1OBDA

Saicar-synthase complexed with atp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
303
structure length
298
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKADENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of Saicar-Synthase Complexed with ATP
rcsb
molecule tags Ligase
molecule keywords PHOSPHORIBOSYLAMIDOIMIDAZOLE- SUCCINOCARBOXAMIDE SYNTHASE
total genus 101
structure length 298
sequence length 303
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1obdA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1obdA02
5J9ZA 4DGGA 2GQGA 2NU8B 2YFXA 1FGIA 3KVXA 3U9NA 3AT3A 2QOQA 3BELA 3Q2OA 3ZDUA 2Q83A 2QO9A 5DR9A 1O6KA 3FJQE 4DEBA 3D83A 2OI4X 3MH0A 4O21A 5FUTA 5I4NA 4XG2A 4YLLA 3ZLYA 3P7CA 4BGQA 1YW2A 5CU3A 3EL7A 3UG1A 1K2PA 4GT4A 2REIA 4JDKA 1Q97A 5E8UA 2X0GA 5E9EA 1GSAA 4X7QA 5HD7A 4P90A 4DAWA 4O2PA 4FYNA 3U9CA 3RHKA 2PWLA 4DHFA 5IA1A 1XH5A 2OBJA 4NW5A 3PJ2A 4CKIA 3QU0A 3QX4A 2XKCA 4MVFA 3GCSA 2XP2A 3O7LD 4FZFB 3OUKA 3W16A 4DG0E 4C5CA 4IJPA 4BCQA 2VWVA 3GU7A 4NWMA 4DYMA 2B9HA 4NL0A 2XB7A 4PDOA 4YZMA 4AGUA 4JOAA 5J87A 3RAWA 3A7FA 4EKLA 2BRBA 3LFAA 5CALA 3EMGA 1CE8A 1I7LA 1MP8A 1PF8A 1VYWA 4EH5A 2VTTA 4Q2AA 2QLUA 3VULA 1GZNA 4G34A 4D1SA 5C8KA 4HVGA 5AV4A 5BVDA 4RIWA 3SAYA 5JQ5A 3QRJA 1U54A 3V3VA 4FIIA 5IDNA 2GNGA 2P55A 3CLYA 3FYKX 2F57A 1XH8A 3L8VA 2CPKE 4ACGA 2QNJA 2X2KA 4IWPA 2G1TA 4CFUA 4I5HA 5AM7A 5FP6A 4K11A 3EFKA 2QO2A 3K3IA 3HMOA 3OBJA 1Q8WA 4IAYA 1IA8A 1FMKA 3ALOA 5CAPA 4WHZA 1DAYA 1PXNA 1QPEA 3LPBA 3NSZA 3CY2A 4RA5A 4FKSA 5HBEA 2O5KA 2NRYA 3LVPA 4FTRA 4IW0A 2ZM3A 4KUJA 4A06A 3MVLA 4ZTSA 3WYYA 3ZH8A 5M55A 3POZA 3R83A 4MA0A 2I40A 2RFNA 4BRXA 3DKCA 3R63A 4JX3A 4RQKA 2OLSA 2X8DA 3DZQA 3WF7A 3ZSHA 4AZEA 2VNWA 4XX9A 5ANKA 5E90A 2JIIA 3QUDA 5LWMA 1BUHA 3MIAA 3Q4CA 3ZM4A 4JRNA 4G17A 5ANDA 5BPYA 4I21A 5HG8A 5JVLA 1Q99A 3FZ1A 4Y83A 5HE0A 1NVSA 3IECA 4M12A 4JS8A 4RBLA 4YLKA 3W10A 4O7NA 3KULB 3L9PA 1PXLA 3EKKA 4L3PA 4ORKA 4YZBA 5K3YA 2C6LA 4NM3A 2GHGA 1YXTA 2X39A 3IO7A 3QCSA 4FNYA 3S95A 3GIDA 2NU9B 3L1SA 3ZTXA 3R01A 5CX9A 4H36A 2BRNA 3EYGA 1H00A 5HTBA 2UZEA 4F7SA 4QQ5A 1OITA 4L42A 5DIAA 4BCPA 2R9SA 4O0TA 1GZKA 3AT2A 5AUVA 3U55A 3BU3A 2O63A 4C61A 1YWNA 5AA8A 2AC3A 4V01A 2OG8A 3ZZWA 4RJ5A 2ZDTA 3JY0A 2B0QA 2VU3A 3LXPA 4PV0A 4CSVA 3H9FA 3F7ZA 1PYEA 3D2KA 2W1EA 1E4EA 5E7RA 1NXKA 3V4ZA 4M7IA 4G6NA 1AGWA 4FKQA 2XCKA 4IZ5A 2BHEA 3U87A 4F08A 4F65A 3QD4A 4IWOA 3UZRA 1OBDA 4J96A 3BG5A 4GS6A 4QSHA 2W4KA 4J7BA 4KNBA 3BGZA 5EW3A 5KZ0A 2NNWB 3T3VA 1AD5A 2R3KA 3KN6A 5D10A 3S0OA 4A7CA 2QF7A 2YZNA 1JSVA 5LMBA 4LOQA 4IANA 4EH4A 2GNIA 4EUTA 3KRJA 1LEZA 1JNKA 4O6LA 4F4PA 4RJ6A 3ORRA 4FFRA 1JDEA 2VD5A 5FQDC 1B6RA 1OIRA 4DBNA 4O96A 3W8LA 5JGBA 3B2WA 3KEXA 2G15A 1P14A 3KMMA 2J5EA 3NLBA 3IGOA 4ZSEA 4E26A 2JKQA 4TUYF 2X4FA 3I79A 4DGOA 2HY0A 4O7TA 4HCTA 2CLQA 2Z02A 3MY0A 4O38A 2EB3A 3EFLA 3F3UA 2I6LA 2PZIA 4RVKA 2JKMA 3MGYA 4FEXA 4TYEA 4XLIA 5EYKA 2PZYA 4RQVA 3U8WA 4FTCA 4MNFA 1ATPE 3TV4A 3MVJA 3R8ZA 5J1VA 4IACA 4IADA 3SD0A 4RPVA 3E88A 1YOLA 3Q5ZA 3NR9A 5DGZA 5D41A 4M15A 4IVDA 2XMYA 4BBFA 3QQLA 1H25A 5KMMA 5H80A 3LJ0A 5IQFA 4DIMA 2ITUA 5AIRA 2YM4A 2E9PA 2ZDUA 2X81A 3IDBA 4AFJA 3TV7A 2OK1A 5HX8A 3DBDA 1IOWA 2YITA 4W4YA 1T45A 2GTNA 4GFMA 1OKZA 3PIXA 4DTKA 5IEVA 2WB8A 3HLLA 3IDPA 3LCSA 1PHKA 1U59A 4QYHA 2X2LA 2C6DA 3R1NA 3T3UA 3RPVA 4AP7A 3GB2A 3EQHA 3KULA 4FG7A 5DR2A 4C7TA 5CENA 5BYLA 4XOZA 2W5HA 2ERKA 2CNVA 4L53A 3P1AA 4IZOA 5C1OA 2ITYA 2VTRA 4C33A 4ZHQF 4I20A 3SG8A 3NUNA 4GUBA 2ZMCA 5CSPA 3KXGA 4PRJA 3TIGA 3N6RA 5IUGA 4U3ZA 3KCFA 4M8TA 2PE2A 3NUPA 5KKRC 4HVSA 3W8QA 5JGDA 2WHBA 3WO0A 4P2KA 1KV2A 2IVVA 4WBOA 5IF1A 1W93A 4X21A 5FXRA 2C6TA 4R1YA 3VJNA 3KF7A 4WNOA 4U79A 2WXVA 4JT3A 3HBLA 4ZJJA 4ANBA 3ZO2A 3ZRKA 1Q62A 3D9VA 4JQ8A 4XZ3B 4RWIA 5E1SA 3WZUA 3R9DA 4EBWA 4MTAA 1P2AA 3MWEA 4EHZA 3FKLA 1J7LA 2C3LA 2C5XA 3G6GA 4X3FC 1GY3A 2BFXA 2H6DA 3C50A 3II5A 3FE3A 5C8MA 3SG9A 3E5NA 3UFXB 3NDMA 3WARA 2B54A 3LMGA 3OWPA 5TR6A 2UZBA 3FKNA 4I5CA 2IZRA 4CMUA 4TYIA 2YAKA 2ITZA 2W17A 2QO7A 3LFEA 4FGBA 4IM2A 2YIRA 3QL8A 2GPWA 3HX4A 2V7OA 3OUZA 4GW8A 4ZTNA 2OWBA 3F2NA 2YYAA 1CKJA 5C4LA 2W9ZB 2IPXA 5EI6A 3A7IA 4PX6A 2J0KA 1WVYA 4QPSA 3JR1A 3VRZA 3FQHA 2R3JA 3P78A 4LOPA 2OH4A 5J9YA 2DZDA 2YAAA 2CSNA 2YIWA 1NVQA 3K5HA 4QMYA 4NU1A 4N4SA 3VPCA 2PBZA 4Q9SA 3PPZA 3M11A 5DFPA 2HW7A 4FKWA 3ZO4A 5M4UA 2E9NA 3GVUA 4I0SA 3GOPA 5AV3A 2B9JA 4FEVA 2VTNA 4ZS4A 3KRWA 1F3MC 3E64A 4BCJA 5AP4A 3PXFA 5BYZA 3OOMA 3UQGA 2JEDA 3NEWA 2FSOX 4CNHA 4DC2A 1MUOA 4YMJA 3R7VA 1YXUA 3RALA 3D4QA 4QTEA 3ZXZA 3R8PA 2ITNA 3DFAA 1ZYJA 4F9BA 4A07A 3DXQA 4E6DA 3PZEA 3QZHA 4E4LA 3H4JA 4FKOA 4L7FA 4RX7A 1KUTA 4YSJA 5L3AA 2YZMA 3UC4A 3RV4A 4N6ZA 4DLIA 1XKKA 3W2RA 4EZ7A 3WF6A 3GI3A 1Z57A 2XJ2A 4FKPA 3NIZA 3R5XA 4L8MA 4WNPA 3DKFA 4O0WA 2QKWB 5DI1A 3R71A 1WCCA 5FRIA 4ZSAA 4UYAA 4IQ6A 3BPRA 2ZM4A 4J8NA 4PNKA 5DA3A 4AF3A 5JQ8A 2ITXA 1IG1A 2WIPA 4KBKA 3ORXA 4XH6A 4CGAA 2I0YA 4C58A 2CJMA 4A4LA 5HNIX 5HNBA 3OF0A 4TV8F 3TT0A 3C4FA 1U4DA 3EFJA 4FT3A 3SHEA 4O2ZA 3FZSA 3LP8A 2XKFA 4M97A 3BCEA 5H2UA 4BTKA 5KBQA 