1OBDA

Saicar-synthase complexed with atp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
303
structure length
298
Chain Sequence
b'SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKADENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMIDOIMIDAZOLE- SUCCINOCARBOXAMIDE SYNTHASE
publication title X-Ray Structure of Saicar-Synthase Complexed with ATP
rcsb
molecule tags Ligase
total genus 101
structure length 298
sequence length 303
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1obdA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1obdA02
3UP2A 3LMIA 4RWLA 4M67A 1YXSA 3OXIA 5B2LA 1JKSA 2ETMA 2C0TA 4O7RA 2ZJWA 4D5HA 2QURA 3NEWA 5IEVA 4BY9E 4CFMA 4S32A 2I1MA 4NK9A 5DEWA 3NR9A 2YCQA 4AOTA 4IX6A 4D28A 3C1XA 5GHVA 3FI4A 3JVRA 3QGWA 4CT2A 1KE7A 2IZSA 3F9NA 4LRMA 5FNVF 4XG7A 5L2WA 3BGPA 3TJCA 3DB8A 4EK5A 2QOKA 5IA4A 2QODA 5CU4A 3AX6A 4YR8A 2UW9A 3MW1A 3OEZA 2HZNA 2CLQA 2R3KA 2WKMA 3NX8A 5IQAA 3VW8A 4WBOA 4EH4A 5BMVF 2QKWB 2J90A 3IGGA 5HLWA 3NYVA 4GCJA 4OBPA 4LUDA 4Q5EA 2HAKA 4KA3A 5EKOA 5JZJA 2UW6A 2VO6A 2BAJA 3KXZA 2GQRA 3N4UA 4RIXB 4ZMEA 2PE0A 3QQHA 3A7JA 4WO5A 4DLJA 4O2BF 3VHEA 3UO4A 1RQQA 4HCTA 4BIDA 3WIGA 1NXKA 4MAOA 4PMPA 3K3PA 4V04A 4XYLB 5JVLA 4BYJA 4I4TF 4YNEA 3GCQA 4FSMA 4R78A 2WTJA 4D55A 3UOJA 3PZEA 4EEVA 2C4GA 1Y8GA 4IANA 5C1OA 4IC8A 3KRJA 3UE4A 3LIJA 3V51A 2W4KA 4HQ6A 4OTRA 2CN5A 4C62A 3R5HA 3DAEA 3PXQA 4IM0A 2Q0NA 4FFNA 5IQIA 3POOA 2WMVA 5JH6A 1BX6A 3FI2A 1W93A 3Q6UA 3CLYA 4RX7A 2BALA 3R00A 3RK5A 4MA0A 2E9VA 3BYVA 1BL7A 1AUXA 3GCPA 4H3QA 3R83A 3R5FA 2O2UA 1JKJB 2B9HA 5GIPE 2R2PA 4W4WA 2CLXA 2VWXA 4QPSA 3VQUA 3KC3A 4IDTA 5FGKA 5E8SA 2W0JA 4IFGA 1YWNA 4A9TA 5BUEA 2UW5A 2F57A 3Q2JA 4FZ6A 3VS7A 2W5BA 2GS6A 2VTAA 1JPAA 2ZV8A 2PVYA 4E5WA 5FBOA 4HW7A 4RZWA 2BRNA 4DEGA 2JDOA 2PVPA 3O7LB 4G1WA 1P4OA 4QMXA 2GTMA 2FP4B 3VAPA 4IVCA 4YSJA 4FZ7A 3ZLWA 2EXCX 2X4FA 3ZXZA 4MTAA 5IPJA 5BVDA 3FQEA 5C8YF 1QL6A 3QCYA 3G8CA 4TYHB 1M52A 3A60A 3HUCA 2IWIA 2R3GA 2XNBA 4RLLA 1Q99A 3BGZA 3IGOA 3Q9XA 4YJRA 3ZFYA 3E63A 5M51A 4FFLA 4XRLA 1J7UA 4Z7HA 3DTWA 3AC8A 4LGHA 3GCUA 3R73A 2ZV7A 3I4BA 3VUIA 2WMAA 1WVWA 2ERZE 3LXPA 3P0MA 4DGOA 2XNNA 3EKKA 4FKLA 1ULZA 3DGKA 3D7ZA 3P79A 3KRXA 2PBZA 3R5XA 5EM7A 3ZRKA 5EZYF 3H10A 4I93A 2XK3A 3EQIA 4MBLA 4QP4A 5DWRA 4D0XA 2YCSA 3FKOA 4QMSA 3UNZA 3CC6A 3NUXA 3SXFA 1CQJB 4YPSA 3VS0A 2WXVA 2XM8A 4O81A 5D11A 2WO6A 3ROCA 3S0OA 3M42A 4RWKA 3PVUA 2HW6A 4ZHQF 2WMTA 1S9JA 1J3HA 2RL5A 2W1CA 3ET7A 4RQKA 2EXMA 3MB7A 3BG5A 2OXXA 4KRCA 1H08A 4Q5HA 5CSVA 5A14A 2WIPA 3ITZA 3KN6A 1QPEA 1PMVA 2B0QA 2PY3A 4I0TA 3QTQA 1GGOA 3LLAA 4BDBA 5I9UA 2C5YA 4ZP5A 3AT3A 3EN7A 4O7NA 3ORIA 3II5A 2IJMA 3BGQA 4BCQA 3I0OA 3JY0A 2HYYA 3DJ6A 3BRBA 1NVRA 2FSMX 3PPZA 4R1VA 3G5DA 4XP2A 4YJTA 3UTOA 3I1AA 4AN9A 1QMZA 5KMLA 1I7NA 2W4OA 4MNEA 5LVOA 4HVIA 4AA0A 4W8EA 4AT3A 3O8UA 4OBQA 1XBBA 4RIWA 5AP1A 4RG0A 3W2RA 2DLNA 3SRVB 4MWHA 1YXVA 3Q9ZA 1ZOGA 3QYZA 5IH6A 1JKKA 1Q24A 2JIIA 3PIZA 5TR6A 4IAAA 2Z7LA 3QFVA 4FKVA 3UO6A 3NSZA 2YABA 1WBSA 4U81A 5LVLA 4ITJA 4FKPA 4MV8A 5DPVA 4ARKA 4E8AA 4C3FA 3TV6A 3KVXA 3DOGA 2CMWA 2JD5A 3OFMA 3OWPA 4FVQA 4YZMA 4ERWA 4N70A 1UU3A 4OT5A 3KL8A 3LCSA 4F0GA 4A07A 3BYMA 1UU7A 3EOCA 3UYTA 5L2IA 3UVPA 3R2BA 4KBKA 3P7CA 4AE9A 3OP5A 3FMNA 3LE6A 4TZRA 4NSTA 3ZSIA 4L01A 4I21A 3TIIA 3EN6A 2GTNA 1RJBA 4QTBA 4EUUA 3FQHA 2R9SA 4TN6A 5BPHA 3R1YA 4XNEA 4J98A 3RK7A 4HVDA 3PXKA 5IISA 4QNAA 3SHEA 2R7IA 4FKWA 4LV8A 3QQJA 1YI3A 3CS9A 3FSFA 1OMWA 5KMJA 4GL9A 2PMOX 5DT0A 3VUGA 3ZZEA 1YOJA 4EZ7A 4JDHA 2VTTA 4QMZA 5ETAA 2P0AA 5DHJA 1J7IA 2JGZA 3KXXA 3LXLA 2VTHA 1NT2A 4FIGA 3NUNA 4Z9LA 4AZFA 3B8QA 3LLTA 3CD3A 3P5KA 4FKJA 1SVEA 1UU9A 2X2MA 3G6HA 4X6QC 5DR2A 4DEIA 1R0PA 1UKHA 4YU2A 2R3IA 3BWJA 3DS6A 5A4TA 4B8LA 4ZI7F 3JY9A 4YP8A 4U97A 3QCSA 4OGRA 3VNTA 4U0IA 2XNEA 4KS7A 2UZLA 2BAKA 3AC4A 4A4XA 5IQDA 4D2RA 2ITZA 3NIZA 1O9UA 2OJ9A 3G15A 4FL3A 4L44A 5FXQA 5HIBA 4C2VA 5IUGA 2C1BA 5I9ZA 5KBQA 3KAJA 4U45A 2G1TA 5CLPA 3I12A 4JG7A 2Y0AA 3L8SA 3NNUA 3LJ2A 4EKLA 3R23A 2GPHA 4GT4A 4W8DA 4FTKA 3FI8A 4ANSA 1YOMA 1M2PA 3VBTA 4FNZA 4DFYA 3QQFA 3KALA 4AG8A 1GOLA 1OITA 3R7YA 1YHVA 3TZ8A 1BYGA 4I0RA 2NRYA 4C34A 3L9PA 4RJ4A 3EN4A 4PL4A 4U79A 5EYMA 5HO8A 5B7VA 2ZDHA 4QP8A 2FUMA 2UW3A 3MPMA 5CZHA 3SOCA 4DFXE 4R6VA 5HI2A 2PULA 3DKCA 3RHXA 2YITA 3RMFA 1M17A 3EL7A 5ANKA 5J9YA 2VTLA 1PX2A 4MD9E 5HBHA 4IX4A 2XNMA 4WG5A 4Z16A 2GPSA 3QZIA 5EFQA 3R21A 5E91A 3SD0A 1GIIA 4FX3A 4G6OA 3M2WA 3SVVA 2BTSA 1GAGA 1AGWA 4FL1A 2O3PA 3MGYA 4QMYA 4MD7E 3PG3A 5AP2A 4BVUA 2R85A 4RWJA 2LGCA 3FY2A 3O23A 5DE2A 3VW6A 3IDPA 4ZZOA 3JPVA 5F94A 4F7LA 3G0EA 3ZCLA 3OEFX 2Y6OA 1Q4LA 3NAYA 1EH4A 5E90A 3IQ7A 3OCSA 2Y8OA 5DT3A 1H00A 4L46A 1MP8A 4I6BA 4B0GA 5B2MA 4G3EA 3POZA 3RWPA 1V0OA 3MH2A 4KNBA 2XKEA 2PZYA 5AUVA 5HCZA 5DOSA 3RJCA 4CTCA 5CA1F 2X0SA 4Y8DA 4DF3A 2R5TA 2C00A 2GHGA 5AUZA 1CS0A 1Q3WA 3LFDA 1O6KA 5IA5A 3R2YA 4FEQA 5BQ0A 1GZKA 2CN8A 3E92A 5KNJA 1SZMA 4EGJA 2J0LA 3K54A 3COMA 3R1QA 4Y72A 4AA4A 4JT3A 2YWVA 1SYKA 4RC4A 3I79A 3FHRA 4FE2A 3MB6A 1NA7A 2BHEA 4DEEA 3GEQA 3R0TA 2CZGA 4L45A 1WBNA 