1A48A

Saicar synthase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
305
structure length
298
Chain Sequence
b'SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
publication title The structure of SAICAR synthase: an enzyme in the de novo pathway of purine nucleotide biosynthesis.
pubmed doi rcsb
molecule tags Atp binding protein
total genus 97
structure length 298
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 1998-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1a48A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1a48A02
2ZYBA 3GOKA 5ITAA 4HNTA 4O84A 1Q8ZA 4ACGA 4BIDA 1CKIA 3WO1A 4FFLA 3O7LD 2R3FA 5FEQA 4C59A 3MI9A 3PY3A 1OKWA 3RVGA 2VTLA 4FIEA 4AGUA 2OJ9A 2NRUA 1PXMA 2BTSA 4HGLA 3SXFA 4C33A 4FFPA 4H3BA 1YWNA 2IVVA 1KE6A 3BRBA 1V0OA 4FTTA 1OL7A 5DT4A 1WVYA 4BBFA 4BDCA 2XZSA 4IEBA 2XK6A 5C4LA 2IVUA 4GFOA 1H0WA 2V22A 3OBGA 3UNZA 3W55A 3ZS5A 1KE9A 1SVEA 2QVSE 2GDOA 1E4EA 1V0BA 4LV5A 1LP4A 3TZ8A 5CVHA 4EKKA 1M52A 3TNHA 3VO3A 4O0UA 2PVKA 3GGFA 5JGBA 4GW8A 1PY5A 5L8KA 4D58A 4PDPA 1U46A 4PL3A 2X0SA 4O22A 1JSTA 2F2CB 2WMAA 3DTCA 1YXVA 4J71A 1MQ4A 4LFIA 4A9UA 4JL9A 4QMMA 3VS6A 4E93A 2BZJA 4R1VA 4O7SA 3VJOA 2PSQA 4BDBA 3WF7A 5IPJA 1VYWA 1YW2A 3C5UA 3EH9A 2RG6A 2CNVA 4EK5A 2CKPA 4UBAA 4ZTSA 3LJ0A 5KBRA 1LEWA 3ID6C 4RZWA 3ODZX 3EL8A 4OTRA 3MESA 4FNXA 5TT7A 1AUVA 3TW6A 4EOSA 3UP2A 2CPKE 4CFXA 2NRYA 3HKOA 4BDGA 2BAQA 3KAJA 1OB3A 1TKIA 2BIKB 4YJRA 1MRUA 3DJ7A 3QTRA 3W16A 3SVVA 4ALUA 3JZIA 2YL2A 2R3KA 1IA9A 3PJ1A 3RI1A 2QR7A 1GGOA 3Q32A 3ZFXA 2YAAA 4JBQA 3PPKA 4ZP5A 1H00A 2VZ6A 3L1SA 3CKXA 4FC0A 3R5XA 5FDPA 3ATSA 4IHPA 5CQWA 2WMVA 4JOAA 5CU2A 2ETKA 3GQIA 4ME6A 4FTAA 3WARA 2R3QA 4AX8A 3A7GA 1URWA 2BIYA 2ITTA 2I0EA 5KKRB 1Q8YA 1OL2A 2QONA 1JKKA 3G2FA 5ETFA 4QMUA 5JFVA 3FEGA 1H07A 4FT5A 2WELA 4C4IA 4MWIA 3AX6A 2CDZA 3WNZA 1JNKA 1YI4A 4QYYA 4CMOA 2CCHA 1QL6A 1OMWA 2QO7A 5E90A 3D94A 3G9NA 4F64A 5HBRB 1M14A 3E88A 3Q5IA 3FYKX 4FZDB 3U6HA 3ZONA 1OVEA 3FBVA 2CGXA 4QMSA 5CY3A 4RZQA 2WTCA 5M51A 4UZHA 1Q24A 4G1WA 3E92A 4I21A 1IG1A 4WNMA 4CFFA 1B6CB 4E4MA 4YAJB 3HVCA 2BHEA 3HAMA 4IJ9A 4O6EA 3GBZA 2I0YA 1UVRA 3GENA 4O7VA 5CF5A 3OS3A 3GC7A 4NW6A 4D9UA 1IAJA 3TNQB 5HCZA 3MY1A 4L01A 2VD5A 5IA0A 4QO9A 3LCDA 4IW0A 4Y95A 3LVPA 4BCNA 2RFSA 5CEPA 4CG8A 4F1TA 4TTHB 3BU6A 2W06A 3P9JA 4PF4A 3HA8A 3G15A 3ZFMA 4M12A 1M7NA 2GHGA 2R3HA 1ZLTA 5DE2A 3F82A 3CPBA 4X3FA 4AS0A 5HZNA 3DQXA 1JDBB 2R9SA 2Y8OA 3C9WA 4G6NA 5ICPA 4QYEA 3DLSA 3ORNA 4A07A 4E4TA 3OXIA 4D0XA 3QC4A 3I5ZA 4ZI7F 3ZDIA 2BPMA 2ZDQA 3MJ2A 4LI5A 3RCDA 4U8ZA 4TRLA 4CMTA 4DGOA 4XRLA 2WKMA 4WHZA 3BG5A 3LW0A 4LRJA 3UQGA 1CM8A 2JKMA 2PVHA 4BN1A 4DGMA 4FA2A 5CSHA 1CKPA 2PUIA 3NX8A 2IW9A 3PA5A 3AC2A 4RJ7A 5HG5A 1JBPE 1QPJA 3FL4A 3QRTA 4IAFA 1Y8YA 1IEPA 3H9RA 2IP4A 5H8GA 5BVEA 1IOVA 3I0QA 3PXYA 5BVWA 2VX1A 4R5SA 3SV0A 2ETRA 5AIRA 4KABA 4KBKA 3OCSA 4EJ7A 4RVKA 5I9YA 2CMWA 3HECA 4F7SA 2P4IA 4IVDA 5CVGA 5D41A 4ZTQA 1WVWA 1XH5A 4G3GA 4H1MA 3A7JA 2WMUA 1YWVA 3RPSA 2J50A 5DFPA 2OXYA 4GK2A 3LZBA 3NYOA 5BMSA 4IX3A 1GZOA 4TWOA 2R7KA 4I55F 1VEBA 4ORKA 4F4PA 5K9IA 4KBCA 3R21A 4YZ9A 5M55A 2W71A 2YM3A 2P33A 4MA0A 2PVMA 4IAYA 4UWYA 5E8YA 3VA7A 1XBBA 3DK3A 5D10A 5IUIA 4YSJA 3IDBA 1DIKA 2RGPA 3DFAA 4RWJA 4W8DA 3MSSA 4IMYA 4DFZE 4DCAA 3AOXA 4RIXA 4X3FB 2Y6MA 3SOCA 3VF9A 4YBZB 2NNWB 4JDJA 3V4ZA 3R9NA 3QQKA 3WYXA 2HXLA 3LHJA 4ASXA 4YTCA 4RJ5A 2CZGA 4FKWA 2XBJA 3N4VA 3QQHA 3O2MA 4JBOA 1UU7A 4JS8A 4TWPA 3UIBA 1GIHA 5KKRC 5L6OA 5AUZA 2QODA 2GPWA 4FV6A 5M09A 1R39A 4M9UA 2C6EA 3PXRA 3ZM9A 5B2KA 2ZDTA 2O8YA 4I94A 4F0IA 2IZRA 4JR7A 3ZH8A 4FV2A 4AZWA 5HQ0A 2QLQA 2ITYA 2A0CX 2YM6A 5J9LA 5H8EA 1FOTA 3HV6A 5FXSA 1IAHA 3LOKA 1TQMA 2JAVA 4FV1A 5F1ZA 4MF1A 5FEEA 3UIUA 5L2TA 3ZEPA 3QXPA 1PK8A 3QL8A 3UODA 4HCVA 3ZXZA 4CMUA 4LYNA 2WEVA 4HNVA 3TNWA 4NM0A 2XKCA 1OPKA 4AZFA 2PU8A 2GNJA 3RWQA 4NFMA 3VS4A 1H1SA 3C0IA 3H4JA 5BYYA 3BYUA 4MV6A 3BHVA 4GK4A 3T9TA 1QPDA 3CY3A 4AT5A 4I93A 4DG3E 4HGTA 4FU0A 3ZMMA 3HB9A 5C8KA 2YM5A 3EOCA 3Q9ZA 3PE1A 1H1QA 3QRIA 3C51A 5EM6A 5H8BA 4YHTA 3VUDA 3GT8A 4PNKA 2ZAZA 4C4JA 4XJ0A 1PXJA 2PE0A 4HNFA 5CZIA 4RIXB 3MA6A 3PPJA 3LXNA 4V05A 3F5GA 5AM6A 4I6BA 4FKVA 3TCPA 2UZUE 3VRZA 2W6QA 4C5BA 1KC7A 4YJPA 1P5EA 5HGIA 1M6VA 5LVOA 4QP8A 2ITOA 5IH6A 3VF8A 4RT7A 2J9GA 2XVDA 4OUCA 3C4WA 1ZYDA 3RTPA 4J98A 2CGWA 5HD7A 4ZSLA 4ZS4A 5GJFA 4L8MA 3EFJA 3GU6A 4YJUA 4S34A 4ACDA 1JKSA 2BHHA 4FOBA 2PZIA 4ZY6A 1B6SA 2XNMA 4O86A 1Z9XA 1GIIA 2R0UA 4J96A 2X39A 4IVAA 4EWQA 1EZ1A 4KUJA 2G15A 4I41A 5FP6A 3IOPA 3U9NA 5BMMA 4YZMA 4QP7A 4HVIA 1AD5A 2C3JA 4QP3A 2PZ5A 4I0TA 1GAGA 4DINA 4NCTA 1K9AA 1H27A 4DH3A 2AUHA 4YB8B 3HUCA 2YFXA 5FP5A 2HENA 2VTRA 5HCYA 3TJDA 2HY81 3BQRA 2A27A 3LM5A 3A7HA 3QF9A 4BZDA 3MFUA 4E5WA 4EOPA 2XEYA 3NGAA 2BDJA 2ITPA 4PDYA 1W98A 4ZJIA 3LCSA 2W6ZA 4TPTA 4YJNA 4E4NA 5A4QA 2ZDHA 2WMRA 3ZBXA 4ZAUA 2B7AA 3NDMA 2BDFA 4O96A 4IC7A 5EOBA 3R73A 3FKNA 2P2IA 3GCVA 1ZMVA 4OTWA 1J7IA 4BIBA 4EH9A 4Q9SA 1U54A 4ZIMA 1SCUB 2WFYA 3MWDA 5EHLA 5CU4A 4U80A 3ZUUA 1LPUA 4FTLA 4XV1A 4N6ZA 