2CNUA

Atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with aspartic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
305
structure length
302
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
publication title Saicar Synthase: Substrate Recognition, Conformational Flexibility and Catalysis.
rcsb
total genus 106
structure length 302
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2006-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cnuA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2cnuA02
4E26A 2R5TA 1BL7A 4PMMA 2Y4PA 3DLSA 1JSVA 2B9HA 4RFZA 5FEQA 3R7OA 3NYXA 3IW6A 2YL2A 3ZYAA 3HBLA 3LFSA 3F3ZA 2I0EA 3OHTA 2VWUA 4JOAA 2QOLA 1YHWA 4FVPA 4M15A 4RRVA 3UDBA 5C27A 4CVAA 5M4IA 1M2RA 3NYOA 3PTGA 4FSWA 4UWBA 1Z2PX 2OIBA 4ZZOA 3TQTA 1CQIB 3ORIA 4LOQA 4S32A 2PVNA 1M7QA 4FMQA 1W0XC 3LQ5A 2QQ7A 2A4LA 4BCFA 2V58A 4WIHA 1EUCB 4BBEA 4KKEA 3I60A 1Q8TA 2W1FA 3JY0A 3PA4A 4N70A 3NNWA 2WTWA 2XF0A 2ZYBA 4NFMA 5L8KA 1OBDA 2RFDA 4WG3A 5L2IA 3NW7A 4FICA 3D83A 5BVFA 1Q5KA 5EQEA 3UPXA 3RPSA 3NEWA 4V0GB 5AUTA 3GC9A 2XP2A 4UYAA 2VZ6A 3C4CA 4GJ3A 4DFLA 3FMJA 3IG7A 3FL5A 3D15A 4PDSA 3TIGA 1H24A 1ATPE 3UIXA 4R6VA 4KBCA 5FXQA 5CSHA 2VAGA 2GQSA 2JLDA 3GU5A 3QCXA 5HESA 3SOCA 5CF6A 2YS7A 3A99A 3V6SA 3R2BA 5EM5A 5ETCA 4K1BA 5HD7A 2QC6A 5CF5A 3UC3A 3V4SA 3LCOA 3MIYA 2R3NA 5F95A 4M0YA 3ORLA 4M68A 2XNMA 3U87A 5CTPA 1H26A 4RX5A 3CY3A 5I9ZA 4XMOA 4L44A 2YIWA 1VJYA 3EL8A 2YHVA 3SV0A 1G3NA 3F66A 2E9UA 1W83A 3COKA 3OXTA 4DLKA 1HOWA 1DV2A 3V5JA 5DMXA 4ARKA 3HRBA 4Y85A 4YZNA 4CV8A 5I9WA 2RGPA 2CGUA 4TYEA 4F7LA 1U46A 5BQ0A 4IX5A 2XK3A 3I1AA 4FFNA 3DLZA 3MPTA 3R7YA 5AAGA 3PWYA 4QPAA 1XBBA 3S4QA 2R3GA 4AE6A 4YLLA 2RG6A 4NFNA 2XKDA 4YJRA 3VQHA 3WZJA 2BKZA 3EL7A 3KXMA 4J99A 2IVVA 4MWHA 4DFZE 3FDNA 3HRCA 3MW1A 1H0VA 4NKSA 4LQMA 4NTTA 4DG0E 4E5WA 2ZDUA 4FTCA 5T68A 2YM8A 3Q53A 2JKOA 2VTRA 1O9UA 4FV8A 4JBOA 1MP8A 3A60A 5HVJA 3RALA 4LM5A 3POZA 2W9FB 4P7EA 1B6RA 4RQKA 3COMA 2PVPA 5HE3A 3KEXA 3COHA 2B0QA 3T8OA 2OICA 1KE7A 4FNYA 4IVBA 3AD6A 4QNYA 2DLNA 3FLZA 4I55F 3IW5A 2YWVA 4GFMA 4ASZA 4I5MA 4IMYA 3G51A 3RK7A 4NCTA 4KD1A 2PVKA 3QQUA 4NZWB 4HVSA 3EFLA 4RJ4A 4RJ7A 1U54A 4XNEA 4YU2A 1W7HA 1GZ8A 4RLLA 3VWAA 3FI4A 5IH6A 3R8ZA 3BU5A 3LW0A 4C0TA 4C58A 2ZMDA 3QRJA 3AD4A 3CJFA 4YP8A 1URWA 2X7GA 4I5PA 5IISA 4ZTHA 4NW6A 4HQ6A 4FZDB 1OI9A 3E62A 3G90X 4RC4A 4ZS4A 3R8PA 5EM7A 2YA9A 3JS2A 4QO9A 5EYCA 2YZNA 5BPYA 1CTPE 3PSDA 3OUKA 5A46A 4YURA 3EFKA 2XBJA 1G5SA 2FSMX 2C0TA 2WELA 3D5VA 3NCZA 4DH8A 4EHEA 5A14A 3F9NA 4AOTA 2R64A 4EUTA 3NMUF 3CP9A 4EH5A 2CGVA 1YVJA 4W8EA 2E9OA 3N4VA 4I4FA 4XCUA 5EQPA 1FOTA 4M12A 4N4SA 5HHWA 3I0QA 4AZFA 5TF9A 2PYWA 1ERKA 3EQDA 5AWMA 3SXRA 4ALVA 2ERKA 3QYWA 3A61A 1JKTA 4CQEA 1E4EA 2I7QA 4I3ZA 4BDHA 5CEQA 4O2ZA 4NM0A 3S2PA 4FYOA 5CI7A 3OT3A 4BBFA 1IOVA 3CCNA 5CU3A 5FQDC 2XS0A 2GS7A 3P7BA 1A9UA 4LYNA 3ZLWA 2ITUA 4TT7A 2IW9A 2V55A 5HO7A 4R7IA 4CFMA 3FPQA 2XIYA 3PPZA 4QTCA 3BYUA 3LFCA 4JLCA 3TZMA 4YLJA 2VO3A 2C00A 4DEHA 4JBQA 4DFXE 5L6PA 1Y6AA 5LVLA 3GGFA 3NAYA 2R0UA 4I41A 4YO4A 2Y9QA 3LVPA 2GS6A 2HK5A 3ZZEA 2Y6OA 2FB8A 2VTTA 4XS2A 4MNEA 3RZBA 4JR3A 4KIPA 4CGAA 4CCBA 3AC3A 5IA3A 5J1VA 3KXGA 3CSVA 3LMIA 3QCQA 2XK9A 5E90A 2XBAA 3E63A 4G2FA 5ETFA 2WMUA 3LFAA 2WD1A 4YUQA 3MSSA 1WZYA 2REIA 3PPJA 4IM2A 3WO1A 3PXRA 3Q6UA 3QC4A 3LCSA 3UOLA 1EZ1A 3LLAA 4LRKA 4EC8A 4USEA 4Y8DA 5JKGA 5KX8A 3BGPA 4O7WA 4FFRA 4ZMEA 4HYSA 4FKTA 5FNVF 4AUAA 3LKMA 2HW7A 4NTSA 5EFQA 2W0JA 5D7AA 2NRYA 4USFA 1SNXA 5M07A 4F0GA 4GL9A 4CD0A 1PF8A 3W33A 5CZHA 4CFUA 1KOBA 1ZYDA 3M11A 5FGKA 1EUDB 5LOVF 4NU1A 4OT6A 5AUZA 5IA0A 3P23A 1PW2A 4FKQA 2J5EA 4PMTA 2W6ZA 3FZSA 3UYSA 4QTBA 2DWBA 3SRVB 1OL1A 5HU3A 4ENYA 3FXZA 3FSFA 4WKQA 3R8VA 3TEIA 1DIKA 2IVSA 4EEVA 5HLNA 2WOTA 4KKGA 2JITA 2A27A 4AGWA 4BDEA 5TT7A 3T9TA 4F99A 1ZY4A 2CDZA 4IACA 3MFRA 4O7NA 3ZRMA 4M67A 4RZQA 1H8FA 5D8DA 4G6LA 4UALA 4I6BA 4WRGA 2Z04A 3QC9A 3GUBA 3FWQA 2YN8A 4AT5A 5IQDA 4UWCA 3MWUA 3QD4A 4IANA 2EVAA 3GLKA 3CE3A 1A48A 3E8EA 2H96A 4FK6A 4CFXA 1Z9XA 5GJGA 3ZSHA 5JFSA 1ZAOA 3P79A 4A9RA 3DKFA 3ID6C 4AP7A 2XNOA 2YZGA 5EH0A 5BMSA 4OR5A 1Q8UA 4R3RA 2ZMCA 3FHIA 3FYJX 1OVEA 4HZRA 1S9JA 1YI4A 2XJ2A 4PX6A 4YBJA 2YCFA 4ORKA 1BLXA 3AT4A 3OUUA 2GNGA 3C4EA 3TTIA 3KQ7A 2PU8A 2HYYA 4MD8E 4JX3A 1SZMA 4QP4A 4L45A 2BZJA 2Z02A 5A4EA 2R7LA 4FTTA 2PUNA 3P0MA 2C4GA 5CU4A 3OT8A 4N0SA 5I9VA 3W16A 1L3RE 3L1SA 2ZV8A 4EK4A 3LAUA 4Y73A 5JFXA 4I94A 5DYJA 3R9RA 4FKWA 2W1IA 5IQGA 3R5FA 2ETKA 3R7IA 1YWNA 2XRWA 3C5UA 5M51A 3UVRA 5LP6F 3GCQA 4YZCA 4RIOA 3DBFA 4QQ5A 3MVLA 4D1SA 1E4EB 2OK1A 3LOKA 4EK8A 2WB8A 4Y95A 4FGBA 1URCA 3DAEA 3SW4A 3CQUA 2GPHA 1AQ1A 2W4OA 3OY3A 3FZTA 4O0TA 3R1YA 4MBLA 5A6NA 3NUYA 2PULA 3SAYA 5HLWA 2XJ1A 3FBVA 2JFMA 4JR7A 4DTBA 3QQLA 3GCVA 5IH4A 2BMCA 4TWPA 2HJWA 5TKDA 2ITZA 2BHHA 1YKRA 2Y8OA 3DGKA 2PVFA 3DXQA 3C13A 3W32A 4QP9A 3L8PA 5D41A 1RDQE 1PJKA 2C47A 5CNOA 1B39A 5AUXA 3HYHA 1FVVA 2C5XA 2R3JA 4QTAA 1M7NA 4E4MA 3QWJA 2WMAA 4C5CA 2G1TA 3ZUTA 4LI5A 2CGWA 3K54A 3RCJA 5AADA 3LXLA 3MPMA 2VTOA 1JKJB 2IPXA 2UZOA 3ROCA 1M0WA 2Y6MA 4B6LA 