2XD4A

Nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
421
structure length
421
Chain Sequence
b'MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
publication title Nucleotide-Bound Structures of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase
rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 114
structure length 421
sequence length 421
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2xd4A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2xd4A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xd4A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2xd4A04
2R87A 3N6RA 4DLKA 4EG0A 4EAAA 3AW8A 3BFPA 4TV9F 5C1PA 4O82A 3GLKA 5CA1F 4Y8VB 3MWEA 2FPGB 4ZOLF 2YZNA 4FE2A 2PBZA 4O2BF 5FNVF 1DIKA 4FFRA 4C5BA 1KEEA 2CNVA 1Z2PX 4O7RA 4EGJA 2FP4B 2W6OA 5KX5F 3VPBA 1DV2A 4E4TA 3TW6A 3RV3A 2YS7A 5LYJF 1CQIB 4FFPA 3VA7A 4O4IF 2CNUA 2VPQA 3KAJA 4MV9A 4HNTA 2GLTA 1KJJA 2C00A 3R9RA 3SE7A 2GQSA 5GONF 4HR7A 3VPDA 4YBZB 5JH7F 4J6EA 5CAEB 2HJWA 2DWCA 5LXTF 2YL2A 3ETHA 1B6SA 3RUPA 2CZGA 4O7TA 5BPFA 1W93A 1Z2OX 4MA5A 1EZ1A 1SCUB 2Z02A 1CQJB 2SCUB 2IP4A 2QF7A 4O7LA 5DMXA 4WD3A 5LOVF 2ZDHA 5JQGF 3V4ZA 5JQWA 1AUXA 3OUUA 2W71A 4FU0A 2ZDQA 1CS0A 4YB8B 4O4HF 1KBLA 3BG5A 4HNVA 4XZ3B 4M9CA 4MAMA 1GSOA 4FGRA 3JZIA 3OUZA 3N8DA 5HV6A 4L1KA 2CQYA 2YS6A 3U55A 4XYMB 4ZQIA 4EA8A 4EABA 4O7SA 5BMVF 4O7ZA 4I50F 4O7WA 1C30A 2V58A 2X0SA 3ORRA 3JRWA 1GSHA 2PVPA 1M0WA 4O7NA 5LA6F 4FFMA 4M98A 4EA9A 5HBRB 4O81A 2XD4A 3G8CA 1I7LA 4O4LF 1M0TA 3TIIA 4I55F 1C3OA 5KKNB 5JVDF 4MV3A 4TUYF 2VR1A 2NU9B 2R82A 1DV1A 1E4EA 2W70A 1PX2A 4YJ2F 2FB9A 2NUAB 4C5CA 2YRWA 4XX0B 4TV8F 4XYLB 1EHIA 3U54A 1GSAA 4FFOA 2R84A 3MJFA 2VQDA 1OBDA 3TQTA 1I7NA 3ETJA 1T36A 3K5IA 5LP6F 2V59A 4O84A 3WO0A 1KC7A 2R85A 4O2AF 3TIGA 4MV8A 2NPOA 3KAKA 4EA7A 1BNCA 2I80A 4O7YA 4IHJF 1IOWA 2HGSA 1JLLB 4FFNA 1BXRA 4YAJB 1M6VA 3BSYA 3JRXA 2R7KA 2NU8B 3BSSA 5I47A 1KJQA 1GGOA 3MWDA 2DLNA 5K2MA 2DIKA 2XCLA 3BSWA 1JDBB 4I4TF 4DIMA 3R5XA 4QSHA 2P0AA 2R6FA 2W6PA 5H80A 1JDEA 2ZDGA 4O4JF 4O86A 2NU7B 3R5HA 2YWVA 2V5AA 2GPSA 3JZFA 4M9UA 3AX6A 1KJIA 1W96A 3HO8A 1GLVA 1KJ9A 3V4SA 1WR2A 5IYZF 2R86A 5J2UF 1A48A 2R7MA 2OLSA 3I12A 2VHEA 1A9XA 4IIJF 2NU6B 1ULZA 2I8CA 2W6ZA 4ME6A 3RFCA 4M99A 4MV1A 5CA0F 3NUAA 1KJ8A 3K3PA 3U9TA 2PN1A 4NYEA 2CNQA 5C1OA 2R7LA 2Z04A 2YZLA 2YRXA 3UFXB 4MA0A 3Q1KA 4WBNF 3WO1A 2R7NA 1VBHA 2YYAA 3LP8A 3R23A 2FPPB 4MV7A 2YZMA 3G8DA 2YW2A 4ZI7F 1AUVA 1UC8A 3KREA 3QFFA 2FPIB 3HB9A 4HQ6A 5BPHA 2W6MA 2W6QA 3RV4A 4O83A 1IOVA 3E5NA 4MV6A 3K5HA 2J9GA 3WNZA 4HNUA 5EZYF 5JVLA 3HBLA 1PK8A 3VOTA 4YJ3F 5J2TF 3TINA 5CB4F 1EUDB 1VKZA 4IZOA 3GIDA 1KUTA 4YAKB 4C5AA 1OBGA 3ORQA 4FFLA 3Q2OA 2W6NA 4IWYA 1Z2NX 2YZGA 4O7VA 2I87A 4EGQA 2GQRA 3R5FA 3LWBA 4MV4A 3U9SA 3VPCA 1CE8A 1VBGA 1E4EB 1UC9A 4IWXA 2DZDA 2QK4A 5C8YF 3KALA 3DF7A 1B6RA 4RZQA 3VMMA 4ZHQF 1EYZA 5D8DA 1JKJB 2GPWA 1EUCB 4GGMX 2WYOA
chains in the Genus database with same CATH superfamily
1G6KA 2P9JA 4MS1A 1YAJA 4D96A 3GJYA 3ZWVA 4P4TA 2X1LA 4U7DA 3PKIA 5FWXB 5SZKB 2XSZD 4WKGA 4MZXA 2OO5C 3AEUA 1XROA 1KARA 5HZMA 1NI4B 3F46A 1MJGA 4J2HA 3Q9SA 2VWPA 4KWTA 3QXXA 1IZ7A 1R0KA 1HM5A 3PFNA 5I4CA 3QWBA 2Q6OA 3VSDA 2W6IA 3IKLA 3ZWNA 2VJYA 4HNGA 4U7GA 5EZYA 4DNQA 1JPJA 2VYFA 1QFXA 4KUGA 5F77A 5CVJA 3TJRA 1V8DA 4WNYA 1NYTA 4HGPA 3DKRA 4UDXX 2ZUDA 4S04A 1XF1A 4LF9B 1OJLA 5FBLB 2ZRBA 3NV9A 4OJMX 4UBOA 3LHKA 4C7OB 1VZ2A 3C8HA 4OA8A 5BWTA 1GSHA 5KCMA 2HUNA 4ZC1A 1HMPA 3PP8A 3SKYA 2GPJA 4BBZA 5MFZA 2ODAA 3HKBB 3DHEA 3SS7X 3RB6A 3BAFA 1E3WA 5JRJA 3EIHA 1GAWA 3VNNA 4QUBA 3QI7A 1SR8A 3DVAB 4CMHA 5CFLA 3WWEA 5BR8H 4L8VA 3NHZA 3A2NA 5LKAA 3GMSA 1FYDA 1ZAYA 3CW8X 2ES4A 3BXXA 1JFFA 4HK4A 3ADKA 2FMKA 1RHMA 3GJSA 3EODA 5B12A 2QT1A 1GIAA 4LMAA 5SV2A 3ICWA 3O8NA 1IWBB 4RGBA 5IJZA 1OAKA 4URFA 2HWUA 1YJAA 3DYIA 5KFYA 2C2GA 3WL7A 4RO0A 4U7CA 2R00C 5KQLA 2Q7OE 4OXNA 1YVDA 4XIYA 3AZPA 1FE8A 1XU7A 3N41B 1W59A 3DW1X 2NTJA 4LFBH 4QFBA 2WF5A 2WM9B 4P4SB 4ZVQA 1GGFA 1W96A 3NDJA 3SIWA 4LRXA 4WCFC 3CLRC 2OO3A 4I2VA 1A48A 2PD4A 1GITA 1HDRA 3W6PA 2EJ2A 3R77A 1CIVA 3P4XA 2X9QA 4U6PA 3DKVA 3B3FA 2ISQA 3EJ6A 1GFIA 4O1MA 2PN1A 4MRMB 1IEQA 3REOA 4OXQA 3RHZA 3TS1A 4YLYA 5CPBA 2BI7A 1CHDA 2R8PA 5EG5A 4G67A 1PCXA 4J0CA 2RGVA 3NJ8A 5JMTA 3W5HA 4LJ8A 1SVMA 4BAUA 2V6FA 4MHOA 1YFJA 2VHUA 1EXWA 1NT4A 3N8KA 1LD3A 3ZWYA 4L4UA 2ZRMA 1EFCA 3W4IA 4B3CA 1ODJA 2MSKA 3E1KA 4O2RA 4WN9B 1BA2A 1TEXA 4TVBA 1HC7A 3FPHA 4WCFB 3KVNA 5FL7D 1BEUB 4WFIA 4MW5A 5CVEA 4AYWA 4RYDA 5LC1A 1G2QA 3GIJA 1S2DA 3T7KA 1VJCA 3Q41A 4KSYA 1KEVA 1FU7A 1X8LA 4JELA 4ZVRA 1EFPB 5I5SA 2JATA 2ZKLA 5A4JA 2WPNA 1GPDG 5EZ6B 1I4LD 1VHTA 3JALA 3H5TA 4EI7A 3WYCA 3REQA 3QVGA 3FYHA 4C20A 4YAUA 3FCCA 3FRIA 4D82A 4OQLA 5J59A 1K5PA 4CV2A 4HDRB 5CD1A 3D6HA 1DXQA 1R18A 4DR1H 4Z4QA 1I1OA 2XAUA 2BGGA 2F67A 6PFKA 4MV0A 1R27A 3MTGA 3AM1A 2ATLA 1GTRA 4FJ1A 1PK9A 4KXMA 5CD9A 2Z9CA 2JFZA 5EMLA 3RHTA 1KJWA 2PZEA 5IN5A 3VPBA 4F85A 2WUFA 3KOOA 4CYMA 5ALTA 1E1QD 2PTHA 3PJEA 4KYUA 3HN6A 3G79A 4LZZA 4I1PA 4GFDA 2LE0A 2YNMA 1N6LA 2O9JA 1M2WA 3F73A 1DC5A 