1OBDA

Saicar-synthase complexed with atp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
303
structure length
298
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKADENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of Saicar-Synthase Complexed with ATP
rcsb
molecule tags Ligase
molecule keywords PHOSPHORIBOSYLAMIDOIMIDAZOLE- SUCCINOCARBOXAMIDE SYNTHASE
total genus 101
structure length 298
sequence length 303
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1obdA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1obdA02
3CP9A 5HNBA 4BI1A 4YPDA 3UC4A 3RHXA 2W6MA 2A2AA 4O4JF 3V3VA 1UNGA 2WOTA 2XKDA 2BRMA 4QPAA 5ICPA 2ITPA 5CALA 3V4SA 4E5WA 3JRXA 3D7TB 4HOKA 3HV7A 4XX0B 2PMLX 2JITA 3EQFA 3KRJA 4UYNA 5DT0A 2W06A 4LGHA 5AP3A 4I50F 4FIJA 3ZFXA 4YJQA 4JI9A 2C6MA 2V5QA 1ZOEA 3DKOA 3KA0A 2G01A 3ODYX 3PJ1A 4I6BA 4WNKA 1IG1A 3T8OA 4FFNA 1H0VA 4BIDA 5M08A 1Q3DA 5JRQA 2WO6A 3DZOA 4CNHA 2IW6A 3QXOA 3ZM9A 4USEA 2FO0A 2G2HA 2J6MA 1K2PA 1R1WA 2F7XE 3QKMA 4OUCA 5CZHA 2YRXA 3VBQA 3CQEA 5DWRA 3K3PA 3GP0A 5BVDA 1ZYSA 3QRUA 2BRGA 5H2UA 3I81A 5J1WA 3MB6A 3C50A 3Q6WA 3LZBA 3OY1A 5JFSA 1W8CA 2WMVA 4JJRA 4FV0A 5HORA 1HCKA 3UNZA 4FT9A 3S1HA 4F7LA 3V5PA 4FT0A 3O50A 4CLIA 3DQWA 3G0FA 4FK6A 5HG8A 4ANLA 4AGUA 5FP6A 3DTWA 4FNXA 2PVKA 4HGSA 2O64A 5CS6A 5CT7A 3AGMA 5AJQA 4AGDA 3A62A 4IWOA 4X2JA 5E90A 3UIMA 5BUIA 3I79A 3E7OA 2HZ4A 1P4OA 2VO0A 4FI1A 3VMMA 3BYSA 1BX6A 2CN8A 4E4NA 4RG0A 2R7IA 1SZMA 4MV6A 4P5QA 1M0TA 2ITTA 2BZIB 3BQRA 5HD4A 3R1SA 2I0VA 2HCKA 3FHIA 3S95A 3OD6X 5EKOA 3QQGA 3MSSA 4EEVA 3QX2A 2PBZA 4O0VA 3Q1KA 3N9XA 2W6QA 4WUAA 3FLQA 3NX8A 5JQGF 3BV2A 3KMWA 4FVPA 3ZEWA 3AQVA 4RX7A 4N6ZA 1WBSA 2XBAA 3B8QA 4OT5A 1ZMWA 4OTIA 5KE0A 1PYEA 5IEYA 1QPCA 4IM0A 2OU7A 5EHYA 2WMUA 4DCEA 3G0EA 4FTKA 2OJGA 4GK3A 1XH8A 5AWMA 4B0GA 5F94A 2OFUA 2UW3A 3UQGA 1Q4LA 5K4IA 1PXLA 4QMVA 4EJ7A 3SDJA 3FLZA 5F1ZA 4EOJA 3ETHA 4X0MA 3R8UA 4MA5A 3OUNB 5LARA 2O3PA 2C3LA 2XNPA 4YJ3F 4GKIA 1FINA 2YZGA 1JKSA 3RKBA 2NPQA 3NMUF 3CKXA 1WCCA 2CDZA 2C69A 4U80A 4YZDA 4QP4A 3TNWA 4F9CA 2Z04A 4EQUA 5E1EA 4U45A 5EDQA 2BIKB 5K4JA 5A14A 3LFSA 2VWBA 3DBDA 3FE3A 3HRCA 5LP6F 4IQ6A 4MQ1A 4QP6A 3V5TA 5DFPA 1PJKA 4BYIA 5BPHA 2HW7A 3WIKA 4YMJA 1DI8A 1Y8GA 1ZAOA 4U3ZA 4AA0A 2R84A 3KAKA 4II5A 4JBOA 3M11A 3R7YA 4FV5A 2IZSA 3P0MA 1P5EA 2PUUA 2VAGA 5FNVF 2PUNA 3B2TA 2NRYA 3MDYA 4IZ5A 3QCSA 2OF4A 5IA0A 5CSHA 4I4TF 4FTUA 2OZAB 3JZFA 1BMKA 4BBEA 3TWJA 5KZ0A 1GGOA 4Y8DA 2DS1A 2V5AA 4WNPA 5I9UA 4CKIA 2XCLA 5IYZF 3H0YA 2BPMA 2C0TA 2YFXA 4FSWA 2HXLA 3IKAA 3EH9A 5LOHA 3ANRA 3E63A 2GQGA 2UZNA 2YACA 3PUPA 3QRIA 4KIQA 4QPSA 4TUYF 1KWPA 3Q04A 4P7EA 4TPTA 2OJJA 3EFKA 2W1HA 2YABA 3ZONA 4YR8A 5DR9A 4ZMFA 3VUMA 3EYHA 3FMMA 3EL8A 2E9VA 3CTQA 3IK3A 4IMYA 4ITJA 1E9HA 1QPJA 4N57A 3VS4A 4U5JA 5HV6A 3LP8A 4QYHA 1AUXA 3BBTB 3DBQA 3IGOA 4RJ4A 1CKJA 5LWNA 3PFQA 3K2LA 3HMPA 2ITNA 3EZRA 3G51A 1PKDA 4FTMA 2WIHA 5CSXA 4ZIMA 3ANQA 4C34A 2WQOA 4EOPA 1OL7A 2JDSA 2R3MA 3PE1A 3BX5A 5KHWA 3SE7A 2BR1A 4IC8A 2P33A 5HVKA 4NFNA 3NUNA 4F0IA 3MJFA 3OWKA 2FYSA 4PDPA 5BVNA 3NYOA 5EFQA 4W8EA 1EUDB 3I12A 3SW4A 4WBNF 5LMBA 4ASZA 4ZTMA 2FB9A 1YHVA 4MD7E 4EHEA 4MBIA 2VO6A 3QC9A 5CU6A 4ANQA 5C26A 5HTCA 3SLSA 5E8VA 4FTNA 3OZ6A 3BIZA 3G15A 3I7BA 3BU3A 3DNDA 5HG9A 3WF6A 1OI9A 4RVTA 1XH5A 1P4FA 1VBGA 2BALA 2R7BA 2EB3A 1ZZLA 4YTIA 3PG1A 4QMMA 4EK3A 5DR2A 5FEDA 2EXCX 4EBWA 2GLTA 4D1SA 5A4EA 2BZHB 4BDAA 3BE9A 2ZV8A 4ZLZA 5CF8A 3G6HA 2UVZA 3ACKA 4LOPA 4PQNA 2R3PA 4R5SA 5D10A 5JQWA 1ERKA 1MP8A 4JBQA 2YM5A 3SD0A 2PVLA 3RALA 2R7NA 3MESA 2JKMA 2QI8A 2EVAA 4OLIA 5CEKA 4ERKA 3GU6A 3PP0A 3IW4A 1OPJA 4BCIA 4WO5A 2UW5A 4BCPA 4DEBA 1GSHA 3HEGA 4BI0A 3AX6A 2I0HA 1Z57A 2GSFA 3ZS5A 2W96B 3FLYA 4PTEA 3P23A 4GFMA 4S34A 4C4EA 3UMWA 4GIIA 4G6LA 4X3FA 4MXXA 3WOWA 3O23A 5L8LA 2CNQA 3ZMMA 5LVOA 2W1IA 2PY3A 1U5QA 2Z7LA 5EOBA 3UOLA 5JH7F 1X8BA 3DK6A 5AV4A 1OIRA 2OIDA 5M51A 1QMZA 5IQGA 3SXRA 2ETKA 2CMWA 3A7JA 4QOXA 2YCFA 3P08A 3H3CA 4K11A 2X7GA 4O22A 3NUPA 2DWBA 3Q60A 2ZB1A 5EOLA 1Z2OX 3U87A 3WYXA 3T3VA 3BWFA 4BF2A 1IOWA 1U46A 3PA5A 3G6GA 4NJDA 1HOWA 2ITZA 3OT8A 2J0JA 3LHJA 1ZY4A 4DT8A 1J7LA 2IZRA 3QL8A 4FV4A 2CNVA 4O83A 2J0IA 4A9RA 2I8CA 5JK3A 5M4IA 2R3FA 4A9UA 5CA0F 4PP9A 3A4OX 3ZYAA 2BKZA 2PWLA 2IP4A 1KUTA 4OTFA 1IEPA 5ITAA 4C0TA 2PVFA 3R9RA 4ENYA 5L2TA 1KJJA 3TW6A 4YP8A 2YM3A 3MPTA 4N6YA 3BELA 4RZVA 3D7ZA 2AUHA 1PW2A 1PXKA 2OICA 2XKCA 3CJFA 3PXKA 3RMFA 3PRIA 3RI1A 3L8XA 4ID7A 3KVXA 5BUJA 4DH8A 5L2SA 3TUCA 5IH5A 5M4FA 4BIBA 4KA3A 1U54A 4DCAA 3CE3A 4PX6A 3ZM4A 1CQJB 3OCBA 4TWOA 3F5UA 5GONF 1IRKA 4LUDA 4XG4A 2R3KA 4FZAB 3R1QA 5GNKA 4ANMA 3TCPA 4M7IA 3ALNA 4GV1A 4XYMB 1YOLA 2XZSA 3C51A 3LLAA 4IADA 2WQEA 4IACA 4JDIA 4YLJA 2X8IA 3CSVA 3LCKA 3PIZA 3OVVA 3RJCA 5C4LA 2WZJA 2I80A 2ZJWA 2R3HA 3GLKA 2WELA 4XOZA 4EQCA 3KALA 3TZ8A 5HD7A 3ELJA 4U0IA 4PDYA 5HI2A 2DQ7X 4E5BA 3HA6A 4WNOA 5KZIA 2BTSA 3FI4A 2PZYA 3VVHA 5I4NA 2A0CX 3UIBA 4AUAA 5AIKA 2C6IA 5IUGA 2YDKA 3F2RA 1ZYJA 1I09A 3DJ5A 4ZY4A 5CEPA 2V58A 4D4YA 3NUYA 3H9OA 3D2KA 4UALA 1Q24A 3AC1A 5K5NA 2W17A 4O7TA 5AM6A 3THBA 3R6XA 