3LCTA 2VWBA 5JFVA 2UW6A 1ZYJA 1YRPA 4KNBA 4TWCA 2QG5A 4OBQA 2W1EA 3O7LB 1VYZA 4YHFA 4OW8A 3AMAA 2B54A 2QVSE 4FOBA 4FI1A 3TV4A 2F7EE 3VS1A 5C8NA 4BCJA 4ZY4A 4FNXA 4F7NA 5C8KA 3MJ1A 5A54A 4BZNA 2UVXA 3RAHA 4MHAA 4EH2A 5LCJA 5EHYA 4MXXA 3KREA 5CX9A 1ZLTA 3W2PA 4J7BA 4CMTA 4HGLA 2YCRA 4YBZB 3K5UA 1I09A 4DTAA 4NUSA 2NU6B 5BVKA 4O2PA 1U4DA 4QMLA 4JNWA 2R2PA 4X0MA 3LFDA 4F09A 4FIEA 4FZAB 3KRLA 4B9DA 2J51A 1FQ1B 4FKSA 4HNVA 5AA8A 2EWAA 2OIQA 1YXSA 4QMTA 1YW2A 5BX0A 1PX2A 2PTKA 4KS7A 4O7VA 1DV1A 1G8AA 4ACGA 4H1JA 4DT8A 1PMEA 5IF1A 3BQCA 3WYXA 5BUEA 4O6EA 4TL0A 1B38A 3MPAA 4DH3A 3F2AA 3MI9A 2RL5A 5AP2A 2UZDA 4CZUA 3T9IA 3HAVA 3RV4A 4E6CA 2F49A 2W7XA 3P9JA 4G6OA 4OT5A 5ANGA 3VBQA 3WZUA 3TW6A 5G6VA 2P4IA 4O4IF 3DKOA 2YM7A 4QYFA 4AZWA 5KKRC 4FG9A 3EQBA 1YDSE 3FQHA 3PP1A 1F3MC 3QTWA 4GIHA 2PN1A 4O4JF 2P55A 3M2WA 5M4UA 2OBJA 5ANKA 3F6XA 4CXAA 2BR1A 1WBVA 2OJFE 2C6LA 5FG8A 1JLUE 3FPMA 2ETRA 4QP7A 3OWJA 1OKVA 1ZY5A 2QOBA 2QONA 3VUIA 3ZSIA 1T45A 4K9YA 3Q4CA 2UUEA 3EMGA 3PZHA 3TNIA 4CKRA 3BHUA 5BYZA 3R01A 5FXSA 4O86A 3S0OA 3R21A 2VTPA 2E2BA 3OUNB 4RIYA 4IEBA 4XV9A 3UTOA 3R2YA 5E92A 3HAMA 2QOFA 4KS8A 5CVHA 1VZOA 4FU0A 1A9XA 5BMVF 5GONF 1LP4A 3CXWA 4UEUA 2C1AA 3KMUA 4O0UA 4I21A 3BYVA 3PUPA 5FEDA 3V01A 3HRFA 1MQBA 3ANRA 3FMDA 3QRUA 3QQKA 3ZDUA 3MV5A 4QT1A 4X21A 3QKKA 1QPJA 5FM3A 3ZLSA 3KXZA 4QMNA 1AUXA 2WIHA 2OIDA 3QA0A 4AAAA 3LFNA 4TWNA 4EQUA 3OP5A 1Q8ZA 3TKUA 3F3UA 3S1HA 3DNEA 3W8LA 2UZVA 5D1JA 3GFEA 4FC0A 4BTJA 4HGTA 1QMZA 3R23A 4FTKA 1WBNA 1ZXEA 2ERZE 1ZYSA 4CRSA 3F2RA 3Q96A 4TYHA 5JMSA 3HA6A 4ZOLF 3HP2A 4DITA 1GIJA 2F9GA 2PL0A 3IGOA 3RAWA 3R02A 4NWMA 3CQWA 2OJJA 3OEZA 4AA4A 4PP9A 3KFAA 5I9YA 1FVTA 2HENA 4EONA 4MQ2A 2B9IA 2BUJA 3CD3A 4JI9A 4BTFA 2C6EA 3EQGA 1WFCA 3BWJA 3UBDA 5HX8A 4I1ZA 2ONLA 5HZNA 5HE0A 2XNGA 3UOKA 1XH9A 2QOHA 5ICPA 1KJ8A 2NU8B 4ZXTA 1H1RA 3TI1A 3KXNA 4J52A 2XVDA 1W93A 4GFGA 1WMKA 4X7QA 2XK6A 3O0GA 4U43A 4X2JA 4HNUA 1XH6A 2X9EA 3H9OA 5HGIA 5D12A 3DBEA 4DN5A 5J7HA 3QD0A 2WKMA 3OW3A 1TKIA 5K3YA 3DB8A 3PVUA 1M17A 3E8NA 4A07A 5HE2A 3Q2JA 1GAGA 3NX8A 3RKBA 3JZFA 4MV7A 4BCOA 2WMQA 5CYIA 2F7ZE 5HBHA 3UP2A 1NVSA 2XK4A 4HNIA 4HOKA 4WOVA 1H4LA 4HVIA 1GOLA 1KJJA 3DK6A 3GEQA 3NDMA 3LZBA 4IM3A 4UB7A 2CNQA 2PMIA 4KWPA 2R0IA 4QQJA 3V8WA 4GW8A 4AT3A 5KX5F 1KSWA 4C59A 5J1WA 3SE7A 5LA6F 3R04A 3ORQA 3R8MA 1IAHA 3ULIA 4AGDA 3KRRA 3Q04A 4R1VA 4GK4A 1CM8A 4O4HF 4YAKB 2R3HA 2CN8A 3CTQA 3TV7A 4HYHA 5H9BA 2BFXA 3E64A 4LRMA 3MB6A 3DOGA 3FMEA 1BI8A 4M14A 4GVAA 2CGXA 2XIKA 4AG8A 4E4XA 2BTRA 4OGRA 3VUDA 2PE2A 1CSNA 3ACJA 3QZFA 5IQIA 4E4TA 4IB3A 4U9AA 5K4JA 3F5XA 3TKHA 4F9BA 4U7ZA 3O2MA 3GBZA 2UV2A 3GU8A 4GT3A 4LGHA 3FHRA 2YCSA 3I6WA 4DGLC 3DKCA 5DRDA 3RTPA 4FIFA 5CT7A 4FR4A 5JH7F 4JRVA 3FY2A 4FSZA 2W1HA 4WG5A 4FE2A 3QUPA 2CNUA 3FL4A 2CNVA 4NM3A 4YLKA 2FP4B 5J2UF 5FTQA 5CSXA 2W05A 5EHLA 1EYZA 1ND4A 2P0CA 5KE0A 3CKXA 5I0BA 1WBWA 4XG3A 4E4LA 2SRCA 4V01A 2X0SA 4U44A 4YBKA 4IHPA 3KF4A 5ANDA 3UIMA 1V0BA 2BROA 2C1BA 2ZDHA 3N4UA 4B8LA 2ZVAA 4FT7A 1OL5A 3OZ6A 2GSFA 3PY1A 3P5KA 4C7TA 2BRNA 5HG8A 4F1OA 4AU8A 3P7CA 4XUFA 3KK9A 2BCJA 5HO8A 4C4EA 4TV8F 4RLKA 2IWIA 2IZRA 2YJRA 4U8ZA 3SXFA 3VQUA 4U45A 4DE4A 3RWPA 1H1PA 2WYOA 2G2IA 3DBQA 2OZAA 4C38A 5IQBA 3W18A 3NS9A 3PY0A 4UZDA 2QG7A 3FLWA 1Q97A 5HNBA 1H07A 3QFFA 2VWXA 4KA3A 4TNBA 4GJ2A 4IJ9A 5KMKA 5JQ5A 4NH1A 4PY1A 5AA9A 4D4VA 1PXNA 1YOJA 4AF3A 4ZY5A 2YRWA 2VR1A 2C5VA 4OBPA 3N51A 1ZZ2A 2J0LA 5AV4A 2HAKA 5DBXA 4O2AF 3DZQA 5LMBA 3NVMB 2GPWA 2OLSA 1KJ9A 2BPMA 3A7FA 3QCYA 4ZLYA 2C3JA 3DBDA 3HNGA 3KA0A 5KZIA 4G3FA 4EQCA 3ETHA 1JOWB 5BUIA 1XR1A 2F7XE 4BIBA 1UWHA 2YW2A 3VMMA 3H0ZA 5KBRA 2XCLA 5IDNA 3BLHA 5T6KA 2J2IB 3UP7A 3Q9WA 3TIZA 4UYNA 3HMNA 4UWYA 3T3VA 2X0GA 4WBBB 3RAIA 3QWKA 2NU7B 3RVGA 5KCVA 1DI8A 5J9ZA 4MCVA 4PF4A 3Q3BA 1LR4A 1LEWA 3IDPA 4FTAA 5HBJA 4Y83A 3I12A 4ANLA 4X3FA 2QU5A 3EZVA 3PA5A 1QPEA 4BCMA 3Q2OA 4YJSA 4XP0A 1XWSA 3AC4A 4EOKA 5M53A 3G8CA 1F0QA 3WF7A 4IAYA 4BF2A 2QK4A 2OH4A 3DNDA 3TZ9A 3Q5IA 1FMOE 3I5ZA 3BHHA 3DJ5A 3TL8A 3QGWA 2ETMA 4C2WA 4EORA 3F5UA 2BDJA 3ZC6A 3NLBA 2W9ZB 4O7ZA 3EQPA 3UG1A 3W2RA 4F9AA 1P14A 1PY5A 2XM8A 4NW5A 4FSMA 5IUIA 2X9FA 3Q5ZA 4IWOA 3BELA 4AXAA 3EN4A 5AP1A 1WBTA 1H08A 2YWPA 1OL7A 3I5NA 1GZKA 3NSZA 3UVQA 3GU4A 4RMZA 2X39A 3VULA 3FMMA 1OL6A 4YZMA 4F6WA 2W96B 4BYJA 4DFBA 4FL2A 1W82A 4QYEA 3NUUA 4M97A 3O96A 4RJ8A 5EW3A 3PPKA 3V3VA 2UW9A 4FEWA 5LVNA 2W6OA 3QTSA 2R9SA 4B0GA 3FKOA 1IA8A 5J87A 3IOPA 2R7MA 3C50A 2IZUA 3NGAA 4DGOA 4PMPA 3ORRA 2VWVA 2ITTA 4IAFA 3Q52A 5TO8A 2FSLX 4PL4A 3NUPA 4LUDA 5CT0A 2JAVA 2J7TA 3UMXA 5CQWA 2CKOA 2I0HA 1OPJA 4TZRA 3R8UA 3E3PA 1K9AA 4GU9A 4KUJA 4XG4A 3GC8A 3SC1A 2IG7A 2UW5A 5KMOA 1OZ1A 4IX6A 4EHZA 2CZGA 5CEKA 1XH5A 4KSQA 4K33A 3FZ1A 1WBPA 1MQ4A 3DQXA 3UYTA 4O0SA 4FTOA 2R84A 4C4GA 5ANJA 4Z16A 2W1CA 1WVWA 4FGRA 3EN9A 4F70A 3VBYA 3U6JA 2BDFA 2RG5A 3FI2A 3RGFA 1H0WA 5AAFA 3KRXA 3UNKA 3QD3A 4RSSA 3I6UA 4FT9A 4ENXA 2XNNA 1J91A 3KU2A 2VNYA 4A4OA 2FPGB 4HYIA 3VNTA 2GHLA 1PXMA 2HXQA 4EL9A 3FC2A 3BPRA 3OTVA 1YXVA 3I0OA 3I7CA 1CDKA 4D2RA 2WHBA 4D0XA 2VO6A 4AFEA 2GU8A 5M55A 