5KYGA 2A7XA 3PRHA 5IMBA 1LS6A 5FOWA 1RRVA 5JQGF 3PL5A 4D9KA 1O5OA 5BQFA 5EKXA 5CB4A 4EO7A 4M21A 2J6CA 2A4MA 5CT6A 3LY8A 4CXMA 3THYB 3P0HA 4IDGA 1KY4A 2R8HA 3DAAA 1HDGO 2BFMA 1U2GA 2C5HA 2EP8A 3T06B 1M76A 4GYYA 2BFEB 3OT5A 4F5DA 5TE9A 3RRBA 1YHZA 3M5CA 2EVWX 4NIMA 3I4MG 2B4RO 1X7WA 1JWLA 3S2ZA 2RGBA 1NOJA 1VXRA 4QYWA 4ZP1A 3DONA 1DCFA 5CK4A 1WPQA 2ANCA 4FC7A 4LOIA 3TQFA 2WWRA 3KHLA 3SQOA 3U26A 3AHJA 1UBKS 2ZIFA 4CODB 3U4QA 1I7DA 1MZVA 1HQKA 4YRTA 3UQ8A 1TM5E 1O89A 1T36A 2I1WA 2I1VB 1JW9B 1B8OA 3CFYA 3G0CA 3QMPA 4YXWA 1J99A 2Q3FA 3F90A 4ZYWA 1P1KA 1LPPA 1JHRA 4EYHB 2DT8A 4DBLE 1KOFA 4GM0A 4R6XA 1J42A 4CV3A 2QM7A 4GSLA 2G1UA 1YHNA 5HM6A 3L8ZA 4EB0A 4B45A 5L95A 1UDWA 1QX4A 2NMVA 2WSSD 3UAVA 3F6RA 3GZJA 2LKDA 2QPLA 3KOZA 3ROEA 2YWCA 4B6QA 2AMYA 5JOQA 5BOSA 3GIPA 1SBQA 3WA6A 4C89A 2A7QA 3M49A 2DAAA 1VI2A 2WIBA 3TW0A 5KNBH 2NSLA 4Y6GB 1AA6A 3IP3A 2OCIA 2YIJA 1KVUA 3KR1A 4TL8A 4Z49A 4Q8FA 1WR8A 2G6TA 4P6VF 1WMAA 5I8WA 3RSOA 2XKJE 2CMFA 2LTAA 4FWBA 1HUQA 2J5XA 3LPAA 1A9XA 1Q0SA 3WL4A 4IJUA 4TQGA 1ZP6A 3LQKA 2W83A 4X7MA 3IO3A 1QNFA 4ZTZB 1W8DA 3RS3A 4F4UA 2QTRA 3LQRA 4O2BB 3NU1A 1HE3A 1U0EA 1LEHA 1W73A 1LDGA 4HZUA 4MIOA 4I3GA 1A4XA 3L9XA 1L7PA 1PGNA 3UAWA 1B00A 2YYAA 5AM1A 4O3NA 3KLBA 5FADA 4Q43A 4PX5A 2O3SA 5JXIA 5T6MA 1IATA 3OZXA 4B7CA 2IUUA 4G0VA 3KJFA 3PWKA 4BQSA 2C97A 1JX6A 5G3ZA 3ML1A 3O8LA 3U49A 1A0GA 1WL8A 2ZWOA 5EUBA 3PX7A 4UHHA 1R8YA 3O8DA 5C1IA 3V7UA 3OCJA 5DMHA 4EDHA 4GMFA 4CTKA 1DMRA 1GKLA 1TECE 2Q3MA 1KUTA 3LXXA 5H59A 3FIJA 3LWNA 2ALJA 1EFRD 3AUYA 5C5CA 1P7PA 4URYR 4O7VA 1U04A 4P2GA 5LVAA 3E2PA 1U9YA 1K27A 3K05A 3RG8A 3T95A 1OW3B 3VR6A 4WNIA 3NRCA 4WFKA 1CNMA 5JAQA 4M8NE 4B4OA 2GCPA 3RVDA 5A03A 2GCGA 1XAGA 5FWAA 4CDRA 1N36B 2VF2A 3VJRA 1VCIA 1V3QE 1N3IA 2BZGA 2JA5A 2VXCA 4BZQA 1HNZH 1L4LA 4M60A 4B3XA 2RGYA 3GBSA 4UCSA 1NSTA 3A6PC 5F76A 5TQVA 1H2AS 2JZOA 4ZN6A 1YDEA 3N76A 5EFOA 3HDVA 3ZKWA 1L5ZA 1U8CB 4JQOA 3B6KA 1D4ZA 3HJCA 5I7EA 3HY3A 4ZEVA 3LLUA 2NTYC 2FWBA 4J0HA 3TOCA 2G4VA 2Q21A 2BBTA 1DKMA 1SK8A 4DR3B 2JBHA 4A73A 3BFJA 2X8LA 3EVFA 1M8GA 3JWIA 1J6UA 4AICA 3GA0A 4LFBB 1WUHS 3Q3JB 3I9LA 3OZFA 2JC3A 1GEEA 4I9UA 1T9GS 5TF0A 2B25A 4BMSA 4R0NA 2JFPA 3WMRA 4W1PA 4IQ0A 3SX0A 1G8PA 4ZO8A 3SXUB 1NJGA 5C35A 5IAJA 3C5CA 4CNQA 3DO5A 2WSLA 3T1NA 4RPLA 4IF4A 5HUHA 3A9TA 1NBMA 3TDKA 3IFSA 2H8GA 5JVDF 3UH0A 3FMPB 5BR4A 3B51X 1D9ZA 1IN5A 1R0CA 2GKSA 3F7OA 4NKRA 4CQLA 5J4LA 3LDHA 3U1VA 2X5RA 1NTRA 4YRRA 3PW4A 5I6DA 1RQNA 4FKZA 3UKJA 4CN9A 2PGDA 1NW8A 2W9BB 4G25A 2ZRQA 1KVQA 1BE1A 2UVPB 3L5KA 5LMCA 5EXSA 2ZITA 5GQSA 4G89A 3RHSA 3PFKA 4HYKA 2W8BA 4XYGA 4O1IA 2P0AA 4TL9A 5AOBA 5CDFE 2F2TA 1ZUD1 3D6FA 2AHOA 1ZUHA 1GTVA 4ECWA 5FLKA 1JX4A 3LX4A 1T6BY 2A1IA 4XJTA 2OVBA 5DTIA 4ALJA 4RB1A 2NIPA 2B94A 2Y76A 4HADA 3V8QA 4GZMA 4CVNA 1RABA 2YUIA 5TEWA 4MKGA 2BMWA 4JJ6A 4BRWA 4ZGBA 4U3JB 4I9GA 2UZAA 4RTQA 3JX9A 3CBGA 4YYZA 2BYTA 1WUTA 1VLHA 5CA0F 1EKFA 1C7EA 1RKUA 4BVHA 1J5EH 1N3BA 1LJUA 5GM1A 5CBPA 2HA7A 1Y0BA 3O3OB 4DLWA 1F2VA 1FVOA 3COYA 4DHEA 4BXOA 4YJKA 3WLJA 1KI8A 5FRDA 4UHKA 3BABA 2ZYWX 3AONB 3T9EA 4KXQA 3KG2A 3A9UA 3PNVA 3EAFA 5EKSA 1ODIA 1FFEA 1E2UA 3BILA 4AZSA 2Q4DA 2CE7A 4DZTA 3QWIA 1P4RA 4WN3A 4LJ6A 3UJ6A 1EX6A 2PHZA 1Y37A 5J5VA 1YIDA 3DEJA 3UWMA 1IEXA 3HBJA 3TZEA 1CP3A 1MQ8B 1OTHA 5FFNA 4YPOA 4MW1A 1IFXA 3BMQA 3NWPA 2Z95A 3MR6A 3IEVA 2XRMA 3J7TA 2B4AA 5BT8A 2EZTA 1IK4A 3WGGA 3A10A 3DLIA 2HUPA 3WBFA 1Z4QA 5B2FA 4M49A 3ULKA 4KIGA 2YRFA 4RPJA 3UPTA 5E1OA 1O94A 1JGTA 2OV1A 3QG1A 1XTVA 4G5QA 5BT9A 3MZ0A 3AU8A 1ZGHA 5CPFA 4GZ3A 2X3FA 3CPHA 2FHSA 2IDJA 3WIOA 3IXQA 2YQ5A 1ZESA 1BXRB 4F3CA 1PQUA 3FZYA 4J9LA 4PIPA 2E0IA 3KT8A 1N8KA 1LPSA 5CFMA 3PXAA 4QOIA 1OFUA 1B8UA 5GGYA 3VKUA 2I62A 4XWOA 3H04A 3OHAA 6ADHA 4D46A 1SEIA 2VO1A 1ILWA 4EFDA 4URXR 3TXYA 3QX9A 1G5IA 4YJDA 3TQQA 2W2MA 4M86A 3A11A 1V8FA 1T3SA 2EG9A 2VC2B 3H83A 5AW5A 2K6GA 5D5PA 3WLLA 4B6EA 4BB0A 3EVCA 4KVAA 3A14A 2DC1A 1KT8A 2F43A 3KK0A 1MN6A 1NUQA 1O57A 3M6UA 5LQMA 4DCNA 4LBWA 1H9BA 1LLUA 3JS5A 1XTIA 1VPLA 5K0EA 1MB3A 1ZRSA 3IGFA 1F5SA 3JZIA 3E15A 2BI4A 1UT6A 4MYSA 4RENA 2V9CA 2HN9A 4ZO6A 1DKRA 2AW3A 4BZXA 1WSWA 1GPNA 1Z7BA 2X76A 1N32B 2ECOA 1IMJA 2DTDA 2V9PA 1V3TA 4HAOA 2NADA 4YCBA 4UFNA 4DGSA 3HNPA 1Q2UA 3G8CA 1SZCA 4UNPA 5SY4A 5DTMA 5EL0A 3DPIA 3F8NA 1RXYA 1D2GA 1OZHA 4A7PA 1TCCA 2QGFA 3PUYA 3V8EA 4UMVA 4K0KH 2NO6A 3IN5A 4ZIRB 1E98A 5AKXA 2WT8A 3TZBA 3Q6MA 2DX7A 4QJ3A 1DX9A 5JROA 2GNPA 4DJTA 3COZA 3KKPA 3DO8A 1QQ5A 4XVRA 3FNRA 3TLJA 1TJPB 1QGDA 1JBEA 4TZTA 4P4LA 2EFCB 2Y4NA 1IXKA 4BB6A 2YWRA 2D1SA 1KDTA 1NJ5A 3TVDA 3KCQA 1OWTA 5IT9W 4BMOB 1COZA 4Q7JB 3SJCA 1KSFX 5LXTA 1JR3E 1TDJA 2LV8A 3WJAA 2Q0HA 4ER5A 3S29A 3SPXA 2GZHA 5D1NA 1J9ZA 5DNUA 3DULA 4B1FA 1TZ2A 2GPSA 4JOSA 4MWDA 1CY2A 4W5NA 4J4TA 3CHYA 1FB5A 3SX4A 4UD6A 5FR1A 1ZU5A 5I51A 1FS5A 3ZDBA 5IYZF 2YHSA 3PNLA 3NIFB 1PHPA 4CCAA 3HKCA 4DUYH 1O9HA 3MYYA 1QOZA 3I9NA 5EMMA 3RJZA 4DWJA 2W6CX 2QUHA 4UBNA 1JVBA 3R6TA 1GGHA 3EOZA 4AJ4A 2IYOA 5A0TA 1RXUA 3FLMA 4JWKA 4NZYA 4N6GA 4F9EA 1SRRA 4JLPA 1P2UA 4J29A 1JH8A 1QE0A 1P4HA 2XGMA 1SCDA 1R9GA 