2XD4A

Nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
421
structure length
421
Chain Sequence
MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide-Bound Structures of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase
rcsb
source organism Bacillus subtilis
molecule tags Ligase
molecule keywords PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
total genus 114
structure length 421
sequence length 421
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2xd4A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2xd4A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xd4A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2xd4A04
4O7YA 4E4TA 1EUDB 2VQDA 4MV3A 4O7VA 2FB9A 4HNVA 5HV6A 4MA5A 1JLLB 4FU0A 1W93A 2PVPA 2W6NA 4EA7A 2FPGB 2X0SA 2YL2A 4QSHA 2NU6B 4M9UA 5IYZF 1VBHA 4FE2A 3R5FA 5CB4F 1OBGA 3VPCA 2YWVA 2R86A 3MWDA 2CZGA 5C1PA 3K3PA 2YZMA 3U9SA 4YB8B 1Z2NX 2P0AA 2OLSA 2YZGA 4O7RA 3Q1KA 3U54A 4M98A 2YS7A 4EG0A 5J2TF 2QK4A 3OUUA 1CS0A 1JKJB 2V59A 4O7ZA 5FNVF 4IWYA 5JH7F 4EGJA 2YZNA 2R82A 2R7MA 3ETJA 5C1OA 2WYOA 2NU8B 5KX5F 4L1KA 5LA6F 1I7NA 2FPPB 4HQ6A 4MV1A 1KEEA 4O2AF 4C5CA 4HNUA 3V4SA 3JRWA 2VR1A 3SE7A 2QF7A 2DZDA 1M0TA 1KBLA 3RUPA 1BNCA 3HB9A 4XZ3B 2R7NA 1Z2PX 2I87A 3LWBA 2FP4B 2YZLA 4IIJF 3VOTA 4XYMB 3RV4A 3VMMA 2NU7B 3G8CA 4M9CA 2NUAB 1SCUB 3ETHA 2R7KA 4O84A 1VBGA 2FPIB 1KJIA 3TQTA 2W6QA 1CQIB 2SCUB 1AUVA 5JQGF 4O4HF 1AUXA 3U9TA 1GSOA 3VPBA 2Z02A 4ZOLF 1E4EA 5BMVF 1C30A 1B6RA 4MV7A 3R5HA 4WBNF 4O7SA 4FFMA 4O86A 1PK8A 2J9GA 4I55F 1B6SA 4O83A 2ZDGA 3JZIA 5H80A 3N6RA 2YRWA 1EZ1A 4C5AA 1VKZA 2XCLA 2DLNA 4FFPA 4FGRA 2CQYA 3BSSA 2I80A 2R6FA 3R9RA 4YJ2F 4O81A 2W71A 4XYLB 3WO0A 1IOWA 1KC7A 2PBZA 4FFRA 1A48A 3R5XA 4MAMA 4ME6A 2Z04A 1DV2A 2GPSA 2NU9B 4TV8F 2GLTA 1E4EB 3GIDA 5LYJF 4XX0B 4ZHQF 4O4IF 1OBDA 2YRXA 3JRXA 3WNZA 2DWCA 1M0WA 5C8YF 3E5NA 5BPFA 3VPDA 3MJFA 5LP6F 2HJWA 1KJ9A 3OUZA 1KUTA 3LP8A 5BPHA 5JVDF 1GSHA 4MV6A 2R85A 1GGOA 4EA9A 1EYZA 1EUCB 4O7WA 2GPWA 5JQWA 1GLVA 4EGQA 1Z2OX 1KJJA 4C5BA 1CQJB 3BSWA 4DLKA 1M6VA 3GLKA 3HBLA 2R87A 4EAAA 2VPQA 3HO8A 2XD4A 4WD3A 4TUYF 4NYEA 1W96A 1KJQA 4O82A 3NUAA 2I8CA 2ZDHA 5LOVF 2CNVA 3WO1A 1A9XA 1UC9A 3MWEA 2C00A 3KAKA 5LXTF 3KREA 4O7LA 2V5AA 3ORQA 4YJ3F 3RV3A 5CA1F 1CE8A 4ZI7F 4DIMA 3QFFA 4YAKB 2GQSA 5CA0F 3TW6A 3BG5A 2W6PA 2V58A 1WR2A 1GSAA 2PN1A 1DIKA 3AX6A 3K5HA 4MV8A 3TINA 4TV9F 1JDEA 2W6MA 2GQRA 4FFOA 4O4JF 5GONF 2VHEA 5HBRB 4I4TF 4Y8VB 3TIIA 5J2UF 4HR7A 3G8DA 2DIKA 5D8DA 4O4LF 4O7NA 2YS6A 3JZFA 4ZQIA 4MA0A 3DF7A 3TIGA 3BSYA 5JVLA 3AW8A 3ORRA 3Q2OA 4IHJF 3I12A 3BFPA 1ULZA 4GGMX 5KKNB 3N8DA 1EHIA 3V4ZA 3KAJA 3UFXB 5K2MA 2R84A 4M99A 4O7TA 1C3OA 2R7LA 4I50F 5CAEB 4EABA 4EA8A 4FFNA 5EZYF 4O2BF 3R23A 4RZQA 4MV9A 2W70A 1T36A 4IWXA 1IOVA 2W6ZA 2YW2A 3K5IA 4HNTA 5I47A 3VA7A 3KALA 4YAJB 2YYAA 1DV1A 2W6OA 4FFLA 2CNUA 1BXRA 3U55A 4YBZB 1PX2A 1UC8A 2IP4A 2HGSA 4J6EA 2ZDQA 5DMXA 3RFCA 2CNQA 2NPOA 1JDBB 1I7LA 4MV4A 1KJ8A 4IZOA
chains in the Genus database with same CATH superfamily
4QFCA 2TMDA 4U02A 4BQRA 3TLKA 3Q8KA 1UBHS 3NHSA 1VG9B 5EWMB 4PC1A 4GLBA 5FTKA 3HFGA 4BTVA 2JGEA 1QGAA 2F9LA 4PZUA 5JXHA 2BGIA 2QB5A 2FSHA 3QKTA 2D5IA 1LU9A 2JIBA 3PLRA 3OJLA 4TZKA 3JASA 1YCDA 4KE9A 5J2TA 1WF3A 4KWCA 1C41A 2WVAA 2VQ3A 4JJ4A 3VC1A 2FY8A 4PG8A 4X64H 2Q5LA 5I5TA 1HDEA 2AXQA 3O5AA 4PX2A 4BECA 2WPNA 4G4SP 2XBMA 5EXDA 2XZLA 2PR2A 2WWGA 1VL2A 1P4HA 1WCV1 5FTWA 3QX9A 3HBFA 4BV8A 1Y6QA 4JEMA 1K6JA 3NKFA 1Y3DE 2GD1O 1GDDA 2F62A 3FMIA 3WLOA 1KJZA 2XA9A 1LVHA 2PKXA 4MVJH 4RA9A 3UGJA 5DGCA 3H5WA 5JIBA 2C07A 3IQFA 4K6OA 2NP6A 4FUTA 3UKDA 2G72A 4E09A 1C4WA 4LV6A 5FPRA 4HJRA 3KLBA 5AJTA 3W6OA 3ZHRA 1Y3HA 3DTVA 4RU9A 1FSGA 4I7HA 5K3FB 4QODA 2YX1A 1E1CA 2R8KA 3M70A 3QEMB 3UMBA 5L9AA 1E3JA 1QB7A 4WY8A 4ZO9A 3BVPA 3FPBA 1JECA 3QVGA 3OZEA 2SKCA 5EIBC 4A0RA 5C7LO 4N3NA 4Z0NA 3EIOA 5IFLA 4FBTA 1ETHA 1HC7A 2OLSA 5AWFC 3TVYA 2GRUA 4CE5A 3TLCA 2FGKA 2V3CC 3T7SA 2E0IA 4WZAA 4XDGA 3VTAA 2VF8A 6REQA 5DNVA 2AE1A 1PNQA 4A3KG 3N42B 4NCJA 1W581 1XGKA 2ZYSA 4KXVA 1DTWA 2YVKA 4YP6A 1XDSA 1LNZA 1LBHA 4M55A 4MS4A 1RHJA 4Z4FA 1VJCA 2JK0A 4GXQA 1XDUA 2C35B 2VAPA 1S0NA 1O6GA 1EK2A 4B75A 3IPRA 5CHEA 3RCBA 2ZE5A 3LT4A 1M1UA 1P0PA 1PQWA 3I73A 2ECOA 4E70A 4NATA 4ZAWA 5CIYA 1EIWA 1GV0A 3ZQ4A 3T7EA 4IJUA 2QM7A 4XJTA 5JH7F 3DJFA 3FHLA 4UU7A 4ALKA 3UV6A 5AI6A 3GEBA 2J33A 3CEPB 2E5WA 1PU2A 1CDEA 1PVDA 4TSFA 3CIFA 4C4TA 3V6KA 3H99A 1ZAYA 5LZ7A 1ZOLA 3QLEA 1YRAA 2NNLD 1FDOA 5EWJA 5GJVC 1I7NA 3AF1A 3KJZA 4LF6H 3DTVD 3EF3A 2IYSA 1RI4A 1Q57A 1UBLS 3CGWA 2ZAYA 4N7BA 4YMWA 4RVNA 1KEEA 1JG2A 3I23A 1TCVA 3B85A 2HMVA 1Q15A 3L6EA 3V4SA 1Y1RA 3SM9A 5H68A 1GPAA 4KVGA 4E1BA 2D7CA 4LJ4A 5AW1A 3M6MD 3OM1A 1ZUWA 1QZTA 2RONA 4F4YA 3CPJB 1MPXA 1I50A 2DZDA 1XRPA 2X4GA 3GJ5A 2ZUCA 3A26A 3DEZA 4Q12A 3GLIA 1ULBA 2RFLA 2VJCA 1S68A 1MIOB 4AJ9A 4GR4A 3PT5A 2BFBA 5HMMA 1IWPB 3BE6A 1MT3A 1G3UA 2OHHA 1GHTA 3HDTA 1VHDA 2RHGB 5L4SA 1RLMA 3FBTA 3EUEA 3DO8A 4LRXA 1SUDA 2DPXA 3FOWA 2HX1A 4QU9A 3CX7A 1X1RA 3JSAA 2ZTMA 1VL5A 4FC7A 4V3BA 3HABA 2WUFA 5DHTA 4MLDA 3UJBA 