1M0WA

Yeast glutathione synthase bound to gamma-glutamyl-cysteine, amp-pnp and 2 magnesium ions
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
486
structure length
481
Chain Sequence
PSKDQLNELIQEVNQWAITNGLSMYPPKFEENPSNASVSPVTIYPTPIPRKCFDEAVQIQPVFNELYARITQDMAQPDSYLHKTTEALALSDSEFTGKLWSLYLATLKSAQYKKQNFRLGIFRSDYLIDKKKGTEQIKQVEFNTVSVSFAGLSEKVDRLHSYLNRANKYDPKGPIYNDQNMVISDSGYLLSKALAKAVESYKSQQSDPIVAFIVQRNERNVFDQKVLELNLLEKFGTKSVRLTFDDVNDKLFIDDKTGKLFIRDTEQEIAVVYYRTGYTTTDYTSEKDWEARLFLEKSFAIKAPDLLTQLSGSKKIQQLLTDEGVLGKYISDAEKKSSLLKTFVKIYPLDDTKLGREGKRLALSEPSKYVLKPQREGGGNNVYKENIPNFLKGIEERHWDAYILMELIEPELNENNIILRDNKSYNEPIISELGIYGCVLFNDEQVLSNEFSGSLLRSKFNTSNEGGVAAGFGCLDSIILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords glutathione synthetase
publication title Large Conformational Changes in the Catalytic Cycle of Glutathione Synthase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 171
structure length 481
sequence length 486
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 1m0wA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1m0wA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1m0wA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1m0wA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 1m0wA04
3JRWA 4HNUA 3LWBA 1M0WA 5LXTF 1VBHA 2FPGB 3JZFA 3TW6A 5CB4F 1CE8A 3BG5A 2GPSA 2ZDQA 5CA0F 3Q2OA 3QFFA 1C30A 1EZ1A 1DV2A 1I7LA 2P0AA 1GSOA 4C5AA 2VPQA 3WO0A 1T36A 1W96A 4HR7A 2YS7A 2W6OA 3ORQA 3MWDA 4O7NA 3G8CA 2DIKA 3V4ZA 4O4JF 2QK4A 2I80A 2NU6B 1JKJB 4MV3A 1KC7A 1BNCA 3VA7A 4O7SA 5LA6F 3TQTA 3R5FA 1KJ9A 4IZOA 2Z04A 4O4LF 3KREA 1EYZA 2NU9B 1C3OA 4O84A 2CNQA 2NU8B 2R7NA 1KJ8A 3I12A 3N8DA 3UFXB 5KKNB 2YS6A 4MAMA 2GPWA 2W6ZA 2R85A 1CQIB 1A48A 3TINA 2YW2A 1KBLA 1E4EA 1CQJB 2OLSA 2DZDA 3LP8A 3WNZA 2GQSA 3TIGA 4HQ6A 3NUAA 2FB9A 1EUCB 2CNUA 1M0TA 3ORRA 3N6RA 5DMXA 4MV8A 5BMVF 1IOVA 3DF7A 2YZGA 4O7YA 4YJ3F 1PX2A 3SE7A 4YJ2F 3VOTA 2NUAB 2ZDHA 5J2TF 2V59A 4O7VA 3HBLA 5JVLA 1WR2A 2I87A 4FFLA 1AUXA 1JDEA 4RZQA 4EGJA 3K5IA 2DLNA 4O7LA 2YZLA 5C8YF 2V58A 5HBRB 4TV8F 4TUYF 5JVDF 3MWEA 4MA0A 2YYAA 3GLKA 2SCUB 1GSHA 4YAKB 2XD4A 5H80A 4QSHA 3R23A 3OUUA 3ETHA 3VPCA 2GQRA 4XYLB 2R84A 4FFRA 1EHIA 1B6RA 4MV6A 4E4TA 2R87A 3MJFA 4FFOA 1VKZA 2W6NA 3HO8A 5JQWA 2R7KA 2YL2A 2HGSA 1I7NA 2W6QA 4YAJB 2FPIB 4O7RA 4O82A 2X0SA 3GIDA 2FP4B 2YZNA 3RUPA 2VR1A 1W93A 4ZHQF 2CNVA 1EUDB 2Z02A 1GSAA 5C1PA 3RV3A 2R86A 1VBGA 4DLKA 2WYOA 3KAKA 5CA1F 4YB8B 3R5XA 4ZOLF 1M6VA 3AX6A 4IHJF 2ZDGA 2YRWA 5JH7F 2PBZA 4O7ZA 2VQDA 1OBGA 1Z2NX 1Z2OX 3RV4A 3KALA 3V4SA 2C00A 5C1OA 4YBZB 3AW8A 4FE2A 5CAEB 2V5AA 2CZGA 2R7LA 4MV7A 2W71A 1KJJA 4MV1A 2I8CA 2R82A 1KJIA 1BXRA 4C5CA 4MV9A 3U54A 1OBDA 5GONF 3VMMA 5KX5F 2W6PA 4HNTA 4NYEA 1B6SA 1E4EB 4TV9F 4O7TA 4O83A 3K3PA 4I4TF 4M9UA 5J2UF 4O2AF 1AUVA 4I50F 1JLLB 4I55F 4O7WA 4EG0A 2XCLA 3HB9A 2HJWA 2NU7B 1JDBB 3KAJA 2PVPA 3U9TA 3ETJA 3U55A 4O86A 1KUTA 4ME6A 1GGOA 4MV4A 4FFMA 2FPPB 4XYMB 1A9XA 1DIKA 4FFNA 3WO1A 5LOVF 2PN1A 2J9GA 5EZYF 1IOWA 4O4HF 4O4IF 4MA5A 3TIIA 1GLVA 4O81A 3JZIA 4L1KA 3K5HA 1PK8A 5BPHA 3R5HA 2R7MA 1ULZA 5JQGF 1SCUB 5HV6A 1CS0A 4XX0B 3Q1KA 2W70A 2YRXA 4DIMA 3U9SA 3JRXA 3VPBA 4FGRA 4C5BA 2GLTA 3G8DA 4EGQA 3R9RA 1KEEA 5LP6F 2IP4A 4FU0A 5FNVF 1KJQA 2W6MA 5LYJF 4WBNF 4O2BF 4XZ3B 4ZQIA 3RFCA 5IYZF 4HNVA 1Z2PX 2YZMA 1DV1A 3OUZA 5BPFA 4FFPA 4ZI7F 2DWCA 4IIJF 2QF7A 4Y8VB 3E5NA 2YWVA 5D8DA
chains in the Genus database with same CATH superfamily
2C9DA 3FKJA 2JA6G 4UQPA 2CXTA 5LZ2A 4X94A 1GEGA 4BLQA 1L4EA 4N47A 4MIEA 1MJ5A 2H31A 4CLOA 1HTBA 4O4JF 4BRUA 4ZQHA 3BICA 1GTMA 3BA8A 4UNRA 4RK4A 2G67A 3W77A 5HPYB 1KEKA 4X7RA 1ODTC 4HYQA 1JHAA 2JIMA 3V8PA 3V4VB 4BN5A 3D6NB 2V9PA 3HZRA 3BE4A 2GAOA 1SXGA 1W25A 3HUDA 4YASA 3D6VA 4TMKA 5CDYA 4GX5A 1DCMA 4IH4A 3ZEAA 3S2FA 4ECAA 3DE1X 3B38A 1JIKA 4NPCA 4PINA 1V35A 5KFSA 5CA1B 3ZZ1A 5CXXA 2CXHA 1IVYA 1MGOA 2D0OB 3WXBA 3ZQ4A 1XXHB 3GEIA 4PBCA 1EK6A 4DG9A 1B73A 3SS8A 3F6EX 1N2CE 3W2TA 3CEBA 4O3SA 3DW3X 4LH6A 4M53A 3ZUGA 3MQ4A 1ZH2A 3KXYT 4HDAA 1Z7GA 1J8DA 4LBZA 1TUBA 1VHLA 1C7IA 4JHXA 3QTTA 1AN0A 4ZAFA 1U7XA 3NT4A 1TU4A 5ALWA 2WU0A 5DLPA 4EY5A 2HY7A 4WKBA 5C7LO 5L4LA 1XDZA 2X76A 4ZQGA 2FPXA 2O8DB 3K2QA 4PSKA 3CGGA 5FA5A 5BWOA 4R1MA 4BVFA 1WW3A 3GN2A 3N0TA 4LYJA 3DR5A 1T6NA 1O57A 5KFHA 4D9BA 3QPBA 1PL8A 3UA4A 2D06A 5ITZB 1Z4KA 5LIPA 4MYTA 4MKHA 3TRFA 1QCZA 1JQ3A 2AUMA 5FQNA 1T36B 2VXCA 4X1KB 5LD2C 4R6XA 1HPLA 4TRJA 3EG9B 1Z35A 2Q6TA 1Y4SA 4LGVA 3BKWA 2BHSA 2XIJA 2PX3A 5T67A 2RHDA 2QGNA 4TUYA 3NBUA 1RABA 1BJKA 2AX4A 3UW1A 5KNLA 5DI9A 3GMDA 1TECE 1Z47A 1OIVA 2MCTA 4IMIB 3B9QA 1IZ7A 2NU9A 1II8B 3KOUA 2QSJA 4KHZA 4TLMB 5BORA 3BA1A 1IXSB 2WHXA 3F73A 4BV2A 4GP9A 3NVKI 1I4DD 4KNWA 1MBZA 2PSHA 3O4FA 3DOIA 5L53A 1IY0A 1K68A 3R9XA 3CNOA 3ANSA 4RHYA 4KE8A 4PNHA 4F9FA 1HO3A 3PNKA 1Q0RA 3SYMA 3EVEA 3E0XA 3GVXA 4QUBA 4P2BA 2AW5A 4AZ3A 3IVMA 2P9ZA 4JXZA 3I04A 5DLYA 4CR7A 2C04A 2WNHA 3SVZA 1KMNA 4OA8A 2FVXA 5HNKA 1Y1WA 1OAAA 3NDBB 1X19A 4RGQA 3V4OA 4Q4DA 1U1FA 2FLLA 5GJBA 2ZRMA 3L7IA 3PJRA 4IVQA 3AGPA 1TA4A 2JDIA 2FK8A 4IEEA 3BUSA 3BH7A 2ZKIA 1BN7A 4GI5A 5JAQA 2BFCA 2BDEA 1YS7A 