1OBDA

Saicar-synthase complexed with atp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
303
structure length
298
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKADENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMIDOIMIDAZOLE- SUCCINOCARBOXAMIDE SYNTHASE
publication title X-Ray Structure of Saicar-Synthase Complexed with ATP
rcsb
molecule tags Ligase
total genus 101
structure length 298
sequence length 303
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1obdA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1obdA02
2HY0A 5CF8A 2ZDQA 3GU7A 4X0MA 3I79A 3E93A 2JKKA 4AA5A 3A61A 4BTFA 5IA0A 2XM9A 4YJQA 5E90A 3N4UA 4MEDA 4IZAA 2VWUA 3O2MA 1U4DA 2PY3A 4ANSA 4Z9LA 4HGLA 4LMUA 4XRJA 3ZXZA 2C3LA 3DBFA 3R7UA 4C7TA 2W71A 1EYZA 4ZY4A 4A9RA 2O5KA 4XG8A 4AS0A 4YJ2F 5I5ZA 2YISA 5DEYA 3V4SA 4E26A 2QOKA 1BNCA 4AGDA 3ZMMA 3TWJA 4NFNA 5LOVF 4L3JA 2CGXA 2J7TA 1IA9A 2Z7LA 3T9IA 3ZRLA 4U6RA 5EHYA 3TN8A 5L8KA 4E4TA 4FFNA 3UIMA 2W0JA 5M4IA 5DOSA 5FRIA 1M2RA 2J5FA 3ZM4A 2R64A 4EK6A 4JX3A 3BV3A 4IZ7A 3SGCA 4DAWA 4EH3A 1WBPA 5TO8A 4FBXA 2CGUA 1UU8A 4HGTA 2XP2A 4FK6A 4XH6A 5BUIA 5FDXA 5DN3A 4O6LA 3O51A 3PA4A 4USDA 3MIAA 1LPUA 3PYYA 4YJUA 1Z2PX 4GSBA 5DT4A 4FNWA 4AZEA 4QMVA 4AW1A 4NTSA 2XM8A 2C1AA 5HE3A 3R9NA 1WBOA 1PMVA 3BHHA 4O0WA 3UJGA 1Q8YA 2UVZA 3AC4A 3FZSA 5CF4A 3F6XA 1YWNA 3TDVA 5M51A 3MS9A 3PE1A 3BG5A 2ITWA 3EZRA 2ZOQA 3LXLA 3QQUA 5FXSA 4U40A 3LOKA 4BHNA 1M7QA 2BRBA 1H08A 3RK9A 4A4OA 4EK4A 3C0HA 3O50A 2C69A 2ZYBA 4MWIA 4MTAA 4FKPA 3ORZA 4JR3A 3KXHA 3QC4A 4EC8A 3L8PA 3IO7A 3F5GA 4GG7A 3QD3A 1NT2A 4HYSA 4AA4A 4A9UA 3GU6A 5HO8A 4FTUA 1OECA 3QQHA 3RAIA 3W2PA 5LMKC 4HVIA 2J9MA 1ZY4A 2IJMA 1UNGA 3EN6A 1JPAA 3VS7A 4EKKA 3NCGA 5A6OA 5CU2A 4K11A 5DEWA 4ENYA 2V5AA 4NM3A 4L6QA 2NPQA 5C9CA 5HCYA 4QMMA 4HPTE 4QP4A 5LARA 3QRIA 3KCFA 4RWIA 3MH0A 5B2KA 2V5QA 2XNGA 4EHVA 2RGPA 1NA7A 4NW6A 1QL6A 3DLSA 4M69B 4IB3A 2VTSA 3ZUTA 2FB8A 3I5ZA 3D14A 1IG1A 4L53A 4MXOA 3WE8A 4QTCA 3RPVA 1OBDA 5T68A 2HELA 2I0HA 4FSQA 3UO6A 4FTCA 4CFUA 3GB2A 1OKYA 4CCBA 4KIPA 3K2LA 3KMMA 2O64A 4O84A 3WNZA 3UIUA 3VN9A 3NGAA 3OWJA 4YMJA 3QC9A 5AP6A 3BX5A 3OEFX 4GYGA 4FNYA 4RC4A 3V5QA 4MCVA 3W2SA 3WF9A 5JFXA 3Q4UA 4FKVA 2V58A 1J91A 3UP7A 3LQ3A 4RJ8A 4CTBA 5DGZA 4FFRA 3HKOA 3L1SA 2BZKB 2R7BA 2JEDA 1M2QA 2G9XA 3F7ZA 4FV5A 4C4HA 4D9TA 2W6NA 3HGKA 2G01A 2BAKA 3I60A 4H36A 3RWPA 1PXJA 2X9EA 4YHJA 3VS1A 4FUYA 4EK8A 2OG8A 5KO1A 2FB9A 3R5XA 2YDKA 2YM6A 4IB1A 2VWVA 4IFCA 4ZEGA 5CEPA 1VEBA 3FZ1A 1JOWB 3QALE 2FSMX 4PDSA 2I87A 4KA3A 2RL5A 2W4KA 3KXMA 3HECA 3C4EA 4IFGA 4JG8A 4O7LA 1NW1A 3NRMA 1TQPA 4IAKA 4JDJA 4ZSLA 3WF8A 4CV8A 5J9YA 1A9UA 4JAIA 3AD6A 4G16A 3ORQA 3F5PA 3SOAA 2CKPA 2Y8OA 2WEIA 4L01A 3CQWA 3ENHA 4PMPA 5M55A 3PA3A 5FD2A 2C5VA 2BVAA 2J0MB 2PUUA 1ZY5A 4Z7HA 5HQ0A 3MWEA 3WO1A 3MI9A 4RA4A 4GT5A 3Q96A 3RK7A 3TACA 4O82A 4CT2A 4IX3A 4I6FA 4I4EA 3S2PA 3NNUA 4X2GA 1F5QA 2FP4B 1GIHA 1OGUA 2OF2A 3PJCA 4H3QA 4BZNA 2YWPA 2GNLA 4HNUA 2WKMA 1ZOEA 4BDKA 4RT7A 5EDPA 5K5NA 3WIGA 4GMYA 2UW6A 2ZV7A 3IOKA 3R22A 5DT0A 4G3GA 5HZNA 3E87A 4WRSA 3JUHA 3G15A 5J5SA 2IVSA 3QTQA 2VTQA 3HZTA 3IK3A 3V8TA 2HIWA 2XEZA 2YCQA 3K3JA 5KUPA 4XX9A 1SNXA 2P33A 3CTHA 3MVHA 2OFVA 3WF5A 4C4FA 5FBOA 3LWBA 2JFLA 2X6DA 3BBTB 3COKA 3FSFA 3EZVA 3S3IA 4G34A 4FEWA 2UZNA 2BDFA 2PVNA 3H9FA 3PVUA 4TN6A 1GJOA 3QKKA 4RIWB 4BBEA 3QKLA 3HBLA 3BYUA 2QOQA 4QTEA 4C4GA 3DTCA 4KBKA 4UY9A 2AC3A 4FKQA 4RIYA 4WUNA 3ZBXA 2ETRA 5EOBA 3D7ZA 3OXZA 2Z7RA 4AUAA 4ZMFA 3UC3A 1OVEA 1J1CA 4FZAB 2VTOA 1XBAA 2BILB 3QLGA 2GPWA 4C61A 4PQNA 4S31A 5CLPA 3SHEA 4M97A 1UU3A 2V22A 3AMAA 4AF3A 4W4XA 5ETIA 3CD3A 2UZDA 4E6QA 3QGWA 5FDPA 2PYWA 4RQVA 2WTKC 3P4KA 5D1JA 4QMQA 2VWWA 4H3BA 5AAFA 4WKQA 5FXRA 4ZJIA 4YZNA 4F7JA 3QD0A 1KV1A 3IDPA 3QTXA 1CE8A 3TW6A 4ZHQF 1KJ9A 4ITHA 3Q9ZA 4O2PA 3CY3A 3BHTA 3FC1X 4K33A 5EM7A 3TNPC 4XG7A 4D2RA 1MUOA 3F61A 4J8MA 3W33A 1W8CA 3VNTA 3ORMA 5GIOE 2OWBA 2B4SB 4BDEA 4IAIA 1MP8A 2XCHA 1P5EA 4Q9SA 4II5A 2XIYA 2O65A 4EJ7A 5C8KA 4R3CA 3FXZA 2OXDA 4FFLA 3E62A 2BPMA 3ZOSA 3Q52A 3C0GA 1KE5A 3QYZA 5A4QA 3R7OA 1WBNA 5E8VA 4O7YA 4I23A 4L00A 2LAVA 2OXYA 3BWFA 4FIEA 3OOMA 5HNBA 1WBSA 3RPRA 3GFWA 5K4IA 5E9EA 1G3NA 3FMMA 2VTMA 4X2NA 1FVVA 4YBKA 4DE4A 5A4EA 3HRBA 3EN5A 2XUUA 1Q5KA 1LEZA 4GJ3A 2PMOX 3UO5A 4O2ZA 2ZDHA 4FIJA 5IA2A 1B39A 1UNHA 5IG1A 4YTFA 3O96A 1BL7A 3F82A 4M13A 2W1DA 3TNHA 4U79A 3D83A 2QG7A 2X8IA 3ZSGA 3PG1A 3G33A 1EHIA 4R7IA 4DC2A 5BVOA 3VBTA 4I4FA 2HOGA 2AUHA 2ZV9A 2OI4X 3COIA 4JBPA 2BDWA 1XH5A 5HCXA 1FBNA 2XK3A 3FYKX 1O6YA 3V8WA 3DKCA 3FMDA 2CGWA 2ITTA 5FLFA 4YR8A 5I9YA 5B2MA 4KABA 1KC7A 4UZHA 4TV9F 5E4HA 2BAJA 5M07A 3TM0A 1R0PA 4R1YA 3TTIA 2OZAA 2QOIA 2XRWA 2JKOA 4OBPA 1H0WA 4K77A 5CQUA 1B6RA 3F66A 3VF8A 3HMPA 3NR9A 3ODYX 2HGSA 3N51A 3AG9A 2VAGA 4U97A 2BRHA 3ZEPA 2IZUA 3R83A 1WBWA 5IUIA 3VULA 3AD5A 4TKSA 3T9TA 1J1BA 4CD0A 5B2LA 4EEVA 5LOHA 3LMHA 4GV1A 5HORA 5JVDF 1P14A 2GS7A 4FSZA 3F2NA 3LHJA 3FMKA 4FMQA 4NCTC 4JT3A 3IW5A 4FKTA 1VJYA 2CSNA 4PV0A 5HE0A 4O83A 1Y6BA 4ASEA 3O7LD 4L9IA 2YM4A 3D9VA 2GLTA 4XV9A 2OO8X 5BVEA 5C01A 4YO4A 