2YZNA 3CEKA 2GQGA 3D0EA 3IOKA 1H1WA 4XG8A 1Q8ZA 1XBCA 1XH4A 3ZLYA 1JAMA 2OH0E 2O5KA 4O82A 5A4CA 2W6ZA 3OT3A 1B38A 5AIKA 5F20A 4B7TA 4IH8A 3AMAA 4ASEA 4A9SA 4O7VA 3LQ3A 5E8UA 2B4SB 4NW5A 3A7GA 4RJ6A 5ANOA 4MXAA 3R30A 2IZRA 1U54B 2A27A 3HMMA 4YAJB 5A3XA 3U51A 3BKBA 5HLNA 3AC1A 2VTRA 4FKQA 3UIBA 2JLDA 1XHAA 3DB6A 3DDPA 4EJNA 2OLCA 5J2UF 3CPCA 1M0TA 1Q97A 4BTFA 4JVGA 5D10A 3W18A 3S1HA 3ZHPC 5M4IA 4YBZB 3LFEA 3OUZA 2F2UA 1PXPA 4IVDA 2DQ7X 2Y4PA 4FNXA 4FK6A 5DG5A 3HAMA 5CU3A 3LZBA 2G15A 4D4RA 1GLVA 2W99B 2OIBA 1AQ1A 4AN3A 4E4LA 5IEXA 3EYGA 5CQUA 5HV6A 1J91A 1W8CA 3M1SA 4FT3A 4CKJA 2G2HA 3Q5IA 2FPPB 3LFCA 5LWMA 2Z7QA 4W4XA 4O22A 3AG9A 3R7UA 4QP7A 2GNFA 1BMKA 1SVGA 5A4EA 1GZNA 2J0MB 3NNVA 5FP6A 4GVJA 3ORMA 4XV9A 4MX9A 4ANBA 3LCDA 5M08A 5L2SA 3E87A 3LPBA 4OTQA 4PTCA 2CKEA 5HEZA 4L53A 2CGXA 4LRKA 4RZQA 2OJIA 3BPRA 2WOUA 1Y6BA 4D1ZA 3QC4A 1DI8A 4KD1A 3FMLA 3V5PA 2HJWA 5CAEB 2XK9A 5IDPA 4B9DA 4E4TA 2LAVA 3ZONA 4C37A 3EIDA 4FL2A 5AUWA 5HE3A 4NCTC 4C61A 4O7LA 1K2PA 4WUAA 5T6KA 2R7NA 4FTUA 2UZUE 4JDKA 5TT7A 2VPQA 3L9LA 2R3QA 5L6WL 3RWQA 3Q1KA 5F1ZA 4DINA 2BFXA 1JSUA 2VD5A 3V8WA 3PA4A 3PJ3A 3GC0A 4HNFA 4PV0A 3ORNA 1P2AA 2CHLA 4WOVA 3E7OA 3MBLA 3MS9A 3C4XA 4UWYA 4G3FA 5EI8A 5E8XA 3MJ2A 2YM5A 3ALNA 4G3DA 4EC9A 5EDQA 4NZWB 3KULB 4YURA 5IA1A 4ME6A 4CTBA 4IVAA 5AMNA 2UZEA 5JKGA 2YM3A 2BHHA 5HE0A 2YDKA 1CKJA 1OKWA 2IVVA 4QP2A 4R77A 4YC8A 3UG2A 3IDCA 3Q2MA 5IU2A 2Z04A 4DFNA 4MVFA 2OGVA 3RAIA 4YAKB 1MQ4A 3NVKI 4F0FA 1WBWA 2YCRA 2OF4A 4GS6A 4XG3A 3R7EA 3UNJA 4APCA 5I9YA 3NCGA 4XRJA 3ZEWA 3C4FA 5DGZA 4JR7A 5D12A 3NYXA 3Q6WA 4E26A 2XCLA 4UXQA 5D1JA 2G01A 4U8ZA 3TI1A 2UVYA 4FA2A 4IWOA 4AX8A 4A9YA 5EOBA 1A48A 5ANDA 3ORXA 4EONA 2A4LA 2QCSA 3VN9A 1JDBB 1PMUA 1JOWB 4FI1A 2F7EE 2PU8A 4IWDA 3VPCA 3FC1X 5ICPA 2P55A 1GJOA 1SNUA 4IZAA 4E6AA 2PSQA 3CY2A 3LOKA 5BUIA 3FMHA 5J9LA 2ITYA 4RX8A 2C3JA 1SM2A 2EWAA 3SG9A 4HYHA 3VQHA 5EKNA 3B8RA 5KMNA 1ZY4A 4KBAA 4K9YA 2CGWA 3WIKA 4HNVA 3WF8A 5HNIX 4TNBA 5M4CA 5HNGA 1LEZA 2PUPA 2WU6A 2QOBA 1C30A 1TQPA 4C4HA 3FZRA 3SG8A 3LXNA 4X2NA 4CFVA 3H30A 3V5QA 2UZBA 2UZVA 3UOKA 4E1ZA 4IHJF 4CD0A 3VRZA 3NLBA 3E8EA 3MH1A 3UQGA 4BCOA 4ZMFA 1IA9A 4RFMA 4YO4A 1KEEA 3EQGA 4NUSA 2BILB 3U9CA 4PQNA 5IA0A 5A6OA 4GW8A 4M69B 2GS7A 2XBAA 3R1SA 4J95A 4M8TA 4J52A 4FZAB 3P7BA 4R7IA 4AQCA 3MIYA 4FK3A 1KWPA 2WGJA 3D9VA 5IUHA 3SGCA 1Y91A 3AD4A 3MY0A 3HP2A 2VAGA 5LVNA 3QRJA 4WKQA 2QHNA 4NL0A 5CQWA 5M06A 1YXXA 3JUHA 3LM0A 1Q62A 4FTTA 4ZZNA 5JFVA 4DLKA 4WUNA 3TDVA 4FSZA 1ZMVA 2ZAZA 3HX4A 4FKIA 2PHKA 4K2RA 5D7AA 3T3UA 4F9BA 3FKLA 3Q9YA 3UQCA 4O2AF 3P08A 4O4JF 1Q8WA 3KRLA 4AW0A 5KUPA 2J50A 3H9FA 4NH1A 3OY1A 2PZPA 3BHVA 3VWAA 4ZLYA 1OECA 3VBVA 4IB5A 3MJFA 4FKUA 4PRJA 4F99A 3RPVA 1WVXA 4BCPA 1ZAOA 4YHJA 3ZSGA 4F6SA 4P7EA 4PL5A 3TIZA 5BYYA 4F09A 5K5XA 3UO5A 2ETKA 1O6YA 5DVRA 4IAYA 4MEDA 1BI7A 5I9WA 3R9DA 3TZ9A 4RC3A 5HG5A 4I41A 2QD9A 4TPTA 1VBHA 2GLTA 2IO6A 4ANQA 1PMNA 2X8DA 3QWJA 4BHZA 4F6UA 1LUFA 2JIVA 3QALE 4M9UA 3SW4A 5EW9A 4FV7A 3S4QA 5K5NA 3F88A 3ZUVA 2B1PA 2BR1A 2WMSA 3MPTA 1OUYA 3LMGA 3OCGA 4FV4A 3PXYA 1OM1A 4YSMA 1OBDA 4L67A 2UV2A 5CS6A 3O7LD 2X9EA 3DK6A 3DKFA 4ENYA 3TUCA 4HR7A 5EM6A 1TQIA 3QGYA 3EZVA 4O0UA 2B55A 2F2CB 2IN6A 1VKZA 5CB4F 2J9MA 2PUNA 2V62A 3QQKA 1OL1A 1P14A 2AUHA 4TXCA 3TKIA 3K5IA 4GFMA 3AQVA 3LFQA 3DZOA 3U8WA 4YLJA 5IQGA 5BVFA 4IAIA 4C3PA 2W71A 3CR0A 2WMXA 1JBPE 3ZRMA 3MWEA 3HRCA 5FTQA 3W33A 4M15A 3MV5A 4QPAA 1H28A 3BV2A 2XMYA 4LV5A 5C9CA 3WYYA 4RX5A 3QLFA 3DDQA 2VQDA 4O86A 4LQMA 4EHZA 5CT7A 3VS2A 1KJ9A 4I24A 4C58A 3IKAA 3G9LX 3GT8A 4QMMA 2W9FB 2G2FA 3CGFA 5AP3A 2HZIA 5CF5A 2DYLA 1LPUA 4JXFA 1Q8TA 2W1HA 5EH0A 4U41A 2OI4X 2WZJA 4QNYA 3UIUA 4C3RA 4DTAA 4BTKA 2B52A 2J0JA 4WA9A 3DNEA 2W6MA 3R8UA 2XCHA 1ATPE 1XH5A 2RFSA 3PUPA 4CFUA 4XJ0A 1YXTA 4DITA 4MNEB 4E6QA 1OBGA 2C6TA 2C47A 2YJRA 3RKBA 4GG7A 3WZUA 3RK9A 2NO3A 5IH5A 4RIWB 4AAAA 4IJPA 3BLHA 2BUJA 4IZ7A 3HNGA 2ETRA 3DV3A 4ZSLA 4MKCA 4KBCA 3HMIA 3MFTA 2W96B 3IO7A 3WF6A 3V4ZA 2W6QA 4QTEA 1PK8A 4EHGA 3AC2A 3VUDA 2DWBA 3GB2A 4M7IA 1OL7A 4OTGA 2V5AA 4E6DA 2XK4A 3HECA 5LQFA 4OUCA 4CRLA 2FGIA 3H0YA 1W96A 5CAUA 2V58A 5B2KA 4D0WA 2HXQA 1OI9A 4NW6A 3HV7A 3ELJA 5AWMA 4DT9A 3ETJA 5LOHA 3AW8A 2WELA 4P4CA 4DN5A 2R3MA 3QD3A 3TUBA 2YIWA 5CEIA 2CKOA 3Q5ZA 4S34A 1NVQA 4WRGA 1EUDB 3I5NA 4G6NA 4TV9F 2XJ2A 3BIZA 4RJ7A 4LOQA 4ZZMA 5J9ZA 3RFCA 3DKGA 4ZQIA 2JIUA 4U3YA 4IWPA 4KB8A 3MH3A 4RBLA 4XHKB 4XV2A 2YDJA 4RT7A 2R3JA 4BN1A 2PZ5A 3DAJA 2PE2A 3OMVA 4KWPA 4FT0A 4WIHA 5KX5F 4AGDA 3MTFA 5L6PA 3TIGA 1OKZA 4AE6A 2BIYA 5FTGA 3PVWA 5I5ZA 2VWWA 3DZQA 4G5JA 2PZRA 3F3WA 2XIYA 4FSYA 4UEUA 5AV3A 5M07A 4USFA 3ZDIA 4LMUA 1XH8A 4M0ZA 4EOSA 3QQLA 4AGCA 4MWIA 2FPIB 1T46A 3VF9A 3QTUA 4U44A 5D7VA 3TQTA 1B39A 3PRFA 4IWQA 4DG2E 2PK9A 3F66A 1NVSA 1ZZ2A 1AD5A 1PRYA 3R71A 4R3CA 1CQIB 3KMMA 3MVHA 2W6PA 4JBVA 3V4SA 2ONLA 4RVLA 3QXOA 5DYJA 4FIHA 3R01A 4XLIA 4FOCA 5DRBA 2EUFB 4FSNA 5BMSA 2WYOA 2I80A 1L3RE 2WQOA 3LCOA 3PY1A 2R84A 4Z3VA 4YJNA 3BEGA 3UZRA 1KE6A 3ZU7A 2VN9A 5JGBA 4QMLA 3RCDA 3ZDUA 4NTSA 4C35A 1GIHA 5A46A 1WBOA 2ZOQA 3NUUA 2BRMA 3REPA 