2QHNA 2I40A 3GC9A 4MAOA 4YB8B 2VTJA 3PSBA 3LFDA 4GT5A 4KWPA 3LAUA 4J1RA 4AT4A 1KV2A 3IOKA 1ZMVA 3SXSA 4CQEA 3AT2A 3QZIA 3TN8A 5ACKA 3H4JA 4IDTA 2J9MA 3MI9A 4JG6A 4HQ6A 4MAMA 5AEPA 2GPWA 3LCTA 4DFNA 1SVHA 3GBZA 4C2VA 4BR3A 4QSHA 3TZ9A 4FK3A 4WRSA 2IVSA 4BC6A 4K6ZA 1BLXA 4BTMA 3QGWA 2GS2A 3AMYA 5KMNA 3QTWA 4ZQIA 4C02A 2C5VA 4M12A 2X1NA 2JKOA 2GS6A 5CQWA 4EH7A 4QQTA 3EN5A 2YM7A 1Q99A 3GI3A 3JZIA 3AT4A 3QA8A 4EK6A 1CE8A 1FBNA 2ITVA 4R3PA 3ZU7A 4EOQA 3COHA 4IX3A 4R77A 3U51A 1B39A 4DH7A 2GQRA 2QOQA 1HCLA 4FR4A 1EYZA 4OT6A 4W8DA 4PDOA 3NR9A 2WXVA 3W2OA 2PVMA 4QTEA 4YUQA 2RF9A 3MS9A 5FDXA 1DV2A 3KB7A 3E3PA 4ASDA 2W5HA 3OUZA 4PY1A 3KEXA 4EWHA 3VJNA 4FT7A 4M3QA 4C35A 4D0XA 1W83A 4F6WA 2X0SA 3DKGA 4IAIA 4XG2A 2B9FA 3DLSA 5HE1A 3R7IA 1OKZA 4AP7A 5CU0A 3QRKA 1PKGA 4J99A 4IB1A 5HESA 1XJDA 2YS6A 4HVGA 3W10A 5KMJA 5D7VA 3MPAA 1CSNA 4LI5A 4WKQA 2PMNX 3CPCA 3NNXA 4AZSA 3K54A 4G34A 4C61A 4GH2A 4EI4A 5IISA 3C4WA 5IPJA 1H1WA 5HCXA 2GQSA 4UB7A 4FFRA 4KRDA 2OKRA 3ODZX 4I21A 4NSTA 3D83A 5KKRB 4KINA 4NL0A 3W18A 4DEGA 5IH4A 1FGKA 2CN5A 2XK9A 2Y6MA 3TT0A 4BDKA 2FB8A 3I7CA 1APME 2Y4IC 4M67A 2YZMA 3ERKA 3EL7A 4FSZA 5C01A 4RLKA 3PSDA 5E8ZA 5IG1A 1ZY5A 3P78A 4PL5A 2VTOA 4EOMA 5LQFA 2HYYA 1PF8A 3W8LA 1M2QA 5HO8A 3ZO1A 5C1PA 1XKKA 2IVVA 5DIAA 3E8EA 2R4BA 4KBKA 4XV9A 3F66A 3V51A 3WE4A 1I7LA 4G3FA 4ZSEA 4EWQA 2R3GA 4AZWA 3VS6A 2W1ZA 2J0LA 2YAKA 5HX6A 4MXCA 5ETAA 2NRUA 4ZSJA 3GUBA 4AT3A 1PYXA 4FG7A 2J4ZA 3L9MA 1YI3A 3QA0A 4IVAA 2X7FA 3Q32A 4MK0A 1L8TA 2EWAA 4IM3A 2J2IB 3VHEA 3RAIA 3D5VA 3FMJA 3ORMA 3ORLA 3ZEPA 1OIYA 3V6SA 1JKKA 4O86A 3TXOA 3R73A 4BDIA 1YW2A 5BVOA 2HXQA 4CXAA 2OZOA 1MQ4A 4C4GA 3E8CA 1UV5A 3BLQA 4U3YA 4XLVA 5EW9A 3O96A 2H96A 4M0YA 3RTPA 2JKKA 3LFAA 4DF3A 3E5AA 4DLKA 4L43A 2R3QA 1Y6AA 3AMAA 3AD6A 4CFWA 4F9YA 2R82A 2ETMA 4HYUA 4X6QC 1XH7A 2GTMA 4NKAA 2A27A 2WNTA 1RW8A 1ZWSA 4QP9A 5CEQA 3NW5A 4ORKA 3JVSA 5T3QA 1J3HA 4LV8A 1E4EA 2XNGA 1Q8TA 2VX1A 3N4TA 3AD4A 2BMCA 4CV9A 3ZUTA 2XJ0A 3P5KA 3BI6A 3ETAA 3HO8A 1WZYA 2CKPA 2I1MA 4H3BA 2ZVAA 3JPVA 2BDFA 3WI6A 2C30A 3FMKA 4MV1A 4MX9A 3BPRA 4CMTA 2CGVA 2HJWA 3I4BA 4DE4A 3MVJA 3PVGA 4OTHA 3TIYA 1YWNA 3KL8A 3OWLA 3Q9XA 1YXTA 3EQPA 4IANA 4BGHA 3RPVA 4DBNA 4EC9A 4FKRA 4BBMA 1YI6A 1W93A 3DPKA 1SNXA 3DT1A 1UU7A 3RPYA 3OBJA 1BL7A 2ITUA 2WMXA 3MFRA 4J52A 4BZDA 1NW1A 5BVFA 3UO5A 2YAAA 3VNTA 3VS7A 2YW2A 1S9IA 4RX9A 3F5PA 4QMUA 2X6DA 1CS0A 4G31A 5AUYA 5FRIA 5CNOA 1T45A 3C9WA 4JDJA 4JX7A 3ZFMA 1Q62A 1OL5A 3R9NA 3U8WA 5E7RA 3QRTA 1YXSA 1GAGA 3H9RA 3MIYA 3DQXA 3VUGA 4QT1A 5FD2A 4A4LA 3CTHA 2PTKA 4YC6A 4TXCA 4YBJA 4BCHA 4XRJA 4IX5A 3LOKA 3LVPA 4CKJA 3JXWA 5HIDA 4ASXA 3DTCA 1PXNA 4TV8F 5AA9A 3UPZA 3TJCA 1GY3A 3GC8A 3DDQA 2V62A 4EONA 3P4KA 3PPJA 2A19B 3QYWA 3LJ1A 4O2PA 5M53A 2YZNA 3K5IA 3HMOA 3KMUA 4QTDA 3RM6A 4D2SA 4IJPA 4EZ7A 4F6SA 3SQQA 4WD5A 4N70A 3WZDA 4FZFB 4HGEA 5ETIA 5KKRC 1L3RE 3PSCA 1OUKA 2ZV2A 3EQIA 4O7YA 2G15A 4R78A 2UZLA 5J9ZA 3NW7A 3SHEA 5CAEB 1YXVA 3V5QA 4FFLA 4ZP5A 4L9IA 4RC3A 1V0BA 5HBEA 3ZOSA 3QD2B 4ASEA 3ENHA 2W7XA 4IB0A 3MWDA 3R8ZA 4K77A 4W4WA 5HBHA 1OUYA 4DYMA 3DBCA 2XIZA 3DJ7A 2XCHA 3HMMA 4Q5HA 3U55A 4C5AA 5EQPA 3FQHA 1UWJA 5DT4A 3D0EA 5L6OA 3HUBA 2WKMA 3COIA 4ACHA 3R8MA 3Q6UA 2KULA 4HZRA 2DZDA 4WA9A 1VEBA 3PTGA 4RC4A 5EI6A 4EK8A 2YRWA 3A7HA 4DHFA 4FNWA 2QHMA 4FNYA 3OG7A 2C6LA 1WVYA 3EMGA 3QCQA 4FBXA 3L9PA 4QMNA 3ZO2A 4BCNA 4PMPA 5HTBA 2NU8B 2HZIA 4BCKA 1R0EA 3C0GA 1BUHA 2W5AA 1EHIA 4G3DA 5CSWA 4ZI7F 5KMIA 1FOTA 4NYEA 2BDWA 1Z5MA 2YIXA 4TWCA 4FSNA 3VW6A 5J2TF 3O51A 4HCTA 3DV3A 4O6LA 2GHLA 4GJ2A 3HL7A 3ZFYA 3QTQA 4B4LA 4QTAA 5L2IA 4JT3A 3V5LA 1OZ1A 4V01A 2WMRA 4AU8A 2XK8A 4GKHA 1UU3A 2QU5A 4RVMA 4GU9A 2YWVA 3OTUA 2BTRA 4FOBA 3U9SA 5HE3A 1V0OA 3R9HA 4U43A 5DRDA 4FNZA 5LOVF 2AYPA 5J8IA 3FLWA 4G3CA 3Q4UA 3EQRA 4XBRA 4EOLA 4IH8A 4N4SA 1FPUA 2GFSA 4E20A 1YRPA 3IW5A 4QMWA 3KK9A 2WTDA 4JR3A 4MWIA 3AD5A 4R5YA 1OL1A 4X2NA 2H8HA 2FSLX 2UW4A 5BYYA 4QMQA 4YJSA 3TUDA 3NWWA 4CKRA 5IA4A 1YKRA 1PK8A 4UWYA 2R3OA 2V7OA 5KMMA 3EIDA 3QU0A 4MV9A 4FV6A 4IEBA 3FHRA 4G5PA 2F57A 4QP8A 4USDA 4YJRA 3VPBA 3JR1A 2VX3A 3PDTA 5DA3A 2XRUA 3HRFA 3P9JA 5C8MA 5CF4A 4FMQA 4OTWA 2IW9A 4BDGA 5LXMA 1SNUA 2I0YA 2XIXA 4HYSA 4EH5A 4C4JA 4I6QA 3ORRA 3O17A 2RGPA 3P7BA 4MV4A 4FG9A 5DOSA 1C3OA 3UG1A 1REJA 5DEYA 5GJDA 4YURA 3K3IA 1ZLTA 2OXDA 2O63A 3A7FA 1A06A 4APPA 3VWAA 4ZTQA 4FVRA 3C5IA 3FZTA 3WF8A 3R2YA 2FSMX 1F3MC 4DLJA 1BNCA 1YXUA 3PLSA 2QG5A 4LQMA 3G8CA 3TKIA 3CS9A 3QCYA 4XP0A 3RWPA 4Z7HA 3MH1A 5CXHA 3WARA 3UNJA 4FEXA 2XP2A 3FUPA 3NAYA 3KF4A 3RINA 3LM5A 3HB9A 4QNYA 4EC8A 5A4TA 2BUJA 3NNVA 4RLLA 2YISA 2P3GX 3FY0A 2CSNA 1ZZ2A 3VOTA 4IM2A 4EKKA 4BHZA 4MVFA 1W96A 3S2PA 4IVCA 4XX9A 4R3CA 5IH6A 3ETJA 3UNKA 2GNIA 4C58A 5CASA 2FPPB 3WNZA 1A48A 3ATTA 4DN5A 4O0SA 2NUAB 2F2CB 2BVAA 3R23A 3B8RA 3E64A 3UGCA 4EUTA 2YERA 2I87A 1UU8A 3UO6A 2YIRA 2X2MA 3P7AA 3TV7A 3FXXA 2C1AA 4AN2A 1BL6A 4EHVA 1H25A 1OIQA 1W98A 2C5OA 3CQUA 3GU4A 4X3JA 3QD0A 5FDPA 5DRBA 3ROCA 5M09A 1JKTA 3LMHA 4C33A 4NM7A 4R1VA 5AP1A 5HZNA 4ZTSA 3OMVA 3QWKA 2GNFA 1YDTE 5IQDA 4FEVA 3L8SA 5EH0A 5IF1A 