2CNUA

Atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with aspartic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
305
structure length
302
Chain Sequence
b'SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
publication title Saicar Synthase: Substrate Recognition, Conformational Flexibility and Catalysis.
rcsb
molecule tags Ligase
total genus 106
structure length 302
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2006-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cnuA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2cnuA02
1PKGA 3W55A 3DBDA 1YDTE 2WHBA 4EOLA 2B9IA 3CLYA 4I5HA 3VS2A 1NVQA 4QSHA 3PSBA 2YIYA 4N6YA 4YJVA 3SRVB 3FQEA 3OWPA 3NYXA 4KRDA 4C2WA 4AFEA 1YHSA 3MH0A 4I6QA 3R8VA 1FVRA 3PXZA 2Y4IB 3EKNA 4QMZA 4V0GA 5DT4A 3RK5A 3MWUA 3UOHA 2YS7A 5AP0A 3B8RA 5IQDA 4UZHA 3PIZA 3Q9WA 2X7OA 4M97A 1WBVA 3ZZEA 2IJMA 2WTIA 4HCTA 5AV2A 4DFUA 3LXLA 4FFLA 3VPBA 4QMYA 4KUJA 4EQUA 2XIRA 3ALNA 2V59A 4PDSA 4EH5A 2FPPB 4FE2A 3ZMMA 2Y0AA 3DXPA 4FIFA 2FB9A 3LFCA 1VBGA 3R9NA 4CTBA 3VRYA 2GS2A 4IH8A 3W2RA 2JDSA 5KMOA 1LEWA 2C4GA 2QO7A 3G0FA 4NK9A 3PIXA 5D10A 4F6WA 4EK8A 1XO2B 3WZEA 4G3EA 3OW4A 3R0TA 3DGKA 3I79A 4AZEA 1YWNA 4F0IA 3KQ7A 4E1ZA 3MA6A 5CQWA 2C00A 1VZOA 1YOLA 3FLQA 3CP9A 4OBPA 3WF6A 4IDTA 4DCAA 4FFNA 5AMNA 3C5UA 3ORZA 2XNOA 2R4BA 3F5UA 4I50F 5EQEA 4XYLB 4RIWB 4CSVA 1W96A 2EU9A 2G2HA 2JLDA 4FEXA 4K33A 4LOQA 5I9WA 2XEYA 4JRNA 3ZO1A 5M56A 2JKMA 4FTOA 2WEIA 3AT2A 4OT5A 4OT6A 1Q41A 4TKSA 5E8TA 3QX4A 3G33A 2IVSA 4C33A 4ZK5A 3GC9A 3G9NA 4FI1A 4O7NA 3WI6A 1XH5A 3VQHA 2SCUB 2C6KA 5FM2A 3EQGA 4CD0A 1H1WA 3T9TA 2Z04A 5CEMA 4RWIA 5LOVF 4Z3VA 2YHVA 4BCFA 3D9VA 1H08A 3Q6WA 1JLUE 3FMLA 5FG8A 1V0OA 2J0IA 1EHIA 3TIIA 4G31A 4RIXB 5HIBA 5BX0A 2BZKB 3FPQA 4R7HA 1GZ8A 1TQMA 2XBAA 4EQCA 4C38A 4FMQA 2JC6A 4YJ3F 3O2MA 4EBVA 3KU2A 1JKLA 4DINA 2G2FA 3QGYA 3U4WA 3W1FA 2EB2A 2QOQA 2HCKA 3ZU7A 3ORRA 1OIRA 3IG7A 4A4XA 1Q3DA 4BHZA 3R8UA 3UO4A 3QWKA 2P3GX 4GJ3A 2JKOA 4BN1A 3HGKA 4FFPA 4I6HA 2C5XA 1C30A 3LE6A 5HNBA 3PIYA 2OKRA 3AOXA 3NIEA 3PXRA 4FTLA 3RCJA 2WMAA 4FGRA 3KY2A 4LRJA 5CALA 4G34A 5AWMA 4F6UA 5KMKA 2XRWA 4BGQA 4L6QA 3SW7A 4BCOA 4JX7A 3I12A 3D14A 3VW6A 4ZMFA 2GNIA 1I7NA 4XH6A 2FO0A 2W5BA 5IF1A 5IUGA 3GQIA 3BBTB 3AC4A 4DLKA 4FSZA 3CC6A 1YHWA 4FV1A 3UZRA 4FKVA 4O2ZA 4YTIA 4AW2A 1JSVA 3QXOA 3KAJA 5ANDA 5BPYA 1PYEA 2C5OA 1BNCA 2YCFA 1LUFA 4M7IA 4DLJA 4YTCA 5JRQA 4EH3A 2A4LA 3WARA 3NCGA 4FTKA 4CFNA 2HWOA 4DTKA 2OH4A 3DBQA 1BYGA 1XHAA 3BQRA 4R78A 2XJ2A 1OL1A 2BROA 4U41A 5EZYF 1MUOA 4BF2A 1REJA 2Z7QA 3EFWA 3NR9A 4EORA 5CF5A 4EH8A 5JGBA 2V5QA 2PUPA 1KE5A 5KHWA 1H01A 2X39A 4R1YA 5DBXA 1RQQA 2Z7RA 5CYIA 5IQAA 4XRJA 2X1NA 1BMKA 4ARKA 2J90A 2GU8A 5IU2A 4FNYA 1Q61A 4PY1A 3R9RA 3DK7A 2EXMA 3ORKA 3LFQA 5HE0A 1QPJA 3ZRKA 2JDVA 3VUGA 3SOCA 4BB4A 2JKKA 1XH9A 2BDJA 3D15A 4GRBA 4JX3A 3MFUA 4M9UA 3L9MA 5AUUA 2R7LA 5LJJA 1Z9XA 4DGMA 3G0EA 2O65A 5DR9A 4XOYA 3TNPC 5CF6A 1X8BA 3PP0A 2HWPA 3OEZA 3TNQB 3WZDA 3UG2A 5CVHA 2PHKA 5CS6A 3VS6A 3P4KA 5BMMA 2OIDA 2YIQA 1UKHA 4GK4A 4JDKA 1BKXA 3R21A 3F5PA 2YDKA 4EEVA 4ANBA 2C5NA 3BI6A 2IW9A 2DWCA 3ATSA 4CRLA 5BVFA 4U3YA 5FDXA 4N70A 3HRFA 5FXQA 3RAIA 5IA2A 1OL7A 1Q97A 3TZ9A 4DFNA 3VOTA 4LV8A 2BILB 2GNGA 4O0UA 4XS2A 2H8HA 4TT7A 5HESA 3UNZA 4KINA 2R3IA 4DEHA 4FTIA 1ATPE 3MFSA 4Q2AA 4FV4A 3WO1A 2PZPA 1H25A 2P2HA 3A8XA 5H2UA 2GHMA 3QYWA 5BVOA 4DH5A 3PVGA 3GI3A 4C58A 3FAAA 3RCDA 3S00A 3LXPA 3DNEA 3UQCA 1L3RE 2J2IB 4IZAA 1SCUB 4BDFA 4X6QC 4IZYA 3R5XA 3VUDA 1IAHA 2ZMDA 4C4FA 5CU2A 4QYYA 4MA5A 1V0BA 4FEQA 4BGGA 4ZTMA 3TUCA 3D2KA 3TV6A 3FXZA 4PTCA 5FEDA 1YI3A 3V5QA 4BCJA 4FNZA 4D5HA 3OVVA 4BDAA 2XBJA 3CD3A 3NAXA 3P79A 2QKWB 4FOCA 2YJSA 2VWUA 3NDMA 4JJRA 4MKCA 4MA0A 3ET7A 5I9XA 3R02A 4MCVA 4YZ9A 5M53A 2OF2A 3PXQA 1KE9A 3DAKA 3KRWA 3EZRA 3LZBA 3MN3A 5B2MA 1UU3A 4IC8A 4FG7A 4RA5A 4MBJA 4V05A 3QRUA 4FTUA 4P7EA 1A9UA 3EL7A 5KMJA 4XP0A 2GS6A 3UPXA 2LGCA 2G9XA 4M14A 4GT4A 4A07A 1FVTA 1CKJA 3HBLA 2PVJA 5E9EA 5ETAA 3CXWA 5IQBA 4TTHB 4U7ZA 4L3PA 3CGFA 3LHJA 4I41A 5CVFA 4NJ3A 2BTRA 3FPMA 3FLNC 4YZBA 4ACGA 3IDCA 5IA1A 4C5AA 2H96A 2GTNA 3OTVA 3ORLA 3QKMA 3QX2A 2JAVA 4G3GA 3EN6A 4FIGA 4PDYA 4ZTHA 3VN9A 2ITQA 4DF3A 4F0GA 5IMEA 3Q2OA 5FNVF 5EOBA 3L9LA 2PTKA 5GJFA 2OLCA 4FSMA 4FT3A 1KJQA 2NU9B 4EOMA 3CGOA 3A7GA 4R6VA 4IFGA 3D94A 4U80A 5M57A 3VS3A 2WQMA 4RWLA 4C02A 4LM5A 5KX5F 2VO0A 3NEWA 4D28A 3O17A 3P78A 3PJ1A 4MH7A 1W82A 4NM5A 4NJDA 5EI6A 1H8FA 2ZOQA 1Y91A 3PE2A 4MD7E 4WHZA 4I3ZA 5AP4A 1S9IA 4ZSLA 1OGUA 3MSSA 4Y83A 3V6SA 4Y46A 1UU9A 2ITWA 4QP8A 5AA9A 3FI4A 2C3IB 3FHRA 4JDIA 5F94A 5F1ZA 5AAFA 2JBOA 2F2UA 4L7FA 2X4FA 3PRFA 4DBXA 4EQMA 3KB7A 2W6MA 3KK9A 4TRLA 4UXQA 5CNOA 3UTOA 3KF4A 5I9VA 4ASEA 4FIIA 4IWPA 4IW0A 1U5QA 4ASZA 5C9CA 3ZUVA 4O6LA 4YZCA 5FQDC 2FSTX 2JIUA 2WMRA 4QMUA 3FC2A 3OXTA 3R28A 2PWLA 4R77A 3M42A 3RAKA 1IASA 2X8EA 3JPVA 1WBOA 3KREA 3O7LB 3Q53A 4FTMA 2WOTA 5FRIA 5CT7A 2YM3A 2I7QA 1EUCB 4IFCA 3HB9A 4D4YA 5J1VA 3G9LX 4O0XA 4G6OA 2WMTA 4I22A 3BHTA 4ANMA 4DHFA 3KC3A 4RLLA 2R7IA 4QP9A 3AMYA 4EJNA 5M07A 4DH8A 1M2QA 3HP2A 3R7YA 