1OBDA

Saicar-synthase complexed with atp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
303
structure length
298
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKADENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMIDOIMIDAZOLE- SUCCINOCARBOXAMIDE SYNTHASE
publication title X-Ray Structure of Saicar-Synthase Complexed with ATP
rcsb
molecule tags Ligase
total genus 101
structure length 298
sequence length 303
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1obdA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1obdA02
3TACA 3QUDA 1A06A 2QOIA 2ZAZA 2G01A 3FV8A 2C3LA 3KRJA 2R87A 4ZY6A 3PSDA 3C50A 1OM1A 4KBKA 4FOCA 3MH0A 4EQUA 1LUFA 4IANA 4ZSAA 3EB0A 3BRBA 5ICPA 5KBQA 5EYDA 5AP2A 2OJIA 3ERKA 2RIOA 4GKHA 4QP6A 1M2QA 2GQGA 2RFEA 3GUBA 4QMUA 5CZIA 1J7UA 3UG2A 3VBTA 5JFSA 5BVWA 5JGAA 3MWUA 3FPQA 2R0UA 2JDOA 5M56A 1JNKA 2XMYA 4FIIA 2XKDA 3M2WA 4EH4A 5FBOA 2F7ZE 5L2IA 3KKVA 4IW0A 4L46A 4JAJA 3PXKA 4WIHA 4DEBA 3MPTA 3D7ZA 4FODA 4JDJA 1IAHA 3FSKA 4ZTHA 4EJ7A 3CR0A 3RAHA 4G9CA 4C7TA 2UZTA 1K9AA 2CLXA 3O71A 4TKSA 4CTCA 3CE3A 3NRMA 3HRBA 3FLWA 4CQEA 3BHUA 4RIWA 5DGZA 2XF0A 2B9FA 4FV7A 2R84A 3HV5A 4DEDA 2C30A 3HMIA 1W8CA 1WVYA 3MJFA 2P2HA 2NU9B 4AU8A 3DXNA 1YRPA 5LMKC 2UW3A 4IWOA 5CI7A 5M44A 2WU7A 4BCIA 3BGZA 5C8KA 4PWNA 4CFNA 3Q96A 4OTFA 3G2FA 3BYMA 3MH1A 2W6OA 5AM7A 3FI2A 4QP8A 1EH4A 3HDNA 5ANEA 3ZO2A 4B8LA 2C5OA 4KKGA 4U3YA 3RALA 2GLTA 4D28A 4XCUA 3LFBA 3WO1A 4UXQA 3KQ7A 4MKCA 4Y8DA 4BBMA 3U6IA 1TKIA 1GSAA 4I5HA 2REIA 4QRCA 5E1SA 3ZXTA 1U5RA 3EN4A 3I0QA 3F6XA 2B55A 3GC9A 2KULA 1IG1A 2W5BA 3PRFA 3WOWA 5J7HA 4U41A 4MNFA 1HCKA 3NZ0A 4ASXA 3TNIA 2UW7A 3K5UA 3LIJA 3UBDA 4E6DA 4DF3A 1E1XA 5I0BA 3JUHA 4FSNA 1OMWA 3R2BA 4O7WA 3L9LA 5IUGA 3GC0A 4U40A 4HJOA 1P2AA 3PIXA 5CAPA 4U8ZA 5AA9A 1JSVA 1UNGA 5IQCA 2YIQA 2DQ7X 1KSWA 3QQFA 3QWKA 1UWJA 1XR1A 4DFXE 2W6MA 3BHYA 4RA5A 3ETHA 1OUKA 3R28A 3R0TA 3PG3A 2YITA 3KF7A 4YZCA 1JKLA 3AQVA 2OO8X 2VO7A 3DBFA 3QRUA 4JDKA 2XNOA 3ZDIA 2NU7B 3SC1A 3BBWA 2B9IA 4X6QC 3GQLA 2C5XA 3Q4CA 3ZCLA 4KA3A 5HLNA 3VWAA 1W7HA 4QO9A 4IAZA 1RQQA 2PUPA 3PJ2A 4F0IA 3BQRA 4N6YA 4O0VA 4XG7A 5D41A 2X2MA 3WF5A 3ZS5A 3E8EA 4EWHA 4H58A 3DCVA 3OCBA 1CKIA 4LV8A 4MV3A 1ZMVA 2O5KA 3VBWA 3MFSA 2BAKA 4AZTA 2VQDA 2UUEA 3TIGA 3PXZA 1KBLA 4IAYA 3SX9A 2BFYA 3I7BA 1Q24A 4KS7A 4LL5A 3SVVA 3DQXA 2YZLA 4KKEA 5AUWA 4FFPA 4NW5A 2JC6A 4KS8A 4RT7A 4TYIA 5ACKA 5T68A 1LPUA 2R4BA 3JYAA 3PRIA 4IAKA 4YO6A 4BGHA 4F9AA 3NAYA 3E93A 4ZTMA 4MV9A 2ERZE 4ZY4A 4EH9A 4HCUA 3IS5A 3BV3A 2YABA 3DTCA 3NVMB 4A9TA 5BPYA 3Q2JA 5IQIA 3W18A 3A7FA 5CTPA 5EQEA 4IJ9A 3DJ6A 4MF1A 4O7SA 4YB8B 3V6SA 5HO7A 3GCQA 3P9JA 2ZDTA 3LMHA 4B6LA 1WCCA 5BYLA 4BDHA 3TNWA 3LP8A 2VWIA 4O96A 4EI4A 4YTFA 5CASA 5E8WA 3TDVA 4CT1A 5JGDA 5M4FA 4EORA 2F9GA 3PDTA 4Q5EA 4FIGA 4U5JA 4U9AA 4O4LF 4A9RA 3DA6A 2WTWA 4JX3A 4XMOA 4D4VA 4D55A 3A62A 3NLBA 3RV3A 4J98A 3NIZA 4UBAA 3NYVA 4CXAA 4XG6A 5CSHA 5FM3A 4BGQA 3GCVA 4S31A 1QPJA 4O2PA 4ACGA 2IWIA 2IZUA 2ERKA 3TXOA 1M2PA 2FUMA 3ZZEA 2CN8A 5HZNA 3CY3A 5C1OA 5AIRA 3P78A 4FE2A 5JZJA 3CXWA 4RC3A 2RF9A 3C51A 3DKOA 4EGQA 2UZLA 1XO2B 2R3PA 1GZ8A 1V0PA 2WGJA 2XM9A 3R63A 3FXZA 4Z7GA 3LJ1A 2X2KA 3PPJA 2X9EA 5LP6F 2PVRA 4IB5A 4A9SA 1UVRA 4EK5A 5BVOA 3G51A 4RX8A 5LARA 4ID7A 4FKQA 3JZFA 2W70A 2PK9A 4E4LA 3I0OA 3BE2A 3ALNA 3LJ2A 1M52A 4PX6A 3LFDA 3QKLA 3R7YA 4IVDA 4PMTA 4UZDA 5HTBA 1OPLA 4ASEA 5C1PA 1L8TA 2QURA 4NT4A 4Z9LA 4PNKA 2GPWA 3R9DA 2DWCA 4Z3VA 2HXQA 2WMVA 4EBWA 1XBAA 2OFVA 4MD9E 4EZ5A 2VR1A 4FTIA 3PY3A 2BRMA 2I87A 2WXVA 4YZMA 2C6KA 2EUFB 3UNJA 3NNXA 5GNKA 2O8YA 2WU6A 3HA6A 3O7LD 3OVVA 2W0JA 2ZV8A 5E8VA 3OCTA 3CY2A 4A07A 1LEWA 4AAAA 1RE8A 3FC1X 4CGAA 3CKWA 1KJ8A 1WBNA 2PZRA 3NUSA 3UP7A 1T36A 4EG0A 3JS2A 4DA5A 3FLQA 5H80A 1DIKA 1BUHA 4BIDA 3EQPA 3R83A 3E5NA 1KEEA 1NY3A 1ZZ2A 2QOCA 2VGOA 5E92A 3ZOSA 3DDPA 4QQCA 2HJWA 5F20A 3CJGA 3FL4A 2YS7A 3IQ7A 2JIUA 3Q52A 2NPQA 4FV6A 4QMOA 5BVEA 3TKUA 4BTMA 4E6CA 4KB8A 4RA4A 3EQIA 4I5PA 2YM7A 2B54A 3KU2A 3MY0A 3BCEA 3KXMA 3THBA 4MEDA 2IPXA 4QMTA 1BL7A 5AM6A 1U46A 3WZJA 3HUBA 4O6LA 2HK5A 3FLYA 5KUPA 3TNPC 3SV0A 1V0OA 5JMSA 2WIPA 1IAJA 4IEBA 2VN9A 4QQJA 3JPVA 5AWMA 3OEZA 4MV8A 4C59A 4DG2E 3QALE 1OKYA 4BZDA 3RVGA 1GAGA 4AXAA 2XS0A 2W17A 2VTSA 3C4CA 4EONA 2UW0A 2C6DA 3BEAA 4CFVA 3E7VA 4BCHA 2YHVA 4FKIA 5D10A 3T9IA 1H4LA 4FYNA 4HYSA 3AC2A 3ORRA 4BF2A 1ZY4A 2QU5A 4CMTA 5HU3A 4DTBA 3UMWA 4CKIA 3KMMA 3R5HA 5AV0A 4PNIA 5LXTF 1X8BA 2P3GX 4ZJVA 3BHVA 3EN7A 5C1QB 5JEBA 3PJ3A 5GJDA 1BNCA 4C61A 4IADA 1WBOA 4YTCA 5IUHA 2YJSA 2GFSA 5DN3A 4M9UA 4GYGA 3FEGA 5F95A 4GG5A 5JFVA 2PE2A 3EYHA 3F9NA 1IRKA 5DNRA 1IOVA 3VA7A 3AC3A 4XYFA 5HICA 2PMIA 3SW4A 2QKWB 5CZHA 3VAPA 1WBPA 3LFEA 1J3HA 3K54A 4E73A 3A7IA 1A9UA 2HZNA 4ZS4A 3OEFX 4XYLB 3ZH8A 3ZUUA 4C0TA 1BLXA 4DC2A 2I8CA 5A4EA 2W4JA 4YR8A 2WEIA 3LCOA 4CV8A 1CM8A 3MIAA 4IVAA 4I93A 1IASA 3D5VA 1R1WA 3HGKA 4Q9SA 4U44A 4EZ3A 2GSFA 3FBVA 4ZTNA 3PIZA 4QYEA 3ZU7A 2NRUA 1PXPA 4QMNA 2GPHA 1FQ1B 3AGMA 3MGYA 5K3YA 4TYJA 3LJ0A 2OW3A 5IQDA 3CC6A 3PYYA 5GIPE 3QZFA 2W9FB 2WOTA 2DIKA 2HOGA 3QUPA 3RM7A 3FZ1A 