JA 2ITQA 4GG7A 4A4LA 3WIGA 2C6OA 4YJVA 3BHHA 3AG9A 5K4JA 4YBKA 3TV4A 4AE9A 3GCUA 3DCVA 1A48A 2BHHA 4FV9A 4ZAUA 3CS9A 3IGGA 2XBJA 4TW9A 5J8IA 2BZHB 2W5HA 4KSQA 2IWIA 2YHVA 3LFEA 3PY3A 3AD6A 4FIJA 4K77A 4ZY4A 3VUMA 4JDIA 1Q8YA 1BX6A 1OITA 2OICA 5IQFA 4U81A 2ETMA 2VZ6A 1DAWA 3LE6A 3MWUA 3UQFA 2XKCA 4H1JA 4BDAA 4EK4A 1MRVA 1WCCA 4R3CA 3QUDA 4ZTNA 3IECA 4GFMA 1YXSA 2Y4PA 4C2VA 1M6VA 3PVBA 5KNJA 4LMUA 5LMAA 3NGAA 4GJ2A 3QZIA 1TQPA 3E3BX 4MXZA 1EH4A 3F66A 3I81A 4FEWA 4Y46A 5HI2A 1FBNA 3MTLA 3V01A 5KX8A 5EHLA 5F20A 5EQEA 5J87A 4R5YA 4IZYA 3AMBA 3FZOA 4RZQA 4AS0A 2I0YA 3ZZWA 2DZDA 4KB8A 2QLQA 4C59A 3L1SA 2BAKA 3AT3A 1JKJB 4YR8A 4O2BF 3I1AA 4ZOGA 5FD2A 3QX2A 4ZJIA 4EH6A 3AT2A 2BUJA 2XVDA 5E90A 4FNYA 3OD6X 4QP4A 2X4FA 5ANKA 5FQDC 4R1YA 1XKKA 4RG0A 4GK2A 5AIRA 2WQMA 3IQ7A 5CQWA 4JRNA 5A9UA 4FK3A 4IMYA 3UYSA 3DKFA 4QQCA 2QOKA 4CT1A 3G33A 2JKKA 3AMYA 3FDNA 3AT4A 3KULA 3OZ6A 3PXRA 4NJDA 3R7YA 4E1ZA 5JMSA 3Q4UA 1AD5A 2F7EE 2B53A 2PZIA 2YIWA 4DTBA 1H01A 4I4TF 4DGGA 2JAMA 3EMGA 3MH1A 3D14A 4QPSA 3BQCA 3UPZA 3QBNA 3CLYA 3QLFA 3Q52A 3UIMA 5D41A 3SLSA 4KBAA 3ANRA 2WTDA 4XV9A 4QTDA 1DI8A 3FI4A 3FZSA 1ZY5A 3OHTA 4FSQA 4XS2A 4C35A 4RZVA 3K3PA 4KUJA 4J98A 4ACGA 2J6MA 5M44A 4N6ZA 5EG3A 3TUCA 5H80A 4ZQIA 2WFYA 4LL0A 3TCPA 3BBTB 1P4OA 4ZSLA 3F5GA 3QTZA 3KN5A 4J7BA 3DZOA 1OL2A 1XQZA 1YHSA 4FKGA 4C0TA 1KUTA 1BL6A 3KRWA 4BC6A 4ZTMA 5L8KA 4WUAA 5EW3A 3OUKA 4W4VA 4AZFA 4BI0A 4BCIA 3UMXA 1Q41A 1R0PA 3G5DA 2W6NA 4FKTA 4XBRA 2CKOA 3CEKA 4U9AA 4C36A 2BKZA 2PVKA 4IVDA 4YLKA 5HG5A 4NU1A 1KE6A 1PYEA 4MHAA 5KMOA 3R5HA 1QL6A 3ELJA 3IGOA 2PZPA 2VTIA 3KMWA 1NA7A 3QWJA 4QQJA 4TYGA 1R39A 2CZGA 3ENMA 3PY1A 4FV3A 1S9IA 2H9VA 3V5PA 4JX7A 3ZO4A 2X2MA 4GSBA 1FMOE 4O2PA 4DG3E 3FMDA 4V01A 5IH6A 5KMLA 4IB5A 3MVMA 5JGAA 2BTSA 5AEPA 4MAMA 1OVEA 2G2IA 3QKKA 3TL8A 5E9EA 4ZTSA 5AUUA 4I4EA 3PA4A 4U0IA 2R7NA 4XX9A 4AWIA 3ROYA 2NU8B 1W82A 2W99B 3IW6A 2UVXA 3GU4A 2W1IA 4YJ2F 3D94A 5H8BA 1PMUA 4LV5A 2Y6MA 4Y73A 1NVRA 2E9VA 3CQEA 1Z2PX 3VA7A 5D12A 2IZUA 3MA3A 4G2FA 4Y8VB 4QTAA 1Q8ZA 3PIYA 5AV0A 3LQ8A 3WO1A 2C3JA 2GNHA 5CU4A 3ETAA 3LIJA 5HU3A 2JIIA 3LFCA 4H36A 3MH2A 4TWCA 4RIXA 1VBGA 4UB7A 4FG7A 2UW3A 2WIPA 3EN4A 4JAIA 4PL3A 4KIPA 2R7LA 3I5NA 5CB4F 3R83A 3H9FA 3L8PA 4D1SA 4UWBA 2QC6A 3WZJA 4G3DA 3WF5A 4FSRA 3G9LX 2XJ1A 2GDOA 3DKOA 3BE2A 4AZVA 5ETAA 2OW3A 2GPHA 3C13A 4HVIA 4BI1A 2I80A 4RVMA 3DV3A 3HBLA 3MBLA 2YWPA 3FC1X 3L9MA 3GIDA 2OJIA 3OBJA 3SKCA 3M1SA 3ORIA 4P7EA 4DLKA 4NKAA 1GZ8A 4FEVA 4M97A 2WO6A 4EOQA 3ZRMA 4QYHA 5ANIA 5D1JA 3FPMA 4RLLA 3CD8A 3DK6A 4UEUA 4LQMA 2XKEA 2E2BA 5HG8A 4FEXA 3QL8A 4D5HA 4O0VA 3OROA 5M55A 5GIOE 4ZZMA 3I5ZA 2XIKA 2CLQA 3HRBA 4XG2A 4AGWA 5HX6A 4IAAA 3Q9ZA 4H05A 5FGKA 3S00A 3EQBA 2VWYA 2B9HA 3NUSA 3NVKI 2PZYA 2C3IB 3GP0A 1QPJA 3HUBA 4UWCA 4FTKA 2VTTA 3FY0A 3SDJA 4ZZNA 4IC8A 3KMUA 1C30A 2X6EA 3SW7A 3BLRA 4DCEA 3IDBA 2ERZE 4W4WA 4M9UA 2W1FA 1IAJA 1OKWA 1BKXA 3LLTA 3COKA 1G3NA 4AW2A 5LARA 4G3CA 1VJYA 4ZS4A 5IYZF 4FSZA 4QNAA 2X0GA 2YCFA 1RE8A 4XYFA 2QF7A 1T36A 1OB3A 5CA0F 2DIKA 3BLHA 3K5VA 4LGHA 1KOBA 4IJPA 4YTIA 3U4WA 1CQJB 4U7ZA 5B2MA 3D83A 5CANA 3RAKA 2ZOQA 3NUYA 4ZLZA 5HO7A 4M14A 4AFEA 4EC9A 5EM7A 4DFBA 3HGKA 3QYZA 