3F9RA 2JNWA 4MP3A 4AO6A 1IUPA 4QC2A 4DVJA 5K8CA 4LXIA 1C41A 3ZVRA 2RBKA 1EZ4A 1GG8A 3EGDA 2K7ZA 2KWIA 1K27A 3MMZA 1IY2A 2V5UA 1JDNA 3ER9A 4MKIA 1PQYA 1A7AA 2PBFA 4HNRA 2QTBA 1XCOA 4GC5A 3TL2A 1MB4A 1AG9A 1NUUA 1JDVA 3WLMA 1PZGA 5JS7A 4BC1A 3KEFA 3E53A 4GOJA 3DOJA 1MZBA 4ID9A 3WDSA 4GEGA 3KQVA 2R8KA 5F64A 4M0EA 1UQTA 1W87A 1TADA 4M55A 3PXBA 1UAYA 5F78A 5BUSA 2A9FA 1E79A 1P0FA 3QVGB 1K75A 4DSZA 3TZBA 1XZPA 2AH5A 2MYPA 4I1UA 2ZE8A 3UXHA 4BLPA 1L4LA 3MCVA 3KSZO 3SYRA 1Q7TA 5EKSA 4ZMRA 3RWBA 4UDYX 4NS4A 4Q15A 3UENA 2FU5C 1NZFA 3V7YA 4JBGA 4NKRA 1RHRA 4QJIA 3VSAA 3QPUA 3NASA 2ZBGA 5HGJA 4TSFD 1JJ7A 5BR8B 1NJ6A 1SCDA 1D3AA 4QXPA 5E6RB 3CLKA 4IOLA 4FJ2A 3X43A 3H83A 3QE9Y 5FPSA 3FZNA 1WCV1 1KOGA 2EAUA 3TUJC 4L9AA 4A2QA 2VQFH 2XQGA 2CCGA 2D2IA 3WGYA 4RANA 3AR3A 3QEOA 5IMBA 5DT9A 4L57A 3N3BC 4EFDA 4NX2A 4WFQA 3IEPA 2C97A 2SCUB 3AV3A 1YD7A 1F2TA 2FETA 1HL3A 4ESVA 5KYXB 1RR6A 2QLMA 1XPJA 4E5DA 4RH3A 3DR3A 5ED0A 2O1SA 5JWHA 5C18A 5C1DA 4ZMSA 4S35A 4BYMA 4CMBA 4EJMA 1H5NA 3VR0A 4BNWA 4ARUA 3AU8A 3TMKA 4EGCB 3BHMA 4FR5A 4D98A 3HCNA 3RSLA 4ZHQF 1F0NA 4J91A 2VZ8A 4US2R 2IDMA 2Q1WA 2AR0A 4PGGA 5CLQA 5JC8A 4H35A 2CQYA 4CM5A 2VDNB 2WV9A 5KJ6A 2VRCA 3GRUA 3ZU5A 4CQLA 1EU1A 3L8GA 2W83A 1RDFA 1X7YA 1Z2NX 2FFJA 2VSYA 1XJ5A 4I8IA 1VI6A 1FFXB 1RAEA 2GSWA 3PFWO 1C3OB 1ONSA 1YKGA 3MS7A 4HGOA 9LDTA 3ZBTA 1L6RA 2OE2A 3B5JA 4WKPA 1CY1A 5EP4A 3OTHA 1B6TA 1NRJB 5DXFA 1NNEA 3CVXA 1VYTA 4CFYA 4AXXA 2UUBH 2E3JA 5K3FA 3C3WA 4ZIRA 4IFIA 1Z36A 4PFJA 5A04A 4C20A 1QRTA 4AY6A 4UMEA 1HDOA 5GOZA 4O83A 2AC7A 2JFQA 4HEA1 1ZMBA 4UAUA 2AOUA 2OSBA 1XC7A 3LA6A 4JLNA 1K8XB 5JYDA 4J9LA 4BX0A 3C5EA 5IHXA 5CDUA 3HJHA 1CNFA 4DC1A 2J9FB 1BGVA 1LC0A 5CHYA 3FMIA 4DXAA 1AU9A 3PFCA 1A9XA 3ZJTA 5KO2A 3KOMA 2CMHA 2J9GA 4HAZA 3PF9A 3KQNA 1JILA 3DYVA 3EZYA 3MT9A 4W1RA 1QBGA 5MFZA 1YIDA 2C28A 3L4JA 5AKYA 4BGDA 3B6JA 4YJHB 3IKJA 1H8HD 1BGXT 5IDYA 4ED6A 1GRQA 3OZSA 3GIKA 4FK8A 2UZ1B 3CNQS 3DE5X 1NBHA 1DAFA 1GL3A 4DNOA 5E4FA 1IM2A 1TWHA 3CJTA 4HZGA 5U4XA 4L74A 5DHPA 3KJEA 4O0MA 4JV5B 4Q1BA 3ZI0A 3UF0A 4HKTA 4JBIA 4QODA 2VJKA 3OZRA 4FDVA 3M1YA 4GPAA 4Q02A 2AI1A 1CS0B 1IUKA 1L5VA 4MHOA 3ND8A 1YQ9A 5FEMA 3QKSB 5AVVA 3DO8A 2OENG 4D6XA 3SS7X 2BYTA 2MSWA 3GJSA 5BNIA 2FDCA 4ZT3A 3QNMA 1DBQA 1CPYA 2HPHA 3M2PA 4CM7A 2EJBA 1KC7A 5KJ1A 2PKRA 2C84A 3V1MA 1ZL0A 3T34A 5EP3A 4YA6A 3A6DA 1QYCA 2GN9A 2H18A 2YWHA 3CPJB 1XFAA 1JHPA 3RARA 3WWHA 1S7GA 2GKGA 2KB0A 5LP6A 1JRLA 1IOLA 2QX6A 3WNBA 1QF9A 1ORIA 4QNRA 1PS0A 4CR6A 2XDQB 3C3AA 4MZXA 4WN9A 2CNOA 3TOSA 1MOSA 5KDDA 4A93G 4BQOA 4G26A 1ZU4A 4TLCA 4JUAA 2XJ4A 4UPEA 1EVKA 1OU4A 3LDUA 1DG1G 3I9LA 3AY3A 1K8QA 3BWYA 1BSVA 2BRUC 2COIA 4URZR 1U0TA 3VX3A 2XKJE 2WKRA 1J39A 2L42A 5LM3A 1BE8A 2Q2OA 3JSXA 2RF4A 3SR4A 2ZUFA 1V95A 2JAXA 4E14A 3S0JA 3LHKA 1HKHA 1WY7A 4JLMA 1W49A 2E4XA 2V7WA 1RXYA 3ZHBA 6NULA 3OZIA 3H3XA 4LJ7A 4CMGA 5G1OA 3KTMA 2DQKA 2F00A 2OXEA 2L17A 4JOSA 3DL7A 2CUTA 4DKXA 4H08A 4DY6A 2XVXA 3C98A 1UC9A 3G2PA 3A37A 3RHTA 5ALIA 1P8AA 2JFPA 2AJLI 1RXCA 2X15A 4DQVA 2X0SA 3O3CA 1W34A 3RADC 2GCIA 5AI4A 1RTKA 4QTXA 1QWOA 1QH0A 2Q2UA 4MO9A 4PLHA 1BKDR 4FI3F 2JGNA 4EUFA 2YXEA 4PPQA 2HSWA 4O4IB 4U0KA 1AM4D 3CUYA 4UUQA 1K2VN 3Q0TA 1K9VF 3GPIA 3MM4A 1V7PC 3F6RA 4CG2A 1M2JA 1ZNQO 1PK7A 3L0SA 4BGEA 3LPCA 2ZYHA 3AERB 4QIHA 3I58A 5AJTA 2GK4A 2X8JA 5TX7A 1CRWG 2AMLA 3UMGA 1QE0A 4B9EA 1SKBA 5EFZA 2B36A 2OCIA 1OFUA 3LBAA 5ALEA 2A1UA 1XJQA 1VGQA 1PO7A 2P6MA 4UFOA 5AW9A 4FTWA 2ZR7A 1KSGA 5IYZB 2DHEA 1JJVA 2J3MA 3QFCA 4PYMA 3OZBA 3W2IA 4PLZA 4GYJA 1ETHA 5FWDA 3H1TA 4CM3A 3KHTA 1OXKB 4QPCA 3ON5A 4M1ZA 1UMBA 4IINA 5CB4B 1ATZA 3KOWA 4HDNB 1AS2A 3HXOA 1KFJB 4TMFA 1SEIA 3AL0C 1JGTA 5K03A 3TBFA 3IHWA 1QYDA 4GOLD 4YMSA 3TR0A 3VZBA 3PVCA 2ZAGA 2WA1A 5M34A 3HGMA 4DPLA 4N12A 1JZTA 3DKPA 4ON9A 3MFQA 1N75A 1A2BA 3RG2A 2QX9A 3R7BA 3I4NG 1TK9A 2EWVA 4IBOA 4JP1A 3ICOA 5IABA 1ODSA 1UJ2A 3GJYA 1CKNB 1TAQA 3BB3A 4TWRA 3PZRA 1K9SA 3SX2A 4DV3B 1U2ZA 3NYWA 5IAJA 3TRKA 1U7TA 4RVHA 1J0EA 2BI7A 4X3CA 1CHNA 3PRYA 3WWYA 4Y6RA 3A1SA 1QJ4A 2Q4EA 1PFVA 4Y7DA 1Y8QA 2DECA 2AGPA 3HFGA 1KFKB 3UJ9A 4P3PA 1FUKA 4RNNA 3VYWA 4GP6A 2LKDA 4UW9A 1OWPA 3W5DA 1X7DA 2XT6A 2QYSA 3AETA 4TSFA 2A4KA 4HEJA 2G09A 3HV2A 2GEVA 3NEJA 1RKQA 3OIWA 4PPFA 4AJHA 4ZOEA 3NORA 4DDHA 2ES4A 1U2RA 3HACA 4I7HA 2JI6A 4J1TA 3DFZA 4F2PA 3F67A 4MVJG 4QUJA 4GMKA 4Q7KA 4QT0A 4EKDA 4ESOA 1XWFA 3RTCA 2R9VA 4W9MC 2XB4A 1JIVA 4BFTA 1L1RA 3H7IA 4OX9B 4O2BA 4PG6A 1WKBA 4V0SA 3MA0A 4ZO9A 2ATXA 2ORED 1WF3A 3WK4A 3LK7A 3RC1A 4XQGA 4ZEOA 4YYEA 1HK7A 2BMFA 2ZBFA 2HNBA 1GYFA 1BYIA 4YJ2F 5H68A 3RBVA 3TD9A 4CV2A 1Q0TA 4QBTA 2PX4A 3L6EA 2YC4C 2SECE 3C3EA 2YJNA 4B33A 2BR3A 3K32A 1NF8A 3MLAA 4JELA 1JJAA 4JBNA 3B12A 5AIBA 5CP8A 4YH1A 5KG1A 1IRXA 4TQ9A 4ISCA 4IO1A 1GHTA 2TMYA 1JWBB 2QQEA 4Q1EA 3N0WA 4LY6A 3RE1A 1OYOA 1N6PA 1H4TA 1C1DA 5H80A 3RRXA 1T4BA 4PN7A 1QG0A 4URUR 2UZ3A 1ZN9A 9ATCA 1I1NA 2DBQA 4Q66C 3JV7A 1HBJA 3KPVA 3WMEA 3GPLA 2V0NA 2P0EA 3WMGA 2VWQA 4YI3A 5JEEA 2YVKA 2H4JA 4WX2B 4DUZH 1Q57A 1VPLA 2WD7A 1YDHA 2WF7A 2Q6IA 2W8ZA 5JRDS 3UG6A 3JQFC 1I7NA 3H2JA 3R6GA 4CCWA 4L4RA 3HYNA 1MABB 4DL9A 5K5EA 4LBYA 2PZFA 1S8NA 1EFKA 2PMEA 4IIDA 