3LFEA 3QGYA 1UU3A 2V22A 4RIXA 4BDGA 4EQMA 2R3IA 3KULA 2ZB1A 1QCFA 2CCIA 3FZPA 2OZOA 4J8NA 4UXLA 3QQFA 1UVRA 3HZTA 4AZSA 3QHWA 1OKZA 1AD5A 5FLFA 1BI7A 5JGDA 3KN6A 1FVRA 3HMOA 3K5IA 4Y5HA 1H1SA 2VWIA 2GTMA 2GQRA 4JX7A 4ACMA 4DFUA 3E7OA 2YM3A 3KRWA 4M7IA 2X2MA 4IAZA 3M1SA 1XH4A 2W17A 4Y8VB 1WCCA 4C61A 4MD9E 4HNFA 4IZ5A 4AZTA 3LP8A 2C6MA 2GPSA 3PJCA 1OBGA 2BKKA 4FV4A 2XNPA 4RA5A 1FPUA 1FGKA 5IUGA 4O0YA 5HIEA 4FVRA 4U41A 5HNIX 4I6QA 2W99B 1R0PA 4L7FA 4FEUA 4O7SA 4R77A 4BI2A 4FKPA 4L6QA 1XBCA 3QTUA 1IASA 4RC2A 1PXLA 2CJMA 4F6SA 3D5WA 4HPUE 3PLAE 3LJ1A 4EGJA 2P33A 4EOSA 3HECA 4RX9A 1LUFA 3PRIA 3F5PA 3O51A 2CCHA 4OTIA 3RHKA 4BZOA 4TPTA 2W71A 3HV4A 4ACHA 4NL0A 2G2FA 5A3XA 4O83A 1JDEA 1CKIA 2WPAA 1J7IA 3AQVA 3FXXA 3GB2A 4B99A 3F61A 3UOJA 4PWNA 3DFAA 4EHGA 1WVXA 5EM8A 4G17A 3AD5A 3OXZA 4IDVA 4YC6A 2HWOA 2R3QA 3BHTA 3VPBA 2PVRA 3HV7A 4E73A 5LMKA 2ITYA 3B2TA 3DQWA 1EH4A 3Q9YA 2YDKA 5LYJF 4QYHA 2CHLA 1Q4LA 4GFOA 4YZ9A 4C36A 3HO8A 3H10A 3KMWA 3ZO3A 4ZZNA 2UW4A 4I0TA 4CLIA 3NVKI 2WMRA 3R1QA 4EH4A 2AUHA 5HIDA 4QMWA 2WMSA 3AXWA 5FDPA 5A4CA 3Q2MA 2W1DA 5K5NA 3NIZA 3U51A 4O38A 4MK0A 2FYSA 5DH3A 4IADA 4HGEA 3KCFA 2IVTA 3VUGA 2E9NA 1QL6A 3EN5A 1BMKA 3FMNA 4X3JA 3CQEA 3ZO1A 5KBQA 2W70A 4DBXA 2I0YA 2XRUA 4JIKA 5IG1A 5JVDF 4O0XA 2J6MA 3HMMA 3IW4A 3V5TA 4ZTMA 5HORA 2C0OA 3ZTXA 4FTJA 5HEZA 5K5XA 4IIJF 2XKCA 3BX5A 3MVMA 5DI1A 2UZWE 2HCKA 2QF7A 2HXLA 5HCXA 3RJCA 3WE8A 5M08A 1O6LA 1OB3A 2B52A 5M06A 4QQTA 4IX4A 3A4PA 2P2HA 2CMWA 2CLQA 5IA2A 2OW3A 5DIAA 2YIRA 2QODA 4FV7A 4H05A 2JDVA 3F7WA 3EQCA 5M4CA 4P2KA 3U8WA 4MXAA 4B4LA 2C6KA 3H3CA 5L8JA 3H0YA 4G5PA 4N6YA 4AE9A 3KAKA 5E8UA 4I50F 4A4XA 3IDBA 3UO4A 5CAPA 5IEXA 5LWNA 4KRCA 5CEMA 5B2MA 3WOWA 5CU0A 3WO0A 3AOXA 3FI8A 3R71A 4CFWA 4CT2A 5JSMA 4RIXB 5C03A 3IPHA 4MXYA 5D9HA 3KULB 5CEPA 4FSRA 2VWZA 3A2CA 2NPQA 4YJVA 3FLYA 5AV2A 2PVHA 4CTCA 2WEIA 4EUUA 3HX4A 4EOLA 5CNNA 3VVHA 3LFBA 4WNKA 4G3GA 1U5RA 4GIIA 4S34A 1LPUA 3VBWA 3ZXTA 5HE1A 3PWDA 5I4NA 4AW1A 2ZM1A 3MJFA 4U97A 5JFWA 2OFUA 2CN5A 4O21A 4D0WA 2PVJA 4C5AA 3R6XA 2ZJWA 3BU3A 3IQ7A 3IKAA 2H6DA 5AP7A 4L53A 4BBMA 4XV2A 3ALNA 3FV8A 3OW4A 4IZAA 5AV1A 4ZIMA 5EG3A 3VS4A 3BKBA 4H58A 3CTJA 4RFYA 2VTJA 4R5SA 3NW6A 2I1MA 1IRKA 3RMFA 4EH3A 5BUJA 3MH1A 3C5IA 4Q9ZA 2QR7A 3P1AA 3OCTA 5CY3A 5GNKA 3UFXB 4NCTC 1UKHA 3NNXA 3EZRA 4QMSA 3T3UA 1JLLB 3GENA 5EI6A 5LOHA 5CLPA 3OUZA 3A7IA 5E8YA 4AN9A 3O17A 4I24A 4JDIA 4MNFA 4JXFA 4LL0A 1JPAA 3RV3A 3CY2A 3BGQA 2GDOA 3GU7A 2JKQA 4IIRA 4XX9A 4ZSLA 4BGGA 4GKIA 4DF3A 1YWRA 2E9PA 3ALOA 4DLJA 2QU6A 2UZNA 5L2SA 3VS7A 3QD2B 1JNKA 1XHAA 5HVYA 2YM4A 3UQGA 1O6KA 3KRJA 3LE6A 3OWKA 4K11A 2W5HA 2JFLA 1BUHA 3R00A 3QZGA 4FEXA 1NXKA 4AX8A 4R3CA 4PTCA 4TKSA 2E9VA 1Z5MA 2JIVA 1SNUA 4HYUA 4NKAA 4XG9A 5H8BA 4BCKA 3ZFXA 3KCKA 1U54B 5IA4A 5E1SA 5HCZA 3SG9A 3SXSA 5M56A 5JRQA 3WNZA 3BI6A 3O50A 3HGKA 4PQNA 4EH6A 1BL6A 3QLFA 2O8YA 3WZEA 5HU9A 4J8MA 2R3LA 3QKMA 4BZDA 4DH1A 3C0IA 4UBAA 5F94A 5GJDA 3ZO4A 4K77A 4K8AA 2CPKE 2C5YA 4BRXA 1BXRA 1E9HA 4XH6A 3EH9A 3R63A 3A8XA 4DBNA 4FFMA 2VTIA 3A8WA 4YTHA 4FZ7A 3G0EA 4X2NA 5IMEA 4J97A 3QCSA 2A19B 3OWLA 2GS2A 2YM5A 4EH8A 4G31A 4YJ2F 5J2TF 4YR8A 4U6RA 2YIQA 3F88A 4ZZMA 1R39A 3ZRKA 2P3GX 2V0DA 3VW8A 3W2CA 4BB4A 3LMGA 2ITPA 1UNGA 1UNHA 3SW7A 1VKZA 4ZTSA 3ZUVA 3Q9XA 4BDIA 3L9LA 3RK9A 5HX6A 2J5FA 3CGOA 3PSCA 2RIOA 5JZNA 4AA5A 2CLXA 2XIXA 2XKEA 3HDNA 3OXIA 4X6QC 4AN3A 4OUCA 4QMZA 4AT4A 2WTJA 3MH3A 4S30A 3R73A 4CT1A 3OG7A 4D1XA 5A4QA 5JH6A 5TR6A 4EC9A 3R7EA 4D9UA 3VS2A 4JBVA 4IM0A 4P90A 2XIZA 4HCVA 3AT2A 3ATSA 4ZSGA 5KMNA 5J8IA 4RWLA 2C0IA 1ZOHA 2WTVA 5DEYA 3RNIA 4FG8A 3OCBA 1YDTE 5CXHA 3ORMA 2R3FA 3JRWA 1M52A 4LUEA 2W4KA 1MRUA 2X2KA 3EWHA 4IDTA 1ZMVA 4ANQA 5HD4A 4Q5HA 3WF6A 4QYYA 4YPSA 5HG7A 1SCUB 3PJ3A 3RM6A 2J9GA 4GYGA 3MA6A 3DDPA 3GOKA 3DK7A 5J95A 3R9NA 3SOAA 4MNEB 2PUIA 2PVMA 4L7SA 5EI2A 2YABA 1JSUA 5HICA 2XB7A 4AN2A 5LJJA 3ZRLA 4JBPA 4MVFA 1KE8A 2G15A 5KHXA 4GEOA 4O22A 4P4CA 5DEWA 3OCSA 2CKEA 3NCGA 5J9LA 4M8TA 3ZHPC 3UODA 3QFVA 4GRBA 3I7BA 2WMWA 4O27B 4XG2A 4TV9F 4G3DA 3E8CA 3PDTA 4IH8A 4IVCA 4KBKA 5AP0A 2OFVA 4O6LA 4C02A 4CSVA 3AX6A 3MWEA 3HLLA 2XK8A 5DWRA 3QRIA 4GG7A 2FH9A 4G34A 5AFVA 5HNGA 4RWIA 3UNJA 5DR2A 3NUNA 5L6OA 1ZMUA 2NUAB 3SHEA 3NUSA 3BWFA 3GC0A 3H9RA 2FUMA 4TYJA 5ACBC 5CENA 5C4KA 5L8LA 1YXTA 4C35A 4XJ0A 5CF8A 3HMIA 3U6IA 1MUOA 3ZC5A 4I20A 4LG4A 5ITAA 2GNLA 2R87A 2UW0A 3AT3A 3QTQA 3G15A 3E5NA 2QOIA 2VUWA 1KWPA 2J50A 3UVPA 4EJ7A 5BVOA 3C4WA 4D5HA 1RE8A 2YEXA 4YTFA 3GFWA 3MESA 3K5VA 4HR7A 2QKRA 2ZV2A 1XKKA 2V62A 4L43A 1M0TA 4GS6A 5B2LA 2YFXA 2NU9B 2XKFA 3C51A 3MBLA 5EOLA 4YZDA 3VO3A 2WQNA 4AOJA 4BCQA 1W96A 3PRFA 1Q8YA 1IOWA 3K3JA 1RQQA 4WD5A 3RPOA 1Y6BA 3ELJA 3N8DA 4W8DA 3UGCA 1J7LA 1ZOGA 3V5QA 4CMOA 5IUHA 1CKJA 4FX3A 5C8MA 3JY9A 1U59A 4I5CA 3ITZA 3LQ3A 4U0IA 2VX1A 3NYNA 4EOIA 2B53A 2NRUA 4E93A 2X2LA 3Q4TA 4XLVA 3UG2A 5KNJA 4FVQA 2ZAZA 4FTUA 4AS0A 5DN3A 4TTHB 3NIEA 4LV5A 1Y91A 1ZRZA 2WTCA 4U79A 4ZTLA 5KKNB 4DLIA 3AC8A 2BVAA 5FP5A 2O2UA 5A6OA 3MY5A 3TUDA 3LWBA 2WZJA 1W98A 4RBLA 4RPVA 4WBOA 3ZLYA 3O8PA 3PLSA 2R7IA 1F5QA 