3JRWA 2VWXA 4RPVA 2GQSA 4IJPA 4KIQA 1YKRA 1EZ1A 1H1PA 2H6DA 4BZOA 1SNUA 2CCIA 1VYZA 4AZVA 3QAME 1L3RE 2GFSA 4CFFA 1YVJA 4O4JF 4ENXA 4W8DA 5IQGA 3SX9A 5JQGF 2GS2A 1NVSA 2JIUA 3AGLA 3VS2A 4J71A 1SVHA 4PL3A 5LYJF 5E8WA 1YHVA 4ZIMA 5DR9A 5LXTF 3PPJA 1T46A 2W05A 3R1NA 2OJGA 4IHPA 2VUWA 3PPKA 5AV2A 5EDRA 1W96A 4U8ZA 5L2WA 2ZB1A 4IW0A 3G0EA 3MFSA 1KJJA 1URCA 4HNTA 3LCKA 2E9PA 3WI6A 4ANQA 3PY0A 5AP5A 1JKJB 5IYZF 3BYMA 4RG0A 4B8MA 1YXVA 2H9VA 2IPXA 3ORNA 5JRSA 3PPZA 3HMMA 4G5PA 4YBJA 3O71A 3UE4A 2QLQA 1HCLA 1JQHA 2PVHA 2VTLA 3BCEA 3ZSHA 1KE8A 3FSKA 4UXQA 4OTGA 2J51A 2PMNX 1Y91A 4L44A 4BDBA 1GAGA 3G8CA 2AC5A 4EOQA 5M56A 4ZOLF 1MRYA 5HVJA 4WD5A 4YB8B 2O63A 3ORXA 4C33A 3SD0A 3EYGA 3U9SA 2HY81 2WMUA 3DZOA 4V0GA 3VQHA 2PPQA 2VWIA 3UTOA 4CNHA 2DZDA 3GP0A 3AGMA 5KBRA 3AC3A 4IM0A 5EYKA 2B7AA 3OBGA 4O96A 4PL5A 5A46A 5EI8A 1XHAA 4RFMA 3VRZA 2JBOA 3KULB 4O21A 4ITIA 3QD4A 3R04A 1WVXA 1PXOA 4KD1A 4NJDA 4XUFA 4I5CA 1RJBA 1LUFA 3KRJA 3CGOA 4IVAA 4F0FA 3HA6A 4QQ5A 5BNJA 1ZZLA 2J90A 2XF0A 2YM8A 2WHBA 1CKJA 3OMVA 4X7QA 4YTIA 4XMOA 4AA0A 5HO7A 2OLSA 3GT8A 4BCGA 3E8NA 3MSSA 3PJ8A 2NO3A 4OLIA 5AP3A 2PZPA 3ELJA 3ORIA 4YJPA 4YU2A 4BIEA 2X81A 1PYXA 5J9LA 3KN5A 4V01A 4IB0A 3L9MA 2VO3A 2WU7A 1WZYA 2QF7A 5IMEA 4RJ7A 5ETCA 2X8DA 2XIRA 3DNDA 3HO8A 3U54A 4E5WA 2ONLA 4Q5EA 3E7VA 4WSYA 3EQDA 3CD8A 3SXSA 3NZ0A 1CDKA 5C4KA 3GOPA 3HEGA 3KVXA 2YCSA 4JI9A 2BAQA 4MNEA 1JNKA 4ARKA 5HI2A 3UOHA 1G8AA 3VC4A 4DH3A 1FINA 2EXCX 2F9GA 2PUNA 2DWBA 5HGIA 1R39A 5AIKA 3V01A 3NUNA 5C27A 3KB7A 2GNGA 2UZBA 3LZBA 3QQLA 4BGGA 2WQBA 3IGOA 2YCRA 3LCDA 2RIOA 4EWHA 1M0TA 3D15A 2HJWA 5LVOA 3C4WA 2I80A 3FLQA 3PRFA 1UA2A 1ZRZA 4BTKA 4KSPA 4CFNA 5IDNA 5CZHA 4ZMEA 3NX8A 5CAVA 2PUIA 1B6SA 2W1CA 3COMA 5D41A 4F65A 5DH3A 4Z3VA 5FGKA 4FTAA 3Q9XA 2VQDA 3C51A 2R7NA 4ZSJA 3M11A 4DLKA 4PMMA 3SA0A 3N9XA 2W4JA 3NSZA 4G3EA 4IWDA 3V51A 4HZSA 1RDQE 2W6ZA 2GQRA 3OW3A 2PVFA 5JH6A 5IZFA 4YHTA 2EB2A 3F7WA 3E3BX 4WNOA 3LFAA 4HR7A 1WFCA 4XP2A 3NUUA 2WZJA 4FZ6A 3FKOA 5I9WA 3BE2A 4UWBA 4O0UA 5DRDA 1ZYSA 1E1XA 5AAEA 2WTDA 2XMYA 4MV8A 3P5KA 2NRYA 4LL5A 1IRKA 1T45A 2I1MA 3DKFA 4APCA 2VTJA 2UW9A 1OL6A 2V0DA 3OCGA 2Y4IC 4FG8A 4NZWB 1KSWA 1MQBA 3QCSA 3CY2A 4MV1A 3PIZA 1W83A 4IQ6A 4FSWA 4OTHA 4TWCA 3R8UA 4D5HA 3EKKA 5EYCA 2W5BA 4WHZA 2QOBA 2QURA 3ZZWA 5HLNA 3JR1A 1I7LA 1H28A 3E5AA 4QMOA 5C03A 1Y8GA 2C30A 3MWDA 3BI6A 3RCJA 4ZI7F 4RIXA 2J6MA 3W8QA 3VRYA 4G5JA 3Q1KA 2EB3A 3EQHA 4JBOA 4XOYA 4CGAA 2WAJA 3LFFA 2C6LA 1IEPA 2E9UA 3I6WA 4KWPA 2IW8A 3LLAA 5FTGA 2YIWA 3AD4A 2CDZA 2XK8A 3EN4A 3H4JA 4FYOA 4LRMA 4NM0A 5FUTA 2IWIA 3R1YA 5EQPA 4ZLYA 5DWRA 4C35A 4DTAA 4Y8DA 5AJQA 4F09A 3Q9YA 4IVDA 3LXNA 4O0YA 3C7QA 5KHXA 3LQ5A 3W2RA 2XCLA 4QMZA 4NFMA 1PMUA 3BIZA 4F0GA 2E9OA 3KXNA 3R9OA 3BU3A 4N57A 2PZRA 5H8GA 2OKRA 5BUEA 3U9CA 4EUTA 4MK0A 2CPKE 3QCQA 2C5XA 3MH2A 5TF9A 2F2UA 3BYVA 3T8OA 3VHEA 3ZZEA 5E8SA 3MJFA 3PVWA 1SM2A 2WEVA 4K8AA 1QPDA 4MD7E 3HAMA 4KAOA 5JEBA 1KJQA 1V0BA 2ZMCA 4KRDA 5G6VA 3HMOA 5ANEA 4ME6A 5DR2A 3EQCA 3MTFA 3P86A 4F64A 3WILA 2ZM3A 3TZ8A 3ORPA 4IIRA 4E4MA 1WVYA 4RWJA 5J9ZA 5DPVA 5EQYA 5JGBA 3I5NA 5LVNA 1Q41A 3VBWA 4ANMA 4B0GA 3Q32A 4WIHA 3P9JA 4FTRA 4EBVA 4EHZA 4S32A 4F7SA 4EG0A 2AYPA 3NW6A 2CNQA 1OB3A 3UPZA 3RPOA 4IACA 5EKNA 3MN3A 3PIYA 5IQFA 5KMMA 2C6OA 5EDQA 3R01A 1ZMVA 3VBVA 5CXZA 1OITA 3PSBA 3OTUA 3C5UA 3F3ZA 3PTGA 3QL8A 4DEDA 3QFFA 5AUZA 4BGQA 1Q24A 4F0IA 4X3FA 5ICPA 3MPTA 3QHRA 4FZDB 4D1ZA 4M12A 2UZEA 2Q0BA 3FI3A 4MV9A 4AOTA 2YS6A 3E63A 2R87A 4AU8A 4WNMA 2ZDUA 3HYHA 3R00A 4O2AF 1BI7A 3NYNA 4M67A 5E8XA 3T3UA 2BIKB 4HW7A 5A4CA 5M08A 3VJNA 2PVPA 4CKRA 3H10A 3ZYAA 4HNVA 3MYGA 3P0MA 2QVSE 4YHFA 3KK8A 2BTRA 4HCTA 2QO2A 2C0OA 4MV4A 3O23A 2ERZE 5LVPA 2I6LA 3FMHA 3MPMA 2W1FA 4ZTRA 3F88A 4AGUA 2QO7A 3R23A 4YLJA 3ZUVA 4D4VA 3CC6A 4Y73A 1PMEA 3TKHA 3QRJA 4K6ZA 2PSQA 1XBCA 1YDSE 1B6CB 4YJ3F 1UKHA 4QYGA 1R78A 3GLKA 1V0OA 2FPGB 4FTTA 3WZEA 2OIDA 2YJRA 3EOCA 5DLSA 1XH4A 4O0RA 2XRUA 1IOWA 1PXPA 5T3QA 4YNEA 1TVOA 3QU0A 3VW8A 3ANQA 4FK3A 4IAFA 1OL5A 3MJ1A 4DFZE 5LP6F 3U51A 2VO7A 3IDBA 3MPAA 4GKHA 5ANDA 3V3VA 4EH5A 5IH4A 3R02A 5HIEA 5KKRB 2V7OA 3B8QA 4F6SA 2GHGA 3R21A 4CMOA 4CFVA 4K1BA 5GIPE 3DBEA 3L9NA 3TNWA 3TIZA 5JRQA 3LMIA 4RZVA 3MH1A 3S1HA 4EK3A 4YJVA 3UP2A 3A4PA 4TYJA 4NWMA 3N4TA 4L3PA 3LFNA 3QD2B 3CCNA 3MH3A 2HZ4A 3FXWA 3SC1A 3VBQA 4D55A 4FU0A 5ANGA 1ATPE 1X8BA 4BHZA 2FSTX 4Y5QA 3TIYA 3TZ9A 4BRXA 5EI6A 4IC8A 3RAWA 2X4ZA 4JG6A 3GU4A 4L7SA 5CSVA 5DG5A 3S4QA 3SRVA 1PYEA 4FNXA 2J4ZA 1BI8A 3QLFA 4LRJA 4BI0A 3LAUA 2RG5A 2XJ0A 4RZWA 2OJ9A 4QRCA 3JXWA 3NYVA 3WF6A 5IA4A 4MKCA 3EQBA 5BYZA 3UPXA 2PE1A 2R3FA 4KS8A 2P55A 4QMPA 3WYYA 2YRXA 4CV9A 4YTCA 3UNKA 1FGKA 3ALOA 4XG4A 1DIKA 4I21A 1E9HA 2QKWB 2Y4IB 5IH6A 3VS0A 4FX3A 3BE9A 4IZYA 1DI9A 3HL7A 4CKJA 4ZLOA 4J52A 4M14A 3U87A 4ZSGA 5FEQA 2R3IA 2W1EA 2VV9A 3FMNA 4EOPA 2R3QA 4FFPA 1SCUB 3FI2A 4OT5A 3UZTA 1F3MC 4FSTA 3VVHA 4AOIA 2XD4A 5TKDA 1Q3DA 2WU6A 4FV6A 5AWMA 3SAYA 2NUAB 5HG7A 1GZNA 4EZ5A 1PKGA 5CASA 3UODA 1H4LA 4IHJF 3KXGA 3H30A 4LV8A 3LM5A 5HCZA 5LXMA 4L1KA 5DFPA 1M14A 4TL0A 3PE2A 3Q04A 2QD9A 