2XD4A

Nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
421
structure length
421
Chain Sequence
MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
publication title Nucleotide-Bound Structures of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase
rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 114
structure length 421
sequence length 421
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2xd4A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2xd4A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xd4A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2xd4A04
4IHJF 4MV9A 4O7WA 2NU7B 1JDEA 3BFPA 1WR2A 5CAEB 1EUDB 3TQTA 4YAKB 3V4SA 1I7LA 2R84A 3G8CA 2W6ZA 2W6NA 2OLSA 4L1KA 1JKJB 2R7MA 2R82A 5HV6A 3RUPA 1Z2NX 3I12A 4XZ3B 3ORQA 4C5AA 4O4IF 4O4HF 1M0WA 4YB8B 1SCUB 5JQGF 1CE8A 1C3OA 4J6EA 3VMMA 4ZOLF 3WO0A 4MA0A 4ZQIA 2DIKA 4EAAA 2GPSA 2YL2A 2V58A 3SE7A 3VOTA 3K3PA 4IIJF 5CA1F 2DZDA 4XYMB 4O86A 2YZMA 2NU8B 3VPDA 1BXRA 2YRWA 3WNZA 4MV8A 1DIKA 4C5CA 2W70A 2XD4A 1OBDA 2VPQA 5IYZF 5JVLA 1DV2A 4O2BF 2XCLA 3KAJA 2YWVA 1T36A 3TINA 1B6SA 1VBGA 1EHIA 5LXTF 3AW8A 3BSYA 1B6RA 2YZNA 4FE2A 4MV4A 3Q2OA 2CNVA 3QFFA 2W6PA 1IOVA 3U54A 2I87A 2CZGA 1A9XA 4MV7A 4O7TA 4M9UA 3JZIA 5EZYF 4IZOA 1UC8A 3OUUA 4WBNF 4Y8VB 2R85A 2FB9A 4WD3A 2QF7A 3HBLA 1KJIA 4MAMA 1PX2A 2GPWA 4FGRA 2GLTA 3ETHA 1KJJA 3WO1A 1E4EA 1GSOA 4HNUA 5K2MA 3K5IA 2R7LA 3DF7A 2ZDHA 2R6FA 1Z2PX 2YRXA 2FPIB 2W71A 3BSSA 3TW6A 4MV6A 5CB4F 2W6OA 5FNVF 3VPBA 3G8DA 2PN1A 3V4ZA 3HO8A 1Z2OX 2FP4B 4HQ6A 5KKNB 4TV9F 2HJWA 3ORRA 4IWYA 1JDBB 2PBZA 4ZHQF 2ZDQA 4M98A 1IOWA 2ZDGA 3MWDA 4O83A 1A48A 2I8CA 1KJ8A 2FPPB 5BPHA 3MJFA 3MWEA 1GLVA 2YYAA 4FFLA 4O4LF 3GLKA 3KREA 4GGMX 5J2TF 5KX5F 4XX0B 2C00A 3K5HA 1KBLA 2R86A 5BMVF 2R7KA 4I4TF 3OUZA 5J2UF 3RV4A 1KJQA 5BPFA 2W6QA 3R9RA 3N6RA 4FFPA 4NYEA 4E4TA 2NUAB 4EA9A 3AX6A 1EZ1A 1VBHA 2PVPA 3U9SA 4M9CA 2FPGB 2SCUB 2W6MA 2YS7A 2V5AA 5JVDF 1GSAA 1EUCB 4HR7A 4MV3A 2YZLA 5CA0F 3E5NA 3R5HA 3LWBA 1GSHA 4O7SA 1VKZA 3VPCA 1UC9A 4ZI7F 1DV1A 2YW2A 4O7YA 1EYZA 1CQIB 1M6VA 3NUAA 4DIMA 2J9GA 1ULZA 4ME6A 2P0AA 4O7VA 2I80A 3U55A 1KJ9A 4EABA 4EGJA 2VQDA 1GGOA 2QK4A 1C30A 3JZFA 4O7NA 5GONF 2GQRA 4MA5A 2YZGA 1OBGA 2Z04A 4YBZB 4YJ2F 2Z02A 3Q1KA 5C1OA 4XYLB 4EA7A 4EG0A 1W93A 4O7LA 5LOVF 2IP4A 3HB9A 1CQJB 2R7NA 4M99A 5DMXA 4YAJB 2HGSA 2CNUA 4HNTA 2DLNA 2V59A 4FU0A 4I50F 4QSHA 3TIIA 3VA7A 2NU6B 4YJ3F 3R23A 3RV3A 4TV8F 2CNQA 3RFCA 5I47A 3JRXA 3LP8A 4O81A 3GIDA 5JH7F 4O82A 4O2AF 2R87A 3TIGA 3R5FA 5JQWA 4O84A 4FFOA 2DWCA 5HBRB 2X0SA 1JLLB 1AUXA 3KALA 1KC7A 4FFMA 4IWXA 3JRWA 1CS0A 5C8YF 1BNCA 1W96A 2GQSA 2YS6A 4RZQA 5C1PA 2CQYA 2WYOA 2VR1A 5LYJF 5H80A 1M0TA 1PK8A 3BSWA 1E4EB 4I55F 3ETJA 4EGQA 4O7ZA 1I7NA 5LA6F 4TUYF 3UFXB 4FFRA 4C5BA 4HNVA 2VHEA 3R5XA 2NU9B 3BG5A 3N8DA 4O4JF 4FFNA 3U9TA 4O7RA 5LP6F 4DLKA 3KAKA 4EA8A 1KEEA 1AUVA 5D8DA 2NPOA 4MV1A 1KUTA
chains in the Genus database with same CATH superfamily
5LZ4A 2H18A 1QFXA 5TIIA 1BZYA 5K4HA 4MMZB 2K7FA 3GRCA 4FEAA 1FLNA 2PKQO 2G25A 2JBAB 4FX2A 3W2TA 3MS4A 3CLRC 1JLSA 3FYCA 4PAGA 1QHHB 4KAAA 1UKEA 3SEZA 2J4DA 3FPEA 4D44A 4A2BA 1JWLA 1QTRA 5JANA 1YTUA 4O63O 4JLJA 1WMFA 1SK8A 2JIPA 5KOHA 1ZY2A 1Y98A 3G1UA 2WEKA 3GJ4A 1IM8A 1NKVA 3IAHA 1MCZA 1T8UA 5JFTA 3PHHA 5BURA 5LU9A 1JMKC 1UM9A 1VCNA 3BGDA 2G63A 1I5EA 4EO9A 3U48A 3HRIA 1S2OA 3HMKA 1R5BA 1KZ6A 5CEJA 1F3OA 4OHOA 5EWFA 3ZBPA 1HTWA 3DXFA 2ZK7A 5EL0A 1GT91 5DE3A 2UXBH 3FUVA 3R41A 3BRWD 3WLTA 1R0CA 4EY5A 4HAXA 2X5JO 4DNXA 4AYBE 2HU8A 1WHTB 1G20B 4MAMA 4IAJA 1Q7BA 2BGMA 5K2MA 2W71A 1WV1A 2A5YB 1JZSA 4NQRA 3AJ8A 1U1GA 4D4JA 5BWOA 4OB8A 2OB2A 2V7EA 2BRUC 4GOXA 5HM6A 3TR5A 1TZJA 2Y3IA 3UK2A 4YCSA 2W9CA 1ZVMA 3RC1A 1W85B 3RK4A 5K8VA 3QLJA 4RWEA 1VL1A 2EXXA 1HOTA 1LBTA 4NMXB 1Y8CA 3KSMA 3MCUA 1CUFA 1NJ2A 2FETA 2Z2IA 4JLVA 1WV0A 2C9MA 1B0PA 4HATA 3R7LA 2FMFA 1IZZA 2WF9A 3IRUA 3SIXA 1OXSC 5EHGA 4N18A 5C31A 4EVQA 2FPPA 4FE7A 2F8MA 1ZMBA 2N75A 4EWLA 4M0FA 4PPYA 5L3SB 1JR2A 2FRDA 2QPLA 2D2IA 1DWPA 1PCXA 3AY6A 4EUSA 2PMBA 2E4YA 2H9IA 1UFVA 4OL9A 1DIOB 2GEBA 5DG8A 3KU4A 1MGOA 2PK3A 4R3UC 2ZETA 3LPNA 3FHTA 1OBFO 5BWWA 1GYQA 2DB3A 1DV1A 4XASA 3EIWA 4BASA 4M0PA 3STVA 1VGRA 4RJIA 3K0AA 1QOQB 1M2KA 3AVUA 5EG5A 2AQIA 4X1KB 2C94A 2FLNA 4ECUA 3DULA 1QMGA 3IUYA 1PZGA 1QIEA 1I3OA 1ZIXA 4CDRA 3UANA 2VG8A 1T1JA 4UDYX 4LDQA 3HPRA 1TI7A 5DEOA 1P1HA 3ZIUA 4XYLB 3NXSA 3MB5A 1ETHA 3A0RB 4KDRA 2E89A 2B9EA 1F2UB 3V3TA 4YO7A 4RHYA 3ABSB 1IJEA 1UP7A 1O54A 1MAUA 3RV3A 3PJFA 4NE2A 4RD4A 4JLKA 1DE0A 4J7AA 1BEEA 2A1UB 2GBCA 1Y9EA 3RF6A 4ISBA 3NUGA 1DRVA 4QWEA 1P4AA 1VHQA 1M2HA 3GP3A 3O38A 4HTFB 3FM9A 3NWBA 3D7SA 2NTEA 4CCAA 4RORA 1FOEB 2OV3A 2Z43A 4BQOA 1LJLA 3FSJX 1NVTA 4BLOA 4A2QA 4QJ5A 2Y93A 3VO1A 2FR8A 4E6NA 1XAJA 5KBYA 3O0DA 2AEEA 3A11A 3QXCA 2ZE8A 4F6LA 1F8GA 3H20A 5BSWA 4F8YA 5IABA 2AR9A 4ZKDA 2JLQA 3SJ7A 4MVWA 3VPGA 1WXGA 4YX9A 1DAGA 2O5EA 3DW3X 4Q3OA 5D00A 2VJKA 4HEQA 4ECTA 2YMMA 1GTG1 1U11A 3DWEX 4MGKR 2LBPA 1CUGA 2CE7A 4QBKA 1WUIS 4DQDA 3IVMA 4KPYA 4RNCA 1D4ZA 5AW8A 5AVZA 4X7BA 3IEPA 2JIMA 