2CNUA

Atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with aspartic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
305
structure length
302
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
publication title Saicar Synthase: Substrate Recognition, Conformational Flexibility and Catalysis.
rcsb
molecule tags Ligase
total genus 106
structure length 302
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2006-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cnuA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2cnuA02
2XIKA 3LXLA 3P5KA 2ITTA 2JDRA 2VZ6A 1F5QA 3E8NA 2GNHA 2CN8A 3DK3A 2WTKB 2J4ZA 3UMWA 5CU6A 1H8FA 4GFMA 4H3QA 4F1TA 2O63A 5H80A 1KJ8A 4WIHA 5JK3A 4R5YA 3L9NA 3JR1A 5CEIA 4A7CA 3CBLA 4TYEA 3VRZA 4CLIA 3FLNC 2O64A 3W55A 4QYGA 5ANEA 4GKHA 1GGOA 3R8ZA 1PY5A 4TT7A 3IPHA 5L3AA 2GTMA 4GYIA 5HZNA 3VC4A 2E9NA 3TEIA 4ZP5A 3Q2OA 3PA3A 3R22A 2PVHA 1G8SA 1OL7A 1URCA 2W1DA 4FUXA 2X7FA 4C2WA 4BR3A 4G3CA 3VUIA 3HA6A 3EZVA 2R4BA 3FYJX 4JBOA 4IWOA 5T3QA 2JFMA 3VUGA 2OZAB 3BYOA 4EJ7A 2I8CA 5CU3A 2YISA 2HY81 3Q60A 3ALOA 4PL4A 5TF9A 5I9ZA 4F7LA 1B6SA 5IQAA 5AJQA 2QOHA 4LMNA 1E4EA 3LFDA 5DIAA 4I6FA 3RM6A 1TKIA 4NU1A 4BCIA 3NCGA 3U8WA 1VBGA 3UOKA 3F9NA 4GCJA 4BCGA 2FB9A 4FKIA 4Y5HA 2BHHA 3DBQA 4EOKA 2W1FA 4NFNA 3UODA 3TDWA 4C2VA 4O0TA 3GC8A 4XH6A 5CAQA 5HBJA 3QD4A 4O2ZA 4HR7A 2VWWA 4N70A 1PXMA 1PXJA 1J7LA 1WBSA 4RLKA 3COIA 2C4GA 5CNNA 2W7XA 3MVLA 1J1BA 4JDJA 2YJSA 2VPQA 2A0CX 3NUNA 4OR5A 5J9ZA 5EHLA 3VQUA 3WE8A 2WOUA 2J51A 2VAGA 4IX5A 1F3MC 5J5SA 4O0UA 3QRTA 5C4LA 2P4IA 3KXHA 3P1AA 3ZBFA 4D0WA 3T3VA 3QA8A 2GHLA 2JC6A 2C69A 1ZRZA 5IEXA 4FL3A 2XK7A 2QOQA 3F88A 4AN9A 3RV4A 4GS6A 1QPDA 4X2NA 4Z7HA 5CA0F 4AF3A 4ZXTA 1PW2A 3G0EA 4ITIA 4HNVA 3E8EA 2UVZA 2VTPA 4PMMA 1KEEA 4EYJA 4U5JA 4FFRA 2CSNA 5CXHA 3F61A 4BCMA 4CV9A 4RIXA 5EHOA 1U54A 3BYSA 4APCA 2B9IA 3G9LX 4FL1A 4D2SA 5AV0A 5JSMA 4BTJA 5KNJA 4BI1A 3EMGA 3QTZA 3HEGA 2IZRA 4E4LA 3DY7A 5A3XA 3NS9A 3JUHA 1SVEA 2NP8A 4Y73A 4A4LA 4AA4A 4CTBA 3MN3A 2RF9A 4NSTA 3BHUA 3E63A 3MBLA 2FO0A 3DAKA 4NKSA 3KRWA 4JBVA 1CS0A 2IO6A 3FQEA 3CY2A 1UWHA 4ANMA 4EH6A 2GPHA 2HZ0A 2VX1A 5H2UA 4UXQA 4FFPA 3UQCA 1KWPA 5D9HA 3BCEA 3VUMA 5HBEA 5CANA 2BDFA 3BGZA 4R7IA 5DT4A 4BY9E 2BRHA 1M52A 3NX8A 3DT1A 2AC3A 4ZTQA 4FOBA 2QODA 5IQIA 5J8IA 5IPJA 4RJ5A 3WZKA 4CT1A 3LFBA 3V5TA 2YM6A 3PSBA 4JVGA 1Z2PX 4ACMA 5K5XA 3AT2A 4TWOA 5GINE 3AMBA 1JKSA 4RPVA 3CQUA 3BV2A 3D5UA 4XV1A 5M53A 1JKTA 3GU8A 2R0IA 2I0YA 3DPKA 4I41A 3E5AA 4YBKA 2XEYA 5D12A 2FPIB 1CTPE 5JGDA 4X3FA 2ITWA 4QQCA 3UQFA 4UZDA 4QRCA 3M1SA 4C4GA 1I44A 1LPUA 3EFJA 2XVDA 3GENA 1ZAOA 3AMAA 4IM0A 3OUNB 2HAKA 4ZMFA 1PJKA 4XS2A 1Q41A 4U79A 4IDVA 4WOVA 3MI9A 4XUFA 3RPRA 3HMMA 4L46A 4UV0A 4C4HA 4DYMA 3KK9A 5BVDA 3R5FA 1R3CA 3BYMA 1XHAA 2EU9A 2VWYA 2VO0A 4WHZA 1ZYCA 3FPMA 4FV3A 4WBOA 5DRDA 4DE4A 1XKKA 4YU2A 3A62A 4YO6A 2BALA 1U46A 2C68A 4AW5A 5LVPA 2R7KA 3QF9A 3D2KA 3NSZA 2PVNA 5J87A 5F95A 2W5AA 3Q9ZA 3I0OA 3F3ZA 1BX6A 4IH8A 4AW0A 1QCFA 3G33A 3MS9A 4O38A 4WNOA 3MWUA 3DKGA 4RC4A 4FSTA 3RVGA 4RIWB 3EQBA 5JFXA 1H1WA 5AIKA 3PJ3A 4F4PA 3O17A 3SW7A 5BPYA 5E1EA 4NZWB 3MH3A 5E92A 4BBFA 4ZTNA 4HCUA 2HCKA 4IX6A 4YO4A 4BICA 4YJSA 4FTNA 5JFWA 3QKKA 4I6BA 4P5ZA 3Q2JA 1DV1A 2OZAA 2F7ZE 3G51A 1J3HA 2UW8A 3I79A 3ZFYA 5IA0A 3GCSA 5DNRA 3PWYA 4J8MA 2UW5A 5LARA 4BHNA 4QMLA 2NRUA 2EXMA 4KINA 3DJ5A 4MX9A 3VWAA 3ZXTA 4GSBA 4F1MA 5CEKA 1UKIA 1OECA 2HYYA 4GT3A 3HMPA 2XK8A 2UVYA 5AUYA 2UW6A 1Y91A 4IANA 5CZHA 3BLRA 5KZIA 3HUBA 3ZLXA 4RX8A 1IASA 5JQGF 1W0XC 3LCKA 3VW8A 5KMKA 4EC8A 1S9JA 2YS6A 4L3JA 5C1PA 2OWBA 2H96A 4JR7A 4ACCA 4EHVA 3NVKI 3L8PA 1DAWA 3CC6A 4WA9A 3L9MA 4EUUA 4OTIA 1H08A 5C27A 4FEUA 3V5QA 5FTOA 5IA3A 4HGEA 4MBIA 4FGRA 3RWPA 3CD3A 5LWNA 4CFUA 4B99A 3H10A 3N8DA 3B2WA 4O22A 3ZFMA 4HCTA 5EM5A 3QUDA 4QYFA 2Z8CA 2PMLX 4YLLA 3IG7A 4QMMA 2BR1A 1YI6A 3MY1A 3BHHA 2G2IA 1PMUA 2R64A 3QZFA 5ETIA 4NM7A 2GQSA 3CP9A 3DLSA 4OUCA 4FKWA 3Q1KA 3QUEA 4F7JA 5DEWA 2CLXA 5EW3A 3COMA 5E1SA 3HO8A 2C47A 3FUPA 4YTIA 2PVFA 5CNOA 4F1OA 5K9IA 3U9TA 3JZFA 3EB0A 2QOBA 1IA9A 1WVXA 5C01A 3D0EA 5M4CA 3CTJA 4DG3E 4HVGA 4CLJA 2WEVA 3SE7A 4LOPA 4O7VA 4OW8A 4A9UA 1OKWA 3ZSGA 1PX2A 3U6JA 3IECA 4H3PA 2UW4A 2J5EA 3G8DA 3NNXA 1PMNA 2Z7SA 2FA2A 2R85A 4MA0A 4O7NA 3DKOA 3GOKA 3AQVA 5FG8A 5H3QA 3E3PA 4FTIA 5EYDA 3DCVA 1WR2A 5F20A 3DLZA 1DAYA 3JS2A 5HEZA 4ZSLA 5HX8A 3ORPA 2VTOA 4XV9A 2GS6A 5EH0A 3HRFA 2V5QA 3PIYA 3PZEA 4UN0C 4ZLOA 2GPSA 5DPVA 3Q4UA 5EHYA 3A4PA 3D5XA 3LMHA 1ZARA 2WMUA 4KSPA 1TQIA 4FNZA 3NYXA 3QTQA 5HI2A 2VTRA 5EDRA 5M57A 1I09A 3KMUA 5DYJA 2VUWA 4J98A 2R3OA 1U5RA 1K3AA 2XNPA 3QLGA 3FLYA 4M12A 4BDFA 4YB8B 1EYZA 2NPQA 3DNDA 3HLLA 4WRGA 4U3YA 5HLNA 3W2PA 4BHZA 2UZBA 3II5A 3EQCA 4FIEA 4GW8A 4XRLA 2HELA 5BVNA 3REPA 4XYMB 4TY1A 1EH4A 2VTIA 2XKDA 3L8SA 3UP2A 5AFVA 1ERKA 3QRKA 1E1XA 2Y8OA 1V0PA 2YCRA 3QYWA 4O27B 2IZTA 5IDPA 2XIZA 5AM7A 4EWQA 5J9YA 5HBRB 4FZ6A 3I5ZA 1FOTA 2WELA 5KX5F 3NDMA 4RLLA 3IO7A 4YJOA 4BTKA 3DDPA 4C4EA 2C1BA 5IMEA 4H58A 4DEEA 4IAZA 5FTQA 3HB9A 4FX3A 3RGFA 2PYWA 4OTWA 2YM7A 2YRXA 5LMBA 1LEWA 