1M0WA

Yeast glutathione synthase bound to gamma-glutamyl-cysteine, amp-pnp and 2 magnesium ions
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
486
structure length
481
Chain Sequence
PSKDQLNELIQEVNQWAITNGLSMYPPKFEENPSNASVSPVTIYPTPIPRKCFDEAVQIQPVFNELYARITQDMAQPDSYLHKTTEALALSDSEFTGKLWSLYLATLKSAQYKKQNFRLGIFRSDYLIDKKKGTEQIKQVEFNTVSVSFAGLSEKVDRLHSYLNRANKYDPKGPIYNDQNMVISDSGYLLSKALAKAVESYKSQQSDPIVAFIVQRNERNVFDQKVLELNLLEKFGTKSVRLTFDDVNDKLFIDDKTGKLFIRDTEQEIAVVYYRTGYTTTDYTSEKDWEARLFLEKSFAIKAPDLLTQLSGSKKIQQLLTDEGVLGKYISDAEKKSSLLKTFVKIYPLDDTKLGREGKRLALSEPSKYVLKPQREGGGNNVYKENIPNFLKGIEERHWDAYILMELIEPELNENNIILRDNKSYNEPIISELGIYGCVLFNDEQVLSNEFSGSLLRSKFNTSNEGGVAAGFGCLDSIILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large Conformational Changes in the Catalytic Cycle of Glutathione Synthase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
molecule keywords glutathione synthetase
total genus 171
structure length 481
sequence length 486
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 1m0wA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1m0wA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1m0wA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1m0wA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 1m0wA04
2CNQA 3GIDA 3N8DA 2YRXA 4YJ2F 2ZDGA 1A48A 2X0SA 2W6MA 2YL2A 2YZNA 1VKZA 4YB8B 4Y8VB 5EZYF 5C1PA 3AW8A 4O86A 3BG5A 3U9SA 2PVPA 1A9XA 3MWEA 3SE7A 2Z02A 2R7KA 1EYZA 3KALA 4O7YA 5KKNB 1OBDA 3RUPA 2R84A 5C8YF 4MV8A 2NU6B 2R7LA 2Z04A 4ZOLF 5JH7F 4O83A 1E4EA 2DIKA 3KREA 2FPIB 2W71A 3I12A 3R5FA 5LYJF 3VA7A 1VBGA 1KJQA 4FGRA 4TV9F 2YZMA 2NUAB 2V5AA 5DMXA 4MAMA 2FPPB 5GONF 2YYAA 4MV1A 1SCUB 3HO8A 3K3PA 2GQRA 3LP8A 3MWDA 4NYEA 3JRXA 4O2BF 4XZ3B 3KAJA 1C3OA 1GSOA 3GLKA 1JDEA 2HGSA 3TINA 1CQJB 5CA0F 2I87A 2VR1A 4FFLA 3RFCA 2IP4A 5LXTF 5KX5F 1I7LA 4L1KA 2YW2A 3HB9A 4IZOA 2GLTA 4HNVA 5JVDF 3WNZA 2CZGA 4FFNA 4IHJF 2R7MA 4DIMA 3ETJA 1CS0A 4O2AF 1VBHA 3ETHA 1KUTA 1OBGA 4IIJF 4DLKA 4YAKB 1ULZA 4TV8F 5JVLA 1BNCA 4O82A 4M9UA 2XCLA 1IOWA 4O7TA 1GLVA 4EG0A 2DZDA 1WR2A 3LWBA 2NU8B 1BXRA 1C30A 3V4SA 1I7NA 3R9RA 3WO1A 1KEEA 3RV3A 2HJWA 3TQTA 1EZ1A 1GGOA 2GPSA 2VQDA 2W6NA 4FFPA 3U9TA 4O7RA 4WBNF 2V58A 4ZI7F 4O4LF 2J9GA 4FFRA 2YRWA 3HBLA 2DLNA 4YBZB 3V4ZA 1M0WA 4HQ6A 4HNUA 1Z2NX 2W70A 3RV4A 1KJJA 2WYOA 3AX6A 4FU0A 4C5CA 2QK4A 1KJ8A 2R85A 3G8DA 2GPWA 3TIGA 2V59A 5LP6F 1KJIA 3R23A 3TIIA 4MV3A 3K5IA 1CQIB 5CB4F 1GSAA 1Z2PX 4I4TF 4O4HF 2GQSA 5CA1F 3N6RA 4C5BA 4EGQA 4MV6A 2YS7A 3OUUA 4HNTA 3KAKA 1DV2A 3NUAA 4O84A 3VOTA 2PN1A 5BPHA 5C1OA 2R86A 3VPCA 4O4JF 5BPFA 1DIKA 1W93A 1IOVA 1B6SA 5BMVF 3Q1KA 4O7ZA 4O4IF 3Q2OA 1EUCB 1M6VA 1T36A 2R82A 5FNVF 5IYZF 5LA6F 3TW6A 4HR7A 1KBLA 2OLSA 2W6QA 2CNVA 1DV1A 1JDBB 3JZFA 1EHIA 2ZDHA 4ME6A 1KJ9A 2NU9B 3MJFA 1AUXA 3UFXB 1PX2A 3U54A 4O7VA 2C00A 2W6ZA 1GSHA 3R5HA 3G8CA 4YAJB 5CAEB 2W6PA 3JRWA 2YS6A 4FE2A 4XYLB 5D8DA 5JQWA 4XYMB 2W6OA 3OUZA 3ORRA 2I8CA 1CE8A 4MV7A 4O7NA 1KC7A 2PBZA 2YZGA 4RZQA 4MV4A 2YWVA 4TUYF 3E5NA 1Z2OX 3K5HA 4MA5A 3QFFA 3VMMA 2YZLA 4I50F 5H80A 1M0TA 2NU7B 4MA0A 4YJ3F 3DF7A 1PK8A 2FP4B 5LOVF 2FPGB 2R7NA 2I80A 2DWCA 4O7WA 4O81A 1W96A 5JQGF 4ZHQF 5J2TF 4O7SA 3WO0A 1B6RA 5HBRB 2ZDQA 4XX0B 3VPBA 5HV6A 3JZIA 3ORQA 4C5AA 2VPQA 1JKJB 2QF7A 4FFOA 1EUDB 1E4EB 4O7LA 4MV9A 3U55A 4EGJA 2FB9A 2P0AA 4FFMA 4I55F 2R87A 1AUVA 4QSHA 4ZQIA 1JLLB 5J2UF 2CNUA 2XD4A 4E4TA 3R5XA 2SCUB
chains in the Genus database with same CATH superfamily
2PJZA 1ADBA 1FCJA 2OFFA 3TMKA 5BNWA 2ZIXB 4K40A 1USWA 2ZB3A 3GRVA 3USZA 1YR2A 3IUMA 4CKBB 2NXNA 5JARA 4U3JA 3PNMA 4ZKDA 3U9SA 4L3VA 4ZVUA 4HDOB 4O8CA 5F73A 5K03A 2W0SA 2VQEB 1JHUA 4I0WB 1P0CA 4O7YA 2KBEA 2Q5EA 2VDRB 5I7FA 3KT3A 2PRZA 4FKBA 3WBJA 4QX6A 5B7GA 5JD3A 4F56A 3AVYA 2VO1A 4I7HA 1J20A 1LA2A 4ZVPA 2GZDA 1EJ2A 2ZR7A 3A10A 2REXB 3VDXA 1SUCA 2RHCA 4LRXA 4BGIA 1SC4A 2DWOA 3PHCA 3GLIB 2ODTX 4ZVOA 4DCPA 2R6GA 3ESBA 3PA6A 3OETA 2D4AA 3IESA 3ZU2A 2DBZA 4GGOA 5F12A 1YE8A 1LZLA 1XXHA 1Y8RA 1XGKA 4CCSA 5KSWB 1YQDA 3KDSE 2GAJA 3CLSD 4BVHA 4RMJA 4ANFA 4TLBA 4YXFA 1SURA 1KGSA 4KBGA 3QKIA 1TT7A 2ZYHA 2DULA 4JD5A 3OEHD 4DCUA 2DUNA 4JLVA 3VR4A 1JKJA 1R5OA 2BHRA 5IEJA 2NAPA 3T7EA 1BCRB 2FMTA 2PZBA 3ITDA 4NG4A 2B30A 2Y4OA 4MUJA 3WO1A 1LX7A 3WL3A 3QLVC 3I2IA 1MTZA 2IBSA 2X0FA 1JPNA 4GFDA 5ARBA 5J4LA 2N75A 4WBNF 4LA4A 2OLKA 4G0YA 1EWKA 4DT1A 3ILVA 2XMSA 1ZCBA 1E3JA 1KMQA 2GLXA 2GO7A 2XDAA 3F9IA 3P5SA 2H2FA 3M1YA 5JDIA 2YHIB 4AF7A 2J0UA 1OXXK 3BXXA 4BLRA 2Y1GA 2PRJA 5AJUA 1YULA 2PK3A 4ADSG 3OQOA 3S8YA 1XTJA 3H5AA 2B92A 3LBYA 5EQTA 1EX7A 3D8BA 5E1DA 4DEXA 4K86A 5LLDA 1GPDG 4ZOEA 5K8VA 3TPCA 4WUVA 3W9YA 3A9CA 4CFYA 3K4HA 2E5LH 5BYAA 1HT1E 2CNOA 4MMZB 3RAJA 4HVTA 1KDVA 4B81A 4NHEA 3U7JA 1RHJA 1X80A 3H9GA 2YCLA 4HR7A 2EIHA 2GM3A 4MYDA 4V2UA 3SMVA 4YPVA 5IYZB 1Z7BA 2XCOA 2QPLA 4OXRA 3L2OB 2JA7A 4XLZA 4XGQA 5G1OA 4G23A 4PQGA 2C00A 5IYBG 2V8OA 5JSUA 4MYSA 1BC5A 5KYWB 1H9BA 2OO5A 4UHEA 5C9ZA 2CXRA 3OICA 5JSKA 4FM9A 1XFDA 2II6A 1H4SA 3EVBA 2WG0A 3RJZA 3OAAD 2CKZB 4EDFA 3SDSA 2H92A 4OQLA 4IRUB 4QICA 3CF2A 3CZCA 2RKOA 2IHVA 2PKRA 4Q48A 5JFGA 2ZOSA 1P7VA 4M1OA 4MI3A 1DZIA 