3P9JA 5CEOA 3NAXA 2YACA 3KU2A 3ACJA 2R3LA 4R1YA 5FD2A 4FTAA 2ZDGA 1UNHA 5FEDA 1FBNA 3P7AA 4FUXA 4C4IA 3PXRA 3ZBXA 2XF0A 4L68A 3MH0A 2IVTA 5HTBA 3QUEA 1DV1A 4P90A 1BUHA 3U54A 5HCXA 5AAFA 3RAHA 1M14A 3T3VA 3H4JA 4XBRA 5HHWA 2YISA 4ZY5A 5F4NA 2OWBA 2YAAA 3BEAA 3L8XA 4FEXA 5CU0A 1WCCA 5J8IA 2WMQA 3EFLA 4BDHA 4ENXA 2O0UA 4GIIA 4D1XA 4QYGA 4ANMA 2YCFA 4DGGA 1PKGA 2UZWE 4KKHA 4GYIA 4BCHA 2WTCA 4MXCA 3AOXA 5ITAA 3NUSA 2HY0A 2NU7B 2W70A 4RIOA 3JZIA 3CP9A 5LARA 3FPQA 4O6EA 1T36A 1PKDA 2VU3A 2GU8A 3SOAA 3UNKA 2CJMA 2GSFA 2F7ZE 5CZIA 1PYXA 4DLIA 4K1BA 2PPQA 2W5AA 2OXDA 4RIYA 4TYIA 3LCKA 2IVSA 4FNWA 3QD2B 4M97A 5AUYA 3D4QA 4AT4A 2XEYA 3PJCA 4IC7A 3PXFA 3GCSA 3DBEA 2HENA 1G5SA 2YIQA 2PVRA 3NCZA 5DA3A 3TKHA 4BCJA 4F64A 2NU8B 3FZOA 4CNHA 2R82A 2WTDA 3COKA 4EBVA 1TQMA 2IW6A 2C5OA 1SVHA 5HVKA 5KHXA 1FQ1B 1PHKA 2XYUA 2XIKA 3Q9WA 4ZK5A 4TUYF 4FV8A 4R3PA 4BCFA 3OUUA 3OZ6A 2BTRA 1UU8A 3RAWA 1G8AA 3OUKA 4I94A 5FBNC 4ONAA 4OBOA 3LM5A 4G31A 3F82A 5HBEA 4GU6A 1MRVA 4X3FA 3VMMA 4FYOA 4PNIA 3NZ0A 2PZIA 5LMAA 3HVCA 5DN3A 4DTKA 5FDPA 1ZWSA 3QX4A 4TYGA 4F63A 5EM8A 3UQFA 2BRBA 1KE8A 4WSYA 3TL8A 4DC2A 2XK7A 3OOGA 3TV4A 3EFWA 3DKOA 1Z5MA 5AV0A 5M4FA 2QOCA 3GU8A 5J1VA 3PA3A 3V5TA 4QMPA 4I23A 4USDA 1UWJA 3TNPC 2YJSA 4FV3A 3LFAA 2BROA 2XZSA 3IONA 3FY0A 3BQRA 5IQEA 4PDPA 1BL6A 4MV4A 4GYGA 2ZDQA 4DH3A 5DIAA 2J5FA 3EMGA 4ANLA 3VUHA 2ZV2A 5M53A 1U4DA 3NGAA 1OL5A 3HKOA 4HYSA 5L3AA 5KBRA 5DNRA 5LVPA 4JDJA 2RG5A 3L9NA 4GKIA 1U46A 3TINA 4ZLOA 3H9OA 2C30A 1OKVA 1OL2A 1KE5A 4C33A 3F61A 4EUTA 2OZAA 3HYHA 5IMEA 4G5PA 4C59A 3JRXA 3OC1A 4F6WA 3JRWA 3H0ZA 4R7BA 3QTWA 2PMIA 3VS3A 2FVDA 2ITQA 2P4IA 3QZGA 5E7RA 5GJGA 3E5AA 3E64A 4S31A 2ITTA 1FMOE 4FV9A 3ENMA 3W1FA 5EYDA 2HXLA 4X2KA 4BI2A 3DCVA 4GK2A 4A4LA 2H6DA 3R02A 4EWQA 5C1QB 3RAKA 2HCKA 2PVLA 4C2WA 1WFCA 4LOOA 1Z57A 3F7ZA 4A9RA 3CTHA 1K3AA 2R3HA 1E4EA 4GUEA 2W05A 4BI0A 5KMIA 4FZDB 1IASA 4AW2A 3WO0A 3FLZA 1KUTA 3CKWA 4F65A 2R3PA 5K9IA 2XNGA 2XCKA 4CKIA 4UYNA 5LWNA 5HBJA 2CCIA 3MFSA 4FUYA 5EDPA 5I9XA 3GQLA 4DT8A 2XKDA 4L9IA 2WHBA 4EK3A 3K5UA 4ERKA 2XH5A 1KJ8A 3RM6A 4I5PA 4X21A 5TF9A 4E4MA 3FAAA 4J97A 3UP7A 3DA6A 5ACKA 3G2FA 3FLYA 5EI2A 4DEBA 5FM2A 3N4VA 4AZVA 3EL8A 4FIEA 1S9IA 2O8YA 4UV0A 1Q5KA 3W2SA 4ZLZA 2ITXA 5GNKA 3QX2A 3FL5A 4CZUA 4J8NA 5K4IA 3IS5A 4RPVA 3TZMA 3HMOA 1IAHA 5A6NA 3CCNA 4FTQA 3U9NA 2VTOA 4QMUA 4Y5QA 3WYXA 3A62A 4DH1A 1W84A 4U6RA 3VRYA 2XK8A 3BE9A 3OG7A 3MFRA 1PXMA 2YS6A 2YFXA 4AZSA 3JR1A 3OROA 5G1XA 3C4ZA 4FIFA 4MNFA 4BRXA 5H9BA 3BI6A 2XUUA 4IB3A 5EYKA 4R5YA 4MYGA 2W1DA 1RW8A 2J7TA 3AT2A 2Y7JA 4IADA 3FMMA 4B4LA 3NRMA 4C38A 3PVGA 4UZHA 3FL4A 1V0PA 3BBWA 3PRIA 3SXSA 2J6MA 3HA8A 2C69A 2QR7A 3OXTA 2HW7A 2WEVA 2AYPA 1JSVA 1WBVA 3OW3A 4ZJIA 4DYMA 5IA2A 4F1OA 3DFCB 5BVNA 4V05A 4XEYA 2C5VA 5L8JA 1XO2B 4F70A 1Z9XA 2BAQA 2W7XA 3E62A 2YERA 2QI8A 4IB1A 1IOWA 2JDSA 2WMBA 2DUVA 4FVRA 1DAWA 1V0BA 2FO0A 5HZNA 2XP2A 3ZM4A 4BCIA 4N6YA 3P23A 2B7AA 4DIMA 5H8EA 4FZFB 4F7SA 1EUCB 4QYYA 4C4FA 5IMXA 4FFOA 2ZM3A 3TNWA 4PWNA 4DH5A 3EJ1A 3BHHA 4L8MA 4O7ZA 4DG0E 2GDOA 3V04A 3Q4CA 2GCDA 3OTUA 4FT7A 4QMNA 4O0RA 1KSWA 3ZRLA 4YUQA 4FYNA 4JLCA 3KB7A 3LJ0A 2YM4A 4QTAA 4ZEGA 4YJ3F 2PUIA 2BIKB 1TKIA 3RINA 5M44A 3QTRA 2NU9B 2JKKA 4I5CA 3FWQA 3ORZA 3UIXA 3ZEPA 4Q9ZA 4XOZA 5CXZA 1WBTA 4TY1A 3DBDA 3EHAA 4BB4A 5BVWA 3R8LA 4FR4A 4G17A 2Z7RA 2BZIB 4HCUA 3A61A 4UYAA 4IAFA 5CSWA 3TV7A 4EQCA 5CASA 4H36A 4WG4A 2Y4IB 4RVMA 5HVJA 4DGNA 2ZV9A 3UMWA 1YOLA 3KCFA 4V0GB 4XZ3B 3TDWA 3GCVA 4C5CA 3AC3A 4R3RA 4D4VA 5IQHA 4FTJA 4FFPA 4MH7A 3BQCA 5JFXA 3VIDA 2GHLA 2O63A 3C4CA 3JXWA 4WNPA 3WF9A 3ZO1A 4DCEA 5BX0A 4BDGA 2IVUA 4BICA 4GSBA 1Y57A 2HOGA 5IQBA 4DGLC 2JITA 3PJ1A 5CY3A 2H9VA 3HRBA 1CE8A 4XBUA 4IMYA 4EH5A 3DPKA 4FICA 4EK4A 1UNGA 2YS7A 1OIUA 3U9TA 3QZHA 2OFVA 5H3QA 3HP5A 5KHWA 4B6LA 1URCA 5GINE 3WO1A 5AAGA 3CPBA 4BIEA 5KMMA 4I50F 3NDMA 3ZMMA 4YLKA 3FKNA 5IH4A 4ACGA 4ZSAA 2JKQA 5DMXA 4Y83A 4GIHA 3VJOA 1WZYA 1YWRA 3NWWA 4IZ5A 5JVDF 4YZNA 4OT6A 3L8PA 2XRUA 1VYZA 2CCHA 2R3RA 3F6XA 4BR3A 2ITVA 2ZB0A 3DJ7A 3HV6A 4PTGA 1ERKA 2FSOX 3F2NA 3GP0A 4GVAA 3TNHA 4B8MA 5HO7A 1ZOHA 1FVVA 3MY1A 3FI3A 4LM5A 2SRCA 3M11A 3PTGA 5CENA 2VR1A 4EJ7A 4NJ3A 2RGPA 5H8GA 3PYYA 2X9FA 3D94A 3NMUF 3BHTA 5HX6A 3TTJA 4FTNA 3V6SA 1IR3A 4TL0A 4O0TA 4QMWA 2HELA 2C5NA 4IAZA 4C5AA 2QHMA 2X8IA 4JOAA 1GSOA 4FIIA 5TKDA 5LVMA 1OIYA 1IOVA 2A0CX 3COIA 5HCYA 2Y4IC 4RRVA 3B2TA 3PWYA 3EFKA 2QOHA 2QOLA 4DFZE 3E93A 4LFIA 4O2ZA 3SDJA 4PUZA 3QQGA 2C3IB 1E1VA 3QKLA 2W6OA 2VWUA 1H01A 3VOTA 5DR6A 3O50A 3VS1A 3KAKA 4K0YA 2I40A 3QHRA 3MJ1A 5LJJA 1YWVA 4FFMA 3HDNA 4GH2A 4WT6A 5CI6A 2PVNA 4KKGA 3EQCA 3OBGA 3A8WA 1J7LA 3MVMA 5CYIA 5M56A 2R7BA 4G2FA 3EQFA 1VBGA 2EU9A 3FUPA 5JK3A 4DH8A 4HYIA 5HNBA 3AMYA 4IAKA 4GT3A 4BDIA 2GFCA 3PSDA 3HV3A 3DAKA 2CNUA 3ERKA 5JGAA 3MA6A 2V22A 4O7WA 2VV9A 4UWBA 3KN5A 5AM7A 3TACA 4AF3A 1ZZLA 2C1AA 3MY5A 4EQMA 3BBTB 4JNWA 5JQ8A 2I8CA 3TJDA 3W10A 4YB8B 1UNLA 3I7BA 3KVWA 1H0VA 3PY3A 4QMTA 3QFFA 5CF4A 3BELA 3ACKA 5ANEA 5AUUA 3MVJA 1OPLA 3UG1A 2X7FA 4YJQA 5IUIA 2GNIA 3MYGA 4HGEA 2GMXA 1Y6AA 3GC9A 4N4SA 1MRYA 