3QL8A 4O83A 4FZAB 4UALA 4IW0A 4RIWA 4X6RA 1RJBA 5J95A 2X9FA 2JLDA 3VJOA 4C0TA 1UWJA 4PP7A 3MV5A 3O50A 3QKMA 3ZEPA 3OS3A 1YQJA 3FLSA 4MWHA 4XHKB 2PZYA 2WQMA 4FYOA 4EI4A 4F64A 5AUTA 3GC0A 4Z3VA 3E3BX 4S2ZA 3C1XA 4PV0A 4O0VA 4A06A 5EG3A 4P4CA 4HNIA 3ZFXA 3QRIA 4CGAA 3I5NA 4ZTLA 2AC5A 1UNHA 3ORRA 2V0DA 4GEOA 2HENA 4G9CA 4YPSA 3LP8A 4TYIA 5LXTF 4YBZB 3CS9A 2BTSA 5IZFA 3FMKA 3EQIA 3NEWA 2IW8A 3V04A 3Q32A 4FG7A 3FMJA 1UU8A 3FZPA 4JRVA 2BFYA 4QYEA 2QQ7A 4JG8A 3FKOA 2E9UA 1KE7A 4O7ZA 3CGFA 4ACGA 5IQGA 1CE8A 3GIDA 4ZOLF 3EL8A 2WU7A 2YDIA 4RBLA 5EOBA 3DOGA 4Y83A 5HE3A 1BI8A 4IWDA 1KSWA 3T3UA 5KKRC 1W93A 3P78A 2R84A 1YXVA 5H9BA 3MWEA 2BZKB 5AP1A 1U5QA 3DNEA 3PWDA 3OFMA 4IVCA 3G5DA 5EOLA 3KMWA 2UW7A 1A06A 2WTCA 4FUYA 3AC5A 3ZRLA 5AAGA 2VTTA 4FIFA 5IA4A 4QPSA 1RW8A 4KRDA 4K33A 3HV5A 3RALA 4CQEA 5EQYA 5IQBA 1Z5MA 3EWHA 4I6QA 3TZ9A 3ZO3A 5E8YA 2XNOA 2X0SA 4EH8A 2IWIA 4JQ8A 4ZHQF 5LXMA 1Y57A 2QOFA 2R3KA 4JG7A 2XM8A 4UZHA 3C0HA 2FGIA 3W10A 5A6NA 2F7EE 4XEYA 4E5WA 4ERKA 5KMLA 5C8MA 4E6CA 4F0GA 2ZDTA 2G9XA 4ZTMA 3PY1A 4FKRA 2GQRA 5L2IA 3E5NA 3W33A 2BKKA 5K5NA 4DEBA 3R5XA 4O4IF 3F69A 2CKQA 3ATTA 3OROA 4FZ7A 4GK3A 5AUZA 4AN2A 3NUAA 3T9TA 3PFQA 5AA9A 4CD0A 2IPXA 3W2CA 4CZTA 4O4LF 3O71A 4YZCA 4TNBA 4ZTHA 2I80A 3PP1A 2YZLA 4MNFA 3NYVA 4EH7A 4EH9A 1DS5A 5GJFA 5L8JA 3FL5A 2I1MA 3SV0A 1MQBA 3QQUA 1C30A 4ZQIA 4FSYA 2BUJA 2R7BA 1OL6A 5GNKA 3G15A 4PTGA 4EOPA 3Q5IA 4GT4A 4IIRA 2W96B 4K6ZA 1PKDA 3QWKA 1Q3WA 3DU8A 1FVVA 2KTYA 3EYHA 5EYKA 1YXSA 3RP9A 2WIPA 4EK4A 1RQQA 2X4FA 2G2HA 2HZIA 2OIBA 3OBJA 3HV4A 5AX3A 4EBVA 3ZS5A 3WF5A 1KJIA 4B9DA 4EK5A 3NMUF 3VMMA 4UEUA 3FEGA 4DEAA 2O0UA 2VWBA 3VUDA 2ESMA 4Z16A 3BLHA 3BPRA 3CR0A 2ZOQA 3EHAA 4E4NA 2R3LA 5B7VA 3KKVA 2CCIA 3IQ7A 5BUIA 4EH3A 3DV3A 1T36A 4E6DA 1CQIB 2A2AA 3UTOA 4OT6A 3ZTXA 4QO9A 1XO2B 4G5PA 5C26A 3BU5A 4IHJF 3NAYA 3TXOA 3PRIA 4Q9SA 5LMAA 2OF4A 4AGWA 1W84A 2CNQA 5AV1A 3OG7A 4F6UA 3DFCB 1KE5A 3HUCA 2J2IB 5FBNC 4PRJA 3MVJA 3ROYA 5BVWA 4QP7A 4C37A 5CU4A 4QPAA 1OGUA 2Z02A 4DGGA 3QUPA 5IU2A 2QKRA 4MV3A 2WTWA 4DGLC 1YDRE 3ELJA 5A54A 4Q5HA 4C3RA 4QP6A 3KREA 5DGZA 4GL9A 4MK0A 2W9ZB 4CKRA 2RKUA 2C0TA 4UWYA 2VGPA 4DITA 2B54A 5HIBA 2Z7LA 3H30A 3LCOA 1H00A 4B8LA 4CFXA 3AMYA 4D28A 4DGMA 3UOHA 1Q8WA 1GZKA 5T6KA 4FGBA 2QOLA 2RL5A 4W4VA 3T8OA 1M7NA 4G3FA 4HYIA 3E87A 4CMUA 4JG6A 1S9IA 4QMSA 2PVMA 4Z55A 1MQ4A 4MXZA 3SXRA 2YEXA 4F9YA 3K5UA 1H27A 1APME 3FI8A 3QKLA 5AM6A 3IGGA 3S1HA 4MD7E 4ZEGA 2PE1A 3FZRA 4JAJA 3IOPA 4FT3A 3TNPC 3ORQA 2Q0BA 2RFDA 2YIXA 2W06A 4I6HA 4GFOA 3ZUVA 3PPZA 3KAJA 3SG9A 1FGIA 2GU8A 3PG3A 4XX9A 4YGAA 5ANIA 5J9LA 5IUHA 2YCQA 2QOCA 4BTMA 5IUIA 2QOIA 4EH2A 1M2QA 2ITXA 5CQUA 5KBQA 2Z04A 4JNWA 3V8WA 3P08A 2EWAA 4D5HA 1BKXA 3VOTA 3D2IA 2PVJA 1YXTA 3MPAA 3QQLA 3FI4A 4AU8A 3Q9XA 1AQ1A 1YKRA 3KA0A 5D1JA 5A46A 1OKYA 2ZMDA 3PSCA 4U7ZA 5JFSA 2YYAA 3ORKA 2VWXA 4FV5A 2AYPA 4CKIA 2JBPA 4FTLA 2ZDGA 4I5HA 2PL0A 3PLAE 4O7TA 2IVSA 4LGHA 4ALUA 5KX8A 3AT4A 2W1ZA 3E62A 3GBZA 3TWJA 2LGCA 5DR6A 5D8DA 3NWWA 3GQLA 2Q0NA 4BDHA 5TT7A 3MVHA 3R28A 5AX9A 1KJ9A 2FSOX 3NCZA 4YJUA 1JKLA 1JWHA 2GNFA 3Q4CA 3H4JA 5CLPA 4H36A 4NYEA 4NCTC 1W7HA 5DE2A 2ZB1A 4XP2A 4E93A 4LOQA 2C30A 4XMOA 2JKQA 2W17A 5IG1A 2IZSA 3OUKA 1L3RE 3QD0A 1CMKE 4BGQA 1VEBA 4QTBA 2WB8A 2R7NA 4FL2A 3IW6A 3ZHPC 3TNIA 2GCDA 4IB0A 2J9MA 4NW5A 4E26A 1J7IA 3M2WA 1WBPA 4TWNA 3OF0A 3PDTA 3ZEWA 4DFBA 3E93A 1KV2A 4OTGA 5M4UA 5TKDA 3C51A 1UU3A 2JDOA 2NRYA 1BYGA 2OIQA 2XIRA 4RVKA 4G6NA 4JDHA 3TTIA 4YTFA 5JKGA 1BXRA 3LQ5A 4BCOA 3LMIA 4ANQA 3UZTA 2I6LA 3CY3A 4Y72A 4DEGA 2XJ0A 2ZDQA 3DXNA 3OD6X 1XBCA 5AP4A 1QPJA 4U6RA 4IZ5A 3RM7A 4BZDA 5LWMA 2XS0A 2WQEA 4KB8A 2ITPA 3EYGA 5LA6F 2W6MA 3QX2A 2WD1A 3DB6A 1STCE 3R01A 4YZ9A 4JR3A 5H8GA 2Q83A 4BZNA 4GMYA 5IYZF 5EW9A 4FKVA 2REIA 4M7IA 4O2PA 3NPCA 4FVPA 4MKCA 3KALA 2UZEA 2VV9A 3M11A 4A4XA 3R30A 4DFXE 4ZY5A 4H1MA 1PXNA 2OH4A 2YDJA 5JGBA 4FTAA 2DWBA 4RJ4A 4YZMA 3FSFA 3VUKA 3QA0A 4F6WA 5A4QA 4ITJA 5CEOA 2BPMA 1GJOA 4H39A 3C0GA 2F4JA 3LOKA 1H4LA 4LRKA 1FVTA 3VS4A 4ZS4A 3RAHA 3ZM9A 1A9XA 4GV1A 4BGHA 3DTWA 2BRNA 4YZDA 1JLLB 3GQIA 1KE9A 3DBEA 1OL1A 5EW8A 1YI3A 3C50A 5HESA 2BCJA 1ZYSA 3VHEA 4DLJA 3FLZA 3DDQA 3PVBA 4ZLZA 5JQWA 4DF3A 1KE6A 3D5WA 4B8MA 4RIOA 4WO5A 5JZJA 5HLPA 1MUOA 3SD0A 2FH9A 5CA1F 3FZSA 4AG8A 5M08A 4EOMA 1YWNA 4IJPA 2XKCA 4CRSA 3ORZA 4MHAA 3Q6WA 4IAAA 4PF4A 4YJRA 4FTKA 5IEVA 4KBKA 4WBBB 3GLKA 4U80A 3D7TB 4C3PA 4EEVA 3MSSA 3BELA 3O2MA 4RA5A 1H0VA 4GH2A 3DS6A 2PHKA 1OBGA 3H9OA 1XH5A 4FNYA 5JMSA 3BYUA 3MESA 3BX5A 3QYZA 5L2TA 3ZBXA 1O6LA 3GCUA 5GIPE 4D2RA 1VZOA 4V05A 5DG5A 4LMUA 4ZTRA 4BVUA 4IWQA 4EONA 4FIIA 4X0MA 3CSVA 1H1SA 1GIIA 2C5VA 3QC4A 4KKGA 2ZV7A 3H9FA 2H9VA 2YABA 2PU8A 4DCAA 3WZUA 3V4ZA 4NK9A 2YM4A 4EG0A 4G3EA 5C8YF 3BE9A 3F3WA 5FEDA 5AUXA 2PMOX 5EM8A 2PY3A 1A9UA 3V51A 4WG3A 5BNJA 5HE0A 4W4YA 4DC2A 2IW6A 2XBJA 4JAIA 3PJ2A 4IDTA 4DG0E 3KRLA 2WMRA 2PZPA 4P7EA 4QMTA 4YUQA 4BGGA 3N4UA 2ONLA 2ZYBA 3I60A 3VS5A 4C3FA 2ONLC 4O7WA 3G6GA 5KO1A 2V59A 4X3FB 3V6RA 5EI2A 4FIJA 4R3CA 3MWDA 5HO8A 3W2QA 3UFXB 5AUWA 4JS8A 3KL8A 4YJQA 4M3QA 4U45A 3UIXA 