1Y5RA 3M4YA 2YXLA 4BFTA 3MLEA 4C01A 5LZ8A 3VMMA 1K2WA 3BZUA 2DIKA 1C4OA 1TM5E 2Y1CA 1PQUA 2H5IA 3ZNPA 3RTEA 2A9VA 2Q6TA 3T7DA 1BXRA 1O95D 3Q8XB 4YRFA 1OZGA 1SUCA 1JP7A 3BMQA 1TK3A 1S0NA 4BP9A 2QNBA 5FI5A 3QK7A 2H52A 3GMSA 4AL4A 2HA7A 2CLOB 4D3XA 3DD5A 4M7OA 4R1NA 3MJVA 5TMBA 5I51A 1N3YA 5K3CA 1XPUA 4TTPA 4Y98A 4HFJA 1L5HA 3ZCVA 4QGSA 3HXOA 1Y7TA 4YEDA 2X19A 3KAPA 5KTMA 3L84A 4NENB 4BUJA 2VCEA 1JJAA 4JQZA 4C78A 4D45A 1WZ2A 4NG5A 13PKA 4M54A 5M34A 4IDOA 4BBJA 3HA5A 5JO0A 2YOFA 4NC9A 2F55A 4TZTA 4X1IB 3KXDA 3GDWA 3T41A 3SHQA 5AW3A 4WLOA 2P79A 3WBBA 3PNPA 3GJ5A 4L07A 2WYVA 1QGOA 4HRYA 3VR3D 5TT0A 5AHXA 1Z0JA 3MHPA 3RM3A 3RVLA 2GFHA 4YCMA 3ADCA 1KOFA 5DGXA 1MJFA 3E9NA 4LPKA 4R16A 4E31A 3VU9A 1RWPA 2XYPA 2VRNA 3I6BA 4Y1RA 2PRYA 4ZHQF 3CNNA 5FJJA 3RB8A 2A7QA 1VLZA 1KWKA 2BFAA 5EZYA 4Q9IA 3WMRA 1MQAA 1FSFA 2VCYA 1EIZA 4PY2A 1H85A 5DXAA 4LF9B 1ADYA 4IFEA 1IYDA 5G0SA 3S0JA 1C3JA 2HBQA 1L5WA 4BKQA 3FOCA 4JI8H 3P2EA 1P75A 3UV6A 1JEEA 4NE9A 3E2PA 4XX0B 3P5SA 4NK5A 2C00A 3DB1A 1P1FA 3E23A 1TEVA 5FNVA 4M8KA 5DRTA 4C3VA 4GKJB 5I7VA 1RAHA 4GQIA 1DKMA 4EA9A 4BNFA 1CNEA 2YMQA 3GDEA 4C2MA 3WLRA 1UL1X 4AJPA 2CDNA 2OWDA 4BFLA 3DZKA 1XXLA 3SDSA 1BDJA 4C4AA 3V1MA 2J5KA 3ORFA 1Z9BA 4G5GA 1VKZA 1SCKA 4DUGA 3JWJA 3ZXIA 3JAMA 1M7HA 2A9RA 3DLTA 1ZFNA 5REQB 2PS3A 2RGNC 2G1PA 3AIMA 1KZHA 5BMVA 4OGFA 5AVUA 5C51B 4XJSA 5ALHA 2Y1GA 5KG1A 1V37A 2X42A 2XCQA 5ALOA 2ERCA 2JJ1A 1CEYA 4TVKA 5BR7A 2VAPA 1N75A 4YV7A 2AQ8A 1XMIA 3D3WB 2JA6G 4B6GA 1R16A 5KU7A 2YIVX 4XWAA 3I5AA 1JSZA 2BOVA 5D51S 1NYQA 5KG0A 2QXYA 2RHLA 3ZTWA 1B6GA 3CLSD 2XOXA 5BRJA 1J33A 3L4BC 2YZ7A 4C4XA 3OIVA 2J6HA 1Z22A 1BCSB 1CLEA 1EDBA 3KVNA 1RKUA 3KOOA 3SZGA 1GOTA 3MFYA 4LYAA 1ULTA 3DDUA 2R2AA 4JC5A 4HUQB 2NYVA 4EZEA 2J9RA 4AP6A 2REQA 4KH1A 1KC7A 4OLJA 3ESRA 3ROGA 2CDRA 1DFGA 2BFDA 3HA3A 4MJXA 1VOTA 4BKRA 3R7WA 3AHJA 5TQ0B 3MCWA 2NVUB 3DPSA 3P52A 3ZHBA 1M10A 3BPSA 5JYCA 1XNHA 3BXOA 1E77A 3RLFA 3K09C 1YS2X 2QR5A 1YB4A 4W6QA 4FFRA 4C0JA 5KFPA 2Z58A 4US1R 3ZQUA 2IUYA 3MELA 3FOWA 4MI3A 3BJRA 2DFKB 4F46A 3JAKA 4WJKB 2ABWA 1MZVA 4D81A 3ZBTA 1XEXB 1QZZA 2PD6A 5L8VA 1JIIA 4OXIA 1DAIA 1YT5A 1GL7A 2Q8PA 4EFDA 1ZWKA 4ALIA 3CEHA 5DWVA 4BPBA 4OMCA 3A6EA 3B6IA 2PFSA 4PO8A 2EHJA 4GXNA 5KAPA 1PEDA 2ZOSA 3CJQA 2XZDA 5D01A 2VJYA 1XCJA 1PJLA 2YRWA 4XIJA 3HCBA 2HJHA 1B2RA 4UBLA 4A4DA 3RRZA 1DB3A 2R92A 4KIFA 3F8NA 1S10A 4N8DA 4ZJUA 1O5IA 4XUGB 3WK9A 3CZ4A 4TMWA 2JGDA 1E59A 4CC6A 2DJIA 3I83A 4IKOA 4UTVA 4CM4B 3TECE 2VJDA 1Q0TA 3TW4A 4HZUA 2M6LA 5B58C 3F6YA 2A9JA 3SEFA 4DR5B 5A6VA 4N3BA 5DLQC 4A0HA 2ZB3A 3USZA 4KIWA 4LGMA 4O8CA 2B6NA 3W2IA 1VDZA 3REFA 3BK1A 1SZJG 3SR0A 1IMJA 1ZHHA 1VPTA 2IEYA 1EU1A 3CF4G 2H4FA 4CIBA 5ALMA 2IS1A 2YHBA 1WB4A 4DR6H 4AQYH 4M4SA 3VHXA 3WWPA 3OT1A 2AFIA 3L04A 2M05A 4EG8A 8OHMA 2EYQA 2IZ0A 4RW0A 3L7AA 1HTBA 4IIEA 2G28A 3FPLA 1U8ZA 3AONB 5EJGA 2B82A 2QN1A 4QPPA 4JA0A 1QHHA 4W5NA 1A9YA 1V1RB 2RC6A 3PXUA 4PNPA 5I7FA 2PGLA 1E7YA 2FMUA 3CUUA 3D5EA 3EMVA 3LECA 1VHJA 2GPJA 3GLGE 1TZBA 3FCEA 4B8YA 2EDAA 3KSZO 3LNCA 5MGNA 5KFAA 3RTGA 1KJQA 1L5LA 3AESA 4MYCA 4BZPA 3CUKA 4RCZA 5CB0A 2QUZA 4G5YA 5IUKC 1ULHA 4Q4AB 3R0XA 2AZ4A 2ZATA 3FBWA 3G1WA 2F3TA 3L02A 4TQGA 2DFLA 4HVCA 4BXOB 3UW1A 4YP0A 9LDTA 3LYAA 2Q99A 3EG9B 4HNHA 4DV7B 4PHGA 2AG0A 4FDUA 4F1KA 3OWHA 1V9SA 2I5PO 5EE5B 2H7VA 1WHTA 3CBGA 3HV0A 1KI3A 1LDMA 5EJ9A 1RQPA 4ALKA 4AJOA 3AEQB 3NGMA 2QM3A 3P26A 1XC7A 1VA5A 3DNPA 5TMDA 1BH2A 4YCNA 3OC6A 1KMCA 1HDZA 4AKTA 1JZTA 4E2YA 2C54A 1D07A 1DOZA 2RD2A 2YWGA 4IG4A 5FUWA 3FLMA 3AH8A 2A2ZA 3QELB 2NU6B 3KELA 1U2PA 1J0DA 4OA5A 4C7XA 2BRUA 2R87A 1JR3A 4P93A 4OHYA 4MXDA 1L5ZA 1SFRA 4MUGA 4JH0A 3EVGA 4QXRA 2M6SA 1EUYA 1K4MA 4IDFA 1JN0A 3GG2A 5IZ4A 1UWLA 2PMEA 2JAQA 1NQ5A 4PG8A 5EPOA 4U2BA 4X5OA 4DCVA 3MT8A 3NT4A 2JB9A 3PR4A 1J8YF 4RFVA 3GTQA 1K27A 1X7GA 2FPRA 2IFTA 2HNKA 4JA2A 4JN6B 1RZRD 3A0UA 4FB5A 1U0SY 2XQKA 1P0IA 1LQUA 4ZI5A 1G2WA 4QVGA 3AXSA 1LNQA 4MVJD 1PX0A 1PS0A 1XZAA 2I6GA 2GN1A 3TS1A 5EWLB 4BQEA 4X1KA 4EW3A 2GBIA 2W2KA 1GEEA 3W1VA 2X15A 4JL5A 4JI7B 4LOIA 3W4JA 5FOUA 2RGVA 1JHRA 5UKDA 3WFJA 2QQ5A 1EM6A 5KIAA 4IIGA 2GWHA 3WIOA 4QBHA 5JS1A 1Y1WG 3IAFA 2VNJA 2ZXEA 5ENDA 1GZ4A 2UZ3A 3X3HA 4D02A 4OYLA 1VRCA 3FR7A 1RWVA 2YHIB 4GZMA 3WLNA 2JJ1D 5IP5A 3D6VA 5EWMA 2AMJA 1NM5C 3NTRA 3M33A 4JJ7A 1FQWA 4YRMA 1P1KA 4MIEA 1V9LA 1W48A 1YJQA 2WTFA 3BBPA 3JATA 1T2CA 2XGPA 1H2RS 1QBGA 5G2OA 3DAHA 2OUIA 3PX3A 4G9GA 4J07A 4XX1A 3EC1A 2K5UA 5BN4B 4M21A 3RIGA 5LWQA 1DDGA 5KQPA 4Q1DA 1CUAA 3OZDA 2Y0SE 4PZ6A 1DT3A 2XIJA 2XTZA 1ND5A 2FCAA 4R51A 1A3GA 3M6FA 5ALVA 1HE4A 4U7JA 4KWEA 2K7ZA 1CHDA 1P17A 2XE4A 4LTDA 1E3DA 3TW6A 3GZTB 3PEYA 4N12A 3FDIA 2D7JA 1DC5A 5C3UA 3UQ8A 1H3EA 2VDMB 4KJZA 1RMQA 2FPKA 2I4TA 3SJUA 5AI4A 5K4GA 3HSSA 2QIPA 4HNAA 4DLRA 1TL7C 1C9DB 4D43A 1ZXBA 1C4WA 3F74A 1FXWF 3C3PA 1HYHA 2P4SA 2WIKA 5EIEA 2QQFA 3LUDA 2AGVA 3X1WA 5ENVA 4K88A 5CLIA 3DXXA 4RHFA 2VH5R 1LD3A 1YRBA 4WX2B 4U2DA 4R0NA 1E61A 1YWGO 4G0QA 4JB8A 2PMKA 3Q5EA 1DT5A 4CMKA 5JS2A 4LYGA 4M86A 4G26A 5LUBA 5EKTA 4R84A 4DJJA 1LBHA 5K4AA 3WBKA 3U4CA 3VNNA 