4O0WA 3MPTA 3UP2A 4DEAA 3V4ZA 4O7LA 3PWYA 1M2PA 4MXAA 4R7BA 2Z7RA 4PDPA 3SG8A 2O3PA 3DJ5A 2GQGA 4BDCA 3RI1A 1CM8A 2XNNA 4RWLA 1LEWA 3UOHA 5GJGA 3V5QA 1M17A 3R7OA 4BDEA 5DMXA 3DPKA 4L1KA 1JSUA 2IW6A 5HNBA 4GFGA 3D7TB 4MTAA 1PK8A 2OK1A 4DFLA 3EKNA 5F9EA 3QALE 4PV0A 4BDDA 3W1FA 3H9OA 2PZ5A 3E7OA 3R1NA 5CAPA 4RIOA 5DR9A 2R84A 3F3TA 2Q0NA 5HGIA 4K33A 2CDZA 2OJ9A 2X8IA 2XYNA 4E5AX 3DKCA 2B55A 4FYNA 4PNKA 4HQ6A 2FSLX 4WG4A 3LFAA 4YHTA 4I50F 3ZFMA 3DLZA 5A4EA 3F88A 3GFEA 3NIEA 3MB7A 4FFRA 3OCBA 1AQ1A 2QOHA 5HESA 3RGFA 3AXWA 1YXTA 1Y57A 2PVYA 5CSXA 1HCLA 2V5QA 3TIGA 3W8LA 3TJCA 5DEWA 3PJ2A 2QHNA 2YDJA 3BZ3A 2W7XA 3NNUA 4L42A 4KIQA 2J5FA 2XJ0A 3KB7A 4I6QA 5BPHA 4AOTA 3ALOA 4D58A 5K4IA 1H27A 3LXKA 2W9FB 4O0XA 4OTDA 2Y9QA 5M4IA 4BYJA 1S9JA 4HCTA 1T45A 1URCA 5J1WA 4U6RA 3SVVA 2GPSA 3OF0A 4F6SA 2NU7B 3MGYA 3HL7A 4BCFA 4DH7A 4L46A 1Y91A 4QT1A 4D9TA 4EOOA 3KN6A 2W5BA 2QO7A 1EZ1A 4MV8A 4BTMA 3KAJA 3CQUA 1OIQA 2EB2A 3HA8A 5DHJA 2VTQA 3QWKA 3QXPA 3R2YA 4IAZA 5ITAA 4MV3A 4PMPA 2WYOA 4MBLA 3Q04A 5DGZA 3L9PA 3U9SA 4RIXB 3VS4A 4E4XA 3CGFA 3G6GA 3QHWA 3R63A 4TXCA 5C9CA 4WNMA 4EYMA 1I09A 5LOHA 4DFXE 2ETKA 4DFZE 3NW5A 2G1TA 4G3FA 4KKGA 4DTKA 3CR0A 4FL3A 2O2UA 4D0XA 4IIJF 1X8BA 3JXWA 4FSNA 3PJ1A 1WR2A 3KRXA 5FEEA 3VUDA 4TYEA 3TWJA 4JBOA 3FL5A 2NP8A 2GQRA 4C2WA 2HJWA 3QQFA 5DR2A 3U8WA 4C4JA 4C4IA 4YLLA 4YJTA 4AOJA 2OH4A 2YIQA 4RWIA 2R3JA 3NEWA 5EYCA 3ODYX 4GT3A 3KXZA 5AA9A 4FNZA 4MK0A 3LVPA 4YNOA 1UU3A 5TR6A 5EDQA 5M07A 4QP9A 2HGSA 1UU8A 5DBXA 2BHEA 3R01A 2XCKA 3QZGA 1XH8A 3A7IA 2XIRA 3C4CA 3QA8A 4OTQA 5IH4A 5EZYF 4HNIA 5IUHA 3PDTA 5J95A 4F7LA 2J7TA 1H25A 3H0ZA 4TWOA 4E5WA 4XEYA 3GQLA 2J2IB 4D4VA 3TTIA 3VS6A 2GNJA 3RAWA 4C3RA 1SVHA 4H39A 3TEIA 5JSMA 3W2QA 3R5FA 3POZA 4IC7A 3KXHA 1WBPA 2FP4B 3LXPA 1VEBA 4YZBA 1P4FA 2DUVA 3MY5A 2XH5A 4RFMA 4X3FA 4C4HA 5BYYA 1EUDB 4FFMA 4I23A 2ZDTA 4FUXA 4MBJA 3C0GA 2J51A 4M84A 4XLVA 3W2SA 4FA2A 2J50A 2RG6A 2UV2A 4U8ZA 2YRWA 4X7QA 4ZTLA 5IISA 1GIJA 3VBVA 4J8MA 4RBLA 2ITTA 5AIKA 3ANQA 3O0GA 3IO7A 4I21A 4CMOA 2C5XA 3R21A 3RWPA 3CJGA 1PYXA 5E92A 3UC3A 3RHXA 1XH5A 5C1PA 4MXYA 2VTHA 5AP0A 5HU9A 3KRLA 5DI1A 3LM0A 1LEZA 4EK5A 5M56A 3GCPA 2IPXA 4IB3A 4CNHA 5DA3A 4FIHA 2NUAB 4HVDA 2A0CX 3ORQA 4F1TA 3NUPA 4AZEA 4FIIA 4FV1A 4PUZA 4X3FC 4IAYA 2ZV7A 3I79A 3TI1A 2UZEA 4PTGA 3UNJA 3OTUA 3GGFA 2VX1A 5C1OA 4HNFA 3GNIB 5C8MA 2WEVA 2C3LA 4CD0A 4RVKA 2YCQA 1BNCA 4LRKA 1GSHA 4MCVA 4GFOA 2YIYA 1FGKA 3I6WA 5A4LA 5ANEA 3RZBA 3LZBA 3FV8A 3RALA 3DFCB 2ZV2A 3WIKA 4CG8A 3FQHA 3PUPA 2OBJA 2AC5A 2VD5A 2VRXA 4IVBA 4M68A 4M0YA 5DN3A 4DTAA 4FTUA 4EYJA 4EONA 3DF7A 4QP2A 4EOPA 1Q62A 2R3NA 1O6KA 4D28A 4FTAA 4O38A 5JZNA 3UFXB 4E4LA 3QC9A 4KKEA 5K3YA 4AF3A 2ZB0A 2VTAA 4E20A 5HNIX 2YAAA 3Q60A 4ALWA 4ASXA 4YMJA 5JFSA 2WMTA 2P4IA 4F64A 3O7LD 3JZIA 3QRKA 4P2KA 4DT9A 5JQ8A 1Y6BA 1U46A 3VHEA 2EB3A 1DM2A 1WMKA 1I7NA 2PVMA 4PMSA 3GXLA 3U6HA 1K9AA 5CAEB 3SOAA 5C8YF 3DB6A 2IP4A 3UZTA 2X7OA 1ATPE 4D2SA 4WD5A 2VWUA 4R7IA 5KZ0A 3AC4A 3OP5A 5LVOA 1QCFA 1H1QA 4FIEA 3NUNA 1LPUA 4W4XA 3WZDA 5EI8A 5E4HA 3F5UA 2VGOA 4FSMA 3H10A 3WE8A 4L8MA 2VN9A 1XH7A 3EYGA 4RJ7A 4DA5A 3VOTA 2OG8A 1R78A 4B8LA 3OCGA 2VWIA 4FTJA 4ITHA 1VYWA 3DU8A 