1JKLA 4IFGA 5BMSA 4JRVA 5JSMA 5EYDA 3AC3A 3KRRA 3VULA 4LRKA 3VBTA 3VW8A 4L3PA 1M52A 4CTBA 4UYAA 2WTCA 4RGJA 4C36A 5AA8A 5LVPA 1URCA 2R87A 4GUEA 4WBOA 3GB2A 3DOGA 2IW8A 5F95A 3HZTA 2WTKC 3UJGA 3GFWA 1O6KA 1H24A 1Y91A 4E93A 2Z7SA 4UWCA 3C1XA 4BTFA 4FSQA 3DKFA 4QP1A 5AUXA 5D11A 3NCGA 3GT8A 2OXXA 4L46A 4L67A 3LIJA 4JAJA 3GFEA 4Q2AA 4NUSA 1E1XA 5L6WL 4KABA 4AWIA 4D9TA 1G3NA 5KO1A 4YTFA 3DA6A 3AXWA 3NUUA 1BYGA 5FXRA 4CTCA 4HNUA 2J51A 4FV7A 4GL9A 4HCVA 5CVHA 3UOKA 2J50A 4C62A 5CAUA 1KBLA 2R3JA 4AQCA 4D58A 4N0SA 3RPRA 3W2SA 5FM3A 5K3YA 4DINA 5IU2A 1JDBB 4MHAA 3QFVA 4RIXA 3ALOA 5FTOA 3Q4TA 2C5NA 1PXMA 2EXMA 3FMLA 2P0CA 5CT0A 3UBDA 4O2AF 2VTLA 4H1JA 4E6AA 3MTFA 1JBPE 4ANBA 2ZDHA 2GPSA 4FGBA 3L8PA 4AGWA 1TQMA 2I0EA 3UDBA 4L68A 4D1ZA 4BIEA 3QALE 4AFJA 4MTAA 5J7HA 5E8YA 3QCXA 4QTCA 1CDKA 4EHZA 5M56A 5D1JA 2CLQA 2CKEA 3N51A 3Q96A 3VUDA 1UWHA 3QHRA 2UZOA 3W55A 2G2FA 4PNIA 2Y4IB 4TNBA 5TR6A 1TVOA 2CGUA 2VO7A 3QC4A 5IDPA 3KY2A 3I6WA 4FG8A 4K8AA 2XBJA 1OB3A 4O7VA 4EH2A 3IGGA 5HCYA 1STCE 4I5MA 5CI7A 1KE6A 3ZDUA 3MWUA 2FA2A 3AMBA 3MY0A 4XG3A 3RM7A 4FTRA 4XRLA 2PK9A 5E92A 1YQJA 3NW6A 2C0OA 4H39A 4MD8E 4AFEA 4FIGA 2JLDA 3JY0A 2OSCA 4AZEA 4HR7A 5DEWA 3Q5IA 3EN6A 3VO3A 1OPKA 1WVXA 4X3FC 4FYNA 2Z60A 3C7QA 1GIJA 3QTIA 2UZVA 3N4VA 4FV1A 3PZHA 5AP0A 5AP5A 1IR3A 4QMZA 2VX0A 3QQUA 5D7AA 4FFOA 4AZVA 4UZDA 2BFYA 4ZZOA 2W1CA 3FKNA 1JDEA 3LJ2A 4AOJA 3NLBA 5CU2A 2QLQA 4GIHA 4XEYA 3TQTA 2QG7A 2X7OA 2ONLA 4EQMA 4IZYA 4HVSA 1JSUA 5GINE 3BWJA 3OXIA 3TNIA 4PMSA 4ZY5A 3FKLA 3DS6A 5AV3A 2G9XA 4FT5A 3HAVA 4YO6A 3QZHA 2V7AA 4ZMEA 2HY0A 1OBDA 2X81A 2HW6A 1U5RA 2ERKA 3HMNA 4BDBA 3DFAA 4X21A 5HCZA 1WFCA 2BFXA 2CKQA 5BVWA 5DYJA 1ND4A 4RQKA 4I41A 4AN9A 4RA4A 4ZZMA 3T9TA 1OKWA 1YHSA 4Q5EA 5FTQA 2QK4A 5I9ZA 4OTQA 2VR1A 3AC2A 2PVRA 3BYUA 3LFCA 3NNUA 4CG8A 2H34A 4F99A 3FXZA 3QTSA 1JWHA 2ITYA 5EQEA 5ETCA 4AS0A 3SA0A 3RK9A 4PDSA 4RBLA 3GCQA 1CKIA 3VUIA 5CEMA 4KAOA 4O27B 2W1FA 4C3FA 4F6UA 4J7BA 3OCSA 3U9NA 5HIBA 1E1VA 5T68A 3M2WA 3U54A 3Q9YA 2J0MB 1M0WA 3NSZA 2JDRA 3I1AA 4TT7A 4CT1A 5HBRB 3NYNA 1GOLA 3QZFA 4FTJA 4KS8A 4S33A 1DAYA 2C4GA 3M1SA 3CY2A 4WBBB 1E4EB 4GT3A 4RJ7A 5BVEA 4FFPA 5JT2A 1NXKA 4UY9A 5FBNC 4H36A 4ZY6A 4TL0A 5BMVF 2YJSA 5CA1F 5FTGA 4O81A 4MV3A 1H01A 2P2HA 3SOAA 1H1SA 2XEYA 4XG6A 3WYYA 3CEKA 4FGRA 5CXZA 4AACA 4IIJF 3KXXA 5M07A 2R0IA 1CTPE 4LYNA 4F09A 5CANA 3FEGA 3MFSA 4U41A 3NGAA 1FMKA 3PE2A 3IOPA 4H3PA 4NM3A 4Y5HA 3WZUA 4FA2A 2G2IA 4FV9A 1RJBA 2C6DA 1QPEA 2WFYA 3HLLA 4Q9SA 4V0GB 4Y46A 1KJQA 5C8YF 2YIQA 3NIEA 3UVQA 3SG8A 3MV5A 2KTYA 3HP2A 3QHWA 2GS7A 3FXWA 4FVQA 4MQ2A 5E4HA 1PXIA 3Q9ZA 2IWIA 5IQBA 2F2UA 3FY2A 4X2FA 4RIOA 3MB7A 1GJOA 1MRVA 2V0DA 4E6CA 3ORIA 3FQSA 3MVHA 4FZDB 2HWOA 3NNWA 3QD3A 3VUKA 4HNVA 3O71A 1QPDA 3ZLYA 4F64A 4YZNA 3RHKA 3GNIB 4O0TA 4C37A 4DFBA 2XRWA 4IZOA 3ENMA 4Y5QA 3F3ZA 3PPKA 5CLPA 2OK1A 3WZJA 2R9SA 2X2LA 4CMUA 4ENXA 5HU9A 2PPQA 3RUPA 2X4ZA 3O7LD 4EH9A 2PE2A 3D5WA 2ZM3A 4NM0A 2OJIA 4YO4A 1ZYDA 4XHKB 5EI2A 3UZPA 4AN3A 1IAJA 2QD9A 2UZUE 2W1EA 3LFNA 4G3EA 2PN1A 5LVNA 3MJ2A 4Z16A 5BNJA 4TW9A 2RFNA 4YSJA 2OJ9A 4DFZE 2BKKA 4DIMA 1AQ1A 4AW5A 2BROA 4O7LA 3VS3A 4RA5A 4RWJA 4WG5A 4AZFA 4JQEA 4DFYA 4EGJA 5IQCA 4O2ZA 2JBPA 3POZA 4QP3A 5ANGA 5EHLA 5AUZA 3BU5A 1NVQA 4CT2A 5AP2A 3RP9A 5HE0A 3ID6C 4FUYA 2IVUA 3TDVA 3ORTA 5AP6A 3LFFA 3QQFA 4HGLA 4GFGA 2PZ5A 2WTKB 3Q2MA 4XV3A 5AAEA 3QKKA 3MH2A 4Z7GA 2YA9A 4YJ2F 3MY1A 4ME6A 2GNHA 2B55A 3HAMA 5KCVA 4G9CA 2VQDA 3GCVA 2W4KA 3H0ZA 3ACJA 3GU7A 3P79A 4EG0A 2OF2A 3FLSA 3G9NA 4RC2A 2B54A 3HRBA 3FWQA 4YHJA 4DEDA 3OWJA 4MXZA 5AUWA 3R04A 2XH5A 3BLHA 4IVBA 2HZNA 3KRWA 2C0IA 3NUXA 4XH6A 2WQMA 2YZAA 3QX4A 3EZVA 3BQCA 4GS6A 3ORNA 3U4WA 3VF9A 5F4NA 3WE8A 1XO2B 3MFUA 4G3GA 5FXQA 3R28A 4L6QA 4MV7A 3GOKA 3IW6A 4EJNA 4UN0C 5FP5A 3PA4A 4KIPA 3SV0A 2W6PA 4J97A 1KJIA 4K33A 3FI2A 4B7TA 4RJ8A 5BUEA 2W9ZB 5EW3A 3FL5A 4Y8VB 4ALUA 2ITOA 3G2FA 2PE1A 4EH3A 1PY5A 5FXSA 2VO3A 3VAPA 1EUCB 4C5BA 4XG7A 2C1BA 1SCUB 2CHLA 3CC6A 5F20A 1IA8A 2PUIA 4ZEGA 2VWWA 1XH6A 4YZCA 5EM6A 4E8AA 5E8SA 3VRZA 5C4KA 2YYAA 1SMHA 2ZDGA 4L44A 4M84A 3BKBA 3NEWA 4U42A 2R64A 5DE2A 2OFVA 4DTBA 3O8UA 5CF6A 2VNYA 1NA7A 3CD8A 3MA3A 4HW7A 1NVRA 5JH6A 3LXPA 3Q53A 4WNMA 2JFLA 1DS5A 4V04A 1VBHA 3BG5A 2C6KA 4F65A 2C6EA 3LLTA 3L1SA 4U40A 1KE8A 1XHAA 2WTVA 2X8DA 3ZUVA 3F3WA 5AUTA 3KXNA 4YHFA 3FC1X 4J71A 3ZXZA 3EYGA 3F5XA 4OTRA 3E87A 2CJMA 3D14A 4JR7A 4YPSA 2RFDA 3TACA 4EZ5A 3UPXA 4L53A 4FKIA 5FLFA 1FVVA 1V1KA 3DBEA 4FIFA 2B52A 3FL4A 4I5CA 4O7NA 5H3QA 2X4FA 4FKOA 2JIVA 4TTHB 1XQZA 3D5UA 5J95A 4IAZA 5DI1A 2UZEA 1CM8A 2UVXA 3PVWA 2YHVA 2R86A 2CLXA 2Y0AA 4MYGA 3MBLA 5B2LA 2ONLC 1WBPA 2IJMA 2QOHA 4L3JA 4W4XA 4JG8A 4NU1A 4AX8A 1Y57A 3R22A 3Q2JA 4ZJVA 3WF9A 1GIIA 4AA5A 3OOMA 3PXZA 3QYZA 2ITWA 4ZTRA 3R8VA 4D5KA 5KHXA 3GXLA 4ALVA 4XG9A 4BZNA 5ANJA 4L42A 3GGFA 3CXWA 3TNQB 2X39A 4L45A 3ZO4A 3PPZA 3ZSGA 4WT6A 5LA6F 5L8JA 2ZDUA 2UZTA 3VJOA 4FOCA 4JDKA 4P5ZA 2CGXA 2VWYA 1B6SA 3MN3A 2Y6OA 3DB6A 3PLAE 5JFWA 2VTQA 5IQAA 4JIAA 3GOPA 3ZUUA 5M57A 2V59A 4LUEA 3TUBA 3AC5A 5FEQA 5B7VA 3IW8A 5M4CA 3KXHA 2DLNA 3OEFX 