4ACCA 4C2WA 5CU2A 4BIEA 4C33A 5L2SA 2QKRA 3ENHA 3E3BX 4HQ6A 3WZDA 4KSQA 2R7KA 4X2KA 5CXZA 1I44A 3KEXA 1JWHA 4FTKA 3MW1A 1F0QA 2UVYA 4RC4A 1H8FA 1P14A 3A7GA 3VUGA 4YZ9A 3I6UA 3BU6A 3KC3A 4D58A 3FLNC 4I5MA 4BZNA 5A9UA 4QTDA 2G15A 3I6WA 5A4LA 2OJ9A 3FWQA 2VNWA 2VWWA 5B2MA 3CCNA 2E9PA 3LE6A 3OROA 5FDPA 2QU6A 5EOLA 3ZEWA 5BPFA 2B0QA 2GS2A 4PTGA 3C9WA 5BVDA 1E4EB 2BUJA 3O8PA 1KC7A 3FMKA 2VUWA 4H1JA 5AP3A 2ONLA 4Y5QA 1YXUA 1H27A 3QCQA 1PX2A 3EN9A 3K5IA 3HUCA 4M97A 5FNVF 5A54A 2R3NA 3TZ9A 2A0CX 5EOBA 4EOIA 1H0WA 1PXJA 2WO6A 4O7NA 4JOAA 4ZMEA 4JQ7A 2JDSA 5E8UA 4ALWA 2YWPA 2YS6A 4GMYA 4XG2A 2I40A 4E1ZA 5LWNA 5M4IA 3RPRA 5A4CA 2XJ1A 4KSPA 3WIKA 2EXMA 2WAJA 5E1EA 4KD1A 4A9UA 3MJ2A 4B4LA 4DYMA 5C4LA 4NFMA 2PYWA 1Q62A 2VTJA 3NUPA 3R6XA 4IACA 5GINE 4LUDA 4AOIA 4YPDA 2VTTA 4XG4A 5ETCA 4D5KA 5CF4A 4EHEA 2LGCA 3KULA 5CQUA 2QLQA 2ZB1A 2YW2A 4APPA 4GYIA 2Q0NA 5CU0A 2RFDA 2UZDA 3W2QA 4RIOA 2A2AA 4YJRA 5HV6A 3POOA 2F57A 4YMJA 1FBNA 5IQEA 3G9NA 4JR3A 4HGLA 4ZY5A 3AX6A 4W8DA 5EYCA 3BQCA 2WQBA 3F3VA 4JRNA 4MXAA 4RWIA 3JXWA 5HCXA 3F3UA 5AMNA 3HAMA 4DH7A 3P79A 4RJ5A 5IMEA 2ITTA 3IDPA 3R7IA 4D9UA 5HBEA 3CD8A 4O82A 4MBLA 1B6RA 3H9RA 1LR4A 4E93A 1Z57A 4ZTQA 3GC7A 4YZNA 2J0JA 2P33A 4E26A 4JG6A 1G8AA 3FE3A 4IC7A 4GK4A 5HVYA 4MH7A 4PRJA 4EL9A 1GSOA 5CB4F 4NM0A 5JVLA 3RK9A 5CQWA 2XNGA 1WBSA 3W2CA 3UFXB 4HNFA 3N9XA 4ZMFA 1BL6A 3QQJA 4FSQA 5E8TA 1OIUA 2H9VA 2X4FA 4IB3A 4ZJJA 1E9HA 1TQIA 4OBQA 3MI9A 1W83A 4RGJA 4FT3A 2W1DA 1ZYJA 3IOPA 4ANSA 5KX5F 2P4IA 5B2LA 2BZKB 3B8RA 4RJ7A 1OITA 3KGAA 5HESA 4I23A 3WYYA 1FGIA 4R7HA 2J6MA 3LOKA 3MS9A 4I41A 4Y5HA 3WYXA 5BVFA 1VBHA 4DBNA 3GQIA 2C47A 4X0MA 4F7SA 4Q5HA 1GOLA 1ZYDA 4FSZA 2BRHA 2Z02A 5EHLA 5TR6A 1PMNA 2ETMA 2WQMA 3TDWA 5KMMA 2EB2A 2OIQA 1A48A 1T45A 3MY1A 1IOWA 3E5AA 4FR4A 5EDRA 4M0ZA 2GTMA 3A4PA 1XKKA 3H0ZA 2WQNA 2G2IA 3DOGA 4DITA 1GJOA 4O7VA 2WTDA 4FTCA 1C3OA 1H28A 3W33A 5K5XA 4DBXA 3VBQA 5EH0A 2XA4A 3FDNA 4YC8A 2ACXA 5CS6A 4YSJA 4YLLA 3WARA 4GS6A 1APME 5TO8A 3I79A 5K4JA 5CF5A 2H96A 3MBLA 4TY1A 1SM2A 3PA5A 4G6NA 3QF9A 1KJJA 4O84A 1UNLA 3AC1A 3LFSA 3NAXA 5AFVA 4ANQA 4Q2AA 3R8LA 4G3EA 4PP7A 4HCTA 3BYUA 4L45A 4BDFA 4ZHQF 3SD0A 4G3FA 5DR9A 2V7OA 3Q4TA 4RJ8A 4S30A 4EC9A 4JBOA 2BDJA 4XOZA 5D1JA 2PE0A 3EN6A 4FTNA 4YBKA 3OMVA 3RWQA 4BGGA 3FY0A 2GU8A 5I5ZA 5FEEA 4Y85A 3Q4ZA 2H6DA 4L68A 5JH7F 2CSNA 4BICA 3F5XA 5A4TA 3LFCA 4NYEA 2VTHA 4YJTA 2QNJA 4I0RA 2GHGA 3DT1A 4OTIA 1J1BA 1PXNA 3QHWA 4H05A 1H1WA 3U9NA 5HLWA 5EW8A 4YAKB 3PP1A 3GOKA 3L8VA 2XEYA 1NT2A 3TIZA 2BRBA 2XYNA 2XH5A 1ZMWA 2WMQA 2EU9A 2P0CA 3DZOA 4ZSEA 3MTLA 2SCUB 3F69A 2OG8A 2QI8A 3LCTA 5BYYA 3HL7A 4R6VA 4KBCA 4P7EA 2CN5A 2OF4A 2WMTA 2ITPA 3HV3A 1J7IA 3E88A 4FSRA 1PHKA 2QOBA 3OD6X 1EYZA 2CKQA 3KL8A 3ID6C 2UVXA 2ZV9A 4M0YA 5HD7A 2ZV2A 4CCBA 5M09A 5FTQA 5E9EA 1XHAA 5GIOE 1PJKA 2XNEA 1U5QA 2JD5A 3FMHA 2PN1A 2X2LA 2HW6A 1XH6A 3DFCB 5FBNC 4FGBA 3H4JA 3VQUA 3NSZA 5GHVA 5F9EA 1JLUE 2Y8OA 5AUYA 1Q8WA 3FMMA 4DH5A 5LXMA 3OWKA 3CPCA 2FP4B 3HA8A 4GCJA 2WTKB 1KE9A 3R71A 3A61A 1Y6AA 4QT1A 2PTKA 3DB6A 4NUSA 4O4IF 4PTCA 3AXWA 3GENA 4D2SA 4M14A 1CKJA 3R21A 2PVPA 3KF4A 3QZIA 4XYMB 4UALA 1SNUA 3QA8A 4FG9A 4FSYA 1TQMA 5DPVA 2YDIA 2BTSA 2JIVA 2QOQA 3VHEA 2C6OA 5ANGA 3RPOA 1GZKA 2PBZA 1W84A 3D2IA 2F7EE 3OW4A 4AA0A 3F5GA 4BRXA 3W2RA 3ORQA 2WD1A 2IW8A 3GC8A 4USFA 3DJ5A 1CDKA 4FUXA 2XRWA 4FOBA 4O4JF 2RG6A 4XRLA 2UW6A 5HIEA 1YWVA 2JIIA 1BI7A 4OT6A 2VD5A 2W05A 3QYWA 4G1WA 1Y91A 2G9XA 4BCNA 1J91A 3FZOA 2UW5A 4A4LA 4XP2A 4ME6A 4MV1A 3UIXA 4EEVA 2Z8CA 5AP5A 2BZIB 2PY3A 4O2AF 5IA2A 5AEPA 2YACA 3WF7A 4GL9A 1KE5A 4PMSA 3R8ZA 2XEZA 5DH3A 5KHWA 3ZYAA 3HECA 4FNXA 4C37A 4NCTA 2ZM3A 1BI8A 3PPZA 1YKRA 4BYIA 4QP1A 2C69A 2XIKA 4S33A 4F1TA 2CNQA 4RIWB 1JSTA 3DLSA 2R2PA 5AX9A 3VIDA 4JG8A 4O83A 5KNJA 3EOCA 4L3PA 4PP9A 3IW8A 4C4HA 4LMNA 4O0RA 4Z55A 2HZ0A 3BGQA 1YXSA 5CNNA 3L8PA 1H01A 5EI2A 4F64A 5M57A 2QG7A 2W5AA 2WPAA 5EW3A 3UC3A 4IZOA 4YU2A 4TYEA 3OY1A 3G6HA 3GP0A 4G5JA 2YIYA 4QTBA 4X2FA 4LOPA 3ANRA 3PG1A 4BDJA 4ZJIA 4OUCA 2ZM4A 3QRTA 5D12A 3MB6A 5J8IA 2XNMA 2YYAA 1BX6A 4ZSGA 2VO0A 2DYLA 3TQTA 4AOTA 1VZOA 4XNEA 2DZDA 3CP9A 3I60A 3O7LB 3GU5A 4OTWA 3GU7A 4QMXA 3U9CA 5IH4A 1OECA 5LVLA 4TN6A 3C7QA 4DGGA 3RK5A 5JQGF 2JBOA 4IDVA 2C0TA 2IN6A 2VWBA 4EH8A 3IO7A 4RX9A 4AE6A 4EOKA 3SG9A 3DS6A 3S95A 5FG8A 2H34A 2XNPA 2X6EA 4DTAA 5AADA 1XH5A 2R82A 3GEQA 5JVDF 4JR7A 3IDCA 4D4SA 2C5NA 4DN5A 4TWOA 3PJ8A 3FZPA 4I6FA 3DKCA 4X3FA 5D7AA 1U54A 4LL0A 3MDYA 2XNNA 3QQHA 4JJRA 4G17A 4ZIMA 3TI1A 4Y72A 4BIBA 4DG3E 4PDYA 3NYXA 4RWJA 3FQEA 4QQ5A 4IWPA 3KXXA 3K3IA 4FMQA 3NW5A 3K5VA 4C36A 2OZAB 3FY2A 2UZOA 4QMLA 2W6PA 2X0GA 2W96B 4XHKB 2VX1A 3ORTA 5HE3A 5AV4A 1KOBA 4GUBA 4ITJA 5B7VA 1CQIB 3RPYA 5HLPA 3UO4A 4F4PA 1R3CA 2B53A 5L2WA 3EWHA 3TNQB 3H9OA 5EDPA 2FPIB 1H1SA 4DG0E 2PU8A 4I4FA 1F5QA 4FK3A 4YJNA 1H00A 4I6BA 2E2BA 2NU8B 4HVDA 4I6HA 5CX9A 4CG9A 2ZMCA 3AC8A 4KRDA 1H07A 4XV9A 3ET7A 4BTFA 4DH3A 2YM6A 4R3CA 3IONA 3OY3A 4LOOA 2OICA 5HQ0A 1C30A 2QVSE 5DWRA 1A9XA 1XJDA 4FL1A 3BELA 4F0GA 1Q5KA 1YDSE 1S9JA 1YWNA 5HNGA 1XQZA 2XBAA 3V6RA 5IA3A 4CZTA 