4BDFA 4I20A 5C8KA 4FVQA 4C4EA 3PVWA 1OL6A 3RV4A 3LFNA 2WTJA 2AUHA 2OZOA 3O17A 5AJQA 4FL2A 4AN2A 4FZ7A 3D9VA 3HKOA 5C26A 3TJDA 5AV4A 2CCIA 2W05A 3BWJA 4EKLA 3ORXA 1OL1A 3MH3A 3WARA 3IPHA 5CY3A 4XYMB 4AT5A 2WEIA 1PKDA 3FPQA 5EOBA 3MJ1A 3R00A 4F9YA 5FNVF 3QQKA 3UC4A 3VRYA 1R3CA 5L3AA 5A4TA 5I9VA 5EKNA 2ZDGA 2UZDA 2VGPA 3I60A 3Q4TA 4UBAA 4YC8A 3ZFYA 5BVNA 2QKRA 1XH4A 4LGGA 3HMMA 5I0BA 3K5UA 4RIYB 4ORKA 4BCNA 3QAME 1OPJA 3TNHA 5AX3A 2O64A 2C47A 4L3JA 4DFYA 3GFWA 3SE7A 4NTSA 2GS2A 3AGMA 4NIFB 4L44A 4HVSA 2W6MA 5GIPE 2RL5A 2VTLA 4O6EA 5I9WA 5D7AA 3NCZA 4QYEA 5IQHA 1IR3A 2XKDA 5FG8A 3QQGA 3FXWA 4FNWA 4K8AA 4UXLA 1GLVA 5KMKA 1M0WA 2WTKC 3SXSA 4NT4A 4HW7A 4IWQA 4GMYA 1PW2A 2CJMA 4IX4A 2W6PA 3MY1A 4XV3A 2B9FA 4CSVA 5IA0A 4IB0A 3G0FA 2RKUA 4M8TA 1H1PA 3P7CA 4NYEA 3CTHA 4S31A 3T3VA 4CMUA 5CF6A 2XJ2A 1ZY4A 2DYLA 3UVRA 4F7SA 4HYSA 4X3JA 4DBNA 5IA4A 3UIXA 2F49A 3CCNA 1SVEA 5KMJA 3DDQA 2YM6A 1M14A 2ITZA 3F5XA 5LJJA 2C1BA 2V7OA 2WTIA 2W1ZA 4QRCA 3QCQA 4I92A 2XK7A 2XZSA 4USDA 5T3QA 3T9IA 4C4GA 1Q8WA 4LM5A 3C4FA 3T3UA 2IZRA 3GCSA 3BV3A 4H3QA 2BRNA 5HBEA 5AAEA 2R7IA 5CT0A 5EM8A 2X2LA 1CKIA 2H8HA 3D7ZA 3MN3A 4XG9A 3W2CA 3GLKA 4DH5A 4HNUA 2XM8A 3DQWA 3F2RA 4LL5A 3DKGA 1IOWA 4O91A 2PMLX 4RSSA 3PTGA 4ANBA 4M67A 4L52A 5FXRA 3OS3A 2YJRA 2O63A 3DY7A 2WMSA 4JL9A 1U54B 1HOWA 4FG9A 4UZDA 3G51A 3U9TA 4G6OA 3HO8A 4I41A 3U54A 4AXAA 4JDKA 4ZIMA 4KNBA 3ZRKA 1SNUA 3KF7A 1JVPP 1K3AA 1ZMUA 3HAVA 2UW4A 4YJUA 3DBDA 4JDJA 4G16A 4ZHQF 3RUPA 3CP9A 2W06A 1E4EB 3N4TA 2PMNX 4O7NA 4EHGA 1E1VA 3MVHA 3NNXA 2WMBA 1YHWA 3KXGA 4XZ3B 4IJ9A 1ZMVA 3HA6A 3R9NA 3R28A 2OIDA 3LKMA 1FGIA 2F7ZE 2UW5A 2XRUA 4ITJA 4KWPA 4O0SA 4KRCA 4X2KA 3LCSA 4Y8DA 2W6OA 5IQBA 3ZCLA 3C7QA 2PVLA 4FZAB 2XNBA 3RCJA 4ASDA 4B4LA 4CEGA 1PY5A 1P14A 3CY2A 5TT7A 4Y95A 3UZRA 5HORA 1Q8TA 2BZIB 2UZTA 3W2OA 1ERKA 4MA5A 5JVLA 4BBFA 1JSTA 3OCSA 4GT4A 3TG1A 2UW0A 2UZBA 2QR8A 2VTRA 3R8LA 3NMUF 3Q96A 4KIOA 2QO2A 5IMXA 3F3UA 4NCTA 4D1XA 2B52A 2X81A 1DI9A 3HV6A 3DXNA 3ZDUA 3DAKA 1L3RE 3NUXA 3P79A 4MQ1A 1MQBA 4CRSA 1GAGA 4O4JF 3PPZA 2WB8A 4O22A 3CSVA 2YDKA 2JDVA 2BCJA 4BTFA 2CNVA 4YSMA 5EHYA 3QTQA 1REJA 5HHWA 4DGOA 4EGQA 2XCHA 2O8YA 3GEQA 4PDOA 3CY3A 3HDNA 4X2GA 2NRUA 3EL8A 2BMCA 2HY0A 2C3KA 1M52A 5EDPA 3JY0A 4B6LA 4Z7HA 5IEYA 1PKGA 3KK9A 4G5JA 1J7LA 2F2CB 3F3WA 3R7UA 3WI6A 4EUTA 5A46A 4IANA 4YJ3F 3PPKA 2UW6A 5C4LA 4RJ8A 2B7AA 3EQGA 5ANJA 2VWZA 3I4BA 5HCYA 2WQNA 2A4LA 5L6OA 3VC4A 4IQ6A 4LFIA 4EK6A 3EWHA 3NS9A 4K2RA 2JITA 2NNWB 5CWZA 3Q2JA 2WNTA 5FTOA 2O0UA 4NCTC 3SHEA 4EK8A 2R0IA 2VTNA 3ZBFA 2PUPA 4FODA 3NNVA 2V5AA 4G1WA 1ZOGA 4HGLA 4QQ5A 3VW6A 5JQGF 5D9HA 2Z04A 4F08A 2BIYA 4XG8A 4BZDA 3UVQA 3TUBA 4H58A 3LP8A 3L8SA 2W1EA 3EFJA 3IW5A 5DEYA 3VUIA 4EJNA 5A6OA 1AUVA 1VBHA 4NFMA 2C5VA 4JT3A 4TZRA 2HOGA 3LOKA 4C33A 4EH2A 1ZYCA 3C1XA 3TKHA 1WBTA 3COHA 3QFVA 5EH0A 5IA2A 4AW0A 3A60A 2C5OA 3FLQA 4MWHA 3PE2A 3VPCA 4YJQA 1OM1A 3ZFXA 2O65A 4X6QC 5ANDA 2I0EA 2HZ0A 5FRIA 2I7QA 3BCEA 4R78A 1SVGA 3QFFA 3KFAA 3BLQA 4IAFA 5AP3A 2YM3A 3DT1A 3OUNB 4YP8A 3OW3A 4RRVA 1VZOA 2GHGA 4QO9A 3W2PA 4L00A 3Q9YA 4UALA 4ANSA 3KXXA 4BHNA 3FHRA 4F6WA 1OIYA 3PIXA 4OTIA 3W32A 5AP6A 5IDNA 3UNKA 4QMQA 4WNPA 5IF1A 