4QP8A 3PXYA 4Y46A 4ZTNA 3MFSA 1UU9A 3HKOA 2UW8A 4YJPA 5DR9A 5EKOA 5DPVA 5EZYF 2J4ZA 4I0SA 4LMUA 4CMUA 5C1PA 1FBNA 2JIIA 3DS6A 3IOKA 5AX9A 1Q41A 3E7VA 2YM6A 3WF9A 2R82A 2XEYA 4FA2A 1NVRA 2AC3A 2F57A 3IGGA 4FSYA 5IQHA 3R1NA 5IQAA 3VUHA 4PL5A 1Q3DA 4S33A 5AUYA 4ZP5A 5IH5A 4JDKA 3UQFA 1PXIA 2B4SB 2BIYA 3G2FA 5EYDA 4J71A 4MWIA 3G0FA 3OBJA 2XYNA 4YZBA 3KALA 4V05A 3E3BX 3PG1A 2Z2WA 4O0WA 4YHJA 3F3VA 4N6ZA 5DNRA 5M44A 3OBGA 4GU6A 4QNAA 1XJDA 4O7TA 4XG7A 2PZ5A 4E5BA 2PZIA 4XYLB 1OIUA 4O96A 4G1WA 4YHTA 3KB7A 3U9CA 5BPFA 3LXNA 4PDPA 3HV6A 1NW1A 3ORKA 4DEAA 3QUDA 2XD4A 2VTLA 4RIWA 3ZH8A 4ASDA 4WNMA 3TACA 3KC3A 3PXZA 1JSTA 3UJGA 1PHKA 3BHYA 3BLQA 4NJDA 2W5AA 2X4FA 5CALA 2W6PA 2B1PA 3MH2A 4NT4A 3FE3A 3RP9A 3ORXA 4NSTA 4EH7A 4FKGA 3LHJA 4OTGA 3SGCA 1E1XA 3VJNA 3QTZA 1Y57A 2QOCA 2RKUA 3DBCA 1STCE 4FZ6A 4BN1A 1KBLA 4IAKA 2QKWB 3JYAA 3UIBA 1RW8A 2OGVA 4RFMA 5AEPA 3WI6A 2XNEA 3OS3A 2O0UA 4WSYA 4GUBA 4YNEA 4F9WA 5J5SA 3B8QA 3ULZA 4XZ3B 2PY3A 4XOYA 2HY81 4BCGA 1ZYCA 5CA0F 5KMIA 5JGAA 4TYIA 1SVGA 4D9TA 3R5XA 3U4UA 3VS0A 2OKRA 4KB8A 4LL5A 5CASA 3VOTA 4DG3E 3UE4A 2XCHA 1UA2A 1NT2A 2YACA 2YDIA 2X6DA 2XK7A 2V5QA 4I5HA 3EJ1A 4JVGA 4MYGA 5FD2A 4YMJA 2W06A 1H28A 5CI6A 1OM1A 3PP0A 3D7TA 4D4SA 3SD0A 3DXPA 3F5GA 4U3ZA 2ESMA 4M0ZA 3LXPA 3ODYX 4O7LA 2CKPA 3AC1A 2YJSA 3LXKA 4PL3A 4YTIA 5K9IA 3L8VA 2WGJA 5CF4A 3R22A 3PVGA 4XLIA 4YO6A 4A06A 3THBA 5JQWA 3WBLA 3NPCA 2ACXA 4C2VA 2XMYA 5AP5A 4F9YA 5IEYA 3BLRA 3ORZA 4IE9A 4M84A 4P5QA 3GIDA 3N6RA 3SX9A 3BU6A 5FM2A 3FLQA 2O63A 2R85A 3V6RA 3TDWA 4IFGA 2JDTA 3OOGA 3S95A 2XH5A 3LMHA 4CG8A 4BVUA 3QZIA 4EOQA 3VBVA 5LVOA 4QMOA 4PRJA 4MA5A 4WUAA 3UMWA 1Y8GA 5K4IA 4FYNA 2JKKA 3JR1A 4UZHA 5AM7A 2ZDGA 4AA0A 2FSOX 4TN6A 1VBGA 3BHVA 4G5JA 3E88A 4MTAA 1OKYA 3LIJA 1IA9A 1UKIA 4XV1A 5E8VA 5LCKA 3DAKA 4IFCA 4BCNA 4II5A 4F9CA 4O0RA 3R9OA 5EDQA 2XM9A 2IO6A 2DIKA 4NM7A 4J96A 3DCVA 2O65A 3FLNC 4RIYB 3II5A 4AW2A 4ZJVA 4NIFB 3WILA 4ALUA 4ZOGA 3BV3A 3F3WA 4MH7A 1M14A 2R3PA 3BIZA 4IC7A 5B7VA 2O64A 2YCQA 3VW6A 3MIAA 4DG2E 2ITXA 5F4NA 4F08A 2JGZA 4X2KA 1B6CB 2C6DA 2DUVA 3S00A 2B9JA 3S3IA 3WARA 2JIUA 3F2NA 1V0OA 4JRNA 2J9MA 4L3JA 4QSHA 4EZ3A 2OXDA 4YJQA 4EG0A 2X81A 4C34A 4MX9A 1JKSA 2JDRA 2ONLC 3BRBA 3WZDA 3RI1A 3GI3A 2B7AA 4XEYA 5HQ0A 3D9VA 5L2WA 2OJ9A 1MRVA 2XJ0A 2Y7JA 3PFQA 4L9IA 4X2GA 4BDFA 3D2IA 4RJ3A 1PMNA 3IONA 4IWDA 4RIWB 1UV5A 5CU6A 4E8AA 3DF7A 1WAKA 2XA4A 4TYHB 2OSCA 3CS9A 4BI1A 3TUCA 2HIWA 4ZQIA 2PK9A 4D2SA 4X2FA 2ZOQA 4QQCA 1P5EA 1KV2A 1OKWA 4PTGA 3GQIA 3FKLA 3ZFYA 3JPVA 3VIDA 5C4LA 2R86A 2BZHB 1OITA 3V5PA 3OVVA 3VJOA 4MA0A 4GCJA 4WBNF 4FTNA 2ZM4A 5HBRB 5CA1F 3CBLA 3MFTA 4FUYA 3GQLA 2P0AA 3MTLA 5FTGA 3ZUUA 1TQIA 3NAXA 4N57A 3ZOSA 4E7WA 1R3CA 3ERKA 3WIKA 5CAOA 5CAVA 5HIBA 3U54A 2J0IA 2OXXA 4R78A 3VF8A 1OPKA 2OO8X 4TY1A 5IEVA 2WXVA 3GU6A 4C4HA 4DIMA 3LJ0A 4FV6A 2I6LA 4U42A 4XX0B 1PMVA 2OWBA 2UVZA 2BFYA 3G6GA 3IS5A 2IW8A 3LM5A 3RAKA 4HJOA 4L8MA 1OPLA 4BDBA 1T36A 5DR6A 2HELA 3TT0A 3LM0A 3UO6A 2YDJA 5F1ZA 1GSHA 2J90A 1WBOA 1GSAA 2Q83A 2IW6A 3BE2A 3HMPA 4BTMA 5AV3A 1GY3A 4EOMA 4XRJA 4RJ6A 5E4HA 5EW9A 4AGUA 2A0CX 2UZLA 3KF7A 3CGFA 3G6HA 4PNKA 2QOKA 5CAUA 3UQCA 3QX2A 4I23A 2ZM3A 2C6OA 3D7TB 3ZFMA 2V7OA 5HTCA 1GNGA 5F9EA 1SVHA 4LOPA 4O7YA 4FIJA 3BGZA 3EHAA 3OFMA 3BE9A 3NWWA 4MF1A 3UIUA 4FKUA 4QOXA 1H27A 2C3KA 4DCAA 3OOMA 3HUCA 2G9XA 4EOJA 3Q4ZA 4O82A 4FT5A 1KJIA 5CXZA 5C8YF 5HI2A 3EYHA 5IA5A 5M57A 4F4PA 5BVDA 3D0EA 4L52A 4TRLA 4F6UA 5JVLA 2WFYA 3DY7A 2WTDA 3MYGA 3TG1A 4K6ZA 3ZM9A 2XEZA 4B8MA 2OF4A 4JL9A 1R1WA 2VV9A 2G2HA 4BYIA 4PUZA 5H8GA 4S31A 3UNZA 2OF2A 4C4IA 2VQDA 3G8DA 3DDQA 4IWPA 4F7JA 1YHVA 1J1BA 2PUUA 2ZDTA 3KGAA 4D55A 4JQ8A 4LOOA 2XUUA 3FJQE 3G33A 3RK5A 3TKIA 3UC4A 3EQRA 3HVCA 3R5HA 4FFPA 4C3PA 3W1FA 2XZSA 2I40A 5GIPE 4U5JA 3IW8A 3A4OX 3PVBA 4F1MA 4R1YA 3ZU7A 2BRBA 4A9SA 2PWLA 2VO7A 3OCGA 4XV3A 3PZEA 1CMKE 5FXRA 2WMVA 3LPBA 1BNCA 5C1OA 3HA8A 2YIXA 3ZLXA 3RHXA 5KMJA 1ZARA 3C4ZA 3FI3A 3JVRA 2BDWA 3Q60A 3O8TA 4GKHA 4KABA 4XHKB 2X8IA 3QLGA 4RWJA 4CTBA 4JQEA 4IWQA 3L8XA 3QBNA 4HVDA 4FTQA 2JDOA 3UZTA 1YWVA 5A9UA 2QLUA 4OTDA 5HLPA 4D1ZA 4Z7GA 3PIXA 4D58A 3DV3A 3IECA 4XBUA 4U80A 1JKKA 5KUPA 4CV9A 1SYKA 2KTYA 4O7RA 1JQHA 1H01A 5JEBA 1RJBA 4F64A 2C5OA 3PE2A 4Q2AA 4BGHA 2R3RA 4E6AA 3TZ7A 5A4LA 4OTFA 2OZAB 4KAOA 4F65A 3E87A 5E1EA 2EXMA 2XCKA 4ZEGA 4YTCA 5A4TA 4NYEA 3NYVA 4F7SA 2W6NA 4DFNA 3AGLA 1Q61A 4HGSA 1QPDA 4EZ5A 5ANEA 4L00A 2WMXA 3C0HA 4KBAA 4IB1A 4R7BA 4WO5A 3IK3A 4W4VA 3SG8A 4MV6A 2YRXA 1XO2B 1SVEA 2EB3A 5DT0A 4ACDA 4U3YA 4APPA 3HL7A 3CD8A 1P4OA 1ZZLA 2JDSA 3O7LD 5AUWA 3QHRA 4YJOA 2I80A 2KULA 1H1WA 4QMYA 4X3FC 5ANOA 4DT9A 1OIYA 2BIKB 3DKGA 4MXCA 3A7JA 4AFJA 1KEEA 3DJ7A 3EKKA 1PXPA 5JQ8A 1J3HA 2WQOA 3QXPA 2HOGA 4QPSA 3D4QA 4EWQA 2UVYA 4O84A 2QOQA 4QMQA 3PE1A 3R9DA 3A62A 5D11A 1Q3WA 3P78A 3C4FA 4HCTA 3CKWA 3VF9A 1PRYA 3ZSGA 4D28A 4DINA 4WA9A 3ODZX 2EXCX 2HW6A 1GZNA 2W5BA 3C7QA 3QA8A 1YHSA 5H2UA 3LFFA 2O3PA 4BDAA 1Q8WA 3TCPA 3W2OA 2Q0BA 4KIQA 3E93A 4BCPA 4OTRA 3U4WA 2VTHA 5KMMA 3QUEA 1GSOA 3GOPA 4H1MA 3BBTB 3FSKA 3FXWA 4O81A 4CZTA 3C4XA 