3I5NA 1Z9XA 4GVAA 5ANDA 1FGIA 4MA0A 3R9OA 1H27A 2UV2A 2BCJA 2W99B 3FZ1A 3PP1A 1JSVA 3GQLA 2FPGB 4NM5A 2WMBA 1PMUA 4UV0A 2JAMA 5AAFA 1V0PA 5HE2A 1KOAA 5IUIA 4DGMA 5TF9A 4DG2E 4XMOA 5CU4A 3FZPA 5F9EA 2BZKB 4QP2A 4XLIA 3JYAA 4YNOA 4XJ0A 3KGAA 3DXQA 4RJ3A 3RGFA 3KAJA 5DPVA 3K5HA 5BPFA 2H6DA 1WBOA 3PWDA 4O0UA 4GW8A 3TV6A 3PG3A 3A8WA 3NPCA 5M44A 4J53A 4MXOA 5C9CA 4DGGA 5JFXA 2JDVA 5CWZA 1LR4A 1H1RA 2CGWA 3EQHA 4LV5A 4HPTE 3WBLA 4D9UA 5EZYF 3EN4A 4C3PA 3CR0A 4IZAA 4BKJA 2C5YA 2VD5A 3UG2A 3U6HA 4RSSA 2PYWA 4IAAA 1ZARA 3NRMA 4FKTA 3QLFA 1VJYA 4DFXE 2WOUA 2XKFA 2J0KA 1KE9A 3FQEA 3TTIA 4UXQA 4QMXA 2VU3A 4L01A 5DVRA 4X2GA 4EYJA 2I6LA 3RWQA 2GCDA 4EOKA 4HVDA 2YITA 4GVJA 3DAEA 2GNLA 3LXNA 1OKYA 1B6RA 3E7VA 2XCKA 3GCUA 4BICA 3FSFA 3EFJA 3OOGA 4IAYA 3ZLWA 4E4MA 5CAOA 4BI2A 3V4ZA 4O6EA 3TIGA 2WMTA 4GYGA 3EFWA 1PMVA 3HYHA 4I6FA 4RFYA 5J87A 3KKVA 1EH4A 3DY7A 3EWHA 4K2RA 2XYUA 4IVDA 1WBTA 4NH1A 3PJ2A 3S3IA 2C6TA 3NIZA 4FTQA 5EDPA 3VUHA 4BGQA 3FPMA 2F9GA 2WMAA 4FODA 5TKDA 4FKSA 4CFMA 5J2UF 1Q8ZA 4O7RA 5DH3A 3ORQA 3L9NA 3P7CA 4ALWA 4BZOA 4D4VA 3BE2A 2IO6A 2JDOA 3HUCA 2YM8A 5FG8A 1KC7A 3H30A 4CRLA 2BAKA 3CCNA 5HVJA 5IMEA 3D7TA 1OECA 5HLPA 4WG3A 2R3IA 2R2PA 4FSRA 3R7OA 3CPBA 1RDQE 5DR6A 2WYOA 3OW3A 4WSYA 3COMA 4CFNA 4DEHA 1SM2A 4RX8A 3JY9A 3SW7A 4FE2A 2C3IB 3C4ZA 5AUVA 2OGVA 2B9JA 3G90X 2JGZA 1H07A 3FZRA 4JDHA 3WO1A 2VWZA 3MVMA 5FM2A 2E9PA 3EQCA 4K9YA 4BCJA 1JSTA 3TEIA 2VNWA 4UZHA 3UIXA 2XIYA 1YHWA 2R3RA 2XNEA 3F7ZA 3FYKX 3W2QA 4IZ7A 5J9LA 2OG8A 2C5XA 3AGLA 4OGRA 4CCUA 3BGPA 3KRXA 2FPIB 3A7GA 4KS7A 2E9OA 5HHWA 5IA1A 1PMEA 2A1AB 3LWBA 3D9VA 1Y8YA 4TRLA 3QWJA 3HV4A 3IDCA 4G6OA 3HDNA 3F2NA 5JEBA 1Q8YA 3LCDA 2FH9A 3UP7A 5C1OA 1R39A 3BGQA 2VGPA 4A7CA 2QOBA 3O0GA 1Q8UA 5AM7A 1U4DA 4CCBA 1XBAA 1OIUA 4BN1A 2WMSA 3NUSA 4FL3A 3LXLA 3FBVA 3N6RA 4KKGA 4IIRA 4YNEA 3GENA 4CVAA 4FTCA 2R3NA 3QUPA 3HDMA 4QYEA 1W7HA 1TKIA 4QYFA 5KKNB 4QRCA 3WZEA 4PRJA 4TKSA 2IZTA 3LE6A 5FUTA 4B8MA 4RIWA 1BI7A 2IZUA 2W71A 5H80A 3OUKA 3QQHA 5I0BA 4KB8A 1H1PA 3R1NA 5HGIA 5JGBA 4OBOA 3UYTA 4U81A 4F7NA 3AW8A 4EKLA 5I9VA 1DV1A 4DEAA 3IW7A 4YJOA 4YC8A 4BDDA 3FMDA 3FZOA 3MA6A 1CMKE 1U59A 1YWVA 3NYVA 3LQ5A 2XVDA 2R7MA 4TZRA 3CIKA 3B2WA 3KVWA 1VR2A 3O7LB 4X3FB 3MFTA 1LEWA 3VC4A 1QCFA 2XD4A 1O6YA 2I7QA 1W84A 3LFEA 2E2BA 4QYGA 5C27A 4XUFA 3KC3A 2JEDA 3WIGA 2QNJA 4EH6A 3ULIA 4F1OA 4DGOA 2YM4A 2J7TA 3C4EA 3IONA 2CKOA 1GZOA 4GMYA 4NTTA 1UA2A 4ACMA 2C3KA 3U6IA 4K18A 1RQQA 2IPXA 3BHHA 1G8SA 5IQHA 4YZMA 4BDHA 4A9SA 3PJ3A 4Z3VA 1LPUA 5LVLA 5C8KA 3MIAA 3Q52A 3T9IA 5B2MA 5BYZA 5K9IA 2IG7A 4FIEA 4F9BA 2XUUA 3QAME 4GG5A 4NJ3A 3BYVA 4D55A 4YTCA 3AG9A 1I44A 4RJ6A 3U9CA 2HENA 2RG5A 2WHBA 2C3JA 3LFQA 5BPYA 3ZRKA 4LM5A 4HYHA 2PSQA 2Q0NA 4JNWA 4QQ5A 5M4UA 4YJTA 3KQ7A 2BRBA 4OTGA 3ZDIA 3OEZA 5HNGA 2QLUA 3SG9A 4QO9A 1KOBA 4JQ8A 3DBFA 5AMNA 1AUVA 2FGIA 5J1VA 3R02A 3Q4ZA 4FKPA 5BYLA 4OBPA 4QTBA 3AC4A 5FBOA 3TG1A 2ZOQA 3OUUA 5IEVA 4GG7A 2XYNA 3POOA 4G2FA 4JLCA 5HIEA 5LWMA 1IASA 2B9IA 4ZXTA 1Q5KA 4AAAA 4M14A 1UVRA 4EK4A 2PVNA 2X2KA 3QXPA 1A9XA 1W0XC 4AOTA 3SAYA 4RFMA 4CMOA 3VS1A 1GZ8A 5KX8A 1O6LA 2WMQA 4O0RA 5ANEA 3DU8A 3II5A 4ERWA 2QOFA 2QF7A 3FLNC 4EH8A 2Z2WA 3ORPA 4G5JA 3KU2A 1H26A 2F7EE 4R7BA 3F5GA 1SVGA 2VTTA 4TYHA 3GU5A 4R7HA 4D0WA 1KV1A 5DLSA 4U6RA 4S2ZA 4E6DA 3R30A 4I4FA 4L3LA 4EK5A 3HBLA 3LKMA 4OTDA 1Y6BA 5D12A 3ZC6A 4CFXA 4DH5A 4TYJA 2PVYA 2WGJA 3P86A 4HPUE 4J8NA 3MWEA 3F9NA 4F9WA 2QCSA 4AG8A 3QUDA 4I23A 4MF1A 4FTAA 4YBZB 3KN5A 2VTRA 3U6JA 3OXTA 4ZSGA 4A4OA 5J5SA 3PVBA 5B0XA 2GNGA 4XZ3B 3OROA 2QOOA 1KE5A 4IHJF 1JQHA 3QTXA 4ITIA 3S00A 4DH3A 2EUFB 2JBOA 4FKLA 5IEXA 4FEWA 5I9WA 2VRXA 3PJCA 4HYIA 3R8PA 4ZK5A 4EHGA 2XM9A 4IE9A 1UKIA 3G5DA 3WO0A 4V05A 3HVCA 5AV0A 5H8BA 4DITA 3FZSA 3OTVA 5DN3A 3DB8A 4CEGA 1WBVA 1JOWB 3NUAA 1VZOA 4JVGA 4DAWA 4I0TA 4DEEA 4FSMA 3EFLA 2AC5A 4O38A 4ZTNA 4DC2A 4L1KA 1OITA 2P55A 4CD0A 3DF7A 5H9BA 5JMSA 4RRVA 1YWRA 3FMHA 1REKA 1K3AA 4M0ZA 4BCMA 4JQ7A 4G1WA 4GUBA 1OPLA 1AGWA 1WBWA 4I1ZA 3EN7A 4PWNA 2W4JA 3OF0A 1IA9A 4I92A 2ZM4A 2HZ0A 4KUJA 3FI8A 4GEOA 2XIKA 3W2PA 5HKMA 2JFMA 4IWQA 4QMSA 4Y95A 4CZTA 3K3JA 3KXGA 3LFBA 4O0WA 1OBGA 3C5UA 3KULB 4D5HA 5GJFA 2YDIA 3UZTA 5KMLA 2OH4A 3BLRA 2WAJA 3QTZA 5AAGA 5HBJA 5JQ5A 4X6RA 4MCVA 3E8DA 2O5KA 1PXPA 3IDPA 4L7SA 3TZ7A 3C4FA 3KK8A 1JKJB 2FSOX 4F4PA 4NFMA 3SVVA 3VPCA 3ZH8A 3V5WA 4NKSA 3V8WA 1WBNA 4TY1A 4YC3A 2PVHA 2PZIA 3PA3A 3QTRA 5G1XA 4YAKB 4DA5A 5JN2A 2PMOX 2PU8A 5EHOA 2XA4A 4YSMA 3D4QA 3OHTA 4BGGA 4TWPA 4FKWA 3RPOA 2W6OA 4FEQA 3O8TA 3GC7A 4IW0A 1MRYA 4ZOLF 4JL9A 1URWA 2XNMA 4CZUA 4RX5A 4DGLC 3S0OA 4FEUA 2WTJA 3SC1A 4OR5A 5E8XA 4C5CA 1H28A 4YAJB 1ZRZA 4O0XA 2W1DA 4L7FA 4NWMA 1JAMA 2QOIA 2ITQA 4F63A 3R2BA 5L6PA 1H00A 4O0YA 4ZLOA 5IMXA 3UQFA 4LMUA 4PP7A 4HCUA 4UXLA 4F0GA 4YZ9A 2OW3A 2FSTX 3UFXB 3WF7A 5B2KA 5IQIA 4I6HA 1XWSA 1U54B 3QF9A 2QOLA 2DYLA 4GCJA 4JOAA 5AP7A 3F7WA 4I24A 2BIYA 2X6EA 3R5HA 4FL1A 3PYYA 5BVKA 4S30A 2W1GA 4P90A 3R8LA 4F7JA 2HGSA 4KRCA 2R5TA 5CQUA 4F1TA 2XK3A 2V22A 3OC1A 3ORZA 3TZMA 1LUFA 2QURA 1JVPP 5BMMA 4DG0E 3I5ZA 5K5XA 3RFCA 2BILB 