3FKSD 4LWOA 5CMLA 3VU9A 3LKBA 3HG7A 1ODLA 5HK8A 1E6KA 3MLBA 1FDUA 3F7MA 1PW7A 1GCGA 5C80A 2N1BA 2EIHA 5LP6A 5IJWA 2CJPA 4RMGA 1YVRA 4C7VA 2R25B 2Y8EA 2BLLA 3SK0A 4RCZA 2N9UA 3EVNA 3E3LA 4JFAA 2Q62A 4BP8A 3SWWA 4QXQA 4DZZA 3SR3A 1ZK1A 1I3OA 1JS1X 3OFJA 5DPMA 2SICE 4GLJA 3WQHA 4WXPA 4KR6A 4MTEA 3RCBA 2YV1A 5DXJA 2QP9X 1HDYA 3B2EA 5B5SA 2RIPA 2BL4A 4YRGA 4A4DA 1TAEA 1TJ5A 3PDIB 3Q8MA 3WGKA 3LYUA 4B6SA 4YMWA 5CEFA 5AJYA 3UAYA 3I9JA 1II8B 3Q3CA 4P7BA 2EFYA 3GRFA 5K3OA 5JV5A 3FR8A 4GP7A 2ZZMA 3EPHA 4LSZA 4D3XA 1IBLH 3VZDA 4RNNA 5DX8A 1CY8A 2Y05A 4E14A 1DFIA 2EATA 5JD5A 3FMOB 3MR2A 3VTFA 3NZEA 1ZK3A 3LKZA 5WRFA 4Y8VB 3VQTA 2H51A 5CBKA 5BUQA 3NAMA 3NMUF 1T8RA 1DIRA 2JAQA 2RKBA 2REOA 4NCKA 2WZBA 1S10A 2WTFA 4Y1RB 2ZAOA 3CY6A 5F2KA 1MDFA 4A3BG 1OT3A 1S4MA 2HOQA 3HCDA 1FFWA 1R74A 4F93B 4ZFNA 3RAEC 5B3JA 1GSIA 3A58B 2VHXA 4DR4H 1NATA 4HRAA 3FDFA 4NCBA 2GF0A 4PR3A 1N7GA 3OCYA 1VCNA 2HRCA 3TQOA 4UFZA 3W3AA 3U1TA 1DT3A 2YCBA 2J5QA 2YKGA 4F4JA 3RUDA 3OUUA 4L8YA 4UW9A 1RBQA 3HU5A 5KJ6A 5LBTA 1KS9A 1TLLA 3DTVA 3C6KA 1U7TA 1K3UB 3S6JA 4PLGA 4QPDA 4MUYA 4RGYA 3GK3A 3HOXG 1RHRA 4GRIA 3WWOA 4EYQA 2O4CA 4X8MA 2C2YA 4Q7EA 5AW9A 2OGUA 5IG2A 3GQVA 5BR1A 4N8SA 3OQIA 1J5EB 1W46A 3EZYA 4LBYA 5EUQB 3T99A 1N5DA 5FH9A 3IUJA 1IBKH 1OXXK 4PR0A 2VJBA 3L1VA 5L1JA 1GZDA 5F33A 3NBKA 1FP4B 5FR2A 3SC6A 1XRRA 3GB9A 5TF4A 2GNOA 2OYCA 1NM5C 2PQ0A 2MSNA 2HV9A 2G5PA 1VJDA 1T9KA 1JPNA 2UZ1B 3W5BA 1ZG3A 4IRMA 1SC1A 3RS5A 1IXRC 3MJ4A 3TBHA 1KBZA 2P6PA 1T4BA 5K8JB 2JAWA 3IQZA 2PPVA 2N1MA 2Q5OA 3ENNA 3IKMB 4E5KA 3BTOA 3CUUA 1R8SA 1RM4A 3L7JA 2WILA 5JIBA 3WL6A 2B2XA 2A30A 2Y9MB 4GR4A 5K5EA 2F7SA 1CQPA 3A1CA 3IB3A 3BDAA 2BGLA 1U4NA 4MUKA 2QZ4A 5CM2Z 2LUOA 1IRIA 1QG0A 4EKNB 4DLBA 4PRZA 1K9SA 3OEEA 4CQMB 2FVXA 4XGIA 3KAPA 4NWIA 4KOEC 4TVOA 1U8TA 3MBKA 4JB8A 3KZKA 3W78A 2QVGA 2V1XA 3ZJ5A 5DHRA 3N0RA 1XZCA 2CFSA 2BQ3A 5ELXA 5HRUA 4PN7A 2EJ3A 5C4XG 1NV9A 5CG2A 4J0JA 4R2WA 3ZHOA 3RODA 1KMQA 4JIGA 1UBMS 4AP9A 5AVTA 3UNXA 1MC5A 1ZW1A 1EVQA 4HDOB 1E1RA 3K9WA 1BIFA 4JYMA 4U6SA 1I30A 3ROTA 4G8JA 4BQPA 4CETA 2NZWA 4GZ6A 2ZXFA 1KXJA 4UU8A 3C4JA 3GYGA 4NJEA 3ODGA 4ZJPA 1A3CA 4OGKA 1KGSA 1N25A 2QD5A 4JA0A 1VE9A 1ZN9A 1QANA 4LJ4A 3I6IA 4LPKA 2OWDA 1GT6A 3AR8A 4UPDA 2PNJA 2W57A 2IE0A 4B6JA 2FSUA 2B92A 2WU4A 1AGNA 1H0RA 1IVNA 1HH4A 2EOAA 1MVNA 4S2EA 4ENTA 1NW7A 3P9XA 1P3JA 1VKHA 1OU4A 4JVLA 4P81A 4N7BA 3EIXA 3FRJA 1TD1A 5CVCA 2L69A 5KPDA 4IWXA 4PQGA 1P9OA 3I28A 1P3Y1 3DZGA 2QE7A 2EQ5A 2QRVB 5ALMA 3VMMA 3KZ1E 4YR3A 2VJMB 4LI0A 1QXSA 3BHMA 1T8YA 3NP9A 4XM0A 1BOFA 1ZDMA 4QARA 1YKSA 2ALZA 1NXPA 1UMDB 4K0KB 3GV0A 2NYVA 2BQUA 1OLUA 3QEJA 2TMKA 3O4HA 1ENPA 1QV6A 2XGQA 1A69A 2O2ZA 4TZ6A 2VPTA 4FDVA 3Q8KA 1NL3A 1TZKA 3KWFA 1ZHOA 4JP8A 1FLDA 2ATCA 4BVEA 3HVUA 3A6JA 1AT1A 3RAGA 4Q9LA 1CG6A 2QMZA 2Q1UA 5KDDA 1H93A 3D3NA 4HEA1 4ZMSA 4L02A 3C8ZA 3EA0A 3BMNA 1CQJB 1U31A 2NZYA 5C4IA 3O8CA 2AZDA 2F9LA 1H1LA 3B89A 3PVXA 2RGWA 1E1CB 1UM9A 4OYLA 4YUZA 3WK7A 3GUCA 9MHTA 1DAAA 4DILA 2W0MA 3ZE2B 2B21A 1BFUA 1E7QA 1ODTC 4DMLA 2VZ0A 1IE3A 4N03A 3A1VA 4DUYB 1ZINA 4LF9H 1NOKA 1FJXA 1JR3D 2J9YB 1HSZA 4H3HB 1Z37A 3PXEA 1Z07A 4ZAWA 1VZ3A 3UGJA 4DJEC 5L45A 1IZZA 2ONCA 3HJFA 1CRLA 3FDIA 5GJCA 4QC2A 5MGNA 4ESEA 4J6FA 4HQOA 2X8AA 3SVZA 1MFPA 1QIGA 3QY0A 1U0GA 4CEIB 3D5QA 4EYEA 5K3AA 5L4LA 1TK2A 2VQFH 2IS6A 1DCMA 1JXQA 4IIHA 3TCKA 2XF8A 4H3KB 2EJUA 2ZRAA 5KYNA 1VLJA 1EUYA 4X71A 1B3RA 4G1UC 4CZ2A 3HQ4O 1HI9A 3LUCA 3AVUA 1EVZA 4KB5A 4EHIA 2YZKA 5H1YA 1P7CA 2E18A 1EJ6A 3H5NA 3MINA 1I2CA 5D2CA 2ZIXA 3FMAA 3A1TA 5CRIA 2GO1A 2BIFA 2XIQA 4LHZA 4ZCTA 2OLJA 5EJ7A 1SBIA 5F4ZA 2Z98A 1QYVA 2O1XA 5FUXA 3D1VA 4JV0A 5EC8A 3AKEA 1WR2A 4POOA 3NLLA 1IBLB 3GG2A 5CGQB 3RK4A 1PJ8A 4MO2A 3NYWA 5L1KA 4C76A 2IIPA 3THXA 3EDOA 3TZHA 1L8OA 2CUTA 4IXDA 3IAHA 1KO8A 2AQHA 3NORA 2DWQA 1SIUA 4AMUA 4EHJA 3EGVA 2WRZA 2E87A 3DOUA 4PYKA 3DQQA 1UJMA 3AF1A 1QKKA 4LDRA 4TUYA 4K6FA 4DQDA 1EUCA 1I6LA 4DOMA 3UZBA 1TYCA 4I5FA 2R92G 4N0EA 4V2IA 1QQTA 2BR0A 1AUVA 2MIIA 4DR4B 1G3QA 4ZCLA 2TECE 3HDQA 3TBFA 1VLMA 2K5UA 4YQFA 4FYKA 1CS0B 1CUWA 2C29D 2JFHA 3BACA 2VUMG 5AH0A 4KQXA 1Y4DE 5D6NA 1KAMA 1JUDA 2KW5A 2Z30A 1L4HA 1OJ7A 4MTCA 4ZYTA 1FJ2A 5DIFA 2AG0A 4IICA 1RXIA 2BR4A 2VSYA 4ZREA 4MUFA 4Y2PA 3NKVA 3J7AK 1TAQA 3PC7A 1Z6QA 3DAYA 3FY4A 4NECA 3RREA 3JVEA 2ZRLA 3HDHA 1K6IA 2IZ6A 1VKRA 1QRSA 2FW7A 4G0QA 3RVRA 1NTOA 1JJVA 2FI1A 3WWZA 3EARA 1W1IA 4C78A 4CMJA 2A2ZA 2O0HA 2ACKA 3T3DA 4X1KA 1L1EA 4Z1OA 3AIOA 3M2TA 2IEIA 5KTSA 4DCCA 3FDXA 4YAGA 1I01A 1SUWA 1EEXB 3L6OO 1ZUWA 2PS3A 2JW5A 4FFRA 2P4QA 2F55A 5LDHA 3C3CA 2WJYA 4FIZA 3QW2A 1PEDA 4DDMA 3LPDA 4RJTA 1CUBA 3VU1A 4ECTA 1KRWA 3OIGA 2NZUG 5KFXA 3A7EA 5CX1A 2ZM5A 2JAHA 2W5UA 2CXPA 4HAZA 3KZVA 1HORA 4NBRA 4DPMA 3DWIA 5CEEA 1NUSA 4AP6A 2BCJQ 3RS2A 5E6SB 3RUPA 2HF2A 1NSYA 2BTQA 3JAMW 1NDQA 1E6WA 1LBTA 1KYWA 1LSUA 4PCVA 4N47A 3WIDA 1T5HX 3SQLA 3QWFA 4EB8A 5HKLA 1C8VB 1SGWA 2W71A 2GFHA 4EJSC 1YBHA 3RS0A 3H8VA 1FRNA 2FZGA 4UHFA 1YSCA 1M8PA 2HT1A 4H3VA 1YR2A 3OJFA 2R65A 2BCEA 1U28A 1P2DA 2HAEA 1B26A 2WTMA 1GKIA 3CX3A 1E7SA 4DL9A 4XM1A 