2CNUA

Atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with aspartic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
305
structure length
302
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Saicar Synthase: Substrate Recognition, Conformational Flexibility and Catalysis.
rcsb
molecule tags Ligase
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
total genus 106
structure length 302
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2006-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cnuA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2cnuA02
1E1XA 1CTPE 1I44A 5CT0A 4EK6A 2PWLA 5DT0A 3WE4A 3QAME 4U41A 4IE9A 4HPUE 4WG4A 3WF6A 3N4UA 4RJ7A 4ALVA 4HNTA 2GHMA 3A8WA 2R3HA 5LMBA 3DKCA 3QKMA 4WRSA 5CB4F 5C8MA 4X2GA 3DBDA 1JSTA 1OL5A 1PMUA 3BLHA 3QQKA 4IQ6A 4JDHA 4CMUA 2FUMA 4R5YA 1Y6BA 4Z55A 3LXKA 3HP2A 3NSZA 4FEWA 3FLZA 4HVSA 4NT4A 4S33A 5EQPA 4YJUA 2BTSA 3RI1A 3VHEA 5KMKA 4C5CA 5CAOA 2OKRA 5AUXA 3CR0A 4LOQA 2BKKA 4EQMA 1GIHA 4O4IF 2PSQA 4HYSA 5CSWA 4AT5A 4XCUA 4AW2A 2EU9A 4ZQIA 4EHEA 4HVGA 4IANA 4CFMA 5JGBA 1OL1A 3HV4A 4RX8A 3LCDA 3FMMA 4RSSA 4HZRA 3MWDA 4CZTA 2UZNA 4FTAA 5I4NA 2V22A 5EOBA 5M09A 3WOWA 4ZY4A 1URWA 5KNJA 2R7IA 3TV7A 1HCLA 3K3PA 2YL2A 3ACKA 4YJQA 4MXAA 5AJQA 4I4EA 4G3FA 4O7SA 3CEKA 4QMXA 1H28A 2E9NA 4LV8A 4S32A 4TYHA 3KREA 4IM3A 1C3OA 2C1BA 5HCXA 1E4EA 3FI4A 3OG7A 2DLNA 1G5SA 2C5OA 3DAEA 3KEXA 1PXPA 2VWYA 2XMYA 2ONLC 3HA8A 4PDYA 4RIXB 1ZOGA 1VZOA 2BVAA 2VTRA 3CLYA 4MAOA 5L6WL 4CFWA 3QCQA 4Z7HA 1KOAA 2C0OA 1O6YA 4Y95A 4O7YA 3VUDA 4B0GA 3LJ0A 3KB7A 2JDOA 3WZEA 5CZHA 2XK7A 2GHLA 4QYGA 3VRZA 1UV5A 4BHZA 4CXAA 1B6CB 3G2FA 3FY2A 4JR3A 3TTJA 5HNIX 2PK9A 3H9OA 4CQEA 4YZ9A 3HECA 2W71A 4U80A 4X3FC 3U55A 3DAJA 2FSLX 4J53A 3FQSA 4MXZA 4DG3E 5IEXA 4A4LA 2R3FA 3SLSA 1JPAA 3PVGA 5HQ0A 1BXRA 4QMQA 2F2UA 3FSFA 3S4QA 4BCJA 1OMWA 4ZY6A 3ZLYA 2HENA 2WMBA 2X2LA 4BTMA 3W2SA 3R73A 3UMWA 3U6JA 4K1BA 3RKBA 1SZMA 4ZTSA 2IZUA 5L2WA 3QFFA 5K3YA 3LFDA 4CMTA 3QD4A 3UIUA 3WE8A 3T3UA 4FZ7A 3OCSA 4CRLA 5JFWA 3QZFA 3DT1A 4FV4A 4RFYA 5CXZA 4ZS4A 4BDEA 1JNKA 3PG1A 2XIZA 5HTCA 3GC9A 1A9UA 4HCVA 1H1QA 4YR8A 4YZCA 3OWLA 3GGFA 4BICA 3DJ7A 3LFCA 4FFRA 3MH0A 1OBDA 3F7WA 5LXMA 4I1ZA 4LI5A 2YISA 4H1JA 2PTKA 4TUYF 3LXNA 5CSXA 3ROYA 5IQHA 3FUPA 5BYLA 2AYPA 4CTCA 1NVSA 5JRQA 5KMLA 1JSUA 3LAUA 4AA4A 5HBJA 4FSWA 1ZYCA 4JT3A 5CEIA 4FSQA 3MVHA 1JLLB 3KKVA 4W4XA 1K2PA 4C4IA 4O0YA 5AX3A 4CKIA 5JQ5A 4ERWA 5BVFA 3KN5A 5CQWA 5LARA 2WTKC 4X2FA 4G6OA 3E62A 2R2PA 3C9WA 2WIPA 4RX7A 5IISA 4FTOA 2UZTA 3BHVA 3GCPA 4TYHB 3UC3A 5KMIA 4NWMA 3GQLA 4ME6A 5IUGA 3AD6A 1SVEA 3A62A 3PRIA 3EYHA 4MV7A 1BL6A 2F49A 1C30A 2ZMCA 5M4UA 2XKFA 3WARA 4IDTA 1CDKA 1H0VA 1YRPA 3IW8A 4IAFA 2WMUA 2UVXA 4TN6A 5D10A 5BMMA 4E5AX 5AA9A 3ELJA 4XRJA 3FMHA 2OH0E 3FKNA 3KXGA 2F7EE 4DLIA 3FL4A 1BYGA 2PVNA 2VWBA 3HAVA 2JITA 4ALUA 4TNBA 2V58A 3KAJA 3KXHA 3QTUA 4PP7A 2VTJA 5BPYA 1Q4LA 2X2KA 4YBJA 2PZRA 3IW6A 1LEZA 5DN3A 4ZLZA 4TKSA 4IVCA 4C4EA 1YWNA 2XK4A 3PA5A 5KMMA 3IG7A 4G5PA 3QRTA 3HRBA 4KS8A 1S9JA 1Y6AA 2XCKA 1W84A 1MRUA 4WNPA 3W32A 4C7TA 3S0OA 2DZDA 3GEQA 4MVFA 5IQFA 4FIHA 4J99A 3NW7A 3UIXA 2NU8B 4IX5A 3OF0A 2UVZA 3HRCA 5HD7A 2ONLA 1T46A 1VR2A 4GT5A 3VNTA 4BHNA 1REJA 2IP4A 4FNXA 4C02A 1XH7A 4E26A 3E92A 3SW7A 4XV2A 2W4JA 4GCJA 5CAPA 2UZDA 3L9MA 3R8PA 2PUIA 5JH6A 5F9EA 3F7ZA 3PY0A 1XH8A 2HZNA 3IOPA 4C0TA 2QKRA 3DJ6A 2FGIA 4O7LA 4OTWA 3VQUA 3BWFA 5EM5A 1PXOA 1WVYA 3GCQA 3SA0A 5C8YF 4YLJA 2C6EA 2E9PA 4PMTA 1I7NA 2VO0A 4GKIA 4K18A 3ZFMA 4G9CA 3MY1A 4FTRA 4HVIA 4BZNA 4EOLA 5LMAA 3EFLA 3NUAA 1H24A 4QP3A 3D5VA 2PVHA 4GH2A 3S3IA 1H07A 3FQHA 1UKIA 3UJGA 4YZNA 5DRBA 2XUUA 4Z9LA 2W1HA 1SNXA 4QMMA 3TACA 4FSNA 4FFMA 3QUEA 4M7IA 5HICA 1WBPA 5IQIA 3TG1A 3ZC5A 4LOPA 3SGCA 1QPJA 1CMKE 3GC0A 4G3CA 3WF8A 1ZZ2A 4FNWA 4BGHA 2W6OA 1PW2A 2OJ9A 4L7FA 4GW8A 5D41A 4DFZE 2HELA 3PG3A 5JZJA 4XH6A 5JH7F 5A54A 4JG6A 2ITTA 4NTTA 4IZYA 4IB3A 5I9XA 3DK3A 1OUKA 3OCTA 4KS7A 1W98A 5DHJA 5AEPA 1H0WA 5D12A 1KWPA 3W2OA 2V7OA 4BCQA 5CQUA 3JVRA 4NK9A 4B9DA 1PF8A 2PVRA 4YO6A 5EYCA 4C2VA 5ACBC 5CU2A 4KRDA 5D1JA 3BQCA 2UUEA 3LCOA 4L53A 3NW6A 3ZLSA 4ASDA 5A4LA 3WILA 3KAKA 5E8UA 4YB8B 1XR1A 1XKKA 4WNMA 3QTQA 5DNRA 3PIZA 5F1ZA 4EH2A 2V5AA 1ATPE 5EM6A 4CFUA 1O9UA 5H2UA 3KALA 1W93A 2FYSA 3KQ7A 4JDIA 3GCVA 5EHOA 3W1FA 5J2TF 4RZWA 4U5JA 4YC8A 4NKSA 4PL4A 2X6EA 5I9ZA 2F2CB 1H26A 3R8ZA 4A7CA 3PWDA 3ZRMA 2OXDA 4AGDA 5IU2A 3JUHA 2P3GX 3MB7A 4P7EA 2I40A 3DKGA 4YURA 3OUZA 4M9UA 3K5VA 1ZZLA 4BCMA 4RIOA 3R5FA 1SVHA 4FVQA 4IX3A 4F6UA 3G6GA 3CTHA 1KEEA 2ZJWA 3P08A 3G8DA 5CEOA 1JOWB 5CAVA 4YTFA 2JKOA 3V6SA 4FMQA 3EQIA 2WELA 2V55A 5JKGA 2EXCX 5AP6A 1U54A 4QMSA 4DEDA 3CPCA 4RZVA 5FRIA 4JOAA 4NM5A 4KKEA 4YNEA 3DNEA 3Q9WA 3E88A 5G6VA 4DTBA 5HI2A 2DIKA 3EZRA 3POOA 4L46A 4CD0A 2QQ7A 4EH6A 2F4JA 4XG7A 2C4GA 2QCSA 4R1YA 3A4OX 2PY3A 1DS5A 1V1KA 4G6LA 4JBPA 4QMYA 5JMSA 3Q4ZA 2ESMA 4MD9E 4DEIA 3KK8A 2C5VA 2VRXA 4KIQA 1GLVA 4YNOA 3HMIA 4RVLA 2XZSA 5CU4A 2X6DA 3HMNA 4WHZA 3MPTA 4WD5A 3NDMA 4IH8A 2CNUA 3GI3A 1Z2OX 4DINA 3BLRA 1TQPA 2I8CA 4XZ3B 2PPQA 3CKWA 3M2WA 