4M7OA 2FPGA 3NVAA 1E3DA 1SRRA 4NEGA 3NGLA 3NBZC 4KR0A 3DKKA 4K6MA 4R1PA 3I9NA 1N3LA 1M8PA 3CWQA 4MHSA 1NFFA 3C1AA 3OA0A 1JTFA 4ED9A 3VISA 4D81A 4AS3A 5H83A 2WYHA 1G21B 4JJGA 2PXCA 4MV7A 4LMYA 3E05A 3K94A 3T5HA 3P2KA 4XR4A 1GVNB 2NVBA 4LXQA 3E18A 3KJQA 4B2PA 4RLSA 5G0WA 2RHWA 3ZBPA 3U0BA 1L5OA 1H8HA 5LQRA 4KQKA 4MUMA 5KX5F 1DX9A 2PXHA 2W6PA 5AXDA 3D1VA 3JQGB 3RBAA 4CCSA 1TTPB 4I0WB 1IBCA 1RU3A 3M2TA 3WHLA 3ULKA 3JU3A 4CRWB 2FEPA 4HPJB 4NDAA 4A3SA 2ODBA 4OHKA 3LLVA 3BMOB 4HNGA 1Z17A 2N47A 5LXTB 4UE3S 5FLEX 4UFZA 2OOSA 3U4HA 4NCNA 3LY5A 5CT4A 3UK1A 3D7SA 4KGXA 4W9RA 4EUSA 3GROA 3HJNA 2ZSDA 4IHJA 2JHCA 5KQMA 1IB6A 4KU4A 2YVUA 5F12A 3VTFA 3UK7A 4LZNA 1M2OA 4TXNA 2EC5A 4H1HA 2VTKA 4N5DA 3ZQUA 3FPBA 2Z6VA 2R5FA 1J97A 4WLVA 4ZZ2A 2DKOA 1RJRA 3UG7A 2GHTA 3EC2A 1FS4A 2XF2A 3P5SA 2X0FA 4K9NA 2PFGA 3P0FA 2IUFA 4E2YA 1TC2A 1DC4A 3FOWA 2P67A 2D0PB 2F48A 1CSEE 3V7UA 5I8WA 1OZHA 3H4VA 2RDMA 5TQ2A 1OYWA 3FF1A 3S29A 4MUJA 2VRWA 3I5XA 3SBDA 5JAHA 1SB9A 2NOAA 3EPLA 4OHCA 4NXNB 5ADUS 3OZWA 1MUUA 4PR3A 4GC6A 3PC2A 3FRHA 2QXYA 3MCUA 1MO5A 4PX3A 3I52A 4HX2A 5C8DA 3HKEA 1UM8A 4IJ5A 2QM0A 4QWEA 1EVLA 1DAKA 3TLMA 2CJPA 3ENVA 2GN0A 2O0JA 3VNBA 2QIPA 1S2IA 1MA3A 1VIMA 1O0SA 4LGYA 4CF5A 4WDRA 3K0BA 2FEMA 1AJEA 4RD1A 4B3DA 4RMNA 5D7NA 1ZP6A 2CXRA 3Q7SA 5KFUA 3BPSA 4DLBA 3I9V1 4JVMA 1GILA 3TIGA 1OFVA 3AVUA 3DBIA 1IJKA 2ZAIA 2DVMA 1ZIPA 3JRNA 4ZGBA 3ANNA 3HPRA 1QOQB 5CNKA 1HDXA 3MWFA 2VKQA 1IM5A 1W1UA 8AT1A 4O7YA 3KJIA 1AY0A 2PGIA 4B5LA 5CA0A 2Z3WA 2AMYA 2FXVA 4DV2B 3O21A 2ERCA 3DULA 3FPCA 3LQYA 2R0QC 3L6OO 5D86A 5IJ0A 1YRBA 1TU0A 3DDUA 3HMKA 3SZUA 1E4VA 2OBNA 3NHPA 1RCUA 1FDOA 1MIHA 4ZCIA 4ECUA 4BMCA 2YYAA 1J25A 1FA9A 2GFIA 1QHSA 2IBMA 1BXGB 1I50A 3W34A 1R9TA 1XCPA 5KTRA 1VQ1A 3O9VA 4EB8A 1AE1A 2NO7A 1T0UA 1JT2A 2QMEA 3B51X 2P9FA 4CV3A 2PKXA 1Y5RA 1QDEA 4M8KA 1TAHA 1V39A 3M81A 1Z0ZA 4RF2A 5AHXA 4K3VA 5CW2A 1A97A 1R4MB 5CVJA 2W9AA 5JJIA 4M3NA 3KUKA 2GZ3A 4PYQA 2WHPA 4Y7CA 3QEBZ 4H4DA 4Q3EA 2O2ZA 2NSJA 1FTSA 4QYIA 1EWKA 5FA8A 1Z06A 1QUEA 1ZRNA 5BWRA 1M6VA 4RVNA 4MGHA 4TKMA 3N76A 1N1GA 4IDOA 1YT5A 3WNDA 1Z5PA 3VV2A 2I4TA 1HG1A 1LJ8A 2XT9A 1I2DA 3KIPA 5F3DA 1B1AA 1KVTA 5C1OA 3AJEA 4TTRA 4JLJA 1DELA 3W8FA 3ROZA 5AKGA 1X9GA 3QY0A 4A2BA 1P7YA 1AKQA 4NVRA 4CKZA 5I9TA 1VI5A 4KWHA 3O26A 1J9EA 2BUCA 4XWTA 4DMRA 2YXBA 4FEEA 5GONF 3OP1A 3IVXA 3ED5A 3I45A 3UANA 1CX9B 2XCTB 2MYTA 1H1TA 4HB2A 5CNIA 4P1ZA 2QN6A 4HCJA 5FCDA 3UJNA 4GKKH 1SJ9A 4DIFA 4AS1A 5IT0A 2IUEA 1EBFA 4KQGA 3PF8A 1KK0A 4MRVA 2R93G 1GGOA 1UEJA 3KYDB 4LF6B 4YX9A 3Q7QA 1PG5A 4MQEB 4EJFA 2QROA 2Z2YA 2ZSJA 4ETIA 2O3JA 3KSUA 3U7EB 3DEHA 4DC0A 2J3IA 1WP9A 1VZ2A 1ADYA 1Z15A 5EZ6B 3ZVKA 5FTMA 4EKNB 1FJGB 2VDQB 4J9RA 2H1LA 1JDZA 3NKFA 2GLTA 3ECAA 4Q1FA 2QRMA 4HWOA 3AYXB 4C76A 5CFRA 2QTNA 4BAUA 5J9FA 2GRAA 1IVNA 4JJ4A 3V7NA 1ILWA 4AKTA 1TVKA 2NAPA 4WCVA 2NO0A 2WJPA 5CFOA 3W5JA 4QOEA 1CS4C 2PJDA 3WKBA 1XCGB 4XTRA 5AVSA 3TFWA 4BO8A 2FMTA 5BWMA 3QI2A 3PA6A 2Q27A 4IAJA 1I0ZA 4FS2A 5AW2A 5CRIA 3DC7A 2RGVA 5G1PA 4QLAA 4L16A 4DV6H 2WWTA 2PVSA 1DV2A 1KERA 4KYTA 5DM60 2D62A 2ZIVB 3IAEA 4FUQA 4DV4B 3L8YA 3OO1A 2WJJA 3PWSA 4X63A 5KFBA 1E2IA 3HBAA 1NP3A 1O94C 4IDQA 4PCUA 2VA9A 2PV0A 4B3GA 2VYQA 3QK7A 1YDFA 3HXKA 2IYYA 4IPTA 1GG5A 5JJBA 1XNRB 5EHXA 3NV9A 2ZT5A 1SUWA 1L1EA 4EMUA 4TMWA 3DMYA 2BFAA 2O9JA 4L7QA 1YI0A 2R8YA 1EK0A 2W2KA 1Q0SA 4RZ2A 1SVNA 1IEVA 2V97A 2SKDA 5LDHA 1OZFA 4YJKA 1GU7A 2DMRA 1Q22A 1C3JA 1EK1A 4R8VA 1FS5A 3B3AA 1EFCA 3CRW1 2Q0SA 4B1FA 1AGPA 1VJTA 4ZGWA 4GRAA 3RIEA 1D2HA 4FS1A 1YHNA 2WZCA 1Y8RB 5FBRB 2WJGA 1JT9A 4CIVA 1Y81A 3ILYA 2QP4A 1ISHA 3EVDA 3ST7A 10MHA 2JFVA 4RBNA 5HKLA 1NXQA 1U0RA 1IIBA 4UXHA 1LWNA 2ZAOA 1XCLA 3VUFA 2H1RA 5EUCA 5B5SA 2GDJA 1JLHA 4ZYZA 3G2HA 2VHUA 4AXBA 2I0FA 4DAOA 4G5RA 3HUEA 1PR2A 3LX4A 4F3TA 4UHKA 2CE2X 1GO3E 2JKVA 2DTDA 4D5EA 4ETWA 1EHIA 1XAJA 4MV6A 3TQ1A 4TS1A 4P83A 2R11A 5TXGA 2WAQE 2BJVA 3WX0A 3IO3A 3OJXA 1IIRA 3H2SA 3A6GA 2YYYA 4D8UA 5KNCD 4F45A 3GJ7A 2W2OA 4P08A 3C8ZA 4B8WA 1R6BX 3I01M 3PHCA 1M7HA 3NBKA 4NDNE 2DQYA 2QM3A 3U1TA 4XB2A 1HLGA 2DU8A 1VJ5A 3QX9A 1V1RB 5HCUA 1RYMA 3NKLA 4ZVRA 5J4KA 4C14A 1NOIA 3LRTA 3C4QA 3U44A 5JQGB 4P6VF 4HYTA 2PFSA 5KYKA 1Z4IA 1O9BA 1DG9A 1XZDA 3ZDAA 1WXGA 3LIIA 5U1PA 1GNRA 1AKRA 2NV2B 4KXVA 1L3BA 3SQNA 2Z3VA 5J63A 2CLLB 5TC4A 2WKPA 4HEHA 5A5EA 1KJJA 2ETXA 5FLXW 3BWVA 3CLRC 3VKVA 2I8CA 2GBIA 1XN4A 3VR2D 1ES9A 4BBRG 1KWKA 3SHQA 2NO6A 2I03A 1TCCA 1TW3A 3A05A 1IZZA 3VKFA 2C83A 4XM0A 3WZ2A 3PA8A 3R9KA 5EKXA 4DCUA 4DWVA 2ZZKA 2QMYA 2ZRCA 2ACKA 1FXWF 4NK4A 5G3ZA 1BHQ1 4CM4A 5T4FA 2WBLC 2VNKA 4MUYA 2I8AA 1IU9A 4UVDA 2R1VB 4IVPA 3WJ2A 1ZUHA 2WMDA 2C9MA 5AM5A 1TM4E 1YQWA 4D6YA 3WFZA 1P17A 5L7TA 2IYLD 3RUAA 2VI5A 1IN1A 3O0DA 3DYIA 4H0NA 2R8EA 2XGJA 2W48A 3RBDA 2XBMA 4RSGA 1Y5IA 2XQVA 1U1CA 5L1IA 1I1HA 2YWBA 1JG3A 3R9RA 4M1KA 2B2XA 2XXJA 1YOVA 3IILA 2OYRA 1UF9A 3GVHA 3EXFB 2RH4A 4ISBA 3SSAA 1L8LA 1DQZA 3OFKA 3GA5A 2WIGA 3EXIA 1JPVA 2QBYA 1HE2A 1KEUA 1ODCA 2QY9A 5JARA 2XXAB 1KWGA 3A4YA 3AINA 1PG2A 2H1WA 3HKBA 4Z1MD 5F76A 1YUNA 2QN7A 4IX9A 4QUEA 1NVKA 1GTSA 4FGWA 4LFBH 4BGVA 4LBWA 2FNAA 3UHAA 1MT0A 3UJ8A 4EBCA 4PZ0A 5F2NA 1UBTS 2C8JA 