3I64A 3R7DA 1NVMB 2VHQA 1IBRA 4DSNA 2OY0A 1I13A 2BMAA 1ZNZA 2PZLA 1SVSA 3T5GA 1EUCA 2Q4TA 3UGKA 3HNPA 4B17A 3DVAB 2RJOA 4H60A 1H4SA 1WCIB 4L4UA 5FTWA 5C8YB 3KIPA 4UDOA 3BACA 3GT3A 2E4ZA 4AQDA 3IBYA 4LYEA 4BVKA 4RF2A 1PTKA 3ZU3A 1QF6A 5IN5A 1OLXA 3EPGA 3KJXA 2IY8A 4MQ4A 2JASA 3AINA 2Q5EA 2CLMB 3JR3A 1F4PA 3C1UA 4XGRA 3LBYA 3DE1X 1QXSA 3T9CA 2Q4OA 5IJ0B 1B16A 2HLDA 1R6AA 3RBEA 3M4NA 2IEIA 5JUMA 3ETNA 3GRVA 2WZDA 3L40A 3DBHA 4TL8A 3GLIA 4RCVA 3QXJA 4GBED 1Y9AA 1EWTA 4B82A 2XWBF 4KFTA 1LQ2A 4TMYA 2LW7A 3A4TA 4NONA 1UINA 1LC3A 4G2TA 3JQ6A 4GC7A 4YJ3B 3I6QA 3KL2A 2GZMA 1W4AA 5B58T 4LMPA 1TO1E 4J0FA 1GTVA 3UT0A 2G4LA 3SNOA 3ZOKA 4G86A 2CUZA 2QSUA 5FPOA 2XUDA 4DDMA 4XCQA 4IHKA 3B7PA 1O95C 4QAJA 1VE7A 1X1CA 4EG5A 2QMHA 3DV2A 3UBTA 4JDPA 3EUFA 4TKUA 2G71A 4RPCA 4Q48A 1HT0A 3LZCA 4D9CA 4PQYA 2NO4A 3OA0A 3JQPA 5HZGA 4JFAA 1A9TA 1ZR2A 4X7MA 3KV1A 3RKRA 5HCNA 2NV0A 2XVYA 3D64A 3T3NA 4WBNB 4NDAA 4KOEC 3GV0A 2HLHA 5T5QA 1JUDA 4NZ9A 3ZU4A 2RGNA 4LNUA 3PUJA 4WDRA 2HMUA 5C7LO 4UKDA 2IE0A 3PX7A 5EFOA 1VMEA 4Y9UA 1QHXA 1XEWX 4JBNA 2FV8A 4OHFA 2O03A 1G21E 3DBLA 3GF4A 1J07A 3VOTA 3HVUA 2V7PA 1N3LA 3HB0A 4EG4A 3OTQA 4LYDA 1XO1A 1D9XA 3HO1A 3DZGA 3WYBA 3RC2A 1E0SA 4N3AA 4YUWA 3ROPA 1U8XX 2R8JA 1BTOA 2WVJA 3EIUA 3L4BA 3BSYA 4DDVA 2REOA 4MMYB 2H1LA 4HUQA 1J4AA 5HNKA 4E5PA 4PYRA 5GAJA 4X61A 3OCJA 2UZ0A 1P0FA 5B1IA 3SC2A 1SWWA 1TZKA 3HHPA 4ZZ3A 2F7SA 1WHSA 4FS2A 3D8RA 1TFUA 4ZU6X 3ZWCA 1BEZA 1VIDA 1YDWA 4KGZA 3PUKA 2MINB 3OP1A 3K8ZA 4ZGBA 4LH7A 4N47A 5K0ZA 3SZ3A 3RHZA 1G7TA 2F8SA 3K09A 3IDOA 5ANRB 4PFSA 3NBAA 4N6NA 2G9NA 5TGTA 3TW8B 1Y5MA 4A8JC 3QEOA 4PLCA 3IUQA 3H5IA 2AJLI 2EFDB 5AKKA 4DHEA 3MWDA 1V5IA 1Q0UA 4D3ZA 1DG9A 2HT1A 4UATA 3S40A 4IMPA 1TYZA 3V8MA 4B45A 1IFXA 4DIFA 5CXUA 3W5JA 3ES9A 2VZ9A 1M1YE 2H65A 4Z7QB 3OZRA 4BE7B 1YC2A 1GG8A 1O08A 2QZSA 4N4AA 4G9BA 2HMSA 3QWUA 3ZXSA 1OF1A 4PNHA 5DT2A 3OH8A 2IIQA 3V2GA 2AFHA 3WGZA 1Y6ZA 4M9CA 4AUMA 3G9XA 3K9QO 1EXNA 3GA7A 3ZU2A 4U7HA 1RK5A 1XT6A 3B3FA 4BAGA 4IY1A 3CLSC 1YQGA 3IQXA 3IT0A 5HZKA 1DMSA 3NHAA 4ASUA 4WKOA 3GROA 3H11B 5AJYA 2UUOA 3V1LA 1A8QA 3TYXA 5BN1A 2PWBA 4EPYA 3O2QB 1XEAA 3AW9A 3KJFA 2ZJ8A 5E4YA 5JH7A 3OQBA 4PE5B 2EZ9A 1M34E 3RS5A 3ZWXA 4OQYA 4EVIA 4S1WA 3WAJA 2EYUA 4Y6PA 5TS3A 4DLTA 5KVCA 3PNSA 4KRXA 1KRXA 3ADDA 3ORHA 4OHXA 2G06A 3THXB 2CFRA 3H9QA 4WADA 4IV8A 1YOVA 3CPHA 3ASYA 1M2WA 4I9NA 3AGQA 4C6SA 4Q19A 3T7RA 2QX6A 3RYHA 4QPJC 1RMYA 1ZWLA 4DBLE 1SA0B 4YPOA 4ZCIA 3U19A 1E1DA 3NRCA 4QGBA 4YBZA 3QUTA 1ZR4A 4F9EA 3GFBA 1SBIA 2C4TA 4M22A 2IUTA 2JA5G 5J40A 2J6SA 3KCQA 3RSLA 2Q6VA 1TRHA 3I76A 1G3RA 1UIRA 4WACA 3GNSA 5IKMA 2AX4A 4BDTA 5KMGA 2NYAA 4DMRA 1DTSA 1BHO1 3AEKA 3HYNA 3UUGA 3LT1A 4EPTA 2YINC 3T3GA 3M6WA 3CSWA 4OI4A 2QLNA 4MK4A 1SYXB 2IV2X 5JQGA 2WW8A 5AUNB 1KMHA 3E9YA 3ZDQA 2YXDA 3WXMA 1R0KA 3QIVA 4HWTA 4IOJA 3TNLA 4CE5A 1AKYA 2ILTA 3KUXA 1D4AA 1RYBA 2AE2A 4EA6A 2CXUA 3CZRA 2Y99A 1EFKA 1EAMA 1KI6A 3CKMA 4H31A 2D5BA 2WKRA 3PK0A 1N5MA 1VRVA 4GX0A 4R1OA 2ZXUA 4TWZA 4BNWA 3L8ZA 3WLMA 3ER6A 5KREA 1ZIDA 4DSTA 4QUEA 5CIWA 3H2HA 4OQ4A 4P34A 3QMMA 3W4IA 3K71B 2R8HA 2J3LA 2BHNA 1ZN8A 1C8VB 3IC5A 4HAUA 4TQAA 4D79A 3LAWA 2OLEA 2O50A 5KYYA 2MHCA 5F1YA 2YVLA 5LNK6 3JRNA 5K03A 4KO3S 4YPFA 2W2VA 4R40A 4Q16A 2E3JA 3PEVA 2GJ4A 1KC1A 5FR9A 3UA3A 1OAOC 3A6DA 1QS0A 2CHFA 5IJAA 2FA9A 5FTLA 4RCYA 3PNBA 4DM7A 2HLDD 1TKCA 4TS4A 1EI9A 4H16A 2GZ2A 1XZBA 1G8FA 3VSCA 3CNEA 4JVMA 3DDCA 4OHRA 1MB0A 5H59A 1PIWA 2YBDA 4BKUA 1VP3A 4YNBA 3OOHA 2NPIA 3ZE1B 5TF0A 1NBOA 1WUYA 3ONFA 3HU5A 1ZQ1A 4O4LA 2GZSA 1NV9A 3KWMA 3UMRA 3WP1B 1I4OA 1JV2B 5G53C 1NHGA 1VL8A 1ZVVA 5EI5A 4AJNA 2G09A 3ISJA 4FNGA 3N44B 3GVXA 1WMBA 2DUJA 4U2GA 5B1YA 5JCZA 2WZBA 3O2JA 3OURA 2H59A 1T5SA 1V2GA 1PWEA 4HQOA 2JZOA 4UVEA 1O9HA 1AGPA 1C0LA 3QTTA 3BEDA 1A04A 2YYZA 2OE2A 4NKRA 2C9DA 2A88A 2ZIWB 3A9TA 3P8ZA 4XUCA 4YY3B 2W2PA 4OXNA 3UPUA 3QPAA 1JVSA 2VKTA 5HS6A 5I7HA 4GLXA 2IYTA 1J0CA 2XKAA 4PDBA 3OHAA 5H02A 1G7SA 4B3DA 4YBRA 4X44A 2YJZA 5JNRA 1O0CA 5JFOA 2GD2A 4RPKA 3L6RA 3KQUA 3M5DA 3A32A 5JWOA 1NRIA 5EJ8A 4K8OA 3CXUA 4FWBA 2FDRA 1N2IA 4DVJA 5EEHA 3ZWVA 4NPCA 1Z5PA 5DLEA 1M3SA 1QU2A 5K0BA 1FNDA 4M0DA 2AUTA 2X5RA 2PCJA 3BGWA 3JXEA 1MRSA 1EVYA 1NLUA 2NO9A 4FN5A 2CL0X 1OYOA 3LRXA 1ZUHA 4LY9A 2A1HA 4M7PA 1S8FA 3I3SR 2JKYA 1EGMB 3C16C 3OMXA 5HCIA 3ND5A 2PUDA 4NEQA 2O6LA 5FA6A 3TIIA 3L6EA 3TOZA 1PVDA 2AYXA 3WRXC 4FINA 5BW6B 3EQZA 4IAOA 4O2AF 2NVXA 2P6NA 1EBFA 4C03A 5F73A 1TWGA 4EI2A 2XB6A 5B55A 1Z6XA 1E0KA 1ENZA 4MDFA 3WHIA 4EMSA 4FBGA 2PU7A 3DH0A 3PL1A 3GH1A 3K9FC 4TN1A 3KQOA 1Q7TA 1FFHA 1ECGA 3OIFA 2YV2A 1TOAA 4MB0A 1VLMA 1MIHA 1G9TA 2UZ1A 2ZS8A 1XZPA 3VZSA 2J5RA 2GZHA 3DBOB 3DHVA 2WIFA 2PJUA 4ZQFA 4PZUA 4XFDA 1FJHA 4FHDA 4KPFC 2PKCA 4UU1A 3G2HA 4O59O 4UULA 4KYIB 3CRQA 3SQLA 2X6RA 5JISA 2CK3D 3PD0A 3KSRA 2A9OA 3G9QA 2E49A 2PFKA 4DLYA 1ZOPA 4ZYWA 4ASUD 4A27A 5C8YA 2H4JA 4KFUA 3UF0A 3KAQA 4Q1VA 1T3ZA 1XNJA 2AKAB 3RS0A 1CY7A 4KYTA 4TS3A 2DYKA 1N36H 1KFKB 3M3HA 3BXFA 2GXAA 3K0BA 3FVRA 1SOVA 3L93A 4DCPA 2AXNA 3E58A 2BFWA 3VZDA 4C5CA 2RHHA 4US0R 4B7UA 2BGUA 2VPQA 4CV2A 