1A48A

Saicar synthase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
305
structure length
298
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of SAICAR synthase: an enzyme in the de novo pathway of purine nucleotide biosynthesis.
pubmed doi rcsb
molecule tags Atp binding protein
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
total genus 97
structure length 298
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 1998-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1a48A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1a48A02
4C5CA 3QX4A 4JDIA 5KMKA 2ETKA 3BQCA 3SD0A 1B6SA 4IQ6A 1NA7A 1CKPA 4L7FA 1DM2A 2G1TA 3NVMB 2PPQA 4DAWA 3CGOA 2Y6OA 3JYAA 3MIAA 1H4LA 3QTSA 4U81A 4AA5A 5CNOA 2HCKA 2I0VA 3RM7A 4AX8A 3KXHA 4BYJA 4DFLA 3EN7A 1W84A 4XYLB 5IEVA 3Q2OA 5E9EA 3I12A 4YBJA 4M14A 3FZTA 1BKXA 4O7YA 4U44A 2GTMA 3FPMA 3TT0A 3FZPA 3LJ0A 4LOPA 5EHOA 4DEEA 3RAWA 4G9CA 3EQBA 4RLKA 3LHJA 3SG8A 3KRRA 4IADA 3TI1A 4BGQA 4QMLA 4EK3A 1LEWA 3RGFA 3BYMA 3OUKA 2VPQA 4FYNA 4FKOA 3L9MA 2QG7A 4MBLA 4KKEA 3ZXTA 3DJ5A 4YGAA 2FH9A 1K9AA 2VWVA 4MQ1A 3Q5IA 3B8RA 4O7WA 2ZV2A 2OFVA 2JLDA 3AQVA 5IQAA 4DGMA 2C6LA 4EKKA 4EH5A 3MPAA 2VTMA 2QO9A 4PP7A 2BTRA 2QQ7A 3F69A 2OXDA 3QRKA 4FL3A 4QMWA 5FTGA 3UGCA 3U9SA 5EM5A 5HV6A 3HAVA 4XOZA 2UZWE 4QTDA 5FTQA 3NIZA 4IZAA 2XS0A 3Q9ZA 1QMZA 1PHKA 3D5XA 3FEGA 4FKSA 4W4WA 4Q5HA 4BCKA 2BIYA 3ODYX 5L2IA 4E6CA 3P1AA 1XH4A 2YL2A 5IQHA 3F3TA 3CTQA 4PMPA 4O4LF 3GI3A 5G6VA 4TL0A 2WAJA 1P2AA 3OT3A 4FT5A 4L44A 3RI1A 2UZDA 1F0QA 1H1WA 2OFUA 2W1DA 3PXQA 2W0JA 2CN5A 5A4TA 4N57A 2YDIA 3UJGA 3OUZA 2P0CA 4TWPA 4CSVA 4ITHA 3AXWA 3R1QA 4JDJA 5H8GA 3RVGA 3S00A 2IN6A 5B0XA 2YAKA 1QPEA 1WBTA 5GJFA 4K33A 2J50A 2X7GA 2UZTA 2X9EA 4AN9A 4FG7A 4FKVA 1XJDA 2WU7A 4LM5A 3R8UA 3QC9A 4KKGA 2WTKC 3MTFA 2YACA 4PWNA 2ZV8A 2GHMA 4HNTA 3QYWA 3WF7A 4O2AF 3R01A 2VTRA 1UU7A 2QR8A 3O17A 2NO3A 5D41A 3F61A 3U87A 1H0VA 4FV9A 5M06A 3BV2A 4KIQA 3W10A 3ZO3A 4GCJA 2PVMA 3F3ZA 3BHHA 3LM0A 3QQKA 4RGJA 4EC8A 3QKMA 4CV8A 3BLQA 3DF7A 4S33A 3V5QA 3S2PA 2QHNA 3FI8A 3CBLA 4RVLA 5F20A 4CFXA 4YHJA 5DIAA 3C1XA 2ZMCA 3FMNA 4CVAA 3ITZA 4YJPA 4D5KA 5CAEB 2UZBA 3ENMA 3Q9WA 3FC1X 2PU8A 4MD7E 3U9TA 3IW6A 2V22A 2Y8OA 5HVYA 1CDKA 2JEDA 5JH6A 1EUDB 4YNEA 2ACXA 5BMVF 4JRVA 1PXPA 3UIMA 1V0BA 4NH1A 1NVRA 4O0SA 3DAJA 3VUIA 5AUWA 2OJFE 4C7TA 4DLJA 4R1VA 1OIUA 5KHXA 1PMNA 3QLFA 4XG4A 4RT7A 3NYNA 3TV7A 3E7VA 1UNHA 4RQVA 4NM7A 3L1SA 4E73A 4HVGA 4CFNA 5IA5A 5FNVF 3TIIA 2ITTA 3PDTA 4ZTSA 1Q97A 5DVRA 4AXAA 4GU6A 3VMMA 3ZO1A 1R1WA 4PL4A 4I41A 3KMUA 2I1MA 1FGIA 1GZ8A 1VKZA 3DT1A 2WD1A 4GS6A 2ZB0A 3L9PA 3QL8A 4BHZA 4BTJA 4F08A 2HYYA 5FBOA 2YZMA 3VUGA 4GK2A 4RVMA 3QGYA 3MPTA 3LE6A 4L3PA 4XUFA 4ANBA 4CG8A 3P7AA 4WA9A 4D55A 3Q5ZA 2C5XA 5CF8A 1OL2A 4QP1A 2ITZA 1KE7A 4LUDA 5ETAA 4BTKA 2ZDQA 4O7LA 1JKSA 3TKHA 2PVFA 4BDDA 4Z55A 3ORRA 1RDQE 5AV4A 1IA8A 4V01A 3RHKA 4QP4A 4JXFA 1Q41A 3DA6A 4UBAA 4FSZA 3LMIA 2GNJA 5M55A 2CHLA 2RGPA 5ACKA 5AA8A 4IVDA 4DTBA 1KJQA 3VPCA 3ZZEA 4AGWA 5EW9A 3FAAA 2BZKB 3GFWA 3BGQA 3ZRMA 4BY9E 1Z2OX 3ZS5A 1H26A 3HVCA 3AG9A 3O50A 5CZIA 4O0UA 4E6DA 2UUEA 2W9ZB 2BRMA 3IOPA 2P2HA 4FL1A 3PP0A 4F6WA 4ZZNA 3NCZA 2Z8CA 3T9TA 5JQ8A 4JQ8A 3EN5A 3D0EA 2EUFB 3CJFA 4A4XA 2ITVA 3VHEA 2VTPA 3O7LD 1LEZA 3QD0A 4IB3A 4YLJA 5I9YA 1WBOA 3BYVA 3MTLA 4QTEA 2I87A 4QSHA 2C00A 2QI8A 3QBNA 1BI7A 2OI4X 4YSJA 4BCOA 1MRYA 3ATTA 5KKRC 3VPBA 4GVAA 3RHXA 5FXQA 3NW5A 4EKLA 3FLQA 4XLVA 2PYWA 4EONA 4E6AA 4GEOA 4XCUA 4YP8A 1H25A 4LGGA 3QU0A 4DH3A 4KBKA 4EQUA 2JDRA 5HLWA 1URWA 3AC5A 5GJDA 1H08A 4APPA 4ZSAA 4UALA 3UG2A 2YM4A 4A7CA 1WFCA 4I55F 1H27A 2PVKA 3EN4A 3N4TA 3WZKA 4C4GA 4EK4A 1UU8A 4KD1A 4J53A 3GC7A 4DFNA 5JFXA 3HYHA 3RTPA 3OUNB 3FLYA 3OF0A 4WUAA 5KHWA 3GU5A 4O7TA 1B6RA 4IH8A 4PX6A 2QONA 3LQ3A 3LFSA 4K8AA 3ROYA 3PJ1A 2WXVA 5G1XA 4ZJIA 3FXZA 1DI9A 2CZGA 4LL0A 3HO8A 3FZSA 3OCTA 3PJ2A 4AFEA 2CNQA 2I0HA 4FZ7A 5EK7A 5LMAA 5KUPA 3QGWA 3FKOA 4GSBA 3L8PA 5E1SA 4ZTQA 1JDEA 2WOTA 3POZA 2GNFA 3COKA 1ND4A 3MY0A 4I24A 1WBPA 2X8DA 4D4RA 1STCE 3HNGA 3JVRA 1KJ9A 1CMKE 2QOFA 3K2LA 2FSLX 1J7UA 2PVNA 4L45A 4LYNA 3KULA 2XCLA 3LMGA 2IPXA 2WEVA 2XKDA 3H30A 4I6FA 1J3HA 5CSVA 2W05A 2WU6A 3JPVA 4I3ZA 5K3YA 4FTUA 3FKLA 4RIWA 5BUJA 3FMJA 4FTQA 3PLAE 2WO6A 2JIIA 4JQ7A 3OUUA 3A8WA 5D8DA 4FFRA 3CP9A 3QFFA 4G17A 4HOKA 2OF4A 3EN9A 4F6UA 4DBNA 3AGMA 2BHHA 3GOKA 4EHVA 5HICA 3TN8A 2BR1A 3IO7A 3PTGA 1MRVA 5CA0F 4FEUA 2R5TA 3TQTA 3DBQA 3N4UA 2CLQA 3TDWA 4BHNA 3IG7A 4KIOA 4JBOA 5ANGA 3JZFA 2X4FA 2HENA 2F2CB 3ZFXA 2WIPA 5JGBA 3LP8A 4X2JA 4EI4A 4DLKA 2BVAA 5FXRA 1Q8ZA 1H1PA 2PVRA 2X8EA 3L8XA 4H3BA 4ORKA 4P5QA 4X2KA 1SVEA 4FYOA 2QOHA 3KRLA 4X6RA 4XLIA 5CI7A 2W1EA 1M14A 2OJ9A 2UW9A 4RVKA 5JEBA 2R7IA 3LVPA 2AC5A 3HV3A 4IZYA 3R23A 2BZIB 4E5WA 4BRXA 3BWJA 3G9NA 3NYVA 3THBA 3TUBA 3KAJA 5JKGA 2UVXA 2FSMX 1Y6BA 5E8XA 5HO8A 4F4PA 4QOXA 2V0DA 3KULB 3NUPA 5CYIA 5ACBC 3N4VA 3KC3A 3FYJX 4M12A 3FQHA 3UPZA 5EQYA 3FMEA 5LXTF 1XH6A 4AZWA 4IFGA 1OBGA 2OLSA 4O4JF 5EDPA 3NW6A 2UV2A 2YM5A 2WMTA 2BROA 4NTTA 2R82A 4E93A 4I21A 4YJRA 2W9FB 5HESA 1GIIA 4IAYA 