2J7KA 1OLXA 4L5BA 2PFKA 1F7UA 2EG5A 1XA0A 4EWLA 3IELA 3LHFA 4ZJZA 4FHDA 3CTPA 2Y0CA 4EHFA 3TDNA 3W1BA 3O3OB 2RAFA 3A2KA 3JVVA 3R0XA 4UXJA 2CN1A 2OUKA 1RJPA 4JP2A 3GB9A 1G21E 1TQ6A 3TGWA 3DLBA 2ZJOA 2XWQA 1OC4A 3QP9A 1ZJ5A 2RAVA 3BDVA 3L6BA 1ZSYA 5KYUA 1VLHA 3ESZA 4CW7A 3NUAA 1YZKA 1P1KA 4L85A 1OI4A 1ULSA 5LZ9A 3EX7C 3IO5A 3PT9A 2G25A 3KXIA 4HQRA 3HEMA 2O59A 1R6DA 4CNQA 4TVIA 4JXJA 3ZHXA 2UYYA 1OFGA 3F9CA 1YJ5A 3RSCA 3QUBA 5A5FA 2P5UA 4LNUA 3RFVA 4RCZA 3EF1A 1YRHA 3DZKA 3HA5A 5FD5A 4AJEA 1PWHA 4DSAA 2FE3A 1QONA 3RTDA 2AFHB 2WAAA 1MZVA 4RYDA 4FWIB 2R6FA 3KUUA 3K1AA 2XUGA 3K0CA 4KDRA 4PFSA 1ODLA 2CJWB 1E2JA 2QPOA 3DDHA 1P80A 3H2GA 3I73A 4IF6A 1O6CA 2QSYA 1XZMA 1LX7A 2IOQA 5TDHA 2R7KA 4TMYA 4ARAA 4R71A 1FSZA 1SHTX 3TS1A 1B0UA 3PNSA 2FPRA 2QLLA 2ZROA 3BK7A 1YNSA 4F5WA 1W0CA 3LO8A 3EYAA 5KQRA 1QQTA 3CYFA 4HWSA 1VSBA 3SLKA 4GZ5A 2B0JA 3GAZA 4HN2A 1S0MA 1ZGBA 3G2NA 3WQSB 5GQSA 4I9FA 1GPKA 3REQA 2P4SA 1DRWA 1T6XA 3ZLUA 5CFNA 3BCRA 5CM8B 4OYHA 1IAQA 2QD4A 2AN5A 4D8WA 3L92A 4JQSA 1X87A 4F84A 3KNZA 4U7HA 3C5HA 2V3WA 2JLUA 4BVKA 2QQFA 3SD7A 2HYDA 4EB0A 2EHJA 2W71A 3IQGX 3B5IA 3GU3A 3KYCB 4EHDA 4BWFB 4RKFA 1C3LA 3LLSA 5CLLA 4E2XA 1RQLA 2Q2WA 5HKAA 4XVUA 1WY5A 1SBNE 4GS5A 1WZIA 3COJA 3C3CA 3AESB 3NC0B 1Y14B 2O03A 3AEQA 1Y8AA 4Z9BA 4ZRNA 4P4NA 4UU8A 4O7WA 2Z1NA 3GMSA 5C31A 4HH1A 5CD9A 3KD2A 4I1SA 4FW9A 3WBJA 3T4PA 4KX5A 4PCVA 3FB4A 2ODTX 3K2EA 2VDLB 1WPGA 2AU0A 4A36A 4C29A 3FBWA 3E58A 4O2RA 2VJMA 4LF7H 1MJFA 1NUAA 2G7MC 3RK1A 3GLIE 4ZCSA 4KPUB 2F1IA 3ZOZA 3TLKA 2GTIA 2NXWA 4Z4EA 4JV0A 1XEWX 3KZ1E 3LHSA 3IEIA 4JB2A 1JKIA 4LOAA 1V5EA 4WLUA 3M89A 2J3QA 3VR5A 2HYIC 3T1YH 3H4BA 3SP1A 2F8TA 3EDRA 3VO1A 4DBLC 3ITEA 4BJ5A 1RQPA 5JZSA 3PPYA 3NBYC 1KDVA 1T8YA 4KE9A 4GQAA 3MJEA 4TL7A 2EFGA 2ZBUA 3CH5A 3S2GA 3X44A 3MBIA 4DRZA 1MLDA 1EPUA 1LGYA 2REQB 4F3KA 1P0IA 3C6MA 4RFVA 5GIPE 1KMCA 4YJFA 4CKBA 3SYTA 5CB0A 4HUQA 4OH7A 1QGUB 3F3YA 4KNVA 2O0KA 4RY0A 4G5HA 5EGSA 1G9XA 3ZI7A 3RB6A 1DOAA 1JG2A 2FK2A 2JA7G 4RTQA 1Y37A 2G63A 1PLLA 1V2HE 4ARSA 2QT1A 2EKZA 3BB4A 3P0RA 3L02A 1KC1A 5SYAA 3TNLA 2VPSA 2X4DA 5BN3B 4U2EA 2Y05A 1NKVA 1RXUA 3GLVA 2GD1O 5A5GA 3S68A 2GWRA 2GSDA 1JAZA 3M82A 1P4HA 3DTFA 5IARA 2XMSA 3K0HA 1BWQA 1K5DA 1W94A 1L4FA 1UK6A 2AR9A 1RC8A 4O1HA 3WQHA 2A0UA 4X5OA 1PGJA 2QG4A 4BFUA 1XMXA 1JLMA 3D5QA 3VNNA 4G9EA 5A6SB 3IX7A 1T5TA 5HEKA 3HN7A 3IHLA 3DFUA 8LDHA 2Z1DA 1XZ8A 4LYAA 1ZGHA 4CE6A 1P33A 3TJRA 5KFYA 3UICA 2IS6A 4L50A 4F4UA 1X39A 3L79A 2V8OA 2GXAA 2OMKA 2E55A 1R9NA 3OUUA 1OT5A 2WU3A 3O8BA 4JBLA 3Q0IA 1Z34A 1R00A 3PHHA 1PT8A 1XVIA 1O2DA 2WZBA 1IB0A 1I01A 1SUAA 1DDGA 1QJCA 4JZKA 4LYDA 1YJAA 3U17A 1PTJC 1HDIA 1KKLA 3F6YA 2FEWB 2XMBA 4ZD6A 3IDQA 3T9CA 3ME5A 4ROTA 5DWDA 4WI1A 3JASA 2FXIA 3ZI4A 5ALSA 4KX3A 1XTSA 3RV3A 5DNCA 2AXPA 3OC0A 2H1IA 2TYSB 1X7WB 4KO2S 1GRNA 1BWSA 4ANFA 1J9ZA 1F38A 3WLKX 4DCJA 4XD2A 4N41A 2IVFA 4Y3UA 2II6A 5CHEA 1JTEA 2LGJA 1XRQA 2CXOA 2X0KA 3WLJA 3CHYA 1SBIA 3GG2A 2NXEA 4J1NA 4OJNA 1EB8A 5EJMA 4C21A 1MAUA 5EE9A 1P16A 4FDTA 1XZAA 1TKAA 4EMSA 2HRQA 2HREA 2QL6A 4ZI7B 2ENUA 1VDMA 1NQAO 5EYPA 3KQQA 5DOZA 4RK7A 4DM7A 2NZ2A 3UJ3X 2C31A 4CIWA 3AM5A 1I7SB 3Q40A 1C7ZA 4D8VA 1T9BA 4BVJA 1SCBA 1UUFA 4F04A 1L7BA 5F9FA 4HH4A 1JHOA 1VBNA 1YHYA 2A5DA 1Z4QA 2A3RA 2J08A 3UXEA 3ZR4B 1JS1X 3OOWA 3BMCA 2OYCA 3KBOA 1OWTA 5AHRA 1TD9A 2VTBA 2UYQA 4DQLA 5IZCC 4OATA 3P1JA 4CIBA 3KB6A 4IUYA 2IYOA 1VGVA 2G8NA 4RHCA 2HIAA 1GITA 1P4SA 2YFYA 2BSAA 13PKA 1Y3AA 2BQ3A 3O47A 4OOFA 1P18A 3FCUB 1TWAA 5EQTA 1Z5OA 1XEFA 1DBVO 1F0KA 1Q95A 3ZWNA 5HSGA 6REQA 1C81A 4R41A 1TYDE 3FWZA 1B76A 4NR0A 4ND3A 5IKOA 3P9PA 2F1HA 3GBVA 2HRZA 4L5IA 3DE4X 3C6QA 5THXA 2QD3A 5JXIA 1I7LA 2PBLA 4CLHA 4PO1A 4BJ3A 4F3CA 2AKYA 2JLZA 2BH9A 4NFLA 1WBJB 4HR7A 1EM8B 3ORQA 4BY9E 2PNFA 3I2FA 2IK8A 3L4EA 3CUKA 3P0IA 3K70B 1R5JA 3VA7A 4WPGA 2ATIA 2AZTA 4H60A 3DE3X 4UTXA 1QIGA 2YDYA 5E0OA 4FZJA 4BCCA 3VHXB 4R84A 1MPXA 4B6QA 3K4HA 5KZMB 2CDAA 3ROQA 1CZNA 1H2ZA 3DV2A 2A0XA 2VQFB 3UAXA 2WTNA 3VU1A 3FHCB 3ZY4A 2QQGA 3CBQA 4Z2AA 3P4YA 4BIIA 2OC4A 2X9QA 2H1VA 3T7IA 1G5PA 1EEXB 2E4WA 4HSEA 3CN9A 1KAGA 3IVGA 4YMHA 2ID4A 2NZ8A 4DLUA 2ZDHA 5FAXA 5ECYA 4TXMA 4RFSB 2P27A 4DT1B 1U1DA 1Z33A 5GJWC 3Q8MA 2JGAA 3PQ5A 4NV0A 3U3XA 1Q17A 1WSWA 3QPVA 2O2EA 1II9A 1GT91 3CY6A 4BO6A 4FDAA 2AG5A 1P4RA 3L04A 3AFIA 2OB2A 5EE0A 3KS9A 1J8QA 4E3WA 4IWYA 3S44A 2PUFA 3TXXA 2O5EA 1PS8A 3GA0A 2HLHA 2QYTA 3SHTA 4K28A 4Y9TA 3TQCA 4U7WA 2D2EA 4WFKA 1V3VA 4Z3OA 1BMTA 1F8UA 3ADBA 4OFXA 3L6CA 2WDZA 1DKNA 4AP9A 3A4LA 3QSGA 1Z6TA 1RS0A 4URYR 5KT4A 5BV7A 1E6WA 1W8IA 4WOKA 4RLQA 2VF2A 1HLDA 1WXFA 1KU0A 5I60A 4U7PB 3N2LA 3RJZA 3ZW8A 4BKUA 2UUBB 5KBYA 3MSXA 5HZMA 2YRWA 4EOGA 4OBBA 3HJBA 2B2NA 1YACA 1CFZA 1F2DA 2V6MA 2WICA 2GYYA 4CPDA 2DCUA 3QLUC 3TL3A 1WM1A 3O8DA 2HK9A 4HMQA 3CINA 5JD3A 4QM6A 5AMXA 5E3IA 3W1GA 3GUYA 5AVKA 5IT4A 3PDCA 1GGVA 1M1UA 1IMOA 2PZBA 3GLQA 2IYVA 3PK0A 2QRZA 5EQJB 3IVRA 2R96A 4MVYA 3KXKA 2QAIA 1HZZA 1P3DA 1O08A 4XSVA 1USUA 2WTUA 3B2QA 1YS9A 2O48X 1FZTA 4JDUA 1QV9A 1A9QA 3W9BA 2HJGA 2XMGA 3AFGA 2IYPA 3NW9A 3IUEA 1SVUA 3PTZA 4ZCMA 1R12A 2Q28A 1GARA 4KN6A 4JJFA 1WMAA 4EARA 3IVAA 2J8ZA 3CONA 