2R3RA 1QPEA 5A3XA 2W4KA 2W6ZA 5IU2A 3G8CA 2G2HA 3OXIA 1SVHA 2W1CA 3KRRA 2Y9QA 3V01A 3SOAA 3VS0A 3SOCA 3G33A 3D15A 4ZZNA 4YPSA 4DH8A 2G1TA 3L9NA 4I0SA 4O6EA 3V5QA 2JFMA 4AA4A 4OGRA 5M4UA 4ENYA 4RVMA 4V01A 5AUVA 2I6LA 3LQ5A 2OJGA 4RLKA 3IKAA 3R9HA 5A46A 3S3IA 2VTNA 2PUIA 3LWBA 5HVJA 4YJOA 3KXZA 4FV0A 3RUPA 1J7LA 1B38A 4ZTSA 4DCAA 2YZAA 5KMIA 3MVJA 2A27A 3PZHA 1UA2A 1OB3A 4RFZA 5ANIA 5H2UA 4AF3A 4CFFA 5LVMA 5CEPA 3HNGA 1H25A 3SA0A 4BTJA 5KKNB 4USEA 2PMLX 5DR2A 5A6OA 1XBBA 3BLHA 4YJQA 2F2CB 4O38A 4QMYA 3SAYA 1IA9A 3LCDA 4IVCA 4RIXA 3EQRA 4FSMA 2WTVA 1YVJA 3QLFA 4XLVA 3SXRA 3UTOA 1SYKA 1KWPA 4AW5A 5HD4A 5JGBA 3PLAE 5EHYA 4FG8A 5KBRA 5HE2A 2NP8A 2GS6A 2P55A 3EMGA 3QA0A 4FNYA 4QPSA 2X1NA 2YZGA 4LFIA 3COIA 4XX9A 4FV3A 2GMXA 3TG1A 4U80A 4C58A 4RLLA 1V1KA 3UOJA 3QGYA 5DT3A 1YWRA 1ZYSA 2UV2A 1Q97A 1CMKE 2CGXA 3VBVA 5CANA 3NWWA 4UYNA 3QXPA 3TV6A 3PVWA 2YZNA 4ZOLF 1OKWA 3QX4A 2NU6B 2HAKA 1H26A 3ZRKA 3OUKA 3U54A 2OKRA 4DT8A 3VS1A 4C4FA 2IVSA 3MYGA 4KINA 3NR9A 3BEGA 4G6OA 3QTXA 4UEUA 5DT0A 4ANBA 4AT3A 2CNVA 3I7CA 5CEOA 2OZAA 4RIYB 3MY5A 1YXXA 4MYGA 4X2GA 5J87A 4C2VA 4O22A 4RVKA 5TOZA 4CFMA 3MTFA 3DBQA 2PVKA 3QKKA 2ITOA 3NIEA 4GW8A 4NK9A 2QOHA 4CRSA 2J0IA 3KALA 4EH6A 3G15A 3QAME 3A7HA 4MQ2A 3QBNA 3FMDA 2ITUA 4KIOA 3F82A 5H8EA 4I22A 3UJGA 2ITQA 1JKTA 2C6TA 1G3NA 3CGFA 4MD8E 4UWYA 5LOHA 5C26A 4P5QA 4WRGA 2I1MA 3LXPA 2XNBA 3AMBA 4L7FA 4CMUA 5KMOA 2VAGA 4IX6A 3U6JA 3EKNA 3HMNA 3VS7A 2DLNA 4CT2A 2XKFA 2I80A 1XH4A 1FVRA 4FTMA 1G8SA 4M69B 3HP2A 4HZSA 3QQLA 4LG4A 1FOTA 2HWOA 2HY81 4IX3A 1REJA 4FTJA 5HCZA 3ZFYA 5M53A 2BIYA 5F4NA 2YM3A 1NW1A 2X39A 5E4HA 5I9UA 4XP0A 2AUHA 3LHJA 4RQKA 4AE9A 5KCVA 4BBEA 1VKZA 4F99A 3UODA 2ZB0A 4RMZA 2VNYA 5IH5A 3DF7A 2WMUA 3TNHA 4AQCA 4WBNF 4L42A 1YW2A 3EQGA 5B2KA 4UN0C 2YDJA 4FKOA 5AV3A 2W1IA 4WD5A 3D5XA 4ZEGA 2RKUA 4R3PA 3FXXA 3R02A 4FV5A 4M68A 4EGJA 4KAOA 3TJDA 3FMEA 4R78A 3BWJA 3NGAA 2B52A 1CSNA 3KREA 5A6NA 4MCVA 4GIIA 1JQHA 3NCGA 4JBPA 4BVUA 3FZSA 3DBCA 4IBMA 3QQKA 1JOWB 1UU7A 2WMBA 4J97A 2R7IA 3OCGA 2C1AA 4O81A 2OJJA 4GJ3A 2R5TA 5IDNA 3DK6A 3BYSA 4M8TA 4RJ4A 2W5HA 3RINA 4TV9F 3RM6A 3VUKA 4JS8A 2X7OA 3QU0A 1GZNA 2ESMA 4EH7A 2HZIA 3I81A 3OOMA 5TKDA 1KJ9A 4QP7A 2CGVA 4NW6A 4IWQA 2QONA 2VV9A 4J71A 5DI1A 4R5SA 4D0XA 3II5A 3KXGA 3OOGA 4N4SA 4HVHA 1EZ1A 3K3JA 4JIKA 3CJFA 3QTIA 4DEIA 5AA8A 2VO3A 4S32A 3ACKA 5CT7A 2VX3A 2ZM1A 4MXOA 4Y8VB 2DUVA 2ZV7A 2DS1A 4TXCA 3UYSA 3OTUA 2CKEA 4JBQA 4CRLA 1R39A 4FEQA 5BNJA 4O0TA 1BYGA 4FYOA 4BCFA 4K6ZA 4EOMA 2Y4IB 3FUPA 3W2OA 2BPMA 5BUIA 4O0SA 2GNLA 4JAIA 1Z9XA 4WO5A 4MV4A 4XBUA 4YJUA 3GCSA 3P5KA 2WEVA 1RDQE 4QTEA 5L6PA 1I7LA 3PXQA 4FKJA 4E6AA 3ZRLA 3ZC6A 3DLZA 1KE7A 4OTDA 5FDXA 3SGCA 5HTCA 3ROCA 4U7ZA 1OL2A 4RIYA 4IE9A 4BDKA 3V8TA 1WR2A 2FVDA 5H9BA 5CALA 2F7XE 5HKMA 3WBLA 5HG8A 3ANQA 5AP6A 3WZUA 1W96A 2PPQA 4A9YA 1WBVA 1OKVA 2EWAA 2OWBA 3EJ1A 5J1WA 5EDQA 3PP0A 3P08A 4R7BA 3BBTB 4DEHA 2OH4A 4XP3A 2V59A 5EM7A 3DU8A 5J1VA 4ZLZA 3TL8A 4O0XA 2YCFA 4FKRA 3RK7A 2VWVA 4OBOA 3MVHA 1Y8YA 3TUDA 4H39A 2OIDA 3E8DA 2YRXA 3EQBA 4BY9E 5HVKA 3CGOA 4C4IA 5DHJA 3BLRA 4GSBA 4YAJB 4BDIA 1DV1A 3GB2A 3EZRA 4AFEA 4DGOA 3GNIB 3JRXA 3KK9A 5GONF 5KMKA 3VJNA 2QO9A 3QTSA 3UOLA 3OZ6A 4AW2A 4A06A 3A7JA 3DPKA 5DVRA 3VBXA 2CNUA 4D1SA 4ACMA 1QPDA 1URCA 2FB9A 4RC2A 3EQCA 2OXDA 4QTCA 5HEZA 4AT5A 2HIWA 4F0FA 2IVUA 1AGWA 3KULB 4KRCA 3EH9A 4B9DA 3CD3A 3KRWA 4HNIA 2IVVA 3QQUA 4EZ7A 5M08A 3WILA 4UY9A 2R3GA 2C4GA 3B8QA 4PDOA 3P4KA 4KKHA 4MVFA 3HRCA 1M6VA 3HZTA 4ZAUA 3OS3A 3V8WA 4IQ6A 2C3JA 3ATTA 3Q1KA 2WB8A 5H8BA 3FSFA 3SDJA 3E8CA 1O6YA 2I0HA 5E8SA 5B0XA 4MV6A 2FSMX 4AZEA 3QWJA 3A99A 2B1PA 1ZOHA 4B8MA 4PDSA 3I1AA 3C1XA 1ZOEA 4AN9A 3RHKA 3BZ3A 3KN5A 3E62A 3AGLA 5CVHA 1JDBB 3QZGA 1T46A 4E4TA 3HP5A 3FPMA 4HCVA 4K2RA 2C5YA 2X81A 4O2ZA 4FU0A 2E9UA 4TV8F 2C3IB 3H10A 2CDZA 3COHA 4MA0A 2YCSA 2VTMA 4D1ZA 4FNWA 4MBJA 3C4EA 2QG5A 5J9YA 3AC5A 3COKA 5DMXA 2PL0A 4HPTE 2BILB 3ODYX 5DIAA 3PPKA 5GJFA 2ZJWA 3PA3A 4M13A 5AP7A 3UOHA 2ZYBA 3JR1A 3GCPA 5J9ZA 1OGUA 3QCSA 3V8SA 4X6RA 5JKGA 4L53A 3SHEA 4U0IA 4JBVA 5HG9A 5HNBA 3RAIA 3MA3A 5CF6A 3MA6A 3V5WA 2C6LA 1F3MC 2V62A 1QPCA 4TWPA 5FXSA 3HYHA 3C0HA 4RZVA 1UKIA 4U6RA 2CKOA 3E64A 4ZXTA 4F1MA 3Q5IA 4IHJF 1M7QA 3Q9YA 2VRXA 3QFVA 5FGKA 2ONLC 5HIDA 2VTPA 1PYEA 4ITHA 4A4OA 5CSWA 2BHEA 2YAAA 3BHTA 5AAEA 4FV4A 1YOLA 1LEZA 2BTRA 3S1HA 5KO1A 2W6QA 3QYZA 2ZDQA 3N6RA 2J2IB 5C4KA 2ETKA 4BCGA 1FVVA 2BIKB 1JPAA 5HG5A 5CSPA 5E90A 3R9RA 3ORXA 3VW8A 4YURA 1YI4A 5FD2A 1H1RA 3TJCA 4DEAA 5DE2A 4C35A 3A60A 4TYHA 3NVKI 3KK8A 1Z2NX 3CKXA 3MFUA 2ZDHA 4FTQA 4ACDA 5CAOA 4YBZB 4ZP5A 5JK3A 3F7WA 1PRYA 3VMMA 3CTHA 4YP8A 2YEXA 4NTTA 3UPZA 2YCRA 4OBPA 4DFZE 1R78A 1JBPE 5E8ZA 2V7AA 4FEVA 2ZDUA 3B2TA 2JEDA 1MQ4A 3NX8A 4GFOA 1WVWA 2PWLA 3G0EA 3P86A 4FL3A 4K11A 5CYIA 3UMXA 4IJPA 3KCFA 4QMPA 4IX5A 3WF8A 5BX0A 3GT8A 4NFNA 3TIIA 1YHWA 5EFQA 2PSQA 2IZSA 1M2RA 1Q99A 3PTGA 4G3CA 3LVPA 3ZEPA 3COMA 3UNKA 1CE8A 2XKCA 3VRZA 4BCOA 2CPKE 2Z60A 5EM8A 1B39A 4ZZMA 3PXFA 1M0TA 3OBGA 5ANOA 5CEQA 1IEPA 3VS6A 3POZA 3GU8A 4GEOA 4N57A 5FTGA 5IQGA 1GY3A 4QYGA 3S00A 