2NNWB 1O6LA 2BFYA 4TNDA 3ZS5A 2I87A 4D1XA 5L2IA 2WIHA 3ERKA 4AUAA 4RC4A 3GXLA 4ORKA 3EN4A 5L6OA 1PX2A 2YS6A 1KBLA 4A06A 4O7RA 1Y57A 4CKJA 4MK0A 5AP1A 3RHXA 3GC0A 3TCPA 4F9AA 5A4TA 2OJ9A 3BWJA 5K3YA 1PXJA 2Q83A 2W1ZA 2ONLC 2R7BA 3ORMA 3Q2JA 1JSUA 3BE9A 3FZSA 4GS6A 4YJSA 5HQ0A 4UZDA 3RINA 3U51A 2BR1A 4YBKA 4RMZA 2PVPA 2VU3A 4FKGA 2YAAA 5HNGA 3MWEA 4TWPA 4PMPA 4D2SA 2XKEA 4I6BA 4MV7A 2X6DA 4ZOLF 3VBVA 1UV5A 5CAUA 4OLIA 3U9TA 4JQ7A 5C4KA 3PVBA 3QHRA 1GNGA 2HXLA 2CDZA 3CPCA 3HV5A 4U79A 1A48A 4C7TA 4CFMA 1OM1A 1JKJB 3NW5A 4QPSA 4X2GA 4XG9A 1QCFA 5B0XA 1HCKA 4EUUA 2GFCA 4GYIA 5I9UA 4II5A 3ETHA 3LLTA 3IDPA 1J91A 3QTSA 4NFNA 5LVOA 1LP4A 3ORPA 3C50A 2GMXA 2Z02A 1STCE 2E2BA 2IVTA 2P33A 2Z7SA 3GFEA 4AF3A 1BI8A 1VKZA 5J9YA 4HOKA 3ZCLA 2UZUE 3F5XA 1OIYA 3FMHA 1RW8A 4U43A 2ZAZA 3VUKA 4FZ7A 3AX6A 4I0RA 4BDGA 3EFLA 3OBJA 3C5IA 3JR1A 3NSZA 4M0ZA 5JMSA 5LVMA 3AG9A 4UWBA 3A62A 2FSMX 4YJRA 4CT2A 5KMMA 4AN2A 1W7HA 3QL8A 1Q62A 2R3QA 2OG8A 4ZSEA 3JUHA 4RX8A 2R82A 3DKGA 1LEZA 5CI6A 4PMTA 2W1CA 3R7UA 4U81A 5JEBA 4K2RA 3S1HA 1ZAOA 1JNKA 3HYHA 3TINA 2J5EA 2BIKB 2X6EA 4EOOA 3U6HA 3CBLA 3BQCA 4FKOA 4OR5A 1SMHA 2WTJA 4TYHB 3UP2A 4I24A 2PMNX 1GZKA 3R2YA 3UZPA 4MXOA 5CNNA 4FNWA 4KKHA 4IAZA 2BCJA 2PZIA 1F3MC 2V22A 3C7QA 3MBLA 3QRTA 3UP7A 3EQRA 4PDOA 4FV3A 5H8GA 3R7VA 1EUDB 1G5SA 4PNIA 2AC3A 2QVSE 4D9TA 3QTUA 3LCSA 2YZMA 4FZDB 4AX8A 4AW0A 1ZRZA 2VTMA 4RFMA 3DFAA 3IKAA 2F7XE 3WF9A 3D0EA 2QF7A 3TIYA 4E4XA 4KB8A 3H3CA 1PW2A 3O8PA 1ZMWA 4LI5A 5CSPA 2V62A 3F3UA 2A1AB 4KWPA 4A9TA 2RGPA 2YCSA 3GCPA 5ANIA 5E90A 5HG9A 4D2RA 4O2BF 4AA0A 3KMWA 4M3QA 1FMKA 4ALVA 2OU7A 3OZ6A 3IW6A 2CNQA 4FKTA 4UY9A 4XP3A 4AS0A 3G6GA 5BUJA 1OBDA 2GS7A 3SXFA 3TKUA 5IA4A 3T3VA 1U5RA 4EKLA 4E4MA 2UZDA 1M0TA 4HZRA 3M1SA 4UALA 3K5HA 4FL1A 2ITVA 4CKRA 4IWDA 2FPGB 4HZSA 4UBAA 2WEVA 5AP7A 3V5TA 2BHHA 4FTCA 2WPAA 3DKFA 2VX1A 2YZLA 5K4JA 5DE2A 4AE6A 2RKUA 3R7EA 4MV3A 2OIQA 3KRLA 1FGKA 4FFMA 2B9HA 4M68A 4B99A 4BCHA 4EOSA 2WYOA 1M17A 3V8SA 2W1HA 2SRCA 3EWHA 1GGOA 2XMYA 2HJWA 2CLQA 4JNWA 3Q4UA 3T8OA 1L8TA 3DA6A 2RF9A 2ZV8A 4IAFA 4EYMA 5JQ5A 3RPSA 2HOGA 5C1PA 4FKPA 4O7LA 1E9HA 2BRMA 1URCA 4EHZA 1NT2A 4QYGA 4MNEA 1KE8A 4EWHA 1GSHA 4JRVA 4AWIA 5AEPA 2A27A 3LCOA 3MFTA 3NW6A 5EM6A 2EXCX 2XCKA 3DXQA 1PXOA 3DK6A 4JVGA 5GHVA 3R8LA 3RTPA 4HGEA 5BQ0A 1WVXA 2Z8CA 3BZ3A 4J1RA 3C4WA 3E88A 4O22A 3QUPA 2VN9A 4YBZB 3BRBA 3Q1KA 4PMMA 3S95A 2XA4A 3GOKA 4MNFA 4CCUA 3F69A 5J9ZA 3ETAA 3HMNA 4G5PA 2W0JA 3MVHA 1DS5A 1V0PA 4P4CA 4QYHA 3UVPA 4E20A 1H1QA 4FX3A 4DEBA 2YZAA 4NH1A 4EH2A 2OO8X 4AGCA 4H58A 5CEQA 1EH4A 3RAHA 4WG5A 3BGPA 3N4UA 5IQIA 4CTCA 2REIA 3SG9A 2NUAB 5HKMA 4X3FA 2WTKB 5L3AA 3VF8A 4YC6A 2R0IA 4O38A 1ZMVA 3N4TA 4RQVA 4ZJJA 1CMKE 4EOKA 4DGOA 2A0CX 4ZLYA 3OXZA 4J53A 3LKMA 2Q0NA 2VWZA 1U54A 3HV7A 4JAJA 4CV8A 4YTFA 4AA5A 2JIIA 2WQOA 4K11A 5BYZA 4FICA 1T36A 4L42A 2V7AA 4PTGA 4QTAA 2F9GA 2WTKC 3OF0A 2XNPA 4CFXA 3AXWA 2G01A 1CM8A 3B2TA 3JYAA 1GOLA 3PSDA 3LOKA 2H34A 4ZZOA 4F4PA 1AGWA 3W32A 5C01A 4FIHA 4FV8A 4FZFB 5CEKA 4L1KA 2ZJWA 3VAPA 3BIZA 3V5WA 5CEPA 3UIBA 4C4IA 5HZNA 3LXKA 2DUVA 1DV2A 4Z7HA 2VQDA 4EGQA 1WAKA 2QURA 3BHUA 3H0YA 3JS2A 4QMVA 2W9ZB 5CSXA 5AIRA 2NO3A 4LQMA 4BI1A 5TF9A 4DIMA 3VRZA 3P23A 3DLZA 2WTVA 3N6RA 2ITYA 5AAGA 4XMOA 3REPA 2CN5A 2YCRA 2ZDTA 4PP7A 4J8MA 4K18A 4GUEA 2RG6A 4GG5A 4WNOA 4LGGA 3FLWA 4MNEB 3RPVA 4BHNA 3UOJA 4QQCA 4NFMA 3P7BA 2OW3A 3AD6A 4LOPA 5C1OA 4S30A 1YVJA 3P9JA 4KA3A 4S34A 4BZDA 4CQEA 4QTCA 2UZVA 4CVAA 4FGBA 4HGTA 3DDPA 3F2RA 3TTJA 1OKZA 3TXOA 4HVSA 2XCLA 5CF8A 4WUAA 3SX9A 5ETFA 4H1JA 4BDDA 3ORNA 3ZXZA 1ZXEA 4MEDA 3BHYA 1P14A 3MI9A 2QODA 4EK6A 2R3NA 3Q2MA 1OUYA 1Q24A 4YJOA 3VVHA 2HY0A 4JBPA 5LARA 5J2UF 3QTRA 3AD5A 3NNVA 4QMTA 3ORXA 3U8WA 4QQTA 4B4LA 3D5XA 3DPKA 3DJ5A 3OWLA 4FYOA 4I1ZA 3TJDA 1J1BA 4HCVA 4IB5A 3FKNA 4MXAA 1SVHA 4X3FB 4X6RA 4XX9A 4MX9A 4EH9A 2PU8A 4NTSA 1JKSA 3KXMA 2XNMA 5D1JA 5HCXA 3RZBA 4MV4A 2BDWA 4RLKA 4FVQA 4XLIA 3WF5A 2J50A 4DGLC 3ZFMA 4MXCA 4E5AX 4ITJA 4L00A 5JGDA 3G2FA 3IW7A 1TQIA 2RFSA 3LW0A 1U54B 1YWVA 4WO5A 5FGKA 1M6VA 4HPTE 4KD1A 4BTJA 3TKIA 5EHLA 4BC6A 3OXIA 4X3FC 3VA7A 4RT7A 3U54A 3RKBA 2QCSA 4FV0A 3LQ8A 1LR4A 5EH0A 4YJUA 5CENA 4D9UA 4FTJA 2C6MA 1GZOA 3O96A 2W06A 4L44A 5IQEA 1PMEA 3S2PA 2AYPA 3OCBA 5LVLA 3C4ZA 4NSTA 2RFNA 3MH3A 3T3UA 4LFIA 4WOVA 2B7AA 4NL0A 3MJ2A 3LXNA 4LG4A 4EHEA 3EQHA 1OPJA 1PXIA 4FT7A 4F70A 3IGOA 4YC8A 3VHEA 1QPEA 4XV1A 3W16A 2XIKA 4I0TA 4QMQA 1APME 1MRYA 4FG8A 5HO8A 4ZEGA 3LCKA 4S32A 4PRJA 2OJFE 2QHMA 3HAMA 4ENYA 3AGMA 3F3ZA 5BVWA 3N51A 3BE2A 2C3KA 4NCTA 4QMSA 5EM5A 3COMA 2WQNA 5IMXA 1FBNA 4APPA 2ZB0A 1VJYA 4MF1A 5FP5A 3ZO4A 5JFWA 3PUPA 4M8TA 3EQPA 2GTMA 2ZM1A 3B8QA 4WRGA 3D83A 1Q99A 5DIAA 5FTQA 4AW5A 2HGSA 4W4WA 3NIZA 4F64A 5IQHA 1CDKA 1WZYA 1LPUA 3QTZA 4O82A 4CCBA 4DH1A 3A4PA 3E8NA 2XEZA 3R7IA 3RAWA 4WT6A 3ZOSA 2YFXA 3NYVA 3Q96A 5CEIA 2FYSA 2PE0A 3BPRA 4MTAA 3C4FA 3NUAA 2PVLA 4D55A 4YJNA 3WO0A 3DBFA 1M52A 3NZ0A 4GK2A 3PP1A 2YACA 4WKQA 3FZPA 4C0TA 2BFXA 1GY3A 2Y8OA 2ZM4A 2XK4A 3CTJA 3F61A 4GT5A 4JQEA 4OBOA 5B2LA 2OXXA 4C62A 5DNRA 4XG4A 3BHVA 3M11A 