2QODA 4U44A 3ET7A 4O7SA 3QTUA 3KMMA 2R7KA 2CPKE 3BU6A 3OCTA 3I0OA 3PZEA 4Y73A 2ESMA 2XNNA 1YVJA 4KNBA 1W82A 4A07A 4D4SA 3RPSA 5HLWA 5L3AA 1GZKA 3HNGA 3KN6A 4G16A 4WIHA 3QQLA 5LXTF 4C3RA 2NU7B 2YM6A 3MJ1A 3V6RA 2QR8A 4OW8A 2J5EA 1AD5A 5EG3A 4M13A 2WMWA 4IB5A 3VBYA 3Q3BA 4A06A 3R00A 1P2AA 1M14A 3C13A 1K9AA 3EQDA 3R1YA 4HGTA 4ZS0A 4AF3A 5DMXA 1ZOGA 3UC3A 4XV1A 1LEZA 4DG3E 4F7SA 3KXZA 5KMOA 1PRYA 5CI6A 4AXAA 4Z55A 2OH0E 5A4QA 3FPQA 5AV2A 3R5FA 1S9JA 2XNBA 3HKOA 4M15A 4TNDA 3RV4A 2ZMCA 5ANIA 4NCTA 2X9EA 3SRVB 4ZOGA 3TM0A 1ATPE 2VTMA 2GDOA 3C4CA 1Z2PX 3W32A 2W70A 3GVUA 1BXRA 3LJ0A 4CLJA 2HIWA 2WEVA 3FC2A 1G5SA 4I5HA 3SGCA 3UOJA 3E93A 4FSYA 2OIBA 2ZYBA 5C03A 1VKZA 4CV8A 4YLKA 1CQIB 2G1TA 5DT3A 5ANKA 5IQEA 2QU6A 3W1FA 2JAVA 4PL3A 3TDWA 4ZJIA 4ACGA 3VRYA 3ZCLA 2RIOA 5CU3A 3IPHA 4I93A 4PNKA 4UEUA 5C1QB 3FDNA 3PXFA 4PTCA 2XEZA 1Q8WA 2GNJA 3A61A 3CBLA 3O2MA 3FMNA 3DFCB 4FC0A 2AC3A 3F88A 1TQPA 2EB2A 3N8DA 2X0GA 4NW5A 5A4LA 3NAXA 1C30A 4DEIA 3PY3A 3QBNA 5CAPA 1OMWA 2Z8CA 3QUEA 4XYLB 3PY0A 3W8QA 4BDFA 3LXKA 2E9UA 4HNTA 2OLCA 3E5NA 2YWPA 2FVDA 4FL2A 5CTPA 3SKCA 2W0JA 5CX9A 1UNHA 3G8DA 1FVRA 2LGCA 4EYMA 1O9UA 5IA3A 2VTIA 5E8WA 5H8EA 2W05A 3E88A 5KX5F 3EKNA 4FKJA 3O8PA 4EH4A 2HAKA 5CSVA 5FEEA 2CCIA 3D2IA 1DI9A 2Q0BA 3NVMB 3RCJA 3BYOA 2GMXA 4QQCA 4S31A 5FGKA 4I3ZA 2VTNA 3MYGA 4BDJA 5LMKA 5JZJA 2HELA 2QONA 4MNEB 2IN6A 5L2WA 4EOIA 2FP4B 5I5ZA 5HLNA 4UBAA 4HVIA 4UWBA 4U9AA 2QR7A 3AC8A 5EW8A 2JC6A 3ULZA 2OIQA 4LMNA 1WMKA 2BRHA 4C38A 2QO7A 4YHTA 4E7WA 4HNFA 4MNEA 4FSTA 4KBCA 1F0QA 4EUUA 4USFA 3ZZWA 4CSVA 5EYMA 3REPA 4NW6A 3R01A 5HG5A 3KFAA 3A8XA 2W4OA 3BCEA 4O84A 4QP7A 3QD4A 4YJNA 2NU6B 5CYIA 3K5UA 4D28A 2WU7A 3UVRA 3V04A 1YI4A 2Y7JA 3RK7A 4FICA 4QNAA 2NNWB 4XBUA 2P0AA 2VUWA 5AADA 1ZXEA 3V5JA 4O2BF 2BZJA 4ZSLA 2V55A 3QQJA 4IHPA 2WTIA 2UW8A 2UUEA 3I0QA 3RK5A 2PE0A 3DKCA 4F1MA 2QO9A 2QVSE 3AT3A 2UW0A 3C4XA 4GK2A 3V01A 4C4IA 4ZAUA 5LYJF 4RWLA 4ITHA 2GPHA 5AP4A 3SXFA 4OBQA 3GIDA 3F2AA 4Y72A 4Y85A 2YEXA 4A9TA 1JLUE 3QRJA 4IC7A 4O91A 3FAAA 5JGAA 1J1BA 5JKGA 2ZB0A 4C4HA 5GJGA 2WQNA 4L8MA 5A4CA 4FV8A 4D4RA 5EKNA 2XJ2A 4O4IF 3FJQE 4MV8A 1SVEA 3I6UA 3ROYA 2SRCA 4YZBA 2WB8A 4ANSA 4RZQA 2P4IA 4DFLA 2ERZE 3CQWA 1XBCA 4PV0A 3HP5A 2PHKA 4IBMA 4JRNA 2A4LA 2GHMA 5EK7A 3KF7A 4FIHA 5A3XA 3IO7A 2B4SB 3JVRA 5JZNA 1PX2A 1GLVA 1BI8A 2W6ZA 4BVUA 4MXYA 5CEOA 2PMIA 2BDJA 2W9FB 3BHYA 3F3VA 1UKHA 3M42A 1FMOE 4XCUA 2PUPA 4I55F 5KBRA 1I7NA 1DM2A 4IDVA 4EORA 1R0PA 3ORKA 4M9UA 3U9TA 4J95A 1XR1A 4YU2A 3MVLA 1H8FA 1NY3A 1Z2NX 3PWYA 2GHGA 2W6NA 2JKQA 3IQ7A 3W33A 4ACCA 4AW2A 4BTJA 4X2KA 1M2PA 2GTNA 5EM5A 3F82A 3R7EA 2BAQA 1FVTA 2VN9A 3TINA 3LMIA 4PMTA 3BGZA 1OVEA 1KSWA 4J98A 4E5AX 4H05A 4G6NA 4RVLA 2ZV7A 3R9DA 2PZPA 4LFIA 2NU9B 2ZMDA 4YLLA 5HQ0A 4FFMA 2WPAA 3E62A 3MGYA 3VBXA 1GSAA 4YJUA 4YTHA 4Y83A 3IS5A 3G33A 4FT3A 5E9EA 4JAIA 4KBAA 2YZLA 3OT3A 4D2RA 1YXXA 3VBVA 1YOMA 4C7TA 1PHKA 1BKXA 4RJ5A 4O4LF 3UODA 1J7IA 5ANOA 3OFMA 3F6XA 2C6OA 2UZWE 2PVPA 2ACXA 2XF0A 3VQHA 5HG7A 3VN9A 3CGOA 3KXMA 2VZ6A 4XS2A 2OZAA 4QMLA 1B6CB 2OI4X 3S4QA 3VS5A 4R3RA 2C00A 5AIRA 3V8TA 2YS7A 2QOCA 4KSPA 2XK7A 3H9FA 4G17A 3R7VA 5KNJA 5CZIA 4AZTA 1KE7A 5ETFA 3IDBA 3TIIA 1VYWA 2Z7RA 4CG9A 3BHVA 3OWPA 2YJRA 3SOCA 1QL6A 4FSUA 3DXPA 3OS3A 4AT5A 1OL2A 3CKWA 2UW7A 4O7ZA 2HY81 3VIDA 1TQIA 1ZYCA 1FQ1B 3Q4CA 3ZHPC 3ZSHA 3UQCA 2ITXA 4GK4A 5LMAA 4XP2A 3RVGA 3KULA 4PL4A 2UW6A 5DNRA 1GZNA 3K5VA 2CNUA 3TNPC 2ZV9A 4I94A 4U7ZA 3EB0A 4MXAA 3LCSA 3HV6A 1P14A 4RT7A 4IAFA 3HGKA 5HVYA 3HMIA 4CFVA 2YL2A 4WUNA 4HNIA 5EDRA 3BEAA 3WILA 4TYHB 4F9AA 3DNEA 3E3BX 4GT4A 3VF8A 4BYJA 4TV9F 5KBQA 4B6LA 3W2CA 1RE8A 3D5XA 4I4EA 3COKA 4ZHQF 4WG4A 4H58A 2B7AA 4BHNA 2C68A 3A4PA 3ZZEA 3P1AA 5LVMA 4RZWA 5IQFA 3ZRMA 4EL9A 4FZ7A 1MRUA 1G8AA 5DG5A 4U8ZA 5EYKA 2YIYA 3EOCA 3MTLA 1GSOA 3C0HA 5JFVA 4J96A 2VWIA 1OM1A 4R6VA 5GHVA 3EKKA 4BRXA 5CVGA 4E73A 3A60A 3PJ8A 3ZLSA 4QMPA 1Q97A 4NT4A 4DFUA 3F61A 4FKUA 5JQ8A 2YDJA 3DXNA 2YCQA 4EOOA 4ZSAA 5EM7A 4QMYA 4MBLA 3RCDA 2Y4PA 3DK7A 3BHUA 3EHAA 2VWUA 3EQBA 4NZWB 2RFSA 4TWNA 3RAWA 1PXOA 3H10A 3D15A 3WF5A 3GEQA 3OCGA 4RFZA 5ACBC 3SRVA 3TL8A 4KD1A 1A9UA 3DDPA 5D9HA 2DIKA 4O21A 2VV9A 2YCRA 3QFFA 2YN8A 3UIUA 3OY3A 2Z7QA 2C47A 5CEIA 4M68A 3GCPA 4ONAA 4B8LA 3UOHA 4YGAA 4JG7A 3NZ0A 4GRBA 4IX6A 2BHHA 5AUUA 3LCOA 4IWDA 4RPVA 5E1SA 3RAKA 5EI8A 2VTAA 3BV3A 4DH1A 3FKOA 3R21A 4LRJA 2E9NA 2ZDQA 4G9RA 3OP5A 3NYXA 1Q61A 4LOOA 4IB3A 2EU9A 2QKRA 3ZBXA 2UZBA 5AX3A 3R7UA 5L8KA 1CKPA 3FV8A 4JS8A 4O4HF 2XM8A 2Z02A 3KCFA 4RWIA 3FI3A 2J90A 3ORXA 4E26A 4ZTLA 5IA5A 4AE6A 1Q41A 4GYIA 4LL5A 4W4VA 3ZRLA 4UX9A 2WEIA 4DTKA 3CD3A 4IAKA 3WZKA 5M06A 3EQGA 5LCJA 3UTOA 5IA2A 4TYIA 5LCKA 2R85A 3LM0A 1NT2A 4NCTC 2HOGA 4DTAA 1M6VA 4RIWB 1GNGA 4W4YA 5IZFA 1XBBA 2Y8OA 3A99A 4YBKA 2B9HA 3CTJA 4E1ZA 5M55A 5GIPE 2PZRA 5A46A 3D94A 2NP8A 2XK6A 1WVWA 2DUVA 3I60A 4JBPA 4JIKA 3UP2A 5E8UA 4F08A 3HECA 1KJ8A 4C59A 3PXYA 3FSKA 1YDRE 2RG6A 2BAJA 3QQKA 1DAWA 4LG4A 3E92A 4HVHA 5CSPA 4L00A 3VS0A 4O7WA 3DAKA 2WD1A 2QC6A 3IG7A 2QO2A 3E8NA 2WIPA 1ZMUA 3R63A 3MW1A 2O8YA 3ZBFA 5FQDC 