3MJ2A 4W4XA 4ZLZA 1WBNA 4S31A 2IW6A 4AOJA 4TYGA 4AW5A 4R7IA 5AWMA 4Y46A 2YA9A 3ENHA 2NNWB 3NDMA 1YOMA 3P7CA 5CVHA 2F7EE 3T3UA 3PPZA 3A7FA 5JRSA 3UC4A 3UZRA 4UXQA 3C0HA 2GHLA 3ZBXA 1KEEA 4O83A 4RIXA 4BDFA 2J7TA 2QLUA 2WTDA 5EQPA 5EW8A 3RV4A 3VIDA 3TV6A 5A14A 2GFCA 3F2AA 1FVRA 5DRBA 2JDSA 3C0GA 1SZMA 2VD5A 4GIHA 4J95A 3VS6A 4MBJA 3PY3A 4WBBB 3R7IA 3VC4A 1J1CA 2GPWA 1RQQA 2GSFA 4FT0A 3GCQA 2DWBA 4UEUA 4RJ4A 2WIHA 3C4FA 3MH3A 3UIXA 2C0IA 4YB8B 2Z7RA 3SLSA 3VS0A 4X3FC 3SHEA 2O5KA 2XYNA 5E8TA 3VS4A 3BCEA 4XYFA 4ONAA 3R71A 3ZM4A 4J8NA 1Y91A 5CEMA 4NW5A 5IU2A 3FE3A 2XJ1A 3OEZA 4CXAA 3OY1A 5HIBA 2Q0BA 4ZY4A 3EQIA 5KCVA 1XO2B 3R9DA 3GC8A 4OBPA 3BEAA 5IPJA 2VTOA 4R78A 3MH1A 5HG9A 3OZ6A 4JL9A 3QQFA 5EG3A 4ZIMA 4R77A 1Z5MA 4HZRA 4XX9A 4XV1A 4O6LA 3MDYA 4RSSA 4AW1A 4FEQA 2AYPA 3F5XA 3H0ZA 4P7EA 4WNMA 5AP1A 4BKJA 3GIDA 4IZ7A 3TIZA 4F70A 3L8VA 4JBPA 4KRDA 2FPPB 3NS9A 3LFAA 5DYJA 3S4QA 1SNXA 4QMNA 2VNWA 3MW1A 4DG3E 1YXXA 2YM8A 5D11A 2C3KA 4EYMA 3FWQA 2HY81 5E90A 5CEKA 2FUMA 3WIGA 3EB0A 5BX0A 4XV9A 1KJ8A 4YAJB 5C27A 4X3FB 4DC2A 4O7RA 3VO3A 2RF9A 2YAAA 3HMIA 4IJ9A 1ZYCA 4PMTA 1J1BA 2W1HA 1FPUA 5EW3A 4EK8A 2Y6MA 4FUXA 3KRXA 2W1CA 4BVUA 5AAGA 3DTWA 2BILB 3RK9A 4ACHA 5C1OA 4AT3A 1H1RA 1XH8A 3P79A 3GOPA 3TL8A 4PRJA 3V8TA 2UVZA 4TZRA 4F09A 3VJOA 4QPAA 5M4FA 4QTAA 4TV8F 3R30A 4O0WA 5A3XA 2X0SA 2Y0AA 2YZAA 3HX4A 1GZOA 4G6LA 4OTWA 5I9VA 2QF7A 4FGRA 2WMQA 4IDVA 3HECA 3A2CA 5J5SA 1GJOA 5A4QA 3I0OA 2VO7A 4OTRA 3POOA 5LP6F 5H8EA 2VTTA 1H1SA 2PSQA 5C8NA 2OSCA 1H0WA 4WUNA 3GC0A 5HLPA 5K5XA 4DINA 1CSNA 2XK3A 3MSSA 4U9AA 5GINE 2R3OA 4IM3A 5BNJA 5IUHA 3MWDA 5L2TA 2UZUE 2YW2A 1GSHA 3QUDA 4YAKB 2H6DA 4MBIA 2GNLA 4L46A 4UB7A 5DPVA 4FSQA 4B9DA 4QRCA 5LOHA 5BVNA 1EH4A 3BBTB 4JG8A 2J0JA 2ZV9A 1OECA 3R83A 1YWVA 3TZ9A 2QOKA 3VS2A 2XUUA 4R5YA 5F4NA 4EBWA 5C4LA 3QALE 4MV3A 5AX3A 1M7QA 5HIEA 5IISA 1WZYA 3K54A 3EYGA 4K9YA 3W2SA 1OB3A 3F2RA 3I5ZA 3U9NA 5B2MA 3E5NA 4II5A 3GQLA 4TNDA 4FKIA 4X0MA 4FFPA 5K5NA 2WMSA 2YIQA 3QZIA 4MXYA 3AGLA 3FMLA 5CSWA 4U40A 3OVVA 4U97A 1DAWA 4FV3A 4BCHA 3Q4ZA 4BZDA 5IQBA 2W17A 4F64A 2X39A 2YM3A 3M2WA 1M2QA 4FKJA 5HIDA 1IASA 3OP5A 5AV1A 2YIRA 3HA8A 5DA3A 4QTBA 4BB4A 5BPFA 3EFLA 3LXNA 3R04A 5M08A 3QTQA 4OTGA 4GL9A 4CMOA 5FM3A 5IQCA 4WG5A 4RX5A 1OI9A 4IIJF 3VBXA 4L42A 3T9IA 3OY3A 4XV2A 4A9UA 2BUJA 3R73A 3EQDA 2W5AA 4DTKA 4R5SA 3UE4A 4N0SA 3VBQA 2VNYA 5BVKA 3QQUA 1H28A 4ZK5A 3EOCA 4GYIA 5CAQA 4PDOA 1Q4LA 1PK8A 4O2BF 1U54B 4DG2E 3IKAA 3EQFA 5JK3A 1FVVA 3A4OX 3RPVA 1DV2A 3UMWA 5E8SA 2W70A 1V0PA 2QO2A 5LARA 3DQWA 3VS5A 4YTFA 3NW7A 4NM5A 4FKPA 3AD5A 2LAVA 5CU3A 4BZNA 5AAEA 4FV2A 4FIGA 4NJDA 5CASA 3W2OA 4O7SA 4BCPA 4AE6A 3MVHA 4FV5A 1Z9XA 2VWUA 4JNWA 3C4XA 2PMNX 3NNVA 4DFUA 4EWHA 2C6EA 2G2IA 4MKCA 5FEQA 5L8JA 4FIHA 3ZC5A 5LMKC 4H36A 5E8UA 4Z9LA 1JWHA 4FSMA 5EYDA 5IMEA 5M57A 3K5IA 3ULZA 2CGVA 3QQHA 3ERKA 1FMOE 1PMUA 2C6OA 2R3NA 4C0TA 3KVWA 5A4EA 2EB2A 1VYZA 3KREA 3O8PA 4IE9A 3E8EA 5D1JA 4B8MA 4QMSA 5HX8A 3U6JA 5EZYF 1W8CA 4BCMA 5EKNA 4XHKB 5IDNA 3OXTA 4GMYA 4EGJA 4GJ3A 1TQPA 2O8YA 1Z57A 3DDQA 4G34A 4KSQA 4U0IA 1BL7A 1BLXA 3C51A 1KE9A 2CGXA 2XK7A 3LMHA 4UX9A 4JRNA 3BU3A 4CT2A 2W6PA 1CTPE 5CEOA 4JBQA 3LCSA 4O82A 4USDA 2ZYBA 3U9CA 4C4HA 4DT9A 3NUYA 4O86A 2UZOA 1JQHA 3NMUF 1GZNA 1M17A 4HGSA 4ZTHA 3MESA 5JSMA 1K2PA 5KNJA 2IP4A 3LZBA 3D7ZA 4MAOA 4QP6A 3AT2A 4ANLA 4E7WA 4Q9SA 3PFQA 4FEVA 4BCNA 1R39A 4EGQA 4I23A 2QVSE 3BU6A 4K18A 5DR2A 5BYZA 3DZQA 4ZTMA 4U7ZA 3R5FA 3EKKA 4G3CA 4IM2A 3TV4A 4DCEA 2HJWA 3UIBA 1ZY5A 1ERKA 1P14A 3FUPA 4TYHB 3RJCA 3DB8A 4XRJA 3HEGA 3HV4A 4M97A 4RIYB 5CXHA 3DQXA 3DXPA 3BHVA 3A7JA 3ZFYA 4CV9A 4O4HF 4DFZE 4RFZA 2WGJA 3F7ZA 5J95A 2R2PA 5JVLA 3CTJA 4BCJA 2CMWA 1Q62A 5CWZA 3KVXA 3PIYA 5TF9A 5ITAA 3DGKA 2E9NA 2V58A 5IA1A 3IK3A 1ZZ2A 2PY3A 1MP8A 2XYUA 2XEZA 3UC3A 3UVQA 1PXJA 3SRVB 4ACMA 3R8LA 1FVTA 3LAUA 4FTCA 4FX3A 4FBXA 4AN3A 4BDHA 4C4FA 4DEBA 2Z7LA 4F0GA 4YMJA 1P4FA 1PW2A 2YFXA 2BFXA 4MNEA 3DLSA 4K0YA 4JR3A 4QQJA 4RJ6A 1W96A 4ZI7F 3E3BX 2CGUA 3BE2A 5J7HA 2Z60A 1H8FA 3QQLA 4H1JA 4JJRA 4LRJA 3A7GA 4NYEA 3A4PA 3II5A 4XH6A 4DFBA 3L9NA 3ZHPC 4I4EA 4J52A 4FV4A 5ANJA 2E9OA 2EXCX 3R21A 2XKFA 3VRZA 4QQTA 2XM9A 3TNQB 5BMSA 2C68A 5AP4A 4MV8A 2RFEA 3BLHA 3E3PA 3LCOA 4KIPA 4WOVA 1JBPE 3VVHA 4EOSA 3O51A 4EQCA 1Z2NX 5CI6A 4O0TA 4KUJA 2QC6A 5HVJA 3NUXA 5IA2A 5CLPA 4RVTA 5CQWA 2ITNA 5L3AA 3HMNA 3OCBA 4ZOGA 2C47A 2YN8A 4FKRA 3R2BA 4RWLA 3QA8A 2B1PA 2BDFA 3DS6A 4LV5A 5LCKA 4LGHA 3R8MA 1U4DA 5TR6A 1EHIA 2WQNA 4F7NA 4FKWA 2YS6A 4IMYA 2R7BA 1L3RE 3AC3A 4ZS0A 2R3PA 2VGPA 2W1IA 5ANKA 3V5TA 3UOKA 5JGDA 4PNKA 2CN8A 1W83A 5HI2A 5I9UA 4HW7A 2XIZA 4IHPA 1IOWA 5AUTA 5LVLA 4E4MA 5L8LA 4HR7A 2WTIA 2C6KA 4E4XA 3DU8A 5AIRA 2G9XA 5H3QA 3CQEA 4EJ7A 3HLLA 1JSTA 2Y4PA 4IVCA 3PZEA 3R7UA 1NXKA 4IX4A 4AACA 4C02A 4HYUA 1SCUB 2WTCA 3SOAA 4YJVA 1HOWA 1CS0A 3JY9A 2C5VA 3P08A 2XD4A 4BI1A 2W4JA 4QMXA 3R00A 3ZMMA 3BYOA 4FR4A 3CQUA 5FTOA 3FY2A 5LMBA 5M4CA 2HW6A 4MEDA 5BVOA 3AMAA 3KN5A 4FU0A 3V6RA 4IX5A 1J91A 4C4EA 2VRXA 4IC7A 2I0YA 4EBVA 5IF1A 4RX9A 5HBHA 4CEGA 5EYCA 2G2HA 1KV1A 4DGLC 2CNVA 