1M0WA

Yeast glutathione synthase bound to gamma-glutamyl-cysteine, amp-pnp and 2 magnesium ions
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
486
structure length
481
Chain Sequence
PSKDQLNELIQEVNQWAITNGLSMYPPKFEENPSNASVSPVTIYPTPIPRKCFDEAVQIQPVFNELYARITQDMAQPDSYLHKTTEALALSDSEFTGKLWSLYLATLKSAQYKKQNFRLGIFRSDYLIDKKKGTEQIKQVEFNTVSVSFAGLSEKVDRLHSYLNRANKYDPKGPIYNDQNMVISDSGYLLSKALAKAVESYKSQQSDPIVAFIVQRNERNVFDQKVLELNLLEKFGTKSVRLTFDDVNDKLFIDDKTGKLFIRDTEQEIAVVYYRTGYTTTDYTSEKDWEARLFLEKSFAIKAPDLLTQLSGSKKIQQLLTDEGVLGKYISDAEKKSSLLKTFVKIYPLDDTKLGREGKRLALSEPSKYVLKPQREGGGNNVYKENIPNFLKGIEERHWDAYILMELIEPELNENNIILRDNKSYNEPIISELGIYGCVLFNDEQVLSNEFSGSLLRSKFNTSNEGGVAAGFGCLDSIILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione synthetase
publication title Large Conformational Changes in the Catalytic Cycle of Glutathione Synthase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 171
structure length 481
sequence length 486
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 1m0wA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1m0wA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1m0wA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1m0wA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 1m0wA04
3R5HA 4O83A 1VKZA 1EUCB 2NU6B 3WO0A 4O7TA 3N6RA 4ZQIA 2ZDHA 3U55A 3TIIA 5LP6F 1I7LA 4HNUA 3LP8A 2NU7B 3E5NA 3TIGA 5DMXA 3LWBA 2W6NA 2V58A 1EZ1A 2SCUB 5BPFA 4MV1A 2W6QA 4NYEA 4O7NA 3R23A 2YRXA 4TV9F 2PBZA 2ZDQA 2NU9B 1JDEA 5LOVF 4FE2A 1BNCA 5JH7F 2VPQA 1GSAA 2R82A 2FPGB 1M0WA 5KX5F 4O2BF 1W96A 5LYJF 1PK8A 2PN1A 1EUDB 2R84A 1KJJA 2HGSA 3K5IA 2YYAA 2W71A 5CA1F 1E4EB 3JRWA 3Q1KA 1CQIB 4QSHA 1KBLA 2CNQA 2GPWA 4C5BA 1ULZA 2Z02A 3ETJA 3MJFA 4O7RA 4O4LF 1KEEA 4FFOA 4O7LA 4FFPA 2DWCA 4IZOA 4FFNA 2NUAB 2R7NA 2I87A 4DIMA 2R87A 4FU0A 2X0SA 1VBHA 3NUAA 4EGJA 1A9XA 1JKJB 4O4JF 3QFFA 2FP4B 1C30A 3KAJA 2YWVA 3KREA 2QK4A 1I7NA 2VQDA 4O7VA 3MWDA 2R7KA 4O7WA 3GIDA 4RZQA 3R5XA 5J2TF 4XYMB 5KKNB 1DV2A 2V59A 3VPCA 3I12A 5JQWA 2W70A 2DZDA 3AX6A 4O81A 3TQTA 4O7YA 5LXTF 2HJWA 3RUPA 1DV1A 3JRXA 4YJ3F 3KAKA 2GLTA 1BXRA 1KJQA 2FB9A 2YS7A 3R5FA 3U54A 3KALA 5FNVF 4O84A 3U9SA 3TINA 1E4EA 4IIJF 4I55F 3WO1A 4I4TF 3WNZA 1A48A 2PVPA 4O7ZA 3GLKA 4YBZB 2YZNA 4C5CA 2FPPB 3VOTA 4FFRA 1M0TA 2J9GA 5C1PA 2GQRA 4YAJB 2R86A 4FFLA 1PX2A 2CNVA 3VPBA 4WBNF 1AUVA 3ORQA 2YS6A 3VA7A 2R85A 3V4SA 1C3OA 3JZIA 5J2UF 1KJ8A 2DLNA 2W6MA 4MV8A 4YJ2F 4FGRA 4MV3A 5C1OA 4XZ3B 5EZYF 2YZMA 2W6PA 1KJ9A 4ZI7F 1OBGA 2NU8B 1Z2NX 1JLLB 2YZLA 1GSOA 3RV3A 5BPHA 1B6SA 2VR1A 1IOWA 3VMMA 4XYLB 4L1KA 3UFXB 4HNTA 3RV4A 3AW8A 5BMVF 4EGQA 1JDBB 1EHIA 3HB9A 4O86A 2P0AA 1KUTA 3K5HA 1GLVA 4TUYF 2IP4A 3N8DA 4YAKB 1DIKA 5HBRB 2XCLA 1CS0A 1KC7A 4EG0A 5H80A 3ETHA 1SCUB 3G8DA 4XX0B 5CAEB 5HV6A 3K3PA 3TW6A 4E4TA 3R9RA 3SE7A 5CA0F 3OUZA 1GSHA 2OLSA 5LA6F 3JZFA 2QF7A 4IHJF 5IYZF 2WYOA 4MA0A 4HR7A 3U9TA 5JVLA 4I50F 4O82A 1GGOA 3OUUA 2I80A 2XD4A 4ZOLF 4C5AA 3G8CA 4O7SA 3Q2OA 1Z2OX 4MV4A 1WR2A 1B6RA 4MV6A 1KJIA 1VBGA 1IOVA 4O4HF 1W93A 2C00A 1CQJB 2YRWA 1Z2PX 4M9UA 1M6VA 3BG5A 2YL2A 3ORRA 3HO8A 5D8DA 1EYZA 2YZGA 4MV7A 5JVDF 5GONF 2V5AA 5CB4F 2I8CA 1AUXA 2DIKA 4ZHQF 4TV8F 2ZDGA 4MA5A 4MV9A 2GQSA 4ME6A 2R7MA 2Z04A 4DLKA 3V4ZA 2CZGA 4HNVA 3RFCA 2W6OA 2GPSA 3HBLA 2R7LA 2FPIB 4O4IF 5JQGF 1T36A 1CE8A 4Y8VB 2CNUA 3DF7A 3MWEA 2W6ZA 4MAMA 1OBDA 5C8YF 2YW2A 4FFMA 4YB8B 4HQ6A 4O2AF
chains in the Genus database with same CATH superfamily
1NURA 3NBYB 1G21B 1ZJZA 1FJHA 3SQLA 1Q2XA 3DOJA 3BK1A 1N8TA 3UV7A 5JOQA 1P2BA 2QTAA 1N4DA 4Q1AA 2W6NA 3TGLA 1TOAA 4UZEA 2Q1TA 4B76A 3OCJA 4BTEA 3LP6A 4HY3A 5F9HA 2OQIA 2H2WA 4UTPA 4U0KA 4NICA 4YMHA 4G1FA 2WB4A 1DX4A 2N9UA 1CLUA 1P0FA 1B43A 3R7WA 2V7QA 4OX9Y 1XDBA 5I9IA 4EFEA 2BF7A 3ROTA 4PSVA 4BBSG 4O2AA 4GC9A 2IDZA 1K4YA 2ATXA 1PJLA 5FYDA 4FJ2A 5IAEA 4N0MA 4Y8VA 3NTQA 3HUFA 3TKYA 5FYQA 1T1IA 2OBMA 4I1PA 2NSDA 3G2QA 4GX1A 4TS4A 1E8DA 4QG3A 4N9WA 5JO0A 1N0VC 3LGXA 2P27A 4EI9A 3THXA 1UK7A 1TD9A 1DADA 4DV3H 1ZIOA 3QYFA 4ML3A 4WFJA 3VOAA 1CDZA 4EY3A 2H92A 1OA1A 1THGA 2OOKA 4QBTA 3W7BA 2ZWAA 1XCJA 2P9GA 3NEYA 4PXYA 2GA9A 5LQJA 4N49A 3NBZC 3RGWS 4ECYA 2NVUA 3VH1A 3RUPA 3NHMA 3NORA 3TM5A 2ZSHA 1NOJA 3CC8A 1KQPA 1NVUQ 2CXXA 5KQPA 4M8KA 1GPH1 2BR3A 1NW6A 3K5WA 2J41A 5KKAA 1XPUA 3N2YA 1G291 1WB5A 3MNFA 3NGXA 1VCOA 1WMDA 3F9CA 4J94A 5LMCA 3H40A 3INYA 2J87A 4NOMA 1TYAE 1Q74A 1ZAUA 3S8MA 2CKZB 1M2NA 4HDRA 1T5DX 2XE7A 3IV9A 1POXA 4MP6A 2D5BA 4JX9A 1U7DA 3W4JA 1AK1A 2XYQA 2WPNA 4DR4B 3R76A 3IBYA 4NBKA 5C5CA 3T7JA 3QE9Y 4XR9A 3LTNC 2IODA 6LDHA 5E8RA 3EF3A 3DE4X 4A3MG 1POWA 1TYEB 2NTYC 2C4UA 1M74A 1IBRA 4K0KH 4KGVA 2GVDC 1H5QA 3M89A 1T9DA 4PAOA 1ODIA 4HNHA 1NMZA 4KHZA 1TO2E 2VDWB 4M89A 3VTKA 4Z8YA 1RQPA 3L3BA 1L0BA 1XEWX 2X1LA 4UHBA 4WK4B 3LJKA 3TGWA 5K05A 4IS2A 2GBLA 3OPYB 4YGYA 5LSAA 2B9EA 4ZMRA 5BT8A 1HDRA 1V2GA 5GOTA 1PR4A 2DKNA 2P5SA 1ZW1A 3V7NA 5B1EA 3DC7A 3DWIA 2UXBH 2PZEA 2WVJA 3GR6A 5LNK6 3FCEA 2GJ9A 3GVIA 3GEMA 3RT9A 3VM6A 4ND8B 4PZEA 3O8NA 3F1LA 4LF5H 5KFVA 1AE1A 1BCSB 4PLCA 4Z4IA 5DNCA 3WL3A 4BQQA 1G17A 2PSHA 4CIWA 1TM2A 1IK6A 3RROA 2HLHA 5CFQA 1GO2A 3JAMA 3CKMA 1NX6A 