3PP0A 5DG5A 2DWCA 4P2KA 3Q60A 1Z2NX 2H34A 3FZTA 2OU7A 2X1NA 2XRWA 2Y8OA 2QU5A 4QO9A 3KN6A 4NFNA 4XMOA 3LJ2A 4TWCA 2QOLA 5DRDA 5J8IA 5LWMA 3BBTB 3LM0A 5CVGA 2GLTA 1YVJA 3A8XA 4Y73A 5CSVA 3BELA 3PXYA 2YDIA 5DVRA 1YOJA 4L8MA 3OMVA 5FDPA 3FY0A 5LOVF 3SV0A 1W96A 2QURA 2ZDTA 2VD5A 3MJ2A 5A4EA 3TIGA 3MJFA 3MWEA 5EDPA 3CPBA 3KA0A 5IQAA 5DYJA 4ZJVA 4AZEA 2WQEA 4FYNA 3JPVA 4GMYA 2VNWA 3MSSA 4RJ3A 2J0KA 3HV7A 4QTDA 4ACDA 4HVHA 3C7QA 2WEVA 4GJ3A 4L42A 2VWVA 1Y91A 3FPMA 3QZIA 2WTIA 1YDSE 4U45A 3PE2A 2GTMA 4UEUA 3ORPA 4O0TA 3LXPA 5EI6A 5LCKA 2PVYA 2BHHA 3TTIA 4JLCA 3VJNA 4DFXE 3G33A 3IW5A 4L67A 3UBDA 3PXKA 4DCEA 3C5UA 3QF9A 4UWYA 3ZZWA 4U42A 5IDPA 3PXQA 5CXHA 1EUCB 2PMIA 3UZPA 4E4MA 1FGIA 2WU7A 1YHSA 2QOOA 3U4WA 4YJ3F 5D8DA 3EH9A 4I4FA 3D5WA 5AV1A 2VUWA 5K5NA 5HHWA 2CN8A 3D9VA 3D0EA 4JXFA 2J0JA 4C35A 3BWJA 3FWQA 5HU3A 2CKEA 4QP2A 4MWHA 3TV4A 3P78A 1QL6A 3AT2A 4NW5A 3Q4CA 4XS2A 4BBEA 1OUYA 2CKOA 4DE4A 3EKNA 4Z3VA 5E92A 5C4KA 5HIEA 3AT4A 4EOQA 2HCKA 4XX0B 2NNWB 3TN8A 4OW8A 1MRYA 4DAWA 2CGVA 2YFXA 4N4SA 4LL0A 1OIUA 3HA6A 5IH6A 3V5QA 3DAKA 3FI2A 3BGQA 4H1MA 5AAGA 2QO9A 4GG7A 2XVDA 4AAAA 1YXXA 4O7RA 4FG8A 4K0YA 2JDRA 4L3JA 2PL0A 3N8DA 4O83A 5CVFA 4FGBA 5J9LA 2O64A 2GS2A 4AZWA 4BDIA 1H00A 2O63A 2YJSA 4PL5A 2BFYA 4XV1A 4QTAA 3R2YA 4CV9A 4F7SA 5EH0A 3QHWA 1KE5A 3I81A 3FC2A 1REKA 2GU8A 3D5XA 2P2IA 2VNYA 3R1NA 2XKCA 4FV3A 3RINA 3CC6A 3COKA 3PUPA 2VWUA 1OPLA 5IA5A 1Q8TA 3R5HA 4AW5A 5IMEA 2WIHA 4FZAB 3AG9A 4FSMA 3BYSA 4HCUA 4IC8A 3EYGA 1OL6A 1HCKA 4YTCA 5FEQA 4H39A 3CTQA 4C2WA 4CNHA 3GIDA 3VPCA 4TWOA 3CJFA 5LMKA 4TYEA 4ACGA 3C51A 5GJDA 1KJIA 4H05A 2EXMA 2OO8X 3PIYA 3QRIA 3LZBA 4RLKA 3C5IA 3NCGA 3E3PA 4LRMA 2ZOQA 5FTOA 4LUDA 3UO6A 1YI4A 5TO8A 3NNUA 2BPMA 3OC1A 3FXWA 4RFZA 5LVMA 3NWWA 2WTVA 3BV2A 3DK6A 3WYYA 1ZMUA 4DFNA 4FKIA 1M14A 4ZEGA 5HBEA 2IJMA 2XIRA 3BGZA 2BRGA 3QD3A 3RPYA 4FIEA 4TW9A 3GP0A 4JQ8A 5LJJA 3QQHA 1OBGA 3G90X 4XNEA 1Q8ZA 1LUFA 1TKIA 5AV2A 3FMJA 4AP7A 5ETFA 3LFBA 4RA5A 4YJ2F 3QYZA 3N4TA 4K11A 4M0ZA 5F94A 4M0YA 5E8TA 3A7JA 3QU0A 3TIZA 4IJPA 4F6WA 5B2MA 4BDAA 1BNCA 5HD4A 3L8SA 2Q83A 3FL5A 2QVSE 4XG9A 4R3RA 3DZOA 4AS0A 4ZSAA 3KF4A 2HZ4A 3UZTA 1IA8A 4L00A 3U9NA 2X9FA 5CA1F 4MHAA 2QO7A 4EHZA 3EWHA 3FSKA 2CMWA 1TVOA 4XP2A 3I60A 3OHTA 1Q61A 5H8BA 5HGIA 4ITHA 2LAVA 3MWUA 2J7TA 4G2FA 2GS7A 1IOWA 1PK8A 2ZM1A 3QZHA 4B8LA 4FT9A 3GQIA 4V0GB 3MTFA 3VS4A 1R39A 2R7LA 1IG1A 1JKJB 2ZDHA 2IG7A 2JD5A 5H3QA 3R7EA 5KZIA 3VBYA 4BI1A 3TWJA 1SM2A 5BVDA 5KHXA 4F1MA 2YCQA 1WBNA 2VPQA 2R4BA 2YS7A 3PPZA 3F2NA 4FKTA 2NRYA 4JAIA 3ETAA 2O8YA 3LMIA 3Q6UA 4FOBA 4IX4A 4F08A 3COIA 3ORZA 4QQ5A 4BC6A 4EUTA 3ORQA 4FEXA 4G3EA 2YDKA 5T3QA 1VEBA 4I6FA 4L3LA 4MNEB 2BAJA 3ZDUA 3ZO4A 4E6AA 3ETHA 4JDKA 2YZGA 2QHNA 3PIXA 4J96A 1WAKA 4QQCA 5J1WA 2WTJA 3RALA 3P23A 5I5ZA 2CHLA 2C69A 3EKKA 1BKXA 3DQWA 3HZTA 5EKOA 5B7VA 3A99A 3FDNA 3TW6A 1DV1A 3ZTXA 1IOVA 4IW0A 4BGQA 4YLLA 2XK9A 3I79A 5JFSA 2C0IA 5M57A 4TT7A 3QRUA 4M14A 5L8JA 3Q9ZA 3VC4A 2VZ6A 3ZYAA 4LV5A 4EZ7A 4OTHA 4GKHA 3FXXA 4IJ9A 5BX0A 3O23A 4J95A 4X21A 4YSJA 3R7IA 1Q8UA 4QPAA 5DLSA 3OY1A 3UGCA 4U97A 3QKLA 5E4HA 5ANIA 3CS9A 4MXCA 4BY9E 2XM9A 3KMWA 4MX9A 4E6QA 5C4LA 5C1PA 1MUOA 1RQQA 4I24A 1OGUA 4I21A 1AUVA 4IVAA 4FT7A 5J9ZA 1UWHA 1JAMA 4ZOGA 2RG6A 4C58A 2R3JA 4G31A 4H36A 5HIDA 3R7YA 4S2ZA 3BG5A 3TIIA 3F3UA 2UW9A 4LG4A 2BDWA 5E1SA 4JAJA 3OUUA 1IEPA 2ZV8A 3AQVA 2QO2A 5FM3A 4R6VA 4O2ZA 4W4VA 2OWBA 3JS2A 3ETJA 3CGOA 4F9BA 1G3NA 3ORRA 2B9IA 3V5WA 1ZMWA 3CXWA 3OCBA 3T9TA 2BDJA 5M44A 3TNIA 3RNIA 5JN2A 3ORMA 4H58A 4JRNA 5EK7A 3Q53A 4FIJA 4FL1A 4QP4A 1FVVA 4ITIA 4BBMA 2B1PA 4ONAA 3R04A 4OGRA 2UZEA 3VBQA 2VGOA 3LPBA 4FKGA 4TY1A 1Z2PX 4D5HA 2VWZA 4A9RA 4FTNA 4MV1A 3ID6C 4C38A 1RW8A 4YJRA 3O7LD 1YDRE 4XBUA 1KOBA 5ANJA 2E9UA 3I5ZA 2R3IA 4HZSA 3NCZA 2VTQA 5IA4A 3DF7A 3B2TA 3VVHA 2ERZE 4HGSA 1IR3A 2J9MA 3GU8A 4RVMA 3FLQA 1OIRA 2ZB0A 3Q96A 3QQLA 2G9XA 4F9CA 1GGOA 5CA0F 4O7TA 5D7AA 3MTLA 4PNIA 2ZAZA 4MYGA 4EKKA 4MK0A 3GCSA 3UIMA 4FV9A 5AAEA 2X9EA 4II5A 3VJOA 4EG0A 3MFTA 4X6QC 2X8EA 4U8ZA 4YJNA 4GYGA 5L3AA 3G5DA 4D2SA 4MKCA 1SMHA 3UQGA 1UU8A 5TF9A 5IH5A 4A9SA 3L8VA 1JKKA 4DGLC 4PMPA 1XBBA 5KE0A 5B2LA 2VQDA 2XK6A 1AD5A 1FQ1B 1KE8A 3BX5A 3RK7A 2NRUA 2ITPA 3DLZA 3NUNA 4C5AA 1FPUA 4N6ZA 4JX7A 2X8IA 1BI7A 4P5ZA 2QOIA 2I0YA 4FKJA 4G9RA 5HE0A 2RL5A 2C68A 3PJ3A 4IBMA 1YXUA 4TPTA 4ZZNA 2QR8A 2VO7A 4WBOA 4F0FA 4HNFA 2BUJA 2Z2WA 1WR2A 4GRBA 2R84A 3PY3A 2XYUA 4EOJA 1OZ1A 3LFFA 3ZS5A 4WOVA 3VW6A 4FUXA 4MD8E 3JRWA 3NUUA 4XG6A 2QONA 2X4FA 5AIRA 1YWRA 4MXXA 2HOGA 2XKEA 4CG9A 3FLNC 5KHWA 3OW4A 1Q8WA 2UW8A 2VAGA 3H3CA 3ROCA 3TV6A 1WBSA 1T36A 2B9HA 3ZO1A 5C03A 2VTSA 4BBFA 2XM8A 4BYIA 3OP5A 4K2RA 3THBA 2ZDUA 1R78A 1XH6A 1CSNA 2PE0A 3LM5A 4HPTE 2OIQA 4OTRA 5A4TA 3V5PA 5LCJA 4FV6A 5FQDC 3QWJA 4LGHA 5H8EA 2EWAA 2BROA 4KABA 4C3RA 2WMQA 3MVJA 3FZPA 3NUXA 5DWRA 2G15A 1DI9A 3AXWA 4I0TA 4NM0A 3ZHPC 1M7NA 4M3QA 4MA0A 3AX6A 1W82A 1R1WA 2XNBA 2VR1A 5AP4A 3MIAA 1F3MC 3TQTA 2OH4A 4ZTLA 4QYFA 5HBRB 3UVRA 4IB0A 3E5NA 5JVLA 5KKRB 3I12A 2IO6A 4A9UA 2BCJA 2HXQA 4I23A 4QP8A 4DA5A 4Q9ZA 3QGYA 4EWQA 