4RMZA 5HO8A 4BGGA 5M57A 2BILB 2J0LA 5ETFA 1CSNA 3JPVA 2I1MA 3QTIA 4HCVA 1SMHA 5C26A 4HNFA 5I9YA 3GCVA 2JAMA 4ACMA 4D4YA 3CTHA 2UZTA 3TUCA 4R6VA 1NY3A 3F3VA 3KREA 3L8SA 5JFXA 1Z2NX 1OL5A 4B8LA 4YPSA 3V6SA 4FUYA 4DF3A 4HVHA 5DT4A 4NIFB 2R84A 4WKQA 3NIEA 4G16A 3MTFA 2JGZA 2C1AA 3DNDA 3ODYX 4ZZMA 3UMWA 4EJ7A 3S3IA 1GSOA 4RIYB 3W2CA 3TZ8A 5E8YA 3U9TA 5CA0F 2GPHA 2WTIA 4IAFA 3UMXA 1XJDA 2VWIA 5J5SA 4G3CA 1TVOA 3JZFA 4BYIA 2XNMA 5IMXA 3OY3A 4O83A 2PE1A 3LW0A 4G9RA 2XNNA 3EH9A 3GC0A 2A19B 4S32A 4AW5A 4F09A 3AT4A 4ZY5A 3S00A 5IA0A 5AP2A 2OFVA 2XJ1A 4CFFA 2NUAB 4N6YA 2J6MA 3G0EA 2W5AA 4O2BF 4Y46A 4EZ5A 3DTWA 4QTAA 3ZLXA 2DIKA 3NAYA 2WEVA 5HBJA 3ZFXA 4CKJA 4CT2A 4M68A 2VTMA 2W7XA 3RP9A 2WTDA 4BZNA 2FO0A 5CY3A 2VWYA 3QA8A 5E8SA 3O7LB 5HIBA 4DFLA 5I9VA 4FFMA 5B2KA 5H9BA 4M3QA 3Q9YA 3HO8A 3EN7A 3IPHA 4NFMA 5CWZA 3FHRA 5ANOA 3Q9WA 3TJDA 2WMBA 3F82A 3TG1A 2WQNA 3G0FA 4MNEA 3HRFA 2G01A 3Q4ZA 3JY9A 4PTCA 5AAFA 1VEBA 2W71A 4FICA 4ZTMA 1UNHA 4MV3A 1FVRA 3NUXA 3R1SA 3BU6A 3PP0A 2EU9A 1F5QA 4G3FA 3BZ3A 2G2IA 4BDAA 4D28A 4EOLA 1W8CA 3R2YA 3QQHA 4X3JA 2VGPA 2UVZA 3AC3A 4JAIA 3IW7A 4D4VA 5E8ZA 4IAIA 4ZSLA 2R7MA 4XP3A 4GK3A 4U3YA 2ZV9A 1JKJB 2BAJA 4FSQA 4XV1A 1B6SA 5FM3A 4P4CA 3FY0A 3OROA 3OWKA 4ID7A 3HL7A 4NH1A 3OCTA 5HVJA 5DRBA 1CS0A 4E4XA 4O7RA 3L9NA 4I92A 3QXOA 4IBMA 3AC8A 2C69A 3JRXA 1BL6A 4FTNA 4YJUA 4MBIA 2PZRA 5EHLA 3AD5A 4USEA 2YZLA 1JDBB 3BHTA 3UOJA 1XH6A 1NA7A 3PZHA 2FPPB 1CQIB 2J0IA 4I6FA 4QP9A 3BKBA 3Q2MA 2UZDA 2XBJA 4AWIA 3LFBA 3TEIA 4L9IA 4JNWA 2OIQA 3MJFA 3PXZA 1M7QA 4G3GA 3AC4A 4BDIA 4YJTA 1YRPA 3RGFA 4P5QA 2XF0A 1XBBA 2ITOA 2FVDA 3EN5A 4L67A 3E8EA 3VW8A 3WIGA 4DEIA 4MV8A 1HCLA 3SC1A 3GNIB 2UW5A 3HB9A 3VBWA 1XR1A 4ZMEA 2OICA 2QD9A 4X6QC 4IB0A 4E1ZA 4QMQA 2P0CA 4ERKA 4RG0A 5J9LA 5EQEA 3TXOA 4AAAA 4L52A 4QO9A 4FI1A 3VBYA 4AOJA 4U97A 5ACBC 4TYHA 5DLSA 3OUUA 3RV3A 3HDNA 4M69B 4BCHA 2J50A 2RIOA 4OBPA 3LWBA 1SNUA 4OTQA 3FSFA 2I7QA 3ZYAA 1M0TA 5J2TF 5J7HA 4IM0A 3IQ7A 5HNGA 3MFRA 1Y8YA 3AMYA 5AMNA 2VX3A 5K9IA 5F94A 3IG7A 4EK8A 4EGJA 3P79A 4D58A 5KMJA 4CZTA 3PDTA 3HUBA 1YDTE 4FX3A 2O64A 3BEAA 3G15A 3R1YA 1SM2A 2RL5A 2QHNA 3PY0A 4C4EA 1XBAA 2V22A 2Z7SA 3QTZA 4AQCA 1OPLA 4EC9A 3ZFMA 2V55A 5FEEA 4II5A 4DH3A 2QOKA 4FL2A 3POOA 2YZAA 5CF6A 4OUCA 2BVAA 2KTYA 4GK4A 2OW3A 3KRRA 2VTOA 2JDVA 2ONLA 5C4KA 5CEMA 3U51A 3O8TA 4CT1A 4KABA 4OTHA 2UZOA 5GONF 2JDOA 4ZP5A 5AV2A 3LIJA 4KKEA 2JKOA 2OKRA 4QMXA 4M9UA 2FUMA 2V5AA 2GNHA 3BHVA 4KBCA 4GFOA 4UXLA 4AXAA 5I9XA 3GC9A 3AQVA 2W9FB 3FI8A 3O96A 4F1TA 5IQBA 4V0GA 2HJWA 2XCHA 2GLTA 5GHVA 4AW0A 1GAGA 2WMVA 4W4XA 2J90A 4AOTA 2PYWA 4EONA 4YUQA 3E87A 3P7BA 3WE8A 3VS2A 5EK7A 5GIPE 1YHSA 3MY1A 2Z7QA 5CT0A 1BMKA 5D7VA 2V62A 3ZMMA 4TYJA 2BTSA 4KD1A 4NFNA 5BMVF 1J91A 1WBTA 3EN9A 3IW5A 3PRIA 4PL5A 1WBOA 3PVGA 3NPCA 3LKMA 2JFMA 4LGGA 1PXKA 1PXJA 4IVAA 4RJ7A 3UOLA 4AE6A 2R64A 2XYNA 1Z5MA 3JVRA 2I0EA 4EI4A 3UTOA 5HD4A 1I7NA 4KS8A 2ITVA 1FGKA 5J8IA 3E8DA 1ERKA 1XH9A 5HG9A 4FFNA 3QD2B 3UE4A 5IZFA 5HV6A 3OD6X 2R85A 1WBPA 5HBRB 3IDCA 4TKSA 3DK7A 5I9ZA 2IZSA 2XIXA 4PMSA 3ATSA 3OEZA 3MS9A 4ZLOA 5D8DA 4EK4A 1P5EA 3DDQA 3KVWA 1SVGA 3RPSA 4DGLC 1OGUA 3NCZA 1HCKA 4TWCA 5FLFA 1SZMA 2QG7A 3DOGA 4BDJA 4L6QA 3BYUA 4U6RA 4OW8A 4BCNA 5IQGA 5CAUA 5F20A 4C38A 3R7OA 3D94A 4ALWA 4F0IA 2YM8A 4L1KA 2JBPA 1W0XC 3LXKA 2OF2A 4AT3A 3IK3A 3LMHA 3UQCA 4MD8E 4MKCA 2G9XA 3R8VA 4YURA 2PPQA 3MV5A 3ZS5A 4AGWA 2GPSA 2PMNX 1BLXA 3OW4A 2YABA 4U44A 4C0TA 2XIRA 3FLSA 3BHHA 5EM5A 4J53A 2GS2A 1Q3DA 3SXSA 4C3RA 1KE9A 3NNXA 2R3NA 2UW8A 2W6OA 2ZV8A 1UU8A 4FL1A 4IX3A 3VAPA 3CQUA 2HZ0A 3HVCA 2QHMA 2ETRA 3GCUA 3NWWA 4DFZE 2F7EE 1M0WA 1ZZ2A 5GNKA 2P2HA 3PE1A 3LXNA 5DMXA 3EJ1A 4U8ZA 1QMZA 3MTLA 2X6EA 3DQWA 4GKIA 4IB1A 3ZLSA 3TKIA 5CAOA 4U80A 5DH3A 5LXTF 4LI5A 5KHWA 1O6LA 4J98A 1YHVA 2BZJA 4R7IA 4UWYA 2R7IA 4X2JA 2W6QA 4TYHB 3TM0A 2C3JA 2W1IA 4O2AF 1C3OA 4O7LA 5HIDA 4TZRA 1Q8TA 1PX2A 3PIYA 4OTRA 5AFVA 3ZXTA 3A7HA 4F9CA 3RCJA 2F4JA 3MY5A 2QVSE 5A6NA 5IPJA 2IWIA 4MYGA 3NMUF 4RJ8A 3R6XA 4M84A 5CYIA 3PTGA 4ZZOA 3N8DA 4IIJF 3VOTA 4XG6A 4V04A 4YJSA 2RG5A 3BQCA 2F7ZE 4RLKA 4TWNA 5BYYA 5CLPA 5HQ0A 2OSCA 5KMNA 5AUWA 3UZPA 3TV6A 4YAKB 3P4KA 4Y8VB 4JL9A 2H9VA 3RNIA 4BR3A 3GQIA 5K4JA 4EGQA 4C4FA 2XIYA 4RX5A 5EKNA 4MAMA 5HI2A 1ZMWA 4C2WA 3Q9XA 2YW2A 4FZ7A 2UZNA 4F0FA 4AT5A 1MQBA 5L2SA 2QK4A 2I0VA 3DCVA 4H05A 3RAIA 2HELA 5C8NA 2Y0AA 1R1WA 4BI2A 1S9JA 2X4ZA 3O23A 5AWMA 4UWBA 4BI1A 3LCKA 5DT0A 1BYGA 2PZPA 3D14A 4BN1A 2XM8A 3CCNA 2X9FA 4WUNA 1OIYA 3W2PA 3FBVA 3GC8A 2W1GA 4EL9A 1GNGA 2BKKA 2OXXA 2W1ZA 5HCZA 1MQ4A 4IX5A 5M06A 4X2NA 5BVEA 1F0QA 4KS7A 2YL2A 2ITPA 4O7ZA 4IX4A 5EDQA 4FG9A 4FR4A 5FGKA 5KHXA 3ROCA 1OL1A 3SDJA 3TW6A 2PVRA 2EVAA 2UW3A 1LR4A 2ZDQA 2YIYA 2ITQA 3ENMA 3PIZA 4FTQA 5CEOA 4AZWA 4O4HF 3K5VA 1OBGA 5HE3A 1SCUB 5DHJA 3NCGA 1XWSA 4MEDA 2XK4A 5FXQA 3R21A 4EH2A 3DNEA 2W0JA 5IH6A 2W6NA 3UNJA 2VAGA 3QBNA 5K4IA 1LPUA 4KKGA 3V8WA 4RWKA 2X8IA 3SKCA 4ZK5A 4DFUA 1G3NA 5L8JA 1WVXA 2R3FA 3NVKI 3P5KA 4MV1A 4FZDB 4BY9E 2EXCX 1XBCA 4YJRA 2W1FA 4BDCA 4KIOA 3U6JA 5AEPA 2AC5A 2BUJA 3ORIA 4HYSA 1UKHA 