4L42A 2WTIA 4F7LA 1KE9A 2ITOA 5IQBA 5A54A 4QQCA 3QKMA 4QMYA 2O0UA 5E8ZA 4IWQA 4LI5A 4X2JA 4X3JA 1A48A 4U0IA 1I09A 2I0YA 5BVWA 5EH0A 3RINA 3IW4A 2HWPA 1A9XA 4QP1A 5IUHA 4IMYA 1CKPA 4CZUA 4O27B 2VX3A 1PX2A 2X7OA 4R7BA 5CEOA 2B9FA 2PZ5A 3P79A 4BI1A 4GU9A 2UZVA 1ERKA 2YRWA 5HX8A 3OY3A 4RJ3A 5C8YF 2OLCA 2WTWA 4TW9A 5AA8A 4EOMA 5DR6A 3RFCA 2JDSA 5FTOA 2W17A 5D7AA 1W98A 4PNIA 3IW7A 1DS5A 5JZJA 5ITAA 2HCKA 5AUUA 3EFJA 2Y9QA 3DBDA 4GVJA 1ZAOA 3K3PA 3OFMA 1ZARA 3MFUA 2E9VA 2XCKA 5L6PA 5AIRA 3G8DA 2RKUA 1M17A 4IIJF 1U5RA 3NW7A 1MQ4A 5CVFA 2ZV8A 4D2SA 4CLJA 1Z5MA 4BY9E 3JZFA 4IDTA 5LVMA 4LQMA 4E6DA 5CVHA 3Q6WA 3I4BA 4J96A 4QMWA 4RVLA 1OL2A 2QKRA 1QMZA 3MJ2A 4XYLB 3KREA 3KRLA 2UZOA 1RQQA 4LMNA 4BCQA 1BLXA 4O7VA 2YZGA 5DMXA 2IW6A 3M1SA 2YFXA 1DI8A 3BHYA 1M0WA 2F49A 3K3IA 4FE2A 4G6NA 4EBWA 3GNIB 2Y4PA 4XOZA 2PULA 2YABA 3BGPA 4V05A 1G5SA 4RRVA 2W1HA 2J5EA 3SV0A 2PUPA 4O4LF 3RHKA 3MBLA 2GNJA 2X2MA 2RFEA 3EYHA 3LCSA 4XP0A 4IJ9A 4X2KA 4O7RA 3GCSA 3L9PA 2FGIA 3A99A 3UMWA 2F7EE 2JLDA 4M3QA 3WO0A 3PXYA 2YIYA 3C5IA 3MV5A 1VYWA 4MXYA 1A06A 3V6SA 4AFJA 2PU8A 2WXVA 2C4GA 2UUEA 5DYJA 2E2BA 4DT9A 5K4JA 4QMSA 4C0TA 3TIGA 3OW4A 5AP1A 2KTYA 4FL1A 5IQHA 2W6OA 3OWKA 2BROA 3F5UA 1V1KA 3PWDA 5ACBC 4FV4A 4GU6A 5L3AA 3EFWA 3LM0A 4FSNA 4MD9E 3FL5A 2C6DA 5CXHA 4GUBA 4JOAA 4TNDA 4YJTA 2WMAA 4EOOA 4XG3A 5C26A 3IKAA 3QX4A 2A4LA 3R5FA 2YM5A 2X7FA 3VPBA 2ITPA 2QHNA 4DFYA 3L8XA 5C4LA 5CI7A 3KA0A 1C30A 2DIKA 2VO6A 4UZDA 3EQGA 3FMEA 3LJ0A 4C34A 3EN7A 4RX9A 2YN8A 3PLSA 4I6HA 4ZSAA 3TUCA 4PY1A 3E88A 1KOAA 2PK9A 3LCTA 3PZEA 4ZP5A 3REPA 2YERA 2YIQA 2B9HA 4R78A 4IX6A 2W4OA 1BKXA 3R1SA 2W5HA 4XCUA 5D12A 2XBAA 2R5TA 2E9NA 2X7GA 3CE3A 2YA9A 4FKIA 4O91A 1GIIA 4O7WA 4OTFA 3IOPA 3JY9A 3S0OA 4C4EA 4I5MA 4RA5A 2YZLA 4R7HA 2GNIA 4FEUA 5HG5A 4FTKA 2C3JA 3RI1A 5DBXA 5D7VA 2OXXA 3UG2A 4RMZA 4BBMA 4G9CA 3R9RA 2NU6B 4XV3A 4ZZOA 4MYGA 3DF7A 3VO3A 3BKBA 2W7XA 4YO6A 4U80A 4JIKA 3MFTA 4ZTLA 2PMIA 5JGDA 4TZRA 4M9UA 4JNWA 3OC1A 3QZHA 5K9IA 3LJ1A 4HOKA 3IPHA 4G3CA 4FVPA 1ZWSA 4TWPA 3A60A 4R3PA 4TYHB 4MAMA 4S30A 2C1BA 1WCCA 2QU5A 1PXMA 3F9NA 4UXLA 3TZMA 4ACHA 2P3GX 5J2UF 2BKKA 3TT0A 3PZHA 3RZBA 2R84A 2ACXA 3UOKA 4F1OA 5K5XA 4FZFB 2ERKA 2VTNA 4R6VA 3Q5ZA 3MY0A 4QP7A 4D58A 4ZZMA 3A8WA 4GKIA 4B6LA 2UV2A 3FLNC 5CY3A 4N70A 5FG8A 3RP9A 1G8SA 4DLIA 5CA1F 2I0EA 4AGWA 1GZKA 4AT5A 1WMKA 3ATTA 3GC0A 3Q2MA 4FFOA 2PMLX 3GENA 4I4TF 2RF9A 3V4ZA 1OBGA 4TV8F 3EIDA 4ZJVA 3DKOA 4YLKA 4L46A 2CHLA 4D5KA 3AC8A 4XG2A 2ZJWA 3DS6A 3IW8A 5IQCA 3TG1A 1YHWA 1FOTA 1ZYDA 2X8EA 5H9BA 4X6QC 5AP2A 4A9SA 2OJFE 2YAKA 1RW8A 1PY5A 5AM6A 4ZZNA 3GCPA 2R3KA 3FI8A 5GONF 2I8CA 1K2PA 3I1AA 5KMJA 5KZ0A 3RAHA 4N0SA 1KBLA 2BUJA 2J2IB 2VD5A 3EQFA 1NY3A 3KU2A 3BHUA 4RIYB 1Q4LA 3ACJA 1JSTA 3TL8A 4DLJA 4EOIA 4FIFA 3KF7A 1JWHA 5EHOA 3EMGA 2OFUA 3VBYA 3V5TA 1YWVA 3CSVA 3POOA 3DDQA 4I1ZA 2HWOA 4M84A 3TI1A 2F2CB 5A3XA 4L7FA 2VTRA 2JBPA 5CAEB 2C5NA 3R1QA 3HLLA 5AX3A 3VUDA 5DT3A 3LPBA 3DJ7A 4PUZA 4LG4A 1SMHA 2H96A 4E8AA 3AT3A 3MVJA 3UQFA 4U41A 3ORRA 3TUBA 4N4SA 4W4WA 3SE7A 1GSAA 4PDYA 3QWKA 5JK3A 2QCSA 1IAHA 3PIXA 4CTCA 2R0UA 3HMIA 3UGCA 3A2CA 3QXOA 1M6VA 4EH2A 3ZO1A 4CT1A 2YW2A 2CN5A 5AMNA 4FZ7A 5CYIA 2WMRA 5JQ8A 4AFEA 3GC9A 1MRVA 1GIJA 4R77A 2CKOA 4GH2A 2WMTA 4JL9A 3ZO4A 2QNJA 4GS6A 4NW5A 2GS6A 4AZFA 2ONLC 2H8HA 2WNTA 2JDTA 2ZMDA 2PE2A 4YZCA 3G6GA 4QMTA 4OTWA 5DVRA 4IZOA 2OIQA 5HD7A 1YDRE 1BL6A 2OICA 3LVPA 1UV5A 3F3UA 5E7RA 1OZ1A 3BZ3A 2BALA 1OI9A 3ZO2A 3OCBA 4BCNA 3CKXA 2JDRA 5FP6A 5AEPA 3EQPA 3E8DA 5D9HA 4O2BF 1J7UA 4AQCA 4BVUA 2JIVA 1GY3A 3R63A 3ROYA 4BCJA 3FY2A 2VTTA 2FSLX 5IEXA 3UQCA 4G1WA 2Z60A 1E4EB 3E64A 4OTDA 2CCHA 3NWWA 4IE9A 3R8VA 4HVHA 2UW5A 4UWCA 3FQSA 3NUSA 5HESA 1YOJA 2RFDA 2X0GA 2PTKA 3CPBA 3TKIA 1PK8A 5IMXA 3RNIA 2IO6A 2ZM4A 1J7LA 4QPSA 5IA5A 1P2AA 3WZUA 5CSWA 2Z7QA 2WTCA 2VWZA 3QBNA 1JKTA 4XG6A 2I40A 3TXOA 4F1MA 3NUYA 4F9YA 3T3VA 4ALWA 3HUBA 3QQKA 3QUEA 1YI6A 3FHRA 3BQRA 5ANKA 2OK1A 5EQEA 4LYNA 4A4XA 2ZM1A 1C3OA 4MA0A 2YAAA 3VMMA 2J0IA 3PXKA 2BKZA 5CNOA 3PG3A 3A7HA 3WZDA 4FIIA 4OT6A 4YJSA 3SQQA 4PTEA 5HEZA 3KRRA 3KFAA 4O7NA 4DITA 2R4BA 5IQDA 4EH6A 1J7IA 5F95A 3QX2A 4DN5A 4WNPA 5KE0A 3MIYA 4XP3A 3WOWA 4QTAA 3DKGA 3HDNA 3B8RA 1IASA 3FY0A 4FEXA 3FZRA 2DLNA 4JBQA 4PMSA 2WQOA 5B0XA 2PVRA 4H3PA 3OUNB 5EM6A 1KOBA 3FL4A 4M8TA 3KF4A 4WO5A 3U8WA 5KCVA 4FV0A 4Y8VB 1AUXA 1GZ8A 1WR2A 2WYOA 4IAAA 3EJ1A 3R2BA 1XH7A 2Z7SA 3E8EA 3KULA 4I94A 4NKSA 4I50F 5HHWA 2GNHA 3BYOA 3EQRA 3TINA 2R3JA 4GFMA 2CLXA 5DRBA 3NNXA 2PBZA 4AN9A 1QPJA 2UW4A 5AADA 3JVRA 2NU7B 3Q6UA 1F0QA 3FKLA 2XVDA 2CGVA 3FQEA 5LJJA 3FMLA 1SZMA 4TYGA 3NUXA 1EUCB 2HYYA 2XK6A 1Z2OX 3ZTXA 5JH7F 5GNKA 2IVTA 5KHWA 3OEZA 4FVRA 3GEQA 4EH8A 5CQWA 2PL0A 3LFQA 1KJ8A 3IG7A 4FKWA 5FTQA 2ITUA 2QHMA 1FMKA 4G3FA 4QYHA 2CMWA 5JKGA 4CKIA 2WTKB 3QTUA 3C4CA 4L45A 2BCJA 3TDWA 2W1ZA 3GU5A 1XR1A 3HUCA 2C6EA 3PSCA 3RV3A 2VNWA 1H00A 3QRUA 3VS6A 1ZMWA 4JAJA 1YI3A 5IDPA 1Q62A 4MF1A 1CTPE 3CBLA 4Y83A 2XB7A 4F08A 4R5YA 3HP2A 4I3ZA 4J99A 3LXPA 1EUDB 4I22A 1TQMA 2XYUA 3OUKA 3PY1A 4EQCA 4DCAA 4HVSA 2QOOA 4U7ZA 5HU3A 1GSOA 4GEOA 