2FFRA 1SCBA 1X92A 4G4GA 3G5MA 4IBOA 3KOZA 1TTHA 5B3LA 1C8KA 1GJRA 1H42A 1KFCB 1KNQA 1VHTA 2I2XB 2YNMA 2ZPTX 3W79A 1YVUA 4YJ3B 3C98A 1YDEA 2P2DA 2HQOA 4DL7A 5JXGA 2Q3CA 4IXMA 2CXUA 4NX2A 2I4TA 1JXQA 3GJ8A 4NFHA 5F7OA 2HCTA 4P2GA 4R6WA 4D8YA 2FMXA 1CQJA 2FYTA 2QG9A 2JIQA 1HEIA 3BIOA 3JWIA 3NT2A 3MCZA 3BD7A 3BQ1A 1ESDA 5FLKA 1FPQA 1YJXA 2FPIB 4WECA 4BZXA 4KHPB 2QG4A 3MAJA 3ESDA 2V98A 1G20A 4KR9A 4EHBA 4XOIA 7REQB 1NFQA 4EYIB 3THXB 1V4YA 5JQGF 1QGED 3DAOA 3SGIA 1G5QA 3RAQA 4B3BA 4FW9A 1EVQA 1IUNA 2FPKA 3GEGA 5CR9A 2HKIA 2ZPUA 1G64A 1PBNA 1R00A 4FZ5A 4JWKA 2ZAGA 4I1VA 1LI4A 4JI1B 5HR5A 4FGWA 2G4VA 1K7YA 1X19A 2XE8A 3G59A 2RBGA 5DPMA 3GT0A 3GP5A 4E07A 3KZCA 1ZHOA 3QH4A 4MTDA 4XM1A 3FUVA 3ZQJA 1C9JA 1E9VA 4O7SA 1O2DA 2AR9A 2G77B 4DYVA 5I5XA 3NHYA 1KO8A 4FIDA 2PWAA 1FNBA 1WMSA 3G6XA 3MWKA 3B53X 4BO9A 1EFVA 2AN5A 2QRVB 1IHDA 1VYUA 3C1OA 3U7JA 2QLLA 1G21E 1JN0A 1YFKA 3FSJX 1XZEA 2O8VA 2NO6A 3ELDA 3N7TA 1RBQA 4U8HA 5BNFA 4H9GA 2FWAA 1Y6GA 1K1SA 3IV6A 3RIMA 3PA6A 1E99A 1FNNA 1GR1A 1VPEA 2GEVA 1W44A 2OKCA 3L0PA 4GOKA 4KE6A 5FO0A 1G9SA 4PAQA 4AJ4A 1H2ZA 1Z3CA 1DFGA 1Q44A 2IZOA 4LYYA 4S24A 3V00A 1FFGA 1EVZA 1WULS 4KQ1A 4R01A 4YUYA 3KTMA 1YJ8A 1C4XA 3F4BA 3CWZA 1GYFA 3UOAB 2QIPA 1Z25A 5I9SA 4PGMA 2FAXA 2H1VA 3HACA 4GQAA 4O81A 4BIIA 1Y1SA 3OQBA 1VIMA 4BCCA 4V0KA 3RVDA 4E03A 1R37A 2I03A 1IM8A 2O7NA 2XGMA 3BFXA 3CKKA 3TD2A 1V71A 2QU7A 2TRSB 1KY4A 1NYRA 2RCYA 3SIWA 3KUCA 3GDOA 5BSKA 1QIEA 4BB6A 1YFZA 4DARA 4D8UA 4E31A 1AMUA 4PLPA 2HCBA 4AY6A 1PP4A 1LC3A 3AY3A 4LJ9A 4AO8A 5KT5A 1QG2A 1AB6A 3QE4A 2B78A 1E2PA 1UBTS 3UWOA 1GG5A 2J3QA 4ROSA 4ZN6A 4EO4A 3T9CA 1NMZA 4OGKA 4D3SA 3MJDA 4YUVA 1HK7A 4H0FA 4IMRA 5INTA 4LHVA 4TMYA 5BWLA 1F0YA 4LRWA 1Z37A 5GV7A 2FPGA 1G2WA 5KFRA 1S4QA 1DLJA 1XZHA 2AXNA 1X7DA 2PMCA 4U7JA 4YB8A 3W1WA 7REQA 3E81A 1WCMG 1A9OA 4M1SA 3S27A 4NU6A 4X7BA 2I6XA 1HDXA 1Z26A 4C3ZA 5CFLA 1OA1A 5KNDH 2EZTA 4I4NA 1DO2A 3KL2A 4FLEA 3AHJA 2DPGA 3EMDA 4TSRA 5LDDC 5KCMA 4WLUA 4TMZA 3PP8A 2BFOA 2AL7A 3GBVA 2A8YA 4AI6A 3L77A 1XA4A 1VE9A 1SM4A 1VP9A 4EJSA 1P7CA 3LDAA 3P2YA 4RE6A 4XLTA 3JALA 4NESA 5E7MA 5ESWA 3P0FA 1CZUA 2Q2VA 4ZANA 2P4EA 4BKMA 5KQSA 2E5LH 1IQPA 5AR1A 2CLCX 5KFVA 3FOEC 4UOQA 3ZU3A 4B3HA 1OVMA 1XMXA 3K05A 1EUCB 4U6QA 4BX3A 4ZGBA 1USGA 3FWPA 1Y8ZA 5A71A 3WB9A 4EGQA 5EHZA 1UBOS 1SD5A 1VRVA 2JHPA 2MINB 4DMFA 4BPBA 2HVRA 3HA2A 3CPSA 3QBDA 1ZITA 1AE1A 2EIHA 2HSJA 3MLAA 4X62H 3PT9A 1SZJG 1QQ5A 2AD1A 1XL1A 2VDLB 2ZOSA 3K4QA 3RTCA 4EAAA 4NZYA 3NRBA 1IBKB 1G5FA 1E66A 5I7RA 4EEKA 4O2AB 4DJAA 2QYHA 2B98A 3KKPA 4TKZA 2HY7A 2J6UA 3QUCA 4XTRA 1DKOA 2DT5A 4A7PA 2CGEA 4TXHA 5BVGB 5LYYA 3CLUD 3ONDA 2XNKA 3Q3HA 4HYYA 4QUGA 4RDIA 3IP6A 2B4RO 4AURA 4OBXA 3SN6A 3D4OA 1M9NA 3SZOA 1UBJS 3U0VA 2P77A 4LJKA 1NY6A 2Q6KA 4H77A 1C7IA 1XZPA 1ID1A 1O6BA 2NO5A 2X7XA 1PRYA 5DW3A 9LDBA 1RC1A 5K3OA 5JAHA 3R1IA 4JV0A 5IEBA 3UJ7A 1I4LD 1XCBA 5BWVA 2VCEA 3E8MA 1Q84A 4MYCA 2UXCB 3EIUA 5FA5A 2ZYIA 3AC0A 1PZGA 5B7PA 4BJ1A 1G4HA 4RZIA 4QAJA 3FGNA 3MOGA 3FKIG 2G07A 1I3LA 2BKXA 2WD7B 1XLWA 2IZ6A 4O3RA 3BA1A 4A3SA 2O2CA 3OICA 4NJMB 1D6NA 1NW4A 1V8OA 3TCNA 1V51A 4J9KA 2EKLA 2WD8A 3ENQA 1YC5A 3QA3E 5DT2A 4ZCQA 4DYHA 4LMBA 3L7LA 3SS9X 4ARIA 1AN0A 5IDYA 2ZT5A 1ISGA 3HUEA 4BX9A 3VSAA 2GQSA 5K8TA 4L8GA 4XFKA 3U44B 3I9KA 1OAOC 2A4MA 3TW6A 4NFLA 5GIPE 4QDXA 2KPOA 1V9PA 4DV7B 1FTNA 5FAXA 4AZ0A 4AUEA 1PZHA 1EIZA 4F3KA 1QLHA 4ETMA 1RPTA 2IBTA 2JLCA 4V39A 4HZUA 2P6MA 3MQ2A 4H27A 4OOFA 4BASA 2VOBA 3WHPA 2OFPA 2HDWA 1NLYA 5JZMA 1C30B 2X0NA 2Y0SE 4BNTA 1AO3A 5JVDB 5J4VA 4U2EA 3QM1A 2XF2A 4REQA 3D54D 4MV8A 1BIFA 1NV9A 4QHTA 4GZ6A 1UK9A 2V9ZA 4J94A 3OKFA 4XX1A 1QRUA 4DM7A 3GGOA 2PVSA 4QQNA 3EGCA 1W2GA 3KHKA 5BN4B 4DTCA 2LV8A 3ND6A 3TEMA 3GIIA 4XIFA 3EPLA 4URVR 4DB4A 1PHRA 4EW2A 2D7DA 5JQGA 5ITWA 3B12A 1Y42X 5F2KA 2DH6A 1Z6TA 3KE9A 5LMUB 1Y33E 4CT0A 2X8JA 1DBQA 4RS3A 4DY4A 1SFRA 1GUBA 5IASA 5L6LB 1ZJ6A 3UWDA 4W7SA 3B1KA 1F2UA 1WZCA 4V0LA 2O07A 3NHBA 1M0EA 1QCDA 3E9CA 1WBJB 2FOLA 3LHFA 3ASYA 1O97D 2VNKA 2VYND 1P2FA 2OYSA 2JAQA 1FEZA 1WRBA 3DL0A 3OT5A 4L3WA 2ONKA 1HO3A 4N49A 3RJMA 3RKRA 3T9BA 3FPHA 1G7SA 1N1DA 3H20A 4IAJA 3L8EA 4U8GA 1BW9B 3C8ZA 3MRVA 4MHOA 5ESXA 1HUQA 5AKZA 3NBMA 3D2AA 4TN1A 2JLZA 3DE2X 2SNIE 3BXZA 3O0TA 1WUIS 3NB0A 3BSYA 4A3CG 5HRCA 1VDMA 2XMQA 4C1BA 3NETA 3D4IA 5TEVA 3L49A 5JBNA 4CDRA 5JVLA 3MGGA 1WY5A 2XWSA 1DC8A 3UC5A 3DMTA 4RY0A 2VUUA 4NICA 1DHRA 1SVKA 2RGNC 3CR3C 3KJGA 4FMPA 2G3YA 3QY9A 3I9MA 4DIEA 4JD5A 1PDVA 3UFXB 1E3EA 3GEHA 3K09A 2FLWA 1RJ9A 3KVVA 2J6IA 4LI0A 3UJNA 4IH4A 4U9UA 5ALJA 2R84A 1KDZA 3L4JA 4TMWA 3WBFA 1IN6A 4WN9A 5KOYA 2YWEA 2AI2A 1RBMA 2R00A 2V8BA 3FUUA 3K8YA 3JYLA 4HDRA 5HEKA 3CFYA 1NBHA 3B13B 5HZHA 2BGWA 3H8VA 4WCDA 3W1GA 2QUKA 1A9RA 3IT2A 1G3RA 4G6ZA 2O4CA 4DCVA 2JGFA 4F4WA 1N34B 1N6LA 1X77A 5BRAA 2LIVA 4NZNA 3R23A 2GA9A 1WNFA 3IT1A 4BB5A 3IAS6 3ZWDA 3JAKB 2OPBA 3KQQA 2CYCA 2DWPA 3QJYA 3CR7A 1ZK2A 1XTPA 2WIDA 4NMWA 4BMOB 4TTPA 4YMHA 4INJA 1UMCB 3I37X 4REQB 4FYJA 5A3QA 2ILTA 2OZVA 1J97A 4Q7MB 4NG4A 1N2GA 2PE5A 3MF4A 4Q1BA 2J7KA 1H9BA 2X3UA 3PYLA 3B1JA 3HV2A 1SC1A 