3PIYA 1QPCA 5BNJA 3DY7A 2UUEA 3P5KA 2UZDA 1ZWSA 4QTEA 4E6CA 3S00A 5FLFA 5CAUA 3I7CA 5D7VA 5EW9A 4BHZA 4PDSA 2BKZA 2C3LA 3VC4A 3UVQA 3ZSIA 4BYIA 3K5HA 2QR8A 2Y4IB 4JBVA 4RIYA 4F70A 5I9VA 3BU5A 3HV4A 2YCRA 3HMIA 3BGPA 5CEQA 1EUCB 2OKRA 2F7ZE 3CLYA 2AC5A 3FZOA 1GSAA 3BHTA 5HKMA 4YC8A 4O0WA 3I60A 4DYMA 3QWKA 2VTOA 4ONAA 3DBDA 4G17A 5DN3A 5DR2A 4KBAA 5HG9A 3MPTA 3VUIA 5JMSA 4YJ3F 1F0QA 3WZKA 3RK7A 4YU2A 5EYCA 4MAMA 3L8PA 3EQRA 3TTJA 1T46A 2R3PA 4EHVA 5LCKA 5A4TA 1H1RA 3FLSA 2WD1A 2CSNA 1SZMA 2H34A 2VAGA 1M2RA 3TZMA 3FKLA 5LA6F 2NU9B 2BRHA 3LFFA 1UKIA 2A2AA 4TY1A 5FEDA 4DFBA 4OT6A 2V7OA 5JFXA 3IDPA 3ET7A 3V5JA 4OBQA 4PWNA 1KE8A 3OZ6A 3MVJA 3R7OA 4QMTA 4UWBA 5DVRA 4B9DA 3E5AA 2PMIA 3FE3A 5HIBA 5CF6A 5LQFA 1I7LA 3VHEA 2NU7B 2XF0A 4APCA 3CC6A 1Y8GA 4Z55A 3C0HA 3DB8A 3OOGA 2UW9A 4MA5A 2W1FA 4FEVA 5LOVF 4WNKA 3RFCA 4NSTA 1REJA 3TV4A 4GU6A 1XWSA 3QTWA 2X7GA 5I4NA 5HLWA 2PZPA 4R6VA 3EIDA 3OTVA 5CNOA 4ANQA 1Z2NX 4JBPA 2WMQA 1FMKA 2PMLX 4HJOA 4X2JA 5M56A 5HICA 3ZOSA 3LP8A 2EB3A 3KMWA 2PVFA 4DTAA 4KD1A 3BYOA 4FFOA 2GMXA 4IAIA 3RHXA 2UZVA 5M08A 2XNBA 3EZRA 4APPA 4EOQA 2OGVA 1DI8A 3KMMA 2HZNA 4RX9A 2XEZA 3U8WA 2R87A 3A8XA 3BBTB 3UOKA 1OKZA 4Z7HA 2PYWA 2G9XA 3N4UA 2OH4A 2WO6A 1SNXA 2RG5A 4GVAA 2WMBA 3V5QA 2VTPA 3FQSA 4AZVA 3KMUA 2P3GX 1DV2A 4I5PA 4FVQA 2Z04A 2ZMCA 3I5NA 2FB8A 4P5QA 4D9TA 5IH5A 3C13A 3R04A 1TQPA 3NYVA 3HMMA 3FLZA 2UZBA 4AA5A 3ALOA 3ANRA 5HI2A 5J9ZA 2CN8A 3VUHA 3FMLA 1XH9A 3PVWA 4FE2A 3BHHA 1Q8UA 3LLAA 4QPAA 4U3YA 3R8ZA 4Y8VB 1X8BA 3EN7A 4PP9A 3RP9A 3K5IA 5C4KA 3LCKA 4O2ZA 3EL7A 3R8VA 4WBOA 4M15A 3SXSA 2EB2A 5IZFA 4K77A 2GLTA 4C36A 5T68A 3P7BA 4RVLA 3V5PA 3TQTA 4G31A 4ZMFA 3FHIA 1R3CA 4Y85A 3COMA 1YI3A 2LGCA 4QP1A 4AZTA 3R23A 3CCNA 2VTQA 4AU8A 3FXZA 5CX9A 4C34A 3BYMA 2ZOQA 3DT1A 2W05A 2CNQA 3LE6A 3QKLA 2QKWB 4L42A 5IA5A 1PMVA 5E92A 1PMEA 3Q60A 3DBFA 2X8DA 3QTIA 3D7TA 3AT4A 4I5CA 2WTWA 2X6DA 4GKIA 1JVPP 3B8QA 5C27A 4HQ6A 4FL3A 4RMZA 4FSZA 3E63A 4AG8A 2Y4IC 4AGWA 4N57A 3W1FA 3W2RA 4O4JF 4QYHA 4XV3A 3MTLA 2W6OA 3VBQA 2CNUA 4XMOA 2GSFA 3WI6A 3CD8A 3NAXA 3JY0A 4U9AA 4USDA 3ACKA 3Q9WA 5AV3A 5CENA 2V5AA 4TNBA 4V0GA 1VYZA 2FUMA 3ZTXA 3DV3A 3CKWA 3FI4A 4GIIA 4R1YA 3WOWA 4DEHA 5AA9A 3C4ZA 3U55A 3OW4A 2HW7A 3QD3A 4HZSA 3FPQA 5IEXA 3NNXA 3DQWA 3ELJA 3F3TA 1W0XC 3PE2A 5AUXA 4YGAA 3UMXA 3ZLWA 1PX2A 2B1PA 4FKGA 5E8TA 1YXUA 2X2KA 3DU8A 5GJGA 4FFRA 2W1HA 4C35A 3QQFA 2HELA 3KY2A 5FRIA 3Q3BA 4Z9LA 2QHNA 3RV3A 1OM1A 3C1XA 3TNPC 2ITZA 4CCBA 5J5SA 5J1WA 4KSQA 4BCQA 1ZYCA 2YZLA 4EK6A 1VKZA 5EDQA 2C1AA 3Q9YA 4MNEB 2IZUA 3IGOA 2R84A 2JDRA 1IR3A 1JKTA 3F6XA 2BDWA 4U45A 3V5WA 5AP0A 3ORMA 1AGWA 4XYFA 3RAWA 5B2LA 4FV5A 3RAKA 1B39A 4QOXA 3U9TA 4BRXA 2JDVA 3MVMA 5DR6A 1YRPA 4J1RA 3EQCA 3I6UA 2EXCX 3V04A 3RALA 2QK4A 4TV8F 3TJCA 4EH6A 4D4SA 3IOKA 3P08A 1TVOA 4QMQA 3O8PA 5CZHA 5GNKA 4UY9A 3FI2A 5LP6F 3WBLA 3W18A 1FVRA 2WOTA 2PMNX 5KMLA 4XCUA 4CTCA 5JN2A 4BBMA 1ULZA 2C5OA 4JDHA 4TN6A 2HZ0A 3C0GA 1R78A 2BILB 4J8NA 4UXQA 2BZIB 3PXFA 4USFA 5HHWA 5HORA 3I79A 3AC4A 4MCVA 4JIKA 4I6QA 2ERKA 4U7ZA 3KU2A 3OWPA 3U4WA 3NR9A 4MXOA 2P2HA 4USEA 3E3BX 5LXTF 4CLIA 2YDJA 3RKBA 1MQBA 3R7UA 2CGVA 3F69A 1U59A 4BDAA 1BYGA 4G5PA 4E7WA 5AV4A 2FP4B 1PF8A 3H10A 2GNFA 4GVJA 3TZ7A 1FVVA 3TZ9A 2HW6A 5C8NA 3MYGA 4DC2A 3VW8A 1GZ8A 3CY2A 4QTCA 3UYTA 1QPEA 3QAME 1YVJA 3NSZA 5LCJA 4XX9A 4B6LA 3ZLYA 4GS6A 4QMVA 4ERWA 3IW8A 1KV2A 4IZ7A 4C0TA 2CKOA 4OTHA 4L00A 4CZTA 3CGOA 4XG9A 3WF6A 2J6MA 4PV0A 3ZO3A 4UYAA 2PWLA 2B4SB 3R8LA 1KJJA 2ZJWA 2ZV2A 5HG8A 3TL8A 2YJRA 4L67A 3ZEWA 4G5JA 4YJQA 1R1WA 4GYGA 4FG8A 5LMAA 1KOBA 4WIHA 5HU9A 3GQLA 1OI9A 4RFMA 4EYMA 1OBGA 4AFEA 4AN2A 3Q96A 3UG1A 2R3LA 4J53A 1KV1A 3P79A 5I9UA 4C4EA 1MP8A 2GPSA 4IIJF 3LM0A 3BI6A 4FT3A 3MH3A 4TWCA 4MBIA 3KA0A 3CP9A 3ORPA 5ETIA 3ROCA 1ZOHA 4C5CA 2QCSA 2PK9A 3QC9A 3EKKA 1M0WA 1U4DA 2GQGA 3QRUA 1Z5MA 4DFUA 3EQDA 3UZRA 1Q5KA 3F3ZA 4FT9A 4GMYA 5KO1A 4OTFA 3ZO4A 4O6LA 3AMAA 3MDYA 2BRBA 3DB6A 4MD8E 2FO0A 2OIBA 4CFUA 5LVLA 2BMCA 2XMYA 4HNIA 4R77A 4DG2E 5CA0F 4IWDA 4XLVA 2OXXA 5C01A 4FR4A 2C47A 1Q41A 4FZ7A 3R7IA 4A06A 1KJIA 4HNUA 1JLUE 3QUDA 2OJIA 4IB0A 4XUFA 3VBTA 2YISA 3H30A 3BYSA 4H3QA 3UNJA 4ANSA 4D1XA 1UNGA 5CVFA 3PXKA 2R4BA 4F99A 4XX0B 2W4KA 3LFEA 4I92A 4BCJA 4EC9A 2Z7QA 4JDKA 4FV7A 2BAJA 3QHRA 4RA5A 3GXLA 4V04A 3QWJA 3VUGA 4QP9A 4FEWA 3TKHA 2CLXA 1DM2A 3VS0A 4YTFA 4ZSAA 1T36A 5EZYF 1CKJA 4DH8A 2WMTA 2HK5A 3CPCA 3ANQA 3PJ8A 4HGSA 1DS5A 4IAAA 2CN5A 1NXKA 4JAIA 3WZDA 1AUXA 1Z2PX 4L1KA 2BR1A 3R2BA 1A9XA 5JZJA 4HW7A 2VTJA 4RG0A 4GIHA 2YJSA 2WHBA 1OUKA 1H01A 5HV6A 5LMKC 4RC4A 3A8WA 4HYUA 3H0YA 3U6IA 3QA0A 5J8IA 3CTJA 4P90A 4DG0E 4FICA 4BI0A 5IDNA 1F5QA 2CKEA 5C8YF 1ZMWA 5JQWA 3QA8A 3ZZWA 3T3VA 3FMEA 4WRGA 1NVQA 1OIQA 4KINA 4F6UA 4MQ1A 2XNGA 4IX5A 5ANKA 3DBQA 2FSOX 1PXKA 4NT4A 4P5ZA 4E6DA 1W96A 4RFYA 3RNIA 3U4UA 4G3DA 3OHTA 4CCUA 3C50A 4ACMA 4ERKA 3GUBA 4V01A 3H3CA 2NUAB 1G5SA 2XNOA 3Q5ZA 2FVDA 3R8PA 1M2PA 4G16A 4TNDA 2JKOA 5M4FA 4O7NA 4W4XA 4DLIA 4EH5A 1PHKA 1GY3A 4MH7A 4TZRA 2XM9A 2UW5A 5KKNB 2WU7A 4EOLA 