4UALA 5CEQA 5JH6A 2XBAA 3CEKA 3FZTA 3LCDA 4U45A 2YRWA 2BCJA 4XRLA 1UWHA 5DG5A 3UO6A 5EYCA 1B6CB 3P23A 2R86A 2Q0NA 4A9SA 4ENYA 3KRLA 4CLIA 5EW9A 3A8WA 4FA2A 3QZGA 3WO1A 4YC8A 2C5OA 2JIVA 3IW6A 4L44A 3A2CA 4R7HA 2FSMX 1YI3A 2ZB0A 5JMSA 4QYGA 3TIIA 1RQQA 5CI6A 4F7LA 3LCOA 5CAVA 3PPJA 5T6KA 3PG3A 4C35A 1IAJA 2Y6OA 3C9WA 2ZV2A 5LQFA 3PA5A 4FBXA 4H58A 5EZYF 4XV9A 2B9FA 4ME6A 2OXDA 4G5PA 4L3LA 5LOHA 3BYOA 4IMYA 4NM5A 5KMIA 2OJ9A 1YWRA 2X6DA 4QP1A 1G8SA 3ZEWA 3QKLA 4EWQA 3GC7A 1WBWA 4M67A 2DQ7X 5BQ0A 1ZARA 3SRVA 3ZRMA 2C0TA 3V5PA 4FV0A 2A0CX 4CFVA 1Q61A 1PMEA 2YIXA 5EOBA 3H9OA 4F9AA 4WNKA 2ZVAA 3G9NA 4FSWA 4V05A 1M7NA 2PVMA 4G6OA 4L45A 2BALA 2QOOA 5HG7A 5CXHA 2F2CB 2J51A 3QTUA 4MV4A 2R3OA 3BI6A 4DG3E 4V0GB 2QR7A 4DH8A 3DLZA 1QCFA 3KK8A 5JN2A 4FIJA 3ZSIA 5KKNB 3SXRA 3WBLA 4A9UA 4RVMA 2ZM1A 4DINA 4YHTA 3THBA 5A4QA 4CTBA 4EH6A 5AAEA 4DG2E 2RF9A 4RC3A 4E4MA 5KMLA 2QU5A 4HGSA 4JX7A 3ITZA 4YZCA 2QONA 2CCIA 3VW6A 4B6LA 2BKZA 3FC2A 3GGFA 3L9LA 2W5BA 4FG8A 3TIYA 4HZSA 2VQDA 3HEGA 5DT3A 5LVLA 5M4IA 4LUDA 3A99A 2Y4PA 4FL3A 3ZCLA 4J1RA 5BX0A 3S2PA 4OT6A 5T3QA 4MV6A 3MH1A 1QL6A 3ETAA 5DPVA 3NX8A 2UW9A 4LYNA 3R22A 3L8PA 4U7ZA 3UC3A 4ASZA 3MJ2A 4D5HA 4BCOA 2BDFA 2QLQA 4ANMA 4BICA 3F66A 3OXIA 1JKTA 3A4OX 4KIPA 3VS7A 2QOBA 4X3FA 1ZLTA 3GCQA 2ETMA 3DTCA 2XVDA 2Z7LA 3R1QA 3TKHA 5DE2A 5AX9A 4DH5A 3PJ1A 2IN6A 4XYFA 3HYHA 3Q6WA 4IAAA 2R82A 1MRYA 4K77A 3UIMA 3UNZA 5I9UA 5LVOA 1A06A 4GG7A 4QTDA 4ANSA 3R7YA 5TOZA 4A9TA 4UEUA 2W96B 3GCPA 3P7AA 3CXWA 1MRUA 3OEFX 4FV3A 1GZ8A 5D9HA 2BR1A 5TF9A 4QOXA 3ZBFA 2WTKC 3H10A 3AC1A 1Q8YA 1M2PA 2XNBA 4LV8A 4DLJA 4NT4A 5A4EA 4BZDA 1UNGA 4ZSGA 4AZSA 3PWDA 4E73A 3UVQA 1H24A 2PULA 2W05A 4JQ7A 3T8OA 4JVGA 3AD6A 4MXOA 5A6OA 3G51A 3DQXA 2CLXA 5HG5A 1M6VA 2FB9A 3FLQA 2JBOA 2ERZE 3QCYA 4K33A 4K8AA 3FLYA 3R73A 3H3CA 3UYSA 1WBSA 3DKGA 3HRCA 2R0IA 3DGKA 1UVRA 3HZTA 5ANGA 2CDZA 2V58A 2ITTA 1DS5A 3OOGA 3PLAE 4WBNF 2VTPA 2VTQA 2WMTA 3NYVA 3SXFA 4EK3A 4E8AA 3BRBA 2FP4B 3RZBA 4F64A 2BAKA 3N51A 2DWBA 1L8TA 4OTGA 5HTCA 3ORQA 4IZ7A 2B55A 5BMMA 3V5WA 3R9RA 2R7BA 4PDPA 4EHGA 1BL7A 4JAJA 3RWPA 3W2SA 4YTIA 1DM2A 2A1AB 1YDRE 2BAQA 2JKKA 3NAXA 2FPIB 5KKRB 4KRDA 4RZWA 3FWQA 2YM6A 1YDSE 3E8CA 1Y8GA 4BDFA 2X0SA 4DFXE 1Z2PX 4IWDA 5F4NA 3A62A 4YJNA 3V4SA 4D55A 3BWFA 5CF4A 3FV8A 3PRFA 4E6QA 4XG8A 3VS3A 4NTSA 3DLSA 4IIRA 4IDTA 3NYXA 1YXXA 2BROA 4FSNA 4CFMA 4RFMA 5CU4A 5IA4A 2Z8CA 5AUTA 4K18A 1URCA 4PQNA 2BMCA 3AC5A 3ZHPC 2B9IA 2ZB1A 3FMNA 1DI8A 2J2IB 3UNKA 1C30A 4TXCA 3KF4A 2YCQA 3G5DA 3HV4A 3CTJA 3KGAA 5IUHA 4I93A 3ULIA 4EH7A 2W70A 3U4WA 2WMQA 4QQJA 3TNWA 1IASA 4QQTA 4AA5A 2H96A 3O71A 3NUYA 3O8UA 3LFFA 4FT9A 3ZC6A 4RX8A 3E7VA 2QCSA 3PJ3A 5FBNC 3EOCA 2W6PA 4M0ZA 4BDEA 3BGPA 3C4EA 3OP5A 4HYHA 2LGCA 4A4XA 2AUHA 5BVNA 3OWJA 1JWHA 3EYHA 2CHLA 4HVIA 3A7GA 2B1PA 5HU3A 5C03A 2RG6A 4IE9A 3RAHA 3SOCA 2I87A 2OJGA 4M14A 4D0XA 4WIHA 3EFWA 3R8MA 4QT1A 4BF2A 1Q5KA 5JKGA 4E5WA 3BX5A 3RTPA 3W1FA 4GL9A 2R7LA 1FOTA 2RGPA 4UBAA 5F9EA 4MXAA 2PUUA 3HMNA 4LUEA 1KWPA 4J97A 5HX6A 3LFNA 5AIKA 1PMUA 3F6XA 4NKAA 1KOAA 4KSPA 4HW7A 1WBNA 3QQUA 4L68A 4N57A 2NO3A 3PXQA 5A3XA 3NVMB 3QRTA 2PMIA 5A4LA 4RIXB 2WYOA 3HV3A 2J5FA 2CN8A 4BCMA 5B2MA 4E20A 1Y91A 3C0HA 5H3QA 1VJYA 3QF9A 5IQCA 2ZYBA 3OZ6A 1WFCA 5CU0A 3FZRA 2PUIA 1KOBA 3MDYA 4GVJA 4FUXA 4QYYA 4WT6A 3UP7A 1UA2A 4EUUA 2ZDHA 2G2HA 5EHYA 2VO0A 1FVVA 3VC4A 4DH7A 1PW2A 4S31A 2VTHA 3F5XA 3KALA 3ZUVA 5L8LA 5IQIA 4MH7A 4NM0A 4U81A 3A4PA 2YEXA 4Z16A 4F63A 5IQHA 3E92A 4YJOA 4O0SA 5CNNA 4MD7E 3TNPC 3UIBA 1W83A 3MVHA 1U5QA 1YOJA 3FMHA 4WG3A 5K5NA 5LJJA 1BX6A 3P08A 4LL0A 4MAOA 5AUYA 2IW9A 3MIYA 3P86A 5JQWA 4A9RA 4AG8A 4TN6A 3F69A 4DTAA 1PJKA 1FPUA 2VO7A 3BYSA 3W2QA 2OGVA 2OJIA 4ITJA 4RSSA 4TL0A 2XUUA 4JBOA 3U9SA 4RWJA 1Q4LA 4FEWA 3U6IA 3LFSA 4EH9A 1DV2A 2ZOQA 4ITHA 5E8XA 4NSTA 2VWWA 2CNUA 2R3LA 4Q9ZA 4E5BA 5FNVF 4XG7A 3AMBA 5TO8A 3S1HA 3KA0A 4L46A 4G2FA 3ALNA 4FOBA 2XA4A 1YHWA 3GFEA 3KN5A 4GIIA 4WD5A 2RFEA 3AGLA 4RWLA 2YZGA 1TQIA 4DLKA 3MB6A 3I7CA 4O0UA 3E7OA 1V0BA 4CMOA 1ZY5A 3FPMA 4L3JA 4HNVA 2XK6A 2X9EA 4FIHA 5FEQA 4AOIA 1YI4A 2OO8X 2XZSA 4JIKA 4RLLA 3R8LA 3W33A 4YZDA 4FV1A 3PE2A 4ZEGA 2OFUA 3PLSA 4IZYA 2WTVA 4R78A 3UIXA 4JDJA 3U6HA 2CKEA 4RFZA 3QFFA 4EOKA 1ZRZA 3D2IA 5HESA 3I0OA 4BDHA 3BGQA 4D1XA 2HOGA 3JVSA 4KIQA 4MBLA 1H1PA 4FTLA 1RW8A 4IX6A 5ETAA 5BUJA 2UZWE 2C3IB 5HCYA 3QFVA 3R8UA 2I8CA 1OI9A 5JQGF 4O0YA 4QMVA 3DBQA 2O0UA 5JT2A 2WNTA 3Q3BA 3JRWA 1YI6A 3K5UA 2C68A 5AJQA 4CFXA 3IGGA 3GOKA 3EQGA 1KJ9A 1BXRA 4HR7A 2VWZA 4Z55A 5HIEA 2R3MA 3E8NA 4O84A 2JDSA 3CD8A 3T9IA 5CEKA 3JZIA 1DAWA 3E3PA 5FDPA 1GSHA 3NW7A 4D9TA 4PP7A 2WMWA 2J9MA 3QZIA 2QQ7A 3PVUA 4PTEA 5E92A 3GUBA 1M2QA 3ZO3A 4OTIA 3K5IA 4D4SA 3OTUA 4XNEA 4HCUA 4CZUA 2CN5A 3RAKA 3I0QA 4IEBA 3O0GA 5LCKA 3TZ7A 4ZJVA 5AAGA 3WNZA 2H34A 5DVRA 4BHNA 2F9GA 3A8XA 3LLAA 2WU6A 4LMNA 4MWIA 4FV5A 3VWAA 3C4XA 3LM0A 2XNGA 3ZZEA 3GQLA 2GS7A 4WOVA 3EZRA 3EWHA 1YKRA 4FKRA 3OVVA 4JLCA 4FGRA 2W06A 4I4EA 1WVWA 2P3GX 4HPTE 4H1MA 4I5MA 3GU4A 5EW8A 2VO6A 5AP3A 1CM8A 4FKLA 3RK5A 4ASDA 3MWDA 4NTTA 1H1RA 2HK5A 2VWXA 5DRDA 