2XD4A

Nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
421
structure length
421
Chain Sequence
MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide-Bound Structures of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase
rcsb
source organism Bacillus subtilis
molecule tags Ligase
molecule keywords PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
total genus 114
structure length 421
sequence length 421
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2xd4A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2xd4A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xd4A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2xd4A04
3BSYA 2YZGA 1C3OA 4HNTA 2FPPB 5K2MA 4EA8A 4QSHA 1IOVA 2W6PA 2NUAB 2R7KA 2YS6A 4YB8B 3ETJA 1EUCB 3MWDA 2PN1A 2Z02A 1UC9A 1GLVA 4O2AF 5C1OA 5LA6F 1PX2A 2R87A 2I80A 2CZGA 1A9XA 2YRWA 2VPQA 1EHIA 4HR7A 4HNVA 3RV4A 4O4LF 3BFPA 4C5BA 1KJJA 3KALA 3KAJA 3U9TA 4O7RA 1CE8A 5KX5F 2W6MA 1GSOA 1AUXA 4YBZB 2Z04A 3R5FA 1OBDA 4XYLB 3Q2OA 4DLKA 1JKJB 3KAKA 3I12A 3N6RA 4O83A 2VHEA 3G8DA 2YS7A 5CB4F 2W71A 1DIKA 1KJQA 3MWEA 3OUUA 2HJWA 2W6OA 4O7VA 3U55A 2ZDGA 2IP4A 5JH7F 1UC8A 2I87A 2R86A 1OBGA 2SCUB 4MA0A 1M0WA 2W70A 5I47A 4O7WA 4IIJF 4XZ3B 4YAJB 3GIDA 3JZFA 3R23A 3NUAA 3BSSA 5C8YF 4MV7A 1KUTA 2WYOA 1VBHA 1Z2NX 3HO8A 3MJFA 4I55F 1B6SA 1GSHA 4O7YA 3TINA 3N8DA 3VOTA 4FGRA 3K3PA 4EG0A 2VQDA 4YJ2F 4IZOA 2FB9A 3V4ZA 3DF7A 4FFLA 4FFOA 3K5HA 4ZI7F 5HBRB 4HNUA 1AUVA 5GONF 3G8CA 3UFXB 5D8DA 4C5CA 2QK4A 2YRXA 3R5HA 3JZIA 2R7LA 1I7LA 1W93A 4MV9A 3AW8A 3JRXA 1JDEA 2XD4A 4O7TA 2NU7B 2NPOA 2J9GA 5C1PA 4M98A 3Q1KA 5CA0F 5LOVF 3OUZA 2R84A 4O7ZA 4EA7A 2CNQA 4TUYF 2W6NA 3RUPA 1KJ9A 3U54A 2YZLA 4ZHQF 4O4IF 4MAMA 2V59A 4IHJF 5LP6F 2NU8B 2GQSA 2PVPA 2FPGB 3HB9A 3E5NA 1VBGA 2YWVA 2FPIB 4ME6A 2GQRA 1KC7A 3BSWA 5JVLA 4FFPA 3R9RA 2ZDHA 4FU0A 5J2UF 2W6ZA 3KREA 2R7NA 1E4EA 4ZQIA 4WBNF 1KJIA 1M6VA 2R82A 4MV4A 4FFNA 3TW6A 1EYZA 4FFMA 1DV1A 4EABA 3BG5A 2HGSA 2QF7A 5LXTF 4M9UA 4IWYA 3WO1A 3ORQA 2NU6B 4E4TA 4I50F 1M0TA 1JDBB 3HBLA 1C30A 4MV1A 2YZNA 4O7SA 1ULZA 2ZDQA 4EGQA 2R6FA 4O2BF 1Z2PX 4Y8VB 3VPDA 5JVDF 1DV2A 3TIIA 3RV3A 2DZDA 2R7MA 3JRWA 4YAKB 2P0AA 3VPCA 1GGOA 3TIGA 4I4TF 1E4EB 5H80A 2YZMA 4ZOLF 1T36A 4DIMA 4NYEA 1B6RA 4O81A 5CA1F 3LP8A 2C00A 2CNVA 3LWBA 3WNZA 4EA9A 2GPWA 1KBLA 2FP4B 4M99A 1PK8A 2YW2A 2PBZA 3SE7A 1KEEA 1SCUB 3WO0A 4J6EA 4O7LA 4TV9F 2W6QA 5DMXA 2OLSA 2V5AA 2R85A 3VMMA 4GGMX 4MV8A 4XYMB 4IWXA 2X0SA 2YYAA 4MV6A 2GPSA 2DIKA 4O4HF 5JQWA 1EUDB 2VR1A 2DLNA 5FNVF 1BXRA 1VKZA 1EZ1A 2NU9B 4O86A 3ORRA 4O4JF 4WD3A 5LYJF 1CQJB 1W96A 1CQIB 2XCLA 2I8CA 4FE2A 4HQ6A 1WR2A 5CAEB 4RZQA 5BPFA 4M9CA 1GSAA 1Z2OX 5HV6A 2GLTA 2DWCA 4MV3A 5BMVF 4O84A 1IOWA 4FFRA 2CNUA 4O7NA 1A48A 4C5AA 4EGJA 5J2TF 3VA7A 1KJ8A 3AX6A 4L1KA 3GLKA 5KKNB 4YJ3F 4O82A 4TV8F 4EAAA 1I7NA 4XX0B 5IYZF 3K5IA 3QFFA 2CQYA 1JLLB 5EZYF 1BNCA 2YL2A 3RFCA 3U9SA 5BPHA 5JQGF 2V58A 3V4SA 1CS0A 3TQTA 3R5XA 4MA5A 3ETHA 3VPBA
chains in the Genus database with same CATH superfamily
3IBCA 4EO7A 3GTQA 3BHIA 2ZWIA 3K5PA 5TXGA 3J81W 3C0FB 4ZP1A 1A8HA 2UV8A 1IE3A 1NFFA 3AP2A 3F6PA 2FFJA 2PWAA 5IASA 5JISA 3WGLA 1XMOB 1K68A 4DV5H 4QVGA 2AJ8A 4DC9A 3OSUA 4LYGA 4C4XA 3SD7A 3T1VA 3VZBA 5IJWA 4CQMD 4P4TA 1J9ZA 1FSGA 2BFDA 2R92G 4OSEA 5AKHA 2EW8A 3T7IA 5HZKA 4UOZA 3GARA 5LQRA 1U3DA 4M49A 4R8UB 1AZLA 2B8NA 2OEPA 4D6PA 3QMVA 1JEQB 5LQAA 4AG3A 4HZUA 3PD0A 3R1IA 5FUYA 4TXNA 1A9OA 1AN0A 2EF1A 3EIHA 2W83A 3LC7O 5FI5A 4B31A 2XB6A 2EOAA 2EJ0A 4TQGA 4B4UA 4TT8A 1BJRE 2JH9A 1G6Q1 2QL7A 1QOQB 2CB9A 1L3BA 2NV2B 2C58A 4BO0A 4OY3A 4BBZA 2HA5A 4QWAA 3A1VA 1PX2A 1BYIA 3FFXA 2OECA 4IIYA 5JY1A 2D7JA 2IF0A 3SHWA 3W5UA 4K9SA 3AETB 2FGJA 2OAP1 4GLFA 1GPLA 3H4DA 3CH6A 4DNPA 1UT8A 2O3SA 4NX2A 4B47A 3PJRA 2JA6G 1VQ1A 1PWZA 1HE4A 3HOYG 1QKJA 3MQFA 2ASJA 1ADYA 1QFYA 2QZPA 4I6EA 4J0CA 4N5NA 4UKDA 5F35A 1YS7A 2MSWA 2C5FA 1I2KA 3DKPA 3H8VA 3OWXA 4TSRA 4UTOA 3FMOB 5DWQA 4A3IG 2XBUA 3N1UA 1V5EA 3ELYA 5KNLA 4WSOA 3O8QB 4UU0A 4KI7A 1TT7A 3EZ7A 3C85A 2BJVA 3M6UA 1EVLA 3DOJA 1RPNA 2OBBA 1OAKA 4MUYA 2BKUA 3EEQA 3TPCA 1OW3B 4MQBA 3EGEA 4ZT3A 1DAFA 1CJMA 4H6XA 3DO8A 4HYQA 4MQ5A 3ZQ4A 2CLDX 4YMHA 3SQXA 2F67A 1NPYA 4GLBA 4GMXA 2XYVA 4R3NA 4QL3A 5G0TA 2HRBA 4EMTA 2DPYA 4WCFC 1KJZA 4ZVKA 1WMBA 1IXZA 1LNZA 1KETA 2WKRA 4HX5A 5HGXA 5IBCA 5EIOA 1QFMA 5JAHA 2R2AA 3EW7A 4IRXA 3VRHA 2ZUCA 2BYTA 2W6MA 3HCRA 5K8JB 4GWKA 2UXBH 1XLWA 2FWBA 2PLWA 2V7QA 1DJOA 3JVVA 4GQBA 4RC9A 4F8YA 4JU8A 1DFIA 2FSSA 1NUPA 1V16B 5LMCA 3CTPA 3EA4A 3GR6A 4GC7A 3KZMA 2AN1A 2QRVA 4HLDA 4KXQA 5AK0A 2CJWB 4N47A 2NP7A 4EW1A 2OCLA 5IVIA 4KYVA 2ISSD 4WUTA 3WE7A 1VB3A 4FKBA 1U2PA 1USKA 4RCZA 1R6DA 3NFRA 4DN6A 3CT4A 2XUPA 3W1BA 3O1LA 4G97A 5B4TA 3NPMA 1BXGA 1Y14B 3LDGA 2G82A 3PUJA 5BQFA 2C2DA 1FZQA 4FX2A 3H13A 9ATCA 5DLDA 1HO3A 3DAOA 1HDZA 2WU1A 3KXDA 4LJSA 3D7LA 5DBGA 3UEOA 4AY6A 3P7MA 4UAVA 1AQUA 1EFPA 2R48A 4XUEA 4ZOEA 4K0KH 1G4AE 4MUGA 4XD7A 4CKCA 2XCAA 4FYKA 4EL5A 2LP4Y 4A03A 1DJQA 4RHEA 4V0QA 4L02A 2DPIA 3HVJA 5HIMA 2XZOA 2GETA 4O7VA 2ZDGA 1F0YA 1WEHA 3NOXA 4QOHA 