3MFSA 2J0MB 2GNIA 4NM0A 4AZTA 5CXZA 4AT5A 4RC3A 5A6NA 3FJQE 2X6EA 3I7BA 4F9CA 2P55A 4I0SA 4A07A 4FFOA 1M0WA 3BEGA 4G31A 5HD7A 3QUEA 4IIRA 5D12A 2QOQA 2A27A 3FQEA 3UNJA 4DYMA 2X7OA 3UO5A 4MV6A 4YBZB 1MRUA 3F3WA 3WI6A 2JDTA 3WF9A 3ZFMA 4E20A 4E4LA 1YW2A 1KE8A 1JKJB 4U6RA 5KMLA 3K5UA 4DA5A 4F9WA 2XNOA 1WCCA 3KK8A 2PMOX 3NYXA 2XEYA 3QRTA 3C0IA 3TKIA 1CKIA 3Q04A 4MK0A 3LKMA 4C62A 1QPDA 4O0YA 4IC8A 2YITA 4PTGA 3O23A 1RE8A 3LCTA 4R3PA 2R3QA 2PTKA 3W2QA 3BLRA 3FKNA 3I1AA 3LLTA 4AGDA 4ZMFA 5HGIA 4ARKA 4D58A 3QUPA 3MH2A 3WE8A 2YCSA 3UZTA 3AC8A 5AUZA 2BAQA 4CMTA 3W1FA 1XWSA 2VTAA 5LCJA 4XRLA 3R9RA 2PBZA 3VOTA 4B7TA 2VX3A 1W98A 3B2TA 3OMVA 3BX5A 2WFYA 4K1BA 1LPUA 1TQIA 5A9UA 4IWPA 5C8YF 1YXVA 2NRYA 3SKCA 1BXRA 2V7OA 2RL5A 2WNTA 5DGZA 4IX3A 5DT3A 4J71A 2J9GA 1XKKA 3H0YA 3RUPA 4C5BA 3DNDA 4CTCA 4EG0A 2IW9A 3SAYA 4IZOA 3D83A 2OW3A 3EH9A 2UW7A 4GRBA 2R0UA 3KY2A 4XNEA 3MA6A 2VQDA 3BI6A 2CDZA 2ERKA 2GCDA 2JFMA 5AV0A 4FSTA 3KMMA 3SQQA 5CSPA 4J97A 3MVLA 4QNAA 1OL1A 3DK6A 3ZSIA 4ERKA 4CNHA 5IQDA 1TVOA 3WNZA 4EL9A 4RLLA 3TJDA 4O21A 3ET7A 2DIKA 3C4CA 1ZYSA 2YISA 4C2VA 3KFAA 4I5MA 4CCUA 3ORIA 3QZGA 3NVKI 3SVVA 4FTJA 2ITUA 1Y8YA 3CLYA 1RJBA 3OBJA 4QYYA 5AP5A 1WR2A 1XH5A 2P0AA 3IGOA 4FEXA 4IEBA 3ORQA 2J5EA 5LWMA 1JNKA 2W1GA 2B9HA 3ALNA 4N6YA 2IZTA 2VWZA 5EI2A 5CALA 2YDJA 3GC9A 2QOBA 4I1ZA 3F5UA 3OWKA 4U8ZA 4MNFA 3B8QA 4TNBA 4IB5A 3WYXA 4FV6A 5DR9A 1XBBA 2F57A 2VX0A 4H58A 5HHWA 3W33A 2E9PA 5EKOA 3HBLA 1OGUA 4RJ5A 2WKMA 4LI5A 4NZWB 5AM7A 3VHKA 4JIAA 1NT2A 4FKQA 2R84A 4H3QA 2DZDA 5ETCA 2QODA 4ZEGA 3QHWA 5LQFA 2REIA 3ALOA 4QYGA 3ETJA 2X81A 3MFTA 2VX1A 4AW2A 3HA6A 1H07A 5JQGF 4MA0A 2BCJA 5CENA 3R5HA 4K11A 3KRJA 3ORMA 3DJ7A 4O2ZA 3CPCA 5DR6A 2R0IA 3W18A 1VBHA 3I79A 4RX8A 1XR1A 2Y9QA 1GIHA 3F2NA 4LRKA 2F9GA 4DH5A 4XP2A 1PMVA 4L00A 5BMMA 4EC9A 2OGVA 2FA2A 2WMAA 2XIYA 4DLIA 2IZRA 5EH0A 4C37A 2ESMA 5C4KA 5HLNA 4EOPA 2OZAA 4ACCA 2B53A 4BIDA 4NJ3A 4TWOA 1NVSA 4R3CA 4HCUA 3HV6A 4KAOA 3FSFA 3FC2A 5FP6A 2X9FA 5CAOA 3BV3A 2ITPA 3LFBA 3VF9A 1YQJA 4O4IF 1ZOHA 1T45A 5JZNA 4PUZA 4XJ0A 2WEIA 3WZDA 5EHLA 3ETAA 3DAKA 4I94A 1PYEA 3BPRA 3E7OA 3A62A 4FSYA 4XMOA 3DNEA 5LOVF 1UKHA 3IQ7A 3R9OA 4KKHA 4FKLA 5DRDA 4C4JA 4RZQA 1SMHA 1A9XA 3P0MA 4FSUA 1BL6A 4FFMA 1AUXA 4F99A 3G6HA 4L9IA 3EZVA 1R78A 3TWJA 3WF5A 4UWCA 4YPDA 5F94A 4ASXA 5DEWA 3DJ6A 2JKMA 3KF4A 1IG1A 4IANA 4MTAA 1WAKA 3OS3A 2UW0A 5KX8A 5L6PA 1KJIA 4CKJA 4QMPA 4V04A 3D7TB 3VUKA 4ZS4A 4ZZOA 5B2LA 5AUUA 3GB2A 4Y8DA 5JQ5A 5E8YA 3BYSA 3COIA 4P5ZA 5D7VA 4AWIA 2YZNA 3RAHA 1U46A 3E63A 1OUYA 2W7XA 3UVRA 2C6MA 4PF4A 3ROCA 1R0EA 3PE1A 3KN6A 4G6OA 4W8EA 4FTIA 1JDBB 2GNHA 2IG7A 1OM1A 3C4EA 3KK9A 1KC7A 3P7BA 2G2FA 4FC0A 4DFXE 3IONA 4LFIA 3MJ1A 5AA9A 5HU3A 3OOGA 2PWLA 4FZDB 1AQ1A 4IVBA 3N51A 4L8MA 5DE2A 4CQEA 5HBEA 2ITWA 2R7NA 1XBCA 3CKXA 3V01A 3EQPA 3G90X 4B0GA 5CTPA 2FPIB 4Y85A 4X6QC 3C9WA 1WVYA 3GCSA 3CJGA 3UO4A 1EUCB 4CFUA 3NYOA 4NK9A 3ZRKA 4AZVA 2W1ZA 2W5BA 4ZTNA 5M44A 3BHUA 4HYIA 3LPBA 3OC1A 3TZMA 3ORZA 3OXZA 5FD2A 4IWOA 2WMRA 2VTIA 1IRKA 2JBPA 4RFYA 4U41A 4KNBA 3BKBA 3H3CA 2FB8A 4XEYA 5CVFA 4O0XA 3GQIA 4PDYA 5KO1A 1AGWA 4BN1A 3MH0A 2WTKB 4KBCA 4Y72A 3PIZA 3FI2A 5DN3A 3NX8A 1H24A 1GNGA 2HK5A 4L68A 4RBLA 3TTJA 3FMDA 4O7ZA 3H9RA 4RWJA 4TYJA 4BDJA 1IOVA 3SOCA 4YLKA 5CZHA 2PVJA 4J98A 5KKNB 5DI1A 3RK7A 3ZEPA 4EK5A 2HOGA 4F9YA 4AZFA 1W93A 4JT3A 2XIKA 4FV0A 3HP2A 1OKZA 3I6UA 4FNXA 3TXOA 1OPKA 4ZMEA 4YC8A 5AFVA 3G9LX 3RPYA 4HNIA 4HVHA 4FG9A 2UW8A 4FNZA 4JX7A 3VW6A 4J8MA 2JAMA 1KUTA 2YM7A 4M84A 4HVIA 4U80A 2IW8A 2FYSA 3R7VA 3QTRA 5T3QA 3NR9A 4USFA 5HNIX 4L1KA 1I09A 5JQWA 2UW5A 4BYIA 2P3GX 5CA1F 3CIKA 3MFUA 3N9XA 4EH8A 4DT8A 4RZWA 2OBJA 1OKVA 1OZ1A 2ZV7A 1CM8A 3OTVA 5EDQA 3H9FA 2OKRA 4LQMA 3ZOSA 3BBWA 4FG8A 2H8HA 4DEIA 4C58A 4U5JA 4M7IA 3TG1A 5FM2A 4G3EA 3WILA 1A9UA 1ULZA 2XZSA 1URCA 3ZBFA 2A1AB 3BYUA 3ATSA 5HNGA 3CSVA 3C50A 4C38A 3FL4A 3FBVA 3PRIA 4O7NA 4TW9A 1JKKA 2QU5A 3QD4A 4KSPA 2C6TA 1FINA 2NU7B 1ZMWA 4YZMA 2Q83A 2PVHA 2VV9A 3TZ8A 5H8BA 2PMLX 4PDSA 5AMNA 3TACA 4AW0A 3RKBA 2C6DA 2FSOX 3GVUA 3ORLA 1CKJA 2PE0A 2X4ZA 4G3FA 4LOQA 5EM8A 3LOKA 3M1SA 3PLSA 3V8WA 4ASZA 1XBAA 3IW5A 4MAMA 2UZVA 4YHTA 3ZLXA 5J1VA 4NUSA 4ALVA 5ETIA 1OL6A 1PRYA 2ZM1A 3PXKA 4X2FA 4BDAA 4C59A 2RFSA 4EOOA 4CT1A 3SA0A 2BKZA 2HGSA 3TIGA 4F7JA 3UZPA 3BU5A 3RPRA 4YJ3F 1FBNA 3FLNC 3ZDIA 4ZY5A 5AP6A 1YXTA 3TUDA 2WMUA 2PUIA 2CCIA 3WZUA 3TNWA 1FGKA 1Q8UA 4HNUA 2CNUA 2QG5A 3RWQA 1PXKA 2XH5A 5IEYA 1V0OA 4PQNA 4BF2A 4V0GB 3OTUA 2QO7A 5EM6A 5K4IA 4N4SA 2OZAB 4AN2A 4TRLA 3LCKA 3KA0A 3NWWA 3R22A 3ZZWA 2C5YA 3GCPA 3HL7A 3LLAA 4JG6A 4CCBA 5AM6A 2R87A 4F9AA 3NSZA 1Q8YA 2YYAA 2NU9B 4ALUA 3A99A 3P86A 2I8CA 3QRIA 4YBKA 5CU0A 3BGPA 2VO6A 4UXLA 1Q99A 1YHSA 2O2UA 2PE2A 2EXMA 3D5WA 4O7VA 3NAXA 4NSTA 4BTFA 4GKIA 5EI6A 4YZCA 1OL7A 2VAGA 3O7LB 5AP3A 3LXKA 5DNRA 3ZC6A 2XNMA 5CY3A 5C8MA 3SG9A 1W82A 5IQFA 3CR0A 4JDKA 1R0PA 4DEDA 1SYKA 3HRFA 3R2YA 4CTBA 3KGAA 3RM6A 3UQGA 4ACDA 2Y4IC 1F5QA 2BRNA 4GFOA 4YZ9A 3UNKA 2HZ0A 3F82A 1GY3A 3O96A 4CKRA 2YCRA 3QZHA 4M8TA 5A4CA 4F6SA 4QP3A 2BTSA 3ULIA 1JSVA 4GFGA 