2P3SA 2J08A 4FKMA 1ZN9A 3KYCB 2YW9A 4YQFA 5SYMA 4MR9A 2DFTA 4AMGA 4DV3H 1C1HA 1Z16A 3DZIA 3H8VA 2GCPA 2CNVA 4FK8A 3TQRA 5HF8A 3TTSA 1GTRA 4JEIA 2OKCA 3VTKA 1PR4A 1UMBA 3WR5A 2B7BA 4Z86A 2FUEA 5TT1A 3AR6A 1QR6A 4PSVA 2AMFA 4ZRMA 1UJNA 4CQMB 3PQCA 3LT0A 3I23A 2NVBA 1PNOA 5KFVA 2BGKA 2BFPA 1D5WA 2VF8A 1L5NA 2PYDA 5JALA 2ZTVA 2EVWX 1LLDA 3SHVA 4J94A 3T9FA 2VKQA 2D4HA 3M49A 1O95A 1E79D 5IHPA 4G1MB 5ALGA 4CT4B 3D0RA 3L8FA 3ITKA 5ALNA 2DM6A 4S0XA 1CIPA 1CB0A 4R9VA 1PWYE 2LTAA 1YQUA 5DIFA 1JU3A 1MH1A 1P5ZB 3LMLA 1F8FA 4IIHA 3TAHA 3OQPA 5FD5A 1LPSA 2YXNA 5HE8A 1GPBA 4QZVA 5LMCA 1HDRA 3G9TA 2V6FA 4HDSB 3ZE0B 2X8AA 2B34A 2AX3A 4NDZA 4FTWA 4KQFA 3A31A 5CYPA 1ZC4A 2AEMA 4EK9A 2M1ZA 1XDDA 1F2VA 3GNLA 3KOWA 4UE3S 4NXNB 3CH7A 4MQ5A 2Z57A 1M6VB 4RDCA 4C4OA 1U9CA 1L8LA 1JL3A 1YKSA 2IHUA 1GYPA 3O94A 1Y63A 2GXQA 4NULA 3PDUA 3HS3A 3IP1A 5AVJA 2AQKA 1XRLA 2IELA 3N70A 4HTAA 4XH9B 4YMHA 4ZRDA 4LDRA 1A4XA 5EWJB 1BC5A 4FMDB 1SD2A 3COZA 5SYNA 1CYDA 1FMLA 5BR8B 3AHCA 3R0JA 5F1PA 3WQSB 1C30A 1DQNA 4HYEA 4IEFB 5A4AA 2XV1A 5H1YA 3T1QA 1V41E 3RSZA 1M66A 1MAWA 2FR0A 3ZIDA 5DYNA 4HMQA 1R8QA 1KEPA 3H42B 1RWMA 5I9TA 4G24A 4FS1A 3OI7A 2HPAA 4EFBA 3PZPA 3OZ7A 3ND6A 2QTAA 4EJSB 3L7YA 4O4JB 1L4EA 5LZ7A 1XAHA 3ZHZA 4BLVA 2RKOA 1QE3A 5GZ1A 4PGFA 1CPYA 4Y0NA 2P1DA 3CEMA 3O9VA 1T3SA 3VA7A 1EKXA 3S99A 3VX4A 1N0HA 5IPFA 3G82C 4Z7JA 1MZPA 3DE5X 4A8JA 1YU6A 4LZAA 3I2YX 4J9VA 3D3KA 1I1HA 1AV7A 1YR2A 4FD2A 1VZ2A 3AKYA 1M76A 4OLFA 1HNXB 2HPVA 1O9GA 1IXKA 2NUTB 3GJRA 3S55A 1CUCA 1SKQA 3C8DA 4U7DA 3PR3A 3MTDA 1EFRD 2E85A 2B1IA 1JKIA 3V4PB 3JS5A 5JXGA 3H18A 1CIVA 3FCSB 5K1ZA 3O21A 1KVTA 4GL4A 3DR3A 2HBYA 3IQDB 2IZ1A 1NUTA 4UXIA 3KJZA 3IKTA 6NULA 3WGYA 4M9ZA 2B63A 4OHMA 4M87A 1WLYA 1WNFA 2X9LA 1BS2A 1X87A 4V1CA 2ETVA 1Z36A 1L5VA 4U3JA 5KINB 1ISRA 1QX4A 4MP6A 5A4MS 2DKOA 3KCNA 2QRPA 2ZVJA 3LDAA 5CLQA 4YTEA 2IS6A 4I55A 3RSCA 2B4TO 4HVLA 3K3PA 4IIJF 4RIGA 3EWNA 3GHYA 3PVZA 3SXJA 3RS4A 3EJWA 4S35A 4EQ6A 1RYFA 1EDOA 4AZ3A 3TK1A 3C6QA 2HJGA 1P2FA 2Z5GA 4EHBA 1XI2A 2HF8A 4WCFB 3N9IA 4GYYA 5IDYA 1XVIA 4DFDA 2R25B 5A0VA 3VKVA 4RD6A 5HF5A 1RBQA 1RYMA 3HV2A 3AZQA 1KI4A 4HLUA 3R3ZA 1UBTS 3HYLA 1HT3A 1YZVA 3IAUA 3S2SA 3W9YA 3CS3A 3OZUA 4Z9AA 2H8GA 4BVLA 1Z68A 3R7FA 5JMWA 4A2WA 3AL0C 3HBLA 1DBQA 2IYOA 4EX7A 3QUSA 2HDHA 3KZKA 3REQA 4LF8B 5D1NA 5LN1A 2UXCB 4WZBA 1QH8B 1M8PA 1IQUA 1S03G 3G2PA 3FNGA 1I32A 3AU8A 1F2TB 4Y1EA 5FBKA 2BFEB 1E69A 2QUAA 1P0CA 4UW9A 3UXMA 4UMEA 2B0JA 3DM5A 4XR9A 1TJNA 3F5FA 4IDAA 3A1SA 2J31A 1QWOA 1IN7A 5EJEA 1EGVB 3JQBC 4A8HA 1V11A 3FGZA 1NVVQ 2J48A 2P67A 5BSHA 2GM5A 2QRVA 3D4LA 1I7DA 4IW3B 3U60B 1NQXA 1EVJA 1AKRA 3DOEA 1PJBA 3A1VA 1PU2A 4UZEA 1I7QB 2PLWA 1ZM4A 3UK0A 3BN3A 1HE2A 5BSEA 2I7CA 1EGAA 2JGFA 1G4HA 5AM0A 1MHPA 1I33A 3IUBA 3CX7A 3NYRA 3RU7A 3NS7A 1ORDA 5BN5A 3GLQA 4JOCA 3H1FA 3WOHA 3FUTA 3LWBA 4ZCQA 4FGUA 3OJWA 4M9QA 1XKLA 4HC4A 1QG2A 1IXRC 1OAOA 4FT2A 1G64A 3G8YA 1I3KA 1EKFA 3G8AA 5IWCA 4DB4A 2JA8G 1KJNA 5BT8A 4RELA 1LCIA 3NHSA 3HCCA 4Z2YA 4J75A 1EM8A 4WZAA 1VLHA 4MUMA 3NPMA 1LVHA 5F7JA 1E58A 1V1MA 3DHEA 4U00A 2AQ4A 1RKQA 2GK3A 3JSXA 3PC8C 4W5WA 2GDZA 4JT4A 5FPYA 1PGPA 5I01A 4BNZA 4JC4A 1R6TA 4ZEOA 3WG9A 1EFDN 1SU4A 2XZLA 3MRTA 3NBKA 2AR7A 3H2GA 4TV8F 3FYUB 5F23A 4UDNA 1CHNA 4OMDA 1XU9A 2EKZA 1NONA 3UMGA 3RC8A 3OFNA 3AVYA 2ZIAA 4AJ2A 3EAQA 1YRLA 2DVMA 4NOMA 1O57A 2WM9B 1E4YA 5KYXB 2WSBA 1B04A 1OT5A 5TLSA 3IGFA 4GRIA 4BVGA 4AJEA 3RKUA 4BJ3A 3PDIB 2R92G 1G55A 2BH2A 3PC3A 3TLGB 4QOGA 2P7HA 5BQPA 3V8RA 2EFJA 4RC9A 3I62A 3U44B 4CKEA 3RLIA 2W58A 1ENPA 3R5XA 4Q18A 3HFRA 1XHFA 3MD0A 4RH0A 4N9WA 4FYJA 1M72A 4L27A 1FEZA 1ZZGA 3C8ZA 5FI0B 2X4IA 4RETA 3N86A 3ZK8A 1CZHA 3SICE 2G7MC 4P2GA 3PA6A 3UMMA 4XB6B 3W2GA 4DJTA 4RAYA 1QU3A 4D6PA 5DYIA 5K0LA 3FZYA 2ROQA 1WU7A 4ZVQA 1C80A 3DOHA 2P4EA 3G0HA 6REQA 2P2ZA 1NFFA 2Z8YM 1W1WA 3ZHOA 4F60A 4ZDIA 4JJAA 1K92A 5FBVB 3AILA 3BF8A 2P3QA 2QVBA 3SSNA 2XHZA 2Y0CA 2BYTA 3BF7A 3WYAA 3NKLA 2YYSA 4JYPA 3TMYA 4RB3C 5BWNA 4CUKA 3R24A 2Y71A 4AX8A 5WRFA 3CX3A 3KV3O 1ANKA 1RZRA 4Y9SA 3RANA 5BQFA 2FQ1A 4NTZA 4I7HA 2OB1A 4US2R 1NBAA 4G09A 4NATA 3WRXA 3ZVNA 3ZKAA 4QGHA 1I2KA 4MVJA 1JG4A 2VVTA 1RR6A 3FTCA 1TMKA 2Q3BA 4DGQA 4CV0A 1KORA 2G1KA 3EPKA 4Q34A 3USCS 5LKAA 2IYYA 1OU4A 3UJCA 5JYBA 2XY4A 3CT6A 3B2NA 4FGRA 3RJ9A 3VNSA 2B5OA 3VYTB 2I6FA 2WIBA 4R1PA 1DBPA 4PX9A 2QRMA 4YP1A 2R6FA 1RM4A 1TCAA 4ZV7A 3OETA 4IDEA 2PX2A 3O3CA 4DA0A 4B81A 4F3RA 3QX7A 2PD3A 4EFKA 4D9MA 1R3DA 4Y6SA 2ZSIA 3SJCA 4FB4A 1C1XB 1A69A 3KB8A 1Y82A 4CQJA 1A8HA 2O5VA 1D0SA 1NYTA 1P91A 3ZW9A 3LGAA 1IZ7A 5SY4A 5EOVA 1M2VA 4KMRA 2PO7A 1SKYB 2XMCA 4FYIA 1J0XO 1T9ZA 3FSEA 4BDSA 1XDGA 1MT0A 5FOSA 3GFPA 2BM1A 2AYYA 1IEXA 3F3KA 2UVRA 3GWZA 4BMOB 4ZZ0A 2JG3A 4TYYA 3M89A 1I1NA 4BVFA 1OROA 3X1ZA 5DEIA 4RS4A 1FRVA 3SVZA 3F6BX 5LOVB 3PQ8A 1XFDA 3O3MB 1ZESA 3FWPA 5CDYA 4ZAWA 1CIJA 1GKIA 2OFFA 3O93A 4HGZA 4BJ6A 4EDFA 1Z0ZA 3O3OB 4O0MA 1OFHA 3DDHA 4C20A 4YRBA 3SZRA 1KAGA 4A0FA 4UD2A 1LJUA 2FTKE 2ERXA 3KYCA 2IBSA 2X6QA 2UUCB 5FI3A 3MTAA 5AVTA 1P74A 1NVFA 3D7NA 2QPOA 1XCBA 2C9YA 3KVVA 4AO7A 3OZGA 