2A58A 1HYGA 2V7XA 4RVSA 4RDXA 1ACJA 3E70C 3FWZA 4PG5A 1MBZA 4BWYA 2B2CA 5JAZA 5F3DA 2GSDA 1MENA 2QTRA 3PPVA 3P94A 4IGIA 3OZGA 1USWA 3DTYA 1INLA 3O0TA 3L7MA 2YV1A 4ZVUA 3F3SA 3G0CA 3DMPA 4E4RA 3N7AA 2NQTA 5TQJA 4IRMA 3IIMA 4PGFA 1EFUA 2F1JA 3RIXA 3GT0A 1XJQA 3BREA 1E3WA 3DDSA 3IO5A 5G3YA 3ZZNA 1Q83A 2CFIA 2F00A 4ZMRA 3UAOA 1MIHA 1CFZA 1YE3A 2CVPA 3D7NA 1JTEA 1N5JA 3JAWA 5GZ6A 3DKVA 4ARAA 3MBOA 3ZDCA 3H2ZA 2XSZD 1LXCA 4J2TA 1Z5PA 3E8XA 4PYLA 3CWZA 1H6DA 2WLSA 5D3QA 1E66A 1VIAA 1B3BA 4Y0AA 1J24A 4IR9A 2QTBA 4EG6A 5IN4A 4UEWA 1AV7A 4YQYA 3RKRA 1GM5A 1UXOA 4CKWB 2P40A 1PTJA 1Q1BA 1MAHA 1W29A 3ZGXA 1Z2NX 4BC0A 2DERA 1Y5LA 4NV3A 1GN9A 2D1YA 2FR1A 3F6CA 2AXQA 3CNQS 3K35A 2VBIA 3FFTA 4JLOA 3CS3A 4IGKA 2XITA 4KVAA 4I55F 1ZCBA 4L7VA 4OCZA 4P7FA 1I6UA 4F21A 4F93B 5DO9A 1ZP6A 1N78A 4EHDA 4MGHA 3Q7SA 3QKSA 3REFA 2C42A 2Q4TA 1IEXA 1R0ZA 3ZY2A 3O1IC 3VOTA 5JS2A 2ZBRA 1T29A 3BCUA 1DOZA 2CLIB 4R8SA 5F4BA 3RUDA 3RRYA 3HJRA 3ZGVA 3CONA 3FDFA 2COKA 2X4IA 3G5UA 4MIKA 2HHCA 1L5NA 3QVOA 2R8ZA 2OHOA 3C3WA 2WB2A 2F1IA 3STXA 1RWXA 1I7PA 3H1BA 1VL1A 1Z6QA 4KJZA 4IR7A 5J4LA 1H6CA 1K6MA 2XIGA 1AC5A 2BFFA 1WXXA 3AXSA 1T5DX 4RK1A 3BX1A 4GD3Q 5AIBA 3UMMA 3J7AC 3BMNB 4MOWA 4IV8A 4KV9A 4U2DA 3G6KA 2YC2C 1ZHSA 4P35A 3RYCA 2AEMA 2ECOA 3E48A 3NBQA 4NJMB 2R5WA 5DQGA 2H4JA 1NT2A 3K0KA 4LVUA 1TWFA 3SYLA 1P2FA 4YGXB 1CY7A 2QVXX 1WNFA 4HZIA 4QBFA 4RMJA 1L5QA 4TLAA 3T3GA 2VPWA 1FFSA 3WKEA 2ESRA 2OKCA 3NYWA 5JWRA 5LWHA 1KWKA 1X8LA 1RQLA 3G88A 2BVNA 2FMTA 2Z5LA 5CH8A 2CKZB 1JYFA 1M2GA 2GXSA 3FFBA 4JYCA 4E13A 3ETGA 1Y3AA 4I5IA 4DV3H 3UF0A 1PJLA 3ZE1B 5J5AA 3V7YA 3W8FA 5JU6A 4BKUA 4KQ6A 5KNBA 4I5EA 2HK6A 5DYIA 1FNMA 5M5BA 4OHCA 2E49A 1GZDA 5EGSA 4DL6A 1EUCA 3AUUA 2C88A 3HCPA 5DLGA 3MJRA 4YRJA 1ZM4A 3O8NA 1VYUA 5DISB 4G0NA 1GGMA 3LXUX 4UAUA 1YIDA 1T94A 1CUBA 1CUHA 3HYLA 4B4DA 5JH7A 2ASVA 3ZLJA 2NXCA 2YZLA 2EKZA 5GAJA 3VC3A 4CF5A 5FUWA 2CEKA 1O97D 3OQIB 4U7HA 3VBEA 3OZIA 2QRZA 2X4LA 2HMAA 1P19A 5COAA 4MAMA 4C6TB 5JEDA 3NDJA 3PPYA 1SA0A 2FWNA 1SCUA 3LGXA 4LOIA 3OJWA 1SUEA 4FMCF 1AKNA 1GTRA 3RRNA 1FFGA 1JHRA 1Z5UA 1X14A 1ZRSA 4BVAA 2DUWA 2BR3A 3D8UA 2P2ZA 3DDZX 3LT0A 4WNIA 3TL6A 4AYXA 1J4AA 3KB2A 1WABA 3PKJA 4KR3A 4DV2H 2Y1EA 4MVCA 1Q0RA 4F38A 9GPBA 4JKYA 5FLYA 4EDHA 3WLAA 4J16C 2ZGVA 4XFJA 4UCWA 1A5ZA 3N70A 2AQ8A 4W9MC 2MYPA 5KOIA 3GLGE 4PSUA 2Q2NA 4EYIB 1Z6GA 3HOXG 1MNQA 2FH5B 1QORA 3B6ZA 3FYUB 4GNKA 2IPAB 4KFCA 3HDHA 1DBWA 1LFAA 3AZOA 3FKSA 4DIEA 5CUQA 5LN1A 2M6KA 4FJ0A 3AEQB 1ZW1A 1VG1A 3IE2A 4YUVA 3KQVA 3L8MA 2CXXA 1U1DA 2Z9DA 4C03A 4YMVA 4KO1S 4UBLA 2K2WA 4NPAA 4KITB 3IB3A 1J0DA 4WFIA 3TJZA 4AC9A 3KQLA 1K7FB 2V7BA 2XXAA 4M1QA 1UZAA 3ROQA 1ZK1A 4KGDA 1XNQB 4P4GA 5CBKA 1DV1A 4Q8FA 2QY9A 4GQAA 4AF6A 1YI0A 1LSSA 3DL4A 5GTDA 3N2GB 2YFYA 4R5MA 1G4HA 1Z7EA 2QTTA 1X19A 4JV5H 2FPIA 2JANA 2YYZA 3NJ4A 3U4IA 4MYDA 3PQ4A 3DTVD 2V4ZA 2RGYA 4HQ0A 5HZHA 4ED6A 5I5UA 4E4TA 4LJKA 1ZONA 3WIDA 2GJAA 5LLSA 3TAXA 1M0TA 2DLDA 4CCSA 3BMOA 2WZCA 2AZMA 1ELOA 1C30A 3LPNA 5EIFA 2B5OA 2EF0A 4JT4A 2JG3A 4MIYA 2BRUC 4OPMA 3UO8B 5AVQA 5CAEA 1WE2A 2COIA 3ADPA 3NGXA 5KPJA 2AFIB 5DN9A 1SXPA 2PX6A 2BI7A 2UVPA 1HFEL 5TGZA 3IP5A 5AW4A 3VZCA 4RD0A 3U7QA 2HA3A 3F78A 2QX6A 4LZJA 2DZDA 5C0OE 4CI9A 1WSCA 1H1LA 4YIKA 1E3EA 1K89A 3B51X 2PD3A 1KI9A 2GN8A 1AKWA 3CF2A 3L6OO 4ZHQB 5CA1B 2RIPA 5IHXA 2VTVA 4JMLA 3Q3VA 4WBNA 1UP7A 3SEAA 3GJXB 1XLTA 4BFVA 5HOEA 4LF4B 2R6CA 4EI7A 2VZEA 5J3JA 3DVAB 5K0NA 3GV7B 3H4IA 3C6QA 3W4KA 4FK8A 2BKXA 3MTBA 1DC6A 1GKKA 3NTRA 4A73A 4C14A 1U7PA 1SZJG 1X8XA 1Q1QA 2Q9AA 3LP8A 1UK9A 1CZOA 1U9ZA 3A3NA 5DGAA 2X7HA 1UDRA 4C6SA 1MKYA 3G5TA 4DLRA 3DMDA 4IDQA 3QJGA 1L7EA 1F7UA 1U6KA 1EWRA 5B58C 1DO8A 2R8YA 3O8OA 1I4OA 2C57A 1GDTA 3WNZA 3BRCA 3I9LA 4JOQA 3L82B 2R8EA 4GM0A 3CB4A 5TY0A 3UM9A 5CG1A 1AG9A 3E9ZA 3R7NA 2FP4B 2PWZA 3RPEA 4GZ5A 1DWUA 3GF4A 4D3YA 2Z57A 1N36B 5H02A 4QO7A 5ALJA 3T41A 4W5TA 3OEEA 2XDQB 3SIXA 1H4QA 1SC9A 4P7GA 2IHKA 2A1UA 1UCFA 1KEEA 5DP2A 4J3JA 2WC1A 2BGMA 4EAQA 1C4KA 4TQUS 5F77A 3EFHA 2RK6A 5BVHA 3WMRA 4JOSA 4CEJA 5KT4A 1IY2A 1FQOA 1CWUA 1M6EX 2CXHA 3K73O 5T57A 2UYCA 3PQ6A 3JVDA 3VNQA 5LQDA 4K6HA 4PX9A 2V6FA 5EMLA 5AICA 4G37A 2VHQA 5DE3A 5BQPA 4ZA2A 5K8CA 4FEYA 2NVYA 4EH1A 3PF9A 1UJ5A 3GIWA 2HDKA 1IUOA 3RC7A 1BGVA 3VDRA 4CFSA 1Z37A 5JD6A 1TC2A 1RS0A 4B7ZA 4DR6B 1E3QA 4F1JA 1SUDA 4QBGB 3BTOA 1UFRA 1R8YA 3BHMA 2R65A 1KAHA 3AKCA 2IXTA 2FZ5A 3KYBA 3WKDA 1II8B 1PGNA 1S10A 4L0DA 1V1JA 3DHWC 1W0JA 2G25A 4KPGA 5FNVF 5KSWB 5EWJB 1S4QA 1C3JA 1VMKA 2QJWA 4RF5A 4O3RA 5K5EA 3E82A 5DSTA 3ER6A 3M33A 3X1WA 4XUDA 5IAAA 3R7LA 4CMDA 5K09A 2QYOA 4PIMA 2F8SA 4FJ1A 1KMHA 3CHYA 3DUFA 1KI2A 5K9ZA 1G8YA 5DBEX 1SVSA 3TY5A 1L7OA 1WR2A 1P6XA 2YYYA 4I1UA 4HATA 1JHZA 4NAUA 3KXPA 3L46A 2ZRQA 3DGFC 4FMCB 5BR4A 3RYCB 1Q0ZA 4IJ5A 4BY7G 1VKHA 2R751 1A8UA 2OT3B 2QTMA 2R96A 3DXZA 4FDLA 4RHCA 1EKXA 3TVYA 3V8BA 3PX3A 3H5IA 3GPLA 2C31A 4DSNA 4MV3A 1RACA 3QOYA 4RTOA 3ZYCA 4RAOA 2RGRA 4OK3A 5DNWA 4AMUA 1GZ5A 3QYFA 4X54A 2QV7A 3R9XB 1SVNA 3OBIA 4OLJA 5DNAA 4WE3A 3QU9A 2HRZA 1XPJA 3D64A 2V03A 3O4HA 1D6SA 1AGPA 3RBAA 5LDDC 5K0BA 