3BYMA 2Z7SA 4X3FB 3V5WA 4FV5A 3TWJA 5EM6A 4DAWA 3WIGA 1OL2A 2LGCA 3I81A 3ANQA 4FTRA 4LV8A 4PTEA 3JRXA 5TOZA 3KVWA 1Q24A 2GNFA 3BCEA 3TNQB 2P2IA 3P08A 3DJ6A 1C30A 5IU2A 3SRVA 3ZCLA 2WEVA 3OY1A 4JG7A 4FEVA 4L68A 2QD9A 5LARA 4A9TA 4GMYA 1ZOEA 3ORNA 5JK3A 4BY9E 4KIOA 3E92A 4Y5QA 2V5AA 3B2WA 3DT1A 4XRLA 5E8XA 4E4NA 2FSTX 5CSPA 1NVQA 3QF9A 4L3LA 3TV6A 4H3QA 4AGCA 5HG9A 1NA7A 1JKLA 3AC5A 3MGYA 4DCEA 4HCUA 1JWHA 3F82A 3QTXA 4U40A 2VU3A 3QZHA 3TTJA 1PKGA 2IZSA 4IB5A 4YJNA 4I93A 3PYYA 5E7RA 1Z57A 1AGWA 2OJIA 3TM0A 2B55A 3KK8A 4YPDA 5FRIA 4GH2A 2GHMA 4IBMA 4L46A 4RGJA 4D4RA 4PP7A 3TUBA 4AQCA 4DGMA 3R7UA 4NK9A 5CEOA 3V4ZA 2R4BA 4PDOA 4FODA 1Q62A 3DA6A 4ASXA 1GLVA 3QQJA 4FKOA 5IYZF 5JQGF 4EI4A 4JQ7A 1GGOA 3R7VA 5GJFA 4AZVA 4ME6A 3AGMA 3JUHA 4XYMB 4YAJB 4WHZA 3EFWA 3G9NA 3VUMA 1YI3A 3I79A 4CRLA 1I7NA 2QO2A 4MKCA 3VS6A 3F3TA 4RZWA 3CEKA 3HV5A 4FT0A 2LAVA 2PHKA 1DI9A 2FA2A 4FKIA 1QPCA 2DWCA 1PYXA 2Z7QA 3FAAA 3WF5A 2PZRA 5DRBA 2VGOA 4I92A 5ACKA 5L3AA 2GTNA 4LMNA 3V8TA 2C30A 3TNWA 2BALA 2GFSA 5AP3A 2VTSA 5HTBA 2NP8A 2GCDA 3D14A 5AP6A 2BRHA 5JN2A 2VD5A 4G9CA 4PV0A 3GXLA 2QO9A 4RX8A 1PK8A 4XP2A 3W10A 5AX3A 3ZXZA 5G1XA 3PSBA 4RVKA 1KJQA 1TVOA 4FSUA 5E8ZA 2PE0A 4ACCA 5C26A 3TIYA 4M3QA 4XG6A 1DM2A 1V0PA 3EIDA 1UWJA 4YGAA 4G9RA 3QL8A 3H4JA 4FEQA 3GCSA 1KE5A 2YAKA 3BBWA 3JZIA 1Q99A 2A1AB 1BKXA 3MB7A 4KRDA 5I5ZA 5CWZA 1R78A 3BEAA 4ASEA 3FLSA 4FFOA 2I87A 4ERKA 3FQEA 3MDYA 3EKNA 4MEDA 3V5LA 2G01A 2UW3A 4L67A 4WNOA 4C3FA 3UZRA 3GT8A 4O2BF 3ETAA 4JDJA 4DGGA 4D5KA 1FINA 1J1CA 1WVYA 2AYPA 2O5KA 3FZRA 4WT6A 1APME 5IDPA 2V7AA 2BILB 5AUVA 5AJQA 5IQCA 5LMKC 2AC5A 5LWMA 3TXOA 2R3OA 3BEGA 2PZPA 1KE9A 4FT3A 4H3BA 1CQJB 5BYYA 3KMMA 2PMOX 3M42A 4CFFA 1G8SA 5L6WL 5JZJA 3UPZA 1PXJA 4FIIA 4MBIA 5B2KA 5GIOE 2RFNA 4XYFA 2W6QA 1NY3A 4PDYA 5CAQA 3D94A 4QP1A 1EHIA 2UZTA 3ZONA 5EDPA 3K3IA 5IQFA 4C4FA 3EN6A 3TINA 4FZFB 2VWWA 2J0KA 2X8EA 3ZZWA 1H1QA 1GIHA 3CPBA 4CKJA 2YS6A 3W55A 4AWIA 3EQFA 4ZLOA 3U55A 2BAJA 3DFCB 4GT5A 3R0TA 4GK2A 3U9SA 4IX3A 2VO0A 4IVAA 5FDXA 1HCLA 4RVLA 3FYKX 3ET7A 3CR0A 4CKIA 3K2LA 4H36A 4W4WA 4I4EA 1JAMA 3H9FA 4TUYF 4M9UA 3A7HA 5CEIA 4WG4A 5J9YA 3DK3A 1KOAA 4EK5A 2I8CA 2BRGA 5H3QA 5EQYA 3V04A 5HCYA 5EHOA 2I0VA 3EYGA 4QTEA 3MN3A 3MVJA 4CEGA 1XH8A 4DC2A 3NRMA 3L9NA 3OTUA 5KO1A 2YZLA 3N9XA 4UX9A 2R3MA 3R28A 4TYGA 4DHFA 4HW7A 1PYEA 5LXTF 4GUEA 3R1SA 3SLSA 3AMYA 4QYGA 4RWKA 4Z55A 3OC1A 2Z7RA 2BHEA 4ID7A 4O4LF 4FFLA 2IVUA 5EK7A 5CSWA 4UN0C 3PJ1A 4IB0A 2IN6A 3CLYA 2PE1A 3VRYA 4DH7A 3KL8A 3KXHA 4G6NA 4MBJA 3R8LA 2GFCA 3PY3A 4EJNA 2F2UA 2FGIA 2UZUE 5M09A 5BYLA 4C37A 4JG6A 2Y0AA 5IPJA 4E6QA 5JT2A 2BZKB 5ANIA 4C33A 4D4YA 1WR2A 4DEBA 3PG3A 1M2QA 3ACKA 3WYYA 4AACA 2UZEA 2VTAA 2VTNA 2NNWB 3LFQA 3F7ZA 4FKJA 3A7GA 3ZM4A 5DFPA 2FPIB 3U9TA 3VPCA 2WMBA 1W8CA 4ZLZA 4C62A 5AM6A 4BKJA 2YERA 1DAWA 4ZSEA 3DTWA 1X8BA 3MTFA 2WAJA 5JRSA 5EYMA 2FVDA 4Q9SA 3BV2A 3NNVA 1J7UA 3MFUA 4DTKA 2QLQA 4Q5EA 3V8SA 5BVNA 1M2PA 2BAQA 1YOLA 2BRMA 2VRXA 3CIKA 3D7ZA 3IW7A 3VC4A 1SM2A 4FIGA 2C6TA 3ZBFA 4GVJA 3EFJA 4R7HA 2GLTA 3O23A 4AW0A 3FMHA 3BZ3A 1H25A 4LRJA 3D5XA 2QURA 3TJCA 4A4LA 4ANBA 4BCHA 2VTMA 3DAJA 4RVTA 4EBVA 4GT4A 3PJ2A 3EQHA 1XBAA 3ZMMA 4MV4A 2C3LA 2QNJA 4I6FA 4YJ3F 5IQEA 3SQQA 5T3QA 1TQPA 2X4ZA 5BNJA 2JEDA 4IZOA 4Y72A 2PVLA 3CJGA 3WZKA 4RT7A 4CFVA 1AUVA 5DT3A 5EI8A 3QQGA 4FTMA 3ZS5A 3SVVA 4C5BA 3P4KA 4Z7HA 3HEGA 4XG8A 3QXOA 5AP4A 2R3KA 1REJA 2YYAA 4O91A 4EK3A 5DHJA 1L8TA 3W2SA 5BVEA 3IO7A 4BHNA 4E20A 3U6HA 4S2ZA 4CLJA 4ZK5A 2IP4A 2PZYA 2NO3A 2C5NA 3LCDA 3PXFA 4JAIA 4LFIA 2B9FA 3WE4A 4YC8A 3HUBA 3G9LX 5HG5A 5IMXA 3VA7A 4IHJF 4I0RA 4MV9A 5L2TA 3EB0A 5CSVA 3FC1X 4M13A 5AIKA 2OG8A 4ZSAA 4ANSA 3C1XA 3AC2A 2VX3A 3OROA 4XBRA 3C0GA 5LVMA 4YB8B 3LQ8A 2ITVA 5I9XA 3ZEPA 4JT3A 1OGUA 2Q0NA 3UOHA 3AMBA 5I9UA 4ANMA 3TIIA 1A06A 2HZ4A 3FUPA 3ZEWA 3DTCA 4DA5A 1YOMA 5LMAA 5FP6A 2VTQA 3VBXA 1SMHA 4QMMA 4CFNA 4I4TF 3L9PA 2W1ZA 4JS8A 4BC6A 4E6DA 4F0FA 4FUXA 5JGBA 2DZDA 4FK3A 2ITQA 4OTHA 4C3RA 4A9YA 1MRYA 4CNHA 3LLTA 4X6RA 1Y8YA 4BTKA 1K3AA 4QMXA 3ENMA 5HBEA 4OTQA 1CS0A 3Q1KA 2R7NA 3HDMA 3MA3A 3JXWA 4EK6A 4ZI7F 4O0VA 5KMLA 2GHGA 2JAMA 2UZBA 4BIDA 3RUPA 4FBXA 4OLIA 3ZDIA 2RF9A 3QQHA 1GJOA 4FTIA 3NNUA 4ZHQF 2OJGA 2VX0A 5AMNA 1VR2A 2C3IB 4DYMA 5DA3A 1KE6A 4MV8A 3POOA 5E8WA 5E8TA 3QRKA 5CQUA 3QRTA 4KSPA 1E1VA 3CPCA 3FKNA 4J98A 1YQJA 4FV2A 3O71A 5FEEA 2QOOA 2F2CB 1R0EA 3Q9ZA 4WNPA 1UU8A 2ZB0A 2WIPA 4F0IA 1OIQA 1VYWA 3OMVA 4J1RA 4BDKA 4FV0A 4MD7E 1ULZA 2H9VA 3TDVA 3MVHA 4K18A 2ITWA 5KKRB 3W8QA 5DT4A 1OMWA 3EQIA 3HB9A 2J0MB 4DFYA 4QMPA 3VRZA 3QTIA 4USDA 4BHZA 5AUUA 4XOZA 4DEGA 2Z8CA 3ORPA 4I6HA 5IZFA 1UNLA 3IDCA 3NUXA 4MAMA 2YAAA 4QTDA 3BQRA 1BX6A 4DEEA 5DE2A 5EOBA 4EKLA 5CAEB 3MY0A 3FZOA 4MV3A 4EOOA 3EN7A 4FIHA 4WRSA 2QR8A 3BYOA 5DG5A 5AAEA 2JKMA 1FGIA 2QI8A 2XNBA 3AG9A 4EOPA 3BG5A 3KXXA 4CG9A 5H80A 4QP3A 3ORTA 2WO6A 3WF8A 5GINE 1WBSA 4IQ6A 2J0JA 4DEIA 4OBOA 2UW7A 2GNHA 1PXOA 3DU8A 4GSBA 5DVRA 3RWQA 2YISA 1Z2OX 5LQFA 3JVSA 3R30A 1T46A 2EUFB 2HZ0A 2JD5A 4BGQA 2WOUA 3P7AA 4QMVA 2XYUA 5EYKA 3Q6WA 1UU7A 4BICA 4FNZA 3RCDA 