1Q4LA 3MY1A 2R86A 5FEEA 4WRSA 5C8MA 4Z7GA 3MIAA 1KWPA 4F6SA 4O2AF 5E8WA 3GUBA 2NRUA 1OITA 1OPLA 1ND4A 2Y4IC 2VAGA 1OKWA 3CY3A 1IA9A 3FY0A 3KXGA 5A4QA 2GPWA 4YPDA 2VX0A 3DQWA 4ITIA 1YXVA 1UNLA 3PPZA 5H8BA 4KBKA 3KRRA 4G3FA 4TWCA 4BDHA 5L2SA 3RFCA 1NW1A 4Q9SA 4RVMA 4BDIA 3UFXB 2GPSA 4O81A 3FWQA 5KKRB 2B53A 4XJ0A 4C4EA 1SNUA 5HG8A 3R1SA 4F1MA 4LRKA 2PVYA 1OVEA 4XYMB 3I4BA 3ZSGA 3L8SA 2QO2A 2VRXA 3QALE 4BVUA 1PMUA 3FHIA 4TYJA 3EOCA 1XJDA 4WA9A 3VMMA 2B4SB 4AGDA 2Y6MA 3EZVA 3BYMA 3TM0A 5IQCA 2IPXA 2I0VA 3C13A 3ZM4A 3KEXA 3UDBA 1JWHA 5CZIA 5I4NA 5LP6F 3C9WA 4AZTA 1P2AA 4ZY4A 3NGAA 5KKRC 2X9EA 2QKRA 1VBHA 4IAYA 2R85A 3ALOA 3UJGA 3QAME 2RIOA 3SQQA 4O0YA 4FBXA 5JQWA 3E5AA 1OMWA 4RZVA 3A8WA 5D9HA 5E8YA 5J1WA 4WNPA 5C27A 5CZHA 3LFAA 4QT1A 5KKNB 2OJJA 2VTOA 5E8UA 4AW1A 4AT3A 4AG8A 2RG5A 2XK7A 1RE8A 2YISA 4CG9A 2XK3A 1GIHA 5M4FA 3PZEA 3NUPA 2PZYA 3RM7A 3H10A 4L52A 3KULA 3RVGA 4GMYA 3WE8A 4OTRA 3DAJA 4D4VA 4ACMA 1F5QA 4NCTC 4QYFA 1XWSA 4Y5HA 3TNHA 3GCSA 3UVRA 4BCMA 5HORA 1URWA 4V0GB 3VS0A 4EG0A 3SKCA 4EKKA 4EOJA 3VUMA 1ZWSA 2R3FA 1AQ1A 5E8XA 3W8LA 4D4RA 3NMUF 4AGWA 2C3LA 4CT1A 5HLWA 1PYXA 1CKPA 1EYZA 2VTNA 5E7RA 3S0OA 4H3PA 1T45A 2RL5A 3QYZA 2R64A 5DVRA 5JT2A 4I94A 5AV0A 2X4ZA 2OSCA 4W8DA 3I60A 3SDJA 2PE2A 3IOKA 3IGGA 3ID6C 2JAMA 4UV0A 1PXKA 3GT8A 3F9NA 2W6ZA 4O21A 4RX7A 3Q4TA 3GVUA 3HV3A 4NU1A 1CE8A 1B6SA 5L8JA 2ZDUA 3JRWA 2P0CA 4B6LA 4TWOA 3HUBA 5FD2A 4L53A 4X2KA 1PJKA 1BLXA 3V8WA 2WGJA 4EOQA 3DZQA 4PV0A 5EHYA 1H28A 3PWYA 4FA2A 2BUJA 3L1SA 5I5ZA 1W93A 2QG5A 2WELA 1E4EA 4BIEA 3NNXA 4F7LA 3OCTA 2IW6A 5DI1A 5E4HA 3DBCA 4ZSJA 4FT9A 1DAYA 2UVZA 3A7FA 3E8EA 3F2AA 4BCGA 3EH9A 3O8TA 4F9WA 3F7WA 1P4FA 2Y4PA 4PQNA 2X81A 1DI9A 4BI0A 2UZTA 4U40A 4XBUA 2OXYA 3HMIA 3DK3A 5EYMA 4Z16A 5T6KA 4FV2A 4O27B 2OIBA 4DBNA 3TKHA 4L01A 5HVJA 3LM0A 4EC9A 3DFCB 2AUHA 1O9UA 5HBJA 2PMIA 2VNWA 3HKOA 2CCHA 4GCJA 4HCUA 3LFFA 4JIKA 2V5AA 4FZ6A 5C8YF 3OP5A 4DG2E 3ZSIA 1DIKA 3IW5A 1ZY4A 3Q4CA 4L46A 3GBZA 1ZZLA 3GU5A 4TXCA 5F95A 4CNHA 5HX6A 2WMVA 3DXNA 2GSFA 4IB1A 2GPHA 4AXAA 4TNBA 3TTIA 4ZXTA 3LMIA 4E6QA 4IX3A 2XNGA 3VBTA 2BAJA 2H6DA 4Q5EA 1JSTA 2HZNA 5JRSA 4DFBA 1QPCA 2UW9A 5KUPA 3KULB 3V01A 5I0BA 4M12A 4FUXA 4MAOA 3LJ1A 2QO9A 4GG7A 2IVUA 4DG0E 5GONF 4IX6A 3M2WA 5FBNC 4ASDA 4YZMA 4E4LA 4F9CA 3GCVA 4RJ6A 1PMVA 4BBEA 2G2IA 4IAKA 2YAKA 4N4SA 4Z55A 3BYVA 3FMKA 4S31A 3L8XA 3QRJA 4XBRA 5E91A 3OT3A 3QQJA 2OXDA 4TN6A 4CLIA 4WBBB 4ZSGA 2VTQA 3PVUA 3KCFA 4UWYA 4ZMEA 4FR4A 2VGOA 2W99B 3BU3A 2CGVA 4CFWA 1KOAA 2JGZA 3LWBA 3I5ZA 3V5PA 2JFLA 4FV7A 3ZLYA 3IPHA 5EYDA 2G15A 5HLPA 4O7TA 3QD0A 4C35A 4ZI7F 2C6IA 3O7LD 4O4HF 3GOPA 4HYIA 4QRCA 3FV8A 4CRSA 4EJ7A 4PWNA 3IONA 3RGFA 5ACKA 2BTSA 4LUEA 5KHXA 4YSMA 3MY5A 3FEGA 5TOZA 3P86A 4X3JA 3GCQA 3FSKA 3OY3A 2C69A 3BEAA 3G5DA 3MPMA 3KXHA 2VGPA 3ORIA 2QOBA 3NNWA 3OY1A 3ZLSA 1E4EB 2Z2WA 5G6VA 3GU6A 4DAWA 1ZOGA 5JKGA 2WMSA 3V51A 3QGWA 1KV1A 4FIEA 4J98A 5F4NA 3FMJA 5DPVA 3QUDA 5AP3A 4DFLA 1A9XA 3HL7A 4FSQA 3S3IA 5HVKA 3VPCA 2OGVA 4MHAA 4IIJF 4IE9A 1H27A 2OLSA 4X7QA 2UZLA 3ZM9A 2QOCA 2DQ7X 2XNBA 3H30A 3CTQA 5I9YA 2F57A 4WG3A 2O64A 3QCSA 2NU8B 5HHWA 4IJ9A 4RPVA 4YBJA 4NM7A 2KTYA 1SNXA 2PUUA 2W1IA 3EL8A 4ZTQA 3R5FA 5D11A 1E1VA 3EQDA 4DN5A 3CJFA 5IZFA 4XV2A 4HNFA 5EOLA 1M14A 2YERA 2E9PA 4ANLA 5HV6A 4O0SA 3DKOA 5J8IA 4RG0A 4A7CA 2FVDA 2PZ5A 3K5IA 2NU6B 4CG8A 1OL5A 3MFRA 3FQHA 4CV9A 3Q9ZA 4AZVA 2QU5A 2C6LA 4YJQA 5GJGA 2W6QA 2YYAA 1PY5A 5FM3A 1UNHA 4HR7A 1OECA 3Q4ZA 4ERKA 4GFMA 5KZ0A 3AT3A 4APCA 3CD8A 4J96A 1Z2PX 4XYFA 4G6LA 4G1WA 3FXXA 2W1GA 2BKZA 2C0IA 3NNUA 5ACBC 1ULZA 2I0EA 3SD0A 2E9OA 3LAUA 1YRPA 4GU9A 4X21A 2JDTA 2JBPA 1K3AA 3FI8A 3FUPA 3HLLA 4J99A 3E93A 4OTDA 2CKEA 4ID7A 4O2PA 3Q9XA 3BYUA 2ITNA 4E6CA 1BL6A 4IMYA 2VTHA 1YQJA 4WUNA 5IEYA 2BZIB 2XNEA 3LCTA 4Y5QA 2O3PA 1DI8A 3D7TA 5IH6A 3TJCA 4OUCA 2ACXA 5HU9A 1WBPA 3NYNA 4XP2A 4B7TA 3SOAA 4EC8A 3SLSA 3MJ1A 3ACJA 3DOGA 1MRUA 2HW6A 5AIKA 2C30A 3JRXA 4IZOA 3UC4A 2GNJA 1NA7A 3BV2A 2W6OA 4TV9F 4IZ5A 4E93A 5M08A 4UEUA 1TVOA 3DQXA 2WMXA 2J0MB 1AUVA 4Y73A 5EQYA 5IA5A 4FSNA 4YAKB 4IEBA 4RZQA 3GENA 3ZSHA 5L8LA 4HYHA 3HZTA 1K2PA 3O23A 3NYOA 4MYGA 3R2BA 2ESMA 3RNIA 3VS1A 5AM6A 3VW8A 3D2IA 3VS4A 3UZTA 2VWIA 3ANRA 4F65A 4BDJA 2VX3A 5CASA 4H05A 3VWAA 4RJ7A 1WMKA 5CAVA 3KVXA 1OKYA 4IX5A 4I5PA 3PPKA 2UW8A 2X7FA 3I0QA 4RVKA 2VO3A 3KMUA 2VPQA 3KXXA 4L68A 4R3PA 4CMOA 3BG5A 2YIRA 5A4EA 2E9VA 2QOHA 2PVFA 3QHWA 3A7JA 5FXSA 3ETJA 1CKIA 2CKOA 2VWVA 3OROA 3VBQA 3ZYAA 1JVPP 3HRCA 3ULZA 1H07A 2QLQA 2QK4A 2XNNA 2XKFA 4RC2A 4A9SA 3QTXA 3F3WA 4FEUA 4FTQA 5EK7A 2ZB1A 3GCUA 4QMWA 3UO6A 4F7NA 4HGLA 2CLXA 5EW9A 1F0QA 4RRVA 3PWDA 3H0ZA 3RP9A 3W10A 3W2CA 2WQBA 3HDMA 4E5BA 1YOJA 4XV9A 5GJDA 2YDJA 3JY9A 1UWHA 2C1BA 2WFYA 4HNIA 4NZWB 2CN8A 1UVRA 4E8AA 1IG1A 4RWKA 3D4QA 1XQZA 4QQJA 2XM9A 2ZVAA 4XOZA 4XX0B 5CWZA 4JR7A 5T68A 3A60A 3U6JA 4RJ8A 1GIIA 2YDIA 3EB0A 4O6EA 4BCPA 3AC2A 3P7CA 4QMPA 3L9NA 3HAVA 3R22A 4OTIA 4PL4A 2C47A 2XKDA 4M13A 4AZSA 3MIYA 1KEEA 3N8DA 2R3MA 1KE7A 3D7TB 4AOTA 4TYIA 1YI4A 4ZAUA 4ZIMA 2VWXA 3CQWA 2FP4B 4D58A 4O4JF 4JG7A 1IA8A 