4RWIA 2XK6A 5M4IA 2J5FA 3IW7A 2JITA 1CE8A 4DF3A 4YHFA 3D94A 1LP4A 4ASDA 4C4IA 4F7LA 3C13A 3JVSA 3H10A 4L6QA 4PP9A 4PY1A 4QO9A 3TNHA 3DBDA 3SX9A 3UP2A 4FSWA 3EN6A 3HRBA 5AX9A 3Q4TA 3PJ3A 2WQMA 5D7AA 2F7ZE 5FQDC 3CY2A 4H05A 5IH5A 3F6XA 2BKKA 4KB8A 4YZBA 4O0VA 2X7FA 4MV1A 2ONLA 4YJQA 3R63A 4S2ZA 4MHAA 4YTHA 4C35A 3VAPA 4I5CA 3UODA 5CB4F 4KS7A 4C3PA 5CQUA 3ZUUA 1OVEA 1DS5A 1PXNA 3OHTA 4RMZA 3UQCA 4EUTA 2FPGB 5IYZF 2C1BA 4U42A 5BVDA 4YNOA 3F66A 4FTLA 5AV2A 3ZUTA 5M07A 4XBUA 1PXIA 4NFMA 2FVDA 4ACGA 3S3IA 4Z16A 3GP0A 5FUTA 4BICA 2E9VA 2JDOA 4CD0A 3BZ3A 4JI9A 5H9BA 2WQBA 4MXCA 3O8TA 3MIYA 1WBSA 4JS8A 3DPKA 3TNIA 3JS2A 1XH7A 1JKLA 2PZPA 3Q4CA 3VN9A 1LR4A 3Q96A 5TT7A 3SE7A 4I20A 4RWKA 3SV0A 3HGKA 4KA3A 4FTNA 2XBAA 2XF0A 3DKCA 5IQIA 1J7LA 4ITJA 3V5WA 4FGBA 3ACKA 3KCFA 5HO7A 5B2KA 4IHJF 4AE9A 3V6SA 2W99B 3AOXA 3G6GA 5IZFA 4UWYA 3DY7A 1YWRA 2OJJA 3OCSA 3PSDA 1IAHA 3V04A 4E4TA 3MWEA 2XRWA 3QRUA 4XOYA 3WE4A 3LWBA 3QCXA 5BYYA 3ELJA 5KMJA 3ORPA 2RFNA 3OWJA 4Q5EA 3LM5A 3JUHA 4JOAA 3K5VA 4XX0B 1AUVA 3CGFA 4PV0A 4DEAA 3MBLA 4HPTE 1LUFA 3I81A 4FICA 5E8ZA 4AOIA 1KE5A 4XYMB 1PXLA 1DI8A 2HZ4A 3NIEA 2EWAA 3PVUA 4B8LA 3F7WA 4XG3A 1ZOGA 1Q24A 2G01A 4L43A 5HVKA 3NLBA 3OROA 2NP8A 4AGCA 1GSAA 3QZFA 3WYYA 3KAKA 4WO5A 4RRVA 2UW6A 2VTNA 2XKCA 1QPCA 3MS9A 5IH4A 5JN2A 3DBFA 3W2PA 5AUXA 2PE1A 3MB7A 4IAKA 4HGLA 3PSBA 4L3LA 3KMWA 2I80A 4RA5A 5L6WL 4BBEA 4QMYA 5EFQA 3G33A 2C3LA 3I7CA 1Q61A 4O0RA 3IS5A 3HAMA 4JLCA 4QT1A 2VWBA 3KXXA 2YIYA 3IW8A 4GW8A 4R7BA 4ALWA 3Q4UA 4U43A 4BI2A 4EUUA 1KWPA 4HGEA 4ZXTA 3WOWA 1TKIA 2ZM4A 4N6ZA 1GOLA 1HCLA 2ETMA 3ORKA 3ID6C 3OD6X 3PJCA 2JIVA 4LMNA 3DLZA 3PSCA 4XG7A 3V5LA 4HVSA 3UBDA 1L8TA 3ZU7A 5K4JA 4ZP5A 3KKVA 1BX6A 3KXNA 4G5JA 4Y83A 3SXSA 5CEQA 1M7NA 3FI3A 3E92A 1R3CA 3I4BA 2W6QA 3JR1A 2ZDGA 3GCVA 3PG3A 4CRSA 5HEZA 3QF9A 4G6NA 5E92A 3REPA 2YRWA 2WZJA 3HZTA 5CEPA 4S32A 2XNPA 3MY5A 4I0TA 3LXPA 2FSTX 4O38A 4TN6A 3UOLA 2C30A 3E87A 2LGCA 5BUEA 3UOHA 3QLGA 3KEXA 4NKAA 4PTEA 3PE2A 4MCVA 1OL5A 2Z02A 3DKOA 1E4EA 2ITQA 4I92A 5FP5A 5C9CA 5E1EA 4BDBA 4YJTA 1B6CB 5BYLA 4S34A 4YC6A 2IWIA 3VS7A 3M42A 3LJ1A 3FXWA 4EJNA 4WIHA 4FTMA 1YI3A 1YI4A 4UY9A 4EOQA 4ZOLF 4LUEA 4F1MA 4FMQA 3LJ2A 5E4HA 3LW0A 4U79A 2YABA 4YJUA 4YJ2F 1GZKA 2V55A 2X6DA 1PXOA 2X2KA 4FOCA 4OW8A 5EYMA 4D28A 1PYXA 4HCTA 4YTIA 4E5AX 2OF2A 2QOCA 3EL8A 4EH9A 1T36A 3VA7A 2GQGA 4FKUA 4RQKA 4ZLYA 5FBNC 4H39A 2WPAA 4RJ8A 1ZYJA 2OH0E 3LFFA 4FIIA 4JG7A 3NAYA 3PPJA 3ZRLA 3KL8A 2WTWA 3R28A 5IDPA 2C0OA 2OICA 2IVVA 2PZYA 3FL5A 4C3FA 1F3MC 4FFNA 3V5JA 3IGGA 5ANDA 3TJCA 4A9RA 4EOIA 3MB6A 4IB0A 4ENYA 5CU4A 5HORA 4FKTA 3HMPA 5JFSA 2GS7A 1UV5A 4UZDA 4C33A 2R7KA 3Q1KA 3QQJA 1ZRZA 4QQCA 2JDVA 4YJOA 1OKYA 4LG4A 2HZIA 3E8DA 3QRJA 5I9XA 4D9TA 5C1PA 4ZJJA 2BALA 4QMVA 5HE0A 2PVLA 2QKWB 5C26A 3HUCA 2YWPA 5DEYA 4EH4A 3U8WA 4E6QA 3VBVA 1OIYA 3QAME 3GU4A 5C01A 4TUYF 1WVXA 1GIJA 4GK3A 5CF6A 2GLTA 5LVNA 3K3PA 4MVFA 2OO8X 4RC2A 2VWYA 4TPTA 4WSYA 5BVEA 1GAGA 2BAJA 5BPYA 2W6NA 4P4CA 1T46A 4HGTA 3VUMA 5FGKA 4MWHA 4WRGA 2BZJA 3FMHA 2ZOQA 3MA3A 4APCA 2E9UA 2BPMA 4EH2A 1ZLTA 1G5SA 1ZYDA 4L7SA 3ZEWA 5JFVA 3MPMA 2BZHB 2ZDHA 4I22A 2R86A 3DOGA 2OK1A 2XBJA 3R7YA 2PUNA 3TCPA 1PMEA 4A9TA 4CLIA 5AEPA 3HDNA 2CPKE 4A4LA 1B38A 2PN1A 1YWNA 1NW1A 3D7TA 3LXLA 2A4LA 3UNZA 3NZ0A 2J0KA 4GT4A 5F9EA 4CG9A 1O9UA 4MYGA 1KV2A 2VU3A 3CEKA 3PVGA 1UA2A 4FUYA 1VZOA 3EIDA 3MJFA 5T6KA 4BCGA 3G15A 5M4UA 3P78A 4A4OA 2B55A 4UZHA 4OBOA 4M67A 3ANQA 4RX7A 2BAKA 3D4QA 3U6HA 3PG1A 4O81A 1NVQA 2W6OA 3RFCA 2B54A 1J7IA 2J0IA 3DXNA 5IQGA 2JFLA 3OXIA 2PUUA 4BIEA 5LWNA 3AD4A 3GU7A 4O84A 2HELA 4KBAA 4C34A 4FIEA 4KS8A 4K6ZA 4AUAA 1WBVA 1UVRA 3QD3A 1OIQA 4FV8A 4RA4A 3U51A 2OG8A 4LV8A 3ZSGA 1S9IA 3OWLA 3ZCLA 5HNBA 2QK4A 3I6WA 3Q9XA 3BIZA 3TUCA 5EOLA 3VF8A 3RCDA 1YDRE 1REJA 3D14A 3NCGA 1OBDA 2J9MA 4XV3A 3E93A 5LA6F 3W32A 4ANSA 4EHGA 2RKUA 5A4LA 4LRMA 1YHVA 3R1NA 4O91A 4HNVA 4KRCA 2R4BA 3E64A 3PA4A 5KMOA 3HV5A 4G16A 4OLIA 4TTHB 3ZSHA 4GFMA 4F63A 4AOTA 4D1SA 1UKIA 1QPJA 3PUPA 4U45A 2AUHA 5AADA 3TKUA 3G2FA 3OWPA 3QQGA 4RIOA 2OXYA 4OTDA 4WNOA 4E26A 3Q6UA 3R9NA 4AP7A 4QMTA 4QTCA 1K3AA 3MVMA 3TM0A 3AC2A 3WBLA 3AX6A 4XP0A 4BR3A 3HKOA 1IA9A 4MXZA 3PWYA 2OIBA 4GT5A 4GU9A 4JQEA 4X3FA 3R7EA 4DGNA 3FY0A 3UTOA 4EOLA 5JGAA 3PP1A 5IUGA 4IAZA 2EU9A 2QURA 4O22A 4H1MA 5GONF 3WO0A 1YVJA 4IVAA 4Y95A 4EH7A 1M0TA 3EHAA 3HMOA 4IWQA 3R8ZA 2QCSA 2C4GA 4FEWA 4TV9F 3NGAA 4OBQA 5KMIA 3ZH8A 3LFNA 4PL3A 1CQIB 3E88A 2W96B 3MN3A 4WBNF 3QA0A 4UYNA 5IH6A 5JVDF 2F7XE 2YERA 2YM6A 3BELA 3CD8A 4FNWA 4I93A 2B4SB 3VQUA 4TWNA 2B0QA 1G8SA 2OLCA 3IW4A 2SRCA 5CSHA 4USEA 4XP3A 4YJSA 1SVHA 1ZMVA 5DFPA 2F2UA 3NEWA 3AC1A 3T3VA 1NY3A 4HZSA 5J9ZA 4ANMA 1E4EB 4EOMA 3KXZA 1IAJA 4IDTA 2GPHA 3U6IA 4BI0A 2VWWA 4FV7A 3WZJA 5LJJA 1W7HA 3GBZA 5CU6A 2CKPA 3U55A 5J2UF 3H4JA 4YC3A 2J90A 3W16A 5EDRA 3N6RA 4ANQA 3V8SA 3CPBA 1Z2PX 3DXQA 4M68A 3V5PA 3IDPA 4C36A 5KMNA 3FQSA 5CAUA 4MV9A 5LYJF 1JAMA 2H34A 3W55A 4E4NA 4J7BA 5EI8A 4MD9E 5A54A 4XG9A 4CKIA 2R3JA 4FV1A 4WRSA 1Q5KA 4GT3A 2ONLC 1ZMUA 2I40A 1YRPA 4QQ5A 3R8VA 4FT9A 5L2WA 2JKQA 