2YZAA 4TT7A 1JLUE 4H1JA 4DEHA 4J95A 4E7WA 1Y57A 4O7TA 3CEKA 5IF1A 4LRKA 4CCUA 5EW3A 4XNEA 2IVUA 3OOGA 4UB7A 2O2UA 1SVEA 2YDIA 3R9HA 3FBVA 2UZTA 3FXXA 4Y72A 3U9TA 2IG7A 3HNGA 4AZSA 5LWMA 3GGFA 4L52A 1PHKA 3ZHPC 2YS7A 4UYNA 4QP9A 4QTDA 5HBJA 3SDJA 2UW7A 2EVAA 4DH5A 2R3LA 3RPSA 3PY3A 5T6KA 2C3IB 4MQ1A 3Q2JA 3BQCA 3ITZA 3NPCA 4I6QA 4KRCA 4WT6A 4X3FC 4YAKB 3H9RA 3NDMA 3PDTA 5LQFA 4FKSA 2V55A 4RFYA 4U81A 2XNOA 2QR7A 3BBWA 2HZ0A 3EFLA 3HAVA 4TWOA 3TNIA 2IN6A 2JIIA 3I7BA 3DK6A 1APME 4FKOA 4JRNA 5HE1A 3R7EA 3R7VA 3ZUUA 4D4SA 3SG8A 1O6LA 1I44A 3TJDA 4D0WA 3U4UA 5JZNA 3A7IA 2BZHB 2WD1A 4IVCA 5CEKA 4IX4A 1OIUA 2WELA 2XKCA 4FGRA 3EWHA 4OTIA 2W9ZB 3MW1A 3OUZA 4IEBA 4I5HA 5CSHA 3LFEA 4XZ3B 4JDHA 4O38A 2P2IA 2WMQA 2PHKA 4F6WA 1OPLA 2RFSA 4E20A 3VS5A 5F9EA 3OWLA 3PLAE 3ROCA 2PVYA 1H8FA 3HB9A 1YDTE 4FKUA 4P7EA 1H25A 1QPCA 3FC2A 5LVLA 2VRXA 5HBEA 2DQ7X 3E92A 1W84A 1Q99A 3QZFA 5F4NA 3MA6A 4G3DA 4DA5A 2XNMA 2OGVA 2R3MA 4EH9A 3O0GA 3AT4A 5DA3A 5G1XA 4BCPA 4MV3A 3IDCA 4CRLA 5M06A 3N6RA 2B9JA 3CQEA 4IAYA 3UVQA 2HW6A 2O8YA 5BUJA 3BELA 3E7OA 3MA3A 2QOFA 4DEIA 2HXQA 3W1FA 4FTOA 2R3GA 2OSCA 1LEWA 2QOCA 3LW0A 2WFYA 4E1ZA 3E5NA 3OZ6A 5CAUA 1WBTA 1PXNA 5CF6A 3UFXB 2C0IA 3HMNA 4DGOA 3VS4A 2B53A 3GC8A 2VTPA 3BLQA 3DB8A 4U43A 3DGKA 4XYFA 4FSRA 4FV9A 4DBXA 4DINA 4EZ3A 4Z7GA 4TRLA 3ET7A 4EH7A 4EI4A 4RGJA 3NAYA 1KJIA 3K5UA 5HLPA 4UX9A 3N8DA 5IA1A 1Q61A 4FT3A 4W4YA 3HV5A 1ZMUA 4LV5A 4HCUA 3PJ1A 4Z55A 2X1NA 3L9LA 4FV3A 5AV3A 3I7CA 2XEYA 4C38A 3ENMA 1BXRA 2OBJA 3CPCA 5IQAA 2WQNA 3R30A 3R8ZA 4RVKA 4LOPA 2VWYA 3TZ7A 1R3CA 1UWHA 4HCVA 4NK9A 2R3NA 1M7NA 4IC7A 4BDCA 4Z16A 3NW5A 3QZGA 4YC3A 4AE6A 2BZIB 2GFCA 3ZLYA 3R0TA 2UZUE 4FV7A 5KNJA 3AOXA 1FMOE 2G1TA 4DFBA 4MBLA 3H9OA 2FSOX 4FGBA 1YI4A 4ACGA 2ZAZA 4OGRA 4GUEA 5E1SA 3GCVA 5HTBA 5HBRB 5CT0A 3KRXA 4XBUA 5CU4A 4BB4A 3PJ2A 2CNUA 1CQIB 1YWRA 2W9FB 4QP3A 2UVXA 3DTWA 4OW8A 4WA9A 4C5BA 4A7CA 2UW3A 1TQIA 3NAXA 2XBJA 2J9GA 4O6EA 5BPHA 1Q8WA 3EQIA 2WQEA 4YLLA 4A07A 2WO6A 3ZDIA 4C3RA 1DV2A 2QO9A 1H0VA 3DPKA 1SYKA 3NLBA 1XJDA 2YEXA 4AZTA 5L2TA 2ZDGA 4IAZA 3TTJA 2R85A 2UW8A 1WAKA 5I0BA 3NVKI 3DXNA 4PDPA 4FI1A 4NM5A 1H1RA 2DUVA 4JQ7A 4BDGA 4DGMA 4XG9A 5EKOA 2BRGA 1UKIA 3KGAA 4I24A 2BTSA 3VW6A 3W8LA 2YWVA 3JVSA 4JRVA 3HV4A 3K5IA 3AMBA 1STCE 3RM7A 4AOJA 3DBCA 3F69A 4FKJA 4YNOA 3EL7A 1CSNA 2XZSA 3VUMA 3UNZA 4RFZA 3V04A 3EHAA 4YZDA 3RK5A 3V5WA 4QP6A 3OG7A 4XV2A 5JFVA 4MQ2A 3OS3A 2WTVA 4DFUA 1OUKA 3FLWA 4EHEA 5C1QB 1YXSA 4YBZB 3QZIA 1JVPP 4K18A 4I93A 3D7TA 4A06A 3I6UA 1U54B 4NUSA 3JYAA 4IADA 2J0KA 4O0VA 5GHVA 4B99A 5IA3A 4FYNA 1AUVA 1BYGA 3PFQA 4ZTSA 4ZS0A 1V0PA 2XNEA 1VBHA 2I0VA 3FJQE 3QUPA 2R82A 4RLKA 4AWIA 4YAJB 2CLQA 4BKJA 3HV3A 2Z02A 4LL0A 4DFLA 1YW2A 2ITZA 3CGFA 4C02A 2JD5A 4G17A 4BIBA 3HP5A 1URWA 3ODZX 4LGHA 3W16A 4AN2A 4USEA 1BMKA 1YXTA 1L8TA 3ERKA 5HNGA 2R7KA 1IA8A 4DGNA 1VZOA 3IONA 2XH5A 4C36A 3AC1A 4RJ5A 4ZTHA 2PZIA 3O8PA 3MGYA 2IP4A 2VR1A 1Y6AA 2JKMA 2I7QA 4JR7A 4AW5A 1FVTA 2Z8CA 3Q4ZA 4S33A 4XRLA 4PTCA 3R8PA 2R7LA 4I5PA 1FQ1B 4PP9A 3K5VA 4QMLA 4AZWA 2JDVA 3RWQA 3FWQA 2WOTA 4YJNA 3V8SA 3ZC6A 4DHFA 1PKDA 5FP5A 4P90A 1ZYJA 4BN1A 3BRBA 2ZVAA 4X3FB 4YGAA 1NVQA 3KEXA 4WBOA 4ANBA 4WBNF 3NVMB 4CSVA 3NNVA 3OXTA 3GQIA 4OUCA 2W96B 1KEEA 4FODA 2BR1A 2R86A 3NIEA 3KCKA 4NH1A 3QCXA 4X6RA 5A6NA 3DDPA 5L2SA 3NUPA 4AG8A 5E92A 4DEEA 4D1XA 4OTQA 4E4LA 5LA6F 4E6AA 1GNGA 1HCKA 1O9UA 3C13A 3SOCA 4EK5A 5A4TA 3UOJA 5LMAA 2PVLA 2ETKA 4BDDA 4J8NA 4E5AX 4V04A 3FI4A 4I0TA 4TYEA 5BYYA 4O0TA 4M68A 4XYMB 4JQEA 3KQ7A 4RBLA 3WYXA 4XX0B 3HVCA 4D0XA 5J87A 4Y46A 3COHA 4C62A 5KMIA 3GIDA 4FICA 3MVLA 4DH7A 1H27A 1M52A 1Q3WA 3GVUA 3CTJA 1OKVA 3UOLA 2C6KA 2OU7A 5JFSA 4MA5A 3KXXA 1ZXEA 4CXAA 4CLIA 2QK4A 2HW7A 4JS8A 5JVLA 4KBCA 1PJKA 3DB6A 3DLZA 5EW9A 2GU8A 3N4VA 3UVPA 3GUBA 5IPJA 1OIYA 4NT4A 5F1ZA 2GTMA 2C6MA 4ANLA 2YHVA 1FPUA 1UU9A 4Y95A 3RPYA 2P0CA 2PVMA 1YRPA 2X6EA 3ZBFA 3DAKA 3O17A 5AX9A 4L3LA 3I0QA 1AD5A 3QQFA 4F6UA 4FT5A 1I7NA 3UVRA 2HZNA 3JS2A 4PWNA 3C50A 5J1WA 4P5QA 4TPTA 3R7YA 3WF7A 5D8DA 3OD6X 5AM7A 4E4XA 4JDKA 3SXRA 5LWNA 3W32A 4UN0C 3EL8A 3ETHA 2Y6OA 4NYEA 1REKA 3ID6C 2F7XE 2OW3A 3FV8A 3G0FA 3OWPA 3PUPA 3Q60A 1S9IA 5EG3A 4C58A 4EHGA 4F99A 4TXCA 4FG9A 3SRVB 1PF8A 2VGPA 3TEIA 1JDEA 4U42A 2ITNA 4LUEA 3OCSA 3PA5A 3PJ3A 1YOMA 2CZGA 4UWYA 1JKKA 4P4CA 3ZONA 4BI2A 3RM6A 4IANA 1BX6A 5CX9A 5K3YA 3W2QA 3F2AA 3L8SA 2HAKA 3VF9A 4DIMA 4TNBA 3BHVA 2ETMA 3EKNA 4J97A 3S95A 4ITJA 2JGZA 3F3WA 3PXFA 4CG9A 2R7MA 4D4RA 4B8LA 4C4JA 5E8UA 5L8JA 5JQ5A 3V5JA 4FV1A 5J1VA 2A0CX 2FYSA 2GPHA 4FSMA 4GFOA 2FA2A 2YIRA 3MTLA 1U59A 4C2WA 4CFWA 4U5JA 3R7IA 3QHWA 4YPDA 4DTKA 4RC3A 5BMSA 4XJ0A 4BIDA 1XO2B 2BZJA 3VBXA 2NU8B 1W82A 3CLYA 3DJ5A 4EOJA 2BFYA 4GW8A 4GK3A 2GHLA 3VOTA 3SVVA 1CS0A 3NCZA 4CVAA 5CEQA 1CMKE 3MY1A 4KUJA 3U55A 5BVNA 2QLUA 5CEMA 3POZA 4NTTA 4FT0A 4IWPA 3KMWA 1XH6A 3D5WA 4QYFA 4DEAA 5HTCA 3HRFA 1XQZA 1XBBA 3U9NA 5IQEA 2WTJA 4KNBA 1ZLTA 3FLYA 4KIOA 5EOLA 3KVWA 3OROA 4F9AA 3ETAA 1LR4A 2JAVA 5AP4A 4H39A 4I0RA 1M2PA 2FUMA 2OIBA 2SRCA 3NIZA 2QQ7A 4R5SA 4UEUA 5CU3A 3A7GA 2QR8A 3FKNA 