3UW3A 4IX1A 4M38A 3NTXA 4EYQA 2HU7A 4ZFNA 2RC5A 3ROXA 1FNNA 3H2IA 2UYHA 1OXTA 1DBSA 2LGJA 3N2LA 5F21A 3N43B 4OK3A 4IM7A 3AETB 3AUTA 2P9BA 2QRNA 2W2TA 2O1SA 1Z45A 3HB4X 4O7LA 5AK5A 3LBFA 1OC2A 4M99A 4YRRA 2C9OA 1RSZA 2NW6A 1X1EA 2VDNB 1B7GO 4HLDA 3FW1A 4PZLA 1W1UA 1NSYA 3KRTA 2FFQA 2O0HA 3Q5GA 1RMTA 2ZRCA 1FRZA 4JXJA 3HCFA 3CVWA 3PG5A 4V0SA 3IPCA 2BM8A 4EM6A 5CFLA 3TD6A 4DIBA 5GOZA 2Q21A 2G70A 1C7QA 1MVOA 2XWJI 1PSDA 2GX6A 4G4SP 1G3QA 5EGSA 3N5CA 3FTPA 3KKQA 4DG5A 4GMGA 2Q9CA 4FBLA 1E2MA 1EX6A 1Y9JA 5DW0A 5E7QA 2C88A 2NU9B 3EEBA 2B36A 4LFCH 3KAKA 1XJQA 4QARA 1IPHA 5H9VA 3OECA 1GFZA 3F46A 3OZXA 2IXEA 2IIPA 2JS7A 5EKUA 2X8JB 3QBEA 1JEOA 1EJ2A 2AK2A 1QYCA 4MV9A 4JOBA 5HW0A 1URPA 2OWOA 4XIGS 4CM5A 1E3EA 2CLKB 3V4SA 4TT8A 2R84A 3GFOA 4ARIA 2WJAA 1JBEA 3RT1A 1WRVA 2HRRA 4ZCRA 1YDHA 4MI9A 5A6SB 2FPWA 4O4IF 1EXVA 4G37A 3NYIA 4BGDA 1FFSA 4EBCA 4RD2A 4RL4A 4X7PA 1ZNQO 2JBAA 4B3CA 2REXB 3UGTA 2QP9X 4JI2H 4PVDA 2QYTA 3DUFB 4JGBA 4LGYA 4ENVA 4PXAA 4BU0A 1ORIA 4R2JA 4KFRA 3SIRA 2AU0A 5AJZA 4BN5A 5ILQA 3UYYA 1D2CA 5KPDA 3D4BA 4CKWB 1R0BA 5C32A 2C9ZA 2HIGA 3ZWWA 3AJDA 2OHOA 3ZHSA 4XYBA 4P4SB 4MYRA 6PFKA 3VOBA 5KNBH 3SIWA 3AYZB 1P45A 1N8NA 1X19A 2XZTA 3OFND 4RGBA 3E18A 3BWMA 2X5KO 3AVXA 4DIUA 3CZPA 4B6RA 5J2UB 4QWWA 5AK3A 3EEOA 3FKIA 2UXDB 2AWNA 3RO7A 3AFOA 1W8IA 4J0EA 1KZ4A 5IKEA 2E5FA 5ALKA 2W48A 4RKYA 2AGOA 3I9V6 3H75A 1C3VA 3BDIA 1G20A 4AG3A 5HX7A 1XVLA 4PANA 4C2AA 5FPTA 3SQDA 3QG5A 1AHHA 2A3NA 2Z56A 4K6FA 3VH3A 3PXBA 4DV5B 3LLSA 3CZMA 1K66A 2NTVA 1MN6A 3RNOA 1QIHA 3PQ6A 3HXPA 3G3EA 5KJCA 3LO5A 3VNBA 4TVOA 1K8YB 3KHGA 3GP5A 4BO9A 2BR0A 3A14A 1S8OA 5KFKA 1RE1A 1W85A 3H2JA 5KX5F 1OPRA 3ICVA 4S1VA 2QM7A 3DPUA 5B2FA 4G0ZA 1P1JA 4B71A 2PXAA 1VBMA 1J1UA 1X6VA 1T9BA 2RIPA 4M1EA 1W8DA 3GRPA 3SQXA 1LVUA 1O6GA 1KMIY 4LYYA 4LE0A 5L3SA 2D5CA 1FP1D 4DUZB 2C4KA 3E61A 2J45A 4C7BA 4DRZA 1UDBA 1BN7A 3C3DA 4MS4B 3V34A 3E4CA 5CFPA 3ILXA 4P7FA 5HGJA 3CVOA 4UNNA 2UU9B 4JUIA 1S96A 2QAGB 4EJFA 3IT2A 3H5VA 3NTUA 2WFMA 5D84A 1N8SA 3BH0A 5K3AA 3ZHUA 1WB6A 3A4IA 3AF4A 5AHWA 3QFSA 5FBQB 2PUGA 3T3PB 3OCXA 3SSAA 3KEQA 2HHHB 3NIFB 3LUCA 4CHTA 3WTBA 4B3RH 2P9YA 3IQWA 3RTXA 3FVWA 2IHKA 4PS0A 4XYLA 1K86A 2X0FA 5HMMA 5GTDA 3DV9A 5AXDA 5HXAA 2L0XA 3M9NB 1F2UA 2P4UA 3KFVA 2JANA 2H85A 2XWQA 2XF2A 3FLBA 3EQ9A 2GHTA 5IKXA 2V9ZA 1S3IA 3BXPA 2JCYA 3JQBA 3STHA 2V45A 2ZJYA 1R5NA 3TH5A 2A1UA 1Z34A 3EW9A 3EVCA 1ZH6A 1CR0A 3Q9SA 5KFUA 3U40A 2VDLB 4HTFA 2VUTA 2EZ8A 1X38A 1P5FA 2QDKA 4MLCA 3K1ZA 2VHUA 3UT6A 4BMXA 3BA6A 3F4KA 5JO9A 3FUXA 1VSTA 3FNRA 3LKZA 2RI6A 3OPYI 3I1JA 3TDKA 4KDEA 3MIZA 1NATA 2PKEA 2RHRA 4RKWA 4KNVA 3D6MA 3U26A 2OEPA 3TOXA 3OUTA 5KNCA 1WLSA 2FZ5A 1DO2A 2YJ6A 1NOJA 5L51A 3VVLA 5IVKA 4UCTA 1B3RA 3AKEA 4TTIA 2VH1A 4ZVKA 3G5UA 3IN5A 1JR4A 3CG4A 1KAHA 3E8MA 3W3AD 1LWNA 4AWBA 1KZ9A 2WC1A 5I7AA 5DYWA 3PC8A 2QL9A 1I6WA 5CT5A 3K70B 1ZRHA 3Q1LA 2XXAB 4P3YA 5CJPA 1I24A 2IDKA 2ZUBA 1VIYA 2FKLA 5ILGA 4AMBA 1E3IA 2VWQA 1G5QA 4MR7B 1JHVA 4GVLA 3SPXA 2GAJA 2VSYA 1UBMS 2WP0A 4RPHA 4K2HA 4B6EA 3KYHC 1OU0A 3TEMA 2AJCA 3PI7A 1SJ9A 1L7VC 3RIEA 5B7NA 1ZNXA 3PUWA 1Q20A 5JLAA 4BO0A 4CM3A 4NENA 1FC0A 1G3IA 3T35A 1LBSA 3O8QB 1U0FA 4KXWA 2OAEA 1C8KA 1CQWA 1IQPA 4QFBA 1EE9A 3I6MA 3A4MA 4I6EA 1F12A 4X1IA 1PS8A 5KPJA 4X71A 4YMLA 3QWBA 3EGDB 1SC9A 3OIUA 4JHXA 2B94A 3T15A 3BTSA 2AFVA 3H4VA 4LF6B 1YUMA 2ODBA 1NL3A 2G72A 3KUCA 2W8BB 3M6LA 1IN5A 4QOSA 1NNSA 2HRDA 4HV4A 2CF5A 5CPBA 1U7XA 1ZGGA 4ECEA 3KREA 5K99A 1UP6A 4QEZA 2G07A 4M1SA 2WMYA 3B5JA 2PIDA 4YJDA 2FSVC 5E38A 2UYQA 4BX2A 3ANXA 2B21A 4CPDA 4JSYA 5JR3A 3AV0B 2C2RA 4RHUA 5C5JA 3NYQA 3IO3A 1KRWA 5KTKA 2JIOA 3FWZA 3QUQA 2ADOA 4XX0A 2I3DA 5DHRA 4E6EA 3F73A 3X2EA 2PH1A 1WB9A 2Q2NA 2J3EA 4K03A 3PDJA 2E6UX 4AUNA 1HYQA 4BV3A 1QFZA 5COQA 3OU7A 4QTUB 4F96A 1GJRA 1MV8A 2YVQA 3KPVA 1NLMA 3AL3A 3IUJA 5D3MB 1P5HA 3Q7TA 3QKWA 4Z54A 1ZAUA 2DPGA 2B61A 2OD7A 4ZARA 5IC4A 4X64B 1AE1A 5A4IS 1DG1G 3GRRA 5REQA 3GEIA 5IBRA 2XDWA 1QTQA 2HWWA 3EGXB 3DONA 1LBEA 2QRHA 1VCIA 3HDJA 3THYB 3ITDA 1C1XA 3ZDCA 3QVVA 1RJFA 4LFBB 1L5GB 4KNYA 2VBIA 4G67A 4LQ4A 3D3WA 1YZQA 4BQSA 4KQ2A 2V0GA 4DIDA 1N6LA 3AG6A 4O84A 1V7ZA 4MZDA 3KKOA 5EKSA 1JHPA 3WQRA 4D96A 1BCSA 1TLTA 1UCFA 2SKDA 4DQVA 5JEDA 3C0KA 2G3YA 5BSRA 5F9LA 3A6JA 2RH8A 1FNCA 4ENQA 3FGPA 3S2GA 5TVGA 4I1IA 3QXHA 3UB2A 1WJGA 1RCTE 3B70A 5L1IA 2Y0BA 1Y1PA 2PUEA 1XTZA 3GJTA 1PJ4A 1JA1A 4ED0A 1T9KA 3DP7A 4W8HA 4K40A 1PUJA 2ZB8A 4H4DA 4ERNA 4E13A 5TQ0A 2IGTA 2NVUA 4FS3A 4MIOA 2Q5CA 2WE6A 2OA0A 1Z28A 2UYYA 4ND4A 4D8TA 2I3AA 2GZRA 5AWFC 5D2CA 3QNWA 1ZOOA 2O2DA 1W87A 4R3NA 4O3QA 4ENRA 5ALYA 4MULA 3CSSA 5CTJA 3VR5A 4LS3A 1HWYA 3IRVA 3CLUD 3AB3A 4Y2VA 1XMSA 2EOAA 3T9BA 4JMLA 4NF2A 1NJ8A 4YB8B 1IULA 1UJ6A 1XEXA 4W7HA 1GPAA 2H2GA 3E15A 3LLVA 5C5EA 4K28A 5TARA 1J56A 3C6ZA 2R8OA 3AMVA 3GUUA 1YK0A 1IUKA 3K0FB 4UNIA 2HCFA 2UV8A 3PUYA 5IF3A 4YQWA 3NANA 1S2IA 3HT5A 4Y2TA 3U6KA 4AICA 4YXWA 3QA9A 4X3CA 1Q22A 4BV2A 3GFFA 2XUHA 4DV0B 2WYHA 2QLBA 4JELA 5AOCA 2CK3A 3T7SA 4BVHA 2GM4A 4MS1B 4DV2H 2RB4A 4P4LA 5DSXA 3AL2A 4JT8A 4WOJA 3NORA 3PNOA 1H9AA 4YHHB 