1DAKA 2LKCA 3DVSX 4DPMA 3CINA 1CRPA 5FT9A 4D9GA 5AI0A 1CRLA 4NAUA 4AZSA 2O59A 1QHHB 4J9LA 3NM5A 3VNQA 1Q92A 5IJ9A 4YUAA 4FFLA 3B60A 1RLIA 3RSLA 4HN2A 4CG0A 3DQZA 4PSCA 5DU2A 1F20A 1T0PA 2Q4DA 2QL7A 1HNWH 2ZSUA 2PMDA 3PI6A 1VG0B 1SBCA 5AM4A 3I4LA 2HUPA 5DBHX 3JX9A 4J6EA 2NXWA 1U99A 3VV3A 5D3KA 5IHXA 1SD1A 1KEEB 1I2ZA 2O50A 4NP6A 4B71A 2O5RA 1V96A 4M7PA 4MW1A 2CVQA 2VF4X 2CNQA 3BWEA 1R5NA 1H2RS 2DUNA 1RBYA 5AICA 2VJBA 3HCDA 1YTUA 1MAAA 1Z5ZA 2L82A 2QZJA 2NZUG 4ID9A 4CM4A 3I2YX 1XHFA 2XGGA 3FPGA 4XQEA 4EPWA 1LKZA 2EGUA 2H5LA 3GCWA 3RQSA 3U1VA 4YCSA 5K0FA 2V9WA 1P8JA 2OR3A 3DCIA 2RIPA 5DWDA 4B6OA 5IYZB 1GPYA 3WAKA 4O7YA 4YQWA 1XTBA 2GAAA 2JVKA 1U0BB 3ER8A 3NHMA 3KEOA 4PR0A 1MA0A 3OFND 1A88A 1XP8A 1JR4A 3CW2A 1C3EA 4QO8A 1PZFA 5TRTA 2XMRA 4X6UA 1KYWA 2H4JA 3EC7A 1XWIA 2GN4A 4KMSA 4EMBA 3UZBA 2B2XA 3K1AA 1MQSA 2PSEA 4JGIA 4A1OA 5HV6A 2PLNA 3H2GA 1SB9A 3ONFA 5CDYA 1XVVA 3DMNA 4U2CA 1KI2A 1JLLB 3T1YH 3ESXA 4P3YA 5LQMA 2VZ0A 3RTBA 2JFWA 2IU0A 4RWEA 3HDGA 4G0WA 1GNTA 4TXMA 4G9GA 2VLIA 4EA7A 2QX6A 1SIOA 2WUDA 3IAEA 3CJQA 3ZE9A 4EVRA 5IG2A 3JQBA 2B7LA 1R9JA 2C3MA 1BVUA 2IEGA 2FE1A 2G0NA 4NDZA 4BFYA 1I24A 2EKQA 3O84A 1NF8A 2O23A 1LDBA 2PZAA 3JQFC 1ISSA 2VAVA 1GG8A 1KJWA 3V6LA 1Z17A 1ZETA 3RLIA 1ZKMA 4BBZA 4TKVA 3GTJA 1WB5A 3EZ2A 3GAAA 4DW8A 1OH8A 1BXGB 2F1KA 4OXKA 4M8SA 1OBGA 2Y77A 2W93A 2R751 3JQ8A 4JLMA 4JJKA 3F8NA 3FDFA 1A9TA 3FH0A 5CEFA 1C3LA 1GUYA 1DBSA 2QG6A 2J1LA 2O1XA 4MRMA 4AJ1A 5B3AA 3S28A 4UMDA 4K9LA 2GBLC 3R6LA 3RG2A 1LJ8A 1MDFA 2DQ4A 2QZ4A 4BP3A 4UPVA 3MWEB 1Z2NX 1ABEA 2E6UX 2IU6A 4Q3LA 1H6AA 3TW8A 4Q1VA 1C1XA 3IALA 3FY4A 1W94A 5AKYA 1OGIA 1EGVB 3GCZA 2XOEA 3BL5A 1ACMA 4HAXA 5G0WA 5AW9A 4UTNA 5FJJA 3R0XA 1H2WA 5JWHA 1ORTA 5JISA 5FLXA 1MH1A 5ISMA 2N75A 1THTA 2IF0A 2PJUA 3NM4A 4HS4A 4MPRA 1NWHA 1JQAA 4LGCA 5LPNA 1H2AS 3L0YA 4UXIA 4LKOA 1LSOA 3OUUA 3GEMA 1H3EA 3RC7A 2H7CA 2E5FA 3KT6A 2NSLA 5BSVA 2H1WA 4OHZA 4PLYA 5K4HA 4DR2B 1QQBA 2VQ6A 1W4RA 1RCFA 4JLWA 3SIPA 4BQNA 2R6AA 2CZQA 1KA9H 5EE1A 1XP5A 2HSZA 2R6HA 4OFWA 4R2IA 5L3RA 1FTWA 2WJVA 5DI3A 5A5DA 1E2BA 3KYHC 1QP4A 4PSKA 4TLDA 3ZJYA 4JGBA 3M49A 4O3OA 1B43A 1JT9A 3E58A 4HQ6A 4M0DA 2XT6A 1RVDA 3NUQA 4MMYB 3RIGA 5IPFA 3MTIA 3FAZA 1JQJC 2YW9A 4NBSA 4DIDA 2JFOA 3L2PA 1NG9A 3EB9A 2JVIA 4JSRA 1IAVA 1M8PA 3JZMA 5EXEA 4D41A 4UHDA 2UZ1B 2I3GA 2VPYA 3DKRA 3PNKA 1ZCFA 2IP1A 3IVAA 4MKIA 4OXRA 1R9GA 2PSSA 4GRDA 4UE2A 2WFLB 1SPBS 2I67A 3OZ7A 5E7JA 2Q50A 5HGJA 4EVSA 3EIHA 3GBPA 4AO7A 5C5CA 3ZBUA 3E9QA 3C6YA 4EX7A 2WYWA 3AETB 4JLAA 1BVHA 3GPCA 1XNGA 2H48A 4II7A 1C7ZA 2AF4C 2WF5A 1WEKA 2R6CA 2WMNB 4WFIA 3TZEA 4DMUB 4G0OA 3ZE8A 4A2PA 3RGXA 4R31A 1JG6A 3LUFA 4WESB 2C2KA 3TZHA 1E1KA 3F7OA 2LP4Y 4GMKA 3VSBA 4JL6A 4ZOQI 3ADBA 2Q2UA 1JJAA 4D98A 4LMAA 2CJFA 2OO3A 3M9LA 5K8VA 3GP8A 4E21A 4MB6A 1R27A 4GMXA 1THZA 3K5WA 1H1TA 3FBWA 4J90A 4LEIA 1I6WA 3GJQA 3PUJA 3S2FA 5J2TB 1TZJA 3QELA 4II2A 5THXA 2COKA 4I4TB 4R2LA 1SUSA 5FBVB 1YVPA 4D0LB 1N9KA 1ZJ4A 4DR3B 3LQQA 2V0CA 3IQEA 5I8PA 4CLOA 4BBPA 3FMGA 5JXWA 3HBJA 3ZY4A 2ATCA 1RZUA 4L5CA 3RVMA 1XSEA 4GXRA 2XZDA 4YRRA 3UWSA 1AIPA 4JI5B 5LKAA 5AVXA 1KJIA 4K6FA 4OXYA 1FXUA 1BDHA 2W7PA 2W6QA 1DEHA 1I6MA 5LA6A 1FFDA 4DV3H 1VSUA 3UK7A 1A7UA 3UPTA 4O4HF 2VWHA 4ZZ2A 4UHFA 1UBNA 1F5SA 5FV4A 5K09A 2UYHA 2I33A 1A27A 3R8XA 2Z02A 1U8ZA 1XMIA 1GTL1 3SI8A 1WSDA 2Z9CA 2ZCUA 3BDAA 1DXYA 4JFAA 4X1IA 3TF5A 1D4AA 4ZVKA 1PVVA 1ZK4A 1WW3A 2YWDA 3B6KA 1XKTA 4FMBB 2OXIA 3RU9A 1GU7A 4BO5A 1DSSG 4ZU3A 4I1OA 3R5HA 3GGPA 3U6BA 1XTJA 4LRUA 5H70A 4DQKA 5ICSA 1J49A 4P7GA 4R2WA 3A10A 2FSFA 1BKDR 5F9FA 3DAPA 2BFPA 4P0PB 4XWTA 2NAPA 4MQ6A 4O4IB 3ZDAA 5FKJA 3I6BA 3ZGYA 2WW8A 3KUXA 1HSOA 3S2EA 2P2YA 5IJWA 2FDXA 3JARA 1VYTA 1REQA 1NJ1A 3S81A 3RB3A 3THRA 3ZEIA 5K0BA 1KRXA 2EZUA 2X77A 3LUBA 5DOVA 3QXCA 2YWGA 4RTSA 1R9MA 2Z09A 4K3VA 3W2FA 2OESA 3AUYA 4E2FA 5ALHA 4QJFA 1YMVA 1YQUA 3LM8A 3TGWA 1J00A 3MMZA 4FEAA 5B57C 5AW2A 3DO5A 5G3YA 2QVGA 2OCKA 3F6CA 3A9VA 1DWQA 4B3XA 4CZ2A 4DRZA 1NZDA 3DKIA 4HGPA 1RHMA 3DWEX 4Q16A 3LDFA 1OVGA 4A03A 5CXXA 2CQYA 4ECUA 1UWCA 2V4MA 1I0IA 3W04A 1L4GA 2BRUC 1A4UA 5AP9A 3GLTA 3ZH9B 2O1SA 1RPJA 3R9RA 2O3UA 4LF5B 3ANLA 2V7QA 1K75A 5GJBA 2AMYA 4HC4A 8LDHA 2FH5B 4YYZA 3L7IA 4NZOA 5F9LA 4LA4A 2GXAA 4MYRA 4X1YB 1UJ4A 4UE6A 5AHWA 5JSZA 5JS7A 1E2MA 1O95A 1PG5A 1U3UA 2RGDA 2VP3A 2X1HA 3M3HA 1WS6A 4GI3A 4RH1A 5LC1A 4A6XA 1GGFA 4NCKA 4A3IG 3IXMA 1C5KA 2NW6A 1TVKB 5EJMA 5FHQA 4C6TA 3RS8A 4LXTA 5D3QA 4ME6A 1Z5OA 2R8OA 3WGGA 4CM9A 3O2QB 1JEEA 2HR1A 1N2SA 4ZIRA 3REQA 2NU8A 1QRSA 3AONB 3CNNA 1LSUA 1J0DA 2DR2A 4E4RA 5DTEA 2A57A 3GLIB 3SLKA 4AJLA 3A1CA 4BBRG 1Y8RB 3K9HA 2H9AA 3MTJA 4HHEA 1F8YA 4HUJA 4WCVA 2IV7A 1TM1E 5FHRA 1JIVA 3UYKA 2UVRA 4P58A 1J99A 5HCNA 5J4KA 2X1MA 1Y8CA 5C8YF 4A3MG 2EJUA 2H7VA 2GEJA 4GYWA 1ZISA 5A2GA 3KVNA 3PUWA 1XK5A 5D1OA 2EFGA 4LKRA 3AF4A 5CD9A 5K05A 1BDBA 2I7CA 1P2TA 3Q6MA 1XBTA 2QM8A 2Y27A 4XIIA 2E2HA 1E8MA 3KAQA 3OTOH 5HF8A 4UW9A 3U7RA 1U98A 3WRYA 1CZKA 2O03A 1ZVJA 1JR6A 4S05A 5KQRA 3DZCA 2AHRA 2WWTA 2LZ0A 3KLPX 4PGGA 3ULKA 2EX0A 2Z08A 2BI4A 3A6FA 1XF9A 4AY4A 5SY6A 1CUYA 