2XP2A 2UV2A 3K3JA 3QKKA 1YW2A 3VJNA 5BVKA 5BYYA 1UU7A 3JVRA 4FT0A 2NP8A 3G8DA 5A3XA 3BLRA 4YSJA 4L8MA 4QP7A 3FYKX 5ETCA 3TIZA 4ZY6A 2BMCA 1FINA 4LOOA 3F3VA 3FJQE 3TNIA 1G3NA 2GNFA 4ZS4A 1UWJA 1IRKA 3TW6A 4LGHA 3ROYA 2W71A 5LXTF 5A46A 4R5SA 2PSQA 1KJ9A 3LVPA 4BCQA 5LYJF 5LMKA 2LAVA 3FMEA 2W96B 3T9IA 5GIOE 4MV6A 1O6KA 4ONAA 4DITA 2WB8A 3RV4A 5FUTA 4AQCA 2W1DA 2YWPA 3CSVA 4YNEA 3KFAA 3R6XA 4D1ZA 1ZOEA 2ETRA 5CSWA 4MXZA 1ZYSA 3QTQA 4FSUA 4HVGA 2C5YA 3AD4A 1E1XA 1OKVA 3S4QA 4EK5A 5HIEA 5L6PA 4GIHA 4D4SA 5K9IA 4FG9A 2JEDA 5CI7A 4R5YA 4IJPA 4LRMA 5AUYA 4JDHA 3VBXA 2BKKA 3IW8A 3PY3A 3ZLXA 5E8VA 1H24A 1VEBA 2W7XA 4IWQA 2YM8A 4KIPA 4XHKB 1Y8YA 4AU8A 3W8QA 4NW5A 3UYSA 2R3PA 4G9RA 1FVVA 3EYHA 4IAIA 1CSNA 2GNHA 4YC3A 2XCHA 3DV3A 5L8KA 2CJMA 2YA9A 3BGZA 5HD4A 4OTFA 3DBEA 4I6FA 3ZDIA 3IS5A 4YPSA 4B9DA 1YWRA 4CGAA 3NRMA 4WIHA 2BIYA 2HENA 3V4ZA 3O0GA 2QLUA 5HCZA 5BVEA 2OI4X 3UMWA 4EHGA 5D8DA 2ZDHA 1AD5A 1CS0A 4YO4A 4O91A 2A2AA 3E64A 1FGIA 1KUTA 1A06A 2X8DA 5EFQA 4I4TF 2CKQA 2O63A 3MB7A 2OWBA 4K0YA 4RJ5A 4GSBA 3COIA 4FV9A 5EHOA 3A99A 3QD3A 5CXZA 2VZ6A 3F82A 2VO7A 1JKTA 3QUEA 4JG6A 1KC7A 2VTSA 4YHJA 1P5EA 3KL8A 4BKJA 4C4HA 5IQFA 1DM2A 1JBPE 5M55A 3Q9YA 4ZJVA 3L8VA 2GQSA 4FV6A 1XKKA 1U4DA 5ANEA 2CKPA 1YXTA 3QD2B 4RJ3A 4YGAA 2W9FB 4GIIA 1Z2NX 4EHVA 5JQGF 4GVJA 3HDNA 1P4OA 2WAJA 3QZIA 5IISA 3OHTA 3V04A 5AX3A 5CSVA 2F7ZE 5A9UA 2OBJA 3OWJA 4FEVA 3R23A 2QR8A 3F5GA 4NTTA 5CX9A 5HTBA 4GFOA 3U4UA 3TZ8A 1Z5MA 3TDVA 2UZNA 3H9FA 2CGXA 5DG5A 4WBOA 4C4GA 4FKLA 3TG1A 3WIGA 2YABA 3E62A 2V58A 3TT0A 4F09A 5LQFA 3PA4A 2WQEA 4EH7A 2OFUA 3MPAA 4BGHA 2JKQA 5L6WL 2XF0A 4FFRA 3R73A 2QNJA 3QCQA 4TZRA 1M7QA 4ZQIA 3MH2A 3UYTA 3QA0A 4FKRA 5LMKC 1JKKA 1FOTA 4ALUA 3G15A 5H8EA 5CEOA 3Q5ZA 3ZBXA 4BDCA 3KAKA 1JAMA 3BGQA 3LJ2A 2CZGA 3PLAE 3P5KA 1JQHA 1HOWA 3QFFA 4USDA 3A4OX 3PFQA 5EW3A 2UW6A 3JVSA 4FV5A 3FLSA 3EFJA 3DDQA 5CAPA 1WBTA 2UW3A 2IZTA 5A6OA 2IW8A 2YZGA 3SGCA 3UVQA 4WG4A 4A4LA 5BMVF 5IUHA 4HPUE 3AT4A 2PVRA 4DFXE 5B7VA 3ZUUA 3F6XA 4E5WA 4HVIA 3I0OA 3TL8A 4ZZNA 4I4EA 3OT8A 1I7LA 5H9BA 1WBSA 3KVWA 4HVDA 4CFVA 1OPKA 1UA2A 3PRIA 5HGIA 4DTBA 1T46A 2X2KA 4IACA 5TKDA 3UODA 2BRNA 4JT3A 1XH7A 4KIQA 2QOLA 3W18A 4IB3A 2JD5A 3UMXA 3CKWA 5AM7A 2V0DA 4JL9A 3GGFA 3ZRLA 3EHAA 4KRCA 2OJIA 2HZIA 5IG1A 1PRYA 3QQUA 4C34A 2R3OA 5LWMA 3FL5A 4I55F 3F7ZA 3CY2A 3EN9A 2I40A 4KAOA 5M09A 5DHJA 5E8ZA 1HCLA 1YOMA 2B55A 4DTAA 3AMAA 4F99A 3UE4A 2XJ0A 3TWJA 5IPJA 3E7OA 4FC0A 3V6RA 1H4LA 3IOPA 4K77A 4ZZMA 4O84A 4KSQA 3COKA 3U9NA 2YEXA 1M0WA 1YXXA 4DCEA 4V01A 2VO6A 1OI9A 2PN1A 4O96A 3HV4A 4YLJA 4CEGA 3UC3A 3MW1A 5DFPA 3RV3A 4ACHA 4NUSA 1REKA 3CPBA 3DLSA 4G3CA 4F9BA 5A14A 4RX5A 3BLQA 2BAQA 4EUTA 3DAEA 4BYJA 4NIFB 2PUIA 2RFDA 2R3JA 5ANKA 5HEZA 3FL4A 2B1PA 5E92A 5EM7A 5HVYA 2WTCA 3SAYA 2XD4A 3FZTA 3R30A 5B2KA 1FMOE 5C1QB 5M4UA 2P0AA 5IH4A 4ACCA 2FA2A 3ORTA 4H39A 1Y6BA 3E63A 4GU6A 3NWWA 2GLTA 4WBNF 3QD4A 4IHJF 3GB2A 4MQ1A 5I9ZA 3PG1A 3KN5A 4U44A 1KE6A 2J51A 2QOIA 1XBAA 3Q6UA 3PYYA 5CAOA 2Y9QA 4ZHQF 2Z60A 4EBWA 3MB6A 3LM5A 4J52A 3ORQA 2J0LA 2YIXA 4BRXA 4DEGA 4P2KA 3EQBA 1WVYA 3QBNA 3ROCA 4JQ8A 4QP1A 3UQGA 1M2RA 2BZJA 4BICA 3RUPA 5IQGA 3LFNA 3K54A 3WYYA 2ERZE 4JBOA 3FZ1A 3A2CA 2C1AA 5HCYA 4YHTA 5FLFA 4IVDA 2DWBA 1W8CA 4BTKA 3QLFA 5CXHA 3VIDA 4K1BA 3QZFA 4IANA 3ZBFA 4AACA 3CE3A 2YW2A 4IADA 4TW9A 4QNYA 4J95A 4GJ2A 2ETMA 3ZFXA 5EG3A 1IEPA 5AV3A 2R84A 4LMNA 4W4VA 3IDBA 4QTDA 4YZDA 2PMOX 4L7SA 1U46A 3PY1A 3R63A 5GINE 3I7CA 4MWIA 4X2JA 5D12A 5DT0A 1Q5KA 1ZMUA 4L67A 2DYLA 4O0VA 4PTEA 3SA0A 4MV8A 5BVNA 5AADA 5K4IA 3KXNA 3CEKA 3UO5A 1PHKA 4DA5A 1H1RA 3QWJA 4C3PA 4EZ5A 3SG8A 3KXZA 3ODZX 3HP5A 3HMOA 1ZYDA 2GFSA 3LPBA 3PVWA 4NM3A 4RVTA 2R3RA 2VTLA 1WCCA 2BVAA 3OBGA 3ZO3A 2R87A 3W33A 4GYGA 5CU0A 2QI8A 2IP4A 4DEAA 3A7IA 4DT8A 3CIKA 2I80A 2PVHA 4AT4A 1XBCA 1U59A 5AA8A 2R3KA 4L43A 4J71A 4DG3E 3D5VA 3K3IA 2DLNA 4M69B 2C68A 5JH6A 4ZTLA 2R2PA 4EYJA 4NWMA 3EYGA 3HNGA 5KX8A 1SVEA 2O0UA 4B8LA 1B6CB 2P4IA 2E9UA 4PP9A 3ZO2A 3GLKA 4DYMA 3TN8A 2J4ZA 2YJRA 4O7SA 3VULA 4RIOA 4D0WA 1DV1A 1Q8YA 2EUFB 4QMXA 1VYZA 3TI1A 3R83A 1OBGA 2C0OA 2XJ1A 3PE1A 3R71A 3ZEPA 5C4LA 4XV3A 4KABA 3LP8A 4FKSA 4FODA 4FYNA 5LA6F 1ZY5A 4L3LA 4U5JA 2QC6A 4EL9A 2ZDQA 5LCKA 3WIKA 1ERKA 4GL9A 3BBWA 4A4OA 2GQRA 3I7BA 2W5HA 4KSPA 3TZ7A 3QKLA 5M4IA 4B8MA 3DU8A 3HMPA 4QPAA 4XG2A 4AFJA 2J6MA 2GQGA 1IAJA 5AUXA 3DCVA 4FTRA 1BX6A 2HELA 2OJGA 3MTFA 4N6ZA 4YURA 3HO8A 4BCKA 4NKSA 3JZIA 3GNIB 4IHPA 4G5JA 4O83A 1NVRA 3RWQA 2F4JA 4DGNA 4U45A 5AV4A 4YJPA 3FZRA 4ZOGA 2GCDA 3DJ7A 2VTRA 3UIXA 5FP6A 3W2SA 5CTPA 4D1SA 3KA0A 4JI9A 5HG5A 4FVPA 4FSWA 4MD9E 3TV7A 2GNLA 4EK4A 2BPMA 4I20A 4R7BA 4GUBA 3BHHA 4FEWA 3DF7A 3IQ7A 4FKJA 2E9NA 5DRBA 4UB7A 5KZIA 1YDSE 3K2LA 2QQ7A 3MVLA 1Q8WA 3P7AA 4FTNA 4O7YA 5AP2A 2WMUA 2O2UA 3BLHA 3KGAA 4FK3A 5EYCA 4YP8A 4QTBA 2R3GA 2W70A 5IA3A 5LWNA 4C3FA 3GU4A 5HU3A 5M06A 4BY9E 2J5FA 5J2TF 4OW8A 4EI4A 5J7HA 4OTGA 3HA8A 4K6ZA 4XCUA 3WOWA 3RPYA 5KMLA 3HECA 3K5UA 3PJCA 3I81A 1R3CA 2JITA 4CZTA 2YRXA 4C5CA 3QQHA 4BTFA 2PVKA 1XR1A 4M67A 4QP4A 5FEQA 5HICA 3UGCA 3OUZA 5EDPA 2W4OA 