3PE2A 3ZO2A 4DEHA 3NUPA 2FSLX 4K18A 4ZY4A 2WNTA 3D7TA 5KCVA 4JR3A 3GFEA 4FFRA 4JBOA 3HLLA 3RV4A 4LL5A 3K2LA 3EQRA 4EH7A 4G6LA 4N6ZA 2WTWA 3PWDA 4KABA 4EOOA 3LW0A 5AP0A 1QPDA 3BU6A 4WHZA 4QYFA 4EORA 3QD0A 3NVMB 4ZAUA 5JFWA 4BF2A 4BCMA 5EHYA 3BE2A 3I7CA 3FZTA 4XLVA 2KTYA 4QSHA 4MXYA 4YMJA 4FV6A 1YDTE 1W83A 3UVQA 3FE3A 4I5MA 2AC3A 4PP7A 2RKUA 2DZDA 4HVSA 1IRKA 2XVDA 3IW7A 3KCKA 3SLSA 2I0VA 1IG1A 3FLSA 2YRXA 4YLLA 3QRKA 4BTMA 3QZFA 3CY3A 2V7AA 4QP1A 2HWPA 4O4IF 3U4WA 3FLNC 2QO7A 3R22A 2BVAA 1R3CA 2B9IA 3QQUA 3UJGA 4FNYA 4Y46A 4TYJA 1YI6A 3GU7A 3G90X 2BZKB 5DH3A 3WF7A 4BGQA 4PNKA 3CTQA 1WMKA 3RM7A 5EOLA 5FXRA 2R7KA 1KJIA 4CQEA 3GQIA 3VULA 5JEBA 2PVHA 3UDBA 4ACCA 4YBJA 2UW7A 2X6EA 5K4JA 1JLUE 3N51A 3HMNA 4CKRA 4TYEA 5BVOA 1JKLA 3VUKA 3WZJA 3UPXA 3KEXA 4W4YA 3R9RA 4PMSA 3Q04A 4WBNF 1ZOEA 2Z60A 3NNXA 4IIJF 3IW6A 1H24A 4N0SA 4TWOA 3OF0A 4QQ5A 2Y9QA 5C8KA 1FGIA 2IW8A 4I6HA 5M4UA 3F3VA 4OTIA 3AGMA 5CWZA 4CMOA 4QQTA 5LCJA 1JVPP 3O0GA 3A99A 5E8WA 4F0IA 3ROYA 5HQ0A 4H58A 4RJ8A 4YC6A 5CVFA 5M55A 5JQGF 2OJGA 4GU9A 4RLKA 5H2UA 4BGGA 2VUWA 4ZTSA 4Y8VB 1Z2OX 5J1WA 2WTIA 2PMLX 4FG9A 3WE8A 4YZ9A 4WBBB 5HICA 3ZO4A 4Q9SA 3VF8A 5LMKC 2R86A 2WEIA 4DCAA 4RVTA 3QCQA 3KXGA 2NUAB 4EL9A 4Z55A 2YRWA 2HY81 2YM8A 4PL3A 2RF9A 3FLWA 1W82A 4ZOGA 3W55A 2VWVA 5HE2A 2CNVA 4AW5A 4BDCA 4K8AA 4RJ5A 3D5VA 5DFPA 5CXHA 3F2RA 3FXZA 3ZLSA 3G8DA 3BLQA 3JVSA 4YGAA 4FEUA 3S95A 3ID6C 4IM3A 4RIYB 2W17A 4C4GA 3Q53A 3PFQA 4L52A 3KXHA 4NT4A 1EHIA 4I55F 3ZLXA 2ONLC 1VJYA 1H1RA 4EOPA 3ULZA 3GIDA 5KMOA 3ORPA 3FDNA 4YNOA 4CSVA 4E5BA 2ITNA 2BFYA 3EQPA 2W1IA 4JG8A 4MV1A 3E7VA 3MI9A 4A9UA 5BYLA 4QP3A 1Y8YA 3QRTA 4XH6A 5FTOA 4RFYA 4XV1A 5CNNA 4IHPA 4RWIA 4ASZA 5TOZA 3ATTA 1JLLB 4FV0A 3FEGA 4X3FB 4DTBA 2QLQA 2XNOA 2QO9A 4I4FA 4MXZA 3QA0A 2R87A 3C9WA 3SXRA 2QVSE 1JKTA 1WVYA 3GC7A 1XQZA 5HE1A 5AV4A 3LAUA 5E9EA 3TZ7A 3CD8A 5E1SA 3H9RA 4G9CA 5AAEA 5ETCA 3KRWA 4AN2A 2W06A 3VBWA 1OPJA 4FEWA 2HGSA 5HESA 4FSUA 3DQXA 3FMJA 4ACDA 3DT1A 4UBAA 2Z8CA 3GU4A 4FKOA 3R7OA 4ZS4A 2H34A 4S33A 5JRQA 3WZEA 1RE8A 4E4XA 3EB0A 4NM0A 3ZYAA 2BZHB 3TNQB 2JAVA 3ZTXA 4FT9A 3Q3BA 4EH6A 1OGUA 1PMEA 4C0TA 3R7IA 3GENA 3QBNA 4O7SA 1E1XA 2PL0A 4YJUA 2WQNA 5E8YA 3PIYA 4NCTA 4ACMA 4L3LA 4E5AX 2OKRA 3KF7A 3VUMA 5I0BA 2UZDA 4EOLA 3V8TA 2JKOA 2VO0A 4EH3A 4MQ1A 4RFZA 3Q60A 2Z2WA 5HKMA 1H07A 4CV8A 5CAVA 5HIDA 3QWKA 4EKKA 4AT5A 4FSQA 3BZ3A 5B0XA 3P1AA 4GV1A 5FDXA 5JSMA 2IP4A 3SE7A 2XIXA 5AEPA 3KQ7A 2BKZA 1M2QA 3AXWA 5AV1A 3R8MA 3V6RA 5KZIA 3W2OA 4H1MA 4A7CA 3O96A 4OTWA 5HORA 5CAPA 1E4EB 3FXXA 1DM2A 4O83A 4AACA 1IEPA 4LMNA 2R64A 4GT5A 3R1NA 1RDQE 4EYJA 5EK7A 3HMPA 4K11A 4YC3A 1C3OA 5JMSA 4QQJA 4LYNA 4AFEA 3KMUA 2GNLA 4O7TA 4IM2A 1SNXA 4LGGA 3R9OA 4L43A 4CLIA 5D9HA 1M7NA 5M09A 3RCJA 4ACHA 3VHKA 5CAQA 2QU6A 4BDKA 2VTMA 2XKCA 4L3JA 2J2IB 2VTPA 3OWKA 4R7HA 5ETFA 4EOKA 4LL0A 3VS4A 2C6MA 3I6UA 4HNUA 5A4QA 4YTCA 1KE9A 2I0YA 4GJ2A 1HCKA 3DNDA 3FQSA 3GXLA 4IZYA 4QYEA 2C6OA 4PF4A 2X2LA 5CVGA 2QKRA 4J99A 3QA8A 4HJOA 5HIEA 3DBFA 4XS2A 5FM3A 2DIKA 1CKIA 1FVRA 4O6LA 4KRDA 3BWFA 3E5NA 2BZJA 4IEBA 4CFNA 1M0WA 4TKSA 4UY9A 1W98A 3U4UA 1H4LA 3C7QA 4ZY6A 2VX0A 2OW3A 3UZTA 2X39A 3ORLA 4CT1A 1J1BA 3K3IA 4S30A 3C0IA 2EB2A 1XH7A 2P33A 4OR5A 4J1RA 2AC5A 2W9ZB 3ETAA 4Y73A 4D58A 3ORQA 4OW8A 2QONA 4CGAA 5AA8A 3SQQA 4QYHA 5DR9A 1XBAA 3PG1A 4NKAA 1UVRA 5A54A 4HGSA 4YBKA 4O21A 3R7VA 3TG1A 3PDTA 3KK8A 4NU1A 2OICA 3QKMA 2Q0BA 4NYEA 4NIFB 3TIYA 3LCTA 5TO8A 1A9XA 2WQEA 3HRFA 4EZ3A 3CQWA 3EH9A 4MF1A 4FC0A 5K3YA 3QTXA 2C3LA 2CKQA 3OCTA 4QRCA 2VTSA 3PSBA 2I87A 3GOKA 3AT4A 3O2MA 4AZWA 3QKKA 2VTJA 3ETHA 2PVJA 2JEDA 2ZYBA 1ZARA 2ZMDA 1KOAA 3AC5A 4YTIA 3UC4A 4BGHA 5EI6A 3HA6A 3QC9A 4UB7A 4CFWA 2NPQA 3QXPA 4AFJA 2X1NA 4O84A 4TWPA 5CTPA 4BCGA 3FPMA 3TW6A 4K6ZA 4LOPA 3HEGA 4L3PA 3ULIA 3MESA 1OL6A 1LP4A 4E93A 2QC6A 4L00A 1KOBA 3BV3A 4WNKA 4XCUA 5E92A 3SC1A 4EK6A 2W4JA 4C5BA 4YJSA 5LMBA 4O0YA 3A7HA 4G3GA 3G33A 1PF8A 3T9TA 3UGCA 2ZDTA 4YJ2F 4HZRA 4CG9A 4X2GA 3FMDA 3HZTA 2YEXA 3GOPA 4U80A 4BCNA 1WR2A 4CCBA 2F7XE 3DXNA 1CTPE 4I1ZA 1QCFA 2V7OA 4JRNA 4O38A 3V5JA 2YZGA 4YO6A 2FPGB 3LWBA 4HVHA 2YZMA 3QUDA 3VA7A 3W8QA 3LMHA 2J5EA 3LXKA 4JI9A 4LUEA 5E1EA 1JWHA 3QU0A 4C36A 2PVKA 2ZDUA 3QTIA 3TTIA 1OIRA 4YJPA 3ZXTA 2R4BA 4AOIA 2PN1A 2B54A 4IB0A 3ZSHA 4GUBA 3R8VA 1QPCA 2V0DA 2VWBA 3FXWA 4LI5A 3UBDA 1IAJA 4XG6A 4ZJVA 2BCJA 3GI3A 1GZ8A 3GLKA 2WD1A 5ANJA 2FB9A 1R1WA 3LJ1A 5M57A 4FBXA 1G3NA 5ETIA 5JQ5A 3FBVA 5C01A 1KBLA 5FP5A 3UODA 2CGUA 3FYJX 1M2RA 4FTMA 4O91A 4EYMA 2PMNX 1BLXA 3PPJA 3THBA 1SCUB 3CQEA 4C4JA 3DK3A 4PDYA 5E8TA 1Z2NX 5CEPA 3D5XA 4U3ZA 5D8DA 1UWHA 3T8OA 3C0HA 3F5PA 1EZ1A 4II5A 3BX5A 3Q2OA 3HBLA 2QG5A 5GJDA 4ZOLF 4DGMA 3RUPA 1H0WA 4F7JA 3O51A 5ANGA 2R3OA 4YHTA 5BPYA 2YW2A 3VBQA 5HU3A 5HX8A 2WQMA 3TT0A 2RFNA 5D41A 3FC2A 4ALWA 3VO3A 3MTLA 4TV8F 2J4ZA 4NFMA 4YHFA 1PXKA 2QU5A 3GU5A 2EVAA 4IBMA 4O0WA 4QTDA 3RTPA 3ZFXA 4E73A 4Q2AA 4G16A 5CX9A 2ITUA 3UC3A 3U6JA 4IVBA 4YZBA 2YL2A 4ZTHA 1PXOA 1AUVA 2YZLA 4O7YA 4D1SA 4TWNA 2YIYA 4IIRA 5F95A 3V01A 4DBNA 4IX5A 3E8NA 3G51A 4F08A 3MWDA 1REKA 4H39A 