1BUHA 3QF9A 2WMVA 5HIBA 5BMMA 3ZO3A 5CA0F 4FTLA 4LGGA 1GOLA 4H58A 4JQ8A 2YYAA 3MDYA 3RVGA 4XEYA 3D4QA 3MWUA 2VU3A 4RIOA 1OIQA 2R7IA 3AT2A 3ZH8A 3PXQA 4HNFA 4CEGA 4CQEA 5KMLA 4EQUA 5JMSA 3DV3A 3U6IA 2GDOA 4BDFA 3RV4A 3H0YA 4HPUE 2R3RA 4YJOA 2YACA 2C0TA 1Z2NX 3AMYA 3FPQA 2X39A 2HZIA 3CKWA 3PVBA 4FTMA 4HJOA 4DG0E 4J7BA 1XH8A 3FZOA 3Q4TA 3ZLSA 4UALA 4FVQA 5HD4A 1S9JA 5HBHA 4AW2A 4PTGA 5JN2A 4KSQA 4TY1A 3PP1A 4E73A 3ZDUA 1U46A 3LXKA 3OCTA 2XIXA 4M0YA 4EH4A 4OR5A 4ERKA 4O22A 3HX4A 3E8CA 4MAOA 4PNKA 3BEGA 4JG7A 5AV0A 2DYLA 3B2WA 5E8TA 4GG5A 4TWNA 4EGQA 2YM7A 3C4FA 4C59A 2H34A 2R3PA 3HV6A 3Q3BA 4FTNA 4FEQA 5HV6A 4F9BA 5CENA 2OZOA 2XIKA 3VS3A 4EL9A 3KAJA 4J53A 3W18A 3AX6A 1R0EA 3R6XA 2UZWE 2XYNA 3DZQA 2EUFB 4JBVA 4GFGA 5DNRA 3F3VA 2FH9A 3OT8A 3BPRA 1JBPE 4G2FA 1PXLA 3GXLA 3IS5A 4PF4A 4RIWA 3AXWA 3IW6A 3O7LB 4D1SA 3ZRKA 5JSMA 4TYHA 3ANRA 2LGCA 2CKQA 5A14A 3PVGA 2UZLA 3UQGA 3LQ8A 4C4IA 4G6LA 3GI3A 1RE8A 5ANJA 4DH8A 3VAPA 4F63A 2SCUB 5LCJA 4IWOA 4FR4A 4JVGA 3CQUA 3RTPA 2GPSA 1JSUA 4YJRA 2XKFA 4GJ2A 4U44A 5HG8A 4O81A 5BQ0A 1IR3A 1OIRA 2J50A 4IB5A 3GCUA 3QWJA 4LM5A 4GL9A 3CTQA 4EWQA 3KC3A 1JLLB 3P08A 4WUAA 3CJFA 4FIHA 4MWHA 3LKMA 4PX6A 4ZOGA 1E1VA 4ZTMA 4U3YA 3S00A 1ZZ2A 4HVDA 3MESA 4K0YA 2W6PA 5EW8A 1XWSA 2DWCA 3SW4A 4RQKA 4TYIA 2Z2WA 4BCKA 4RLLA 5AFVA 4DYMA 1DV1A 3P7CA 4XHKB 1OKZA 2C47A 1Z9XA 4FG7A 5HVYA 2C6IA 4FSYA 3P78A 5ANOA 5D11A 4WG5A 4IBMA 3A7JA 4MBJA 3PSDA 5BYLA 3BU6A 3IQ7A 3TNQB 3GC7A 3QTIA 3K5HA 3OBJA 5J8IA 5I9XA 3QA0A 3TUDA 2X4FA 3CS9A 4O86A 1JDBB 3GCQA 1FVRA 3CXWA 5ANIA 3ZEWA 3EB0A 1XH9A 3QUDA 4DGGA 3P23A 2XKEA 5BVKA 3VUIA 3ZFXA 2B0QA 3H3CA 3ZM9A 4FL3A 4RJ4A 5L6OA 2EU9A 2X9FA 1ZOGA 2EXMA 3K54A 5M09A 2B54A 3FQHA 4J1RA 4BCFA 5LMKA 5JFWA 1GZOA 1Y8YA 2WIHA 3FYJX 3D0EA 3LE6A 3C0IA 4BDJA 5JT2A 3KRWA 2IZTA 2BIYA 3A4OX 2V59A 1Q97A 5CAPA 4AT3A 4ZJJA 1VKZA 4XLIA 5CAOA 1KWPA 3FEGA 5CSPA 1Q8TA 2ZB0A 4PMTA 2ITQA 4C37A 1KE6A 5AAGA 3LFCA 3WBLA 3ZLWA 4OBQA 1VR2A 3DU8A 3G90X 2C00A 3NS9A 4WOVA 5BX0A 5KZIA 5AUVA 2PWLA 2REIA 5D10A 4YURA 3D5VA 3QRKA 4HYIA 2HK5A 2YITA 4YTHA 3B2TA 4MNFA 3WE4A 1UWJA 3KALA 4ASZA 1UVRA 3HDMA 1P4OA 4TTHB 4XLVA 3KL8A 4A9TA 5C8NA 2C68A 3D5XA 3DJ6A 5J95A 1PW2A 3R28A 5IQIA 3W55A 5CAQA 4U9AA 4F1TA 2BDJA 1OM1A 2X2LA 4JIAA 3FHIA 3OTVA 3PXRA 2VN9A 4ORKA 4O0SA 4G6OA 2A27A 1AQ1A 3O8UA 2Z04A 3SW7A 5HX6A 5HU9A 4A9YA 3DCVA 4ZK5A 2ESMA 3MB7A 3RAKA 5JQWA 4IVBA 3QCYA 1W7HA 2GHMA 4FT9A 4LOOA 3EN9A 5J2TF 3LCOA 4DH1A 4DFNA 3W2OA 5L2IA 4AXAA 4CFMA 3D5UA 4U3ZA 5CF5A 5CU6A 4BTJA 3ORKA 1E4EA 4ALVA 5AV1A 1GLVA 1W93A 4B9DA 2WIPA 4GYIA 4WNKA 4Y5HA 3UMXA 4EOLA 4YUQA 5I9VA 4ACDA 3UIBA 2FO0A 5CALA 3TV6A 4FOCA 4ACMA 3JY0A 4E4NA 5EZYF 5M4CA 5BMVF 3R5HA 2XA4A 4KS7A 3L8VA 3ZFMA 5CB4F 3RMFA 2PN1A 4P5ZA 3ZC5A 5EM8A 3NEWA 1K3AA 2VX0A 3VUKA 2BRMA 5H8EA 2C5OA 4M0ZA 2VO0A 4L68A 5EYDA 2FVDA 3UBDA 4B4LA 4EQMA 5I9ZA 3VA7A 4FKRA 5KX8A 2WMWA 2JAMA 1YXUA 5EI2A 2W6QA 1OL1A 1FGIA 3R71A 1H07A 3VIDA 4DEGA 2QC6A 4YP8A 3GU8A 1DAWA 3ZXTA 4BCMA 5FM3A 1YQJA 3F5XA 3V6RA 3GOKA 4FUXA 4FSUA 2IZRA 4DG3E 3OUUA 5BVDA 4YZMA 3AC2A 5EYMA 5HE2A 2R3HA 4LFIA 3A62A 2WGJA 3E3PA 3W2CA 4USFA 3SKCA 3UYTA 2W70A 2W06A 5M44A 5KX5F 5L6WL 2VWBA 3H0ZA 4FV8A 5FXQA 5TR6A 2NNWB 3NYOA 2OZAB 4DT8A 3QQJA 4S2ZA 2Q83A 4KKHA 4MXAA 1PMNA 2XJ2A 2A1AB 3D2KA 3Q9WA 1U5QA 2VTHA 3Q5IA 2WPAA 3LIJA 4FKLA 4GK4A 4WRGA 1YHSA 1OMWA 4APPA 2YZNA 3CJGA 4C5CA 5AP7A 3Q2OA 3QTWA 5IEVA 2BHHA 1REJA 3LFSA 4AX8A 4C3FA 4CRSA 4RSSA 4JLCA 5BPFA 4L43A 3UO4A 4RZQA 3VUHA 4QP2A 3RALA 4B7TA 3RKBA 3KY2A 3LFBA 2PVKA 5M53A 3QTRA 3KK9A 3TV4A 4I20A 1IOVA 3F3TA 3M42A 2QONA 4DGLC 5I9UA 4EKLA 4ZLZA 3ETJA 3LP8A 3VWAA 3U4WA 2XNBA 4NU1A 4PRJA 3UC4A 3DK3A 3R8MA 5CT7A 4O7SA 4ZTNA 4ASXA 1ULZA 3GQLA 2B1PA 4WG3A 2F57A 4QNYA 3R8LA 3JRXA 5F94A 2ITYA 4EUUA 4P2KA 4E6CA 2B52A 4GCJA 2Y7JA 4QYEA 5CI6A 4ZAUA 5EFQA 5CS6A 3DA6A 2VTAA 4Q9ZA 5FEDA 2FPIB 4QT1A 4MV7A 4ASDA 3RHXA 2BMCA 3BGQA 1H26A 1PRYA 5GJFA 3TKUA 4EYJA 3HV7A 3EH9A 5H2UA 5AA9A 2R3OA 2XKDA 4GT3A 1H1SA 3LFDA 5E1EA 4NIFB 4RX8A 3NYXA 4QSHA 1SVGA 4YSMA 4ACCA 3UYSA 2YCFA 5GJDA 5IUGA 5C1PA 4ERWA 3D94A 2X2KA 3U6HA 2W1IA 4UBAA 1ND4A 1TKIA 5IH5A 2YM3A 1WBVA 4BDAA 4MX9A 4YC6A 4HGEA 3DOGA 5CNNA 4ONAA 2V7AA 1PXIA 1W0XC 2W99B 3V5PA 3Q53A 3GFEA 4I41A 4UYAA 3WIKA 5KBQA 2YJSA 2EWAA 3DT1A 3TQTA 1OL7A 3DAJA 4XS2A 3DQWA 2C6TA 3FZPA 5DE2A 1J3HA 1WVWA 2R0IA 3IECA 4BC6A 4F4PA 5J7HA 4KBAA 2OJJA 4W4VA 3UIXA 4AGCA 4EONA 4DBNA 3A8XA 4QQJA 4AT4A 2G2HA 5AP0A 4JJRA 3MVMA 2XS0A 4V0GB 3MFRA 4BDHA 3C9WA 4Q5HA 2X0SA 2NP8A 5DIAA 3R73A 2WOUA 5TT7A 1Z57A 3DFCB 5FQDC 4ZSEA 4QYYA 4EC9A 4MD8E 4X21A 4K9YA 3RUPA 3U6JA 4C2VA 2XK9A 2XK7A 4FKGA 5CWZA 2C3KA 2R2PA 3G51A 3KN6A 4FIGA 4H1MA 4XV1A 4O0XA 1Q8ZA 3FAAA 4MXXA 3C4ZA 4KKEA 4RVTA 3F2RA 2WMBA 3QQGA 2ZV2A 4E93A 2HXLA 2DS1A 3PXZA 4YZBA 3OT3A 4JDIA 1O6KA 4CG8A 3VPCA 4QQTA 3ATSA 3DXQA 4YC8A 2BFXA 2GSFA 2F4JA 4FL2A 4MXZA 5CSXA 5AUTA 5GINE 1DAYA 2CKEA 3LMGA 5IU2A 1CKIA 4LUDA 3OVVA 2RG6A 3KMUA 3UG1A 3OP5A 5ACKA 4BCIA 3BV2A 5M57A 2CN8A 1K9AA 5LCKA 2QOHA 3AQVA 4KINA 3ZS5A 2IVVA 5EHLA 3TCPA 3VHKA 5B7VA 