3CQWA 1Q3WA 2XMYA 2R7LA 1A06A 4YR8A 5HZNA 3JRWA 4ID7A 5J8IA 3EWHA 2PMIA 2WOUA 3BG5A 3L9LA 4ZSLA 4L67A 3QTIA 2C5NA 2FP4B 4AZSA 4ZJVA 2QD9A 5F1ZA 1Y57A 3VULA 5CX9A 5K9IA 1OUKA 5ANOA 3S0OA 2UW4A 3O8UA 4FZAB 4FZFB 4Z7GA 4HVDA 4BDKA 5CT7A 2HWOA 4UV0A 2J0LA 2P4IA 5E8WA 3QC4A 3DB6A 4N70A 3DV3A 4I6BA 2C3IB 4AF3A 2QOOA 3Q6WA 1ATPE 1YHWA 2VTHA 4IZ5A 3KXGA 1UU3A 2I0EA 2RIOA 3G51A 2ETRA 4HJOA 4MXOA 5DWRA 4C61A 3UFXB 3FDNA 1OITA 3A61A 2VTSA 3QXPA 3V51A 2HWPA 1E1XA 2RFDA 2YIWA 4NWMA 4C2WA 3NPCA 3QKKA 3RWPA 4DN5A 3QD2B 4DE4A 3B2WA 2GMXA 5TO8A 5M53A 2F4JA 2XM8A 4DHFA 2XNNA 3Q2JA 4ERWA 3R5XA 2WTJA 5D10A 1SNUA 5A6OA 2IVTA 4BDEA 4FOBA 4PTCA 1M52A 5I5ZA 4OTHA 1XH9A 1KOBA 3U54A 4EH3A 3HV7A 4ZZMA 4ASEA 4MX9A 1YOLA 3O2MA 3SC1A 4I4TF 4ZSJA 1IEPA 4IWDA 4TYEA 3PXRA 4IX6A 5KX5F 4U3YA 4EWQA 4O27B 4YZNA 5LVOA 5CSXA 1M2RA 3FZ1A 3PRFA 4XS2A 1I44A 3GFEA 3LFEA 5CT0A 3VUDA 4F1TA 3JZIA 2XP2A 3WO1A 4OUCA 3MGYA 1M2PA 4GVJA 5EHYA 2DLNA 1M6VA 1APME 3KU2A 3CTHA 3QX2A 4YJNA 4M69B 2C3JA 1UNLA 4I6HA 2FO0A 2ZAZA 2O63A 3QWKA 4QYFA 4AS0A 3A7IA 2WELA 3BGZA 2PULA 3UVPA 3E62A 4Y73A 4D1ZA 2WMVA 3IPHA 4QYEA 2GQSA 5GIOE 1YKRA 2XB7A 2VTJA 2CSNA 2RG6A 4YSMA 3TDVA 4BIBA 2JC6A 2XNGA 3ODZX 4LOOA 3P5KA 2XKEA 3PJ8A 3Q53A 4A06A 3PY1A 2SCUB 3CKWA 4O6EA 3VWAA 3A7HA 4TKSA 3VJNA 4AFJA 1EYZA 5DMXA 5AV3A 2F49A 5HE1A 3K3JA 2OXXA 1U59A 2NRUA 1YXUA 5M09A 3VW8A 4X7QA 4QNYA 1WBWA 4RIYA 5CANA 4WNPA 4A9SA 4F9BA 3SW7A 5HBRB 2HXLA 1ZXEA 2XCKA 5L6OA 1H01A 3IECA 2YDKA 3U4WA 4D5HA 2BMCA 4PDPA 4YPSA 1U5QA 5DG5A 2UW3A 4FT7A 1PX2A 3QCQA 3DBEA 3AMBA 3FLWA 3R8PA 5JT2A 3UYTA 2C69A 3JXWA 4NW6A 4JDHA 4QP7A 3G8CA 3TNPC 5M51A 1HCKA 2R7MA 3DK3A 3I5NA 3WIKA 3JY0A 2NUAB 3Q9YA 5CS6A 3Q3BA 2QOIA 3EQCA 4FI1A 4QMUA 3QTXA 3RV3A 3VQHA 5HBJA 2KULA 3D5UA 4CZTA 4OTIA 3AW8A 2R64A 4NKSA 3RK5A 4D4YA 2XJ2A 3UQFA 1G8AA 3DKFA 3G0FA 2X1NA 4FTAA 4IJPA 3EQGA 4FTOA 4TT7A 3SXFA 4UN0C 4MV7A 4I4FA 4IFCA 2RG5A 4R6VA 4CFFA 2X0GA 1JLLB 5I4NA 2ITXA 3PPKA 2OWBA 4G3DA 1C3OA 2G15A 2IJMA 4L3JA 2O65A 1VJYA 3QWJA 1O6LA 2VGOA 2YHVA 3D15A 4ITIA 4MH7A 1BI8A 2PZIA 4DFYA 4QMOA 3RAIA 1Y8GA 4EHEA 3UMXA 3TINA 4C5AA 4TYIA 4X2NA 2FGIA 2YCFA 3R1SA 4MXXA 3KB7A 3Q32A 1QL6A 2P2IA 1TQMA 4HCVA 1W0XC 2W1FA 5ANEA 3OW4A 1JSUA 3I0QA 3COMA 1P4OA 4FZ6A 3SW4A 2XK4A 3FLSA 4AT4A 4I50F 4FIFA 3E8NA 4NU1A 1Q8TA 1UWHA 5ETFA 3IDCA 1MUOA 4GG7A 3RNIA 4CZUA 1C30A 4NFNA 3FHRA 1SM2A 2C5OA 3MV5A 4O2PA 2XIRA 5J2TF 2JKKA 3BQRA 1ZAOA 3A8XA 3FHIA 4I0RA 3HB9A 3QTWA 3PA3A 3D2IA 3DBCA 4ZAUA 2UZEA 5HG5A 4X21A 3CC6A 2R3LA 3EQRA 4IBMA 4YTCA 1ZWSA 2WTVA 4H3PA 4TYHA 4XG2A 4MV4A 2OIQA 2GHGA 5FRIA 2VN9A 3VRYA 2B9JA 3NUNA 2W71A 3QTUA 2OZOA 4Y8VB 2NPQA 4IACA 4G3GA 3O71A 3RP9A 3CD3A 3GLKA 1X8BA 4MQ2A 4B6LA 1WVWA 5KBRA 2R3RA 1BNCA 1XHAA 4MNEB 5HD4A 5IA4A 2KTYA 5HX6A 3DTCA 4ZLOA 3DCVA 3BHYA 3PXFA 2XVDA 3I60A 3PY0A 4E1ZA 4F7SA 3HMMA 2UVYA 2PZ5A 4JIKA 3F5PA 2ZVAA 4K2RA 4OTFA 4WBOA 5JMSA 1O6KA 4ZTRA 5DBXA 2X2MA 5DT4A 3P4KA 3WF8A 2A2AA 1BMKA 1OKWA 4TXCA 1VYWA 4ZTLA 4DGGA 2OH4A 2YJSA 2CKOA 5C8KA 5GNKA 3FV8A 4IAIA 4I5PA 4KABA 4W4VA 2XJ0A 3KCKA 2UZNA 2X8IA 4ZSGA 4M9UA 3EL7A 4PMSA 5DT0A 1UU9A 4BGGA 4D0WA 5LVPA 3GCUA 4F0FA 3GEQA 3EFJA 2NU6B 5FDPA 4FA2A 3KXMA 2O0UA 3TEIA 1GLVA 3MI9A 3P9JA 5E91A 1QCFA 2PVPA 2VWXA 3O0GA 4FVPA 4WD5A 3EFKA 4GJ2A 4JVGA 4XG8A 1Q3DA 3U4UA 2B7AA 2Z7SA 3PZHA 3S95A 3F5GA 2J51A 4FT3A 2VO3A 4UWBA 1VR2A 2PHKA 2QLQA 3Q2MA 5C03A 4JBVA 4JAIA 3ZONA 4ME6A 4HYSA 3OFMA 4FSRA 5CAPA 2VZ6A 5HE3A 3BWFA 3K3IA 4ENXA 2WB8A 3UIUA 4D1XA 4E5BA 5AAFA 1PY5A 2H96A 3GENA 2V5AA 4GYGA 5EM7A 3VBTA 2BHEA 2Y4IB 3C5UA 4IB1A 3ZLSA 1UWJA 2ERZE 2JBOA 2YIXA 4RIWB 3VBYA 4FE2A 1U54A 2JKOA 3W2RA 3ZDUA 4DH8A 3ETHA 3ORNA 3F3VA 3PA5A 2JIUA 3DAEA 4WG3A 4AA0A 2V59A 1KSWA 4Z7HA 5E7RA 1A48A 3AC4A 4X2GA 2IO6A 2PUPA 4MD8E 2XNEA 4RZVA 2DWCA 2JAVA 2ZJWA 1JPAA 1U5RA 2X2LA 3UOJA 3V4SA 3L8SA 5JZJA 4QYHA 3RALA 3PVBA 5L2SA 3OEFX 4J99A 3C4WA 5KZ0A 5ICPA 3N8DA 4AAAA 4D4SA 1WMKA 2HW7A 3QTZA 1OPJA 2A0CX 2Z2WA 4EZ3A 2IVSA 4BGHA 4K77A 4RC4A 4OTQA 4QMMA 2BRGA 2GFSA 2WQEA 4GUBA 4CGAA 4DITA 2J2IB 4YURA 5BQ0A 3HP5A 3LFQA 4F1OA 3OT8A 3QHRA 3LFDA 4FKGA 4CFVA 4GK4A 5HCZA 4KWPA 4ZHQF 1E1VA 3EMGA 5FEDA 3K5HA 2R3FA 3TZ7A 5BPHA 3IDBA 4OT6A 4QPSA 4DGOA 4CRLA 1YOJA 2VO0A 4QP2A 5BVWA 2PVYA 1BYGA 4FTRA 3DZOA 5M56A 3BRBA 5JRQA 4Q9ZA 3ZYAA 2ITOA 5TOZA 4WHZA 2C1AA 4BCIA 1JOWB 4E8AA 4M15A 2PK9A 4D2SA 5CNNA 5HTBA 2CCHA 4GH2A 3MFRA 2HIWA 5KBQA 3OBGA 1OIRA 3FSKA 2PL0A 3EJ1A 3VNTA 3UG1A 2YWVA 4EK6A 3NRMA 1VBGA 4ZQIA 1DIKA 4FK6A 2ZM3A 3PIXA 3RINA 3NUUA 2B9FA 4HNFA 4NIFB 4QMZA 3FPQA 5DLSA 4DCAA 4YO4A 5BVFA 4PL5A 2DUVA 5IUIA 1GSOA 4JX3A 2WYOA 2ZB1A 3SRVA 2ZMDA 4EHZA 4LL5A 2W5HA 3Q52A 3DK7A 4S30A 3DKGA 1DV1A 1RW8A 2PZRA 3MY1A 4YU2A 1OMWA 3VUHA 2R3GA 4D4VA 2Q0NA 2GQRA 3P23A 2QR7A 4JAJA 1AD5A 4FVRA 3EZRA 4GIIA 4XG6A 3ZO2A 5H2UA 1ZOEA 2VTQA 2VTLA 4EOJA 2YZGA 2IVUA 3QYZA 1H1QA 4L53A 4Y5HA 4D9UA 2JD5A 2R9SA 4OR5A 5IQEA 2YRXA 4EZ7A 2DYLA 1G3NA 3ORXA 3KRWA 4JR7A 1O6YA 1S9JA 5FLFA 4LMUA 3D5VA 2O64A 3G0EA 3NUSA 3GGFA 3OOMA 3W8QA 4A9YA 1I7LA 5J1WA 4FTTA 5D9HA 4AGUA 3ZUVA 4J1RA 4AU8A 3EKNA 