1JEYA 1SBQA 4Q4DA 4TXLA 3VZSA 3DR5A 1SHLA 1QRRA 2GEDA 3EVAA 4KYIB 4RNDB 4F60A 1B8OA 3CPJB 3RGGA 2XB4A 4F3TA 2YVLA 2IYVA 2AG6A 3ECSA 3FOCA 1BE1A 3FG9A 4L28A 3G3EA 3PDIB 3OCZA 3UAVA 2UXCH 2QT0A 3KHSA 1IOZA 1E1RD 2A5DA 4HJXA 4Y7CA 4NBLA 3SIRA 4Q43A 3C1AA 4G0PA 4PGGA 2EP8A 2W2TA 4B6FA 2J4FA 1NLYA 2Q3MA 3DVLA 3H1TA 3PW7A 1DVRA 3NW9A 4RD3A 4BYMA 3RROA 3SOPA 2J3IA 4A5OA 4EAAA 1F12A 1I2MA 2AKYA 2AJLI 3IB6A 2P2SA 2YC4C 4ZYYA 1TE2A 1VHQA 2P1DA 3VH2A 4EX7A 5TPWB 4NFHA 3D5EA 2CQYA 1T2UA 4W8HA 3DWFA 4J9UE 4EW3A 2YL2A 4IVPA 5BVGA 2FPGA 5CLQA 2PR7A 1WSBA 4AECA 5C37A 4L75A 5E95A 2ATVA 1UPUA 3KSRA 4EA6A 3QKSB 1GZUA 1WSWA 3SS7X 4DBLC 3H7AA 4FGUA 3U49A 1TPZA 3G9QA 4MPJA 2HF9A 4ENTA 1UJ6A 4P5PA 1EFHA 2GH1A 3ITKA 3L6UA 3ROXA 3UOWA 1V5IA 4BCCA 3PDWA 4EYOA 1ZFNA 3OKAA 4MA5A 3EISA 3F47A 2YJ3A 3CCBA 4KIFA 3MRVA 4WV3A 3G6VA 5DGIA 3AHEA 1LVGA 3EXHA 3H17A 5E38A 4UXHA 4KXWA 4GKKH 3SZGA 1Z13A 2F3QA 2C9CA 2JK1A 3QBVA 1C1DA 5KG1A 3H0CA 4D8TA 2FPPB 3IXLA 2CY0A 1Y9EA 2REQB 2WIFA 2LZ0A 1E1DA 2QN6A 3QVSA 3LXXA 5EE1A 1LBHA 3W8EA 2JIZA 3RSSA 2FOLA 3O3CA 1QP0A 1QO9A 2VQEB 1ANKA 4F4UA 1XAGA 4IILA 1M2EA 3QUAA 3ZWXA 5LMZA 2C3YA 4DRXA 2EBFX 1M2JA 2BMWA 4R2IA 2MR5A 1ZH4A 4G26A 5EP3A 3WKAA 3ZNQA 2B7BA 3JZ6A 3LCCA 4JL6A 4TKUB 4Q44A 1XBTA 3EYWA 4JYAH 4BQFA 4HTFA 3GJ7A 4ZYXA 2C20A 1YS4A 3ACCA 5KT7A 3EIQA 2WAMA 1QC5B 3G8AA 5BNZA 5A4IS 4G25A 2NYAA 4ZV9A 1E2HA 5TARA 3OF3A 1P80A 3A31A 3WS7A 1XVTA 2DMRA 5CTAA 4BB0A 1Z5GA 4OXNA 4FGJA 5AW6A 1JG2A 2B98A 3WQHA 2IWHA 3WL8A 2G5GX 5I5EA 3AU8A 3IP1A 4XUCA 4GWGA 1OC4A 3AHIA 3BHNA 4KR7A 1XDZA 2VVTA 3GIMA 2PJZA 2Y99A 4G5OA 5FI3A 4F9FA 1EFVA 1X39A 8ATCA 2GPJA 1UKEA 1YZFA 1KBZA 5EI5A 1EHIA 3VOAA 4EJSC 5KFMA 2DSNA 2WM8A 1HI9A 1GU7A 4QJIA 4CM8A 3BMXA 3IDQA 1FBTA 1QB7A 2GT1A 2WPDD 3HNPA 3IHKA 2PKQO 2E21A 2MT9A 4URZR 4MWSA 1N3YA 5K8UA 4OJTA 4FM9A 5L9AA 2O2SA 4KU4A 4JI8H 1D6JA 3CMCO 5DJ5A 3NC0B 2XQIA 2ZIXB 5EZ6B 2QTFA 4RU1A 2H65A 3U1BA 3HOZG 2HMTA 3GH3A 2HMUA 1P2BA 5ALVA 1Y1SA 2PSFA 3NBYC 2C4TA 2COEA 1X9IA 2WVHA 4QAQA 5EQFA 1OV4A 4GOKA 2KLBA 4WHMA 4E5SA 4AURA 5JSYA 2AD5A 3A06A 4X24A 1NV9A 1V35A 3EDYA 4JI1B 2VFAA 4K1XA 4CJXA 1V16A 2KYRA 4ZOAA 4F7WA 2J7PD 3E7PA 2I6TA 2BMVA 5EUCA 2P9QA 1E3WB 1JQ3A 1DKMA 4DV1B 2CFCA 3BTUA 3N53A 1ZD4A 5EKDA 1Q3HA 2B9VA 3UJ7A 1C0LA 2GERA 4J1TC 5BR8H 1RJPA 2XIQA 3CRVA 5LIPA 2QUJA 2UUAH 1HEIA 4TMKA 3F8WA 3GT4A 1N2OA 3RSFA 3SZUA 3KKKA 5J1TB 4ZK2A 2V3CC 1UFOA 2F43A 3ZCTA 4F4HA 2VK8A 2ZI3A 3RAPR 1VJCA 3BGOS 2OQIA 2XUKA 1UMDA 3TLMA 4HDMA 1CC1S 3LNTA 1I6LA 1VPLA 4KMOA 1M9NA 2DOKA 2FZ4A 3IE0A 4W6QA 2AF3C 3PYXA 4KWIA 3PR4A 2MOKA 2WFZA 4L8GA 1LTQA 2I2AA 4MMXB 5FBQB 3O38A 1DEAA 2VPIA 3W5IA 5HX7A 4MWTA 3GXOA 2MCTA 3PE3A 3MWEA 2AG5A 4QDZA 3B6EA 3K0AA 5AXAA 2PJDA 4IYRA 1YONA 1AA6A 3OUUA 3CEHA 2QTVA 5LP6C 4U0JA 1R9MA 1NBMA 2VJMB 3JQAB 2QT9A 3MUFA 1UBLS 3IIJA 1L7NA 5LL6P 1BCSB 3PEWA 3H5RA 3RVKA 5A4MS 3OCYA 1TCAA 3U55A 2J09A 2PZ8A 3MRXA 4K5QA 2C7PA 4O3PA 2YHIA 3GRYA 1M2VB 2FXIA 4R1MA 3GILA 2I0FA 3V46A 2ZJYA 3MFHA 5L51A 4TKUA 1X1AA 3QWUA 4EFNA 4BBJA 1RJDA 3OEYA 1A5TA 4KQ9A 1V3QE 1KSJA 1T3TA 3FIJA 3IHWA 4PR3A 1Y5IA 3Q2KA 2XTAA 3I4LA 3VV2A 5TJHA 3WTCA 2O0MA 3BWYA 3TQ1A 2HJSA 4WN9B 3R7BA 3GIDA 5HF5A 1HE8B 3V4VB 3E6AA 4NICA 2CXOA 4CMJA 4NL4H 1YFJA 2R8IA 4GMDA 1N1DA 4FC7A 3QVUA 1XI2A 5KQMA 3MFYA 5HK8A 2H2WA 1D6MA 1F4PA 2CNWD 4DR7H 1EVJA 4PE5B 5EQJB 1H2XA 3VKFA 2EERA 4P4SB 2QAGB 4YV0A 2CN1A 3MMPA 4O4IB 2OHGA 2UUBH 1KUTA 3C3PA 2GCPA 2HLPA 3OFSA 2W37A 5K03A 2W2QA 5ENVA 5JYBA 1IMJA 4PNEA 3N9IA 4HWRA 2GZMA 1WLYA 1II8A 2NO1A 3H75A 2CT8A 2JIQA 4Q3NA 1IJBA 3TY9A 3L9WA 5L4NA 5FLXA 3GQBB 2FSPA 3EPJA 3TKYA 4W4TA 4JLMA 1WNTA 2EJWA 5HRCA 1MZPA 4B73A 3CM0A 2J4CA 1ZGCA 1ZVMA 1T0HB 3NDRA 1YR9A 3FKJA 4I8XA 3SJAA 4EJSB 2WTUA 2Y92A 2EKLA 4XR4A 4YRTA 2JEIA 2C2BA 5BW6B 4DWWA 5IDWA 4PVDA 4J9RA 3QTLA 2UXDH 1N5LA 7MDHA 2GKSA 4BLVA 1FFXA 4FBMA 4RLQA 4EG0A 3HJBA 4I8IA 3ZV3A 4V1CB 4D44A 1NJGA 4JJFA 5GONB 4TM8A 1P29A 4RIHA 2Z4RA 1ML4A 1KRHA 4ND4A 4X5OA 3M9OB 3A1EA 4LXQA 5DB4A 5A0VA 3F90A 2XDQA 4MPDA 1KIFA 1CG6A 4YREA 3RTEA 4N01A 1QHGA 4ESEA 3KJGA 3MLAA 4NEQA 1Q7EA 1E5XA 2J3DA 4RE6A 4FFLA 4N5MA 4PQRA 4QYMA 4X8HA 4DVGA 2I3AA 5IS2A 1WXEA 1XRPA 3KCQA 5SZHB 5FF9A 3QUQA 4TROA 3RJMA 3ZY5A 5IRCD 1T5BA 1DKOA 1E6EA 2OOSA 4BECA 4AO6A 3TZ6A 3D6MA 3IKJA 3MJHA 1AD2A 1KYTA 1EINA 1N3BA 2YRXA 1Z4QA 1T9DA 1HDYA 2FMKA 2GRUA 3QVWA 4NLLA 4Y9UA 5HGJA 1TLFA 4AW9A 1F6BA 2Z43A 4Q7MB 2VAXA 4MQFB 3GJ6A 3N2ZB 4DLYA 5DP1A 1BQ3A 1U1CA 3ZWYA 4QWEA 3WLLA 3IKTA 3HJGA 3JQFC 5L3SA 2FPWA 3NHLA 1IH8A 1B23P 4ND7A 2PHZA 4HXEB 4NOMA 4DWVA 5COQA 4CVNA 3VOBA 5THQA 1Y1VG 3JATA 4U0KA 1YNOA 1W4LA 5HE9A 1P9OA 2QUIA 1T4MA 3M9LA 3QWBA 1MW8X 3C6ZA 1QGYA 3V6JA 1C3OB 1ENOA 3OX4A 4GRAA 4I3FA 4LNUA 5SV2A 3DUFB 3KEGA 3LAWA 4BV9A 2ZSEA 4H7FA 2IYZA 1PCXA 2JFHA 2AWNA 1NLMA 4M0LA 1I2BA 4R68A 5E1OA 4B81A 4EY8A 1D1QA 2E6UX 4HAIA 4EQ5A 1NRIA 2V59A 1QHFA 3CZQA 3DEIA 4C87A 4EG3A 5A3RA 5CXQA 3NV7A 5F1KA 1XYVA 1GQFA 2BFBA 4N54A 1G20A 4L4ZA 4WZBB 1YGPA 3L04A 1GZ6A 2FEOA 4QWCA 3I4NG 1UP4A 3KD2A 2XMCA 3WB2A 3W6UA 2EBWA 1B00A 4YJFA 3EIFA 2COUA 