5CM2Z 1H5NA 1CETA 1MAUA 2G17A 4LXHA 1WDMA 2HRBA 2ORIA 4Q4AB 2CB0A 3AJDA 1E2FA 1EWRA 3P94A 1Y1VA 3ZEIA 3LMLA 3TEMA 4D41A 2HBRA 2H4WA 5DK6A 1JU3A 1YOVA 2GASA 3X1XA 1DBWA 1TC2A 4YR7A 2I2WA 3TOSA 1E2IA 5AJXA 1OI4A 5DPMA 1ZOOA 2OLKA 3AILA 4FD2A 2C3OA 5D3MA 3WLJA 2J0UB 3ZXSA 5AWFC 3M1IA 1QRDA 5JJCA 1ID8A 2PCLA 2QL9A 4B47A 2NU6B 3KIPA 3U4MA 1CSEE 5I6DA 3CA8A 3C2QA 3AG5A 4ED9A 3T3MB 4I55B 1MJNA 2ZWIA 2B1IA 2VAXA 4Q19A 2QXTA 2H1HA 5JASA 5FBVB 2W6QA 5L4SA 3G5AA 5DN6A 4BLPA 3HVJA 4OIFA 3RC8A 2PMBA 4RMHA 4RPLA 3ZLBA 2HPZA 3JD4A 1QZXA 2AG6A 4A03A 3PR5B 2CNOA 4X54A 1P2UA 1ZH2A 2ACEA 1NOKA 3KHSA 2JEOA 4WOKA 3TD6A 5HGJA 3AIIA 4EA8A 1W94A 1DRWA 1PBNA 1RKXA 1TVCA 3WBKA 1JHYA 2LR0A 1J0AA 2UZ1A 3WNQA 1H69A 3QMVA 3F5SA 3JX9A 3N1UA 3LWDA 2CHQA 3TY8A 1BGWA 3GT0A 1ZIDA 2EJTA 2WKQA 4I4IA 1JH8A 1Y1QA 4LDZA 4K8RB 2R44A 1OH6A 3C3EA 2OB2A 1EB8A 3WK8A 2NACA 3SZGA 3DB2A 4RIEA 4U02A 5CJ2A 3RJ5A 1Z37A 4GZ3A 2NYVA 4KQGA 1XZGA 3LT4A 5EE0A 1YAJA 1R5JA 1RABA 1Q21A 5P8WA 4J16A 3JVVA 4PLVA 4EG7A 3A9CA 3I64A 1DS6A 2YS7A 4H0NA 1VIMA 1E2KA 1XKTA 4C4PA 4KQJA 1GIAA 5FNVF 5IAJA 3LQQA 3ZZ1A 4BP3A 3WNZA 3GGJA 2VF7A 1QYCA 3D6JA 3LA8A 5DYIA 5KUTA 3VNNA 5SY4A 5I5XA 2WNSA 2YWJA 2E2WA 3P97A 3LDAA 3FFAA 2CUNA 2ZUBA 1RYRA 1W6UA 3ZG6A 2ODTX 5T57A 1QF9A 4Z53A 3CX4A 4BMPB 2EATA 2RK4A 4YJ2F 3A04A 2B25A 4CQNA 3DD1A 2ZI4A 1TFUA 3AEZA 1Z0SA 3IEPA 4FYJA 2JF0A 1S2DA 1JQ3A 4BC0A 3S2SA 1GUAA 3NALA 3NNNA 1PTKA 2C0PA 1Q84A 5F1PA 5CDTA 5JY1A 3ZU3A 1Y33E 1DWQA 3G5UA 3G9TA 4GEKA 1S03G 3WLEA 3G3EA 4B2LA 1F2VA 4EL0A 2F4NA 5B4UA 1MGPA 4G0OA 5DN9A 3UYKA 1PUIA 1I4DD 4N3NA 3L1UA 2ERYA 4HB0A 3DEFA 4YRFA 1ZVMA 3C5HA 4K3VA 1IN4A 3FWPA 1DZ3A 3RFFA 4B2IA 1YF3A 2GPBA 2HRRA 3ICCA 4UQPA 2D00A 1DE0A 3LS2A 2EKDA 2IZ7A 4BIMA 2FQYA 1QLWA 3FCOA 4DRXB 1U3WA 2WJHA 3PRHA 3RU9A 4I50F 5GPBA 1WXEA 4FK8A 1D9XA 3EARA 4YACA 2H4JA 2RHGB 4WHMA 1SQ5A 5B58C 5J4VA 4OM8A 1N5LA 1TVMA 3C3DA 4E5KA 2P30A 3RS3A 5KTOA 1YJQA 2R6CA 4Q1EA 4R9SA 1IXRC 4F56A 3N8GA 1Z34A 1DFGA 5FAKA 5EWGA 3V7FA 3C3CA 4CNQA 3MBIA 4K9LA 1PWEA 4MV7A 1W9MA 5HM8A 1ZESA 2GZSA 1KMMA 4ZHQF 3HA5A 4HGYA 4C4AA 5EJEA 3GPDG 3W5IA 4EH1A 1YR7A 4ME6A 3C15C 3PQ8A 1TF7A 1NZFA 4B7UA 1IONA 3PWSA 1TGVA 2KBFA 1UXHA 1O6ZA 4NFHA 1R64A 4Y9UA 3WRXA 2JI8A 1P3Y1 10MHA 3V42A 4ZVPA 1QKKA 2Y93A 4AJOA 3O84A 3PB3A 5KSWB 4JXKA 1SOVA 1KY4A 3EVTA 1T5TA 1EUZA 3PR2B 5HUHA 1SUCA 3V1UA 5KTYA 3EIUA 1RMQA 3O0DA 2IOFK 1X7WB 1A76A 1RHJA 1RVDA 3P9QA 5DT9A 4EPRA 4R5MA 4O1HA 3H99A 1FYEA 4I4TB 3BKWA 2BEUB 2CFTA 3QMPA 2OBFA 1HEIA 3ZI7A 2H00A 4MICA 3VI4B 1CJKC 4MR7B 2CNBA 3UC9A 2CMGA 3LE8A 4U2GA 1JAXA 2CY0A 2NT4A 2WJZB 1T0UA 3KVRA 3WK6A 1IAVA 1Z3CA 4EZBA 1ZK4A 2FPKA 5AJZA 2K2WA 4FX5A 4R3WA 3VDQA 1D07A 3OQIA 4CKEB 3A05A 4H15A 3THWB 5BR4A 3RYHA 2VJNA 3MHTA 1EH5A 3FMFA 1W29A 4KN8A 2GKGA 1BJKA 4UTZA 3ZCSA 2CCKA 1BX0A 1S4MA 2FLNA 1P61B 2X42A 1WMFA 4FFPA 4KZPA 4QOGA 1A4IA 4EUNA 2LDBA 1DEKA 4Y0AA 3GJ3A 1GU1A 5BRNA 5IJ9B 4JELA 2YVKA 2JGDB 1RZ3A 4UULA 4EGSA 1GL6A 1NW4A 1OV4A 2ZM6H 4Y7DA 1MABA 5M3BA 1SUWA 3G5MA 1V71A 3QXSA 4D8XA 2AGQA 4GS5A 5A7GA 4CL0A 1SC9A 4GL2A 3DE3X 3MIZA 2XKKA 2UYHA 4FHZA 2IYRA 3FFBA 1C7IA 3QVJA 3B3QA 1NTRA 1ZD9A 4JJ4A 3HGMA 5ADUS 2I6XA 3AC0A 3G2IA 3EGOA 3I45A 3WZ2A 5ESRA 3EXHA 4QUBA 3KKEA 2X0EA 5F4ZA 5GZ3A 2L42A 2BMFA 4O3PA 2YYYA 3AO0B 1NW3A 4INPA 3KJIA 4X91A 4MIEA 1NI3A 4HXGA 4RVNA 4IRKA 4F9FA 4C2MA 3TAXA 2RHRA 3VNSA 4D44A 3F98A 4M0PA 4ZVMA 3I28A 1TUBA 5C3EG 3I4CA 3LK7A 4GOOD 3FBWA 2RBGA 2QX7A 4ZI7F 3QFHA 3MC1A 3VJRA 1Y6GA 1OYOA 2AFHE 3WB1A 1XRNA 4QRIA 2PO7A 1LQUA 3HP7A 1LD3A 3WYDA 5KJCA 2FY8A 2ZRPA 4KREA 1WZCA 1B6GA 3DDSA 4RJLA 1UZLA 1L5ZA 1WRVA 2VPXA 4DA0A 5LP6B 1LPNA 4MPPA 4BDTA 4IHJB 4M87A 1CS0A 1ODTC 3NNSA 3UT6A 4D9CA 3PWKA 3UHPA 4E15A 1TGYA 4DR2H 3GP3A 3SNHA 3NANA 2IQIA 3AR8A 3NRCA 3U44B 4WWHA 3H0GA 3U40A 3G6WA 3E6AA 1CUIA 1ESEA 3IRVA 3D8HA 2WYOA 3ILVA 4DR6H 1O77A 2PL5A 2FK1A 3F3MA 4WEQA 4A0SA 4QPPA 4DV0H 4LOAA 2XV1A 1E32A 1WTAA 1IY1A 4GGMX 4Q3NA 1P5RA 5I7OA 1EX6A 3PNMA 3W8RA 3B6MA 1O95D 3DLHA 4J0QA 3RQIA 2ZU0C 1LDYA 2FKNA 4U7TB 2EC5A 2O5CA 2GJSA 3P9PA 3LP5A 2C28A 5H1YA 3HM2A 5L1IA 1XZNA 1URPA 1E96A 1CUZA 3MRXA 4RM2A 1EDBA 4JQOA 3P2KA 1QZTA 1L7EA 1GO3E 2D13A 1FNMA 4I66A 1LU9A 4INAA 3IDQA 1G18A 5BV1A 3R6DA 2CNUA 3ZGZA 3BBLA 4X1OA 1C29B 2EFDB 2WTNA 5HF9A 3CX6A 5ARCA 1U2ZA 4MVJF 5K0CA 1N2CA 2G4CA 3QU9A 1H2AS 2PZJA 3HR8A 1V6AA 3PTLA 2B94A 3C7CB 5DTMA 1JWAB 1I2AA 1YZUA 4E6EA 3L8DA 4MW0A 1W46A 2QPOA 3WHKA 4CLRB 4QDJA 4PQRA 1G5QA 3KG2A 4LOHA 4O25A 3GPCA 2Q0XA 3R3WA 5FA8A 3ANTA 2W8KA 3MJCA 5KOHA 2ADMA 4UUOA 2BFAA 1NX9A 3CLSD 3V80A 1TQ2A 5HR5A 4IUCS 3DW3X 1K0UA 4DL2A 4TQUS 4W8HA 3P26A 2NTNA 4EK9A 4WKOA 5KFEA 2HLDD 3AHCA 1XDDA 4AKSA 3Q7PA 1EVJA 5KJ6A 5DLDA 3KBOA 5JZ9A 2GEKA 3A3KA 1UPBA 3QVXA 2O03A 2A5YB 5KFLA 1US8B 2W57A 4OYHA 4BEJA 2Q5QA 4US0R 2PUAA 1BHSA 1W0CA 4JKYA 3QX9A 3VC7A 3JARA 2AJTA 2VHYA 5SZIA 2OH2A 1GDHA 3EXEA 2CZCA 2H3HA 2ALJA 1G20E 1GNSA 3A9UA 2WI8A 4LFCB 3HJAA 4LXGA 3RQSA 3K2IA 4Z1MA 5CUQA 1X9NA 3TI9A 3IAUA 2CMFA 4I2NA 2W70A 2A5DA 5M34A 4FYMA 1BCRA 2HWXA 1K27A 4FKMA 4FLMA 5A2QW 1DEXA 3EOAI 2HWWA 3TRIA 2GEUA 4IGEA 2GCPA 4COKA 3PEUA 1LNQA 4IIJF 1G5RA 3GCWA 