1TAEA 3S2EA 3T7EA 4CM4A 2L19A 4TWRA 2JFOA 3BS4A 3BMOB 1E60A 4LJAA 3W8RA 3OIDA 3TEFA 5DK4A 2A0KA 2JHGA 2AOTB 4A23A 5B4UA 3RRJA 4Q7QA 1GFIA 5E8RA 3MUEA 1AZTA 2MR6A 2AFIE 5EIOA 3KDSE 5ESXA 4XDGA 4RMNA 3RUFA 2HN9A 3GTKA 5CBPB 4IZ6A 3ZDZB 4PQFA 4MUNA 1QIKA 3IAAA 4XDZA 3R9WA 1OZAA 4R4JA 3VR0A 3VZPA 1MG5A 1I10A 2X0KA 4FNOA 4OEHA 3MR3A 1KSGA 2W2OA 3FWKA 4HLUC 1UAYA 2V98A 3MFIA 2WUVA 4GGMX 1W5FA 4DQ0A 2CXNA 3E0QA 1ODIA 4Q02A 2D1QA 1CWUA 1MAAA 5KNCD 1VZ3A 1WXXA 1V1RA 1QOPB 4AKSA 1P16A 4Y2QA 1DC7A 1VE3A 1DXQA 1Q16A 4JK3A 1BXZA 9LDBA 1M8JA 1A77A 2FX3A 4BPRA 4DUPA 1IWBB 2OYCA 5A5DA 2E21A 5JVDF 2BHSA 3DMYA 2BEKA 1KPHA 3U4GA 2OQIA 3TOCA 1FTSA 4NNPA 2NVWA 2CFOA 2VP2A 3GRYA 1E79A 1T6ZA 3S5UA 5JPCA 4ML3A 4UU7A 4KFCA 4YYZA 4Q4AA 3UJ8A 1Q95A 1XTPA 3VI3B 4NS4A 4W82A 3QE2A 1JAZA 3GRZA 2G9RA 2IDMA 4Q8FA 4BXOA 4G4IA 3MMZA 3EG9A 3JD3A 3ELWA 2W7TA 4GC6A 2XKJE 5E8JA 3DZ8A 4KV7A 3KTAB 3H2KA 3L8HA 2FMAA 3BE4A 3E03A 3AEQA 1VA4A 4PSDA 2OBMA 1IVYA 2DFPA 2VHVA 3RVSA 1XIVA 1GZDA 2NSJA 3RJ5A 2KM1A 1GU1A 2HNAA 3WL7A 1P2GA 2YV4A 3AKDA 1XNQB 2GN9A 1JR3E 3SLKA 1NQVA 1U0NA 2SNIE 2OPBA 3S2IA 2VBCA 3UIEA 4X66B 1F51E 2R5FA 3QELA 3GTMA 2NU6A 3ZZNA 1IN1A 1W4CA 2OAQ1 4U4AA 2B7LA 2Z3VA 5DHSA 2G76A 4DMKA 3MN1A 4JKIA 221PA 3VNQA 1GL3A 1K7EB 2OCDA 5CDGA 5AM3A 5L4LA 1XA0A 2OOKA 1PK8A 2WVGA 4UHJA 1Y33E 1KY2A 2J1LA 1NX9A 4QOJA 1SEVA 4NAUA 1ZGCA 1C3EA 3H1EA 3LK6A 3J7AK 5KNDA 1L5KA 5D8DA 2JCVA 2NZVG 1NFRA 1C7IA 1E89A 3V6MA 1QG6A 4FZJA 3E4DA 2E4WA 4EGCB 3BIFA 2UVQA 2YUTA 4OMFG 4KHPB 2YFQA 4C88A 2B9VA 3QYAA 1Z2NX 1HKHA 3WYFA 3BWYA 1BQ4A 1L4NA 4YCCA 3HCWA 4UHCA 5EWLA 5B3JA 3OO0A 3P97A 2PWYA 1WDMA 3MMPA 1T13A 2YY7A 3GBPA 2FZKA 1FTWA 3VSEA 4GPTA 4C04A 4QWMA 1EFRA 3U3RA 3IDSA 1S9FA 1MJ5A 4EYGA 3P9CA 1RQ2A 4LZPA 4A3KG 3ZHTA 4UQPA 4HSEA 5CXXA 5DF1A 1P8AA 4ERXA 5A9RA 1C9KA 1BXKA 4HADA 2YHIA 4KAXA 3K4QA 4FE2A 2C4UA 2B0CA 4MTEA 1QONA 3I05A 5CGZA 2C07A 4TSKA 3N2EA 1LPPA 1TJPB 2I6XA 4WNAB 2OCBA 2BTOA 2X8BA 3JZDA 4RPJA 2BM0A 3T5CA 1DGQA 3IR5A 3DEKA 3R3UA 1PJZA 4V3CA 1ECCA 2V5UA 1SVKA 1Z37A 1Z4NA 3LP6A 2WM3A 2JEOA 1R27A 5BN4A 4ZGWA 1RRFA 3ADBA 1DJLA 1MQSA 2XIQA 3WGTA 4AU1A 1AIPA 3IHTA 4LJLA 4XPZA 1Q12A 2OC9A 3CH5A 3GLTA 1ACLA 3JD2A 3R5JA 2J3IA 1ZRMA 1UBCA 4NR0A 2WKPA 2O6HA 4KITB 2JFHA 3M7IA 5DM60 4PLTA 4NCJA 3QYPA 1KFCB 4DDWA 5IDXA 1RXWA 2ODPA 1Y3IA 1P0MA 1PZMA 3HR8A 3Q9LA 5LKRA 4AJHA 2OAGA 3PN1A 2OD9A 3VR5D 4YGYA 3PJDA 1KA9H 2RONA 2EC5A 2BP7B 3QHPA 3BJIC 3UWSA 1KS2A 1FMFA 3DV0B 2GO7A 4HZGA 3TLJA 1J22A 3S2FA 1LDEA 1Z6GA 2O57A 4KP7A 2NQ8A 4G0UA 4WIAA 3IXMA 3H5OA 5BORA 2YZLA 3WJAA 4CR8A 2COIA 4HRXA 4I9HA 3U5TA 1DCMA 3P0RA 4ZC1A 4URXR 3O2SB 3UZOA 3PJRA 3S27A 5KC9A 1G2PA 2WAQE 4YXWD 4MOWA 3I5MA 3CRMA 1YB5A 1DLJA 4R0MA 3ADOA 3HJGA 2H3HA 5JARA 3WA7A 3QVUA 4NPHA 3IVXA 4XM0A 1Z6PA 1ST2A 2P41A 4P92A 3ZU5A 1KVRA 3HSYA 5ICGA 1IY0A 4IHQA 5YASA 3DVAA 2QJWA 3GZ4A 4A6XA 1WCIA 1CRZA 4MI6A 4C7JA 4L95C 5DLPA 1GTZA 5G0VA 2PIAA 3NOXA 3QP9A 2CHQA 1I8TA 1TW3A 2PX8A 1RXVA 3ZLUA 4ETNA 4O81A 3GLIE 2GI4A 3B1FA 4HK4A 3N8GA 1T3NA 1KY4A 1RWXA 2QA5A 4Y2YA 4BVAA 5IJ0A 3RBZA 3WRWA 4EPVA 3ENVA 1YQXA 1HDIA 3RFUA 4I50B 3TBFA 2NO1A 1HV8A 3ONNA 3HI4A 4C4TA 2DPYA 1QVAA 1G8PA 3H6GA 4RVSA 4WXEA 2VR1A 1YO6A 3D4NA 5H80A 3CVJA 3MS7A 3GIKA 3BWEA 5IYBG 2NLOA 4QEKA 4YJ3A 2FSVA 5IHXA 2PAFA 5DTJA 1NI4B 3LC7O 1N7JA 3F5SA 1R6BX 1YJ5A 1X7ZB 3ZHVA 3K94A 4ABTA 3OM0A 3R6TA 2PL9A 4WESB 4G07A 4YLEA 2ZBRA 2OQVA 2H92A 3DAAA 1TTPB 4FFBB 1A95A 2EIXA 1O9BA 2WJWA 3OF2A 3CURA 4KBYA 1EJ0A 4MTCA 5LA6B 1C9NA 2R6CA 3BJYA 5IC5A 1L7XA 3L1UA 3LV8A 3QEAZ 3W5DA 1VECA 1B8PA 1GGFA 1TZMA 5KCZA 4K7JA 3WDSA 1EHCA 4BWYA 2XEDA 2HQOA 1T8YA 1IZ9A 3K5PA 1IWPB 1ORTA 4WBNA 2DLCX 4A82A 2OCGA 4KMOA 3I9NA 3PXAA 4QIWA 2HVSA 3W9SA 3MK31 4L76A 4URVR 4FYHA 5G1OA 3SYNA 3LHDA 1C7RA 1Z62A 3PFHA 2SBTA 4PX5A 2FJZA 1F14A 5BWTA 4FR0A 1AGRA 2ZRLA 1H66A 1NHWA 2RK4A 2HF7A 1L4UA 5FFNA 5I7WA 4FMCB 4MARA 3ZG6A 1UBNA 4M0CA 1PT8A 1TTQB 4A3BG 3IBGA 4EKDA 1U2ZA 2IXAA 3L2OB 3GC6A 4URUR 4DW8A 3CIFA 3W90A 3WYNA 5KJFA 5IYZB 2JZCA 2R85A 2JFVA 1SUWA 2CMHA 1M2FA 3KLBA 1CUVA 4NL4H 4KXXA 4DR4B 1L6IA 2WQ7A 4LHEA 1L1QA 2YZ2A 4F8EA 2ZGIA 1C4KA 3PZRA 5DI9A 2O4UX 3ABIA 3OCWA 3BMCB 2MINA 4EJSC 4P1ZA 3ROZA 4Z3DA 1VKNA 2XVZA 5KFNA 3Q3VA 4KXLA 1SUSA 3ZBQA 2IZ6A 1JSXA 5KCMA 1F9EA 1FVHA 3OX1A 3G2JA 5ISMA 5KNDD 2PZBA 3IA2A 3TW8A 3R75A 4MYTA 4BTVA 5ULLA 3RSOA 2Q0HA 3TJRA 3ZVKA 1ZVKA 9ATCA 2HMWA 4B6SA 1RHMA 1T0PA 3KG2A 3QOXA 2QR3A 2BI8A 2GJAA 2C2KA 1XCPA 1QDEA 1W4RA 3FPKA 3N6RA 3AR7A 1L7RA 1FYXA 4WK2B 2AFHE 3WGNA 3Q6MA 2POCA 2GN4A 5HP4A 1IM2A 4WOBA 3H4TA 4RVOA 4IZHA 3RQIA 3DKIA 4ECXA 1P7YA 5F5XA 2RHBA 4R1SA 2WDZA 5T14A 4N5HX 2W83A 1RQLA 2XITA 1QRRA 3AI2A 2J0SA 1R66A 3WGKA 1IYEA 1RFGE 5DNWA 4AQ7A 4GI2A 5ALIA 1UEXC 4EHDA 1RYZA 3CZCA 3H11A 3SF8B 2HLNA 1T10A 3LBIA 3L01A 4NHEA 1VIMA 3KETA 5GQSA 4CL8A 3MINB 1KQOA 2YXBA 1IJFA 5FJ8G 3LT4A 1QFJA 1NQAO 1B23P 3NP9A 3JD1A 2IC5A 1WMSA 5EHXA 3FNBA 4C4RA 4CVNA 5ITVA 1TB4A 4JJFA 5CLJA 2HO4A 1YB7A 5CFOA 3HDVA 3THXA 4JZKA 2ZTSA 3ZDFA 2Q3LA 2WM8A 1BW9B 2QROA 2NYUA 1BFUA 4IF6A 1AH2A 1ICEA 