4S2EA 1SUAA 2PIAA 4G01B 4H1VA 2EGGA 1G3IA 3ZIAA 1N5MA 4DCNA 1YR8A 1RCTE 2XH8A 3OCWA 4W5JA 3FNBA 3KYDB 4FPXA 3TQIA 2W8BA 3VNNA 2C2WA 4W1QA 1EFPA 1GUZA 3GBSA 4B4WA 3OF5A 4DS3A 1W30A 2Z2YA 3THOA 1M2VB 5EIFA 3F7NA 4CEJA 3OI7A 5HIMA 4L4SA 4BLOA 3GB8B 4NYEA 2IUYA 3HCBA 1JJFA 4TZTA 1KJQA 5L45A 3SVLA 1JTVA 4QXOA 1UWLA 5EWEA 1JL3A 2CL5A 3QMMA 3W90A 2FG6C 2IF2A 4GT1A 2Q0SA 3ORSA 2C5GA 2FJUA 3CURA 3MFHA 3CT6A 4U7GA 3NUAA 4CTNA 5GJCA 1QO0A 2VBCA 5KTKA 5ALRA 3ICOA 3U3RA 1WKBA 2JIZA 1ZI8A 5FPPA 4LYEA 3RHTA 5F2OA 4YWHA 4UAJA 4XSHA 5LB2A 4WLFA 4HTFA 4UPEA 1V3TA 1G16A 1HE1C 3A6JA 3EC2A 4C0BA 1F60A 1ODJA 1SOAA 3G0GA 1MC5A 5CU7A 2IBKA 1VL1A 1X7YB 1UFKA 1TO6A 2HJHA 4ZCRA 1ODSA 3ODPA 4W5WA 2D2IA 1Y8QB 3TW4A 3DZHA 1PZNA 1NDQA 1ZH4A 1WPRA 4JBLA 1RS0A 4HMOA 3LC0A 3LW8A 3KXDA 1HZJA 2YCHA 4JXUA 4DIMA 1GT91 1RYZA 3DHNA 3UMCA 1NN5A 3TXXA 5IP5A 1CR4A 1I5RA 4YV1A 2VYFA 3E7DA 3M6FA 5JMTA 2I6GA 4FTWA 1GQYA 1WR2A 1GRQA 2FDCA 5K3SA 5BXQC 2O7QA 4ENUA 2DBRA 1B3BA 4XVHA 3UW1A 3IBCA 4UTOA 3T1HB 2XCSB 2CNOA 2QGFA 2QVXX 2XT0A 2Q0XA 4G8CA 3JASB 3IT0A 1YF3A 5AJVB 4EHLA 3KJXA 3TX2A 4ZI5A 3JU3A 2GA8A 1AS3A 3EQ7A 4LK3A 4R8MA 3A1WA 5FX2A 4O2LA 1BKSB 1CBUA 4MCIA 3R7AA 2QR3A 4Q9HA 1HSZA 2G04A 3IAM1 5J59A 4ZYXA 4IV0A 1MAVA 1Y37A 1LJLA 3W05A 3LKVA 1B8OA 4GPEA 3NEPX 1QHHA 1ZPDA 2OCYC 4BTLA 4O3PA 1CRQA 4CMIA 1RNLA 1ZNYA 1D0IA 2J6TA 2D54A 3HMQA 4YRFA 3GTQA 4C7OA 3AUTA 4N8SA 3ZDFA 2XHZA 3L6RA 4N6OA 3HKCA 2PU5A 3BREA 1R0YA 4WLEA 3RF7A 4MQFB 3AHFA 5KT4A 1NNLA 4WCFA 3RAPR 1U0SY 1RXVA 3P4UA 1NVDA 2EL7A 3GRZA 3JZDA 3UCFA 4C3VA 3GAFA 3EDYA 5LMCA 3DDNA 3IH5A 2PBRA 1JKXA 4LMPA 4XPIB 3TG8A 2IXTA 3VM6A 3S2ZA 5LP6B 4QJ4A 2VOEA 4J3NA 4DRFA 2VUIB 5C31A 1GR0A 1CKMA 1SXJC 4WDRA 3WZ2A 3NZEA 2OK7A 1P33A 1OXBB 1RHQA 4FDUA 4UBKA 3MR5A 4MUHA 4R9NA 2EJBA 3TIFA 3V4PB 3WFIA 4AICA 1DRVA 3GJ3A 2FFJA 5GQSA 5IM4A 2COUA 2JLBA 3LSYA 5LUAA 3SKXA 1QE0A 3FVWA 4R2KA 3AHCA 4CKWA 3FYSA 1JG7A 2WKRA 1G63A 5JNWA 5IWAH 5LLDA 1GTJ1 4F91B 5IYZA 1U80A 4XOUA 1PW5A 2VJNA 5BN5B 3R3HA 1CU1A 1LF0A 4H3HB 4G4SO 1KZ6A 1ZM7A 4HDMA 4M6WB 4XQCA 3OU6A 3MSXA 3ZY6A 4CL0A 4ROTA 4YT5A 2Y0PA 5K0NA 2PMZA 3PU6A 2ZVDA 3AUUA 4HDNA 4QLBA 3PCTA 3BCHA 1M6YA 3MQ4A 1OFIA 2CMGA 1DAPA 4H2DA 1ULZA 5BWTA 1PDWA 4KHZA 5KKNB 1EHIA 2N42A 2Z3ZA 3V4ZA 1XCMA 2CVHA 1E5TA 1PCXA 2PSDA 4HDOB 4IXDA 4OOEA 3LBNA 5A7HA 4L51A 5SV2A 4NCBA 3FPCA 3K1JA 1VJDA 3AEZA 4UMVA 5FUYA 4A3EG 3CUSA 4XH9B 2OZLB 4ABTA 2DXIA 2OMEA 4RTJA 1YK1A 4DT1A 2OM2A 3CKLA 3PSAA 5IDQA 1VECA 3WNCA 4YHHB 3F0TA 5CFQA 1FRZA 4BWYA 4E5UA 3WDLA 4ER6A 2ZJ0A 1OXMA 1D5CA 3PQDA 1R6DA 4MVXA 3WQHA 4F2GA 2AQ8A 3VR3D 4NBNA 3IA2A 2ZVQX 5BUCA 1HXHA 1ZUNB 2QX8A 4DUZB 4MV9A 1YL6A 3EW7A 4C0KA 4HH4A 5D51S 1G291 3QVKA 4NJMA 4UBIA 4W4TA 3RQIA 4AP5A 3Q3EA 4O4JB 5FXMA 3CXRA 2E18A 4ED8A 1QLWA 3FZYA 2DVMA 2FVYA 2OD9A 2QL9A 4UOZA 2JIPA 5LZ4A 1TJ3A 1CKEA 1JHQA 4U39A 5DHFA 3SOPA 4JJIA 1SHKA 3I4MG 4BNFA 3RADC 5REQB 4L95C 5I47A 2IZ5A 3X3HA 1OX6A 2XTZA 2XADA 4FDTA 2QJTA 2OGUA 3B3AA 3UHAA 4MYSA 3E3NA 5CFNA 4R1LA 2PUCA 3KR1A 1KZ7B 4JMLA 3VSDA 1SXJD 3KLNA 3D8TA 1F8UA 2MDTA 1LUAA 3HYCA 4YBZB 4CMFA 3I72A 3L92A 3Q5EA 4YLGA 5K8LA 5JJIA 4R0VA 3I1FA 4ZO8A 1Y0BA 1DE0A 3L1JA 4CMGA 3ENWA 4DR7H 1MH9A 3COYA 4E3ZA 2WWXA 1J25A 1D6JA 3NJRA 1DT3A 2GAJA 3FCUB 1YB6A 2IL1A 3GFFA 1ZICA 1OXVA 4BPRA 5FOWA 2QN9A 3KPVA 3OX2A 3QTBA 2GQ0A 4D9CA 1KVUA 1N6PA 2DBVO 2JHCA 5L3QB 4OM8A 4KV7A 3PG5A 3SF8A 2N1BA 2DBQA 3GV5B 3A4IA 3FNIA 5I7AA 3UMFA 3WGZA 4TWZA 5HPYB 5FI3A 5CLIA 2WEKA 3OPNA 4P2BA 3RBAA 3L4KA 1J2UA 1QHIA 2IXBA 2OQIA 1P8LA 3C3DA 2QAJA 2ZE7A 1LB1B 1SXQA 2R8EA 3M3PA 4WOPA 3WX0A 4Q8FA 3NYWA 2RE8A 1JV2B 1O94A 2QLJA 4BMZA 3ZD8A 4NDAA 1FFWA 3OPYA 1HR0B 3TBHA 2HSDA 3VNSA 3VYVA 2E6KA 2IS6A 1BTOA 1EVJA 1SKQA 2RB5A 3OU2A 4KYUA 4QLAA 4H6XA 2M6RA 1MC1A 1ZH8A 2FX3A 1L1RA 4OL9A 4NCAA 1MIOA 4XD7A 1MXFA 4XX0A 3VAAA 2C1XA 2FB9A 3HJCA 2WDTA 3CU5A 4JP2A 3ZS8A 5C7YA 1UAAA 4C0XA 4ZRDA 1QGUB 2XE6A 2WICA 4TYNA 3RC3A 4GVPA 3P19A 2P2LA 3V6MA 1TJYA 1WTAA 4JGGA 4J1TC 3REOA 3PB3A 1CB0A 1HDIA 3QXSA 1IHUA 4KO8A 3MPOA 1WWKA 3TL2A 4PFJA 2WNSA 3KYDA 4YJFA 3T1YB 4P7FA 1KGSA 1JIJA 1G21B 3VO1A 3NU1A 4JI3H 5E1OA 3UGQA 4CV0A 1I3MA 1KI8A 1E9RA 2Q07A 4KQMA 1RK6A 1ENPA 3FCCA 4O1MA 5ANRB 3MR3A 1XKLA 4ZMBA 5IT0A 3L7CA 4A9AA 3QJGA 3BXFA 2PV7A 2EIXA 1COZA 2ACWA 2IC5A 1QF9A 2C4VA 3ETGA 4DDKA 2VHQA 4GQIA 2D6FA 5C5DA 1UMBB 3T5DA 1Z4KA 3DKVA 4O29A 4A0QA 1GL6A 3H2BA 2W2MA 3SXUA 4BLQA 3MWDA 4C7VA 3Q3CA 1Q0TA 1SKUA 1O95D 5EPEA 1J0XO 4BNVA 4DMGA 2OHXA 5I60A 4E14A 3MTGA 2VNHA 5L3VA 4JI4H 2R62A 1XRNA 3A9TA 2I78A 1YDFA 1V4NA 4HMQA 3BFVA 2R8PA 3D1LA 3L6CA 4X61A 2Q6TA 4DLRA 1QE3A 3CE6A 4PTYA 5DTMA 5JATA 4GLJA 4L4ZA 3GJ4A 1W47A 1KEKA 1EESA 1HYEA 4Y9UA 1V2GA 4DCTA 1P19A 4AJHA 4ZRNA 5BP7A 2X9NA 3VYWA 2VAMA 4RTNA 4JR1A 4BKQA 4KRYA 5KKCA 1NATA 1PFVA 3MAAC 2IPLA 3HVUA 3S7ZA 2C82A 4BRSA 2OP1A 1HE4A 4D8TA 1IY1A 2N46A 4YJGB 3W2TA 1MV8A 1ZM2A 2E87A 4ALIA 5FI0B 1TC2A 3O3CA 1MX1A 4CV1A 1E1LA 3CKMA 2DPHA 2HDOA 2AUNA 3LUCA 3A4NA 3LLMA 2FUKA 3ZBTA 5C1OA 3F49S 2JARA 1SG0A 3NP9A 3MD9A 3NPMA 1O57A 3N53A 4QGGA 2FETA 2RJ3A 4OQZA 2FRVA 