5G3ZA 3T7TA 2ZQZA 3ON5A 5DYWA 1ONPA 3W1GA 3ZHRA 3NHSA 1GNPA 2NYRA 4E6PA 3IBSA 2ZULA 1G6Q1 2Y92A 3ORQA 1JTFA 2EZ4A 1PFYA 5C1BA 5EJ8A 4AJPA 2G67A 2MU1A 5DGCA 5SZJA 1J23A 1ZRHA 1IVSA 4J29A 5CLJA 5EZYF 3BFJA 1SU4A 1JZQA 4OI2A 1SUSA 3S8YA 3UBMA 1Q19A 2V96A 3U0GA 1Y34E 2ZKLA 4EPYA 5B12A 1B74A 2CVFA 2HDWA 1Z8FA 3E2IA 3G17A 5F35A 4GPZA 2XNDD 3PN1A 5FA5A 3I9V6 1PZNA 3PLNA 2KBEA 3AR7A 3OD5A 4Z4EA 1GTSA 4LJAA 4CFYA 4YAOA 1HDOA 4AK9A 2W2PA 3I01M 3GO4A 2P6UA 1FJGB 4N8SA 1VSQA 5JU6A 1EWYA 1W0JD 3QWAA 1RXUA 1MJ5A 2VDNB 1EFCA 4HZUB 1SA0A 2O2EA 4QPJC 2H18A 5AVKA 1FFEA 1JHOA 5D51S 1WO8A 3UHOA 2JFWA 2C5EA 3QQPA 1JHZA 2GA8A 4DCOA 2J9ZB 2NN3C 4G5YA 3CSWA 1Z7GA 3HCAA 4MUHA 4RNCA 1VBGA 2XCTB 2Z6UA 4K46A 3STYA 1X86B 3UK6A 1L5KA 1BE8A 2VA2A 3DZDA 1SEIA 3LW7A 1U7PA 3HYSA 1YI1A 4IIBA 4UARA 5FBKA 4KCGA 1RRCA 3G6YA 4ENVA 3HL0A 2E1PA 3HDTA 2R2GA 3BHJA 3Q7RA 3WLNA 4ASUD 3ZU4A 5AJVB 3JPWA 1AHNA 2O20A 4NG4A 2YNMA 5KSPA 2N0SA 1PJBA 4BNVA 3OCXA 4L0QA 3AOEC 3MZ0A 4O59O 4PQGA 4KGZA 3N2NA 4CRWB 4QC2A 4W5WA 1NNLA 4ZT7A 1XEXA 1C30B 3VPHA 2P79A 3EDRA 1EKXA 1IY2A 1KZ4A 1ENYA 3NBQA 4YA6A 1ILEA 1NVAA 4MJXA 3L49A 2WTXA 5AW4A 1GAQA 1C7FA 4UXIA 3ZGXA 3NYRA 4WLUA 1TU4A 3O94A 2R97A 3RS5A 3OX2A 1FS5A 2C99A 2H8KA 2GI4A 2A9PA 3A6FA 3C8UA 1Z8HA 3C8HA 2ADFA 4WK2B 4FYWA 2QGFA 3D4OA 3TTTA 4BVHA 1HE1C 1IN1A 1DBVO 4B5LA 3TOCA 1SU7A 3WGOA 2QEQA 3IR5A 5G0SA 3BTVA 4M88A 3E61A 2WG1A 4P0TA 2OXFA 5KFQA 2RDJA 2WT4A 1PN3A 2V8BA 1F6BA 2V3VA 1PUXA 3CR8A 3RNLA 3TQRA 5K5EA 3ZZ0A 4DFDA 5JS8A 4FU0A 1CJCA 3R6WA 2H65A 5EVJA 2AQKA 4FI3F 4IDPA 1T1GA 5KFNA 5CW1A 1Z7WA 4KUHA 1DIAA 4MUFA 1VHJA 2P9EA 2PQ6A 3FDFA 5DFAA 4J0CA 2JA5A 4UUPA 3U6KA 1U1FA 2VSNA 1GDTA 2FZGA 2F17A 1A9RA 1PS0A 1N6HA 4LYFA 3WGZA 4AWBA 2J3QA 3CBGA 3VQTA 3U6BA 1ZHSA 3N59A 1ZD5A 4E33A 2W2LD 1UWLA 4P7KA 5A3QA 4O84A 3BFPA 3G82C 3KLOA 3AKEA 5ALXA 1P77A 2C98A 2FFBA 5JSKA 3UJDA 1CQIA 3SEZA 4N12A 4Q3AA 2RD2A 3D2LA 4B48A 1Y8CA 5GJVC 3BA1A 2XA2A 1MU0A 1RZVA 2BRUA 2GBGA 1RRFA 1QP0A 1NSYA 4QOEA 2JCGA 2OCIA 4PO8A 1UMBB 1M1UA 2JGJA 4ECAA 3DEKA 4EI2A 4F3KA 4KDCA 1OC4A 3I1JA 4PQFA 4Y2XA 3CUVA 1ZXXA 1IUOA 1M83A 4PR0A 5BR7A 1LPSA 4GLLA 3JQGA 3RV3A 2FN9A 4LDAA 2J08A 3DF9A 3FIUA 2R7AA 1KYTA 1Q1NA 4QDXA 5GM1A 5CVUA 5F3WB 1BDHA 5FPPA 3GV5B 1P0MA 4EHNA 4X66H 1FP1D 3KUXA 2HHHB 4NABA 1NVVQ 3MTIA 3QWFA 5TR9A 3L0BA 3RS2A 4UCVA 5MGBA 3FWZA 4YT2A 1W4BA 1I7DA 1WH2A 4AO8A 3FKSA 3CKLA 2C77A 1WUIS 3KEOA 1NIPA 2HF8A 3LI2A 5F7ZA 3I01A 2IRWA 2ZITA 2VJMA 4YJ2A 1ML3A 5HNEA 4YPFA 2VRWA 3EUFA 1P74A 3JVDA 1RCTE 3VH3A 2P4SA 2UVDA 1WKVA 1TUEA 1YFZA 3UWSA 3RAEC 5KHOC 6REQB 3R5JA 2VUGA 2EYUA 1PR6A 2ZYGA 1MTZA 2C3YA 3NAGA 1E1LA 2X0FA 4Z5XA 3QLVC 2XZLA 1DWUA 4D96A 3LYUA 2B8JA 3GGDA 4WJZA 1N3YA 2PS1A 3AEKA 3EF1A 4UU1A 3GV7B 3BQ1A 4KAAA 4H0CA 1CVIA 4Y6QA 1V8OA 2BI4A 2QJRA 1N5OX 1JIVA 1W44A 3GH3A 2GZ3A 4NBSA 1QSGA 3WLOA 3LX8A 2I4OA 3K6KA 4KIGA 4DLKA 1U1CA 3OQ1A 2O2SA 2P2YA 4DQLA 2QQ5A 4M1OA 1QHHB 3FAZA 5E6UA 1SKBA 5KPDA 2PX5A 3OECA 2RHOA 4LJ8A 5BWLA 3T5AA 1EM8A 4LMPA 1E9AA 3EXG1 1QHSA 4X8MA 1E9VA 4H35A 4QEDA 3N2EA 2C1EA 3UJ9A 3KXDA 3AF4A 3OURA 4DMKA 1WHTB 1RM3A 3KL2A 2AOVA 1E3SA 1VBMA 4ZKDA 3PLRA 4MV5A 4P58A 2E2HA 3V8VA 4D4KA 1A9XB 1P2GA 4RDHA 5TEWA 4MMYB 3D3EA 2W42A 3VYVA 3NZEA 3GRPA 5SV2A 2EBUA 2FSVA 4MRVA 1S5PA 4O7NA 2XYGA 2YINC 4MUYA 3TLBA 1M8PA 2Y0DA 1PGNA 4YT5A 2GFQA 2XQFA 3VU1A 4F11A 3MQ2A 3LQ4A 1L5LA 1A71A 2V54A 1EP2B 1C0PA 4RQBA 2I2DA 1HNXB 2IXAA 2VVTA 3ER6A 1HGXA 1O95C 4BVLA 2VJCA 1VPWA 3KXLA 4ON9A 4LCJA 2CLKB 2CF6A 1VPVA 2R4TA 2PLWA 2EWMA 1SOUA 4ND3A 1AK9A 5IAOA 2J3MA 4KO8A 1AO0A 4IX1A 4JBXA 3EYWA 2Q99A 3TJMA 3KTDA 4KK4A 2R87A 3PA8A 5CJJA 4LY6A 3U80A 3HCBA 4QOJA 4OHZA 2RGNC 3SSOA 3KKZA 4B0PA 1WSCA 3GEEA 4Z4FA 4MVXA 4U3JA 4B3RH 2G82A 4R31A 3TI7A 4D9FA 2ODQA 4KKXB 4JC4A 1HNZB 1O2DA 1E5LA 4HAZA 2WMOB 1C41A 4JX8A 3NHBA 3RFUA 2Q0SA 5KT5A 3FDXA 3P32A 3HH8A 4OXKA 4RFLA 3H9CA 2W93A 521PA 2C54A 2C04A 3JTEA 1OXTA 5K3DA 2O8FA 4F4JA 1U0NA 3KWFA 4YH1A 2C1ZA 1W75A 3I8OA 2CNDA 4A6DA 1DO2A 1ZU5A 2C42A 2CL0X 3JWIA 4DR3B 5IJ0B 2BF4A 3P0IA 3U4HA 4EBDA 5KFKA 5C1PA 2D2FA 4UDXX 3FMIA 5E0OA 4TKVB 1KU6A 3CLSC 1BFUA 1F2UB 3L6DA 1EVKA 4XQ0A 5EHQA 3OZGA 3OZCA 4A3JG 1ZHFA 2PG3A 2GZ1A 1CKNA 3IXQA 1CKOA 1PK7A 3MCWA 2F62A 1T4BA 2RARA 2HDHA 3IIEA 3FPBA 3GEBA 2L19A 4XRRA 5BRAA 1W59A 4P82A 3AXSA 3TRDA 4B80A 4JLBA 1UH5A 1E0DA 4PLHA 3M1AA 5K0NA 4BNUA 2RC6A 2VK8A 5JXHA 3S1AB 2W4MA 1K88A 2A30A 3BQ9A 2X8AA 1ICEA 1BU8A 3RB8A 5K0ZA 3WB2A 4KP7A 1N5MA 3UEOA 2WVHA 4IX9A 1Q0HA 1OOEA 1Z4KA 1XZEA 1LLQA 3Q2KA 2JG3A 4HXEB 1A8SA 4G5GA 1DFIA 4G1BA 4CT4B 3PNYA 2CFIA 3T9CA 3UAGA 3R8XA 5AVRA 1M6HA 4W5QA 2WOJA 4FFVA 1DG1G 2XTNA 4FSXA 2QVBA 2OYRA 4ARUA 5CNIA 5L3SB 3GJ8A 2VK1A 4GW3A 3U7EB 4R2JA 4KYVA 3ITKA 4RD3A 4X63A 2ZTMA 1DC5A 4ZOEA 1O6GA 4N18A 3J81A 1ZWLA 1P8JA 3EF0A 4Y1FA 2R1UA 1LB1B 2XF2A 5GONF 1HFJA 3BERA 2XQJA 5HBRA 4TV8F 3W7AA 4RZSA 3QM1A 4DQVA 3IULA 3TZCA 1Z22A 2UUCB 1G66A 2X0RA 1GTJ1 4M8IA 1GRRA 3P8ZA 5E9WA 4DNQA 4G9BA 2MINA 2YQZA 1VMIA 4U2CA 3UCEA 1QM5A 5C8YF 2J5KA 2SHKA 3MA0A 1EQUA 1ZSYA 4NLGA 2X6QA 3PE3A 4KPUA 4G1EB 3KJQA 4GU5A 3AU9A 3T8YA 3DFMA 3HMQA 4TMKA 4IBOA 2J6UA 1DAKA 2EQBA 