1M54A 4H2DA 2E4AA 3IT1A 4CR7A 1FP7A 1TT7A 4MINA 1SA0A 5JG7A 4WCFC 3GGSA 1AQNA 3DKVA 4AJIA 3BB3A 1Z25A 2I6TA 3K9HA 3CLUC 1M6EX 2ZQZA 1YVRA 4TM5A 1OFUA 3W79A 4N5MA 4EZBA 4ITRC 4UBJA 1SHKA 3ZGNA 1Z3IX 2GCEA 4YP3A 2I8LA 4Q43A 4ER7A 3HGMA 4MUBA 2WJ3A 4OQEA 2A4KA 5DSZA 5J4HA 4P4TA 1QYXA 5JZVA 5B30A 3EK2A 1JT2A 4BB5A 3KKLA 3EMDA 5KS2A 3C8MA 5JSHA 4A3CG 2JGEA 4D9GA 4MVJG 1JX6A 1YK1A 4DJ5X 3O73A 1RJRA 4B3MH 2FJPA 3FZGA 2VP9A 4Z0PA 3TB4A 3JQCA 1WDTA 2OGSA 1ZHOA 1Z06A 4A16A 5MN6A 1E6LA 1RTKA 1JQ3A 1FDSA 2DQYA 3U0GA 3NC0B 3R3WA 2HI0A 3HOZG 1JPNA 1A71A 3MGBA 1CZOA 3OTWA 4YRLA 4D8UA 1MW9X 2A84A 2G0AA 3D6UA 3EVZA 3GVPA 5COBA 3PC4A 4ND8B 4WY2A 4MGIR 5DWQA 5KFDA 4BNYA 3B9PA 3GAZA 3RVJA 1K5PA 2RKWA 1PR0A 1AC5A 1WEKA 1LS6A 5L1KA 3OQJA 2D7CA 3Q3HA 1A9XB 2ZT8A 3NHFA 4PM4A 1TRKA 4H6PA 1WXDA 2DT8A 1N0WA 3X1JA 2JDIA 3BB1A 3QVXA 2AEFA 3TLXA 3SFVA 1TF2A 4BCBA 2TMDA 4K6CA 3RW9A 4EL5A 5KYWB 3H65A 4GNKA 3RR5A 1UC8A 2ZAYA 2DTXA 4X94A 3VI4B 4ZYXA 2PG3A 1T6BY 3LCMA 1C1DB 5BSUA 4IXNA 1YBMA 4CG0A 3DXZA 1B26A 2YRXA 3X1YA 5CVTA 2XT9A 3IPLA 1NF2A 4PWZA 4HDMB 1TO2E 3WC4A 4ZVLA 5E7IA 2OHHA 1F60A 5F5NA 1XQWA 3O7MA 1X8JA 4LXHA 1T29A 3UUFA 2FK2A 1NUAA 2BIFA 2W4QA 4JNCA 4BHTA 1C81A 4QFCA 3OJFA 3FYUC 3FROA 1T4DA 1VCHA 4RSGA 3TR6A 4AXXA 2ODWA 4QHTA 1NGSA 3RU2A 4HUTA 4NBKA 4PBCA 4HAIA 2H06A 5AXBA 4KR6A 2ZYTX 4D1YA 3SZLA 4J1QA 4R8MA 4BEJA 4K9KA 2J6UA 2F62A 3HVKA 1O77A 4WOKA 3B52X 4NECA 1TU0A 2FPGB 3SR3A 3EH1A 1CY4A 2FSUA 3N7TA 1WD7A 3LT2A 4G6ZA 4UUOA 3TZKA 4ER0A 4QTYA 4X3PA 3L6BA 3Q72A 4OP3A 3NKFA 5CCEA 3T5KA 1Q0HA 3K6KA 1SG9A 1P2VA 4OJYA 1JIQA 5CM8B 3UOGA 3KOMA 1NZDA 1B1CA 1KI2A 4M49A 1OFGA 4FI3F 4Z0HO 1TJ5A 5HJ5A 2E5WA 5BWMA 1QHSA 4PAMA 1UM8A 3KHKA 1NE2A 5TV2A 3L1IA 1GV0A 3HVHA 3HJTA 3I0ZA 5DQIA 4OIFA 5BW4A 1YFKA 3FZNA 5EGNA 3AFHA 4P36A 1N34H 4M7WA 3MUOA 3CNQS 2NX2A 4NZNA 1EA5A 5DI3B 4ZT5A 4DQLA 5C3EG 3N5KA 2Y1XA 4EP1A 2CXSA 2CNQA 2UKDA 3UH1A 2QTWB 1PEKE 4IYRA 2BH9A 4P98A 4AM8A 2L18A 4W5TA 5FLEX 4PO1A 3AR9A 4BMVA 3I2IA 2N1BA 2C5BA 3FIUA 3TPFA 3I28A 4ND2A 1WAMA 4K9PA 1LTQA 3OE1A 3EUEA 1C0EA 4HB4A 3PF8A 1YQEA 2XTJA 1OKKD 3ZDDA 3EPIA 2BP7A 4RZQA 1RC8A 3ZH9B 2HJSA 2WLTA 1QRSA 1NURA 3VXKA 4OH1A 4GBGA 4OQLA 2JJ8A 3NVDA 1YR1A 4JGIA 1II9A 4D0NA 3LFTA 1RFLA 5T57A 4EGAA 1ZICA 5TMPA 3BHIA 4JLWA 4UBNA 3CSDA 2QL7A 2A86A 5T3UA 4QA9A 1ZJ6A 2Q27A 3ECSA 2QD4A 3SE0A 2B83A 3HKCB 2VXYA 2ZI5A 1H94A 4YPVA 3FKIG 2F43B 4C29A 2SHKA 3QSYA 2W6NA 3L5OA 1XZKA 5DTQA 1AK2A 4WW0A 1LS1A 2TMYA 1HYBA 4INJA 2W6ID 3GUZA 1OFVA 3CEBA 3G85A 4JXZA 1MNAA 1ULSA 2BPOA 2O52A 4PXSA 1OILA 4J9PA 1CNFA 4R7RA 5ELLA 4ZCPA 1NW9B 4HEA6 5ALDA 2AVDA 1EVLA 2I29A 3QLUC 4GWGA 4QX6A 4KRYA 4G5OA 2OO7A 4XCXA 4GEGA 2V3WA 4C7VA 4F8JA 4CLOB 3IJRA 1YNSA 2O2IA 2OGTA 3CWQA 1XTIA 1TD1A 1WF3A 2W6PA 4K1XA 4MV7A 1Q7RA 4GGPA 1PEAA 3WJ7A 5AKIA 5DMHA 5B64A 1TF5A 3HADA 2I71A 1FS5A 5J2TB 3NT2A 1BHQ1 4QIHA 1IONA 5IXJA 5GIPE 3OX3A 1TPYA 4Z8XA 1FA9A 1CZRA 1IG3A 1Y9ZA 3PTAA 1W94A 4FGWA 2A30A 3W3AA 4F56A 1VL2A 3N53A 4GR4A 4CQMA 4AMUA 4KN9S 1EG7A 3BIOA 4AS1A 3AVQA 4I2VA 4ZP1A 5C4GB 3E9RA 1Y4AE 3I1IA 1KQ3A 3DQQA 5E95A 5TF4A 1M2OB 2IYAA 1EFLA 2R8XA 3GX1A 3LDUA 5K3DA 1KDRA 4CE6A 4JI3B 4ID9A 3I0NA 3RIZA 3RUIA 1UQRA 1QZXA 4BZWA 3JAWB 4U7WA 4DARA 5ADHA 5AJHA 2E0IA 2D8AA 4MPPA 1KJYA 1QQ7A 1XMQB 5K05A 2C3OA 3SVTA 1OXUA 4HDSA 5DOZA 2WVAA 3KWFA 4HR7A 4NP6A 4YASA 3W5OA 1QP0A 1X1TA 3VNUA 2FG7C 1PUXA 4DJAA 1GNRA 3T3HA 2VTEA 1M6VA 2D62A 4PC7A 4HWRA 4RA9B 1OPXA 3BA8A 5HKLA 4AJKA 5L3ZA 4KR9A 4XDYA 2R8YA 4OJMX 5JNTA 2NMVA 3LQKA 3GARA 4S1PA 1XEFA 3ASVA 2JDID 3EZFA 4QICA 5EWJA 2G08A 4I5DA 1YVUA 4NYJQ 4M0LA 1XZ8A 4OKIA 5AW7A 4NBUA 1P5RA 1YQDA 4LXQA 2FGKA 2WVHA 4YRGA 3H0CA 4ZYYA 3ANLA 3MPOA 2W4IA 4Y1FA 1Z4OA 2J46A 1U63A 1W1IA 4XWGA 1MFPA 1ZRNA 2YCHA 5CXSA 3MQFA 1GZ3A 4PWQA 3JRXA 1KY3A 3WKDA 2GA9A 3KTMA 4EJSA 4EBEA 2GF2A 2Z4RA 2KPOA 4O4JA 3UMJA 1Z0SA 4OFXA 4ZZIA 1JQKA 1O97D 1OW3B 4CUJA 1GO2A 3CVXA 5ERXA 3UJAA 5F35A 2ABJA 1QQAA 4J8PA 2VXOA 1V26A 4Z3OA 1C7JA 1S0UA 1DKQA 1ZGAA 4YT2A 3CEPB 4BMNA 1RLTA 5CA1B 2UYCA 5ECDA 4UEKA 1DQRA 1FX1A 5J43A 3R3HA 2N47A 3LQ4A 3VAZA 2NUTA 3HRKA 3FRIA 1T3LA 3VJRA 3LT5A 4ILEA 3A1EA 1XJ5A 4OMUA 3GY0A 1YUNA 4FEEA 5IM4A 1JDVA 7GPBA 2ZRKA 2EP8A 3UWKA 3NVKI 2XNDD 3WKEA 3TRFA 4LJ7A 4UCFA 4BNLA 3PQ4A 1XZMA 2CWDA 4YCLA 1O6BA 4MYDA 2Q5LA 2FUG6 3OOSA 1ZW6A 2X0DA 4MWEA 1SR8A 3L6DA 5L3QB 3UXYA 1ARZA 5LMNB 1KEWA 1AQIA 1YI0A 3DOJA 3RGWS 3PC7A 4ZXPA 1E99A 3BGSA 4J9MA 2VQSA 3U1VA 1DUVG 2C2BA 4XQCA 2HG8A 4I4CA 3OVMA 4TGLA 1XNRH 2YUIA 3TD2A 3WADA 1N4DA 2XTAA 2XD4A 2C7QA 1K4YA 2CUNA 3GTJA 3WGVA 3E2MA 3AU9A 1A1SA 4YI3A 2V5VA 1KI7A 3SJBA 3UATA 5EOYA 4Q6WA 3TFWA 2QYHA 4WCFA 2P2NA 4LSWA 4E5YA 3WB1A 5EYPB 2OKGA 3RIMA 5E0OA 4RTPA 1SOAA 5KFGA 4PYJA 5AI8A 5BOSB 3L4KA 1KPGA 2IP1A 4IDQA 3LVBA 5I7UA 2QD2A 4GOMD 4E51A 1WE2A 1NBMA 1V5WA 1QGAA 1YZUA 4FLFA 1J21A 3F8TA 5B3JC 4AP9A 1CUIA 1F6DA 4GP6A 5HIMA 3JW8A 3MWEB 1S97A 3Q8SB 1QH8A 2V54A 2BKEA 3IIIA 4KLCA 2JGAA 4UHDA 5KFRA 1F2TA 2H5JA 1JIVA 1F06A 4AIRA 2X0JA 1RNLA 2BFEA 2ZU6A 1G8AA 5H16A 3FVQA 5LPNA 5G4KB 3RSSA 2ZIUB 5I5UA 