1TQMA 2B9FA 3R1YA 2OFUA 4IAIA 1P14A 4O4JF 3VS3A 3ANRA 4AE9A 3LIJA 4KWPA 3WZJA 3LKMA 4R3RA 1JDEA 2GHMA 3PY3A 4QMUA 3CTHA 4FKUA 4WNKA 4V0GB 4MA5A 3VS2A 2SCUB 3R00A 5BUEA 3KEXA 4J71A 5F1ZA 1R0EA 3OC1A 5LMKA 3P86A 3ID6C 4U40A 2WMWA 2X8EA 3HL7A 4BDKA 2HOGA 4FTUA 1OB3A 4EGJA 4RZVA 1KOBA 3RHKA 2GNIA 4UY9A 4AOTA 3FXWA 3FMMA 2I0VA 3R1QA 3L8XA 5C8NA 5LJJA 2J90A 5DA3A 2NU6B 3TN8A 3FL4A 4MBLA 4RVLA 4BDCA 4PNKA 5HORA 3EQPA 3RAWA 2VR1A 3K3PA 2GPWA 3ZO4A 2GQGA 3PZHA 1Z57A 2QLUA 2UZWE 1JSVA 4IB1A 4CCUA 2XNMA 2NO3A 4KD1A 5CEMA 5CSWA 4GU9A 3TL8A 4ITHA 2Y7JA 3NNWA 1XH6A 3R71A 4FTQA 4H1JA 1CQJB 2R7MA 4EUTA 4MXCA 3NR9A 4IAYA 1FMOE 3TACA 4QT1A 5ANOA 3OOGA 4J8NA 3A4OX 2CDZA 4JDIA 4NFMA 3UIMA 3R02A 3RTPA 3QXOA 3MIAA 4BF2A 1WBTA 2BAKA 2HW7A 2C6EA 3R9RA 3KXXA 4RX5A 2PVPA 3R8MA 2Z2WA 3DBDA 3E92A 4C36A 5HG5A 4X2JA 4XP3A 3QRJA 3U9SA 5AA8A 4EKKA 2X1NA 3P0MA 4FR4A 4G3DA 4S30A 5GIOE 4J53A 2QVSE 3D5VA 1ZZLA 3WF7A 4I4FA 3E8DA 5AIRA 3QX4A 5BMSA 1Q5KA 4G5JA 2X39A 4ZAUA 3S4QA 5DLSA 5HIEA 3UPZA 3V6SA 1PXIA 3KXMA 2YM5A 2WKMA 2JDTA 4M15A 4XYFA 3VO3A 1Q97A 3MA3A 2C1AA 2P2IA 3F5UA 4AOIA 4ANBA 2W6NA 2XJ1A 4QP1A 4R6VA 5CQWA 3FKLA 2UV2A 4Z7GA 4D4VA 3D15A 4F08A 2VGOA 1YI4A 2Y4PA 3ALNA 4I5MA 4RX9A 5HIDA 3PVGA 2AUHA 3QALE 3ZDIA 4YJ2F 2GSFA 1IA8A 4FTRA 3C7QA 1O9UA 4BCFA 5ITAA 3CEKA 1GOLA 1O6KA 1NW1A 3FLWA 1FGKA 2W1GA 3PPKA 4ANLA 5G1XA 3D7TA 2XNGA 4RJ8A 2FPGB 3ZUTA 1NA7A 5CEQA 2C00A 3H9RA 2I87A 3A7HA 4FSRA 4S34A 2W6PA 3U6IA 4WUNA 3GEQA 2XF0A 3OWPA 1OPLA 1IOWA 3PLSA 4XV2A 4NWMA 1JPAA 3SXSA 3FPQA 1Q99A 4IB3A 1LEZA 3DJ6A 4D1ZA 3ROCA 4NKAA 2ZM1A 3OBGA 5AP5A 4CFMA 4F6SA 3MYGA 4QMNA 1NY3A 3EKNA 4NT4A 3U51A 2XYNA 4KAOA 3BU3A 5FEEA 5HG7A 2W4KA 3VPCA 4D9UA 3ET7A 4F99A 5C4KA 5A4TA 4Z9LA 4NH1A 2A4LA 3NIEA 5CF8A 4IACA 4LOOA 2OLCA 1Y8YA 3BGQA 4FFLA 4RC3A 4AGDA 4KBAA 2WO6A 3JYAA 3V5PA 3IDCA 4CRLA 1J91A 2BDWA 2JAVA 2JIUA 4XOZA 3BU6A 3DKCA 3MB6A 5ETAA 3ANQA 3OTVA 2KULA 4BDBA 2XIXA 2CLQA 2DZDA 4X3FC 5BVKA 5IH5A 3BHTA 4ACHA 3KMMA 4O7LA 2Y6OA 1Z9XA 2R7LA 1IAHA 1OIUA 2WQNA 2YZAA 4FSNA 3VNTA 2VTQA 3BLQA 3FMLA 3QQKA 2PVLA 3BIZA 2X4ZA 3LCDA 2OJ9A 3LM5A 2WTKC 2DYLA 4V0GA 3IW8A 4FSMA 5CZIA 4EOQA 5IA1A 4R1VA 3UOLA 3MH1A 3MFUA 4GJ2A 2JEDA 3I6UA 4QP2A 5DRBA 4BDGA 1AUVA 1PKGA 3DXQA 3LLTA 4L44A 2C6IA 3OUZA 1P4FA 2R3IA 4FNXA 4GT5A 2EB2A 2F2CB 2ITOA 2XIYA 3QFVA 3S95A 5CAPA 4RZQA 4I5PA 1LR4A 4BDIA 1M6VA 3LWBA 4O6LA 4F63A 4HPUE 1T45A 1B38A 2W1EA 3JVRA 3R63A 2WHBA 5BMMA 2QK4A 2VQDA 3KN5A 4IAKA 5DHJA 3PJ1A 1EZ1A 4IX4A 4I4EA 4KKHA 4EOSA 5JQ8A 1BMKA 3OCGA 2GTNA 1MRVA 3KXZA 3JRXA 4HNFA 2QC6A 3EIDA 3OXIA 4ZJIA 3OOMA 2PZIA 4GJ3A 4BBMA 2VTJA 4FFNA 3HDMA 3SW4A 1Q62A 3UC4A 1IAJA 1V0OA 4HVDA 2R82A 3ORXA 4M67A 4HVHA 4LRMA 3EH9A 4WUAA 3Q4ZA 4CNHA 5A4LA 2C5OA 4K2RA 4WNMA 3MGYA 1M14A 4TYJA 4KIOA 3RAKA 4L01A 2UW0A 1XWSA 2GS2A 4C5AA 4FKSA 3ZDUA 3DXPA 1YXXA 3H0YA 1URWA 4FG8A 3KQ7A 4E7WA 4AS0A 3U54A 2IJMA 1ZZ2A 3LQ8A 4ZLYA 3FQHA 5EYCA 5M55A 5LQFA 2QD9A 2HW6A 5AV2A 4ASEA 3RJCA 2W1IA 3BWFA 2JFLA 3MJ1A 3G6HA 3MPMA 3A8WA 4I3ZA 4C59A 3I12A 4EGQA 1KC7A 3TTJA 3EOCA 3G90X 2VNYA 4QYHA 5CSXA 4AE6A 2QCSA 1BLXA 3U9CA 4J52A 5FGKA 2X8DA 2Y4IB 3D14A 4W8EA 1VYWA 1VJYA 2BZHB 3EL7A 3IW7A 4KABA 5E91A 5D11A 2YRWA 3QHWA 4LUEA 3OWJA 3CPCA 4F9BA 3G2FA 4PTCA 2G2FA 4G6LA 5DT0A 2J0MB 3NW7A 2VN9A 3DAJA 4EHZA 5JFVA 3V4SA 1OM1A 2RFEA 4ASZA 3VS0A 1I7NA 2WAJA 5F4NA 4YNOA 5HU3A 4USFA 1GY3A 2VO7A 2C6MA 1BI7A 3MA6A 5D10A 3Q9WA 4E4TA 2OO8X 1JAMA 3QBNA 3PJ8A 4N6ZA 3OP5A 2X0GA 4B0GA 4N57A 3FMHA 5C03A 2JDSA 1SYKA 4QQJA 1OKVA 4IM2A 3QTRA 2BAQA 5TOZA 2PZRA 5BX0A 2C3JA 4U42A 2R3QA 4I24A 1BL7A 4GVAA 3AD5A 3VBVA 5IH4A 4TTHB 3TIGA 4CFNA 3V3VA 2JITA 4RIYB 2CN5A 4O21A 2B9HA 1SMHA 4GFGA 4YHTA 1Z2OX 4RVTA 2W0JA 2BVAA 3B8QA 1IR3A 3K3IA 2Z60A 3NAXA 1WVYA 3OEZA 3PE1A 5HNIX 3DZOA 3LM0A 4MBJA 1G5SA 4D4YA 5B2KA 4XZ3B 5BMVF 2P33A 1F0QA 2VWIA 3RAIA 3TV6A 3AC2A 3BEAA 1YHWA 5EFQA 2VTHA 4W4WA 3KXGA 2HK5A 3CPBA 4YTHA 4A07A 2WYOA 4GUBA 4N6YA 3CJGA 1DI8A 2BDJA 2W5HA 5K4JA 3QCXA 2YAAA 2VTNA 3C4EA 3R6XA 1XH9A 5DEYA 5KMOA 4YPDA 3TNQB 5TO8A 3FI2A 3WIKA 5D41A 1WBOA 5FEQA 4AACA 3VBYA 3TQTA 5AUUA 3MPTA 4ZZNA 1QPEA 1JNKA 3H0ZA 4BDAA 3QXPA 1YVJA 3VBTA 1Q8UA 3VQHA 5CF4A 3RCJA 4IVDA 4F7NA 1OVEA 4R78A 3OCTA 4P2KA 3ETJA 3POOA 3Q04A 3U55A 4MH7A 2HXQA 2UZNA 2XMYA 3OEFX 4O84A 4PDYA 3NYOA 4YHJA 4X2FA 1CDKA 3NVMB 3PA5A 4FSWA 3SX9A 4OGRA 3SOAA 3KFAA 5AADA 4DINA 4GRBA 5KHWA 1YDTE 3UVPA 5CAOA 2PE0A 5FXSA 2OGVA 2YN8A 3KF7A 4CVAA 2WMTA 2EB3A 4CV8A 3LFCA 2WTVA 4ME6A 4EK8A 4QP3A 4HOKA 3LAUA 2GHGA 5ANDA 2DIKA 3SC1A 2YS7A 5HICA 1DI9A 1OPKA 4MCVA 5CSPA 4C7TA 3S0OA 1HCLA 4Y95A 3FKNA 3R9DA 4C62A 2E9OA 1JBPE 1UKHA 2PUPA 4L8MA 3QQHA 4BCJA 4FTOA 2IW9A 4UBAA 4DEIA 3VIDA 5I0BA 2F9GA 2PE2A 3TNHA 5FDPA 1PHKA 1FMKA 1GIJA 4QYYA 3ORLA 2VO3A 4MQ2A 3A99A 4PL3A 4FV7A 4IZYA 4DH5A 2NNWB 2P0AA 4I22A 2WNTA 4RWLA 3O7LB 4AZSA 4FEQA 3HECA 3QZIA 3W2OA 1QMZA 3R8VA 4ENXA 4IZ7A 3B8RA 4O0YA 1CM8A 3MH2A 4G1WA 4XG8A 3U9NA 5JH6A 2R3GA 4HYHA 4ALVA 1YOLA 3GU4A 5CVHA 4C4JA 3C4CA 3RK9A 3R9HA 2YIWA 5HVKA 3BI6A 2FSMX 4OLIA 4C5BA 4U0IA 2XRUA 3R21A 3TKUA 2F49A 