1E61A 2CY0A 1YD7A 1S8FA 3ZU3A 2DWPA 1QQ7A 1YNOA 1N1EA 1EAYA 3CA8A 1C3OA 1AQJA 1G5PA 2ERCA 4Z9BA 2C7RA 2PLNA 2I9KA 1NNUA 4TV8F 2AR9A 3SC2A 3DL2A 2PRKA 1SKAA 1H4SA 3WRYC 3J80W 4XFJA 4WESA 5DLQC 1CZUA 3NAZA 1O0CA 5K0GA 2FWMX 2UKDA 3OZBA 4DLVA 1WO8A 2JGAA 1IN6A 3ROQA 4EJSB 1QYCA 1Y6FA 3IR5A 3WADA 1J5PA 2UYQA 3ZKAA 4B87A 3U5TA 4NAVA 3PC2A 1KDYA 4J1TA 3WYBA 1ULUA 5KINB 4L95C 1PRYA 3GW8A 1UKEA 3HLKA 2LW7A 3DXXA 2OFPA 1JZQA 4PVDA 4JNKA 1OYWA 2ZVJA 4C6TB 2NP6A 3VVMA 2VDMB 3HEMA 2ZR7A 1LNQA 4MS1B 1CB0A 3AUSA 1XZAA 1UOEA 2OCXA 1QGUB 2R11A 2GEKA 3R3ZA 5IKEA 1YCDA 4M7RA 3DDUA 4KI7A 4KW7A 1Z6YA 1S7GA 2AG5A 3MCWA 3H11A 1TFUA 1NV8A 1ULZA 1UPCA 3AEUB 3WDLA 3HA5A 4TTSA 3H2BA 1X92A 3K0FA 4GSKA 5FJJA 4GQAA 2Z3ZA 4K9LA 2J3JA 3AP3A 5CNKA 2EFJA 1T5LA 3QLTA 2O06A 3VR5D 1E64A 3SI7A 3R23A 1SVIA 1HE4A 5F2NA 1VYVA 1QB8A 1YQQA 1I6UA 1YB7A 1Q7RA 5EZYB 2BBOA 2ZT6A 4CMIA 3F0TA 5CCXA 4JJZA 3K5HA 1V45E 2IV2X 2WWIA 1I8TA 2O07A 1NBEA 4L74A 2I99A 3TB4A 3DMTA 4YDHB 1XRQA 4EBEA 5DNWA 1OH7A 5JASA 1FPQA 3VR4A 5K8UA 2VLBA 3GV5B 3EBPA 1K2VN 4CBVA 3F6CA 4MRNA 4C0HA 2I87A 3ENKA 2GQRA 5AI6A 4HAIA 8ABPA 1BH2A 1BYIA 4OQXA 4MJLA 2P9CA 4N8DA 1E3WB 4BX0A 3K70D 3F2IA 3T9AA 3TTVA 1M34E 2GLUA 1OYYA 3DL4A 2JBAA 3CRW1 5KOYA 4HS9A 1Q14A 1M8KA 3ZV7A 1N36H 2X5JO 1U7DA 3D6AA 4JYPA 1ADJA 5FBVB 4GKBA 3K6RA 2PKWA 1Y3IA 5AJTA 2W7OA 4E6NA 4R1UA 1HG1A 1LPOA 3R7AA 2VQFB 1DTWA 4I9HA 1RPNA 3FSGA 3KOUA 5FPQA 1KEKA 3GL9A 4ZRNA 1XDNA 1R9TA 5KDLA 4RPIA 5K1ZA 5LNK6 3JAWA 2ECPA 1KR5A 3GRCA 1QWOA 2CLEB 3K0CA 1SHJA 3T9BA 4EQZA 5BNFA 5KFBA 1L5KA 4DR3H 2YVAA 3ZXUB 4ZYZA 4P3OA 4A3MG 2B5OA 4RIEA 5DMXA 3E9RA 2KBEA 1RLUA 1PKEA 2WKSA 3DAFA 1ZH8A 3RUCA 1O8BA 3UCFA 3RPEA 5A7HA 3B6MA 3Q1LA 3AG6A 4JLMA 4LG1A 3ON5A 2QMQA 5IUKC 5TSDA 1G2PA 1VHJA 4MEBA 1HF3A 2KSQA 1MQ9A 2JIZD 1MRSA 1TW2A 4YR0A 4NFHA 3EF0A 3A3OA 3PQ7A 1WWKA 3TRJA 4LV8B 1RJDA 1M0TA 1FXWF 1S96A 3JQBA 4B2IA 4RSMA 1W85A 1TEVA 4P34A 4X0EA 2R7AA 3VZRA 2V7BA 1ZVQA 4Y6OA 3UGKA 4XX0B 3RKSA 1L7MA 1GNLA 2B36A 3QLUC 2J5RA 2R84A 4DV3B 1RTTA 1FXUA 1CBUA 3EFEA 1U8AA 1ZMOA 2Y1WA 1NJ6A 4J91A 2A3RA 4P3YA 1ESNA 4Z0PA 4LQCA 3WYAA 5DX1A 1GDHA 2QMEA 1KY3A 4QHSA 4XIIA 3LLVA 2TSYB 1JEQB 1T6YA 3THOA 2ASLA 2O23A 3PTZA 3HBFA 1SQFA 4FWIB 1QIMA 3CXUA 1RC8A 1ZW6A 4HHEA 3JALB 3JATB 5IK2D 3BGVA 5CFPA 5CUQA 2E9SA 3FNIA 4PX3A 1YGYA 4MO9A 4MGKR 2K7FA 3REQB 3QVGB 1GZ7A 3QEOA 3QU7A 5GIPE 3QPAA 1J4AA 5JQGA 4KQ2A 3ROGA 3AX6A 4P4NA 1PAUA 4FP9A 4UUMA 3H5RA 4E22A 4G1BA 4MWOA 3LULA 4LWPA 1YVPA 3AINA 3FTEA 1U2GC 1L4MA 2AEEA 3WV5A 3GVPA 1AD2A 2D5CA 1ZHSA 1YZKA 1U94A 2FRDA 1XTRA 3HCWA 2DHEA 4ME6A 2OYRA 1RI2A 3ZYZA 1Z5OA 4NL4H 4EJ0A 2DHCA 1J23A 3EH2A 4MRRA 2Y0CA 3QFHA 2YH2A 3LHFA 4YMHA 3IJEB 3U80A 1JKJA 1OREA 2K87A 1NY5A 1YCGA 1UP6A 4I9NA 1ZWKA 3T7EA 1Z6GA 4I8DA 3R7NA 2C4WA 4ENWA 3GVCA 3A6FA 3OU7A 3AYZB 4LVCA 3E5NA 3AHFA 4DMMA 4AWAA 5IWCA 4IG4A 3M9OB 2XQGA 4G5RA 3H1AA 3OQ1A 3LO5A 4FC6A 1KP2A 1HYQA 4RVFA 1ONBA 3MB5A 5AOCA 4L3OA 4Y1GA 4B3SH 1TWAA 3CNEA 2PH1A 2OGWA 1DXHA 2VYQA 1MUUA 1X80B 3NR2A 5EJIA 5I9BA 1DU4A 2CJWB 1XD8A 5DGAA 2FSPA 2ARKA 4MRSA 2YXEA 4WJKB 5JS2A 3M3HA 3G1WA 1EINA 2J09A 4A93G 1J90A 2D0PB 2Q5LA 3G9XA 1H2WA 3VUFA 5FOVA 3FJOA 1UKYA 3OM9A 4UHCA 2VTBA 3HCCA 4YP5A 3EY9A 1DC7A 1YJBA 1U0FA 4BQIA 3UAZA 4R7ZA 2XB8A 1Y98A 4IF6A 4I46A 2OCKA 2VK2A 4OO3A 3RWOA 2VHVA 3G0GA 1JFRA 4BP3A 5BV1A 5HBRA 3G6WA 1CR6A 1PWYE 1RJ9A 1ZD8A 5JC8A 2WW8A 4O7RA 1OUMA 1OASA 2RH5A 2P2GA 3NDRA 2DY1A 2FPOA 2X7XA 2VWGA 2M05A 1N6PA 3DOCA 4M88A 5D85A 3CKYA 4LSXA 4LE1A 4NATA 1OBVA 5KSWB 4TMVA 4HDQB 3U61B 1JNXX 2VRCA 3NT4A 2YYSA 1E9AA 3M6XA 2TMYA 4EF4A 2VHQA 2Q3JA 5E4FA 5L7WA 2NTEA 2PUWA 4PZLA 3V6HA 3RGWS 1NONA 1C3XA 1TW3A 3GTOA 4W1RA 1W1UA 5T3UA 2X4IA 3FOAA 2JJ1A 1TPYA 3NNNA 1WCIA 2OCYC 1FYXA 3T5MA 3KV3O 2ODTX 4Z0HO 2AJCA 1N2CA 4RJJA 3EK2A 2VJAA 5JPDA 2JA5G 4MQUA 5BSVA 1A3GA 5DG9A 3KPWA 5K0SA 4Z1MD 2G1PA 1N32H 1T3GA 1YRAA 4NYIR 2P2LA 2RJ3A 2G8LA 3DR3A 3W79A 1DAFA 3LFHA 1LNZA 3IKTA 2IYUA 3TAUA 4Y3UA 1CUCA 2J6HA 1ISMA 5EWJA 5DI3B 5HDQA 2BP7A 4IRDA 1KH3A 1ZYUA 3ZW8A 5KNDA 2QAGC 2PX2A 4M6WA 2IU3A 1HDOA 1OBOA 2AC2A 3VHXB 1RMYA 1EX9A 2ORIA 1DJQA 2ZTMA 2A1UA 4PYIA 4ZAVA 4B4KA 4BL5A 3IXMA 4CLDA 5FBKA 2DFLA 1J07A 1AKEA 2Q41A 3CRVA 1FDOA 6NULA 4F84A 1CVLA 5K4GA 1ML4A 5TV2A 4J9NA 1ITZA 3O8RA 5KWSA 5KG7A 3LAWA 3MFQA 4YS6A 4E3WA 4QNRA 4HV4A 4JB2A 2JGNA 1KPHA 4O33A 7AT1A 1H94A 5F4BA 2FE3A 1TCVA 3OZIA 3ZZNA 5E1MA 3CMCO 1G55A 4ZCIA 3IAEA 1BFDA 1PL8A 2QMYA 3RUEA 2VUGA 4Q7LA 3H75A 1T1JA 3K6SA 2Y1GA 2O48X 1GO2A 4J7XA 3K35A 3Q0TA 4UVIA 4LJYA 2HVQA 1PS0A 1DO2A 3ZLUA 2DQSA 1GZ6A 2QAGB 3CUTA 3PU6A 4JLJA 3LUFA 5AJVB 3O1JC 1JJ7A 4G1VA 2Z3VA 3AR9A 3UK2A 4RULA 5H4GA 1XPJA 4KZPA 2ZAYA 4RMNA 3OO0A 4TWJA 1DUVG 2IU4A 3QYPA 4ND8A 4JY7A 4R3NA 4A9AA 1KL7A 1CFJA 5JVDA 3Q11A 4QPZA 1VGQA 2FFAA 4RB3C 5UKDA 3MPUA 5I4IA 3V4RA 4YUXA 3IMCA 4FILA 4MLPA 1QMGA 4UU1A 5FLEX 5CT4A 1JVNA 1JSXA 3UATA 4UAJA 2PJRA 2O3QA 1X94A 5I7FA 3FCOA 2XYGA 1C9MA 5JFGA 1SEPA 1QFZA 1XLWA 2OESA 2Q2OA 1VCHA 4CGZA 1DVRA 4DA4A 2JLAA 4NV3A 5HKOA 2WJHA 4CM3A 1EX7A 2MHCA 2G0AA 2M6LA 3LFTA 