1JLUE 2XIXA 2ZDTA 4DIMA 2WMWA 4EQMA 4OGRA 2CKQA 2GS6A 4NTSA 5I9WA 1JVPP 3ZXZA 2EVAA 1YI6A 2BIKB 5A46A 5H80A 2OJIA 2BDJA 3LQ8A 4HPUE 5DHJA 2BRBA 1XQZA 3FLZA 4IAAA 1REKA 1FOTA 4DH7A 3BHTA 3FI4A 1YDSE 5HTCA 4CFMA 5CF5A 3GXLA 3ANRA 4RFMA 2ITYA 3ZO4A 1ZZLA 4DG0E 4PNIA 3ZTXA 3OG7A 5EYKA 1V1KA 3DFCB 4NL0A 3WARA 4EORA 1KJJA 3R7OA 2VR1A 5AP0A 3RAKA 5LMKA 2XCHA 3CY3A 4L52A 2WQOA 3PXYA 4IM0A 4M3QA 2CGWA 3MWUA 1UNGA 2B9IA 4BCFA 2WMXA 4NCTA 2W06A 5CU2A 3NNXA 4ZY6A 4FNYA 5CVGA 3W2CA 5HE2A 1VEBA 2GDOA 4YLLA 2OU7A 3DFAA 4V0GA 2FB9A 5HKMA 5KMMA 2OIDA 1PF8A 2XK8A 3OW3A 4YUQA 4I6QA 5DH3A 1KE6A 2XRUA 3MVJA 1KBLA 2VUWA 5CEIA 3CCNA 4GUEA 4BDGA 3FZOA 3FMKA 4XZ3B 2BDWA 4O96A 4FFLA 5IMXA 3D2KA 3VS3A 5J9YA 5JFWA 2R3MA 5HQ0A 4C3RA 2HAKA 4D0XA 2Z04A 3C4ZA 3CS9A 1E9HA 1BUHA 4KINA 2QOLA 1GGOA 4EEVA 5KKRB 4CFWA 3EFWA 4G2FA 4Z3VA 2QU6A 3UYSA 5BUIA 3SDJA 4Q2AA 5E8VA 3EYHA 3F9NA 4W4YA 4RPVA 3A60A 3ACJA 3AD6A 3PWDA 3VBWA 5CAVA 1ZARA 3S1HA 4EOKA 1FMKA 5C1QB 2C6IA 2I7QA 1Q8WA 3UPXA 3PVWA 3DDPA 2R3HA 5AUYA 3NUAA 5I9ZA 5AIKA 3NNWA 3C7QA 2W6ZA 3QFVA 1SVGA 2OJGA 2R3KA 3QXOA 5J87A 4HQ6A 5AP7A 4AQCA 5FG8A 1MQBA 4R7HA 2A19B 1Y6AA 4G1WA 3NNUA 2E2BA 2O3PA 3BE9A 2IZSA 3R1YA 4V05A 2YZLA 4QP8A 5F95A 4BC6A 4U3ZA 2W4OA 5HG7A 3AMYA 2V5QA 4EH6A 4PMMA 2JGZA 2YJRA 4UYAA 3UDBA 5IEXA 5LXMA 4GV1A 4OT5A 2V62A 3RMFA 3GNIB 4M0ZA 5L8KA 4G9RA 4FL2A 4WG4A 3M11A 4WT6A 5HCYA 1ZY4A 2J6MA 5LVMA 4X3JA 3HRCA 3ZLWA 2GTNA 3FXXA 3H9OA 3PYYA 1YDTE 4MXAA 5IG1A 4TWCA 4BTMA 2VWIA 4EZ5A 3R0TA 3R02A 3GU6A 4BZOA 2HZNA 4ZSEA 3RPOA 2CLXA 3ZLYA 3QCYA 3Q60A 2XA4A 4FSNA 4RIXB 3SXRA 4BBFA 5JH7F 3SGCA 1YXSA 5HCXA 3RZBA 4CMUA 1I7NA 2XNBA 3FMMA 3HDMA 3D9VA 3R6XA 1EZ1A 4IAFA 5B7VA 4WNKA 5DOSA 4MF1A 2R85A 3QCSA 1FQ1B 2Z7QA 4QP9A 3QKLA 4EYJA 3LIJA 3GU8A 3WF6A 4B4LA 1KOAA 4DBXA 4RJ7A 4RJ3A 2GPSA 4YO6A 4R1YA 2IZUA 2XK9A 5KZIA 4Y5QA 1P5EA 5AJQA 4BCQA 3G8DA 3FYKX 4RG0A 1DAYA 3TIYA 4FODA 2H9VA 2QHMA 2WHBA 4AA4A 4L01A 2ZDUA 4YZDA 4MA5A 2QNJA 2BRHA 4BDCA 3CXWA 3IOKA 3T8OA 4FIJA 2CKEA 5FEEA 3LQ5A 5FXSA 4F0IA 2GU8A 5KE0A 2C0TA 3OCGA 4CLJA 3MYGA 1H00A 3RCJA 2DQ7X 4BBMA 3F3UA 5T68A 5GJGA 4NCTC 1PJKA 3TTIA 4FVQA 4G5PA 3KF7A 5IA3A 2AC3A 2WMBA 3HUBA 2GS2A 4M13A 2B52A 1JKTA 3CE3A 3E8CA 5AP2A 3LCDA 5HG8A 3E5AA 5I0BA 3AT4A 5GIPE 4AZEA 4FTKA 3C5IA 1PKGA 4WKQA 2P33A 4FK3A 5FDXA 2HY0A 4NT4A 3R9HA 2DS1A 4DEHA 4P90A 3KQ7A 1PKDA 2W6MA 2NU8B 3ORTA 3F88A 4HYHA 5AUVA 1CQJB 4F65A 1B39A 2BFYA 2V7AA 4NM3A 3UP7A 4AG8A 2YS7A 2EB3A 5ANIA 3UO6A 4W8DA 3V3VA 3VS1A 3KALA 4MWIA 4D2RA 2J4ZA 3RPSA 4DH1A 2QKRA 2R3IA 1PXMA 1OPLA 2YEXA 4B99A 4TY1A 4P2KA 2HXQA 5EQEA 5J9LA 2CJMA 2UZLA 3AT3A 3WZEA 4BDIA 4GG5A 3COHA 5EOBA 4DTAA 4J96A 4QMQA 4IW0A 3GT8A 3ZM9A 4I5HA 5CF4A 3LFCA 3EQHA 4XBRA 5HU9A 3JRXA 5IA0A 3W8LA 1IR3A 2W4KA 4M0YA 3G5DA 5TKDA 1MQ4A 2Y7JA 2YCQA 3PXZA 3TW6A 5GHVA 3GUBA 3V4ZA 4GKHA 2I6LA 3FZRA 2GNGA 4R3RA 4DEGA
chains in the Genus database with same CATH superfamily
4C5CA 3QX4A 4JDIA 5KMKA 2ETKA 3BQCA 3SD0A 1B6SA 3BABA 4IQ6A 1NA7A 1CKPA 4L7FA 3TMOA 1DM2A 2G1TA 3NVMB 2PPQA 4DAWA 3CGOA 2Y6OA 3JYAA 3MIAA 1H4LA 3QTSA 4U81A 4AA5A 5CNOA 2HCKA 2I0VA 3RM7A 4AX8A 3KXHA 4BYJA 4DFLA 3EN7A 1W84A 4XYLB 5IEVA 3Q2OA 5E9EA 3I12A 4YBJA 4M14A 3FZTA 1BKXA 3KIOC 4O7YA 4U44A 2GTMA 3FPMA 3TT0A 3FZPA 4AXEA 3LJ0A 4LOPA 5EHOA 4DEEA 1DGSA 3RAWA 4G9CA 3EQBA 4RLKA 3LHJA 3SG8A 3KRRA 4RCNA 4IADA 3TI1A 4BGQA 5I5TA 4QMLA 4EK3A 1LEWA 3RGFA 3BYMA 3OUKA 2VPQA 4FYNA 4FKOA 3L9MA 2QG7A 4MBLA 4KKEA 3ZXTA 3DJ5A 4YGAA 2FH9A 1K9AA 2VWVA 4MQ1A 5I5XA 3Q5IA 1A0GA 3B8RA 4O7WA 2ZV2A 2OFVA 2JLDA 3AQVA 5IQAA 4DGMA 2C6LA 4EKKA 4EH5A 3MPAA 2VTMA 2QO9A 4PP7A 2BTRA 2QQ7A 3F69A 2OXDA 3QRKA 4FL3A 4QMWA 5FTGA 3UGCA 1ZAUA 4NZMA 3U9SA 5EM5A 5HV6A 3HAVA 4XOZA 2UZWE 4QTDA 5FTQA 3NIZA 4IZAA 2XS0A 3Q9ZA 1QMZA 1PHKA 3D5XA 3FEGA 4FKSA 4W4WA 4Q5HA 4AXDA 2BIYA 3ODYX 4BCKA 5L2IA 4E6CA 3P1AA 1XH4A 2YL2A 5IQHA 3F3TA 2A1HA 3CTQA 4PMPA 4O4LF 4GLXA 3GI3A 5G6VA 4TL0A 4TVIA 2WAJA 1P2AA 3OT3A 4FT5A 4L44A 3RI1A 2UZDA 1F0QA 1H1WA 2OFUA 2W1DA 3PXQA 2W0JA 2CN5A 5A4TA 4N57A 2YDIA 3UJGA 3OUZA 2P0CA 4TWPA 4CSVA 4ITHA 3AXWA 3R1QA 4JDJA 5H8GA 3RVGA 3S00A 2IN6A 4PZ6A 3TY8A 5B0XA 2YAKA 1QPEA 2HVQA 1WBTA 5GJFA 4K33A 2J50A 2X7GA 2UZTA 1CKMA 2X9EA 4AN9A 4FG7A 4FKVA 1XJDA 2WU7A 4LM5A 3R8UA 3QC9A 4KKGA 2WTKC 3MTFA 2YACA 4PWNA 2ZV8A 2GHMA 4HNTA 3QYWA 3WF7A 4O2AF 3R01A 2VTRA 1UU7A 2QR8A 3O17A 2NO3A 5D41A 3F61A 3U87A 1H0VA 4FV9A 5M06A 3BV2A 4KIQA 3W10A 3ZO3A 4GCJA 2PVMA 3F3ZA 3BHHA 3LM0A 3QQKA 4RGJA 4EC8A 3QKMA 4CV8A 3BLQA 3DF7A 4S33A 3V5QA 3S2PA 2QHNA 3FI8A 3CBLA 4RVLA 5F20A 4CFXA 4YHJA 5DIAA 3C1XA 3LQSA 4EQ5A 2ZMCA 3FMNA 4CVAA 3ITZA 4YJPA 4D5KA 5CAEB 2UZBA 3ENMA 3Q9WA 3FC1X 2PU8A 4MD7E 3U9TA 3IW6A 2V22A 2Y8OA 5HVYA 1CDKA 2JEDA 5JH6A 1EUDB 4YNEA 2ACXA 5BMVF 4JRVA 1PXPA 3UIMA 1V0BA 4NH1A 1NVRA 4O0SA 3DAJA 3VUIA 5AUWA 2OJFE 4C7TA 4DLJA 4R1VA 1OIUA 4BJJA 5KHXA 1PMNA 3QLFA 4XG4A 4RT7A 3NYNA 3TV7A 3E7VA 1UNHA 4RQVA 4NM7A 3L1SA 4E73A 4HVGA 4CFNA 5IA5A 5FNVF 3TIIA 2ITTA 3PDTA 4ZTSA 1Q97A 5DVRA 4AXAA 4GU6A 3VMMA 3ZO1A 1R1WA 4PL4A 4I41A 3KMUA 2I1MA 