4P5ZA 4F6SA 4YR8A 3UOHA 5CF8A 3QQFA 3F3WA 2HGSA 1UKIA 2P2IA 3MFSA 4J71A 4E6CA 5BPFA 4FV2A 2IVUA 4UN0C 2R3RA 3WZEA 3NGAA 1GZOA 4TYGA 3HV6A 2OLCA 1XH4A 4IC8A 4KINA 5HCXA 4XBUA 3O8PA 2FGIA 1OUYA 1J3HA 3CGFA 5DWRA 5CA1F 1U46A 2QU6A 4FSTA 4AN3A 3DAJA 2E9OA 4TWOA 3G6HA 5HZNA 3CE3A 3QTXA 4FSMA 5CANA 2W6MA 4C5AA 1PK8A 4WG5A 4GIHA 3UIUA 3O50A 5GIOE 4UWCA 3ORMA 3FC1X 4IDVA 1JBPE 3QALE 5EM6A 3FEGA 5F1ZA 3TQTA 3LMIA 4DN5A 2YA9A 4HYUA 3EQIA 3JYAA 4I6HA 4Y85A 4GT5A 3UYTA 5LVMA 4H3PA 1H27A 5HVYA 4XX0B 1VKZA 2CNQA 2HW6A 4ITIA 3MFTA 5DN3A 4ZSJA 5M51A 2WTCA 3PXYA 2O2UA 3AC2A 3DJ7A 4UYNA 4GYGA 4LL5A 4Y95A 3OCSA 1OIQA 3QC9A 3CP9A 1A9UA 3DBCA 5L6PA 1SYKA 4JG7A 4O91A 1KJQA 3BE9A 3FMJA 4FTIA 4C34A 2GSFA 1OECA 1KEEA 4XOYA 3V8TA 4AS0A 3NUUA 4X0MA 1H0WA 5JGAA 3PSDA 4BHZA 3PXRA 3FI4A 2CMWA 5LMKC 2G2FA 2R0UA 3KXHA 4YBZB 4I3ZA 3QKKA 4FZAB 3PVWA 5CZIA 4EHEA 2JFLA 4G9CA 4RVTA 3SRVB 2QURA 3U54A 4JG8A 3GU6A 5IA5A 3TI1A 4ASXA 2DLNA 2WELA 4FEUA 4K2RA 1ZYCA 2GMXA 3BLRA 3W2OA 2IW6A 5D1JA 3SX9A 4A4OA 1Y6AA 1QPDA 3ULZA 3NNWA 4EOPA 1CKIA 3MI9A 4K6ZA 5M53A 1M17A 4ERWA 2J0JA 4YNOA 3VBVA 3NYOA 4YJVA 2VTJA 1AQ1A 1OVEA 3FYJX 2C5YA 4GJ3A 5CVGA 3KXXA 3IKAA 3DAEA 5IEXA 1J7UA 3D5WA 3FAAA 3ZSGA 1LUFA 4AUAA 3TUBA 4IH8A 3DY7A 3KU2A 3OCGA 4ZXTA 4DT8A 1H08A 2FSTX 3VVHA 4CRLA 4DT9A 1GGOA 4E4TA 4PNIA 4G3DA 1W98A 1R0PA 5IQDA 2E9VA 2R5TA 3PWYA 3KQ7A 4XHKB 3CQEA 3MYGA 4E6AA 3FXWA 3CPBA 1H1WA 4FFOA 3PY1A 3ODZX 3OS3A 2C00A 4FVQA 3I6WA 4YP8A 3PVBA 4OLIA 2C1BA 3ERKA 4D0WA 4ZTHA 3MH3A 3DK3A 3ID6C 3ACJA 2JITA 3ORTA 4WRGA 2IVTA 2XH5A 4UZDA 2V5QA 2NRUA 4RRVA 5AA9A 4UV0A 1XHAA 4O27B 4CG9A 3I1AA 5L6OA 4Z7GA 3IONA 3DT1A 3C5IA 4I6BA 4B7TA 4EH8A 4FYOA 3FMKA 1TQPA 4FV6A 4MA5A 4G6LA 4LM5A 1FVTA 5DEYA 5AM6A 4YC6A 3EHAA 3HAMA 3AD4A 4GT3A 4O86A 2X7FA 1YXSA 4H3BA 4MXYA 3RMFA 4CMTA 3ZO1A 3AG9A 4BVUA 4ZY4A 2W4JA 2XIKA 3FZOA 3PG1A 4R3PA 3DBFA 4WSYA 4X2FA 4O6EA 4XS2A 5HO7A 3SOAA 5C1QB 2C6IA 3BWJA 3QUPA 4AA0A 3BU5A 3BIZA 3H0YA 4LOOA 1XO2B 4IWQA 5LVPA 1M2RA 4OGRA 4AW2A 3NNVA 5AP0A 2OIDA 4MNEB 3RHXA 4B99A 1KV1A 3QD3A 3QRKA 2B52A 3EZVA 4U0IA 5IU2A 4GCJA 5HHWA 4OT5A 5J1WA 4PL3A 4FKUA 4I0TA 4C3FA 1VZOA 4ARKA 5AP6A 4L43A 4BDBA 3I5NA 2W99B 3C0GA 2JIUA 3JS2A 2UZVA 4JBVA 4RC2A 5HE2A 4AU8A 2PL0A 5KNJA 2PMLX 2HIWA 3V5LA 4D2SA 2PTKA 5BNJA 5KMKA 2F2UA 3EN6A 4HNIA 4NUSA 4YSMA 4BKJA 4ZMFA 5A14A 2J4ZA 4FSZA 4O4IF 1REJA 4XP0A 5HLWA 4MF1A 1KBLA 3QYWA 2BDWA 2OIBA 4AA4A 1H07A 2XK3A 1H1SA 4ZAUA 2WMSA 3NUSA 4ALUA 5BVOA 3LLTA 3D7TB 3ZRLA 2VX0A 4XRJA 1PXOA 4O7SA 3R04A 1GLVA 4GVAA 4FKJA 2IZTA 3W18A 5HLNA 5AV1A 4GRBA 2W1HA 4UXQA 1ULZA 1OL6A 1RE8A 4Y73A 4DGNA 3UG2A 3COKA 5KBRA 2VNYA 2JDTA 3FLNC 3R28A 4G1WA 5JZJA 4BC6A 4C36A 4LRJA 2HWOA 2PHKA 2OH0E 3I81A 5LARA 3UO5A 3UZTA 4U9AA 2FYSA 2GDOA 4QMSA 1E1XA 2R3QA 2XKEA 4H3QA 3FLZA 4QP4A 5M4FA 4RT7A 3PSBA 4PDYA 4IAKA 1YXVA 4LRMA 4RZVA 3ATTA 3TN8A 4L00A 5BMSA 3LFCA 2VPQA 4U41A 1W84A 3HP5A 2KULA 4TNDA 1E4EB 5LA6F 3LXLA 4GSBA 4EEVA 2XNPA 2VRXA 1BKXA 2WU7A 5L2IA 3BEGA 2B53A 2SRCA 3CKXA 1IA9A 5IA2A 2FPGB 2IW8A 4TY1A 3MPMA 3GXLA 4IFCA 1WZYA 5E8VA 3WILA 5IISA 3RFCA 4AZFA 4D2RA 3EKNA 4NCTC 4OTFA 2FSLX 3K3JA 5IH5A 2X7OA 2UW0A 5EQYA 4MV7A 4H1JA 4CV9A 4FT0A 4ZLZA 2IP4A 3CJFA 2BZHB 2VX1A 4F7NA 3TTJA 4K1BA 4PMMA 2W1CA 3H9RA 4JR3A 3LFQA 2BIKB 1J7IA 5BVKA 1PY5A 3I60A 3G90X 4O7VA 3VUDA 4YZNA 5BVFA 4ONAA 3RPOA 5FTGA 5KMOA 3TINA 5KX5F 2GHLA 4APPA 4BTMA 4HVDA 3R9OA 2PK9A 5AP7A 5CB4F 3V6RA 2R4BA 5I0BA 4HQ6A 4MQ1A 2ZV7A 4BCIA 4EOQA 1R3CA 5JRSA 3TKUA 5BPHA 4LQMA 3FHIA 3DF7A 2HWPA 5CEIA 4O0VA 3RJCA 3TWJA 3DV3A 5CASA 2YS7A 1FBNA 5DOSA 3E63A 5EM8A 1OUKA 1YOMA 4I4TF 5ANIA 2WMAA 4QTBA 4FSUA 3WOWA 4QMOA 3OTVA 4NM7A 3ZUTA 1NW1A 3QHWA 4GEOA 3QKMA 4DCAA 5GJGA 1TKIA 1EUCB 4I22A 4EH3A 1CDKA 3WI6A 4AZVA 4YTCA 4QMZA 3VO3A 4NCTA 2BFYA 3PYYA 3DA6A 4CFNA 4MQ2A 1H0VA 2YWPA 1O9UA 5ETCA 1SVHA 3OHTA 4WUAA 2IVSA 3PXKA 3TL8A 2VWUA 4IJ9A 3D15A 4XYLB 3FMEA 4OTDA 4CLJA 2R3PA 2GHMA 4LV5A 2PY3A 5HLPA 4GH2A 4FEQA 4CVAA 5L6WL 3HGKA 4GJ2A 3ZLWA 2XM9A 4PF4A 4DITA 3LJ1A 2CGWA 1QPJA 3F9NA 4UZHA 3OUNB 4I50F 3B8RA 2WAJA 3NW5A 1W7HA 2E2BA 4JDHA 3O2MA 4XG9A 2UW4A 2WD1A 5CEPA 3DK6A 4D9UA 3V01A 3ORLA 3HP2A 2DYLA 3LOKA 2HXLA 3RK9A 2GQRA 4F6WA 2DWCA 3ENHA 4ZLYA 5HGIA 4WNMA 4Z7HA 2CCHA 4O81A 3RM7A 1AUVA 3FI3A 5EDPA 3LJ2A 4DGMA 3WIKA 3OWLA 4I23A 3DKOA 4AGCA 3M1SA 3DB6A 3UVRA 1E1VA 2J7TA 3FMMA 4GK2A 4R3CA 4XG4A 3CTQA 5H8GA 5FP5A 3A61A 4DBXA 4KRCA 3UP2A 5JFSA 4YHJA 4FIGA 3QWJA 1JAMA 2H8HA 3QTSA 3T9TA 2VN9A 2WZJA 5FDXA 3VUGA 5ICPA 3D7TA 4QPAA 5EI8A 3UODA 2BPMA 5AUZA 2VTIA 4CKRA 4I41A 2DS1A 1OL7A 4K9YA 1P4OA 3C5UA 5CNOA 4FE2A 4ZQIA 3ZM9A 5EHOA 4PDSA 5CI7A 2NPQA 4X3FB 4ZTQA 1STCE 4XJ0A 2VTSA 4S33A 1OZ1A 3BBWA 2WOTA 5EQPA 3QCQA 5AP5A 3ET7A 4ANQA 4BZOA 1KE5A 3EQDA 4LG4A 4YJ2F 3R9HA 2UW6A 3NYNA 5HKMA 3VBTA 5IG1A 2YM5A 1R39A 5J95A 2QOLA 2ACXA 4U42A 1IRKA 1KE7A 2A4LA 3QXPA 3QQJA 3PUPA 1XQZA 1CTPE 4K0YA 4ANLA 2UUEA 4GV1A 4FTAA 3VPBA 2RKUA 3C51A 3VUHA 2OU7A 4QMTA 4EWHA 3VS0A 2UW7A 3BQRA 3N4VA 4MXXA 3VRYA 3KMWA 4C4JA 4E93A 5IEYA 4C59A 3ANQA 4EHVA 5EDRA 3QLFA 2BRHA 3QLGA 