4QUJA 1MB4A 1ZVJA 4OHBA 2VUGA 3IQIX 5IAOA 1GKUB 2FPIB 1PQYA 1QK4A 2I55A 3OM8A 4N82A 1YJ5A 1NUTA 2DF8A 4TKVB 3MYRA 5KCZA 2F48A 4S1TA 5FTKA 1G21B 2J41A 4ITUA 1J9EA 2J3LA 5CITA 4UHKA 1R9NA 2FUEA 5KTMA 1G8SA 5CT5A 5E3IA 2WJVA 4XDZA 1N6KA 1XQ9A 1P1FA 1LC3A 2AT1A 1TMGE 2KJQA 2XUIA 1SK8A 2E0IA 3EFOB 3GJ5A 3GMDA 1AGXA 3DV9A 3L1HA 4W7IA 4FOLA 4UDNA 5AJYA 1NVDA 4UUBA 4K9PA 2G83A 1Z6XA 2C1XA 3DBOB 3L1KA 2UYQA 4DMRA 3U56A 2CNOA 4ARVA 4POAA 4H27A 1J97A 4Y2UA 2BDTA 4YXWA 1ZMTA 2PQ2A 3OHMA 4AZ0B 4X65B 3V8RA 4BNXA 1XEAA 4V0ME 4MS4A 1GYRA 2GBGA 3DW3X 2PNJA 4QPDA 1TK2A 2VYQA 2FN3A 3EHEA 3OIFA 2R82A 1X1BA 2QX7A 4M86A 2OZPA 2WNIA 3MB8A 3OOSA 3QU4A 1JR2A 2O2CA 4GBJA 4H31A 3INRA 1G2QA 4M7PA 4JVNA 3ES9A 4FFMA 4MVJM 1SR8A 3HS3A 1ONPA 2WSBA 2QF7A 5F1PA 2E9SA 5KNBD 4H16A 1I1LA 4I4IA 4B35A 4EW6A 2J8ZA 2Y4NA 3BILA 3V8QA 3F6BX 3DE1X 1H2AS 1ZUNA 1XMPA 1ZHHA 2PK3A 1NQOA 1ODCA 2QI9C 5AESA 5KYWB 3UENA 1K5PA 1G64A 3K9CA 2YN2A 3OT4A 5KJ6A 3B2EA 5HJEA 3KJEA 4FFDA 1CUAA 3HBLA 1K4KA 2X0KA 3D2LA 3W8NA 1W25A 1AZSC 3HYCA 4PCVA 4EBDA 3GV5B 5AHRA 2ZTMA 3SQMA 1TAUA 2YYSA 2D06A 5AP9A 1E18A 1MTZA 3BACA 3DVAA 3JWIA 5JY6A 3KDPA 2B94A 4GSLA 3UUGA 3AVVA 3ELDA 4CM9D 3A6LA 2CKMA 3H9UA 4BBSG 2W8KA 1BE6A 4F50A 2GJKA 1WCIA 1WPGA 1X13A 2WP8J 3AEKA 2R7MA 3O92A 5ERGB 3NNDA 1YAHA 4RF4A 1JG3A 2VP2A 2X9VA 3TPFA 4F5YA 2P0AA 5IJXA 2OAEA 1C7FA 3EEFA 4PO3X 5JVDA 1JDNA 1P2VA 4IHJA 1QFXA 2GYUA 5H68A 3UWOA 4C7VA 4TXJA 3I1IA 4K6KA 4O25A 2YCLA 1FL9A 2W9AA 1LSUA 1PFUA 3LECA 4LDJA 4YCSA 4IRKA 2JLBA 2CWWA 4Y67A 5FO1A 4D4LA 1KK1A 1VYTA 2YXBA 1HV8A 3WYCA 4HPWA 2NTNA 2JD0A 3CO0S 2AN9A 3ZWDA 2G1UA 1WRVA 2ES4A 1EVZA 2XMBA 5AVJA 3WY9A 1W44A 2NLOA 4CRWB 4M60A 3RYIB 1X8KA 4AO7A 1HQCA 2AV6A 1GZ7A 3M8KA 1GFWA 3KKEA 5TS2A 4AY4A 4DILA 521PA 1XD2A 3GTPA 1GYPA 2AQHA 1D0IA 2JCXA 2ETXA 1Z56C 1C81A 1VSTA 2RGUA 2VRWA 2H1CA 1RXVA 1KO5A 4L51A 1ZESA 5I01A 5GQSA 4P7JA 3LX5A 1JKXA 3FMFA 3VC2A 3ETLA 4EHIA 2PL9A 4BBAA 2HQOA 4Q4JB 2BKVA 2NVUB 1YBFA 1Y34E 3A9TA 1OGJA 3DT6A 1AHNA 1H9BA 1RHUA 3MTQA 1PL7A 1XDWA 1UOQA 4HDQB 1ETHA 1Y8QB 5AJTA 5SY4A 2GYVA 2FAXA 4Z3KA 2IP1A 4YPVA 2ENWA 4AKSA 4Q4HA 5JDIA 2O2GA 3HSKA 2FZVA 3WGTA 4B33A 4IDAA 1TUBB 3OE7A 4EQ6A 2JCVA 2PRKA 2J67A 5A5FA 1Q6YA 1PUIA 3DYBA 3KLMX 1ZL2A 3ZVMA 3Q0IA 3AJEA 4NBWA 4NWIA 2ON6A 3JVIA 4NPCA 1RXIA 3TFQA 3DDUA 2E55A 2I78A 4J7CA 5HUHA 1TQ8A 3G2PA 3VX4A 3E23A 2XE8A 4RAYA 4GPZA 4XJXA 3PNVA 3OZBA 3UTCA 1KBOA 2ACKA 1RRPA 5JQWA 1JBKA 4HQKA 4FLMA 4QD3A 5J59A 5LOVB 3EC1A 2P7IA 1PFKA 4HGZA 3OLZA 3QXXA 3V2UA 1I6KA 1W2HA 4RK5A 5HUQA 5ICGA 1IWBB 1UKAA 3AUXA 1CKNA 3D0KA 4X95A 1ADBA 1O6GA 2QS9A 2YQ4A 3AF2A 4LK3A 2WTMA 4HNAB 4F1WA 2HV8A 2QJFA 4KXLA 3EVNA 1L7XA 2ZM6B 4P83A 2P9ZA 3NHRA 1GQ2A 2O1WA 1ISFA 1SHUX 4B7UA 5MGBA 4Z51A 1ZA1A 4JK3A 1L5RA 2E37A 2EHDA 1JHDA 1KR2A 3KNZA 3OPNA 4PZUA 2W2LA 4EEKA 4DREA 2ONKA 4DJ5X 2HREA 4B6SA 2WU3A 3UH1A 4O84A 4ZO6A 1FVIA 1H5NA 1NBHA 3B3JA 3QH4A 1GDHA 4HGOA 2JFNA 5EUQB 4J0IA 3WRYC 1NBIA 5K0EA 4HH0A 1KQGA 1IAVA 1ZETA 3NIFB 2HGXA 4N0MA 4DTCA 5B30A 2PH3A 1AUOA 1OUMA 1R1DA 3KR1A 4GC5A 4UOQA 3CZPA 1QO0A 1ZC3A 5DLYA 5FBLB 2WG1A 4EY5A 4D4HA 3DTVA 3AKDA 1TQ6A 3DWEX 3R0IA 5M04A 1U11A 2QEQA 3GLVA 2JPDA 3UT5B 3NM6B 4H35A 1IK4A 1LRJA 5FTNA 2W8BB 4PLVA 1RYRA 4PQFA 3S2SA 3AX6A 1OTYA 1DO2A 3E8MA 3X1ZA 1GOTA 4F04A 1CZUA 1TEXA 1G6HA 1M2OA 2CDNA 1WP9A 5IG2A 3GB8B 1F2TB 3HCBA 3AB7A 3AXTA 5C5CA 4QYIA 3RWOA 3MUNA 1WY7A 1SQFA 2IS6A 5JXIA 2N75A 4DADA 2XIJA 3GOHA 2JI7A 5DGTA 2PR2A 2H29A 1F2TA 4DV5B 1CSEE 2W9CB 1OT3A 1MT3A 1PT8A 1MW9X 2J3QA 4FT4A 4RTRA 5CVJA 1NHGA 1RYNA 4LGYA 4WZZA 1SC4A 2OBNA 1XOIA 4RNCA 1UT6A 3HXKA 4GVXA 4IVNA 5FXMA 5IAKA 4HH4A 1PYDA 3GBSA 5IJAA 1F48A 3A10A 3EZ6A 1OLXB 1VBNA 3L4KA 3E8SA 3SM9A 3ZGLA 4Q93A 3QJYA 4U2KA 4WJKB 3VNNA 1QDLB 2CNLA 3CX3A 4MWZA 3DTVB 4B9AA 4DCMA 4PR0A 1W36B 1U0OC 1J2RA 2CLSA 2HMWA 3QFRA 2GBCA 3ZDXB 3EZFA 3RYIA 4UBJA 2JJYA 3N86A 1AO3A 5E1DA 4QHTA 2AMFA 4EGSA 1DMSA 1NA5A 1Y80A 4YAGA 4MWEA 3HV0A 4FGLA 5KWJA 2ZTHA 2CXSA 4AY5A 1W4ZA 4B3RH 4K7JA 5CCXA 2FQYA 4JBHA 3CPEA 3W2TA 2PT6A 2PL3A 3EPIA 3TJMA 3ADBA 3L1VA 2ISQA 2OCKA 3QU5A 4R31A 3CURA 3UQ8A 4GKBA 4R9VA 3DE3X 2VC2B 3U6BA 2NUAB 1R4ZA 2AG0A 2JEGA 2JFPA 3HXLA 4JH0A 1MXHA 4GPD1 3IV6A 1N2GA 1HY3A 3EBOA 1A95A 4ZT4A 2G9NA 4A7PA 4BQPA 5AM4A 1EP2B 3OOJA 3UPUA 3M5DA 3ETJA 2H7YA 4WACA 4DR1H 3IOBA 1O97C 3DVQX 1JIUA 1V37A 1YUNA 3P2JA 4GX1A 1R6TA 1L5KA 4YIHA 4EYQA 1K0FA 3WTBA 2F8TA 4LJRA 2OV4A 3P5SA 3PGKA 4A2BA 1FA9A 4DLTA 1YF3A 2Q2OA 3ZWCA 1FSPA 4G1BA 4P3NA 1VI5A 1T9HA 5L7WA 3KTDA 3IAM6 1CETA 1J56A 2RB4A 3DMTA 4MI3A 4Z86A 2EVWX 3AB8A 4UFOA 1KVRA 5MN4A 1RLMA 3IUQA 4B44A 5AUOB 2OCGA 3KQHA 5KTPA 2R87A 2I80A 3AUKA 3KYCB 3N59A 1E9EA 3PN1A 2QPLA 3HRHA 4BO5A 4J75A 1L5SA 3FHLA 4JJKA 4TWZA 2VPQA 4PHTA 4BFYA 3GEHA 4HNVA 1SRRA 4ZAVA 1SJ9A 2D2EA 3K92A 1NMYA 5AVSA 4L6IA 2IPXA 3PHBE 2ZAYA 2O05A 3HVKA 4KDRA 3QPBA 5IXYA 2E85A 2OM6A 2VXOA 2NW6A 1Y6GA 3DDWA 1U7DA 1U9IA 2ABJA 1V6AA 3CH7A 3EB9A 3K0FA 2CHUA 3GFTA 4PAWA 3ORHA 3C74A 4M55A 3PUYA 1PL8A 4ARUA 3RB4A 4MUEA 1XCOA 1QH8B 1BW9B 1TUEA 3JALB 4MKZA 1LX7A 1M1YA 3F4KA 2AZXA 