3WZUA 1GSOA 2BRBA 1R0PA 2DS1A 2IN6A 3DB8A 3LFEA 5EM8A 4DEEA 4DH3A 2X0SA 5CA0F 4XUFA 1MQ4A 4P5QA 3OUNB 5E1SA 3LJ0A 3GU8A 5A6NA 3JXWA 4DT9A 2QG7A 3VJOA 2HZ4A 5EI8A 4RGJA 2C3JA 3O51A 2F2CB 5AFVA 1I09A 4L9IA 5HE1A 4JR3A 4GEOA 3FXWA 5LCJA 3RPOA 3NUUA 3TEIA 3TUDA 3WE4A 3UPZA 2ITPA 3ODYX 5DA3A 5DH3A 4YB8B 3C4CA 5JQ8A 1YXSA 4TY1A 4FSTA 4LMUA 4XNEA 4XLVA 3KN6A 3MDYA 1XH8A 2W6PA 2WMWA 4Y8DA 2CNUA 1WR2A 2X8IA 3WBLA 3EIDA 5EDRA 4G3DA 2J0JA 5JH7F 4W4XA 1QMZA 2YM5A 4YO6A 4N57A 2VWBA 1DAWA 3ZC5A 2W17A 4FVRA 5JN2A 4ZS0A 2J9GA 4MXYA 2J7TA 4K9YA 2W4KA 5J95A 4FUYA 5CT0A 2XK9A 3PXYA 5CU6A 5K5NA 5CU4A 5EDQA 4XG8A 3OG7A 1Q3WA 4IM3A 2C6DA 3RPRA 5CA1F 3QQKA 4H3QA 2GHLA 5HE3A 3V4SA 1Q8TA 3OC1A 5DEYA 2OZAA 3NPCA 5TR6A 3QZGA 3EMGA 4TUYF 5D7VA 4F7JA 4R3RA 3OTUA 2IZUA 3LMHA 1JDEA 4E26A 3NUYA 3MGYA 3WF8A 1BL7A 5JSMA 4QOXA 4CLJA 1Y6AA 4FTAA 4A9RA 4DFZE 3R9HA 4IZ7A 3CCNA 5DOSA 4BTMA 4DE4A 4F63A 2XH5A 4USEA 2PMLX 3E7VA 5AX9A 3RWPA 3PXKA 3QA8A 3LLAA 4ZSAA 4F0FA 4YLKA 4F08A 3MS9A 3OMVA 4GW8A 4DLIA 4ME6A 4O7VA 4GT3A 4TPTA 4IC7A 3SHEA 1H00A 2C6OA 2XIXA 5DN3A 1IOVA 4YAJB 4GH2A 4PX6A 4GKIA 3QU0A 2ZV2A 3R9DA 2CCIA 4MBIA 4AA4A 4Q5HA 4ALWA 1M2PA 2XUUA 3EJ1A 3FY2A 2Y6OA 3W2PA 3UBDA 2WMQA 4FK6A 3U55A 3O8UA 5IDPA 4TL0A 4C4JA 1Z2OX 3R9OA 1KJIA 2WU6A 4FSRA 3VHKA 1ZARA 3SE7A 3FQSA 3QZHA 2XS0A 3F3TA 3KCKA 3LFBA 2CHLA 2OICA 3CJGA 1GAGA 3POOA 4ASXA 2HYYA 4C5BA 2NPQA 3WF7A 1RDQE 2IO6A 1H26A 2ZDGA 2FH9A 3ENMA 2CGWA 1YKRA 3KALA 3QF9A 4ZTRA 1H0WA 5HX8A 2GHGA 1I44A 3GFWA 2R3HA 2VV9A 4J7BA 2NRYA 4MV1A 4FSYA 3EN7A 3C4XA 4O7WA 1UU8A 4AE9A 4QP6A 1UKIA 5T3QA 4E4TA 2O8YA 1NXKA 1V1KA 5HG7A 3MYGA 4CMTA 3LQ5A 3VF9A 3QQFA 4NKAA 4IM0A 5HTCA 4QQ5A 5CSHA 2ONLA 5BYLA 3QCXA 3F88A 1B6RA 3FBVA 5KBRA 2IZRA 1GLVA 3QXPA 1OZ1A 2OZAB 3KRXA 5KBQA 1KJJA 4PL3A 5BVDA 5EI2A 5M44A 4YLLA 2I1MA 3GIDA 2IVVA 4O4IF 3ACKA 2HXQA 4CMUA 3EFKA 4MXXA 2R7NA 2HAKA 3D7ZA 3RHKA 3PLSA 4HYUA 4Y85A 4IB0A 2EVAA 2W1FA 3C0HA 4L45A 4C2VA 3LQ3A 3QC4A 4ZP5A 3JZFA 4I93A 2B0QA 3RJCA 3TNWA 4YMJA 5GIPE 3NVKI 5ANOA 3QLGA 5CANA 1XH6A 4UN0C 5LOHA 1GIJA 3OUKA 2QOFA 5J9LA 2I0YA 4IX4A 5AUZA 4CXAA 2R7MA 4S2ZA 3U6IA 2BZHB 3C0IA 4I5CA 2I8CA 4RIYA 1OB3A 2ETKA 2WO6A 5KE0A 5L2WA 4H36A 5CQUA 5FTGA 3V8TA 4EOIA 3KRJA 3R7OA 2XIZA 4JAIA 1YHVA 3DY7A 2R5TA 3AC1A 3P0MA 4FL3A 2PE1A 3R1QA 4ANQA 3ZLWA 5BMSA 3UNJA 5G1XA 2ITOA 3G6HA 2IWIA 3FZOA 4O0WA 3UG1A 3ZONA 3DZOA 5IYZF 3IK3A 4MV9A 4PDPA 5AP5A 2UZBA 4AN3A 1MP8A 3O50A 2QOKA 3E8DA 5E8SA 3VUIA 5DYJA 4DH7A 3ZH8A 4U97A 5FXRA 4I0SA 3OD6X 3DT1A 4HJOA 2OF4A 3OWKA 4XG7A 3AC8A 4BDBA 2AC5A 4JIAA 4AN9A 1W84A 2BAKA 4RFYA 2ITTA 4BIBA 2X9FA 2ITUA 1PXMA 3O71A 2PVMA 5DEWA 4AGUA 1PXPA 4U42A 4ANSA 4CFUA 1NY3A 1YI6A 2KULA 4UYAA 5FDPA 3L8PA 3HV6A 2C6EA 3R8PA 5KMIA 4KS8A 5HD7A 3BKBA 1AUXA 4C61A 3BEGA 2BALA 3DNDA 3OCGA 1UNGA 1J1CA 4IWOA 4OBQA 5DLSA 2G1TA 4HNTA 4E4NA 2FSLX 4PUZA 5DRDA 3ZTXA 2PULA 3ELJA 2ZYBA 2WXVA 3GU7A 3R1YA 4UXLA 3AW8A 4U6RA 2C0TA 4QMNA 2C5VA 3R8ZA 3PJ3A 2YM4A 4C3RA 2VWWA 2UVXA 4AOJA 4AOIA 3R04A 4TYHA 3FC1X 3VO3A 4FOBA 3RALA 4BDEA 3Q5IA 5BPHA 3FI3A 2HZ0A 3I5NA 1Z57A 1XBBA 1NVSA 4KKEA 3DKCA 1IR3A 3E5NA 4HNUA 2XZSA 5HNIX 3BELA 3KMMA 5JVLA 4FU0A 3MPTA 5E1EA 3PPJA 4KIOA 4U9AA 4BZOA 2R7KA 5JVDF 5J5SA 1OL2A 5CLPA 3KF7A 2PVNA 2IZSA 3Q32A 4LV5A 4P5ZA 5KMNA 3WNZA 3VUHA 3EQFA 2PL0A 3EQIA 2FB8A 4FL2A 4UYNA 4MBLA 4QP3A 3QRKA 4C36A 5D7AA 5DR2A 1OL6A 2BDFA 2OK1A 1KOBA 2XM8A 2V55A 3LMGA 4RQKA 4Q9ZA 1QL6A 2WMBA 3QC9A 1WFCA 3ZDUA 2XKCA 3FMMA 4GVAA 4BR3A 1GJOA 2YITA 3MV5A 3OOMA 4RIYB 1J7UA 5D41A 5DWRA 3WZKA 5CB4F 4H3BA 3QQGA 2B54A 1TKIA 3MH1A 1OIUA 4I4FA 1CQIB 4G17A 4EZ7A 4I92A 4MD8E 3RM6A 3FI2A 1Q8ZA 3AC3A 1SZMA 3LCDA 3C51A 3F66A 2OFVA 4KBCA 1M7NA 4IM2A 4J8NA 3NAYA 1J7IA 3OW3A 1PF8A 3HX4A 4GK3A 4NW6A 3FLYA 4JDJA 4HGSA 4BBMA 1H1SA 1JDBB 2CSNA 2QONA 5IUIA 2XB7A 4YZNA 5IH5A 4UX9A 2WTDA 3CTHA 4XEYA 4XG6A 2R3LA 2OH0E 5C8NA 4EGJA 4PL5A 2ZV9A 2VTAA 2JFMA 3PXFA 4HQ6A 2HW7A 3HEGA 1MRVA 4XRLA 1R78A 1B38A 2VD5A 4FNXA 5IDNA 2PBZA 3N4VA 1YDRE 5KNJA 5BPFA 3W2OA 2XYNA 2YIWA 4DFYA 3FE3A 3HA6A 4OGRA 3PJ8A 2QR7A 4QMLA 4HVHA 2YL2A 4F1TA 4CKIA 1R1WA 3MWDA 4O0RA 1FQ1B 4BBFA 1EZ1A 4RX9A 2EB3A 4RFZA 3U87A 3KKVA 2X2MA 4YTHA 3RK7A 3VS7A 4A9UA 4YU2A 3MA3A 3FKLA 3AQVA 2PY3A 3HVCA 4BYIA 3TQTA 4YR8A 4PF4A 2B9FA 1B39A 5KO1A 4O4LF 3VC4A 3V5LA 3PZHA 5L2TA 2UZEA 4G2FA 4DEDA 4EH4A 2ERKA 1S9JA 3DTCA 4QYEA 3U9CA 3ZXTA 3EKKA 1H1PA 3UQFA 2DIKA 4E6DA 2VTPA 3UNKA 4Y8VB 2YZNA 4FFOA 2YN8A 4ZJIA 2FSOX 4IAAA 2CNVA 3TIGA 3Q52A 2UUEA 3BU5A 3D5WA 5JZNA 5H80A 4EH6A 3K5VA 3VNTA 2XK6A 5C8KA 2W1EA 3C4EA 1CQJB 3ENHA 1JLLB 3G51A 3KK8A 5LMAA 4EOPA 2QOOA 5HO7A 1CTPE 4H1MA 4L3JA 3C0GA 3NUSA 2QD9A 4A9YA 3UIUA 4Y72A 2B52A 1G8SA 4LYNA 4M15A 2JIVA 3HRBA 3R00A 4JS8A 4IVCA 1XH4A 1R0EA 3OOGA 4G9CA 3ZUTA 2BHEA 2F49A 4FKIA 1W0XC 2PK9A 3UIMA 4F7SA 5FBOA 1PXLA 4ZLOA 3II5A 2WKMA 5ITAA 1WBWA 3HMMA 2VUWA 4G6NA 5AUTA 4BCIA 5EW8A 4WNMA 2DZDA 4ENXA 2J0KA 3QTIA 1SYKA 5JGAA 3R5HA 1R39A 2Q0BA 2VNYA 3Q04A 2FGIA 3FDNA 4FKWA 4IVBA 3R1NA 5LXMA 3AMBA 5C26A 3NW7A 3UOLA 3GQLA 3N9XA 3MVJA 3FYJX 3HUCA 5AAEA 3TZMA 3WYXA 