2UVYA 2JLDA 3FY2A 4TPTA 4CTCA 4D4RA 2WGJA 4I1ZA 1PKGA 2WQEA 2R2PA 4FNXA 1GIIA 4GKHA 3TTIA 1JSTA 3K2LA 4YHFA 2XNEA 3GLKA 3OT3A 3WZDA 3M42A 3CBLA 4GU9A 4RVLA 5FBOA 2Z7RA 3IW4A 5C1PA 2UV2A 3FI2A 5LVNA 2OZAA 4XV3A 4PP9A 3SLSA 5IH4A 2ZAZA 3HNGA 2YERA 4IM3A 4U43A 5JFVA 3VQUA 2ZDGA 3QD0A 5EKOA 2B7AA 4EQMA 2Y9QA 4Y8DA 5M09A 5DNRA 3HRBA 3MPTA 4G31A 3DU8A 2ETKA 3QRUA 4KWPA 2Y8OA 4MBJA 3UGCA 5L8KA 3DB8A 3FPQA 3HECA 3AOXA 4CXAA 2C6OA 4ASEA 2WIHA 3S4QA 3V5QA 3OFMA 5FG8A 4ZIMA 4R5SA 5F95A 1H01A 4F9YA 2BDJA 5EH0A 3BYMA 3ETHA 3I5ZA 4AFEA 3F2RA 4NK9A 5CS6A 3ZDIA 3JUHA 2VO3A 1ZOHA 3VS1A 1Q8UA 3Q6UA 1VYZA 4FC0A 1V1KA 3W55A 4EYMA 3ACKA 3R5FA 4FIEA 3HAVA 1BI8A 2BTRA 3QX2A 3ZUUA 2CGXA 1SNXA 1UWJA 2GCDA 2OZOA 3EQRA 4AE9A 4QQCA 5HBHA 5LWNA 2YJRA 2R3IA 3D0EA 1Q3WA 1WR2A 5LOVF 4I24A 4IC7A 3VMMA 1B38A 3QTWA 1H4LA 2YN8A 3MW1A 3KCKA 4F1OA 4BI0A 3LCTA 3L8XA 5JK3A 4W4VA 3MA3A 3DXNA 3PPKA 4C62A 5CZHA 1A9XA 4ACHA 3COIA 2PVHA 3F2AA 3QA0A 4PTGA 5HICA 1IEPA 5AADA 3KRXA 1PMNA 3REPA 3QYZA 3BHUA 3MN3A 5TKDA 4EOSA 3MSSA 4EKKA 4JJRA 4CCUA 5M4CA 4EYJA 4MHAA 5CU2A 4AGDA 4FZ6A 1JLUE 1OPJA 2C0IA 3EN4A 4ZTRA 5LCJA 2YS6A 3IS5A 4DEAA 4RZQA 3G9LX 4RIYA 4IHJF 2CKOA 4IZAA 4XYMB 2OF4A 2V0DA 5DEWA 4XV2A 3VS5A 2HZ4A 2X1NA 4Y72A 1KE6A 3EQFA 3O51A 4USDA 3RKBA 1M14A 2SCUB 1UU3A 4QYEA 2C5NA 3H0ZA 2YDJA 1PXPA 3Q2JA 2Z2WA 4I5PA 3GEQA 3FKOA 2HZIA 3VF9A 4C3PA 3RM6A 5IQEA 5EFQA 3LHJA 3KY2A 3E62A 4JBPA 2NU7B 1TQMA 2XNOA 2LAVA 4KKHA 1WAKA 5KCVA 2PZ5A 3TZ9A 5EYDA 3VJOA 2R87A 3BV3A 1JKKA 3BLQA 1Q8ZA 2QOFA 4ZTLA 1OKYA 3E5AA 3OC1A 4CEGA 3P9JA 1K9AA 1QPCA 2X7GA 2BIYA 4O7YA 4RA4A 3FL4A 3TJCA 4BB4A 4BCKA 5L2WA 2CKPA 3GFWA 4BDKA 2HYYA 4L01A 3KL8A 5C9CA 1M52A 4IVCA 4Q5EA 1H1QA 4O0XA 4EOOA 2PN1A 3PFQA 2PVPA 3CPCA 5CAEB 4OBOA 5BVWA 2NU6B 2XK9A 3RI1A 4AW1A 5KUPA 1BI7A 3UJGA 4HZRA 1DI9A 2YDIA 2E9UA 1PRYA 4B0GA 4YGAA 4HGEA 1JKSA 2C5VA 2XEYA 4UX9A 2C30A 5M56A 3PJ8A 2RFDA 4MX9A 2YCFA 2BHHA 3GU5A 4GFGA 3VS6A 4BGHA 2QG5A 3KXNA 1O6YA 4EOMA 4BDDA 3F3TA 4RX9A 5FTOA 5BUIA 2WQBA 1PMVA 1ZWSA 4ZY6A 4FNZA 2PVKA 1Z9XA 3CIKA 4KA3A 4YPDA 2HY81 4TNBA 2HZNA 2PE0A 1OM1A 1V0OA 3UVPA 4MCVA 5HORA 4I94A 2IO6A 3VN9A 3L9MA 4D5KA 3R9NA 3C13A 2O65A 2C6MA 1URWA 4S30A 3Q1KA 5CF5A 1UU7A 4F0GA 5M08A 2Z60A 4U40A 1OKWA 5E8TA 4I0RA 4E4NA 1LP4A 4F9WA 5EI2A 4GYIA 4BTJA 3ZC5A 2YIQA 4FVRA 5L2TA 3C0IA 4BTFA 4O82A 2GNLA 3DJ5A 4G5JA 3QWKA 4QP6A 2R3HA 4RJ4A 2QKRA 3N4TA 4XG3A 3VIDA 4EJNA 2PU8A 2QR8A 1ZMUA 3OW3A 4TRLA 4BIEA 4KAOA 3F5UA 4FKGA 4WRSA 3ELJA 3FQEA 1YWVA 3KAKA 1JVPP 1JSUA 2WTJA 2PUPA 4QYFA 3WZJA 4J99A 2W1DA 1Q41A 4O0RA 2YM7A 4Z9LA 1IR3A 2X2MA 4N70A 3GU8A 3RPYA 4BCFA 1OL2A 4YJQA 3FMLA 2J9GA 3F61A 4R7BA 4D1ZA 1JPAA 5TT7A 1GJOA 5ANJA 2VTAA 2C6EA 4YZ9A 4DFYA 5A9UA 4HJOA 1R0EA 4FODA 3WYXA 3Q32A 5GJDA 5CAQA 3RPRA 2R7NA 3AX6A 2XKDA 4JXFA 2UZLA 3H30A 3NZ0A 4MXCA 3VQHA 4EORA 4P7EA 3EIDA 4WG4A 5IMEA 3PJCA 3WZKA 3M2WA 3RINA 5JEBA 4CV8A 4CQEA 3BV2A 3ZFYA 5I5ZA 1GIHA 3COHA 3MBLA 4AN9A 2WPAA 5FD2A 4FSRA 5IDPA 5A4CA 2WKMA 3VNTA 5CTPA 5JVDF 3TDWA 5ETIA 3ETJA 4FFLA 3MESA 2Y4IB 3OY1A 5CU6A 3R0TA 4DCEA 3JXWA 3WF9A 3TNHA 1B39A 4DEEA 1SVEA 2VV9A 2ONLC 3V51A 5AUUA 2WTKB 3HA6A 4F70A 4JR7A 1KE8A 3KC3A 2YM3A 2ZMDA 5LP6F 3ZONA 4FK6A 2PSQA 2Y7JA 4FTUA 4F7JA 1NVRA 3QQGA 4G3EA 4YB8B 4JI9A 3SQQA 2A27A 3FUPA 3D5XA 4IVBA 4APCA 3SA0A 4NJ3A 2YRXA 4LFIA 1U54B 3DFCB 2X8EA 4ZOLF 2Q0BA 2YCSA 2CZGA 3N4UA 4TWPA 2R3GA 5CQUA 4HNTA 5JH7F 3UQFA 2B4SB 3UPXA 3CY3A 4BYJA 5D12A 2XIZA 4MD9E 5KX8A 1OB3A 2QOIA 2OZAB 3PP1A 2GNJA 4CRSA 1T46A 4BBEA 4PMPA 2QC6A 1PXMA 5CSHA 2GU8A 4FTKA 1ZAOA 2WO6A 5JZNA 4QTCA 4X6RA 3SVVA 3CS9A 4S2ZA 4BBMA 2HXQA 3E93A 2VUWA 5EOLA 1ZOEA 4KB8A 3SV0A 3TCPA 1EYZA 2WEIA 3OCBA 2PVYA 2XRWA 3FL5A 4FIFA 1A48A 5FM2A 3TNQB 4FNWA 4FOCA 4I55F 2XJ0A 3QAME 2W6ZA 3OT8A 4JG6A 3TIZA 4TV9F 3I7BA 4FKVA 3DJ6A 5CSXA 5ANEA 4DEHA 3HUCA 4TW9A 1VBHA 4FV9A 5JFWA 2JC6A 1IOVA 3OMVA 2Y4IC 2BRMA 3R2BA 1Q24A 3F5GA 2XRUA 2I0HA 2YDKA 3OBGA 1REKA 4XEYA 3WF8A 4HGLA 4M13A 4OR5A 4ACDA 4CG8A 1FQ1B 2CKQA 3BHYA 1JOWB 3HV7A 5E8WA 5C01A 4C4IA 4QNYA 2PVNA 3MA6A 5BUEA 1ND4A 3KXMA 3UPZA 4C37A 3EQBA 3NW6A 2YJSA 3MVMA 3LM5A 3ORKA 4ZZNA 5J2UF 5AP1A 3FLWA 2VTLA 3HMIA 1P4FA 4XMOA 4EQCA 2C3KA 3FXXA 3LZBA 3VHEA 4E5AX 4FMQA 4F6UA 3AGMA 1R78A 2WTWA 4XP2A 4QMNA 4PWNA 4KBAA 2WQMA 1YVJA 1Z2OX 5G6VA 1MRVA 1PKDA 3ROYA 3NS9A 3CC6A 5G1XA 1FMOE 2WMXA 4YBKA 1L3RE 4QMMA 3KKVA 3TNIA 2YCRA 2I80A 3Q9ZA 5C8YF 2XYUA 2JAVA 4UB7A 3SGCA 3BYVA 1ZZLA 3VUIA 3V04A 4HNUA 4O22A 4RIOA 5LMAA 4IHPA 1ZYSA 3F3ZA 3C1XA 1E9HA 4Q5HA 5E1EA 2UZUE 3PY3A 3QGYA 4XBRA 3KB7A 5HEZA 3RVGA 4I4FA 3E3BX 4RGJA 5FEDA 4FKTA 3R7IA 4ZI7F 4MXZA 1WMKA 4C4HA 1KSWA 3D5VA 2WMUA 3C4WA 3SW7A 3QZFA 4B9DA 4YJPA 5HVKA 1DV1A 4DEGA 1KJ8A 4XUFA 3B8QA 1CMKE 3QTRA 4J95A 3Q04A 4FT7A 3A7JA 4KSQA 3QTQA 3B2TA 3C7QA 1LEWA 1IAHA 5IUIA 4O4LF 2HCKA 3LE6A 4FKIA 3K54A 4OTWA 1OKVA 2XK8A 4NJDA 3UBDA 2P33A 3R02A 1UU9A 3V8SA 2ESMA 2VR1A 1ZXEA 1W96A 4IB5A 4EK6A 1VR2A 1EZ1A 5B0XA 3HKOA 3BBTB 3Q5IA 2CGUA 1OIUA 2PMOX 4HOKA 4QP3A 3ZEPA 5T68A 4AZTA 4Z3VA 3TUDA 2AYPA 3FZPA 4OBQA 3QUEA 4R3RA 2ZJWA 