3ZSHA 2QLUA 3AC1A 3OG7A 4O38A 3SW7A 3QUPA 2OBJA 5EYMA 4MEDA 1H08A 3I81A 4I0RA 4ASDA 5ACKA 1WBSA 3UVPA 2YZMA 4R3PA 3H9OA 5IH4A 4KS7A 2ZVAA 2Y7JA 2YIYA 2UW3A 4RIOA 4L45A 4TYGA 2QU5A 2J5EA 3DNEA 2PVJA 4O2AF 4MV3A 3N6RA 5KX5F 5CF4A 2VTAA 4L7FA 5M53A 2QOIA 4FK3A 1WAKA 4F6SA 5EI6A 3GVUA 2RFEA 3NLBA 4CKJA 5EYDA 4BB4A 3ROYA 2I8CA 4IQ6A 4L3LA 4EOKA 1VJYA 3I6WA 3LPBA 4HPUE 5KMMA 2OFUA 3UQCA 4LOPA 1H24A 4ENYA 2H9VA 5A3XA 4CTBA 2VWUA 5DOSA 1YXTA 4PTCA 2QF7A 5FGKA 4X21A 5D11A 3LQ8A 3OF0A 3E93A 4R7BA 4W4WA 2X1NA 3KK9A 4EBWA 2QI8A 3GCQA 3IS5A 1MUOA 3IW6A 2ITXA 4S33A 5JQ5A 2GS6A 4MXYA 2R2PA 4FSUA 3ZUTA 5BVOA 4Y72A 2YAKA 4Y5QA 5IA2A 3TIYA 1KE5A 2R3OA 4XH6A 1GIJA 3DCVA 3O23A 4DTBA 4Z7GA 5B7VA 4FSNA 2XCKA 3TWJA 4JXFA 2WQBA 4XOYA 2GNGA 3FC1X 4IAKA 5HTBA 2H6DA 1PMUA 3I7BA 1PXOA 4NW5A 4AZEA 5J9YA 3QGYA 3RK9A 5DRDA 2R0IA 3NUSA 4L44A 4O0XA 3GU5A 3I12A 3NNVA 2A19B 3HAVA 3LIJA 4E8AA 2OF4A 2OXDA 4Q5EA 1E4EB 1XJDA 2Q0BA 4BCMA 4PQNA 1DAYA 2B9IA 3QX4A 3UPZA 5EI2A 3UMWA 3D7ZA 5AWMA 3NVMB 4JQEA 4L43A 3NUAA 4A9TA 3HZTA 3F5XA 3ORZA 3PIZA 3R9RA 2QOHA 2HZ4A 3O96A 4LRMA 2YDIA 3DXNA 2OWBA 4C4GA 4NL0A 4NJDA 1KE7A 2JITA 2V58A 5DEYA 3W8QA 1ZRZA 4YZDA 5ANEA 5HNBA 3ZHPC 4BCGA 4K0YA 2QC6A 2XIYA 5JQGF 4D4VA 4ZZNA 1R0EA 3QYWA 5KX8A 4DBXA 1JSUA 4LL5A 2WMWA 2C0TA 4PMMA 4IDVA 2VTHA 3KRJA 3ODYX 4YJOA 3FHRA 3MV5A 4ZSEA 4EK4A 3F7WA 5L2SA 2XNEA 5BUJA 2VQDA 3DDPA 4EYJA 4CLJA 3MW1A 5BVNA 3U9CA 3PIXA 5J87A 2JFLA 4FZFB 3MS9A 4DH5A 4UWCA 3O17A 1M2QA 3BU3A 4IIRA 1WFCA 4PL4A 4BC6A 3DGKA 5K4IA 4JIAA 4XEYA 1KOAA 2YWVA 2QOLA 2CCIA 3VS2A 2KULA 5DNRA 1RDQE 4C3FA 5T3QA 2I1MA 3WF8A 5CAPA 2E9PA 1XQZA 3LXPA 3MGYA 3FKOA 2E9NA 2JIUA 3L8SA 4JLCA 4E4XA 3V5TA 3HO8A 4I4EA 3OUNB 4X2GA 3ULZA 3F2NA 2RFNA 1CDKA 5IQFA 4M69B 4FT0A 1K3AA 1VZOA 2WTJA 4DEDA 3TUCA 2X4FA 2HZIA 4O2BF 4FIIA 1OZ1A 4MBLA 5AV1A 3O8UA 3EYGA 4BCKA 4ZLZA 4XG2A 5AEPA 4FKLA 4H36A 2V0DA 4FIJA 2XK7A 2ITWA 1PXLA 5A9UA 2JDSA 1IRKA 1S9JA 3JXWA 3E8EA 1FGKA 2JGZA 3PJCA 3Q6WA 4C3RA 5HE2A 4D4RA 5AX3A 4ACCA 2ITNA 1J1CA 3DK7A 5KHXA 1NA7A 4FV3A 2C6KA 3IW7A 5HO8A 2HYYA 3UDBA 4BCFA 5CB4F 5A4CA 2PVLA 4YC6A 5EK7A 5DR9A 4X2KA 4L46A 3PYYA 4KIPA 4O2PA 1O9UA 3PP1A 5TKDA 3UTOA 5LARA 1YDTE 4BCHA 5IQEA 4IACA 3G33A 4IJPA 4HVDA 3ZRKA 4LUEA 4M68A 4AA0A 2WTIA 5C26A 1QMZA 3COIA 3U9SA 4ZLYA 4FNYA 2QOKA 2J0JA 4FTIA 3ZDUA 3O71A 3PVUA 4FKQA 5AMNA 2IPXA 2Y4PA 3HUBA 2UZOA 5HEZA 5DG5A 3SDJA 3LMGA 3VQUA 2R7LA 5BPHA 2ACXA 4QTBA 3FZ1A 5EQEA 5HCXA 4WD5A 3B2WA 4ITJA 3ZSGA 4I24A 4Y46A 3CEKA 3UGCA 3VBWA 4L7SA 2Q83A 4FKTA 4P2KA 3MBLA 1TQIA 4D2RA 3KB7A 4WBBB 1WBTA 2YABA 4IM3A 4PMSA 4RWIA 4IAZA 4AW2A 3ENHA 4DN5A 4Q5HA 2YIQA 2XYUA 3R1YA 4W8EA 4DFYA 2WOUA 4EG0A 4BDKA 2ONLA 1KJQA 3QZHA 4FTOA 4K2RA 3FDNA 5GJDA 1G8AA 3W33A 1PXIA 4UX9A 2J2IB 4NTTA 5HVJA 4Y8DA 2C3KA 2VTTA 5CSWA 4QP6A 5GIOE 2HJWA 4BDIA 2Z60A 2UZEA 3DOGA 5CYIA 3VS7A 5AUTA 1CE8A 2XNNA 5D9HA 4FIFA 4U0IA 4FG9A 2IN6A 1GSHA 4LMUA 4Y73A 4AWIA 4I6FA 1O6KA 2QOBA 4QNYA 4YZNA 4EH3A 4IH8A 5EG3A 2I0HA 3NNUA 4AP7A 5AP6A 4D1ZA 3KKVA 4C2VA 4X0MA 2X9EA 3NYXA 3OTUA 4EQMA 3FLNC 4YPDA 3QYZA 4ANMA 3UYSA 3BHYA 3RAHA 2FPGB 2XIRA 4HGEA 2QQ7A 4O21A 3AXWA 2ITUA 3NS9A 4EWHA 1I09A 4IB1A 3MB7A 4MWHA 1JSVA 2R5TA 5CU3A 5JEBA 3TIIA 4IWPA 2OICA 4I50F 2BROA 2Z7RA 4BTFA 4O4HF 3AT2A 2F9GA 3NAYA 4AXAA 4C58A 3E5NA 3FYJX 3RPOA 1OIYA 1W7HA 5A6OA 4IZ5A 3OCGA 3M1SA 2XH5A 3TNIA 3G90X 1OPJA 3MN3A 2CGUA 4GG7A 3FL5A 4FVPA 3THBA 4DBNA 4FEUA 5AIKA 3KQ7A 5JH6A 4IWQA 2XCHA 4RQVA 4YR8A 3M42A 3L9LA 4KIOA 4XG6A 5ETCA 4F0FA 5KMIA 3CIKA 4X2FA 3GP0A 2W1EA 3EQPA 3HRBA 3SXRA 4RRVA 3MA3A 3W10A 3PP0A 4GJ3A 5KE0A 4FSRA 2QO2A 3U87A 4FK6A 4X6QC 4P4CA 1OGUA 2VWVA 2JKKA 1EHIA 3G9LX 3OWJA 3VN9A 3FPMA 4TYIA 3RM6A 4JX7A 5BQ0A 4FYNA 2PZRA 3G8DA 4YJ2F 3KXHA 4ZTLA 3TI1A 3EN9A 4IFGA 4RIWA 3DS6A 1YHVA 5GHVA 4J8MA 4GT3A 4IZAA 2O63A 4QTAA 4AGDA 5BVDA 5IUGA 3P78A 4NYEA 1OUYA 1Y6AA 2QNJA 5CSPA 3QZGA 2E9UA 4DH1A 1JKLA 3UFXB 1JOWB 4CKIA 3EB0A 3DBCA 5C9CA 3R2YA 4NFNA 4U41A 3TN8A 3NW6A 5JSMA 4XBRA 5CQUA 1YKRA 2FA2A 2C6IA 4KA3A 4FV9A 3WE8A 3IECA 2W7XA 3ETJA 4U42A 3IO7A 4NWMA 4EKLA 4OTDA 4EHZA 3EQGA 3FI3A 3ZYAA 3U54A 3UOLA 2DWBA 2W4JA 3ZFYA 2XBAA 3AD5A 3WE4A 3UZTA 2GFCA 1CQJB 3QFFA 2RFDA 5EM7A 4AQCA 5CXHA 3W2OA 5AP3A 1BX6A 2B54A 1PMNA 2R3MA 3T3UA 4C62A 4X7QA 3RPVA 3UO5A 5CALA 2OO8X 4D4YA 2VWZA 1JPAA 4NU1A 2YZGA 4C4HA 3LMHA 2VWXA 3B8RA 3SLSA 5KHWA 4ID7A 3G8CA 3K3IA 4J7BA 3BGQA 2JLDA 2HAKA 3JY9A 3SC1A 1YOLA 4JG7A 3DDQA 2J5FA 4UEUA 2B9HA 1Y6BA 1XH6A 4OLIA 2XYNA 3BZ3A 3FQEA 3CR0A 3NCGA 3R5FA 3DXQA 3EKNA 4X3FC 2R64A 4W4YA 1BKXA 2NO3A 4S31A 5JK3A 4DEIA 4WG3A 2E2BA 3HV3A 3KXGA 3P4KA 2C3IB 2OLSA 3QZIA 1RE8A 2PY3A 2XK3A 3W2QA 3P0MA 3FLYA 3KXZA 4TWNA 3R1NA 1DI9A 2B55A 3HMOA 2YHVA 2YIRA 3HRCA 3NUYA 1CSNA 1Q99A 4RIWB 4MTAA 4MK0A 3S95A 1BI8A 4PX6A 3N4TA 4DITA 2W9ZB 2JIIA 4OW8A 3PZHA 4WUAA 4RJ6A 5HLNA 4O7LA 5DBXA 5H2UA 2OFVA 4C2WA 5AA8A 3PZEA 3PRIA 4DEGA 4QMZA 1BXRA 4F9BA 4XYLB 4BICA 2UW6A 4G3FA 4YSMA 4C4FA 2GCDA 4CVAA 5HBJA 2SCUB 2FB9A 4H1JA 4EHGA 2R3RA 5IG1A 3VW6A 3Q4ZA 3NUXA 