1ZN7A 3KQNA 5AUNB 4N5DA 5LKRA 5A04A 3FDJA 1N2JA 4ND8A 4XWGA 4NOMA 4ZMSA 2A58A 2FN9A 2OCIA 4XJXA 1QIIA 4IICA 4CW7A 1NX6A 3OEEA 1F9EA 2R25B 4ETWA 1ZOIA 1W9HA 2A1TS 3PGMA 4JUAA 3QV2A 1YQ9A 4BE7B 1ZNWA 5CDHA 3IAAA 5BUQA 2AR0A 4OYRA 1YULA 4G86A 5L3QA 3AEXA 3ZGXA 1J06A 4FYHA 2RHMA 4MROA 4HDMB 4P36A 3KEMA 3KHSA 1QTNA 3QW2A 4PLHA 4QQKA 4RPLA 1H0RA 4I5FA 2ONJA 2GPTA 2G25A 2PMFA 3EFOA 2WHPA 1ARZA 2OBLA 4F5WA 4IIJF 1H9AA 4D9EA 4DBZA 3KSBC 4FUQA 1J0BA 1YE8A 2KS6A 4NENB 3PO2G 4QQRA 4CI9A 4UHBA 1Z0SA 2BD0A 5DOZA 1FK8A 5F51A 1HNXH 2J9FB 3RE1A 1Z9BA 3ROMA 4POOA 1WV0A 2W8ZA 4GR9A 3SBDA 4A3BG 3OC6A 1GQRA 3CG0A 3LCUA 4O5OA 3U7HB 4ISCA 4XTCS 1CEYA 3DPIA 4J8PA 3CLSC 1E2UA 1QWSA 3HJNA 3QF4A 3I42A 3K31A 4X85A 1LJUA 5HS6A 4O84A 1YOVB 3CZ4A 3GMSA 2DERA 1DWUA 2HHAA 1FJGB 2VZ9A 1JFFA 1KH3A 5JCJD 4JJEA 1P75A 3OIYA 2XTMA 4RTPA 3NVDA 2YJ4A 4B43A 4YMGA 5KOJB 3EXEA 2WQ7A 1TWAA 1NQ5A 5ALOA 3USES 2NUTB 3TR0A 1H9CA 3U9TA 3NKVA 1GKYA 4MKXA 5I7UA 1ZMOA 4FSDA 2JASA 4BKUA 1PD1A 1U2DC 1PL8A 2MSWA 4F11A 2EW2A 2X5KO 1TD1A 3IS3A 1K8XB 2BDTA 2WU8A 1I3KA 1OXXK 2ZIUB 2F7SA 3FNQA 4XD2A 5HG0A 1EKVA 1GAWA 3X1KA 1E7QA 3GUUA 1WCWA 1NLUA 1IN8A 1L7MA 2EKBA 2NNWB 3GMTA 3IHWA 1GQFA 4M9ZA 5HCUA 4FFMA 4O86A 4PYRA 3UCEA 3QU9A 4B2PA 3EW9A 4EP1A 1ITZA 5DISC 2C9ZA 2HU7A 2HNAA 2JIRA 4QEDA 3KHHA 4XB6B 4TYYA 4NBKA 2R8ZA 1G4UR 1PNOA 1O77A 1AQIA 1QE5A 2QTZA 2NTEA 4M0FA 1RYBA 3UJ3X 4DJTA 4Q18A 4ZK2A 3FTFA 2ZROA 2O2IA 5DH9A 5B37A 2UXDB 1JGTA 1NBIA 4AKIA 1ENZA 1G20B 3ILSA 5LU9A 1HGXA 8ADHA 3STYA 2H1OA 4LCJA 3WGTA 3I2GA 1URPA 3S6JA 4KRGA 4DIKA 5I9LA 3V55A 3WLRA 2IYQA 4LVUA 2MJLA 4XCQA 4DG5A 2FW1A 3KKKA 3BTSA 1MTZA 4DPKA 3PHGA 4IRDA 3E3AA 4FJ1A 2R92A 3HWX1 4TLBA 4M1YA 3BQ0A 3UB4A 2H52A 3KE8A 1U0LA 4HGOA 1E20A 2Q9AA 1KVQA 2VWPA 4HRAA 5E8JA 3V3KA 4QWAA 2N3ZA 3EFOB 5CLGA 4I19A 4RQAA 4PBCA 2BIFA 4YP3A 2NXJA 2H00A 5B53A 1P7VA 3EF0A 1T6NA 4JENA 5BMVA 1K8ZB 1JG4A 1NU8A 2JRCA 1YUMA 1G1AA 4KQEA 4O1IA 2J45A 2RGGA 1MO3A 3A05A 2IXAA 1KVRA 2GLTA 4CM5A 2LKDA 5H59A 1KNXA 3R74A 1WXWA 3H9QA 3BBPA 1AK9A 3CZQA 3IOMA 1NW3A 1VI6A 1BRMA 2HL6A 4YY3B 1W4AA 2YRXA 4JN6B 3JRXA 2A14A 3PFNA 5JAUA 2O8FB 2H3HA 3WIVA 1I0ZA 4LDPA 2WD9A 4F86A 3O8RA 4UDOA 1K1QA 5B6PA 5K0GA 3WNZA 3GJ0A 3VOSA 4UHJA 1YZQA 13PKA 2PG3A 4KQFA 1IONA 2GNOA 5HXAA 3HS3A 3C6MA 3H6HA 3A14A 3QKRA 1Y1KE 2G88A 4C21A 3LL4A 4OHWA 1P80A 3BOSA 1SUIA 1TIPA 1UJ6A 3DDHA 1T9GR 4A5OA 2AXPA 4PLVA 4CL8A 1GSHA 5JT1A 4I1RA 2OMKA 3H17A 2VRCA 4NONA 1BVYF 1CLUA 3OM0A 3NEAA 4DGQA 1MRSA 2BFNA 2QL6A 3PQ6A 4HNQA 1VJRA 3CW9A 3N86A 1Q3TA 4KX5A 1OGYA 3K71B 3PD1A 4LE1A 4Y9RA 4W5OA 1XROA 2F8SA 4XYMA 1CJKC 4MPJA 5G0TA 3GAMA 2R4UA 2FQWA 2PUWA 1JJ7A 4LNUA 3RVLA 1Y63A 2DFKB 3I34X 4AMBA 1DUIA 2PDAA 3MINB 1RKXA 2VNJA 4JA2A 1IB6A 1VL6A 4FGZA 3AVWA 1DAAA 2JKVA 3CSUA 1TADA 4Q34A 3HBLA 1ZH0A 3NH6A 4ECYA 2X9LA 1LSJA 3JD2A 2WF7A 3PQ5A 1GKLA 2E7ZA 1V9SA 3K92A 4WD3A 1W5EA 2EP5A 3INRA 1F4PA 4TUYF 1LPSA 3KKOA 1GD1O 3GIWA 5KVVA 2ECQA 3AJDA 2GJKA 4ZP1A 3WSVA 1GTZA 2P9YA 4PYKA 1C9EA 2XD9A 1JHMA 5IX8A 3H9CA 3A25A 3ISTA 3P9RA 3HYRA 2ZWOA 1XOIA 3SFZA 3H5LA 1OAKA 1LNQA 1MUUA 4HEA6 5TMDA 2DAPA 3SEAA 3MOSA 4P7BA 4F6CA 1NBMD 2FTKE 5TPZA 1I80A 4E3WA 3Q72A 1EBFA 1JLKA 2IUUA 3TNDA 2X6TA 1K88A 1QX3A 1NIJA 5NULA 2C97A 2GERA 4LF8B 3CLRC 2J0UB 2MOKA 3N5KA 4MP3A 2ODNA 3BMOA 5FBZA 3PRKE 2JLUA 2QLNA 3QBJA 5CA1F 1TI7A 2OOSA 1NUAA 3FZEA 4PANA 1S2MA 2VRCD 5ECWA 4R3WA 3SX4A 3TTWA 5F7ZA 2ASEA 4KJZA 5EEHA 3NWJA 4IRCA 3EX7C 2Z6UA 4Z9FA 3G13A 4HYEA 3S70A 3HP7A 2JCSA 4WK2B 2MCFA 4ECSA 2OYRA 4DHWA 5BRJA 1CNMA 5C32A 3I2JA 2W4IA 4L7VA 2EF1A 3BJEA 3NUZA 1XEXA 3QLJA 4DL3A 1A8HA 1KAEA 4XAQA 5F1YA 4BN0A 4TVBA 1KSHA 5T5QA 3ESBA 4LW8A 1V3VA 1U1EA 2PSJA 2ST1A 4WI1A 3QTLA 4OHFA 2NT3A 1KL7A 1Q1NA 1U0FA 1WMEA 1W85A 1LPPA 1YQTA 2JAUA 3HJHA 3NP7A 3WNQA 2XUGA 1UDXA 1JXMA 4HF7A 3FLEA 4PBSA 1D2NA 1TA4A 1R10A 1Z4QA 5DYWA 3ZD6A 4TV9F 1NRXA 1WQ1R 2FPLA 3DWFA 2IHKA 3OT1A 1NVMB 4FGJA 3EGWA 2JGMA 1JRLA 2GCPA 2NVUA 4C0HA 4F84A 1RE1A 5CYFA 1B23P 1PQ4A 3GV7B 4LHXA 1ULUA 2EZ8A 2HWUA 4MSUA 3NHJA 4Y2SA 3AWDA 5DBFA 1TM4E 1ZIYA 1FP4B 2F3TA 4G2NA 1PT9A 4NU0A 4MW4A 4A0SA 2JGJA 4OF4A 1N3LA 1FLDA 4MVJG 4ZC8A 3UUWA 1M54A 4EFBA 1V41E 3FPSA 3KPJA 1E3WA 1A5TA 2C0QA 2G08A 4RVUA 4XVRA 4Y9TA 3SIXA 3DW1X 2XZOA 2FSPA 4CLHA 1M66A 2VHEA 2BMEA 4DN6A 1U0HC 2YWJA 5IM5A 4DDTA 3ANYB 3AM1A 3UZOA 2P6OA 4LUCA 2CKZB 3ZHCA 1U1CA 3TIIA 1GU1A 2FU5C 2OHJA 5EA2A 4JT4A 4LV5B 2OQRA 5FBRB 3ND8A 1TAEA 2ZM5A 4JVLA 1TLFA 4XB2A 4CFYA 4TX1A 1BS1A 3JATB 3R0IA 3CA8A 2NUTA 3HVIA 1E9SA 2IZ7A 5C0OE 4OQQA 2DM6A 2VNAA 5CA0A 5I5EA 2ZJ7A 1GNSA 2PS1A 2IV3A 1HV8A 1R7RA 4IR1A 4V3CA 3RFUA 5ED4A 2H4FA 2OSVA 4HWGA 4IXNA 4Q01A 1K63A 5EN4A 1RFGE 3BGOS 2JNWA 1KK0A 5J40A 3AW8A 3PDWA 2BMAA 4WFKA 5FNVA 4E51A 1Q0QA 3E0QA 3UBTA 1FTYA 1ZJJA 4IV8A 4CYMA 2M2IA 1LPMA 3K9FC 1V1MB 3MGCA 1LDEA 4J2TA 2XXBA 3BEDA 3GJ7A 5D3MA 3UH0A 4DDUA 4RQUA 3GQBA 5EJ2A 5LXTA 2PH7A 2C54A 5AVYA 5GTDA 3D3JA 3G7SA 4RU1A 4GMDA 1PGOA 3TQSA 3MMXA 3RHZA 1E4VA 4M99A 1DAOA 1IXSB 1JHDA 4H0NA 3GL9A 4BWVA 1C3OA 4I50F 1JMKC 1LDYA 3EXG1 3I64A 3LCCA 5DBEX 1E0KA 2G9ZA 