3RK7A 3A60A 3FSKA 2PUNA 4JQEA 4RC4A 2EUFB 4HPUE 2GQSA 4R77A 3RUPA 1DIKA 1I09A 4QP2A 3GBZA 4DFBA 2WQOA 2GNFA 3I4BA 3VS4A 4EG0A 5A46A 3O17A 5D11A 4EQUA 4GG5A 5H8EA 4DE4A 4W8EA 2FH9A 4YO6A 2P4IA 5CVFA 4IAZA 4A9YA 3G2FA 4FFPA 2PVFA 1T36A 2QI8A 3AXWA 1K3AA 4WO5A 1G5SA 3DZOA 5IQAA 4HGTA 3VF8A 4RFYA 2W4OA 4YO4A 2PVLA 4Y5HA 5EG3A 3LFDA 4ZS0A 4B4LA 3OXZA 3MWUA 4LMUA 5CXZA 5KE0A 4ENXA 2P0AA 1U5RA 4YBJA 3MH2A 3N9XA 1HOWA 3ZOSA 2EXMA 4NKSA 4AACA 2EB2A 4FV8A 4EBVA 5JSMA 5KZIA 3U4UA 2F7XE 2YISA 3BE2A 3MJ1A 3ORZA 4M0YA 4RIWB 1FINA 4RJ3A 4BDGA 3PSCA 3RCDA 3HA8A 3HV5A 3CGOA 3NRMA 4C02A 2BZIB 3NUAA 4QRCA 4MV9A 3ANRA 3DS6A 4FTTA 4FTJA 5B2LA 4EOJA 1ZY4A 2V59A 5E91A 4MK0A 4F1MA 2VZ6A 3QCXA 4FTOA 4FVPA 3Q96A 1S9IA 3VA7A 3D7ZA 1PXIA 3QHRA 3CD3A 1V0PA 2IG7A 5CSWA 4CCBA 2VGOA 3ORPA 3G8DA 4X2KA 5AX3A 1EH4A 3PA4A 1EHIA 4DA5A 5FXSA 3FDNA 5B7VA 4R5YA 2EWAA 2JD5A 2C0OA 2O3PA 3GP0A 3CJGA 1J1BA 5GJFA 5K5XA 1XH7A 4X2GA 4JBQA 3UO4A 4ZJIA 4EK5A 3C4CA 2YHVA 3F7WA 4FK3A 4FTMA 3FXZA 1G8AA 5AUXA 3R7EA 2IZUA 2GS6A 1KJJA 3R7UA 2XK7A 1ZYDA 5DR6A 4QNAA 2OJFE 3SW4A 2HENA 5KO1A 5I9WA 1GIJA 3IW8A 4NYEA 2XS0A 5GINE 1YQJA 4L7SA 4RIXA 2GFCA 4W8DA 3RWQA 4YJ3F 1H28A 1EUDB 5IYZF 4MWHA 5E4HA 3EL8A 2C6KA 2WOUA 3EB0A 3C4ZA 3QGWA 5CQWA 5DYJA 5LMKA 2GTMA 2J0MB 4BCGA 3EQCA 1VBGA 4U5JA 3FMDA 3VBQA 3PA3A 4YU2A 1ZOGA 2BRGA 4BIDA 1JKLA 2WFYA 3R30A 3IOPA 5ACKA 1KJIA 4C5BA 2HAKA 2R7KA 1CQJB 4EZ3A 1PYXA 2QOCA 4QMLA 4HYIA 4J52A 4Y5QA 5AV0A 5IA3A 4YAJB 4ALVA 2A2AA 3QRIA 2XCLA 1JQHA 1RDQE 3VHKA 1JLLB 5JRQA 4BIBA 1I44A 4YTFA 2F49A 4JIAA 3AW8A 1OPKA 3KK9A 4XLVA 2JDRA 4NW6A 4YC3A 3OG7A 5FTQA 4DTBA 5C27A 2Z04A 4JDIA 2C4GA 2Y6MA 3AMAA 4QP7A 3LAUA 3EQPA 3DAKA 2O8YA 4EC8A 4PMTA 4FU0A 4TT7A 3GENA 2DUVA 3FQSA 3SE7A 4R1VA 4LGHA 5DBXA 3DPKA 1W82A 4E7WA 3HDMA 4CFWA 3COMA 3WF5A 1KC7A 4GU6A 4C2VA 3MFUA 2IJMA 3D5UA 2OXYA 5A4TA 4NZWB 1OMWA 3CKWA 4B8MA 3UOKA 1Y6BA 3Q53A 4DH1A 3ZU7A 2ITWA 4AT4A 3Q4TA 5D7AA 5CSVA 3R23A 3KFAA 4GMYA 4FV4A 4ACCA 5EM7A 4PY1A 4YTHA 5HE1A 3V5TA 5M44A 1APME 3DBEA 3HMPA 4FV7A 4QMPA 4TTHB 3V5JA 4QMWA 4FSYA 1H26A 3R00A 4CD0A 3P0MA 1H8FA 4O7WA 4ZOGA 5ITAA 5CT7A 4QP8A 4AX8A 2UVXA 2GFSA 3MB7A 4H39A 3KMUA 2CGVA 2RFSA 3KAJA 3Q52A 2WMRA 4WA9A 3TZMA 3CQWA 5LXMA 3OXTA 3CR0A 1NT2A 4S34A 3VUKA 3BLHA 4YNEA 2PVJA 3G8CA 4O4JF 3QC4A 4XCUA 4LRKA 3TDVA 3I6UA 1WBVA 4F99A 4N0SA 5M07A 3I12A 3F88A 3LQ3A 3HMMA 4UY9A 1Y57A 5CVHA 2VWBA 3DDPA 3F5PA 3LQ8A 4IFGA 4AN2A 3GT8A 2QODA 3R5HA 5LYJF 3ORNA 4GUEA 2BZKB 3WE4A 3KXZA 4FT5A 2YWVA 4PUZA 4C4GA 5H8BA 3VUMA 5HU9A 2C47A 3ZBXA 4QMUA 2NP8A 1UNLA 2V7AA 1ZMVA 3UDBA 2YACA 2OJJA 3Q60A 4IB3A 4J8MA 5A54A 2XD4A 3TACA 4W4WA 3K3PA 4DEDA 1X8BA 4I6QA 4YLJA 1CKPA 3MPAA 4USFA 3G33A 3LQ5A 3VBXA 1GOLA 1UV5A 3DXPA 4JRVA 3Q4UA 4PL4A 3IOKA 4WBBB 3W32A 1RJBA 3QQKA 1BNCA 2FB8A 2QOHA 2XEZA 3NNUA 5EYMA 4DFNA 3CSVA 1J1CA 2FA2A 1AUXA 4EOIA
chains in the Genus database with same CATH superfamily
5J9ZA 4DGGA 2GQGA 2NU8B 2YFXA 1FGIA 3KVXA 3U9NA 1FVIA 3AT3A 2QOQA 3BELA 3Q2OA 3ZDUA 2Q83A 2QO9A 5DR9A 1O6KA 3FJQE 4DEBA 3D83A 2OI4X 3MH0A 4O21A 5FUTA 5I4NA 4XG2A 4YLLA 3ZLYA 3P7CA 4BGQA 1YW2A 5CU3A 3EL7A 3UG1A 1K2PA 4GT4A 2REIA 4JDKA 1Q97A 5E8UA 2X0GA 5E9EA 1GSAA 4X7QA 5HD7A 4P90A 4DAWA 4O2PA 4FYNA 3U9CA 3RHKA 2PWLA 4DHFA 2OWOA 5IA1A 1XH5A 2OBJA 4NW5A 3PJ2A 4CKIA 3QU0A 3QX4A 5I5TA 2XKCA 4MVFA 3GCSA 2XP2A 3O7LD 4FZFB 3OUKA 3W16A 4DG0E 4C5CA 4IJPA 4BCQA 2VWVA 3GU7A 4NWMA 3TMOA 4DYMA 2B9HA 4NL0A 2XB7A 4PDOA 4YZMA 4AGUA 4JOAA 5J87A 3RAWA 3A7FA 4EKLA 2BRBA 3LFAA 1S68A 5CALA 3EMGA 1CE8A 1I7LA 1MP8A 1PF8A 1VYWA 4EH5A 2VTTA 4Q2AA 2QLUA 3VULA 4TVIA 1GZNA 4G34A 4D1SA 5C8KA 4HVGA 5AV4A 4GLWA 5BVDA 4RIWA 3SAYA 5JQ5A 3QRJA 1U54A 3V3VA 4FIIA 5IDNA 4EEQA 2GNGA 4FJVA 2P55A 3CLYA 3FYKX 2F57A 1XH8A 3L8VA 2CPKE 4ACGA 2QNJA 2X2KA 4IWPA 2G1TA 4CFUA 4I5HA 5AM7A 5FP6A 4K11A 3EFKA 2QO2A 3K3IA 3HMOA 3OBJA 1Q8WA 4IAYA 1IA8A 1FMKA 3ALOA 5CAPA 4WHZA 1DAYA 1PXNA 1QPEA 3LPBA 3NSZA 3CY2A 4RA5A 4FKSA 5HBEA 2O5KA 2NRYA 3LVPA 4FTRA 4IW0A 2ZM3A 4KUJA 4A06A 3MVLA 4ZTSA 3WYYA 3ZH8A 5M55A 3POZA 3R83A 1TA8A 2I40A 2RFNA 4BRXA 4MA0A 3DKCA 3R63A 4JX3A 4RQKA 2OLSA 2X8DA 1TAEA 3DZQA 3WF7A 3ZSHA 4AZEA 2VNWA 4XX9A 5ANKA 5E90A 2JIIA 3QUDA 5LWMA 1BUHA 3UZOA 3MIAA 3Q4CA 3ZM4A 4JRNA 4G17A 5ANDA 5BPYA 4I21A 5HG8A 5JVLA 1Q99A 3FZ1A 4Y83A 5HE0A 1NVSA 3TEKA 3IECA 4M12A 4JS8A 4RBLA 5BWWA 4YLKA 3W10A 4O7NA 3KULB 3L9PA 1PXLA 3EKKA 4L3PA 4ORKA 4YZBA 5K3YA 4AXCA 2C6LA 4NM3A 2GHGA 1YXTA 2X39A 3IO7A 3QCSA 4FNYA 3S95A 3GIDA 2NU9B 3L1SA 3ZTXA 3R01A 5CX9A 4H36A 2BRNA 3EYGA 1H00A 5HTBA 4UCSA 2UZEA 4F7SA 4QQ5A 1OITA 4L42A 5DIAA 2HVQA 4BCPA 2R9SA 4O0TA 1GZKA 3AT2A 5AUVA 3U55A 3BU3A 2O63A 4C61A 1YWNA 5AA8A 2AC3A 4V01A 2OG8A 3ZZWA 3UDTA 4RJ5A 2ZDTA 3JY0A 2B0QA 2VU3A 3LXPA 4PV0A 4CSVA 3H9FA 3F7ZA 1PYEA 3D2KA 2W1EA 1E4EA 5E7RA 1NXKA 3V4ZA 4M7IA 4G6NA 1AGWA 4FKQA 2XCKA 4IZ5A 2BHEA 3U87A 4F08A 4F65A 3QD4A 4IWOA 3UZRA 1OBDA 4J96A 3BG5A 4GS6A 4QSHA 2COIA 2W4KA 4J7BA 4KNBA 3BGZA 5EW3A 5KZ0A 2NNWB 3T3VA 1AD5A 2R3KA 3KN6A 5D10A 3S0OA 4A7CA 2QF7A 2YZNA 3DAAA 1JSVA 5LMBA 4LOQA 4IANA 