4ERNA 5L8VA 4MW4A 3PXAA 1LK7A 4FMPA 2BQ3A 4YJHA 4X85A 1TZBA 3CVZA 3L7CA 4TWBA 4H9GA 2YWCA 4QDXA 5SYAA 1PWYE 4N48A 5AMXA 2H1FA 3FYDA 1JHUA 3IMCA 3TMYA 4NDNE 1PLKA 3R5FA 4UM8B 4J9PA 1E8NA 2O4CA 3G49A 4U7JA 3RRZA 4FW9A 5BNTA 5GVSA 5HZMA 1RW4A 3ZK9A 2QP3A 1KGSA 3PFGA 5L6LB 4I9UA 3O26A 3JQDA 2PUCA 4CT5A 2HNAA 3OLWA 2AU0A 4ND8B 3ZCVA 3UOAB 5JROA 4R2WA 1R12A 3NB0A 1W5BA 4R7GA 3PJDA 2QXYA 2XQGA 4OHXA 1KJQA 4PGMA 4C0HA 3SI7A 5DLPA 3U5ZB 4W8GA 3SYNA 1PD0A 1T5LA 1YRWA 1XSEA 2MSCB 5HDBB 1A9XB 1FVFA 3R8XA 5A4FS 5KMGB 5FP0A 1TT5B 3IMEA 4LG1A 1HTWA 3MTJA 4RELA 3FI9A 4D9NA 2VUMG 3W9UA 4DL9A 2WSYB 4I81A 1G7TA 4UHJA 2R25B 3WLFA 4L5AA 1CVLA 2D1RA 1WETA 1ZY2A 5EVCA 1CDZA 2SCUB 1BO6A 1DKPA 1PJAA 3HPRA 3M1LA 4I4CA 4IV5A 1UDWA 2YH2A 3IEIA 1JEQA 3KU4A 4FPXA 4R16A 5B6JA 5JMOA 1JHXA 1GU1A 1DADA 1QQ6A 1X38A 2NN3C 3K7EA 1D1PA 2GKOA 4XCVA 1M6WA 2ZM5A 1X1CA 3NBZB 5EOYA 2IVFA 3RIGA 4CMAA 2WB1A 4HPXB 2JGKA 1M2KA 3JZFA 2NYUA 2AI2A 2V6BA 2I7CA 1TA8A 2V55B 2VHTA 4I7HA 4YRFA 1XUOA 4IH1A 1F2VA 4IICA 2O0HA 4QUEA 4U8HA 3SCZA 1OI2A 3A37A 3PFFA 2HA0A 2VDJA 3LCJA 4HQLA 2BGWA 2NVOA 3ABOB 2JB9A 4TL9A 2B63A 3QG1A 3DXFA 4EFEA 2P8JA 1PHRA 2B25A 1JTFA 3UZUA 2XQFA 4AN1A 4BQNA 5F23A 2PO7A 4JBWA 2M32A 3S70A 2I67A 3MR5A 1XZIA 2O3UA 1A04A 1JU4A 2H5JA 1A1VA 1OYWA 2HWXA 1FRVA 4RA6B 1NAIA 2EJVA 4YXFA 4B7CA 1ZNQO 5E1BA 3LUDA 1PZHA 3ER9A 1B6SA 4B1FA 4RIEA 5FWDA 1YR1A 2JCSA 4OB8A 5JD4A 4HSEA 3W6ZA 1NX9A 2GR9A 1XDUA 2XGQA 3OOWA 5KFTA 2NXEA 2YJTD 4F4YA 1G18A 4C06A 2XX3A 5BRNA 4YROA 2CVHA 2D2XA 2I1LA 2Q9CA 4LRSB 1IG0A 1GHTA 3K5WA 3KHKA 1QE3A 1YBVA 1G2WA 2JI6A 4EK9A 5ILOA 2VDOB 3RTCA 1WXIA 2WF8A 1PN3A 1XMSA 1NE7A 3BCHA 4L5IA 4FZ5A 3FDJA 4Q4AB 5HIJA 2HHFA 1NN1A 2AMJA 1EGHA 1Z7BA 3U1VA 4B0PA 4D9GA 3RVMA 4MR8B 4TV9A 4JV0A 2QD3A 1XCMA 3W3AH 3S8EA 2EP5A 3FJOA 4BPRA 5LBIA 3WWPA 3CKMA 1Q92A 1NW6A 3OP4A 3ROZA 3WOHA 3PX7A 2Q45A 4KGVA 4ECZA 1NW7A 2B7LA 1UZMA 3DOUA 1GPKA 1HE5A 3IQDB 5BSMA 2W7TA 4ECXA 1UINA 3IVMA 3NTOA 5AQ1A 5IF9A 3C87A 2QYHA 5HBRB 3VYUB 5HFJA 4N39A 4QHYA 3OIVA 3ILXA 2ZTSA 3HR7A 3B9PA 4YR3A 4D82A 3KBOA 1GO2A 3IEKA 1ONOA 2QX9A 3BQNB 1FPQA 4ATNA 3AUSA 2DBRA 4G4IA 2W48A 1O94D 1CZHA 3IT0A 5FA5A 4AS1A 4LMRA 4XLTA 5JS8A 5C2JB 3GLGA 2C2GA 3P19A 3QMMA 4PQYA 1THGA 4W5HA 5KNBH 2P9TA 5JDIC 5AO9A 1I24A 4JYZA 4ZCPA 4ZVSA 3OFND 1LDBA 3CVXA 2NU7B 1ECLA 1TM4E 2CNWA 2DWQA 4JGIA 4X66H 5EMMA 1YULA 1YKSA 4A0FA 1DIAA 4DANA 4PIVA 1M2VA 5KNDH 4HDSA 4A8TA 2XHEA 3ECAA 4WCFB 3G5AA 2EFCB 4BZQA 4C3VA 4C9BA 2ICAA 3WOVA 1JQ5A 4TUYF 1P4JA 1P7PA 3KETA 1KJ9A 2WFMA 1UBSB 4XLLA 1O8BA 2Q0XA 3EXHB 3VFDA 1JEAA 4YP5A 2OV2A 2II6A 3Q8KA 1G5FA 2XQJA 4EY4A 3GN1A 1PG5A 1H42A 3OOYA 5D5HA 2DR0A 2WYIA 2C7GA 3RD5A 4HFMA 4KE7A 2EEZA 3GI1A 1YGYA 1ZU4A 4RDIA 1GY8A 2VJBA 1CR0A 2Q49A 2QVGA 4QQFA 1CY0A 1C50A 1TJYA 2WK1A 3CF6R 3NM5A 3I37X 1TOAA 2BONA 2KB0A 4H4DA 1HLGA 5AD1A 3NWJA 5KYWA 1G6KA 1OWTA 2FPGB 2OBFA 2VNJA 4FLEA 1YZ3A 4J2HA 4GEGA 3I83A 4ZREA 3PUKA 2W42A 3Q8QB 3K70D 1P8JA 2XHZA 1OBFO 2RSLA 1E58A 1BE8A 1Z29A 4HVTA 1RSZA 1RI2A 2BEVB 2GQRA 2CW5A 3BSWA 3PCXA 4OX9H 2Y9MB 1KO7A 2DXIA 1X94A 4TVSA 4GYYA 4EI2A 4DAEA 1FMJA 1BVUA 1NVMB 4Q00A 4ACBA 3HU5A 3ZHSA 4N7BA 1RVV1 3VHRA 2IDZA 1ADCA 2EZ9A 3I6QA 3ISJA 3K15A 4M1ZA 4U3JA 3R24A 5ALXA 1BGWA 5LNK6 4R40A 3FMGA 1JXAA 1KNQA 1VI2A 2P6RA 3GJ0A 3KHRA 1L9XA 1NQ5A 1M6VA 1RJ9A 2FG5A 2QZ9A 1VG9B 3D6JA 3FNEA 4RPHA 2AC7A 1U4NA 4EY7A 1A50B 5AVTA 3AUAA 3TRHA 4OH7A 3TLYA 1W46A 2X0EA 1JDTA 5EIAA 2GEFA 2ZITA 1EE9A 4E0BA 5HMMA 1FSFA 4QGAA 5FJIA 2D5IA 1RT9A 3I3SR 1XHEA 1KVTA 1Z62A 5AM0A 3GPIA 3WBKA 3LDHA 3QF4B 4LC9A 1MAUA 3GK3A 4WFJA 4XFKA 1V2GA 4OJNA 4MCIA 3IUNA 4MKXA 1VPWA 3GGCA 1NDUA 4MR7B 1CF9A 4X94A 1SOAA 2UUOA 2XRZA 5IT9W 3IA7A 3OQHA 1XNGA 3SBEA 3S7ZA 3ICQB 3L0CA 5F21A 2A5YB 3CR3C 1PR4A 4O8CA 1XU7A 3TZQA 2YWDA 3JWGA 4GS5A 4HWSA 3V7NA 5IH3A 4KNYA 3PXDA 5E4FA 3H6GA 5EIBD 4OXYA 3M5WA 2OKGA 5GM2A 1V5WA 4JC0A 4L8FA 3RJ5A 1E2KA 3KZVA 1W2GA 1OXUA 3LOPA 3TTVA 3LF2A 4CI0B 3N40P 5JI2E 4TYWA 1ODIA 2A1IA 4C0KA 3AUFA 4CCYB 3Q7EA 3W6NA 4RCNA 2RKBA 1HSZA 3HWRA 3S2UA 1EDOA 2PYZA 3RV3A 2WF6A 5L1LA 4JELA 4RHUA 3TCXB 2DR2A 3CISA 1NF2A 3B60A 3WK5A 1DBRA 2I71A 1Q20A 1RPZA 3KQQA 3NVMB 3HR8A 4ZT5A 1BDBA 4J0FA 1OFVA 4YP9A 4WGGA 5L3VA 2ZWVA 2CW7A 1XWIA 4PYMA 4OXKA 4RS4A 5TQVA 1XE3A 3AY6A 3G79A 4D9FA 3BRWD 4EG8A 4NYEA 3X1JA 1KY2A 4K9LA 3L0IB 1VDZA 2YX1A 5H8WA 1FLNA 1YXMA 2I6FA 2I66A 2FE1A 1E77A 1Z16A 5KT3A 1MA0A 2EXXA 2IITA 3CN7A 2OV6A 1Z4JA 2J0UA 2XWPA 4LV8B 4CMHA 4I5FA 4A3BG 3KJFA 1F6DA 2Q6KA 4KBGA 1UAGA 4O8ZA 4AU1A 4LHYA 4CLHA 4AM8A 5C9ZA 3E4CA 4TXHA 5AYVA 3MGBA 1YVUA 4BFTA 3C43A 5JADA 4GSYA 3NYIA 1E8DA 3IYLW 3QG5A 2DPGA 4Z7JA 3LHSA 4E94A 5JAUA 1VIDA 4ECTA 3FZEA 4GGPA 4WDQA 3S6JA 4GC9A 3BEOA 4CR6A 5DN6A 4V2UA 4Q8EA 1YT5A 4OO3A 2ZXEA 4MRRA 2C3OA 3H2GA 2YVAA 4OA5A 1ISSA 3LY5A 3MCUA 3Q3IA 1XTJA 4KNWA 4B46A 2B3TA 1EFCA 1LJUA 3HY3A 4URVR 3AP1A 3RRFA 2BHLA 1Q7RA 2IZ6A 3COYA 4MKHA 4XJSA 2IZ5A 1P31A 2ADOA 1GPNA 2XOKA 4IZIA 5IW8A 3TVTA 2PQ0A 5C8VA 1AGNA 3A6HA 2ZRFA 3CX8A 3EJWA 2XECA 4MVXA 2AG8A 2QXTA 5CPBA 2C3MA 3CNLA 1ZU5A 3LW8A 1XTVA 3TD6A 