2ZU6A 2BCEA 1EDOA 3WXBA 4PF1A 4HYQA 1II9A 3BEDA 5BURA 1SKYE 2GYWA 1EMDA 2EIYA 3ZJ4A 3HS3A 1WEKA 4ZYXA 2O2HA 3MTDA 4UASA 4Q6WA 1CS4C 4PNHA 5AH0A 1J9ZA 4FB4A 4DL7A 4W82A 4LGMA 4M0LA 4Q4CA 1YZNA 1XRMA 1BN6A 2IU6A 1QK5A 4OX9H 3U09A 1YJAA 1LLFA 1EWVA 2QE7A 4F8JA 1C3VA 4R16A 4YC7A 1I4LD 2ZSFA 4LBYA 4XCQA 1CEYA 5ARDA 4KXVA 3HGTA 2YX1A 4KDRA 3DFIA 4A6PA 2WB2A 4QBGB 2ZIEA 1Y5NA 2ZYHA 3KXKA 4BFWA 3UOAB 3B5IA 3V1MA 1EG2A 2H0QA 4AURA 4EDFA 2EJCA 2B1QA 4GLWA 1EP3B 2AF3C 4Q00A 4L16A 1GZDA 2PJDA 2BV3A 5M2QA 1XYYA 3GTPA 3U2QA 1FJ2A 2HX1A 3K30A 2GN0A 3EGDA 5HFNA 4CKZA 4K28A 5KNBA 1SOAA 4DTIA 3CZAA 4HPWA 1Q57A 4JI8B 3IOMA 3JQ6A 3PYMA 5EXTA 2HVQA 2HQSA 3O4RA 3TINA 2GZHA 3UWPA 4G84A 4K9DA 3KSUA 3EVCA 3A27A 4A5SA 1BU5A 1KGDA 4NMMA 5HWSA 5JDIC 4MRMA 4OJMX 1GPMA 4ND4A 2ZZKA 3SEFA 4JN6B 1CUAA 3IAM1 3BQ2A 1E1YA 3ZVLA 3G2OA 3INGA 4I3FA 3BHNA 2ZJ3A 2QTGA 3PDCA 1WXIA 1SVNA 3CF6R 3FN4A 3ZWXA 4RZUA 2ZSUA 5DLPA 4N5DA 1XHFA 3DE6X 3JQ8B 2QN9A 1X38A 1IZZA 121PA 3ZLVA 2DWOA 4WY5A 1XZBA 2VA9A 4X1KA 4U7CA 4YCCA 4MWEA 1IUNA 3KPWA 4LWQA 3BK7A 1IN7A 4GRIA 2WIBA 3AIOA 5FV7A 3L0DA 4IG4A 1TAQA 1KQNA 4M76B 1OVGA 4TQGA 1FFBA 2GNAA 4MYRA 3UANA 4EMBA 4FBTA 2ON6A 4JFAA 5ITSA 4TZ6A 2XB9A 2OSBA 2OGUA 3TW6A 4FHEA 4IFBA 3KJNA 3DVSX 4WXMA 4JR2A 4QGHA 1RJQA 3CRRA 4HC4A 4R8UA 2G3YA 3GK3A 3LY5A 1PFWA 5LYJB 3UOGA 3KPUA 4PHCA 4ENRA 1R9MA 2GZDA 3KQLA 2QIPA 3LHIA 3PJFA 1NKVA 4C6TA 1MH9A 4YP5A 2BELA 4IWNA 3Q1LA 4F4UA 1XRPA 4LJ6A 4BO7A 1DG9A 2FFRA 2H51A 2KB0A 3A7DA 3Q7TA 2G9RA 4RDIA 1TJ5A 3UCXA 4UCXA 3HM9A 3W1WA 4N6GA 2Z4SA 1SC1A 5JJBA 5ITZB 3SYTA 5KYUB 3EA5A 4EB0A 3NBFA 1VP9A 4HDOB 5JAMA 4I9GA 3NHZA 2FPIB 1KEKA 2Y0BA 4C29A 5C8DA 4O6VA 2XGJA 5HFAA 1R1DA 2WIDA 3VHLB 3KQKA 3ZGNA 1ULTA 2AW5A 1FVXA 1K3FA 2BZGA 4JOQA 3DE7X 4KO2S 2QN3A 3QLEA 4H3SA 1YB4A 1W2HA 3X2SA 4EG1A 1WSAA 2BE7A 2LE0A 3QVUA 5KDDA 4D9NA 3PXAA 3WA7A 2FMUA 3QKSA 3A9WA 3G59A 2YVLA 2YZKA 1T2AA 3OJCA 1JHUA 4N03A 4RKEA 1OX4A 1KP9A 3EH2A 5L7TA 1N6KA 2R5FA 5JH7F 4AYBE 3DM5A 4PICA 2QW8A 3CV3A 1XLTA 3NTLA 3P1JA 1UJCA 1VSTA 4YV0A 1TVKA 4RHFA 4QDUA 2I4RA 2G1AA 1ZJJA 2QVLA 3FLEA 2ZI9A 5TGTA 3EUEA 1T9GR 4QHYA 1R4AA 3UYYA 1YR2A 5JLAA 1J56A 3I0NA 2X4IA 3MWLA 1E1DA 3LV8A 4CLEA 2W2XA 3ENVA 5B6IA 3JRNA 2PKRA 2J0QA 3MT0A 5F9MA 4QTTB 5BR1A 4PX9A 4JYMA 1EIWA 4FFWA 4NFSA 5HZGA 2HU7A 1SQ6A 2BFBB 1E9DA 2Y71A 2VDRB 1P16A 4RF3A 3R3VA 4BO8A 2BEWA 1SXJA 4MINA 1P0IA 3IX7A 3W5SA 1D2NA 4DV5B 3NBZB 1HL3A 4ZK6A 3RM3A 3EFHA 2C5AA 3T3IA 2BGRA 3OF3A 3EXIB 4PHTA 2BQ3A 1K2VN 2UYQA 3W2IA 2I29A 2GKOA 2PEYA 3SM9A 3U39A 4AQYH 2VNSA 4KN6A 3UGKA 2BMEA 3M9XA 1LJLA 1QV7A 2VJBA 3AU8A 4QYXA 1G3RA 1HBJA 3FKIG 4AYXA 3KAPA 2B8TA 1M0TA 1CFJA 4RWZA 1GFWA 5HA5A 5KWSA 4JCOA 3JASA 2B37A 4HNAA 1RC1A 4M22A 3U5ZB 2A9QA 1KJ8A 4LHXA 1RXYA 2Y9PB 4U7PB 2WAXA 1SK8A 3RIGA 4FS2A 5EEHA 3A3PA 2GZAA 3W9BA 3C5EA 4NJEB 1U2SA 3T0GA 4V0NA 2V0GA 3D6NB 1W30A 1XVAA 4B6SA 3O3NB 5I9TA 4DG9A 4JH0A 2J59A 6GPBA 4JBNA 5I7RA 1N5DA 3O75A 3SS9X 5F3DA 4BMCA 2DECA 2AOUB 5L4LA 5DOZA 2WG0A 4DABA 1C1XB 1OGJA 1VLMA 2A7QA 1FRFS 2OO3A 3W8EA 1J5XA 4HRXA 3K5HA 4TUYF 3CKYA 1RJDA 3GT4A 3A2KA 2FN4A 3DVLA 3PWTA 3Q98A 4CKWB 4CBVA 1LRLA 5K6AA 4YCNA 4L0MA 5KFSA 4IQ8A 2YWDA 1NULA 2PXXA 4DLUA 3K6SA 5LA6F 1BHO1 4CIDA 2PL1A 4OQXA 3PGMA 4DCMA 1S6YA 3O38A 1V11A 4DV7H 1CEXA 1RYSA 1M2HA 3EPJA 3PIIA 5CVTA 4MV0A 2PUWA 2XRYA 1WB9A 5IF9A 5DTQA 1Y8ZA 1BYIA 5DSTA 2XMBA 4GLBA 1IOVA 4WRRA 4GWLA 1N48A 4R1MA 1TNDA 4Q9HA 3HO8A 4YHBA 2VEOA 1QNFA 4CEHB 3CU5A 3SMVA 5BQ5A 2X8BA 4P53A 4EAQA 5K0FA 16PKA 3CVOA 2ZDGA 1PTJC 3LQFA 1IZ7A 1DINA 5EEGA 2BMWA 1WXGA 3ID6C 3EQZA 4H6VA 4PSAA 3U7JA 1DEHA 3IDSA 5FOVA 3W06A 4Z7OB 4W7IA 3G88A 4R7ZA 3AF5A 4FVTA 2I6UA 1MTOA 4KO3S 1RS0A 2PL9A 2OBLA 4BMSA 2H5EA 2FOIA 3FUUA 1KAMA 1EGVB 5BYKA 4DLVA 4K5QA 4RHYA 1XCOA 6CHYA 2QTTA 3TO5A 4REOA 3P9YA 4ID3A 1IK4A 2B1GA 4PZ9A 4BJ3A 1OB2A 3FNBA 1M34B 4B3IA 3IJ5A 1XNQH 4FFDA 1Z4MA 4O3OA 3E82A 2GXSA 2IWHA 3W6ZA 4F06A 3VVCA 3HCRA 2Q3JA 1RVV1 3VR6A 4FCWA 4NBNA 4P3XA 1CIVA 5D6OA 1DAIA 2C96A 2R1TB 2J9YB 3IHTA 4Y9DA 2Q46A 1TEHA 2B34A 1E98A 5DMHA 2QQGA 2XDAA 2DCMA 4R68A 1YVDA 3G0CA 4L75A 4XRGA 3KRTA 3IKJA 1DDGA 3ETJA 3AESB 4HL6A 3ECAA 1HY3A 1N8NA 2J5XA 4DTCA 3F6SA 5I5WA 4TLDA 1FMFA 4DB4A 3AP3A 4RK1A 4DL5A 2GUWA 4QGBA 5K6RA 2AJDA 3GWZA 3R9IA 3VSBA 3BFKA 1JRLA 1TEVA 3GFRA 4GM0A 1IN5A 1T24A 3HLYA 3RTBA 1JQAA 4I99A 5GM2A 3EVAA 4DUYH 3NWJA 5FLKA 1BYUA 1BGXT 3GIJA 5EMKA 1PD0A 4CLHA 5K09A 4FUQA 2OPBA 4RTKA 2XKJE 4BO9A 4IIGA 1QP4A 2BFFB 2CXTA 3NASA 4BUJA 3NWEA 1C50A 1C1YA 2R68A 2QRQA 2ZTHA 3ABZA 4J6FA 4F1KA 1DNPA 2JEFA 4TGLA 4B3TH 4M4SA 4TMYA 3U9SA 1UMCA 3S1SA 3L8MA 1A3GA 4O7ZA 2POQX 3OM8A 3DV0B 4MAFA 2BI8A 3OFSA 2V97A 5FCDA 2IYQA 4N82A 4W4TA 4JU9A 2FFJA 5JPIA 4C0XA 2IYLD 1U4OA 3VA7A 5J9FA 3GNQA 4GOLD 4ARCA 5A7HA 3OHMA 2WF9A 3ZKWB 1UAAA 4RSGA 5H4HA 1Q0SA 3HU2A 4X3PA 2CNKA 4XKJA 3MWYW 5AXDA 4GLFA 2VUUA 3OFVA 5JG7A 2XOKD 4ROTA 4UKDA 1UT5A 1L1RA 1GU0A 5EJGA 3U3KA 1QYXA 4X3OA 2R00C 4XYLB 1MC5A 2I2FA 3KPJA 3HY6A 2CLHB 3X1YA 3KL4A 3IEMA 3VV3A 3HPQA 1ULUA 3HZOA 2DFPA 2ZT6A 3ESAA 1DU4A 2DGDA 4ZHSA 3F8TA 1GGNA 3BDAA 3NJRA 5BUSA 2OQVA 3SFTA 3FZQA 2RHHA 1W1IA 3IUSA 5CFNA 4G65A 