3ZXZA 5ETIA 4M69B 2OSCA 4XYLB 2Y4IB 4O7ZA 4EOPA 1K9AA 4BIBA 3BKBA 5I9WA 5EW9A 2JDSA 4APPA 5ETCA 4CLIA 4DGOA 3DA6A 3A60A 5FNVF 3LE6A 5JZNA 4MV4A 1FINA 2BRBA 3JVSA 4FV5A 5HIBA 5TR6A 3T3VA 3ZOSA 3EL7A 5ICPA 4CFNA 5LQFA 4WO5A 4AACA 4LRKA 2W7XA 4F0IA 4FKWA 2E2BA 2ZV9A 2CNVA 3EQFA 3F5UA 5CX9A 2R9SA 4YHTA 3O8PA 4JG7A 3R02A 4G17A 1SNUA 3S2PA 4WBBB 2XNNA 2DWBA 4XLVA 2FPGB 3OVVA 3OXZA 5J1VA 2FO0A 4FTUA 3SW4A 1PXJA 2UW3A 3QLFA 3W33A 5HNGA 3UC4A 4OUCA 4MBLA 4YLKA 1GOLA 2B4SB 2R85A 3C0HA 3HX4A 1M0TA 3F9NA 5DR6A 3NZ0A 4IVBA 3HRFA 3A7HA 4CT2A 3PY1A 3QGWA 3QL8A 4P5QA 3WF7A 5FXSA 4F0GA 2Z02A 3FZOA 3ZH8A 3AC3A 3P7BA 4B4LA 4YUQA 4F1TA 2YEXA 5HO7A 1FMOE 4R7HA 3WBLA 2CCHA 2OJGA 4KB8A 3EHAA 5BVKA 3BGPA 4HNIA 1ND4A 5BMSA 3HO8A 3I1AA 4DH7A 2W1CA 4F64A 2WQMA 2DS1A 3ITZA 4IC7A 4LUEA 3ZO3A 2SRCA 2RFSA 2X7GA 2W4KA 3OTVA 2BIKB 5BVEA 3WZKA 4EBWA 5C8NA 4O2BF 2VTMA 2Z8CA 4X2KA 2W1DA 2GDOA 2W5AA 4CG8A 4J98A 3TNWA 4XUFA 3H30A 2PMOX 5CNNA 4BCGA 1XWSA 3MY0A 3RTPA 3AC4A 4NSTA 3EFJA 3KXZA 5E8XA 3UZRA 4CVAA 2XH5A 2R3RA 3N9XA 4AOIA 2RFEA 1ZOEA 5EFQA 4CKRA 2C1AA 5KO1A 3V5JA 4NL0A 2C5NA 3PP1A 3ZCLA 3RP9A 2KULA 4YBKA 4FV0A 5CSHA 3MN3A 3RPRA 2C6MA 4AOJA 4E7WA 3C4CA 3UVPA 4LOOA 4GYIA 5JVDF 4OTIA 4USEA 4FKRA 1J1BA 3VS1A 4O0RA 2WB8A 2XNEA 3EN6A 3R28A 3JZIA 1JLUE 3NIZA 3O51A 2QOFA 2GSFA 1GZNA 1KE7A 2OZOA 4YGAA 5AP1A 4BTFA 4CMOA 5A6OA 5CF4A 4FT3A 3NVMB 1NVRA 2WMAA 4D1ZA 3ZBXA 3L8PA 3VMMA 4XV9A 3FE3A 3F5XA 3TUCA 3DK7A 5LVOA 2W0JA 3IPHA 2BTRA 4XEYA 1JBPE 3QQJA 1OVEA 4CCUA 3BLQA 3COMA 5H80A 3DDPA 4Q2AA 3M1SA 1KJJA 4I5PA 5C8KA 5HE1A 5A4QA 4EK8A 1UA2A 5IMXA 4EBVA 2BDFA 4MV8A 3Q2JA 4QQTA 1FVRA 5GNKA 5FUTA 4EOMA 4XHKB 4DTAA 4O81A 5DI1A 4FV2A 4DH8A 3MYGA 1IRKA 2UZVA 2QD9A 4O7WA 4FR4A 2IW9A 3FZRA 4JVGA 5F95A 4E1ZA 5KBQA 4GIHA 3PPKA 5E1EA 5CS6A 4GK2A 4P4CA 4F7NA 2QLQA 4JJRA 4BDCA 1EYZA 3JZFA 4IHJF 2PE1A 2NO3A 2FPIB 5H8GA 2PHKA 3FZ1A 3HDMA 2C6IA 2AC5A 4D58A 4E5WA 3RGFA 5KZ0A 2C5YA 3IECA 3VW8A 2W6NA 2I80A 4IWPA 3P7CA 5A9UA 2J0IA 2OLCA 4QMLA 4FG7A 3ZSHA 2AUHA 3FZSA 1R0PA 3MPMA 2I7QA 4ZZOA 5AP2A 3F82A 2UW6A 3AMAA 3I4BA 4HGLA 4G1WA 4RBLA 1XH4A 3LKMA 5JFVA 2OIBA 3A61A 1WZYA 2W9FB 5DGZA 3ZSIA 4C61A 3CQEA 1KV2A 4M67A 3P4KA 3C4ZA 4PWNA 3RCJA 1W8CA 4YZBA 2QG5A 4AN9A 2F57A 4V05A 5BNJA 4BN1A 2VU3A 2YDJA 2JKQA 4OT5A 4YPSA 2C00A 2W6MA 3LWBA 3R2BA 2GFSA 3AT3A 2PUPA 3BPRA 2XNOA 3BYVA 3I7CA 4WSYA 2ZDGA 4D9TA 4O2AF 5BUEA 4U79A 3OD6X 2QODA 4PF4A 4XRLA 3OT3A 3FMKA 4ZMEA 4FVPA 2YZMA 3U8WA 4DLKA 3GNIB 4K33A 4YTHA 3LLTA 3UYTA 3V8SA 5HZNA 2NU7B 3EQCA 2Y7JA 4RWKA 3ULIA 1PRYA 4D1SA 5KBRA 1S9IA 4ERKA 2Z04A 4RJ4A 3OWPA 2R87A 1GJOA 2R3KA 4KBKA 4L43A 1Y8GA 5CANA 3F3WA 3P0MA 4AN3A 4C36A 5A6NA 2VO3A 3KRLA 5JSMA 2YS6A 4RFMA 4W8DA 3FKLA 4ANSA 4IZAA 3LFSA 3FI8A 3EB0A 3R21A 5HV6A 5EI8A 5E91A 2B9FA 3VF8A 2YCRA 2W1FA 5M51A 2JKMA 3EQGA 3B8QA 4IZ7A 4OBOA 2B55A 1KV1A 5IUHA 2CGUA 4I22A 3G51A 3IW7A 3PPJA 4C4GA 1A48A 1GNGA 2B7AA 4C4JA 3UQFA 4QMWA 4E6DA 5ETAA 3OBGA 3A7FA 3F2RA 3F5PA 3HV3A 4PMMA 3B8RA 4AZVA 2XCLA 1QPCA 3F3VA 2FH9A 4L3PA 4O0SA 2OF2A 5TOZA 3CTJA 4FKUA 2ITXA 3VUIA 4FE2A 4F9AA 1VBHA 4PTGA 3Q9YA 2O2UA 4FTCA 3G8CA 4MBJA 3UOJA 2HYYA 1M6VA 3VBVA 4ACMA 4GT4A 3GC7A 4EK5A 3I6UA 4HYIA 3OS3A 3TI1A 4K8AA 4CEGA 2B9JA 4LQMA 4U0IA 1IAHA 1F5QA 4NUSA 2EB3A 3SRVA 3RHKA 3UG2A 4U81A 3QXPA 5IA0A 3COHA 4IAZA 2ETKA 1LPUA 2WTKB 3ANQA 2PVFA 3LQ8A 2C3LA 3QCYA 4Q5HA 4U44A 2JKKA 4ZTQA 1M2QA 1XH5A 5IEYA 3Q3BA 1XBAA 2CGWA 4DFLA 3W2PA 3V5LA 2ZMDA 3Q4TA 1GSHA 4WBNF 4D1XA 1FBNA 2VTOA 3DTWA 3G9LX 3MESA 5CY3A 5AMNA 2G01A 2FPPB 2IVTA 2YA9A 3JXWA 4PY1A 5AP5A 4RX5A 3LXLA 4MF1A 4JBVA 2LGCA 1W7HA 3DLSA 4JI9A 4C33A 2WYOA 3MH2A 4A07A 3EQBA 3GVUA 4R7IA 2GTNA 5TT7A 3UODA 2I87A 5EHYA 4I6BA 2C47A 3MFRA 4XJ0A 5BMVF 3ATTA 3PSDA 3ET7A 2J51A 5FEEA 3R9OA 2XJ2A 3HBLA 3BU6A 4V0GA 4G16A 1P2AA 2QOHA 3DB6A 3MJ1A 4KIOA 4GV1A 3ZONA 3FHRA 4FV8A 4GVJA 4KBAA 5B0XA 4CGAA 4EKLA 5A3XA 2JEDA 3K5IA 1E9HA 1LR4A 4XYFA 2YZLA 4AZSA 4Y46A 2XIXA 4O38A 3MS9A 3PE1A 4D2RA 4X3JA 4UYAA 5CSPA 3ZLWA 5E7RA 3DTCA 1Q62A 2JFLA 4BDKA 3OWKA 4F70A 3TINA 3ORNA 5CALA 2O5KA 3BI6A 1H1SA 2IVSA 4QOXA 1MRVA 1UKHA 4GU9A 1DM2A 3FBVA 5D11A 1X8BA 4DGGA 4AT4A 4M97A 2RIOA 4J8MA 1SYKA 3FLWA 4ZHQF 3CD3A 4X2JA 4F63A 3AGLA 2WQBA 3R01A 5BVOA 4BTJA 5J5SA 3QRJA 4MH7A 3RPVA 4FTKA 3PXZA 4F65A 1A06A 3UOLA 4BZDA 4YU2A 4ZK5A 4EH8A 3NAYA 4QMOA 2ITOA 3EQPA 3W2QA 1XQZA 2BILB 3KULA 3PRFA 4HNUA 3CJGA 5K9IA 5C1OA 3VUMA 3UYSA 3MIYA 4IEBA 4ZP5A 4FTJA 4C34A 2PZIA 3AOXA 5IA3A 3DQXA 4KSQA 4XOYA 2X0SA 4FZ6A 3QWKA 4FTTA 5DOSA 4DC2A 4DH5A 3CQUA 5ANKA 2PMNX 4TL0A 4GS6A 4KD1A 5JGDA 5E9EA 5M56A 1NT2A 3R1YA 3ORIA 5IH4A 2A2AA 2J0LA 3RAIA 4CSVA 3DZQA 3O96A 2C6DA 3TJCA 2PN1A 4U9AA 4MV9A 3PVWA 4I0RA 2YM4A 4FKLA 5HU9A 4E6CA 3FYJX 3KU2A 2OK1A 2WGJA 4IWDA 4GJ2A 3SQQA 3SHEA 1CKPA 2QKWB 2BRNA 4XG4A 4YSMA 2IZRA 3PWYA 3DNDA 3SOCA 3RUPA 3FEGA 5A4CA 4BCKA 3TL8A 2JIIA 4QSHA 2YITA 3POZA 3SRVB 4CTBA 5FEDA 5DMXA 4P90A 4ZOLF 3EN5A 4FBXA 1M52A 3EFKA 4Y85A 4UN0C 3KRJA 3RV3A 3T8OA 3MB6A 4RPVA 4JX3A 2FVDA 5KKNB 4DITA 5CEMA 3R0TA 2C3KA 1JKLA 3LQ3A 2Y4IC 5FBOA 3R9RA 3AMBA 