3VA7A 3LQ8A 4XOYA 4CRSA 3EJ1A 3GCSA 2RFEA 1SYKA 4R1YA 2Y9QA 4KSQA 3ZSIA 4NIFB 2QQ7A 3DGKA 1XH4A 2OWBA 1J91A 4PUZA 5EM8A 4E6QA 3R83A 5KUPA 1MQBA 2ZDTA 4GJ3A 4GSBA 3MY5A 3HX4A 4I22A 4MD9E 4RWKA 4WHZA 3ZO3A 4AOIA 4IWPA 1VYZA 4C2WA 4FV2A 3KCKA 2XNOA 4K1BA 3JUHA 4JBVA 1PXJA 3KREA 4RQVA 3VHKA 2OJFE 4KIOA 4CFUA 4FU0A 3UO4A 2REIA 3JS2A 5EYCA 4I20A 4I0SA 3PVUA 3EN9A 4BB4A 3R71A 2XK4A 3UE4A 4EOSA 5CAVA 4FKQA 4L52A 5CENA 2UW9A 2XS0A 4MNFA 4NK9A 3T3UA 3TKHA 4E4XA 5LMKC 5CB4F 5C8NA 2F49A 4QYYA 4FKGA 3BEGA 3AOXA 3RV3A 2HK5A 3A2CA 3DCVA 3GQIA 3Q2OA 4ZS4A 4AW1A 1R78A 4MEDA 2R0UA 2IVTA 4GFOA 4BDEA 3PIYA 3R5XA 1OL6A 4WOVA 5E8TA 1JNKA 5JRSA 3FMEA 1H4LA 4QMTA 4U79A 4DLIA 1DIKA 4H3QA 5BX0A 3ZTXA 3HV5A 3ATSA 4RMZA 4M97A 2WTWA 3DJ6A 5AFVA 2VGOA 3UYSA 2WU6A 1OKVA 3PXRA 5A6NA 4FUXA 3TV4A 4HZSA 3W16A 4XNEA 3QZGA 4BBFA 2XMYA 3NCZA 5IUHA 2HWPA 3CGFA 4LRMA 5JGDA 4RVKA 3DLZA 5DHJA 4ZJJA 4EZ3A 2VWXA 5JVDF 1ULZA 1KJ9A 5T6KA 1WAKA 3TTJA 1YOJA 2YCSA 4FTOA 4XG8A 2X9FA 5H8GA 2PL0A 4FYOA 5HO7A 4APCA 2LAVA 4MKCA 5DBXA 3RAHA 4J8MA 1KEEA 1Q3WA 4TN6A 3L9LA 4WRGA 4ARKA 5JVLA 3DAJA 4I5PA 3BHTA 4O96A 4ZTHA 4A4XA 4RIXB 5E91A 2B0QA 4P2KA 2P2IA 2O65A 5AX9A 3MH0A 4F70A 4GU6A 5HU3A 1H08A 5CAQA 4IFCA 4FKVA 1B38A 1NVSA 4FV3A 3OBGA 2GFCA 3PRFA 2OLSA 1MUOA 5I9XA 5CNNA 3LQ3A 3ITZA 3LW0A 2JIIA 2J5FA 2R7LA 1OGUA 2SCUB 3OW4A 3VS2A 3TNHA 3CY3A 2H9VA 2NO3A 3F69A 4M69B 5D41A 5AV1A 4BDCA 5HNIX 1JLLB 3BZ3A 5CVFA 4B99A 5CY3A 4RIYB 4D1XA 4U97A 3ZXTA 2QOKA 4XYFA 4BCFA 3QKLA 3HA8A 4QMOA 1PMNA 5KMKA 1J7UA 1M17A 3UVPA 3LPBA 3VQUA 3UZRA 1J1CA 4A9YA 4AA4A 2XJ1A 3RZBA 4QQJA 2VPQA 4R7IA 4RIYA 4AE9A 4DT9A 1IAHA 1M7NA 4FTIA 3TI1A 4EBVA 4E4LA 3DK3A 4FZ6A 4PF4A 4DBXA 3A7IA 2BHEA 2OBJA 4FX3A 4I0RA 1XH9A 4Z9LA 4LL0A 5IDNA 2W5BA 3RNIA 4BCOA 1GIHA 3CJGA 2F7ZE 2JD5A 3BBWA 2XB7A 2ZAZA 3MPMA 5TO8A 2PVJA 5A9UA 3CLYA 3TIZA 2B53A 2XKEA 4TYGA 2CCHA 3QGYA 4IX4A 4PMMA 3FYJX 3Q5ZA 3QLGA 5TT7A 3JRWA 1T46A 1F5QA 2VWVA 2OXYA 2F4JA 3NDMA 4H1MA 3R0TA 4BCGA 4B9DA 4YJPA 5LJJA 5A54A 5D8DA 2YIWA 4ZZNA 3F3UA 1UU9A 2O2UA 4JX3A 4JXFA 5GIOE 2CZGA 2ETRA 4EGQA 2JIUA 3F3TA 2GU8A 1M2RA 3DZQA 2PULA 4FTLA 3KRLA 3ZLXA 5HEZA 4XV2A 2FUMA 2WQBA 5HX8A 3N4UA 3VBWA 5A6OA 2UZDA 2QKWB 3UMXA 3ZC5A 1T36A 3LMGA 4BTKA 4ZLYA 4F0FA 4Q9ZA 1H0WA 2Q83A 2VTSA 1YDSE 3MH3A 4DGNA 4K0YA 3G9LX 4PTGA 4C4FA 4KKEA 4FTTA 3BYMA 4MBJA 4NTSA 4X7QA 3SX9A 4XP3A 2RKUA 4MWHA 3HV3A 3BRBA 3Q9WA 3NVKI 2RL5A 3U4UA 3NS9A 4FIIA 1H1QA 1JPAA 3OXZA 3L8VA 4LOQA 4M8TA 4MH7A 2XIRA 4TYEA 5BQ0A 2DWCA 4YJVA 2VTHA 3TJDA 1WR2A 4KKHA 3C0IA 4IJ9A 5J9YA 4AW0A 1IOVA 3W2RA 5G6VA 4HJOA 3GU8A 1UNLA 2UVYA 5CF5A 1ZOHA 5I9YA 4E4TA 3GC0A 2X8EA 4LGGA 3TKUA 5DGZA 5EQYA 5TOZA 4CFFA 4V0GA 2R3LA 1R3CA 5HICA 2O0UA 4BY9E 4BCQA 3V8SA 2OO8X 1EZ1A 3PXQA 4O82A 2VTPA 2B1PA 3PY1A 3PIXA 2J9GA 1LP4A 2BRNA 2JDTA 4S32A 3IECA 4AGCA 2ZM1A 4ACDA 1M7QA 4CGAA 4P4CA
chains in the Genus database with same CATH superfamily
3CP9A 5HNBA 4BI1A 3BA9A 4YPDA 3UC4A 3RHXA 2W6MA 2A2AA 4O4JF 3V3VA 1UNGA 2WOTA 3JSNA 2XKDA 2BRMA 4QPAA 5ICPA 2ITPA 5CALA 4LH7A 3V4SA 4E5WA 3JRXA 3D7TB 4HOKA 3HV7A 4XX0B 2PMLX 2JITA 3EQFA 3KRJA 4DHIB 4UYNA 5DT0A 2W06A 4LGHA 5AP3A 4I50F 1OGYA 4FIJA 4YJQA 3ZFXA 3BLAA 2C6MA 4JI9A 1A0GA 2V5QA 1ZOEA 3DKOA 3KA0A 2G01A 3ODYX 3PJ1A 4I6BA 4WNKA 1IG1A 3T8OA 4FFNA 1H0VA 4AXCA 4BIDA 5M08A 1Q3DA 5JRQA 2WO6A 3DZOA 4CNHA 2IW6A 3QXOA 3ZM9A 4USEA 2FO0A 2G2HA 4JXUA 2J6MA 1K2PA 1R1WA 2F7XE 3QKMA 4OUCA 5CZHA 2YRXA 3VBQA 3CQEA 5DWRA 3K3PA 3GP0A 4QEBA 5BVDA 1ZYSA 3QRUA 2BRGA 5H2UA 3I81A 5J1WA 3MB6A 3C50A 3Q6WA 3LZBA 3OY1A 5JFSA 1W8CA 2WMVA 4JJRA 4FV0A 5HORA 1HCKA 3UNZA 4FT9A 3S1HA 4EFEA 4F7LA 3V5PA 4FT0A 3O50A 4CLIA 3DQWA 3G0FA 4FK6A 5HG8A 4ANLA 4TM5A 4AGUA 5FP6A 3DTWA 4FNXA 2PVKA 4HGSA 2O64A 5CS6A 5CT7A 3AGMA 5AJQA 4AGDA 3A62A 4IWOA 4X2JA 5E90A 3UIMA 5BUIA 1I2LA 3I79A 3E7OA 2HZ4A 1P4OA 2VO0A 3W0PA 4FI1A 4QDVA 2HG8A 3VMMA 3BYSA 1BX6A 2CN8A 4E4NA 4RG0A 2HHFB 2R7IA 1SZMA 5K3WA 5BWUA 4MV6A 4P5QA 1M0TA 2ITTA 2BZIB 3BQRA 5HD4A 3R1SA 2I0VA 2HCKA 3FHIA 3S95A 3OD6X 5EKOA 3QQGA 3MSSA 4EEVA 3QX2A 2PBZA 4O0VA 3Q1KA 3N9XA 2W6QA 4WUAA 3FLQA 3NX8A 5JQGF 3BV2A 3KMWA 4FVPA 3ZEWA 3AQVA 4RX7A 4N6ZA 1WBSA 2XBAA 3B8QA 4OT5A 1ZMWA 4OTIA 5KE0A 1PYEA 5IEYA 1QPCA 4IM0A 2OU7A 5EHYA 2WMUA 4DCEA 3G0EA 4FTKA 2OJGA 4GK3A 1XH8A 5AWMA 4B0GA 5F94A 2OFUA 2UW3A 3UQGA 1Q4LA 5K4IA 1PXLA 4QMVA 4EJ7A 3SDJA 3FLZA 5F1ZA 4EOJA 3ETHA 4X0MA 3R8UA 4MA5A 2HVSA 3OUNB 5LARA 2O3PA 2C3LA 2XNPA 4YJ3F 4GKIA 1FINA 2YZGA 1JKSA 3RKBA 2NPQA 3NMUF 3CKXA 1WCCA 2CDZA 2C69A 4U80A 4YZDA 4QP4A 3TNWA 4F9CA 2Z04A 4EQUA 5E1EA 4U45A 5EDQA 2BIKB 5K4JA 5A14A 3LFSA 2VWBA 3DBDA 3FE3A 3HRCA 5LP6F 4IQ6A 4MQ1A 4QP6A 3V5TA 5DFPA 1PJKA 4BYIA 5BPHA 3WWHA 2HW7A 3WIKA 4YMJA 1DI8A 1Y8GA 1ZAOA 4U3ZA 4AA0A 2R84A 3KAKA 4II5A 4JBOA 3M11A 3R7YA 3TW7A 4FV5A 2IZSA 3P0MA 1P5EA 2PUUA 2VAGA 5FNVF 2PUNA 3B2TA 2NRYA 3MDYA 4IZ5A 3QCSA 2OF4A 5IA0A 5CSHA 4I4TF 4FTUA 2OZAB 3JZFA 1BMKA 4BBEA 3TWJA 3UQ8A 5KZ0A 1GGOA 4Y8DA 2DS1A 2V5AA 4WNPA 5I9UA 4CKIA 2XCLA 5IYZF 3H0YA 3UZOA 2BPMA 2C0TA 2YFXA 4FSWA 2HXLA 3IKAA 3EH9A 5LOHA 