4D02A 3QXJA 3TL6A 4BKPA 5KREA 4CMHA 4RVCA 3LZDA 3DEJA 2BCGY 2P78A 4WERA 2IEYA 3BBPA 3ABQB 3NNSA 3JQDA 3RIZA 5C1IA 4DZZA 3VI4B 4JJ7A 1L4BA 5G4KA 4CCYB 1O5TA 1A76A 1KEWA 1KI3A 1NDUA 4TL6A 1Z8DA 4BE4A 2JCBA 4W6QA 2HL6A 4YP0A 4NENA 1HORA 3ADCA 4URFA 5FTNA 4KREA 3V5NA 3SKYA 3RYCB 1RYSA 3BXHA 1Y7HA 4QDJA 4XZ3B 4KSCA 4Y18A 2ZETA 2FFQA 2YZMA 1IY9A 2GHRA 4ZAYA 1MCZA 5TARA 3IPCA 4Y8VB 2VEOA 3X2FA 1RRMA 4DYHA 1FFEA 2ONYA 2FW7A 1R9MA 2V1XA 1Y1VA 4LZAA 1K06A 3FZEA 3U62A 5HE8A 1E8NA 1Y9DA 1ZKMA 1SBZA 2ZIXA 2KLHA 1ANKA 5IJXA 2Y76A 1OXUA 3DDSA 3G8AA 4NCAA 4HS9A 4LJSA 3WA6A 3KKLA 3OLCX 3GMIA 1K0UA 1KOFA 2J5XA 2OESA 4J0GA 2I33A 3V8EA 1TUEA 4IZOA 5CIWA 1FXUA 2WFLA 1YQUA 1A9TA 4HQOA 3WKCA 5L40A 2PGNA 4R8KA 4A3MG 4R1OA 5KKNB 4NI5A 1SY7A 4MDYA 3OI7A 4TQRA 3CZPA 1YMQA 1C4XA 3DPSA 1Z0IA 4GPD1 5DHRA 3W9UA 5TGZA 3AYHB 4AN1A 5DNAA 2ACVA 4Q4JB 4IIJA 3H0CA 4YPVA 4G0NA 5EIWA 5BSEA 5K6AC 1JE1A 2YJTD 2WKSA 2I6GA 4D25A 1A4RA 4IGEA 3LC0A 3IIIA 1N8SA 1JEYB 3FR8A 1GR1A 2W0MA 3QY9A 1FFCA 1CUVA 4KJXA 1D6JA 2QRHA 5IVPA 4EYIB 3TLGA 1UAAA 3EGIA 4MWTA 1EHCA 4MWGA 4EQ6A 3OIGA 1CJKC 3JALA 1KZHA 1ESDA 3BD6A 1F48A 2C2KA 4O4HA 4PDBA 1SAYA 1P77A 2MSLA 4RB0A 4S2EA 5FXMA 5DK4A 1JR2A 4XUGB 4QPPA 3CJQA 1Z16A 5K2OA 2Y9MB 3QXXA 1XRPA 4YP3A 3KVVA 3JATA 3JSNA 3LSYA 5KHLB 1COWD 1Z5VA 1HQCA 3AFHA 1ZNYA 2P8JA 3OQPA 2NSYA 3R3ZA 3GZNB 2XCIA 2VSQA 1O97D 4XVQA 2JJ2D 1QOPB 4YRIA 4J0EA 1G5QA 1KH2A 3RJMA 5EJ9A 4PZ8A 1K3UB 1QQAA 4QICA 3V4LA 5FYQA 4U2CA 3B7PA 1NN3A 4W1SA 5JTUA 4AF6A 1X9NA 1DSSG 3ENZA 3QXSA 2ZJTA 1UPFA 3E2PA 1QU2A 3PU6A 5LVAA 1XXHE 3G23A 3DVRX 2HIVA 2IH4A 2FTKE 4L8YA 5L4NA 4Y9UA 4CR8A 3GIQA 2XCAA 3BE5A 3NAMA 4OMUA 4UHHA 5J5CA 2OFFA 3H8VA 1XAGA 3KDPA 2GCGA 2P0YA 1T9DA 3W5AA 4H7EA 2OBXA 2WUGA 5K8VA 2C94A 1SBCA 1XK7A 3NAZA 3EZ2A 4CLEA 2PUJA 5IM4A 1MAHA 1C3VA 1Z4OA 3O3NB 1K97A 1QPZA 1XD2A 2EVWX 3TSZA 3L5OA 4Q4HA 4OM8A 1AMNA 2FPOA 3G2MA 5CW1A 5JXWA 1WCMG 1SRQA 2WJIA 4JXXA 1KQ3A 1XXLA 2G36A 3QVLA 3TMYA 1QGYA 4ZYUA 4EYKA 4W5NA 4EUEA 1WMEA 2VIIA 1KIMA 1G8FA 2HIHA 1NJFA 2Q1SA 1G9SA 1Z0JA 4DIMA 2FMFA 1RLMA 4YGXB 4K6OA 3IL2A 2FOIA 2V65A 2PZLA 2XYPA 3DO6A 3FWHA 4RTJA 1QMPA 1ITZA 2FMUA 3OFND 3SHOA 4U00A 1WABA 1ZEJA 1F2UB 4ARZB 2GNOA 3VR3D 4NCBA 3WS7A 1FZQA 1TMYA 5KT2A 3BFVA 1XWIA 3HFSA 3CSDA 1T8WA 1HTWA 1AQLA 4BXXG 1QHHA 1EGAA 1PJAA 3NM5A 4IKEA 1XHLA 3ZXYA 3KYHC 5DQGA 1Z2DA 1QIEA 3B7GA 2GPSA 3ZVNA 4KMOA 1H2WA 5B4VA 3DXXA 2XE4A 4JEHA 1MRNA 1PJ2A 1CDDA 3GVIA 4JOCA 1N78A 1CY4A 1P9WA 1A71A 1VECA 2UXBH 2Q4RA 3AEKA 2Y67A 2DLCX 4WZAA 4YFYA 4QJ4A 2EL9A 1U3WA 2XNDD 3V1KA 1IVSA 2PAAA 1JR4A 2BTQB 3OZTA 1VSQA 4TTJA 1CEQA 1QORA 3OJOA 5AKKA 1T4CB 2CLOB 1T3GA 2PGOA 1HYHA 3FI0A 3DV9A 5FNVA 3E0QA 3T3GA 2FSVA 3L6UA 2W0SA 3LP6A 2HF9A 3AZPA 1J2UA 2RJOA 5LLTA 1ST3A 4D4MA 3R7SA 1RHKA 4U9HS 2ZS9A 4XFJA 3CIOA 5ILOA 3KG2A 3GTKA 4D4IA 1U0EA 4GUAA 1TUGA 1ZOSA 3W1WA 4HLDA 4W5TA 2IZ1A 1KO1A 3IBFA 4TROA 4E1VA 4M0FA 4Q3OA 4ZOLB 4DUZB 3HR8A 5BSGA 3AF0A 1RJFA 5TNXA 3FYUA 4AMUA 4K6HA 1NNI1 1EFTA 4DUGD 4ZZIA 4TV8F 1ESCA 5BV0A 4GGMX 1Z7YA 2VZ9A 3HB7A 1DUSA 2RC5A 5TQJA 3FI9A 4FJ0A 1JBKA 1KO7A 3JZMA 2XNJA 1GL9B 1BDHA 1C9YA 3DLPX 4REMA 4I9GA 1QANA 4RJLA 4K8OA 1UT5A 3MAGA 3ESXA 4B6SA 5GADl 2M6SA 3W79A 2HA3A 1SPBS 2YHIA 3C7AA 3TD6A 1YKFA 1WUJS 2JRLA 4WLFA 4ILEA 1I0LA 2O1WA 2Z09A 1ZC4A 3FSJX 3TX6A 2AG8A 3WZMA 2IEDA 1DVRA 1WUTA 4OGFA 5NULA 2IWHA 3EVZA 5IT5A 4KQMA 5KSZA 1N2CA 1RBYA 4NNOA 4EEYA 3P9ZA 5T8KC 2A0KA 2QW0X 5KHAA 2XMCA 5JNVA 3KTAB 2FMHA 4JI0H 3HVKA 1K7YA 4QYSA 4EDFA 4WH0A 5IC4A 2QX7A 1C0KA 2ECQA 3NDPA 1A95A 2QKYA 5MN5A 2VK1A 4JCOA 1JVBA 2W6JD 1PJCA 3SC3A 4AJNA 2YBEA 2NYAA 3KUDA 4OL9A 2C7OA 2R4TA 3O93A 3BFKA 1S02A 4YV2A 2VK2A 5F1PA 1ZITA 4JASB 3A4MA 4MUXA 1V7ZA 4JYMA 2GO7A 4O86A 5DB4A 1YK0A 4ZOQI 1UQUA 1HOTA 3EPRA 2RAPA 5FJIA 1U2GA 2PWAA 3KLNA 1TZJA 3ESAA 2ONJA 3ETEA 1YV9A 3DDNA 3VNSA 4QULA 3BZWA 4O63O 2AGVA 1Q3HA 3KU4A 5HYVA 2P3OA 5D85A 5K45A 3MJHA 4BE7B 5ELLA 5WRFA 1GQSA 3DS8A 3VYVA 1CP3A 3QXGA 4UCVA 2CHEA 4PVCA 1UZUA 3WHPA 4ZI2A 1VPDA 3LXUX 2H0QA 3Q7TA 4M6WA 1ZM3A 1U3VA 5LP1A 2JA5A 2QZSA 4X97A 2HHLA 1YB2A 1AZLA 4U63A 1UJ6A 4NDZA 2UDPA 2XDYA 5KMGA 1A5ZA 3OTWA 4GM4A 2GXUA 4U4AA 3AT1A 3G9XA 3SIRA 3HKZE 3X1WA 3QX7A 5GV8A 4M76B 4K81B 4UHBA 1Z39A 3JCZA 2WY2D 3I76A 4IDCA 4MS4B 4LF8H 1DXYA 5AO9A 1QH1B 3IAS6 2GN8A 5EZQA 4HTFA 1NNLA 1KPGA 1V41E 5DW3A 1RZRD 2HIXA 2VDPB 4HQNA 1BNCA 1D8AA 5LA6F 3KVRA 4RK5A 2HMVA 5JCOC 3NM6B 3TVYA 4DLRA 3RLIA 1J99A 1T8RA 3IUBA 3THXA 1S8FA 3OY7A 1CQIB 1ZRHA 3PDIA 4EUHA 4HRYA 1XBTA 3AOGA 3HCEA 2VQEH 3JQAB 5JHHB 3E70C 3HVRA 3Q6MA 3EWIA 3GHHA 3RT7A 2IVZA 2R2GA 5IXYA 2WIKA 3OPXA 3AP3A 4UDOA 2VXOA 1KDZA 1YB7A 4KHPB 4J94A 4X1IB 3G7UA 4FFLA 4XDHA 4NCIA 3GCXA 2XQFA 4WZBB 3U3OA 4RZQA 3CX6A 3JD2A 4AECA 4MW6A 2H29A 5C8YF 2V7VA 4A1FA 2QLJA 3AF2A 1FSGA 2XUZA 3JPWA 4XGRA 5DM70 3D4OA 4TQGA 3WV4A 2BP7B 5CFMA 4AX4A 1U90A 3BT7A 2FRDC 5FT9A 3ZY5A 4QBGB 4ZDIA 1EXWA 1L4UA 2I3BA 2VN8A 3KYBA 2CW5A 2JEFA 2FOXA 4YAJB 1TUIA 4YCBA 3WMRA 3A36A 1N7HA 2JAPA 4RV9A 3B1WA 5IN4A 5AW5A 4EFEA 2QN9A 4JI1H 5IBQA 1W93A 4NLGA 3HCCA 1VFPA 4LRUA 4FS8A 4E5NA 2CK3D 2VATA 1KBOA 1E1NA 3I1IA 3OQHA 1AVTA 3ZW7A 3RYTC 2Z1MA 