3W3ZB 4ZEXA 2WTMA 2WA2A 3UNXA 1QFMA 1JQDA 4HUQA 4KO1S 4BB5A 3ORHA 1OUMA 5IXJA 3RABA 4DUGA 5EA2A 3KFXA 3R20A 3W8DA 4Q16A 3ICQB 1U8UA 2PGNA 5CITA 1NR5A 1T2CA 4AL4A 4ARZA 5K3EA 2J48A 4CM9A 5H3LA 5AW7A 3QFTA 2E1RA 4DIOA 2B8NA 2QZJA 2HG8A 1B04A 3NVMB 2PX8A 3B78A 5KNDH 5KFJA 4Q1FA 4G07A 3ERCA 1Y1TA 1W9HA 1NQXA 4ZREA 1RI1A 2HGXA 4OQ4A 2JCXA 4L07A 2AOTB 2FN8A 4WGGA 3OI7A 4PPGA 3EAFA 1EXVA 3F7MA 1T35A 1KFCB 2ZI3A 1WVMA 4PPQA 1QIFA 2AFHB 5JQGF 4EJ6A 5KU7A 3K9HA 1WW8A 4V1CB 5CCXA 3RLIA 4M0UA 2XECA 3W77A 4BLQA 1EK0A 2FW1A 3ROPA 4Z49A 3CEPB 1MO2A 1E69A 1QIIA 2ZI6A 3WQQA 2GBIA 2AG0A 3R5TA 3C7DB 4Q7LA 4QXQA 3ZV3A 3CT4A 4NYIQ 1YS4A 2BD0A 2HYIC 3KUKA 4B3MH 1ZQ9A 1FUUA 3L93A 4IXMA 1UXOA 1DTSA 2MT9A 3CWQA 5EIHA 2P11A 2QWXA 3VPAA 1NUUA 4Q1CA 3ZQ4A 4J0GA 2IW3A 1SXHA 3MOIA 5AKIA 4J43A 1JR3A 2YC4C 2XT0A 2UDPA 4P2BA 1TJ4A 1U99A 4D0GA 4RELA 4HXYA 2ZZNA 1ZJWA 1XJ0A 1GOTA 3V9PA 1SUFA 4JI2B 2NO4A 2PN1A 1B15A 1IM8A 3CEMA 3B3FA 1FFCA 2FHPA 2SICE 4OAQA 4UD6A 4BBPA 2A4MA 3NM5A 2J9RA 3NTXA 2ZRLA 1GYFA 3JZ6A 5CLLA 5KVVA 3EGXB 1QFSA 1J22A 4ARVA 1QGOA 3A1CA 3VDRA 1PDOA 1HKHA 2J9FA 5T8KA 4CLOA 3OOHA 4Y30A 3N58A 4CU5A 1R5BA 4JYCA 1ZR4A 2QTZA 4W5TA 5J43A 2H31A 3V1LA 1CUCA 5AW3A 2EX0A 3W1EA 5JFGA 2DU8A 3KEQA 4RW0A 2WFZA 3GG9A 3DNMA 1JBKA 1K98A 5G02A 1RACA 1ZXLA 4AP9A 4JL8A 3COZA 4IO1A 4C2BA 2C7OA 1J8YF 3K2BA 4CF5A 4JODA 5ECGC 1CY2A 4C88A 3QBEA 3INNA 5DWDA 4JI4H 4QGFA 2VQEB 2H1VA 5JC8A 1N0UA 4QODA 2FRVA 2PCJA 1AUQA 1U63A 5AICA 2CNLA 1OD6A 1USUA 3PC4A 1V9SA 4G8BA 3QJGA 1O8CA 3OE7A 3SDZA 3FCXA 3ZS8A 2JLYA 1T2FA 4NX2A 5T7BA 3CF4A 4YXFA 2HK9A 3AL2A 2QAGC 5EZSA 2VF4X 3T5KA 1Z18A 1II8B 2WBLC 4CG2A 3IPXA 2VT2A 1X1RA 1GN8A 2HDNB 5DTRA 4LRYA 4B81A 3L6BA 2C2MA 4OH7A 1W2WB 4RD2A 3Q7EA 3BT7A 2FUNB 2XUPA 5EMLA 1OLXB 1HKUA 4KIJA 1PYDA 1CUVA 3FMPB 3UOWA 1Q6YA 3E7DA 1QQAA 4R9VA 1BVRA 2VPPA 3RAGA 1CF2O 2DETA 4INOA 1AUPA 5T6MA 1F9AA 1YA6A 1I33A 5CX4A 4YDQA 3H42B 3SOPA 3T9AA 3JATA 1RI3A 2G1PA 3ZBUA 1IATA 1UJBA 3MTQA 4QA9A 2XLCA 3W4KA 4C30A 1G20B 3KVOA 1NUPA 5EJ5A 2HRCA 2NXNA 1PF7E 3RBAA 5DKFA 1R37A 3PEEA 1W1UA 3A4NA 3PHJA 2FE3A 4G56A 1NVVR 4MEBA 1ZK2A 1K75A 4XCVA 2P6PA 1DTWB 3AL0C 3KXYT 4W5RA 1PVDA 2BZ1A 1CRQA 1OAOC 1ATIA 4RNDB 4NESA 4X6XA 1OPRA 1YK0A 5IK2D 3E9ZA 2J31A 5CA1B 2HWKA 1D7AA 1QRAA 4KR3A 4JEHA 1ISJA 3W3AH 2Q2OA 3S0JA 3N7AA 2ZSKA 1L1EA 3NFRA 5CFOA 1DAEA 3UB3A 3OO1A 1GPKA 1GT91 3HXQA 3UHAA 1W76A 2V5AA 5AKKA 3C3MA 1OJ7A 3HCPA 4R41A 1EFVA 3H18A 2Q29A 3HSKA 3O9MA 2WSSD 1FS6A 4GE3A 2QTLA 4IRDA 5KCMA 3FVVA 4EDHA 4U6QA 5IASA 1M5RA 5EQTA 3IHKA 1ZINA 3LC1O 1QB7A 4ZDIA 1QCYA 1BH6A 2H4ZA 3VDXA 1RQNA 2YVQA 2OHGA 4DKXA 3CZ9A 2GNPA 4LCBA 3HKZA 1PW7A 4B3HA 2AWNA 3T3PB 1Y3DE 2WMNB 3EBOA 1BQEA 2HU5A 5FBWB 1O96A 3PGVA 3M5WA 5T14A 4NE2A 1NBMA 5A6SB 4CM3A 4B2PA 2Z58A 1OREA 3IUEA 3AR5A 3SC2A 3VNQA 5JE8A 3P9KA 4IIDA 2IUEA 1FS4A 5AVQA 1ZO8A 2JIDA 1L8LA 2EERA 4YALA 3GDFA 2B98A 5HQTA 5TPZA 2GD2A 4HEA6 3A6ZA 3N2ZB 1PZHA 2FETA 5F52A 3ETLA 2IFTA 3CVYA 3H7AA 3KJGA 3GD5A 1EVQA 3LY8A 2NXCA 2AR0A 1IM5A 1YI8A 1R27A 3TR5A 2G6TA 2B6HA 3EPIA 1WCIA 3RK0A 2BGGA 3GAMA 1ZQ1A 5C3MA 3GLHA 3GLFB 4FYYA 4RENA 1NVGA 4WZZA 5CGZA 3UMJA 4K6FA 5KYXB 4UHFA 2HWUA 2ZRNA 2VK4A 1FQOA 4GP6A 1LF5A 4I08A 3E9NA 1PKEA 1OWOA 5BMOA 3SNOA 3K9QO 1F20A 4DC1A 1Z5NA 3EJWA 4HHEA 4O2RA 4NL4H 1U5CA 3OY7A 1SU6A 4D4LA 3PDIB 5EXPA 2O8EA 4RX1A 2C3UA 3GJ5A 4EMTA 3FYSA 5F9LA 1USVA 2PS3A 5TNXA 5JAQA 1ZD8A 1I6WA 3C7KA 1AU9A 4UBOA 3RYIA 4PYJA 1M1YA 4AY6A 3A1VA 1XNHA 3U54A 1D6SA 2XSZA 5AJYA 1YRHA 3UJBA 2E3JA 5KYWB 5F33A 3VHXB 1RBMA 1A48A 3DZIA 3UKDA 1ULHA 3RIHA 1J70A 2IHTA 4YDRA 3ESXA 5ER9A 1P3JA 4CT0A 1NYRA 1KHHA 4IDOA 2FEPA 2OFFA 2IIPA 2RGGA 2XIGA 3F2IA 2R85A 2Q6VA 3QH4A 5G4KA 1XD9A 3JZIA 1NBAA 5LYYA 2YUIA 3V34A 4QNMA 1V47A 2R79A 1GYRA 3DBIA 4MPDA 3GUUA 4RJTA 2H52A 1NLZA 4Q15A 3IQGX 4ZO8A 2ZJTA 1V7QA 1PKXA 2QTRA 1P9NA 1YU9A 3PX7A 3DSRA 4EYKA 1ZMBA 3VJLA 3P45A 1KYQA 4NJMA 3HB9A 3RRYA 2GHQA 3VKHA 1SIWA 2ZUUA 4H1TA 3DBHB 4DSTA 4RYDA 3TLJA 4WAUA 1GUYA 2WFLA 2OK8A 4Z4GA 2HA2A 1ST3A 4LQCA 2H4XA 2R8BA 2ZSAA 2ZS7A 5EIWA 5EFZA 4ZV9A 3FHTA 1NNUA 2E37A 1HC7A 2DFKB 1E5XA 5KSOA 1H8HA 3DLCA 4LNUA 4D3YA 1LWNA 1N78A 1N2EA 4NZNA 1UBFA 2WAAA 4HBZA 4CC6A 1I14A 1V8ZA 2W2OA 4Z6KA 3ZXUB 3ZV5A 1M7JA 2R8HA 3JSXA 5EWLB 3M3HA 1V1JA 2PH7A 2GD6A 2FWNA 3N0XA 4D81A 1AA9A 1R0ZA 1G8JA 4M9XA 1RD4A 2OP0A 3L8FA 3HDHA 1ZM4A 3WIVA 1FVOA 2GESA 4FWTA 4EGAA 4DCUA 4ZDJA 3PJEA 2ZSBA 1S7GA 4JLOA 3L7IA 3CUEF 1RKVA 3F8WA 3UT0A 1JILA 3BABA 5FJJA 4BMDA 4Q03A 4O4JB 1SUPA 3ZE9A 2BFOA 4M38A 2QSYA 4IF4A 2KI5A 4KMMA 4IQGA 2C1XA 2OBBA 1D9ZA 1T5IA 5H83A 4NV3A 1KR5A 2PPVA 4KV7A 4XSVA 4XB1A 1E9FA 1C0LA 2OXCA 4FYIA 5JCZA 1J2JA 3VX3A 3UO8B 1AURA 1KZ1A 1H9BA 1VPDA 1Z17A 1Q12A 3K0KA 3LP8A 2JA6G 2UVPA 2WHEA 4UZFA 4A10A 2OHIA 1Z2EA 4X8LA 2I91A 4DILA 1EZ1A 5TVGA 4EKDA 4M9CA 1QCDA 4FFBA 3F3KA 1YR6A 4DR7H 2QGNA 5EE1A 1TJYA 2CBGA 1RWBA 3IQXA 1Z13A 1RXVA 4X84A 3A6JA 2BJHA 1GRCA 1U3VA 3VDNB 1LS1A 1H0SA 1LW6E 2QYOA 4GKAA 3ZN2A 1A7KA 5BW4A 3EODA 3LG2A 3Q1KA 2PGOA 1S2NA 4CG1A 2Z5LA 4RIGA 3MUFA 3DAHA 2JGNA 1F5SA 3GLIB 4RAYA 1P1BA 5EY5B 1NF3A 4NENB 2O0HA 3E9DA 3CMMA 3WVNA 1NHWA 1UP4A 1H0KA 3SS7X 