2AZMA 1ZOOA 2GCOB 4MR9B 4UXJA 4BVHA 2QR2A 2CNKA 2VSQA 1O6ZA 5BYJA 3TGLA 5FPOA 1L2ZA 3HA3A 3PR3A 4J0FA 5M5BA 2BYTA 2J6CA 1I2BA 3K8OE 3FWYA 4G63A 3UTCA 1CQIA 1FFXB 1KDRA 2GPNA 2X3YA 4B3SH 5A4FS 4JV5H 1PSZA 2AJ8A 2GVDC 3PSHA 5MFPA 3COPA 1YSCA 4WY5A 2H4WA 3ZV6A 3ZHVA 1Y5MA 3G23A 2WSIA 3QE0A 1IOVA 2YW2A 1V1RB 2BH9A 2JI4A 3DW3X 4V0SA 1BFKA 4ZOLA 3PVCA 3GLGE 1E6EA 1GRCA 1L5GB 1J90A 3TTXA 4AD8A 1GDHA 3HCAA 1I13A 3VR5H 3ZE2B 4J9PA 4AZVA 2IZ0A 1IN5A 1WY7A 2J5QA 2P35A 3IYLW 1NQAO 2C2BA 1RWMA 2CMDA 2G83A 2UUOA 1V43A 5TJ9A 5D87A 1U9YA 3VZDA 4JOCA 4FCVA 5E0OA 3PNOA 4IIFA 1VI2A 1N56A 1J2TA 1DO8A 2RMKA 3OOSA 1PX2A 2IOFK 1VFNA 1GPWB 4NPAA 2OXFA 1SU6A 2BSXA 3THSA 1U3DA 1BWSA 3Q3VA 3AVQA 2XRZA 2ZDQA 3K6KA 2UYGA 1X80A 3M2TA 4KQHA 1OFUA 1ISHA 4CMIB 1CUUA 4DR5B 3A8TA 3DFUA 5D1HA 1ZD2P 4ZVRA 2XUJA 2VJDA 1AQLA 3BMQA 2HV8A 3LDUA 1BMFA 1J07A 1T8UA 4NDNE 5AW5A 3WAGA 5KFIA 2BFDA 4B4KA 1X86B 4RUCA 4TQRA 3BMCB 4B8ZA 2QTGA 4N39A 2REQA 4BMNA 2BEUA 3IJPA 1E59A 4NEQA 4Z1OA 1IBKH 1NQXA 3MVEA 4MTEA 5C81A 1T4CB 5IW8A 5I5GA 2YDXA 2P6PA 3IDAA 2Q2TA 2G9VA 3EBOA 3KJIA 4I8DA 3O8QB 4ZT5A 1OH5A 3DOCA 1RLTA 1TK3A 1X8LA 4RHYA 1VCIA 5I5WA 1OD6A 5KJCA 4B87A 3ROZA 4DCGA 2EZ4A 1FLNA 4L9AA 3RS9A 1CWUA 3GMDA 4X7PA 1EK0A 3VHXA 4A8PA 3I2KA 4M0LA 3EUFA 3OMXA 4MCAA 3X1XA 4F38A 4F9FA 4OXNA 4B3SB 4QBIA 4RKEA 1FYFA 1GLGA 1M6EX 1Y81A 2J7PA 5SZJA 1YE3A 4Q03A 4GGPA 2DE0X 4AZWA 4Q3BA 1SVWA 3IP3A 1ZINA 2IYOA 3PXCX 3MYYA 1MNQA 4ZAVA 1Z5NA 2QYTA 2UXBB 5EEGA 2A5DA 1T2DA 5F1KA 3MWMA 1TW3A 3INYA 3PV0A 1S2LA 4UDXX 2W6IA 4CM4B 4B7XA 2OHIA 4FI3C 4JKYA 1XMQB 2D13A 3PIDA 4NYJR 3SC2A 2FR0A 4OKSA 1GU0A 5DGHA 3JALB 5ALWA 2HLDD 1XJCA 4I1YA 1C9NA 4OLFA 2GM4A 4WX2B 4P3XA 5FPHA 3ZWBA 2RGCA 3AI3A 4AWAA 3OHMA 1BDIA 1M2FA 5IC4A 3KQPA 2Z5GA 5JDCC 4HN4B 2IEDA 2JCYA 2DFNA 1EFHA 3JCZA 1OI7A 4KMOA 4QXMA 1F8XA 4RAQA 5B6JA 2G0AA 2O2EA 1SZDA 5I9NA 1EQAA 2GWRA 3JPYA 1VKJA 4BMCA 4YB8B 3KQLA 4XJSA 3AJAA 5G3ZA 2P0AA 3TM5A 1J24A 4TT3D 1K68A 4FGSA 3ZYCA 1U4OA 2QE7D 2XUPA 3CW8X 3KFLA 1JB1A 1MQ8B 4HWOA 4KX3A 4NVRA 5HNEA 3GIQA 4C7JA 5CFMA 3IIMA 2QT0A 4PX3A 1O6CA 3C16C 1XTVA 4IOKA 1BMTA 2JA6G 4EG0A 2XQJA 1BOFA 4TTRA 1M8FA 2ZJ4A 3OM9A 2WTAA 3EVNA 2O6HA 3TXAA 4OJNA 1HNZH 4MQEA 4DQDA 3E03A 1MENA 2RGNA 2PXCA 1IQ0A 2GEDA 2PRZA 3Q11A 4MEBA 3AVTA 1ZRSA 3ED1A 3RIXA 4U5XA 4GIBA 3UEOA 2WSBA 4DQNA 1CFJA 5EVJA 3USCS 3TECE 1I1OA 1DKQA 1YACA 2R7MA 5K3WA 3WQSB 4EKYA 2IPAB 2OV8A 4ADSG 3A11A 1E62A 4QUAA 3O8QA 3H5IA 5LA6F 1ORWA 3T0FA 4XUEA 3B9QA 3MJSA 1P6XA 5AKJA 3EH2A 3HR4A 3PGKA 4N65A 5BN5A 3WLLA 2GTPA 3UNXA 4QYIB 4LH7A 3C1UA 3UC9A 1HH4A 3TDNA 4D9MA 1A2OA 5L53A 1MAUA 3C48A 3FWKA 3H0CA 1Z6GA 2GB4A 2W2LD 2AKYA 1COWD 2W2OA 4Q4DA 1II8B 5ILQA 2E2IA 5TR9A 3PUHA 4EFKA 4F3CA 2QW1A 3SJ7A 4GLWA 3WL6A 4QGSA 1ORRA 1BQ3A 5TJHA 1G6OA 5DM70 3GEPA 1A76A 3NGXA 5GOTA 3WK5A 1OWNA 4CF5A 1A71A 1C1HA 3AZQA 2BGNA 5TMPA 1M6VB 1OZ0A 4K6CA 4ZXPA 5KG1A 4NKRA 3DE4X 4HDSA 2BMFA 2V0GA 4XWKA 1MVLA 2Q9UA 3E9NA 1WXQA 3QVTA 4ZAZA 2V03A 3IEXA 1NLMA 4ND5A 4LNHA 4MLCA 4LHSA 3DTNA 5JCOC 3WKAA 1ZA1A 1PWZA 5BV8A 4IGFA 3CJTA 2VQEB 2E4ZA 3E9EA 2J85A 3A3PA 5BORA 2GZSA 2YQ4A 3RASA 2MSNA 3TZLA 1PE0A 5C18A 3TTSA 4TM7A 4B85A 2WVGA 3BH6A 3QOXA 6ABPA 4DCUA 4OQ4A 1NF9A 4R84A 2B1RA 2WAAA 3B6ZA 3BHMA 4XVQA 4BFWA 5C4MA 5C1DA 3AF6A 1HMYA 1SZPA 4R7RA 1DBVO 1KJYA 1M2GA 4P38A 4PSAA 3K6SA 4WKOA 3G8BA 5EP4A 4AB1A 4IPTA 2G80A 2OBBA 4IRKA 2FF7A 2DR0A 1GAEO 4U7TB 3WBBA 3SBEA 2C7PA 1TJ5A 4L73A 3OQNA 3GFRA 3HYNA 4JQSA 1CQIB 1FFXA 3M33A 4KJXA 4I5DA 1F5NA 1KORA 4P4GA 4IEEA 5F2EA 4AYBA 3V3TA 2CNWA 3GARA 2O20A 3ESRA 3FDXA 4I55A 1EG7A 1VE3A 2JH8A 4QJBA 3NV9A 4DJDC 2VHCA 1YK0A 3GUYA 1GZ3A 3SXJA 1FDSA 1W0KA 1RR6A 5KYVA 4CF6A 4ZOLF 2G6TA 3AFHA 2JA1A 1BHO1 4IMJB 4QW9A 1WCMA 2CLDX 2QTLA 3K9QO 3SNOA 5HCIA 1BJTA 3QVUA 4QHSA 1GLNA 3LYAA 5EIEA 2A9KA 4FHDA 4D4JA 1FRNA 1JKFA 2E4YA 4LSAA 5J2UB 3W1VA 4B8YA 3VR4D 3WA6A 4YXWD 1PR2A 3IIIA 3MGAA 5KDDA 2F4VH 2FZWA 4ARCA 1RYEA 2F9FA 4V03A 4Z9XA 3F7TA 1M6WA 5ALTA 4B6GA 3JQAA 5DBIA 3A70A 3CCBA 3EEOA 5A3RA 1R18A 4YJ2A 1RZRA 5IZ4A 2HK7A 1MX3A 3WSWA 1U7TA 4DJ5X 4E15A 4DMRA 4QUDA 3K0HA 2VSNA 3DR5A 5T3UA 4D4IA 3NYIA 1FZTA 3MC1A 4EG7A 1EQ2A 3UJ9A 4H1TA 1QH0A 3ANTA 2P3OA 1ZCBA 3QPVA 4IXTA 1D04A 2OCAA 1RWXA 3QEKA 4HD8A 4NFYA 1SRRA 5CJPA 3V4VB 4D3XA 4DSNA 1B8PA 3QLTA 5DP2A 4DVGA 5GVSA 5A3JA 1XTQA 2K7ZA 3KSUA 3PHLA 4I9GA 1S2NA 2C04A 1LGYA 2DECA 2HJGA 5FBKA 3TLMA 4CG2A 3MR6A 1R1DA 3RSFA 2XAUA 1Z3IX 5U9CA 2ECFA 3UK1A 1T4DA 1LDGA 1ICIA 1JEYA 2BKEA 2J09A 1CHNA 1V5IA 3QVLA 4Q8EA 5BRNA 4BFZA 2FSVA 3GA7A 4Z0HO 1LK0A 1E77A 2AJBA 3K0FA 5GZ1A 4RJ2A 3GTGA 5IKPA 1BWPA 1I2DA 4CMJA 4TV9A 1Y34E 4PC2A 2B82A 3N74A 3KWFA 2BEWB 2I2DA 2BEJA 5JUMA 1N8SA 1Q0UA 3FX2A 4U7HA 4GKVA 3ZVNA 5JSFA 1W36C 3QU7A 1TA9A 3E2IA 4MUYA 5DNDA 1Q7CA 4WERA 3EMKA 4JZYA 3ON5A 2VEOA 4HG2A 3X1YA 4F72A 2XC9A 4MS4B 5CJ2A 3V8BA 1G2PA 2IE0A 5DLGA 1US8B 1OUMA 1TJPB 4LJYA 4N1AA 3VHLB 4ZEMA 5CBPB 5J1TB 4GLOA 2QAGA 3LO5A 3HU1A 4Y2VA 5BOSA 2AX4A 2DWUA 3D4PA 3GLUA 1S02A 3WL5A 4DV6B 3OEED 3FKSD 5CTAA 1D03A 4AKTA 4ER0A 4PZCA 4MQLA 4FDMA 2ZB8A 4JCCA 