4MBJA 2OLSA 3SW7A 1U59A 5AX3A 5AP5A 1I7LA 5HVYA 2YA9A 5KO1A 5AADA 1LEWA 3MFUA 4J8MA 4C02A 3PSCA 4IQ6A 4AOJA 2C0OA 4PP9A 2VX1A 3EKNA 1SMHA 3IG7A 4RSSA 4ITHA 5E8VA 4XG4A 5J5SA 3NPCA 3KGAA 3DBQA 3DF7A 4HGLA 4I3ZA 5JN2A 4TTHB 1CMKE 4EBWA 4YTHA 4IFCA 3BLRA 2QF7A 4MA5A 3LFNA 1JSTA 3CSVA 5EM5A 1GY3A 3NYOA 5EW3A 3EN5A 5HD4A 3Q96A 2YYAA 2XK6A 2J0KA 1BXRA 3EN9A 1MRUA 2VGOA 3FMEA 1VR2A 2X0GA 5J2TF 3FV8A 3DY7A 2JBOA 4XX0B 3ZFMA 3W16A 5ANIA 4KIOA 2JFMA 3FSKA 2ZMCA 1FGKA 2XEZA 4ITIA 3W2PA 5L8KA 3SKCA 4E4NA 1BI8A 2C6LA 2FH9A 3D15A 5FQDC 4GK3A 3PY0A 4BIBA 3UOHA 2JAMA 2V55A 4LRJA 4FOBA 2ITWA 3RVGA 4F7NA 3O17A 3PA5A 3F3UA 2REIA 4HZSA 3R04A 4HNIA 1YHSA 2I7QA 4FKSA 2X4ZA 4JX7A 3CIKA 3NW5A 2OSCA 3OWLA 4EGQA 1I09A 3SV0A 4GFGA 3UMXA 1H27A 1BKXA 1Q8YA 2VWZA 4CEGA 4KKEA 2FYSA 2C6DA 4EOJA 2YM7A 2PVMA 3OXZA 4XP3A 5CSPA 4CLJA 1FPUA 1K9AA 1PXLA 4QO9A 3KRRA 3PVBA 3D7TB 3COHA 1ZXEA 4IE9A 1PXIA 4X2FA 3IOPA 4JQEA 5BNJA 3A7FA 2RIOA 3TEIA 5FEQA 4CZTA 5DBXA 2WTKB 3AD6A 3EZRA 4MXXA 3QTSA 5EW8A 4BHNA 3NYNA 4J71A 5IQCA 2C6IA 3R63A 4CG8A 5KKNB 3I0QA 4O2PA 2JDRA 4WRSA 1J1CA 3G6GA 3DXQA 5CI7A 4AP7A 2V59A 4D4SA 2VWYA 4J53A 4TNDA 4EOIA 2DWCA 1FVTA 1CSNA 2OU7A 4XG2A 5FG8A 4G34A 3ZC6A 3NIEA 3C0GA 2VNWA 4YZDA 5T68A 3PJ8A 3R9HA 4ASXA 4F9CA 4MV7A 1REJA 4I5HA 3F69A 4AU8A 4PMTA 5AIRA 3VS6A 4JG6A 2BDWA 3ANRA 2XYNA 3TN8A 4UWCA 4RZVA 4DHFA 3GNIB 5C26A 4EK8A 1YHWA 2C6KA 2R0UA 1XH9A 3UPZA 4O4HF 1ZYJA 4HPTE 5FLFA 1W0XC 4KINA 4XV3A 5DRDA 4BZDA 5AA9A 4JAJA 4WD5A 3FJQE 3DU8A 3C13A 1X8BA 2X7GA 4J7BA 2WPAA 3MIAA 4D2SA 2WFYA 2WQBA 3KREA 3RPOA 5FUTA 3R9NA 3SAYA 3BU5A 2XIRA 4H3BA 2YWPA 1XJDA 2YIRA 3FHIA 3BYOA 3MWUA 4ID7A 3UVRA 3HAVA 3DXPA 3L8VA 4JIKA 5CU6A 1NW1A 3MVLA 3ZO3A 4ALUA 3TM0A 1KV2A 4MD8E 4C7TA 4L6QA 2CGVA 3A4PA 3IW5A 1Q61A 5CVHA 5T3QA 5CALA 2YAKA 2J0IA 2VO7A 2PVFA 3CJGA 3QTZA 4DEAA 3LQ8A 4FV1A 3L1SA 4PDSA 3SX9A 2WTKC 3WI6A 2R7MA 4S2ZA 3RNIA 2Y6MA 4EH8A 2G9XA 1ZMUA 4ZIMA 4H05A 3ZZWA 2E9NA 3WZDA 1B6SA 2GHMA 3LQ5A 4D9UA 3ATSA 4I20A 3U87A 1VYWA 4FKGA 2ITOA 3BCEA 3NW7A 3K5HA 4X7QA 4F9AA 2CPKE 2H8HA 4JIAA 1B6CB 2HZ4A 4OTFA 3KFAA 2WIHA 1H26A 1ZYDA 3C4EA 5L6OA 2J9GA 3NS9A 2QQ7A 3GUBA 4Y5HA 2QK4A 2VWIA 1NY3A 4RIXA 3JZFA 1I44A 3QHWA 1UKIA 3TNIA 2JFLA 3Q32A 2WMWA 1DS5A 2QNJA 2UUEA 5C27A 4O0XA 1H8FA 5A4LA 1OUKA 4NKSA 2XRWA 4M12A 1EYZA 4ALVA 4FTLA 3PP1A 3QRIA 4JQ7A 1Q8UA 3ZH8A 3KXMA 3PIXA 5ACBC 3GFWA 1UV5A 3VPBA 2YM6A 2GS2A 3ANQA 3CKXA 3W8LA 4FEVA 2W1FA 5J87A 4X2JA 2NP8A 3JYAA 4MCVA 2VTIA 2HZ0A 3KMWA 4NWMA 2OH4A 3IPHA 4JJRA 5HLPA 1E9HA 3EFJA 4QMQA 2C6EA 3C5IA 3TXOA 3D83A 3CBLA 4AGUA 3PLAE 2QOOA 5JQWA 2RG6A 4OTHA 2P2HA 4M84A 3BYSA 4W4VA 5EQPA 5C03A 3IECA 5C4LA 5L8LA 2UVZA 4L1KA 4O4LF 3GGFA 4JBQA 4CFFA 5F9EA 3D5UA 3MSSA 3HGKA 2BRGA 3OWJA 4AA5A 4JAIA 1A06A 4RX9A 3RI1A 5FXSA 4FSWA 4XX9A 2PWLA 2FA2A 2IZUA 4EH2A 1KV1A 2UW4A 4FSRA 2UVXA 3T9IA 4ASDA 4MV3A 4XYMB 5IYZF 5H8BA 3KK9A 3P86A 3WZKA 4L42A 3CXWA 4CVAA 2O65A 4J96A 4XOYA 3ZC5A 5LXTF 4QP6A 2F4JA 2FB8A 3A2CA 4MXOA 4TYHA 3QYWA 2R7LA 3E88A 3KF4A 3F7WA 2G2IA 1GSAA 4WG3A 3U9SA 5KMKA 2DS1A 4U40A 2X2KA 4NJDA 4O0VA 5IZFA 3CE3A 2C68A 4DFBA 1U5QA 4FV2A 1JDEA 3U55A 5AP4A 1YI4A 3DTCA 4Y85A 2R3NA 5BVKA 3N4TA 5EDRA 4BDEA 3I60A 4ZTRA 1CM8A 2J51A 5E8ZA 2A2AA 2X7OA 4RC2A 2YDIA 2Z7SA 5CAOA 5HBRB 3A8XA 2BMCA 1YW2A 3BHUA 4AZTA 1OPKA 2WTVA 3GVUA 4NM5A 4U7ZA 2H96A 3FYKX 3DLSA 3BHYA 2VGPA 4QMOA 4V01A 2CNQA 5CNOA 2SCUB 5HTCA 4P5QA 2GNGA 4D4YA 5BUJA 1F0QA 4I22A 2UW8A 3KKVA 4R5SA 4DAWA 4GEOA 4BBEA 4AGWA 5IA3A 1H1PA 4HNTA 3S00A 2W1GA 1F3MC 3D2KA 3G9NA 5EHOA 2XJ0A 3HDMA 4X3JA 3RALA 2B53A 3TKUA 4EC8A 4MAMA 1F5QA 3IW8A 4A4OA 5BPFA 2R0IA 3A4OX 1H25A 1HCLA 3Q4ZA 5LOVF 2YN8A 5C8NA 2GNJA 3N9XA 4FTOA 1KJQA 4JQ8A 4MV6A 3WNZA 4HCVA 3RP9A 1YDRE 4IX3A 2VO3A 5C8MA 2OZOA 2VX3A 4YZCA 4FT5A 4TRLA 5G6VA 4HPUE 2ITPA 5AJQA 4DA5A 3MPAA 3ODYX 2O64A 3F5GA 2XBJA 1R0EA 2W5HA 4C4EA 4FGBA 1GSHA 2PE1A 5JRSA 3SRVA 5IF1A 3K5VA 2QLUA 4QTCA 2QR8A 1KJJA 2BDJA 5FEEA 3KA0A 3P4KA 3MDYA 5JGDA 3FLQA 4BZNA 3F3TA 3DK7A 2P2IA 3H3CA 2XJ1A 2RFEA 3PPKA 3V5LA 3DBCA 1APME 4KSPA 1PJKA 2UZTA 4X6RA 4RVKA 2OIDA 2I6LA 2F9GA 1YXUA 1ZLTA 3CJFA 4FSTA 2QOQA 2NNWB 4DFLA 3ZS5A 5H80A 1OB3A 5HU9A 1BNCA 2E2BA 3LHJA 3O71A 5CANA 2OIQA 3PJ2A 2UZOA 4PDOA 3FZPA 4ZSGA 5BYZA 4QOXA 4TWCA 4JS8A 3QCXA 3C4WA 2YIXA 5LA6F 3G0FA 5CF8A 4U43A 3PE1A 3VBYA 4BBFA 2BPMA 4GMYA 3OHTA 4CFXA 1DI9A 3F3ZA 1OVEA 2B9JA 3ZOSA 4QQCA 4KIQA 5LCKA 3CGOA 4YJOA 4DFUA 3RPRA 2ESMA 4D5KA 4EHVA 4P5ZA 4YJVA 5CU2A 3V3VA 3OD6X 3R8ZA 3PLSA 4ZSEA 3QL8A 4QP9A 4WNMA 4AWIA 4M13A 4PMMA 4GRBA 4BTJA 5EQEA 3N8DA 2W1EA 4EOMA 2XIZA 4JDIA 4UZDA 2Q83A 3NNWA 4AZEA 5DEYA 5AUTA 1T45A 4UALA 5AX9A 4APPA 2W1ZA 3QLGA 5AUXA 4F1TA 3Q52A 1P5EA 5LYJF 3UZPA 1IA8A 1UA2A 1V1KA 2C3KA 1O6LA 3IW4A 2BRHA 4U9AA 5EYCA 1U5RA 2ACXA 4CXAA 5IG1A 5CA0F 4HOKA 5HG8A 2QOIA 3QUPA 4HYUA 3ZM9A 4BDFA 1DV2A 3OCBA 3OVVA 3K3JA 4KAOA 4NTTA 5JT2A 2OF2A 1FINA 1JNKA 2WMUA 3MN3A 4F1MA 5GIOE 4DE4A 3KY2A 4BZOA 5A9UA 2OFUA 3AGLA 3QD4A 4UXLA 5BMMA 4M3QA 2OJFE 3VVHA 4EQUA 4UN0C 1DAYA 3LFSA 4NM3A 5CF6A 2WMRA 3LKMA 5BVEA 3A7IA 3E8CA 3R28A 