3R9DA 4XOYA 4I24A 4AU8A 3EB0A 2QG5A 2GSFA 2VV9A 2FGIA 3BU6A 2I6LA 3PYYA 4PDSA 3BYVA 5EI6A 4E4MA 3LPBA 1OKYA 2JIUA 3OCTA 4BDKA 5LMKA 1T46A 3RHKA 1JDBB 3A4OX 1KV1A 5E8VA 2PUUA 4JR3A 3WE4A 5KO1A 4A07A 3NCGA 5CASA 4AGUA 4WT6A 4C3PA 3TZMA 4FT0A 1TKIA 2NRYA 4KINA 4EGJA 2QLUA 1UKIA 2VO0A 4P5ZA 4ME6A 3NLBA 1ZLTA 3VMMA 4O83A 4C61A 4F9AA 3OVVA 4X21A 5A6NA 4F63A 2JDSA 1ZOEA 2V55A 2R3PA 2QOOA 4ZS0A 1KJ9A 1YXXA 3BEGA 4QMYA 3A8WA 4YGAA 4C5CA 3D2IA 5BUJA 4AA5A 3CBLA 4EUUA 1PXNA 3OBGA 3OG7A 1KOAA 4CCUA 1W83A 3Q6WA 4FVRA 5IUGA 5HE2A 3IDPA 4KA3A 5AM6A 4C38A 3COIA 3RJCA 5LMKC 3HECA 3A62A 4M15A 4YC3A 3AC3A 3GC0A 3U87A 5F95A 5IQGA 3DBEA 2VWVA 1ZRZA 4G3GA 1YHVA 5H8GA 3ZSIA 1JKTA 4WBOA 3LCDA 3NPCA 4PX6A 5HE1A 4IB1A 3R0TA 4GYGA 4IM2A 4FOBA 2PY3A 2UW7A 3NYVA 4MQ2A 1V0OA 3D7TA 3G15A 2XNEA 3PXQA 4FEQA 4IVAA 4TRLA 1Q8UA 2JKQA 4CKJA 2WMQA 3CKXA 3FI2A 1VYZA 3FLSA 1IRKA 2GNFA 4GK3A 5M4CA 3ZTXA 1GZOA 4ZOLF 1H26A 4CZUA 4HPTE 4EZ5A 5HD4A 2P2IA 4O82A 4ACHA 2CN5A 4JG6A 4KABA 2HY81 3P23A 4N6YA 2BDWA 4IZAA 3GUBA 2VO7A 3TNPC 2Y8OA 5LOVF 5L2SA 3EH9A 1W84A 2W4OA 3Q4CA 3FI3A 3EN5A 4BVUA 2PVPA 4MV9A 4JOAA 1KBLA 3NSZA 2OSCA 1OL5A 4GL9A 3EQRA 3IS5A 3ZUTA 2CNUA 3A7JA 3QRIA 4FGBA 1BYGA 3CD3A 5B0XA 4BN1A 1ULZA 2J0KA 3E93A 3PVUA 4XP2A 3ZRLA 4BRXA 2YZLA 1JKLA 5HLWA 1QPEA 3EKKA 2ZV8A 3CXWA 4QMTA 3S1HA 3DXPA 4MYGA 1XHAA 1Q3DA 4NSTA 4BCMA 2C1AA 3AGLA 5JK3A 4UZHA 4F4PA 1Z2OX 1UA2A 2C68A 4R6VA 3V5LA 3RINA 4XOZA 1JKKA 5EFQA 4LUDA 4XG6A 3CC6A 4IM3A 2R3LA 4ACMA 2X8DA 3VHKA 2J9MA 4YTCA 1J7UA 4ONAA 3C0IA 4O81A 3ACKA 4RVLA 2ITOA 2WELA 5AWMA 3EQCA 2IW9A 5J9YA 4GVAA 4FFLA 5GONF 3F7ZA 3DNDA 3LQ5A 2EXCX 3R8PA 3V8SA 2SRCA 3QYWA 5M51A 2J4ZA 4O21A 2V0DA 3O71A 5CENA 2RGPA 2J5EA 2PVJA 5D8DA 4W8EA 2W4KA 3QZFA 4I5PA 4EQUA 3ALNA 5AUXA 3HZTA 4MVFA 5IQIA 2PUNA 2R3MA 4FSTA 1H1WA 2PE0A 3GC7A 4H1MA 4PTCA 1QPDA 4YZNA 4QNYA 2AYPA 4BHZA 1GGOA 1G8SA 1ND4A 4G6LA 2OIQA 4N57A 5EYKA 2V7AA 4QP3A 3LXNA 4I6FA 5KZIA 3IOPA 3O8PA 4WG3A 4P5QA 4OTWA 4U40A 4AQCA 4C34A 5JQ5A 3FLYA 4FKLA 4QYYA 5KHWA 2ZMDA 4CFNA 4PQNA 3QRUA 3SW4A 4RX9A 2C0TA 4FTMA 2QHMA 3UQGA 3ZC6A 4X0MA 5J5SA 3LWBA 3DDPA 3E8NA 2W0JA 3TZ8A 3WF7A 2YIXA 3U9NA 2W71A 5HBRB 2OLCA 3B8RA 3ORRA 3NNWA 4S34A 4YHJA 3O96A 2QOLA 4HCVA 2CKPA 3PFQA 2JKOA 4WUNA 3PPJA 4MXOA 5CZIA 3HMIA 2JC6A 3FZTA 2JDTA 5EW8A 5CF5A 2XKFA 4AG8A 1PF8A 3ITZA 4KKHA 4J95A 4XBUA 3DNEA 5LWMA 2WMRA 3ZSHA 3KK8A 4YSJA 4GS6A 2OH0E 3T9TA 4BY9E 1XH9A 3EJ1A 5CQUA 4FFOA 4HPUE 4V0GA 3VNTA 5E8ZA 4CFXA 2GS7A 2YCRA 4YBZB 4MX9A 3LCOA 2WHBA 3OWPA 4FT9A 2G01A 4LUEA 2E9OA 5JZJA 4EH8A 4ZSEA 4BGGA 5CEPA 5LXMA 4WKQA 1QPCA 1YI4A 4DHFA 3AX6A 2XA4A 4LG4A 3KRRA 4J8NA 5AM7A 5E8SA 4NM7A 3UBDA 4ERKA 2CGVA 5CEIA 3VS7A 4EG0A 2W5AA 3H4JA 4A9SA 3LHJA 3Q5ZA 4QP1A 4CTBA 3OW4A 3N4VA 3OXTA 2WMWA 3PSBA 4BKJA 3UJGA 4F7JA 4NK9A 4MV6A 4JIKA 4AZSA 5IG1A 2VUWA 4I0RA 1XBCA 3GU7A 4L68A 4M12A 4U5JA 2R2PA 5HG7A 3NAXA 1F5QA 4YJSA 5HVKA 4GT5A 4C4FA 3ZEWA 5FDXA 4JAJA 4MBIA 2HWOA 3DJ7A 2ITUA 4AUAA 4GKIA 4BF2A 5JEBA 4QYFA 4KRDA 3U4UA 4DEDA 4F70A 5LVLA 5JH6A 5BPFA 2QOIA 1YRPA 2JBOA 4KD1A 2WQOA 5CF8A 3P08A 3DTWA 3TN8A 2YERA 1URWA 1O6YA 3QD3A 4JLCA 1OUKA 1M2QA 3LFBA 2XK3A 1JPAA 1PMVA 2GFCA 2R3HA 3E92A 3P5KA 1KE9A 1ZYJA 5FLFA 1VKZA 3LJ2A 2BDFA 3DAJA 4FTNA 3PZHA 3RKBA 4FU0A 4BCKA 2IJMA 3DOGA 3MYGA 5AMNA 1VR2A 1ZYSA 5AFVA 5CVFA 4BTJA 3JVSA 2X6DA 3UG2A 3EYHA 4QOXA 4CKIA 4DG2E 3KEXA 3OWKA 5CSPA 1SCUB 1BLXA 2CKQA 3M11A 5LXTF 1WBNA 3OOGA 4GJ3A 4O96A 4L7FA 4O2AF 2R82A 4L43A 4AFJA 2ITWA 4L53A 3BHUA 5DRDA 3UVPA 1JAMA 4P4CA 3HNGA 4ZY6A 2XP2A 2YZMA 3DAEA 3VUHA 4C3FA 4TNBA 4F6UA 3MSSA 1H00A 4MD9E 4BDGA 1XJDA 4GK4A