1R0PA 5E8SA 2W6OA 2BIKB 5E8ZA 2CGWA 3NUPA 2R5TA 4Y46A 3EKKA 1WAKA 3NUXA 3BHYA 1FQ1B 3ORIA 4TWCA 1XQZA 1FPUA 4IHPA 3M42A 4DEDA 1B39A 3GC7A 3NNVA 1R1WA 3F5PA 5AAFA 4YLJA 2R3MA 1M17A 2YWVA 4FVQA 5CTPA 3UIBA 3FY0A 3MTFA 4AT3A 1OKZA 3LFNA 4EQCA 1PF8A 2UW3A 2ITYA 2XNNA 3BE2A 4D1SA 3WIGA 5HE1A 2VTSA 4Y5QA 5L6WL 5F94A 5C8KA 2B0QA 5KCVA 5FUTA 3OMVA 5CF5A 4N0SA 1CKPA 4R77A 5B0XA 4DAWA 4MV8A 5ETFA 4AT5A 4YZBA 1J7UA 3HP2A 4GKIA 4G16A 4EH4A 2WMAA 4HNTA 4O96A 4RFYA 3V5LA 1MRYA 5IA2A 4RIYA 4BCPA 2B7AA 2NU7B 3RPOA 2V55A 2BAJA 3HZTA 2YCSA 3EN9A 3SLSA 2BIYA 3PVWA 4I0TA 4FT9A 2YW2A 2GDOA 4MV1A 1FBNA 2ZVAA 4M97A 1TVOA 4GU6A 4QMQA 2OH0E 2JIVA 5HD7A 2R87A 2XK4A 4Y8VB 2HXLA 5G6VA 5IUGA 1VKZA 4M14A 4DCEA 5IQHA 1O6YA 1OITA 3CLYA 3SVVA 4LM5A 5CY3A 5I9XA 1Y6BA 3IW5A 3JZIA 4HGTA 4RWIA 5DR2A 5HG8A 3BRBA 4XOYA 4FSQA 4KIQA 4M0ZA 4O81A 1RE8A 4WNPA 5HCYA 3SDJA 3RK5A 1IOVA 3BQCA 4RSSA 1Q4LA 2ERKA 3UO5A 3C5UA 2HWOA 4JBPA 3SA0A 5KE0A 2BRGA 1H26A 3VAPA 2Z7RA 3CXWA 1GAGA 2C5XA 4ZSJA 1H25A 5HGIA 3RMFA 3PUPA 4HYSA 4K11A 1GLVA 4AWIA 2OFVA 2XBAA 5HQ0A 3H3CA 3IW4A 5A6OA 5ACBC 5J1WA 1V1KA 2OSCA 4O6EA 2WMBA 2CKEA 3UNJA 5I9YA 5C1OA 4AFEA 2GS7A 3ZYAA 4BRXA 3R04A 1FVRA 3PP0A 3F2AA 5IH6A 3TT0A 3UDBA 3AXWA 4E5BA 5DR9A 5E8XA 2YDKA 4JRNA 2OBJA 3OW4A 3C5IA 3AX6A 4IB5A 4YAJB 3NZ0A 5A4CA 2Y0AA 4XG7A 4J96A 5CB4F 3ZO2A 4GK4A 3G0FA 4YURA 3CIKA 1CKJA 3B2TA 4K77A 3FC1X 4IIJF 4QNAA 1YRPA 3UGCA 3UP7A 2H6DA 3EQGA 3TNWA 2WGJA 1OI9A 1Q3DA 5LCJA 4ORKA 2FB8A 4UWBA 2B55A 2VU3A 5AP7A 5L6OA 4IFGA 3UYSA 5FM2A 4RG0A 4XG4A 3PA4A 5EQEA 1PRYA 2I0HA 3V5JA 4YMJA 1EHIA 4ZY4A 5AAEA 2W6ZA 2YZGA 4BYJA 3AC3A 4O91A 4L6QA 4FE2A 3R7YA 4MAOA 5BYLA 1YOJA 4F7SA 4RVMA 3A7GA 1Q8ZA 2A1AB 5BUJA 4BBEA 2C3KA 5JVDF 3FZ1A 4FKTA 4EL9A 2DUVA 5E90A 2R3PA 4QP9A 4DH1A 3F3VA 1P5EA 2PVRA 4TV9F 2JIIA 2H8HA 3G8CA 2XK3A 4HZSA 2C3LA 3FWQA 4RJ3A 3UQGA 2V58A 4FIGA 4XLIA 3DB8A 4FV0A 4HW7A 1T46A 2WQBA 3AGMA 4XLVA 2WTDA 2V7AA 3GFWA 4L1KA 1U4DA 4J95A 3CD8A 4YC8A 5K3YA 5JT2A 3WO1A 5CU2A 4LRJA 4UYAA 5CVFA 4YP8A 5M09A 4LV5A 4PMPA 3FV8A 3A2CA 3EQRA 4FOCA 4IQ6A 4DTBA 5CSVA 3VUHA 4FKLA 4HQ6A 4MV6A 3RZBA 3R8LA 4U8ZA 3HNGA 2BILB 4ZTSA 4CFWA 3S00A 4EOLA 3OVVA 4DBXA 2HY0A 2IG7A 4DFLA 3E7OA 4H05A 3W1FA 3LZBA 4BCHA 2IZUA 2OJFE 3FYKX 4DIMA 3N6RA 1AGWA 1NVSA 4IZOA 4FYNA 5I9VA 3ENMA 5I4NA 5CI6A 3D83A 3NUYA 5FNVF 2XA4A 3KVWA 4MYGA 3LFQA 2P2HA 3BEGA 3UYTA 4IEBA 2XNEA 3ZM4A 5CYIA 4BDJA 4PMTA 5JRSA 3SXFA 2YZMA 4MQ1A 4M13A 2QOOA 4R3PA 3GXLA 1GSAA 4IVBA 5IF1A 4F70A 3V8TA 4K9YA 1M2PA 4J7BA 1E1VA 1SCUB 3NLBA 4XG2A 4D9TA 2OF2A 4IAFA 1EUCB 2QF7A 5A4EA 2WTJA 3KF4A 1MP8A 4U41A 4YTCA 1Y8GA 3BZ3A 3GU6A 5IQFA 4Q2AA 4BCNA 2Y6MA 1ZMUA 3DJ7A 2X9EA 3L1SA 2SRCA 4GIIA 5L8KA 3HDNA 3MY0A 3NUSA 2W6QA 4FV4A 4MXXA 1EUDB 2PK9A 3TIYA 4MAMA 2CCHA 1VBHA 4NTSA 2VTMA 2XK6A 4PY1A 2P3GX 2IVVA 3IS5A 4X7QA 2X8IA 3WE4A 2R86A 4BDDA 1JVPP 4XRJA 4B6LA 5HBHA 2YIQA 3F3UA 3VF8A 5HKMA 3FMDA 4R7BA 1CKIA 4BI0A 4BIDA 2CGXA 3WOWA 5IDNA 3UVQA 3P9JA 4EHGA 3FDNA 5FLFA 3Q2MA 3HX4A 5FP5A 3VF9A 4QMPA 4FTJA 4IVAA 5AV4A 4GIHA 3WI6A 1UU7A 2UZDA 5J7HA 3F3TA 4UWCA 1DV2A 3TZ7A 4DTAA 2W9FB 4FG9A 5I5ZA 2J0IA 4FV2A 1OIRA 4E1ZA 3VBXA 4ACDA 4O4HF 3PXFA 3C0IA 4TN6A 3SAYA 1ZOEA 3F7WA 3OY3A 2RGPA 3FBVA 5LVNA 3AW8A 3ORNA 2B52A 2XCLA 3UNKA 5I9UA 4PP9A 4AP7A 5CU0A 5JGAA 3LFSA 4M0YA 3QCSA 3JVSA 3R7VA 5E8WA 3VS1A 4AW2A 4GG7A 2QHNA 2QR7A 4C58A 3RPSA 5IMXA 4K8AA 3QCYA 3DK6A 4I0SA 3R8PA 3SG8A 3ZC6A 2QU5A 4JXFA 4EBWA 2J9GA 5HV6A 4RC2A 4DFNA 3EQHA 2CGVA 3HRBA 3Q4TA 4KUJA 5HNBA 4WD5A 4QP8A 4YBJA 4LL0A 2FSTX 4OTFA 3FC2A 4EOJA 4C61A 5E4HA 5M4FA 1UV5A 4S32A 2WMVA 3NGAA 4JQ7A 4USDA 3ITZA 2DWCA 5GONF 3C4FA 4FFOA 4MV9A 3O8PA 3R7EA 3WF8A 1H1RA 4MVFA 3IGOA 1YHSA 2OIDA 4MXOA 4G3GA 5LMKC 2F57A 1KBLA 2PUUA 2FPPB 2J5FA 4TWPA 1KJJA 2F7XE 4FKPA 2YHVA 4ONAA 4I93A 2O65A 4OTHA 5JEBA 4KSQA 1GSOA 3N9XA 3E64A 3ERKA 4L3LA 2R7IA 4OTQA 3HAVA 3QD2B 1PMEA 3AC1A 4KKEA 4XJ0A 4DH3A 4QTDA 3O23A 2X7GA 1UA2A 4F9CA 3EJ1A 1W83A 4DLKA 4GVJA 4CG8A 5D7AA 4CSVA 1H01A 2C0IA 3FZTA 1M7QA 3GVUA 4WKQA 5AP2A 1Y6AA 2OK1A 3C4XA 2YIRA 1OL5A 2GFCA 1OL2A 2VWVA 5EI6A 4CEGA 3UPXA 3D94A 2C6TA 3ZO1A 4LG4A 4V01A 3QQJA 2QKWB 2VWUA 3LXPA 4F9AA 1KJQA 5C9CA 3W8QA 3FMNA 3LJ1A 3MB7A 2W4OA 2WEIA 2ZDUA 4EC9A 3KCFA 1YWVA 2JDVA 2CMWA 4D4SA 2XKEA 3NNUA 2W71A 2CJMA 3K5IA 3JPVA 4WT6A 4W4XA 4II5A 4EQUA 2W1CA 4C4FA 2OKRA 3UJGA 3U87A 1OIYA 3C13A 2VX0A 4BKJA 3D4QA 3HAMA 3KVXA 3MJFA 3R1SA 5JZNA 3W2SA 4D55A 2BFXA 1WFCA 3W2RA 4G9RA 2W70A 1NXKA 4AZFA 4QMWA 3F2NA 2JKMA 2EXCX 3ZRKA 4CMTA 3OXZA 4M9UA 4AUAA 3AOXA 2XEZA 5KBRA 1PMVA 3PY0A 3EFLA 3FAAA 4TXCA 3DTCA 4JX7A 5HE2A 4IFCA 4AA5A 4UB7A 3AD4A 1OIQA 3AC4A 4CCBA 2FP4B 4L52A 3MIYA 3GCVA 4EZ3A 1XH8A 4FA2A 5A9UA 5DN3A 3ULZA 1OZ1A 3P23A 3TDVA 5CALA 2WTIA 4C5CA 3HRCA 3A7JA 3E88A 4AFJA 4HVSA 1ZYDA 4BN1A 5LVOA 5BPHA 3L9PA 4EK3A 4YAKB 2R3JA 2UZVA 3GU7A 4PUZA 4ZOGA 5HVYA 2E9PA 4QOXA 2QG7A 2FVDA 4YSJA 5HU9A 4S33A 1RDQE 4HVIA 4XP0A 1ZY4A 2G15A 5FTGA 4KIPA 4FKOA 3DQXA 1REKA 2B9JA 4PWNA 4LYNA 4JDKA 2GNJA 3QZGA 4YNEA 3AT3A 4EQMA 4EYMA 4AAAA 3QQFA 4C02A 4EJNA 4Q9ZA 2ETKA 