3NUUA 3F3ZA 4C5AA 5CWZA 2W4OA 4LGGA 4YZBA 2BHHA 2CLQA 4YTIA 4NL0A 4M3QA 5L2TA 3VRYA 4FUYA 3IDBA 3LLAA 4JDIA 3P7CA 4XV3A 2WQOA 3PXYA 4EK6A 5C03A 2XCHA 4CEGA 5IEVA 2I0EA 2RG5A 4N0SA 4B7TA 4HR7A 4J99A 3HMPA 3QKMA 3PWYA 2GNIA 3R23A 4H3BA 4FFNA 2IW6A 1CS0A 3ZC5A 2VO6A 3UP2A 3ZHPC 3LXNA 4OTGA 3UQCA 2Z7SA 3ROYA 3UZRA 3DJ7A 5HU9A 3KAKA 3R8PA 3AOXA 3RV4A 3VPBA 5I9WA 2YIRA 1EUDB 4MNEB 5LCKA 5CA1F 4NSTA 4BDCA 2OZOA 3ORMA 3EQDA 4J95A 2WKMA 2XIZA 3ALOA 3BIZA 3ZSHA 2CGWA 5F94A 3EN5A 1DV2A 3HO8A 4E5BA 3DK7A 4TRLA 5CVFA 1AUVA 4I50F 3ZLWA 3CEKA 1EUCB 2QC6A 1PK8A 2E9VA 3OWLA 1PYXA 3DTWA 2ZMDA 4F63A 3OXTA 4LQMA 5C8MA 4FZFB 5IA1A 4XV2A 2FPPB 2R3FA 1KJIA 4AT4A 2W99B 3D94A 3PA4A 3RJCA 4F6WA 4CKRA 1OPKA 1YQJA 5KKRB 4ZS0A 3F2NA 5FP5A 2PVFA 2J51A 2VWYA 4HPUE 5J9LA 1YDTE 1AQ1A 2VWUA 3IECA 3OC1A 5LVPA 5HE1A 5DFPA 4O7TA 2YRWA 3H3CA 1MRVA 3KB7A 1DAWA 4MXXA 3RCJA 4ZSJA 5ETIA 1VR2A 4CTBA 3C13A 4J8NA 3UQGA 3TT0A 1ZZLA 5KZ0A 5HBJA 1UU9A 3EFWA 4IC8A 4L52A 2I0YA 2R3OA 4H3QA 4QPAA 5HBRB 5HG7A 3QCXA 3EHAA 4YJ2F 2JLDA 3D5WA 3KFAA 3C4XA 4PUZA 1SNXA 2HGSA 5EHOA 3ZONA 2PUUA 4TWNA 3C4FA 4EOSA 3U87A 3GIDA 3BU5A 4DE4A 4ZLOA 1O6LA 3FAAA 3MVMA 5EZYF 2WMXA 4ITIA 2BMCA 3K2LA 1VJYA 2OLCA 1TVOA 2BAJA 1MRYA 4G16A 4AOJA 5HBHA 4FV1A 2YN8A 3ULIA 4EHVA 4CLJA 5ITAA 3R5XA 1KE8A 2A1AB 3TTJA 3WF6A 1DS5A 3NUAA 4HNVA 2GNHA 4XG9A 2QQ7A 1NA7A 2Y7JA 3RAWA 4XOYA 2R85A 1M7NA 2QOFA 1H1QA 3D7TA 4CG8A 2O65A 3R8MA 2IP4A 4X7QA 5I4NA 5DLSA 2BRGA 2AC5A 4B0GA 2VPQA 1H0VA 5IYZF 2A4LA 2V22A 5AV1A 4AGCA 3JY0A 2W1FA 2PVJA 3LKMA 3V4SA 2IVTA 3W2PA 1ZRZA 3VS3A 3JVRA 3U4UA 4H1MA 4DEGA 4W4YA 3KCKA 1PMEA 4WOVA 4OTRA 2J90A 4APCA 5HCYA 4B99A 2XIXA 3FKNA 3PY1A 4I5CA 2HYYA 3DAKA 4OLIA 4XG3A 5LWMA 4X3FB 2XK9A 1U54B 5AUXA 2XCKA 2P0AA 4DGNA 2X8DA 4MAMA 3MVLA 3CLYA 4O27B 4JG7A 5JN2A 1OL1A 3NDMA 2OIBA 2C0IA 5E8XA 3S2PA 3UZTA 4UZHA 3DQWA 1WMKA 5IDPA 4FTUA 3ITZA 3R1SA 2PZIA 1SCUB 4FSUA 5L3AA 1W0XC 4FV8A 4G3DA 4O86A 1QL6A 2CJMA 4BDGA 4C3PA 4MNEA 3AMYA 4I94A 4F7NA 2O3PA 2YISA 5IEXA 3PVBA 2VTIA 4G2FA 2R3IA 3WZEA 3ZO1A 4QNAA 2DWBA 4Y46A 2SRCA 5CU4A 3TTIA 5E8YA 1Z2OX 2HXLA 4EK3A 3ORIA 3LAUA 4MQ1A 3PXRA 4FT7A 4L00A 4Z7HA 3R2YA 3KVXA 3O23A 3ZO4A 4FVQA 2RFSA 4NCTC 2OFUA 2XKEA 4XG8A 3S4QA 3VJOA 4DT9A 2J4ZA 3GFEA 4ERWA 4F1OA 4GIHA 2FPGB 2ITXA 1YI3A 1U59A 2YWVA 2EXCX 3EFJA 4NIFB 4XRJA 3BI6A 5AUUA 5L6OA 4QQTA 4M7IA 4LUEA 3E7OA 5D8DA 3FZRA 4L44A 2YZMA 3HKOA 2V0DA 1O9UA 3LCKA 4CKJA 3LPBA 2PMOX 4C34A 1JSUA 2R64A 3F88A 2FSLX 3I4BA 2ITNA 4QNYA 4TT7A 3RHXA 4RJ3A 1UWHA 3OHTA 4WNMA 3B2WA 2J0MB 4XH6A 4E5WA 4FA2A 3SW7A 3EFKA 3N51A 3WF9A 5GJGA 4XX0B 4JLCA 3FQHA 3G5DA 5H3QA 3TV7A 4AW1A 4R3RA 5JQWA 2Y6OA 3T8OA 3GOPA 3V5JA 4MK0A 4F70A 4WA9A 4BCQA 1Q61A 4WUAA 3G0FA 4YHTA 3RNIA 4NU1A 3ELJA 4R1YA 4U79A 4RIXB 3T3VA 3W2SA 2BDFA 4P4CA 4BDAA 3Q53A 4JT3A 4I0TA 2B9HA 3F2RA 1FVTA 3SKCA 2ITYA 2O64A 2NUAB 3R8UA 4W4VA 4DAWA 1PXKA 3PWDA 2B9JA 3GXLA 4D0WA 5JRSA 4GKIA 4EYMA 2XYUA 3VUMA 3L9PA 1BKXA 3P7BA 4EBVA 3IW5A 4FTLA 1Q8ZA 4WG5A 4E8AA 2YJRA 3AMAA 4IH8A 3D0EA 4HGTA 4HYIA 4QYYA 2X0SA 5CAUA 4ASDA 5D7VA 3HBLA 1XH7A 3CBLA 2PZPA 3VULA 3I12A 1OBDA 4TUYF 3GFWA 1Q8TA 4TZRA 5CT0A 4DHFA 4EYJA 5K9IA 2G2FA 3GBZA 2WTKC 4EKLA 3PFQA 4ZQIA 3Q9ZA 4X3FC 4EKKA 2QHMA 3OUNB 2UZEA 3FMNA 2GFCA 5C8NA 4QMVA 4CCUA 2RL5A 2P2IA 2ZDGA 3TUCA 1FINA 4TPTA 1ZYCA 4ASZA 5J2UF 4PL4A 4AGDA 4DTKA 1ZXEA 3VO3A 3FXWA 2R7BA 3QRIA 3E63A 5ANDA 5AV2A 1ZMUA 3F66A 3ZFXA 4NJDA 5EM5A 5L8JA 4GJ2A 2OF2A 1MRUA 1OIYA 1WBWA 2F2UA 4YTHA 4BZOA 5FTOA 5FUTA 4IAAA 5DT4A 3MN3A 2GQSA 3DAJA 4GUEA 2JKQA 2XZSA 3U51A 2I7QA 3AT2A 3QTUA 5HI2A 3R7EA 3WNZA 3GGFA 2BRNA 4XJ0A 3QRJA 1W98A 2XK8A 4J96A 5IH6A 3UIBA 4O21A 4BCPA 1W82A 2O63A 2GS7A 3HAVA 3FI8A 1Q8UA 2OJFE 3TZ8A 3GVUA 1MUOA 4FT9A 3R73A 4OTQA 2W71A 5DEYA 4TL0A 4W4WA 2W7XA 3OT8A 3EQFA 4EH3A 1K3AA 2Z7RA 4JXFA 1OI9A 4JQ8A 5AJQA 4AGWA 3OP5A 3ATSA 2W1HA 5D11A 3FI3A 4UX9A 2HCKA 4FNZA 3LFAA 1Y8GA 3QTWA 3R1NA 4L67A 3K5HA 2XK6A 4Z16A 3VOTA 3E87A 4FX3A 4EHGA 5AP0A 3I5NA 4X3JA 2BCJA 2CKPA 5F1ZA 4F9YA 4XEYA 2J9MA 3QLGA 4AG8A 5CAVA 3FHIA 1PY5A 3BLQA 4IZ7A 5J2TF 4DLKA 1O6KA 4HNTA 4C4JA 3C5IA 3E8NA 4R5YA 3MV5A 3HMMA 3QD3A 3R22A 4D9TA 3N4TA 3O96A 4FL2A 4EUUA 4S2ZA 4BDBA 2QO2A 5EK7A 5JH6A 4L7SA 4JNWA 5LMAA 1VBGA 3C5UA 2YM8A 4FVPA 5FRIA 4GG7A 4YLJA 3D9VA 5EKOA 4GVJA 5HIBA 2QR8A 3NCZA 2ITWA 2VX0A 3E92A 5EI8A 3V51A 3CQWA 3MFTA 2C6IA 3R30A 5IQAA 2GNJA 3AC4A 3MPAA 4G31A 4FT5A 1XBCA 4O2BF 2E9OA 3EFLA 1OBGA 4KBAA 1WBTA 3UQFA 2XJ2A 4QP4A 4WG3A 5AUZA 5IUIA 5CY3A 4OTHA 3UO5A 1PXOA 4PQNA 1GNGA 1QCFA 4RFYA 4E5AX 2R7LA 5LMKA 2AC3A 2UW8A 4JVGA 4WHZA 3DXQA 3D4QA 3NNWA 4FC0A 4V0GB 2JAVA 5CEMA 2JDRA 4J8MA 3TN8A 1STCE 3FC2A 2VGPA 3VS4A 4UWBA 2QOLA 3PLSA 3A8WA 5I9VA 3IOKA 3O8TA 5KHXA 3UGCA 4ZTRA 2ITVA 4H36A 3VN9A 4FVRA 4XLIA 5KMNA 3BHHA 3DBEA 4TNBA 4DH1A 2XK3A 4FV2A 3R8VA 2NO3A 3OFMA 5CF8A 3VBYA 1XWSA 2GHMA 1OIQA 2JAMA 2WFYA 2Y4PA 2PZ5A 4P5ZA 3U6HA 3LFQA 5ANKA 4CMOA 3DDQA 3PSBA 4X2JA 4GFMA 2XP2A 2WHBA 4FKWA 4FKGA 3TZ7A 1M0WA 5BMVF 2BFXA 3NEWA 4FIFA 3GU4A 4ONAA 1B6CB 3EIDA 2XK7A 3RGFA 1JKSA 3O8UA 2PVNA 2XVDA 