3ATTA 1LEZA 3BYSA 5E8SA 4EWHA 4FL3A 2H34A 2QHMA 4W4YA 5M4FA 3L9MA 3MWDA 4FTLA 3QU0A 2PMLX 2PPQA 1I7LA 4RA4A 4AOIA 5HV6A 4ZAUA 3L8SA 4K2RA 2DQ7X 3FQSA 2H8HA 3MS9A 4A9UA 4FSTA 3REPA 1P2AA 4H39A 5CB4F 4M69B 1GIIA 4IZ7A 4IAIA 2PUPA 1V1KA 5D7VA 4YSJA 2OU7A 3MH0A 5CANA 4BR3A 4DEDA 1XQZA 4GK3A 4L1KA 2BAKA 3HV3A 1OUKA 2C6IA 5FBOA 2FB9A 4RVMA 3OD6X 4R3PA 4QP6A 2JBOA 3SKCA 3GCPA 2YITA 4R5YA 4ITHA 1KC7A 3G5DA 5FTOA 2ITOA 2HWPA 2GNIA 4BCIA 4EYMA 4IAAA 2C68A 3OWPA 1O6YA 5CVFA 3VS3A 4RC3A 3B8RA 4JIAA 5IA1A 4G3CA 2OH0E 5EKNA 3MY1A 2YZMA 5BMMA 2QO7A 1TQMA 4ZJJA 2VN9A 2ZV9A 4EZ7A 2C69A 4K0YA 4NJ3A 4YJUA 5DGZA 4BI0A 4BDDA 3RPVA 3ZO2A 4FV3A 3FY0A 4KINA 2IJMA 2SCUB 1I44A 2VWYA 3DZOA 5AIRA 4IVDA 4IZYA 4QRCA 3TNPC 2PVYA 4FKLA 2X8DA 3SA0A 3CTHA 5CS6A 3D5UA 1PMUA 4J53A 4HZSA 4RJ5A 5HVKA 3E5AA 2QHNA 3NW5A 1W84A 3PIYA 3Q32A 4FL1A 3TJDA 3ROYA 3DB6A 3QALE 4G3EA 3OEFX 2ITNA 2BZIB 3KAJA 3GC7A 2JBPA 2VNWA 2V59A 2X6EA 1OUYA 4FV9A 4ALWA 3PA3A 2GMXA 1K2PA 2BTSA 5EDRA 4F1TA 2WTKC 3QX4A 4TNDA 2OXYA 2R7BA 2PSQA 1IR3A 2XIRA 4FSQA 1FMKA 4JDHA 4MQ1A 4A7CA 4CCUA 2W4JA 1HCKA 2OLCA 3ZBXA 3FEGA 2YZAA 2X1NA 4FNWA 5GHVA 4JG8A 3QYZA 4FKRA 3ENHA 2OI4X 2WQMA 2PMNX 3F69A 3PVWA 3COIA 3KKVA 5CU2A 2W1GA 3VN9A 4AW5A 2DYLA 2WU7A 2W6MA 3VHEA 4JAJA 3MJ2A 3Q4UA 3ETJA 3CC6A 5KZ0A 3GP0A 5C01A 1IG1A 4FOCA 4TWOA 2WQEA 4MXOA 1DAYA 2X7FA 1GZOA 4ITIA 2R7KA 2WTKB 5LVPA 4MAOA 2HGSA 3H30A 3RFCA 4ZMFA 2HZNA 3O8UA 4L3PA 2WQBA 4JJRA 1P4FA 5FBNC 3VHKA 4XP3A 4ZJIA 2ZDQA 3TZ8A 4FKVA 3D2KA 1CE8A 3PXQA 4DH5A 5F20A 3LJ2A 4V0GA 2F4JA 5DLSA 3VBTA 3LCKA 4EH9A 4QP2A 4Z3VA 2EB2A 4UV0A 1YXUA 4BIEA 5LXMA 4L01A 4U81A 4BDJA 4EKKA 4MXZA 4HVGA 3EOCA 2PBZA 4ONAA 1VBHA 4DGNA 5CZIA 4FSNA 4LGGA 5DOSA 2IZTA 3W2QA 1M6VA 2A2AA 1B6SA 3AW8A 3DPKA 2CKQA 3E8DA 2DS1A 4RG0A 4I22A 4YSMA 4BDCA 4C4JA 3DXNA 1YDRE 4E5AX 3VUKA 3NZ0A 1BYGA 3UZPA 4OTWA 2WU6A 2FO0A 4APCA 1OECA 2WNTA 5CVGA 4F63A 4YJTA 2JC6A 4UXQA 4ZY6A 1PXKA 3RPYA 4J95A 4PNIA 3QAME 1KV1A 1JDBB 2YIYA 2HY0A 5AV0A 3GCUA 5FUTA 2ZV7A 3RPRA 4WUNA 1YXXA 1C3OA 4IJPA 4RZVA 1IEPA 5BVWA 3FMKA 3UO5A 4GYIA 5ETAA 3PJ8A 1YI6A 4ZS0A 4EHVA 3KY2A 4GG5A 3C9WA 4RQVA 4HNTA 2GQGA 1KUTA 4EBWA 5B0XA 2X7OA 3KVXA 3OF0A 3R83A 1ZWSA 4TW9A 5BPHA 5C1QB 4ZTRA 4ZTQA 3U9NA 1S9IA 4G16A 1VEBA 2HZIA 5E9EA 3GNIB 2VGPA 4ERWA 3TNHA 4QMUA 3QTRA 4YNOA 3R9HA 4IW0A 4V04A 1XH7A 1ZMWA 2VPQA 1U5QA 4EYJA 5HKMA 5C9CA 4FV1A 1Z2NX 4EGQA 4W4XA 4B7TA 3FMLA 5KHWA 4HPTE 4RX7A 3PXKA 2Y4IC 4HVHA 4ZSJA 3P86A 4KKHA 3VAPA 2GNJA 2RFSA 4PMSA 4MV1A 2WMTA 4YC3A 5E91A 2QCSA 4E1ZA 4P5ZA 1JVPP 4UY9A 3TN8A 3KN5A 3N4TA 3SDJA 3V51A 2FPPB 3PIZA 3NUAA 2WTIA 5ETIA 2EU9A 3VS5A 5H8EA 4NM5A 4IC8A 5D10A 3K3PA 2Z60A 3GVUA 1H00A 1CKPA 3I4BA 1IAJA 2CSNA 3QKLA 1OIRA 3NR9A 1REKA 4GV1A 4H3PA 2RFEA 1DS5A 4TXCA 4Z9LA 4ITJA 3RM7A 4L42A 3RINA 4AZEA 3HP5A 1PKDA 4FG7A 1JBPE 5EW8A 3K5HA 2Y4IB 2Z7LA
chains in the Genus database with same CATH superfamily
4E26A 2R5TA 2Q7DA 1BL7A 4PMMA 2Y4PA 3DLSA 1JSVA 2B9HA 4RFZA 5FEQA 3R7OA 3NYXA 3IW6A 2YL2A 3ZYAA 3HBLA 3LFSA 3F3ZA 2I0EA 3OHTA 2VWUA 4JOAA 2QOLA 1YHWA 4FVPA 4M15A 4RRVA 3UDBA 5C27A 4CVAA 5M4IA 1M2RA 3NYOA 3PTGA 4FSWA 4UWBA 1Z2PX 2OIBA 4ZZOA 3TQTA 1CQIB 3ORIA 4LOQA 4S32A 2PVNA 1M7QA 4FMQA 1W0XC 3LQ5A 2QQ7A 2A4LA 4BCFA 2V58A 2ZFYA 4WIHA 3LQSA 1EUCB 4BBEA 4KKEA 3I60A 1Q8TA 2W1FA 3JY0A 3PA4A 4N70A 3NNWA 2WTWA 2XF0A 2ZYBA 4NFMA 5L8KA 1OBDA 2RFDA 4WG3A 5L2IA 3NW7A 4FICA 3D83A 5BVFA 1Q5KA 5EQEA 4QDVA 3UPXA 3RPSA 3NEWA 4V0GB 5AUTA 3GC9A 2XP2A 4UYAA 2VZ6A 3C4CA 4GJ3A 4DFLA 2EJ2A 3FMJA 4F78A 3IG7A 3FL5A 3D15A 4PDSA 3TIGA 1H24A 1ATPE 3UIXA 4R6VA 4KBCA 5FXQA 5CSHA 2VAGA 2GQSA 2JLDA 3GU5A 3QCXA 5HESA 3SOCA 5CF6A 2YS7A 3A99A 3V6SA 3R2BA 5EM5A 5ETCA 4K1BA 5HD7A 2QC6A 5CF5A 3UC3A 3V4SA 3LCOA 3MIYA 2R3NA 3KIOC 4M0YA 5F95A 3ORLA 4M68A 2XNMA 3U87A 5CTPA 1H26A 4RX5A 3CY3A 5I9ZA 4XMOA 4L44A 2YIWA 1VJYA 3EL8A 2YHVA 3SV0A 1G3NA 3F66A 2E9UA 1W83A 3COKA 3OXTA 4K6NA 1HOWA 4DLKA 1DV2A 3RNYA 3V5JA 5DMXA 4ARKA 3HRBA 4Y85A 4YZNA 4CV8A 5I9WA 2RGPA 2CGUA 4TYEA 4F7LA 1U46A 5BQ0A 4IX5A 2XK3A 3I1AA 4FFNA 3DLZA 3MPTA 3R7YA 5AAGA 3PWYA 4QPAA 1XBBA 3S4QA 2R3GA 4AE6A 4YLLA 2RG6A 4NFNA 2XKDA 4YJRA 3VQHA 3WZJA 2BKZA 3EL7A 3KXMA 4J99A 2IVVA 4MWHA 4DFZE 3FDNA 3HRCA 3MW1A 1H0VA 4NKSA 4LQMA 4NTTA 4DG0E 4E5WA 4UFZA 2ZDUA 4DHZA 4FTCA 5T68A 2YM8A 3Q53A 4UCVA 2JKOA 2VTRA 1O9UA 4FV8A 4JBOA 1MP8A 3A60A 5HVJA 3RALA 4LM5A 3POZA 2W9FB 4P7EA 1B6RA 1WRVA 4RQKA 3COMA 2PVPA 2VUGA 5HE3A 3KEXA 3COHA 2B0QA 3T8OA 2OICA 1KE7A 4FNYA 4IVBA 3AD6A 4QNYA 2DLNA 3FLZA 4I55F 3IW5A 2YWVA 4GFMA 4ASZA 4I5MA 4IMYA 3G51A 3RK7A 4NCTA 4KD1A 2PVKA 3QQUA 4NZWB 4HVSA 3EFLA 4RJ4A 4RJ7A 1U54A 4XNEA 4YU2A 1W7HA 1GZ8A 2XANA 4RLLA 3VWAA 3FI4A 5IH6A 3R8ZA 3BU5A 3LW0A 4C0TA 4C58A 2ZMDA 3QRJA 3AD4A 3CJFA 4YP8A 1URWA 2X7GA 4I5PA 5IISA 4ZTHA 4NW6A 4HQ6A 4FZDB 1OI9A 3E62A 3G90X 5I5SA 4RC4A 4ZS4A 2COIA 3JSLA 3R8PA 5EM7A 2YA9A 3JS2A 4QO9A 5EYCA 1A3GA 5BPYA 1CTPE 2YZNA 3PSDA 4BCNA 3OUKA 5A46A 4YURA 3EFKA 2XBJA 4DRFA 1G5SA 2FSMX 2C0TA 2WELA 3D5VA 3NCZA 4DH8A 4EHEA 5A14A 3F9NA 4AOTA 2R64A 4EUTA 3NMUF 