4MJXA 4C7JA 4OLAA 4JLWA 2BFFA 4FCCA 1U2DC 1W87A 4LE0A 2Z6UA 3OY7A 3FSEA 3N3BC 5EP4A 3TTYA 1Q2XA 2CLOB 1AN9A 5EDWA 3PQDA 3CEPB 1AQNA 5IT0A 2PS0A 8ADHA 2WTNA 2OHIA 3B1VA 4GOXA 3HABA 4TVIA 5IKXA 1XZDA 3KZXA 3IPLA 3AF2A 3WSTA 5AESA 4CQLB 1EGHA 4OHYA 5IJ9B 3VC3A 5DGHA 2FP3A 1IY1A 4Q1AA 4PZUA 1FYFA 1UBEA 3MELA 1FDWA 1WY5A 4RV9A 4BUZA 2H11A 4JSYA 3UICA 3M1YA 4Q5IA 4PRLA 5CA0A 3NYIA 1IH8A 2R8BA 1XU4A 4FHDA 1VIVA 3H8WA 2UVDA 3OQBA 2XUIA 4EUFA 5FD6A 4MW2A 2VT7A 2JGLA 3KUDA 1VL2A 3UYLA 4S1PA 2FMIA 3DE1X 1P1FA 3TMKA 2VAMA 3TL6A 3TY9A 5LLTA 4GXRA 2IHBA 1ZUIA 1Q7EA 3GNLA 1NY6A 1GZ5A 4ZT6A 3SZGA 1CKNA 4KRXA 1UT8A 4CIYA 4YALA 5F5LA 2R7ZG 2EJVA 5LOVF 4FS8A 3NI2A 2CW7A 1HT1E 1W44A 1W0JD 5AKIA 4CG2A 3LZCA 3TF5A 2V7UA 3X1XA 2A14A 5JZSA 3O3NB 1KMHB 5ECDA 2BFWA 4Y9DA 3DLPX 4YP7A 4MCHA 4MB2A 3D8TA 5CBPB 3SYKA 1L7BA 1C50A 4WOKA 3K4QA 2HR1A 5IDXA 1SHKA 2ZYTX 4DA8A 4BBRG 1V3VA 4PC6A 1M8FA 4P7JA 1KVRA 3WWJA 3OOYA 1AS3A 4DL3A 4JLUA 2WJJA 4RQUA 5I5TA 4MARA 3B78A 3IPCA 4DMUB 1TIPA 4HQLA 1A9TA 3ZJ4A 4TM7A 2PYDA 2HSWA 4O2AF 2JGDA 5DULA 1QTQA 2BM0A 1J1IA 4UTZA 3HGTA 3IV9A 1WSCA 3BMQB 1PSWA 3RGGA 4LUCA 1T3HA 3SHVA 1IXZA 1UC4B 5DW0A 2AS0A 3I76A 4X62H 4MQBA 1M10A 2ZR9A 2FSFA 3SQMA 1IZYA 1XDSA 1XRSB 5KJCA 3PC6A 4KO1S 1Q77A 4B3SB 1UWCA 2J0UB 2JA7A 4NE9A 2CW8A 2CCKA 1W4LA 1ZPDA 4XW2A 1M7JA 4HFMA 1O9BA 3IBCA 2H8KA 1NYRA 2V7EA 3K71B 3P4YA 1NXQA 3NHUA 4V0OA 4R7GA 1KKMA 4Z4HA 3QWUA 4B8YA 5BUSA 1SQ5A 2PRSA 1G4HA 3IJPA 4CKBA 4GC7A 3LPNA 4FEGA 1GZVA 2GVDC 1V7CA 1OZ0A 3R3VA 4G9BA 2N3ZA 1TNDA 1RI1A 2XTZA 1EK6A 5TVKA 4MP6A 2GO7A 5DGXA 3AI7A 2GJ9A 4HXEB 4WEQA 5AK0A 1AE1A 2B1QA 3HL0A 1X9IA 5IHXA 4MWGA 4HWSA 3WV4A 2VBCA 1SBYA 3LI2A 3VHQA 2RFLA 3DE7X 5F2EA 5BWWA 3PNOA 3ZBPA 1TWGA 3RC3A 4W5WA 1FTSA 3QFFA 2F43B 2I3GA 1M73E 3UTDA 3B9PA 2CYCA 3E5HA 4YLGA 2QG4A 5ALQA 4BFUA 3BKXA 2Q7DA 4JYBA 1WTAA 2QX4A 2V7WA 2ZIZA 2WYUA 4FJ0A 4NCJA 2AVNA 1KAHA 1Z88A 4A6EA 3P9CA 2AWNA 1UAAA 2ATVA 3MJSA 3E58A 4A8JC 3W4JA 1G8FA 5LIPA 1I2LA 2P8SA 4UJ5A 2Q07A 2FU5C 1I13A 1Z2NX 4G0OA 4FUTA 3GRZA 2A0KA 2CEKA 1BVYF 1C2YA 3WQSB 2SKCA 1OD6A 4PC3A 1JEOA 1M3SA 3LYAA 3EGDA 3G5AA 2HO4A 2WYHA 3LPCA 3IR6A 2ZRFA 1L9KA 2UUPA 4BGUA 1SXPA 4ZHQF 1O75A 1J0CA 1Z25A 4OHCA 4JLKA 4HUTA 1JHAA 3LQYA 5IYZA 2A9RA 5C3MA 4JJGA 3R44A 3WB0A 4JU9A 1JQJC 4RK5A 4BFSA 1MDBA 4YR7A 2PSFA 3GD5A 2HLDA 3M9NB 2DQZA 4APMA 3RT1A 3ITDA 4C0QC 2PGAA 4A3SA 4E1AA 1D7OA 3GLVA 2J0QA 3DEAA 4D3FA 1WEKA 3AJ8A 5DGTA 3LOUA 1WMEA 5F9HA 1X3SA 4TM8A 2YN0A 2P4HX 3HT5A 3GCGA 5L6MB 2RGEA 3DG9A 4A8JB 4PWQA 3WLSA 4MGHA 5LYJF 1JTFA 2CNUA 3KAJA 2VHCA 2C9DA 4L0MA 1MLDA 1CEQA 3AM5A 4NDZA 2AEFA 2P1ZA 5DHUA 2RJNA 1UKBA 2NT4A 2O8EB 2OFFA 1SKYE 4I9FA 3TTTA 3P52A 1N5MA 1PSDA 4PNEA 1ZUNB 3HKCB 2C3UA 5AUQA 2ID8A 4FYIA 3KDPA 4B6PA 3LT1A 4L1KA 4JBLA 1ZCAA 2D8MA 1ZRMA 2XUZA 1E2NA 2WU3A 1PW5A 1SM4A 2DBRA 1XD2A 3H7IA 1C80A 3P27A 2CCJA 3PW0A 2PJDA 2MOKA 4K46A 3VU9B 2UYOA 3PQFA 2ZJ6A 3TZKA 3Q9NA 4QXPA 4KK3A 2NU9B 2AXPA 1B76A 1Y6JA 4RAYA 2H52A 3KJQA 4KAFA 4M8LA 1GSAA 2ZTVA 3C6BA 2GYUA 3DOHA 3K8QA 3ZZTA 4TRRA 3I5UA 3FKIA 4XUGB 3VNUA 5EOVA 1GL9B 2AB0A 4FHCA 4QVKA 4L9RA 5BVHA 2RGGA 4AURA 2Y1OA 4LYHA 5B3JC 2B61A 2B2CA 2AR7A 3U39A 1B14A 4OU5A 2C83A 4HX9A 5B4TA 2QIPA 1P81A 2GAJA 3OIYA 1O97D 3PK0A 3FHTA 2WEKA 2PA3A 2BGMA 1GNQA 2R79A 2AOVA 2YWEA 3COJA 2RBKA 5BW5A 1U8ZA 1JIVA 3AKZA 2JGJA 2OEPA 4AVYA 4IKPA 1WP9A 4FZ5A 1SIBE 3GRRA 3CLUC 6YASA 5E7JA 1LQTA 2A92A 3SZMA 2OBXA 4NZ9A 3ACCA 3IAM6 1FS4A 4HQFA 3DWEX 2GJ4A 4TV9B 4REOA 2VHJA 5COBA 1FVIA 1SQ0A 4MWEA 2IHKA 4IVNA 1NC3A 2ZJZA 1WY7A 2Q5EA 1XT6A 1YI0A 1RYZA 3ELUA 1QTIA 4LY6A 1H22A 1LY1A 4EL5A 4DCTA 2HM7A 4QWDA 3MS2A 2P3OA 3PJDA 3DFMA 1C1DA 4OATA 3U4GA 1O5TA 2CNNA 2IEZA 2GZSA 3RB8A 2ZOSA 4R0VA 1M2HA 4AP5A 2GA8A 1IHDA 3ZN2A 4UZFA 2ZR0A 1GPLA 4O83A 1COWD 3KYDA 1F2DA 1CY4A 1Z6ZA 1OLXA 4WJZA 2FXIA 3PNQA 4HEQA 4IGFA 4WLFA 5JSYA 3LDFA 1HOTA 5IN4A 1KZYC 3GPBA 3H1TA 3HOVG 4IQ8A 5B7NA 1BGXT 1C9DB 5EN4A 3QVSA 3RWMB 4F2HA 5BWCA 2WV7A 1WB6A 3QUTA 1NQUA 3FGPA 3HPQA 1E3TA 2FW6A 3KTAA 4DG5A 4KEAA 5DXFA 4MQ4A 4Q9JA 1EFLA 5CR5A 3SNOA 3L4KA 3LUHA 3OA0A 3AW8A 1J8FA 4MRPA 3V7NA 5EHGA 4C4TA 4L8WB 1WKVA 3UGTA 1X39A 4LV6A 4P3KA 4QNMA 2JIDA 3GO4A 1VRVA 4X54A 3RBVA 3ANNA 4KLRA 2VBFA 5J5CA 4M3NA 1CXZA 2C2XA 4LZOA 2WA1A 3G7SA 1QYWA 4F1KA 4X62B 3ZE0B 4XCQA 3D4PA 2EW2A 3BL8A 4BX2A 5J4VA 3L4JA 1ADBA 4CL8A 3DFUA 1FUIA 4V39A 1GG2A 2A59A 4CC6A 5J3JA 4WXRA 4JYCA 1GNRA 2QRZA 1DAMA 2GN8A 4JAVC 2LDBA 2XIJA 3CH4B 1SELA 4IIVA 4O3SA 4BMYA 4D3ZA 4Q0MA 1MVOA 2V4MA 4KH0A 1QO0D 3NUQA 3CE9A 4KLNA 3N0WA 3ESRA 5TQJA 4HNVA 1GPKA 2HWKA 4DKJA 2DU8A 1XQWA 5EJ8A 4GIBA 2HF7A 3U7EB 2J3EA 1VRWA 2HH9A 2SBTA 4BNZA 3L7DA 3T0FA 4YAKA 1U0JA 2G77B 2WNSA 1DWQA 4DV7H 1KZHA 1F3LA 3L06A 4L8FA 1P0IA 1NRXA 2OD2A 3FCYA 1RAAA 5KFVA 2W58A 1EB9A 3LSTA 2GZRA 1XK6A 2QUAA 1NR5A 5K0CA 4YQZA 1EE2A 3ZWQA 3TRFA 4D99A 4FYYA 1Y7PA 2OCAA 1Z8NA 1BQEA 2RC5A 3GAMA 3O82A 3NRBA 1NUUA 2UZIR 4RB2C 4OHOA 4U7WA 5FTLA 4M0PA 2AW5A 2VRNA 2CT8A 4GH5A 2OBFA 2GF2A 3VZCA 4UARA 3G7UA 2QQ5A 4N39A 5TGDA 4ZYVA 2FDXA 2IYFA 3I9MA 1RAIA 1NVXQ 3USES 