4MZXA 4I1SA 2PKQP 3EZ9A 5K0EA 3A9SA 1NFRA 4ZOAA 2PJZA 4XWYA 2P8SA 5BPFA 4PLCA 1YBVA 2PKEA 1EG2A 3H8JA 1F2DA 1YRYE 2RHLA 3ORHA 4GPTA 4JB8A 5ALDA 1YNOA 2DCUA 5EMMA 3UJPA 2NAFA 1JYEA 4R1QA 4W8HA 1DL5A 3L0IB 2WILA 4PCLA 3QKWA 5FQOA 2P6UA 1XK6A 3EQ6A 4AQYH 2HDHA 2BC9A 3H1FA 3AIIA 1M2VA 2VZEA 3EEFA 3WGIA 1IWBB 4JXJA 3JVEA 3VU0A 4C6TB 1WPXA 3ZOZA 4RB1A 1X8KA 3W0LB 4NXMB 3D8NA 4L5YA 1Y3AA 3ICWA 3ZWXA 4RANA 3EXIA 2SICE 2VPPA 1UEIA 1L4FA 1W4ZA 2H2HA 3EEQA 4S1PA 4MGYR 3DULA 3GLKA 1SIWA 2OCBA 3KTFA 2VNSA 3BILA 1WOMA 3AQIA 4AY3A 2HPAA 5HQJA 5EOYA 1G2OA 4QOEA 1G8SA 1MABB 2J0QA 1CD5A 5U1PA 1N2CE 1H1LA 1F0NA 5FWNA 3HXQA 3W2GA 4DR5H 1QTIA 3OP4A 1AZSC 2H92A 2PH5A 1TVCA 2WHQA 4YCJA 4UNRA 5F1OA 1EFLA 1QMGA 4DEYA 4FCTA 3G68A 2VH5R 4OHOA 3QVMA 4DV2B 3KYIB 1K97A 2BCEA 2M9MA 2WINI 4BKRA 4ZO4A 1B0ZA 3BFKA 4MWSA 4TKVB 4UE3S 2AGVA 4W5RA 2Z6QA 2AQ4A 3IKTA 2COJA 3W8RA 3N2YA 1Z5WA 4V0MA 5H02A 4D97A 2BI8A 4ED7A 4MUJA 3IR6A 1UUFA 2ZULA 3COSA 1X3LA 2EEPA 2UV8A 2VDJA 5C8VA 1S2DA 3QHAA 2ZT8A 5AM1A 5JS6A 2B92A 3BFJA 2PX4A 1J21A 2V5AA 2ZU6A 3CLSD 4HYTA 5IVDA 4KZKA 5IP7G 3CZCA 3HZRA 1KR2A 2PXXA 1X7HA 3ER6A 4LJAA 2XMZA 1KS2A 5FTNA 2HT6A 3QXHA 4A4DA 3BD8A 2QRQA 1LQUA 1SCAA 5LQUA 2FMHA 1BDMA 2QUZA 3VAZA 4LVOA 1T0HB 5IMBA 1R66A 2DJIA 1XJ0A 2AI3A 1QCZA 4MW7A 4R9RA 3SFVA 2ZAOA 4KK4A 4BMVA 4AS1A 4JJAA 2QAGB 3BG5A 2FUG6 1IULA 1CIPA 2ZBGA 3KOOA 1N6IA 1BE1A 4J7UA 1PZEA 5L3SB 3WGVA 1FMFA 4L4RA 2PN1A 2JGKA 1PJCA 2H1IA 1FU4A 3NGMA 3QUQA 4L2IA 2UZ4A 1PV4A 1K7XB 4TOIA 4BY7G 2C5BA 4C2BA 5JWOA 1UZNA 3WRYC 4CM6A 2Y0BA 2BEWA 4RZXA 1VIAA 5LP6A 2XWQA 5WRFA 2H57A 3LCMA 1E3DA 2PSHA 1S8AA 4H7JA 5AXCA 1W7AA 4M89A 2IYTA 1X70A 3TN7A 1J6UA 4RD6A 4YI3A 2XOKD 1ZGGA 1NPDA 1ZESA 1DTEA 2EBHX 3KOMA 4JWTA 4M0UA 4M1TA 4ECZA 5I7VA 4PYQA 4WXPA 3RLFA 2A6PA 4RF5A 3PDCA 1PJZA 5FBQB 2Y0EA 5LMZA 4BGVA 5DO9A 1J8FA 1YIAA 1F3OA 1NZFA 4CM7A 2JH9A 3NH9A 3UVEA 4UUNA 2JG3A 4A23A 2O8CB 3EA5A 2FG7C 3BRWD 1SHZA 4JA0A 5JW6A 1TJ4A 3DTFA 1R74A 1PJTA 1VL0A 2PQMA 3QEOA 5NLLA 2ROQA 2CFMA 3LMLA 2W0MA 5IT5A 1XZKA 1VLJA 3I8SA 5IUJC 1EWRA 5JYEA 5TMBA 1GO2A 1WTCA 2GCNA 3WWHA 1HETA 1G60A 3CEJA 1U1IA 4QYMA 4M9SA 2ZETA 3G8DA 3K0CA 5KMGB 2OBXA 1Z0KA 3HI6A 4EPXA 4E5YA 2NZWA 2RF4A 1IZ0A 1BYUA 3GGJA 5DG7A 4OB6A 5JCZA 4ZQIA 1CY8A 2Q5OA 3WFJA 2EWMA 1B3RA 3Q9LA 3VR5A 1A9ZA 4KV9A 2YHBA 3C4QA 4AQYB 1VE7A 4JQYA 3I5XA 4KWTA 1O4WA 2VP0A 1TMOA 4F4JA 4ZCIA 4XIJA 3K0SA 4G5QA 4YA6A 3EQ2A 3BD9A 2XMCA 3E82A 2W7TA 4J07A 1PGQA 2ZTLA 2W48A 2A1TR 2VXOA 2XW6A 4HCJA 5E9JA 3BORA 2ZYAA 5K2MA 3NTXA 3T5BA 4B3TB 3VVBA 4FOLA 1WIWA 1CJMA 3PF8A 4F1KA 2B7BA 4B6PA 4GZ3A 4RB2C 1H5NA 4DBLC 5AIBA 1A5SB 2WT4A 3LT5A 2Q27A 2A1HA 1QG0A 2PGNA 3IV9A 1WMFA 2WTEA 4KBYA 5EWJB 4YV0A 2YV4A 1L5RA 2GF2A 1LK7A 1M5TA 2H65A 4MVYA 1XZGA 4MVJP 4ONEA 5GM1A 3X43A 3CEHA 5ENVA 2ZWMA 5D7NA 3KBBA 1UWKA 3HUUA 2QZ9A 3FMVA 1W87A 1Q20A 3BRWA 3PCXA 4DV1B 1IUOA 3AR5A 5CE8A 3LY7A 2DFPA 3EUWA 3OFNA 4QASA 4FIZA 4RHTA 4ZCPA 421PA 3EEBA 5IWCA 2P67A 2AV6A 1OIXA 3VVLA 2BM1A 2VHUA 2PUGA 1FX0A 5CX4A 5DSTA 1J2RA 5H3HA 3ZLJA 1KI7A 3RF2A 2NX2A 2ORYA 3IRUA 3FF4A 3RTXA 3U6KA 1EMDA 4HADA 4OLAA 3BKXA 3C5CA 3VZBA 1OQAA 3FA2A 5JAIA 5HIAA 1NI5A 3SICE 5KSOA 3ZJVA 3H4BA 3ZBQA 1Z68A 3GNLA 3VAYA 1GITA 3OPQA 5G1OA 2Q5JA 4BU0A 4DRXA 4W9NC 2R6GA 4LNUB 3PNLA 3T1VA 5BV2P 4OQDA 1GCOA 1AXEA 1XL0A 3ZE6A 1NF2A 2PFSA 3NX4A 2VSXA 1LTKA 4P08A 5BWOA 3LO8A 1XTZA 1EQUA 1Z38A 1IOZA 1RD4A 2NVYA 2J9XB 2A9RA 3B1FA 5JAQA 1Q2UA 5LD2B 4JNKA 5A5VA 3MMNA 3T15A 5IVKA 4EGSA 5KSYA 4HWKA 2D1SA 1WZNA 2CC2A 1Z2DA 1TF5A 3R7NA 5IU6A 2GS9A 1U04A 3CRNA 5BN3A 1MGOA 3G0DA 4AUMA 1E3QA 2MINA 5DYTA 3ZTYA 3IEUA 3LBHA 4DL9A 1W9MA 4FBGA 2C9OA 1G66A 3EBLA 4K9RA 3ADOA 2JFZA 3BTVA 3P9YA 1M6NA 4JUDX 4UARA 4WA8A 4YJFB 3OTOB 2PQ6A 3ABOB 1EUDB 4OMDA 4QOHA 2DQSA 1SHTX 2YJ3A 4B6JA 4AZ0B 1JU4A 2EFHB 4MP6A 5KYXA 4RHEA 3E7WA 3CCFA 1BHSA 3AR4A 5JNLA 4BNJA 3WB0A 3CEBA 3N8GA 4R7ZA 4RGVA 4XJVA 2GO1A 3PXEA 5AVVA 2NVBA 3C3XA 2Y1FA 4RDXA 2HZBA 4LJ7A 4EO7A 2WTFA 1W93A 4KPGA 1Z74A 2FWMX 3M3DA 3A32A 2UUBB 2C1ZA 3OPYB 4FM9A 3I2FA 4BKOA 3W1EA 3MMPA 1H2HA 1S8NA 2R47A 3Q7TA 1QANA 1YZYA 2E89A 2FZLA 3LHSA 1F14A 2VS1A 2JLWA 1AT1A 4DUPA 3U7QB 4LXUA 3IUNA 4PS1A 4MV5A 4OFXA 3U2QA 1SUBA 4HRYA 3ZU2A 4WEQA 4C01A 4L6AA 4JI6B 1KEWA 4PRLA 1F06A 3PGVA 2K5UA 3C6KA 4R9UC 3GRAA 3VPXA 1DCKA 2VDQB 1YR7A 3GPIA 1J2JA 4JSTA 2DG2A 2ZQ5A 4KW7A 2IXDA 4XW2A 2YWVA 1DU4A 3AL0C 1YU6A 5BOVA 2HV9A 2I71A 5IF3A 4JV2A 3R6TA 3CUKA 4H35A 4QM6A 1ZIOA 3II6X 1CV2A 1WV1A 3LC7O 5KG7A 1GIAA 1LX7A 3AY0A 3JAKA 4Y0AA 1XXHE 1Y5IA 2YZGA 4X6LA 5F4ZA 1EDEA 1IYDA 3D8SA 2VPZA 5KKAA 1U6JA 1U2ZA 2B35A 4LMRA 1Z56C 5EGSA 2A94A 3C6ZA 3T7AA 2X6QA 2ZS8A 1XNJA 3OZCA 4IRMA 3OT4A 2VHJA 3MTQA 4DR1B 3HRKA 1E4OA 3KSDO 4OQPA 2BKVA 8AT1A 1UBMS 4XPZA 1D07A 2Z2IA 3OX3A 4X6XA 1JKJB 1U3TA 3QIAA 4HNRA 4RLSA 3T4PA 4IWYA 3GHHA 5D5QA 3T8YA 1CUVA 3UFXA 1VSVA 4KDFA 2J7PD 2AG1A 2OAQ1 3EDQA 1KOJA 2YY6A 3M4ZA 2CDBA 1PEDA 2HQSA 4Y67A 4Y6OA 3CN9A 5CEJA 1IBMB 4P0QB 3PHBE 4CE6A 2NG1A 4JYAB 2CB9A 4L74A 4N9WA 1E58A 2HH9A 3I61A 4PSUA 3RRZA 5KQGA 1UEXC 2O48X 4C2UA 4AJEA 5JEEA 