3MTEA 4H7KA 4MROA 4Q9KA 2ODQA 1NUPA 2J6IA 3CUEF 5FO0A 3W2HA 3VNNA 4IDEA 3M4NA 4NENB 5TPZD 3VPBA 4HDKB 2W6JD 3I04A 1TMOA 3GGJA 3BF7A 2JLBA 1X38A 3JTEA 3K72B 4MYHA 2DFPA 3DLTA 1D7OA 2G7MC 4F91B 1ZPDA 4V02A 5SY6A 4MAFA 4AO8A 1UC5B 2EYUA 4AZTA 4EUEA 5JEDA 4EVSA 1GPMA 1YZGA 4HMOA 4RNMA 1AKUA 2VH1A 4BZXA 3WDKA 2HRCA 4HQFA 1E1MA 3RJ5A 4ETMA 3WAJA 3AUTA 3KQKA 1EWVA 3ECCA 2X76A 1RJQA 2B6NA 3AL3A 3MSXA 3BD7A 4P2BA 5KFLA 2Q9AA 5K4HA 3K92A 1TZBA 1X1CA 2AFHE 2O2HA 3ZHOA 3S2GA 3ROZA 3ADCA 1LK5A 3C85A 3M1LA 3F6CA 5LYJF 2C2WA 3KWMA 4KQHA 1RXEA 3V1YA 2I2FA 1IXKA 2PFKA 1K6JA 1E58A 1ZJYA 2NUAB 1ZJ6A 2QW0X 2R8BA 2Z9CA 1O95D 1T2EA 2IW1A 4R1QA 4OTZA 5M5BA 4FQ7A 2KWIA 3LLCA 1YVUA 2J46A 2OXIA 2QN6A 1L7VC 1Y7IA 3I9V6 4GMGA 4R8RA 1P77A 2J7PA 4B33A 4M8KA 3RNLA 1WNFA 4RXMA 4EY7A 3ZK7A 1I7LA 2G9UA 4AJ9A 1DAKA 3RBZA 5A7FA 4GOLD 3DHEA 4V1CA 2O8DA 2GM4A 1HT3A 1H2HA 2IZ5A 1OXTA 1ZR4A 4WDRA 2R8KA 1Y8QB 3LIPA 3MJRA 3NPAA 5E2AA 4AJ2A 4V1CB 2EGGA 2AFHA 1R10A 2DH6A 2NTJA 2Y92A 3PCRB 4OP2A 3WMXA 5EE0A 1I7NA 3IBYA 4FFVA 1EHYA 4O2AA 5DHFA 2WUEA 3U3KA 3DV2A 3UBMA 4C6HA 1MHTA 1LSOA 1T4DA 3HKDB 4ZAGA 4CRWB 4DUGD 1MIHA 1Z15A 3B7PA 4B3MH 3W2GA 4O25A 3WLMA 2POQX 3IURA 3S2IA 1PNVA 5L40A 5CNKA 4GRDA 1KERA 5EWMB 3JQGA 2D0OB 3IJPA 4FBTA 2H4XA 1YASA 3AXSA 2GPAA 2ZRGA 2YV4A 3DZCA 4GPEA 4KYUA 1EP3B 1EWTA 5SYAA 3GCZA 3BAZA 4H3KB 4HZGA 1YXMA 1QFMA 2M6SA 4BWSC 3MWFA 4D4JA 5HRUA 1PSDA 4WKBA 5A2GA 5ALFA 3EY4A 2ZCVA 721PA 2IH2A 5DAAA 2VDUE 3MT8A 3B48A 1QNFA 4CUKA 1CWUA 5J5AA 2RHBA 1I6LA 1L5HB 5BQFA 4XW2A 4ACBA 1Z07A 2WE6A 4QFCA 4E6PA 2JIBA 1ULAA 5BSUA 1M7JA 3L8DA 3Q6NA 1X70A 2QMOA 2Z56A 4M55A 5E6SA 1OCEA 1RI5A 1YQQA 3GUVA 3H86A 5KFSA 2HGWA 2HTFA 2OCPA 1RLIA 4XIIA 2QR5A 4KVGA 2XB9A 4P9NA 5L3RA 3S1AB 3ZC3A 1OFUA 4HPWA 4YC7A 1S0OA 4YROA 3R7WA 4D3DA 1BHSA 1FF9A 1F51E 1EGQA 4UMDA 8OHMA 1CZUA 4X1YB 4OHYA 1BN6A 2CV2A 2I3AA 3VMMA 1MF7A 1K1QA 1IH8A 1FU7A 4AECA 3W5AA 4XD7D 2XNCA 1E77A 1HDIA 2DB3A 1D4FA 1JSRA 2X1LA 1RPJA 2XCPA 4I36A 1QGOA 4EY8A 1P39A 3ABQB 1KAEA 1Q1GA 2ZT8A 2IXDA 1B6GA 2IVZA 3K32A 4G5GA 4D56A 5C4GB 5CA1A 3RC8A 2EFYA 3W4IA 7ADHA 5CLIA 1WMBA 2R25B 3SEZA 1Y82A 5CJJA 2VLIA 2HJHA 3ZE0B 4N47A 2OCYC 4ECEA 3MQFA 3HDQA 1AUVA 1U7HA 2C99A 4MUKA 5KFCA 4L57A 3UFBA 3ELDA 1HE4A 2P2LA 5KREA 4BQRA 3IVAA 3AJRA 3NBZB 4QEKA 3VVCA 1NN1A 2JAQA 2C9DA 4H4CA 4NL4H 2FWNA 2XXAA 1U2PA 2CL6X 1QC5B 3GBVA 4ZQHA 4E5DA 3CW2A 4JP5A 3WGZA 2D1TA 2XVMA 3VNSA 1D2AA 1I0ZA 4QWEA 1QIFA 1A4XA 1DC4A 1CULC 5FOTA 3TG2A 4DRFA 5BWUA 4CR8A 3EEQA 1G1AA 1KU0A 1RJFA 4QG7A 4UUQA 3BB4A 3WG9A 4URZR 1EUQA 4JN6B 2JIPA 3I76A 3KLNA 1ULSA 1Z47A 2JI7A 2LW7A 2XJ9A 5AVZA 4W5TA 1ID1A 1MX5A 1U2RA 3GU3A 2B1QA 3OCCA 3FLEA 3WC4A 3WKDA 1UC8A 2DAAA 1SRQA 4RZXA 3IBCA 4JXKA 1CQJB 2ZYAA 1B8PA 1Y6ZA 3GV0A 3U3OA 3A6EA 3D8NA 3E3MA 3Q2IA 1IN4A 3R3SA 1V6CA 3C5VA 5CITA 2OHJA 4F11A 1S03G 1BWRA 2GILA 4NTZA 5ADHA 3HKBB 2BFCB 1MA0A 2I65A 3SEFA 1P45A 2H4JA 1KQPA 1N92A 4CC6A 2JC3A 1CUYA 3O0TA 3MXOA 1F7VA 4IXNA 2O2GA 4EA7A 1B8VA 3V4SA 2GEJA 4PC1A 2X9GA 4EA9A 1IFXA 1JHVA 3IERA 5CDHA 1NIPA 1RAIA 1DIRA 4KH1A 4KLRA 2O2DA 4XWAA 2J4FA 1BDJA 1ECBA 1YS7A 5C0OE 2E18A 5A4AA 1FNDA 4DMHA 5BNIA 4JDPA 5FPKA 1M76A 2LIVA 5G1PA 1ZUIA 4KN9S 1CUCA 4Q4HB 5E7JA 2O1WA 1KH3A 5A4JA 3AF1A 2A1HA 4HYYA 4B4DA 1QHHA 2F8LA 4P4SA 1VIMA 4A2CA 1B2LA 1YS1X 2YHIA 3T1HB 2R92A 4G5OA 4AXXA 2Y4RA 1PS8A 2HRRA 3GFPA 4XYGA 3UZUA 1QRUA 4QIHA 2DFKB 2LNDA 3F8SA 1Z28A 2G3YA 4Y6LA 5A5FA 4JOBA 2GRUA 4O59O 4JZYA 5KSZA 2JVKA 1MIOB 2R66A 3DVRX 3LGSA 1VLZA 3R40A 4E0BA 2IPLA 3ZH2A 2QI9C 4BGVA 1HLFA 1ZI6A 2YXEA 3I01A 1IZ8A 1SD2A 4NCKA 3F1KA 5FLXW 3GRFA 2X0NA 3IP3A 3DZFA 4HFNA 4RVDA 2CV0A 1VPVA 4KRXA 4HLDA 2GCOA 1PGQA 2CUTA 2OWOA 2K5UA 3UF0A 2IOFA 5E0OA 1BGWA 4MVCA 3L82B 3OWOA 4OK6A 1PIWA 4TL6A 3PICA 4Q8EA 4F3TA 3PW5A 1GFSA 3QFCA 3VJMA 1TVKB 1XZJA 3EB9A 2WAQE 3OT5A 1KO1A 4M0FA 1ZNWA 4AWXA 3CJQA 5JFTA 2OCDA 3NKFA 3L4BC 2YXBA 1FS6A 2GEDA 2H9YA 2PKYX 1YFJA 1R6UA 1ULHA 1R16A 4PO9A 4BYGA 3RADC 2VP3A 3H1FA 2D2XA 4KLCA 5ICGA 1M5TA 1Y8QA 2WHRA 3H0GG 4LMYA 3Q7QA 3JATA 4O3QA 1PZMA 4R98A 1FW8A 1VP3A 4C20A 2VHTA 2O8BA 1JP7A 1NAHA 4PRYA 3CINA 2PKQP 4MR9A 4TV8B 4EHIA 1FFYA 4UDYX 4D8YA 5CLLA 1FX0B 3C3BA 4ZV9A 1BS9A 4BRSA 4BQPA 2V6BA 1DNPA 1X74A 5AHXA 2JJ2D 2UYHA 2A3RA 3MCAA 4IEIA 5NLLA 3HYTA 2TMYA 1CDOA 3BRSA 4Z54A 1DGQA 3FOZA 3RVPA 4FZ3A 1VBFA 1WOMA 3C3PA 1KDOA 1W4AA 4FMDF 1HK7A 2JHAA 1GQRA 1ZI8A 1T0IA 2WTUA 4A2QA 4YACA 4OLAA 2OVBA 5SY9A 3PW4A 1KFCB 4RLSA 5T6BA 1EGHA 4KQ2A 4PZLA 2BFOA 4RSHA 3UTDA 4CV3A 2YHBA 2PX3A 3KS9A 2FWAA 3UWOA 3KZNA 2FWRA 3L04A 1U8ZA 3SSOA 1ND6A 2HK8A 4A93G 4K81B 1QSGA 2HLPA 1XPUA 3HCAA 1A9YA 2O3RA 2XT0A 2ZTMA 4ZA2A 1FNSA 1XD8A 3JQCA 3LDFA 3HK2A 2G63A 3PNSA 3ZDCA 3IOEA 5KVAA 2CHGA 5H59A 1U98A 4PNZA 3A32A 1XR3A 1ZGJA 4C0SA 2W6ID 1V43A 1MNAA 3N2EA 3GNQA 3BS4A 1CUDA 1FMJA 1Y3IA 3PQFA 3HYRA 4E1BA 1GTL1 2FFJA 3FYHA 3I92A 4JQSA 4R71A 4TQSA 1IAVA 2P9JA 1W5BA 2P9FA 3LY8A 3VZBA 1ZZGA 1P1CA 2HRQA 3MELA 5AQEA 3TCXB 3WK7A 2IE8A 1D1QA 2BISA 3DCNA 2QENA 2CFOA 4DSZA 2PT6A 4EG7A 4N6NA 2SKEA 4EHBA 5H3CA 5KNLA 2BGIA 2V3WA 2GVDC 1YMQA 1OT3A 3D8RA 3VU3A 2FOIA 5DNAA 1SCDA 3SJAA 5L4SA 1CR6A 4DRXB 4G0MA 