3ANRA 3E63A 2GQGA 2UZNA 2YACA 4WHXA 3PUPA 3QRIA 4KIQA 4QPSA 4TUYF 1KWPA 3Q04A 3T9EA 4P7EA 4TPTA 2OJJA 3EFKA 2W1HA 2YABA 3ZONA 4YR8A 5DR9A 4ZMFA 3VUMA 3EYHA 3FMMA 3EL8A 2E9VA 3CTQA 3IK3A 4IMYA 4ITJA 1E9HA 1QPJA 4N57A 3VS4A 4U5JA 5HV6A 3LP8A 4CKBA 4QYHA 3ML1A 1AUXA 3BBTB 3DBQA 3IGOA 4RJ4A 1CKJA 5LWNA 3PFQA 3K2LA 3HMPA 2ITNA 3EZRA 3G51A 1PKDA 4FTMA 2WIHA 5CSXA 4ZIMA 3ANQA 4C34A 2WQOA 4EOPA 1OL7A 2JDSA 2R3MA 3PE1A 3BX5A 5KHWA 3SE7A 2BR1A 4IC8A 2P33A 5HVKA 4NFNA 3NUNA 4F0IA 3MJFA 3OWKA 3TEKA 2FYSA 4PDPA 5BVNA 3NYOA 5EFQA 4W8EA 1EUDB 3I12A 3SW4A 4WBNF 5LMBA 4ASZA 4ZTMA 1P8LA 2FB9A 1YHVA 4MD7E 4EHEA 4MBIA 2VO6A 3QC9A 5CU6A 4ANQA 5C26A 5HTCA 3SLSA 5E8VA 4FTNA 1KT8A 3OZ6A 3BIZA 3G15A 3I7BA 3BU3A 3DNDA 5HG9A 3WF6A 1OI9A 1TA8A 4RVTA 1XH5A 1P4FA 1VBGA 2BALA 2R7BA 3O5AA 2EB3A 1ZZLA 4YTIA 3PG1A 4QMMA 4EK3A 5DR2A 5FEDA 2EXCX 4EBWA 2GLTA 5I5UA 4D1SA 5A4EA 2BZHB 4BDAA 3BE9A 2ZV8A 4ZLZA 5CF8A 3G6HA 2UVZA 3ACKA 4LOPA 4PQNA 2R3PA 4R5SA 5D10A 1VS0A 4EFBA 5JQWA 1ERKA 1MP8A 4JBQA 2YM5A 3SD0A 2PVLA 3RALA 2R7NA 3MESA 2JKMA 2QI8A 3KIOC 2EVAA 4OLIA 5CEKA 4ERKA 3GU6A 3PP0A 3IW4A 1OPJA 4BCIA 3BA8A 4WO5A 2UW5A 4BCPA 4DEBA 1GSHA 3HEGA 4BI0A 3AX6A 2I0HA 1Z57A 2GSFA 3ZS5A 2W96B 3FLYA 4PTEA 3P23A 4GFMA 4S34A 1TFFA 4C4EA 3UMWA 4GIIA 4G6LA 4X3FA 4MXXA 3WOWA 3O23A 5BYAA 5L8LA 2CNQA 3ZMMA 5LVOA 2W1IA 4MUQA 2PY3A 1U5QA 2Z7LA 5EOBA 3UOLA 5JH7F 1X8BA 3DK6A 5AV4A 1OIRA 2OIDA 5M51A 1QMZA 5IQGA 3SXRA 4CC5A 2ETKA 2CMWA 3A7JA 4QOXA 2YCFA 3P08A 3H3CA 4K11A 2X7GA 4O22A 3NUPA 2DWBA 3Q60A 2ZB1A 5EOLA 1Z2OX 3DTFA 3U87A 3WYXA 3T3VA 3BWFA 4BF2A 4UCUA 1IOWA 1U46A 3PA5A 3G6GA 4NJDA 1HOWA 2ITZA 3OT8A 2J0JA 3LHJA 1ZY4A 4DT8A 1J7LA 2IZRA 3QL8A 4FV4A 2CNVA 4O83A 2J0IA 4A9RA 2I8CA 5DISC 5JK3A 5M4IA 2R3FA 4A9UA 5CA0F 4PP9A 3A4OX 3ZYAA 2BKZA 2PWLA 2IP4A 1KUTA 4OTFA 5CE8A 1IEPA 5ITAA 4C0TA 2PVFA 3R9RA 4ENYA 5L2TA 1KJJA 3TW6A 4YP8A 2YM3A 3MPTA 4N6YA 3BELA 4RZVA 3D7ZA 2AUHA 1PW2A 1PXKA 2OICA 2XKCA 3CJFA 3PXKA 3RMFA 3PRIA 3RI1A 3L8XA 4PZ7A 4ID7A 3KVXA 5BUJA 4DH8A 5L2SA 3TUCA 5IH5A 5M4FA 4BIBA 4KA3A 1U54A 4DCAA 4DDIA 3CE3A 4PX6A 3ZM4A 1CQJB 3OCBA 4TWOA 3F5UA 3NC0B 5GONF 1IRKA 4LUDA 4XG4A 2R3KA 4FZAB 3R1QA 5GNKA 4ANMA 3TCPA 4M7IA 3ALNA 4GV1A 4XYMB 1YOLA 2XZSA 3C51A 3LLAA 4IADA 2WQEA 4IACA 4JDIA 4YLJA 2X8IA 3CSVA 3LCKA 3PIZA 3OVVA 3RJCA 5C4LA 2WZJA 2I80A 2ZJWA 2R3HA 3GLKA 2WELA 4XOZA 4EQCA 3KALA 3TZ8A 5HD7A 3W5OA 3ELJA 4U0IA 4PDYA 5HI2A 2DQ7X 4E5BA 3HA6A 4WNOA 4NZOA 5KZIA 5KS8A 2BTSA 3FI4A 2PZYA 3VVHA 5I4NA 1S68A 2A0CX 3UIBA 4AUAA 5AIKA 2C6IA 5IUGA 2YDKA 3F2RA 1ZYJA 1I09A 3DJ5A 4ZY4A 5CEPA 2V58A 4D4YA 3NUYA 3W1BA 3H9OA 3D2KA 4UALA 1Q24A 3AC1A 5K5NA 3WWJA 2W17A 4O7TA 5AM6A 3THBA 3R6XA 2QHNA 2I40A 3GC9A 4MAOA 4YB8B 2VTJA 3PSBA 3LFDA 4GT5A 4KWPA 3LAUA 4J1RA 3VPDA 4AT4A 1KV2A 3IOKA 1ZMVA 3SXSA 4CQEA 3AT2A 3QZIA 3TN8A 5ACKA 3H4JA 4IDTA 2J9MA 3MI9A 4JG6A 4HQ6A 4MAMA 5AEPA 2GPWA 3LCTA 4DFNA 1SVHA 3GBZA 4C2VA 4BR3A 4QSHA 3TZ9A 4FK3A 4WRSA 2IVSA 4BC6A 4K6ZA 1BLXA 4BTMA 3QGWA 2GS2A 3AMYA 5KMNA 3QTWA 4ZQIA 4C02A 2C5VA 4M12A 2X1NA 2JKOA 2GS6A 5CQWA 4EH7A 4QQTA 3EN5A 2YM7A 1Q99A 3GI3A 3JZIA 3AT4A 3QA8A 4EK6A 1CE8A 1FBNA 2ITVA 4R3PA 3ZU7A 4EOQA 3COHA 4IX3A 4R77A 3U51A 1B39A 4DH7A 2Y4RA 2GQRA 2QOQA 1HCLA 4FR4A 1EYZA 4OT6A 3T9FA 4W8DA 4PDOA 3NR9A 2WXVA 3W2OA 2PVMA 4QTEA 4YUQA 2RF9A 3MS9A 5FDXA 1DV2A 3KB7A 3E3PA 4ASDA 2W5HA 3OUZA 4PY1A 3KEXA 4EWHA 3VJNA 4FT7A 2ZFYA 3P5JC 4M3QA 4C35A 1W83A 4D0XA 4F6WA 2X0SA 3DKGA 4IAIA 4XG2A 2B9FA 3DLSA 5HE1A 3R7IA 1OKZA 4AP7A 5CU0A 3QRKA 1PKGA 4J99A 4IB1A 5HESA 1XJDA 2YS6A 4HVGA 3W10A 5KMJA 5D7VA 3MPAA 3AKKA 1CSNA 4LI5A 4WKQA 2PMNX 3CPCA 3NNXA 4AZSA 3K54A 4G34A 3PN1A 4C61A 4GH2A 4EI4A 5IISA 3C4WA 5IPJA 1H1WA 5HCXA 2GQSA 4UB7A 4FFRA 4KRDA 2OKRA 3NFGB 3ODZX 4I21A 3D83A 4NSTA 4KINA 5KKRB 4NL0A 3W18A 4DEGA 5IH4A 1FGKA 3W1GA 2CN5A 2XK9A 2Y6MA 3TT0A 3T54A 4BDKA 2FB8A 3I7CA 1APME 2Y4IC 4M67A 2YZMA 3ERKA 3EL7A 4FSZA 5C01A 4RLKA 3PSDA 5E8ZA 5IG1A 1ZY5A 3P78A 4PL5A 2VTOA 4EOMA 5LQFA 2HYYA 1PF8A 3W8LA 1M2QA 5HO8A 3ZO1A 5C1PA 1XKKA 2IVVA 5DIAA 4DAAA 2R4BA 3E8EA 4KBKA 4XV9A 3F66A 3V51A 3WE4A 1I7LA 4G3FA 4ZSEA 4EWQA 4F78A 2R3GA 4AZWA 3VS6A 2W1ZA 4CC6A 2J0LA 2YAKA 5HX6A 4MXCA 5ETAA 2NRUA 4ZSJA 3GUBA 4AT3A 1PYXA 3S24A 3T7AA 4FG7A 2J4ZA 3L9MA 1YI3A 3QA0A 4IVAA 2X7FA 3Q32A 4MK0A 1L8TA 2EWAA 4IM3A 2J2IB 3VHEA 3RAIA 3D5VA 3FMJA 3ORMA 3ORLA 3ZEPA 1OIYA 3V6SA 1JKKA 4O86A 3TXOA 3R73A 2XAMA 1YW2A 4BDIA 5BVOA 2HXQA 4CXAA 2OZOA 1MQ4A 4C4GA 3E8CA 1UV5A 3BLQA 4U3YA 4XLVA 5EW9A 3O96A 2H96A 4M0YA 3RTPA 2JKKA 3LFAA 4DF3A 3E5AA 4DLKA 4L43A 2R3QA 1Y6AA 3AMAA 5I5XA 3AD6A 4CFWA 4F9YA 2R82A 2ETMA 4HYUA 4X6QC 1XH7A 2GTMA 4NKAA 2A27A 2WNTA 1RW8A 1ZWSA 4QP9A 5CEQA 3NW5A 4ORKA 3JVSA 5T3QA 1J3HA 4LV8A 1E4EA 2XNGA 1Q8TA 2VX1A 3N4TA 3AD4A 2BMCA 4CV9A 2HGWA 3ZUTA 2XJ0A 3P5KA 3BI6A 3ETAA 3HO8A 1WZYA 2CKPA 2I1MA 4H3BA 2ZVAA 3JPVA 2BDFA 3WI6A 2C30A 3FMKA 4MV1A 4MX9A 3BPRA 4CMTA 2EJ2A 2CGVA 2HJWA 3I4BA 4UCTA 4DE4A 3MVJA 3PVGA 4OTHA 3TIYA 1YWNA 3KL8A 3OWLA 3Q9XA 1YXTA 3EQPA 4IANA 4BGHA 3RPVA 4DBNA 4EC9A 4FKRA 4BBMA 1YI6A 1W93A 3DPKA 