4M15A 3FPMA 5EM5A 5M4FA 3MB6A 3FMJA 3FUPA 3QFVA 4GIIA 4IX5A 1OPJA 3II5A 4QMXA 3DY7A 3G9LX 3Q4CA 5GJGA 3RJCA 3C4XA 5KMNA 4F7NA 2GNFA 4K2RA 1OUYA 1PXKA 4QTBA 5A4LA 5KKRC 2NU9B 4NCTA 4S34A 4GVAA 2WMSA 4QPAA 5HLWA 5KMOA 2OH4A 3TJCA 2W5AA 4JXFA 5FEEA 3LLTA 2OJIA 3SG9A 5HNIX 4MNEB 3CR0A 2CJMA 3VUGA 3VQUA 5C1OA 4NKAA 2GQGA 4GRBA 2YL2A 2VZ6A 4IM2A 3ZSIA 1KV2A 4DEBA 3QA8A 2A19B 2RFNA 3THBA 1EH4A 1R1WA 4O4IF 4I0SA 4EGJA 3DNEA 3BEAA 5KMKA 4RWKA 4BTMA 2G2FA 4RJ6A 4RX7A 3D2IA 3UNJA 3ALNA 5CTPA 4QMNA 4BYIA 5H3QA 3ORTA 2QODA 3V5LA 4ZXTA 3OXIA 2GTNA 4A4LA 5LMBA 1H01A 4ZTQA 3RCDA 4FFMA 5DI1A 5I4NA 3ACKA 2QG5A 4ID7A 3BLHA 1YXXA 3AC5A 4FOBA 1NXKA 1GGOA 1JKSA 3DQXA 4FA2A 2JFMA 4GT4A 3ZRMA 2HENA 2VGOA 3KXZA 1KE7A 2ITXA 5KKNB 5CU0A 1H1QA 4DCEA 3A7FA 2WMXA 4JX7A 4IDVA 1AGWA 2YIXA 4CZTA 4QO9A 4EYMA 4GK2A 4ZY5A 4C5AA 3VJOA 1OKWA 4DG2E 4BR3A 4L8MA 4AN3A 3G5DA 4X2FA 4E5BA 3JPVA 1GSHA 3ULIA 1UNLA 4BCHA 4YZ9A 2P4IA 2XIZA 4PP7A 3UZRA 1Q8UA 2UVYA 5AUWA 4C3PA 3R2YA 4W8EA 1YOLA 3DBQA 3I12A 2XNNA 4I55F 1CQJB 5E91A 1ZOHA 4YPSA 5BVFA 2FPPB 4ZQIA 4N6YA 4RWLA 5HG9A 5IISA 4FV2A 4UV0A 3SLSA 4G9RA 4FTJA 3QXPA 2Q0NA 4FTQA 1DM2A 3O8TA 5C8MA 2J0LA 3WZJA 3NMUF 5JGAA 5AUXA 4RC2A 1B38A 2P2HA 3R9DA 2CNVA 4QMUA 3TV7A 4DF3A 3GBZA 2V62A 2PVJA 3QGYA 3ZLXA 5EK7A 4EOKA 1KUTA 2F7ZE 4RX5A 3TIIA 3FE3A 4FTIA 3ORLA 3UDBA 4HYUA 2GMXA 3FZTA 5M4UA 3WZKA 4MV6A 4BZDA 3I81A 4RIXB 5FBNC 1U54A 3FDNA 4AACA 4BICA 4EOSA 3NUAA 5CANA 4I92A 4NL0A 5AV4A 5IEYA 3KKVA 3QTSA 4N6ZA 4DFXE 2VTIA 4DTBA 3FLZA 3P1AA 3FLSA 4MHAA 2PZYA 4GIHA 3DFAA 4WG4A 5HIDA 3RGFA 2B9IA 2IW9A 3P7BA 3ZU7A 4YSJA 4FNZA 1P4FA 3EFKA 5HICA 3DAEA 4QNAA 2R9SA 4XBRA 2XJ1A 3M2WA 4PL4A 2IZSA 1UU7A 3UZPA 4HNIA 4OBOA 4HQ6A 3OF0A 4KB8A 3SXFA 3ZCLA 4EORA 5TOZA 1H1WA 4H05A 4Y85A 3W10A 3BLRA 1JKLA 3DK7A 4ALUA 2GCDA 5H80A 1MRUA 4O7ZA 3P7AA 2VPQA 4D4YA 2OF4A 4EZ7A 4G31A 2KULA 4HVGA 1QCFA 2J0JA 4L67A 4AW0A 4EJNA 4BF2A 3I0OA 1JSVA 2Y0AA 1IAJA 3OY1A 2YDJA 3G6HA 3QYWA 4I6BA 1HOWA 4J98A 4NM7A 5E8YA 5CEIA 4CMTA 2G2IA 2UW0A 1ZYCA 1VBGA 4HGSA 4F9WA 3NNWA 1XKKA 4ZS4A 4RVMA 5F20A 1H24A 3LJ2A 4D9UA 2VX1A 4MVFA 2YZMA 3BU5A 3G2FA 2JDOA 2JC6A 2WQMA 5FM2A 2A2AA 3C1XA 4NSTA 4QP8A 5HVKA 3BYSA 1NVRA 1T36A 4O4HF 2ZDTA 4FT7A 4BBFA 3QTZA 4KKGA 1LP4A 2XNPA 4BDIA 2O3PA 4QOXA 4BYJA 2WB8A 3OHTA 1QPEA 4ZY6A 4F70A 4WBBB 3QRTA 1CM8A 4IZ5A 4R3RA 5DHJA 5L8LA 2NRUA 4HYHA 4OTRA 4F9CA 4FC0A 2VNYA 4CMUA 5BPYA 3D7TB 4MXCA 3HA8A 4FEVA 4R1VA 2BRNA 3KAKA 2JITA 5CVGA 2QU6A 2JKQA 4MBIA 3ULZA 3MY5A 2PE0A 4BGHA 4TUYF 2OH0E 5AUYA 3PP0A 4IM3A 3CIKA 4U45A 2ITVA 1OPKA 2W1GA 2P0AA 3HRCA 5A9UA 4PDOA 2BHEA 3G9NA 4LOQA 4CFXA 3DXPA 3IGGA 5ETAA 4IH8A 4NJ3A 3PRIA 4Q2AA 4AE9A 4M7IA 5ETFA 3WARA 4AP7A 2XK4A 3BGZA 4MH7A 3AW8A 1JAMA 4HZRA 3CP9A 5H8BA 2W6MA 3JZIA 2QI8A 5CZIA 4BCOA 2QOLA 3ZFYA 2B55A 3PWYA 5HKMA 4D28A 2Y6MA 2C5YA 2G15A 3BWJA 5FNVF 4AAAA
chains in the Genus database with same CATH superfamily
2HY0A 5CF8A 2ZDQA 3GU7A 4X0MA 3I79A 3E93A 2JKKA 4AA5A 3A61A 4BTFA 5IA0A 2XM9A 4YJQA 5E90A 3N4UA 4MEDA 4IZAA 2VWUA 3O2MA 1U4DA 2PY3A 4ANSA 4Z9LA 2Q7DA 4HGLA 4LMUA 4XRJA 3ZXZA 2C3LA 3DBFA 3R7UA 4C7TA 1FVIA 1EYZA 4ZY4A 4A9RA 2W71A 2O5KA 4XG8A 4AS0A 4YJ2F 3RTXA 5I5ZA 2YISA 5DEYA 3V4SA 4E26A 2QOKA 1BNCA 4AGDA 3ZMMA 3TWJA 4NFNA 5LOVF 4L3JA 2CGXA 2J7TA 1IA9A 2Z7LA 3T9IA 3ZRLA 4U6RA 5EHYA 3TN8A 5L8KA 4E4TA 4FFNA 3UIMA 2W0JA 5M4IA 3BL9A 5DOSA 5FRIA 1M2RA 2J5FA 3ZM4A 2R64A 4EK6A 4JX3A 3BV3A 4IZ7A 3SGCA 4DAWA 4EH3A 1WBPA 5TO8A 4FBXA 2CGUA 1UU8A 4HGTA 2XP2A 4FK6A 4XH6A 5BUIA 5FDXA 5DN3A 4O6LA 3O51A 3PA4A 4USDA 4EEQA 3MIAA 1LPUA 1A0GA 3PYYA 3L2PA 4YJUA 3UDTA 5E25A 1Z2PX 4GSBA 5DT4A 4FNWA 4AZEA 4QMVA 4AW1A 4NTSA 3NBZB 2XM8A 2C1AA 5HE3A 3R9NA 3KYHC 1WBOA 1PMVA 3BHHA 4O0WA 3UJGA 1Q8YA 4CE5A 2UVZA 3AC4A 3FZSA 5CF4A 3F6XA 1YWNA 3TDVA 5M51A 3MS9A 3PE1A 3BG5A 2ITWA 3EZRA 2ZOQA 3LXLA 3QQUA 5FXSA 4U40A 3LOKA 4BHNA 1M7QA 2BRBA 1H08A 3RK9A 4A4OA 3T9CA 1A0IA 4EK4A 3C0HA 3O50A 2C69A 2ZYBA 4MWIA 4MTAA 4FKPA 3ORZA 4JR3A 3KXHA 3QC4A 4EC8A 3L8PA 3IO7A 3F5GA 4GG7A 3QD3A 1NT2A 4HYSA 4AA4A 4A9UA 2EJ0A 5I5TA 3UZBA 3GU6A 5HO8A 4FTUA 1OECA 3QQHA 3RAIA 3W2PA 5LMKC 4HVIA 2J9MA 1ZY4A 2IJMA 1UNGA 3EN6A 1JPAA 3VS7A 4EKKA 3NCGA 5A6OA 5CU2A 4K11A 5DEWA 4ENYA 2V5AA 4NM3A 4L6QA 3W1GA 2NPQA 5C9CA 5HCYA 4QMMA 4HPTE 3PFFA 4QP4A 5LARA 3QRIA 3KCFA 4RWIA 3MH0A 5B2KA 2V5QA 2XNGA 4EHVA 2RGPA 1NA7A 4NW6A 1QL6A 3DLSA 4M69B 4IB3A 2VTSA 3ZUTA 5FPOA 5CE8A 3BAAA 2FB8A 3I5ZA 3D14A 1IG1A 4L53A 4MXOA 3WE8A 4QTCA 3RPVA 1OBDA 5T68A 2HELA 2I0HA 4FSQA 3UO6A 4FTCA 4CFUA 3GB2A 1OKYA 4CCBA 4KIPA 3K2LA 3KMMA 2O64A 4O84A 3WNZA 3UIUA 3VN9A 3NGAA 3OWJA 4YMJA 3QC9A 5AP6A 3BX5A 3OEFX 4GYGA 4FNYA 4RC4A 3V5QA 4MCVA 3W2SA 3WF9A 5KS8A 5JFXA 3Q4UA 4FKVA 2V58A 1J91A 3UP7A 3LQ3A 4RJ8A 4CTBA 5DGZA 4FFRA 3HKOA 3L1SA 2BZKB 2R7BA 2JEDA 1M2QA 2G9XA 3F7ZA 4FV5A 4C4HA 4D9TA 2W6NA 1I1MA 1TAEA 3HGKA 2G01A 2BAKA 3I60A 4H36A 3RWPA 1PXJA 2X9EA 4YHJA 3VS1A 4FUYA 4EK8A 2OG8A 5KO1A 2FB9A 3R5XA 2YDKA 2YM6A 4IB1A 2VWVA 4IFCA 4ZEGA 5CEPA 1VEBA 2HIVA 3FZ1A 1JOWB 3QALE 2FSMX 4PDSA 2I87A 4KA3A 2RL5A 2W4KA 