chains in the Genus database with same CATH superfamily
2PMIA 3ZLYA 2QU5A 4RJ6A 4OLIA 3ZBXA 3QTWA 3WYXA 3ZYAA 4EEVA 3E88A 3R9RA 2OJGA 4FV0A 4OGRA 1DAAA 1GZNA 2A27A 2VWXA 3OT3A 4I6HA 5HZNA 5FPRA 4QMXA 3HX4A 3DB8A 3C50A 4Y85A 5L2TA 2Z7LA 1YOLA 4KBCA 5IQDA 3JRXA 4HYHA 1JWHA 3U6IA 4M0ZA 2OFVA 3FZPA 5LMBA 2ZDQA 5DISC 2X8EA 1WBSA 3BE9A 4J99A 3WF6A 3K2LA 1KJIA 1H1RA 4HNVA 5D7VA 2WTWA 2E9UA 3TDWA 1W0XC 2XB7A 2YITA 4OW8A 3AD5A 3ORNA 2R86A 4JJRA 2ZJWA 5CEMA 2ZMCA 2ITVA 3ZLWA 2XBAA 1KJJA 5KMNA 5M08A 1XBBA 4DEIA 4CRLA 4HVGA 4F7NA 1RW8A 2PVRA 4GUBA 1KEEA 3EFWA 3HDMA 3P7BA 4C37A 2CKEA 2OF4A 3HLLA 5E25A 4BI2A 4YAKB 2JDOA 2XNMA 4J53A 2QNJA 3PXZA 3C4ZA 3RFCA 5ACKA 4AA4A 1W93A 2XEYA 2H96A 3MFRA 2OXYA 3S3IA 4HJOA 1YOJA 2DWBA 2Y4IB 3WWIA 4BIBA 5AUZA 5B7VA 4TPTA 5CI6A 4ZMEA 2YM5A 4QP6A 4YURA 5AAFA 2UZVA 3FLZA 4RIYA 4L9IA 3ZM4A 4GIIA 3DZQA 2EWAA 3MW1A 3TY8A 3VN9A 1YXUA 2FB8A 3D5XA 3HV5A 3R9HA 4A4OA 1BL7A 4DG0E 3ZSGA 1ZZ2A 5BPYA 4I6BA 3R8UA 2UUEA 5DAAA 2XCLA 5AUWA 5HIEA 1R1WA 4EEQA 3MS9A 2XIXA 3QTRA 4K9YA 2XIZA 2F4JA 2JGZA 3EQFA 5E7RA 3FMNA 2R3RA 4WIHA 1Y8YA 2VO6A 4IE9A 1DAYA 4APCA 4C5AA 3DTFA 5IA3A 1GIHA 4G31A 3C4XA 3PJCA 3AOXA 3ZU7A 3U6JA 2BRMA 4CLIA 3GC8A 2OWBA 2ITXA 3LJ1A 2FPIB 4FV6A 2VTOA 3LCKA 4FKRA 4G17A 4EZ3A 1XR1A 3BRBA 5DH3A 3CGOA 3UIUA 4DEBA 1W96A 4AGDA 2C69A 3FY2A 4S2ZA 3BBWA 4U45A 4V0GB 2JLDA 3WF9A 2NU9B 5CE8A 3FHIA 3LW0A 4FV5A 4FGRA 1RDQE 4LOQA 3SA0A 2CNQA 1Q61A 3KU2A 5DE2A 4ZTQA 2C5NA 2PYWA 2WU7A 3D5WA 3UNZA 5CI7A 2P0CA 5ETIA 4LOOA 4N70A 3ZO2A 3I0OA 3K5HA 3BELA 3ULZA 1NXKA 5JGDA 1FVTA 3PSDA 4HZRA 4RC4A 3RMFA 4AZTA 5K5NA 3Q2OA 4LMNA 3VW8A 2R85A 1KE7A 3L8XA 5M4UA 4RA5A 5HE3A 4HGSA 3A4PA 5C03A 2VU3A 4TWPA 5GHVA 1DIKA 1Y6AA 5AP2A 4E93A 4YAJB 3VQUA 1FOTA 3SNOA 1U54A 1KV2A 4XP3A 3CJFA 3FUPA 3QRTA 5AX9A 4XMOA 4TN6A 3DTCA 2W6QA 3F3VA 4JQEA 2ONLA 4L7SA 1F0QA 3RM7A 4USFA 3QGWA 4MF1A 3LFSA 3OT8A 2BPMA 2B1PA 1E4EA 5IQAA 1EKVA 4F0FA 3RPOA 3UOKA 4U43A 3TY9A 3EIDA 5EI2A 2HELA 1H4LA 3VS5A 3V4SA 5FBNC 3HEGA 3W33A 3POOA 4FTIA 2FH9A 5A54A 2YZGA 3QUEA 1WVWA 2QOQA 5EM5A 3AC2A 2X4ZA 4B99A 5E8XA 3FZRA 3UTOA 5KKRB 3VPDA 4OT5A 4FNXA 3DBCA 4MNFA 4DF3A 3D2KA 5IQCA 4IX6A 4WNKA 3ZM9A 2CSNA 2YISA 4FI1A 4RGJA 3UIBA 4GRBA 4ERWA 1BMKA 1I7LA 3GI3A 2ITPA 4GVJA 4X2FA 3FZ1A 1ZZLA 2ONLC 3GVUA 3LFFA 5J9ZA 3CIKA 3ZZEA 3PRFA 2WKMA 1REKA 4OTFA 3MPAA 3DJ6A 3OUZA 3GJXB 4X6RA 5GJDA 1IG1A 1MRYA 3C4WA 4XRJA 4EH4A 4WBNF 4IFGA 3K54A 3KXMA 4JNWA 4CV8A 2J9GA 1V1KA 5EHOA 3OTVA 1CKOA 1NT2A 3L9LA 1JDEA 4DEHA 3QZHA 2Q0BA 3SXFA 4O27B 4R77A 3VONA 2R3KA 2I8CA 4QTEA 3NDMA 3MESA 3QWUA 3P0MA 4UYAA 3N51A 3E87A 2BIKB 2R4BA 4PZ7A 1ZOHA 4OTHA 3GQIA 5JT2A 4HYIA 3O8TA 2OFUA 3RCDA 3KC3A 3QTIA 1WAKA 3PG3A 3FL4A 5IA5A 3H30A 3NR9A 1TFFA 3ZO3A 2JBPA 3RWQA 