5CY3A 5JZJA 3R01A 4ZTNA 5TO8A 2XIYA 4BIDA 2X0GA 5IEXA 4X2FA 1K9AA 3FSFA 3TV4A 2P2IA 3CR0A 5JFXA 4EZ3A 5JFSA 3VBYA 5CF4A 4O86A 4QMOA 2NU7B 4AP7A 4M0YA 4ERWA 4G16A 2VWYA 3ZRMA 3I6WA 1SM2A 4NM0A 2YM7A 3GP0A 4ITHA 1KJ8A 2W5AA 2O5KA 3R8MA 5F9EA 3ATTA 3E3PA 4DGGA 5AJQA 1JPAA 2I6LA 3A61A 1VR2A 3Q3BA 4FZAB 4X0MA 3OS3A 3TUBA 5DMXA 4OTHA 4RC3A 3SXSA 3WILA 2WTWA 4UWCA 4RJ4A 4HNVA 1PXNA 3NX8A 4O7ZA 3TACA 3CS9A 5HBEA 4OTWA 4HYSA 3LFSA 5AP6A 2WNTA 4FKUA 5BNJA 3G90X 3U9SA 1W98A 5ICPA 2WOUA 3FMNA 1ZYCA 2UZOA 4QP2A 3ZFYA 4LL0A 3ZEWA 4RSSA 1BI7A 2YM6A 4RBLA 2JDOA 3ZHPC 4TV8F 2UZWE 5HIDA 1J3HA 3CQEA 3ZZWA 2RFEA 4U3ZA 3OUUA 2F7EE 4M84A 5HBHA 2ITZA 1W83A 5TT7A 4YUQA 4W4YA 1G8AA 5HLNA 3QCYA 5GNKA 3MTLA 1ZYJA 3E92A 3PJ2A 4AT5A 3LFDA 4U0IA 1J7LA 2X2LA 3VS5A 3ANQA 2CMWA 2VTTA 2B9JA 2Y7JA 3GC7A 4X2NA 4YHFA 2ZV7A 5AUVA 1WBNA 3THBA 1KSWA 2FUMA 4FKQA 5DT3A 3AC5A 5KCVA 3OFMA 4RVLA 2BRHA 3V3VA 3MESA 2PPQA 3I6UA 4YNOA 2VR1A 4TYEA 4EK3A 2GDOA 3H4JA 4E73A 3DTWA 5CAEB 4LL5A 4PNKA 1RJBA 1MQBA 1PMNA 4S33A 4Z9LA 4BCNA 4WSYA 2BRGA 2HIWA 3MVMA 4MVFA 3P1AA 4Y95A 1FPUA 4ACDA 2WD1A 4KBAA 4ZY5A 3QQLA 2R0UA 3ULIA 2OZOA 2YCQA 5EQPA 1BXRA 3SVVA 1GSAA 2UW7A 5A54A 2CPKE 2H9VA 4HW7A 3I1AA 3C1XA 2ZM3A 3NLBA 5AV1A 1C3OA 2R9SA 5JK3A 5HBRB 3MJFA 3V5JA 2PYWA 5JFVA 3BYOA 2UW5A 3ITZA 3H9RA 4MQ2A 5CAQA 4FIJA 4IVAA 4MAMA 5EKNA 2EWAA 1ZLTA 4JG8A 4NYEA 4P90A 3GEQA 3Q60A 4R7IA 3VQUA 2UVYA 5M4CA 5A4LA 2QHNA 3GC8A 4JOAA 2FPIB 3QRIA 2I0HA 4TWNA 2X7GA 4TYGA 1OIQA 1KV2A 3DJ6A 4XZ3B 4C59A 3JY0A 4EWQA 3NUXA 2IG7A 2C6TA 3FKOA 4U8ZA 2ITXA 2HY81 2J9MA 4F1OA 5F20A 3PA5A 2CGUA 3FLZA 4CFFA 4QNAA 4I21A 2ZMCA 5BUIA 1GZNA 4IDVA 4ZLZA 4IQ6A 4MWHA 1OUKA 3CQUA 4BDKA 3PDTA 2VTIA 5CU3A 3P08A 2VTJA 3SW4A 1JOWB 4FT5A 1PK8A 4C37A 5DR6A 2YWVA 1QPDA 3CKXA 3BV3A 3BCEA 3TDWA 4NT4A 5ETIA 4E7WA 4QTEA 4R1VA 4LUDA 3SRVA 2P55A 4AZWA 1YXUA 1H0VA 3PY0A 3RI1A 2V7OA 1SVGA 4J97A 4D5KA 5K5XA 2WIPA 1Y8GA 5H3QA 3NVMB 2PUNA 3FMDA 5LMBA 2Z7LA 3PTGA 4WD5A 1O6YA 3BWFA 3COHA 3VBWA 4QMMA 4AAAA 3OCSA 2YRWA 4USFA 3RMFA 5ANGA 2A19B 3SC1A 4CZUA 5A4CA 4D0XA 2UW4A 4GKHA 3BX5A 5DGZA 2WZJA 3LIJA 3MY0A 4IIRA 4EONA 1IOWA 4XG3A 4KNBA 4AZFA 3B2WA 3BYSA 5EKOA 3AGLA 5J87A 4K8AA 3A7HA 4ZTSA 4WNKA 3L9PA 3POZA 1VYWA 4KS7A 5LVPA 3W2QA 4JXFA 5HI2A 3IECA 3E3BX 4YJ2F 2W6NA 3EN5A 3E87A 2WU7A 4DC2A 5EYKA 4QO9A 3SXRA 3D5UA 2QU6A 4IBMA 4KKGA 3EQCA 4W8EA 5CVGA 1PKDA 4RIWA 4V04A 1WVWA 1ZOHA 4E6AA 2UW0A 3WZJA 4GV1A 2W05A 3OEFX 5BUEA 4I23A 4F9YA 3PSCA 4RZWA 4DEIA 3RK9A 2XVDA 3BU6A 2JDRA 4YJTA 5M51A 3IO7A 1TQPA 1ZZ2A 3IW4A 3NCZA 3PA3A 3QFVA 4B0GA 3UOKA 3F2NA 2XK8A 3QTWA 2W4JA 1BUHA 3PG3A 5AUWA 2HK5A 2XYUA 3DS6A 4PMSA 4R3CA 3H9OA 4OTQA 3ZC6A 4RA4A 4JLCA 5ANJA 5IEVA 4GFGA 4I5MA 3DB6A 5C03A 4N0SA 3SV0A 5LVNA 4BZNA 3E8CA 3G8CA 3NUNA 5FTOA 5HE2A 3K3PA 4O0TA 3NS9A 4RIXA 4BI2A 2PZRA 2XRUA 4FTTA 5IA0A 1Q8UA 4JBVA 4JBQA 4RWJA
chains in the Genus database with same CATH superfamily
1PKGA 3W55A 4AXEA 3DBDA 1YDTE 2WHBA 4EOLA 2B9IA 3CLYA 4I5HA 3VS2A 1NVQA 4QSHA 3PSBA 2YIYA 4N6YA 4YJVA 3SRVB 3FQEA 3OWPA 3NYXA 4KRDA 4C2WA 4AFEA 1YHSA 3MH0A 4I6QA 3R8VA 1FVRA 3PXZA 2Y4IB 3EKNA 4QMZA 4V0GA 5DT4A 3RK5A 3MWUA 3UOHA 1IYDA 2YS7A 5AP0A 3B8RA 5IQDA 4UZHA 3PIZA 3Q9WA 2X7OA 4M97A 1WBVA 3ZZEA 2IJMA 2WTIA 4HCTA 4PBCA 5AV2A 4DFUA 3LXLA 4FFLA 3VPBA 4QMYA 4KUJA 4EQUA 2XIRA 3ALNA 2V59A 4PDSA 4EH5A 2FPPB 4FE2A 3ZMMA 2Y0AA 3DXPA 4FIFA 2FB9A 3LFCA 1VBGA 3R9NA 4CTBA 3VRYA 2A1HA 2GS2A 4IH8A 3W2RA 2JDSA 5KMOA 1LEWA 2C4GA 2QO7A 3G0FA 4NK9A 3PIXA 5D10A 4F6WA 4EK8A 1XO2B 3WZEA 4G3EA 3OW4A 3R0TA 3DGKA 3I79A 4AZEA 1YWNA 4F0IA 3KQ7A 4E1ZA 3MA6A 5CQWA 2C00A 1VZOA 1YOLA 3FLQA 3CP9A 4OBPA 3WF6A 4IDTA 4DCAA 4FFNA 5AMNA 3C5UA 3ORZA 2XNOA 2R4BA 3F5UA 4I50F 5EQEA 5CR5A 4XYLB 4RIWB 4CSVA 1W96A 2EU9A 2G2HA 2JLDA 4FEXA 4RCNA 4K33A 4LOQA 5I9WA 2XEYA 4JRNA 3ZO1A 5M56A 2JKMA 4FTOA 2WEIA 3AT2A 4OT5A 4OT6A 1Q41A 4TKSA 5E8TA 3QX4A 3G33A 2IVSA 4C33A 4ZK5A 3GC9A 3G9NA 4FI1A 4O7NA 3WI6A 2HIXA 4DHZA 5CM0A 1XH5A 3VQHA 2SCUB 2C6KA 5FM2A 3EQGA 4CD0A 1H1WA 3T9TA 2Z04A 5CEMA 4RWIA 5LOVF 4Z3VA 2YHVA 4BCFA 3D9VA 1H08A 3Q6WA 4CKCA 1JLUE 3FMLA 5FG8A 1V0OA 1ST4A 2J0IA 1EHIA 3TIIA 5D1OB 4G31A 4RIXB 5HIBA 5BX0A 2BZKB 3FPQA 1FVIA 4R7HA 1GZ8A 1TQMA 2XBAA 4EQCA 2CFMA 4C38A 4FMQA 2JC6A 4YJ3F 3O2MA 4EBVA 5I5VA 3KU2A 1JKLA 4DINA 3T99A 2G2FA 3QGYA 3U4WA 3W1FA 2EB2A 1I2LA 2QOQA 3LQSA 2HCKA 3ZU7A 3ORRA 1OIRA 3IG7A 4A4XA 1Q3DA 4BHZA 3R8UA 3UO4A 3QWKA 2P3GX 4GJ3A 2JKOA 4BN1A 3HGKA 4FFPA 4I6HA 2C5XA 1C30A 3LE6A 5HNBA 3PIYA 2OKRA 3AOXA 3NIEA 3PXRA 4FTLA 3RCJA 2EJ0A 2WMAA 4FGRA 3KY2A 4LRJA 5CALA 4G34A 5AWMA 4F6UA 5KMKA 2XRWA 4BGQA 4L6QA 3SW7A 4BCOA 4JX7A 3I12A 3D14A 3VW6A 4ZMFA 2GNIA 1I7NA 4XH6A 2FO0A 2W5BA 5IF1A 5IUGA 3GQIA 3BBTB 3AC4A 4DLKA 4FSZA 3CC6A 1YHWA 4FV1A 3UZRA 4FKVA 4O2ZA 4YTIA 4AW2A 1JSVA 3QXOA 3KAJA 5ANDA 5BPYA 1PYEA 2C5OA 1BNCA 2YCFA 1LUFA 4M7IA 4DLJA 4YTCA 5JRQA 4EH3A 2A4LA 3WARA 3NCGA 4FTKA 4CFNA 2HWOA 4DTKA 2Y4RA 2OH4A 3DBQA 1BYGA 1XHAA 3BQRA 4R78A 3W5OA 4MUQA 2XJ2A 1OL1A 2BROA 5BWWA 4U41A 5EZYF 1MUOA 4BF2A 1REJA 2Z7QA 3EFWA 3NR9A 4LDTA 