3S1AB 3RQSA 1Q3HA 2ZTHA 2Q6LA 1K1QA 3FBGA 3KBOA 1XRPA 3AUXA 2J85A 3BWMA 3SR0A 2YFQA 5KT6A 2DPYA 3VYSB 4BHTA 1RU3A 1E9SA 1YT5A 2CV2A 4PNHA 1D2AA 2OHOA 3KIPA 1DX4A 3ZHZA 1R4AA 2BFDA 2XWSA 2RDJA 4BQQA 4QWMA 4FTWA 5JJLA 2I4TA 3P2YA 4JUZA 4E09A 3OPYA 5IJXA 2RGNA 4JBGA 1D0SA 3DBRB 9ATCA 9ABPA 3LQ1A 4MTDA 1EAMA 3H9GA 5DYYA 4HMPA 2VHZA 1OLUB 1UZUA 4MW4A 4HJRA 2V4UA 4BNTA 1GPH1 1JZTA 1G19A 2ZULA 3W34A 2GZ3A 3QZ8A 4D4MA 2W2OA 3AERA 4B7XA 4BMPB 3M4YA 4R8MA 1F9AA 1QM5A 2ZYHA 4Q4JB 5FLXW 3MOIA 3VC1A 2WVAA 1GL3A 4EAQA 4HY3A 3RRXA 2PIAA 4DVGA 2H3HA 1L5YA 4ZU1X 2HU5A 4CM4A 3SHFA 3D0OA 4HYTA 4EKYA 5BV0A 1UP4A 4E88A 3R9XA 3WNBA 3SSAA 4FSXA 5LL6b 4X61A 4D4IA 3D2LA 4R2IA 3P45A 2H1WA 3VZQA 1H1LB 2PR7A 4ROTA 2WINI 2VCYA 2CKMA 1UWKA 3BF7A 3CF6R 4RD1A 2WWTA 1XQXA 2G5CA 4JUBA 3G88A 5DBHX 3HOYG 3MCVA 3JQGA 5EIXA 5A1TA 2H08A 2X7JA 1XHFA 1G6Q1 5THQA 2GX6A 3ILYA 3GAAA 1O6ZA 4FCTA 3PHJA 2DJ5A 3MD0A 1RWPA 2PMZE 3QF4A 1JU3A 1GQQA 3FFAA 1ECPA 1UR5A 3CINA 1DAPA 2PA0A 3WIUA 2ACWA 3C8MA 2VDUE 1PKXA 1V5FA 1RPZA 3JVUA 2DFDA 1SHZA 4E5YA 1OLSB 1IOLA 3HJAA 2QSZA 4FBLA 1T9AA 3UAGA 2DQKA 1G21B 1OXSC 1VP3A 2CLSA 4PCLA 3V9PA 3S40A 3AXTA 4RHXA 1TO6A 3V1MA 4RUAA 1NJ1A 5J9FA 3WLOA 5CA1F 1ODSA 3W7BA 1LTQA 4MZDA 3GF4A 4YJHA 3ROKA 3SVLA 2ERYA 3EZFA 5H70A 2C78A 2OLEA 2G04A 2JI8A 3TMAA 3P96A 3L4BC 1PVOA 2JA8G 4HN9A 4Q3NA 5DNDA 5EZSA 4JP3A 5BUCA 2FLKA 4MWZA 2ZIXB 3TW8A 1DJPA 1OHHA 1RP1A 1FNBA 2A78A 1EFDN 3HWSA 4G9GA 2VVTA 2VDVE 4J0IA 4R2HA 3ZK7A 1Z2OX 3UO8B 3IS3A 1EWTA 1MAAA 2QF7A 2X8WA 4MVJI 3UUEA 3D6VA 2R1VA 3CJRA 3F1LA 2JFOA 4F6LA 1JAHA 3H3XA 3O73A 4I1YA 3SJZA 5K3WA 3THRA 3PITA 3HUDA 1YQEA 4I3FA 1MW9X 4I50F 1W5AA 3BXFA 4HAUA 1ZM9A 5F7ZA 3L1JA 1EHYA 5JE8A 1KAEA 4E33A 3OCZA 1D4AA 1P3DA 2NVOA 4JN6B 1WDKA 5IXYA 3ZW7A 3PZPA 1HQCA 2XXBA 4GG1A 1DINA 2JIBA 3VO8A 4OMUA 4JX8A 1OYOA 1DB3A 5KS2A 3TOVA 4LYJA 4QBIA 2IIBA 1MF7A 4R4JA 5G1NA 4JDPA 3IC5A 3ROPA 2FSVC 4DV3H 1N0WA 2OXIA 4YP0A 4E12A 4BATA 4EZIA 3C1OA 3H2IA 3W06A 1PFVA 2H2HA 1JXAA 1CJUC 1JQBA 2PO5A 3O8OA 1UBCA 2V96A 4A3KG 3O9MA 2A1TR 5E9JA 4TLMB 5BWVA 2X41A 2GPAA 5GJVC 3LS2A 2GBLA 2PX6A 3SICE 1BMFD 3SQWA 5EI5A 1E9FA 3TNJA 2J48A 4X1KB 1ST3A 2Q99A 2EDCA 2GEDA 4ARBA 1U28C 1TK9A 4G1CA 1AK1A 1B8PA 4OSEA 3OIDA 5BW4A 1TCBA 1JALA 2PWPA 1I4WA 2D2XA 4HYQA 5CNMA 5CX1B 2G8NA 4TL7A 5CIYA 2O3UA 3QQMA 4EW3A 4WUVA 4JI8H 4P92A 3A27A 1DGSA 3KZNA 1DC3A 4JP5A 3QF7A 4TV8A 1IOZA 3GFFA 4INZA 1GO3E 3ABOB 5LQCA 1M2VA 3LOPA 2GRJA 3L46A 1U7HA 4LYYA 3TLKA 5IX8A 3BIOA 2JHCA 1FMLA 4MV6A 1F17A 4BGVA 4AROA 5TMBA 3FA2A 3QM1A 1ZH6A 2WSYB 5IT5A 5BP7A 4IZOA 1Q74A 3JASA 4HYYA 1G5FA 1G16A 3ZDQA 3I0ZA 3H5AA 3LX8A 3VJMA 2G70A 5FI3A 4DL5A 3VTAA 4IS3A 2WOOA 1V2HE 4JWTA 1C3OB 1XFAA 5HIKA 4UM9B 5E3IA 1ZH2A 4DV7B 2HMYB 4LCBA 2BSXA 3KR9A 1ESCA 1V2GA 4PS0A 5FEUA 4L6CA 4QOEA 4CLEA 2BSAA 1PT6A 2DH5A 1NWHA 1Z5VA 5FA6A 3B3QA 1UIRA 2Q1XA 3UA4A 2CEAA 1HT0A 4TT3D 1A5AB 3G49A 3OHBA 3KSMA 2FJZA 5BRAA 3P9NA 4FE2A 2JLCA 3IDAA 4RABA 2P30A 1PJAA 5EEHA 1V7QA 3ZD7A 4MWBA 4DY6A 2PYZA 3OMLA 2XUFA 2OBMA 2R3SA 4M0MA 1TX4B 1FDRA 3KQUA 3BTUA 1D1TA 3AH8A 1HEYA 3FPKA 3PWSA 5F7OA 4O3RA 2A4KA 1Z7EA 5JCJA 4LX8A 4OH1A 1UK8A 2ZSEA 4YAIA 1ISFA 4JODA 5ILGA 3IDQA 2NVXA 3DMTC 2VUSA 5AYVA 5CJPA 4BBAA 4TQUS 1KBOA 4FI3F 2F64A 5T14A 4IVRA 3UWOA 4RKFA 4IDBA 3PBKA 4LRUA 1ZL2A 2RHTA 3QZUA 4UAGA 3H11B 3DOIA 1TM3E 3T7TA 1R5NA 3K0FB 4FOLA 3CPEA 2UUBB 1FEZA 1X9NA 2ZE5A 1E4OA 1YFKA 2VZLA 5ALDA 3DD5A 3ZWAA 4TTJA 2EIYA 1VE7A 3PNBA 2HNKA 5LD2C 1GPWB 3IIJA 3HXQA 3C6YA 5FFFA 5BVGA 5T4BA 3E82A 1BRTA 3MS4A 2HHFA 3PDJA 5JBIA 2XE4A 4NONA 5I4BA 1M33A 3BWYA 4CMIB 1FS6A 4HAVA 4RFVA 1Z5PA 3IKVA 4G6ZA 1XZBA 4ZU3A 3FW1A 2QSUA 3N42B 4M83A 4QEKA 1O08A 3QH4A 4IXTA 5A4FS 1ZRHA 4C08A 4S24A 4XFKA 1E3MA 4J0EA 1Z2CA 4MV8A 4ZCRA 1EB8A 4KR3A 1YZYA 4DS3A 5DU2A 1N0HA 4ZYUA 1E77A 1ONSA 4XX1A 2PS9A 2BISA 2VP2A 3G2KA 3RAFC 1K06A 1FNCA 2HWYA 4ND6A 5TMEA 1T34A 3H1BA 1H8ED 2D5BA 3GJ3A 2PXAA 5BW6B 1S6YA 1ONNA 3WGOA 4L0CA 4XTCS 5DYTA 1SAYA 4YRZA 5LD2B 2Q5CA 2OSVA 3VR6H 1J0XO 2I76A 2JBAB 2HF8A 5I45A 4Z2AA 4D9CA 3AIMA 1WD5A 3JQ7A 4H77A 3K6JA 2IEBA 1K6EA 5BNZA 4IGAA 3RRYA 1GFWA 2KM1A 2Y77A 4CRWB 1XKTA 3IMKA 2IA5A 4MB6A 3D7SA 1LRLA 4R2JA 1JQDA 2O0JA 3CZ4A 2GBCA 1GUYA 4F50A 1JFFB 3K3PA 4RVSA 4M0LA 1JIIA 1FXWA 1H2XA 3OHPA 2HSJA 4AUMA 1SKBA 1Y63A 1FTQA 3O91A 3FNGA 3I1JA 1P75A 3DOJA 4GR9A 4MUMA 3LLSA 3AJEA 4MW6A 2ST1A 4JKYA 2OM6A 5JANA 3E27A 1T0HB 4HXYA 1YVEI 1A9PA 3RSZA 3OCVA 1MB4A 1KAOA 3W8NA 1Y4UA 3D2CA 4QU8A 1SXQA 1KA9H 4LN1A 2QNIA 5KUTA 2PT5A 4GX2A 5HFAA 4ONEA 5GY7A 4LGVA 2X5OA 3KB8A 3MJRA 1I7PA 5CAEA 4A0HA 2P77A 3PUIA 2C0QA 2BHSA 3UCEA 1SCNE 1HKUA 1BAPA 5K20A 2QU7A 3RTCA 1PF7E 4OI0A 3G1UA 3JCZA 1LBEA 2AVDA 4LJRA 3L82B 4H6WA 2Q3HA 4K8OA 4ZVSA 3DXYA 1Y3HA 2DQ4A 3ND8A 1HLGA 1QS0A 3ZU5A 2ZWPA 2NXWA 2OQ2A 4EEQA 3AVWA 1DIGA 4NRDA 3RTXA 3TNDA 2LIPA 3OZGA 4Y18A 1SVOA 1W6RA 3LXRA 1M1YA 4HH4A 4W6QA 5EYPA 5TGTA 4TSFA 3KSBC 1FF9A 1G20E 1JE0A 4F3RA 2FV8A 4EGJA 5IXSA 5DW3A 4CLHA 1CUHA 1NDUA 2XCSB 2LCFA 1O8CA 4Q02A 5ER9A 2C00A 3TVTA 1BDJA 1YE5A 5A62A 5JQGB 3BMCA 2YR0A 