4FG7A 3UPXA 3P23A 4DCEA 3RGFA 3C4FA 3HEGA 2YCFA 3F66A 3QQJA 4K11A 4MD9E 3BLHA 4ZTHA 2V55A 2RF9A 4AAAA 4JX3A 4EBVA 4F9AA 2V62A 3OMVA 4KB8A 3LFAA 5HTCA 1XKKA 4NJ3A 1U54B 3ORLA 2EU9A 2W1ZA 3H0ZA 2JD5A 3P1AA 4LRKA 4MX9A 1ZYJA 4WO5A 5IEVA 1GZKA 1OL5A 5E8UA 4N0SA 1UWJA 1K2PA 4AF3A 1YDSE 4ALVA 3G6GA 5HX6A 3ALNA 3A4PA 1STCE 2R7NA 3P7CA 5FBOA 4HYSA 5K5NA 4AT4A 4TYHA 2P55A 5DA3A 1FVTA 2W17A 1WMKA 3ZBFA 4A7CA 3W2CA 5HNIX 2YS7A 3IQ7A 4Z3VA 1GJOA 4RIYB 3IONA 4XG7A 4CRSA 4PNIA 4I1ZA 4Y83A 4FX3A 4ITIA 4KKGA 4RA4A 3TEIA 3CQEA 4GRBA 1SYKA 4ZOGA 4M97A 5CI6A 5GONF 5IMEA 2QO9A 4MAOA 2QOFA 4FSMA 1P4FA 1C30A 4TV9F 3DF7A 2IW8A 2OW3A 4B4LA 5IQGA 3F3VA 5DGZA 5L6WL 3PVBA 1NY3A 5KZ0A 3HP5A 1REKA 3O0GA 3VVHA 3R9DA 1IASA 1OITA 1T45A 5FM3A 4HPTE 4WNPA 4BCIA 5M44A 4PTGA 4TKSA 3SW4A 4DF3A 1CMKE 2ZM3A 4B7TA 2WZJA 1H1PA 4IDTA 4PMPA 5LXMA 2A4LA 3OT8A 3R02A 3PY1A 2NPQA 3T9IA 4D5HA 4YTIA 4CKRA 1P14A 2OJJA 3SE7A 5IA1A 3A7IA 3LQ5A 4PTEA 3ZU7A 3MIAA 5CSVA 4AOJA 4DH7A 5K4JA 4FKOA 4E20A 3ZLSA 2V5QA 4QMLA 5IA4A 4O83A 5A4EA 2GTNA 1SVHA 3DKFA 3JVSA 3D83A 4LM5A 4FKIA 3G0EA 4P7EA 1Y91A 4JT3A 4KAOA 5EM5A 2VPQA 3EYHA 4YJVA 1IOWA 1SMHA 2R7BA 5FUTA 3KGAA 2O0UA 2VTNA 4XG4A 3L9MA 1CS0A 1Q97A 2IVTA 3HLLA 4IX4A 4K6ZA 3LCOA 3JUHA 3PG3A 5EHOA 4QTDA 4EHEA 4R7HA 1Q3WA 2PPQA 3Q2MA 5I5ZA 2GHLA 2BRNA 3HL7A 4TT7A 4BTJA 3QLFA 4DTKA 4EONA 4QQTA 3GC9A 3HDMA 3V5LA 4EK8A 3SX9A 4DHFA 5C8MA 5J2TF 4YZBA 3MPAA 3FXWA 3RUPA 2PBZA 4EI4A 1BL6A 3D2IA 4RC3A 1XBAA 3RINA 2XK4A 2YACA 3WF5A 3UNKA 3KN6A 1Q8TA 3NW5A 3E87A 4BGQA 1XH4A 3JRWA 4R7IA 1EYZA 5FNVF 1PW2A 1WZYA 4QMPA 3UIMA 4QP2A 5FBNC 1HOWA 4RJ4A 4CZUA 4EOOA 4OGRA 2R7MA 4C61A 4XBUA 2G01A 4F7JA 4QQJA 3LKMA 2W99B 5EM8A 2BKKA 2PE2A 4FEXA 1V0PA 2W9FB 3FY0A 4MKCA 4DFXE 4E6QA 5M57A 1ZOGA 4NCTC 3BEAA 1G8SA 3GU7A 3ZZEA 3E8DA 3UC4A 3W2PA 4ZZMA 3COHA 3WIKA 3FZSA 3EFKA 4R3RA 4S2ZA 3ZXTA 4E1ZA 3UZPA 2C5XA 4I3ZA 5BUEA 4XS2A 2VGOA 5L3AA 5J2UF 4L3JA 3NUNA 3VS1A 2JIVA 5CT7A 5L6PA 4QMXA 2JDTA 1O6LA 3PPZA 3HMNA 3RPRA 2YEXA 2YCSA 3E64A 4BTKA 4EH8A 3FV8A 3SAYA 3NYNA 4BR3A 3DFCB 3MFSA 4UXLA 4G6OA 2FH9A 3MFRA 3WZJA 2VWIA 5CF8A 1RQQA 2FSLX 3K5VA 2Z7SA 4N6YA 3SOAA 4CXAA 4D2SA 5HVYA 2PUPA 2SRCA 3NUUA 4YHFA 5A14A 1ZXEA 2J51A 3FZPA 5BVKA 4CQEA 4FTRA 2HIWA 2BZKB 4M14A 3Q4CA 3T8OA 2HXQA 2ZB0A 3D7TB 5I9ZA 2Z02A 4I4FA 2X6EA 1GNGA 1YI6A 5C1PA 4FKPA 3GFWA 3R22A 2GNHA 3GFEA 4ALWA 4R3CA 4DEAA 3AMBA 5DRBA 1UNLA 4EJNA 3KREA 4L53A 1BMKA 4Z16A 2VR1A 5ACBC 4KIQA 5LWMA 4V0GB 1WBOA 3QXOA 4GT5A 5CU0A 4AFJA 2C0OA 4ZJVA 3QTUA 4RBLA 4YZCA 4GG5A 1KBLA 3CXWA 3ORIA 5B2MA 3IGGA 4ZEGA 3P86A 2F7EE 1APME 5DYJA 2P0AA 2F4JA 4DEEA 3ZRMA 5K5XA 3MH2A 2W6NA 4XP0A 4CV9A 3E8CA 4FGBA 4CT2A 4IX6A 3H9FA 4AE6A 3UG2A 4E26A 5DMXA 4O0TA 2X2LA 3MTFA 3M11A 3OXTA 1PYEA 3QCSA 3R0TA 2YW2A 3QQUA 4QQCA 1M7QA 4II5A 3UQFA 1JWHA 4YC3A 5D1JA 4WT6A 2UZLA 3HV5A 2ZDUA 4OBOA 5D8DA 4AGCA 3FMKA 4D5KA 3BYVA 4D1SA 3OBJA 1E1VA 2IO6A 2UW0A 3AGLA 4ACHA 4GT4A 3TKUA 3QCXA 4XRJA 3ZM4A 5M4IA 3LFNA 2YZAA 2OG8A 3EN6A 1PKGA 3RWPA 4EQUA 3SRVA 5IU2A 5JVLA 3ZRLA 3D15A 2VTSA 1ZARA 3A62A 2KTYA 4ZMEA 3B2TA 2V59A 3WF9A 5F4NA 3BEGA 1Q62A 2BZHB 3C4CA 4OR5A 2ITQA 3HMPA 4U79A 2C4GA 2YDKA 4FZAB 5ANDA 5EFQA 1WBNA 3HX4A 3KL8A 2YZNA 1OKYA 2G2IA 2HY0A 3BGZA 3MH0A 5EQPA 3PSCA 3WO0A 2Z2WA 2ZM1A 3CJGA 3FI8A 4JAJA 2FPIB 4FTMA 3CTHA 4C02A 3D4QA 3PJ2A 2WIHA 5D12A 1PXNA 4LGHA 3V01A 2ESMA 3QLGA 2VX0A 2UW7A 4QYFA 1XO2B 1JKJB 5F9EA 2B0QA 3KAKA 4ARKA 3UP7A 2X7OA 3VUMA 1FBNA 4UN0C 2VNWA 3F61A 4U6RA 2R3IA 2W1GA 3I0OA 3BCEA 4AOIA 4DIMA 5CXZA 3KF7A 3KRWA 3V4SA 1YDRE 3TV7A 5KUPA 4A4OA 3NCZA 4RQKA 3NMUF 4QRCA 2BAKA 3R30A 3TUDA 3L8VA 1NW1A 4X2NA 2VN9A 3OEZA 4GJ2A 3GC8A 5DT3A 2DS1A 4KKEA 5DI1A 3QKKA 2YM7A 5C1OA 3IKAA 4FT7A 1ZAOA 1P2AA 3Q9XA 4S32A 1B38A 4CD0A 5BYLA 2R3JA 3TV6A 2YIXA 3QTXA 1YXSA 1JDEA 4IVCA 2OI4X 3Q2OA 3A99A 3C5IA 2QURA 3A7FA 3AC3A 1BL7A 3R01A 4XLIA 3A60A 3PSBA 4XV9A 3ACJA 4JR3A 1XHAA 3U51A 1ZZ2A 3D9VA 1WBVA 4AW1A 4QP4A 3QGWA 3NW7A 2J4ZA 4MV1A 1E1XA 4M0ZA 3LFCA 4LOOA 3MPMA 4BIEA 3NNWA 4FKRA 3TIGA 4CFWA 2QKRA 3O51A 3DKGA 4MXAA 3V6SA 3RMFA 2PE1A 3LLTA 4H3PA 4CV8A 5E8WA 3C4EA 3TM0A 3VPBA 3FUPA 2VWWA 3LAUA 2I6LA 4UYNA 2QU6A 4K33A 5JGDA 1A06A 2PMOX 2YS6A 3ORRA 4ASZA 2GNIA 2OLCA 1NVRA 3EN5A 3SG8A 1H4LA 2X2MA 4OTIA 3W8LA 4CNHA 4DLJA 1ND4A 3AC5A 3NWWA 1YQJA 3HV7A 5EDPA 4IE9A 4JI9A 4AACA 5A54A 5AAGA 3DZQA 3EQFA 2J0LA 2Z8CA 4U40A 3VUKA 3OY3A 4M3QA 4BTMA 1CTPE 1VR2A 3CQWA 4ZTNA 2H96A 5HLPA 3ZO1A 3OROA 3KULA 2JBPA 5ANGA 2WTDA 2V7AA 4KWPA 4FFNA 4OBPA 4MHAA 2X0GA 2B52A 3R9HA 2CKQA 2JFMA 4HOKA 5AAFA 5L2IA 1SVGA 4A9SA 5DH3A 3TKIA 3KVWA 3QRKA 5TO8A 2PTKA 4EL9A 5CNNA 3MJ1A 3KALA 3DJ6A 3BV2A 4FSWA 4IANA 3AD4A 1FGIA 3ENMA 4UZDA 3KCKA 2C5VA 2W6PA 5HIEA 2X9FA 4M84A 4E5BA 4W4VA 2DYLA 3G51A 3KXNA 2BFXA 4E4LA 4EK3A 3RK5A 4ZJJA 5AADA 3I4BA 1C3OA 1F3MC 5CWZA 3CD3A 4WRSA 4WBNF 2PVYA 3D5XA 3QTSA 2ZV9A 4IB5A 3R7YA 5CEKA 4EGJA 3FQHA 3QX2A 2PHKA 3NPCA 4F0GA 4FUYA 4YO6A 3VJNA 4I5HA 4U5JA 4LL0A 4I22A 1WCCA 3SGCA 2VNYA 3POOA 3R9OA 3TACA 4GV1A 3BQCA 1A9UA 4CEGA 