3KXMA 3HECA 3C4EA 4IFGA 4JG8A 4O7LA 1NW1A 3NRMA 1TQPA 4IAKA 4JDJA 4ZSLA 3WF8A 4CV8A 5J9YA 1A9UA 3W0SA 4JAIA 3AD6A 4G16A 3ORQA 3F5PA 3SOAA 2CKPA 2Y8OA 2WEIA 4L01A 3CQWA 3ENHA 4PMPA 5M55A 3PA3A 5FD2A 2C5VA 2BVAA 2J0MB 2PUUA 1ZY5A 4Z7HA 5HQ0A 3MWEA 3WO1A 3MI9A 4RA4A 4GT5A 3Q96A 3RK7A 3TACA 4O82A 4CT2A 4IX3A 2HVSA 4I6FA 4I4EA 3S2PA 1XMMA 3NNUA 1F5QA 4X2GA 1GIHA 1OGUA 2OF2A 3PJCA 2FP4B 4H3QA 4BZNA 2YWPA 2GNLA 4LH6A 4HNUA 2WKMA 1ZOEA 4BDKA 4RT7A 5EDPA 5K5NA 3WIGA 2DABA 4GMYA 2UW6A 2ZV7A 3IOKA 3R22A 5DT0A 4G3GA 3UDZA 5HZNA 3E87A 4WRSA 3JUHA 4AXEA 3W0NA 3G15A 5J5SA 2IVSA 3QTQA 2VTQA 3HZTA 3IK3A 3V8TA 2HIWA 2XEZA 2YCQA 3K3JA 5KUPA 4XX9A 1SNXA 2P33A 3CTHA 3MVHA 2OFVA 3WF5A 4C4FA 5FBOA 3LWBA 2JFLA 2X6DA 3BBTB 3COKA 3FSFA 3EZVA 3S3IA 4G34A 1G2WA 4FEWA 2UZNA 2BDFA 2PVNA 3H9FA 3PVUA 4TN6A 1GJOA 3QKKA 4RIWB 4BBEA 3QKLA 3HBLA 3BYUA 2QOQA 4QTEA 4C4GA 3BL7A 3DTCA 4KBKA 4UY9A 2AC3A 4FKQA 4RIYA 4WUNA 3ZBXA 2ETRA 5EOBA 3D7ZA 3OXZA 2Z7RA 4AUAA 4ZMFA 3UC3A 1OVEA 1J1CA 4FZAB 2VTOA 1XBAA 2BILB 3QLGA 2GPWA 4C61A 4PQNA 4S31A 5CLPA 3SHEA 4M97A 1UU3A 2V22A 3AMAA 4AF3A 4W4XA 5ETIA 3CD3A 2UZDA 4E6QA 3QGWA 5FDPA 2PYWA 4RQVA 2WTKC 3P4KA 5D1JA 4QMQA 2VWWA 4H3BA 5AAFA 4WKQA 5FXRA 4ZJIA 4YZNA 4F7JA 3QD0A 1KV1A 3IDPA 3QTXA 1CE8A 3TW6A 4ZHQF 1KJ9A 4ITHA 3Q9ZA 4O2PA 3CY3A 3BHTA 3FC1X 4K33A 5EM7A 3TNPC 4XG7A 4D2RA 1MUOA 3F61A 4J8MA 3W33A 1W8CA 3VNTA 3ORMA 5GIOE 2OWBA 2B4SB 4BDEA 4IAIA 1MP8A 2XCHA 1P5EA 4Q9SA 4II5A 2XIYA 2O65A 4EJ7A 5C8KA 4R3CA 3FXZA 2OXDA 4FFLA 3E62A 2BPMA 3ZOSA 3Q52A 3C0GA 1KE5A 3QYZA 5A4QA 3R7OA 1WBNA 5E8VA 4O7YA 4I23A 4L00A 2LAVA 2OXYA 3BWFA 4FIEA 3OOMA 4CHIA 5HNBA 1WBSA 3RPRA 3GFWA 5K4IA 5E9EA 1G3NA 1EKFA 3FMMA 2VTMA 4X2NA 1ST4A 1FVVA 4YBKA 4DE4A 5A4EA 3HRBA 5BV3A 3EN5A 2XUUA 1Q5KA 1LEZA 4GJ3A 2PMOX 3UO5A 4O2ZA 2ZDHA 4FIJA 5DISC 5IA2A 1B39A 1UNHA 5IG1A 4YTFA 3O96A 1BL7A 3F82A 4M13A 2W1DA 3TNHA 4U79A 3D83A 2QG7A 2X8IA 3ZSGA 3PG1A 3G33A 1EHIA 4R7IA 4DC2A 5BVOA 3VBTA 4I4FA 2HOGA 2AUHA 2ZV9A 2OI4X 3COIA 4JBPA 2BDWA 1XH5A 5HCXA 1FBNA 2XK3A 3FYKX 1O6YA 3V8WA 3DKCA 3FMDA 4AXDA 2CGWA 2ITTA 5FLFA 4YR8A 5I9YA 5B2MA 4KABA 1KC7A 4UZHA 4TV9F 5E4HA 2BAJA 5M07A 3TM0A 1R0PA 4R1YA 3TTIA 2OZAA 2QOIA 2XRWA 2JKOA 3WWHA 3KIOC 1H0WA 4K77A 4OBPA 5CQUA 3F66A 3VF8A 3HMPA 3NR9A 3ODYX 1B6RA 2HGSA 3N51A 3AG9A 2VAGA 4U97A 2BRHA 3ZEPA 2IZUA 3R83A 1WBWA 5IUIA 3VULA 3AD5A 4TKSA 3T9TA 1J1BA 4CD0A 5B2LA 4EEVA 5LOHA 3LMHA 4GV1A 1KJIA 5HORA 5JVDF 1P14A 2ZGIA 2GS7A 4FSZA 3F2NA 3LHJA 3FMKA 4FMQA 4NCTC 4JT3A 3IW5A 4FKTA 1VJYA 2CSNA 4PV0A 5HE0A 4O83A 1Y6BA 4ASEA 3O7LD 4L9IA 2YM4A 3D9VA 2GLTA 4XV9A 2OO8X 5BVEA 5C01A 4YO4A 3JRWA 2VWXA 4RPVA 2GQSA 4IJPA 4KIQA 1YKRA 1EZ1A 1H1PA 2H6DA 4BZOA 1SNUA 2CCIA 1VYZA 4AZVA 3QAME 1L3RE 2GFSA 4CFFA 1YVJA 4O4JF 4ENXA 4W8DA 5IQGA 3SX9A 5JQGF 2GS2A 1NVSA 2JIUA 3AGLA 3VS2A 4J71A 1SVHA 4PL3A 5LYJF 5E8WA 1YHVA 4ZIMA 5DR9A 5LXTF 3PPJA 1T46A 1XMLA 2W05A 2OJGA 3R1NA 4IHPA 2VUWA 3PPKA 5AV2A 5EDRA 1W96A 4U8ZA 5L2WA 2ZB1A 4IW0A 3G0EA 3MFSA 1KJJA 1URCA 4HNTA 3LCKA 2E9PA 3WI6A 4ANQA 3PY0A 5AP5A 1JKJB 5IYZF 3BYMA 4RG0A 4B8MA 1YXVA 2H9VA 2IPXA 3ORNA 5JRSA 3PPZA 3HMMA 4G5PA 4YBJA 3O71A 3UE4A 2QLQA 1HCLA 1JQHA 2PVHA 2VTLA 3BCEA 3ZSHA 1KE8A 3FSKA 4UXQA 4OTGA 2J51A 2PMNX 1Y91A 4L44A 4BDBA 1GAGA 3G8CA 2AC5A 4EOQA 5M56A 4ZOLF 1MRYA 5HVJA 4WD5A 4YB8B 2O63A 3ORXA 4C33A 3SD0A 3EYGA 2EJ3A 3U9SA 2HY81 2WMUA 1OGYA 3DZOA 4V0GA 3VQHA 2PPQA 2VWIA 3UTOA 4CNHA 2DZDA 3GP0A 3AGMA 5KBRA 3AC3A 4IM0A 5EYKA 3RNYA 4PZ8A 2B7AA 3OBGA 4O96A 4PL5A 5A46A 5EI8A 1WRVA 1XHAA 4RFMA 3VRZA 2JBOA 3KULB 4O21A 4ITIA 3QD4A 3R04A 1WVXA 1ST0A 1PXOA 4KD1A 4NJDA 4IWXA 4XUFA 4I5CA 1RJBA 1LUFA 3KRJA 3CGOA 4IVAA 4F0FA 3HA6A 4QQ5A 5BNJA 1ZZLA 2J90A 2XF0A 2YM8A 2WHBA 1CKJA 3OMVA 4X7QA 4YTIA 4XMOA 4AA0A 5HO7A 2A1HA 2OLSA 3GT8A 4BCGA 3E8NA 3MSSA 3PJ8A 4QEBA 2NO3A 4OLIA 5AP3A 2PZPA 3ELJA 3ORIA 4YJPA 4YU2A 4BIEA 2X81A 1PYXA 5J9LA 2EIYA 3KN5A 4V01A 2XAMA 4IB0A 3L9MA 2VO3A 2WU7A 1WZYA 2QF7A 5IMEA 4RJ7A 5ETCA 2X8DA 2XIRA 3DNDA 3HO8A 3U54A 4E5WA 2ONLA 4Q5EA 3E7VA 4WSYA 4F78A 3EQDA 3CD8A 3SXSA 3NZ0A 1CDKA 5C4KA 1UC8A 3GOPA 3HEGA 3KVXA 2YCSA 5DGHA 4JI9A 2BAQA 4MNEA 1JNKA 4ARKA 5HI2A 3UOHA 1G8AA 3VC4A 4DH3A 1FINA 2EXCX 2F9GA 2PUNA 2DWBA 5HGIA 1R39A 5AIKA 3V01A 3NUNA 5C27A 3KB7A 2GNGA 2UZBA 3LZBA 3QQLA 4BGGA 2WQBA 3IGOA 2YCRA 3LCDA 2RIOA 4EWHA 1M0TA 3D15A 2HJWA 5LVOA 3C4WA 2I80A 3FLQA 3PRFA 1UA2A 1ZRZA 4BTKA 4KSPA 4CFNA 5IDNA 5CZHA 4ZMEA 3NX8A 5CAVA 1I1LA 2PUIA 1B6SA 2W1CA 3COMA 5D41A 4F65A 3TY9A 5DH3A 4Z3VA 5FGKA 4FTAA 3Q9XA 2VQDA 3C51A 2R7NA 4ZSJA 3M11A 4DLKA 4PMMA 3SA0A 3N9XA 2W4JA 3NSZA 4G3EA 4IWDA 3V51A 4HZSA 1RDQE 2W6ZA 2GQRA 3OW3A 3T9AA 2PVFA 5JH6A 5IZFA 4YHTA 2EB2A 3F7WA 3E3BX 4WNOA 3LFAA 4HR7A 1WFCA 4XP2A 3NUUA 2WZJA 4FZ6A 3FKOA 5I9WA 3BE2A 4UWBA 4O0UA 5DRDA 1ZYSA 1E1XA 5AAEA 2WTDA 2XMYA 4MV8A 3P5KA 2NRYA 4LL5A 1IRKA 1T45A 2I1MA 3DKFA 4APCA 2VTJA 4DHJA 2UW9A 1OL6A 2V0DA 3OCGA 2Y4IC 4FG8A 4NZWB 1KSWA 1MQBA 1DGSA 3QCSA 3CY2A 4MV1A 3PIZA 1W83A 4IQ6A 4FSWA 4OTHA 4TWCA 3GJXB 3R8UA 4D5HA 3EKKA 5EYCA 2W5BA 4WHZA 2QOBA 2QURA 3ZZWA 