1XBBA 4L7FA 3LFFA 3Q53A 2X6EA 3FHRA 3FXXA 4A9RA 3TINA 4FNWA 5FD2A 3EQFA 4MV7A 1GIHA 4U81A 4TW9A 1UNGA 1B6RA 3GOPA 5ANJA 5EDQA 3LE6A 3OCBA 3V01A 4D0XA 4PDSA 4FK6A 1H1PA 4FV6A 3NRMA 3U4WA 3RFCA 3NIZA 3VJNA 3ZONA 3MFSA 5AV3A 4L45A 2CKOA 5AMNA 1WBWA 1PXPA 1ZOGA 1UVRA 5BVOA 5FDXA 2P0CA 3VS6A 3OZ6A 3UO4A 1W98A 1ZMVA 4M68A 4FV8A 1GZNA 3HBLA 1R39A 2WXVA 4FKGA 2J0JA 3UNZA 3I1AA 4E5AX 3D7ZA 4FVRA 3VW6A 1PK8A 3UO6A 3AC8A 4NJDA 3RNIA 4CFFA 4EWHA 3BYVA 2RG6A 2FUMA 4BCKA 4EOIA 4OTRA 2JKOA 2YIYA 4EORA 3OXTA 5ANGA 3K5VA 2NU9B 1PYEA 4TPTA 1U59A 2WQOA 2JAMA 4DFYA 3F7ZA 2YERA 4O0XA 1QPCA 2X2MA 2DQ7X 3QTIA 4CT2A 3N51A 4DH8A 2V5AA 5JN2A 3HA8A 3OWLA 4AQCA 2PPQA 2WMSA 2BRBA 5LVLA 4H3BA 4XYLB 3TKIA 4IMYA 4DN5A 1BUHA 3S2PA 4E20A 2OLSA 4G2FA 4G6OA 4BCQA 5HX6A 1ATPE 4NM5A 3HMNA 5HO7A 2GLTA 5KKNB 5CASA 4QTCA 3FZOA 3KRRA 4TV8F 4DHFA 4NL0A 3QCQA 1WBNA 2A27A 4ZSAA 5J1VA 4YJPA 3VULA 4BI2A 3Q9YA 4NM3A 3A7IA 4OTDA 4OBQA 4IZAA 2BTRA 2VO6A 2YA9A 3NW6A 2R3RA 1SNUA 2CPKE 5GHVA 1XH7A 3TZMA 4K0YA 3VPBA 4FFMA 3PIZA 5C1QB 2YZNA 2LAVA 3R7OA 4EOOA 1ULZA 4OBOA 4C38A 4TKSA 2OXYA 3N4TA 3R1NA 5L2WA 3TIIA 5K4IA 4FC0A 4OBPA 3QTUA 2PUIA 3DA6A 3KC3A 4TL0A 3O8UA 3Q6UA 5E8UA 2YWPA 3KAKA 4CZUA 4GUEA 2CNUA 2XM9A 1M2RA 3I7BA 4XNEA 4YSMA 3AG9A 3TKHA 5CAVA 1YOMA 1PXKA 4XBRA 1VR2A 4YHFA 2Y9QA 4U9AA 4M84A 3MH0A 2GNGA 2J50A 3SKCA 3MFTA 4I92A 5M51A 3DBCA 1VYZA 4O7YA 5E9EA 3A8XA 3CKXA 3LXKA 4BTFA 4I5CA 5B2LA 4DBNA 4UX9A 2XZSA 2VRXA 2O3PA 3IK3A 1H28A 3TJDA 3PG1A 2RFNA 2C5NA 4LUDA 3O51A 1ZLTA 3BWJA 4FV9A 4MD9E 4O7RA 5GJDA 1XJDA 3R73A 3F6XA 3P7BA 2W1HA 3PTGA 4EZ5A 3EN7A 3TG1A 4RFZA 5LP6F 5KKRB 2PSQA 3ULIA 4DGOA 3PIXA 3EZRA 4LFIA 1ZYJA 5EKOA 3WYYA 2J0KA 2WFYA 3RPYA 2ITVA 3HMIA 3PRFA 5BYZA 3ZUUA 3GU5A 2GNLA 3KCKA 5EQPA 5J2UF 3QAME 4U97A 4E6QA 4J99A 2XB7A 2QG5A 3IKAA 5CXZA 4I21A 4X3JA 1XR1A 5DI1A 2B4SB 5CVGA 3TUBA 2O2UA 3DQWA 2P55A 3FI3A 4HPTE 1FINA 2A19B 2HWPA 4L9IA 3GC9A 2GFSA 1SVGA 3QTSA 2W99B 4YJVA 4E6AA 3WF9A 1UNLA 4MTAA 5EYMA 3UVRA 4QSHA 5EK7A 4BC6A 2ACXA 4CFVA 1XH4A 4ZS0A 3I4BA 2C5YA 3GGFA 4MNEB 4DFUA 2YJRA 4Y85A 3BKBA 1P4OA 4RT7A 4NTTA 1OPJA 5ETCA 5IQEA 2ZJWA 5HTBA 4FBXA 3ACKA 3TJCA 1REJA 4JIAA 4ARKA 3PXKA 5LVMA 1PYXA 1WZYA 3LFEA 2BZJA 4AX8A 4FIHA 4TRLA 4C34A 1Z2NX 3HP5A 3UG2A 4E8AA 2XJ2A 4QTAA 4UXLA 2OI4X 4ZI7F 2ERZE 4O2AF 1OMWA 3DKFA 3WNZA 3BHVA 4NUSA 2XK9A 3QU0A 4OT5A 3UIUA 4O0WA 3ZSIA 2IN6A 2VD5A 4F9WA 3TW6A 5M56A 2YCFA 4ANSA 4RQKA 2XKFA 3ZMMA 1LUFA 3GI3A 5BYYA 3K2LA 3ZLSA 2EUFB 3OTUA 4R5SA 3W18A 1AD5A 4CTCA 4KBCA 4D5KA 4FZDB 4MV4A 4QMXA 3ENHA 5LYJF 3QLFA 3ZH8A 3L9LA 2BRMA 4AGUA 3C4ZA 2G01A 4FTTA 3EN6A 1ZMWA 3SGCA 5J2TF 3LW0A 3ZCLA 2X2KA 4ZSEA 4TZRA 2X2LA 2XYUA 4AZTA 4XG9A 5L6PA 3BBTB 2OJGA 4QMVA 4C35A 3EFWA 4AT4A 5JRQA 3P4KA 3JRWA 2Z7QA 4JLCA 5M07A 4E4XA 2RIOA 4TYHB 3HV3A 5AWMA 2OG8A 3I7CA 5KHXA 1W82A 3TUCA 1JDBB 3I6WA 2B1PA 2ETRA 2YFXA 4O0RA 2V62A 4QMYA 3RUPA 4MEDA 3DK7A 4FT7A 2YITA 2HIWA 1JLUE 3BBWA 3DZQA 4GK2A 2E9VA 4HCVA 2C6KA 3KY2A 1SNXA 4KS8A 5CT7A 1YDSE 4U3ZA 1KUTA 2QNJA 4A9YA 2QO7A 3DGKA 3LXNA 2ITZA 4LI5A 3VHKA 3Q52A 4CXAA 4EKLA 4ERWA 4I55F 2BHEA 3UZRA 3K5HA 4XV3A 5EZYF 1JOWB 3KULB 3ZSHA 4RFMA 3OW3A 1IEPA 5HCXA 3ODYX 3ZC5A 4JL9A 2OXDA 2QI8A 3ZXZA 4WBNF 1H07A 4U43A 3VRYA 5I9WA 2XCKA 2FSLX 1P2AA 4DH7A 4DLIA 4IBMA 4J1RA 3LCSA 5E8VA 3LMGA 4ASXA 4YLKA 3HV7A 3LCTA 5ACKA 3GUBA 3NUUA 5DVRA 4IWPA 3COHA 3GFEA 4DTKA 3BG5A 4O0SA 3R0TA 4WG4A 4EZ7A 4MXYA 5FQDC 3HV6A 4E73A 2IP4A 4A9SA 3QTWA 4I50F 2ZB0A 3DF7A 3LJ0A 4L68A 1G8AA 3F66A 1OUKA 2C6OA 3LQ3A 4RJ6A 1H0WA 4FEVA 4JX3A 4PDOA 4RZWA 5DMXA 3LFAA 1A48A 2QU6A 3TZ8A 4C4IA 1WBVA 3DBFA 3GP0A 3O96A 3OT3A 5L8LA 4FU0A 4FT0A 4N4SA 4AW1A 4JT3A 5CS6A 2CGUA 2J0LA 3O7LD 4NM0A 4KRCA 5FXQA 2XP2A 2YM8A 1H1QA 1ZXEA 2Y4IC 3V5WA 3LJ2A 4JBQA 3GCPA 4G34A 4QTEA 4TNDA 3ETHA 3MW1A 5HVJA 3IDBA 2VNWA 4I20A 4RJ7A 3KGAA 4FSZA 5CT0A 2C6DA 5DT3A 5IISA 3TV7A 3ZLYA 5KMNA 1AUXA 3IONA 5DBXA 3UMXA 4X2KA 4Y8DA 5EM6A 4DT8A 3R23A 4EK6A 2O5KA 5CWZA 3S3IA 3OCSA 1K9AA 2BROA 2XCHA 1E9HA 4FEWA 4R1YA 3ZZEA 4MNEA 4TYGA 2QURA 4U44A 2C0OA 4JI9A 4PNIA 4L53A 4Q5EA 4XCUA 4ZK5A 2ZM4A 5CENA 4QMOA 4FI1A 3RCDA 4HNUA 1YWRA 4ZZMA 2PMIA 3RINA 2JGZA 3CQWA 2CKPA 3PXYA 3QHRA 1IRKA 4PX6A 5KUPA 4ID7A 2I0EA 2PULA 3POZA 2QLQA 5ANKA 4DFZE 2UW9A 4D58A 3CCNA 3AGLA 3V8SA 5BPFA 2ZV9A 3P79A 3A61A 2FYSA 5AUVA 3W16A 4D1XA 5KMIA 5L2SA 4E4MA 5CEPA 3AD6A 2ITUA 2PTKA 4M69B 4D4RA 3N4VA 5FBOA 5FP6A 3CGOA 3QRUA 5DOSA 3R9NA 3RKBA 4FK3A 4B4LA 4YJTA 3WYXA 4MF1A 2HGSA 4DA5A 4QNYA 4ALWA 3Q3BA 4LL5A 2PWLA 1OBDA 2X81A 3OT8A 3EFKA 2R9SA 2J6MA 3ODZX 1OUYA 3NYNA 4FV1A 3UOJA 2IVTA 4QQTA 3KB7A 1BNCA 3MVMA 4MWIA 3HVCA 4DGNA 4YJNA 4F0FA 3FHIA 1XBAA 3UBDA 4O86A 4QMZA 1PXLA 3HKOA 3JXWA 4L67A 3QC9A 1JSTA 1X8BA 5HNGA 4BDEA 4L00A 4AN3A 3PXZA 3D9VA 5HCZA 2YM3A 5FXRA 2H34A 1Q8TA 1J1CA 2XH5A 4F65A 3QTXA 4I1ZA 1JSUA 2OXXA 3R8UA 4XBUA 4IJ9A 3CJFA 2VTLA 4PMSA 2ETMA 4TYHA 4FEXA 5TR6A 4I0RA 1YXUA 1Q8YA 2PZ5A 2RG5A 3CTQA 2R3HA 3SRVB 1I7LA 3A7FA 4JOAA 4BZOA 2OICA 4YC6A 4A4OA 3PXQA 4FODA 3HGKA 2WMXA 4IC8A 3K54A 3KU2A 4FICA 3OWKA 2QO2A 1M0WA 2JKKA 