4ASZA 4XP0A 1M7NA 3G6HA 4DN5A 4L3PA 4AA0A 4MNEA 4EH3A 4IVCA 1F3MC 3H0YA 3TQTA 4Q9SA 2C4GA 3ATTA 3BEAA 4YZCA 1UV5A 1E9HA 1PMEA 3OY1A 4GU9A 4Z16A 4E6AA 5ETCA 2PU8A 2RG5A 2UW8A 3C9WA 5EQYA 3MIYA 5HE0A 3ET7A 5IU2A 5JH7F 1UNGA 2BZKB 3P86A 3SC1A 3VUGA 2H6DA 1DV2A 4I0SA 5JN2A 2VR1A 3FMEA 2ESMA 2GNGA 4FTRA 2XD4A 1GIIA 2WPAA 3BG5A 3R7VA 2XNPA 3II5A 3ULIA 5I9YA 4L67A 2VQDA 5BYZA 5BVFA 2C6IA 4S30A 3DS6A 4K6ZA 4ITIA 2HW6A 3NYXA 2R3IA 5L8JA 3WNZA 3QHRA 4NUSA 5AUTA 2IG7A 3E62A 3KF4A 3DBQA 3LMGA 4J97A 1PHKA 3UO5A 3HMNA 4MXXA 3JR1A 3VS1A 1LP4A 4EH5A 5CS6A 4Y5HA 5HO8A 5IZFA 4FKPA 3EOCA 5IA1A 3IOKA 4FKWA 4R1VA 4MD8E 4N0SA 4MA0A 3R5XA 3F5PA 2C6EA 1R0EA 2ZDUA 4QMWA 4ZSJA 5HBHA 5JFWA 2DS1A 3BYMA 2BFYA 5FUTA 5HEZA 3RPVA 2HAKA 2XNGA 5FM2A 4ZMFA 2ZM1A 5JFXA 5KCVA 5KBRA 1A0GA 1RQQA 3F3ZA 2R7KA 3DBFA 2YYAA 1KJ8A 4AW5A 4FBXA 2Z8CA 2VPQA 4XG7A 3UODA 3IW4A 3E8CA 3TZ9A 3THBA 5CEKA 2WOUA 4DLIA 4FSUA 4JBPA 2R3QA 3OMVA 3N8DA 4E6NA 4NZNA 2F7XE 3GOPA 4YO4A 4X2JA 4BIDA 2A2AA 4F0GA 3W2RA 4UYNA 5HD7A 3S0OA 3R8VA 1H1SA 1TQIA 3BU5A 3MV5A 4GLWA 3KIOC 4DEEA 4FV2A 4R7HA 5AV2A 3VIDA 4F65A 4QMNA 1OPKA 3E5AA 5BMVF 2BALA 3K3JA 1DV1A 1M2RA 2GNIA 3PSCA 2C0IA 3FKNA 4I5HA 4HVHA 5IH5A 2R3GA 4E6QA 2BRGA 3RM6A 2RFEA 4YZ9A 2A19B 2PE2A 3QQUA 4IZ7A 1KE8A 3MI9A 3QF9A 5CTPA 1A0IA 2QURA 4JG7A 5LCKA 1OUYA 4IADA 1UKHA 2XRWA 3DA6A 3EL7A 3H9RA 4HGTA 5DLSA 3TZ7A 4XG4A 5CYIA 4UCOA 1OGUA 2FSMX 4XJ0A 4FTOA 4JVGA 1IASA 3VAPA 3W0QA 5IPJA 3RTPA 2B9IA 4BYIA 2BILB 1IYDA 3BQRA 4CGAA 3QQJA 3F9NA 4ENYA 4TM5A 1YWNA 2RFDA 3HV4A 4DRFA 3PJ8A 4ZTRA 2SCUB 2C6KA 4AN9A 2DWCA 3V8TA 3VPBA 3IONA 2XMYA 2WMVA 1WFCA 2P3GX 5CSVA 2FB9A 3WZUA 5GJFA 3B8QA 4DITA 4ASEA 3BAAA 3ZONA 5K5XA 1I44A 2I40A 4QMMA 3K3IA 3I0QA 2WD1A 4NL0A 2Y7JA 3MIAA 4FZ6A 4TT7A 3HRCA 2G2HA 5TO8A 4DT8A 4BCJA 4IW0A 5HBJA 4YPDA 5J2UF 3NUAA 4IWPA 4YZMA 4DAWA 3LM5A 3OEFX 3R71A 5I5VA 3N9XA 4OT6A 4EOSA 2VTSA 4W8DA 4F9CA 5KMMA 2W6ZA 1JOWB 2ZM3A 2ZV9A 4BCHA 3ORTA 3HV7A 2YZAA 3FKLA 3R7IA 1ZWSA 2QKWB 3WZKA 4AX8A 3NW7A 4DH8A 4F1MA 5M09A 3WYYA 1J91A 4YZDA 4A9UA 1H0VA 4NKSA 3E64A 3DK3A 3OC1A 1UU9A 3TKIA 4AE6A 4A9RA 4ANLA 4D5KA 2VTJA 5AA8A 4PNIA 4I0TA 2IW8A 5CAQA 3ORZA 3KAKA 3L8VA 4KBKA 3RPYA 3FE3A 2COJA 3W0MA 4UCUA 2YACA 4PMMA 2HWPA 1WRVA 3ZO1A 2IVVA 3R2BA 4W4YA 2WQEA 3CQWA 1CE8A 3UDBA 4AGCA 4JXFA 1ZAOA 2IVUA 4U97A 5BX0A 4XYLB 1CKPA 4WO5A 3NAYA 3FSFA 4MNEB 2IN6A 3G2FA 5HTCA 1G8KA 4JR7A 3QXOA 4AAAA 3IK3A 3KVWA 5I5ZA 4DFNA 4G34A 3CPBA 1YW2A 3LMHA 4DBXA 2ERKA 2R7BA 4JMQA 3ATSA 3EQHA 4G9RA 5DIAA 1OKVA 3EFKA 4NWMA 1KE5A 2ZVAA 4EI4A 3PXKA 3BHVA 4ZK5A 1ZYLA 3NVMB 5TKDA 3PA5A 3E8EA 1PRYA 2CMWA 2OJJA 2P33A 4ZLOA 2Z60A 4JIAA 4R3PA 5TF9A 2IZSA 2Z7SA 3JY9A 2QQ7A 3D5UA 3QTXA 4AT4A 4RQKA 3PVGA 5JGBA 5CR5A 5CU2A 5CEQA 5F1ZA 3UP7A 1NVSA 2G15A 2E9NA 2YEXA 3G0EA 3QLGA 4NH1A 4WA9A 4BGHA 4CV9A 3UOJA 3PLSA 2J90A 4HNTA 4O7ZA 5I9XA 3PWDA 5J2TF 1GNGA 5I9UA 5CA1F 3VNNA 4FKSA 4DLJA 3P4KA 4ZY5A 1YDTE 5CNOA 3B2WA 2YA9A 4RFYA 1JNKA 3WF8A 3GBZA 3HMOA 5H8EA 3ORMA 1WZYA 2COGA 2OZAA 4C5BA 4TY1A 5M57A 3LXLA 2QD9A 3C5IA 1GSOA 3BI6A 3CTQA 1P5EA 4PL4A 4CZTA 1L8TA 1SM2A 4F9BA 4FL1A 3V3VA 3RP9A 1A9XA 1OECA 2R64A 4BDHA 3QRJA 3Q53A 4S33A 3ETHA 1OZ1A 