4EORA 4EH8A 5CF5A 5JGBA 3RR5A 2V5QA 2PUPA 1KE5A 3ML1A 1H01A 5KHWA 2X39A 4R1YA 5DBXA 1P16A 1RQQA 2Z7RA 5CYIA 5IQAA 4XRJA 2X1NA 1BMKA 4ARKA 2J90A 2GU8A 5IU2A 4FNYA 1Q61A 4Q4DA 4PY1A 3R9RA 3DK7A 2EXMA 3ORKA 3LFQA 5HE0A 1QPJA 3ZRKA 2JDVA 3VUGA 3SOCA 5I47A 4BB4A 2JKKA 1XH9A 2BDJA 3D15A 4GRBA 4JX3A 1G8KA 1XK5A 3MFUA 4AXFA 3DTFA 4M9UA 3L9MA 5AUUA 2R7LA 5LJJA 1Z9XA 4DGMA 3G0EA 2O65A 5DR9A 4XOYA 3TNPC 4EQ5A 5CF6A 1X8BA 3PP0A 2HWPA 3OEZA 3TNQB 3AKKA 3WZDA 3UG2A 5CVHA 2PHKA 5CS6A 3T7AA 3VS6A 3P4KA 5BMMA 2OIDA 2YIQA 1UKHA 4GK4A 4JDKA 1BKXA 3R21A 3F5PA 2YDKA 4FJVA 4EEVA 4ANBA 2C5NA 3BI6A 2IW9A 2DWCA 3ATSA 4CRLA 5BVFA 4U3YA 5FDXA 4N70A 3HRFA 5FXQA 3RAIA 5IA2A 1OL7A 1Q97A 3TZ9A 4DFNA 3VOTA 4LV8A 2BILB 2GNGA 4O0UA 4XS2A 2H8HA 4TT7A 5HESA 3UNZA 4KINA 2Q7DA 2R3IA 4DEHA 4FTIA 1ATPE 3MFSA 4Q2AA 4FV4A 3WO1A 2PZPA 1H25A 2P2HA 3A8XA 5H2UA 2GHMA 3QYWA 5BVOA 4DH5A 3PVGA 3GI3A 4C58A 3FAAA 3RCDA 3S00A 3LXPA 3DNEA 3UQCA 1L3RE 2J2IB 4IZAA 1SCUB 4BDFA 4X6QC 4IZYA 3R5XA 3VUDA 1IAHA 2ZMDA 4C4FA 5CU2A 4QYYA 3VONA 4MA5A 1ET0A 1V0BA 4FEQA 4BGGA 4ZTMA 3TUCA 3D2KA 3TV6A 3FXZA 4PTCA 5FEDA 1ZYLA 2DABA 1YI3A 3V5QA 4BCJA 4FNZA 4D5HA 3OVVA 4BDAA 2XBJA 3CD3A 3NAXA 3P79A 2QKWB 4FOCA 2YJSA 2VWUA 3NDMA 4JJRA 4MKCA 1G2WA 3ET7A 5I9XA 4MA0A 3R02A 4MCVA 4YZ9A 5M53A 2OF2A 3PXQA 1KE9A 3DAKA 3KRWA 3EZRA 3LZBA 3MN3A 5B2MA 1UU3A 4IC8A 4FG7A 4RA5A 4MBJA 5BWUA 4V05A 3QRUA 4FTUA 4P7EA 1A9UA 3EL7A 5KMJA 4LH7A 3KIOC 4XP0A 2GS6A 3UPXA 2LGCA 2G9XA 4M14A 4GT4A 4A07A 1B04A 1FVTA 1CKJA 3HBLA 2PVJA 5E9EA 5ETAA 3LULA 3CXWA 5IQBA 4TTHB 4U7ZA 4L3PA 3CGFA 3LHJA 4I41A 5CVFA 4NJ3A 2BTRA 3FPMA 3FLNC 4YZBA 4ACGA 3IDCA 5IA1A 4C5AA 2H96A 2GTNA 3OTVA 3ORLA 3QKMA 3QX2A 2JAVA 2HDKA 4G3GA 3EN6A 4FIGA 4PDYA 4ZTHA 3VN9A 2ITQA 4DF3A 4F0GA 5IMEA 3Q2OA 5FNVF 5EOBA 3L9LA 2PTKA 5GJFA 2OLCA 4FSMA 4FT3A 1KJQA 2NU9B 4EOMA 3CGOA 3A7GA 4R6VA 2EJ2A 4IFGA 3D94A 4U80A 5M57A 3VS3A 2WQMA 4RWLA 4C02A 2HG8A 4LM5A 5KX5F 2VO0A 3NEWA 4D28A 3O17A 3P78A 3PJ1A 4MH7A 1W82A 4NM5A 4NJDA 5EI6A 1H8FA 2ZOQA 1Y91A 3PE2A 4MD7E 4WHZA 4I3ZA 5AP4A 1S9IA 4ZSLA 1OGUA 3MSSA 4Y83A 3V6SA 4Y46A 1UU9A 2ITWA 4QP8A 5AA9A 3FI4A 2C3IB 3FHRA 4JDIA 5F94A 5F1ZA 4IWYA 5AAFA 2JBOA 2F2UA 4L7FA 2X4FA 3PRFA 4DBXA 4EQMA 3KB7A 2W6MA 4E6NA 3KK9A 4TRLA 4UXQA 5CNOA 3UTOA 3KF4A 5I9VA 4ASEA 4FIIA 4IWPA 4IW0A 1U5QA 4ASZA 5C9CA 3ZUVA 4O6LA 4YZCA 5FQDC 2FSTX 2JIUA 2WMRA 4QMUA 3FC2A 3OXTA 3R28A 2PWLA 4R77A 3M42A 3RAKA 1IASA 2X8EA 3JPVA 1WBOA 3KREA 3O7LB 3Q53A 4FTMA 2WOTA 5FRIA 5CT7A 2YM3A 2I7QA 1EUCB 4IFCA 3HB9A 4D4YA 5J1VA 3G9LX 4O0XA 4G6OA 2WMTA 4I22A 3BHTA 4ANMA 4DHFA 3KC3A 4RLLA 2R7IA 3GDEA 4QP9A 3AMYA 4EJNA 5M07A 4DH8A 1M2QA 3HP2A 3R7YA 2NNWB 1O6LA 2BFYA 4TNDA 3ZS5A 2I87A 4D1XA 5L2IA 2WIHA 3AKJA 3ERKA 4AUAA 4RC4A 4DHJA 3GXLA 4ORKA 3EN4A 5L6OA 1PX2A 2YS6A 1KBLA 4A06A 4O7RA 1Y57A 4CKJA 4MK0A 5AP1A 3RHXA 3GC0A 3TCPA 4F9AA 5A4TA 2OJ9A 3BWJA 5K3YA 1PXJA 2Q83A 2W1ZA 2ONLC 2R7BA 3ORMA 3Q2JA 1JSUA 3BE9A 3FZSA 4GS6A 4YJSA 5HQ0A 4UZDA 3RINA 3U51A 2BR1A 4YBKA 4RMZA 2PVPA 2VU3A 4FKGA 2YAAA 5HNGA 3MWEA 4TWPA 4PMPA 4D2SA 2XKEA 4I6BA 4MV7A 2X6DA 4ZOLF 3VBVA 1UV5A 5CAUA 4OLIA 3U9TA 4JQ7A 5C4KA 3PVBA 3QHRA 1GNGA 2HXLA 2CDZA 3CPCA 3HV5A 4U79A 1A48A 4C7TA 4CFMA 1OM1A 1JKJB 2HVQA 3NW5A 4QPSA 4X2GA 4XG9A 1QCFA 5B0XA 1HCKA 4EUUA 2GFCA 4GYIA 5I9UA 4II5A 3ETHA 3LLTA 3IDPA 1J91A 3QTSA 4NFNA 5LVOA 1LP4A 3ORPA 3C50A 2GMXA 2Z02A 1STCE 2E2BA 2IVTA 2P33A 2Z7SA 3GFEA 4AF3A 1BI8A 1VKZA 5J9YA 4HOKA 3ZCLA 2UZUE 3F5XA 1OIYA 3FMHA 1RW8A 4U43A 2ZAZA 3VUKA 4FZ7A 3AX6A 4I0RA 4BDGA 3EFLA 3OBJA 3C5IA 3JR1A 3NSZA 4M0ZA 5JMSA 5LVMA 3AG9A 4UWBA 3A62A 2FSMX 4YJRA 4CT2A 5KMMA 4AN2A 1W7HA 3QL8A 1Q62A 2R3QA 2OG8A 4ZSEA 3JUHA 4RX8A 2R82A 3DKGA 3TY8A 1LEZA 5CI6A 4PMTA 2W1CA 3R7UA 4U81A 5JEBA 4K2RA 3S1HA 1ZAOA 1JNKA 3HYHA 3TINA 2J5EA 2BIKB 2X6EA 4EOOA 3U6HA 4JXUA 3CBLA 3BQCA 4FKOA 4OR5A 1SMHA 2WTJA 4TYHB 3UP2A 4I24A 2PMNX 1GZKA 3R2YA 3UZPA 4MXOA 5CNNA 4FNWA 4KKHA 4IAZA 2BCJA 2PZIA 1F3MC 2V22A 3C7QA 3MBLA 3QRTA 3UP7A 3EQRA 1I1MA 4PDOA 4FV3A 5H8GA 3R7VA 1EUDB 1G5SA 4PNIA 2AC3A 2QVSE 4D9TA 3QTUA 3LCSA 2YZMA 4FZDB 5KS8A 4AX8A 4AW0A 1ZRZA 2VTMA 4RFMA 3DFAA 3IKAA 2F7XE 3WF9A 3D0EA 2QF7A 3TIYA 4E4XA 4KB8A 3H3CA 1PW2A 3O8PA 1ZMWA 4LI5A 5CSPA 2V62A 3F3UA 2A1AB 4KWPA 4A9TA 2RGPA 2YCSA 3GCPA 5ANIA 5E90A 5HG9A 4D2RA 4O2BF 4AA0A 1CKOA 3KMWA 4M3QA 1FMKA 4ALVA 2OU7A 3OZ6A 3IW6A 2CNQA 4FKTA 4UY9A 4XP3A 4AS0A 3G6GA 5BUJA 1OBDA 2GS7A 3SXFA 3TKUA 5IA4A 3T3VA 1U5RA 4EKLA 4E4MA 2UZDA 1M0TA 3SGIA 4HZRA 3M1SA 4UALA 3K5HA 4FL1A 2ITVA 4CKRA 4IWDA 2FPGB 4HZSA 4UBAA 2WEVA 4K6NA 5AP7A 3V5TA 2BHHA 4FTCA 2WPAA 3DKFA 2VX1A 2YZLA 5K4JA 5DE2A 4AE6A 2RKUA 3R7EA 4MV3A 2OIQA 3KRLA 1FGKA 4FFMA 2B9HA 4M68A 4B99A 4BCHA 4EOSA 2WYOA 1M17A 3V8SA 2W1HA 2SRCA 3EWHA 1GGOA 2XMYA 2HJWA 2CLQA 4JNWA 1XMLA 3Q4UA 3T8OA 1L8TA 3DA6A 2RF9A 3GB8B 2ZV8A 4IAFA 4EYMA 5JQ5A 4DQNA 3RPSA 2HOGA 4CHIA 5C1PA 4FKPA 4O7LA 1E9HA 2BRMA 1URCA 4EHZA 1NT2A 4QYGA 4MNEA 1KE8A 4EWHA 1GSHA 4JRVA 4AWIA 5AEPA 2A27A 3LCOA 3MFTA 3NW6A 5EM6A 2EXCX 2XCKA 3DXQA 1PXOA 3DK6A 4JVGA 5GHVA 3R8LA 3RTPA 