4FSTA 2YIWA 3CQWA 3MDYA 4GVAA 2YM3A 4GUEA 4TRLA 3U51A 1ZY5A 2XIYA 3EFWA 1AQ1A 5DIAA 3KMUA 3OCGA 3FMEA 4MXYA 5FD2A 3SXSA 4AF3A 2BZIB 2C6LA 3DB8A 3OXTA 3IDPA 4WIHA 3WZUA 3C4EA 3A2CA 1VBGA 3TNPC 3UOKA 3UNZA 2OLSA 4IZ5A 4D4VA 3Q32A 2C3IB 2OGVA 4FT0A 3RWQA 4EH4A 2W6PA 4FT5A 1WBOA 2BIYA 5D7VA 4IAKA 5DR2A 4AZFA 4M84A 3G15A 4XX9A 2WZJA 4FC0A 2OW3A 4QPSA 2UZOA 3QCXA 2HJWA 3K5HA 4I0SA 5IZFA 5IQEA 1ZRZA 2GS6A 1R3CA 2JDTA 5AADA 2BZHB 2VTNA 4CLJA 5EYDA 1UU9A 1J3HA 2G2IA 2XNGA 4M15A 4RIWB 5JRSA 5TKDA 1H1WA 1EUDB 5T68A 1DIKA 2BAQA 2J2IB 2RFDA 1JDEA 4L7SA 2WHBA 4O2PA 4O0XA 4RVTA 4UX9A 5F4NA 2C6KA 1WFCA 4O27B 4XG3A 3KCFA 4J7BA 5ANEA 2CJMA 2VWWA 3C13A 4C4HA 3TM0A 3RV4A 1Q41A 2V62A 5K4JA 3QD0A 4BDDA 3D4QA 4DEGA 3HKOA 3QTSA 2W1GA 2ZYBA 1OITA 4ITJA 4ZTRA 4JIAA 1BUHA 5CAEB 4GK3A 2PU8A 1H1RA 3K3IA 5CWZA 3KULB 4ZSJA 3R8MA 2WEIA 4W4WA 4DG2E 1WVXA 4G34A 3Q9XA 4E93A 1TQIA 1XO2B 2ERKA 4XP0A 5EOLA 4AXAA 4E20A 5L2TA 5LWNA 3UFXB 1U4DA 3DFCB 4BCPA 1NY3A 4MAMA 3HNGA 3ORTA 2FSMX 4X0MA 4A06A 4AA5A 3R7OA 3FQEA 3PJ2A 3E8NA 4I5MA 2R7KA 3KCKA 4OTFA 4YP8A 2NP8A 1KBLA 5L2SA 4LGGA 2RF9A 5BUIA 3FKOA 2W06A 3QYWA 3MH3A 3ULZA 1CQIB 4OR5A 4FU0A 3LFEA 1YHWA 3OROA 3V51A 4BCIA 2NPQA 2QK4A 5EM7A 2XK3A 2Q0NA 3MY5A 3EN7A 3HLLA 4CFVA 2R3GA 4MQ2A 2H9VA 5BYYA 4MNFA 2CGXA 3TZ9A 3Q2OA 2RFNA 3R1SA 3NYNA 4PV0A 4EQCA 3GU6A 3NNVA 3PTGA 4EQUA 4I55F 1J1CA 4PUZA 3AC2A 3O8UA 4WUNA 3SXFA 4BI0A 1SCUB 3ORXA 2W17A 4JQ7A 2F7XE 4NJDA 4ASZA 3AGMA 3IW4A 3NPCA 2XKDA 4TWPA 3SG9A 4YAKB 4FEQA 4DYMA 2W70A 3FPQA 5KMNA 4O96A 3QC4A 2CKPA 4RQVA 5AWMA 1PKGA 5HTBA 3R23A 3NAXA 3GC8A 3H9FA 3O50A 1OKZA 5EYKA 4FFNA 4OTDA 1Q97A 5IEVA 3VBXA 2HY0A 2W1EA 5EKNA 5CU3A 4ZSEA 4DT8A 5IQGA 1B6RA 1PMVA 2VTLA 4S31A 2W9ZB 3C4XA 4RIWA 2R82A 4EUUA 4EOSA 4JRVA 3DKFA 4HVDA 4FV7A 5LMKC 3F61A 3RWPA 4AUAA 4G3DA 1OKYA 1YXSA 4U7ZA 4RWLA 2XA4A 4RG0A 1FVTA 3QUDA 2YIQA 3GFEA 3TUDA 4NH1A 4ZZMA 5HCYA 3VS6A 2BAKA 3MH1A 2QOKA 4CFFA 4U43A 2OJJA 3D83A 3PZHA 4AGWA 5CAUA 4AG8A 3CSVA 2ZM3A 1JQHA 4O6EA 3VS7A 4AZTA 5HG8A 5KCVA 1PXLA 1JKSA 1YDTE 1K3AA 2DUVA 4GSBA 3NYVA 3GU7A 5LVLA 3RM6A 4AU8A 1CKJA 3PZEA 4FL2A 2WQOA 3D2IA 4X7QA 4AX8A 4EYMA 4RJ8A 5EZYF 2PZYA 4YTIA 2XNMA 2I0HA 3I7BA 3OY3A 2WQNA 5I9UA 4FA2A 5J87A 3TKHA 2QNJA 5DE2A 1GSOA 4QTBA 3WYXA 2UW5A 3HV6A 5FBNC 3TJDA 1V0BA 3QLGA 2GQGA 3BYMA 4IM0A 5C01A 3GXLA 2WFYA 3ZEPA 4C3FA 4E5BA 2HK5A 2J4ZA 2O3PA 3OEZA 3KGAA 3C4FA 4IFGA 4YJPA 4IVDA 4EYJA 3FJQE 4Y83A 2GPHA 3L1SA 2J90A 2PVLA 4KRCA 2V0DA 2DYLA 4IMYA 2UZLA 3SKCA 2YIRA 1A9XA 3TNQB 1OB3A 2VTHA 4G6NA 4ZS0A 5E8VA 3BYOA 4HGEA 1W0XC 4PP9A 4KBCA 4AA0A 4ZY5A 3NNXA 1PJKA 4HQ6A 4BDFA 1GAGA 3V01A 4RMZA 4KSPA 3JY0A 2WOTA 3DBFA 3ODYX 2QOBA 4YZDA 4KINA 4I5CA 2VGPA 2FSTX 4ZIMA 5EW8A 4FTQA 3ZC6A 1V0OA 3I0OA 4IB5A 3R71A 4NM3A 2QLUA 2XCHA 3I5NA 3ZBFA 3E5AA 2P0CA 3Q52A 4ZSLA 3RAHA 3H0YA 3KVXA 4MQ1A 3R83A 4EJ7A 5BYZA 4O4HF 1APME 1YKRA 2X8DA 5T6KA 3BZ3A 3VN9A 4ANMA 4F4PA 4O4LF 2ZM4A 3F69A 3BHYA 4AOTA 4DGMA 3U87A 3V8WA 3ZZEA 5CI6A 2C30A 5JFXA 2ACXA 5AP7A 1QCFA 1YI6A 2EVAA 2XJ1A 1ZXEA 3JR1A 2FP4B 3VA7A 4FFPA 4OBPA 2Z7LA 5EG3A 2YRXA 1Z5MA 4S34A 4BDHA 2VV9A 2XEZA 3PYYA 1Y8YA 3K54A 3DKOA 2WD1A 5ANDA 4DEHA 3SXRA 5K4IA 4DH3A 1Q3DA 2R3QA 3HMMA 4FI1A 3ZXTA 3PJ8A 1CQJB 3FMDA 2R64A 3LJ1A 4MWIA 3R6XA 1E4EB 3R9HA 3LMHA 3CY3A 3IKAA 4RC3A 4AN2A 4BTKA 3BE9A 2R5TA 3KF7A 4EHVA 3R8VA 1OM1A 4APCA 2OJFE 3ANRA 3UIBA 1H8FA 3VPBA 4QNYA 1GIIA 5EYMA 3ZFXA 3MFSA 3O7LB 3VIDA 2YWVA 4NU1A 4EH3A 3DBQA 3TT0A 4BCHA 5DEWA 4EH5A 4FSUA 2Y9QA 4CFXA 1R0EA 4FSZA 3HMOA 5HESA 4FODA 1YI3A 3R00A 4RVKA 4ANQA 4R78A 3CBLA 3R7UA 4PQNA 1J7UA 3HL7A 4RIYB 1PXNA 5EQYA 3UP7A 5GJGA 1OIYA 4XYMB 2GNHA 3QQFA 4GUBA 4X2NA 3PVUA 5LOHA 3ORLA 4IIJF 3L9LA 5AA8A 2Z7QA 3BYUA 4M68A 3WIGA 3PA3A 3VF9A 4E4TA 3RAKA 3UNJA 2YIYA 1J7LA 3O0GA 3KFAA 5DA3A 5M53A 2SCUB 5EI2A 3IQ7A 4F6SA 3E93A 3V4SA 2P55A 2VTIA 1L3RE 4PL3A 1IAJA 2W5BA 4IB1A 5HLPA 1O6LA 1GZ8A 3FLSA 4A4XA 1RJBA 5HNBA 5IUIA 3GOKA 5AFVA 2BR1A 3GUBA 3E8EA 3MW1A 2CPKE 3F5GA 3LFNA 5HORA 4IADA 2WTWA 3SC1A 3OTUA 4FNZA 1TQMA 2B53A 2VO6A 4NKAA 5IQCA 4FFLA 4FEVA 2ZV7A 4NCTC 5E8YA 4EH7A 2CKQA 2OICA 2Z7SA 3LVPA 5CEQA 4ENYA 4MEDA 4WG5A 5I9YA 5JQGF 4DEEA 4IAYA 5AUYA 4HW7A 4KNBA 4BCFA 3ODZX 2C6OA 1PXKA 2VTAA 4H3BA 3ZO2A 4EOIA 5CEPA 3KK9A 3AW8A 3R22A 4QNAA 4RGJA 4UBAA 4JBOA 5H9BA 1M7QA 5AUVA 1YWVA 4EHGA 3DBCA 4UZHA 3E63A 4QP7A 4YAJB 3ENHA 1Q5KA 5FG8A 3VO3A 4F9WA 2PBZA 3ATSA 3QZGA 3R1QA 3TXOA 3WI6A 4LMUA 4EWHA 2QOQA 4M13A 2GNFA 3WNZA 2WAJA 3WZJA 1FMKA 4I3ZA 3MFUA 3W16A 4DIMA 2UZUE 3SE7A 3BE2A 3AC1A 4UWBA 5AAFA 4LMNA 1H25A 4C4FA 3BCEA 3V4ZA 3NNWA 2A19B 5BQ0A 2AC3A 4KAOA 1WBVA 2OXYA 4AFJA 3FI3A 4BGGA 1ZY4A 3BRBA 4ZTMA 2I1MA 4L9IA 1I09A 1OL2A 2C3JA 1IASA 3BU3A 4BCOA 2GCDA 3WF9A 2OBJA 1DAYA 3NYOA 4FKPA 3QFVA 1XBCA 2HW7A 4WUAA 1UNLA 4UWCA 5CVHA 5E90A 2HIWA 1U59A 3ZLXA 2ZV2A 4EOKA 4FZFB 3HVCA 5G1XA 3K3JA 3QUPA 1ZARA 2FB8A 3UE4A 1NW1A 4EGJA 5CENA 5FTGA 4EOOA 1QPDA 3QQGA 1KUTA 2A1AB 2WKMA 2YM7A 2X39A 3JYAA 4C37A 2PYWA 4GEOA 2HY81 2HZ0A 3PLSA 1JKTA 3U6IA 5HEZA 1M2PA 4TV8F 3ZM9A 5ANGA 5M08A 4I93A 2DQ7X 1BX6A 2O0UA 