4FKJA 5M44A 3RK7A 3RPVA 4L3PA 1Q24A 3KULA 4LV8A 1G3NA 3TI1A 4AOJA 4ZMEA 3DAEA 2J7TA 5E7RA 4QQ5A 4RGJA 2PUNA 3LHJA 5DH3A 1ZY5A 5E8TA 2ZM3A 1GNGA 4M8TA 5IEYA 1B6CB 4KNBA 2YL2A 3A60A 4LGGA 4G17A 4FTCA 5CAEB 3WZEA 3F5GA 5ICPA 2PVKA 3K3JA 4X21A 3W32A 4AA0A 1Q61A 3PYYA 3VN9A 2UUEA 2OJJA 4FT5A 1NVQA 4X6QC 1DIKA 2PBZA 4LQMA 3ZU7A 2UZTA 3R7IA 4K18A 2C3IB 1WVWA 2G1TA 2R3NA 2XD4A 2DS1A 4IX3A 3FJQE 3FQSA 1NVRA 4DEHA 2ZV2A 4NJ3A 4NIFB 4UYNA 4AXAA 1R78A 4AGCA 3EN5A 3IDPA 3L8VA 3R2BA 2O8YA 3FE3A 2VWZA 4F0IA 5BVEA 3GB2A 3QQGA 4W8DA 3UZPA 2JD5A 4AZVA 3JY0A 5DWRA 5EI8A 4BIEA 5KMMA 2ITNA 2QOKA 3NW5A 3QGWA 5BQ0A 5M06A 4FZFB 3VS7A 3R83A 3WZDA 4PQNA 4O2BF 5H8EA 1SVHA 4XX0B 4L7SA 1M0TA 3LPBA 4MXAA 4RWJA 2XUUA 4ZSGA 2NU8B 2I7QA 4P90A 3OY1A 4RWKA 1MRUA 5HG9A 3O0GA 4NCTA 2PVYA 3JY9A 5EM7A 3PSDA 5T68A 3KRJA 3PPJA 4FKQA 3Q5ZA 3UE4A 5FM3A 3FY2A 4BIBA 4BYIA 4I23A 3TCPA 1SM2A 2WIHA 5LOVF 3FLQA 3UG1A 2C6LA 4CKJA 5GJGA 1ZWSA 5AP3A 2CHLA 3GCQA 4APPA 5AP0A 3MDYA 3THBA 4A9TA 5M4IA 3F82A 5JVLA 3TIZA 3DFAA 3GNIB 4HYUA 5HD4A 5EDPA 1K2PA 4ZIMA 3WBLA 4C33A 2UVXA 3EQDA 1WMKA 4RMZA 2BZIB 2YACA 3GT8A 4MD8E 4I94A 5LCKA 4F09A 3MFRA 2JBOA 1JKKA 3COKA 1KV1A 3RHXA 3SHEA 4O82A 3HMOA 1E4EB 4L43A 3BQRA 1ZOHA 5FRIA 4ENYA 3MTLA 4AZWA 2HZNA 3MJ2A 3VBWA 4BB4A 3QFFA 5H8BA 2R0UA 3O8TA 5BVFA 5JH7F 2IVUA 2BMCA 2QO9A 4PL5A 5A14A 2XNBA 3FSKA 2VX3A 2BKZA 5IQDA 2W05A 3EN4A 2PMNX 2UZLA 3FXZA 3ZZWA 3BGPA 2HZ4A 3F2RA 3U6HA 3QZHA 1IG1A 2CNVA 3RV3A 4XG3A 4YC3A 5CI7A 1H24A 2ZAZA 2OJIA 3P7CA 1JKJB 2X6DA 5DFPA 4FTMA 4PDPA 4YR8A 1JQHA 1KE8A 4O7SA 2GMXA 2I40A 2W5BA 4HZRA 3E7VA 3PJCA 4QP4A 3LVPA 4X2GA 1PXOA 3R9OA 1TQPA 3FMEA 4S31A 4AZEA 4USEA 3WO0A 3WARA 4HGSA 4KA3A 5IQCA 3KK8A 1WCCA 3C4WA 1BL6A 2R2PA 3R5HA 3KXNA 2B53A 4P5QA 3R2YA 4IE9A 5HHWA 3WILA 2F2UA 2RFSA 3ZOSA 3QD3A 1W8CA 2YAKA 3CE3A 4RQVA 2V7OA 3UC3A 2E2BA 3T9IA 3VA7A 3HYHA 3G9NA 4JJRA 4RRVA 5CSHA 3VVHA 4DT9A 4RIXB 3R7UA 2UZOA 4V04A 1U54B 3SRVA 2ZMCA 5CAUA 5HTCA 3ZLWA 5LOHA 1W96A 3E8CA 3I81A 3QWJA 3F5XA 3OHTA 3ETAA 2R3FA 1CSNA 5B2MA 4G31A 3ORTA 2WMQA 1HCKA 4NW6A 5AEPA 3U4UA 1GSHA 3OUUA 3IOKA 1DM2A 3ACJA 4IM3A 4K1BA 4YJ3F 4FSUA 4GG5A 2OZOA 2DLNA 2ZV8A 4RA4A 3ZRMA 3RI1A 1GZOA 4HGLA 2PN1A 2ZDHA 3BV3A 1UU9A 4RX7A 3MY5A 4CG9A 2HJWA 4ZY6A 4CMOA 1SZMA 4ASDA 3WF6A 5KMJA 3VBQA 4HJOA 2WPAA 4IC7A 4WSYA 4B7TA 4EH5A 3ATSA 3QGYA 2EVAA 2QR8A 4XG6A 5KZ0A 3KN6A 4GYGA 4WG5A 2ITQA 1L8TA 3SQQA 4R7HA 4EHEA 1KOAA 3CKWA 4FMQA 5IA5A 2X7OA 2W4JA 3ORMA 4PTEA 4ZJJA 1V0BA 2VTAA 3Q96A 1HOWA 4J97A 5AP6A 5CF6A 5F9EA 1NT2A 2OU7A 5CX9A 4DG2E 2WOTA 1QL6A 3P7AA 1GZ8A 4WRSA 1C3OA 4TUYF 5EKNA 1LP4A 2NUAB 2CZGA 5D7VA 3TUDA 4ZJVA 2UZUE 2WU6A 2QHMA 3C9WA 1YW2A 3PVUA 4JIKA 1ND4A 2OW3A 3PXRA 4ZZOA 4JQEA 3RWQA 3CQEA 3PE2A 3TV4A 4YZNA 3I0QA 3LLAA 3W8LA 2V22A 4IADA 4I4TF 5HLWA 1YHVA 3KRXA 4KS7A 2QONA 3SOCA 3TM0A 5JQ5A 2WZJA 4L42A 2XRWA
chains in the Genus database with same CATH superfamily
2XIKA 3LXLA 3P5KA 2ITTA 2JDRA 2VZ6A 1F5QA 3E8NA 2GNHA 2CN8A 3DK3A 2WTKB 2J4ZA 3UMWA 5CU6A 1H8FA 4GFMA 4H3QA 4F1TA 2O63A 5H80A 1KJ8A 4WIHA 3W0OA 5JK3A 4R5YA 3L9NA 3JR1A 5CEIA 4A7CA 3CBLA 4TYEA 3VRZA 4CLIA 3FLNC 2O64A 3W55A 4QYGA 5ANEA 4GKHA 1GGOA 3R8ZA 1PY5A 4TT7A 3IPHA 4DHIB 5L3AA 2GTMA 4GYIA 5HZNA 2Q2TA 3VC4A 2E9NA 3TEIA 4ZP5A 3Q2OA 3PA3A 3W0RA 3R22A 2PVHA 1G8SA 1OL7A 1URCA 2W1DA 4FUXA 2X7FA 4C2WA 4BR3A 4G3CA 3VUIA 3HA6A 3EZVA 2R4BA 3FYJX 4JBOA 3O5AA 4IWOA 2JFMA 5T3QA 3VUGA 2OZAB 3BYOA 4EJ7A 2I8CA 5CU3A 2YISA 2HY81 3Q60A 3ALOA 4PL4A 5TF9A 5I9ZA 4F7LA 1B6SA 5IQAA 5AJQA 2QOHA 4LMNA 4CHIA 1E4EA 3LFDA 5DIAA 4I6FA 3RM6A 1TKIA 5I5UA 4NU1A 4BCIA 3NCGA 3U8WA 1VBGA 3UOKA 3F9NA 4GCJA 4BCGA 2FB9A 4FKIA 4Y5HA 2BHHA 3DBQA 3PUFC 4EOKA 2W1FA 4NFNA 3UODA 3TDWA 4C2VA 4O0TA 3GC8A 4XH6A 5CAQA 5HBJA 3QD4A 4O2ZA 4HR7A 2VWWA 4N70A 1PXMA 1PXJA 1J7LA 1WBSA 4RLKA 3COIA 2C4GA 5CNNA 2W7XA 3MVLA 1P16A 1J1BA 4JDJA 4HN2A 2YJSA 2VPQA 2A0CX 3NUNA 4OR5A 5J9ZA 5EHLA 3VQUA 3WE8A 2WOUA 2J51A 2VAGA 4IX5A 1F3MC 5J5SA 4O0UA 3QRTA 5C4LA 2P4IA 3KXHA 3P1AA 3ZBFA 4D0WA 5DAAA 3T3VA 3QA8A 2GHLA 3UDTA 1ZAUA 2JC6A 2C69A 1ZRZA 1ZYLA 1A0GA 5IEXA 4FL3A 2XK7A 2QOQA 3F88A 4AN9A 3RV4A 4GS6A 1QPDA 4X2NA 4Z7HA 5CA0F 4AF3A 4ZXTA 1PW2A 3G0EA 4ITIA 4HNVA 3E8EA 2UVZA 2VTPA 4PMMA 1KEEA 5BWTA 4EYJA 4U5JA 4FFRA 2CSNA 5CXHA 3F61A 4BCMA 4CV9A 4RIXA 5EHOA 1U54A 3BYSA 4APCA 2B9IA 3G9LX 4FL1A 4D2SA 5AV0A 5JSMA 4GLXA 4BTJA 5KNJA 4BI1A 3EMGA 3QTZA 3HEGA 2IZRA 4E4LA 3DY7A 5A3XA 3NS9A 3JUHA 1SVEA 2NP8A 4Y73A 4A4LA 4AA4A 4CTBA 3MN3A 2RF9A 4NSTA 3BHUA 3E63A 3MBLA 2FO0A 3DAKA 4NKSA 3KRWA 4JBVA 1CS0A 2IO6A 3FQEA 3CY2A 1UWHA 4ANMA 4EH6A 4LV7A 2GPHA 2HZ0A 2VX1A 5H2UA 4UXQA 4FFPA 3UQCA 2A1HA 1KWPA 5D9HA 3BCEA 3VUMA 5HBEA 5CANA 2BDFA 3BGZA 4R7IA 5DT4A 4BY9E 2BRHA 1M52A 3NX8A 3DT1A 2AC3A 4ZTQA 4FOBA 2QODA 5IQIA 5J8IA 2HG8A 5IPJA 4RJ5A 3WZKA 4CT1A 3LFBA 3V5TA 2YM6A 3PSBA 4JVGA 1Z2PX 4ACMA 5K5XA 3AT2A 4TWOA 5GINE 3AMBA 1JKSA 4RPVA 3CQUA 3BV2A 3D5UA 4XV1A 5M53A 1JKTA 3GU8A 2R0IA 2I0YA 3DPKA 4I41A 3E5AA 4YBKA 2XEYA 5D12A 2FPIB 1CTPE 5JGDA 4X3FA 2ITWA 4QQCA 3UQFA 4UZDA 4QRCA 3M1SA 4C4GA 