4HVSA 1CQIB 5A4LA 2WPAA 3ORKA 4I4TF 2JEDA 1GLVA 2W96B 2WU6A 3MWEA 5G6VA 2OK1A 3HA6A 3KULB 3R63A 5KMKA 3VHKA 2GQSA 3E8NA 1GZNA 1W83A 4BGGA 4F7NA 4F9YA 4MXCA 3ZC6A 4MNFA 5AFVA 3V8TA 4FTNA 5M06A 3ETHA 2GTMA 4FIHA 4YJTA 5CU6A 4LGGA 3Q04A 3ITZA 2VO6A 1UKHA 2J0KA 4GL9A 2J0MB 3G5DA 3DBEA 4XP3A 3GB2A 2BUJA 4YNOA 4O7ZA 2OU7A 2YERA 5LYJF 3PSDA 3GEQA 3FWQA 4C7TA 3OVVA 5I9WA 3BWJA 4LV8A 4BI2A 1ZYSA 1Q8WA 2NU8B 3AGMA 5F94A 4U43A 5L8JA 2JKQA 2O5KA 3FLQA 5BUIA 3DKOA 4EH2A 1M0TA 4NM5A 3HP2A 2REIA 3W32A 4O4LF 2YM4A 2GNLA 2IWIA 4MD7E 4YAKB 2XRUA 5EYKA 4DGNA 2YA9A 4LOQA 4EZ7A 2F49A 1H0VA 5CEOA 3VOTA 3S1HA 3KF4A 3FMMA 2F2UA 2QG7A 4ZSJA 4A4XA 2W1DA 4FFMA 5IYZF 3A4OX 3MFTA 3QKMA 3PG1A 5HVKA 3WZUA 3QZFA 1I7NA 3VWAA 2VWBA 3EQBA 2X8EA 4RZVA 5IA3A 4IM2A 3S4QA 2WQEA 4JJRA 1OL1A 4FKUA 5DWRA 4CSVA 3AMYA 1W84A 3F7ZA 5IISA 4RX5A 1SNUA 3BLRA 3PWDA 3UC3A 3OUZA 3CS9A 1OBDA 4L6QA 4RWKA 4DT9A 2QOCA 2IVSA 3D5UA 2XNPA 3Q4UA 3LJ2A 4LUDA 3AC8A 4O0RA 2G1TA 3V8SA 4BGHA 3PTGA 1FINA 2J0IA 4AN3A 3P7AA 4QT1A 3BX5A 4I20A 2EXMA 5HNGA 3NIEA 2FGIA 3R7EA 5TF9A 3FSKA 3CTQA 3HNGA 3TUBA 4BBEA 4CFVA 3KCFA 4LG4A 1E9HA 3MY0A 5HBHA 3Q2JA 3ZCLA 2WB8A 3I1AA 4EOJA 1WVXA 5E9EA 1IA8A 2IZSA 3QFVA 5JFWA 5CANA 4EQCA 1Q61A 5E8SA 5IMXA 2VO7A 3D0EA 3UOJA 2BTRA 5K3YA 2A1AB 3EFLA 3IPHA 4RWLA 4BKJA 4O4IF 1R0PA 3SG9A 3ORXA 2XJ1A 4FTKA 2VO0A 1H8FA 3KVXA 3PXZA 3JZFA 5IDPA 5FTGA 1OECA 2UVXA 4FV8A 4RPVA 3TINA 5EW8A 2PVRA 4TL0A 3M2WA 3QUEA 3NUPA 1S9IA 5EKNA 5CAEB 5ANOA 3WILA 2C6MA 5M07A 1J1BA 5DIAA 5E7RA 3ZUVA 2UV2A 5CTPA 2PL0A 3NRMA 4QPSA 2F7XE 4N4SA 2B9FA 4S30A 4Y5HA 2Y0AA 4O7TA 5FTQA 5HE3A 4A9RA 4ZSGA 3BBWA 4QMNA 4DFLA 4TUYF 2VUWA 4H39A 4AA4A 2ETMA 3EHAA 5LVPA 4K9YA 3UVRA 4GYIA 3KFAA 4BDDA 3K3JA 3F2AA 2R86A 4RJ8A 3S3IA 3WIGA 5E4HA 4IC8A 3VQHA 4RLKA 2CJMA 2XKEA 4RVTA 4FKJA 3AW8A 3QALE 4RC2A 5ETAA 3QD0A 1H25A 4O7RA 4QMWA 3BKBA 3C4XA 4FZ6A 3COKA 2YITA 4FSTA 3V3VA 4EORA 4CRLA 4ANBA 4RX7A 3KRXA 5IQBA 4EZ3A 2I80A 2EUFB 1VBHA 2W5BA 4O82A 5M4UA 4WG5A 3K3PA 4IZOA 2X81A 4FODA 2C5NA 3O50A 3UO6A 5CEMA 4G3CA 3IW4A 4HVHA 2WNTA 1FQ1B 3KRRA 4FSQA 4YLJA 4ZTRA 4EOIA 4BDHA 4MYGA 4IM0A 4FGRA 2PUUA 2O64A 4YTHA 3VBVA 5DT0A 2R3GA 3FAAA 2HCKA 4CT1A 4XP2A 3FZRA 3ORQA 1JQHA 4L68A 2E9OA 4IB3A 4ZQIA 4IHJF 4MXZA 3MVHA 4JRVA 2CLQA 4CFMA 3II5A 4HYIA 2WAJA 4QNAA 4PUZA 4JRNA 1BI7A 5FG8A 1WBPA 2C6OA 4NM3A 4U3ZA 4PP7A 2PN1A 4WG4A 4TXCA 2C69A 4K18A 2CHLA 4EEVA 2QOOA 2RL5A 3AQVA 3R1SA 4AN9A 3HRFA 2W5AA 3F88A 1OKVA 4CG9A 1Q4LA 2JDOA 2UVZA 3C7QA 4IFCA 5JRSA 3JRXA 4DA5A 4QSHA 3G6HA 5JRQA 2EWAA 3LFDA 4F7LA 5H9BA 2ERZE 4ZK5A 2YIWA 2YRXA 2I7QA 4NUSA 4I0SA 5A6NA 4BZNA 5EHYA 3RV4A 2JBOA 3F9NA 1QCFA 3PUPA 2WQNA 4FUXA 5C1QB 3Q52A 4HCUA 2AC3A 4I23A 4NM7A 4AW5A 5GIPE 2XJ2A 1GOLA 4FBXA 5HIDA 2YWPA 2W1CA 2OF2A 5B0XA 4EUTA 4ZZOA 5LJJA 3OUUA 3PXQA 2OZAA 4QQ5A 3DZOA 5H80A 1URCA 3ULIA 1JAMA 3R71A 3AG9A 3E7VA 4A9YA 4TW9A 5E1EA 1PRYA 4ANLA 4AW0A 2Z7LA 2ZMDA 4R5YA 5E91A 5JQ8A 3RCJA 4M8TA 4AE9A 1MRYA 4FKSA 2BRMA 4Q2AA 3OY1A 5DLSA 5E8ZA 4TYEA 4C5AA 4ZLOA 5IQDA 3BIZA 3OT3A 3A2CA 4K8AA 3F3WA 1KSWA 1ZZLA 4YBJA 1PJKA 2P0CA 4N70A 4FL2A 4YLKA 3BWFA 4XHKB 4FVRA 4YJSA 3LXKA 4EOMA 2B53A 2XIKA 4MV7A 3IW5A 3FZTA 3QCQA 1ZMUA 3VRYA 1A48A 3AT3A 4RGJA 4R78A 2J7TA 4H05A 5DPVA 3SHEA 2QOQA 1RJBA 2C68A 2ITVA 4E6AA 4IBMA 2ZV7A 4NH1A 3CJFA 4MV4A 4C37A 1J7UA 4AT3A 4UALA 4C3PA 2Y9QA 3S2PA 2X4ZA 4FTQA 4Q9ZA 3R83A 2XKFA 4L3PA 4XNEA 2DZDA 2FYSA 2UVYA 3DAKA 1W82A 3JS2A 1U5RA 5FQDC 3UJGA 4NIFB 3NEWA 5E8XA 5EW3A 4JNWA 3Q4TA 2PVPA 2JC6A 2XA4A 4QMOA 4GSBA 3ZO2A 3NVKI 3FMJA 4XOZA 4ZXTA 1DV1A 1VBGA 4HZRA 1PXPA 4O91A 2PVNA 2JAMA 2OZAB 4BYJA 1LR4A 4F9CA 3KC3A 3UIXA 2J9MA 5AV2A 5FM2A 1KJ9A 4GUBA 4JG6A 4M0YA 4L52A 4J99A 4G34A 4BCOA 4NZWB 3GIDA 2J90A 4YNEA 4NTSA 4NK9A 4AOTA 1B6RA 2DWCA 4O0VA 5KBQA 3AD6A 4HVGA 4KSPA 2IZTA 2C6LA 4BY9E 3GI3A 5DEWA 4QYGA 3FC2A 4PMTA 5KMOA 4RFZA 2YYAA 1LEZA 5I9XA 4BDFA 2PUNA 2I87A 2R82A 3QQLA 2WQMA 2WGJA 3POZA 5CLPA 2VV9A 4D28A 4I5MA 2ZDGA 3L9PA 2G2HA 5HX8A 3LFSA 3GCPA 4DGGA 3L9NA 3QTQA 3R00A 2XS0A 4F1MA 1H28A 4G6LA 4X3JA 5LMBA 1UA2A 2FSTX 1Y57A 4LQMA 2YCQA 3QD2B 3E62A 2E9VA 5BYZA 5J1VA 1Z2OX 3PLSA 2WMXA 3ERKA 3TTIA 3DA6A 4EH7A 3RPYA 1J7LA 5IQIA 5IUHA 4YO4A 4LMNA 2EVAA 2I40A 3V6RA 1U5QA 4F08A 5BX0A 3K5UA 2W4OA 4O7WA 4GKHA 5HE1A 4RSSA 3V51A 5IF1A 5CASA 1KEEA 1BLXA 4JDIA 4X6RA 2ONLC 5IQCA 5LWNA 3FMDA 2XUUA 5HBEA 5ANJA 5IQHA 2R85A 3DJ5A 5JH7F 3DPKA 4CFNA 3ZLXA 5AUWA 5LOHA 4GH2A 1J3HA 2HWPA 3D2KA 4PY1A 5HO7A 1Z57A 3OOMA 3LQ3A 3Q6UA 3UOHA 2XIZA 4O0SA 5FXQA 4WSYA 1YXXA 5KCVA 3QBNA 1W93A 5IEYA 3U6JA 4BVUA 3PVGA 4YPSA 5TOZA 1M17A 2Q0NA 4IZYA 3TXOA 3MJFA 3QRJA 4HR7A 4F9WA 4DEBA 4G9CA 4PL5A 3EQIA 3F5UA 3VPCA 5AP2A 5EQYA 3LFQA 3LJ1A 3LWBA 5CEIA 5HG7A 3ZC5A 3R6XA 1YOMA 4RVMA 5CI7A 3EN4A 1J91A 1ATPE 2XK8A 4DAWA 4WNOA 3E3PA 3HDNA 3OWLA 4MQ2A 5JFSA 1P4OA 2XM8A 3FXXA 4G9RA 2XRWA 3EMGA 3G0FA 5AP5A 3TT0A 2O2UA 3OCTA 2WEIA 2F57A 4KRCA 3FJQE 4GUEA 1KUTA 2RKUA 4MV8A 4TYHB 4J95A 5JGAA 2C5YA 2OSCA 4FTUA 3F3UA 3DAEA 1SM2A 3TIZA 3DKCA 3F5PA 3WZEA 4DLKA 2PZYA 