1SNXA 3DT1A 1UU7A 3RPYA 3OBJA 1BL7A 2ITUA 2WMXA 3MFRA 2HIXA 4J52A 4BZDA 1NW1A 5BVFA 3UO5A 2YAAA 3VNTA 3VS7A 2YW2A 1S9IA 4RX9A 3F5PA 4QMUA 2X6DA 1IYEA 1CS0A 3UZBA 4G31A 5AUYA 5FRIA 5CNOA 1T45A 3C9WA 4JDJA 4JX7A 3ZFMA 1Q62A 1OL5A 3R9NA 3U8WA 3GB8B 5E7RA 3QRTA 1YXSA 1GAGA 3H9RA 3MIYA 3DQXA 3VUGA 4QT1A 5FD2A 4A4LA 3CTHA 2PTKA 4YC6A 4TXCA 4YBJA 4BCHA 4XRJA 4IX5A 3LOKA 3LVPA 4CKJA 3JXWA 5HIDA 4ASXA 3DTCA 1PXNA 4TV8F 5AA9A 3UPZA 3TJCA 1GY3A 3GC8A 3DDQA 2V62A 4EONA 3P4KA 3PPJA 2A19B 3QYWA 3LJ1A 4O2PA 5M53A 2YZNA 3K5IA 3HMOA 3KMUA 4QTDA 3RM6A 4D2SA 4IJPA 4EZ7A 4F6SA 3SQQA 4WD5A 4N70A 3WZDA 4FZFB 4HGEA 5ETIA 5KKRC 1L3RE 3PSCA 1OUKA 1P16A 2ZV2A 3EQIA 4O7YA 2G15A 4R78A 2UZLA 5J9ZA 3NW7A 3SHEA 5CAEB 1YXVA 3V5QA 4FFLA 4ZP5A 4L9IA 4RC3A 1V0BA 5HBEA 3ZOSA 3QD2B 4ASEA 3ENHA 2W7XA 4IB0A 4UUGA 3MWDA 3R8ZA 4K77A 4W4WA 5HBHA 1OUYA 4DYMA 3DBCA 2XIZA 3DJ7A 2XANA 2XCHA 3HMMA 4Q5HA 3U55A 4C5AA 5EQPA 3FQHA 1UWJA 5DT4A 3D0EA 5L6OA 3UYYA 3HUBA 4DDGA 2WKMA 3COIA 4ACHA 3T9AA 3R8MA 3Q6UA 2KULA 4HZRA 2DZDA 4WA9A 1VEBA 3PTGA 4RC4A 5EI6A 4EK8A 2YRWA 3A7HA 4DHFA 4FNWA 1I1KA 2QHMA 4FNYA 3OG7A 2C6LA 1WVYA 3EMGA 3QCQA 4FBXA 3L9PA 4QMNA 3ZO2A 4BCNA 4PMPA 3W0MA 5HTBA 2NU8B 2HZIA 1X9NA 4BCKA 1R0EA 3C0GA 1BUHA 2W5AA 1EHIA 4G3DA 5CSWA 4ZI7F 5KMIA 1FOTA 4NYEA 2BDWA 1Z5MA 2YIXA 4TWCA 4FSNA 3VW6A 5J2TF 3O51A 4HCTA 3DV3A 4O6LA 2GHLA 4GJ2A 3HL7A 3ZFYA 3QTQA 4B4LA 4QTAA 5L2IA 2HHFA 4JT3A 3V5LA 1OZ1A 4V01A 2WMRA 4AU8A 2XK8A 4GKHA 1UU3A 2QU5A 4RVMA 5D1OB 4GU9A 2YWVA 3OTUA 2BTRA 4FOBA 3U9SA 5HE3A 1V0OA 3R9HA 4CKEA 4U43A 5DRDA 4FNZA 5LOVF 2AYPA 5J8IA 3FLWA 4G3CA 3Q4UA 3EQRA 4XBRA 4EOLA 4IH8A 4N4SA 1FPUA 2GFSA 4E20A 1YRPA 3IW5A 4QMWA 3KK9A 4AXDA 3W0SA 2WTDA 4JR3A 4MWIA 3AD5A 4R5YA 1OL1A 4X2NA 2H8HA 2FSLX 2UW4A 5BYYA 4QMQA 4YJSA 3TUDA 3NWWA 4CKRA 5IA4A 1YKRA 1PK8A 4UWYA 2Q2UA 2R3OA 2V7OA 5KMMA 3EIDA 3QU0A 4MV9A 4FV6A 4IEBA 3FHRA 4G5PA 2F57A 4QP8A 4USDA 4YJRA 3VPBA 3JR1A 2VX3A 3PDTA 5DA3A 2XRUA 3HRFA 3P9JA 5C8MA 5CF4A 4FMQA 4OTWA 2IW9A 4BDGA 5LXMA 3HT5A 1SNUA 4CE5A 2I0YA 2XIXA 4HYSA 2ZGIA 4EH5A 4C4JA 4I6QA 3ORRA 3O17A 2RGPA 3P7BA 3QQMA 4MV4A 4FG9A 5DOSA 1C3OA 4EQ5A 3UG1A 1REJA 5DEYA 5GJDA 4YURA 3K3IA 1ZLTA 2OXDA 2O63A 3A7FA 1A06A 4APPA 5BWTA 3VWAA 4ZTQA 4FVRA 3C5IA 4AXFA 3FZTA 1G8JA 3WF8A 3R2YA 2FSMX 1F3MC 4DLJA 1BNCA 1YXUA 3PLSA 2QG5A 4LQMA 3G8CA 3TKIA 3CS9A 3QCYA 4XP0A 3RWPA 4Z7HA 3MH1A 5CXHA 4UCRA 3WARA 3UNJA 4FEXA 2XP2A 3FUPA 3NAYA 3KF4A 3RINA 3LM5A 3HB9A 4QNYA 4EC8A 5A4TA 2BUJA 3NNVA 4RLLA 4RCNA 2YISA 2P3GX 3FY0A 2CSNA 1ZZ2A 2Q7DA 3VOTA 4IM2A 4EKKA 4BHZA 4MVFA 1W96A 3S2PA 4IVCA 4XX9A 4R3CA 5IH6A 5CR5A 3ETJA 3UNKA 2GNIA 4C58A 5CASA 5K2MA 2FPPB 3WNZA 1A48A 3ATTA 4DN5A 4O0SA 2NUAB 2F2CB 2BVAA 3R23A 3B8RA 3E64A 3UGCA 4EUTA 2YERA 4CHIA 2I87A 1UU8A 3UO6A 2YIRA 2X2MA 3P7AA 3TV7A 3FXXA 2C1AA 4AN2A 1BL6A 4EHVA 1H25A 1OIQA 1W98A 2C5OA 3CQUA 3GU4A 4X3JA 3QD0A 5FDPA 5DRBA 3ROCA 5M09A 1JKTA 3LMHA 4C33A 4NM7A 4R1VA 5AP1A 3UDZA 5HZNA 4ZTSA 3OMVA 3QWKA 2GNFA 1YDTE 5IQDA 4FEVA 3L8SA 5EH0A 5IF1A 1JKLA 4IFGA 5BMSA 4JRVA 5JSMA 5EYDA 3AC3A 3KRRA 3VULA 4LRKA 3VBTA 3VW8A 4L3PA 1M52A 4CTBA 4UYAA 2WTCA 4RGJA 4C36A 5AA8A 3JSLA 5LVPA 1URCA 2R87A 4GUEA 4WBOA 3GB2A 3DOGA 2IW8A 5F95A 3HZTA 2WTKC 3UJGA 3GFWA 1O6KA 1H24A 1Y91A 4E93A 5I5YA 2Z7SA 4AAYA 4UWCA 3C1XA 2HVRA 4BTFA 4FSQA 3DKFA 4QP1A 5AUXA 3T9CA 5D11A 3NCGA 3GT8A 2OXXA 4L46A 4L67A 3LIJA 4JAJA 3GFEA 4Q2AA 4NUSA 1E1XA 5L6WL 4KABA 4AWIA 4D9TA 1G3NA 5KO1A 4YTFA 3DA6A 3AXWA 3NUUA 4M0JA 1BYGA 5FXRA 4CTCA 4HNUA 2J51A 4FV7A 4GL9A 4HCVA 5CVHA 3UOKA 2J50A 4C62A 5CAUA 1KBLA 2R3JA 4AQCA 4D58A 4N0SA 3RPRA 3W2SA 5FM3A 5K3YA 4DINA 5IU2A 1JDBB 4MHAA 3QFVA 4RIXA 3ALOA 5FTOA 3Q4TA 2C5NA 1PXMA 2EXMA 3FMLA 2P0CA 5CT0A 3UBDA 4O2AF 2VTLA 4H1JA 4E6AA 3MTFA 1JBPE 4ANBA 2ZDHA 2GPSA 4FGBA 3L8PA 4AGWA 1B04A 2Q2TA 1TQMA 2I0EA 3UDBA 4L68A 4D1ZA 4BIEA 3QALE 4AFJA 4MTAA 5J7HA 5E8YA 3QCXA 4QTCA 1CDKA 4EHZA 5M56A 5D1JA 2CLQA 2CKEA 3N51A 3Q96A 3VUDA 1UWHA 3QHRA 2UZOA 3W55A 2G2FA 4PNIA 2Y4IB 4TNBA 5I47A 5TR6A 1TVOA 2CGUA 2VO7A 3QC4A 5IDPA 3KY2A 3I6WA 4FG8A 4K8AA 2XBJA 1OB3A 4O7VA 4EH2A 3IGGA 5HCYA 1STCE 4I5MA 5CI7A 1KE6A 3ZDUA 3GDEA 3MWUA 2FA2A 3AMBA 3MY0A 4XG3A 3RM7A 4FTRA 4XRLA 2PK9A 5E92A 5FPOA 1YQJA 3NW6A 2C0OA 4H39A 4MD8E 4AFEA 4FIGA 2JLDA 3JY0A 2OSCA 4AZEA 4HR7A 5DEWA 3Q5IA 3EN6A 3VO3A 1OPKA 1WVXA 4X3FC 4FYNA 2Z60A 3C7QA 1GIJA 3QTIA 2UZVA 3N4VA 4FV1A 3PZHA 5AP0A 5AP5A 1IR3A 2XALA 2VX0A 3QQUA 4QMZA 5D7AA 4AZVA 4FFOA 4UZDA 2BFYA 4ZZOA 2W1CA 3FKNA 1JDEA 3LJ2A 4AOJA 3NLBA 5CU2A 2QLQA 4GIHA 4XEYA 3TQTA 2QG7A 2X7OA 2ONLA 4EQMA 4IZYA 4HVSA 1JSUA 5GINE 3BWJA 3OXIA 3TNIA 4PMSA 4ZY5A 3FKLA 3DS6A 5AV3A 2G9XA 4FT5A 3HAVA 4YO6A 3QZHA 2V7AA 3BL7A 2HY0A 1OBDA 2X81A 4ZMEA 2HW6A 1U5RA 2ERKA 3HMNA 4BDBA 3DFAA 4X21A 5HCZA 1WFCA 2BFXA 2CKQA 5BVWA 5DYJA 1ND4A 4RQKA 4I41A 4AN9A 4RA4A 4ZZMA 3T9TA 1OKWA 1YHSA 4Q5EA 5FTQA 2QK4A 5I9ZA 4OTQA 2VR1A 3AC2A 2PVRA 3BYUA 3LFCA 3NNUA 4CG8A 2H34A 4F99A 3FXZA 2EJ0A 3QTSA 1JWHA 2ITYA 5EQEA 5ETCA 4AS0A 3SA0A 3RK9A 4PDSA 4RBLA 3GCQA 1CKIA 3VUIA 5CEMA 4KAOA 4O27B 2W1FA