1I44A 1LPUA 3EFJA 2XVDA 3GENA 5BWUA 1ZAOA 3AMAA 4IM0A 3OUNB 2HAKA 4ZMFA 1PJKA 3T7AA 4XS2A 1Q41A 4U79A 4IDVA 4WOVA 3MI9A 4XUFA 3RPRA 3HMMA 4L46A 4UV0A 4C4HA 4DYMA 3KK9A 5BVDA 3R5FA 1R3CA 3BYMA 1XHAA 2EU9A 2VWYA 2VO0A 4WHZA 1ZYCA 3FPMA 4FV3A 4WBOA 5DRDA 4DE4A 1XKKA 4YU2A 3A62A 4YO6A 2BALA 1U46A 2C68A 4AW5A 5LVPA 2R7KA 3QF9A 3D2KA 1TAEA 3NSZA 2PVNA 1XDNA 5J87A 5F95A 2W5AA 3Q9ZA 3I0OA 3F3ZA 1BX6A 4IH8A 4AW0A 1QCFA 3G33A 3MS9A 4O38A 4WNOA 3MWUA 3DKGA 4RC4A 4FSTA 3RVGA 4RIWB 3EQBA 5JFXA 1H1WA 2XANA 5AIKA 3PJ3A 4F4PA 3RR5A 3O17A 3SW7A 5BPYA 5E1EA 4NZWB 3MH3A 5E92A 3TY8A 4BBFA 4ZTNA 4HCUA 2HCKA 4IX6A 4YO4A 4BICA 5FPRA 4YJSA 4FTNA 5JFWA 3QKKA 4I6BA 4P5ZA 3Q2JA 1DV1A 2OZAA 2F7ZE 3G51A 1J3HA 2UW8A 3I79A 3ZFYA 5IA0A 3GCSA 5DNRA 2ABJA 3PWYA 4J8MA 2UW5A 5LARA 4BHNA 4QMLA 2NRUA 2EXMA 4KINA 3DJ5A 4MX9A 3VWAA 3ZXTA 4GSBA 4F1MA 5CEKA 1A3GA 1FVIA 1UKIA 1OECA 2HYYA 4GT3A 3HMPA 2XK8A 2UVYA 5AUYA 2UW6A 1Y91A 4IANA 5CZHA 3BLRA 5KZIA 3HUBA 3W0NA 3ZLXA 4RX8A 1IASA 5JQGF 1W0XC 3LCKA 3VW8A 5KMKA 4EC8A 3CEBA 1S9JA 2YS6A 4L3JA 5C1PA 2OWBA 2H96A 4JR7A 4ACCA 4EHVA 3NVKI 3L8PA 1DAWA 3CC6A 4WA9A 3L9MA 4EUUA 4OTIA 1H08A 5C27A 4FEUA 3V5QA 5FTOA 5IA3A 4HGEA 4MBIA 4FGRA 3RWPA 3CD3A 5LWNA 4CFUA 4B99A 3H10A 3N8DA 3B2WA 4O22A 3ZFMA 4HCTA 5EM5A 3QUDA 4QYFA 2Z8CA 2PMLX 4YLLA 3IG7A 4QMMA 2BR1A 1YI6A 3MY1A 3BHHA 2G2IA 1PMUA 2R64A 3QZFA 5ETIA 4NM7A 2GQSA 3CP9A 3DLSA 4OUCA 4FKWA 3Q1KA 3QUEA 4F7JA 5I5YA 5DEWA 2CLXA 4PZ8A 5EW3A 3COMA 5E1SA 3HO8A 2C47A 3FUPA 4YTIA 2PVFA 5CNOA 4F1OA 5K9IA 3U9TA 3JZFA 3EB0A 2QOBA 1IA9A 1WVXA 5C01A 4NZOA 3D0EA 5M4CA 3CTJA 4DG3E 4HVGA 4CLJA 2WEVA 3SE7A 4LOPA 4O7VA 4OW8A 4A9UA 1OKWA 3ZSGA 1PX2A 3U6JA 3IECA 4H3PA 5I5VA 2UW4A 2J5EA 3G8DA 3NNXA 1PMNA 2Z7SA 2FA2A 2R85A 4MA0A 4O7NA 3DKOA 3GOKA 3AQVA 5FG8A 5H3QA 3E3PA 4FTIA 5EYDA 3DCVA 1WR2A 5F20A 3DLZA 1DAYA 3JS2A 5HEZA 4ZSLA 5HX8A 3ORPA 2VTOA 4XV9A 2GS6A 5EH0A 3HRFA 1ST0A 2V5QA 3PIYA 3PZEA 4UN0C 4ZLOA 2GPSA 5DPVA 3Q4UA 5EHYA 3A4PA 3D5XA 3LMHA 1ZARA 2WMUA 4TVIA 4KSPA 1TQIA 4FNZA 3NYXA 3QTQA 5HI2A 2VTRA 5EDRA 5M57A 1I09A 3KMUA 5DYJA 2VUWA 4J98A 2R3OA 1U5RA 1K3AA 2XNPA 3QLGA 3FLYA 4M12A 4BDFA 4YB8B 1EYZA 2NPQA 3DNDA 3HLLA 4WRGA 4U3YA 5HLNA 3W2PA 4BHZA 2UZBA 3UYYA 3II5A 3EQCA 4FIEA 4GW8A 4XRLA 2HELA 5BVNA 3REPA 4XYMB 4TY1A 1EH4A 2VTIA 2XKDA 3L8SA 3UP2A 5AFVA 1ERKA 3QRKA 1E1XA 2Y8OA 1V0PA 4NZMA 2YCRA 3QYWA 4O27B 2IZTA 5IDPA 2XIZA 3QQMA 5AM7A 4EWQA 5J9YA 5HBRB 4FZ6A 3I5ZA 1FOTA 2WELA 5KX5F 3NDMA 4RLLA 1G8JA 3IO7A 4YJOA 4BTKA 3DDPA 4C4EA 2C1BA 5IMEA 4H58A 4DEEA 4IAZA 5FTQA 3HB9A 3SGIA 4FX3A 3RGFA 2PYWA 4OTWA 2YM7A 2YRXA 5LMBA 1LEWA 3QL8A 4O83A 4FZAB 4UALA 4IW0A 4RIWA 4X6RA 1RJBA 5J95A 2X9FA 2JLDA 3VJOA 4C0TA 1UWJA 4PP7A 3MV5A 3O50A 3QKMA 3ZEPA 3OS3A 1YQJA 3FLSA 4MWHA 4XHKB 2PZYA 2WQMA 4FYOA 4EI4A 4F64A 5AUTA 3GC0A 4Z3VA 3E3BX 4S2ZA 3C1XA 4PV0A 4O0VA 4A06A 5EG3A 4P4CA 4HNIA 3ZFXA 3QRIA 4CGAA 3I5NA 3JSLA 4ZTLA 2AC5A 3NBYB 1UNHA 3ORRA 2V0DA 4GEOA 2HENA 4G9CA 4YPSA 3LP8A 4TYIA 5LXTF 4YBZB 3CS9A 2BTSA 5IZFA 3FMKA 3EQIA 3NEWA 2IW8A 3V04A 3Q32A 4FG7A 3FMJA 1UU8A 3FZPA 4JRVA 2BFYA 4QYEA 2QQ7A 4JG8A 3FKOA 2E9UA 1KE7A 4O7ZA 3CGFA 4ACGA 5IQGA 1CE8A 3GIDA 4ZOLF 3EL8A 2WU7A 2YDIA 4RBLA 5EOBA 3DOGA 4Y83A 5HE3A 1BI8A 4IWDA 1KSWA 3T3UA 5KKRC 1W93A 3P78A 2R84A 1YXVA 5H9BA 3MWEA 2BZKB 5AP1A 1U5QA 2HIXA 3DNEA 3PWDA 3OFMA 4IVCA 3G5DA 5EOLA 3KMWA 2UW7A 1A06A 2WTCA 4FUYA 3AC5A 3ZRLA 5AAGA 5KS8A 2VTTA 4FIFA 4QDEA 5IA4A 4QPSA 1RW8A 4KRDA 4K33A 3HV5A 3RALA 4CQEA 5EQYA 5IQBA 1Z5MA 3EWHA 4I6QA 3TZ9A 3ZO3A 5E8YA 2XNOA 2X0SA 4EH8A 2IWIA 4JQ8A 2ZGIA 5LXMA 4ZHQF 1Y57A 2QOFA 2R3KA 4JG7A 2XM8A 4UZHA 3C0HA 2FGIA 3W10A 5A6NA 1OGYA 2F7EE 4XEYA 4E5WA 4ERKA 5KMLA 5C8MA 4E6CA 4F0GA 2ZDTA 2G9XA 4ZTMA 3PY1A 4FKRA 1XK5A 2GQRA 5L2IA 3E5NA 3W33A 2BKKA 5K5NA 4DEBA 3R5XA 4O4IF 4CKCA 3F69A 2CKQA 3ATTA 3OROA 4FZ7A 4GK3A 5AUZA 4AN2A 3NUAA 3T9TA 3W1BA 3PFQA 5AA9A 4CD0A 2IPXA 3W2CA 4CZTA 4O4LF 3O71A 4YZCA 4TNBA 4ZTHA 2I80A 3PP1A 2YZLA 4MNFA 3NYVA 4EH7A 5FPOA 4EH9A 1DS5A 5GJFA 5L8JA 3FL5A 2I1MA 3SV0A 1MQBA 3QQUA 1C30A 4ZQIA 4FSYA 2BUJA 2R7BA 1OL6A 5GNKA 3G15A 4PTGA 4EOPA 3Q5IA 4GT4A 4IIRA 2W96B 4K6ZA 1PKDA 3QWKA 1Q3WA 3DU8A 1FVVA 2KTYA 3EYHA 5EYKA 4Q4DA 1YXSA 3RP9A 2WIPA 4EK4A 1RQQA 2X4FA 2G2HA 2HZIA 2OIBA 3OBJA 3HV4A 5AX3A 4EBVA 3ZS5A 3WF5A 1KJIA 4B9DA 4EK5A 3NMUF 3VMMA 4UEUA 3FEGA 4DEAA 2O0UA 2VWBA 3VUDA 2ESMA 4Z16A 3BLHA 3BPRA 3CR0A 2ZOQA 3EHAA 4E4NA 2R3LA 5B7VA 3KKVA 2CCIA 3IQ7A 5BUIA 4EH3A 3DV3A 1T36A 4E6DA 1CQIB 2A2AA 3UTOA 4OT6A 3ZTXA 4QO9A 1XO2B 4G5PA 5C26A 3BU5A 4IHJF 4CMDA 3NAYA 3TXOA 3PRIA 4Q9SA 5LMAA 2OF4A 3ML1A 1W84A 2CNQA 5AV1A 3OG7A 4AGWA 3DFCB 1KE5A 3HUCA 2J2IB 5FBNC 4PRJA 3MVJA 3ROYA 5BVWA 4QP7A 4C37A 5CU4A 2DAAA 4QPAA 1OGUA 2Z02A 4DGGA 3QUPA 5IU2A 2QKRA 4MV3A 2WTWA 4DGLC 1YDRE 3ELJA 5A54A 4Q5HA 4C3RA 4QP6A 3KREA 5DGZA 4GL9A 4MK0A 2W9ZB 4CKRA 2RKUA 2C0TA 4UWYA 2VGPA 4DITA 2B54A 5HIBA 2Z7LA 3H30A 3LCOA 1H00A 4B8LA 4CFXA 3AMYA 4D28A 4DGMA 3UOHA 3S24A 1Q8WA 1GZKA 5T6KA 4FGBA 2QOLA 2RL5A 4W4VA 3T8OA 1M7NA 4G3FA 4HYIA 3E87A 4CMUA 4JG6A 1S9IA 4QMSA 