1S0NA 3U7QA 1CERA 5FNVA 1XHLA 2C03A 5EINA 3UJAA 1T91A 3QFFA 3RRNA 1CRZA 3LPMA 3S68A 1ECFA 3QXHA 3PFHA 3KUCA 4POOA 3NDIA 2J3EA 6AT1A 4EX7A 2NUTB 1CJTC 3AEYA 5KT2A 4NYJQ 4LH7A 5J2TF 4AI6A 3FJYA 4BO2A 5I7WA 4FHDA 5HKKA 4BZXA 3RDPA 4WKCA 4CEJA 1OT5A 2OLEA 3KO8A 5B53A 4GGPA 4EF5A 3ZD8A 2R8OA 3RU3A 2VHCA 1J0DA 1TLLA 4UQOA 4LYHA 1E7QA 1GKYA 5EKTA 5TF0A 1ZC4A 5JNLA 4AMZA 3PXDA 4UAJA 1E4EA 3ZEAA 5JYDA 1E4OA 2CXPA 2OC4A 3OQPA 1XDGA 5LBIA 2QROA 1MG0A 2OLJA 3PVSA 1QG6A 1R8XA 4BNIA 1HMPA 4U2BA 1KKUA 2A0WA 4BGDA 4XIFA 5E9AA 3K16A 2ZJFA 4XLTA 3CCCA 3ESDA 1IPFA 1MRZA 4FMCF 2B99A 5HK8A 4FZJA 4KSBA 2X8LA 5A4JA 4F6LA 4GPBA 3UKOA 4MYCA 2X40A 1L5WA 4QJIA 3OLYA 4NATA 3CPEA 2I4TA 2VQ6A 2JIBA 1P4GA 2QX6A 4M1ZA 3HADA 5IC5A 1R18A 4I50A 1QANA 1FFSA 2WV7A 2QY6A 3LPCA 4E46A 1EVIA 3E84A 2QMOA 1E1CB 1H5UA 1O4WA 1ZCAA 4L5JA 5AT1A 2VHWA 2AVNA 3GB8B 5K6TA 1T9ZA 3HSSA 1SCUB 5JDCC 4BBJA 2OD2A 5EFOA 4H2DA 2JLWA 2YV3A 2DPXA 3OZRA 3F6YA 1JG1A 3UGTA 2I4IA 2QHXA 3MT9A 4PZPA 3T5HA 1WMBA 1ZNWA 4P54A 4N5LA 1PDVA 5LQMA 1YR9A 3D6TB 4N76A 2CDRA 1N7JA 5IP9G 1SM4A 3PUHA 4ZHQA 2QSZA 1VJDA 3C3JA 5F78A 2VUIB 1Z2OX 3KAQA 4S12A 2HF2A 3E22B 1UPXA 2GX6A 1U2RA 1Q3KA 5I8WA 3I9KA 1G7CA 2FSUA 1LVUA 4V0OA 2Q5LA 4JMPA 2X0NA 3NHYA 5LQKA 2Y1XA 5F12A 1Q7GA 3WSWA 2CHGA 4MVJM 3WRYA 3TLKA 5MN4A 2PSFA 2O7RA 1SBNE 4PFQA 3CLHA 5AK5A 3OT4A 1OWMA 4TKUB 4YEDA 1PWHA 5E7IA 4DCJA 1B1AA 3FTFA 1XTZA 2OAGA 3K0HA 3H87A 5JWOA 3ZXYA 1RJRA 1OMOA 3C6KA 5CYOA 1NVKA 1W581 4B3XA 1K6EA 1AQLA 3B9BA 3VNAA 3N8IA 1P9LA 4CGZA 2JI7A 2BGNA 4LIPD 1THTA 4UW9A 3ZGLA 4AW9A 4JP8A 2AFVA 4M0KA 3NJ4A 1HURA 4Q12A 5A9SA 1C1DA 3HHEA 4QXMA 5CCBA 2CHUA 3H97A 4UMEA 4UPVA 4BAZA 2J3KA 3EPPA 4KG7A 2V58A 4MKGA 3S4YA 3OD1A 4RACA 1TKRA 3LOQA 3N0TA 4OHWA 1SFOA 2YV2A 1XNJA 4JI0B 1YMVA 4J9RA 3TSYA 4QSMA 1FQJA 1JSXA 3ZDEA 3AM1A 2C83A 5KG0A 3I30X 4K03A 2QN7A 3ETCA 3NVKI 3VHRA 1C4OA 2XAAA 1M1NA 4QLAA 3ZI4A 4Q66C 4QJ3A 2QLTA 4A3DG 1MFZA 3Q8MA 4D0NA 3NHKA 5DGXA 1V5EA 3ZWOA 4L3OA 3V4RA 5GGXA 1E2MA 1QH8B 2H59A 4Q4HB 1R10A 4AJKA 4PIMA 1CR1A 4LVNA 4IZOA 2DBYA 3I23A 2WWFA 3RGZA 2A6PA 4WXRA 3MM4A 2N47A 3O8QA 3EZFA 4TMTA 2PKYX 4WKGA 1GCUA 3LT5A 3O9VA 1Y6FA 1HT3A 4DCTA 3WKEA 3IOBA 1CD5A 5JANA 3TOXA 2ZREA 1RM4A 4QW8A 4K05A 4ED8A 3V6LA 3BRWA 1P2FA 3AINA 4OI1A 1SIBE 4EMSA 4QZVA 1J24A 4B3JA 3OCCA 1G9XA 3VMFA 4IM7A 4EHBA 3JQBC 3FTEA 4ZI7A 2VPYA 2ZM5A 3ZHSA 1A0OA 4JKIA 4B7AA 5I8PA 1AGNA 5FKJA 3MJTA 2JVKA 2RI6A 1IBKB 1DWPA 4BLUA 4CIYA 1S1MA 3NTRA 4WHXA 2BMVA 4IOJA 3GGCA 2LTAA 2A0UA 2B0CA 4QDKA 1U3GA 4UHCA 5AIBA 1Q92A 4EZEA 4GRDA 4FZ3A 3A6GA 5AVXA 2F6RA 3PHCA 5I9NA 4O8CA 2HBZA 4C3VA 1UANA 3ES9A 3Q8XB 3QX8A 3H9EO 2YJTD 1NF2A 2ZKIA 4EGQA 4TL8A 3QKRA 2OV3A 4IIFA 4FBLA 1Q0PA 1YZGA 1T2DA 4RGBA 2I55A 4R83A 3IDAA 2W6JD 3QPDA 4AF6A 4EPTA 1DAMA 1QPGA 4EITA 1CY6A 2BR5A 3CRMA 4HOYA 3EPHA 4TT3D 3MMNA 2NNWB 3DZGA 3G1UA 3BOSA 2QF7A 4OK5A 5P21A 2UZ0A 2OC9A 4F1WA 4BVAA 2JK0A 1O0CA 2UVQA 3KUDA 3M33A 4O82A 1HEYA 5HZKA 4REQA 1B0PA 1NLUA 2R8GA 4K9PA 1EX7A 2R9VA 1L6IA 1REQA 3L7MA 1FFDA 1ANKA 5DIFA 1F51E 3QLJA 4Q5IA 3RIZA 1P39A 2Q2VA 1ESMA 2LUOA 4L5YA 1TT5A 3ZVRA 3RAXA 5IBCA 5ELXA 2ZJ1A 4RTLA 4JI5H 1XD2A 1XZCA 4TSFA 3GPLA 4AIIA 1MMFB 2JBHA 4MVJA 2FK2A 2BQRA 5JVDF 4ANFA 2XW6A 3L04A 2CT8A 4A2PA 2P0EA 2R60A 3BJEA 5BNIA 2FPRA 1SD2A 3LWZA 3QHPA 5IVDA 1LDEA 1VLQA 1QMGA 3H2HA 4I19A 1B0UA 4RTJA 1LWOA 3GEHA 2FPUA 3PR1A 2XI4A 2BI7A 2QRGA 2FZWA 3WJ2A 3B1WA 2NU7A 4BV9A 3UK0A 1AF4A 2VP6A 2HNAA 3E2PA 2CKMA 1VCNA 3RAJA 3OCZA 2PEZA 2C4VA 2REXB 1N1MA 3U55A 3X1DA 4I7EA 4UCTA 1NAHA 1M7HA 4HZGA 5CBPA 1F8UA 2GEFA 2GCOA 4KLAA 4KZKA 3GN2A 3NQ41 4C7BA 3CRQA 2EYQA 3OT1B 2BN4A 4YONB 1XA0A 1VJRA 1D04A 4PONA 8ATCA 4G24A 3P52A 3DTGA 2RGDA 4E2XA 4IR1A 2GMWA 4GPEA 2GJ4A 3OLCX 2VDLB 4HWOA 1FTWA 4UBIA 1SB8A 3FZEA 5TQJA 2FMKA 3A36A 5AVSA 3TFOA 2F43B 2PKWA 1VPTA 3WYAA 1DCKA 4RPKA 1UP6A 5A0TA 2C2OA 4HF7A 3EAQA 1BMFA 3VUFA 1UFQA 2WDPA 2AS0A 4O7RA 4S04A 2EEZA 1NYQA 4J7CA 4KSCA 4U9UA 2X5KO 1I94H 1B42A 5L9XA 4JB3A 5LZ2A 3QBDA 5TDHA 4IIJA 4R3UC 2VOEA 2Q8NA 2VRCA 4V24A 3OKFA 1GFIA 1DBPA 1QJCA 3UAOA 2P2SA 3PW5A 3MR3A 4HTFA 4TRJA 4JLPA 1TA4A 3L92A 4ECVA 5COAA 1DRJA 3IB3A 1FLVA 4JFRA 4AJ2A 3DAPA 1LQ2A 1VZ3A 2JBAA 2HV8A 2PANA 1CNFA 2D0PB 3RRFA 4EKYA 2ZYWX 4NCKA 2EGHA 5GADl 3EW7A 1S1CA 2FZ4A 2WF6A 4F85A 5EZYA 1AKNA 1N2JA 4QFBA 4BMZA 1GNLA 2PLNA 3VV2A 4RNMA 3BHMA 1FU7A 5L3QB 2ORWA 4XAQA 1NFQA 4DV2H 4J90A 3WYCA 3GLKA 1XROA 5KFXA 1RW4A 5FHQA 1VL8A 1QB8A 3GEDA 2CDCA 4MWTA 4FR2A 4D79A 3A1TA 2MSDB 2NG1A 3P4XA 1ZK1A 3WMWA 3R5SA 4XVCA 1IDN1 3DBRB 1EAYA 4YCBA 4ZQFA 4HXFB 5JAZA 2GKSA 2D1FA 2C0QA 4YJGA 5FDFA 1C7ZA 2F9MA 4A1OA 1P2VA 3AEQA 1KKLA 3LX4A 1D1QA 3FCAA 2FJ0A 4PBTA 3ONFA 2WU8A 3WYFA 6Q21A 1UT8A 3LUJA 1CULC 2G6BA 1FFAA 4PZLA 4RHEA 3TS1A 1Z36A 3W1BA 2IS4A 1UBSB 4E2YA 2A7XA 2AJ8A 3L6RA 4RTNA 1ESCA 4B3DA 3TDNA 1GZHB 3H2JA 5IYCG 4RLFA 2NX2A 1CKEA 3HOXG 1EUQA 1XTVA 4PRYA 4LHZA 4NNJA 3JZAA 3WGVA 1COZA 1MAAA 3PL1A 1Z7YA 3NG1A 3VU9A 2ZIVB 3CNLA 3IBGA 3NDBB 2JEIA 3SF8B 2PUTA 2Z8XA 4K40A 5EHGA 5ICFA 4E5PA 2JFFA 3WLFA 4CETA 3O8DA 3CZ5A 5B2ZA 3ASVA 5LMNH 4ED2A 1EJ0A 1I2KA 4EELA 2GHRA 2FK7A 4D8YA 1AQIA 1EK2A 1U80A 