4EH4A 2GNIA 4EUTA 3KRJA 4JXUA 1LEZA 1JNKA 4O6LA 4F4PA 4PBCA 4RJ6A 3ORRA 4FFRA 1JDEA 2VD5A 5FQDC 1B6RA 1OIRA 4DBNA 4O96A 3W8LA 5JGBA 3B2WA 3KEXA 2G15A 1P14A 3KMMA 2J5EA 3NLBA 3IGOA 4ZSEA 4E26A 2JKQA 4TUYF 2X4FA 3I79A 4DGOA 2HY0A 4O7TA 2HG8A 4HCTA 2CLQA 2Z02A 3MY0A 4O38A 2EB3A 3EFLA 3F3UA 2I6LA 2PZIA 4RVKA 2JKMA 3MGYA 4FEXA 4TYEA 4XLIA 5EYKA 2PZYA 4RQVA 3U8WA 4FTCA 1VLRA 4MNFA 1ATPE 3TV4A 3MVJA 3R8ZA 5J1VA 4IACA 4IADA 3SD0A 4RPVA 3BACA 3E88A 3NFFB 1YOLA 3Q5ZA 3NR9A 5DGZA 5D41A 4M15A 4IVDA 2XMYA 4BBFA 3QQLA 1H25A 5KMMA 5H80A 3LJ0A 5IQFA 3WWHA 4DIMA 2ITUA 5AIRA 2YM4A 3UQ8A 2E9PA 2ZDUA 2X81A 3IDBA 4AFJA 3TV7A 2OK1A 5HX8A 3DBDA 1IOWA 2YITA 4W4YA 1T45A 2GTNA 4GFMA 1OKZA 3PIXA 4DTKA 5IEVA 1CKMA 1V9PA 2WB8A 3HLLA 3IDPA 3LCSA 1PHKA 1U59A 4QYHA 2X2LA 2C6DA 3R1NA 3T3UA 4NZMA 3RPVA 4AP7A 3GB2A 3EQHA 3KULA 4FG7A 5DR2A 4C7TA 5CENA 5BYLA 4XOZA 2W5HA 2ERKA 2CNVA 4L53A 3P1AA 4IZOA 5C1OA 2ITYA 2VTRA 4C33A 4ZHQF 4I20A 3SG8A 3NUNA 4GUBA 2ZMCA 5CSPA 3KXGA 4PRJA 3TIGA 3N6RA 5IUGA 4FFMA 4U3ZA 3KCFA 4M8TA 2PE2A 3NUPA 5KKRC 4HVSA 3W8QA 5JGDA 2WHBA 3WO0A 4P2KA 1KV2A 2IVVA 4WBOA 5IF1A 1W93A 4X21A 5FXRA 2C6TA 4R1YA 3VJNA 3KF7A 4WNOA 4U79A 2WXVA 4JT3A 3HBLA 4ZJJA 4ANBA 3ZO2A 3ZRKA 1Q62A 3D9VA 4JQ8A 4XZ3B 4RWIA 5E1SA 3WZUA 3R9DA 4EBWA 4MTAA 1P2AA 3MWEA 4EHZA 3FKLA 1J7LA 2C3LA 2C5XA 3G6GA 4X3FC 1GY3A 2BFXA 2H6DA 3C50A 3II5A 3FE3A 5C8MA 3SG9A 3E5NA 3UFXB 3NDMA 3WARA 2B54A 3LMGA 3OWPA 5TR6A 2UZBA 3FKNA 4I5CA 2IZRA 4CMUA 4TYIA 2YAKA 2ITZA 2W17A 2QO7A 3LFEA 4FGBA 4IM2A 2YIRA 3QL8A 2GPWA 3HX4A 2V7OA 3OUZA 4GW8A 4ZTNA 2OWBA 3F2NA 2YYAA 3W0RA 1CKJA 5C4LA 2W9ZB 2IPXA 5EI6A 3A7IA 4PX6A 2J0KA 1WVYA 4QPSA 3JR1A 3VRZA 3FQHA 2R3JA 3P78A 4LOPA 2OH4A 5J9YA 2DZDA 2YAAA 2CSNA 2YIWA 1NVQA 3K5HA 4QMYA 4NU1A 4N4SA 3VPCA 2PBZA 4Q9SA 3PPZA 3M11A 5DFPA 2HW7A 4FKWA 3ZO4A 5M4UA 2E9NA 3GVUA 4I0SA 3GOPA 5AV3A 2B9JA 4FEVA 2VTNA 4ZS4A 3KRWA 1F3MC 3E64A 4BCJA 5AP4A 3PXFA 5BYZA 3OOMA 3UQGA 2JEDA 3NEWA 2FSOX 4CNHA 4DC2A 1MUOA 4YMJA 3R7VA 1YXUA 3RALA 3D4QA 4QTEA 3ZXZA 3R8PA 2ITNA 3DFAA 1ZYJA 4F9BA 4A07A 3DXQA 4E6DA 2HVSA 3PZEA 3QZHA 4E4LA 1UC9A 3H4JA 4FKOA 4L7FA 4RX7A 1KUTA 4YSJA 5L3AA 2YZMA 3UC4A 3RV4A 4N6ZA 4DLIA 1XKKA 3W2RA 4EZ7A 3WF6A 3GI3A 1Z57A 2XJ2A 4FKPA 3NIZA 3R5XA 4L8MA 4WNPA 3DKFA 4O0WA 2QKWB 5DI1A 3R71A 1WCCA 5FRIA 4ZSAA 4UYAA 4IQ6A 3BPRA 2ZM4A 1VBGA 4J8NA 3DTGA 4PNKA 5DA3A 4AF3A 5JQ8A 2ITXA 1IG1A 2WIPA 4KBKA 3ORXA 4XH6A 4CGAA 2I0YA 4C58A 2CJMA 4A4LA 5HNIX 5HNBA 3OF0A 4TV8F 3TT0A 3C4FA 1U4DA 3EFJA 4FT3A 3SHEA 4O2ZA 3FZSA 3LP8A 2XKFA 4M97A 3BCEA 5H2UA 4BTKA 5KBQA 4RMZA 5HO8A 4BGGA 5M57A 2BILB 2J0LA 5ETFA 1CSNA 3JPVA 2I1MA 3QTIA 4HCVA 1SMHA 5C26A 4HNFA 5I5SA 5I9YA 3GCVA 2JAMA 4ACMA 4D4YA 3CTHA 2UZTA 3TUCA 4R6VA 1NY3A 3F3VA 3KREA 3L8SA 5JFXA 1Z2NX 1OL5A 4B8LA 4YPSA 3V6SA 4FUYA 4DF3A 4HVHA 5DT4A 4TM5A 4NIFB 2R84A 4WKQA 3NIEA 4G16A 3MTFA 2JGZA 2C1AA 3DNDA 3ODYX 4ZZMA 3UMWA 4EJ7A 3S3IA 1GSOA 2QB5A 4RIYB 3W2CA 3TZ8A 5E8YA 3U9TA 5CA0F 2GPHA 2WTIA 4IAFA 3UMXA 1XJDA 2VWIA 5J5SA 4G3CA 1TVOA 4DHJA 3JZFA 4BYIA 2XNMA 5IMXA 3OY3A 4O83A 2PE1A 3LW0A 4G9RA 2XNNA 3EH9A 3GC0A 2A19B 4S32A 4AW5A 4F09A 2DAAA 3AT4A 3NBYB 4ZY5A 3S00A 5IA0A 5AP2A 2OFVA 2XJ1A 4CFFA 1ET0A 2NUAB 4N6YA 2J6MA 3G0EA 2W5AA 4O2BF 4Y46A 4EZ5A 3DTWA 4QTAA 3ZLXA 2DIKA 2HVRA 3NAYA 2WEVA 5HBJA 3ZFXA 4CKJA 4CT2A 4M68A 2VTMA 2W7XA 3RP9A 2WTDA 4BZNA 2FO0A 5CY3A 2VWYA 3QA8A 5E8SA 3O7LB 5HIBA 4DFLA 5I9VA 1VS0A 5B2KA 5H9BA 4M3QA 3Q9YA 3HO8A 3EN7A 3IPHA 5CM0A 4NFMA 5CWZA 3FHRA 5ANOA 3Q9WA 3TJDA 2WMBA 3F82A 3TG1A 2WQNA 3G0FA 4MNEA 3HRFA 5LXTF 2G01A 3Q4ZA 3JY9A 4PTCA 5AAFA 1VEBA 2W71A 4FICA 2EIYA 4ZTMA 1UNHA 4MV3A 1FVRA 3NUXA 3R1SA 3BU6A 3PP0A 2EU9A 1F5QA 4G3FA 3BZ3A 2G2IA 4BDAA 4D28A 4EOLA 1W8CA 3R2YA 3QQHA 4X3JA 2VGPA 2UVZA 3AC3A 4JAIA 3IW7A 4D4VA 5E8ZA 4IAIA 4ZSLA 2R7MA 4XP3A 4GK3A 4U3YA 2ZV9A 1JKJB 2BAJA 4FSQA 4XV1A 1B6SA 5FM3A 4Q4CA 4P4CA 3FY0A 1ST4A 3OROA 3OWKA 4ID7A 3HL7A 4NH1A 3OCTA 5HVJA 5DRBA 1CS0A 4E4XA 4O7RA 3L9NA 4I92A 3QXOA 4IBMA 3AC8A 2C69A 3JRXA 1BL6A 4FTNA 4YJUA 4MBIA 2PZRA 5EHLA 3AD5A 4USEA 2YZLA 1JDBB 3BHTA 3UOJA 1XH6A 1NA7A 3PZHA 2FPPB 1CQIB 2J0IA 4I6FA 4QP9A 3BKBA 3Q2MA 2UZDA 5I5YA 2XBJA 4AWIA 3LFBA 3TEIA 1X9NA 4L9IA 4JNWA 2OIQA 3MJFA 3PXZA 1M7QA 4G3GA 3AC4A 3T99A 4BDIA 4YJTA 1YRPA 4JMQA 3RGFA 4P5QA 1EKVA 2XF0A 4CMFA 1XBBA 2ITOA 2FVDA 3EN5A 4L67A 3E8EA 3VW8A 3WIGA 4DEIA 4MV8A 1HCLA 3SC1A 4CC5A 3GNIB 2UW5A 3HB9A 3VBWA 1XR1A 4ZMEA 2OICA 2QD9A 4X6QC 4IB0A 4E1ZA 4QMQA 2P0CA 3QWUA 4ERKA 4RG0A 5J9LA 5EQEA 3TXOA 4AAAA 4L52A 4QO9A 4FI1A 3VBYA 4AOJA 4U97A 5ACBC 4DRFA 4TYHA 5DLSA 3OUUA 3RV3A 3HDNA 4M69B 4BCHA 2J50A 2RIOA 4OBPA 3LWBA 1SNUA 4OTQA 3FSFA 2I7QA 3ZYAA 1M0TA 5J2TF 5J7HA 4IM0A 3IQ7A 5HNGA 3MFRA 1Y8YA 3AMYA 5AMNA 2VX3A 5K9IA 5F94A 3IG7A 4EK8A 4IWXA 3P79A 4EGJA 4D58A 5KMJA 4CZTA 3PDTA 3HUBA 1YDTE 4FX3A 2O64A 3BEAA 3G15A 3R1YA 1SM2A 2RL5A 2QHNA 3PY0A 4C4EA 1XBAA 2V22A 2Z7SA 3QTZA 4AQCA 1OPLA 4EC9A 3ZFMA 4F78A 2V55A 5FEEA 4II5A 5I60A 4DH3A 2QOKA 4FL2A 3POOA 2YZAA 5CF6A 4OUCA 1XDNA 2BVAA 2KTYA 4GK4A 2OW3A 3KRRA 2VTOA 2JDVA 2ONLA 5C4KA 