1RW8A 3ORTA 5I0BA 2O65A 2WQOA 4GFMA 3R8MA 2HWOA 2XKDA 2ZV8A 2W0JA 3FMNA 3FY2A 3VS3A 1YOJA 2VO3A 3GNIB 5JKGA 3MVLA 3QU0A 4H58A 5LMKA 2GS7A 5DHJA 4K1BA 4L9IA 5AUYA 2RIOA 5J95A 2XCLA 4BDEA 5LVNA 3HGKA 4ASEA 4MNEA 4KRDA 4FSYA 3FMHA 4FL1A 5AJQA 5M4CA 1KWPA 4PRJA 4JQ7A 1ERKA 1XR1A 4KKHA 5E1SA 2XIXA 2X7FA 3PY0A 4BCPA 2W5HA 4EZ5A 2UZTA 1OIUA 2DUVA 2X8IA 2XK9A 4YHJA 2O3PA 5F20A 5KZIA 2VGPA 3OWKA 3BELA 4FI1A 3EJ1A 4YUQA 3V8WA 1UU3A 5AAEA 5BPYA 4FIGA 2BFYA 2BCJA 2WTKB 3ETAA 4FMQA 3SKCA 3UE4A 3OFMA 1UU9A 3CGFA 1DAWA 3O8TA 4MVFA 3MY5A 3CQUA 2QG5A 3QHWA 2XJ0A 4ZS0A 4GK3A 3BV3A 3GOPA 4HYHA 4YLLA 3JPVA 2XB7A 3UBDA 3D14A 2DLNA 4DFNA 4G2FA 1WR2A 2NU6B 2OH0E 3JYAA 3N9XA 4A4LA 4DT8A 3VMMA 1O6YA 1OPLA 1UV5A 3FLWA 1W8CA 2Y6OA 2GPHA 3E7OA 5GINE 5EOLA 3PFQA 3RM7A 3R28A 1V1KA 2WIPA 4GEOA 4ITHA 4ZY4A 4EC8A 5IQAA 4ENXA 3KK8A 4NKAA 4BI1A 5JVDF 1NVSA 2G2FA 3R8UA 3K54A 4J52A 3VIDA 2BALA 4U97A 3IDCA 3VBYA 3PLAE 5CAVA 4G3EA 5HESA 2H8HA 4GFGA 4B8LA 1XH8A 3CBLA 2GU8A 4B99A 4CGAA 2IJMA 4O0YA 2ZB1A 3KXMA 3Q53A 1L8TA 4M7IA 3CSVA 4E73A 5EI8A 2FSMX 4O81A 3EFWA 4OT5A 3SQQA 4F65A 3KRLA 5ANIA 4BZOA 5CAOA 1G3NA 1WBWA 2C30A 2VX3A 2WMSA 1NT2A 3L8XA 1BUHA 3LMIA 5AUVA 3TDVA 3VULA 2C00A 3N8DA 4OTQA 4FTCA 5JZNA 4FNWA 5FDXA 3PRFA 4FOCA 4WKQA 4BHNA 3GCUA 3BE9A 1AQ1A 1ZOEA 4BDJA 1H1WA 2AYPA 3F2RA 5J7HA 3KXXA 4FEQA 4UV0A 2UZNA 5HU3A 1OL6A 3RZBA 5TR6A 1BNCA 4AUAA 2YN8A 3MB6A 1HCLA 5AV0A 5HD4A 5AX9A 3REPA 3DK6A 5L8LA 3WYYA 2QHMA 4WOVA 3RAIA 4RX8A 5FD2A 4EGQA 1EH4A 3OW3A 1H26A 4GCJA 3O7LB 5H3QA 2PULA 3PWYA 3RHKA 3PDTA 3TDWA 3DAJA 2VRXA 3HBLA 2OJGA 2DQ7X 3R7VA 4C38A 5C03A 3QCYA 3UO4A 4KNBA 3MH1A 5AP4A 2W1IA 3D5VA 2FPPB 2GQRA 4D0WA 3BPRA 1XH7A 3OD6X 2W6MA 3JR1A 3RJCA 2YM8A 1Q3DA 4MBJA 2NP8A 3GCSA 2GS2A 4ZHQF 2C6TA 4EH4A 3QD4A 4QMYA 1MRVA 4E5AX 4F09A 1FMOE 3EQHA 2B9JA 4FV4A 3GU4A 3EWHA 5AUUA 5CAQA 2UW4A 2WXVA 5CT0A 2HOGA 4YBKA 2QD9A 5CA1F 3ATTA 3LCTA 4XV2A 4U81A 3TG1A 4F63A 3JVRA 1OIRA 1PYXA 2GHMA 3DTWA 4BF2A 5EDRA 3LFBA 2HGSA 3IK3A 2OIDA 3KN5A 3VAPA 4EUUA 2DIKA 1EUDB 4MXXA 3S0OA 4KS8A 4FYOA 3OEFX 3QTZA 4XYMB 1UNHA 1ZY4A 5FXRA 4ZOLF 2BVAA 5FTOA 4M13A 4MV9A 3FSFA 4NKSA 5AP1A 2GFSA 2IG7A 3R1QA 4O7YA 3OXZA 4U44A 4B0GA 5D7AA 3CE3A 5CS6A 5JT2A 2IW6A 4GU9A 4TYJA 2C6DA 3OC1A 5E8VA 2YRWA 4WUNA 2UW8A 5F95A 4IVBA 4FTJA 3PJ3A 3LXLA 4RJ3A 3QQGA 4PDOA 1I44A 3NZ0A 4YURA 5KNJA 4AZSA 4DGLC 1UWHA 1XBCA 5EH0A 2XD4A 2VWYA 4XG8A 2ZM4A 4D55A 2WTKC 3HYHA 2C1BA 4DE4A 3OCBA 2C0IA 4JQ8A 5BVFA 3PA3A 4RLLA 3BE2A 3VNTA 3BHUA 2VTIA 2R3NA 4UB7A 3W2SA 4FV0A 2OZOA 2OJFE 4JVGA 4M67A 4YMJA 5HE0A 2WYOA 2R7IA 3N51A 1FPUA 5BMVF 3K2LA 3VBXA 3PA4A 4ZY5A 2UZWE 1HCKA 3BLQA 3SRVB 1GSOA 4YP8A 2VTMA 3A61A 5A46A 4OTGA 5AP7A 1LUFA 4HCTA 1YHWA 4IWOA 2VU3A 4IADA 3EZVA 5KMNA 2I0VA 3R5HA 1PKDA 4B8MA 5EKOA 1YWRA 3MWUA 1L3RE 3KEXA 4JG8A 1YHSA 5AM7A 3GU8A 4WA9A 1ZY5A 3OUKA 4I6HA 4XZ3B 5BPFA 2WTVA 3SD0A 2BRGA 3Q1KA 3D5WA 3DLZA 5CSXA 3IG7A 4F6WA 5L2WA 3GLKA 3GC0A 1UU8A 3NIZA 5KMJA 3SA0A 4FNZA 3VS5A 3MIYA 3DNDA 4J97A 1JLLB 2OIQA 3DXPA 3OP5A 2W70A 4O27B 4F1OA 1KJ8A 2LAVA 5G1XA 5T6KA 4XG3A 4ZTMA 5LVMA 2XP2A
chains in the Genus database with same CATH superfamily
2ZYBA 3GOKA 5ITAA 4HNTA 4O84A 3WWHA 1Q8ZA 4ACGA 4BIDA 1CKIA 3WO1A 4FFLA 3O7LD 2R3FA 5FEQA 4C59A 3MI9A 3PY3A 1OKWA 1OGYA 4CMDA 5BV3A 3RVGA 2VTLA 4FIEA 4AGUA 2OJ9A 2NRUA 1PXMA 2BTSA 4HGLA 3SXFA 4C33A 4FFPA 4H3BA 1YWNA 2IVVA 1KE6A 3BRBA 1V0OA 4FTTA 3BACA 5FR9A 1OL7A 5DT4A 1WVYA 4BBFA 4BDCA 2XZSA 4IEBA 2XK6A 5C4LA 2IVUA 4GFOA 4LH6A 1H0WA 2V22A 3OBGA 3UNZA 3W55A 3ZS5A 1KE9A 1SVEA 2QVSE 4UCVA 3PFYA 2GDOA 1E4EA 1V0BA 4LV5A 1LP4A 3TZ8A 5CVHA 4EKKA 1M52A 3TNHA 3VO3A 1ST4A 4O0UA 5BYAA 2PVKA 3GGFA 5JGBA 3U0GA 4GW8A 1PY5A 5L8KA 4D58A 4PDPA 1U46A 4PL3A 2X0SA 4O22A 1JSTA 2F2CB 2HHFB 2WMAA 3DTCA 1YXVA 4J71A 1MQ4A 4LFIA 4A9UA 4JL9A 4QMMA 3VS6A 4E93A 2BZJA 4R1VA 4O7SA 3VJOA 2PSQA 4BDBA 3WF7A 5IPJA 1VYWA 1YW2A 3C5UA 3EH9A 2RG6A 1A3GA 2CNVA 4EK5A 2CKPA 4UBAA 4ZTSA 3LJ0A 5KBRA 1LEWA 3ID6C 4RZWA 3ODZX 3EL8A 4OTRA 3MESA 4FNXA 5TT7A 1AUVA 3WWIA 3TW6A 4EOSA 3UP2A 4AXCA 2CPKE 4CFXA 2NRYA 3HKOA 4BDGA 2BAQA 3KAJA 1OB3A 1TKIA 2BIKB 4YJRA 1MRUA 3DJ7A 3QTRA 3W16A 3SVVA 4ALUA 3JZIA 2YL2A 2R3KA 1IA9A 3PJ1A 3RI1A 2QR7A 1GGOA 3Q32A 3ZFXA 2YAAA 4JBQA 3PPKA 4ZP5A 1H00A 2VZ6A 3L1SA 3CKXA 1TA8A 3L2PA 4FC0A 3R5XA 5FDPA 3ATSA 4IHPA 5CQWA 2WMVA 4JOAA 5CU2A 2ETKA 3GQIA 4ME6A 4FTAA 3WARA 2R3QA 4AX8A 3A7GA 1URWA 2BIYA 3W0QA 2ITTA 4DQNA 3W0SA 2I0EA 3DTFA 5KKRB 1Q8YA 1OL2A 2QONA 1JKKA 3G2FA 5ETFA 4QMUA 5JFVA 3AKJA 3FEGA 1H07A 4FT5A 2WELA 4C4IA 4MWIA 3AX6A 5CM0A 2CDZA 3WNZA 1JNKA 1YI4A 4QYYA 4CMOA 2CCHA 1QL6A 1OMWA 2QO7A 5E90A 3D94A 3G9NA 4F64A 5HBRB 1M14A 1ET0A 3E88A 3Q5IA 3FYKX 4FZDB 3U6HA 3ZONA 1OVEA 3FBVA 2CGXA 4QMSA 5CY3A 4RZQA 2WTCA 5M51A 4UZHA 1Q24A 4G1WA 3E92A 4I21A 1IG1A 4WNMA 4CFFA 1B6CB 4E4MA 4YAJB 3HVCA 2BHEA 3HAMA 4IJ9A 4O6EA 3GBZA 2I0YA 1UVRA 3GENA 4O7VA 5CF5A 3OS3A 3GC7A 4NW6A 4D9UA 1IAJA 3TNQB 5HCZA 3MY1A 4L01A 2VD5A 5IA0A 4QO9A 3LCDA 4IW0A 4Y95A 3LVPA 4BCNA 2RFSA 5CEPA 