5C51B 3KOYA 5TGDA 4RD2A 4JYPA 1P5HA 3WIUA 5I4BA 1R9NA 2DR3A 2KSQA 2VUHB 1K6IA 3B9PA 3SE7A 5DIFA 4DREA 5FUMA 4DR7B 1DADA 3E23A 2JFQA 3GW8A 3LV8A 1JB9A 1E5QA 2GN6A 3HUDA 3NXSA 4L0QA 4PPNA 4RL6A 5U4QA 4FBUA 4HEQA 3A0RB 1ZMBA 4YQZA 2HTFA 1FUYB 2JBAA 2P3LA 4O3NA 2I2AA 1KOFA 2WZDA 2FOXA 3LLCA 4IHKA 4LNAA 4MGKR 3FPKA 3LKDA 4QPDA 2VOJA 4QU8A 1UJCA 4Q3AA 3HY4A 4XQ0A 4CM3A 2CXPA 5C8YA 5A62A 1F6BA 1OV6A 1SMKA 2ZIWB 4EPYA 4OYLA 3RNOA 5DNYB 1EDZA 1YZVA 4WBNA 3DQPA 2YZLA 4MQ4A 4RACA 4A73A 2UXCH 4R9VA 4CKEB 2HPHA 4DRYA 4G0VA 4GC6A 1RWBA 3HP4A 2JD0A 2VTKA 3F74A 4PHCA 2NU7B 2ZS7A 3E7PA 3IPYA 4E88A 3A2KA 2B5VA 2YY5A 4BCDA 3KYCA 5AM5A 2XTAA 4CLDA 1XIVA 4IJ5A 1XD8A 2CKDA 2R48A 1L7EA 4PZ9A 1M5UA 1U8XX 1YR6A 1X9NA 4LHYA 3FCXA 3G0OA 3VU8A 2YMPA 4OB8A 3DOOA 5F2NA 3P2IA 3D7MA 2R1TB 3AVOA 1AMNA 2EW1A 3P45A 3GTKA 3WADA 2IU4A 4BVGA 2Y1KA 5HKLA 3D7RA 4DUGD 1M8JA 3G0IA 3FSRA 4X20A 3WVNA 4N8DA 3MG9A 3SNHA 1JFVA 3SJAA 5I6DA 2BEUB 4UAGA 2HU2A 3B20A 3FOFC 4FDVA 4N0PA 3JRNA 2QLFA 1M2WA 3PPYA 1A2QA 2RSLA 3CNHA 4HPJB 4IXWA 4JYAH 3HVRA 4BNZA 4MVCA 4R1MA 2Q46A 3EYYA 5IAOA 5BMVF 4ZYTA 1K83A 1TZMA 3GN2A 3T12A 3I83A 4J9SA 4CUZA 4DNPA 5A4IS 1B6RA 1K7FB 3GRPA 4DL5A 3P97A 3TLXA 5GADl 1YIOA 2F67A 1CY4A 5FDFA 2VA8A 2TECE 3OE4A 1A5BB 3NQ41 4XA8A 3L0DA 3QE9Y 2W6JD 1EFKA 3E35A 3C3YA 2XVMA 1RYFA 1KI6A 2I1WA 2QTBA 2P9CA 4KGVA 3H0GG 2JLVA 2WSSD 4F5YA 3IEMA 4PHFA 5G4KA 1LXCA 1O96A 1D7AA 1Z6XA 5JNVA 3ZHOA 2J5BA 5IKOA 4BO0A 3TPZA 5B1SA 2O7RA 3ED5A 3U0GA 3EPIA 4I5IA 1LF5A 2YU9A 3LRXA 4RFVA 4B32A 1UKBA 4M1EA 4GBMA 1NKTA 1UDBA 2GARA 2HK6A 1GO3E 2VRBA 1VHWA 1V3QE 3GC6A 2G7MC 4HFNA 4URUR 2WWVD 1NJ8A 2M32A 2Q7XA 1B1CA 3AEYA 4P4UA 4TTJA 3D1JA 5EJAA 1R8SA 3R0JA 3JSNA 4LSXA 1TEXA 3TBFA 4A6PA 3ZGOA 3JZ6A 1ODLA 4QDTA 2B20A 2ERYA 3GH1A 5LQKA 1APBA 4CMEA 1QLJA 1Z2EA 4EKEA 2H63A 4P3OA 4PZPA 2I80A 2R65A 4MNTA 4A8JC 3G2LA 1U7UA 1ZQ1A 4BNUA 5HWSA 2HRRA 1E1RD 3OZXA 2PSFA 1TA8A 3OT1B 4RENA 3TH5A 4D44A 4F04A 2X9GA 5E6SA 1RKQA 1V26A 2B4QA 5JE8A 3W4IA 4EMTA 1OILA 3KFVA 4QWBA 5KFTA 2I8AA 1MVNA 1OLSB 1VKHA 1IJKA 1RW4A 1H0HA 2HXYA 3CNLA 3DMDA 4IUCS 3U4MA 1DIRA 4DQ0A 1A7JA 1Y4SA 2FQ1A 2PT9A 2WWFA 3L7OA 3LF2A 1LV8A 3MJ4A 3PITA 3VXKA 4Z51A 4LF7B 4GKJB 3TEKA 5JLJA 1RXUA 3E18A 3LC1O 1F4VA 3QWHA 2XZPA 1ZW1A 4ZPJA 3W9BA 2AF3C 3KG2A 4GBGA 4MXDA 4W8GA 5CM2Z 2Y71A 3UH1A 3ZNPA 4D7AA 3H8WA 1U11A 4KK3A 4PZLA 1XCLA 3HDJA 1E3MA 3TSCA 4H6VA 1J2EA 5AI9A 5KYXB 2P40A 1JQ3A 1PW7A 3CBQA 1YA6A 1UK6A 1VKOA 5JJBA 2QOEA 4LXIA 2ZAMA 2MYTA 4J0QA 2P2NA 4DOMA 2GWHA 4ECQA 1AK2A 3RS0A 1AC5A 1XN1A 3AUAA 5LJLA 5CCXA 1OYVA 1UXKA 3CISA 4LZOA 1KJ9A 3A1TA 4EF5A 2XKAA 3SQLA 4HFMA 5ESDA 4ON9A 4XM0A 5FL7A 5SYAA 3PJEA 1RZVA 5JAMA 3H1PA 1RJQA 1GGOA 4WZBA 5ALSA 1R8JA 1K0UA 4TLEA 4ZHSA 5DVZA 3A4VA 3GGGA 2WWHA 4GC7A 2C2ZA 3Q7SA 4IRUB 4ZCSA 5K3EA 2OO5A 3ZDCA 5BWUA 1C4OA 1C3JA 2ZSBA 3QE3A 5JMPA 3EGXB 4RFSA 2DX7A 3UENA 2ZR9A 3NWPA 4GNRA 4PTLA 1CQPA 1CQJB 2WOJA 4Q3DA 4ARSA 4AMZA 3K6RA 3G6KA 2I1QA 2O2XA 2HU8A 1XLUA 3V7YA 2QBYA 2QAIA 3ELUA 3O26A 4Y2YA 3U26A 5DLFA 4Z3OA 4B6FA 3EN0A 4IDBA 1YB1A 3A3OA 3ASZA 3N8NA 1I36A 1DEOA 4ND6A 3U3XA 4J7XA 2BHSA 1WBBA 5DYNA 3WLIA 4E4YA 2HD4A 1M33A 2W4QA 2CMFA 2GHTA 1TT5B 3L0ZA 3NG1A 1DRJA 2B3DA 3QVXA 4JCOA 1CUEA 1GVHA 2I34A 3DBHA 1NXPA 1KKMA 1Y9DA 2YY7A 3DZDA 3P27A 4LZLA 1E2FA 3OQHA 3G2PA 5KJEA 4DC9A 3GUCA 4RFSB 3QITA 1DJMA 2M1ZA 3DJYA 4WK6A 2ZRFA 1E89A 1NI4A 3W5IA 1ECPA 4B7CA 2ZJ2A 3Q0EA 3UKJA 1Q0LA 3V8QA 2JJMA 1T6BY 4J9UE 1FQKA 3EFEA 5F1PA 1AHPA 1WVMA 4Y6GB 5E2IA 4IFIA 5K0LA 1XZAA 4DLAA 2ZRHA 1Y1WG 4CTMA 2GKOA 4KNVA 1F48A 2PK3A 2ZSIA 3UUFA 1FS5A 4TTSA 1BJKA 4AYTA 4Y6QA 4YMVA 5CPFA 2WB2A 1B2RA 4PCAA 4LQ4A 5JS8A 1OY1A 2AVNA 3ETDA 3IVCA 3WK4A 4NYMQ 1CF2O 5BSTA 2QN6A 3TJRA 3OM8A 4ENVA 1KU0A 4YR2A 4K9KA 3ZU4A 3B8HA 4DR1H 4AY5A 4D0RA 2H6EA 4I66A 4R2MA 2FA9A 3KVRA 3M9OB 4ODIA 1G0NA 3PA8A 1P1IA 5SZHB 1SBQA 1CUSA 1PFKA 2UYQA 2ZYDA 5D6OA 3VDXA 3WMGA 3FFTA 4M0KA 4ERNA 2GBPA 5CA0F 1M75A 2YFHA 3AHIA 3CX8A 5ALKA 1VZ3A 4WFQA 4B7UA 4JUBA 4EJ0A 5LZ8A 3S8YA 2D0DA 1IYEA 4L27A 4O4IA 4ABYA 2QYZA 1KAQA 4LY0A 4L22A 4MVJF 5AK4A 3HJTA 5AJXA 3VX3A 5LZ5A 4UNQA 3GJXB 2Q1WA 1C2YA 1CR2A 1W1WA 1GQ2A 4PQEA 2QRMA 4D74A 1NASA 4DLWA 4Q9IA 1N4AA 3ZKAA 4BLTA 2FGJA 4RVFA 3AX6A 2ZI6A 4URHA 4GL4A 2PR7A 3CGGA 1A5AB 4NQRA 4E7OA 4CCAA 3R5TA 3K5HA 1OWPA 1GZ7A 1Z5UA 2G76A 2WG0A 4BUJA 3DE0X 2C7OA 1WO8A 1P2GA 1BFUA 1NBMA 2NV6A 4WEOA 2VHVA 3EXHA 1A1VA 2PJDA 3FOCA 2H18A 5IAKA 4R3UC 2Q4OA 2C95A 1KY3A 2DPJA 3OHBA 4TZ6A 4YFVA 1Z82A 4U9HS 5FYDA 2HF2A 5EIBD 3ZW8A 1XZNA 4FQ8A 1QZXA 5DLDA 5JAZA 1QH9A 3CSDA 4QYWA 4EW3A 1I3NA 4G07A 2M6SA 1TGYA 1Z5PA 3B7WA 5FOXA 2UVQA 2P27A 4UCOA 3CTPA 5K01A 1QRRA 1TA0A 2WAOA 4GW3A 5GONF 4NEGA 3TRHA 3C6QA 3OJXA 1DGSA 1FFEA 3ILXA 3ZX5A 5LM3A 1HDCA 2O5VA 3ACCA 2XHEA 1QB8A 3E15A 1PEKE 1TXGA 4I4TF 3H4TA 3KKEA 4M1OA 1YI8A 4GEGA 3AU8A 3FSEA 1I3OA 5E7QA 1M5RA 2DIKA 4MX8A 4J9VA 5J4LA 3NT4A 3LPCA 5D01A 1LPOA 1S3SA 2AI1A 1J70A 1AS2A 4YDRA 1BE6A 4NMMA 4DEXA 3UG7A 4ZFNA 1Z35A 2OBNA 2ZANA 4TLCA 3PFFA 3K7EA 4AW9A 4IG9A 3A36A 5CJJA 2WJAA 4WWHA 3UQ8A 2NZVG 3W8DA 2W8KA