4O7ZA 1QYVA 4M8LA 4I2NA 5C4IA 1UJBA 1KZGB 1H6DA 2O54A 4GKKB 3L7MA 3LFHA 1V45E 4LJAA 4BKOA 2C7PA 1UP7A 3OCYA 5C3EG 4G4GA 3GX1A 3DHNA 4F6RA 4TTIA 5E6UA 1E7SA 4LAFA 1YZ3A 4NBRA 4IVRA 1P1BA 1N2OA 1WHSA 1E99A 3HG7A 1VYUA 4ECXA 3BFXA 4TTTS 4KUGA 3G1UA 2J4FA 1PV2A 4QDZA 2PZGA 2QGFA 2Q0XA 3PT5A 4MWZA 3B1VA 3PYXA 4QM7A 4H1TA 1R64A 2WJHA 2LIPA 3DO5A 2ZB2A 1CQJA 3DZBA 3P9YA 3D81A 3OFNA 3U09A 2HV8A 4BLRA 4BMZA 1ET0A 3UHOA 3VR3A 1HOXA 2WJ6A 3N9IA 1POXA 3HJAA 3NDJA 4MVJH 4QFCA 3TPCA 3EUWA 3MSCA 4GSYA 2OG1A 4L78A 4RNMA 1THGA 3LU1A 3UATA 4QOHA 3N2KB 2X4GA 3H9QA 2FGKA 1Y4UA 2HQ1A 3H5WA 5AI9A 3CLUD 4ZOCA 7YASA 4I3HA 3RRYA 4H77A 3QPCA 1AQJA 1OROA 4C5BA 3O8OB 1A5BB 5JCJD 4R8SA 4DV6B 2CSXA 3T7RA 4DPMA 2BKAA 1FE8A 3I8XA 3MG9A 2WJWA 2XNDA 1CJCA 1D6MA 2EU8A 4NECA 3D7KA 3NG1A 4TN1A 3OU6A 3VZDA 1QRSA 2P9CA 3PXCX 1KQOA 3GILA 4U3JB 3O74A 2BE7A 3EEFA 3IAM6 3K6JA 1HM5A 3SX0A 3EVFA 1IBMH 1BFUA 1DTWA 1XELA 2FE4A 4CF4A 2EBUA 3QZUA 1K6XA 5LOVA 2HRCA 1OTXA 3WO0A 1Y1KE 3KO8A 2H3EA 4KBYA 2XUQA 2G06A 4Q0MA 3BCSA 1S9DA 1JSLA 3PITA 5CR9A 1CU1A 2Q3LA 1ORVA 4NXMH 3LQ4A 5FADA 3C15C 2PT5A 4YDRA 5M5BA 3E22B 3GARA 4BVLA 1KZ7B 1P75A 4RPLA 4OKIA 1WQ1R 1J0XO 2IHUA 4DUGA 3UCXA 4WK6A 2JEIA 2R60A 3DOEA 4AQYH 2E4ZA 2VA8A 3P52A 4JWTA 4RUCA 3BOSA 4LRWA 1PT9A 3LCMA 3OOEA 5LMZA 1RXVA 3MRSA 1FCJA 2O57A 4HH3C 1AQIA 2XMDA 4I1VA 3KTFA 2NTYC 4E13A 2FRXA 2IMWP 5FYDA 4MI1A 3ORRA 1FRFS 1T2DA 2QL5A 3VU0A 3KXDA 1U9JA 1AT1A 5G53C 3A4TA 2ILTA 2ZAYA 4L73A 4NL4H 4U2DA 4A6DA 2WM8A 3IH5A 2FG5A 5F1KA 4QGGA 2QTWB 4Q6WA 1I1OA 3A9WA 3I2YX 1MNQA 3ZNQA 4CG3A 3NXKA 1D07A 2A6PA 3E5MA 1H9AA 1R0BA 5IZ4A 3RM3A 3R7WA 1HV8A 3T7AA 4CKWA 4FI3C 3AR7A 4NMXB 2D7CA 3H9JA 2OWOA 5EWMB 2KBFA 5JVDF 2EFYA 1JU9A 4PRKA 4DE5A 3TEJA 3CE9A 1MA0A 3U3ZA 4EFMA 3J81A 1X1BA 4BN4A 4M1EA 2P90A 4JENA 4QTTB 4XYLB 3C3MA 4D0GA 4TYMA 3AVTA 5KI6A 3ZQKA 4X92A 3GOQA 4EEZA 3ND6A 1NXSA 1VL5A 2D5AA 5J3JA 3CVWA 2W6JA 2VH1A 5G2OA 1CJMA 4UEOA 2OPHA 3COYA 1Z63A 1YFLA 4W5HA 5IXJA 1KMHB 1PBNA 1QHXA 4R2WA 4D9MA 3U3JA 5AD1A 3MFYA 3S1AB 3EXHB 2FCRA 2VUTA 3HU2A 4Q16A 1FVIA 3SR3A 5A9SB 1XVTA 4ZA2A 2M1XA 4BFYA 1ID1A 3PYMA 4JT4A 4PWYA 4L6IA 2A92A 4TXJA 1L9XA 1KEVA 5B3KA 4YBZB 4UNSA 1J2TA 1RRCA 4Y2JA 1IXZA 2A5FA 3WK5A 1EE1A 1ZK1A 4TKLA 1QNLA 1TEHA 5TE9A 3TTSA 1WUHS 1DB3A 3VU9A 1YJCA 1Z29A 4AU1A 1RC1A 4WJZA 1SXQA 4TKZA 1FB5A 4QRHA 4MWSA 5DVZA 4U6NA 4MTEA 3CR8A 4V0QA 2PZEA 4QU9A 3DJFA 4JITA 3K0AA 4LNAA 3UJCA 1T6YA 1D0SA 1U28A 2XTJA 2IYTA 1A0OA 2PT6A 4AO8A 4KRGA 4RTSA 4B79A 5AM4A 3QVWA 4H59A 2O7SA 4PLGA 3A6LA 2HMAA 5CB8A 5EN4A 1R37A 4PRZA 4N7MA 3WSWA 4EY6A 4X3OA 1NC3A 4D0SA 4XM2A 1RXEA 5E9AA 3S8MA 4UOEA 2AJDA 1UR5A 2EDAA 2HUPA 2IS1A 2GXQA 1NM5A 1X1QA 3Q3JB 4EQZA 3DZIA 2A84A 3T3PB 4LPSA 4NG5A 2CNWD 1JYEA 3JSAA 2POCA 5TQVA 3T61A 4ZN6A 4ARCA 1QHIA 4C05A 2I7XA 1UC4B 1S8AA 4RAOA 3VZQA 1RZRA 2JEZA 5DN9A 5B12A 4L51A 3DMPA 1W9MA 1QVVA 1P5ZB 4WBNF 1LLCA 4JFRA 4PG7A 2GEDA 2OORC 2CBZA 3UGJA 1HNWH 1Q91A 3RFFA 4J03A 4FD3A 4MB2A 2HVQA 2GM3A 3ONVA 4M9SA 5IKEA 2ZW9A 2FP4A 4R6WA 5DM4A 4ZU1X 2REOA 2X6RA 4B7XA 1Y48E 4GEKA 3U81A 5SY6A 3ONFA 3OD1A 1L5HA 2C9OA 2GH1A 3QIVA 3Q2OA 4OXIA 4QSMA 3CKLA 3SZRA 1ORRA 3REFA 3QELA 2K6GA 2AKAB 1YDEA 5GM1A 3T9DA 1A9RA 3STYA 4A03A 3PI6A 2Q8NA 4DGQA 4FOPA 4LQCA 4XFDA 1KU6A 2L0XA 2NXNA 2COKA 1ABFA 2X19A 4DQ0A 1H85A 4FX5A 1IN4A 4G1VA 3U7RA 1T2NA 2Z04A 2P2YA 4EW3A 1DTEA 1GPDG 1ADCA 4QRDA 3DTTA 2O7NA 1JDSA 3OSPA 2QTMA 3SPXA 3ASUA 4HDMB 3O4RA 2I7CA 4CLRB 2B61A 4IJUA 4E5VA 4WOPA 4ECEA 3FTDA 2WDTA 1JA9A 1EUCB 3D3QA 3REOA 4N0EA 3C3JA 3GFRA 2YZGA 1DAOA 1HYEA 1PHPA 2PL9A 2GD6A 2B63A 4HQKA 1X7XB 3U7GA 4V3CA 4ETMA 3BFPA 1YB4A 1Y3CE 3EC1A 2XAUA 5CDGA 3G7SA 4ITRC 5KTSA 2CK3A 2Y1GA 5ITZA 3P2IA 2JLVA 2FPMA 4QIWE 4YECA 3ZGVA 5CCXA 3MT7A 2W8BA 1U94A 2YXLA 1FMTA 2BFFB 3I61A 3PE3A 4HJRA 2J0UA 3EG9A 4Q9KA 3G2OA 4OHUA 1WV1A 4HXFB 3FX2A 3CCCA 2GRUA 1PFUA 1AOXA 4Q05A 5ENDA 3EQ9A 3UAZA 4LSGA 3GUCA 1T2AA 1MDFA 4LVCA 3UJDA 3R6DA 2QGZA 3KRTA 1WPQA 4P81A 3K8OE 4K2AA 3CT4A 5L9XA 1AUOA 4WY2A 1NMYA 4DMMA 1U8CB 5KOJB 1EH5A 3T54A 3FCCA 1T5IA 3LQ2A 5TY0A 4U7GA 4HFRA 1ND5A 5C44G 1OV4A 3GLRA 4D99A 1GUDA 3VBEA 4J2TA 4FZ3A 1NU8A 1JIIA 3QX3A 4B3TH 4DIDA 3LYAA 2V54A 1KJWA 3E5RA 4FHCA 1TCUA 5LQNA 3UGQA 3Q6IA 3FKIG 3OPYB 3TQIA 4YRAA 3AXSA 1GCUA 4IY1A 2EZ8A 3K4PA 1TTHA 1JV2B 8OHMA 4XVCA 2BMJA 4W8HA 2NU6A 3CURA 1LSOA 2CUZA 4EKIA 5IDQA 2XUOA 3H2IA 1QIHA 2VF4X 1RPTA 4ARVA 1PGOA 3OEED 1X15A 5CT6A 3AFMA 4S1VA 4YV7A 5K6TA 4DEYA 4ZGGA 4LF7B 5JCJA 4RE5A 4DV5H 4JSTA 1PWXA 2ZYGA 2Y93A 3HCFA 3BDIA 1GOTA 1R9GA 1BWRA 2VT7A 3WL8A 3ZWOA 1Z74A 1U2SA 4Q4AA 3DA8A 3TB4A 1L0BA 1VM6A 1K3FA 3KFVA 2N9UA 5JDCA 1M2VA 1E2GA 4A8JC 3T1YB 2QJFA 1TLTA 4BU0A 4KIFA 2C57A 4A3JG 2G5GX 5J4LA 3ICWA 2G9ZA 1G7RA 3CF6R 1KI1A 3SIWA 2ASJA 1PQWA 4OHRA 2F64A 4BMOB 5TVGA 5HBRA 1ZJ6A 5I6DA 1F1JA 3SC2A 4TKUA 2WU4A 3U1VA 4D9GA 4TL9A 4MYRA 3Q7IA 2GK7A 4AZTA 4BMDA 4YQFA 1TMKA 3A6PC 3O8QB 1PX0A 4CDGA 4WN3A 4LX8A 2LIVA 2CEKA 2EYUA 4BN0A 1KY3A 1G3UA 4F3RA 3TKAA 5KNCA 1C9MA 2QMOA 3RS2A 3ZU3A 4I4TA 4ZCQA 3SQOA 2BI4A 1RI4A 4F1WA 4E12A 3KKOA 4A7PA 1FTQA 2X6TA 1FW6A 1U5BB 4XWYA 3WMWA 1WZ2A 1PVOA 2R4UA 1VPEA 4XUDA 3UAWA 