5HLNA 3JR1A 1I7LA 1H28A 3E5AA 4QMOA 5C03A 1Y8GA 2C30A 3MWDA 3BI6A 3RCJA 4ZI7F 4RIXA 2J6MA 2XAOA 3W8QA 3VRYA 4G5JA 3Q1KA 1TFFA 2EB3A 3EQHA 4JBOA 4XOYA 4MXAA 4CGAA 2WAJA 3LFFA 2C6LA 1IEPA 2E9UA 3I6WA 4KWPA 2IW8A 3LLAA 5FTGA 2YIWA 3AD4A 2CDZA 2XK8A 3EN4A 3H4JA 4FYOA 4LRMA 4NM0A 5FUTA 1CKNB 3LQSA 2IWIA 3R1YA 5EQPA 4ZLYA 5DWRA 4C35A 4DTAA 4Y8DA 5AJQA 4F09A 3Q9YA 4IVDA 3LXNA 4O0YA 3C7QA 5KHXA 3LQ5A 3W2RA 2XCLA 4QMZA 4NFMA 1PMUA 3BIZA 4F0GA 2E9OA 3KXNA 3R9OA 3BU3A 1KTAA 4N57A 2PZRA 5H8GA 4DDIA 2OKRA 5BUEA 3U9CA 4EUTA 4MK0A 2CPKE 3QCQA 2C5XA 3MH2A 5TF9A 2F2UA 3BYVA 3T8OA 3VHEA 3ZZEA 5E8SA 3MJFA 3PVWA 1SM2A 2WEVA 4K8AA 1QPDA 4MD7E 3HAMA 4KAOA 5JEBA 1KJQA 1V0BA 2ZMCA 4KRDA 5G6VA 3HMOA 5ANEA 4ME6A 5DR2A 3EQCA 3MTFA 3P86A 4F64A 3WILA 2ZM3A 3TZ8A 3ORPA 4IIRA 4E4MA 1WVYA 4RWJA 5J9ZA 5DPVA 5EQYA 5JGBA 3I5NA 5LVNA 1Q41A 3VBWA 4ANMA 4B0GA 3Q32A 4WIHA 3P9JA 4FTRA 4EBVA 4EHZA 4S32A 4F7SA 4EG0A 2AYPA 3NW6A 2CNQA 1OB3A 3UPZA 3RPOA 4IACA 5EKNA 3MN3A 3PIYA 5IQFA 5KMMA 2C6OA 5EDQA 3R01A 1ZMVA 3VBVA 5CXZA 1OITA 3PSBA 3OTUA 3C5UA 3F3ZA 3PTGA 4UCVA 3QL8A 4DEDA 3QFFA 5AUZA 4BGQA 1Q24A 4F0IA 4X3FA 5ICPA 3MPTA 3QHRA 4FZDB 4D1ZA 3DTFA 4M12A 2UZEA 2Q0BA 3FI3A 4MV9A 4AOTA 2YS6A 4I6LA 4AXFA 3E63A 2R87A 4AU8A 4WNMA 2ZDUA 3HYHA 3R00A 4O2AF 1BI7A 3NYNA 4M67A 5E8XA 3T3UA 2BIKB 4HW7A 5A4CA 5M08A 1XDNA 3VJNA 2PVPA 4CKRA 3H10A 3ZYAA 2AEGA 4HNVA 3MYGA 3P0MA 2QVSE 4YHFA 3KK8A 2COJA 2BTRA 4HCTA 2QO2A 3WWJA 2C0OA 4MV4A 3O23A 2ERZE 5LVPA 2I6LA 3FMHA 3MPMA 2W1FA 4ZTRA 3F88A 4AGUA 2QO7A 3R23A 4YLJA 3ZUVA 4D4VA 3CC6A 4Y73A 1PMEA 3TKHA 3QRJA 4K6ZA 2PSQA 1XBCA 1YDSE 1B6CB 4YJ3F 1UKHA 4QYGA 1R78A 3GLKA 1V0OA 2FPGB 4FTTA 3WZEA 2OIDA 2YJRA 3EOCA 5DLSA 1XH4A 4O0RA 2XRUA 1IOWA 1PXPA 5T3QA 4YNEA 4LDTA 1TVOA 3QU0A 3VW8A 3ANQA 4FK3A 4IAFA 1OL5A 1P16A 3MJ1A 4DFZE 3BACA 5LP6F 3U51A 2VO7A 3IDBA 3MPAA 4GKHA 5ANDA 3V3VA 4EH5A 5IH4A 3PN1A 3R02A 5HIEA 5KKRB 2V7OA 3B8QA 4F6SA 3TY8A 2GHGA 3R21A 4CMOA 4CFVA 4K1BA 5GIPE 3DBEA 3L9NA 3TNWA 3TIZA 5JRQA 3LMIA 4RZVA 3MH1A 3S1HA 4EK3A 4YJVA 3UP2A 3A4PA 4TYJA 4NWMA 3N4TA 4L3PA 3LFNA 3QD2B 2Q2UA 3CCNA 3MH3A 2HZ4A 3FXWA 3SC1A 3VBQA 2ZFYA 4D55A 4FU0A 5ANGA 1ATPE 1X8BA 4BHZA 2FSTX 4Y5QA 3TIYA 3TZ9A 4BRXA 5EI6A 4IWYA 4IC8A 3RAWA 2X4ZA 4JG6A 3GU4A 4L7SA 5CSVA 5DG5A 3S4QA 3SRVA 1PYEA 4FNXA 2J4ZA 1BI8A 3QLFA 4LRJA 4BI0A 4PZ7A 3LAUA 2RG5A 2XJ0A 4RZWA 2OJ9A 4QRCA 3JXWA 3NYVA 3WF6A 5IA4A 1DAAA 4MKCA 3EQBA 5BYZA 3UPXA 2PE1A 2R3FA 4KS8A 2P55A 4QMPA 3WYYA 2YRXA 4CV9A 4YTCA 3UNKA 1FGKA 3ALOA 4XG4A 1DIKA 3T7AA 4I21A 1E9HA 2QKWB 2Y4IB 5IH6A 3VS0A 3VNNA 4FX3A 3BE9A 4IZYA 1DI9A 3HL7A 4CKJA 4ZLOA 4J52A 4M14A 3U87A 4ZSGA 5FEQA 2R3IA 2W1EA 2VV9A 3FMNA 4EOPA 2R3QA 4FFPA 1SCUB 3FI2A 4OT5A 3UZTA 1F3MC 4FSTA 3VVHA 4AOIA 2XD4A 5TKDA 1Q3DA 2WU6A 4FV6A 5AWMA 3SAYA 2NUAB 5HG7A 1GZNA 4EZ5A 1PKGA 5CASA 3UODA 1H4LA 4IHJF 3KXGA 3H30A 4LV8A 3LM5A 5HCZA 5LXMA 4L1KA 5DFPA 1M14A 4TL0A 3PE2A 3Q04A 2QD9A 4L42A 2WTIA 4F7LA 1KE9A 2ITOA 5IQBA 1G8JA 5A54A 4QQCA 3QKMA 4QMYA 2O0UA 5E8ZA 4IWQA 4LI5A 4X2JA 4X3JA 3HT5A 1A48A 4U0IA 1I09A 2I0YA 5BVWA 5EH0A 3RINA 3IW4A 2HWPA 4DAAA 1A9XA 4QP1A 5IUHA 4IMYA 1CKPA 4CZUA 4O27B 2VX3A 1PX2A 2X7OA 4R7BA 5CEOA 2B9FA 2PZ5A 3P79A 3CEBA 4BI1A 4GU9A 2UZVA 1ERKA 2YRWA 5HX8A 3OY3A 4RJ3A 5C8YF 2OLCA 2WTWA 4TW9A 5AA8A 4EOMA 5DR6A 3RFCA 2JDSA 5FTOA 2W17A 5D7AA 1W98A 4PNIA 3IW7A 1DS5A 5JZJA 5ITAA 2HCKA 5AUUA 3EFJA 2Y9QA 3DBDA 1P8LA 4Q4DA 4GVJA 1ZAOA 3K3PA 3OFMA 1ZARA 3MFUA 2E9VA 2XCKA 5L6PA 5AIRA 3G8DA 2RKUA 1M17A 4IIJF 1U5RA 3NW7A 1MQ4A 5CVFA 2ZV8A 4D2SA 4CLJA 1Z5MA 4BY9E 3JZFA 4IDTA 5LVMA 4LQMA 4E6DA 5CVHA 3Q6WA 3I4BA 4J96A 4QMWA 4RVLA 1OL2A 2QKRA 1QMZA 3MJ2A 4XYLB 3KREA 3KRLA 2UZOA 1RQQA 4LMNA 4BCQA 1BLXA 4O7VA 3AKJA 2YZGA 5DMXA 2IW6A 3M1SA 2YFXA 1DI8A 3BHYA 1M0WA 2F49A 3K3IA 4FE2A 4G6NA 4EBWA 3GNIB 2Y4PA 4XOZA 2PULA 2HDKA 2YABA 3BGPA 4V05A 1G5SA 2QB5A 4RRVA 2W1HA 2J5EA 3SV0A 2PUPA 4O4LF 3RHKA 3MBLA 2GNJA 2X2MA 2RFEA 3EYHA 3LCSA 4XP0A 4IJ9A 4X2KA 4O7RA 3GCSA 3L9PA 2FGIA 3A99A 3UMWA 2F7EE 2JLDA 4M3QA 4AQKA 3WO0A 3PXYA 4NZMA 2YIYA 3C5IA 3MV5A 1VYWA 4MXYA 1A06A 3V6SA 4AFJA 2PU8A 2WXVA 2C4GA 2UUEA 5DYJA 2E2BA 4DT9A 5K4JA 4QMSA 4C0TA 1ZYLA 4QDVA 3TIGA 3OW4A 5AP1A 2KTYA 4FL1A 5IQHA 2W6OA 3OWKA 2BROA 3PUFC 3F5UA 1V1KA 3PWDA 5ACBC 4CKBA 4FV4A 4GU6A 5L3AA 3EFWA 3LM0A 4FSNA 4MD9E 3FL5A 2C6DA 5CXHA 4GUBA 4JOAA 4TNDA 4YJTA 2WMAA 4EOOA 4XG3A 5C26A 3IKAA 3QX4A 2A4LA 3R5FA 2YM5A 2X7FA 3VPBA 2ITPA 2QHNA 4DFYA 3L8XA 5C4LA 5CI7A 3KA0A 1C30A 2DIKA 2VO6A 4UZDA 3EQGA 2HG8A 3FMEA 3LJ0A 4C34A 3EN7A 4RX9A 2YN8A 3PLSA 4I6HA 4ZSAA 3TUCA 4PY1A 3E88A 1KOAA 2PK9A 3LCTA 3PZEA 4ZP5A 3REPA 2YERA 2YIQA 2B9HA 4R78A 4IX6A 2W4OA 1BKXA 3R1SA 2W5HA 4XCUA 5D12A 2XBAA 2R5TA 2E9NA 2X7GA 3CE3A 2YA9A 4FKIA 4O91A 1GIIA 4O7WA 4OTFA 3IOPA 3JY9A 3S0OA 4C4EA 3W5OA 4I5MA 4RA5A 2YZLA 4R7HA 2GNIA 4FEUA 5HG5A 4FTKA 2C3JA 3RI1A 5DBXA 5D7VA 2OXXA 3UG2A 4RMZA 4BBMA 4G9CA 3R9RA 2NU6B 4XV3A 4ZZOA 4MYGA 3DF7A 3VO3A 3BKBA 2W7XA 4YO6A 4U80A 4JIKA 3MFTA 4ZTLA 2PMIA 5JGDA 4TZRA 4M9UA 4JNWA 3OC1A 3QZHA 5K9IA 3LJ1A 4HOKA 3IPHA 4G3CA