4HGEA 5BQ0A 1WVXA 2Z8CA 3BZ3A 4J1RA 3C4WA 5I5SA 3E88A 4O22A 3QUPA 2VN9A 4YBZB 3BRBA 5HNEA 3Q1KA 4PMMA 3S95A 2XA4A 3GOKA 4MNFA 4CCUA 4CMFA 3F69A 5J9ZA 3ETAA 3HMNA 4G5PA 2W0JA 3MVHA 1DS5A 1V0PA 4P4CA 4QYHA 3UVPA 4E20A 1H1QA 4FX3A 4DEBA 2YZAA 4NH1A 4EH2A 2OO8X 4AGCA 4H58A 5CEQA 1EH4A 3RAHA 3PFYA 4WG5A 3BGPA 3N4UA 5IQIA 4CTCA 2REIA 3SG9A 2NUAB 5HKMA 4X3FA 2WTKB 5L3AA 3O5AA 3VF8A 4YC6A 2R0IA 4O38A 1ZMVA 3N4TA 4RQVA 4ZJJA 1CMKE 4EOKA 4DGOA 2A0CX 4ZLYA 3OXZA 4J53A 3LKMA 2Q0NA 2VWZA 1U54A 3HV7A 4JAJA 4CV8A 4YTFA 4AA5A 2JIIA 2WQOA 4K11A 5BYZA 4FICA 1T36A 4L42A 2V7AA 4PTGA 4QTAA 2F9GA 2WTKC 3OF0A 2XNPA 4CFXA 1TAEA 3AXWA 2G01A 1CM8A 3B2TA 3JYAA 1GOLA 3PSDA 3QQMA 3LOKA 2H34A 1OGYA 4ZZOA 4F4PA 1AGWA 3W32A 5C01A 4FIHA 3BLAA 4FV8A 4FZFB 1EKVA 2QB5A 5CEKA 4L1KA 2ZJWA 3VAPA 3BIZA 3V5WA 5CEPA 3UIBA 4C4IA 5HZNA 3LXKA 2DUVA 1DV2A 4Z7HA 2VQDA 4EGQA 1WAKA 2QURA 3BHUA 3H0YA 3JS2A 4QMVA 2W9ZB 5CSXA 5AIRA 2NO3A 4LQMA 4BI1A 5TF9A 4DIMA 3VRZA 3P23A 3DLZA 2WTVA 3N6RA 2ITYA 5AAGA 4XMOA 3REPA 2CN5A 2YCRA 2ZDTA 4PP7A 4J8MA 4K18A 4GUEA 2RG6A 4GG5A 4WNOA 4LGGA 3FLWA 4MNEB 3RPVA 4BHNA 3UOJA 4QQCA 4NFMA 3P7BA 2OW3A 3AD6A 4LOPA 4Q4CA 4S30A 1YVJA 3P9JA 4KA3A 4S34A 4BZDA 4CQEA 5C1OA 4QTCA 2UZVA 4CVAA 4FGBA 4HGTA 3DDPA 3F2RA 3TTJA 1OKZA 3TXOA 4HVSA 2XCLA 5CF8A 4WUAA 3SX9A 5ETFA 4M0JA 4H1JA 4BDDA 3ORNA 3ZXZA 1ZXEA 4MEDA 3BHYA 4I6LA 5BYAA 1P14A 3MI9A 5BWTA 2QODA 4EK6A 2R3NA 3Q2MA 1OUYA 1Q24A 4QDEA 4YJOA 3VVHA 2HY0A 4JBPA 5LARA 5J2UF 3QTRA 3AD5A 3NNVA 4QMTA 3ORXA 3U8WA 4QQTA 4B4LA 3DAAA 3D5XA 3DPKA 3AKLA 3DJ5A 3OWLA 4FYOA 4I1ZA 3TJDA 1KT8A 1J1BA 4HCVA 4IB5A 3FKNA 4MXAA 1SVHA 4X3FB 4X6RA 4XX9A 4MX9A 4EH9A 2PU8A 4NTSA 1JKSA 3KXMA 2XNMA 5D1JA 5HCXA 3RZBA 4MV4A 2BDWA 4RLKA 4FVQA 4XLIA 3WF5A 2J50A 4DGLC 3ZFMA 4MXCA 4E5AX 4ITJA 4L00A 5JGDA 3G2FA 3IW7A 3TEKA 1TQIA 2RFSA 3LW0A 1U54B 1YWVA 4WO5A 5FGKA 1M6VA 4HPTE 4KD1A 4BTJA 3TKIA 5EHLA 4BC6A 4UCVA 3UZOA 3OXIA 4X3FC 3VA7A 4RT7A 3U54A 3RKBA 2QCSA 4FV0A 2X5RA 3LQ8A 1LR4A 5EH0A 4YJUA 5CENA 4D9UA 4FTJA 2C6MA 1VS0A 1GZOA 3O96A 2W06A 4L44A 5IQEA 1PMEA 3S2PA 2AYPA 3OCBA 5LVLA 3C4ZA 4NSTA 2RFNA 3MH3A 3T3UA 4LFIA 4WOVA 2B7AA 4NL0A 3MJ2A 3LXNA 4LG4A 4EHEA 3EQHA 1OPJA 1PXIA 4FT7A 4F70A 3IGOA 4YC8A 3VHEA 1QPEA 4XV1A 3W16A 2XIKA 4I0TA 4QMQA 1APME 1MRYA 4FG8A 5HO8A 4ZEGA 3LCKA 4S32A 4PRJA 2OJFE 2QHMA 3HAMA 4ENYA 3AGMA 3F3ZA 5BVWA 3N51A 3BE2A 2C3KA 4NCTA 4QMSA 5EM5A 3COMA 2WQNA 5IMXA 1FBNA 4APPA 2ZB0A 1VJYA 4MF1A 5FP5A 3ZO4A 5JFWA 3PUPA 4M8TA 3EQPA 2ZM1A 2GTMA 3B8QA 4WRGA 3D83A 1Q99A 5DIAA 5FTQA 4AW5A 4CMDA 2HGSA 3UZBA 4W4WA 3NIZA 4F64A 5IQHA 1CDKA 1WZYA 1LPUA 3QTZA 4O82A 4CCBA 4DH1A 3A4PA 3E8NA 2XEZA 3R7IA 3RAWA 4WT6A 3ZOSA 2YFXA 3BL7A 3NYVA 3Q96A 5CEIA 2FYSA 5FR9A 2PE0A 3BPRA 4MTAA 3C4FA 3NUAA 2PVLA 4D55A 4YJNA 3WO0A 3DBFA 1M52A 3NZ0A 3PUFC 4GK2A 3PP1A 2YACA 4WKQA 4AXCA 1I1KA 3FZPA 4C0TA 2BFXA 1GY3A 2Y8OA 2ZM4A 2XK4A 3CTJA 3F61A 4GT5A 3NFFB 4JQEA 4OBOA 5B2LA 2OXXA 4C62A 5DNRA 3T9FA 4XG4A 3BHVA 3M11A 1Q4LA 3MY1A 2R86A 4PZ8A 5FEEA 4WRSA 5C8MA 4Z7GA 2HHFA 3MIAA 1KWPA 4F6SA 4TVIA 5K2MA 4O2AF 5E8WA 3GUBA 2NRUA 1OITA 1OPLA 1ND4A 2Y4IC 2VAGA 1OKWA 3CY3A 1IA9A 3FY0A 3KXGA 5A4QA 2GPWA 4YPDA 2VX0A 3DQWA 4ITIA 1YXVA 1UNLA 3PPZA 5H8BA 4KBKA 4UCTA 3KRRA 4G3FA 4TWCA 4BDHA 5L2SA 3KYHC 3RFCA 1NW1A 4Q9SA 4RVMA 4BDIA 3UFXB 5BWXA 2GPSA 4O81A 3FWQA 5KKRB 5BWVA 2B53A 4XJ0A 4C4EA 1SNUA 5HG8A 3R1SA 4F1MA 4DDGA 4LRKA 2PVYA 1OVEA 1IYEA 4XYMB 3I4BA 3ZSGA 4EFEA 3L8SA 2QO2A 2VRXA 3QALE 4BVUA 1PMUA 3FHIA 4TYJA 3EOCA 2HGXA 1XJDA 4WA9A 3VMMA 2B4SB 4AGDA 2Y6MA 3EZVA 3BYMA 3TM0A 5IQCA 2IPXA 2I0VA 3C13A 3ZM4A 3KEXA 3UDBA 1JWHA 5CZIA 5I4NA 5LP6F 3C9WA 4AZTA 1P2AA 4ZY4A 3NGAA 5KKRC 2X9EA 2QKRA 1VBHA 4IAYA 2R85A 3ALOA 3UJGA 3QAME 2RIOA 3SQQA 2ZGIA 4O0YA 4FBXA 5JQWA 3E5AA 1OMWA 4RZVA 3A8WA 5D9HA 5E8YA 5J1WA 4WNPA 5C27A 5CZHA 3LFAA 4QT1A 5KKNB 2OJJA 2VTOA 5E8UA 4AW1A 4AT3A 4AG8A 2RG5A 2XK7A 1RE8A 2YISA 4CG9A 2XK3A 1GIHA 5M4FA 3PZEA 3NUPA 2PZYA 1TFFA 3RM7A 3H10A 4L52A 3KULA 3RVGA 4GMYA 3WE8A 4OTRA 3DAJA 4D4VA 4ACMA 1F5QA 4NCTC 3T54A 4QYFA 1XWSA 4Y5HA 3TNHA 3GCSA 3UVRA 4BCMA 5HORA 1URWA 4V0GB 3VS0A 4EG0A 3SKCA 4EKKA 4EOJA 3VUMA 1ZWSA 2R3FA 1AQ1A 5E8XA 3W8LA 4D4RA 3NMUF 4AGWA 2C3LA 4CT1A 5HLWA 1PYXA 1CKPA 1EYZA 2VTNA 5E7RA 3S0OA 4H3PA 1T45A 2RL5A 3QYZA 2R64A 5DVRA 5JT2A 4I94A 5AV0A 2X4ZA 2OSCA 4W8DA 3I60A 3SDJA 2PE2A 3IOKA 3IGGA 3ID6C 2JAMA 4UV0A 1PXKA 3GT8A 2HHFB 3TYKA 3F9NA 2W6ZA 4O21A 4RX7A 3Q4TA 3GVUA 3HV3A 1XDNA 3BACA 4NU1A 2AEGA 1CE8A 1B6SA 5L8JA 2ZDUA 3JRWA 2P0CA 4B6LA 4TWOA 3HUBA 5FD2A 4L53A 4X2KA 1PJKA 1BLXA 3V8WA 2WGJA 4EOQA 3DZQA 4PV0A 5EHYA 1H28A 3PWYA 4FA2A 2BUJA 3L1SA 5I5ZA 1W93A 2EJ3A 4DRFA 2QG5A 2WELA 1E4EA 4BIEA 3NNXA 4F7LA 3OCTA 2IW6A 5DI1A 5E4HA 3DBCA 4ZSJA 4FT9A 1DAYA 2UVZA 3A7FA 3E8EA 3F2AA 4BCGA 3EH9A 3O8TA 4F9WA 3F7WA 1P4FA 2Y4PA 4PQNA 2X81A 1DI9A 4BI0A 2UZTA 4U40A 4XBUA 2OXYA 3HMIA 3DK3A 5EYMA 4Z16A 5T6KA 4FV2A 4O27B 2OIBA 4NZNA 4DBNA 3TKHA 4L01A 5HVJA 3LM0A 4EC9A 3DFCB 2AUHA 1O9UA 5HBJA 2PMIA 2VNWA 3HKOA 2CCHA 4GCJA 4HCUA 3LFFA 4JIKA 2V5AA 4FZ6A 5C8YF 3OP5A 4DG2E