2HGZA 5EMKA 1PJQA 2X9VA 3CPSA 1H0SA 1S9HA 3U3KA 1A2QA 4MH0R 1FSSA 4M0KA 3OMWA 1U0GA 3OD5A 1XZLA 3AB3A 4J7UA 3VR2A 3RVSA 2BM1A 5E9QA 2ZVDA 3B8EA 2V0GA 3HO1A 1P7ZA 4BFWA 2DKNA 4M99A 4QPNA 4MW2A 5LYJA 3M7IA 3V4RA 5KYYB 1SA0B 3GT3A 5KQGA 1PNQA 3NWOA 2FSHA 1G98A 2NG1A 4LDRA 1T8SA 2CDCA 4EJ2A 3E82A 5K8JB 4O59O 5EFOA 4YMUA 2W2QA 3ZGZA 1GPWB 1F6WA 3AY6A 4RCYA 3ML1A 2IPNA 5IT9W 3V00A 4JUCA 3BA9A 4ED1A 2YV1A 4RXTA 4PBRA 4JUZA 4Y1RA 1WIWA 5JVLA 1PVVA 3AIMA 1GKKA 4JOBA 1OXMA 2AX3A 3F90A 1GT6A 3PDWA 5JROA 2J6TA 4MRPA 5AT1A 5A2QW 4NQZA 2O3TA 1KRWA 3CRRA 4F4DA 1LPNA 3ROTA 4UFPA 1U9IA 3V4FA 5E4YA 4JLOA 2EQAA 3EW7A 2Z5LA 3PO2G 3F8WA 2V6BA 3IEXA 2NTJA 5HQ3B 5GPBA 3L84A 4ZI3A 4UEWA 4PEVA 1FU7A 3VDNB 1N5JA 1N3YA 4S3MA 3HZZA 1CHDA 3H87A 3LVRE 4LJ6A 1UXHA 5HOEA 3PJEA 5J2UB 3Q2KA 3SHFA 5EEGA 4Z1MA 5LNK6 4JYAH 1GPAA 4OKSA 3UMVA 2ZYAA 3CNNA 3CVJA 3V4PB 2ZRPA 3Q0EA 4IO0A 3GGOA 4YRZA 3BAAA 2G3YA 2MHCA 3OQ6A 4C04A 2ZTHA 3NUGA 1C0PA 3DBRA 2HDOA 1R2QA 2J9FA 5IAAA 3AFNA 1SC9A 2C4TA 3P94A 2BGTA 3JVDA 4Q21A 3V4SA 4YO8A 2GZ1A 2Q8QA 2VK8A 1JG1A 4E1AA 3RBXA 1E1CB 4WQMA 4C4OA 4MQFB 1FXSA 2M2IA 1T4MA 2XZDA 4UUBA 1CUBA 2LD4A 2IXTA 1I5EA 2CNWA 1DHTA 3DD5A 2A9KA 1KI2A 3PGVA 3FKSD 4RW0A 3EFOA 3SNHA 1GG2A 4TV9F 3Q41A 3V1YA 5KPDA 1Z13A 5FTJA 2UZ1A 2RGXA 4U5XA 1OV6A 2SKCA 2HNAA 4Q19A 3ZJVA 4QEDA 1S7CA 4OV6B 4X20A 4ZJUA 2ABJA 2GBLA 3UWKA 1YRYE 3QYPA 5KG6A 1B26A 1E96A 3SGIA 4I19A 1I6KA 1E2LA 5BPHA 4C0WA 5BSRA 3FOZA 1CS0A 1TJ3A 4RD0A 1XRLA 4MUGA 2IODA 3QKSA 2WSMA 4RS4A 1CUWA 3B89A 3S7TA 1EKPA 4DCPA 2OXRA 1WULS 4M83A 2YIVX 4KXLA 4TM8A 2XY4A 1JQLB 3N2NA 2YKGA 2RI0A 1GTG1 3OUTA 5KFNA 2D8AA 4HAVA 5DM0A 4CZ2A 1CIJA 3RFCA 5BXQC 4LY3A 4QTZA 2X23A 1E61A 2ZAMA 4A23A 3CVZA 2R3SA 2G1KA 4CGYA 1P91A 3PHLA 2FQ1A 2XDQA 2ZG6A 3OLWA 4J9QA 4P7JA 3TOXA 1SZPA 3HVUA 1PQPA 2ECOA 4FMPA 1FLVA 8MHTA 1D4AA 3IPLA 2P7IA 1ENPA 3WIOA 4OREX 1B93A 1I2AA 3F4KA 1GXSB 1JJFA 5F9NA 3HZOA 2DP4E 1SC3A 1M1NB 1YFJA 1VBFA 4MV3A 2HHFB 4IQ8A 1FX0B 1WU8A 2YHSA 4O7SA 2AL7A 3TQTA 2WM9B 2EW2A 3WKAA 4QL3A 1JN0A 1VL1A 4DV0H 2H1HA 3KYJB 1JHXA 4J9KA 5BO5A 5LSAA 4BATA 3GJRA 3I3OA 4E2WA 1Y8CA 2VF5X 4M88A 1OGJA 1P8LA 4RF3A 4GZLA 2XVMA 2YW2A 4TVKA 5FFNA 3ITDA 4OBXA 4P5PA 4UAJA 4IDDA 3WNZA 1MHPA 2J5RA 3FBTA 1BX1A 3EGOA 2JARA 3UH1A 4D82A 3DQPA 1GQQA 3MCWA 4EO4A 3BMNA 2WJ3A 4XYMA 5D3ZA 3KOYA 4M37A 5JECA 1YU9A 1SXJB 3M49A 5D84A 1M1YB 1SZDA 4W6ZA 2QAGA 1I1KA 2H52A 3PNVA 2R1TB 2WIJA 5AK4A 3CZRA 2QT0A 1GYPA 4A3LG 4OHYA 3ZDRA 4P22A 1WDTA 4E03A 2DOKA 1KYYA 2YJ5A 4HNAA 1P4JA 5K20A 3F9IA 2WIFA 3CNLA 3WYBA 5B7PA 3EZ9A 3VPXA 4CMKA 2RHMA 4YRKA 2ADFA 3B53X 2Q2QA 5ISMA 1CUSA 1KQGA 3BCHA 2HF8A 4O3PA 4LE2A 5EJGA 5CVDA 5H59A 4EJSA 4OAOA 1N9KA 1CE8B 1JMYA 1WMBA 2NP6A 2YWJA 2N3ZA 4CIAA 1QIKA 1EJ0A 3FVWA 2FJPA 3ADPA 5JSKA 2H06A 3RG8A 2VRBA 3FVQA 2IXDA 3GUHA 2H2DA 1IWOA 4RGBA 3S1LA 5LN1A 2B4KA 4U6QA 4TSRA 3WADA 1K0FA 3ROMA 3RVLA 4INAA 4QHSA 4UTNA 4RULA 3VPSA 1C7FA 4Q39A 4KN5A 2AFHE 3LDFA 2F62A 1R15A 2VUMA 1VLMA 4IMPA 5HF6A 2JLAA 4MUAA 5BN5A 4B5KA 2JZOA 1I32A 4X1YA 2HCTA 4NHEA 1W36D 2WAQA 5EJ8A 1WO8A 3KHRA 1J7JA 1I2CA 2H2FA 3V8BA 5C5CA 1L5FA 1YVPA 1ESZA 3STUA 3KQYA 4F21A 3RYFB 1V48A 2GPYA 4GZ6A 4UCSA 4I55F 3MUOA 1QO9A 5CD1A 2X5OA 4ZXPA 3LKDA 2BMEA 1F4LA 3FFTA 4C0AC 3KAJA 4DQXA 1H22A 3D7NA 5B53A 5JEDA 3NBFA 3S2UA 2BM8A 3PQ8A 1A3GA 4F9TA 1Y8ZA 5K4GA 2HA5A 3OIUA 3NC1C 3GFSA 1OYVA 1JFFA 1VE1A 1FJXA 2PZMA 3IA7A 5JSZA 4Y6QA 3E9RA 2ZQZA 3DM5A 1FL9A 1DJOA 4K9OA 4C78A 1GGMA 3H2YA 1ZVVA 4FNAA 3HB5X 1XZGA 2J9YB 3GDHA 5CT8A 4CMIB 2ZRBA 4FGRA 1E69A 1RM0A 5CLIA 3QVVA 2RH8A 2IIVA 1KEEA 1S97A 1IXRC 2ZYDA 2OAEA 3Q72A 3EFBA 1RBQA 2VFAA 2X0RA 5CLFA 3UA3A 3DVAA 4P8RA 3B9PA 3UOWA 1HDEA 1A0GA 3LUGA 5P21A 3JD0A 3N8GA 2IH5A 2DFLA 3I9KA 2ZSBA 1YU6A 1SNYA 1FP1D 1KAMA 4JYBA 1WX1A 1S2DA 4BJ1A 3MGKA 4X85A 1QTQA 2QD1A 3EEOA 4E21A 5H3LA 4HY3A 2DPYA 2O8EA 3N28A 4Q45A 2J85A 3I2KA 1BDJA 4EEQA 1E0KA 1A77A 3W1EA 1TZ2A 1GN9A 1K08A 3GN1A 5K0BA 4UAGA 3T7EA 4OYLA 4LXUA 1OTHA 4GL2A 4QYXA 5GY7A 1Y9JA 4YRGA 1SG0A 3QXHA 4G67A 3PR4A 4N03A 2WOJA 1PKXA 5HKBA 4X93A 4NE2A 5DHSA 3G0OA 4MLCA 4OJKA 4TVSA 4WBSA 3FHTA 1L7XA 3GFGA 1E5DA 3CZMA 1YR8A 1ZI6A 4NZZA 5BVGA 4AUNA 3RVDA 2R7NA 5HJEA 3TM5A 4JJ6A 3CT6A 3WLHA 1XLUA 1OLUB 4KZPA 4PICA 3GQCA 3GNTA 4NYMQ 4BXOB 1T0JB 3HE3A 1Y9AA 4XH9B 3K20A 3TRHA 1ZK0A 5E9JA 4HLUC 1ZD2P 3LVBA 4BP1A 4KXYA 1GNPA 4XYEA 1DUIA 1QAQA 2LDBA 3BF7A 1YQXA 1MTZA 3V8MA 2H92A 2AEEA 3OZXA 3HBFA 5CGZA 5HUHA 1IOVA 4KXMA 1W35A 2CVPA 1ST2A 3OZ7A 3UKJA 3QE0A 1E0DA 4W9NC 4B35A 4GKJH 1SYXB 3ODGA 4CFZA 4AJOA 4X44A 1XYYA 1GZ7A 3DD1A 4QVGA 4BX8A 1RXSA 1HY3A 1ZMTA 5L3SB 1HRDA 1QCYA 5ED4A 4PLYA 4LGCA 3WLFA 3RUIA 1V6AA 4DM3A 5BSMA 4TUYF 3R3VA 1EP9A 1RAFA 3L6DA 2C7RA 4HDKB 5HFNA 1KKUA 3EH2A 5EP1A 5C8ZA 1TM3E 2OZLA 3U80A 4EYQA 1O8CA 1FNCA 1IPHA 1DCTA 2ZJBA 5EOYA 5FF9A 1KI4A 1AKUA 1G21A 1M1XB 3VVBA 5J5VA 3T95A 3TMAA 3I23A 2ASVA 2F3SA 2BLLA 1CULC 3HCAA 4KGDA 3H0GA 4DG5A 5CCEA 5KDLA 1X7ZB 5BMVA 1QS0A 3UMRA 3NAQA 5L4SA 2VQ3A 4WE3A 4ZO4A 1I3LA 1N48A 4D1YA 3R5XA 4KMRA 3TUZC 4EHNA 1V4NA 4JQOA 1O6GA 5LKRA 1MTOA 4OFZA 4E3ZA 3KTDA 1S68A 5KG2A 3OBBA 4NE9A 1JLSA 1W88A 4HDOB 4CCAA 2J9XB 