4CG8A 4F1TA 4TTHB 3BU6A 2W06A 3P9JA 4PF4A 3HA8A 3G15A 3ZFMA 4M12A 1M7NA 2GHGA 2R3HA 1ZLTA 5DE2A 3F82A 3CPBA 4X3FA 4AS0A 5HZNA 3DQXA 1JDBB 2R9SA 2Y8OA 3C9WA 4G6NA 5ICPA 4QYEA 3DLSA 3ORNA 4A07A 4E4TA 3OXIA 4D0XA 5E25A 1G8KA 3QC4A 3I5ZA 4ZI7F 3ZDIA 2BPMA 4LDTA 2ZDQA 3MJ2A 4LI5A 3RCDA 4U8ZA 4TRLA 4CMTA 4DGOA 4PZ7A 4XRLA 2WKMA 4WHZA 3BG5A 4IWXA 3LW0A 4DRFA 4LRJA 3UQGA 1CM8A 2JKMA 2PVHA 4BN1A 4DGMA 4F78A 5CSHA 1CKPA 2PUIA 3NX8A 2IW9A 4FA2A 3PA5A 3AC2A 4RJ7A 5HG5A 1JBPE 1QPJA 3FL4A 3QRTA 4IAFA 4QEBA 1Y8YA 1IEPA 3H9RA 2IP4A 4UCTA 5H8GA 5BVEA 1IOVA 3I0QA 3PXYA 5BVWA 2VX1A 4R5SA 3SV0A 2ETRA 5DGHA 5AIRA 4KABA 4KBKA 3OCSA 4EJ7A 4RVKA 5I9YA 2CMWA 3HECA 4F7SA 2P4IA 4IVDA 5CVGA 5D41A 4ZTQA 1WVWA 1XH5A 4G3GA 4H1MA 3A7JA 2WMUA 1YWVA 3RPSA 2J50A 5DFPA 2OXYA 4GK2A 3LZBA 3NYOA 4QDVA 5BMSA 4IX3A 1GZOA 4TWOA 2R7KA 1UC8A 4I55F 1VEBA 4ORKA 4AAYA 4F4PA 5K9IA 4KBCA 3R21A 4YZ9A 5M55A 2W71A 2YM3A 2P33A 4MA0A 2Q2UA 2PVMA 4IAYA 4UWYA 5E8YA 3VA7A 4LV7A 1XBBA 3DK3A 5D10A 5IUIA 4YSJA 3IDBA 1DIKA 2RGPA 3DFAA 4RWJA 4W8DA 3MSSA 4IMYA 4DFZE 4DCAA 3AOXA 4RIXA 4X3FB 2Y6MA 3SOCA 3VF9A 2COIA 4YBZB 2NNWB 4JDJA 3V4ZA 3R9NA 3QQKA 3WYXA 2HXLA 3LHJA 4GLXA 2Q7DA 4ASXA 4YTCA 4RJ5A 2CZGA 4FKWA 2XBJA 3N4VA 3QQHA 3O2MA 4JBOA 2COJA 1UU7A 4JS8A 4TWPA 3UIBA 1GIHA 5KKRC 5L6OA 5AUZA 4FJVA 2QODA 2GPWA 4FV6A 5FPRA 5M09A 1R39A 4M9UA 2C6EA 3PXRA 3ZM9A 5B2KA 2ZDTA 2O8YA 1G8JA 4I94A 2IZRA 4JR7A 3ZH8A 4F0IA 4UCOA 4FV2A 4AZWA 5HQ0A 2QLQA 2ITYA 2A0CX 2YM6A 5J9LA 5H8EA 1FOTA 3HV6A 5FXSA 1IAHA 3LOKA 1TQMA 2JAVA 4FV1A 5F1ZA 4MF1A 5FEEA 3UIUA 5L2TA 3ZEPA 3QXPA 1PK8A 3QL8A 3UODA 4HCVA 3ZXZA 4CMUA 4LYNA 2WEVA 4HNVA 3TNWA 4NM0A 2XKCA 1OPKA 4AZFA 2PU8A 2GNJA 3RWQA 4NFMA 3VS4A 1H1SA 3VNNA 3C0IA 3H4JA 5BYYA 3BYUA 4MV6A 3BHVA 4GK4A 3T9TA 1QPDA 3CY3A 4AT5A 4I93A 4DG3E 4HGTA 4FU0A 3ZMMA 3HB9A 5C8KA 2YM5A 3EOCA 3Q9ZA 3PE1A 1H1QA 3QRIA 3C51A 5EM6A 5H8BA 4YHTA 3VUDA 4DHIB 5I5UA 3GT8A 4PNKA 2ZAZA 4C4JA 4XJ0A 3UZBA 1PXJA 2PE0A 4HNFA 5CZIA 4RIXB 3MA6A 3PPJA 3LXNA 4V05A 3F5GA 5AM6A 4I6BA 3AKLA 4FKVA 2UZUE 3TCPA 3VRZA 2W6QA 4C5BA 4YJPA 1KC7A 1P5EA 5HGIA 3T9CA 1M6VA 5LVOA 4QP8A 2ITOA 5IH6A 3VF8A 4RT7A 2J9GA 2XVDA 4OUCA 3C4WA 3NBZB 1ZYDA 3RTPA 4J98A 2CGWA 5HD7A 3BA8A 4ZSLA 4ZS4A 5GJFA 4L8MA 3EFJA 3GU6A 4YJUA 4S34A 4ACDA 1JKSA 2BHHA 4FOBA 2PZIA 4ZY6A 1B6SA 2XNMA 4O86A 1Z9XA 1GIIA 2R0UA 4J96A 2X39A 4IVAA 4EWQA 3CEBA 1EZ1A 4KUJA 2G15A 4I41A 5FP6A 4UUGA 3IOPA 3U9NA 5BMMA 4YZMA 4QP7A 4HVIA 1AD5A 2C3JA 4QP3A 2PZ5A 4I0TA 1GAGA 4DINA 4NCTA 1K9AA 1H27A 4DH3A 4EQ5A 2AUHA 4YB8B 3HUCA 2YFXA 5FP5A 2HENA 2VTRA 5HCYA 3TJDA 2HY81 2A27A 3BQRA 3LM5A 3A7HA 3QF9A 4BZDA 3MFUA 4E5WA 4EOPA 2XEYA 3NGAA 2BDJA 2ITPA 4PDYA 1W98A 4ZJIA 3LCSA 2W6ZA 4TPTA 4YJNA 4E4NA 5A4QA 2ZDHA 2WMRA 3ZBXA 4ZAUA 2B7AA 3NDMA 2BDFA 4O96A 4IC7A 5EOBA 3R73A 3FKNA 2P2IA 3GCVA 1ZMVA 4OTWA 1J7IA 4BIBA 4EH9A 4Q9SA 1U54A 4ZIMA 1SCUB 2WFYA 3MWDA 5EHLA 5CU4A 4U80A 3ZUUA 1LPUA 4FTLA 4XV1A 4N6ZA 3PIYA 1QPCA 5BNJA 3DY7A 1I1MA 2UUEA 3P5KA 3VONA 2UZDA 1ZWSA 4QTEA 4E6CA 3S00A 5FLFA 5CAUA 3I7CA 5D7VA 5EW9A 5K3WA 4BHZA 4PDSA 2BKZA 2C3LA 3VC4A 3UVQA 3ZSIA 4BYIA 3K5HA 2QR8A 2Y4IB 4JBVA 4RIYA 4GLWA 4F70A 5I9VA 3BU5A 3HV4A 2YCRA 3HMIA 3BGPA 5CEQA 1EUCB 2OKRA 2F7ZE 3CLYA 2AC5A 3FZOA 1GSAA 3BHTA 5HKMA 4YC8A 4O0WA 3I60A 4DYMA 3QWKA 2VTOA 4ONAA 3DBDA 4G17A 5DN3A 5DR2A 4KBAA 5HG9A 3MPTA 3VUIA 5JMSA 4YJ3F 1F0QA 3WZKA 3RK7A 4YU2A 5EYCA 4MAMA 3L8PA 3EQRA 3TTJA 1T46A 2R3PA 4EHVA 5LCKA 5A4TA 1H1RA 3FLSA 2WD1A 2CSNA 1SZMA 2H34A 2VAGA 1M2RA 3TZMA 3FKLA 5LA6F 2NU9B 2BRHA 3LFFA 1UKIA 2A2AA 4TY1A 4AXFA 5FEDA 4DFBA 4OT6A 2V7OA 5JFXA 3IDPA 3ET7A 3V5JA 4OBQA 4PWNA 3BA9A 1KE8A 3OZ6A 3MVJA 3R7OA 4QMTA 4UWBA 5DVRA 4B9DA 3E5AA 2PMIA 3FE3A 5HIBA 5CF6A 5LQFA 1I7LA 3VHEA 2NU7B 2XF0A 4APCA 3CC6A 1Y8GA 4Z55A 3C0HA 3DB8A 3OOGA 2UW9A 4MA5A 4CKEA 2W1FA 4FEVA 5LOVF 4WNKA 3RFCA 4NSTA 1REJA 3TV4A 4GU6A 1XWSA 3QTWA 2X7GA 5I4NA 5HLWA 2PZPA 4R6VA 3EIDA 4TVIA 3OTVA 5CNOA 4ANQA 1Z2NX 3TW7A 4JBPA 2WMQA 1FMKA 2PMLX 4HJOA 4X2JA 5M56A 5HICA 3ZOSA 3LP8A 2EB3A 3KMWA 2PVFA 4DTAA 4KD1A 3BYOA 4FFOA 2GMXA 4IAIA 3RHXA 2UZVA 5M08A 2XNBA 3EZRA 4APPA 4EOQA 2OGVA 1DI8A 3KMMA 2HZNA 4RX9A 2XEZA 3U8WA 2R87A 3A8XA 3BBTB 3UOKA 1OKZA 4Z7HA 2PYWA 2G9XA 3N4UA 2OH4A 2WO6A 1SNXA 3T9FA 2RG5A 4GVAA 2WMBA 3V5QA 2VTPA 3FQSA 4AZVA 3KMUA 2P3GX 1DV2A 4I5PA 4FVQA 2Z04A 1TFFA 2ZMCA 3BABA 3I5NA 2FB8A 4P5QA 4D9TA 5IH5A 3C13A 3R04A 1TQPA 3NYVA 3HMMA 3FLZA 2UZBA 5FPOA 4AA5A 3ALOA 3ANRA 5HI2A 5J9ZA 2CN8A 3GJXB 5BWUA 3VUHA 3FMLA 1XH9A 3PVWA 4FE2A 3BHHA 1Q8UA 3LLAA 4QPAA 4U3YA 3R8ZA 4Y8VB 1X8BA 3EN7A 4PP9A 3RP9A 3K5IA 5C4KA 3LCKA 4O2ZA 3EL7A 3R8VA 4WBOA 4M15A 3SXSA 2EB2A 5IZFA 4K77A 2GLTA 4C36A 5T68A 3P7BA 4RVLA 3V5PA 3TQTA 4G31A 4ZMFA 3FHIA 1R3CA 5D1OA 4Y85A 3COMA 1YI3A 2HVQA 2LGCA 4QP1A 4AZTA 5BYBA 3R23A 3CCNA 2VTQA 4AU8A 3FXZA 5CX9A 4C34A 3BYMA 2ZOQA 3DT1A 2W05A 2CNQA 1EKFA 3LE6A 5BWWA 3QKLA 2QKWB 4L42A 5IA5A 1PMVA 5E92A 1PMEA 3Q60A 3DBFA 2X8DA 3QTIA 3D7TA 3AT4A 4I5CA 2WTWA 2X6DA 4GKIA 1JVPP 3B8QA 5C27A 4HQ6A 4FL3A 