3E3PA 4E4NA 4HOKA 4EL9A 4OR5A 4ALVA 1Q24A 3OOMA 3MB6A 4FIFA 4XV2A 1C3OA 5AADA 2P55A 2VO3A 5CSHA 4AZWA 5B2KA 4YTHA 4UCTA 2C6MA 4FUYA 4C62A 4G9CA 4FTLA 4EWQA 2JFMA 3BV2A 3HB9A 2C6TA 4GUEA 4KS7A 4XNEA 4BDJA 2XEZA 2WIHA 3FEGA 3QKLA 2Z7QA 5HTBA 3H3CA 3ZLSA 4MKCA 2WMUA 5IDPA 4K0YA 1FVRA 2BKKA 5FXSA 2ZDHA 2OO8X 2CGUA 3CPCA 5CAUA 1GZKA 3T9CA 1CMKE 4K18A 1TQMA 1YWRA 3V5JA 4QMZA 4D4SA 2GS6A 1ST0A 2I0HA 5I9ZA 4GH2A 5IEVA 5FPOA 4CFUA 1UWHA 5M53A 1YOMA 2QCSA 2XUUA 5CVGA 3G90X 4B0GA 4AXEA 4TYIA 3A7FA 2ZB1A 3MFTA 3QD4A 1IAHA 4USEA 2BRBA 2GU8A 3NFFB 4IFCA 2YM4A 1DGSA 1K2PA 2LGCA 3PIZA 5BUIA 3QKMA 4D2RA 1OI9A 3HYHA 4YBJA 5DYJA 1CKJA 4E6DA 3FMHA 3AKJA 3P1AA 5ACBC 5BUEA 4DIMA 3S95A 3FLNC 3F82A 4PMTA 5BMMA 5F4NA 4FKUA 4MV4A 1H28A 3C0HA 1OGYA 3BA8A 5HCXA 4RJ5A 3VQHA 5I5SA 1OL7A 1XH6A 4QMVA 3SQQA 1Z5MA 1H8FA 3OWJA 4E26A 4DDGA 2W1DA 4BTKA 3UGCA 2PL0A 1U59A 1EYZA 2OJFE 2ZYBA 3GT8A 3SGCA 4QP7A 5CALA 3W55A 1YKRA 2HW7A 4FFPA 4EK3A 4Z9LA 4EHZA 2DAAA 4CCBA 3VJNA 5I5XA 2BFXA 3HV3A 2CGWA 3V51A 4ACCA 2YW2A 2R87A 3K5IA 4H3BA 2P0AA 5CU0A 2X1NA 3I7BA 5E91A 1G8AA 3TW6A 5C4KA 4IEBA 5DT3A 4YJRA 3JRWA 3O8UA 4UWYA 4FT5A 4O7YA 2GNLA 4O7WA 5AUYA 4DINA 3KY2A 4QTBA 4TYHB 3F69A 3BYUA 2RFNA 3KRJA 2IVSA 5LVPA 3C4EA 3SAYA 4I93A 1OBDA 3RPRA 5CAOA 4TV9F 5IQEA 5FBOA 2J0IA 3E63A 3QUPA 5EK7A 2FO0A 4K11A 4O6LA 2BAQA 4JRVA 1H07A 1LR4A 4IHPA 5CXHA 2VX3A 5CSWA 3VUKA 4F99A 4PRJA 4FR4A 2X0SA 3UO4A 3NUUA 3FMMA 4Z55A 1J7IA 5G6VA 3VULA 3W1BA 5I47A 3AQVA 4O0TA 2W9ZB 3EQPA 2QVSE 4MV1A 4RVTA 4PF4A 5L6WL 4PL5A 5E1SA 3KREA 3WZEA 3ORPA 3R30A 4NW5A 3VBQA 3R6XA 4CMFA 1MQ4A 5AP5A 3ZMMA 1XWSA 2QO9A 5FP5A 4CT2A 4DHJA 1B04A 1GOLA 3GCVA 3CSWA 2C00A 2DLNA 4JBQA 1LUFA 2QOBA 3NX8A 1IEPA 2JIVA 2YN8A 3QD0A 1SYKA 4D1ZA 3VJOA 3W10A 3RAHA 3EN9A 3KXNA 4R3RA 5IMEA 2ZAZA 2XK8A 5EM6A 2VX0A 2BZJA 5CF4A 1CQIB 3OUUA 4U44A 2OIBA 4Z3VA 2PN1A 2HGWA 1H24A 1PX2A 2CPKE 3E8DA 4D55A 1XBAA 3FAAA 4FT3A 4UFZA 3REPA 3EZRA 4IBMA 5JRSA 3QGYA 3TDVA 3PG1A 4FZDB 2NO3A 2XAOA 3HP5A 5DPVA 1OKZA 1H08A 1SMHA 1MUOA 3EN7A 3FSKA 4GG5A 2X9FA 4ID7A 3ZH8A 4QQTA 2J0LA 1I1MA 3R7EA 1Z2NX 3RV3A 3Q9WA 4CTCA 3ODZX 3OEZA 2BR1A 4TL0A 5M4FA 4Y83A 5KE0A 2OZAB 4OUCA 3I12A 4UN0C 5B2LA 1B6SA 1WVXA 3MJFA 2X7FA 3FQEA 4GV1A 1FVIA 4D4RA 2BROA 5KUPA 3PXFA 2XIYA 3AW8A 3MWDA 4IH8A 2XK4A 3DGKA 4L45A 3TNIA 4AACA 5C01A 1APME 2JDRA 2WOTA 3ZDIA 5DWRA 3UYYA 3KA0A 3FYKX 4F1OA 2FPGB 3L9NA 3LMIA 4G6NA 5LWNA 2C5YA 2Y4IC 1QMZA 2YZNA 4JS8A 4BZOA 2NPQA 3KVXA 3QA0A 4ARKA 5EYDA 3PUFC 3KQ7A 2WMAA 4QMLA 5KX5F 3U51A 4HGEA 5E8YA 5FP6A 4C02A 3NRMA 5I60A 3O51A 5A3XA 3LLAA 3FXZA 4IDTA 4A7CA 2WTCA 4FSYA 1UNHA 1B6CB 5C8NA 4FT7A 5J7HA 4O7VA 5EDRA 3ZXTA 4ENXA 1Z57A 1EKFA 4FC0A 1UC9A 5CT7A 2HXQA 1U5RA 4J1RA 4LDTA 2V62A 1JKSA 2WXVA 3S4QA 3ML1A 4XUFA 1OBGA 3S2PA 4KSPA 3R73A 4FKJA 4KS8A 3BWFA 4XX0B 1PMNA 2GQSA 4EQ5A 1KC7A 4BR3A 5FR9A 2FSOX 4CE5A 5C27A 3MWEA 3QQLA 3UG1A 4RA4A 4IX5A 4ZTHA 3TINA 5E8UA 2H34A 3TIZA 3QU0A 4Y72A 3KULB 3LFQA 1AUXA 3EQIA 4RC3A 4U80A 2X2KA 4CFVA 4O2ZA 2VAGA 5IUIA 1VKZA 4LV7A 1U5QA 2KTYA 4J71A 4FKOA 4R5SA 4ALUA 5C1QB 4RWKA 2JFLA 3RK7A 4IIRA 4K1BA 5BVDA 4XG3A 4DYMA 4CVAA 4EHVA 4A06A 3NBZB 1TVOA 4ANMA 3PY0A 2WQBA 1PJKA 