4I1PA 5GGXA 4PS1A 3CUEF 4CM4A 5BXQC 3EIXA 2QSJA 4NQZA 5J2TB 1JEOA 4HNHA 2C78A 3REQB 2UXDB 3GPCA 4LUCA 4F4DA 4NMLA 1L4NA 1FUIA 3C6MA 2J07A 1Y1QA 3BFKA 2XXBA 2VR1A 1YDWA 4ZPXA 4FBLA 4D98A 1X8JA 4H0FA 4CTNA 4CLEA 4JQSA 1V6CA 3HV2A 4DY6A 3T0IA 1ZS9A 5KG7A 1C4WA 5DNEA 3VUEA 1TMYA 2OWEA 2OO5A 1A3GA 2XCLA 1Z6ZA 4R2KA 5AKJA 3RUIA 2GCEA 3CX7A 1SN7A 1BVHA 4OI2A 4FSHA 4X45A 3UA3A 5CAEB 5EHXA 2CHGA 1TU3A 3IX7A 4QREA 1XZEA 1CQXA 5EKUA 1Z2OX 2X40A 4YBRA 5H3HA 3TIXB 3QYPA 5K4AA 3QU7A 2QY6A 5K05A 1S4MA 4IM7A 4G3XA 5JBIA 3C41J 4ZXFA 4PX3A 4EUKA 1MRZA 3LYLA 1LSJA 4WJZA 3WYGA 2BMFA 4FHDA 4A91A 3HOUG 3NM4A 4EX6A 1WHTB 1FRNA 2QBYA 1N2CB 2DGDA 4FFRA 4LN1A 1P0MA 5BN1A 2GA9A 2WG0A 5CM2Z 3B13B 3ILHA 2HL6A 2I8LA 4OQLA 3TG2A 1V1MB 5DV9A 5ERXA 1QCDA 2C95A 4J29A 5B1SA 2JGEA 1XPUA 3ZI4A 3T5BA 1KGDA 3VAYA 1UM8A 3FPFA 1PJSA 4OQNA 2BKLA 1RIIA 1O94C 4IF6A 3VA7A 4TTVA 3OQNA 1QH1A 1EJ6A 2AOUA 3UATA 4B32A 5F9HA 4NATA 2GF9A 4DV7B 1Y8ZA 3IPRA 4KN9S 3WJ2A 4WFQA 3O93A 3CEMA 3A7DA 4HDNB 5AOBA 2YWHA 3H2BA 3ADOA 3KOOA 4AG6A 4QW9A 1PR6A 4LMBA 1IZ0A 3U3DA 4Z1OA 3QZ7A 5JNTA 5KNDA 4E2YA 4R9SA 3WNDA 2W8BA 5ICFA 4ZOLB 2OO3A 4WECA 1Q3KA 1HYEA 3BJRA 3O8LA 3OMLA 4TS1A 2AUNA 2R00A 4MW2A 4S0ZA 2B3DA 4RETA 1OH8A 1SEIA 2IYQA 4R3WA 4DCJA 2JCGA 3L8CA 1KYWA 3NH9A 3HB7A 2HK8A 4JYAB 4BVHA 1OLUA 1O5TA 3V4SA 2EIYA 3TQTA 4LHXA 3FMAA 5K4HA 2TECE 3K0BA 4YB8A 3EGCA 5BV7A 4X92A 3HY4A 1U80A 5IDQA 2QN3A 1JA1A 4LDNA 1XELA 3HP1A 3QVVA 1IN7A 2BHNA 2YZGA 1NTOA 2PRSA 3KWMA 2R79A 3EVEA 3Q0TA 4FYJA 1DBSA 1Z83A 4KRGA 3VVCA 3ASZA 5E3HA 4U7DA 2NUAA 1CTQA 1CIVA 2L17A 5AVWA 2YVUA 2ZJ3A 3ON5A 3WJ7A 1SVLA 4F3RA 2YINC 1GQRA 4G0ZA 3ZY6A 1GFSA 2FDXA 5TB5A 4AP6A 3BTVA 3TW0A 4LE0A 4LYAA 4D6XA 5C53B 1EP3B 4PQEA 1ZCZA 3ZU5A 4EENA 2IHVA 5KWEA 3AKEA 3B2QA 4OQEA 2NUBA 4KSBA 2H3HA 3UAXA 1BXRB 5J23A 1Y1LA 1MIOB 3SX4A 4PXSA 2PS3A 3PHLA 1G59A 1H2FA 3F1KA 3KUXA 5J2TA 2CV1A 1E0SA 1VPVA 1XROA 2SKEA 4RL6A 2LV8A 2HJHA 5D2CA 1V11B 4YP0A 1IPEA 2C2YA 4U1RA 1E9FA 2CV0A 1P5RA 4YQZA 3PA6A 4BU1A 4XCXA 1TQ2A 2NO6A 5KFZA 1YJQA 4B84A 1IN8A 1WD5A 3KV1A 3SIWA 2I54A 3G1UA 3WGUA 1UXHA 4PO9A 5HF8A 1NXSA 4QOSA 4JLBA 3GLHB 1AS3A 1YZNA 3MGCA 5ENZA 2A9JA 3V1YA 4KE8A 1JB1A 2XCOA 3RJTA 3GGJA 4TMXA 1QIJA 3FKIA 2FK1A 2O0KA 2IL1A 2PEYA 3SNOA 2OFFA 3TZLA 4JB0A 1VMIA 2HIMA 2ODBA 3MT7A 121PA 2QJOA 2QLJA 2R1ZA 4JMPA 2E4ZA 4PV7A 4RF3A 3TW8A 5I9LA 2BL4A 1P4RA 1QYCA 4GT1A 4C30A 4KAXA 4FMDB 4PZAA 1C80A 5G1PA 1OR8A 1QDUA 4DQNA 1MC1A 4FXOA 5D00A 2A1UB 2Q3FA 4IMJB 1W5AA 3U48A 4D26A 4BRSA 1UBTS 5DI9A 1JPVA 5HQJA 1HFWA 2OHFA 2QN8A 4JQYA 4IIGA 1CE8A 3FF4A 3JQRA 2NT3A 1GCOA 4FKMA 3P97A 2J6IA 3ZX4A 5KKCA 1PNVA 2FN7A 3OE5A 1W59A 4BQQA 4J49A 4BQIA 2W00A 2YVKA 3ZXUB 1E1NA 2QQEA 1EKPA 3OPYB 1GSOA 4LC1A 1WHTA 3RK1A 2C1EA 1X7YB 1M67A 1O54A 1RQ7A 2ZWOA 3B3AA 4G0XA 4U4AA 1DKQA 3PCRB 3NTQA 3EF3A 4MYHA 4YT4A 4D9EA 5EPEA 1TECE 4M0EA 3T95A 2QM8A 3UQYS 5H9WA 4OHZA 1N0WA 1OYOA 1SELA 2Q5EA 1K8RA 1L3CA 1LK0A 1W4RA 2B30A 1IN5A 1C7RA 2YJNA 1JLSA 1NM5C 1NI5A 5E9JA 5KDDA 2ID7A 2QX8A 3B48A 2O19A 4LF6B 1C9DB 1R4MB 5JLAA 3R5SA 3CNNA 5AI9A 1KHHA 3ZW9A 4C22A 5LUAA 1Q21A 1U65A 1PG0A 1N2ZA 4QWWA 5I6DA 1YJAA 3I9FA 4EKIA 3NGLA 1ZW6A 2IYWA 2QN1A 3VKWA 4CIXA 2R93A 2NZUG 3DBIA 4FDAA 2EGUA 1JVSA 1GZSA 1MB9A 2AWOA 2JEOA 2Q1UA 4P08A 5LOVA 1IULA 1IG3A 2GJSA 1O1YA 3AYZB 3MJ4A 3PYLA 4WK4B 2F3UA 4A6XA 3NNNA 1Z45A 1U3CA 3K8QA 4WZAE 4X3PA 4CM4B 5KG3A 5IF3A 1PJ2A 3SYTA 5I47A 4C1NA 4DV4H 3EGXB 1K9SA 1R0KA 1AVTA 2IHBA 2EAUA 4YAJB 3EPGA 4JI0B 4M4SA 1RXCA 2Q2WA 4MDYA 1FXUA 1P2GA 4GICA 4BJ3A 4D8YA 4IY1A 2FX5A 1MF7A 3PA8A 3BCSA 3L6BA 4MHOA 4MKRA 2YVQA 1ZK0A 1NKSA 4ZK6A 1CRPA 2Y76A 4AS2A 4WXRA 4PAQA 1OBOA 3KSAC 4UMDA 2VBFA 1Y8QA 3I5XA 1CULC 1KZ4A 2PGAA 3DFKA 2ERCA 4DCGA 4GXNA 3HK2A 4RGQA 3GP5A 3GT7A 3KPYA 3COPA 3MJSA 3QW2A 2GM9A 5HQTA 3PNBA 2G0AA 4DV6H 3SEQA 1TA0A 4JI4H 3A1CA 4E5KA 3N0TA 5KVCA 2LNDA 1XDGA 3UCFA 5A5EA 1MNAA 2BFFB 3II6X 1EJBA 2ZJ5A 2L82A 2QT1A 3G9TA 4FIDA 1J0XO 2RDMA 4AJ2A 4AZ3A 3W3AD 1RQXA 3R9KA 1ISRA 2W9BB 5DHRA 3I6IA 1E3LA 4JUCA 2WE8A 1BKYA 4A27A 4A3CG 2EZ8A 5DTIA 2HRCA 4OJMX 4B3RB 2QPAA 4XIJA 5GOTA 1RVDA 3B9BA 1KYVA 3TAHA 3TQIA 2DFPA 3A4TA 4GMFA 5CHYA 2OCIA 2CBZA 1RPJA 1SYXB 4M2LA 4W99A 4NH4A 4CIBA 2IYYA 2UVRA 2P2YA 3TSWA 3INYA 4D80A 1FVXA 3HXTA 4HVAA 3GAFA 1YFKA 4K9DA 2IJGX 3IELA 3R3ZA 4MS1A 4XSHA 3SXPA 3T3EA 3PFWO 3ELWA 3UW1A 4C3OB 2YY7A 2O3RA 1S1CA 2D5LA 3OM1A 1CQZA 4BLSA 3THWB 2Q4DA 4TOIA 4XM1A 1SD1A 5AHKA 3U31A 2ODAA 5D7BA 2R5FA 2XGGA 1FMTA 4XEHA 2C8VA 4OHOA 5EKTA 2DEUA 5FBRB 4FZRA 4PZZA 2ZRDA 3RR2A 3WKBA 2I2FA 3MBIA 2M98A 2CC2A 1GITA 2Y0DA 4NOKA 4AIIA 1YE8A 1Y33E 1VL0A 4BKOA 4RD2A 2YXDA 1U0TA 2C99A 1ZN2A 4D0RA 4DZRA 3AUYA 4EKYA 1F51E 1OH6A 4AKIA 4QPCA 3PO2G 3IAUA 1UAAA 2PRYA 5JH7B 1H2EA 2RGDA 1HC7A 2I1QA 2Z83A 4W82A 5L3SB 1A9PA 5EXPA 3TBKA 2MYUA 4S1PA 2YNMC 1I7LA 3NHSA 3H4BA 5CX1A 4BVEA 1KK3A 2JDIA 3GFSA 4O2AA 2ONCA 2NPOA 2HDHA 3E58A 1W48A 4W5QA 1W581 5LXTA 1ZMXA 2P11A 1RE0A 4MVJF 4MI9A 5DGDA 5CA0F 3E0QA 3WP0A 2IX3A 2AX4A 2FJ0A 3AG6A 4ZZ0A 1R27A 2UXBB 3U54A 3L6EA 2V6JA 5J63A 1BWSA 2XNSA 4KDFA 