3CP9A 3TYKA 2CGVA 1YVJA 4W8EA 2E9OA 3N4VA 4I4FA 4XCUA 5EQPA 1FOTA 4M12A 4N4SA 5HHWA 3I0QA 4AZFA 5TF9A 2PYWA 1ERKA 3EQDA 5AWMA 3SXRA 4ALVA 2ERKA 3QYWA 3A61A 1JKTA 4CQEA 1E4EA 2I7QA 4I3ZA 4BDHA 5CEQA 4O2ZA 4NM0A 3S2PA 4FYOA 5CI7A 3OT3A 4BBFA 1IOVA 3CCNA 5CU3A 5FQDC 2XS0A 2GS7A 3P7BA 1A9UA 4LYNA 3ZLWA 2ITUA 4TT7A 2IW9A 2V55A 5HO7A 4R7IA 4CFMA 3FPQA 2XIYA 3PPZA 4QTCA 3BYUA 3LFCA 4JLCA 3TZMA 4YLJA 2VO3A 2C00A 4DEHA 3TEKA 4JBQA 4DFXE 5L6PA 1Y6AA 5LVLA 3GGFA 3NAYA 2R0UA 4I41A 4YO4A 2Y9QA 3LVPA 2GS6A 2HK5A 3ZZEA 2Y6OA 2FB8A 2VTTA 4XS2A 4MNEA 3RZBA 4JR3A 4KIPA 4CGAA 4CCBA 3AC3A 5IA3A 5J1VA 3KXGA 3CSVA 3LMIA 3QCQA 3W0MA 2XK9A 5E90A 2XBAA 3E63A 4G2FA 5ETFA 2WMUA 3LFAA 2WD1A 4YUQA 3MSSA 1WZYA 2REIA 3PPJA 4IM2A 3WO1A 3PXRA 3Q6UA 3QC4A 3LCSA 3UOLA 1EZ1A 3LLAA 4LRKA 4EC8A 4USEA 4Y8DA 5JKGA 5KX8A 3BGPA 4O7WA 4FFRA 4ZMEA 4HYSA 4FKTA 5FNVF 4AUAA 3LKMA 2HW7A 4NTSA 5EFQA 2W0JA 5D7AA 2NRYA 4USFA 1SNXA 5M07A 4F0GA 4GL9A 4CD0A 1PF8A 3W33A 5CZHA 4CFUA 1KOBA 1ZYDA 3M11A 5FGKA 1EUDB 5LOVF 4NU1A 4OT6A 5AUZA 5IA0A 3P23A 1PW2A 4FKQA 2J5EA 4PMTA 2W6ZA 3FZSA 3UYSA 4QTBA 2DWBA 3SRVB 1OL1A 5HU3A 4ENYA 3FXZA 3FSFA 4WKQA 3R8VA 3TEIA 1DIKA 2DAAA 2IVSA 4EEVA 5HLNA 2WOTA 4KKGA 2JITA 2A27A 4AGWA 4BDEA 3DTFA 5TT7A 3T9TA 4F99A 1ZY4A 2CDZA 4IACA 3MFRA 4O7NA 3ZRMA 4M67A 4RZQA 5D1PA 4CHIA 1H8FA 5D8DA 4G6LA 4UALA 4I6BA 4WRGA 2Z04A 3QC9A 3GUBA 3FWQA 2HVRA 2YN8A 4AT5A 5IQDA 4UWCA 3MWUA 3QD4A 4IANA 2EVAA 3GLKA 3CE3A 1A48A 3E8EA 2H96A 4FK6A 4CFXA 4RCNA 1Z9XA 5GJGA 3ZSHA 5JFSA 1ZAOA 3P79A 4A9RA 3DKFA 3ID6C 4AP7A 2XNOA 2YZGA 5EH0A 3BABA 5BMSA 4OR5A 1Q8UA 4R3RA 2ZMCA 3FHIA 3FYJX 1OVEA 4HZRA 1S9JA 1G8KA 1YI4A 2XJ2A 4PX6A 4YBJA 2YCFA 4ORKA 1BLXA 3AT4A 3OUUA 2GNGA 3C4EA 3TTIA 3KQ7A 2PU8A 2HYYA 4MD8E 4JX3A 1SZMA 4QP4A 4L45A 2BZJA 2Z02A 5A4EA 2R7LA 4FTTA 2PUNA 3P0MA 5I5WA 2C4GA 5CU4A 3OT8A 4N0SA 2CFMA 5I9VA 3W16A 1L3RE 3L1SA 2ZV8A 4EK4A 3LAUA 4Y73A 5JFXA 4I94A 5DYJA 3R9RA 4FKWA 2W1IA 5IQGA 3R5FA 2ETKA 3R7IA 1YWNA 2XRWA 3C5UA 5M51A 3CEBA 3UVRA 5LP6F 3GCQA 4YZCA 4RIOA 3DBFA 4QQ5A 3MVLA 4D1SA 1E4EB 2OK1A 3LOKA 4EK8A 3JSNA 2WB8A 4Y95A 4FGBA 1URCA 3DAEA 3SW4A 3CQUA 2GPHA 1AQ1A 2W4OA 3OY3A 3FZTA 5BV3A 4O0TA 3R1YA 4MBLA 5A6NA 1DAAA 3NUYA 2PULA 3SAYA 5HLWA 2XJ1A 3FBVA 2JFMA 4JR7A 4DTBA 3QQLA 3GCVA 5IH4A 2BMCA 4TWPA 2HJWA 5TKDA 2ITZA 2BHHA 1YKRA 2Y8OA 3DGKA 2PVFA 3DXQA 3C13A 3W32A 4QP9A 3L8PA 5D41A 1RDQE 1PJKA 2C47A 5CNOA 1B39A 5AUXA 3HYHA 1FVVA 2C5XA 2R3JA 4QTAA 1M7NA 4E4MA 3QWJA 4Q4CA 2WMAA 4C5CA 2G1TA 3ZUTA 4LI5A 2CGWA 3K54A 3RCJA 5AADA 3LXLA 3MPMA 2VTOA 1JKJB 2HIVA 2IPXA 3T99A 2UZOA 3ROCA 1M0WA 2Y6MA 4B6LA 1P8LA 3LCTA 2VWBA 4BJJA 5JFVA 2UW6A 1ZYJA 1YRPA 4KNBA 4TWCA 2QG5A 4OBQA 2W1EA 3O7LB 1VYZA 4YHFA 4OW8A 2COJA 3AMAA 4EFBA 2B54A 2QVSE 4FOBA 4FI1A 3TV4A 4CKBA 2F7EE 3VS1A 5C8NA 4BCJA 3UDZA 4ZY4A 4FNXA 4F7NA 5C8KA 3MJ1A 5A54A 4BZNA 2UVXA 3RAHA 4MHAA 4EH2A 5LCJA 5EHYA 4MXXA 3KREA 5CX9A 1ZLTA 3W2PA 4J7BA 4CMTA 4HGLA 2YCRA 4YBZB 3K5UA 1I09A 4DTAA 4NUSA 2NU6B 5BVKA 4O2PA 1U4DA 4QMLA 4JNWA 2R2PA 4X0MA 3LFDA 4F09A 4FIEA 4FZAB 3KRLA 4B9DA 2J51A 1FQ1B 4FKSA 2COGA 4HNVA 5AA8A 2EWAA 2OIQA 1YXSA 4QMTA 1YW2A 5BX0A 4DHJA 1PX2A 2PTKA 4KS7A 4O7VA 1DV1A 1G8AA 4ACGA 4H1JA 4DT8A 1PMEA 5IF1A 3BQCA 3WYXA 5BUEA 4O6EA 4TL0A 1B38A 3W1BA 3MPAA 4DH3A 5DISC 3F2AA 3MI9A 2RL5A 5AP2A 3L2PA 2UZDA 3ML1A 4CZUA 3T9IA 4Q4DA 3HAVA 3RV4A 4E6CA 2F49A 2W7XA 3P9JA 4G6OA 4OT5A 5ANGA 3VBQA 3WZUA 3TW6A 5G6VA 2P4IA 4O4IF 3DKOA 2YM7A 4QYFA 4AZWA 5KKRC 4FG9A 3EQBA 1YDSE 3FQHA 3PP1A 1F3MC 3QTWA 4GIHA 2PN1A 4LH6A 4O4JF 2P55A 3M2WA 5M4UA 2OBJA 5ANKA 3F6XA 4CXAA 2BR1A 1WBVA 2OJFE 2C6LA 5FG8A 1JLUE 3FPMA 2ETRA 4QP7A 3OWJA 1OKVA 1ZY5A 2QOBA 2QONA 3VUIA 3ZSIA 1T45A 4K9YA 3Q4CA 2UUEA 3EMGA 3PZHA 3TNIA 4CKRA 3BHUA 3UZOA 5BYZA 3R01A 5FXSA 4O86A 3S0OA 3R21A 2VTPA 2E2BA 3OUNB 4RIYA 4IEBA 4XV9A 3UTOA 3R2YA 5E92A 3HAMA 2QOFA 4KS8A 4LDTA 1VZOA 5CVHA 1ET0A 4FU0A 5BMVF 5GONF 1LP4A 1A9XA 3CXWA 4UEUA 2C1AA 3KMUA 4O0UA 4I21A 3BYVA 3PUPA 5FEDA 3V01A 3HRFA 1MQBA 3ANRA 3FMDA 3QRUA 3QQKA 3ZDUA 1KTAA 3MV5A 4QT1A 4X21A 3QKKA 1QPJA 5FM3A 3ZLSA 3KXZA 4QMNA 1AUXA 3BLAA 2WIHA 2OIDA 3QA0A 4AAAA 3LFNA 4TWNA 4EQUA 3OP5A 1Q8ZA 3TKUA 3F3UA 3S1HA 3DNEA 3W8LA 2UZVA 5D1JA 3GFEA 4FC0A 3JZ6A 4BTJA 4HGTA 1QMZA 3R23A 4FTKA 1WBNA 1ZXEA 2ERZE 1ZYSA 4CRSA 3F2RA 3Q96A 4TYHA 5JMSA 3HA6A 4ZOLF 3HP2A 4DITA 1GIJA 1CKMA 2F9GA 2PL0A 3TW7A 3IGOA 3RAWA 3R02A 4NWMA 3NBYB 3CQWA 2OJJA 3OEZA 4AA4A 4PP9A 3KFAA 2HDKA 3W5OA 5I9YA 1FVTA 2HENA 4EONA 4MQ2A 2B9IA 2BUJA 3CD3A 4JI9A 4BTFA 2C6EA 3EQGA 1WFCA 3BWJA 3UBDA 5HX8A 4I1ZA 2ONLA 5HZNA 5HE0A 2XNGA 3UOKA 1XH9A 2QOHA 5ICPA 1KJ8A 2NU8B 4ZXTA 1H1RA 3TI1A 3KXNA 4J52A 3TY8A 2XVDA 1W93A 4GFGA 1WMKA 4X7QA 2XK6A 4BJJB 3O0GA 4U43A 4X2JA 4HNUA 1XH6A 2X9EA 3H9OA 5HGIA 5D12A 3DBEA 4DN5A 5J7HA 3QD0A 2WKMA 3OW3A 1TKIA 3SNOA 5K3YA 3DB8A 3PVUA 1M17A 3E8NA 4A07A 5HE2A 3Q2JA 1GAGA 3NX8A 3RKBA 3JZFA 4MV7A 4BCOA 2WMQA 3NFGB 5CYIA 2F7ZE 5HBHA 3UP2A 1NVSA 2XK4A 4HNIA 4HOKA 4WOVA 1H4LA 4HVIA 1GOLA 1KJJA 3DK6A 3GEQA 3NDMA 3LZBA 4IM3A 4UB7A 2CNQA 2PMIA 4KWPA 2R0IA 4QEBA 