3M2WA 4QMOA 3TTJA 4BCPA 4FV4A 4TWNA 2W1HA 3D5VA 2ETRA 2W17A 2CHLA 3LQ3A 4QPAA 2CN8A 1UVRA 3V5WA 3LQSA 4PDYA 2YFXA 3SV0A 1XO2B 2R5TA 3FKOA 4YJNA 2YCSA 3SOCA 3TXOA 2G2FA 4E73A 4XH6A 3NW6A 2W1CA 4IWXA 1IA8A 5BYBA 3AMAA 2F57A 3W0PA 3R8ZA 4BBMA 5JQWA 3R1SA 2F9GA 4U79A 5HVJA 4P90A 4EOIA 1M0TA 3R22A 4IWOA 4WRSA 5EW9A 4IWDA 1GSAA 4O4IF 3BGPA 3FI8A 5GNKA 2RFSA 2UZLA 3JUHA 4QMUA 3G8DA 4UCSA 5BWUA 3VBXA 2V59A 3O50A 5AAGA 4F9WA 4FTTA 3TIYA 2A1AB 3PZEA 3VF8A 4H3PA 2W70A 4ZSGA 5ANOA 2PVFA 2UZNA 1B39A 3COMA 5AP7A 5I5UA 3F7WA 4E8AA 3DK7A 4LI5A 4LV8A 4DFUA 2PPQA 4JDHA 5AP1A 3TNWA 4EQMA 4IZOA 5FTGA 4G3EA 5H2UA 2YM8A 1BI8A 5A14A 4TV8F 3O2MA 3DXQA 4DH1A 2PUIA 1G8JA 2QOFA 4TTHB 2GLTA 4GW8A 5CX9A 1W98A 2W96B 4ZSAA 3FMLA 3ZEPA 4EZ7A 1YVJA 2VWBA 3CE3A 3T99A 5EQPA 4I5CA 4CFWA 4IDVA 2ITYA 2P2HA 4IHJF 1A06A 4M69B 4YHFA 5KKRC 2PBZA 4O7RA 5HLPA 1ZXEA 4RJ3A 4EKKA 1PXLA 2BDJA 2REIA 3BKBA 3GC9A 1CSNA 1XK5A 1U4DA 4JQ7A 3RK5A 5L2IA 1YWVA 3RK9A 2GCDA 1ZMWA 4I1ZA 1J1CA 2VNWA 2YM7A 3VF9A 5DT0A 4BB4A 3BHYA 4TYJA 3NIZA 2J0MB 2QK4A 4I5MA 4EH9A 3HMPA 2PE1A 3MH0A 4DGMA 4NTTA 4YB8B 4JG8A 4CHIA 3PLAE 1BUHA 2YABA 2EU9A 4O84A 3TKUA 3A7GA 3VVHA 2HENA 4N4SA 4BIEA 1PXMA 2KULA 5CXZA 2V58A 3AC8A 4HR7A 3DFAA 2PWLA 3SXRA 3TM0A 3SGIA 3IW8A 1W7HA 5F94A 3SRVA 2FYSA 4FTCA 4JX3A 3UOLA 4EJ7A 5GINE 3E5NA 1V0BA 2BRHA 5E8TA 5L6PA 5JVDF 4FX3A 3V6SA 3QX4A 1PXJA 2BTRA 2WZJA 3NYNA 5HCZA 4ZZOA 3MDYA 2B4SB 4EOJA 4PTEA 1G5SA 2Z2WA 1CKMA 1OMWA 4JQ8A 5JRQA 2CGXA 4FK6A 4WRGA 3V5TA 4CXAA 3CKWA 4NM5A 2PHKA 3Q6UA 4MXCA 1P2AA 2UZOA 2GTMA 3F2NA 3MPMA 3PXYA 3R23A 4ZEGA 1EUCB 5JFVA 2OKRA 3FXXA 5HQ0A 4FOCA 2GTNA 3RAIA 3DAAA 3TMOA 4DH3A 4RZWA 4ZP5A 4FJVA 4DEGA 5KHXA 3QCXA 2YJSA 3Q9XA 4NJ3A 3UMWA 5BNJA 4Y5QA 2PULA 2GPWA 4GEOA 3VBTA 4CKRA 3JZFA 2NYAA 2HZ4A 1GY3A 2Y6OA 4YNEA 5CU3A 5J9LA 4V05A 5FXQA 3WWJA 4PP9A 3C5UA 5FEQA 2R7MA 4HN2A 2B0QA 4RX7A 4YO6A 2JKMA 3N6RA 3Q2MA 1FQ1B 2HZNA 2UVZA 5ETFA 3PE1A 2VNYA 5HKMA 3RVGA 4MAOA 5FDPA 4RFZA 4BDIA 4C58A 4X2NA 5CNNA 3FC2A 3L2PA 3P7AA 2CFMA 3P78A 4UXQA 3CTJA 1CTPE 2R3FA 3MA6A 3PP1A 4GKHA 4U3YA 4Q5EA 4XCUA 1FMKA 2UVYA 3ZHPC 4C7TA 4FKVA 4GU6A 4AAYA 4YLJA 3ZXZA 3EHAA 2IO6A 4EOMA 4A4XA 2VTPA 2XM9A 3R04A 4WOVA 4A9TA 3M42A 2QOCA 3JS2A 4HYUA 4TNDA 3A2CA 3UZOA 1WBWA 5KKNB 2EXMA 5AV1A 4FZFB 2ACXA 5EOLA 3TT0A 3QC4A 4ZJVA 5A4CA 4I94A 2UW9A 4FV8A 5HG9A 1B38A 4ZJJA 4I4FA 1FPUA 1W8CA 3LCTA 4XHKB 2HCKA 5HNGA 4CMTA 3MJ2A 4M7IA 5G1XA 4CFFA 4O7TA 5CAVA 4MUQA 4PY1A 4FFNA 1JLUE 2YAKA 4FIGA 2GHMA 4GIHA 4JI9A 5H3QA 4RX5A 5I5TA 5L8LA 2R9SA 4AOIA 4DHZA 4QMSA 2QI8A 4U3ZA 2I1MA 4YPSA 3FQSA 4EQCA 5IEXA 1EHIA 3AC1A 4DGLC 3TV7A 2QODA 3LFDA 2WU6A 3R02A 4FV7A 5AV3A 2OLSA 2HVSA 4QYGA 5HIDA 2ZGIA 3R8MA 4TKSA 4CFMA 3FJQE 5HX8A 5DT4A 3IKAA 4I22A 4NW6A 3HVCA 4B7TA 5T6KA 4IACA 3TV6A 2B54A 4LOPA 1Y8GA 2OI4X 4CQEA 4O0UA 2YIRA 3QCYA 3A99A 3FBVA 2WMXA 3ORLA 3OY3A 4GYIA 5DNRA 2YWVA 5BQ0A 1P8LA 4QSHA 4NM3A 5D10A 2I87A 1JSVA 4XLIA 2FPPB 4APPA 3BGZA 3DQXA 3OFMA 3VO3A 2X9EA 2UZUE 3N4UA 2GMXA 3I6UA 4O0RA 2ZM4A 2Z02A 1CDKA 3BX5A 4MD7E 3VBYA 4B8MA 4RIWA 3LJ0A 4DGNA 3FMKA 1OIRA 4E6CA 4O4HF 4WG5A 3KKVA 1MRUA 2NU6B 4S32A 4O7SA 3ZC5A 2LAVA 4UY9A 3ROCA 5DG5A 4OBPA 3HUCA 1HCKA