2VZ6A 3BU3A 1PYEA 4U42A 5LXMA 4O0SA 1H1QA 3P78A 4FTCA 1OZ1A 3C51A 4ORKA 2F49A 3D2IA 4NM7A 4XG9A 3ORRA 5EG3A 4IJ9A 5AM6A 4M14A 3WARA 3GBZA 4BDAA 5HGIA 5DLSA 4BCKA 4XYFA 3NUAA 4GG5A 1MQBA 3UIMA 3ZUTA 4ZTMA 5KZ0A 3IK3A 4KSQA 4E6CA 1W7HA 3E8DA 1JQHA 2BKKA 5I9VA 4WNOA 4QT1A 3UYSA 2OXYA 4ZSJA 1QPJA 3LFBA 4BI1A 4I6FA 4K33A 3FZSA 3ODZX 1YRPA 4QMVA 4EH9A 5CSHA 3VS5A 4MQ2A 4FMQA 2IZTA 2P0CA 4YTFA 4MV9A 5EQYA 3F2AA 1HOWA 5AFVA 4ZJJA 4GK4A 4EWHA 3O8PA 2JKMA 4K77A 3HL7A 4I4EA 3QF9A 3DQWA 4A06A 1G8SA 4IDVA 2C0IA 3WOWA 5CEMA 5L2TA 2XD4A 2X6DA 2A19B 3L9MA 4L7FA 3OUNB 3WBLA 2I0EA 3I6WA 4MK0A 3V5WA 1ZMWA 1TVOA 2YHVA 4V0GA 4GJ3A 4DEDA 5KE0A 5IEYA 4EI4A 5E4HA 5AV2A 5J95A 3WE4A 1GZOA 3N6RA 2E9OA 5IDNA 1WBPA 1PXNA 5CEQA 3Q4UA 2X8EA 2BDFA 2E9UA 2GQSA 3EQBA 5HG9A 1YVJA 2VTQA 2XS0A 4HGTA 1ZY5A 3OW4A 3I5ZA 2R3FA 2ZM1A 3D5WA 3E3PA 3ENHA 4B99A 4IZOA 2OK1A 1VEBA 4FVPA 3BYUA 4EHEA 1CKPA 4HVGA 4XP0A 3EQDA 1VZOA 3DFAA 1YDSE 2B9FA 4RJ3A 3R8PA 1KC7A 2QG7A 3PXZA 2P3GX 3WF5A 2A1AB 5GJFA 2PUUA 2WU7A 4G3CA 4U5JA 5AP7A 2XKFA 2KULA 3OY3A 4N57A 4AXAA 3QRUA 1XR1A 3AD5A 5JZNA 4FIJA 2UZNA 4JX3A 3CQUA 1L8TA 2NU6B 4E7WA 4RA5A 2ZVAA 4FU0A 1M7QA 4M68A 3NUYA 2OG8A 4PY1A 4F4PA 3U6IA 2CSNA 2JDVA 4KUJA 3RHKA 4MBIA 3ZUUA 3LP8A 4CMUA 2XB7A 3HV4A 4TT7A 5GONF 2YZAA 2GFSA 2OZAB 4D9TA 4UX9A 1U54A 1R39A 4FKTA 2VRXA 2JC6A 4XMOA 3EWHA 1LR4A 2HIWA 3KXNA 4X0MA 2EB3A 4XUFA 4BBMA 4RGJA 3HO8A 5IQFA 1YQJA 1PXJA 3UFXB 4CV9A 3CTJA 2C5XA 2OBJA 3IDBA 4Y95A 1Q41A 4RMZA 4MHAA 4F9YA 2GPWA 2W6NA 1A9UA 3OOMA 4YPDA 3MA3A 3NW6A 2Z02A 3W32A 4OTDA 4L7SA 1GNGA 2V5QA 1WAKA 1MUOA 1PW2A 4DH7A 1XKKA 5CT0A 5CSXA 5DI1A 2QO2A 3O8TA 5HG7A 4Z7GA 3F5UA 2ZB1A 3VJNA 4X3FC 4CRSA 3OTVA 1Z2PX 4E20A 4FTRA 4KIPA 2I0HA 4F9WA 4RQVA 4BC6A 2JBPA 4AS0A 5J7HA 3OT8A 2OO8X 4FTIA 4IW0A 2FSTX 3RPYA 2GNHA 4NFNA 4FGRA 4EG0A 4AW1A 4KS8A 2WAJA 2VTNA 1FOTA 3I81A 3WILA 2HWOA 1XH6A 1YKRA 1ZRZA 2IPXA 2RFDA 4RA4A 2IW9A 3V8SA 1OIQA 4IACA 3HB9A 3VBXA 3RPSA 3W2CA 4P2KA 2ZM4A 4ZTNA 1B6RA 5I4NA 5DT4A 2CKPA 4DBXA 4ZTQA 4TW9A 3VC4A 1OKYA 3UOLA 2ERKA 4LG4A 3C50A 1XWSA 3ORKA 4ZXTA 4FG7A 1M6VA 4USEA 3ORTA 3EQHA 3ZBFA 3LFFA 2XA4A 3LVPA 4H1JA 3ALOA 4JL9A 2IG7A 3RZBA 5AP6A 1DIKA 3Q4TA 4BDDA 5KX8A 4EOQA 3RV3A 3OS3A 1PY5A 4EZ5A 5KKRB 5C4KA 4FV5A 4I6QA 2WB8A 4OLIA 2WOTA 4JRVA 2PTKA 1H1SA 4ZS0A 5C1PA 4FG8A 2HK5A 3SA0A 4PX6A 1STCE 1ZYSA 2VNYA 4GFOA 3JS2A 4ZTLA 3TUDA 1R78A 3W2QA 4BDJA 4I92A 3C5UA 4PTEA 3E3BX 3FZ1A 4CCUA 5JH7F 1P4FA 4BKJA 5CEKA 2X81A 3GU6A 2XM9A 3KULA 2NRUA 3HV5A 3OBJA 5HD7A 4DG3E 5KKRC 1CDKA 1Q3DA 1ZYCA 2PYWA 3HUBA 4BYIA 5LP6F 5FRIA 3QAME 3U6HA 1URWA 3EYHA 5EHLA 3DJ5A 3RGFA 1GIJA 5LMKA 4CMTA 2OJJA 3PZHA 4FODA 2JDTA 4H3PA 4GKHA 4M0YA 3TCPA 1ND4A 3TWJA 3GC8A 2CDZA 3AMBA 5JFSA 4JBPA 3S2PA 3S3IA 1FMKA 3F5XA 3D14A 3FMKA 3R6XA 4G9RA 2QOFA 2E9PA 4O27B 4AUAA 2UW0A 3PP0A 3B2WA 3DLZA 4I0SA 4FKRA 2XNPA 4O96A
chains in the Genus database with same CATH superfamily
3UP2A 3LMIA 4RWLA 4M67A 1YXSA 1DGSA 3OXIA 5B2LA 1JKSA 2ETMA 2C0TA 4O7RA 2ZJWA 4D5HA 2QURA 3NEWA 5IEVA 4BY9E 4CFMA 4S32A 2I1MA 4NK9A 5DEWA 3NR9A 2YCQA 4AOTA 4IX6A 4D28A 3C1XA 5GHVA 3FI4A 3JVRA 3QGWA 4CT2A 1KE7A 3T99A 2IZSA 3F9NA 4LRMA 5FNVF 4XG7A 5L2WA 3BGPA 3TJCA 3DB8A 4EK5A 2QOKA 5IA4A 2QODA 5CU4A 3AX6A 4YR8A 2UW9A 3MW1A 3OEZA 2HZNA 2CLQA 2R3KA 2WKMA 3NX8A 5IQAA 3VW8A 4WBOA 4EH4A 4M0JA 2QKWB 2J90A 3IGGA 5BMVF 5HLWA 3NYVA 4GCJA 4OBPA 4LUDA 4Q5EA 4LV7A 2HAKA 4KA3A 5EKOA 5JZJA 2UW6A 2VO6A 2BAJA 3KXZA 4QEBA 2GQRA 3N4UA 4RIXB 4ZMEA 5DGHA 2PE0A 3QQHA 3A7JA 4WO5A 4AQKA 4DLJA 3VHEA 4O2BF 3UO4A 1RQQA 4HCTA 4BIDA 3WIGA 1NXKA 4MAOA 4PMPA 3K3PA 4V04A 4XYLB 5JVLA 4BYJA 4I4TF 4YNEA 3GCQA 4FSMA 4R78A 2WTJA 4D55A 3UOJA 3PZEA 4EEVA 2C4GA 1Y8GA 3AKJA 4IANA 5C1OA 4IC8A 3KRJA 3UE4A 3UDSA 3LIJA 3V51A 2W4KA 4HQ6A 4OTRA 2CN5A 4C62A 3R5HA 3DAEA 5BV3A 3PXQA 4IM0A 2Q0NA 4FFNA 5IQIA 3POOA 2WMVA 5JH6A 1BX6A 3FI2A 1W93A 3Q6UA 3CLYA 4RX7A 2BALA 3R00A 3RK5A 4MA0A 2E9VA 3BYVA 1ET0A 1BL7A 1AUXA 3GCPA 4H3QA 3R83A 3R5FA 2O2UA 1JKJB 2B9HA 5GIPE 2R2PA 4W4WA 2CLXA 2VWXA 4QPSA 3VQUA 3KC3A 4IDTA 5FGKA 5E8SA 2W0JA 4IFGA 1YWNA 4A9TA 5BUEA 2UW5A 2F57A 3Q2JA 4FZ6A 3VS7A 2W5BA 2GS6A 2VTAA 1JPAA 2ZV8A 2PVYA 4E5WA 5FBOA 4HW7A 4RZWA 2BRNA 4DEGA 2JDOA 2PVPA 3O7LB 4G1WA 1P4OA 4QMXA 2GTMA 3NFGB 2FP4B 3VAPA 4IVCA 4YSJA 4FZ7A 3ZLWA 2EXCX 2X4FA 3ZXZA 4MTAA 5IPJA 1B04A 5BVDA 3FQEA 5C8YF 1QL6A 3QCYA 3G8CA 4TYHB 1M52A 3A60A 3HUCA 2IWIA 2R3GA 2XNBA 4RLLA 1Q99A 3BGZA 3IGOA 3Q9XA 4YJRA 3ZFYA 3E63A 5M51A 1G2WA 4XRLA 4FFLA 1J7UA 4Z7HA 3DTWA 3AC8A 4LGHA 3GCUA 3R73A 2ZV7A 3QQMA 3I4BA 3VUIA 2WMAA 1WVWA 2ERZE 3LXPA 3P0MA 4DGOA 2XNNA 3EKKA 4FKLA 1ULZA 3DGKA 3D7ZA 3P79A 3KRXA 2PBZA 3NBZB 5EM7A 3ZRKA 5EZYF 3H10A 4I93A 3T54A 2XK3A 3EQIA 4MBLA 4QP4A 5DWRA 4D0XA 1UC9A 2YCSA 3FKOA 4QMSA 3UNZA 3CC6A 3NUXA 3SXFA 1CQJB 1S68A 4YPSA 3VS0A 2WXVA 2XM8A 4O81A 5D11A 2WO6A 3ROCA 3S0OA 3M42A 3T9AA 4RWKA 4DAAA 3PVUA 3DTFA 2HW6A 4ZHQF 2WMTA 1S9JA 1J3HA 2RL5A 2W1CA 3ET7A 4RQKA 2EXMA 3MB7A 3BG5A 2OXXA 4KRCA 1H08A 4Q5HA 5CSVA 5A14A 2WIPA 3ITZA 3KN6A 1QPEA 1PMVA 2B0QA 1A3GA 2PY3A 4I0TA 