4A2AA 4IXWA 5LQCA 4E22A 4MYTA 4Y98A 2IJGX 5ALGA 3TSOA 1HMYA 3C5CA 9LDBA 3UJ6A 3CUYA 4JGIA 4DDHA 3IL2A 3A4LA 4FWBA 2BR4A 5FB3A 1UAYA 5KTRA 3VPGA 2YJ3A 3C43A 4U2KA 4NR0A 1JI0A 4Y1EA 1W88B 2NO6A 3TZBA 3QIVA 4PIPA 2BH2A 4MW4A 2Z08A 2YCBA 2WB1E 4E03A 4TTJA 1OTYA 1I2ZA 2F8LA 1D6MA 1Z6AA 2HBYA 2YHIA 3KKQA 2YW2A 1WXXA 3Q15C 3QEMA 5K0BA 2NO1A 2Y1CA 1YTUA 1PR9A 3IILA 3EGCA 3NCTA 3FYDA 2EF1A 3EQ6A 1JQJC 3DLPX 4QUEA 2P9QA 3RSGA 1VMEA 3WLAA 4JJKA 1M1XB 4Q02A 1ZIYA 4L0DA 2PKXA 2UXDB 1IN6A 2R93A 2WWRA 3IAAA 2DBRA 4P93A 4Q18A 2PFSA 1PWZA 5KDLA 1YQXA 4NYIR 2M6RA 3KZNA 1U9CA 2FGJA 5CM0A 4TYMA 5M04A 2VDVE 3CHYA 4URYR 5C5EA 1WE2A 1Y7LA 4B85A 4D46A 2Z30A 3ZW7A 1SHJA 1O5TA 3G2LA 2QNRA 1Z25A 1T8UA 3QHAA 1RWMA 1TMGE 3FUVA 4OQDA 1EHCA 2AFIA 3GFFA 4C0HA 1RFGE 4IH9A 2G7MC 2ETXA 1U8TA 4N0QA 4G8JA 1WWKA 4WNIA 2IYPA 1E6EA 1F3OA 3G2PA 4N8DA 1UIMA 1GDDA 5KQSA 1T9AA 1CHNA 4NPCA 1UFKA 5AESA 3R8CA 4A27A 3GJSA 2PHZA 1EE1A 5J4HA 1YJCA 1B0ZA 3PP8A 5DHTA 2GTIA 1AG9A 5CA0B 3DQZA 1HXHA 1PR2A 3AGQA 1EQAA 2H1SA 1FF9A 1F8XA 2PBLA 3EIHA 2Y0SE 4C87A 4NMHA 4HYKA 3SXUB 2Q2WA 5IXYA 2JFVA 3P0HA 4UDYX 2IEYA 3R77A 2WE6A 1PG0A 1XYVA 3BMCA 5TXGA 1F12A 1JJBA 1VSBA 3SN6A 1PJTA 1Y6ZA 1SYXB 3AFMA 4EQZA 3K0AA 4I55F 1Z6TA 3MWFA 4FGJA 2ESRA 2V6GA 2P5YA 1ORTA 4MS4A 4IMIB 4LY0A 1Y3FE 3HXOA 2YOGA 1WD7A 1JDUA 1HK7A 3SHOA 4QECA 2IYWA 1RIFA 3HKDB 4NBWA 4I9HA 1N5KA 1RXEA 4UAVA 2V98A 1UBHS 4UEQA 2H17A 4JI1H 3PNOA 1IEQA 5T4EA 4Y1RA 2AD1A 2XTZA 4DA9A 2P0YA 1Z5VA 1ZVKA 4FT4A 1LK7A 4JP5A 5FFMA 2XIQA 3EFOA 4MCHA 2GVZC 2CMDA 3QF4B 2XVMA 5YASA 2OK7A 4XI9A 2PR2A 3UT5B 1SO8A 2HGZA 1V5WA 4CQMB 3BA8A 3B48A 3GYBA 1I4OA 1L4MA 3F74A 4BS9A 2WPDD 2RGCA 5K8JB 3ZYCA 1YCDA 2F1OA 1Z45A 2B4KA 4RCVA 2W7PA 1YSCA 1G2WA 1Z0FA 3A6EA 2HB6A 3KHLA 3DDHA 2EP8A 3EA0A 2RGUA 5AMXA 3SC4A 3JR7A 5TPWB 2QUJA 2HC9A 2Y68A 5FIUA 3REFA 3V8RA 1XMOH 4LRQA 2FOLA 2G1KA 3OC0A 4YP0A 3PZBA 4A8TA 4JYAH 4YX9A 4M60A 2Y77A 4QHTA 5D1OA 4QO7A 3RODA 3PTAA 1ULSA 3H13A 2PVCA 4QWEA 4CTKA 1DXHA 5IWAH 2RG1A 2WSLA 3OZAA 3FY4A 5CFLA 4RVSA 1RZRD 4RVGA 4ZK2A 3FNHA 1XMPA 2QBYA 3MGCA 5CLHA 1ZH0A 1U0JA 3MIIA 1U3UA 4B2YA 2XCAA 3T5BA 4PC2A 2RGEA 1ZRSA 2J5QA 4MV9A 2EKZA 2EQ5A 2XB6A 3MTBA 3W04A 1NC1A 3KKKA 1DX6A 4EG5A 4XIJA 2VQ3A 1R6DA 3HN2A 4WA7A 5GIPE 2GWRA 4MI1A 4P5EA 5CCDA 2YHBA 2RBKA 1E1RA 3SDBA 4MJLA 3PA6A 1QZ3A 1Y8QB 4GH5A 2CLSA 1SCJA 3CF2A 3NC4A 3FRJA 1U0GA 3Q8QB 4BTVA 3V8BA 1HUQA 3FI0A 4B6PA 1J2RA 2IOFA 4RB2C 1HR0B 4KGDA 2JI4A 3CB2A 4QYMA 3QY0A 3D3NA 1Z39A 2W2KB 4YJKA 1JG3A 4FEYA 2O1WA 4MX8A 5K2OA 3QVTA 1ECCA 3U3JA 1ZUNA 2WUFA 5ALYA 1J8DA 3GB9A 1DKUA 1ZG3A 3A0RB 4U7FA 1E3TA 4RCNA 1ZX1A 4ZN6A 2OVFA 4OEHA 1PJZA 4DDUA 5C52B 4FE4A 4IRXA 4KJXA 5E0KB 3SP1A 4Q3CA 1QBGA 4ARBA 2HVSA 2B5VA 1XZJA 5FQNA 4A26A 1FX0A 4FR0A 3ETEA 4F04A 4H7EA 2BHTA 3ROFA 1JJIA 3K9FC 3VHQA 1CNMA 2I87A 2C29D 4CW7A 3I2YX 5HTOA 2XBMA 4UOQA 4D4GA 1KEEB 4E21A 3KREA 3KKMA 4OKIA 4ZCSA 1G8GA 4UUBA 3AXTA 3IV6A 2PH5A 2NAPA 5KKNB 1MH1A 2LKCA 5JS6A 4Y6GB 3IVAA 4ZT6A 5K51A 5DQGA 3EXFB 4FS3A 1T9CA 1CIJA 1ZOPA 2G9QA 2Q21A 4CN8A 4HSGA 3SQWA 2VDPB 4NXNH 4AJ4A 2ZUSA 3CNNA 4PO3X 4MO9A 1KI3A 4ZOLB 1K8QA 3QBJA 4R6WA 5AKXA 4AJJA 1MAWA 2NO9A 3PUIA 4LTDA 4I4TF 4CNBA 1NU8A 4NV1A 5DCYA 3T4PA 2W9CA 3DOFA 2UUOA 2Y1FA 4XQGA 1GQFA 5K8TA 5F7OA 2XUOA 2BLNA 1TQ6A 2YS6A 3FVWA 3PW7A 1LBTA 1OYVA 5C3UA 1V8PA 3PC3A 1ZMXA 3E9EA 2QRPA 2QRVA 4GKJH 5JCXA 2CDNA 3PW0A 1JPJA 2J85A 4LV5B 2M05A 5I5TA 1TQHA 3WV4A 4UM5A 4MCIA 2OYCA 1RMYA 2CQYA 4HDQB 4Z51A 4KTVE 1XZMA 2EAUA 2QNBA 4B17A 3WK4A 4J9KA 2FUKA 2O5EA 2IC5A 4A4DA 3OLVA 4CMIB 2XYRA 3PLAE 2F00A 4PAGA 5BQXA 5CMLA 4G0QA 1J5EB 2RB5A 2YJ5A 1F4PA 5C5DA 4L8VA 1GLVA 1KZ9A 4G2NA 2GAOA 3C0FB 3N8DA 3S6JA 3TW7A 4RXTA 1XZKA 2EHJA 5FBHA 5JYBA 4Y2QA 1IXKA 2UZAA 1YONA 1XE3A 3Q0TA 5AQEA 2QD5A 1I3KA 2WIGA 4TV9B 3QW4B 2VAPA 4KQ1A 4JBHA 1G98A 2V74B 2CC2A 5GONA 2P3QA 2WKSA 2E5FA 4TV8A 1WQ3A 1Z0AA 2I78A 3FYTA 2PIAA 4MWGA 1OZHA 1PZFA 1XO1A 3A3NA 3I8SA 3DKKA 5IJZA 4HK4A 4U8HA 1W35A 3TTSA 2QYZA 1VL0A 4H1VA 2H8GA 4PXSA 3NHLA 5C8YA 4HDMB 3LPDA 4CG0A 2H0RA 3VX4A 1WVIA 4A0FA 2RAVA 4D8UA 3PFCA 4FQ8A 4AWAA 1L5OA 3FWKA 1PR3A 3ANMA 1FTSA 1RRVA 1X3SA 4CLXA 2YCHA 3DYIA 3IQDB 5AK6A 1BHJA 3PGXA 1G4HA 2JAHA 4OGGA 1XRJA 1T6YA 2H11A 1B8NA 5E7MA 1E4YA 4EW2A 5CNMA 4KX3A 2AC2A 4GUAA 5FOXA 1TQDA 1V45E 4UEJA 2XGSA 2DY0A 3AY7A 1A8QA 1YWGO 2P8JA 4NI5A 3GUCA 4FBGA 1LTHR 3KOYA 4Z99A 5LMUH 4KRGA 4MS1A 3E1KA 4B71A 3AVOA 3OJEA 1QONA 2VH2A 1KRWA 1SC3A 5LP6F 5IZ4A 3PCXA 2C7GA 4WZAE 3TUIC 2IP2A 4MPTA 5ALMA 5CE8A 2WILA 3FKIA 2X9QA 4RH3A 4C0QC 1X8KA 5KG5A 1Y80A 1NKSA 5IH7A 4ETMA 2C5BA 4U8GA 3N87A 5FTKA 2RI1A 4J2OA 1QPBA 3OJWA 2UVRA 4J75A 1K83A 5EGSA 1OFIA 1F8FA 1YQUA 3EQ8A 4DV6B 4YREA 5I3ZA 2A0YA 5ALSA 2HO4A 4F86A 3MD0A 3CSSA 5FI5A 2IA6A 1E4VA 2QT0A 3GFSA 3M2TA 2WM8A 3H8SA 1NT4A 2G40A 4XVQA 3WXMA 3P2MA 4M7EA 4V02A 1AO3A 5ALEA 3QOXA 2YN2A 2A59A 1C5KA 4FFOA 3U4GA 3H4MA 2R47A 1K6IA 3LQ1A 2BFCA 2X2EA 2E87A 2YIMA 3LW8A 5BUQA 3KLPX 3ZUGA 4YMIA 4N5IX 3WWDA 3TMYA 4YJHA 3RVKA 1NBEA 1PU2A 1E9RA 3UMFA 4ZEVA 3N3AC 3PGKA 4B3CA 4UUMA 4KACA 5K9ZA 2JLUA 4FGWA 5GV7A 1XBTA 4GC6A 2CVPA 5FD5A 4M9ZA 2GLTA 3LLMA 1G42A 5K99A 4RZXA 