2AFHB 1U9JA 4P3KA 5B6PA 5AJTA 2GLUA 5EKUA 3HP4A 1LZKA 4U9UA 3CZPA 4IDAA 1HEYA 1UXGA 3B5JA 1J2YA 1KVQA 2GXQA 4CMEC 2CWWA 4F4YA 2FMAA 1ECCA 1UMKA 1E2LA 4GWLA 5DM2A 1SZJG 3RDPA 3HCRA 1U8FO 4AJNA 1QO9A 3H11A 3GIIA 3NIFB 4KWCA 3AGQA 2PN1A 4LYFA 4QXQA 1G21E 1W4ZA 2KLHA 5KG2A 4QPZA 1I1OA 1Z17A 1P5FA 2RIPA 3DMGA 4LXTA 3T34A 3JVUA 5H1YA 1Q95A 1Y1WA 5D6OA 3TZBA 3Q2OA 4DL2A 2OM2A 5IYZF 2ZUUA 5A9SB 2N42A 2Q2UA 3GJ8A 3CF0A 3I8XA 4AO6A 2IPXA 5IJWA 4Q7EA 3GJZA 1EVEA 5EIBD 3O2QB 4FOLA 4CKWA 4CR6A 3RLFA 2QZSA 4QUJA 1HYQA 3CVJA 1KNXA 2AL7A 2YS6A 2JFFA 3DQZA 3UAOA 1QTQA 1JKFA 1TDJA 4ZHQA 2VHEA 1WUTA 3I37X 4KFUA 4ZOLA 1YONA 3OTOH 3W05A 3WRXA 4RY0A 4CMBA 1UM9A 4BKPA 1R0YA 3W6ZA 1V3TA 1SG9A 2P4QA 3HB4X 3KKOA 4OLBA 4U7HA 1JTEA 4LRQA 2X41A 1K8RA 4YPFA 4Q3CA 2HLHA 2X4DA 4MUMA 5JTTA 1I3MA 5J2TF 4E4YA 3UCEA 5CX1B 4P7KA 2JEZA 4MOWA 2J45A 2JKZA 2HJVA 1HC7A 4C4PA 2FWBA 3A6KA 4IUYA 4J90A 4YT8A 3GTQA 2XHZA 2I76A 5IVKA 2Q5HA 4Z3DA 1YS4A 1MQ9A 1HL7A 3IS3A 3L05A 3PNPA 1MP0A 5EA2A 4YAKA 4KFRA 1UBRS 1VHQA 1AU9A 3DB2A 3GTKA 4M36A 2ZB8A 5EEGA 1X19A 2PZLA 3L5OA 3K05A 5GPBA 4L5JA 3DHYA 4FT2A 3VOSA 4A10A 1PT7A 3AV3A 3DMTC 3NALA 1N0HA 4Q01A 1I9GA 5F1OA 5K3OA 4QQNA 4LG1A 4TLAA 3C6BA 5KC9A 1CJCA 1H4TA 1UBOS 2HCJB 1AV7A 1JH9A 4BO1A 3A6LA 1S8NA 2MCFA 4JXJA 4R7ZA 2YVQA 2B5OA 1TM5E 3M89A 3NEYA 3DO5A 1M2WA 3FA2A 2PEZA 1GNQA 2ZWMA 2FE4A 3HI6A 2BTQA 1HPLA 3HCEA 1VIDA 1KEPA 5DOVA 3WWZA 5A3JA 3LP8A 7MDHA 3A4VA 2ZP1A 3DBVO 5AWFC 1EI9A 4UXIA 3UOAB 4RGVA 1Q5PA 1UKZA 3BWYA 4U0KA 2B7LA 2KI5A 4ZEVA 5C5DA 1MW9X 2OFXA 4XDZA 4YJFB 1E3IA 2AN3A 2IC5A 5LLTA 2P79A 4KN5A 4XXHA 1G5IA 4YEDA 1G5TA 1PFQA 1YDWA 3ULKA 3OPYI 2IA6A 3DVAB 1DJMA 4IQ8A 5KG4A 2F1OA 4RMIA 4A0RA 2WPDA 3RK0A 3KVOA 3UC9A 3FPLA 1ESMA 4NDNE 2ZZKA 4GXRA 1UBGA 3KBBA 3NYRA 1FLDA 2QTWB 4OHZA 5CP8A 4ZCIA 3KLBA 2W4MA 3QIAA 1MZPA 5CCEA 1FDTA 3O94A 4RKFA 4MTEA 1U9IC 3B1JA 3OX4A 1K7FB 1LI5A 2INGX 2QNIA 4Y2UA 5HTKA 1V8PA 3WQSB 1ISIA 4N4AA 1F8GA 4XI9A 4IUCS 2FX2A 4GWGA 2H52A 2PSSA 2Y1FA 3WSVA 2VS1A 1OOEA 3KR2A 3Q1LA 4G5YA 3IXQA 1KI3A 3OIDA 3EF0A 1Q6ZA 4D99A 1J39A 3PHIA 1TCUA 1Z0FA 2VAPA 2XGGA 4PAWA 5KCMA 5KCZA 1WE2A 3AOEC 4JI8B 1H3EA 3K4PA 1E2HA 1UJ4A 4GKJH 1YQTA 1I2DA 1WX1A 1Y7PA 3N0XA 1X7DA 3QMPA 1F5SA 4FYMA 1YBMA 5G0UA 5GIOE 3T9EA 2P3SA 2VDOB 4NMHA 2CMGA 1XB2A 1TVCA 3FPKA 2YJZA 2C7VA 3IQXA 4WCFB 3TTUA 5FBZA 2R79A 3H6KA 3F5QA 2GMWA 2EARA 3FUUA 3ZUGA 1Y0BA 4F4CA 2ZDHA 2X22A 4DDHA 4DNFA 5C8VA 4WV3A 1SPXA 3C3WA 1N36H 4MVXA 2IZ6A 3DDZX 3EQ9A 5EWJA 4Q3NA 3HLYA 1Z0ZA 3EZYA 2QX9A 4BMPB 3OUZA 3QG5A 4Y98A 3NJ8A 3K1JA 4ZI2A 3GLGE 1I2CA 1VRCA 3DC7A 4BVLA 3PEUA 1SXGA 1V2HE 3BQ1A 5A1JA 1CY7A 2I91A 4ZVRA 3FNGA 5A05A 4NNJA 2HWYA 5EWFA 1AQLA 1TEVA 2ZJFA 3GLHE 3D6MA 1I0IA 2QSJA 2JK0A 3B2QA 1Y98A 5IXSA 1XCLA 1LI4A 3BWXA 4TTJA 3R6LA 2PS3A 1QKKA 2X0IA 1RW4A 2B8NA 1GUDA 4IAJA 2X42A 3K73O 1KAQA 5AW3A 1IATA 3ZD6A 1A7UA 4MV9A 3KTAA 1A0IA 2O3QA 1QR6A 2XKJE 1M2OB 3L9XA 3HA5A 5LQSA 3TSWA 4L4SA 1E1RA 1Q22A 3Q3GE 3E9ZA 3WP0A 3U3RA 3FMVA 4XUGB 2BCEA 2IXTA 1JQDA 2ZPTX 5FTKA 4Z1MD 4F71A 3CVVA 2IIPA 3DE7X 2XTZA 3WMRA 3EMDA 1RZ3A 3M81A 4NMMA 4NU0A 4MI6A 8ABPA 2RHOA 1A2BA 1E5VA 1ORDA 4QA9A 5EP2A 2XIGA 4CMDA 2H5EA 2HBZA 2WYWA 2EFGA 3JZDA 1SHUX 3RAGA 3HHPA 1ZH2A 3PHBE 4NCJA 4BCBA 1VGVA 4UATA 3SGLA 3T1NA 1XA0A 4AZ3B 2PSDA 3GCDA 1PV4A 4ZT5A 1I01A 3W3AH 2D7CA 4EUKA 2FZCA 2G5CA 2GD2A 2RJNA 4KE7A 1N33B 2KE5A 3A28A 3TZKA 3UM9A 2ZAOA 3FKQA 4NIMA 5EHZA 2AC7A 3MWDA 3TYXA 3X3HA 1ABFA 2DBQA 4X66H 3L7CA 1JPJA 4FCWA 3T4PA 3VYTB 4PSDA 1P2GA 3HJNA 2LZ0A 1IHOA 2VR1A 2EHJA 4P4LA 3OM1A 5IDVA 1U5BA 5L8VA 1E1QD 2YBDA 4JAVC 2WM9B 4FDUA 2YYZA 3SXJA 2P2ZA 4JFRA 4OEHA 4MCJA 1AN0A 2BR4A 4MVJH 4KFCA 1YGPA 5EMKA 2PLWA 3BC1A 1UKBA 3OFJA 1CHNA 2FPUA 4NBUA 3U49A 2LKCA 4NULA 1RZRA 1E2EA 2IZ0A 2WSYB 3BGIA 1M9NA 1CR0A 3PQCA 2QRJA 4I5GA 4JBIA 3LD9A 1M1YB 5F2EA 3TFQA 5FR9A 3NBUA 4V3CA 4CT5A 3MFHA 3KFLA 4EQ6B 1RBZA 4MCIA 4OYLA 1QNLA 4P5DA 2QA5A 1NUHA 5F33A 2YASA 1P1BA 1E79D 3AR3A 4M1YA 1QB7A 2E4YA 1CQZA 4MKIA 4DLPA 1N2CA 1QFXA 3AL0C 4N3CA 3TW4A 3AI1A 3SIWA 4QVKA 4U7PB 2WU3A 1A9TA 1MOPA 3MJEA 2DQYA 3VISA 1DFHA 1BEEA 3IT1A 2UUBB 2VJBA 4K26A 5GTDA 1PZHA 4JODA 5KWIA 2JAHA 3VOAA 1H5NA 1I3KA 3HCFA 2FEXA 3WE7A 1S3GA 1XJ5A 4ARBA 4Z4EA 3EXFB 1UZMA 2XH8A 4JI1H 4TT8A 3DMHA 4JC0A 2OZPA 5FA5A 2IQIA 2V1UA 4UNIA 5A6SB 3GDGA 3HKDA 4FHGA 5G0SA 4M21A 4B1FA 2H2GA 2XQVA 3B85A 2ZW9A 2YVKA 3GCXA 5TQJA 1Z2CA 5CXUA 3QK7A 1FRFS 3H8VA 1PFWA 4QEZA 3LHSA 4Y2YA 5AKXA 1JH8A 4MYRA 1D2GA 2A0UA 3UMVA 1AKNA 1BYUA 2HSWA 1HL3A 3GMDA 2R3SA 3CGWA 4IXTA 4MR8B 4YUYA 2BEUB 2OYSA 1KY2A 3A1DA 4MZXA 4HUJA 4F9TA 3ZR4B 4PLWA 1FU8A 1LW6E 3K2EA 3QVKA 4Y2QA 1SC9A 3FCXA 2G9ZA 4M0UA 3PQ3A 4YMWA 4TVKA 1ZCFA 3ORRA 2XZTA 4ECUA 5BT8A 4D46A 5KNCD 2EEZA 2VQEH 4YJ2B 1EQAA 1GZHB 2IS1A 3UK1A 1WUYA 2JFOA 1HO3A 3HPRA 5D2CA 5DM0A 4CQMB 4F4UA 2P5YA 5FPQA 4GYJA 4AVYA 4KR0A 3DAOA 5C1DA 2VDWB 1R3UA 5D00A 2FLLA 2O2IA 3EFBA 3L6UA 3B9QA 5EZ5A 4C0QC 1PJZA 4QODA 4L28A 3WTBA 3AERA 3AF0A 1ACMA 4OY3A 4ESVA 1VKOA 3ADOA 3LW7A 4K6OA 4CLOB 3NGLA 4KHPH 1MRZA 2AHRA 3GDHA 3MRSA 4ZQBA 5LYYA 1YSCA 3K20A 2Q8NA 4WGFA 1NBWB 4ARVA 3L41A 2FPIA 3IDQA 1C7ZA 1P17A 2P0AA 