2Y4RA 2PVMA 4Z55A 1MQ4A 4MXZA 3SXRA 2YEXA 4F9YA 3K5UA 1H27A 1APME 3FI8A 3QKLA 5AM6A 3IGGA 3S1HA 4MD7E 4ZEGA 2PE1A 3FZRA 4JAJA 3IOPA 4FT3A 3TNPC 3ORQA 2Q0BA 2RFDA 2YIXA 2W06A 4I6HA 4GFOA 3ZUVA 3PPZA 1DAAA 3KAJA 3SG9A 1FGIA 2GU8A 3PG3A 4XX9A 4YGAA 5ANIA 5J9LA 5IUHA 2YCQA 2QOCA 4BTMA 5IUIA 2QOIA 4EH2A 1M2QA 2ITXA 5CQUA 5KBQA 2Z04A 4JNWA 3V8WA 3P08A 2EWAA 4D5HA 1BKXA 3VOTA 3D2IA 2PVJA 1YXTA 3MPAA 3QQLA 3FI4A 4AU8A 3Q9XA 1AQ1A 1YKRA 3KA0A 5D1JA 5A46A 1OKYA 2ZMDA 3PSCA 4U7ZA 5JFSA 2YYAA 3ORKA 2VWXA 4FV5A 2AYPA 4CKIA 2JBPA 4FTLA 2ZDGA 4I5HA 2PL0A 3PLAE 4O7TA 2IVSA 4LGHA 4ALUA 5KX8A 4WHXA 4RCNA 3AT4A 2W1ZA 3E62A 3GBZA 3TWJA 2LGCA 5DR6A 5D8DA 3NWWA 3GQLA 2Q0NA 4BDHA 5TT7A 3MVHA 3R28A 5AX9A 1KJ9A 2FSOX 3NCZA 4YJUA 1JKLA 1JWHA 2GNFA 3Q4CA 3H4JA 5CLPA 4H36A 4NYEA 4NCTC 1W7HA 3BL9A 5DE2A 2ZB1A 4XP2A 4E93A 4LOQA 2C30A 4XMOA 2JKQA 2W17A 5IG1A 2IZSA 3OUKA 1L3RE 3QD0A 1CMKE 4BGQA 1VEBA 4QTBA 2WB8A 2R7NA 4FL2A 3IW6A 3ZHPC 3TNIA 2GCDA 4IB0A 4EFBA 2J9MA 4NW5A 4E26A 1J7IA 3M2WA 1WBPA 4TWNA 3OF0A 3PDTA 3ZEWA 4DFBA 3E93A 1KV2A 4OTGA 5M4UA 5TKDA 3C51A 1UU3A 2JDOA 2NRYA 1BYGA 2OIQA 2XIRA 4RVKA 4G6NA 4JDHA 3TTIA 4YTFA 5JKGA 1BXRA 3LQ5A 4BCOA 3LMIA 4ANQA 3UZTA 2I6LA 3CY3A 4Y72A 4DEGA 2XJ0A 2ZDQA 3DXNA 3OD6X 1XBCA 5AP4A 1QPJA 4U6RA 4IZ5A 3RM7A 4BZDA 5LWMA 2XS0A 3RTXA 2WQEA 4KB8A 2ITPA 3EYGA 5LA6F 2W6MA 3QX2A 2WD1A 3TEKA 3DB6A 1STCE 3R01A 4YZ9A 4JR3A 5H8GA 2Q83A 4BZNA 4GMYA 5IYZF 5EW9A 4FKVA 2REIA 4M7IA 4O2PA 3NPCA 4FVPA 4MKCA 4MUQA 3KALA 2UZEA 2VV9A 3M11A 4A4XA 3R30A 4DFXE 4ZY5A 4H1MA 1PXNA 2OH4A 2YDJA 5JGBA 4FTAA 2DWBA 1UC8A 4BJJB 4RJ4A 4YZMA 3FSFA 3VUKA 3GJXB 3QA0A 4F6WA 5A4QA 3T99A 4ITJA 5CEOA 2BPMA 1GJOA 4H39A 3C0GA 2F4JA 3LOKA 1H4LA 4LRKA 1FVTA 3VS4A 4ZS4A 3RAHA 3ZM9A 1A9XA 4GV1A 4BGHA 3DTWA 2BRNA 4YZDA 1JLLB 3GQIA 1KE9A 3DBEA 1OL1A 5EW8A 1YI3A 3C50A 5HESA 2BCJA 1ZYSA 3VHEA 4DLJA 3FLZA 3DDQA 3PVBA 4ZLZA 2COGA 5JQWA 4DF3A 1KE6A 3D5WA 4B8MA 4RIOA 4WO5A 5JZJA 5HLPA 1MUOA 3SD0A 2FH9A 1G2WA 3FZSA 4AG8A 5M08A 4EOMA 5CA1F 1YWNA 5I5TA 4IJPA 2XKCA 4CRSA 3ORZA 4MHAA 3Q6WA 4IAAA 4PF4A 4YJRA 4FTKA 5IEVA 4KBKA 4WBBB 3GLKA 4U80A 3D7TB 4C3PA 4EEVA 3KIOC 3MSSA 3BELA 3O2MA 4RA5A 3BABA 1H0VA 4GH2A 3DS6A 2PHKA 1OBGA 3H9OA 3AKJA 1XH5A 4FNYA 5JMSA 3UZOA 3BYUA 3MESA 3BX5A 3QYZA 5L2TA 3ZBXA 1O6LA 3GCUA 5GIPE 4D2RA 1VZOA 3DTFA 4V05A 5DG5A 4LMUA 4ZTRA 4BVUA 4IWQA 4EONA 4FIIA 4X0MA 3CSVA 1H1SA 1GIIA 2C5VA 3QC4A 4KKGA 2ZV7A 3H9FA 2H9VA 2YABA 2PU8A 4DCAA 3WZUA 3V4ZA 4NK9A 2YM4A 4EG0A 4G3EA 5C8YF 3BE9A 3F3WA 3QWUA 5FEDA 5AUXA 2PMOX 5EM8A 2PY3A 1A9UA 3V51A 4WG3A 4DHJA 5BNJA 5HE0A 4W4YA 4DC2A 2IW6A 2XBJA 4JAIA 3PJ2A 4IDTA 4DG0E 3KRLA 2WMRA 2PZPA 4P7EA 4QMTA 4YUQA 4BGGA 3N4UA 2ONLA 2ZYBA 3I60A 3VS5A 4C3FA 2ONLC 4O7WA 3G6GA 5KO1A 2V59A 4X3FB 3V6RA 5EI2A 4FIJA 4R3CA 3TMOA 5D1OB 3MWDA 5HO8A 3W2QA 3UFXB 5AUWA 4JS8A 3KL8A 4YJQA 4M3QA 4U45A 4F78A 3UIXA 1TQMA 1ST4A 2B9FA 2OFUA 3R1YA 1P14A 4IAIA 4O4JF 3VS3A 3ANRA 4AE9A 3LIJA 4KWPA 3WZJA 3LKMA 4R3RA 1JDEA 2GHMA 3PY3A 4QMUA 3CTHA 4FKUA 4WNKA 4V0GB 4MA5A 3VS2A 2SCUB 3R00A 5BUEA 3BA9A 3KEXA 4J71A 5F1ZA 1R0EA 3OC1A 5LMKA 3P86A 3ID6C 4U40A 4QDVA 2WMWA 2X8EA 3HL7A 4BDKA 2HOGA 4FTUA 1OB3A 4EGJA 4RZVA 1IYEA 1KOBA 3RHKA 4LDTA 2GNIA 4UY9A 4AOTA 3FXWA 3FMMA 2I0VA 3R1QA 3L8XA 5C8NA 5LJJA 2J90A 5DA3A 2NU6B 3TN8A 3FL4A 4MBLA 4RVLA 4BDCA 4PNKA 5HORA 1I1KA 3NFFB 3EQPA 3RAWA 2VR1A 3K3PA 2GPWA 3ZO4A 2GQGA 3PZHA 1Z57A 4CC5A 2QLUA 2UZWE 1JSVA 4IB1A 4CCUA 2XNMA 2NO3A 4KD1A 5CEMA 5CSWA 4GU9A 4JMQA 3TL8A 4ITHA 5BYAA 2Y7JA 3NNWA 1XH6A 3R71A 4FTQA 4H1JA 3RNYA 1CQJB 4EUTA 4MXCA 3NR9A 4IAYA 1FMOE 3TACA 2R7MA 4QT1A 5ANOA 3OOGA 4J8NA 3A4OX 2CDZA 4JDIA 4NFMA 3UIMA 3R02A 3RTPA 3QXOA 3MIAA 4BF2A 1WBTA 2BAKA 2HW7A 2C6EA 3R9RA 3LQSA 3KXXA 4RX5A 2PVPA 3R8MA 4I6LA 2Z2WA 3DBDA 3E92A 4C36A 5HG5A 4X2JA 4XP3A 4BJJA 3QRJA 5I5WA 3U9SA 5AA8A 4EKKA 2X1NA 3P0MA 4FR4A 4G3DA 4S30A 5GIOE 4J53A 2QVSE 3D5VA 4K6NA 1ZZLA 3WF7A 4I4FA 3E8DA 5AIRA 3QX4A 5BMSA 1Q5KA 4G5JA 2X39A 4ZAUA 4UUGA 3S4QA 5DLSA 5HIEA 3UPZA 3V6SA 1PXIA 3KXMA 2YM5A 2WKMA 2JDTA 4M15A 4XYFA 3VO3A 1Q97A 3MA3A 2C1AA 2P2IA 3F5UA 4AOIA 4ANBA 2W6NA 2XJ1A 4QP1A 4R6VA 5CQWA 3FKLA 2UV2A 4Z7GA 4D4VA 3D15A 4F08A 2VGOA 1YI4A 2Y4PA 3ALNA 4I5MA 4RX9A 5HIDA 3PN1A 3PVGA 2AUHA 3QALE 3ZDIA 4YJ2F 2GSFA 1IA8A 4FTRA 3C7QA 1O9UA 4BCFA 5ITAA 3CEKA 1GOLA 1O6KA 1NW1A 3FLWA 1FGKA 2W1GA 3PPKA 4ANLA 5K2MA 5G1XA 3D7TA 2XNGA 4RJ8A 2FPGB 3JSNA 3ZUTA 1NA7A 5CEQA 2C00A 3H9RA 2I87A 3A7HA 4FSRA 4S34A 2W6PA 3U6IA 4WUNA 3GEQA 2XF0A 3OWPA 1OPLA 1IOWA 3PLSA 4XV2A 4NWMA 1JPAA 3SXSA 3FPQA 1Q99A 4IB3A 1LEZA 3DJ6A 4D1ZA 3ROCA 4NKAA 2ZM1A 3OBGA 5AP5A 4CFMA 4F6SA 3MYGA 4QMNA 1NY3A 3EKNA 4NT4A 3U51A 2XYNA 4KAOA 3BU3A 5FEEA 5HG7A 2EJ3A 2W4KA 3VPCA 4D9UA 3ET7A 4F99A 5C4KA 5A4TA 4Z9LA 3T9AA 4NH1A 2A4LA 3UQ8A 3NIEA 5CF8A 1P8LA 4IACA 4LOOA 2OLCA 1Y8YA 3BGQA 4FFLA 4RC3A 4AGDA 3T9DA 4KBAA 2WO6A 3JYAA 3V5PA 3IDCA 4CRLA 1J91A 2BDWA 2JAVA 2JIUA 4XOZA 3BU6A 4PBCA 3DKCA 3MB6A 5ETAA 3ANQA 3OTVA 2KULA 4BDBA 2XIXA 2CLQA 2DZDA 2EJ0A 4X3FC 1DGSA 5BVKA 5IH5A 5D1OA 3BHTA 4ACHA 3KMMA 4O7LA 2Y