1FGIA 1GZ8A 1VKZA 3DT1A 2WD1A 4GS6A 2ZB0A 3L9PA 3QL8A 4BHZA 4BTJA 4F08A 2HYYA 5FBOA 2YZMA 3VUGA 4GK2A 4RVMA 3QGYA 3MPTA 3LE6A 4L3PA 4XUFA 4ANBA 4CG8A 3P7AA 4WA9A 4D55A 3Q5ZA 2C5XA 5CF8A 3SNOA 1OL2A 4QP1A 2ITZA 1KE7A 4LUDA 5ETAA 4BTKA 2ZDQA 4O7LA 5D8DA 1JKSA 3TKHA 2PVFA 4BDDA 4Z55A 3ORRA 1RDQE 5AV4A 1IA8A 4V01A 3RHKA 4QP4A 4JXFA 1Q41A 3DA6A 4UBAA 4FSZA 3LMIA 2GNJA 5M55A 2CHLA 2RGPA 5ACKA 5AA8A 4IVDA 4DTBA 1KJQA 3VPCA 3ZZEA 4AGWA 5EW9A 3FAAA 2BZKB 3GFWA 3BGQA 3ZRMA 4BY9E 1Z2OX 3ZS5A 3TEKA 1H26A 3HVCA 3AG9A 3O50A 5CZIA 4O0UA 4E6DA 2COIA 2UUEA 2W9ZB 5BWXA 2BRMA 3IOPA 2P2HA 4FL1A 3PP0A 4F6WA 4ZZNA 3NCZA 2Z8CA 3T9TA 5JQ8A 4JQ8A 3EN5A 3D0EA 2EUFB 4DHIB 3CJFA 4A4XA 2ITVA 3VHEA 2VTPA 3O7LD 1LEZA 3QD0A 4IB3A 4YLJA 5I9YA 1WBOA 3BYVA 3MTLA 4QTEA 2I87A 4QSHA 2C00A 2QI8A 3QBNA 1BI7A 2OI4X 4YSJA 4BCOA 1MRYA 3W0SA 3ATTA 5KKRC 3VPBA 4GVAA 3RHXA 5FXQA 3NW5A 4EKLA 3FLQA 1EKFA 4XLVA 2PYWA 4EONA 4E6AA 4GEOA 4XCUA 4YP8A 1H25A 4LGGA 3QU0A 4DH3A 4KBKA 4EQUA 2JDRA 5HLWA 1URWA 3AC5A 5GJDA 1H08A 4APPA 4ZSAA 3CSWA 4UALA 3UG2A 2YM4A 4A7CA 1WFCA 4I55F 1H27A 2PVKA 3EN4A 3N4TA 3WZKA 4C4GA 4EK4A 1UU8A 4KD1A 4LV7A 4J53A 3GC7A 4DFNA 1I2KA 5JFXA 3HYHA 3RTPA 3OUNB 3FLYA 3OF0A 4WUAA 5KHWA 3GU5A 4O7TA 1B6RA 4IH8A 4PX6A 2QONA 3LQ3A 3LFSA 4K8AA 3ROYA 3PJ1A 2WXVA 5G1XA 4ZJIA 3FXZA 1DI9A 2CZGA 4LL0A 3HO8A 3FZSA 3OCTA 3PJ2A 4AFEA 2CNQA 2I0HA 4FZ7A 5EK7A 5LMAA 5KUPA 3QGWA 3FKOA 4GSBA 3L8PA 5E1SA 4ZTQA 1JDEA 2WOTA 3POZA 2GNFA 3COKA 1ND4A 3MY0A 4I24A 1WBPA 2X8DA 4D4RA 1STCE 3HNGA 3JVRA 1KJ9A 1CMKE 2QOFA 3K2LA 2FSLX 1J7UA 2PVNA 4L45A 4LYNA 3KULA 2XCLA 3T9EA 3LMGA 2IPXA 2WEVA 2XKDA 3H30A 4UCVA 4DDGA 4I6FA 1J3HA 5CSVA 2W05A 2WU6A 3JPVA 4I3ZA 5K3YA 5BWUA 4FTUA 3FKLA 4RIWA 3UDSA 3FMJA 4FTQA 5BUJA 2WO6A 2JIIA 4JQ7A 3PLAE 3A8WA 3BA9A 3NBZB 3OUUA 4FFRA 3W5OA 3CP9A 3QFFA 4G17A 4HOKA 2OF4A 3EN9A 4F6UA 4DBNA 3AGMA 2BHHA 3GOKA 4EHVA 5HICA 3TN8A 2BR1A 3IO7A 3PTGA 1MRVA 2DAAA 4FEUA 5CA0F 2R5TA 3TQTA 3DBQA 3N4UA 2CLQA 3TDWA 4BHNA 3IG7A 4KIOA 4JBOA 5ANGA 3JZFA 2X4FA 2HENA 2F2CB 3ZFXA 2WIPA 5JGBA 3LP8A 4X2JA 4EI4A 4DLKA 4UCOA 2BVAA 5FXRA 1Q8ZA 1H1PA 2PVRA 2X8EA 3L8XA 4H3BA 4ORKA 4P5QA 4X2KA 1SVEA 4FYOA 2QOHA 3KRLA 4X6RA 4XLIA 5CI7A 2W1EA 1M14A 2OJ9A 2UW9A 4RVKA 5JEBA 2R7IA 3LVPA 2AC5A 3HV3A 1EKPA 4IZYA 3R23A 2BZIB 4E5WA 4BRXA 3BWJA 3G9NA 3NYVA 3THBA 3TUBA 2EJ0A 3KAJA 5JKGA 2UVXA 2FSMX 1Y6BA 5E8XA 5HO8A 4F4PA 4QOXA 3T9AA 1P16A 2V0DA 3KULB 3NUPA 5CYIA 5ACBC 3N4VA 3KC3A 3FYJX 4M12A 3FQHA 3UPZA 5EQYA 3FMEA 1I2LA 5LXTF 1XH6A 4AZWA 4IFGA 3QWUA 1OBGA 2OLSA 4O4JF 5EDPA 3NW6A 2UV2A 2YM5A 2WMTA 2BROA 4NTTA 2R82A 4E93A 4I21A 4CE5A 4YJRA 2W9FB 5HESA 1GIIA 4IAYA 3MJ2A 4W4XA 4ZLZA 1WBNA 4S31A 2IW6A 4AOJA 4TYGA 4AW5A 4R7IA 5AWMA 4Y46A 2YA9A 3ENHA 2NNWB 3NDMA 1YOMA 2XALA 3P7CA 5CVHA 2F7EE 3T3UA 3PPZA 3A7FA 5JRSA 3UC4A 3UZRA 4UXQA 3C0HA 2GHLA 3ZBXA 1KEEA 4O83A 4RIXA 4BDFA 2J7TA 2QLUA 2WTDA 5EQPA 5EW8A 3RV4A 3VIDA 3TV6A 5BWTA 5A14A 2GFCA 3F2AA 1FVRA 5DRBA 2JDSA 3C0GA 1SZMA 2VD5A 4GIHA 4J95A 3VS6A 4MBJA 3PY3A 4WBBB 3R7IA 3PN1A 4TM5A 3VC4A 1J1CA 2GPWA 1RQQA 2GSFA 1KTAA 4FT0A 3GCQA 2DWBA 4UEUA 4RJ4A 2WIHA 3C4FA 3MH3A 3UIXA 2C0IA 4YB8B 5CR5A 2Z7RA 3SLSA 3VS0A 4X3FC 3SHEA 2O5KA 2XYNA 5E8TA 2XANA 3VS4A 3BCEA 4XYFA 4ONAA 3R71A 3ZM4A 4J8NA 1Y91A 5CEMA 4NW5A 5IU2A 3FE3A 2XJ1A 3OEZA 4CXAA 3OY1A 5HIBA 2Q0BA 4ZY4A 3EQIA 5KCVA 5KS8A 1XO2B 3R9DA 3GC8A 4OBPA 3BEAA 5IPJA 2VTOA 4R78A 3MH1A 5HG9A 3OZ6A 4JL9A 3QQFA 5EG3A 4ZIMA 4R77A 2HHFA 1Z5MA 4HZRA 4XX9A 4XV1A 4O6LA 3MDYA 4RSSA 4AW1A 4FEQA 2AYPA 3F5XA 3H0ZA 4P7EA 4WNMA 5AP1A 4BKJA 3GIDA 4IZ7A 3TIZA 4F70A 3L8VA 4JBPA 4CMDA 4KRDA 2FPPB 3NS9A 3LFAA 5DYJA 3S4QA 1SNXA 4QMNA 2VNWA 3MW1A 4DG3E 3BL7A 1YXXA 2YM8A 5D11A 2C3KA 4EYMA 3FWQA 2HY81 5E90A 5CEKA 2FUMA 3WIGA 3EB0A 5BX0A 4XV9A 3W0PA 1KJ8A 4YAJB 5DGIA 5C27A 4X3FB 4DC2A 4O7RA 1G8JA 3VO3A 2RF9A 2YAAA 3HMIA 4IJ9A 1ZYCA 4PMTA 1J1BA 2W1HA 1FPUA 5EW3A 4EK8A 2Y6MA 4FUXA 3KRXA 3KYHC 2W1CA 4BVUA 5AAGA 3DTWA 2BILB 3RK9A 4ACHA 5C1OA 4AT3A 1H1RA 1XH8A 3P79A 3GOPA 3TL8A 4PRJA 3V8TA 2UVZA 3W0RA 4TZRA 4F09A 3VJOA 4QPAA 5M4FA 4QTAA 4TV8F 3R30A 4O0WA 5A3XA 2X0SA 2Y0AA 2YZAA 3HX4A 1GZOA 4G6LA 4OTWA 5I9VA 1XDNA 2QF7A 4FGRA 2WMQA 4IDVA 3HECA 3A2CA 5J5SA 1GJOA 2EJ2A 5A4QA 3I0OA 2VO7A 4OTRA 3POOA 1CKOA 5H8EA 5LP6F 1XMLA 2VTTA 1H1SA 2PSQA 5C8NA 2OSCA 1H0WA 4WUNA 3GC0A 5HLPA 5K5XA 4DINA 1CSNA 2XK3A 3MSSA 4U9AA 5GINE 2R3OA 4IM3A 5BNJA 5IUHA 3MWDA 5L2TA 2UZUE 2YW2A 1GSHA 3QUDA 4YAKB 2H6DA 4MBIA 2GNLA 4L46A 4UB7A 5DPVA 4FSQA 4B9DA 4QRCA 5LOHA 5BVNA 1EH4A 3BBTB 4JG8A 2J0JA 2ZV9A 1OECA 3R83A 1YWVA 3TZ9A 2QOKA 3VS2A 2XUUA 4R5YA 5F4NA 4EBWA 5C4LA 3QALE 4MV3A 5AX3A 3VNNA 1M7QA 5HIEA 5IISA 1WZYA 3K54A 3EYGA 4K9YA 3W2SA 1OB3A 3F2RA 3I5ZA 3U9NA 5B2MA 3E5NA 4II5A 3GQLA 4TNDA 4FKIA 4X0MA 4FFPA 5K5NA 2WMSA 2YIQA 3QZIA 4MXYA 3AGLA 3FMLA 5CSWA 4U40A 3OVVA 4U97A 1DAWA 4FV3A 4BCHA 3Q4ZA 4BZDA 5IQBA 2W17A 4F64A 2X39A 2YM3A 3M2WA 1M2QA 4FKJA 5HIDA 1IASA 3OP5A 5AV1A 2YIRA 3HA8A 5DA3A 4QTBA 4BB4A 5BPFA 3EFLA 3LXNA 3R04A 5M08A 3QTQA 2NYAA 4GL9A 4OTGA 4CMOA 5FM3A 5IQCA 4WG5A 4RX5A 