4QQJA 4GW8A 3V8WA 4AT3A 5KX5F 1KSWA 4C59A 5J1WA 3SE7A 5LA6F 3R04A 3ORQA 3R8MA 1IAHA 3ULIA 4AGDA 3KRRA 3Q04A 1UC9A 4R1VA 4GK4A 1CM8A 4O4HF 4YAKB 2R3HA 2CN8A 3CTQA 3TV7A 4HYHA 5H9BA 2BFXA 3E64A 4LRMA 3MB6A 3DOGA 3FMEA 1BI8A 4CMDA 4M14A 4GVAA 2CGXA 2XIKA 4AG8A 4E4XA 2BTRA 4OGRA 3VUDA 2PE2A 1CSNA 3ACJA 3QZFA 5IQIA 4UCTA 4E4TA 4IB3A 4U9AA 5K4JA 3S24A 3F5XA 3TKHA 4F9BA 4U7ZA 5KS8A 3O2MA 3GBZA 2UV2A 3GU8A 4GT3A 4LGHA 3T9FA 3FHRA 1CKNA 2YCSA 3I6WA 4DGLC 3DKCA 5DRDA 3RTPA 4FIFA 5CT7A 4FR4A 5JH7F 4JRVA 3FY2A 4FSZA 2W1HA 4WG5A 4FE2A 3QUPA 2CNUA 3FL4A 2CNVA 4NM3A 4YLKA 2FP4B 5J2UF 5FTQA 5CSXA 2W05A 5EHLA 1EYZA 1ND4A 2P0CA 5KE0A 3CKXA 5I0BA 1WBWA 4XG3A 4E4LA 2SRCA 4V01A 2X0SA 4U44A 4YBKA 4IHPA 3KF4A 5ANDA 3UIMA 1V0BA 2BROA 2C1BA 2ZDHA 3N4UA 4B8LA 2ZVAA 4FT7A 1OL5A 5BYBA 3OZ6A 2GSFA 3PY1A 3P5KA 4C7TA 2BRNA 5HG8A 4F1OA 4AU8A 1XDNA 3P7CA 4XUFA 3KK9A 2BCJA 5HO8A 4C4EA 4DDIA 4TV8F 4RLKA 2IWIA 2IZRA 2YJRA 4U8ZA 3SXFA 3VQUA 4U45A 4DE4A 3RWPA 1A0GA 1H1PA 2WYOA 2G2IA 3DBQA 2OZAA 4C38A 5IQBA 3W18A 3NS9A 3PY0A 4UZDA 2QG7A 1IYDA 3FLWA 1Q97A 5HNBA 1H07A 3GJXB 3QFFA 2VWXA 4KA3A 4TNBA 4GJ2A 4IJ9A 5KMKA 5JQ5A 4NH1A 3RTXA 4PY1A 5AA9A 4D4VA 1PXNA 1YOJA 4AF3A 4ZY5A 2YRWA 2VR1A 2C5VA 4OBPA 3N51A 1ZZ2A 2J0LA 5AV4A 3KYHC 4I6LA 2HAKA 5DBXA 4O2AF 3DZQA 5LMBA 3NVMB 2GPWA 2OLSA 1KJ9A 2BPMA 3A7FA 3QCYA 4ZLYA 2C3JA 3DBDA 3HNGA 3KA0A 5KZIA 4G3FA 4EQCA 1V9PA 1JOWB 5BUIA 3ETHA 1XR1A 2F7XE 4BIBA 1UWHA 2YW2A 3VMMA 3H0ZA 5KBRA 2XCLA 5IDNA 3BLHA 5T6KA 2J2IB 3UP7A 3Q9WA 3TIZA 4WHXA 4UYNA 3HMNA 4UWYA 3T3VA 2X0GA 4WBBB 3RAIA 3QWKA 2NU7B 3RVGA 5KCVA 1DI8A 5J9ZA 4MCVA 2XALA 4PF4A 3Q3BA 1LR4A 1LEWA 3IDPA 4FTAA 5HBJA 4Y83A 3I12A 4ANLA 4X3FA 2QU5A 3EZVA 3PA5A 1QPEA 2HVQA 4BCMA 3Q2OA 4YJSA 4XP0A 1XWSA 3AC4A 4EOKA 5M53A 3G8CA 1F0QA 3WF7A 4IAYA 4BF2A 2QK4A 2OH4A 3DNDA 3TZ9A 3Q5IA 1FMOE 3I5ZA 3BHHA 3DJ5A 3TL8A 3QGWA 2ETMA 4C2WA 4EORA 3F5UA 1XMLA 2BDJA 3NLBA 2W9ZB 4O7ZA 3EQPA 3UG1A 3W2RA 3ZC6A 4F9AA 1P14A 1PY5A 4DHIB 2XM8A 4NW5A 4FSMA 5IUIA 2X9FA 3Q5ZA 4IWOA 3BELA 4AXAA 3EN4A 5AP1A 1WBTA 1H08A 2YWPA 5BYAA 1OL7A 3I5NA 1GZKA 3NSZA 3UVQA 3GU4A 4RMZA 2X39A 3VULA 3FMMA 1OL6A 4YZMA 4F6WA 2W96B 4BYJA 3W0PA 4FL2A 1W82A 4QYEA 3NUUA 4M97A 3O96A 4RJ8A 5EW3A 3PPKA 3V3VA 2UW9A 4FEWA 5LVNA 2W6OA 3QTSA 2R9SA 4B0GA 3UZBA 1CKNB 3FKOA 1IA8A 5J87A 3IOPA 2R7MA 3C50A 2IZUA 3NGAA 4DGOA 4PMPA 3ORRA 2VWVA 5CM0A 2ITTA 4IAFA 3Q52A 5TO8A 2FSLX 4PL4A 5K2MA 3NUPA 4LUDA 5CT0A 2JAVA 2J7TA 3UMXA 5CQWA 2CKOA 2I0HA 1OPJA 4TZRA 3R8UA 3E3PA 1K9AA 4GU9A 4KUJA 4XG4A 3GC8A 3SC1A 2IG7A 2UW5A 5KMOA 3W0RA 1OZ1A 4IX6A 4EHZA 2CZGA 5CEKA 1XH5A 4KSQA 4K33A 3FZ1A 1WBPA 1MQ4A 3DQXA 5E25A 3T54A 3UYTA 4O0SA 4FTOA 2R84A 2XAMA 4C4GA 5ANJA 4Z16A 2W1CA 1KT8A 1WVWA 4FGRA 3EN9A 4F70A 3VBYA 3U6JA 2BDFA 2RG5A 3FI2A 3RGFA 1H0WA 5AAFA 3KRXA 3UNKA 3QD3A 4RSSA 3I6UA 4FT9A 4ENXA 2XNNA 1J91A 3KU2A 2VNYA 4A4OA 2FPGB 4HYIA 3VNTA 2GHLA 5K3WA 1PXMA 2HXQA 4EL9A 3FC2A 3BPRA 3OTVA 2ABJA 1YXVA 3I0OA 3I7CA 1CDKA 4D2RA 2WHBA 4D0XA 2VO6A 4AFEA 2GU8A 5M55A 3LFEA 1OGYA 3QGYA 1UU3A 3BA9A 2V22A 4RIXA 3BL7A 4BDGA 4EQMA 2R3IA 1DGSA 3KULA 2ZB1A 1QCFA 2CCIA 3FZPA 2OZOA 4J8NA 4UXLA 3QQFA 1UVRA 3HZTA 4AZSA 3QHWA 1OKZA 3TY9A 1AD5A 5FLFA 2QB5A 2HVSA 1BI7A 5JGDA 5CE8A 3KN6A 1FVRA 3HMOA 3K5IA 4Y5HA 1H1SA 2VWIA 2GTMA 2GQRA 4JX7A 4ACMA 4DFUA 3E7OA 2YM3A 3KRWA 4M7IA 2X2MA 4IAZA 3M1SA 1XH4A 2W17A 4Y8VB 2Y4RA 2HHFA 1WCCA 4C61A 4MD9E 2HGWA 4HNFA 2EJ3A 4IZ5A 4AZTA 3LP8A 2C6MA 2GPSA 3PJCA 1OBGA 2BKKA 4FV4A 2XNPA 4RA5A 1FPUA 1FGKA 5IUGA 4O0YA 5HIEA 4FVRA 4U41A 5HNIX 4I6QA 2W99B 1R0PA 4L7FA 4FEUA 4O7SA 4R77A 4BI2A 4FKPA 3BACA 4L6QA 1XBCA 3QTUA 1IASA 4RC2A 1PXLA 2CJMA 4F6SA 3D5WA 4HPUE 3PLAE 3LJ1A 4FJVA 4EGJA 2P33A 4EOSA 3HECA 4RX9A 1LUFA 3PRIA 3F5PA 3O51A 2CCHA 4OTIA 3RHKA 4BZOA 4TPTA 2W71A 3HV4A 4ACHA 4NL0A 2G2FA 5A3XA 4O83A 1S68A 1JDEA 1CKIA 2WPAA 1J7IA 3AQVA 3FXXA 3GB2A 4B99A 3F61A 3UOJA 4CKCA 4PWNA 3DFAA 4EHGA 1WVXA 5EM8A 4G17A 3AD5A 3OXZA 4IDVA 4YC6A 2HWOA 2R3QA 3BHTA 3VPBA 2PVRA 3HV7A 4E73A 5LMKA 2ITYA 3B2TA 3DQWA 1EH4A 3Q9YA 2YDKA 5LYJF 4QYHA 2CHLA 1Q4LA 4GFOA 4YZ9A 4C36A 3HO8A 3H10A 3KMWA 4HN2A 3SGIA 3ZO3A 3RR5A 4ZZNA 2UW4A 4I0TA 4CLIA 3NVKI 2WMRA 3R1QA 4EH4A 2AUHA 5HIDA 4QMWA 2WMSA 3AXWA 5FDPA 5A4CA 3Q2MA 2W1DA 5K5NA 3NIZA 3U51A 4O38A 4MK0A 2FYSA 5DH3A 4PBCA 4IADA 4HGEA 3KCFA 2IVTA 3VUGA 2E9NA 1QL6A 3EN5A 1CKOA 1BMKA 3FMNA 5I5XA 4X3JA 3CQEA 3ZO1A 5KBQA 2W70A 4DBXA 2I0YA 2XRUA 4JIKA 5IG1A 5JVDF 4O0XA 2J6MA 3HMMA 3IW4A 3V5TA 4ZTMA 5HORA 2C0OA 3ZTXA 4FTJA 3BL9A 5HEZA 5K5XA 2HGXA 4IIJF 2XKCA 3BX5A 3MVMA 5DI1A 2UZWE 2HCKA 2QF7A 2HXLA 5HCXA 3RJCA 3WE8A 5M08A 1XK5A 1O6LA 1OB3A 2B52A 5M06A 4QQTA 4IX4A 3A4PA 2P2HA 2CMWA 2CLQA 5IA2A 2OW3A 5DIAA 2YIRA 2QODA 1X9NA 4FV7A 4H05A 2JDVA 3F7WA 3EQCA 5M4CA 4P2KA 3U8WA 4MXAA 4B4LA 2C6KA 3H3CA 5L8JA 3H0YA 4G5PA 4N6YA 4AE9A 3KAKA 5E8UA 4I50F 4A4XA 3IDBA 3UO4A 5CAPA 5IEXA 5LWNA 4KRCA 5CEMA 5B2MA 3WOWA 5CU0A 3WO0A 3AOXA 3FI8A 3R71A 4CFWA 4CT2A 5JSMA 4RIXB 5C03A 3IPHA 4MXYA 5D9HA 3KULB 5CEPA 3AKJA 4FSRA 2VWZA 3A2CA 2NPQA 4YJVA 3FLYA 5AV2A 2PVHA 4CTCA