4LYYA 1CRQA 3WJ1A 3THOA 2JGRA 4A6EA 1G21B 1SOUA 4B7ZA 5J2UF 5LA6A 5BV7A 3A1EA 1NG1A 2FLKA 3NP7A 3DOHA 4NBWA 2VNSA 3BJZA 2LKDA 1O96A 1BS1A 3CGGA 2R5FA 3V4PB 2IYZA 3GVXA 4WGGA 2IK8A 5BMVA 4CEHA 2YTZA 2CNDA 5EOYA 1V47A 2OBXA 4OUKX 3VMFA 1WUIS 2VG8A 3D1JA 4MEBA 4YGYA 4IHAA 2ERXA 2GK4A 2BP7B 4O83A 5AK3A 2HJGA 2W9XA 4UPEA 5L3SA 1RVDA 1BVRA 4A3JG 3QVTA 3ZWXA 2DYKA 4IHQA 1H5UA 3E9DA 4BWYA 1RABA 2D8AA 2X58A 1KEVA 3RUEA 4XZ3B 4G89A 3IMFA 4G0ZA 3RROA 1GAWA 3IOMA 1G8HA 1SC6A 3U44B 5IBQA 4AS2A 4TM7A 5CA0F 4DLYA 1UANA 3O03A 3AW9A 1GRVA 2ODBA 1QFYA 1R18A 2WYVA 3QOWA 4TX1A 1TPYA 2X6TA 2R7MA 1ECFA 2R93A 4OKNA 3HFSA 2HD4A 3BHNA 3RSZA 1GT6A 2IOHA 4YBRA 5FTLA 3U1BA 5EP3A 2AZMA 1LC3A 1EXDA 2XCLA 1IOWA 5IKOA 4CEJB 3HDJA 2YWJA 3ME5A 5A7GA 3LX5A 4Q39A 5CIWA 1JKXA 4G01B 1EA7A 1GFWA 1AN9A 3I3SR 2FK7A 2EQAA 3MTBA 2W6NA 1FBTA 3C7KA 4RADA 1YDMA 5HZKA 1GN9A 5JXHA 3RS0A 5K6AA 1JXAA 2WKPA 1A8UA 1X94A 5TPWB 1XD2A 1JIHA 2Y0SA 1XQ1A 2OCKA 3IQDB 3E9EA 3LHDA 3WOHA 2ASVA 3RAEC 1I10A 1PD0A 4GVXA 1KJ8A 2R85A 1X15A 2W6CX 3H4IA 1HQCA 1MJGM 9MHTA 2AVNA 2J87A 2BR3A 4PLHA 4I9GA 1E1RD 1UBSB 4Q44A 1NNUA 2REBA 1ZIXA 2LBPA 3IUYA 3KYCB 3OIUA 4MVJI 3N6VA 4OXNA 3FMGA 1XZDA 4ZVSA 4XX0A 2PUFA 4RTQA 4TTQA 2HV9A 4BQNA 4LF4B 1JRLA 1MB2A 3ET4A 1RTKA 3I04M 4BY7G 1CDDA 1F14A 4K5QA 2QI9F 3F4KA 3VZQA 2R7ZA 4BASA 2UUCB 1TF7A 3L6CA 3GTOA 5D3QA 2FZ5A 2R96A 4EGAA 1IEWA 4KWTA 3ECSA 4PCLA 4RVCA 1AUXA 5KTNA 1POXA 1O6FA 2EZ4A 2NSJA 1SU8A 1NATA 4RIGA 1PLKA 3ZHTA 2NTNA 3PVCA 4HJXA 2B1RA 3Q6IA 4DN6A 3AR4A 6Q21A 4RCYA 1RP1A 4DV5H 2A8YA 2EJ0A 2W93A 3HNPA 4R84A 1DFGA 4ZI7B 1H5QA 2PGOA 1J9ZA 4YWJA 5IBCA 1VHJA 2WB1E 3CZMA 4S24A 3G23A 1NOIA 4RVOA 5FYQA 4ND5A 2B35A 2QYOA 1HZZC 3O8DA 4EI9A 2QBYB 1UC9A 4RGYA 3OD1A 4V24A 4D9FA 1NT4A 4Y6GB 1TK9A 2C0QA 4FHDA 4UEWA 4HEA6 5DQGA 2FN7A 2FSSA 2ZATA 3DLIA 3GLQA 4BNWA 2P9YA 2P7HA 3P19A 4BBRG 1FJHA 3T3MB 3G02A 3HR4A 2IS2A 4S3MA 5KG1A 1L1FA 4A2WA 4LHVA 2O3UA 4CLRB 1W36D 5EKDA 4K9KA 1YNSA 4CC5A 2ACVA 4QBFA 3NAQA 1Z7GA 5JVDB 3D3QA 2BLLA 3H2SA 2WM3A 5DBIA 1P7WA 2B25A 3FZQA 3OEWA 3UMJA 3PRHA 4PYOA 1W59A 5KKNB 4M88A 3IQGX 4G81A 4DPKA 1UWKA 3KB8A 2DQZA 4O0LA 5I6DA 1TQHA 1ZK0A 3DTVB 2JARA 1QQTA 1GPKA 2WB1A 3O8RA 5EUQB 4AU1A 3WGOA 3DVQX 2C3YA 2HLDA 2XA9A 5DHQA 3DTVA 3A2NA 1C3EA 1FRVA 1TA8A 2E0IA 1THZA 4ZYYA 4IKEA 4CZ2A 5BWMA 5AYVA 3WYCA 1L2TA 2Q4OA 3GJTA 4LF9H 4PU0A 2LGJA 4M9SA 1NQXA 3D6FA 1AF4A 3F3MA 2JGFA 3JVDA 1OZFA 5AXAA 1IBMB 2VOBA 4CQMD 1XJ0A 2J67A 3ANXA 3COVA 2C8KA 2ZTUA 2XGJA 2HY7A 2WJ3A 1P16A 4MB2A 4PLYA 4U1RA 1CJMA 4P3NA 5DGBA 2FN8A 4RHCA 3JARA 1MEEA 4BMDA 2P9QA 2QTVA 4Q0MA 2UVRA 3PJDA 3LPDA 1CF9A 1DQRA 1OUMA 3I6ZA 1SMKA 4B4WA 4UD6A 3E22B 3W5SA 1VJ0A 2WMYA 1JSCA 1NI3A 3BZBA 4LHYA 5TT0A 3N75A 3WDLA 2QPTA 4O4LF 3R4CA 1R5JA 3B70A 2WWFA 1CP2A 5CR9A 3WAGA 3CKKA 3SQNA 3PDIB 1U5AA 4PFQA 5I48A 1W5SA 2Q46A 3BIWA 3LOQA 2UZ0A 1IBKB 3D4IA 4NXMH 4FEGA 4BGUA 1X7YA 2Z09A 5B36A 2OC9A 3MG9A 2IITA 3KVRA 3E35A 1AXRA 3IUEA 4IDDA 1J8FA 2RAPA 4GBJA 4D41A 4Q9DA 2P9CA 3ORYA 1KNQA 4GBGA 4A03A 1VB5A 4Y2SA 3W6UA 1TYAE 3CCFA 1G59A 4OSEA 3FDIA 4CF4A 1C1DB 3FWPA 4BMOB 3LXUX 4Q24A 3SXUA 1SXPA 2A9JA 1Z6ZA 2C96A 4QIWE 2FN4A 2MSLA 3R7WB 4QZVA 2UZ4A 1R12A 2NU6A 4RY9A 4DANA 3DEFA 5BRNA 4KIFA 4EUHA 2RB5A 3W9UA 4XQGA 2W6OA 4NU6A 3K71B 2WSLA 5F9LA 3A3YA 1LVGA 2IYTA 2Y6UA 1SBZA 2H18A 1VIYA 1SHTX 3GRPA 1HEUA 1NC1A 2XIQA 3P0IA 4Y1GA 5DLDA 4ZO9A 4DCOA 5BV2P 2OXFA 4FMCB 3P52A 2PUDA 1F2UB 3R7NA 1T0HB 1ZZEA 4I3GA 1XU9A 3EF3A 5THXA 2FMUA 1F9EA 2PZEA 1FP4A 3JWIA 5HMMA 2DP4E 3H2ZA 4CQMA 1GOTA 4FE3A 3PT9A 3FYUC 5LQMA 2J8ZA 2XBUA 2HR1A 3ORQA 4OXIA 2W2OA 4MR7B 3JZ6A 2ADFA 2IZZA 4QVGA 3TZQA 3DE5X 1LQ2A 5MN5A 7YASA 2PS0A 3PWZA 4E4TA 1KAOA 2COGA 2HVQA 2NIPA 2IW3A 2P4EA 3E8MA 3EOZA 3FBTA 1EEXB 2G70A 3NP9A 2QVCA 5AOAA 6NULA 1W1WA 1NM5C 5F1KA 3I9OA 3AHEA 2YZNA 1AZWA 4PR0A 3FCUB 1UKEA 4BFXA 1KDRA 1VHWA 1S0MA 3DL4A 3U17A 3KR1A 5IDQA 4I4TA 1UM9B 4A15A 3QQPA 2XCQA 4TL7A 2ZT7A 4P86A 4ZHSA 5IWAH 4UVDA 1E4EA 4EB3A 5KFDA 4A8JA 2ZM6H 1J06A 1GJRA 1ZM7A 3OCVA 4ZAFA 4DR1B 4NLGA 1T3SA 2WV7A 2OB1A 3H65A 5FLYA 3T0FA 1WRVA 4TRJA 2QAGC 2F43B 4M1QA 4D9EA 5CEJA 5A2QA 3PC6A 2A67A 4QOFA 1VXOA 2LRHA 1GQSA 1T6YA 1ZGHA 2H07A 2JLSA 3QPCA 3GAFA 1G9SA 3VH4A 4IFIA 1C9EA 3KHLA 1KMMA 2DHCA 4M1SA 4PZDA 3V42A 3RB3A 3KEMA 3I1FA 5H7XA 1T1GA 3WDMA 5KTOA 1G5QA 4XJXA 4HWKA 1VZ3A 4C3ZA 3K70C 4ZCPA 2Y4NA 3VR4H 2ZIAA 3ZLTA 3DGEC 1KH2A 2WAOA 4DPMA 4LJSA 1YR6A 4ENQA 3FZNA 4JJZA 4XE5A 2CK3D 3FE2A 4FSDA 4UTRA 4KACA 4MR8A 4UEOA 3WRXC 2V97A 2XUAA 2C03A 1AOXA 3OFND 1V25A 1E7MA 4JWTA 3DT6A 1GTZA 5EYPB 4XJTA 4BVJA 1LLQA 1NBEA 1IJKA 4DL7A 1PGJA 3JVEA 4BJHB 4CG2A 5C3MA 3GLFA 3PRKE 1RBQA 3F6PA 5AMXA 4F93B 1KYWA 2GZRA 2Y71A 1IM2A 4ECXA 5CMLA 3ZDDA 2V4RA 3LUHA 5IS2A 1KU6A 1QFSA 4Q4AA 4EAQA 2BP7A 2HM7A 3CNQS 3IR7A 4XFDA 3JWGA 1AGPA 3CTPA 1NBHA 3EIHA 3FR8A 3N59A 1EG7A 3N6RA 4MICA 4RQBA 3VR5H 1ZCJA 4Q4AB 5EP1A 4D82A 2RHDA 2FPMA 2P9EA 621PA 2ECKA 4ZCQA 3QYJA 4GUAA 2Q5IA 3DBIA 3UUFA 5CB4B 1FDOA 1O03A 2GTPA 3VR6H 5E6RB 1MPXA 1L7MA 5FJ8G 3M6IA 4AY5A 3SVTA 2ZZMA 3EZ2A 3H5VA 3BEOA 5IRCD 2X8BA 3DE1X 1M6VA 3ZNOA 3L07A 1J25A 3TW6A 4EY6A 2CEAA 4OQXA 1MQAA 4H7PA 