4MXCA 4RJ6A 5CENA 3RPVA 3UG1A 4F7LA 4OW8A 5KE0A 3DV3A 3TUBA 3V3VA 4FKVA 4IZ5A 5CU6A 2Z04A 3OUZA 4FEUA 1SVGA 4I1ZA 1SMHA 4NM3A 1YHVA 4EK8A 2OSCA 4QP3A 2JBPA 2C5VA 1FMOE 4M84A 4EUTA 1ZY5A 3ZTXA 3NPCA 3VNTA 4TW9A 5I9XA 4OR5A 3QZHA 2GNFA 4QOXA 4E20A 2UZVA 4FKSA 4IB0A 4DFNA 2JKMA 2QOKA 5JRQA 4EQMA 1H24A 3FKLA 4KIPA 4AA5A 3EYGA 1JVPP 2RFNA 4D4RA 1M17A 3TW6A 4FEWA 4AW0A 4G6LA 3P23A 5LQFA 1I7NA 4FEXA 3DKFA 2GDOA 5M4CA 3AW8A 3LLTA 1DI9A 3GLKA 4FKLA 2FSTX 2YM4A 1PMVA 5IA4A 1H1PA 1UU3A 4TNDA 2X4ZA 3R00A 4NJ3A 4AZWA 4FTAA 3JRWA 3EQHA 5BVNA 4XZ3B 3VF9A 3ZXZA 2IW9A 5EQPA 1GIIA 2R7NA 5CVGA 4JQEA 4CV9A 4A7CA 4HW7A 4QMWA 3RP9A 3OG7A 4NWMA 2B4SB 3Q2MA 4FTOA 3OCSA 4M15A 3KVWA 2H8HA 5C27A 3DBDA 5FEQA 5BMSA 3KY2A 3T9TA 5M55A 3ZDUA 1KV2A 3DNEA 3KAJA 1OUYA 5HX8A 4FIEA 2C3KA 1S9IA 3F3WA 4GT5A 3M11A 2QO7A 4JX7A 2ZVAA 3LFFA 4RRVA 1Z5MA 4YNEA 4RSSA 2O2UA 2CHLA 3L9MA 4FTRA 3RZBA 4WG4A 3TKIA 3VW6A 4X2NA 3VQHA 3UVQA 5FEDA 4BDEA 5KZIA 5JSMA 2Q0BA 3CPBA 3SLSA 3R04A 4AGUA 3BX5A 2WTCA 5DOSA 3V4ZA 2B7AA 5HNIX 4C4EA 1BXRA 2XIRA 4LMUA 4LI5A 1HOWA 2XIYA 4MV7A 3PZEA 4IIJF 2X9FA 3QL8A 4BCJA 1PMUA 4BHNA 4O7YA 2OU7A 4CFXA 4CD0A 4WRSA 2XUUA 4EJNA 4V0GA 3MWEA 2FSOX 2X7GA 3HMOA 5J95A 5JZNA 3PY0A 3DZQA 5LCJA 3Q60A 3MESA 3PUPA 2J50A 4IM2A 2ITZA 3LW0A 4W8EA 5IA5A 1LP4A 4Y95A 4YBJA 4ACHA 4YO4A 4QSHA 4I4TF 2UW4A 1KV1A 3NUXA 3MJ1A 4WNOA 1G5SA 2CZGA 3FHRA 3AT3A 4K33A 2OXYA 3JVSA 3PVGA 4HNUA 3ORZA 1U4DA 2XBJA 5IQBA 4TTHB 1ERKA 4EQCA 3IW4A 2WTIA 4DFYA 4MHAA 3R1QA 4EOLA 1L3RE 1JKKA 4RX7A 2VTQA 3TEIA 3Q4UA 3UPXA 2PVLA 4A4XA 4XS2A 2J5FA 5IQFA 4U3ZA 3HLLA 4QMSA 2PULA 2YERA 1Y6BA 5CEKA 3UNZA 5L8KA 5FM2A 3HRFA 3DB8A 2QODA 2BZHB 3Q6WA 3PIYA 2WMWA 4HZRA 5LVNA 3LXLA 1RJBA 4FZAB 3O2MA 4J52A 1EHIA 1KOAA 3G6GA 1WAKA 3ETAA 3QXOA 3W10A 4D1XA 4E6QA 3RMFA 1JKJB 2HZ4A 5CSXA 3E3PA 4TYHB 1NVQA 5LOVF 4GVAA 3U4WA 2BAQA 4LGHA 4C5CA 3SXFA 2VTOA 4H3PA 5JQ8A 3P7AA 5ETFA 4NKSA 4AFJA 3HV7A 4BBFA 4O91A 4WSYA 3LZBA 4FBXA 2WMAA 2KTYA 3O17A 2YFXA 4KABA 4G34A 2R86A 3NS9A 1CTPE 1VYWA 4AP7A 4II5A 5LYJF 2YA9A 5EW9A 4R1VA 5BYZA 2A19B 3QHRA 4BN1A 2BROA 5K5NA 3U55A 4BYJA 4L8MA 5JFWA 5E7RA 4NZWB 4DIMA 1Q4LA 1OL6A 1JLLB 1YHSA 3UO6A 4DEEA 4U43A 1MP8A 5DG5A 4LM5A 4P2KA 3ZM4A 4BI2A 3N4VA 4DFLA 1UNHA 4LYNA 2FO0A 4CLIA 4FKPA 3CTJA 4C3FA 4ALUA 3WI6A 5K4IA 2XB7A 4GU6A 3U9TA 4IMYA 4JIAA 4EK4A 4F6SA 5I9ZA 4KUJA 4MAOA 3AT4A 5DA3A 5AAFA 2W1GA 3R01A 3R7VA 3RPSA 5M06A 2VTAA 4JL9A 4O7RA 5KMLA 5DRDA 4D4YA 2PMNX 2FGIA 2V55A 4FI1A 4CNHA 4PV0A 4U97A 4AUAA 4F08A 4QMQA 2X8IA 4AWIA 1XH9A 4HGEA 2XRUA 3NYOA 4ALVA 4FT0A 4HVIA 1Z2PX 2OLSA 3VS2A 5IZFA 1FMKA 2CGUA 3T3UA 5BMMA 3R7UA 3ZLXA 4O0YA 2PZYA 3V5PA 3G90X 4PF4A 3UE4A 2FYSA 2J7TA 2YDKA 3BWFA 2YL2A 1PXLA 4YC6A 2YIWA 4DLJA 1VYZA 3NNUA 4YHFA 2BKZA 2Y4IC 4I4EA 1OPJA 4FK6A 4V04A 2RGPA 4ZI7F 4IX4A 3VUDA 5IPJA 1B6SA 3Q9WA 4NM5A 4FIJA 5I9YA 3BGPA 3UIUA 4LV5A 1GIHA 4K1BA 4YUQA 3S0OA 3KMUA 3P0MA 3QTRA 4BCMA 3AD5A 3QTZA 3L8SA 4RPVA 2WTJA 1P5EA 2PHKA 4E4XA 2CMWA 4L01A 4S34A 2QOOA 3F5PA 4UXLA 5J5SA 3D2KA 4HYUA 4GK3A 1ZARA 2J5EA 3KA0A 4R7IA 4BTKA 3BPRA 4IM0A 2VWZA 4LRKA 3NUNA 3FYKX 4RVTA 5EKNA 5JFXA 4AZFA 3UYTA 4FV9A 2WYOA 3UZPA 2F4JA 4F7JA 4FZ6A 3NUYA 1HCLA 2QK4A 4HVSA 2C6EA 3PJ1A 4J1RA 3W8QA 2R3LA 4F9BA 3H0YA 5T3QA 4V05A 4BHZA 4EOPA 3R1YA 4QP2A 2CCHA 5D9HA 4BI1A 4AX8A 5A4QA 4HYHA 4BC6A 3BYOA 3UVPA 4EWQA 4GH2A 3O0GA 4I20A 2X8EA 4IAIA 4WKQA 4ZSLA 3ZRMA 3AG9A 4EC8A 5CNOA 5BUEA 3DGKA 3JY9A 3AD4A 2GPSA 2XCLA 5E91A 1P4OA 3MH2A 1JAMA 4IAFA 4JI9A 3MH3A 4MD7E 4Y73A 4PL3A 4OT5A 1URWA 2GNGA 4E7WA 3QTQA 1JDEA 2Y6MA 3TWJA 4K8AA 1BMKA 1E1VA 4IDTA 3IGOA 5IA0A 5IEYA 4L3JA 3CQUA 4MWHA 4K77A 4O0UA 3IPHA 1P4FA 1DI8A 3M1SA 3D7TB 3REPA 4YJSA 3UC4A 3DY7A 4F9CA 3DNDA 3H30A 2WNTA 4MXYA 4XV1A 1R0PA 4GV1A 1OL5A 4IIRA 4WNKA 3WO0A 3ZUTA 4BR3A 5EM6A 1OVEA 3I5ZA 2YIXA 4U42A 4K0YA 1VEBA 3R5FA 1KUTA 1I09A 3L1SA 2AYPA 3KMWA 4I3ZA 5HGIA 1K2PA 3BE9A 2BALA 4L6QA 4E4MA 5EYKA 4L9IA 4EHZA 1CKPA 2EB3A 1UV5A 2Z2WA 4USDA 2PVHA 3QFFA 3CS9A 2Y0AA 3LMIA 4RFMA 4WBBB 3SG8A 5HE0A 4AACA 3DKGA 3PE1A 3PSCA 3MWDA 2JDTA 3ZUVA 3OTVA 1W93A 1YXVA 2IZTA 2QD9A 2C00A 2JFLA 4ZTLA 4WBOA 3RKBA 1KJQA 3OWJA 3ZBXA 2UZUE 3ZM9A 5A14A 1Q3WA 2UZWE 2J0LA 3LM5A 4BCKA 3FL5A 4K18A 4BB4A 4DFBA 3VF8A 5IF1A 3FLSA 4RBLA 3SRVB 1AUXA 2QR7A 2E9NA 5BPHA 4MBIA 3OW3A 3VUHA 4IFGA 2F49A 4QMZA 2C68A 1WZYA 3NW7A 5FXQA 2R3HA 1YDRE 2IO6A 1TQPA 5C8YF 3BU3A 5TF9A 3EL8A 5AUTA 5EYMA 4NKAA 2W1ZA 3ZLSA 5LA6F 3FLZA 3ZLYA 1IA8A 3JZIA 5DEWA 4AZSA 2V5AA 1ZAOA 5DRBA 2QLUA 5AP4A 1ND4A 2BR1A 3HV4A 5L8LA 1GIJA 3LMGA 3SE7A 3GI3A 5C9CA 4YGAA 4C4GA 3LXKA 1XH8A 2HENA 3QD2B 3LFNA 3CSVA 3HB9A 3O51A 3W16A 5CA0F 4YJ3F 4MTAA 2XM8A 3VHKA 3HV6A 4RG0A 2BZJA 3U9SA 4QYFA 3MSSA 3DFAA 5AAGA 1Q8YA 3FKOA 3PJCA 1NVRA 2PVMA 2UVZA 5TT7A 4GRBA 4LRMA 2UZBA 3F7ZA 3OBJA 4L3LA 3F3TA 4HOKA 4IB1A 4ORKA 3Q32A 3BYVA 1OL7A 3EZVA 4BDDA 1YOMA 4QP9A 4F65A 3QQGA 4FFOA 1REKA 1UKHA 1ZLTA 3UVRA 1E4EA 3ZFMA 3H9FA 1J1CA 2WELA 3HVCA 3OT3A 4NTSA 4RWLA 3PVUA 3CIKA 3QGWA 4YJPA 3FQSA 3V5TA 3WE8A 1FGKA 4EOOA 2FA2A 4FKUA 3KXNA 3W55A 4PY1A 3AD6A 3ENMA 