3DL7A 4UOEA 2QUIA 2H1FA 4NYJR 4LOIA 3GY0A 2J7PA 1IBSA 2QIOA 1GL7A 4XWTA 2ACVA 1XWWA 2FR8C 1Z08A 2XA9A 2XUHA 3QI2A 1YASA 4X93A 3NI2A 1J5PA 4WTOA 1LLUA 2PRYA 4BLOA 5JXIA 4P2GA 2I1WA 3IKVA 3I2HA 1JR4A 2W0MA 1YZ3A 1GFZA 2QAGB 4J3JA 5JXGA 4ZYYA 5BWRA 5HDBB 5HS6A 4MO2A 1EKVA 1CRLA 1MJGM 1RNLA 4NOJA 1YB5A 1DP4A 2FMXA 4CM4B 3LNTA 1YJ8A 2GXAA 2VTBB 2HLPA 5B36A 3AI1A 2O8CB 2Z83A 3KHHA 4ECWA 4ALMA 3ODPA 1FRNA 2X4DA 1UFRA 2C2ZA 2PMZE 3TSWA 4MRNA 4NDNE 4Q3LA 1QC5B 1OFHA 4D6XA 4Q6BA 2DHRA 1ZZEA 2FSPA 4UTOA 2D0IA 4XFKA 3BXPA 2GCIA 1RHKA 3O5AA 5BUZA 4JP2A 5JIBA 1H3EA 2R751 1YRAA 4G25A 4KXYA 1J4AA 1Z6XA 4DNXA 1QGZA 4NU5A 1OIWA 5FL3A 2Q50A 3P2IA 1OXKB 4RORA 1VG9B 2BTQB 4YUYA 2V7GA 1DIHA 4V0RA 1KMHB 4RL6A 4OFZA 3JZFA 3STUA 1X7ZA 5KQRA 3TFQA 3TUJC 4C0JA 5FWXA 4BO1A 4GSYA 1SWVA 1J99A 4B46A 3ZHCA 1XXHE 1OAKA 2RE8A 4YCDA 1IQ0A 1OVMA 4RETA 1N2XA 1TADA 2JGAA 1K6JA 5LM3A 4OO3A 2A84A 1Y1WG 4DA8A 3S29A 2ZBPA 3LDHA 1T8WA 2OCGA 5E4YA 2O06A 1W93A 3P0RA 4L6AA 4HLNA 5L3RA 3STHA 3HKBB 1C7QA 1I4EB 5G0WA 3GUVA 1UBNA 5BWOA 3NETA 1MP0A 1JMKC 2JKYA 5L3VA 3S2FA 3WHIA 4ZDKA 4QDZA 5CXSA 2I4NA 2Z04A 2HNBA 3ECCA 4TWAA 3DDZX 3H3XA 3KB6A 4LA4A 5IAKA 2B1RA 1CB7A 1Y9ZA 4MQFA 1VHDA 3B6EA 3CO0S 2IHZA 4D92A 5EKUA 3OJFA 5JH7A 3DP7A 3FUTA 2C9OA 5A5DA 4EFMA 4WIAA 3ED5A 4J7XA 2PFGA 4LBZA 5COQA 1E1QA 1VHWA 3JSAA 3OTIA 2UUBB 2R7ZG 1YQGA 2EP5A 2XJ9A 3AWIA 2GM9A 3ZBQA 2DMRA 2EZUA 2A94A 3KUUA 1N34H 4J4BA 1COWA 2FPOA 2ZRIA 1F6WA 3D6VA 1QE3A 4PTYA 4H17A 2HCFA 2LPMA 3KQWA 5H16A 3NIDB 2OKGA 3DTVA 5KX5F 2O5RA 4DVJA 5TGDA 3OU7A 4G67A 3PC8C 2CSUA 1KJJA 1C2TA 2EXXA 1SQ0A 1IIRA 4G5QA 3ZVNA 4YRDA 1TAHA 3BIFA 1W8DA 1LA2A 1DQYA 5CFRA 3IR6A 2OZPA 4M49A 1BA2A 4IIYA 3HRKA 5BV7A 3C8MA 3WRVA 1D5WA 2N46A 3PGA1 4B6QA 2IZ6A 2VAWA 3IIKA 4ECQA 2WJWA 3AVWA 2FSHA 3AV0B 2A9RA 4QQ8A 4RQUA 1Z0IA 2WHPB 3A2LA 1VXRA 4IMRA 1J20A 1YB6A 4N7MA 1E9CA 1K0FA 4BXXG 2C31A 4FMDF 4OGFA 2BGMA 3I4MG 4JDPA 4DCVA 4P4SB 1JHAA 1N9GA 3Q7QA 5J58A 3DDUA 4IEFB 4W5HA 2A86A 4GKVA 3EDQA 1LBQA 1XV5A 3KZXA 1DAFA 4TXNA 4JMLA 2X5XA 3WGIA 3KETA 4BX3A 1H6BA 1ZUIA 3LY7A 5L3ZA 2F59A 4CCYB 2FPLA 2X8JB 4FM9A 4ZO7A 3DDWA 3FUXA 4RD1A 2DPMA 4G5FA 1B76A 4EO9A 2HQ1A 3JQ7A 3UXHA 1ZH6A 2LCIA 3NBKA 4PZ7A 1A27A 1AZSC 2YRFA 3HJBA 4NVRA 4FDLA 3TR6A 4ALLA 3VR5A 1DO0A 1H2YA 1JEYA 1KIMA 1JPVA 1LLCA 2JIZA 3RYFA 3PW2A 4KB5A 1TZ2A 1H2ZA 2FDRA 3T7KA 5BXQC 2NV6A 3FHJA 2E5LB 4KBGA 4TUYA 3LWNA 4GI2A 3EPGA 2D1SA 5EP1A 4L3VA 3HKCA 4XGQA 4J1QA 2PDAA 4G0UA 1K6MA 2Y2UA 1K9VF 1MJGA 1G8YA 2P4QA 2IU3A 4FILA 2QPAA 4KPGA 3EEFA 2QD4A 1KF0A 4QFDA 2CL7X 4JJFA 3OPMA 1RYFA 4ZOBA 5LA6A 2NVBA 1OLOA 1CX9B 2D2VA 1Y0BA 3ENNA 2JA1A 4CQLB 2P1ZA 5EHIA 3AM5A 4RFSB 2XMCA 4QQNA 2WMYA 4GM1A 3FOZA 1JDJA 3B1FA 3N40P 1H1LA 3TTUA 4Q7QA 1IL0A 4XB6B 4QU8A 2JCVA 3FMVA 4H1HA 3U31A 2FWRA 4ENUA 3KYCB 3H2IA 3BXXA 3EK2A 3A3OA 1QK3A 3REGA 1U2GA 2OORA 2GJ8A 4ZVOA 2AGOA 2C82A 3AJ8A 2MIIA 3ELDA 1J8VA 1QHNA 2CXUA 3WWCA 1WMSA 1A4UA 4R9RA 3RVDA 2PX4A 2GK3A 1RMTA 5IXSA 3LXRA 2CCGA 3HWX1 4PYLA 3LBYA 2COIA 1Q1BA 5EJ9A 1B6RA 1HQYE 2F3PA 1Z4IA 2E82A 1AB5A 1SN7A 4HGPA 3M6FA 2WVGA 5ES3A 2ZJ6A 3BXZA 5BY2A 2V6FA 3FSRA 1RC0A 4L9AA 4QULA 3FMOB 2C57A 2FF5A 1I3MA 1KETA 1IZ8A 3USZA 2A3NA 3E7WA 4BNDA 2W6IA 2CV1A 1XI2A 1BSVA 3OEHA 5G40A 1W36D 1Z07A 5BVGA 1XCMA 5KNDD 5ALDA 3FDJA 2XA1A 1BZYA 4NNPA 4XX0A 2XUIA 2TS1A 3IO3A 2FPWA 2I62A 3RBXA 4MHTA 4JBWA 1Z16A 4HDKA 3TN7A 3CG4A 4OOEA 2XJ4A 3C48A 2GSWA 4U9IS 5EVCA 5AVOA 4HYYA 3BIOA 3WS7A 2BGLA 3NHJA 1YRBA 3VR4A 4BVEA 2CVZA 2CK3D 2OL4A 3R7NA 3L1VA 3SJAA 1SG0A 5JD5A 5KFOA 3BWMA 1S4QA 3DBLB 2RMKA 3CY6A 4EKNB 4IJKA 1NJ2A 1I3OA 2ZGIA 3FPHA 4OQNA 2JAXA 3F73A 3U1VA 4AKTA 2X14A 3L0ZA 5IAAA 2EX4A 1A9QA 1EGMB 5B4TA 1M6WA 4K6CA 5IKXA 1RC8A 2UVUA 3F6PA 5EXDA 4U00A 3H1FA 1LGYA 4QBHA 4FDMA 1JJ7A 3DL2A 1EJ2A 1DT5A 4R1LA 3VPDA 1Y9EA 5JNWA 4FKBA 2YWRA 1OZAA 4JJGA 3ZGYA 1OLUB 4RADA 3ZDFA 4YASA 3W2TA 2JAUA 2JC3A 4ZO9A 4WCFC 2HXGA 3HFRA 4X1IA 4DSNA 2PT6A 1P31A 3DHYA 3FR8A 1EX9A 5H5JA 3R9XB 2AKYA 3EPRA 1VBHA 4RY2A 3WIBA 2FP4B 5BW8A 1XVTA 4G0VA 4M99A 4EY7A 1XQ6A 3KKLA 1D2CA 2VNJA 1BWSA 1L4GA 3N7TA 3PRJA 4MQEA 3ITDA 1E9BA 4FOPA 4GI5A 1KWKA 1FFXA 4OATA 3QFSA 3KJZA 5B5SA 4ARAA 4RSRA 3EB9A 3DZFA 4LXQA 3L7KA 1NMYA 2ATIA 5CPBA 1NPDA 2A9OA 4ZKEA 4QXRA 1XYGA 4L73A 4EHLA 1EZ4A 4MWSA 5KS2A 1PLLA 3WL5A 4K3UA 2GQRA 4JV0A 2V8OA 3W6OA 1NYTA 3NVDA 1YHZA 4BTLA 3I9MA 4ACAA 2NUAA 5DLQC 5CT9A 1SU8A 4XGIA 4AECA 1BJTA 3LT2A 4XWKA 4AJ1A 4ZYTA 1HDZA 2XWSA 3DMTC 2C20A 1OU0A 5KIAA 1UINA 1KXZA 2AMYA 5IUJC 1R0XA 3LXUX 4G3XA 4YQZA 1U4SA 1IM2A 2RG7A 1QO0A 5IS2A 3AW8A 4W7HA 5KFZA 3QPVA 1KQFA 3OESA 5I9SA 1W0KD 1FFWA 2VZ8A 1PL7A 5E4TA 1QO7A 4DR1H 2IYTA 5JCJA 2WOOA 4OJQA 3A31A 3IQZA 4IDAA 2Q3DA 1SVUA 2P9TA 1DJOA 1Q2UA 4GUDA 1CUEA 3BJRA 4QXAA 4H9GA 1GEEA 5BVHA 1JKXA 5LOVB 1NM5C 3RS0A 5CHEA 3OP1A 4EJSC 5CDHA 5LQNA 1Z63A 3EDCA 3OAAD 2C58A 3OUUA 2C5HA 4L8LA 1UBCA 4XZ3A 3ITEA 3WWHA 3WBBA 3PITA 5JQGA 1YS1X 3BE6A 5TQ0A 4J0DA 4KQIA 3E18A 1ZJ5A 2FW0A 3O1IC 3PE6A 2M9MA 5DT2A 4ZEWA 1T4CA 5L8VA 4QFCA 5HOQA 1FPMA 3L5OA 3V32A 2Q4OA 3CZCA 4A8JC 5H4GA 2GAFA 1IEWA 4RA6B 4KHPB 4BFVA 3L43A 3MWKA 4WFKA 2ZWOA 1U0EA 2R8YA 4RANA 2I66