1U7OA 5LA6B 3RFFA 1R66A 1P5RA 4ZJZA 2RGBA 4Y2VA 4RHYA 3FIJA 4R7RA 2EATA 3URMA 4F7WA 2WA1A 5CB6A 4GHWA 2LWIA 2AK2A 3U54A 1K86A 1P3JA 4ED1A 3H3XA 4DJEC 5BNTA 2J32A 4F6LA 2I2XB 1GYFA 5FPPA 1KOGA 3V4OA 3UO8B 5CEEA 1F8UA 2OBLA 4FGSA 3KKNA 2MSCB 2YWVA 1DEKA 2IE0A 4H6WA 4BLPA 3LDAA 1OBFO 1X80B 2H4YA 4CMGA 3N0TA 1ECJA 2GF2A 3AEUA 3QITA 4OMCA 4QM6A 3AL2A 3AUUA 2FP4B 5FLKA 1T9GR 4W5WA 3RGGA 2FF7A 2QZ4A 3LTNC 4N39A 4U7GA 1R9TA 2YMMA 2Z95A 4HNAA 4KP7A 4IGEA 2HVRA 1MCZA 2CDRA 3MMPA 1ODCA 4GSLA 1F48A 3S70A 3WI7A 3SHOA 3WGYA 1ILWA 4N0QA 3A7DA 4ZC1A 4YRQA 3GJ4A 4O1MA 1TVEA 1KOLA 4DLLA 1SJ9A 4LIPD 1NFFA 1JNYA 3UW1A 1E96A 3DWGA 1XRMA 3NC0C 3B5IA 2QWXA 1Y1QA 4RH3A 4MHSA 1O58A 3CNLA 4PYIA 2GT1A 1FRQA 3PDIA 5JD4A 3DHWC 3DAYA 1XRSB 2XMCA 2ZVDA 4JZKA 2PFSA 1N2OA 3AW8A 3DHNA 2VKTA 2WKQA 3G5LA 3QOYA 4O63O 4V0MA 5K1ZA 5ILOA 4AQYB 2PT9A 3FYUB 4KK4A 1YUMA 1A9SA 1IZ7A 4I1SA 4UZEA 5DXAA 4DMGA 1RHKA 4RUKA 1ESEA 4U7JA 1A5SB 2VK2A 2AMVA 2PO7A 4K88A 3CR7A 4PFJA 4WBNB 1XNHA 3C3KA 4OMDA 2GRJA 4X63A 4QUBA 1CR2A 1S4QA 3FWZA 3M4JA 3D5TA 2B63A 4ARAA 4DJAA 3HPQA 2MR5A 4RORA 1J07A 2I6FA 3PC8A 4XYBA 5AI6A 3NHFA 1AJEA 1Z3IX 3HVUA 2EL7A 3WZLA 4B2IA 4B3IA 1B0AA 3KTFA 1M1YA 4WSOA 5ICEA 3TMAA 4I1OA 1PDOA 1CZOA 1USUA 2BGTA 4ZP1A 5G4LA 4WN3A 1SH7A 4TV8A 4KQEA 1O8BA 2ZK7A 5IJ0B 3RF2A 3EUWA 1DGSA 4HN4B 5KHOC 3N3AC 1XVVA 3K8YA 1ADGA 3OC6A 5EERA 4IV8A 1PKXA 4HC4A 4PPQA 1AH2A 2IP2A 1FP6A 3IDAA 2D5CA 3JD2A 3KRTA 4UNPA 1ETUA 4WZZA 4CM7A 5AM3A 4QQRA 1P18A 2C9OA 2A14A 5KT4A 2REQA 2Q8PA 5CT9A 1ZVMA 2NVXA 1MQSA 2PJRA 2BM0A 5F77A 3AZQA 4J43A 3EVDA 5BOSB 4EF6A 1WG8A 4BCCA 1U94A 5HZHA 4IMRA 2WKWA 2QDXA 3DEZA 1KI1A 2WP0A 2BBWA 1E62A 3H5TA 3BXPA 3LKZA 4N5IX 1KF0A 3E84A 4G84A 4J76A 2AOWA 5JYBA 4TZ6A 1A1SA 4G85A 3EYWA 4UDNA 1ZL2A 2W58A 4RF2A 4ZRNA 5JH7A 1H6CA 3KYDA 3UMGA 4B2LA 4OOFA 5JR3A 5F3WB 2R86A 1PHRA 2ZXFA 5E9JA 1ZOSA 2CB9A 2P9GA 3ZBUA 3RBAA 3T5LA 4DDVA 5DULA 4DCCA 3JQAA 3TNDA 2FEKA 3KB2A 1SBCA 2QYTA 4EAAA 1N3LA 1W0KD 3V7NA 5JNLA 3T1TA 3RFUA 4HWGA 1C3VA 1TAEA 2IPNA 3AHDA 3LUBA 3EGIA 1RLUA 2NT4A 3E53A 4UBIA 2UDPA 1NLMA 3JY6A 3U4IA 1SUWA 2WVAA 4QU0A 3X1YA 1NF3A 4UASA 5I4KA 3ZY5A 4MO2A 3VR6D 3OTIA 1USVA 2H31A 4AULA 3ADDA 1KMHB 1S1CA 3LP5A 1GNLA 3D6AA 3I72A 4FP9A 5EJGA 3OPQA 5FA6A 2I3ZA 3E5NA 4URHA 1SXJB 1YA8A 1U0EA 1E2DA 2J6CA 3G9TA 1NBOA 3MD0A 1N48A 4FZ5A 1WU7A 2EP5A 3DBHB 5E3IA 1L8OA 2V45A 2YV2A 3DL0A 4HNRA 3VTAA 2XDQA 3ZDFA 2ZLBA 3UWMA 2FWJA 5KNDD 2C5AA 3LOPA 1U0JA 4GXQA 4YNBA 4DHEA 4N8EA 1VJRA 1NMQA 1EGVB 3IR5A 2W6IA 5A71A 1GR1A 2FVYA 2FSVC 4E2ZA 2R97A 3BCSA 5DM1A 5HGJA 3WKBA 4ATNA 3M6MD 4EKYA 3D81A 1NQWA 1P8JA 1OILA 1XAHA 2CDNA 2YYSA 4WKNA 4GEGA 5FHQA 5G41A 3I8OA 1E2QA 3THWA 3M6LA 4DS3A 4JK3A 2C2MA 1QB8A 2WJVA 2SCUB 1HE2A 1O4WA 4LHXA 1N2SA 1A50B 3O7MA 4N9WA 4PE5B 5HIIA 4BV8A 1G38A 4H31A 1EG2A 5CE8A 3WMEA 4K2AA 1QJCA 4NY1A 4Y6SA 4YECA 3RK1A 3B9RA 5CDTA 5C5IA 3SE7A 3PGKA 2VSFA 4ZT6A 3ROGA 3UCFA 1QE0A 2C84A 2HA2A 5HK8A 1XRJA 3AR8A 3QXJA 2PSJA 1X9GA 3ESQA 2R7LA 4OXQA 2O59A 2HJSA 3S1AA 1N9KA 4JUFA 2DERA 3VDNB 1Z13A 1IPFA 2CVOA 3DNMA 3SEQA 1K5HA 1UJCA 1SU6A 2D1QA 3JQGB 2WF9A 3THSA 1VFNA 3IIIA 2EIXA 1EK6A 1NONA 4H7HA 3CYFA 5CA0A 4EECA 1VRVA 2VBIA 4RDXA 5I5EA 3F71A 5LKRA 5CA1B 5KI6A 1GAQA 4LUCA 4ZVVA 3C4JA 221PA 2A35A 3DTFA 5IP9G 1G1MA 1V8DA 3H9EO 3LC1O 3FMIA 4NMLA 4NOKA 5IULC 3IJEB 3ECAA 1E2GA 1RHMA 4TS9A 3S2ZA 1ODLA 1NY5A 4Z4GA 1QQ7A 3GY0A 2XTMA 4YAKB 2E9SA 3WICA 3WLTA 2X23A 5KQSA 2I2WA 4UUOA 1V7CA 2NZ8A 3TM5A 4CIVA 4D4MA 4HQOA 3CLVA 1ELOA 1XRRA 2GI4A 4R3UC 3V1LA 2WJHA 3TSYA 2HGXA 1QS0A 2AFIB 2FRVA 4WWHA 3ZW8A 3ABIA 1Y1VA 4C2AA 3HKEB 2FFBA 2XXAB 4MQ5A 1FDIA 3D54D 5AVKA 4R1OA 2AFIA 3LU1A 3NC4A 3SYNA 4X1YA 4I2NA 1U8XX 3KPJA 1UR5A 2G77B 2XJ4A 4YS6A 4F9GA 4IDBA 5FD5A 3U7FB 5B7QA 2JZOA 3T5AA 1TOAA 4WBSA 4E5VA 1EKXA 1BWQA 1CERA 1T9HA 4PZ9A 3VTFA 2YN4A 4JV2A 3Q8XB 4QU5A 4US2R 1YA6A 1G60A 2O50A 2A5LA 2ZYTX 4IXDA 3ZE2B 5IAKA 4GZMA 4I4LA 4JFAA 1FYWA 1JPVA 3BXHA 3MGBA 2IMWP 1XDZA 2E21A 4OREX 4XWTA 2C0CA 2C29D 2RBGA 4H2DA 2PD3A 3VHQA 2FX3A 3OX2A 3PX7A 1FIUA 4IIHA 5JXWA 1N3IA 3IBFA 1QG2A 3BCHA 1SUDA 2PRYA 3ED5A 2Z4TA 2F1JA 2JFGA 3DXZA 3K8ZA 3RKRA 2XYPA 5DCYA 2CJPA 2CXUA 2IEBA 3UVEA 3RS5A 5AFSA 5BWRA 1AT1A 3RC9A 4B6EA 1ZSYA 3GFTA 4OHRA 3RRMA 4FX5A 2W6PA 2IYNA 4XYLB 4EHFA 2X5KO 2QNBA 2Q3JA 3BMCB 4P08A 3UGKA 3ZXYA 1E66A 1P80A 3HP7A 4Z8XA 1JW9B 2FZ4A 3FTCA 1SXJE 4G1MB 5AKLA 5KNCH 2VH2A 4JT9A 3V8VA 2C54A 3BGSA 3OWHA 4NQZA 1M0TA 1V9CA 3AONB 2YHSA 4G56A 4RFSA 2HBQA 4YJ3B 1I1MA 4FGLA 8ADHA 1JVSA 4KIWA 4LV8B 5D01A 4BO8A 3BBPA 3DZJA 3NHBA 3PXBA 2PGDA 3J81W 4LFCH 1UP6A 1ZEMA 1M0EA 3UHAA 2YQ5A 4J91A 3EIUA 4DIDA 3S1LA 1NHWA 4DPLA 3R0QA 1V1MA 4C5AA 3NVDA 2J3LA 2V6IA 2PMZA 1KK1A 2UUOA 3GPBA 2QJOA 3P20A 4AMYA 3TQ1A 2WHQA 4JYBA 4PSCA 5DYTA 4DLRA 1PJQA 2ZRLA 3CBQA 1F9AA 1OGYA 1CY4A 3M6FA 2E6UX 3CKLA 3C6MA 3NWJA 3OE5A 3IV6A 3LQSA 1DEOA 4TSKA 4DLZA 4GKBA 5FF9A 5K4AA 2HGZA 1P31A 3FFXA 3QZ7A 4YVFA 4ECVA 2WOOA 5FNVB 1MIOA 1O6GA 3SQOA 3Q0EA 4JBWA 1RCTE 3Q8LA 1PSZA 3TD6A 5K6AC 4EUFA 1CEYA 2R8JA 5AJYA 3GRKA 4O4HA 4BB0A 4TTIA 3A3KA 4REMA 1O9BA 4BO0A 4UNRA 5L9AA 1QR2A 1T8UA 4JYAB 1SVLA 2VJQA 2R6FA 3H87A 1JMKC 