3E9MA 4L50A 2GJAA 4F4DA 1BE6A 2YNMC 1PFKA 4W5JA 2WOJA 3FG9A 3ZLVA 2F3UA 3AETA 3C6MA 1AZWA 4IKEA 5KG1A 2NUTA 1CY0A 3BG5A 2NT3A 4O08A 3D2BA 4P8RA 3I9OA 1V5WA 2Y93A 3SLRA 1XTQA 1DQZA 2LVBA 1D2MA 2R8GA 2GXAA 2GN0A 4EJ6A 3OZAA 2H2AA 1ZIOA 5KG5A 3KQOA 3R5SA 1WBDA 2BKVA 2PR2A 4RD0A 3MC1A 4Q15A 4LW8A 1NIPA 1YUBA 3WZ2A 3NHFA 4JI8B 2KBFA 4IIBA 2R9VA 3LTEA 2V6BA 4LTMA 3CZRA 3LCMA 5HF9A 4RZSA 2COEA 1NHGA 5BSHA 1HFEL 3DO6A 4EIWA 3ETJA 1PGQA 4OQQA 5ADUS 3UPUA 1KDPA 3DM5A 1UPTA 1FP6A 2I55A 1TC1A 3KSDO 1G2IA 3NOQA 2IXDA 1JJFA 3ZY6A 1TFRA 5CB4B 1JILA 3X43A 5ESDA 3HB4X 3CN9A 2JH3A 3HYNA 4ARUA 121PA 1NIJA 3EZGA 1T0JB 3L8GA 4HYEA 1VBFA 1Z12A 5TPZD 1U3VA 5E25A 2OD9A 4D4LA 1P61B 3CLKA 2QG9A 2VTBB 3HY4A 1NUTA 3DGEC 1X7WB 1E2LA 5DT9A 4JI2H 3WRWA 2W90A 4X6LA 4UBIA 4N0QA 1EXDA 2XCPA 1KYQA 1S0NA 1YK0A 4XM2A 2HIAA 3FNBA 5CFRA 4N5LA 1UKZA 4DRXA 3U4QB 3WICA 4TSKA 2VAXA 3H0KA 2L42A 1RJ9B 3L0OA 5GGXA 1XZPA 4WVLA 1NULA 4JC5A 4KH1A 3TH5A 1T36B 4N0DA 2JCBA 5YASA 4ZVOA 4HP8A 4QO7A 4DB4A 4MNTA 1PGOA 4ER7A 3EVTA 3KR0A 1CLUA 1E6EA 1E4FT 3EYWA 2CDRA 4UTNA 2Z04A 4ZT2A 1RXVA 3SS8A 3G2JA 4GGPA 3MRTA 4Z7NB 2IIVA 4IH1A 4YRNA 4AI6A 1QLWA 4KMOA 2W6MA 3ZIAA 4NXMH 2R2AA 3E8SA 1SVLA 3KB2A 4WERA 3T3NA 2EF1A 2ABWA 1D07A 3DD1A 4L6IA 1WCIB 2EJ0A 1JDZA 2Z6AA 5BOSB 3CZPA 3NIDB 3HZOA 4C88A 1AQ6A 5F21A 3MAAC 1VPTA 1QHHA 1TMYA 2QMHA 2WAQA 1YI1A 1Q16A 3EQ9A 1Z7GA 1R66A 1RE1A 2WSSA 1L2TA 3CH5A 3EMVA 3P0IA 1YU6A 3Q2OA 2MWMA 3PNPA 4F4FA 4M36A 1A9XB 2PGXA 1ZOOA 4RIHA 1J97A 1LDMA 3HV2A 3HY6A 4V0KA 4KHZA 4D0LB 2B8TA 1GN8A 1AHNA 1LC3A 1SD5A 2XKAA 3HFRA 3W5JA 3IEMA 4HZUB 5EGSA 4JBIA 1TZJA 4M6WB 3T9DA 1VHWA 3GFRA 4RXUA 3CVOA 3RBXA 1CY7A 3HP7A 1S9HA 2A1UB 3DYBA 3RD5A 4LF8H 1VE5A 4F8EA 4CC5A 3BRWD 2G63A 2HCBA 1W4ZA 2CLFB 1F8GA 5JJCA 2VF7A 3HNOA 3OFKA 1HYGA 3IRVA 5EKUA 4KG7A 3AOEA 1GD1O 2F9MA 8ATCA 1QGOA 2E89A 2XZPA 4PNZA 3V1KA 4EG1A 1QZUA 3J81k 4NOMA 5HGXA 2JEZA 2QW0X 3BHIA 5JO0A 1L3IA 1WNFA 2Z3WA 4GHWA 3CKLA 2DRIA 3ANXA 4XWGA 2PS1A 1N0UA 4BFVA 5F78A 4B6FA 1QHGA 3ISJA 5FIUA 3O75A 2BFPA 3FCEA 2FPKA 4EEXA 4Y6PA 1QF6A 4AZ0A 5LZ5A 2PGJA 2Q1YA 1L7DA 4MUBA 3PXCX 1CEXA 1UAGA 1WVIA 3PPYA 4ND8B 3KU1A 5EHZA 3PNKA 3IEIA 2PO7A 3LT0A 3PCXA 3VDNB 4DA7A 3WSWA 1TCAA 1R64A 2HPZA 3ZKWB 1QK4A 4JBXA 1ZK0A 2FMAA 3T4XA 4D5GA 2GA9A 3L7OA 4ILEA 5LLSA 4V38A 5CW1A 1E4EA 1UXIA 1F6DA 5FUYA 5EJEA 2CDCA 3DDCA 4N5NA 1RM3A 2ZFUA 3BJIC 1GUDA 1MX5A 2I7CA 3ENWA 2XUAA 1T3TA 5I3ZA 1VL6A 1NVGA 1X14A 1M83A 3CLTD 2ZANA 2H5EA 2BFFB 1WVGA 4CIVA 3RYHA 3H4IA 5ESRA 4B2YA 2FN8A 3ES9A 3R1IA 1S03G 4YP9A 1PZXA 2OKGA 3FDSA 3BA8A 1NW3A 2FLVA 2EC5A 3ZEIA 4RPGA 2AN3A 2H63A 3SZ3A 3JR3A 3URKA 3O5AA 2FW0A 3P32A 2P78A 2DH6A 1TUIA 5LOVA 1SZDA 3R3SA 2Y0PA 5TARA 3CUKA 2WR8A 3UMCA 1EGVB 3F3MA 4LSAA 4HVCA 1BKSB 1P4JA 4B8WA 2ZJ2A 5CA0B 3DZDA 3O26A 2PL9A 3BORA 4DNFA 1Q6ZA 1DWPA 3R9IA 2ZT8A 3HKZE 1ADCA 2IUYA 4UE3S 1NVAA 2GI4A 5AVZA 4OUDA 1NN0A 3NEPX 2G71A 3D8HA 1L3CA 5TRTA 1E4GT 2I2BA 5AVJA 4E1BA 1IN8A 5KFEA 4BWYA 3WZLA 3FUCA 4D8WA 4NK4A 2F8SA 2VNHA 3WRVA 4HGNA 4OFZA 3AHGA 3CISA 1PLKA 2VP0A 3BIXA 5JWHA 3KREA 4J03A 1USIA 4EH1A 2FEXA 4JOQA 2W43A 2IFTA 2W8BB 4FLFA 3BPSA 2CXTA 4RIGA 4RD6A 2OPHA 4O2AA 1ZITA 4X6UA 2EQAA 2QTWB 4MW0A 3W3AH 4B8ZA 5AK4A 4UM8B 5DM70 1GRVA 1T5BA 4LZAA 2N47A 2R8EA 3Q6IA 5FTJA 4ZO4A 4IV5A 1FNSA 1YDWA 2PEYA 1FFXA 3UB3A 4I19A 3DVQX 5A4MS 1V9SA 1R9NA 5JR3A 3HUTA 3KSUA 1TRHA 2H5JA 7MHTA 3JYHA 1NXTA 1L5HA 4DIEA 4R1MA 1B15A 2A9FA 3WYFA 2ZYUX 5AFSA 2B30A 1I33A 3R20A 1NASA 1TIKA 3DE6X 2BEKA 4TLBA 3V4LA 3GRYA 3VBCA 1O94C 2RHHA 5JWRA 3TZCA 4BXOB 3AP2A 1E2MA 2JGDB 1X87A 2ZGVA 5TEVA 1NE7A 4YMTA 1ULTA 4Q39A 2EX4A 1RRGA 3ZCPA 3TCXB 1B43A 4FBMA 4WXYB 3IQEA 2ZZKA 1C0EA 3ZJUA 2J6SA 2QUJA 5KJEA 1V8ZA 1L1RA 1ZEMA 2OGSA 2KMLA 5C0OE 4QZVA 5K3DA 3ZVLA 2CD7A 1XZGA 2ZIUB 3D6TB 2X86A 4WKOA 2HJWA 2WPDD 4BB9A 4Z5XA 2WJZB 3OPMA 3NTQA 3RB3A 5AVUA 4KPFC 4PGGA 3GPLA 4JI2B 5LUBA 2R4TA 1HNNA 2ODPA 1GYPA 3LPLA 1FVXA 3PQCA 2ZUUA 2BFNA 1C8LA 5E2AA 1TMGE 2SKEA 1PQ4A 3OOSA 1WUYA 3CZCA 1EUDA 4FR0A 3ZLBA 5JNLA 1K8ZB 221PA 3OP1A 2W48A 1E59A 3KHUA 5AHXA 3TOSA 1TI7A 3ZTTA 2IS2A 2JJ2A 1ZOSA 3SM3A 4OP1A 5AJUA 5KNCD 5CTAA 1MB2A 2WIAA 4ZHQA 1BYUA 1TTHA 4X41A 3L49A 1RYBA 3F6BX 1WMDA 3KUCA 2QN3A 1U65A 5A4AA 4TROA 3L7MA 3V1UA 2FEAA 1W0KA 3MUNA 2W37A 1FPMA 1BE8A 3DFIA 1L5FA 3WIVA 1I6MA 4HDKA 4NXMB 1DO8A 3RJMA 1I2AA 1SURA 1L4FA 4OK3A 3DDNA 2NPOA 1E4VA 2QRMA 3A9CA 4PWZA 4FS1A 5K99A 1LDNA 5I5EA 2R8KA 4GOLD 5LYJA 2G40A 5KVAA 4I6EA 1WXQA 3SD7A 2IY7A 2IYSA 3ZDRA 2DLNA 2V3VA 1YL7A 4DPKA 2J1LA 2J3KA 4X1OA 2ESRA 3EGDB 3TN7A 2E2IA 2UUAH 1S2IA 4AO6A 3M89A 1J25A 3QXCA 4ZTBA 1Y8AA 2ZBRA 4A2WA 1WKBA 3CB4A 5IYZB 4ZEMA 4UNSA 3QXSA 3MGKA 3V4SA 3LX5A 4GEKA 1M2JA 4C0XA 1FUKA 1RWBA 4LF8B 2PZFA 1E1LA 1HDXA 2X0IA 2IH5A 4RYLA 4OHUA 3OX1A 2JCVA 4Y1EA 4PYQA 3AUTA 1PN3A 1H2EA 4N6NA 4J0GA 3OIVA 3FKIG 2Q5QA 1R4ZA 1VBHA 5JNSA 3RVNA 5I9TA 1GNPA 5D6OA 2PD6A 1O95D 4ID9A 1U9CA 1CUZA 4JSRA 3OCWA 2ONZA 5H82A 2J4CA 4DIFA 3T34A 4X84A 3DAOA 5KFLA 5LXTB 2AR0A 3RSQA 2JAUA 3EDMA 4BE7B 1RAGA 3KDSE 3W8FA 4KXYA 1BX0A 5F9FA 3G9QA 