5B36A 2C2OA 2FLNA 4LS3A 2FEAA 1F8UA 2QLFA 3CSSA 4ZAYA 4G01B 3P9QA 1BAPA 1U8EA 5DM1A 4AK9A 4QGSA 4G1FA 3MJTA 1ILEA 2EIXA 1H2YA 2NU9A 3M6AA 1DELA 1IJFA 3QMWA 2PMEA 3BDIA 5KS8A 4ZDIA 4CYMA 4U9HS 3FSGA 4DR5H 2LKDA 2NU8B 2YBEA 2OXIA 2GQSA 3FLMA 3R6TA 3CRNA 3R0QA 4I4NA 4MVJH 3HJTA 3I6MA 4KAFA 4OYYA 4HDOB 2R3SA 1QUEA 4LBWA 3B9QA 1LC0A 5I5YA 1U8CB 4Q6WA 2ZPAA 2XWJI 1GTVA 4ARZB 3CX6A 4YRIA 4KR9A 2Y77A 2B1IA 4F86A 3ZVNA 4J4BA 5C8XA 3HB5X 4P53A 4DR2H 1GNLA 2B4TO 4UBMA 3C5EA 2QU8A 2L0XA 2FNAA 3IPXA 3OJ0A 5JYCA 4AWBA 4AP9A 1FYVA 3T9DA 4NYMR 3M5CA 3SHOA 2JAUA 5AKEA 3VSAA 4YJFB 4BNYA 2J9YB 1V5FA 5D6OA 2PE5A 1VLMA 2R68A 4X8MA 5HS6A 4AYWA 2HJGA 4IDHA 4C4ZA 5A4AA 3VR3A 2R7NA 2IYLD 1F8YA 4IJVA 4CLRA 2P9GA 3MPUA 1TLTA 3NJRA 1E4EA 4XYBA 5CD9A 4ZQIA 1ORHA 5KSZA 3C7AA 2LCIA 4MUHA 3TLGA 4B0OA 2WQ7A 1S9FA 3D8TA 2RFLA 1SWVA 1MVNA 2QP4A 3JQEA 3ND6A 3LUHA 3O2NA 4Q16A 5AT1A 3TM5A 4J0GA 1G98A 5GV8A 4S1NA 1IDN1 3VO8A 3ZU4A 3MTIA 3MTEA 3AC0A 5IM5A 3DZBA 3BG5A 5H82A 4DB4A 3DPIA 4CTOA 4YV2A 2ZUFA 1A97A 2Q3CA 4FS1A 2A94A 4ZALA 2UZ0A 3QE0A 1MEOA 4PRYA 4U5XA 5DGBA 2QLTA 4RJ2A 2FW8A 4TMYA 4EO4A 2IHTA 5JANA 4YI5A 2JHPA 5IC6A 4KQIA 3L8HA 4R1PA 5FLKA 3X2SA 1QWOA 3SKVA 2YHIB 4QJ3A 3H3JA 1YOVB 3HPQA 3M6XA 1UBOS 5AVXA 1ZD9A 4INJA 4JV5B 3CGWA 3A9UA 1B73A 1DAMA 1K6XA 1Y0BA 2R6FA 2DJ5A 2IEDA 3HLTA 3VR5D 4BB9A 4K1LA 2OHHA 1UEXC 4M0MA 3DFUA 3P32A 3ESQA 3UFXA 2XB9A 2XRFA 1KMNA 4MWBA 1OY1A 3RU2A 1DV2A 4RULA 1HT3A 1PFWA 4ND8A 3T0FA 4OQQA 3OT1B 3HHPA 5KJCA 4A3MG 1G55A 2QUBA 2A67A 2R4UA 3ER8A 2V74B 1P6QA 4XDHA 1EFTA 1RRVA 3WK9A 3K9HA 3T4UA 1COWD 5FPKA 4R5HA 5DTJA 3ASVA 1Q0LA 3OJLA 4FFSA 4LJ9A 2OPHA 4NC9A 3WP1B 1L8AA 4UNQA 4DLWA 4XIFA 4QG7A 5BW4A 4L08A 1B6RA 1ZK4A 1JR3D 3D1VA 5CXUA 5G3ZA 2X8JA 1ZISA 3GLIB 5JUWA 1YB1A 3P26A 3WGZA 1YS9A 3GVXA 2HC9A 4MZXA 3FHTA 5EMJA 2Q0QA 4EYHB 3OCJA 4RXMA 4ZVQA 3K1ZA 3RASA 4ARIA 4EJSA 3EG9B 2Q29A 4NNPA 5HCIA 4BP8A 3ASYA 4DLSA 4X90A 1W36C 4MTDA 1OFGA 1BW9A 3JALA 2NZ2A 4HX9A 4XGKA 3SHFA 1QV9A 2GEVA 4ALJA 4YUXA 2ZANA 1ZNXA 1P1JA 3ZNNA 1R0CA 4EHHA 2M9MA 2GYYA 4IFTA 3ODGA 4P7BA 1GTG1 3D2BA 3KHTA 1CYDA 2KSWA 4ISBA 3AWIA 5B12A 2UDPA 3DLPX 2A57A 3PQDA 2ZR7A 4ZT7A 4B3BA 3SWWA 1L1EA 2O50A 2W6JA 3L7IA 4KYTA 1C7ZA 4DR4H 1I3NA 1K8XB 2AGQA 1TTQB 1U2DA 3OZCA 3PQ5A 3UN1A 4Z54A 3OQJA 2Q9BA 3FUXA 2OAQ1 4FDTA 5H16A 4QEZA 2UYHA 5JAIA 3KYCA 5KC8A 4R0MA 3A6PC 4BE7B 4G0QA 4AJHA 5DSXA 3G1WA 2VF2A 4MW7A 5C7IO 3VDXA 2RAVA 2ST1A 3C6YA 4QGBA 4Z53A 3NALA 2JA8G 1A9SA 1GA4A 4JP1A 4TT3D 2GZRA 4MV8A 4IP0A 4IWXA 4KLCA 5F2KA 4INZA 5C44G 3CQZA 1VA4A 4G1UC 1GR0A 2EKBA 1UKVY 4TTQA 4BAUA 2EJ2A 1HDRA 1VCOA 1RC8A 3PR5B 2Z09A 1J5PA 2DFLA 4RIIA 2QN9A 3DHEA 4ZARA 3TDMA 3H2IA 5EFOA 2X8JB 3OY2A 4JA2A 5ALIA 1XVAA 3ZKWB 1W47A 2IU6A 1EZ1A 4DBLE 2Q4BA 3I3OA 5HWSA 1NZDA 4YAOA 3WYEA 4D9JA 5AVZA 3EE6A 1CZNA 3QA3E 1UZUA 4QSMA 1N77A 4U2EA 4IIFA 1M7JA 1G2OA 3K0AB 5ECWA 4B74A 1WDLA 5B1YA 1WXDA 5ALWA 1UWVA 2HIAA 1G38A 3I0NA 2WTBA 3PI6A 3P9PA 2Q5OA 1GTZA 1YRAA 2BKEA 1GSAA 2MSLA 4OUDB 1T8TA 3U4HA 3GMIA 2G7ZA 3AHJA 5DNYB 3MUOA 5A4JA 1ND6A 2GTIA 2JRCA 4IJKA 2EYQA 3EC2A 4ZAFA 5IMBA 4CUZA 3LYUA 4A3EG 5KFNA 4CLRB 2AZTA 1BMDA 3PTLA 4E32A 1UBJS 3VO1A 3QKUA 3SHVA 3W05A 1EDBA 3D7MA 2BMJA 3V1LA 5AVVA 5BWXA 2KX7A 1EK6A 2AI3A 4JA0A 2OV3A 3O95A 3WDSA 1FU8A 1ZEMA 3GCWA 4OYHA 3ONFA 1NI4A 1IMOA 1KL7A 1AZTA 3BSFA 5FQNA 4J91A 4C3ZA 5SY6A 5CFOA 3H5NA 4JB3A 3W4JA 4BU0A 4ZKDA 3Q8WA 5B5SA 1JVNA 3C39A 1ZBDA 1WD7A 2OILA 3NBXX 3PE4A 5DVZA 3R6WA 1TJ3A 5DASA 4EGJA 5LQSA 3TUZC 1TM2A 3M83A 1N92A 4DIFA 3O8DA 4NBUA 1BN6A 4PYKA 4BO6A 2AQ4A 1KI6B 1SB9A 2C8KA 2JBHA 1WUHS 4D9HA 3OHAA 2VO1A 2WU4A 3RVDA 2LGJA 1AS2A 3GLKA 4WI1A 3ZD8A 1VM6A 3KUCA 1RJRA 2YFKA 1SOMA 2R92A 1NUSA 1FUUA 1BZYA 2HH9A 2NOAA 4ITVA 3ZTWA 3HM2A 3CBGA 4NU0A 4UFPA 1R18A 1S2NA 3I32A 3IUEA 1CRZA 2JVIA 4IIJA 3U80A 5L1KA 4FMBB 1QIKA 4RGBA 2ZREA 2F8LA 5CU7A 2DBZA 4EJ6A 4QPPA 5JS6A 1AK1A 5I9NA 5EWGA 1EX7A 1BNCA 1K0UA 2CXRA 3KEFA 3KKMA 4O0LA 3VDNB 1W9HA 4NS4A 3V4RA 1N2BA 4LFAB 1MEEA 4BGIA 1ZNZA 2Q3HA 2FRDC 5LQUA 1WDKA 2HSJA 5BPHA 1LNQA 3HO6A 1JV2B 3MT8A 5ELLA 1YMUA 1P1BA 4MGKR 1GPMA 4P4LA 1XHLA 1ZK2A 2F62A 2P69A 1RR6A 3GL9A 1CS0A 3NAGA 5FPHA 4CQJA 4TLEA 1FFCA 3AB3A 3QW4B 4HFJA 4RZ3A 5CX1B 2IHNA 1Z2CA 5CXSA 1WKVA 1JLKA 4NK5A 2AN4A 2V96A 4NXMB 4GI1A 4REQB 2Q8PA 1Y1RA 1H66A 1UPXA 3L4SO 2J3JA 2O7SA 4K86A 4NZ9A 4RVUA 1X7HA 3C3BA 5FBHA 2MMGA 4AD8A 5BSVA 1TGVA 4D8WA 2KLHA 1SD2A 4YJ2A 4E88A 4J9MA 3K72B 2PJRA 4H1WA 1BN7A 3CQ9A 5KFBA 2PQ6A 1XGKA 3KR2A 1YDHA 1CUFA 2A59A 3BULA 3B1JA 4Q9IA 5LQNA 2X5RA 4MWDA 1I94B 1E2UA 2Q41A 1M1YE 3I2YX 1A7JA 4DV1H 2O2HA 1DI0A 2O2IA 5DN6D 3G7SA 4X20B 4N12A 4WZBE 3T5CA 1N2IA 1XEFA 1Z0FA 5KAMA 3OH8A 4L8WB 3JW8A 3RIMA 2XNDD 2SHKA 3X1XA 2GXUA 2OL4A 3CTMA 3O4JA 3PICA 4JUBA 5CDFE 2E7ZA 3WZ2A 2GZHA 1PJ4A 1U8ZA 3AVQA 2PMZA 1W0KA 3FNBA 5K51A 2N42A 3MTGA 2WJAA 5C8YA 4G41A 4I3HA 1UC9A 1BA3A 2HB6A 2DY0A 1DC5A 4Q34A 1DEXA 5ALEA 3AF0A 3T1YH 2GEJA 3V55A 3W7VA 2ZUWA 3AL0C 5E25A 5JWHA 3FB4A 1QO7A 1YR3A 4J07A 4B71A 1H9AA 1RYFA 5BMOA 4PXYA 1MZBA 4W9RA 5I5SA 1GAQA 4AJKA 3PEVA 3LD9A 3T9BA 