3L9PA 2C5XA 2OJIA 4QYEA 4TYIA 5CNOA 3NUYA 5DH3A 4X3FA 4CZUA 4OTGA 3PA4A 5KMJA 2WO6A 2X0GA 4FFOA 4QYYA 4QYHA 3RFCA 4XBRA 3DBEA 2BHEA 4L6QA 5M4FA 5FP5A 1OIQA 3ENMA 3Q04A 4QQJA 4FKVA 4I20A 4R7BA 3VULA 4E73A 1NA7A 3NUSA 4Q9SA 3LCTA 1YXVA 4JNWA 3UG1A 5I9VA 1KJ9A 2OG8A 3UVQA 3FXZA 3HB9A 5JT2A 2REIA 4ZI7F 4DH1A 3IDCA 3IS5A 4YMJA 3V8TA 1KC7A 3R9NA 3VBWA 4MTAA 3Q1KA 4JQEA 3GLKA 2ZVAA 4L1KA 4DEAA 5EDRA 5HVYA 3SDJA 2YM6A 3G0EA 3V5TA 3HYHA 5HE3A 5KKRC 4MXOA 5L8LA 3EQRA 4L01A 2YZNA 1ZLTA 4PDSA 1CS0A 1URCA 4FKOA 5HG9A 4V04A 2IZSA 3C0GA 1XJDA 1ZYSA 3LHJA 3R5XA 1G8SA 4OLIA 3ZMMA 1B38A 1YHVA 4S30A 3DV3A 4I6HA 2JDVA 4IZOA 3RK9A 3IOKA 4NFMA 4HR7A 5HX8A 1UNGA 2XS0A 1KE9A 1HOWA 1MP8A 3GFWA 3LOKA 2UW7A 4YJVA 3CKXA 1Z9XA 4O7NA 2XNPA 3AMYA 3C50A 3OBJA 5IQBA 3R8LA 3QTZA 3HEGA 4BRXA 4KUJA 2CZGA 4J1RA 1JVPP 3HV5A 2V7AA 3FMLA 4FEUA 4E4XA 3SG8A 2UW0A 3MPAA 2WMXA 1RDQE 1MQ4A 4LL5A 2OF4A 4QRCA 4AFEA 5CYIA 2XJ0A 3KRXA 3NR9A 3A4PA 5HG5A 5BUJA 4YC3A 1CM8A 2XB7A 4K6ZA 4RX9A 3W18A 3PXRA 4B7TA 5KX8A 4N0SA 4G5JA 5EQEA 4DBXA 1O6KA 4Z7GA 2C6TA 4USDA 5DT4A 1YW2A 2HWOA 1H4LA 2OFUA 3BV3A 3A7GA 3G6HA 3F3ZA 1FOTA 3KXNA 2OXXA 3D7TB 3V3VA 4BF2A 4A9TA 3RVGA 1DAWA 2BFXA 2GQRA 3FMNA 1I7LA 4E8AA 2HGSA 4L44A 5GONF 5BPHA 1FGKA 3VS3A 1PKDA 2YYAA 4OBQA 5HBHA 3UO5A 3DS6A 3IGGA 4J71A 4XP3A 3QKKA 2E9VA 1J91A 2I6LA 3OEFX 5AV3A 4U40A 2P4IA 3ZM4A 1OECA 3ZEWA 4DGNA 4V01A 4BI2A 2GPWA 5DPVA 2YABA 4NTSA 4QTCA 4MBIA 4RC2A 2B52A 3RCDA 2ITZA 3RPSA 5J95A 4U3ZA 3HGKA 2UV2A 2Y6MA 3ZRKA 4Z16A 1P14A 4QMPA 3O2MA 5LYJF 4ZTHA 4DFBA 2RKUA 2ZDQA 3VS5A 3ERKA 5GHVA 4O0VA 2ITVA 4GFMA 4ACHA 3ALOA 1P5EA 5L2IA 2WMWA 4NIFB 1GZKA 3ZSGA 4F09A 3UOHA 3W2RA 3GCUA 3DXQA 1Q99A 3GU4A 3TZMA 2PUNA 4RWJA 3F3TA 2XK8A 4JIKA 4IWQA 4E4LA 4IIRA 2CNQA 2G2FA 3QD2B 2YCSA 4MCVA 1H27A 4YHFA 3P79A 2HAKA 3DFAA 4H3PA 5M07A 5JQWA 3G9NA 2ETRA 3EIDA 4Y5QA 4Y8VB 1T45A 2IWIA 4YZMA 4FKQA 5EDQA 4R1VA 1VYZA 5HKMA 2UVYA 4I5HA 1ZYJA 4CV8A 4FL3A 4O7VA 5AP3A 2W4OA 3E87A 4WRGA 4EJNA 5LP6F 1JWHA 1YXTA 2PVKA 3E7VA 3NRMA 4W8EA 4TWNA 4TZRA 4PTCA 2GNJA 4ORKA 1WCCA 2PZPA 5HG7A 3Q5ZA 4QT1A 5JEBA 4U6RA 3DOGA 5AUZA 2NU9B 4DCAA 3U54A 3PFQA 3PJ1A 4GL9A 3VUHA 2FA2A 2FSOX 2X4ZA 3ZDIA 4EK3A 5HLNA 4RIXA 4USFA 2R0IA 1UU3A 4FIIA 3FHIA 4D4SA 3RM7A 3BHUA 2IVVA 3II5A 2R3PA 4YJSA 3LFQA 3RAWA 4HNVA 1H1PA 4BDBA 4I50F 1MQBA 4LM5A 4YHJA 5LVPA 5DEYA 3JRXA 4AE9A 4UALA 3ALNA 2WPAA 3PJCA 2HWPA 2BRHA 3E8CA 4N70A 4QMVA 5JQ8A 3RJCA 3H9RA 3DXNA 3OZ6A 5GIOE 4ZJIA 2VWIA 4JBQA 5KUPA 2O65A 2QF7A 4I92A 1PX2A 4DG0E 1EHIA 4BCNA 5DT3A 5CF5A 1Z57A 2WMTA 5LA6F 5CU6A 5A46A 2W5HA 3QQUA 2YZAA 2XYNA 3EN4A 4IDVA 4WNOA 2Q0BA 2WTDA 2XP2A 3M11A 4EGQA 1PYXA 4O21A 4BDJA 5FP6A 4JS8A 1ZOHA 3I6WA 3QBNA 4FGRA 4I6QA 2BZKB 2YM8A 4O6LA 4X6RA 3PSBA 4DN5A 1P4OA 3R9DA 3IGOA 1LP4A 5IYZF 3QTXA 5AX9A 4DT9A 3MGYA 3BU5A 1XH9A 3QRKA 4ACCA 3BIZA 2VX0A 3GENA 3HUCA 3IO7A 4PDOA 4RT7A 2HW6A 3VWAA 1L8TA 1LEWA 3WZDA 4EH9A 3D5UA 3CCNA 4AT3A 4PTEA 4C59A 4O0WA 4ZLOA 2YHVA 3BBWA 4F7JA 3SVVA 3Q5IA 3QA8A 4XOZA 5IQDA 2YERA 5CI7A 4JL9A 5CASA 1G8AA 3MI9A 3REPA 1OPKA 4L68A 2ITQA 3PXFA 2W05A 4FX3A 5EM8A 2WOUA 2YAAA 4GFOA 3ACJA 3LW0A 4QMTA 2P33A 2I0VA 3LCKA 4RJ6A 4BDGA 1KJQA 1PHKA 2RG5A 2PUUA 2VX1A 3QA0A 3QCSA 2ITUA 4Q5EA 4R5SA 4BB4A 5AV0A 2H8HA 3D7ZA 5FTQA 5IG1A 1NVQA 5ITAA 5M4IA 2GFCA 3AC8A 5KX5F 3N4VA 1YOMA 3EOCA 4ANBA 4F7LA 3GOPA 2W6QA 3TKUA 4DF3A 5FXRA 2ITWA 4GT3A 4MV6A 4B6LA 2GQSA 3QXOA 3UDBA 4ALWA 5CF8A 3QTIA 4ID7A 2JLDA 2FB9A 5F20A 1EZ1A 4RC4A 4QP6A 3WO1A 2OFVA 4M12A 2NU6B 1AGWA 2BZJA 4KWPA 2QI8A 2WU6A 2X81A 4ASXA 4IHPA 2J6MA 4U3YA 2Y6OA 4ZXTA 2QOCA 3U4UA 3WIKA 1DI8A 3PLAE 3VRYA 5L8KA 3EMGA 5C26A 4IWOA 1VKZA 1SVGA 2YRWA 4NW6A 3HMPA 1PY5A 4EORA 4TTHB 1B6SA 3H10A 3VUGA 4CRSA 1UU7A 3GB2A 2OIDA 3P1AA 4D0WA 5BVNA 2ZB1A 4J52A 2CCIA 3TZ8A 4D5KA 4X3FB 3JY9A 3BHTA 4IACA 4RJ5A 2XIKA 3IK3A 4UZDA 4EEVA 3FLYA 3QX4A 4Y8DA 3UPXA 3KC3A 4QMUA 2OZAB 2XBAA 4TYJA 4EZ3A 2H6DA 3QTWA 2R3MA 1B39A 2Z7RA 4HJOA 4NJ3A 2JC6A 5FDXA 4BZOA 1BL7A 3EN9A 3CGFA 4DEBA 2QR7A 5CU0A 3IONA 3D2KA 4FOCA 4UYNA 4O84A 3T9IA 4F99A 5CF6A 4Y72A 5J2UF 1GZOA 3CE3A 3OOMA 5FM2A 2HXLA 2WMRA 1VJYA 2VTPA 3W8QA 2P2HA 3UQCA 3MV5A 2CN5A 3LLAA 5ANOA 4NYEA 3UPZA 4EI4A 5EW3A 3C1XA 3TDWA 4AW1A 4ZSGA 5KMOA 3E7OA 3NEWA 2IVUA 3KL8A 3M42A 4R3PA 3KVWA 3LP8A 3OFMA 4QP1A 5M55A 4B8MA 4EZ5A 3SAYA 4DFUA 3KRWA 1W83A 5AUWA 4FV1A 5CLPA 4CT1A 2GNGA 2PMLX 3K5UA 1YOLA 4EC9A 2GNIA 2B54A 4FK3A 5AM6A 1P4FA 4KKGA 3U9CA 5CAQA 4E4NA 5E8WA 3VOTA 3R7VA 2A27A 3TZ7A 2QU6A 1GY3A 2R86A 1PYEA 2Z60A 2YWPA 3O17A 4H3QA 2XD4A 4J8NA 2R0UA 2ITNA 4FK6A 4DLJA 2WMVA 4LFIA 4R77A 1M0WA 3MA6A 5IPJA 4DTKA 4EL9A 4W4YA 2X7FA 1U5RA 1ERKA 3A7IA 3ORKA 3L9NA 3OT8A 5AUUA 1OKWA 1EH4A 4KIPA 3BEGA 1UVRA 2X7OA 3NX8A 4IX6A 2F9GA 3RMFA 4YO4A 3P9JA 3K2LA 3HDNA 1IA9A 3E64A 3D15A 2J50A 4I4TF 4ANLA 4HYHA 2ETMA 4FNYA 1E1VA 5J7HA 4FTLA 5HO8A 3OUNB 5IA2A 3H0ZA 1OI9A 2Y4PA 3LFAA 4BYJA 3E3BX 4IAIA 2W1IA 4ARKA 4WG3A 3HUBA 5AV4A 2G2HA 2IPXA 3F66A 3OXIA 4M8TA 3D7TA 3OOGA 4RLLA 4ZAUA 3R30A 5IA1A 2JGZA 3U9SA 3TCPA 4DHFA 3LMGA 3WF5A 4NM7A 4O91A 4PDPA 1U54B 2I0EA 