4IZIA 4C7OB 1A1SA 1J8VA 2SHKA 3LCVB 2DR0A 5B1IA 1ZA1A 2K87A 3JAKB 4U39A 4NEHB 5E95A 3TTYA 2HI0A 3G0BA 1XUOA 4XPIA 5BQFA 1L5QA 1O8BA 4RHXA 1E4EB 3E2IA 1MOPA 4GSLA 4IR9A 1XDBA 3ZW9A 2BFDA 4ZQCB 4K6CA 3QU9A 4JJZA 4HZUB 2ZJ5A 4PXYA 4B8YA 2VOJA 4D96A 3LQ1A 5CNJA 1AGXA 1NPTO 2G1UA 5G4LA 4FMBB 1UJ4A 4YRFA 3LA8A 4LRSB 1MJGA 1M66A 3ZLVA 3PWTA 3VOSA 5JZMA 2XWBF 3ABOB 3PP8A 5SY9A 1JIHA 1DXHA 2VCYA 1A2KC 3LM8A 2HBRA 5B7QA 5JH7A 3GLTA 1EJBA 4G5OA 4WK4B 5BW4A 3S2ZA 3V6KA 2G80A 1Z12A 1K66A 3HDQA 2A67A 1GTZA 4LZLA 1PR6A 2K5UA 1YVDA 4B85A 4GE0A 5IUJC 2PSEA 5DZSA 3D5TA 4DOMA 1G2OA 2JAQA 2VP4A 3JQRA 2PO7A 3HY3A 5DNUA 1ESNA 3OU7A 5DP2A 4F8YA 2YJ4A 4L3WA 5T3YA 3Q3EA 4WBXC 3U4IA 5E7MA 2UXBB 3O5AA 3DUFA 4FLFA 2IBSA 1EDZA 2WAXA 3WBBA 1YH3A 2ZCJA 1O96B 4LF4H 4GFDA 4WIAA 2O4CA 4AIIA 4YJ3B 4ECSA 5J2TB 4PLTA 2OD2A 3LI2A 4K6GA 5BW8A 3EHDA 3OPVA 4QGHA 3REGA 2FHSA 1C1XB 4LK3A 2JGLA 2ST1A 4QHTA 3TG8A 3GLIA 3RFXA 5T64A 1PV4A 4GU5A 4TZTA 2YV5A 1QRRA 3JQBC 3CQ9A 2GPBA 4I4LA 4B6EA 1ZJWA 4HVCA 1SEPA 2V9WA 4RHUA 3FWKA 3RAJA 1ZNWA 3F6PA 4KWEA 3H7AA 3LNTA 2WDPA 5HBGA 4RMJA 1I1QB 2XGSA 3ZVMA 4IDPA 3AIIA 4RVSA 2QUHA 3K9LA 4BWYA 2V4ZA 3RIXA 5I01A 3QW2A 2DBYA 2F4NA 2FEKA 1KO8A 5AJVB 4ZQFA 4CNBA 2FF5A 4GPZA 2JIPA 3WYGA 4LTDA 2WFZA 2CNUA 1ZQ9A 1AF7A 2P9JA 5HM8A 2XDAA 5F9LA 3JZAA 1X80B 4UCWA 3UWSA 2OZKA 5HZGA 3IUSA 1CYEA 1NPDA 1C14A 1PLJA 4DA9A 3RJ0A 4APMA 3WL7A 3PLAE 3TIXB 3RVKA 1BFDA 4ZP1A 5I8PA 4HFNA 3MD9A 3AEYA 3OCUA 4WLOA 3EPPA 3U9LA 1E60A 3U2QA 5CX4A 5GWXA 3BJRA 5D51S 1RPAA 3MOGA 1FY2A 3RS0A 3LE8A 3R7NA 2YCLA 1M7JA 3VX4A 2O8FA 1DIBA 1BKYA 1FYEA 4NYIQ 3WYAA 1B6RA 1ZVMA 2DKFA 2BHLA 4DXDA 1HA3A 4JI0B 2P9YA 4P3OA 5DLEA 5CB6A 1ZMRA 5JAPA 2PHZA 2A7XA 3BGSA 3F5SA 5KTPA 1XA3A 5DBEX 4EFBA 2NAFA 3O75A 3IIEA 1JDUA 2CUNA 3FPAA 2IBKA 3ICEA 1GA1A 2XD9A 5AJXA 4F4ZA 1ZUNA 5DHQA 2RGUA 1H6BA 4Q37A 5AHOA 3HI6A 4UTZA 4BNDB 3LUAA 3N53A 3WDLA 2VT2A 1KVQA 3WLPA 1Y6ZA 3DFFA 1KNXA 3UAYA 2IYXA 1WOYA 4JN6B 4XQ0A 2JGEA 4P3NA 2JFWA 3QV2A 5B37A 2EKBA 3PXGA 2L69A 3LT1A 4HGNA 1P9RA 2JA8G 2HW8A 3WGHA 2GGSA 3R1IA 3QOWA 1PZFA 1U0BB 2D4AA 2O14A 4OUKX 1QP0A 5DO9A 4LEIA 2F1KA 4ES6A 1G7SA 4J6FA 3I2IA 3NRCA 1M6YA 1SKMA 1KIAA 2ZIUB 4GVLA 3F4LA 1B0AA 2PMDA 2FW0A 4NMLA 3OFVA 1GIAA 2R8RA 2Z43A 5KCMA 2PUDA 1BFKA 5ER9A 3MTGA 1SVWA 4G5YA 3KFLA 2V98A 4DMCA 5GTDA 4D74A 5ALFA 4KXNA 3HNPA 1TA0A 4KSYA 2HU2A 3A0UA 3JQ8B 2WE6A 5F23A 5ULLA 1PHRA 4HG2A 1RPNA 2WPNA 2O0HA 2CMDA 3MR5A 3QBVA 4ECZA 5BRNA 1GQOA 2FAXA 3O82A 1TYZA 3WIEA 3KKMA 1AUPA 5LP6F 5BWVA 1COWA 2JGJA 4LF8B 3KE8A 5JUWA 4HAWA 3MILA 4KR3A 4N5LA 1MT3A 3K09A 4EATA 2YMMA 3PJGA 4J7CA 3G9UA 2D1TA 3B78A 4KAXA 2JJ2A 4RHTA 1DQSA 2V7QD 4O2AA 1ZM4A 5ALNA 2PZJA 2BGKA 4Q1VA 1M0WA 3SQXA 2FW6A 1CIVA 2EP8A 1C0IA 2RHBA 1G3QA 4YB8A 1C30A 4UKDA 1T1IA 3HJGA 4EAQA 4OI1A 1PZXA 3CKYA 3AL3A 2VQEB 2W6OA 4EKEA 1M74A 2ZSFA 2WW8A 4O7NA 4HB4A 1R6TA 4DBVO 1NF3A 1NDHA 4DLNA 1RMYA 1QAMA 1GQFA 4LN1A 4QJ3A 2IKQA 2HQOA 3RREA 3QTLA 2Y66A 3GNLA 1KJ9A 3LQSA 2BQRA 2E5WA 2HU8A 2R7ZG 4OA5A 1MB2A 5BWTA 2BFEB 2GCOA 2V9ZA 4HDSA 4EI2A 2P9TA 3H11A 3K6KA 4A15A 3BWMA 1PGQA 3C41J 2FUG6 5EUMA 5LIRA 2Z8YM 4P58A 3I3SR 4C4SA 1H5QA 3PQ7A 4NAUA 1BRTA 3C0KA 1E2EA 3A6FA 3MIZA 2RIPA 2H1FA 3GWGA 3SEQA 4DCGA 5ERXA 2FR8A 3QQ5A 3OHSX 1RP1A 4I66A 4NBLA 1YQEA 1AS0A 2NUAB 1KVSA 4ZJPA 4JAVC 1WR2A 3I05A 2ID7A 3T0FA 1QOZA 3JQ7A 3EOZA 2PJZA 4DDKA 2QVZX 3K5IA 4A8PA 1E7WA 2D5IA 2XF8A 4QU0A 4DLVA 4W99A 1LSSA 4J0MA 4UOQA 5JMPA 2AQ8A 1FU4A 1NQWA 4IFBA 3IOCA 3ZXIA 3FFBA 1M75A 5CDTA 1BCSA 5T14A 1I3QA 4RMGA 1KAEA 3RKUA 1JNYA 5DTQA 3L05A 1RJ9A 3SG0A 4FYJA 1VG1A 3OTQA 2WYUA 1NE7A 3GVCA 4G5QA 2Y0BA 2PX8A 1SPXA 5AI0A 2YTZA 3JWJA 4N3NA 2YL2A 5FLKA 4MUFA 3ACBA 4W8OA 1LLDA 2PSDA 2J6UA 3RF7A 5DQHA 1V1MA 1KK2A 4J9MA 2Y9PB 3D3JA 4O3OA 2JC3A 2E5LH 4LMRA 2WG0A 3L40A 4JB3A 4BO4A 4BQNA 3DOCA 3MCZA 5EZYB 3DDOA 4BLTA 4ZYLA 3R24A 3C6ZA 3ZE9A 3AX6A 3HNRA 4J3FA 4J0KA 4V24A 3LPLA 1X3SA 1UDWA 3AZOA 1CRZA 1S3SA 1XHEA 3DUWA 1N1MA 4JUFA 4WESA 5K4AA 4KR7A 4OJMX 2DSNA 1D7AA 1FNBA 2WUVA 1QQBA 3HL0A 3BXGA 3WK9A 2IF2A 2J87A 1JX4A 4RTKA 4CF7A 4FQ7A 2CF6A 1Y5LA 5CBKA 1A8PA 2CHUA 1N5OX 3B36A 1MRZA 5DYNA 2I22A 4V2UA 3K3VA 3D3WA 5KKAA 4WINA 3A25A 2Y0SE 5HRCA 2YIJA 1T9HA 3RABA 3PJDA 3QNWA 3E3LA 3THRA 1W5BA 2FQQA 5AWFC 1PF7E 5DGXA 5H0IA 1V5IA 4LJ5A 1XTZA 4M9XA 3IMCA 4Z8XA 2NMVA 4ENRA 3T94A 3G02A 2C77A 3ABIA 3C2QA 1X86B 1J23A 3IYLW 4WCFB 2FDRA 3PC6A 5DXAA 4D41A 3OETA 2XJ9A 1FVFA 4GLXA 2ECKA 1Z5GA 3QHQA 4OGLA 1ZAUA 1AH2A 4RY2A 1OXBB 3H8WA 5AKXA 3DP7A 3DMGA 3ANMA 3Q5EA 5JZ9A 3S7ZA 1FYVA 4HJXA 1SD2A 3V2IA 2QRLA 5LLDA 3OWXA 1MZPA 5NLLA 1IBMB 3N44B 4BP8A 2RDJA 3V6MA 1XTQA 2NSLA 1KI7A 2YFHA 3B6MA 4EI9A 3L7KA 3OECA 3NXSA 2W6MA 5ALGA 2WTMA 1O3YA 4O2BF 1WKCA 5KTMA 4MR7B 4WKGA 4NXMB 5ILGA 3IMEA 3TZEA 4ND8A 1MC1A 3CB2A 4O25A 2Z2ZA 1KZYC 2B34A 2IE0A 3WIUA 1KOLA 1AX9A 3EQ2A 3NKVA 3PZPA 3NWJA 3KWFA 2QE6A 2Z2IA 3HA3A 2FWMX 1RZ3A 2IZ0A 2NVYA 4DF3A 1P3Y1 1NQUA 2O6HA 4R51A 4PC3A 2GCNA 1C3EA 4AQYB 1FTNA 5C3MA 1LDNA 3O90A 4N65A 5C7YA 3K0FA 4X84A 2PZ8A 3FMGA 3WLAA 4YLGA 3CZ4A 5TVKA 3R3YA 1Q7RA 1M2NA 1MRSA 3OIVA 1E6KA 2ZUCA 1J70A 1ECPA 1KAHA 4MKGA 4IUCS 3G9ZA 3EBLA