3QTQA 1GGOA 1WRVA 3LLAA 4BDBA 5I9UA 2C5YA 4ZP5A 3AT3A 3GB8B 3EN7A 4O7NA 3GJXB 3ORIA 3II5A 2IJMA 3BGQA 4BCQA 3I0OA 3JY0A 2HYYA 3DJ6A 3BRBA 1NVRA 2FSMX 3PPZA 4R1VA 3G5DA 4XP2A 4YJTA 3UTOA 3I1AA 4AN9A 1QMZA 5KMLA 1I7NA 3T9FA 2W4OA 4MNEA 5LVOA 4HVIA 4AA0A 4W8EA 4AT3A 3O8UA 4OBQA 1XBBA 1TAEA 4RIWA 5AP1A 4RG0A 3W2RA 2DLNA 3SRVB 4MWHA 1YXVA 3Q9ZA 1ZOGA 3QYZA 5IH6A 3BA9A 1JKKA 1Q24A 2JIIA 3PIZA 5TR6A 4IAAA 2Z7LA 3QFVA 4FKVA 3UO6A 3NSZA 2YABA 1WBSA 4U81A 5LVLA 4ITJA 4FKPA 4MV8A 5DPVA 4ARKA 4E8AA 4C3FA 3TV6A 3KVXA 1VS0A 3DOGA 2CMWA 2JD5A 3OFMA 3OWPA 4FVQA 4YZMA 3UDTA 4ERWA 4N70A 1UU3A 4OT5A 3KL8A 3LCSA 4F0GA 4A07A 3BYMA 1UU7A 3EOCA 3UYTA 3P5JC 5L2IA 3UVPA 3R2BA 4KBKA 3P7CA 4AE9A 3OP5A 3FMNA 3LE6A 4TZRA 4NSTA 3ZSIA 1TA8A 4L01A 4I21A 5I5YA 3TIIA 3EN6A 2GTNA 1RJBA 4QTBA 4EUUA 3FQHA 2R9SA 4TN6A 5BPHA 3R1YA 4XNEA 4J98A 3RK7A 4HVDA 3PXKA 5IISA 4QNAA 3SHEA 2R7IA 4FKWA 4LV8A 3QQJA 1YI3A 3CS9A 3FSFA 4UCRA 1OMWA 5KMJA 4GL9A 2PMOX 5DT0A 3VUGA 3ZZEA 1YOJA 4EZ7A 4JDHA 2VTTA 4QMZA 5ETAA 2P0AA 5DHJA 1J7IA 2JGZA 3KXXA 3LXLA 2VTHA 1NT2A 4FIGA 3NUNA 4Z9LA 4AZFA 3B8QA 3LLTA 3CD3A 4DQNA 3P5KA 4FKJA 1SVEA 1UU9A 2X2MA 3G6HA 4X6QC 5DR2A 4DEIA 1R0PA 1UKHA 4YU2A 2R3IA 3BWJA 3DS6A 2EJ3A 5A4TA 4B8LA 4ZI7F 3JY9A 4YP8A 4U97A 3QCSA 4OGRA 3VNTA 3U0GA 4U0IA 2XNEA 4KS7A 2UZLA 2BAKA 3AC4A 4A4XA 5IQDA 4D2RA 2AEGA 2ITZA 1O9UA 2OJ9A 3G15A 3NIZA 4FL3A 4L44A 5FXQA 5HIBA 4C2VA 5IUGA 2C1BA 5I9ZA 5KBQA 3KAJA 4U45A 2G1TA 5CLPA 3I12A 4JG7A 2Y0AA 3L8SA 3NNUA 3LJ2A 4EKLA 3R23A 2GPHA 4GT4A 4W8DA 3UQ8A 3CSWA 4FTKA 3FI8A 4ANSA 1YOMA 1M2PA 3VBTA 4FNZA 4DFYA 3QQFA 3KALA 4AG8A 5CM0A 1GOLA 1OITA 3R7YA 1YHVA 3TZ8A 1BYGA 4I0RA 2NRYA 5BYAA 4C34A 3L9PA 4RJ4A 3EN4A 4PL4A 4U79A 5EYMA 5HO8A 5B7VA 2ZDHA 4QP8A 2FUMA 2UW3A 3MPMA 5CZHA 3SOCA 2HIXA 4DFXE 4R6VA 5HI2A 2PULA 3DKCA 3RHXA 2YITA 3RMFA 1M17A 3EL7A 2HVRA 5ANKA 5J9YA 2VTLA 1PX2A 4MD9E 5HBHA 4IX4A 2XNMA 4WG5A 4Z16A 2GPSA 3QZIA 5EFQA 3R21A 5E91A 3SD0A 1GIIA 4FX3A 4G6OA 3M2WA 3SVVA 2BTSA 1GAGA 1AGWA 3W0RA 5BWTA 4FL1A 2O3PA 3MGYA 4QMYA 4MD7E 3PG3A 5AP2A 4BVUA 2R85A 4RWJA 2LGCA 3FY2A 3O23A 5DE2A 3VW6A 3IDPA 4ZZOA 3JPVA 5F94A 4F7LA 3G0EA 3ZCLA 3OEFX 2Y6OA 1Q4LA 3NAYA 1EH4A 5E90A 3IQ7A 3OCSA 3VNNA 2Y8OA 5DT3A 1H00A 4L46A 1MP8A 4I6BA 4B0GA 5B2MA 4G3EA 3POZA 3RWPA 1V0OA 3MH2A 4KNBA 2XKEA 2PZYA 5AUVA 5HCZA 5DOSA 3RJCA 4CTCA 5CA1F 2X0SA 4Y8DA 4DF3A 2R5TA 2C00A 2GHGA 5AUZA 3BAAA 1CS0A 5K3WA 1Q3WA 3LFDA 1O6KA 5IA5A 3R2YA 4FEQA 5BQ0A 1GZKA 2CN8A 3E92A 5KNJA 1SZMA 3LQSA 1FVIA 2J0LA 3K54A 3COMA 4EGJA 3R1QA 4Y72A 4AA4A 4JT3A 2YWVA 1SYKA 4RC4A 3I79A 3FHRA 4FE2A 3MB6A 1NA7A 2BHEA 4DEEA 5KS8A 3GEQA 3R0TA 2CZGA 4L45A 4E6NA 1WBNA 2YZNA 3CEKA 2GQGA 3D0EA 3IOKA 1H1WA 4XG8A 1Q8ZA 1XBCA 1XH4A 3ZLYA 1JAMA 2OH0E 2O5KA 4O82A 5A4CA 2W6ZA 3OT3A 1B38A 5AIKA 5F20A 4B7TA 1ZAUA 4IH8A 3AMAA 4ASEA 4A9SA 4UCSA 4O7VA 3LQ3A 5E8UA 2B4SB 4NW5A 3A7GA 4RJ6A 5ANOA 4MXAA 3R30A 2IZRA 1U54B 2A27A 3HMMA 4YAJB 5A3XA 3U51A 3BKBA 5HLNA 3AC1A 2VTRA 4FKQA 3UIBA 4CMDA 2JLDA 1XHAA 3DB6A 3DDPA 4EJNA 2OLCA 5J2UF 3CPCA 1M0TA 1Q97A 4BTFA 4JVGA 5D10A 5BWVA 3W18A 3S1HA 3ZHPC 5M4IA 4YBZB 3LFEA 3OUZA 2F2UA 1PXPA 4IVDA 2DQ7X 2Y4PA 3PFFA 4FNXA 4FK6A 5DG5A 3HAMA 5CU3A 3LZBA 2G15A 4D4RA 1GLVA 2W99B 2OIBA 1AQ1A 4AN3A 4E4LA 5IEXA 3EYGA 5CQUA 5HV6A 1J91A 1W8CA 3M1SA 4FT3A 4CKJA 2G2HA 3Q5IA 2FPPB 3LFCA 5LWMA 2Z7QA 4W4XA 5BWRA 4O22A 3AG9A 3R7UA 4QP7A 2GNFA 1BMKA 1SVGA 5A4EA 5D1OA 1CKNA 1GZNA 2J0MB 3BL9A 3NNVA 5FP6A 4GVJA 3ORMA 4XV9A 4MX9A 4Q4DA 4ANBA 3LCDA 5M08A 1TFFA 5L2SA 3E87A 3LPBA 4OTQA 4PTCA 2CKEA 5HEZA 4L53A 2CGXA 4LRKA 4RZQA 2OJIA 3BPRA 2WOUA 1Y6BA 4D1ZA 3QC4A 1DI8A 4KD1A 3FMLA 3V5PA 2HJWA 5CAEB 2XK9A 5IDPA 4B9DA 4E4TA 2LAVA 3ZONA 4C37A 4UCOA 3EIDA 4FL2A 5AUWA 5HE3A 4NCTC 4NZMA 4C61A 4O7LA 1K2PA 4WUAA 5T6KA 4DDIA 4FTUA 2R7NA 4GLWA 2UZUE 4JDKA 5TT7A 1I1MA 2VPQA 3L9LA 2R3QA 5L6WL 3RWQA 1A0IA 5F1ZA 3Q1KA 4DINA 2BFXA 1JSUA 2VD5A 3V8WA 3PA4A 3PJ3A 3GC0A 4HNFA 4PV0A 3ORNA 1P2AA 2CHLA 4WOVA 3E7OA 3MBLA 3MS9A 3C4XA 4UWYA 4G3FA 5EI8A 5E8XA 3MJ2A 2YM5A 3ALNA 4G3DA 4EC9A 5EDQA 4NZWB 3KULB 4YURA 5IA1A 4ME6A 4CTBA 4IVAA 4CKEA 2COJA 5AMNA 2UZEA 5JKGA 2YM3A 2BHHA 5HE0A 2YDKA 1CKJA 1OKWA 2IVVA 4QP2A 4R77A 4YC8A 3UG2A 3IDCA 3Q2MA 5IU2A 2Z04A 4DFNA 4MVFA 2OGVA 3RAIA 4YAKB 1MQ4A 3NVKI 4F0FA 1WBWA 2YCRA 2OF4A 4GS6A 4XG3A 3R7EA 3UNJA 4APCA 5I9YA 3PN1A 3NCGA 4XRJA 3ZEWA 3C4FA 5DGZA 1X9NA 4JR7A 5D12A 3NYXA 3Q6WA 4E26A 2XCLA 4UXQA 2HHFB 5D1JA 2G01A 4U8ZA 3TI1A 2UVYA 4FA2A 3JZ6A 4IWOA 4AX8A 4A9YA 5EOBA 1A48A 5ANDA 3ORXA 4EONA 2A4LA 2QCSA 3VN9A 1JDBB 1PMUA 1JOWB 4FI1A 2F7EE 2PU8A 4IWDA 3VPCA 3FC1X 5ICPA 2P55A 1GJOA 1SNUA 4IZAA 4E6AA 2PSQA 3CY2A 3LOKA 5BUIA 3FMHA 5J9LA 2ITYA 4RX8A 2C3JA 1SM2A 2EWAA 3SG9A 5I60A 4HYHA 3VQHA 5EKNA 3B8RA 5KMNA 1ZY4A 4KBAA 4K9YA 4WHXA 2CGWA 3WIKA 4HNVA 3WF8A 5HNIX 4TNBA 5M4CA 5HNGA 1G8KA 1LEZA 2PUPA 2WU6A 3RNYA 2QOBA 1C30A 1TQPA 3VONA 4C4HA 3FZRA 3SG8A 3LXNA 4X2NA 4CFVA 3H30A 3V5QA 2UZBA 2UZVA 3UOKA 4E1ZA 4IHJF 2XAOA 4CD0A 3VRZA 3NLBA 3E8EA 3MH1A 3UQGA 4BCOA 4ZMFA 1IA9A 4RFMA 4YO4A 1KEEA 3EQGA 4NUSA 2BILB 3U9CA 