2IZTA 4F9YA 2PULA 2CSNA 2EB2A 2PVJA 2R7BA 3NYXA 2VTTA 3G0FA 1U46A 3OWJA 4G3GA 4QP9A 4I94A 5AP0A 5CZIA 3BEAA 3AD4A 4IM2A 3V6RA 3ZUVA 5CTPA 5CEKA 4L52A 5HLWA 2R7MA 2PVPA 3N6RA 3NVKI 4BIEA 1H08A 2GPSA 3P86A 5AIKA 5J9YA 3FV8A 3F6XA 3C0IA 3KY2A 3OUKA 4TNDA 1ULZA 2UZBA 3MVMA 2VN9A 3O71A 3PDTA 2GMXA 3UMXA 3HP5A 4D28A 1NXKA 3LQ5A 4O82A 2VWXA 4ZMFA 2BMCA 4GG5A 5A14A 1CE8A 5HVJA 4TXCA 5K5XA 3GBZA 3W2CA 2OZAA 3EJ1A 3VHKA 3WO0A 3QC9A 5HE2A 3DCVA 5IF1A 3DJ5A 5HX6A 4ZTNA 4GU6A 2JIUA 4I41A 4UV0A 1YQJA 4D4YA 2IN6A 3P7AA 5IDNA 4BIDA 4JG8A 1STCE 2W96B 3KRRA 4XG8A 4YC6A 3S00A 4BR3A 4MNEA 2ITYA 2QG7A 3HAMA 3IDBA 2W6ZA 4FTIA 4Y5HA 2JFMA 4WA9A 4A4OA 5GINE 5CT7A 1UWJA 4O4JF 3VAPA 3Q2MA 3DU8A 4NZWB 4D55A 2J5EA 1Q24A 4NCTA 2E9OA 2UZWE 2WXVA 3CIKA 1J7IA 5C1QB 2F7ZE 3KXMA 3S1HA 3DPKA 1QMZA 3LCSA 2YW2A 3PSCA 3CY2A 3QTRA 4FIGA 1M2RA 5GJFA 4YJOA 3NW5A 4PMSA 1VYWA 1BLXA 2C0TA 4UXLA 1PMNA 3GT8A 4HGTA 4ENXA 5BPFA 3H4JA 2PE2A 4B99A 2CDZA 4KA3A 3D94A 5E8ZA 3ZFYA 3UNKA 2YN8A 3VBTA 4HYUA 2KTYA 3NIEA 4QTEA 2XBJA 5FGKA 1BMKA 2YM5A 3UTOA 4ZLYA 4GIIA 4FKSA 5FXQA 2YACA 3ZRLA 4D4RA 5L6PA 1Q3WA 4XG2A 2WNTA 5DFPA 4KKHA 2RGPA 4R3CA 3W10A 4DBNA 1ZAOA 5E8SA 4D0XA 4OT6A 2J5FA 4FVRA 4BKJA 1OKVA 1ZYDA 3TNHA 4AQCA 2GNLA 4BVUA 2JBOA 4L45A 4HOKA 3OW3A 4AGCA 4ASEA 3FC1X 4N6YA 3EZVA 3BQRA 2JIVA 3CD8A 3NGAA 2J0MB 1BI8A 3C4WA 3TKIA 2V59A 4IFCA 1U5QA 2NUAB 2R3LA 5DBXA 2JAMA 1AUXA 1JDBB 1ZWSA 4YPDA 5EHLA 3KMMA 2IW6A 3UP2A 4QMZA 4OTQA 5B2KA 3VQHA 2X2MA 3TEIA 2R3NA 4WNKA 3V04A 4UXQA 2VX3A 3VS0A 2BKZA 2PVMA 4FTMA 2W1ZA 1M17A 3S95A 2H96A 4PNKA 3U9TA 1PMEA 3RHXA 3FAAA 5AM7A 3DXPA 5AUTA 3MA3A 3R63A 3F2AA 1KJ8A 3EL8A 3SD0A 4D9UA 3TIYA 2CLXA 3W8LA 5C9CA 4EONA 3O8TA 3RK5A 2Y0AA 4TYGA 5LVNA 3U6HA 4LYNA 1DV2A 4FYOA 3AC5A 4PRJA 1WBTA 3NS9A 2CLQA 2OI4X 4YBZB 3P5KA 3PVBA 3NMUF 5C27A 3VUKA 3B2WA 5JGAA 4RA4A 3Q4UA 3QX2A 3ZUUA 3TUBA 1PXMA 3MVLA 4GK4A 3E8DA 4XLIA 5D9HA 4FSRA 5ACKA 5M4CA 3N51A 2EUFB 4O86A 4J97A 5DR9A 4F1OA 5LXTF 4JDJA 4FUYA 3AD5A 1CKIA 4RZQA 3R8UA 3KXXA 4FIFA 4MA5A 3I0QA 2XEYA 5FLFA 2YIXA 4MV3A 4C5BA 3W55A 1F0QA 3QHRA 3MBLA 3FYKX 1KSWA 1WMKA 2YAKA 4K77A 3RZBA 3TDVA 2V5QA 4GFGA 4WT6A 1WVWA 5M06A 3DDQA 2R7NA 3VS2A 5GIPE 4LRJA 1ZMVA 2BALA 4FG9A 3ZUTA 3DY7A 4UB7A 3UO4A 5BVWA 1Q8YA 2XRUA 4IAAA 2XF0A 4PX6A 4YJTA 1XHAA 4AWIA 1QPEA 1KE6A 1Y57A 2QHMA 2YJRA 3DGKA 3NLBA 4O22A 4RRVA 4UY9A 4TV9F 2WTCA 2WMSA 3D14A 3CP9A 5JK3A 2HZIA 2QC6A 5HCZA 4EC8A 2IW8A 4HCTA 2A4LA 2GHGA 3SX9A 4CKJA 2A0CX 2YCFA 3F88A 1JSVA 4MD7E 4ZJJA 1RE8A 4QMNA 4RIYA 1V0PA 3NUPA 4O0UA 2JBPA 3EQHA 4RWIA 3RPOA 2JAVA 4CCBA 1OPJA 4FZDB 2G1TA 1GIJA 4EK4A 4FSYA 5I0BA 1GSAA 1H01A 2BRMA 3BHHA 5L6OA 1WBWA 5HVKA 3SOAA 2J9GA 3QALE 4C3PA 4AGUA 4FICA 2P0AA 1UNHA 3ZU7A 3EQDA 4C62A 4WKQA 2B0QA 2W99B 3L8XA 4K9YA 4DFYA 4AE6A 2R3OA 1OL7A 4AW0A 2UW4A 4N57A 3Q6WA 2PZ5A 3GU5A 4RQKA 1PXIA 4XV3A 4JR7A 3LIJA 4A9YA
chains in the Genus database with same CATH superfamily
1E1XA 1CTPE 1I44A 5CT0A 4EK6A 2PWLA 5DT0A 3WE4A 3QAME 4U41A 4IE9A 4HPUE 4WG4A 3WF6A 3N4UA 4RJ7A 4ALVA 4CC6A 2GHMA 4HNTA 3A8WA 2R3HA 5LMBA 3DKCA 3QKMA 4WRSA 5CB4F 5C8MA 4X2GA 3DBDA 3VONA 1JSTA 1OL5A 1PMUA 3BLHA 3QQKA 4IQ6A 4JDHA 4CMUA 2FUMA 4R5YA 1Y6BA 4Z55A 3LXKA 3HP2A 3NSZA 4FEWA 3FLZA 4HVSA 2HDKA 4NT4A 4S33A 5EQPA 4YJUA 2BTSA 3RI1A 3VHEA 5KMKA 4C5CA 5CAOA 2OKRA 5AUXA 3CR0A 4LOQA 2BKKA 4EQMA 1GIHA 4O4IF 2PSQA 4HYSA 5CSWA 4AT5A 4XCUA 4AW2A 2EU9A 4ZQIA 4EHEA 4HVGA 4IANA 4CFMA 5JGBA 1OL1A 3HV4A 4RX8A 3LCDA 3UYYA 3FMMA 4RSSA 4HZRA 3MWDA 1A0GA 4CZTA 2UZNA 4FTAA 5I4NA 2V22A 5EOBA 5M09A 3WOWA 4ZY4A 1URWA 4DAAA 5KNJA 2R7IA 3TV7A 1HCLA 3K3PA 4EFBA 2YL2A 3ACKA 4YJQA 4MXAA 5AJQA 4I4EA 4G3FA 4O7SA 3CEKA 4QMXA 1H28A 2E9NA 4LV8A 4S32A 4TYHA 3KREA 4IM3A 5BV3A 2C1BA 5HCXA 1E4EA 3FI4A 3OG7A 1C3OA 2DLNA 1G5SA 2C5OA 3UDZA 1CKNB 3DAEA 3KEXA 1PXPA 2VWYA 2XMYA 2ONLC 3HA8A 4PDYA 4RIXB 1ZOGA 1VZOA 2BVAA 2VTRA 3CLYA 4MAOA 5L6WL 4CFWA 3QCQA 4Z7HA 1KOAA 2C0OA 1O6YA 4Y95A 4O7YA 3VUDA 4B0GA 3KIOC 3KB7A 3LJ0A 2JDOA 3WZEA 5CZHA 2XK7A 2GHLA 4QYGA 3VRZA 1UV5A 4BHZA 4CXAA 1B6CB 3G2FA 3FY2A 4JR3A 3TTJA 5HNIX 2PK9A 3H9OA 4CQEA 4YZ9A 3HECA 2W71A 4U80A 4X3FC 3U55A 3DAJA 2FSLX 4J53A 3FQSA 4MXZA 4DG3E 5IEXA 4A4LA 2R3FA 3SLSA 1JPAA 3PVGA 5HQ0A 1IYEA 1BXRA 4QMQA 2F2UA 3FSFA 3S4QA 4BCJA 1OMWA 4ZY6A 3ZLYA 2HENA 1VLRA 2WMBA 2X2LA 4BTMA 3W2SA 3R73A 3UMWA 3U6JA 4K1BA 3RKBA 1SZMA 4ZTSA 2IZUA 5L2WA 3QFFA 5K3YA 3LFDA 4CMTA 3QD4A 3UIUA 3WE8A 3T3UA 4FZ7A 3OCSA 4CRLA 5JFWA 3QZFA 3DT1A 4FV4A 4RFYA 5CXZA 4ZS4A 4BDEA 1JNKA 3PG1A 2XIZA 5HTCA 4QEBA 3GC9A 1A9UA 4HCVA 1H1QA 1G8KA 4YR8A 4JXUA 4YZCA 3OWLA 3GGFA 4BICA 3DJ7A 3LFCA 4FFRA 3MH0A 1OBDA 3F7WA 5LXMA 4I1ZA 4LI5A 2YISA 4H1JA 2PTKA 4TUYF 3LXNA 5CSXA 3ROYA 5IQHA 3FUPA 5BYLA 2AYPA 4CTCA 1NVSA 5JRQA 5KMLA 1JSUA 3LAUA 4AA4A 4AXDA 5HBJA 4FSWA 1ZYCA 4JT3A 5CEIA 4FSQA 3MVHA 1JLLB 3KKVA 4W4XA 1K2PA 4C4IA 4O0YA 5AX3A 4CKIA 5JQ5A 4ERWA 5BVFA 3KN5A 5CQWA 5LARA 2WTKC 4X2FA 4G6OA 3E62A 2R2PA 3C9WA 2WIPA 4RX7A 5IISA 4FTOA 2UZTA 3BHVA 3GCPA 4TYHB 3UC3A 5KMIA 4NWMA 3GQLA 4ME6A 5IUGA 3AD6A 1SVEA 4LH6A 3A62A 3PRIA 3EYHA 