5CEMA 3U51A 3O8TA 4CT1A 4KABA 4OTHA 2UZOA 5GONF 2JDOA 4ZP5A 5BWTA 5AV2A 3LIJA 5I5XA 3RNYA 4KKEA 2JKOA 2OKRA 3WWIA 4QMXA 4M9UA 2FUMA 2V5AA 2GNHA 3BHVA 4KBCA 3T9FA 4GFOA 4UXLA 4AXAA 2A1HA 5I9XA 3GC9A 3UDSA 3AQVA 2W9FB 3FI8A 3O96A 4F1TA 5IQBA 4V0GA 4PZ7A 2HJWA 2XCHA 2GLTA 5GHVA 4AW0A 1GAGA 2WMVA 4W4XA 2J90A 4AOTA 2PYWA 4EONA 4YUQA 3E87A 3P7BA 3WE8A 1CKOA 3VS2A 5EK7A 5GIPE 1YHSA 2XANA 3MY1A 2Z7QA 5CT0A 1BMKA 5D7VA 3W5OA 2V62A 3ZMMA 4TYJA 2BTSA 4KD1A 4NFNA 5BMVF 1J91A 1WBTA 3EN9A 3IW5A 3PRIA 4PL5A 1WBOA 3PVGA 2HIVA 3NPCA 3LKMA 2JFMA 4LGGA 1PXKA 1PXJA 4IVAA 4RJ7A 3UOLA 4AE6A 2R64A 2XYNA 1Z5MA 3JVRA 2I0EA 4EI4A 3UTOA 5HD4A 1I7NA 4KS8A 2ITVA 1FGKA 5J8IA 3E8DA 1ERKA 1XH9A 5HG9A 4FFNA 3QD2B 3UE4A 5IZFA 5HV6A 3OD6X 2R85A 4NZNA 2ZFYA 1WBPA 5HBRB 3IDCA 4TKSA 3DK7A 1ST0A 5I9ZA 2IZSA 4HN2A 2XIXA 4PMSA 3ATSA 3OEZA 3MS9A 4ZLOA 5D8DA 4EK4A 1P5EA 3DDQA 3KVWA 1SVGA 3RPSA 4DGLC 1OGUA 3NCZA 1HCKA 4TWCA 5FLFA 1SZMA 2QG7A 3DOGA 4BDJA 4L6QA 3BYUA 4U6RA 4OW8A 4BCNA 5IQGA 5CAUA 5F20A 4C38A 3R7OA 3D94A 4ALWA 4F0IA 2YM8A 4L1KA 2JBPA 1W0XC 3LXKA 2OF2A 4AT3A 3IK3A 3LMHA 3UQCA 4MD8E 4MKCA 2G9XA 3R8VA 4YURA 2PPQA 3MV5A 3ZS5A 4AGWA 2GPSA 2PMNX 1BLXA 3OW4A 2YABA 4U44A 4C0TA 2XIRA 3FLSA 3BHHA 5EM5A 4J53A 2GS2A 1Q3DA 3SXSA 4C3RA 1KE9A 3NNXA 2R3NA 2UW8A 2W6OA 2ZV8A 1UU8A 4FL1A 4IX3A 3VAPA 3CQUA 2HZ0A 4CMDA 3HVCA 2QHMA 2ETRA 3GCUA 3NWWA 4DFZE 4CKEA 2F7EE 1M0WA 3W0QA 1ZZ2A 3W0SA 5GNKA 2P2HA 3PE1A 3LXNA 5DMXA 3EJ1A 4U8ZA 4DHIB 1QMZA 3MTLA 2X6EA 3DQWA 4GKIA 4IB1A 3ZLSA 3TKIA 5CAOA 4U80A 5DH3A 3LQSA 4LI5A 5KHWA 1O6LA 4J98A 1YHVA 2BZJA 4R7IA 4UWYA 2R7IA 4X2JA 2W6QA 4TYHB 3TM0A 2C3JA 2W1IA 4O2AF 1C3OA 4O7LA 5HIDA 4TZRA 1Q8TA 1PX2A 3PIYA 4OTRA 5AFVA 3ZXTA 3A7HA 4F9CA 3RCJA 2F4JA 3MY5A 2QVSE 5A6NA 5IPJA 3RTXA 2IWIA 4MYGA 3NMUF 4RJ8A 3R6XA 4M84A 5CYIA 3PTGA 4ZZOA 1DGSA 3N8DA 4IIJF 4XG6A 4V04A 4YJSA 2RG5A 3BQCA 2F7ZE 4RLKA 4TWNA 5BYYA 5CLPA 5HQ0A 2OSCA 5KMNA 2DABA 5AUWA 3UZPA 3TV6A 4YAKB 3P4KA 4Y8VB 4JL9A 2H9VA 3RNIA 4BR3A 3GQIA 5K4JA 4EGQA 4C4FA 2XIYA 4RX5A 5EKNA 4MAMA 5HI2A 1ZMWA 4C2WA 3Q9XA 2YW2A 4FZ7A 2UZNA 4F0FA 4AT5A 1MQBA 5L2SA 2QK4A 2I0VA 3DCVA 4H05A 3RAIA 2HELA 5C8NA 2Y0AA 1R1WA 4BI2A 1S9JA 2X4ZA 3O23A 5AWMA 4UWBA 4BI1A 3LCKA 5DT0A 1BYGA 2PZPA 3D14A 4BN1A 2XM8A 3CCNA 2X9FA 4WUNA 1OIYA 3W2PA 3FBVA 3GC8A 2W1GA 4EL9A 1GNGA 2BKKA 2OXXA 2W1ZA 5HCZA 1MQ4A 4IX5A 5M06A 4X2NA 5BVEA 1F0QA 4KS7A 2YL2A 2ITPA 4O7ZA 4IX4A 5EDQA 4FG9A 4FR4A 5FGKA 5KHXA 3ROCA 3UYYA 1OL1A 3SDJA 3TW6A 3W0MA 5BWXA 2PVRA 2EVAA 2UW3A 3TY9A 1LR4A 2ZDQA 2YIYA 2ITQA 3ENMA 3PIZA 4FTQA 5CEOA 4AZWA 4O4HF 3K5VA 1OBGA 5HE3A 1SCUB 4IWYA 5DHJA 3NCGA 1XWSA 4MEDA 2XK4A 5FXQA 3R21A 4EH2A 5BWVA 4CKCA 3DNEA 2W0JA 5IH6A 2W6NA 3UNJA 2VAGA 3QBNA 5K4IA 1LPUA 4KKGA 3V8WA 4RWKA 2X8IA 3SKCA 4ZK5A 4DFUA 1G3NA 5L8JA 1WVXA 2R3FA 3NVKI 3P5KA 4MV1A 4FZDB 4BY9E 2EXCX 1XBCA 4YJRA 2W1FA 4BDCA 4KIOA 3U6JA 5AEPA 2AC5A 2BUJA 3ORIA 4HYSA 1UKHA 4UALA 5CEQA 5JH6A 2XBAA 3CEKA 3FZTA 3LCDA 4U45A 2COJA 2BCJA 4XRLA 1UWHA 5DG5A 3UO6A 5EYCA 1B6CB 3P23A 2R86A 5I5UA 2Q0NA 4A9SA 4ENYA 3KRLA 4CLIA 5EW9A 3A8WA 4FA2A 3QZGA 2ABJA 3WO1A 4YC8A 1XMLA 2COGA 2C5OA 2JIVA 3IW6A 4L44A 3A2CA 4R7HA 2FSMX 1YI3A 2ZB0A 5JMSA 4QYGA 4UCRA 1RQQA 5CI6A 4F7LA 3LCOA 5CAVA 3PPJA 5T6KA 5DISC 4GLXA 3PG3A 4C35A 4NZOA 1IAJA 2Y6OA 3C9WA 3UZBA 2ZV2A 5LQFA 3PA5A 4FBXA 4H58A 5EZYF 4XV9A 2B9FA 4ME6A 2OXDA 4G5PA 4L3LA 4AQKA 3BYOA 4IMYA 5LOHA 4NM5A 5KMIA 2OJ9A 1YWRA 2X6DA 4QP1A 1G8SA 3ZEWA 2ODTX 3QKLA 4EWQA 3GC7A 1WBWA 4M67A 2DQ7X 5BQ0A 1ZARA 3SRVA 3ZRMA 2C0TA 3V5PA 4FV0A 2A0CX 4CFVA 3CEBA 1Q61A 2CFMA 1PMEA 2YIXA 5EOBA 3H9OA 4F9AA 4WNKA 2ZVAA 3G9NA 4FSWA 4V05A 1M7NA 2PVMA 4G6OA 4L45A 2BALA 2QOOA 5HG7A 5CXHA 2F2CB 2J51A 3QTUA 4MV4A 2R3OA 3BI6A 4DG3E 4V0GB 2HGXA 2QR7A 4DH8A 1ZAUA 3DLZA 1QCFA 3KK8A 5JN2A 4FIJA 3ZSIA 5KKNB 3SXRA 3WBLA 4A9UA 4RVMA 4DHZA 2ZM1A 4DINA 4YHTA 3THBA 5A4QA 4CTBA 4EH6A 5AAEA 4DG2E 2RF9A 4RC3A 4E4MA 5KMLA 2QU5A 4HGSA 4JX7A 3ITZA 4YZCA 2QONA 4QEBA 2CCIA 3VW6A 4B6LA 3T9EA 2BKZA 3FC2A 3GGFA 3L9LA 2W5BA 4FG8A 3TIYA 4HZSA 2VQDA 3HEGA 5DT3A 5LVLA 5M4IA 4LUDA 3A99A 2Y4PA 4FL3A 3ZCLA 4J1RA 5BX0A 3S2PA 4OT6A 5T3QA 4MV6A 3MH1A 1QL6A 3ETAA 5DPVA 3NX8A 2UW9A 4LYNA 3R22A 3L8PA 4U7ZA 3UC3A 4ASZA 3MJ2A 4D5HA 4BCOA 2BDFA 2QLQA 4ANMA 4BICA 4Q4DA 3F66A 3OXIA 1JKTA 3A4OX 4KIPA 3VS7A 2QOBA 4X3FA 1ZLTA 3GCQA 2ETMA 3DTCA 2XVDA 2Z7LA 3R1QA 3TKHA 5DE2A 5AX9A 4DH5A 3PJ1A 2IN6A 4XYFA 3HYHA 3Q6WA 4IAAA 2R82A 1MRYA 4K77A 3UIMA 3UNZA 5I9UA 5LVOA 1A06A 4GG7A 4QTDA 4ANSA 3R7YA 5TOZA 4A9TA 4UEUA 2W96B 3GCPA 3P7AA 3CXWA 1MRUA 3OEFX 4FV3A 1GZ8A 4LV7A 5D9HA 2BR1A 5TF9A 4QOXA 3ZBFA 2WTKC 3H10A 3AC1A 1Q8YA 1M2PA 2XNBA 4LV8A 4DLJA 4NT4A 5A4EA 4BZDA 1UNGA 4ZSGA 4AZSA 3PWDA 4E73A 3UVQA 1H24A 2PULA 2W05A 4JQ7A 3T8OA 4JVGA 3AD6A 4MXOA 5A6OA 3G51A 3DQXA 2CLXA 5HG5A 1M6VA 2FB9A 3FLQA 2JBOA 2ERZE 3QCYA 4K33A 5BV3A 4K8AA 3FLYA 3R73A 3H3CA 3UYSA 1WBSA 3DKGA 3HRCA 2R0IA 3DGKA 1UVRA 3HZTA 5ANGA 2CDZA 2V58A 2ITTA 1DS5A 3OOGA 3PLAE 4WBNF 2VTPA 2VTQA 2WMTA 3NYVA 3SXFA 4EK3A 4E8AA 3BRBA 2FP4B 3RZBA 4F64A 2BAKA 3N51A