4PQNA 5IA0A 5A6OA 4GW8A 4M69B 2GS7A 2XBAA 3R1SA 4J95A 4M8TA 4J52A 4FZAB 3P7BA 4QDEA 4R7IA 4AQCA 3MIYA 4FK3A 1KWPA 2WGJA 3D9VA 5DGIA 5IUHA 3SGCA 1Y91A 3AD4A 5DAAA 3MY0A 3HP2A 3S24A 2VAGA 5LVNA 3QRJA 4WKQA 4DRFA 2QHNA 4NL0A 5CQWA 5M06A 1YXXA 3JUHA 3LM0A 1Q62A 4FTTA 4ZZNA 5JFVA 4DLKA 4WUNA 3TDVA 4FSZA 1ZMVA 2ZAZA 3HX4A 4FKIA 2PHKA 4K2RA 5D7AA 3T3UA 4F9BA 3FKLA 3Q9YA 3UQCA 4O2AF 3P08A 3BA8A 4O4JF 2XAMA 1Q8WA 3KRLA 4AW0A 5KUPA 2J50A 3H9FA 4NH1A 4UCUA 3OY1A 2PZPA 3BHVA 3DTGA 3VWAA 4ZLYA 1OECA 3VBVA 4AXFA 4IB5A 1XMLA 3MJFA 4FKUA 4PRJA 4F99A 3RPVA 1WVXA 3ML1A 4BCPA 1ZAOA 4YHJA 3ZSGA 4F6SA 4P7EA 4PL5A 3TIZA 5BYYA 4F09A 5K5XA 3UO5A 2ETKA 1O6YA 5DVRA 4IAYA 4MEDA 1BI7A 5I9WA 3R9DA 3TZ9A 4RC3A 5HG5A 4I41A 2QD9A 4TPTA 1VBHA 2GLTA 2IO6A 4ANQA 1PMNA 2X8DA 3QWJA 4BHZA 4F6UA 1LUFA 2JIVA 3QALE 2HIVA 4M9UA 3SW4A 3BL7A 5EW9A 4FV7A 3S4QA 5K5NA 3F88A 3ZUVA 2B1PA 2BR1A 2WMSA 3MPTA 1OUYA 3LMGA 3OCGA 4FV4A 3PXYA 1OM1A 4YSMA 1OBDA 4L67A 2UV2A 5CS6A 3O7LD 2X9EA 3DK6A 3DKFA 4ENYA 3TUCA 4HR7A 3KYHC 5EM6A 1TQIA 3QGYA 3EZVA 4O0UA 2B55A 2F2CB 2IN6A 1VKZA 3T9DA 5CB4F 2J9MA 2PUNA 2V62A 3QQKA 1OL1A 1P14A 2AUHA 2XANA 4TXCA 3TKIA 3K5IA 4GFMA 3AQVA 3LFQA 2COGA 3DZOA 3U8WA 4YLJA 5IQGA 5BVFA 4IAIA 4C3PA 2W71A 3CR0A 2WMXA 1JBPE 3ZRMA 3MWEA 3HRCA 5FTQA 3W33A 4M15A 3MV5A 4QPAA 3SNOA 1H28A 3BV2A 2XMYA 4LV5A 5C9CA 3WYYA 4RX5A 3QLFA 3DDQA 2VQDA 4O86A 4LQMA 4EHZA 5CT7A 3VS2A 1KJ9A 4I24A 4C58A 3IKAA 3G9LX 3GT8A 4QMMA 2W9FB 5FR9A 2G2FA 3CGFA 5AP3A 2HZIA 5CF5A 2DYLA 1LPUA 4JXFA 4IWXA 1Q8TA 2W1HA 5EH0A 4U41A 2OI4X 2WZJA 4QNYA 3UIUA 4C3RA 4DTAA 4BTKA 2B52A 2J0JA 4WA9A 3DNEA 2W6MA 3R8UA 2XCHA 1ATPE 1XH5A 2RFSA 3PUPA 4CFUA 4XJ0A 1YXTA 4DITA 4MNEB 4E6QA 3TY5A 5BWWA 1OBGA 2C6TA 2C47A 2YJRA 3RKBA 4GG7A 3WZUA 3RK9A 2NO3A 5IH5A 4RIWB 4AAAA 4IJPA 3JSLA 3BLHA 2BUJA 4IZ7A 3HNGA 2X5RA 2ETRA 3DV3A 4ZSLA 4MKCA 4KBCA 3HMIA 3MFTA 2W96B 3IO7A 3WF6A 3V4ZA 2W6QA 4QTEA 1PK8A 4EHGA 3AC2A 3VUDA 2DWBA 3GB2A 4M7IA 1OL7A 4OTGA 2V5AA 4E6DA 2XK4A 3HECA 5LQFA 4OUCA 4CRLA 2FGIA 3H0YA 1W96A 5CAUA 2V58A 5B2KA 4D0WA 2HXQA 1OI9A 4NW6A 3HV7A 3ELJA 5AWMA 4DT9A 3ETJA 5LOHA 3AW8A 2WELA 4P4CA 4DN5A 2R3MA 3QD3A 3TUBA 2YIWA 5CEIA 2HVQA 2CKOA 3Q5ZA 4S34A 3W0QA 2ZGIA 1NVQA 4WRGA 1EUDB 3I5NA 4G6NA 4TV9F 2XJ2A 3BIZA 4RJ7A 1OGYA 4LOQA 4ZZMA 5J9ZA 3RFCA 3DKGA 4ZQIA 2JIUA 1G8JA 4IWPA 4KB8A 3MH3A 4RBLA 4U3YA 4XHKB 1P8LA 4XV2A 1I2LA 2YDJA 4RT7A 2R3JA 4BN1A 2PZ5A 3DAJA 2PE2A 3OMVA 4KWPA 4FT0A 4WIHA 1CKOA 3WWHA 5KX5F 4AGDA 3MTFA 4DDGA 5L6PA 3TIGA 1OKZA 4AE6A 2BIYA 5FTGA 3PVWA 5I5ZA 2VWWA 2XARA 3DZQA 4G5JA 2PZRA 3F3WA 2XIYA 4FSYA 4UEUA 5AV3A 5M07A 4USFA 3ZDIA 4LMUA 1XH8A 4M0ZA 4EOSA 3QQLA 4AGCA 4MWIA 2FPIB 1T46A 3VF9A 3QTUA 4U44A 5D7VA 1CKMA 3TQTA 1B39A 3PRFA 4IWQA 4DG2E 2PK9A 3F66A 1NVSA 1ZZ2A 1AD5A 1PRYA 3R71A 4R3CA 1CQIB 5K2MA 3KMMA 3MVHA 2W6PA 4JBVA 4LH6A 3V4SA 2ONLA 4RVLA 3QXOA 5DYJA 4FIHA 3UYYA 3R01A 4XLIA 4FOCA 5DRBA 2EUFB 4FSNA 5BMSA 2WYOA 2I80A 1L3RE 2WQOA 3LCOA 3PY1A 2R84A 4Z3VA 4YJNA 3BEGA 3UZRA 1KE6A 3ZU7A 2VN9A 5JGBA 4QMLA 3RCDA 3ZDUA 4NTSA 4C35A 1GIHA 5A46A 1WBOA 2ZOQA 3NUUA 2BRMA 3REPA 3P9JA 5CEOA 3NAXA 2YACA 3KU2A 2ZFYA 2R3LA 3ACJA 4R1YA 4FTAA 5FD2A 2ZDGA 1UNHA 5FEDA 1FBNA 3P7AA 4FUXA 4C4IA 5CE8A 3PXRA 3ZBXA 2XF0A 4L68A 3MH0A 2IVTA 5HTBA 3QUEA 1DV1A 4P90A 1BUHA 3U54A 5HCXA 5AAFA 3RAHA 1M14A 3T3VA 3H4JA 4XBRA 5HHWA 2YISA 4ZY5A 5F4NA 2OWBA 2YAAA 3BEAA 3L8XA 4FEXA 5CU0A 1WCCA 5J8IA 2WMQA 3EFLA 4BDHA 4ENXA 2O0UA 4GIIA 4D1XA 4QYGA 4ANMA 2YCFA 4NZOA 4DGGA 1PKGA 2UZWE 4KKHA 4GYIA 4BCHA 2WTCA 4MXCA 3AOXA 5ITAA 3NUSA 2HY0A 2NU7B 2W70A 4RIOA 3JZIA 3CP9A 5LARA 3FPQA 4O6EA 1T36A 1PKDA 2VU3A 2GU8A 3SOAA 3UNKA 2CJMA 2GSFA 2F7ZE 5CZIA 1PYXA 4DLIA 4K1BA 2PPQA 3LULA 2W5AA 5E25A 2OXDA 4RIYA 4TYIA 3LCKA 2IVSA 4FNWA 3QD2B 4M97A 5AUYA 3D4QA 4AT4A 2XEYA 3PJCA 4IC7A 3PXFA 3GCSA 3DBEA 2HENA 1G5SA 2YIQA 2PVRA 3NCZA 5DA3A 3TKHA 4BCJA 4F64A 2NU8B 3FZOA 4CNHA 2R82A 2WTDA 3COKA 4EBVA 2ABJA 1TQMA 2IW6A 2C5OA 1SVHA 5HVKA 5KHXA 1FQ1B 1PHKA 2XYUA 2XIKA 3Q9WA 4ZK5A 4TUYF 4FV8A 4R3PA 4BCFA 3OUUA 3OZ6A 2BTRA 1UU8A 3RAWA 1G8AA 3OUKA 4I94A 5FBNC 4ONAA 4OBOA 3LM5A 4G31A 3F82A 5HBEA 4GLXA 4GU6A 1MRVA 4X3FA 3VMMA 4FYOA 4PNIA 3NZ0A 2PZIA 5LMAA 3HVCA 5DN3A 4DTKA 5FDPA 1ZWSA 3QX4A 4TYGA 4F63A 5EM8A 3UQFA 2BRBA 1KE8A 4WSYA 3TL8A 4DC2A 2XK7A 3OOGA 3TV4A 3EFWA 5FPOA 3DKOA 1Z5MA 5AV0A 5M4FA 2QOCA 3GU8A 5J1VA 1V9PA 3PA3A 3V5TA 4QMPA 4I23A 3W1GA 4USDA 1UWJA 1P16A 3TNPC 2YJSA 4FV3A 3LFAA 2BROA 2XZSA 3IONA 3FY0A 3BQRA 5IQEA 4PDPA 1BL6A 4MV4A 4GYGA 2ZDQA 4DH3A 5DIAA 2J5FA 3EMGA 4ANLA 3VUHA 2ZV2A 5M53A 1U4DA 3NGAA 1OL5A 3HKOA 2EJ0A 4HYSA 5L3AA 5KBRA 5DNRA 5LVPA 4JDJA 2RG5A 3L9NA 4GKIA 1U46A 1I1KA 3TINA 4ZLOA 3H9OA 2C30A 1OKVA 1OL2A 1KE5A 4C33A 3F61A 4EUTA 2OZAA 3HYHA 5IMEA 3TY8A 4G5PA 4C59A 3JRXA 3OC1A 4F6WA 3JRWA 5D1OB 3H0ZA 4R7BA 3QTWA 2PMIA 3VS3A 1CKNB 2FVDA 2ITQA 2P4IA 3QZGA 5E7RA 5GJGA 3E5AA 3E64A 4S31A 2ITTA 1FMOE 4FV9A 3ENMA 3W1FA 5EYDA 2HXLA 4X2KA 4BI2A 3DCVA 4GK2A 4A4LA 2H6DA 3R02A 4EWQA 5C1QB 3RAKA 2HCKA 2PVLA 4C2WA 1WFCA 1ZYLA 4LOOA 2Q2UA 1Z57A 3F7ZA 4A9RA 3CTHA