4MV7A 1BL6A 2F49A 1C30A 3W5OA 2ZMCA 5M4UA 2XKFA 3WARA 4IDTA 3TEKA 5KHXA 1CDKA 1H0VA 1YRPA 3IW8A 4IAFA 2WMUA 2UVXA 4TN6A 5D10A 5BMMA 4E5AX 5AA9A 3ELJA 4XRJA 3FMHA 2OH0E 3FKNA 3KXGA 2F7EE 4DLIA 3FL4A 1BYGA 2PVNA 2VWBA 3HAVA 2JITA 4ALUA 4TNBA 2V58A 3KAJA 3KXHA 3QTUA 4PP7A 2VTJA 5BPYA 1Q4LA 2X2KA 4YBJA 2PZRA 3IW6A 1LEZA 5DN3A 4ZLZA 4TKSA 4IVCA 4C4EA 1YWNA 2XAMA 2XK4A 3PA5A 3IG7A 5KMMA 4G5PA 3QRTA 3HRBA 4KS8A 1S9JA 1Y6AA 2XCKA 1W84A 1MRUA 4WNPA 3W32A 4C7TA 3S0OA 2DZDA 3GEQA 4MVFA 5IQFA 4FIHA 4J99A 3NW7A 3UIXA 2NU8B 4IX5A 3OF0A 2UVZA 3HRCA 5HD7A 2ONLA 1T46A 1VR2A 4GT5A 3VNTA 4BHNA 1REJA 2IP4A 4FNXA 4C02A 1XH7A 4E26A 3E92A 3SW7A 4XV2A 1TA8A 2W4JA 4GCJA 5CAPA 2UZDA 3L9MA 3R8PA 2PUIA 5JH6A 5F9EA 3F7ZA 3PY0A 1XH8A 2HZNA 3IOPA 4C0TA 2QKRA 2HHFB 3DJ6A 2FGIA 4O7LA 4OTWA 3VQUA 3BWFA 5EM5A 1PXOA 5I5UA 1WVYA 3GCQA 3SA0A 5C8YF 4YLJA 2C6EA 2E9PA 4PMTA 1I7NA 2VO0A 4GKIA 4K18A 3ZFMA 4G9CA 3MY1A 4FTRA 4HVIA 4BZNA 4EOLA 5LMAA 3EFLA 3NUAA 1H24A 4QP3A 3D5VA 2PVHA 4GH2A 3S3IA 1H07A 3FQHA 1UKIA 3UJGA 4AQKA 4YZNA 5K3WA 5DRBA 2XUUA 4Z9LA 2W1HA 1SNXA 4QMMA 3TACA 4FSNA 4LV7A 4FFMA 3QUEA 4M7IA 5HICA 1WBPA 5IQIA 3TG1A 3ZC5A 1KT8A 3GB8B 4LOPA 3SGCA 1QPJA 1CMKE 3GC0A 4G3CA 3WF8A 1ZZ2A 4FNWA 4BGHA 2W6OA 1PW2A 2OJ9A 4L7FA 4GW8A 5D41A 4DFZE 2HELA 3PG3A 5JZJA 5D1OA 4XH6A 5JH7F 5A54A 4JG6A 2ITTA 4NTTA 2ABJA 4IZYA 4IB3A 5I9XA 3DK3A 1OUKA 3OCTA 4KS7A 1W98A 5DHJA 5AEPA 1H0WA 5D12A 5FPRA 1KWPA 3W2OA 2V7OA 4BCQA 4EFEA 5CQUA 3JVRA 4NK9A 4B9DA 1PF8A 2PVRA 4YO6A 5EYCA 4C2VA 5ACBC 5CU2A 3PN1A 5I60A 4KRDA 5D1JA 3BQCA 2UUEA 3LCOA 4L53A 3NW6A 3ZLSA 4ASDA 5A4LA 3WILA 3KAKA 5E8UA 4YB8B 1XR1A 1XKKA 4WNMA 3QTQA 5DNRA 3PIZA 5F1ZA 2ZGIA 4EH2A 2V5AA 1ATPE 5EM6A 4CFUA 1O9UA 5H2UA 3KALA 1W93A 2FYSA 3KQ7A 4JDIA 3GCVA 5EHOA 3W1FA 5J2TF 4RZWA 4U5JA 4YC8A 4NKSA 4PL4A 2X6EA 5I9ZA 2F2CB 1H26A 3R8ZA 4A7CA 3PWDA 3ZRMA 2OXDA 4AGDA 5IU2A 3JUHA 2P3GX 3MB7A 4P7EA 2I40A 3DKGA 4YURA 3OUZA 4M9UA 3K5VA 1ZZLA 4BCMA 4RIOA 3R5FA 1SVHA 4FVQA 4IX3A 4F6UA 3G6GA 3CTHA 1KEEA 2ZJWA 3P08A 3G8DA 5CEOA 1JOWB 3NFFB 5CAVA 4YTFA 2JKOA 3V6SA 4FMQA 3EQIA 2WELA 2V55A 5JKGA 2EXCX 5AP6A 3NFGB 1U54A 4QMSA 4DEDA 2Y4RA 4UCRA 3CPCA 4RZVA 5FRIA 4JOAA 4NM5A 4KKEA 4YNEA 3DNEA 3Q9WA 3E88A 5G6VA 4DTBA 5HI2A 2DIKA 3EZRA 2EJ3A 3POOA 4L46A 4CD0A 2QQ7A 4EH6A 2F4JA 4XG7A 2C4GA 2QCSA 4R1YA 3A4OX 2PY3A 1DS5A 1V1KA 4G6LA 4JBPA 4QMYA 5JMSA 3Q4ZA 1B04A 2ESMA 4MD9E 4DEIA 3KK8A 2C5VA 2VRXA 4KIQA 1GLVA 4YNOA 3HMIA 4RVLA 2XZSA 5CU4A 2X6DA 3HMNA 4WHZA 3MPTA 4WD5A 3NDMA 4IH8A 2CNUA 3GI3A 1Z2OX 4DINA 3BLRA 1TQPA 2I8CA 4XZ3B 2PPQA 3CKWA 3M2WA 3PP0A 5DG5A 2DWCA 4P2KA 3Q60A 1Z2NX 2H34A 3FZTA 2OU7A 2X1NA 2XRWA 2Y8OA 2QU5A 4QO9A 3KN6A 4NFNA 4XMOA 3LJ2A 4TWCA 2QOLA 5DRDA 5J8IA 5LWMA 3BBTB 3LM0A 5CVGA 2GLTA 1YVJA 3A8XA 4Y73A 5CSVA 3BELA 3PXYA 2YDIA 5DVRA 1YOJA 4L8MA 5DGIA 3OMVA 5FDPA 3FY0A 5LOVF 3SV0A 1W96A 2QURA 2ZDTA 2VD5A 3MJ2A 5A4EA 3TIGA 3MJFA 3MWEA 5EDPA 3CPBA 3KA0A 5IQAA 5DYJA 4ZJVA 4AZEA 2WQEA 4FYNA 3JPVA 4GMYA 2VNWA 3MSSA 4RJ3A 2J0KA 3HV7A 4QTDA 4ACDA 3NBZB 4HVHA 3C7QA 2WEVA 4GJ3A 4L42A 1XDNA 2VWVA 1Y91A 3FPMA 3QZIA 4BJJB 2WTIA 1YDSE 4U45A 3PE2A 2GTMA 4UEUA 3ORPA 4O0TA 3LXPA 5EI6A 5LCKA 2PVYA 2BHHA 3TTIA 4JLCA 3VJNA 4DFXE 3G33A 3IW5A 4L67A 3UBDA 3PXKA 4DCEA 3C5UA 3QF9A 4UWYA 3ZZWA 4U42A 5IDPA 1VS0A 3PXQA 5CXHA 1EUCB 2PMIA 1WRVA 3UZPA 4E4MA 1FGIA 2WU7A 4UCTA 1P16A 1YHSA 2QOOA 3U4WA 3CEBA 4YJ3F 5D8DA 3EH9A 4I4FA 3D5WA 5AV1A 2VUWA 5K5NA 5HHWA 2CN8A 3D9VA 3D0EA 4JXFA 2J0JA 4C35A 3BWJA 3FWQA 5HU3A 2CKEA 4QP2A 4MWHA 3TV4A 3P78A 1QL6A 3AT2A 4NW5A 3Q4CA 4XS2A 4BBEA 1OUYA 2CKOA 4DE4A 3EKNA 4Z3VA 5E92A 5C4KA 5HIEA 3AT4A 4EOQA 2HCKA 4XX0B 2NNWB 3TN8A 4OW8A 1MRYA 4DAWA 2CGVA 2YFXA 4N4SA 4LL0A 1OIUA 3HA6A 5IH6A 3V5QA 3DAKA 3FI2A 3BGQA 4H1MA 4QDVA 3W0NA 5AAGA 2QO9A 4GG7A 2XVDA 4AAAA 5CM0A 1YXXA 4O7RA 4FG8A 4K0YA 2JDRA 4L3JA 2PL0A 3N8DA 4O83A 5CVFA 4FGBA 5J9LA 2O64A 2GS2A 4AZWA 4BDIA 1H00A 2O63A 2YJSA 4PL5A 2BFYA 4XV1A 4QTAA 3R2YA 4CV9A 4F7SA 5EH0A 3QHWA 1KE5A 3I81A 3FC2A 1REKA 2GU8A 3D5XA 2P2IA 2VNYA 3R1NA 2XKCA 4FV3A 3RINA 3CC6A 3COKA 3PUPA 2VWUA 1OPLA 5IA5A 1Q8TA 3R5HA 4AW5A 5IMEA 2WIHA 4FZAB 3AG9A 4FSMA 3BYSA 4HCUA 4IC8A 3EYGA 1OL6A 1UC9A 1HCKA 4YTCA 5FEQA 4H39A 3CTQA 4C2WA 4CNHA 2EIYA 3GIDA 4TWOA 3CJFA 5LMKA 3T9EA 4TYEA 3VPCA 4ACGA 3C51A 5GJDA 1KJIA 4H05A 4BJJA 2EXMA 5BWUA 2OO8X 3PIYA 3QRIA 3LZBA 4RLKA 3C5IA 3NCGA 3E3PA 4LRMA 2ZOQA 5FTOA 4LUDA 3UO6A 1YI4A 2AEGA 5TO8A 3NNUA 2BPMA 3OC1A 3FXWA 4RFZA 5LVMA 3NWWA 2WTVA 3BV2A 3DK6A 3WYYA 1ZMUA 4DFNA 4FKIA 1M14A 3UDSA 4ZEGA 5HBEA 2IJMA 2XIRA 3BGZA 2BRGA 3QD3A 3RPYA 4FIEA 4TW9A 3GP0A 2CFMA 4JQ8A 5LJJA 3QQHA 1OBGA 3G90X 4XNEA 1Q8ZA 4GLWA 1LUFA 1TKIA 5AV2A 3FMJA 4AP7A 5ETFA 4RCNA 3LFBA 4RA5A 4YJ2F 3QYZA 3N4TA 4K11A 4M0ZA 5F94A 4M0YA 5E8TA 3A7JA 3QU0A 3TIZA 4IJPA 4F6WA 5B2MA 4BDAA 1BNCA 5HD4A 3L8SA 2Q83A 3FL5A 2QVSE 4XG9A 4R3RA 3DZOA 4AS0A 4ZSAA 3KF4A 2HZ4A 3UZTA 1IA8A 4L00A 3U9NA 2X9FA 5CA1F 4MHAA 2QO7A 4EHZA 3EWHA 3FSKA 2CMWA 1TVOA 4CMDA 4XP2A 3I60A 3OHTA 1Q61A 5H8BA 5HGIA 4ITHA 2LAVA 3MWUA 3W0MA 2J7TA 4G2FA 2GS7A 1IOWA 