3L7AA 3AUKA 3EGDA 5KWEA 1P7CA 3VSBA 1J0XO 3WLAA 3ZW7A 1UKYA 3T9BA 121PA 1ARZA 1GAXA 4K6CA 5KYKA 3R0ZA 4OHBA 4QRIA 3KJEA 1RPTA 1JIQA 4JT4A 2I87A 2CN1A 2PUVA 2W2NA 4J07A 4ZRMA 4P54A 5DISC 2WTEA 4LSWA 1DO2A 1MB3A 1UAGA 3HB9A 1PAUA 1UFKA 1HFKA 2DCUA 3A4MA 3Q9UA 1EFTA 5DLGA 1YJ8A 4HWRA 4FFNA 4NZZA 1ZGAA 1JIUA 5KG6A 3BIXA 3E7DA 2OFWA 5DG8A 3OJWA 3VUEA 1XDBA 1SKYB 4JV1A 2QMZA 5KDDA 1H6AA 5LBIA 2C4NA 1N2CB 4E2FA 5BWVA 1SBQA 3HG7A 2CNNA 2KQUA 5CBPB 3PD0A 4URVR 1RLMA 4Y3UA 4ED7A 4IWXA 3TNJA 2KHZA 1R8XA 2OQRA 1HZZA 2F9MA 3TD9A 1OX4B 5AW0A 4NE9A 5LN1A 3EVCA 4PYJA 3FB4A 4ITVA 4C1BA 2BFMA 1XALA 5B3KA 3KJZA 4QPDA 4Y6RA 1BX0A 1R64A 5F7JA 4B7XA 4DA6A 3IEKA 1KGDA 3N53A 2H1LA 3W5CA 3TLZA 3O21A 2V6FA 3TCNA 2PYIA 1NX6A 5EHQA 3UJ3X 1DC3A 3QMVA 5ITZB 4LHEA 3IUJA 2P0YA 5CFRA 1V2GA 3I1JA 1L1EA 4RHFA 2VDWA 3KCQA 4WOKA 4DLVA 3SE0A 4E08A 4NBRA 1GEGA 1E8MA 1HDYA 3RH0A 2C4HA 3UJCA 2EBHX 4M6WB 4YALA 1N4AA 4J9PA 2QXTA 4ME6A 2WLSA 1AHNA 3PCXA 1D2HA 3TO5A 1W36B 4UVHA 1PJ2A 1W5TA 2C3MA 3VO9A 1W5EA 1GYPA 4PSKA 5LFAA 2O4UX 4KPFC 4M7RA 4AUMA 1SZDA 3B7GA 3W5UA 1EPUA 4L08A 1QP8A 2HNKA 5KFEA 1UQTA 5EIFA 4N0MA 3A9WA 3FYUA 1N2HA 1F4PA 1N6RA 2R5WA 3PRYA 1GGKA 1A2QA 4NV0A 4DUZB 5E3JA 1RQNA 3VJRA 1DX6A 2WC1A 4F3CA 4JCCA 4RDCA 3T7DA 2C1XA 4B34A 3REOA 3GLIE 2Y1LA 3LO5A 3OMLA 4FR2A 1EFAA 4L9WA 2G1JA 2E5WA 2HADA 1FYDA 1B6RA 3DP7A 3L1UA 4IDPA 5C1BA 2QKYA 1OU0A 5TEWA 3TAXA 5HQ3A 3CVUA 2YU9A 3HQ4O 3ZD8A 3NFYA 3AQ4A 4JUAA 5D6NA 3ZDZB 3TOSA 2ODWA 3HRHA 4RZIA 1YOVB 4J9LA 1PU2A 2GN8A 3O82A 1FFEA 3AILA 5DO9A 2GJSA 3T5GA 3THXB 2WD9A 3IG0A 1U28C 1ZESA 3T52A 1P0IA 4JHLA 1OH7A 4GRAA 3P26A 1CQWA 1ZH4A 1L4FA 1U65A 3EXHB 3AHGA 5KNCA 1XXHB 1Y8RB 2EJBA 3BL6A 2YL2A 2AOUA 5FXMA 3K1YA 3I73A 2H63A 4FD3A 5IT4A 5BVHB 4FCCA 3NUGA 2DFVA 4ZVMA 3KXYT 4GL4A 4A73A 1E6LA 2L19A 2ZJ8A 5ERGB 2ZXUA 1J4AA 2ONCA 5TVGA 4E5UA 1MORA 5JJKA 4ZXPA 3FN4A 4IVNA 3CBGA 3PB3A 3ZGNA 4JUDX 3MNFA 4HAVA 3DVAA 3H0CA 1KDYA 3HS3A 4UNNA 5KPDA 4LQCA 1L4GA 1JT2A 3RIEA 2WFLA 1PJ3A 2HV8A 2YZ7A 3GT0A 5DV9A 4DSAA 3WWHA 2XDQB 3BMNB 1A27A 4R9VA 5EKXA 3FH0A 2C2GA 4UFZA 1YZKA 1SCBA 2Q9UA 3R5KA 4OYHA 4UEQA 5DASA 4A0QA 1F0KA 4CV2A 5KC8A 1CLEA 4RFVA 4FWBA 1F3LA 4LHSA 4RGQA 4GYKA 3JQ9A 4WLUA 2HCTA 5KTSA 3ND5A 4LVNA 3K7EA 4JQZA 3H5IA 1TKBA 1G20B 1KYQA 4WERA 4O7TA 1P1JA 1RLTA 1N5KA 4G4SO 1ZNYA 3NDJA 2NPFA 4WAUA 1LNSA 3AF5A 1UNNC 2UU9H 3SBEA 5L6LB 3H5LA 3NVKI 3L46A 3U0GA 2PLAA 3HJCA 4GZ5A 5KYYA 3K9FC 1CDEA 2XZPA 4C7JA 1KI9A 2H1VA 4EJMA 4N03A 3OC0A 4J3JA 3L92A 3FDZA 4HQ6A 4YI3A 4GR4A 4BVEA 5A2QW 1XZNA 1OC4A 2GR9A 1P7PA 4IYRA 2WDTA 2CXXA 3MGCA 3NEPX 5KFGA 2X14A 9GPBA 3P1JA 2C92A 4J0IA 3RC1A 4M4SA 4TQRA 4P4UA 4O84A 5C4MA 4C3VA 1P4JA 2DMRA 1SEPA 3L7BA 16PKA 4N7MA 4H1WA 3NBKA 3MTAA 3HC7A 1EE9A 1ADYA 4P35A 4P53A 3IX7A 1TUGA 3GIPA 1C1YA 3D59A 4PAGA 2PX4A 5AW1A 3IV9A 4O7ZA 3IAM1 4HADA 2NXEA 3FW1A 5I45A 5FPOA 4MNTA 2GK3A 1DKPA 1J9GA 2CL0X 1P0PA 4RVGA 5AK0A 4WDQA 3GUCA 3H1PA 3IDOA 4J29A 5IVPA 4QWAA 4FB4A 1TTTA 2PMBA 1K5DA 4OO3A 4L73A 1DEXA 2WIKA 3FDSA 3V8RA 1UUFA 3MSCA 2QD2A 1SHLA 1VJDA 1HDEA 1XJQA 4QIWA 1XZFA 3IP9A 4HGZA 4R01A 1G8GA 2AHOA 1GTG1 4K9OA 3QFFA 4YJHB 1NJGA 2EC5A 4JI0B 3MMZA 1XD2B 4PIPA 1MABB 4EF4A 4KVZA 2E2HA 3AH8A 4R9UC 5KFTA 3A1VA 3GV5B 5CT6A 5DT2A 3P2MA 4IDCA 4ENRA 1AG9A 3H3FA 4N18A 4LTNA 1U3CA 2ZI5A 2C1ZA 3KZMA 4P0TA 4UMEA 3WGUA 4NFSA 3Q88A 3SBXA 1GPBA 4FT4A 3CVYA 4CM3A 1NNLA 5TQ0B 1NI4A 3T7AA 1DKUA 4YMVA 2ZQYA 3KB6A 2VSQA 5EXEA 3DE3X 3HXPA 2Z3ZA 2H59A 3V8EA 3KT0A 2BC9A 4RZSA 3HOUG 3R5XA 2WA2A 4Y2RA 5MFZA 3J81A 1JMYA 1OI3A 2IEIA 4N3AA 3ZGVA 1AKRA 4HYKA 1KXZA 3HACA 3NDBB 3IPXA 1RWNA 3MUFA 1VP9A 5G53C 1ISPA 3MR5A 3V6LA 1Q1NA 3RT7A 3MR6A 3BHJA 4A3CG 1XL1A 3LECA 3PC8C 1CUJA 4GC6A 1SWWA 2EU8A 4ISCA 5TS3A 3SG0A 4ZJPA 5IT5A 5LSAA 1G7TA 1S6YA 4FBGA 5BYBA 3HWWA 4V1CI 1YVPA 1TLLA 2Q4RA 4PWZA 3SXPA 4NNPA 2BSAA 5IXJA 1RXCA 4AJ1A 1FNCA 3A0RB 4E5YA 1L4HA 4NXMB 1ST3A 3TZHA 1MJHA 1CJKC 1JJFA 2RFLA 2W8ZA 1XZHA 3PE6A 5HCNA 5CIQA 3SZ3A 3F9CA 1NVTA 1A0OA 3U81A 1VHDA 2PA0A 2AJTA 3ITKA 1UDCA 2Z30A 4HH0A 1CRLA 4A23A 4C22A 2A5GA 4C6TA 4X8HA 5FBLB 2YVAA 1IU9A 4UCXA 3W5VA 1ULZA 1EUDA 3NBYC 4XFJA 1MENA 4BUCA 2AQIA 3Q8PB 1XYGA 4AY3A 4HDMA 4QGHA 4IJMA 1T24A 1ZYUA 3VXKA 1GGNA 1C7JA 3TEJA 3RV3A 5HIAA 5JZBA 1U5BB 2TYSB 2JA6G 1MW8X 2HQRA 3U5ZB 5JSQA 1RQRA 3FKJA 1L7RA 1T8TA 4NONA 4L75A 3SVZA 1TQ8A 3RAXA 1BMFA 5CHYA 4J2OA 5L1LA 3RS2A 4YAWA 1X3LA 3I0MA 5CX4A 4I55A 4PG8A 4S1WA 3TIGA 4CMIB 1V5FA 1KJIA 2Q2WA 4LJLA 4XVHA 3R23A 2FPXA 2I99A 3KG2A 4APMA 1P5JA 1R50A 3FPFA 3OO0A 4L5AA 4L5BA 4M9QA 4QBIA 5CJ2A 2OHIA 3RYIA 2JGEA 4QDXA 3PNQA 1Z68A 5FQOA 5KBYA 4O02B 4BB5A 2HF2A 4EG8A 3BE8A 4Z2YA 1YCHA 2CUKA 3DSRA 1NPYA 4R7TA 3I4CA 3KC2A 1O89A 2QZ9A 3TSAA 3JU3A 1OW3B 5HRAA 4WA7A 2F00A 2PANA 3ZWOA 1L7AA 3EQ7A 3A37A 4YCCA 4K8OA 3ZWKA 1XA3A 5DXJA 4OHCA 1T9ZA 5J63A 4JASB 1T6XA 2F1RA 4NZNA 4QGAA 3CN7A 5DNCA 1USGA 1ZNZA 2AC2A 2YRFA 4KXWA 3MCWA 3EASA 3IKJA 3ZIAA 2Q2VA 5IN4A 1TNDA 3UGTA 2XAAA 4B6FA 1N77A 4D3FA 4L4RA 3GIQA 4MH0R 1EVIA 2XVXA 2IGBA 2IUFA 2HT1A 1P5ZB 4KWIA 5J43A 2EJ3A 4AYBA 1Y3HA 3KYJB 3MJSA 4AF6A 5KFJA 3COSA 3U0BA 2YCHA 1NVUQ 4ZDJA 1CRWG 3PD1A 4ARZB 5BRJA 