1WVXA 1PW2A 1ZWSA 4UB7A 4W4XA 5BUJA 5L6WL 2VTRA 2R7MA 2GCDA 3QUEA 2BVAA 4AN3A 3N8DA 2OK1A 1Q41A 1M14A 3EKKA 3RAKA 3W8LA 1OKZA 4YZDA 3ORKA 4C3RA 3VUIA 5CXHA 1AD5A 3OWPA 4K9YA 5AP1A 2VU3A 3ETJA 2R3KA 3W32A 5CSVA 4BI0A 4I55F 2C1BA 2Q83A 2JGZA 5DYJA 2BKKA 2XJ0A 3DXPA 3NW6A 4PMPA 4G3GA 1R0EA 3K3PA 2CCIA 4QTAA 4J7BA 3A2CA 3R7OA 3DAEA 2R3MA 4J53A 1CQJB 3VC4A 3ZSGA 3G9LX 3QRKA 1YI6A 3V5LA 2VTLA 5FXRA 2FH9A 3O50A 5IMXA 4DGMA 2W6NA 2JKOA 2OI4X 1FPUA 4G9RA 1DAYA 4O0WA 3WZKA 1DM2A 4I6QA 3NMUF 3IW6A 1GSHA 4GFGA 4IFCA 4FFLA 3QC9A 5BVKA 1NXKA 3IG7A 3HEGA 4I24A 3CQEA 4R77A 4C5BA 4D2RA 4RZQA 4DINA 2C0OA 2WOUA 3V04A 5LJJA 5FLFA 2VWXA 3L8XA 2WZJA 3Q04A 4ZZOA 4ARKA 3QCYA 4UYAA 4IZAA 4YHJA 2OH0E 3FYJX 4MXZA 5CEIA 3UDBA 3Q2OA 4NH1A 1OIRA 4QYHA 3A8XA 3UIMA 4GT4A 3SRVA 4ERKA 1IR3A 3ZZWA 4O7LA 5IQHA 3NNVA 4HGSA 2HWPA 4CFUA 2UZNA 3ORNA 2LAVA 4AS0A 4RX5A 3VPCA 3F2AA 3OUUA 2X7FA 5IG1A 1QMZA 4N6ZA 4DCEA 5FP6A 4I21A 5KKRC 4F09A 3UOKA 4ANMA 1PXIA 1Q3DA 2WMSA 2V5QA 4KIQA 3G8DA 5CAEB 2R3QA 3C0IA 2JITA 2JKKA 4I92A 1SZMA 4WT6A 4L1KA 5H8GA 1GLVA 5AIKA 3TZMA 3EL7A 3IK3A 3LM0A 2BDWA 1ULZA 2VZ6A 4WNPA 5CLPA 4ZOGA 3BG5A 3QD0A 2JDVA 3RFCA 4E4NA 4XUFA 2GQRA 2OXXA 4O4HF 1ZOGA 3FMLA 3KN6A 4MWIA 5EG3A 4PTEA 5ACBC 3VS5A 5BQ0A 5HX6A 4NM7A 5ETAA 4QMMA 4F9WA 3P1AA 1ATPE 4IVBA 3D83A 4YLKA 3ZMMA 3RWPA 4Q9ZA 2R9SA 5G1XA 3OF0A 4EOQA 3TCPA 4TYGA 4DGLC 5C01A 3Q6UA 4ZLYA 4AN2A 5JQ5A 4FSWA 4RQVA 3F5UA 4Y83A 3A4OX 5CAQA 2NNWB 3GCUA 4FKTA 5G6VA 3D14A 4WUNA 2GHLA 2IG7A 2I0VA 4CZUA 3F61A 4KWPA 3TM0A 4FFMA 4CSVA 4ZK5A 5HO8A 4YC3A 4LRJA 3FZTA 4N70A 3FMJA 3TINA 2IZRA 3C4ZA 3RI1A 3BKBA 1YXTA 3LQ8A 3FI4A 3QD4A 5DBXA 3TIYA 2PUNA 3MB7A 3PE2A 4M12A 2WQEA 3ULZA 4M67A 2QF7A 4TWCA 3MIYA 5EI6A 4C02A 4IHPA 3OXZA 5LVOA 3Q9XA 3BV2A 3ACJA 5CI6A 3HDMA 3TV4A 3VVHA 3WE4A 3ORPA 2Z7LA 4FGRA 3SQQA 3LQ3A 1PKDA 2PVYA 2GTNA 3QC4A 3IW7A 1SVEA 4PDPA 5T6KA 1PF8A 2W06A 4GK2A 2HY0A 2UW9A 1RW8A 3IGGA 3LCSA 3N4UA 3ODZX 3ORLA 5KMJA 4C38A 4FG7A 4JDHA 4FFRA 4PL5A 2YCQA 2XD4A 1V0BA 3GU6A 4D5HA 3Q3BA 2W9ZB 3NYNA 4FZDB 3QX2A 2R3JA 4MX9A 1KE6A 2X6DA 2OGVA 2WMRA 2NRYA 3KRXA 4U81A 5IISA 2YAKA 2HELA 4X21A 4GT3A 4JRVA 3KXHA 2HW7A 4BKJA 4IZYA 1MQBA 4U45A 4C62A 1NVSA 4G5PA 4GU9A 1OZ1A 2W1EA 3W1FA 5M51A 5EQYA 4MA5A 1UU8A 2OBJA 4PMMA 3C0GA 3WIGA 4DFUA 1H08A 4IM3A 2WIHA 3KRLA 2FB8A 3U8WA 5AX3A 4EOJA 4FSTA 4LOQA 2QCSA 4YSMA 2Z7QA 3CTQA 2R0IA 4YJVA 5ANJA 5DR6A 4DLIA 5JT2A 2PE1A 4IWDA 3MFRA 4FTTA 4KNBA 4RWKA 1GGOA 5HORA 4ANLA 2ETRA 2J9GA 5HHWA 3R9OA 4UWCA 3SXSA 4P90A 3RCDA 3ZSIA 4HVGA 2O0UA 2XK4A 3RTPA 4CFWA 5FQDC 5LMBA 3DK3A 4FICA 5KX8A 5M07A 1GZOA 2IJMA 5CU3A 2EVAA 1PXMA 1YOJA 3D5UA 4RVLA 1PKGA 2J0KA 4FZ7A 2YM5A 3HX4A 4UV0A 4YNOA 3TKHA 3Q5ZA 4FIHA 3ZBFA 3ZO3A 4L43A 4EH5A 4F6UA 2V58A 3R9NA 4ENXA 1Y57A 4CVAA 2C6MA 3MPMA 4O7ZA 2QHNA 3FJQE 3M42A 4RZWA 4AZVA 3C4WA 1WFCA 2ZOQA 4XBRA 4EH2A
chains in the Genus database with same CATH superfamily
3TACA 3QUDA 1A06A 2QOIA 2ZAZA 2G01A 3FV8A 2C3LA 3KRJA 2R87A 4ZY6A 3PSDA 3C50A 1OM1A 4KBKA 2XALA 4FOCA 3MH0A 4EQUA 1LUFA 4IANA 4ZSAA 3EB0A 3BRBA 5ICPA 5KBQA 5EYDA 5AP2A 2OJIA 3ERKA 2RIOA 4GKHA 4QP6A 1M2QA 2GQGA 2RFEA 3GUBA 4QMUA 5CZIA 1J7UA 3UG2A 5I5XA 3VBTA 5JFSA 5BVWA 5JGAA 3W1BA 3MWUA 3FPQA 2R0UA 2JDOA 5M56A 1JNKA 2XMYA 4FIIA 2XKDA 3M2WA 4EH4A 5FBOA 2F7ZE 5L2IA 2HGWA 3KKVA 4IW0A 4L46A 4JAJA 3PXKA 4WIHA 4DEBA 4AXFA 3MPTA 3D7ZA 4FODA 4JDJA 1IAHA 3FSKA 4ZTHA 4EJ7A 3CR0A 3RAHA 4G9CA 4C7TA 2UZTA 1K9AA 2CLXA 3O71A 4TKSA 4CTCA 3CE3A 3NRMA 3HRBA 3FLWA 4CQEA 3BHUA 4RIWA 5DGZA 2XF0A 2B9FA 4FV7A 2R84A 4UCOA 3HV5A 4DEDA 2C30A 3HMIA 1W8CA 3AKKA 3SNOA 1WVYA 3MJFA 2P2HA 2NU9B 4AU8A 3DXNA 1YRPA 5LMKC 2UW3A 4IWOA 5CI7A 5M44A 2WU7A 4BCIA 3BGZA 5C8KA 4PWNA 4CFNA 3Q96A 4OTFA 3G2FA 3BYMA 3MH1A 2W6OA 5AM7A 3FI2A 4QP8A 1EH4A 3HDNA 5ANEA 3ZO2A 4B8LA 2C5OA 4KKGA 4U3YA 3RALA 2GLTA 4D28A 4XCUA 3LFBA 3WO1A 4UXQA 3KQ7A 4MKCA 4Y8DA 4BBMA 3U6IA 1TKIA 1GSAA 4I5HA 5BV3A 2REIA 4QRCA 5E1SA 3ZXTA 3BACA 1U5RA 3EN4A 3I0QA 3F6XA 2B55A 3GC9A 2KULA 1IG1A 2W5BA 3PRFA 3WOWA 5J7HA 3QWUA 4U41A 4MNFA 1HCKA 3NZ0A 4ASXA 3TNIA 2UW7A 3K5UA 3LIJA 3UBDA 4E6DA 4DF3A 1E1XA 5I0BA 3JUHA 4FSNA 1OMWA 3R2BA 4O7WA 3L9LA 5IUGA 3GC0A 4U40A 4HJOA 1P2AA 3PIXA 3BL7A 5CAPA 4U8ZA 5AA9A 1JSVA 1UNGA 5IQCA 2YIQA 2DQ7X 1KSWA 3QQFA 3QWKA 1UWJA 1XR1A 4MUQA 4DFXE 2W6MA 3BHYA 4RA5A 3ETHA 1OUKA 3R28A 3R0TA 3PG3A 2YITA 3KF7A 4YZCA 1JKLA 3AQVA 2OO8X 2VO7A 3DBFA 3QRUA 4JDKA 2XNOA 3ZDIA 2NU7B 4IWYA 2A1HA 3SC1A 3BBWA 2B9IA 4X6QC 3GQLA 2C5XA 3Q4CA 3ZCLA 1FVIA 4KA3A 5HLNA 3VWAA 1W7HA 4QO9A 4IAZA 1RQQA 2PUPA 3PJ2A 4F0IA 3BQRA 4N6YA 4O0VA 4XG7A 5D41A 2X2MA 3WF5A 3ZS5A 3E8EA 4EWHA 4H58A 3DCVA 4DRFA 3P5JC 3OCBA 1CKIA 4LV8A 4MV3A 1ZMVA 2O5KA 3VBWA 3MFSA 3PUFC 2BAKA 4AZTA 1IYDA 2VQDA 2UUEA 3TIGA 3PXZA 1KBLA 4IAYA 3SX9A 2BFYA 3I7BA 1Q24A 4KS7A 4LL5A 3SVVA 3DQXA 2YZLA 4KKEA 5AUWA 4FFPA 4UCTA 4NW5A 2JC6A 4KS8A 4CC6A 4RT7A 4TYIA 5ACKA 5T68A 1LPUA 2R4BA 3JYAA 3PRIA 4IAKA 4YO6A 4BGHA 4F9AA 3NAYA 3E93A 4ZTMA 4MV9A 2ERZE 4ZY4A 4EH9A 4HCUA 4RCNA 3IS5A 3BV3A 2YABA 3DTCA 3NVMB 4A9TA 5BPYA 4NZOA 3Q2JA 