1OI9A 3BACA 4IIJF 3L2PA 3VBXA 4L42A 3T9IA 3OY3A 4XV2A 4A9UA 2BUJA 3R73A 3EQDA 2W5AA 4DTKA 4R5SA 3UE4A 4N0SA 3VBQA 2VNYA 5BVKA 3QQUA 1H28A 4ZK5A 3EOCA 4GYIA 5CAQA 4PDOA 1Q4LA 1PK8A 4O2BF 1U54B 4DG2E 3IKAA 3EQFA 5JK3A 1FVVA 3A4OX 3RPVA 1DV2A 3UMWA 5E8SA 2W70A 1V0PA 2QO2A 5LARA 3DQWA 3VS5A 2X5RA 4JMQA 4YTFA 3NW7A 4NM5A 4UCSA 4FKPA 3AD5A 2LAVA 5CU3A 4BZNA 5AAEA 4FV2A 4FIGA 4NJDA 5CASA 3W2OA 4O7SA 4BCPA 4AE6A 3MVHA 4FV5A 1Z9XA 2VWUA 4JNWA 3C4XA 2PMNX 3NNVA 4DFUA 4EWHA 2C6EA 2G2IA 4MKCA 5FEQA 5L8JA 4FIHA 3ZC5A 5LMKC 4H36A 5E8UA 4Z9LA 1JWHA 4FSMA 5EYDA 5IMEA 5M57A 3CEBA 3ULZA 2CGVA 3QQHA 3ERKA 1FMOE 1PMUA 2C6OA 2R3NA 4C0TA 3KVWA 5A4EA 2EB2A 2EIYA 1VYZA 3KREA 3O8PA 4IE9A 3E8EA 5D1JA 4B8MA 4QMSA 5HX8A 3U6JA 4LH6A 1W8CA 5EZYF 2Q2TA 4BCMA 5EKNA 4XHKB 5IDNA 3OXTA 4GMYA 4EGJA 4GJ3A 1TQPA 2O8YA 1Z57A 3DDQA 4G34A 4KSQA 4U0IA 1BL7A 1BLXA 3C51A 1KE9A 2CGXA 2XK7A 3LMHA 4UX9A 4JRNA 3BU3A 4CT2A 2W6PA 1CTPE 5CEOA 4JBQA 3LCSA 4O82A 4USDA 2ZYBA 3U9CA 4C4HA 4DT9A 3NUYA 4O86A 2UZOA 1JQHA 3NMUF 1GZNA 1M17A 4HGSA 4ZTHA 3MESA 5JSMA 1K2PA 5KNJA 2IP4A 3LZBA 3D7ZA 4MAOA 4QP6A 3AT2A 4ANLA 4E7WA 4Q9SA 3PFQA 3TYKA 2QB5A 3U0GA 4FEVA 4BCNA 1R39A 4EGQA 4I23A 2QVSE 3BU6A 4K18A 5DR2A 5BYZA 3DZQA 4ZTMA 5I47A 2HHFB 4U7ZA 3R5FA 3EKKA 4G3CA 4IM2A 3TV4A 4DCEA 2HJWA 3UIBA 1ZY5A 1ERKA 1KT8A 1P14A 3FUPA 4TYHB 3RJCA 3JSNA 3DB8A 4XRJA 3HEGA 3HV4A 4M97A 4RIYB 5CXHA 3DQXA 3DXPA 3BHVA 3A7JA 3ZFYA 4CV9A 4O4HF 4DFZE 4RFZA 2WGJA 3F7ZA 5J95A 2R2PA 3W0MA 2ABJA 3CTJA 5JVLA 4BCJA 2CMWA 1Q62A 5CWZA 3KVXA 3T9FA 3PIYA 5TF9A 5ITAA 3DGKA 2E9NA 2V58A 5IA1A 3IK3A 1ZZ2A 2PY3A 1MP8A 2XYUA 2XEZA 3UC3A 3UVQA 1PXJA 3SRVB 4ACMA 3R8LA 1FVTA 3LAUA 4FTCA 4FX3A 4FBXA 4AN3A 4BDHA 4C4FA 4DEBA 2Z7LA 4F0GA 4YMJA 1P4FA 1PW2A 2YFXA 2BFXA 4MNEA 3DLSA 4K0YA 4JR3A 4QQJA 4RJ6A 1W96A 4ZI7F 3E3BX 2CGUA 3BE2A 5J7HA 5I5UA 2Z60A 1H8FA 3QQLA 4H1JA 4JJRA 4LRJA 3A7GA 4NYEA 3A4PA 3II5A 4XH6A 4DFBA 3L9NA 3ZHPC 4I4EA 4J52A 4FV4A 5ANJA 2E9OA 2EXCX 3R21A 2XKFA 3VRZA 4QQTA 2XM9A 3TNQB 5BMSA 2C68A 5AP4A 3ZLSA 1FVIA 2ODTX 4MV8A 2RFEA 3BLHA 3E3PA 3LCOA 4KIPA 4WOVA 1JBPE 3VVHA 4EOSA 3O51A 4EQCA 1Z2NX 5CI6A 4O0TA 4KUJA 4QDVA 2QC6A 5HVJA 3NUXA 5IA2A 5CLPA 4RVTA 5CQWA 2ITNA 5L3AA 3HMNA 3OCBA 4ZOGA 2C47A 2YN8A 4FKRA 3R2BA 4RWLA 3QA8A 2B1PA 2BDFA 3DS6A 4LV5A 5LCKA 4LGHA 3R8MA 1U4DA 5TR6A 1EHIA 2WQNA 4F7NA 4FKWA 2YS6A 4IMYA 2R7BA 1L3RE 3AC3A 4ZS0A 2R3PA 2VGPA 2W1IA 5ANKA 3V5TA 3UOKA 5JGDA 4PNKA 2CN8A 1W83A 5HI2A 5I9UA 4HW7A 2XIZA 4IHPA 1IOWA 5AUTA 5LVLA 4E4MA 5L8LA 4HR7A 2WTIA 2XAOA 2C6KA 4E4XA 3DU8A 5AIRA 2G9XA 5H3QA 3CQEA 4EJ7A 3HLLA 5FR9A 1JSTA 2Y4PA 4IVCA 3PZEA 3R7UA 1NXKA 4IX4A 4AACA 4C02A 4HYUA 1SCUB 2WTCA 3SOAA 4YJVA 1HOWA 1CS0A 3JY9A 2C5VA 3P08A 2XD4A 4BI1A 2W4JA 4QMXA 3R00A 3ZMMA 3BYOA 4FR4A 3CQUA 5FTOA 3FY2A 5LMBA 5M4CA 2HW6A 4MEDA 5BVOA 3AMAA 3KN5A 4FU0A 3V6RA 4IX5A 1J91A 4C4EA 2VRXA 4IC7A 2I0YA 4EBVA 5IF1A 4RX9A 5HBHA 4CEGA 5EYCA 4HN2A 2G2HA 1KV1A 4DGLC 2CNVA 3MFSA 2J0MB 2GNIA 4NM0A 4AZTA 4WHXA 5CXZA 4AT5A 4LDTA 4RC3A 5A6NA 3FJQE 2X6EA 3I7BA 4F9CA 2P55A 4I0SA 4A07A 4FFOA 1M0WA 3BEGA 4G31A 5HD7A 4AQKA 3QUEA 4IIRA 5D12A 2QOQA 2A27A 3FQEA 3UNJA 4DYMA 4AXFA 2OWOA 2X7OA 3UO5A 4MV6A 4YBZB 1MRUA 3F3WA 3WI6A 2JDTA 3WF9A 3ZFMA 4DHJA 4E20A 4E4LA 1YW2A 1KE8A 1JKJB 4U6RA 5KMLA 3K5UA 4DA5A 4F9WA 1OGYA 2XNOA 1WCCA 3KK8A 2PMOX 3NYXA 2XEYA 3QRTA 3C0IA 3TKIA 1UC9A 1CKIA 3Q04A 4MK0A 3LKMA 4C62A 1QPDA 4O0YA 4IC8A 2YITA 4PTGA 3O23A 1RE8A 5BWVA 3LCTA 4R3PA 2R3QA 2PTKA 3W2QA 3BLRA 3FKNA 3I1AA 3LLTA 4AGDA 4ZMFA 2EJ3A 5HGIA 4ARKA 4D58A 3QUPA 3MH2A 3WE8A 2YCSA 3UZTA 3AC8A 5AUZA 4PZ7A 2BAQA 4CMTA 3W1FA 1XWSA 2VTAA 5LCJA 4XRLA 3R9RA 1IYDA 2PBZA 3VOTA 1VS0A 4B7TA 2VX3A 1W98A 3B2TA 3OMVA 3BX5A 2WFYA 4K1BA 1LPUA 1TQIA 5A9UA 4IWPA 5C8YF 1YXVA 2NRYA 3SKCA 1BXRA 2V7OA 2RL5A 4UCRA 2WNTA 5DGZA 4IX3A 5DT3A 4J71A 2J9GA 1XKKA 3H0YA 3RUPA 4C5BA 3DNDA 4CTCA 4EG0A 2IW9A 3SAYA 4IZOA 3D83A 2OW3A 3EH9A 2UW7A 4GRBA 2R0UA 3KY2A 4XNEA 3MA6A 2VQDA 3BI6A 2CDZA 2ERKA 2GCDA 2JFMA 4QDEA 5AV0A 4FSTA 3KMMA 3SQQA 5CSPA 4J97A 3MVLA 4QNAA 1OL1A 3DK6A 3ZSIA 4ERKA 4CNHA 5IQDA 1TVOA 3WNZA 4EL9A 4RLLA 3TJDA 4O21A 3ET7A 3PFYA 2DIKA 3C4CA 1ZYSA 2YISA 4C2VA 3KFAA 4I5MA 4CCUA 3ORIA 3QZGA 3NVKI 3SVVA 4FTJA 2ITUA 1Y8YA 3CLYA 1RJBA 3OBJA 4QYYA 5AP5A 1I1MA 1WR2A 1XH5A 2P0AA 3IGOA 4FEXA 4IEBA 3ORQA 2J5EA 5LWMA 1JNKA 2W1GA 2B9HA 3AKKA 3ALNA 2IZTA 2VWZA 4N6YA 5EI2A 3JSLA 5CALA 2YDJA 3GC9A 2QOBA 4I1ZA 3F5UA 3OWKA 4U8ZA 4MNFA 3B8QA 4TNBA 4IB5A 3WYXA 4FV6A 5DR9A 1XBBA 2F57A 2VX0A 4H58A 5HHWA 3W33A 2E9PA 5EKOA 3HBLA 3K5IA 1OGUA 4RJ5A 2WKMA 4IWYA 4LI5A 4NZWB 1ET0A 4FJVA 5BWRA 5AM7A 3VHKA 4JIAA 1NT2A 4FKQA 2R84A 4H3QA 2DZDA 5ETCA 2QODA 4ZEGA 3QHWA 5LQFA 2REIA 3ALOA 4QYGA 3GJXB 3ETJA 2X81A 3MFTA 2VX1A 4AW2A 3HA6A 1H07A 5JQGF 4MA0A 2BCJA 5CENA 3R5HA 4K11A 3KRJA 3ORMA 3DJ7A 4O2ZA 3CPCA 5DR6A 2R0IA 3W18A 1VBHA 2Q2UA 3I79A 4RX8A 1XR1A 2Y9QA 1GIHA 3F2NA 4LRKA 2F9GA 4DH5A 2XAMA 2ZFYA 4XP2A 1PMVA 4L00A 5BMMA 4EC9A 2OGVA 2FA2A 2WMAA 2XIYA 4DLIA 2IZRA 5EH0A 4C37A 2ESMA 5C4KA 5HLNA 4EOPA 2OZAA 4ACCA 2B53A 4BIDA