3NAGA 5HE9A 5H68A 2DHQA 3DE2X 3LUAA 4H7IA 5TMEA 3SHWA 4F3KA 5KMGB 1G63A 4RK0A 5DYGA 1WVMA 1XT6A 3H11B 1KSGA 1GPWB 2R60A 2W9BA 3I9MA 3AVOA 5JADA 4YRGA 2XYVA 2VJDA 4BO6A 2COJA 1IWOA 2GN6A 2J48A 2RONA 2QF7A 3D7LA 4V0OA 1E4EB 3KR0A 2HCFA 4YX9A 1SCIA 3KD3A 1R6DA 3FKIA 1U8CB 1GO2A 4HS9A 2FVXA 4PZEA 4XIJA 1J0DA 4LKRA 5AVJA 5HFJA 1P19A 4JCOA 5JXJA 2RK6A 3AYHB 3STTA 4MTLA 2OH2A 3EA4A 4DA0A 4R9NA 3P4UA 1SRRA 1KOJA 2FUNB 2MINA 4QHSA 4RPCA 1YK1A 2H2HA 3F97A 1D0IA 1W9MA 4B8ZA 1ZXLA 3A3NA 1NJ6A 4EDHA 3S2SA 2R1VB 1SXJA 2Y1XA 3MHPA 4OL0A 2QXUA 3N42B 4QBGB 5FR1A 2QRKA 4XGKA 4CG3A 1YTUA 1BWPA 1RWVA 4OQNA 2X86A 5SZIA 4ERNA 5CD1A 2W71A 1Z5UA 3R77A 3L1KA 1C50A 3F6SA 1T6ZA 3KSMA 3ZU4A 1X7YB 2IHZA 5I8WA 4CCYB 1P8AA 5A1TA 2CT8A 3QU9A 1YDHA 4AP6A 4DBZA 1R8QA 2XUHA 2VH5R 1BYIA 1D0SA 1G17A 3BABA 2NYVA 2C61A 4G1CA 4IXMA 1ISRA 1WSBA 3HSSA 4L0MA 1JDEA 2JGIA 3AKDA 4PRZA 5AKIA 1BMDA 1NN5A 2GWRA 2ECOA 4HEQA 1PJAA 1T91A 3TRJA 4TM5A 1VMKA 2IUTA 2ZIGA 3O8QA 3T5PA 4G0VA 4ON9A 4KO2S 2H17A 4OP3A 2V4MA 2P3OA 3PBKA 2DVMA 2YNMC 2X0EA 3PO2G 1KR5A 1N57A 1JNXX 2R6R1 2VUIB 3OSZA 2IUUA 4P4SB 3WDSA 1CX9B 3UEOA 4AKTA 4ED2A 5FBVB 5CNIA 3IO5A 1B1CA 3IOBA 4FYJA 4UU8A 5F2OA 1SZPA 1C30A 2GTIA 1FP1D 1NULA 2VPIA 4KODA 4B87A 4DQUA 1AO0A 1AQJA 1YFZA 4R3WA 3UAGA 3RKUA 2JCBA 2J0EA 3GRYA 2IU0A 5BVGB 1GARA 2EX1A 3EUAA 4L8VA 3V6KA 1OA1A 3OVMA 4GX5A 5E4FA 5TV2A 2UXDB 2PSEA 2WIFA 4PAQA 4WCFC 3QTBA 4ZEXA 3VRHA 3IAFA 1DP4A 3GEPA 3QWHA 2RDMA 4RF4A 5FYDA 2AMLA 4LXXA 1G55A 2QHXA 3DDCA 3E9MA 3I53A 5KT2A 3TL6A 2OV8A 4OSOA 2R92G 4L3OA 1YRWA 2XNDA 2NO1A 2XRMA 3IMGA 4HRXA 4E46A 1Q2UA 1WB5A 4P92A 5EVJA 5CVTA 2DPGA 2P41A 3I4LA 4JB8A 4FYVA 1TJNA 2FEWB 1PJBA 2QVZX 1MC1A 3ZIUA 4P31A 4TRMA 4KGZA 5LIPA 3MN1A 4PGAA 3U44A 4KQJA 3V46A 4F9EA 3PQ2A 4DEYA 4O4IF 3AVQA 1T36A 1EFPB 3BKXA 2JGMA 4Y30A 2V9ZA 4Y0AA 3N2KB 3RYCA 4FUTA 1SWVA 1YIAA 4Z7OB 4RKEA 1Y1PA 3X1MA 4IINA 2XDYA 3RLIA 3N87A 3M2PA 3R3WA 4K6HA 1GYRA 4UHDA 1UBHS 5DLQC 2CYAA 4ISBA 4B80A 3CLUC 4GUDA 4BQSA 2O2JA 1YJAA 5EG5A 3HFRA 3VPDA 1VYVA 2VZ9A 3F7MA 2G4VA 4XM0A 1GUYA 1G6OA 1MB9A 1Q14A 2CW8A 2AB0A 1WMFA 4QDUA 4M22A 1KJYA 1N2JA 1Y4AE 4U2EA 2C0PA 3RYTC 3V6HA 4UM5A 4Y9RA 5CT8A 5BURA 3QF4B 1VBNA 3BZUA 4TUYA 5FOVA 3WGNA 3FWKA 1GZ4A 2HN9A 1DS6A 4EA6A 2WOJA 2WILA 3ZVKA 3RFXA 3UHFA 1N2EA 1TCBA 2DRIA 3AHJA 1KZ9A 4QT0A 4GMXA 5ESRA 4RXUA 4AP5A 2FWIA 3BQ2A 1TYDE 2G17A 3I45A 4U7TB 3PCTA 4N0EA 5JSHA 2H7XA 1U0TA 1GKUB 3EVAA 1VG0B 3JWJA 4GPIB 4N5LA 5ILQA 3W5OA 5BSVA 4IJQA 1LU9A 2BFFB 3IIKA 2Q2NA 4RKYA 1GU0A 2WK1A 3GB8B 3FCCA 3NGXA 2JPDA 1IJBA 1BZYA 2W11A 4JV0A 4JI6H 1V45E 2ZSJA 4Q21A 4PBSA 1JEAA 3VGJA 1RXSA 5EOVA 5I47A 2M32A 3W8EA 1TC2A 1U8YA 4P83A 4ZO8A 2XPCA 4GKKB 3RW9A 1ZBQA 3BX1A 3PFCA 4C4YA 5IAGA 2C4VA 4BLWA 4TVOA 2QLMA 2G6BA 1PFKA 3L7OA 5JW6A 3LSYA 3NT4A 3K0EA 4DIEA 4POOA 4JLDA 2HGSA 1MGOA 2GBLC 3SVLA 4YRDA 1SCUA 3BZWA 3QJ5A 5HEKA 5E6RA 5AVOA 1DBQA 5IABA 5I9IA 4RUAA 3PEEA 4CM6A 1JYSA 3D3NA 2VNKA 3PPVA 1OBGA 2OP0A 2BH9A 1TRHA 2AGQA 3E58A 3RASA 2IEDA 4WTOA 3GFRA 4YV0A 1EKFA 1UJ6A 1NBME 2J3QA 2GD1O 2HMSA 2JLRA 1T1SA 2QLBA 4M1EA 5ER6A 1SXHA 2XWPA 3IVRA 4ED0A 1D6MA 4BTLA 1NVWQ 3H18A 1XWFA 1JFRA 3ON5A 4MW7A 4X8OA 3ZWBA 3N44B 1VYHA 1ZGGA 2F4NA 2A33A 4Q7MB 3S81A 2EHDA 2WI8A 4PC3A 4NE7A 2Q1TA 4LF6H 1T15A 2HOQA 3T7IA 2AX3A 5EE5B 1KZHA 2XBMA 4BO9A 3VPAA 1D4ZA 3WGHA 4EHHA 2P4UA 5KTMA 5L53A 1Y34E 2PIAA 4EGCB 1J99A 1FU4A 2YOGA 4TKUA 3UJHA 3ZHBA 4YQEA 1VLMA 4I55B 4MULA 1NBAA 4OB8A 2EWVA 5PGMA 1Q3TA 1O2DA 4HDSB 2PYDA 5CGZA 3RTXA 5MN6A 3KQUA 4QFDA 1XEWY 1UXKA 3A6PC 1QDUA 1WD7A 2HBYA 3OIGA 4HYQA 3EVFA 1L5YA 1P2UA 4NCIA 1OIXA 3HTXA 1I6WA 2CJWA 4H7DA 5DU2A 1R1DA 2HH9A 2PV0A 3JQBA 4JIMA 4MQLA 4NZPA 1PX2A 2Q2QA 2R8EA 4O5OA 4DA9A 1P9WA 1DEHA 4J94A 1PE0A 2G25A 2GJ4A 3UOGA 5JECA 5AXDA 1S01A 3OZIA 1DIHA 1V41E 1QUFA 3OTGA 2KSQA 2FUEA 4R8KA 3RGWS 4FW8A 3LT2A 5E2IA 4QYMA 2P11A 4FDMA 3WGKA 1J56A 2RHLA 2V6GA 2AZXA 5HKKD 3EZXA 4X9XA 5TXGA 2OCXA 4BBAA 4ZVLA 1VL6A 1PL7A 1P7ZA 1U28A 4UTOA 4BNNA 2LV8A 4TWBA 4RESA 2QGZA 3LKDA 1YQXA 1MV5A 4DR5H 1DAIA 3DNFA 2BFEB 2EKPA 1KIFA 4UCFA 5JG7A 2F3RA 2PD4A 3EARA 5DN9A 4RK7A 4BQIA 2GXUA 3LE8A 1ODIA 4YMTA 1N6HA 5IM4F 2CXHA 3TDNA 2GB4A 3NV7A 3OQNA 1IBKH 2CNUA 5AI5A 3WGGA 1XX6A 2Y0SE 4RNCA 1G8SA 4DCMA 2WQ7A 2P3QA 2I5PO 2XMDA 4IF4A 3R7SA 1SR8A 4B32A 4BRWA 2OE2A 4UQLA 1DOHA 2DWPA 2ZTVA 2H29A 2CLHB 3IEIA 1IBMH 1OKKD 2OUKA 2VA9A 1B73A 4IZIA 1TWCA 4MQFB 4TVBA 2XMPA 5IKMA 1KIMA 3WGLA 1N4DA 4GGPA 2E5LB 3AJAA 3GLRA 4Y6PA 3S29A 1G6KA 1K6IA 1GNSA 1KK2A 3IT0A 2RGGA 4JI8H 3DOUA 2WQZA 3L18A 4BLOA 4II7A 5JMOA 1AK2A 5FP0A 2QZJA 3NOOA 1LBHA 3AETB 3LYLA 2UVUA 3V4VB 2JIMA 4CIAA 1G8KA 1MNQA 1X92A 1IZ9A 2C5GA 2O8VA 1K68A 2Z1MA 3D8UA 2PPVA 3PNOA 3GLKA 4KN6A 4BUZA 1LFDB 4YA6A 4CU2A 1YFKA 2Q8QA 3DDWA 3Q9NA 4WFJA 3TW0A 1Q1BA 4X00A 3OOSA 4L1KA 4INZA 4ND3A 4WZBA 3HGTA 3TDMA 10MHA 1RJPA 2CFIA 1E6WA 1PP4A 3H7AA 1H0KA 2PS1A 2RBEA 3LW8A 1QWOA 4LJ6A 5JNVA 3QXCA 1VAJA 1VBHA 3RK4A 4CL0A 4CKZA 4B47A 3HO1A 1LPAB 4TQUS 3VSCA 3LUPA 3VBEA 1IY9A 3EW7A 3PPIA 4E3ZA 4DMRA 2LTAA 2X9VA 3G2IA 3RS4A 3TUJC 5EAIA 3PW7A 4RD4A 4TUYB 1YE3A 4GSKA 1BMTA 4PZ0A 2PMZE 5AKJA 2P2GA 3S99A 4C7BA 