3A9WA 5AJXA 5LP6C 1K08A 4CCYA 3IUNA 1VYHA 4EY5A 5AK3A 4TPKA 1QFYA 3CVJA 5BQPA 1OFVA 4FBTA 3ER9A 4K9RA 1L1QA 2C0PA 5FQOA 1O0BA 1N6NA 3DEZA 4MTLA 4TX1A 1Q7CA 4MV4A 1LA2A 4LPSA 3WB9A 1V47A 3UJNA 2DZDA 2XMGA 4DNXA 5E3JA 621PA 1UBFA 3KXIA 1GDTA 3DZHA 1UDCA 1YCFA 4HG2A 2JDID 3NEAA 2PSSA 4Q82A 3IDFA 4I1SA 2H3EA 2XPCA 2VNJA 4P82A 2QQGA 2RB4A 2ONYA 2BH2A 1CF4A 1WXGA 2B8WA 2J32A 3E3NA 1G98A 3Q7SA 4KX5A 4Q4HA 5A9SA 2J3QA 2DEUA 3VPSA 1OIVA 5KAMA 4K6CA 4M0EA 3WMGA 5LP6B 1MR3F 2H54A 3ZGVA 1FMFA 4TMXA 1R5BA 3E2IA 1Y8QA 1UQTA 3P26A 1G18A 3BC1A 3ILHA 2JAOA 4N3AA 4X65H 4BJHB 4XQ9A 2A9PA 5FBHA 1QGED 3RUFA 3BERA 3R3XA 1MAHA 1QP8A 4FYWA 4PQRA 4DPLA 1YVUA 1OMOA 4KHPB 3W5OA 2QM3A 3U7GA 3AF4A 1XWWA 1W5EA 4RZ2A 1ZLYA 3AY7A 3RASA 2PMFA 5A4DA 1WXEA 4B71A 3AYXB 4H7PA 1Y14B 1X77A 1N2XA 4O7LA 2B6HA 1LPNA 4FS3A 4RELA 5JUMA 4RH1A 3H2JA 4P9NA 1RQGA 2XYRA 3H4TA 4DTIA 4N8EA 2JF0A 1BA3A 2EARA 5U4XA 2ZJOA 4WNAA 1FFCA 2O7NA 2HIMA 3R0XA 2RAPA 1KOLA 4GO1A 3GT4A 3QEKA 4J0QA 4K1XA 1H42A 1HLPA 3AVVA 4GLBA 2H31A 4Z8XA 4RPCA 3E22A 5FOXA 4FFMA 4WK6A 2CWDA 1ZJ4A 1H5QA 4AS3A 1C1DB 1URPA 2ZS7A 5FUWA 3SI8A 2LDXA 3OWHA 3HLYA 2Q3CA 4QRIA 3MF4A 1GP2A 2Q45A 1XKXA 1M2FA 1S0UA 2I6FA 5I8PA 5L40A 1OLXB 2Q3LA 4R16A 2IYWA 1R4MA 4Z4FA 2GNAA 1R9MA 3NYRA 4GRDA 3AL3A 2IUFA 3E9NA 1QK5A 5H7XA 3KTDA 2BMAA 1PVVA 2RK3A 3PFFA 1EFTA 1YQGA 1XP5A 1SC4A 2QTVA 1TVEA 2PUTA 2NN3C 3L6DA 4Y6LA 4UCUA 3VNBA 5CDSA 2HMUA 3JQPA 3DTVB 1PZMA 3UXHA 1AMUA 4WKBA 4X24A 3FHOA 1FTNA 1E20A 2QJTA 3ZOZA 4AO7A 3KTAB 3A36A 1W1WA 2B9EA 5T4HA 3THWA 1ZN8A 4F3KA 3OQJA 2C4MA 4PONA 1NMYA 4DA9A 3JZFA 2EV9A 3EIQA 1V51A 1G8AA 3CJQA 3FNEA 1Z5GA 4DGQA 3OQIB 2XMDA 3WL5A 2TMDA 4AC9A 1FBNA 2B3DA 3BUSA 3I73A 1PJRA 3O47A 3MT9A 2H9YA 2P9TA 3HYRA 4Q1CA 3Q7IA 3LYLA 1GCIA 5CDFA 3SQDA 4A27A 1UFVA 1G0NA 1U99A 4GAEA 4UU0A 5C7LO 3LO8A 1EDZA 3A3NA 4D0SA 4N7RA 1NGSA 4X20A 4JC8A 1PQPA 4WY8A 2R7NA 1M2OA 2IYLD 3K16A 2XMBA 1GTJ1 5AVOA 1A8IA 1N2SA 5C8DA 2Z6QA 1DNPA 2YVKA 1PIWA 2F3PA 3ZWDA 2FUNB 4X63A 3ADPA 1CV2A 5KFTA 1DLIA 2F4NA 1WQ1R 4JB3A 3IPXA 1Z82A 3H5WA 3FMGA 3H2ZA 3FOZA 5JADA 1PR5A 3M9XA 1PE0A 2D5IA 1Z4MA 2O7RA 1EI9A 4WK0B 1RQ2A 1UMBA 3HLTA 4YAKB 3Q3IA 4PQEA 1EDEA 1P5JA 4FFLA 2YWHA 5BQ3A 2X8BA 2XNJA 2WJWA 3E7XA 4BWFB 1X0XA 4BNKA 3AQ4A 1Q0RA 2MINA 3F49S 2J08A 2CJXA 1JH9A 2RGNC 2EKZA 3MAGA 1FRVA 4BYGA 3KT3A 4P7GA 2X6QA 1GQFA 1Q0LA 4EHHA 3RUHA 4XGNA 3T7JA 1D03A 3C3EA 5AMXA 2RHGB 1N1GA 4XIJA 2N0SA 5B2ZA 1A5TA 4NJEB 4WL0A 3LOQA 2QYZA 1GN9A 2R5NA 4UCRA 4LOAA 3ZY5A 5HNKA 1JLKA 3DLCA 1F8YA 1KEEA 2ISCA 4LY9A 3IUBA 1N1MA 4EFMA 2VHTA 3EN0A 1T1EA 1S2MA 4BCBA 1ECLA 2WHQA 3P9ZA 4PM4A 1RACA 4DLUA 4RHEA 1J00A 5D87A 5JAZA 5B7QA 3SY8A 1Q44A 3RI3A 2GM3A 3VSAA 1B7GO 3QJGA 3UFXA 4KQIA 3M1LA 3JQAD 5A5FA 3MLAA 1LXCA 2UUAB 2ORYA 3E3MA 1OBHA 3H0EA 5F1YA 5IDQA 5A05A 1JLLA 3ITNA 4KAJA 2OXTA 1GGKA 3K1ZA 1OZAA 2J7PD 3A9SA 1P33A 1ZFNA 4O4HF 3RBEA 1YMVA 1E60A 3EZNA 3AERB 1EFKA 3OUZA 3BJRA 4TTPA 2YZ2A 2QE6A 1CJBA 5DB4A 4TLEA 5HMMA 5EE5B 1FJGH 2UUBH 3OEHD 4IRXA 3UMVA 1ZBQA 3R9XB 3ZK8A 2WIDA 4UOEA 1CNEA 5H8WA 4BV9A 1PQWA 1J09A 5EHNA 3KFVA 4ECYA 3KOMA 2XYHA 1X1DA 3BWXA 3EXHA 5E7IA 4XCVA 3BCUA 1L8LA 4NBLA 3U17A 4BO2A 4ZYYA 1CY1A 3JQGB 4N1AA 2DR0A 2HQOA 5CA1A 4F4XA 4X92A 2PWAA 2JASA 3MMNA 2Z5VA 3HFSA 1I2DA 2YC2C 3BMNB 1QC5A 4EGCB 1G9SA 1QPBA 5DRYA 2BM9A 3AJ9A 1KYTA 1OXVA 3VR4H 1UM9B 4QTZA 3AYHB 4FE3A 2P1RA 2BE9A 1PJCA 1SHUX 4OMCA 1JDVA 1MC4A 3O4VA 2AOXA 2IXGA 4GOJA 1ZXBA 2WAXA 3GFTA 4QSMA 2BHNA 2A5JA 1K7FB 2DSTA 2IZOA 1IIBA 1MTZA 2AMFA 2GPBA 3TM5A 5K8LA 4CE5A 4MS3A 2BSQA 1B42A 2Z2IA 3TTXA 3F4KA 1S3IA 3U3ZA 2RJOA 2FF5A 4YJHB 3WMXA 1JHVA 2YIDA 2LXNA 1JR3A 3TL3A 3UJ7A 3OZCA 3TZQA 1XN4A 2ZIAA 4I50A 1BZYA 3Q3GE 4YP3A 1Y1VA 1HEUA 3DHNA 2DF8A 2HHHH 5KYYA 5IAOA 4RK4A 2YQZA 4BAGA 1GVHA 3OFND 1HQDA 3H6HA 4N76A 1BOOA 3Q7TA 4HX2A 4X65B 3RIHA 3OECA 1XF9A 1KC1A 4LCJA 3L8EA 3QIAA 2ZRIA 2HV8A 3EOBI 3DKIA 4PVCA 3L0DA 2BVNA 3GMIA 2R1VB 4BUCA 4M0CA 1NR1A 2QEQA 4KWEA 2GYYA 2C5LA 3MINB 4YQYA 2GN2A 3MK31 4ODIA 2BGUA 3E7WA 4F7DA 3BQNB 3VV3A 2G36A 3OJEA 3RSCA 2XCIA 4N3NA 4TS4A 3FD8A 3K9HA 4ZANA 5J2TF 2C4HA 2DMRA 4URVR 4O3MA 1U0SY 1VKOA 5KTYA 5F7JA 4RL4A 2XVAA 3VKVA 5MN4A 2QX6A 2CXUA 4GBED 4QHYA 3I05A 1IHYA 2C8LA 2GBLC 4QTTB 1NRWA 2B35A 4XPZA 3UA3A 1JDJA 3THXB 3DHVA 2OUIA 2BEJA 3CB2A 5GPBA 1T2EA 1QYDA 4NTZA 4H6XA 5ELLA 1L7NA 1C0IA 2OC9A 4UTOA 3RRMA 1T8UA 4BX8A 3KWLA 5AUNB 4ZDWA 2JANA 5HE8A 5EINA 4TUYB 3HH8A 1JQKA 3TM4A 1EUCB 4M8SA 5MDHA 1SCAA 1M7BA 4IYJA 4J0DA 5HUJA 3ZDDA 1DEXA 4KQ6A 1IBRA 4KZKA 2YBDA 3QX3A 4FYVA 4KQGA 3KLNA 4Y9RA 1FSFA 1L7EA 3O8OB 5J1TB 3PTAA 2YHIA 5IC6A 1W5FA 3GOQA 2FR0A 1F7UA 3M5DA 3W5DA 1UOQA 4UAVA 5CVVA 2FFRA 4EY6A 3WGYA 3OTIA 1C9JA 4E31A 2AOTA 4YUAA 2OHFA 2XT9A 3VR3A 3U7IA 4K6GA 5KG0A 1C1XA 3QP9A 3WDSA 3RT9A 3UKDA 1W5SA 3D6UA 1YTLA 1QZ3A 2GN1A 3BIJA 5A6VA 1CUEA 4HPWA 2OP1A 3HA7A 4DRYA 4FZJA 4F4ZA 3IILA 2C9CA 3T15A 1USVA 4WWHA 2V6MA 1KBLA 3AB3A 4K28A 3AJDA 4GBGA 2C2EA 3K92A 3GDFA 2YHUA 1DELA 1M6YA 4IR1A 4EEZA 5G0TA 5F35A 4JJIA 5HILA 4LWQA 2G9VA 3P0EA 2O59A 3ORRA 1THGA 2ONJA 3W6OA 5CIQA