1EKPA 2ZM1A 3QZHA 4B8LA 4FT9A 1PK8A 3GQIA 4V0GB 3MTFA 3VS4A 1R39A 2R7LA 1IG1A 1JKJB 2ZDHA 2IG7A 2JD5A 5H3QA 3R7EA 5KZIA 3RNYA 3VBYA 3TWJA 1SM2A 4BI1A 5BVDA 4F1MA 2YCQA 1WBNA 2VPQA 2R4BA 2YS7A 3PPZA 3F2NA 4FKTA 3VPDA 2NRYA 4JAIA 3ETAA 2O8YA 3LMIA 3Q6UA 4FOBA 4IX4A 4F08A 3COIA 3ORZA 4QQ5A 4BC6A 4EUTA 3ORQA 4FEXA 4G3EA 2YDKA 5T3QA 1VEBA 4I6FA 4L3LA 4MNEB 2BAJA 3ZDUA 3ZO4A 4E6AA 3ETHA 4JDKA 2YZGA 2QHNA 3PIXA 4J96A 1WAKA 4QQCA 5J1WA 2WTJA 3RALA 3P23A 2XARA 5I5ZA 2CHLA 2C69A 3EKKA 1BKXA 3DQWA 3HZTA 5EKOA 5B7VA 3A99A 3FDNA 5D1OB 3TW6A 1DV1A 3ZTXA 1IOVA 3UDTA 4M0JA 4Q4DA 4IW0A 4BGQA 2XALA 4YLLA 2XK9A 3I79A 5JFSA 2C0IA 5M57A 4TT7A 3QRUA 4M14A 5L8JA 3Q9ZA 3VC4A 2VZ6A 3ZYAA 4LV5A 4EZ7A 4OTHA 4GKHA 2COGA 3FXXA 4IJ9A 5BX0A 3O23A 4J95A 3AKKA 4X21A 4YSJA 3WWJA 1CKOA 3R7IA 1Q8UA 4QPAA 5DLSA 3OY1A 3T9AA 3UGCA 1ET0A 4U97A 3QKLA 5E4HA 5ANIA 3CS9A 4MXCA 4BY9E 2XM9A 3KMWA 4MX9A 4E6QA 5C4LA 5C1PA 1MUOA 1RQQA 4I24A 1OGUA 4I21A 1AUVA 4IVAA 4FT7A 5J9ZA 1UWHA 1JAMA 4ZOGA 2RG6A 4AXFA 4C58A 2R3JA 4G31A 4H36A 5HIDA 3R7YA 4S2ZA 3BG5A 4DHZA 3F3UA 2HIXA 3TIIA 2UW9A 4LG4A 2BDWA 5E1SA 4JAJA 3OUUA 1IEPA 2ZV8A 3AQVA 3LULA 2QO2A 5FM3A 4R6VA 4O2ZA 4W4VA 2OWBA 3JS2A 3ETJA 3CGOA 4F9BA 1G3NA 3ORRA 2B9IA 3V5WA 1ZMWA 3CXWA 3OCBA 3T9TA 2BDJA 5M44A 4E6NA 3TNIA 3RNIA 5JN2A 3ORMA 4H58A 4JRNA 5EK7A 3BABA 3Q53A 4FIJA 4FL1A 4QP4A 2OWOA 1FVVA 4ITIA 4BBMA 2B1PA 4ONAA 3R04A 4OGRA 2UZEA 3VBQA 2VGOA 3LPBA 4FKGA 4TY1A 1Z2PX 4D5HA 2VWZA 4A9RA 4FTNA 4MV1A 3ID6C 3U0GA 4C38A 1RW8A 3BAAA 5CE8A 4YJRA 3O7LD 1YDRE 4XBUA 1KOBA 5ANJA 2E9UA 3I5ZA 2R3IA 4HZSA 3NCZA 2VTQA 5IA4A 3DF7A 3B2TA 3VVHA 2ERZE 4HGSA 1IR3A 2J9MA 3GU8A 4RVMA 3FLQA 1OIRA 2ZB0A 3Q96A 3QQLA 2G9XA 4F9CA 1GGOA 5CA0F 4O7TA 5D7AA 3MTLA 4PNIA 2ZAZA 4MYGA 4EKKA 4MK0A 3GCSA 3UIMA 4FV9A 5AAEA 2X9EA 4II5A 3VJOA 4EG0A 3MFTA 4X6QC 2X8EA 2ZFYA 4U8ZA 4GYGA 4YJNA 3G5DA 4D2SA 5L3AA 4MKCA 1SMHA 3UQGA 1UU8A 5TF9A 5IH5A 4A9SA 3L8VA 1JKKA 4DGLC 4PMPA 3T54A 1XBBA 5KE0A 5B2LA 2VQDA 2XK6A 1AD5A 1FQ1B 1KE8A 3BX5A 3RK7A 2NRUA 2ITPA 3DLZA 3NUNA 1V9PA 1FPUA 4C5AA 4N6ZA 4JX7A 2X8IA 1BI7A 4P5ZA 2QOIA 2I0YA 4FKJA 4G9RA 2XANA 5HE0A 2RL5A 2C68A 3PJ3A 4IBMA 1YXUA 4TPTA 4ZZNA 2QR8A 2VO7A 4DDIA 4WBOA 4F0FA 4HNFA 2BUJA 2Z2WA 1WR2A 4GRBA 2HVQA 2R84A 3PY3A 2XYUA 4EOJA 1OZ1A 3LFFA 3ZS5A 4WOVA 3VW6A 4FUXA 4MD8E 3JRWA 3NUUA 4XG6A 2QONA 2X4FA 1G8JA 5AIRA 1YWRA 4MXXA 2HOGA 2XKEA 4CG9A 3W1BA 3FLNC 5KHWA 3OW4A 1Q8WA 2UW8A 2VAGA 3H3CA 3ROCA 3TV6A 1WBSA 1T36A 2B9HA 3ZO1A 3S24A 5C03A 2VTSA 4BBFA 2XM8A 4BYIA 3OP5A 4K2RA 3THBA 4UCVA 2ZDUA 4HN2A 1R78A 1XH6A 1CSNA 2PE0A 3LM5A 4HPTE 2OIQA 4OTRA 5A4TA 3V5PA 5LCJA 4FV6A 5FQDC 3QWJA 4LGHA 5H8EA 2EWAA 2BROA 4KABA 4C3RA 2WMQA 3MVJA 3FZPA 3NUXA 5DWRA 2G15A 1DI9A 3AXWA 4I0TA 4NM0A 3ZHPC 1M7NA 4M3QA 4MA0A 3AX6A 1W82A 1R1WA 2XNBA 2VR1A 5AP4A 3MIAA 1F3MC 3TQTA 2OH4A 4ZTLA 4QYFA 3W0SA 5HBRB 3UVRA 4IB0A 3E5NA 1I1MA 5KKRB 5JVLA 3I12A 2IO6A 4A9UA 2BCJA 2HXQA 4I23A 4QP8A 4DA5A 4Q9ZA 3QGYA 4EWQA 3ZXZA 5ETIA 4M69B 2OSCA 4XYLB 2Y4IB 4O7ZA 4EOPA 1K9AA 4BIBA 3BKBA 5I9WA 5EW9A 3GJXB 2JDSA 4APPA 5ETCA 4CLIA 4DGOA 3DA6A 3A60A 5FNVF 3LE6A 5JZNA 4MV4A 1FINA 2BRBA 3JVSA 4FV5A 5HIBA 5TR6A 3T3VA 3ZOSA 3EL7A 5ICPA 4CFNA 5LQFA 4WO5A 4AACA 4LRKA 2W7XA 4F0IA 4FKWA 2E2BA 2ZV9A 2CNVA 3EQFA 3F5UA 5CX9A 2R9SA 4YHTA 3O8PA 4JG7A 3R02A 4G17A 1SNUA 3S2PA 4WBBB 2XNNA 2DWBA 4XLVA 2FPGB 3OVVA 3OXZA 5J1VA 2FO0A 4FTUA 3SW4A 1PXJA 2UW3A 2XAOA 3QLFA 3W33A 1CKMA 5HNGA 3UC4A 4OUCA 4MBLA 4YLKA 1GOLA 2B4SB 2R85A 3C0HA 3HX4A 1M0TA 3F9NA 5DR6A 3NZ0A 4IVBA 3HRFA 3A7HA 4CT2A 3PY1A 3QGWA 3QL8A 4P5QA 3WF7A 5FXSA 4F0GA 2Z02A 3FZOA 3ZH8A 3AC3A 3P7BA 4B4LA 4YUQA 4F1TA 2YEXA 1ZYLA 5HO7A 5CR5A 1FMOE 4R7HA 3WBLA 2CCHA 4UFZA 2OJGA 4KB8A 3EHAA 5BVKA 3BGPA 4HNIA 1ND4A 5BMSA 3HO8A 3I1AA 4DH7A 2W1CA 4F64A 2WQMA 2DS1A 3ITZA 4IC7A 4LUEA 3ZO3A 2SRCA 2RFSA 2X7GA 2W4KA 3OTVA 4UUGA 2BIKB 5BVEA 3WZKA 4EBWA 5C8NA 4O2BF 2VTMA 2Z8CA 4X2KA 2W1DA 2GDOA 2W5AA 4CG8A 4J98A 3TNWA 4XUFA 3H30A 2PMOX 4IWXA 5CNNA 4BCGA 1XWSA 3MY0A 3RTPA 3AC4A 4NSTA 3EFJA 3KXZA 5E8XA 3UZRA 4CVAA 2XH5A 2R3RA 3N9XA 4AOIA 2RFEA 1ZOEA 5EFQA 4CKRA 2C1AA 5KO1A 3V5JA 3BACA 4NL0A 2C5NA 3PP1A 3ZCLA 3RP9A 2KULA 4YBKA 4FV0A 5CSHA 3MN3A 3RPRA 2C6MA 4AOJA 4E7WA 3C4CA 3UVPA 4LOOA 4GYIA 5JVDF 1DGSA 4OTIA 4USEA 4FKRA 1J1BA 3VS1A 4O0RA 5I5WA 2WB8A 2XNEA 3EN6A 3R28A 3JZIA 1JLUE 3NIZA 3O51A 2QOFA 2GSFA 1GZNA 1KE7A 2OZOA 4YGAA 5AP1A 4BTFA 4CMOA 5A6OA 5CF4A 4FT3A 3NVMB 1NVRA 2WMAA 4D1ZA 3ZBXA 3L8PA 3VMMA 4XV9A 3FE3A 3F5XA 3TUCA 3DK7A 5LVOA 2W0JA 3IPHA 2BTRA 4XEYA 1JBPE 3QQJA 1OVEA 4CCUA 3BLQA 3COMA 5H80A 3DDPA 4Q2AA 3M1SA 1KJJA 4I5PA 5C8KA 5HE1A 5A4QA 1XK5A 4EK8A 1UA2A 5IMXA 4EBVA 2DAAA 2BDFA 4MV8A 3Q2JA 4QQTA 1FVRA 5GNKA 5I5SA 5FUTA 4EOMA 4XHKB 4DTAA 4O81A 5DI1A 4FV2A 4DH8A 3MYGA 1IRKA 2UZVA 2QD9A 4O7WA 4FR4A 2IW9A 3FZRA 4JVGA 5F95A 4E1ZA 5KBQA 4GIHA 3PPKA 5E1EA 5CS6A 4GK2A 4P4CA 4F7NA 2QLQA 4JJRA 4BDCA 1EYZA 3JZFA 4IHJF 2PE1A 2NO3A 2FPIB 5H8GA 2PHKA 3FZ1A 3HDMA 2C6IA 2AC5A 4D58A 4E5WA 3RGFA 5KZ0A 2C5YA 3IECA 4CKCA 3VW8A 1ST4A 2W6NA 2I80A 4IWPA 3P7CA 5A9UA