1XNRB 4KYVA 5DBEX 2PBRA 1K97A 5EXDA 2OENG 3UJPA 4GPAA 1IBLH 1XMXA 4OH7A 3CWQA 4UHCA 1WH2A 1I8TA 1KYVA 3FDFA 3N7UA 5B37A 1RPAA 2BQ3A 4BFYA 4PSAA 5KFXA 1EAYA 3EGCA 4FCVA 2ES4A 3C48A 2WTAA 1X7WB 4YAJA 4ONEA 1G8FA 5DHSA 3WISA 3S5JA 4AW9A 3EQ8A 3PFGA 3BTUA 4L5IA 4U6PA 1CEQA 1YCGA 3DKVA 3NJ4A 4ZIRA 3U7HB 5HF9A 1S8OA 1HE3A 2MTBA 1FPMA 1D09A 4BNIA 2QSUA 1LWOA 3CNHA 2NZ2A 3OU2A 3MA0A 2C4WA 2ZANA 4H1UA 1LXCA 3WGVA 4N76A 3WIDA 1H1LB 1DV1A 4N12A 3T3NA 2I55A 1ACLA 1CE8B 3CNOA 1U7PA 2VSNA 1KJWA 1QRDA 1RIFA 3GZ4A 3LGXA 3PR2B 4JS0A 1YDEA 5KT3A 2XSZD 1ADFA 4BVGA 4C0KA 2G80A 2ZJZA 2JJMA 3EHDA 1U6JA 3ZNQA 3PDCA 3NPMA 1N6PA 4CCAA 1CVLA 1J49A 4EHDA 1TUEA 3N3BC 2HX1A 2JI8A 2WKRA 4ZO6A 1Z2OX 1TO2E 2HO4A 1QVZA 2E3JA 4DQLA 1EVKA 3AWDA 4JLWA 4MGHA 3IOYA 4Q9HA 4HFRA 4OHKA 4PLCA 1MH1A 5CDFA 3SN6A 3O1HB 5JQGA 1SU4A 2FSUA 3UK0A 3G9XA 4LBVA 1R5BA 2C2HA 4R8SA 1SVMA 2WF7A 4PYKA 2O2CA 4TZKA 4WFKA 1DAHA 4XFKA 3FNEA 1E18A 3H4VA 2Z6VA 3INYA 1JEEA 4JI0H 4LXYA 4G37A 5DKFA 3SWWA 3CLRD 2BTEA 2ZJ2A 3AVPA 3EFEA 1TD1A 1WY7A 5KYXB 1XTBA 4CTOA 5MGNA 5HRCA 3ET5A 3AF4A 4OD0A 5DZSA 3JAWB 2F6RA 1SD1A 3A31A 1E9AA 3EXEA 3IVXA 4MGKR 1JLLB 3L4BA 2Z1DA 3UV7A 4KL8S 4KE8A 2JGJA 3TQHA 1WABA 2VT2A 5JT1A 3K35A 2G5TA 4JUCA 4K46A 2X8LA 4Z1OA 3EQZA 5CD9A 3JAKB 2BY4A 3B38A 3WXBA 1K1EA 4QOEA 1ZGCA 1IBCA 4WD3A 4LGMA 4HNSA 3DR5A 4Y2PA 3BWBA 1T4MA 3DWEX 4KE9A 3PQ4A 1Y1LA 1ZD3A 4M9XA 1LX6A 3U7QA 4YYEA 4F97A 4DUYB 1UFVA 1AUQA 3KKEA 1N8SA 2MSKA 4JQYA 3K6SA 2XC9A 5TVKA 2K2QB 1CKNA 3SAJA 2JFYA 3TW8A 1Y5IA 1FB5A 3OZRA 3MS2A 3Q40A 1II9A 1KARA 2CFTA 3GUUA 3OD5A 2IYQA 4TVIA 3V7YA 3PC7A 5AIBA 2C95A 4UUAA 4G67A 1XZKA 5I60A 1NSYA 1VBMA 2FRDC 2X3YA 4GP9A 1PLLA 1YV9A 1MHPA 2CKDA 2O0MA 2PUHA 3B51X 4N6OA 1I3NA 2PMKA 4I3FA 3I2KA 4RSMA 5CCDA 2WY2D 5K8LA 1EIWA 3ETNA 4MWCA 2OMEA 2REQB 4GM4A 4ESHA 3VKFA 2JI4A 4F5DA 5FOQA 3HJHA 5J9FA 1GZVA 3CQZA 2CVZA 5JIBA 3HJTA 5KQPA 4OAPA 4GKAA 1V4NA 3PITA 4KI0A 3RBXA 2JGDB 3SD7A 4B45A 1DPFA 2X0DA 5JJIA 3EJ6A 4MS3B 2V9WA 3WLQA 4DWJA 5JXIA 2FP3A 4BNKA 5EMNA 3L7IA 4DLXA 2GSWA 2AC4A 1BQ4A 3I4MG 1T2CA 1KMNA 3R2JA 3GFOA 2YWGA 4WXHA 1Q57A 3CVXA 1UPAA 4D98A 3QQ5A 2CVPA 1SA0A 2X6RA 4Z9YA 4HWTA 3ZJ4A 1HT0A 5DWDA 3DZDA 3E22A 1FFGA 3O9MA 2VYQA 5DISB 4YBZB 1A72A 1DAAA 4FNOA 1A9ZA 3QQMA 2GGSA 1OROA 2WF6A 1OKKA 2XLBA 4HB3A 3CLTC 4OJQA 3UPUA 3MXTA 1CJSA 2WE8A 4PSVA 2W90A 4BEBA 1CZNA 2PSHA 4J9QA 3T99A 2Y68A 3EAFA 3HFJA 1WMEA 4C5BA 3HXMA 2XHEA 2Q6IA 2VJCA 2WJIA 3O8OB 1W2WB 5BPHA 1QIEA 1YMVA 2QRPA 3PTAA 1Z0KA 1R4NB 2SKDA 2X4GA 2ZE6A 3ZXUB 2TMGA 3DL2A 5IUKC 3FTQA 8LDHA 2VWGA 2J30A 4K9QA 5GJVC 3GPLA 3TEFA 1XAGA 2C5BA 3SLKA 1D4OA 3UJ8A 1U02A 1MKYA 1NJ2A 3WGTA 3F5SA 3RU2A 4IIBA 2CLMB 2GERA 3CONA 3MJFA 4Q4DA 3UANA 4A5SA 3IE2A 2VUHB 4ZZIA 4DADA 4DTIA 4TYMA 3AB8A 2NVOA 2AW5A 4G5XA 4XUEA 1CRZA 3WADA 4EPRA 3G7UA 3SYKA 4ZVTA 4B3TB 3DKPA 4QNRA 1UBLS 1JFLA 1DDGA 1RCFA 2DTDA 4XJVA 1CIVA 1CY6A 1O75A 1YZUA 3EAQA 1I0LA 2OG1A 4UXJA 4RA6B 4ZTBA 5AXBA 1E1NA 3OWXA 5TLSA 5FI5A 4UPVA 4ZAYA 1C9NA 3D4OA 3R3ZA 1P1KA 2VEOA 1ZVVA 4RS3A 4HEJA 2XNJA 1XCOA 4N3GA 3KL4A 3AVWA 2A84A 5F3DA 1OZHA 2I6TA 1S5PA 1XELA 3BXFA 4FZRA 4I4NA 4MW1A 1P9RA 3QVWA 3U7IA 2BD0A 4YY3B 3O4RA 5EXPA 2IV2X 1UWCA 4F6RA 2PH1A 3IJRA 4LDZA 3EGVA 3UH0A 3D6HA 3WWEA 4KDEA 2F4VH 1KFKB 3WYNA 1CVIA 4ARZA 5CH8A 4J0MA 1ONOA 5DRTA 3HZOA 1R4AA 3IAXA 3ICVA 4GEKA 1QGAA 1ZVJA 2CMKA 2Y1CA 1OTHA 2WB2A 1QH9A 2GO1A 2WP8J 3CUUA 3EMBA 3K15A 1SEVA 1HT2E 3G9QA 3LBNA 4FILA 5COQA 4ETNA 3EC2A 4LXUA 3H6HA 2K4MA 3L8YA 5E4JA 4LFAH 2VUMG 2Z8YA 1B6TA 1E9DA 2B4YA 3D8HA 4RY8A 1EWRA 2FK2A 1J09A 5E1BA 4F4HA 1K7EB 1FPQA 1D4AA 1WRBA 2VJKA 4AYBE 1WV0A 3L79A 4FGJA 5IH3A 4JJAA 3KQOA 3U4GA 1FP4B 1LQTA 5A02A 1E3WB 3IPLA 2Q4EA 1W88A 4DCNA 1ZC4A 5LOVB 1TGVA 4MKZA 4B7AA 1GHTA 1MEOA 1UBNA 3LCUA 2Q07A 1IN5A 1VKNA 3FPCA 1ZM2A 4CKEA 1M1ZA 1V7PC 1U9CA 2AK3A 3EWIA 4L50A 4FFLA 4NPAA 1RXWA 1W88B 4E7PA 3I3OA 3G8BA 4QOHA 3ACBA 4U00A 1DBVO 2LE0A 3R0XA 2HU5A 4W8GA 1GGFA 4PYQA 1GCUA 4B43A 3GJXC 4WRRA 3L7LA 2XUDA 3VO8A 1XMPA 3ZZ0A 4I3HA 1W73A 1E79A 3P0HA 3WLIA 4CTJA 1WMAA 4H1TA 4GC5A 1OWMA 5E3HA 5AKKA 1BH6A 4F5EA 1A9PA 1YH3A 4LYEA 2DTEA 4QAQA 1XRLA 1GUBA 4ROTA 4RPJA 3D3WB 2PQ6A 4TWAA 5H82A 3WWPA 3UG6A 1FZQA 1QF7A 4EA8A 2IELA 3LCVB 4NPCA 5IXYA 5CM8B 3GVHA 3S0JA 2JLZA 1SIOA 3DT9A 3KYHC 1TKAA 4LYDA 3SICE 3NIBA 3ROFA 4JJKA 4C6SA 4L4YA 1UMBB 1MO6A 4YRFA 1U0LA 4QGGA 1NRJB 3NKLA 3L4JA 5B7NA 1A1VA 5LL6b 4DWVA 4M1MA 2VUSA 3TM4A 4B7UA 3NTXA 3COWA 1M6HA 4HZUA 3C8ZA 2FEOA 2BKXA 5FTMA 3PXXA 1ZW1A 3G7SA 1W93A 4LYAA 1N5IA 3HA2A 3V8PA 5JAZA 3T54A 1AZLA 2DLDA 3IE0A 1C9KA 1ZJWA 4R2XA 1E5XA 1NF2A 4UBKA 2AKAB 5ARCA 3F8NA 1W0CA 2HWUA 3C3XA 3R6DA 2BI8A 2J3HA 4X41A 4YT4A 1NTOA 1NKVA 4K7JA 3ZGXA 1WHSB 1GM5A 1K9SA 1V3VA 4HPJB 3CM0A 2V5UA 3U48A 1RPNA 2PZFA 4BTEA 2XCUA 4JKYA 1WKVA 3K5HA 4PQRA 4HL6A 3PYMA 1GZ6A 1V5GA 3TQRA 8GPBA 1F5NA 1XZLA 3KEFA 3TLCA 3F73A 3O1JC 1KI7A 1YS2X 3C3CA 4N3NA 4HAXA 2VHXA 4B3FX 2D4HA 1J0AA 5SV2A 3E48A 4C2BA 1XK5A 4DR3H 5ALOA 3P9NA 4A2PA 4CLDA 2V6MA 5DTMA 1HLGA 4MWEA 4YONB 3FBGA 5GINE 2JVJA 4D02A 4TS4A 3OY7A 1XZEA 3P0FA 5EHNA 5F98A 4E11A 2O8FB 4AZSA 4LMPA 2WMNB 3HOZG 1PTKA 2AR9A 3PKJA