5IQIA 3W18A 3A7FA 5CTPA 5EQEA 4IJ9A 3DJ6A 4MF1A 4O7SA 4YB8B 3V6SA 5HO7A 3GCQA 3P9JA 2ZDTA 3LMHA 4B6LA 1WCCA 5BYLA 4BDHA 3TNWA 3LP8A 2VWIA 4O96A 4EI4A 4YTFA 5CASA 5E8WA 3TDVA 4CT1A 5JGDA 5M4FA 4EORA 2F9GA 3PDTA 4Q5EA 4FIGA 4U5JA 4U9AA 4O4LF 4A9RA 3DA6A 2WTWA 4JX3A 4XMOA 4D4VA 4D55A 3A62A 3NLBA 3RV3A 4J98A 3NIZA 4UBAA 3NYVA 4CXAA 4XG6A 5CSHA 5FM3A 4BGQA 3GCVA 4S31A 1QPJA 4O2PA 4ACGA 2IWIA 2IZUA 2ERKA 3TXOA 1M2PA 2FUMA 3ZZEA 2CN8A 4DDGA 3CY3A 5HZNA 5C1OA 5AIRA 3P78A 3W0OA 4FE2A 5JZJA 3CXWA 4RC3A 2RF9A 3C51A 3DKOA 4EGQA 2UZLA 1XO2B 2R3PA 1GZ8A 1V0PA 2WGJA 2XM9A 3R63A 3FXZA 4Z7GA 3LJ1A 2X2KA 3PPJA 2X9EA 5LP6F 2PVRA 4IB5A 4A9SA 1UVRA 4EK5A 5BVOA 3G51A 4RX8A 5LARA 4ID7A 4FKQA 3JZFA 2W70A 2PK9A 4E4LA 3I0OA 3BE2A 3ALNA 3LJ2A 1M52A 4PX6A 3LFDA 3QKLA 3R7YA 4IVDA 4PMTA 4UZDA 5HTBA 1OPLA 4ASEA 4DHJA 5C1PA 1L8TA 2QURA 4NT4A 2CFMA 4Z9LA 4PNKA 2GPWA 3R9DA 2DWCA 4Z3VA 2HXQA 2WMVA 4EBWA 1XBAA 2OFVA 4MD9E 4EZ5A 2VR1A 4FTIA 3PY3A 2BRMA 2I87A 2WXVA 4YZMA 2C6KA 2EUFB 3UNJA 3NNXA 5GNKA 2O8YA 2WU6A 3HA6A 3O7LD 3OVVA 2W0JA 2ZV8A 5E8VA 3OCTA 3CY2A 4A07A 1LEWA 4AAAA 1RE8A 3FC1X 4CGAA 3CKWA 1KJ8A 1WBNA 2PZRA 3NUSA 3UP7A 1T36A 4UFZA 4EG0A 3JS2A 4DA5A 3FLQA 5H80A 1DIKA 1BUHA 4BIDA 3EQPA 3R83A 3E5NA 1KEEA 1NY3A 1ZZ2A 2QOCA 2VGOA 5E92A 3ZOSA 3DDPA 4QQCA 2HJWA 5F20A 3CJGA 3FL4A 1XK5A 3O5AA 2YS7A 3IQ7A 4AXEA 2JIUA 3Q52A 2NPQA 4FV6A 4QMOA 5BVEA 3TKUA 4BTMA 4E6CA 4UUGA 2COGA 4KB8A 4RA4A 3EQIA 4I5PA 2YM7A 2B54A 3KU2A 3MY0A 3BCEA 3KXMA 3THBA 4MEDA 2IPXA 4QMTA 1BL7A 5AM6A 1U46A 3WZJA 3HUBA 4O6LA 2HK5A 3FLYA 5KUPA 3TNPC 3SV0A 1V0OA 5JMSA 2WIPA 1IAJA 4IEBA 2VN9A 4QQJA 1CKNA 3JPVA 5AWMA 3OEZA 4MV8A 4C59A 4DG2E 3QALE 1OKYA 4BZDA 3RVGA 1GAGA 4AXAA 2XS0A 2W17A 2VTSA 3C4CA 4EONA 2UW0A 2C6DA 3BEAA 4CFVA 3E7VA 4BCHA 2YHVA 4FKIA 1I1MA 5D10A 3T9IA 1H4LA 1ST0A 4FYNA 4HYSA 3AC2A 3ORRA 4BF2A 1ZY4A 2QU5A 4CMTA 5HU3A 4DTBA 3UMWA 4CKIA 3KMMA 3R5HA 4WHXA 5AV0A 4PNIA 5LXTF 4CE5A 1X8BA 2P3GX 4ZJVA 3BHVA 3EN7A 5C1QB 5JEBA 3PJ3A 5GJDA 1BNCA 4C61A 4IADA 1WBOA 4YTCA 5IUHA 2YJSA 2GFSA 5DN3A 4M9UA 4GYGA 3FEGA 5F95A 4GG5A 5JFVA 2PE2A 3EYHA 3F9NA 1IRKA 5DNRA 1IOVA 3VA7A 3AC3A 4XYFA 5HICA 2PMIA 3SW4A 2QKWB 5CZHA 3VAPA 2HIXA 1WBPA 3LFEA 1G8JA 3BAAA 1J3HA 3K54A 4E73A 3A7IA 1A9UA 2HZNA 4ZS4A 3OEFX 4XYLB 3ZH8A 3ZUUA 4C0TA 1BLXA 4DC2A 2I8CA 2Y4RA 5A4EA 2W4JA 4YR8A 2WEIA 3LCOA 4CV8A 1CM8A 3MIAA 4IVAA 4I93A 1IASA 3D5VA 1R1WA 3HGKA 4Q9SA 4U44A 4EZ3A 2GSFA 3FBVA 4ZTNA 3PIZA 4QYEA 3ZU7A 2NRUA 1PXPA 4QMNA 2GPHA 1FQ1B 3AGMA 3MGYA 5K3YA 3UZBA 4TYJA 3LJ0A 2OW3A 5IQDA 3CC6A 3PYYA 5GIPE 3QZFA 2W9FB 2WOTA 2DIKA 2HOGA 3QUPA 3RM7A 3FZ1A 4ACCA 4C2WA 5CU2A 4BIEA 4C33A 5L2SA 2QKRA 3ENHA 3E3BX 4HQ6A 3WZDA 4KSQA 2R7KA 4X2KA 5CXZA 1I44A 3KEXA 1JWHA 4FTKA 3MW1A 1F0QA 2UVYA 4DDIA 4RC4A 1H8FA 1I1KA 1P14A 3A7GA 3VUGA 4YZ9A 3I6UA 3BU6A 3KC3A 4D58A 3FLNC 4I5MA 4BZNA 5A9UA 4QTDA 2G15A 3I6WA 5A4LA 2OJ9A 3FWQA 2VNWA 2VWWA 5B2MA 3CCNA 2E9PA 3LE6A 3OROA 5FDPA 5K2MA 2QU6A 5EOLA 3ZEWA 2DABA 5BPFA 2B0QA 2GS2A 4TM5A 4PTGA 3C9WA 5BVDA 1E4EB 2BUJA 3O8PA 1KC7A 3FMKA 2VUWA 4H1JA 5AP3A 2ONLA 4Y5QA 1DAAA 1YXUA 1H27A 3QCQA 1PX2A 3EN9A 3K5IA 3HUCA 4M97A 4CC5A 5FNVF 5A54A 2R3NA 3TZ9A 2A0CX 5EOBA 4EOIA 1H0WA 1PXJA 2WO6A 4O7NA 4JOAA 4ZMEA 4JQ7A 2JDSA 5E8UA 4ALWA 3TY8A 2YWPA 1S68A 2YS6A 4GMYA 4XG2A 2I40A 4E1ZA 5LWNA 5M4IA 3RPRA 5A4CA 2XJ1A 4KSPA 3WIKA 2EXMA 2WAJA 2XANA 5E1EA 4KD1A 4A9UA 3MJ2A 4B4LA 4DYMA 5C4LA 4NFMA 2PYWA 1Q62A 2VTJA 3NUPA 3R6XA 4IACA 4PZ8A 5GINE 4LUDA 4AOIA 4YPDA 2VTTA 4XG4A 5ETCA 4D5KA 5CF4A 4EHEA 4CKEA 2LGCA 3KULA 5CQUA 2QLQA 2ZB1A 2YW2A 4APPA 4GYIA 2Q0NA 5CU0A 2RFDA 2UZDA 3W2QA 4RIOA 2A2AA 4YJRA 5HV6A 3POOA 2F57A 4YMJA 1FBNA 5IQEA 3G9NA 4JR3A 4HGLA 4ZY5A 3AX6A 4W8DA 5EYCA 5BWWA 3BQCA 2WQBA 3F3VA 4JRNA 4MXAA 4RWIA 3KYHC 3JXWA 5HCXA 3F3UA 5AMNA 3HAMA 4DH7A 3P79A 4RJ5A 5IMEA 2ITTA 3IDPA 3R7IA 4D9UA 5HBEA 3CD8A 4O82A 4MBLA 1B6RA 3H9RA 1VLRA 1LR4A 4E93A 1Z57A 4ZTQA 3GC7A 4YZNA 2J0JA 2P33A 4E26A 4JG6A 1G8AA 3FE3A 4IC7A 4GK4A 5HVYA 4MH7A 4PRJA 4EL9A 1GSOA 5CB4F 3CSWA 4NM0A 5JVLA 3RK9A 5CQWA 2XNGA 1WBSA 3W2CA 3UFXB 4HNFA 3N9XA 4ZMFA 1BL6A 3QQJA 4FSQA 5E8TA 1OIUA 2H9VA 1XMMA 2X4FA 4IB3A 4ZJJA 1E9HA 1TQIA 4OBQA 3MI9A 1W83A 4RGJA 4FT3A 2W1DA 1ZYJA 3IOPA 4ANSA 5KX5F 2P4IA 5B2LA 2BZKB 3B8RA 4RJ7A 1OITA 3KGAA 5HESA 1KT8A 4I23A 3WYYA 1FGIA 4R7HA 2J6MA 3LOKA 3MS9A 4I41A 4Y5HA 3WYXA 5BVFA 1VBHA 4DBNA 3GQIA 2C47A 4X0MA 4F7SA 4Q5HA 1GOLA 1ZYDA 4FSZA 2BRHA 2Z02A 5EHLA 5TR6A 1PMNA 2ETMA 2WQMA 3TDWA 5KMMA 2EB2A 2OIQA 1A48A 1T45A 3MY1A 1IOWA 3E5AA 4FR4A 5EDRA 4M0ZA 2GTMA 3A4PA 1XKKA 3H0ZA 2WQNA 2G2IA 3DOGA 4DITA 1GJOA 4O7VA 2WTDA 4FTCA 1C3OA 1H28A 3W33A 5K5XA 4DBXA 5I47A 3VBQA 5EH0A 2XA4A 3FDNA 4YC8A 2ACXA 5CS6A 4YSJA 4YLLA 3WARA 4GS6A 1APME 5TO8A 3I79A 5K4JA 5CF5A 2H96A 3MBLA 4TY1A 1SM2A 3PA5A 4G6NA 3QF9A 1KJJA 4O84A 1UNLA 3AC1A 3LFSA 3NAXA 5AFVA 4ANQA 4Q2AA 3R8LA 4G3EA 4PP7A 4HCTA 3BYUA 4L45A 4BDFA 4ZHQF 3SD0A 4G3FA 5DR9A 2V7OA 3Q4TA 4RJ8A 4S30A 4EC9A 4JBOA 2BDJA 4XOZA 5D1JA 2PE0A 3EN6A 4FTNA 4YBKA 3OMVA 3RWQA 4BGGA 3FY0A 2GU8A 5I5ZA 5FEEA 4Y85A 3Q4ZA 