2BFBB 4QBGB 2I4OA 5DTEA 4EI9A 3D8HA 2H7CA 4DBVO 1X77A 3E7WA 3QV1A 2FZGA 1G8MA 3K5HA 3K9WA 5MN4A 1HR0B 3EW7A 3V7NA 1K4KA 1ZINA 4UTOA 3LNTA 4DSUA 3OOJA 3L7OA 1Q6YA 1UBSB 3G2OA 1GXSB 1G9SA 3KHLA 4DYVA 4YCJA 2FU5C 4M1YA 3LW8A 1VJ5A 1KERA 4TRMA 4CEHB 4PIPA 3F6RA 3WKCA 2VSXA 2OCAA 2AG1A 4NBNA 4JV5H 2J3HA 1N5KA 2Y27A 2O06A 1WETA 4CF6A 1Y3HA 1RAGA 5TRTA 3HEBA 3EGWA 3A6PC 3A3KA 2WWGA 1C41A 3WGHA 3A58B 4MUXA 1Z08A 4WZAE 5C1BA 4UPEA 1AD2A 5KOJB 2R1TB 2Q3FA 3W6PA 5K0GA 1VLLA 1DC4A 2PMZA 3KQVA 3QNUA 2BF7A 1Y5LA 1NOKA 4ZEVA 5DPMA 4QSHA 1E2QA 4YRKA 5EMNA 4PHFA 3SLGA 4B40A 3ORYA 3QVLA 4PLGA 1A9SA 1V8ZA 4CQMD 2O2YA 4JJKA 3DLIA 2BUCA 5FEUA 2D00A 4OJNA 4YRDA 1ECJA 3DDSA 3FYUA 2QVLA 1S3FA 3PC2A 5JJKA 3EISA 4Y2PA 4MRAA 2OFPA 1WPGA 2CVHA 2Q0SA 1TC2A 3RUAA 2WYOA 1G5TA 3AHIA 2UUAB 4KAFA 1H6CA 4A1FA 5KYXA 4U2EA 3KJEA 3PW2A 4L08A 2O9JA 4PLYA 1FZQA 3NU1A 3LUJA 2C77A 2EGGA 3PDIA 3LXMA 3Q0TA 1JAXA 4O3NA 3TLGA 3RTCA 3EFBA 3U44A 4OGWA 3S2ZA 3ROMA 5A05A 1DQSA 2BCGY 2PSDA 2COKA 1ZD5A 4JKOA 2BGJA 3VNAA 1EWVA 4OJKA 5K3OA 3ABRB 4FW8A 1AHNA 2CCKA 4E3WA 1UT5A 2Q8QA 3A05A 2XQJA 3FNFA 2AYZA 1B74A 1E7QA 1SBNE 2CYBA 1RVDA 3BD6A 2ZSAA 2NZYA 1SCUB 4IS3A 3PW7A 3HZRA 3A6KA 3L49A 4CR6A 3R0IA 1UZUA 1ISPA 2HA5A 2YL2A 3OJEA 3C45A 3EC2A 2H57A 4C21A 3R7NA 1TQDA 3ESYA 1USWA 3AHDA 3IIMA 2O23A 2BCEA 3V7UA 3ZZMA 2G5PA 1BD3A 5JXIA 3ENKA 3NFYA 3MGGA 3VV2A 5K8LA 2OH2A 2VDQB 3GTOA 5A4KA 3PSHA 3L0OA 3AR8A 5E4FA 1S68A 1I9GA 4P58A 3PXXA 1H2FA 2D59A 4MYHA 2HZ7A 4MVJE 1TIKA 1XRNA 1NVEA 3S8MA 4K5QA 4IHAA 2J5XA 1SHTX 3TZQA 1WB5A 1JSRA 1O3YA 1TTHA 3ZUGA 4DL6A 3V9AA 3ZCSA 1UPFA 2HBZA 3DMPA 4YQEA 2QG6A 5E25A 5SZJA 1H8EA 4G5XA 3JU3A 3WLLA 5IUNC 1T0HB 4MVJM 2R8ZA 2CJFA 1JH8A 2BGIA 4PWYA 1NG9A 3GIWA 1GUFA 3KUUA 4XIIA 1OIXA 3ZD6A 5JAHA 3OPMA 4MRMB 3HO8A 1E92A 2IOHA 5AK4A 2FI1A 3F6CA 1HF3A 4IXMA 3V1UA 4RZXA 4B3JA 5ALLA 2ZAMA 3NIWA 2P2GA 4E4YA 3EVDA 3GG9A 2IDJA 2NZXA 3E9QA 4N3CA 3GT4A 3HJNA 5IJXA 4XW2A 4GEKA 4KEAA 1T6NA 3T95A 4KX5A 4ZAFA 2X4LA 2VWGA 3DEFA 4UREA 3LUBA 1A9RA 3T7JA 3NXKA 5G02A 3M5WA 2CEKA 2FN8A 3DFUA 3M4IA 4PSUA 3IQFA 3I37X 2PL1A 2NV6A 3K16A 2CHGA 1V4NA 2VDJA 1G60A 3E9EA 2A14A 4B31A 1X7YB 5CA0F 3E5NA 4QYXA 1QB8A 5IFKA 4RMHA 5LOVA 2O2ZA 5BNWA 1LB1B 3UWPA 3QLUA 2YDYA 3F9IA 3WJ1A 4LF4H 2BKXA 4ZOQI 2HK9A 4RTRA 4IX9A 4R8VA 2P0AA 2XIGA 3LP5A 2I4RA 4G5QA 2W93A 4J1SA 5FLXA 5G1PA 5GVSA 4BRUA 4JQOA 5GONF 4PTZA 4ZI3A 2MIIA 3GV5B 1AT1A 4M55A 2WSIA 3N8HA 2J9FB 2GGSA 3BXHA 1NOIA 4RTSA 4X60A 4EUKA 5JC1A 4IUDS 4EG0A 1ISGA 2E4VA 3FETA 4BVEA 4MW9A 3IURA 1PDWA 3RUEA 5DMXA 2B7CA 2ZWPA 3T6KA 3G5TA 1Q57A 2FK1A 4ARSA 3AETA 3HO6A 2B5VA 1R18A 3IBFA 3QKUA 5I47A 4DY4A 4RK5A 3LVQE 1NBMD 2O7QA 3HOXG 2XXJA 2FUCA 3QE0A 3LC2O 3LUKA 4K9SA 4JUBA 1BMTA 3A1TA 3CY6A 1O6FA 5KQSA 3WMGA 1GQQA 1XTBA 3NIGB 1XK5A 4PCUA 2QXTA 2VYVA 3KXYT 1NASA 3QRWA 1N5OX 1DHRA 2JFWA 4UNQA 1H69A 1YB2A 3SQOA 4BP3A 1O03A 1ILWA 1XE3A 3CJRA 3FTQA 3DPIA 1HNZH 1JKMA 1E6WA 1TAHA 3TI7A 1EFAA 2AC2A 4FUTA 3AEUB 1RLJA 2IOFA 4QO8A 3AY0A 4QUHA 1I4DD 2WMDA 4CLRB 1EQ2A 3QZ8A 1D2GA 4NESA 2CLLB 5DSTA 1A76A 1U7UA 2GN0A 1VHWA 2FOXA 2MTBA 4DG9A 5FKJA 4PSAA 4Y30A 5DBIA 4BLPA 4IHJF 4FN4A 5LQCA 2ONKA 2NU9A 2ZT5A 2YWXA 1NBHA 3RCBA 2VSFA 4BJ1A 1N92A 3IB3A 2X8JA 3O8OB 3O8CA 3DEIA 3KQNA 1OA0A 2ZM6B 3LUHA 4M6WB 4J6EA 4MVJH 3WQHA 4ZOLF 1UJ2A 2QVZX 2C84A 4ZQIA 5C7IO 3C7AA 3EFHA 1RBYA 1Q15A 3I30X 5HOEA 2V7XA 1DC6A 2G36A 3FPGA 5A6SA 5JTTA 4NXMH 2UYGA 1UK9A 4F5YA 1X9HA 4TWJA 1X94A 3A7EA 3I6YA 1FP6A 2HWXA 4L5AA 2B98A 1BFKA 1W9MA 5BWRA 5E1OA 3DUFA 5EHZA 5DHUA 4G8JA 1RYRA 2YWVA 1J39A 1E32A 3EOAI 4A3EG 2HKIA 2O2XA 2B1JA 3BDVA 3WNBA 1Y4ZA 1ECPA 2X2PA 4B5LA 1WQ3A 4O3SA 1V8OA 4CKWA 2FK3A 1YZHA 3OJXA 1UH5A 4KDFA 3ZQKA 3EZ9A 3KC2A 2MSKA 3GRUA 1CR6A 2ZR7A 3IAM6 4P4SA 3PRYA 2UVVA 4Y7CA 4AS2A 3KK0A 1NPYA 2VBFA 1KJJA 4LN1A 3C4QA 3SY8A 5JOQA 4JAVC 5JAMA 4P82A 4MB2A 1K8QA 4Q4JB 2O3RA 5CX1B 4OX9H 3V1NA 3P7MA 3JQEA 1VI5A 2IF0A 2EX0A 1G20E 2QQEA 5J2UA 3M81A 3NNNA 2EWVA 1DBWA 3ODGA 4X3OA 3DO5A 1ISSA 3NEAA 2LDBA 1N8TA 4CWAA 1FJ2A 4C7KA 2VHJA 3ITNA 3I9JA 3WWHA 3JQ9C 3DZCA 1JJIA 4J0MA 1GU7A 3JD4A 5AVVA 4LF5H 3UM9A 2DR0A 1WZCA 3EAGA 4WH0A 3E3LA 2DLDA 1Q7EA 2ZSDA 5DNEA 1U02A 1XA3A 4H4EA 2QSJA 1L4GA 3D7RA 4AF8A 3B1VA 1TA4A 1A7JA 4JBLA 5ADVA 3LPLA 5HKKD 4NMHA 4QXOA 1ZJ4A 3OZCA 2WUGA 5LMUB 3ZWOA 5A3SA 2WR8A 4WFIA 2NPFA 1TPZA 2I1VB 4DWJA 4U39A 3BICA 4QGAA 3WMXA 3T4XA 3ZWMA 4AKGA 2PWZA 4B84A 5BSTA 4B4UA 2VJQA 2ATCA 3UHAA 2J3MA 5M29A 3IVGA 4EEZA 1O97C 2JRLA 1EUQA 3QGMA 3D6JA 3KWLA 5BSGA 2I4MA 2PR2A 3GN2A 3UWDA 2P91A 2ZAGA 4LY6A 4D4GA 1VPWA 3R6DA 2ASEA 3NI2A 3A2LA 3QU4A 2EWMA 5B7GA 3PT9A 1E20A 4DJDC 4HHEA 3GAAA 5BOSA 1VJDA 5KYVA 2MMGA 3E27A 4BFUA 5EJ4A 2JEGA 4RVFA 1P73A 1VDMA 3VAAA 3G6WA 1BQ3A 2QL5A 3SVLA 1MOSA 4X7RA 1VYTA 4MS4A 3V7WA 2IP4A 1K1QA 1P18A 1H8ED 5C53B 3F90A 1KSHA 2KS6A 4IXWA 2CJPA 4CN8A 2QAGA 3FHJA 3ZLVA 3A10A 3L6OO 4YMUA 1PG5A 3PEEA 4UJ5A 1A0IA 4L22A 5BNIA 1P9RA 2BBTA 4AZ0B 4LPSA 4ECZA 3JQDA 1R15A 3RBAA 2ZRIA 4JR0A 2RG1A 3TOVA 4RQUA 3U7RA 3PPWA 1RACA 1A4UA 3GLHB 2BFBA 3AUYA 4HLQB 4LOHA 1PE0A 1J5E<