3DLBA 1SG0A 3ORYA 2YRWA 1Z7GA 1KP9A 3GAZA 4FX5A 1UBCA 5JZSA 1ZD8A 1DKLA 1DDGA 2GCOB 2VK2A 3DL2A 3P4XA 2GHTA 4L4RA 4LYEA 4PINA 4F3YA 4UJ5A 1FSSA 5LQJA 3D4PA 1PT7A 4ODIA 2JZOA 4PZ9A 1PDVA 3MWJA 1WULS 1Z47A 3G2LA 4RWZA 5SZJA 2JFZA 2P3QA 5JBNA 3ZS8A 1CIJA 1YDFA 3DJFA 3ET4A 3GNTA 4TV8B 4X1KB 4BNGA 1HQDA 3L7YA 2XWSA 4IMPA 3HKBA 3ZLVA 4GLOA 1H6AA 4YMUA 4LYDA 2QRGA 1DAKA 4MS1B 4MTEA 4LGVA 3W1VA 1LLDA 5KWVA 3ABSB 1NNUA 1CUJA 1Y4DE 2AFIE 2C8JA 3BWMA 4HYKA 4ALNA 2FSGA 3AVPA 3BQMB 3L5KA 3L7OA 4FIZA 4PWZA 2B8WA 2BGNA 4HYYA 4LSWA 4QJ5A 3QWHA 3AILA 1BHQ1 1ZA2A 3GRRA 3RFUA 3AOEA 1JR4A 1T4DA 1AUXA 3B1ZA 3DKKA 4K6CA 3BXFA 1ACLA 1FRQA 3P45A 5DYGA 5KVQA 5UKDA 1Q15A 2YZ7A 4CEHA 2D59A 4HLUA 1ST3A 2IODA 1CUEA 1UWCA 3FTCA 3PXBA 2O8FB 2J0QA 2NVXA 1ZN7A 2CMFA 2IEIA 2VHJA 4GX2A 4IX9A 4HADA 3F8NA 4GHWA 4O83A 4MW1A 2AEJA 2WIKA 1X1DA 1ZD2P 4MPTA 3V1TC 1QUFA 2N1MA 3BD9A 4N8DA 2BFNA 2W6IA 3F6YA 1W88B 5IVPA 3B1VA 2BRUA 2ZAOA 1M8GA 3C6XA 3PGA1 4OJKA 3U4MA 1CQJA 3QSGA 2FLVA 4HEHA 4MXDA 2PBLA 2J5RA 2VH1A 3O31A 4S24A 4R2JA 2P9FA 5K8VA 2O8VA 1UM9A 5AH0A 4AJ4A 4YCMA 2G76A 2MSKA 2ZXFA 3AR5A 3KSDO 3LWNA 1VOTA 4JR2A 4ACAA 4AKGA 1EFRD 2FZKA 2RGNA 4LGCA 3R4VA 2HNBA 1FDVA 2EKDA 4NXNH 1GARA 1SVIA 2DQKA 3KPWA 4QRIA 2FQ1A 1P60A 2F4NA 4KJXA 5AJHA 2QTLA 4ABYA 1RMQA 2JFGA 3HMKA 1BG6A 3Q41A 4IDOA 4G36A 4PY2A 2DH6A 5CB8A 5JMWA 1OYYA 4YVFA 4UARA 2XGJA 1PT9A 4RFVA 3T1HH 1T4BA 2HK9A 2ZIVB 5L7YA 1E6LA 2ZYWX 3R3SA 3GIKA 1IHOA 4ZEWA 1MAVA 3T7AA 1YC2A 4UOEA 2QIOA 1EVQA 1I80A 2OXFA 1UXJA 1W88A 2JAWA 2O20A 1C14A 1WMEA 2C4VA 2BM1A 3CINA 4D9IA 2SICE 4EPYA 1RRKA 5ICMA 2A33A 3JRNA 4C7KA 3G23A 3SVZA 3Q8PB 1PFYA 3SG0A 3K09A 5IEJA 2N47A 4RB1A 4DSTA 4RK7A 1QWSA 1YVEI 2FN4A 2DTDA 2P5TB 1QK3A 4QJBA 4TWJA 1ZSYA 2A9VA 4X00A 2BZSA 3DT8A 3IGFA 4H3VA 4KL8S 4UCVA 1SHJA 1RFGE 3U3JA 1NMEA 1P5FA 3TRDA 1T8UA 2LR0A 1QMGA 2X22A 3ZH2A 5TGTA 1OQAA 2XTZA 3OAAA 5EE0A 1UPFA 2FI1A 2HZBA 1N2XA 4C4OA 3GFQA 2Z95A 4D4KA 2GN0A 2ZSHA 4L07A 2X8LA 5JPDA 5TVKA 1TM7E 2PGXA 3QUSA 2V5UA 2VK4A 4MV5A 4RZXA 2C7OA 4KXUA 3QVLA 3P9XA 2EFDB 2PLFA 3B9RA 4RFSA 4I50A 4QRDA 3HCAA 1R9JA 3WLQA 5BORA 5BWRA 3PRKE 4KXYA 2VQDA 1GP2A 1YQEA 5E9WA 1GAEO 4JSYA 1C3EA 1Y7TA 3OICA 3V7UA 2JHCA 5DT2A 4D43A 4YJ2F 4BVFA 2PKQP 3ZHYA 1CYEA 3V4ZA 4EEYA 4CF3A 4NZZA 4KO2S 4RKRA 2RHJA 4ZAZA 2NUPA 4DR3B 3DEZA 1B8PA 1ZX1A 2RK4A 3DF7A 3HDQA 4RDCA 2MCFA 4BLTA 4DLLA 2AW5A 5JFGA 3RVQA 4IQ4A 1XVUA 1CDEA 1PEYA 3I1YA 5TMEA 1IIBA 1U8UA 2NVWA 4RUCA 3NHFA 4CMBA 1CJBA 2XF2A 2QTZA 1AN7A 4FVTA 4G1CA 5AKZA 1KNXA 4ROTA 1TJ4A 5FFMA 4TX1A 3W06A 4GH5A 2BR5A 2CL7X 2CLHB 3PEUA 4N6OA 4JC8A 4K9OA 3BQ1A 1ZSNA 4F71A 1KI7A 4OMUA 4LY6A 1X1SA 4Q3OA 4FYPA 4OKNA 1H8ED 1MC4A 5CHEA 3FOBA 5DG8A 4G5XA 1C30B 1UEJA 4DUZH 1GUBA 2GRAA 4IJ6A 3AJDA 4ZAWA 4MYRA 1CUGA 4FNMA 3TLKA 1E1CA 2FX2A 4JFRA 4WZBA 4X65H 5FOQA 1SCBA 2PFKA 3RIYA 2A7XA 4TLBA 1LBQA 2F9FA 4KQGA 3UH0A 4DVJA 5A5VA 2CXPA 1N5KA 2RGVA 3AJRA 1NYTA 2CLCX 4EHAA 1HKUA 1PDOA 2PSDA 2PMBA 2HN9A 2Z3VA 3FTNA 4ECSA 4I2NA 5ADHA 5CD1A 3OUZA 2OO7A 3KSZO 3I6BA 4JV1A 3EQ2A 2WE6A 1GTL1 4CODB 1WDMA 3VQTA 1J2EA 3BK7A 3FZGA 1XZGA 3QPAA 2QROA 1J90A 2VPPA 3FJ1A 3EZNA 3G6WA 1FY2A 3PWSA 4WXMA 3T61A 3W1WA 4DIUA 5C8DA 3DE2X 3ZCPA 3GPBA 3HSSA 1H0HA 4EZEA 1P3Y1 5KREA 2VPXA 2DFKB 2X2OA 2BOVA 3M0EA 2UVWA 1Y4AE 4XVQA 5AKYA 3HO1A 3FMVA 3B6KA 1Q11A 4JP8A 1J2UA 2VQEH 1R6XA 1PR3A 2C3UA 2RI6A 3KVRA 3FYUA 1S0NA 2WTEA 2EDAA 2Q3EA 5CA0A 5TRTA 5A7HA 5BUQA 4CTJA 2GQ0A 1R66A 5HJ2A 4G09A 4DCTA 4L74A 1OLUB 2HA7A 3M6LA 2Q5IA 3HH8A 3L6RA 4M54A 1KC7A 1MV8A 1YASA 2J0VA 3LMKA 3MTDA 4ONEA 4S2EA 3K0SA 1NKVA 4KDEA 2FG7C 1GPDG 3CV3A 1IZ9A 4LSMA 4WADA 1P7YA 3E0XA 4BNDB 4F9TA 3R09A 1DHRA 4K05A 2C2KA 5JEEA 3ZU3A 4A8HA 4WZ6A 1D1SA 1V26A 4URXR 4CQMB 5FJ8G 1OWPA 5FA6A 3ENKA 4GBGA 4IKEA 4JUDX 4XSVA 5CM9C 4WZAA 3MHPA 5IJZA 2ZRNA 1PS0A 2GPAA 1J8FA 1NQTA 3BL6A 1HDEA 4WERA 4YPFA 4ROSA 1OGIA 2ZRGA 5JJLA 5AI6A 1XQ6A 1QIEA 2ADFA 2HM7A 4MV4A 2RI0A 4GPBA 4OI1A 3PC8C 4U7CA 2XUFA 3NAMA 1KI6A 2X3YA 4BO3A 3QPCA 4DL3A 3CLSC 5KVSA 1EX9A 3TEJA 4B3GA 4F8EA 2I22A 4B2PA 5LNK1 3MJCA 4KLZA 3WK4A 2BGGA 2FLPA 4C3UA 4HUTA 3I2FA 4PPFA 3I9KA 1YR6A 1E3SA 2O2JA 4XAQA 1T6XA 1KZ7B 2ZT8A 3KKNA 2BT4A 1ZI6A 2J7PA 3OVMA 1SGWA 4NAHA 4YCJA 1T6BY 2FZLA 4DKJA 3DGEC 4EF4A 1ECPA 1KFBB 4D57A 2VHXA 2XMSA 1P1CA 4IMRA 1IZZA 3R7WB 2F64A 1W1WA 3R3VA 3WMWA 3ZOZA 3IT1A 2X4DA 2A9QA 1UK8A 4BJ5A 1ULZA 3U40A 4X9XA 3BZBA 4RSGA 2ENUA 4L3WA 4UTZA 4KN6A 5DFAA 3TL3A 3DEJA 5IMSA 3ZYZA 2Q3JA 4RWEA 4BCBA 4NV1A 3E1SA 1MMFB 1TQ4A 1U1GA 3RRBA 5F5XA 1EGAA 4FI3C 1ZMBA 2YWFA 5FV7A 1N9GA 3JZAA 3NWEA 5G1NA 3E9QA 3S0JA 3VR4D 3V32A 2HCTA 5K0ZA 1L5VA 3QA9A 4MARA 4U6QA 3TSAA 3TIGA 5LZ5A 5HKKA 3DUWA 3HJHA 1A8QA 3JQ9A 4ZRMA 1YRHA 2Q5QA 2VWPA 4AJPA 4AWAA 4QPJC 2F90A 1A3CA 1L6IA 2VI5A 2GO1A 3MEQA 3TSOA 2OA0A 4B80A 1NBMD 2NQ8A 3LRXA 3E4DA 5COBA 1XNHA 3SY8A 1E4FT 1FXWA 1W8IA 2QRVB 1KO4A 2ZSJA 3D2AA 1L4UA 1EUDA 3GLQA 4Q3LA 4KNVA 2FMXA 1XKQA 1E3TA 3FY4A 3T3MB 4OP2A 4D74A 3DTFA 4RTKA 5JRJA 2NNLD 4RENA 3E2PA 1QCYA 1BWQA 5G4KA 3WYDA 1ZUHA 2O5CA 4DYHA 1Y4UA 1W5SA 3O83A 3HTXA 1VHLA 1WPRA