2H6DA 1A0GA 4L68A 5JH7F 2CSNA 4BICA 3F5XA 5D1PA 5A4TA 3LFCA 4NYEA 2VTHA 4YJTA 2QNJA 4I0RA 2GHGA 3DT1A 4OTIA 1J1BA 1PXNA 3QHWA 4H05A 1H1WA 3U9NA 5HLWA 5EW8A 4YAKB 3PP1A 3GOKA 3L8VA 2XEYA 1NT2A 3TIZA 2BRBA 2XYNA 2XH5A 1ZMWA 2WMQA 2EU9A 2P0CA 3DZOA 4ZSEA 3MTLA 2SCUB 3F69A 2OG8A 2QI8A 3LCTA 5BYYA 3HL7A 4R6VA 4KBCA 4P7EA 2CN5A 2OF4A 2WMTA 2ITPA 3HV3A 1J7IA 3E88A 4FSRA 1PHKA 2QOBA 3OD6X 1EYZA 2CKQA 3KL8A 3ID6C 2UVXA 2ZV9A 4M0YA 5HD7A 2ZV2A 4CCBA 5M09A 4Q4DA 5FTQA 5E9EA 1XHAA 5GIOE 1PJKA 2XNEA 1U5QA 2JD5A 3FMHA 2PN1A 2X2LA 2HW6A 1XH6A 3DFCB 5FBNC 4FGBA 3H4JA 3VQUA 3NSZA 5GHVA 5F9EA 1JLUE 2Y8OA 5AUYA 1Q8WA 3FMMA 4DH5A 5LXMA 3OWKA 3CPCA 2FP4B 3HA8A 5DGHA 4GCJA 2WTKB 1KE9A 3R71A 3A61A 1Y6AA 4QT1A 2PTKA 3T9AA 3DB6A 4NUSA 4O4IF 4PTCA 3AXWA 3GENA 4D2SA 4M14A 1CKJA 3R21A 2PVPA 3TY5A 3KF4A 3QZIA 4XYMB 4UALA 1SNUA 3QA8A 3DTGA 4FG9A 4FSYA 1TQMA 5DPVA 2YDIA 2BTSA 2JIVA 2QOQA 3VHEA 2C6OA 5ANGA 3RPOA 1GZKA 2PBZA 1W84A 3D2IA 2F7EE 3OW4A 4AA0A 3F5GA 4BRXA 3W2RA 3ORQA 2WD1A 2IW8A 4NZNA 3GC8A 4USFA 3DJ5A 1CDKA 4FUXA 2XRWA 4FOBA 4O4JF 2RG6A 4XRLA 2UW6A 5HIEA 1YWVA 2JIIA 1BI7A 4OT6A 2VD5A 2W05A 3QYWA 4G1WA 1Y91A 2G9XA 4BCNA 1J91A 3FZOA 2UW5A 4A4LA 4XP2A 4ME6A 4MV1A 3TMOA 3UIXA 4JMQA 4EEVA 2Z8CA 5AP5A 2BZIB 2PY3A 4O2AF 5IA2A 5AEPA 1XDNA 2YACA 3WF7A 4GL9A 1KE5A 4PMSA 3R8ZA 2XEZA 5DH3A 5KHWA 3ZYAA 3HECA 4FNXA 4C37A 4NCTA 2ZM3A 1BI8A 3PPZA 1YKRA 4BYIA 4QP1A 2C69A 2XIKA 4S33A 4F1TA 2CNQA 4RIWB 1JSTA 3DLSA 2R2PA 5AX9A 3VIDA 4JG8A 4O83A 5KNJA 3EOCA 4L3PA 4PP9A 3IW8A 4C4HA 4LMNA 1P8LA 4O0RA 4Z55A 2HZ0A 3BGQA 1YXSA 5CNNA 3L8PA 1H01A 5EI2A 4F64A 5M57A 2QG7A 2W5AA 2WPAA 5EW3A 3UC3A 4IZOA 4YU2A 4TYEA 4QDVA 3OY1A 3G6HA 3GP0A 3BABA 4G5JA 2YIYA 4QTBA 4X2FA 4LOPA 3ANRA 3PG1A 4BDJA 4ZJIA 4OUCA 2ZM4A 3QRTA 5D12A 3MB6A 5J8IA 2XNMA 1TFFA 1BX6A 4ZSGA 2VO0A 2YYAA 2DYLA 3TQTA 4AOTA 1IYEA 1VZOA 4XNEA 2DZDA 3CP9A 3I60A 1I1LA 3O7LB 3GU5A 4OTWA 3GU7A 4QMXA 3U9CA 5IH4A 1OECA 5LVLA 4TN6A 3C7QA 4DGGA 3RK5A 2HHFB 5JQGF 2JBOA 4IDVA 2C0TA 2IN6A 2VWBA 4EH8A 3IO7A 4RX9A 4AE6A 4EOKA 3SG9A 3DS6A 3S95A 5FG8A 2H34A 2XNPA 3T9EA 3U0GA 2X6EA 4DTAA 5AADA 1XH5A 2R82A 3GEQA 5JVDF 4JR7A 3IDCA 4D4SA 2C5NA 4DN5A 4TWOA 3PJ8A 3FZPA 4I6FA 3DKCA 4X3FA 5D7AA 1U54A 4LL0A 3MDYA 2XNNA 3QQHA 4JJRA 4G17A 4ZIMA 3TI1A 4Y72A 4BIBA 4DG3E 4PDYA 3NYXA 4RWJA 3FQEA 4QQ5A 4IWPA 3KXXA 3K3IA 4FMQA 3NW5A 3K5VA 4C36A 2OZAB 3FY2A 2UZOA 4QMLA 2W6PA 2X0GA 2W96B 4XHKB 2VX1A 3ORTA 5HE3A 5AV4A 1KOBA 4GUBA 4ITJA 5B7VA 1CQIB 3RPYA 5HLPA 3UO4A 4F4PA 3WWHA 1R3CA 2B53A 5L2WA 3EWHA 3TNQB 3H9OA 5EDPA 2FPIB 1H1SA 4DG0E 2PU8A 4I4FA 1F5QA 4FK3A 4YJNA 4CKBA 1H00A 4I6BA 2E2BA 2NU8B 4HVDA 4I6HA 5CX9A 4CG9A 2ZMCA 3AC8A 4KRDA 1H07A 3TEKA 4XV9A 3ET7A 4BTFA 4DH3A 2YM6A 1V9PA 4R3CA 3IONA 3OY3A 4LOOA 2OICA 5HQ0A 1C30A 2QVSE 5DWRA 4UCVA 1A9XA 1XJDA 4FL1A 3BELA 4PZ6A 4F0GA 4EFEA 1Q5KA 1YDSE 1S9JA 1YWNA 5HNGA 1XQZA 2XBAA 3V6RA 5IA3A 4CZTA 2R3RA 1QPEA 5A3XA 2W4KA 2W6ZA 5IU2A 3G8CA 2G2HA 3OXIA 1SVHA 2W1CA 3KRRA 2Y9QA 3V01A 3SOAA 3VS0A 3SOCA 3G33A 3D15A 4ZZNA 4YPSA 4DH8A 2G1TA 3L9NA 4I0SA 4O6EA 3V5QA 2JFMA 4AA4A 4OGRA 3BA9A 5M4UA 4ENYA 4RVMA 4V01A 5AUVA 2I6LA 3LQ5A 2OJGA 4RLKA 3IKAA 3R9HA 5A46A 3S3IA 2VTNA 2PUIA 3LWBA 5HVJA 4YJOA 3KXZA 4FV0A 3RUPA 1J7LA 1B38A 4ZTSA 4DCAA 2YZAA 5KMIA 3MVJA 2A27A 3PZHA 1UA2A 1OB3A 4RFZA 5ANIA 5H2UA 4AF3A 4CFFA 5LVMA 5BWUA 3L2PA 5CEPA 3HNGA 1H25A 3SA0A 4BTJA 5KKNB 4USEA 2PMLX 5DR2A 5A6OA 1XBBA 3BLHA 4YJQA 2F2CB 4O38A 4QMYA 3SAYA 1IA9A 3LCDA 4IVCA 4RIXA 3EQRA 4FSMA 2WTVA 1YVJA 3QLFA 4XLVA 3SXRA 3UTOA 1SYKA 1KWPA 4AW5A 5HD4A 5JGBA 3PLAE 4JXUA 5EHYA 4FG8A 5KBRA 5HE2A 2NP8A 2GS6A 2P55A 3EMGA 3QA0A 4UCSA 4FNYA 4QPSA 3W0NA 2X1NA 2YZGA 4LFIA 2HHFA 3COIA 4XX9A 4FV3A 2GMXA 3TG1A 4U80A 4C58A 4RLLA 1V1KA 3T54A 3UOJA 3QGYA 5DT3A 1YWRA 5I5TA 1ZYSA 2UV2A 1Q97A 1CMKE 2CGXA 3VBVA 5CANA 3NWWA 4UYNA 3QXPA 3TV6A 3PVWA 2YZNA 4ZOLF 1OKWA 3QX4A 2NU6B 2HAKA 3T9FA 1H26A 3ZRKA 3OUKA 3U54A 2OKRA 4DT8A 3VS1A 4C4FA 2IVSA 3MYGA 4KINA 3NR9A 2HGXA 3BEGA 4G6OA 3QTXA 4UEUA 5DT0A 4ANBA 4AT3A 2CNVA 3I7CA 5CEOA 2OZAA 4RIYB 3UDSA 3MY5A 1YXXA 4MYGA 4X2GA 4EEQA 5J87A 4C2VA 4O22A 4RVKA 5TOZA 4CFMA 3MTFA 3DBQA 2PVKA 3QKKA 2ITOA 3NIEA 4GW8A 4NK9A 5DISC 2QOHA 4CRSA 2J0IA 3KALA 4EH6A 3G15A 3QAME 3A7HA 4MQ2A 3QBNA 3FMDA 2ITUA 4KIOA 3F82A 5H8EA 4I22A 3UJGA 2ITQA 1JKTA 2C6TA 1G3NA 3CGFA 4MD8E 4UWYA 5LOHA 5C26A 4P5QA 4WRGA 2I1MA 3LXPA 2XNBA 3AMBA 2HG8A 4L7FA 1CKNB 3KIOC 4CMUA 5KMOA 2VAGA 4IX6A 3U6JA 3EKNA 3HMNA 3VS7A 2DLNA 4CT2A 2XKFA 2OWOA 2I80A 1XH4A 1FVRA 4FTMA 1G8SA 4M69B 3HP2A 4HZSA 3QQLA 4LG4A 1FOTA 2HWOA 2HY81 4IX3A 1REJA 4FTJA 5HCZA 3ZFYA 5M53A 2BIYA 5F4NA 2YM3A 1NW1A 2X39A 5E4HA 5I9UA 4XP0A 2AUHA 3LHJA 4RQKA 4AE9A 5KCVA 4BBEA 1VKZA 4F99A 3UODA 2ZB0A 4RMZA 2VNYA 5IH5A 3DF7A 2WMUA 3TNHA 4AQCA 4WBNF 4L42A 1YW2A 3EQGA 5B2KA 3PFFA 4UN0C 2YDJA 4FKOA 5AV3A 2W1IA 4WD5A 3D5XA 4ZEGA 2RKUA 4NZMA 4R3PA 5D1OA 3FXXA 3R02A 4FV5A 4M68A 4EGJA 4KAOA 3TJDA 3FMEA 4R78A 3BWJA 3NGAA 2B52A 1CSNA 3KREA 5A6NA 4MCVA 4GIIA 3RNYA 1JQHA 3NCGA 4JBPA 4BVUA 3FZSA 3DBCA 4IBMA 3QQKA 1JOWB 1UU7A