4RMZA 4FSZA 3E63A 4AG8A 2Y4IC 4AGWA 4N57A 3W1FA 3W2RA 4O4JF 4QYHA 4XV3A 3MTLA 2W6OA 3VBQA 2CNUA 4XMOA 2GSFA 3WI6A 3CD8A 3NAXA 3JY0A 4U9AA 4USDA 3ACKA 3Q9WA 5AV3A 5CENA 2V5AA 4TNBA 4V0GA 1I1LA 1VYZA 2FUMA 3ZTXA 3DV3A 3CKWA 3FI4A 4GIIA 4R1YA 3WOWA 4DEHA 5AA9A 3C4ZA 3U55A 3OW4A 2HW7A 3QD3A 4HZSA 3FPQA 5IEXA 3NNXA 3DQWA 3ELJA 3F3TA 1W0XC 3PE2A 5AUXA 4YGAA 3UMXA 3ZLWA 1PX2A 2B1PA 4FKGA 5E8TA 1YXUA 2X2KA 3DU8A 5GJGA 4AQKA 1XDNA 4FFRA 2W1HA 3T99A 4C35A 3QQFA 2HELA 3KY2A 5FRIA 3Q3BA 4Z9LA 2QHNA 3RV3A 1OM1A 3C1XA 3TNPC 2ITZA 4CCBA 5J5SA 5J1WA 4KSQA 4BCQA 1ZYCA 2YZLA 4EK6A 1VKZA 5EDQA 2C1AA 3Q9YA 4MNEB 2IZUA 3IGOA 2R84A 2JDRA 1IR3A 1JKTA 3F6XA 2BDWA 4U45A 3V5WA 5AP0A 3ORMA 5D1OB 1AGWA 4XYFA 3RAWA 5B2LA 4FV5A 3RAKA 1B39A 4QOXA 3U9TA 4BRXA 2JDVA 3MVMA 5DR6A 1YRPA 4J1RA 3EQCA 3I6UA 2EXCX 3V04A 3RALA 2QK4A 4TV8F 3TJCA 4EH6A 4D4SA 3IOKA 3P08A 1TVOA 4QMQA 3O8PA 5CZHA 5GNKA 4UY9A 3FI2A 2DAAA 3WBLA 3W18A 5LP6F 1FVRA 2WOTA 2HVSA 2PMNX 5KMLA 4XCUA 4CTCA 5JN2A 4BBMA 1ULZA 2C5OA 4JDHA 4TN6A 2HZ0A 3C0GA 1R78A 2BILB 4J8NA 4UXQA 2BZIB 3PXFA 4USFA 5HHWA 5HORA 3I79A 3AC4A 1B04A 4MCVA 4JIKA 4I6QA 2ERKA 4U7ZA 3KU2A 3OWPA 3U4WA 4M0JA 3NR9A 4MXOA 2P2HA 4USEA 3E3BX 5LXTF 4CLIA 2YDJA 3RKBA 1MQBA 3R7UA 2CGVA 3F69A 1U59A 4BDAA 1BYGA 4G5PA 4E7WA 5AV4A 2FP4B 1PF8A 3H10A 2GNFA 4GVJA 3TZ7A 1FVVA 3TZ9A 2HW6A 5C8NA 3JSLA 3MYGA 4DC2A 3VW8A 1GZ8A 3CY2A 4QTCA 3UYTA 1QPEA 3QAME 1YVJA 3NSZA 5LCJA 4XX9A 4B6LA 3ZLYA 4GS6A 4QMVA 4ERWA 3IW8A 1KV2A 4IZ7A 4C0TA 2CKOA 4OTHA 4L00A 4CZTA 3CGOA 4XG9A 2Q2TA 3WF6A 2J6MA 4PV0A 3ZO3A 1I2KA 4UYAA 2XAOA 2PWLA 2B4SB 3R8LA 1KJJA 2ZJWA 2ZV2A 5HG8A 3TL8A 2YJRA 4L67A 3ZEWA 2HDKA 4G5JA 4YJQA 1R1WA 4GYGA 4FG8A 5LMAA 1KOBA 3W0NA 4WIHA 5HU9A 3GQLA 1OI9A 4RFMA 4EYMA 1OBGA 4AFEA 4AN2A 3Q96A 3UG1A 2R3LA 4J53A 1KV1A 3P79A 5I9UA 4C4EA 5I5TA 1MP8A 2GPSA 4IIJF 3LM0A 3BI6A 3UYYA 4FT3A 3MH3A 3TY8A 4TWCA 4MBIA 3KA0A 3CP9A 3ORPA 5ETIA 3ROCA 1ZOHA 4C5CA 2QCSA 2PK9A 3QC9A 4NZNA 3EKKA 1M0WA 1U4DA 2GQGA 3QRUA 1Z5MA 4DFUA 3EQDA 3UZRA 1Q5KA 3F3ZA 4FT9A 4GMYA 5KO1A 4OTFA 3ZO4A 1P16A 4O6LA 3AMAA 3MDYA 3CSWA 2BRBA 3DB6A 4MD8E 2FO0A 2OIBA 4CFUA 5LVLA 2BMCA 2XMYA 4HNIA 4R77A 4DG2E 5CA0F 4IWDA 4XLVA 2OXXA 5C01A 4FR4A 2C47A 1Q41A 4FZ7A 4UCRA 3R7IA 4A06A 1KJIA 4HNUA 1JLUE 3QUDA 2OJIA 4IB0A 4XUFA 3VBTA 2YISA 3H30A 3BYSA 4H3QA 3UNJA 4ANSA 4D1XA 1UNGA 5CVFA 3PXKA 2R4BA 4F99A 4XX0B 2W4KA 3LFEA 4I92A 4BCJA 4EC9A 2Z7QA 4JDKA 4FV7A 2BAJA 3QHRA 4RA5A 3GXLA 4V04A 3QWJA 3VUGA 4QP9A 4FEWA 3TKHA 2CLXA 1DM2A 3VS0A 4YTFA 4ZSAA 1T36A 5EZYF 1CKJA 4DH8A 2WMTA 2HK5A 3CPCA 3ANQA 3PJ8A 4HGSA 1DS5A 4IAAA 2CN5A 1NXKA 4JAIA 3WZDA 1AUXA 1Z2PX 4L1KA 2BR1A 3R2BA 1A9XA 5JZJA 4HW7A 2VTJA 4RG0A 4GIHA 2YJSA 2WHBA 1OUKA 4UCUA 1H01A 5HV6A 5LMKC 4RC4A 3A8WA 4WHXA 4HYUA 3H0YA 3U6IA 3QA0A 5J8IA 3CTJA 4P90A 4DG0E 4FICA 4BI0A 5IDNA 1F5QA 5CE8A 2CKEA 5C8YF 1ZMWA 5JQWA 3QA8A 3ZZWA 3T3VA 3FMEA 4WRGA 1NVQA 1OIQA 4KINA 3VPDA 4F6UA 4MQ1A 2XNGA 4IX5A 5ANKA 3DBQA 2FSOX 1PXKA 4NT4A 4P5ZA 4E6DA 1I2LA 1W96A 4RFYA 3RNIA 3U4UA 4G3DA 3OHTA 4CCUA 3C50A 4ACMA 4ERKA 3GUBA 4V01A 3H3CA 2NUAB 1G5SA 2XNOA 3Q5ZA 2FVDA 3R8PA 1M2PA 4G16A 4TNDA 3O5AA 2JKOA 5M4FA 1DGSA 4O7NA 4W4XA 4DLIA 4EH5A 2OWOA 1PHKA 1GY3A 4MH7A 4TZRA 3TYKA 2XM9A 2UW5A 5KKNB 2WU7A 4EOLA 3ZSHA 5DISC 3NFGB 2QLUA 3AC1A 3OG7A 4O38A 3SW7A 4PBCA 3QUPA 2OBJA 5EYMA 4MEDA 1H08A 3I81A 4I0RA 4ASDA 5ACKA 1WBSA 3UVPA 2YZMA 4R3PA 3H9OA 5IH4A 4KS7A 2ZVAA 2Y7JA 2YIYA 2UW3A 4RIOA 4L45A 4TYGA 2QU5A 2J5EA 3DNEA 2PVJA 4O2AF 4MV3A 3N6RA 5KX5F 5CF4A 2VTAA 4L7FA 5M53A 2QOIA 4FK3A 3UZOA 1WAKA 4F6SA 5EI6A 3GVUA 2RFEA 3NLBA 4CKJA 5EYDA 4BB4A 2HVRA 3ROYA 2I8CA 4IQ6A 4L3LA 4EOKA 1VJYA 3I6WA 3LPBA 4HPUE 5KMMA 2OFUA 3UQCA 4LOPA 1H24A 4ENYA 2H9VA 3W1GA 5A3XA 4CTBA 2VWUA 5DOSA 1YXTA 4PTCA 2QF7A 5FGKA 4X21A 4NZOA 5D11A 3LQ8A 3OF0A 3E93A 4R7BA 4W4WA 2X1NA 3KK9A 4EBWA 2QI8A 3GCQA 3IS5A 1MUOA 3IW6A 2ITXA 4S33A 5JQ5A 2GS6A 4MXYA 2R2PA 4FSUA 3ZUTA 5BVOA 4Y72A 2YAKA 4Y5QA 5IA2A 3TIYA 1KE5A 2R3OA 4XH6A 1GIJA 3DCVA 3O23A 4DTBA 4Z7GA 5B7VA 4FSNA 2XCKA 3TWJA 4JXFA 2WQBA 4XOYA 2AEGA 2GNGA 3FC1X 4IAKA 5HTBA 2H6DA 1PMUA 3I7BA 1PXOA 4NW5A 4AZEA 5J9YA 3QGYA 3RK9A 5DRDA 2R0IA 3NUSA 4L44A 4O0XA 4PZ8A 3GU5A 3I12A 3NNVA 2A19B 3HAVA 3LIJA 4E8AA 2OF4A 2OXDA 4Q5EA 1E4EB 2ODTX 1XJDA 2Q0BA 4BCMA 4PQNA 1DAYA 2B9IA 3QX4A 3UPZA 5EI2A 3UMWA 3D7ZA 5AWMA 3NVMB 4JQEA 4L43A 3NUAA 3W0RA 3HZTA 3F5XA 3ORZA 3PIZA 3R9RA 4A9TA 2QOHA 2HZ4A 3O96A 4LRMA 2YDIA 3DXNA 2OWBA 4C4GA 4NL0A 4NJDA 1KE7A 2JITA 2V58A 3T9AA 5DEYA 3W8QA 1ZRZA 4YZDA 5ANEA 5HNBA 3ZHPC 2HGXA 4BCGA 4K0YA 2QC6A 2XIYA 5JQGF 4D4VA 4ZZNA 1R0EA 3QYWA 5KX8A 4DBXA 1JSUA 4LL5A 2WMWA 2C0TA 4PMMA 4IDVA 2VTHA 3KRJA 3ODYX 4YJOA 3FHRA 3MV5A 4ZSEA 4EK4A 3F7WA 5L2SA 2XNEA 5BUJA 2VQDA 3DDPA 4EYJA 4CLJA 3MW1A 5BVNA 3U9CA 3PIXA 5J87A 2JFLA 4FZFB 3MS9A 4DH5A 4UWCA 3O17A 1M2QA 3BU3A 4IIRA 1WFCA 4PL4A 4BC6A 3DGKA 5K4IA 4JIAA 4XEYA 1KOAA 2YWVA 2QOLA 2CCIA 2XAMA 3VS2A 2KULA 5DNRA 1RDQE 4C3FA 5T3QA 2I1MA 3WF8A 5CAPA 2E9PA 1XQZA 3LXPA 3MGYA 3FKOA 2E9NA 2JIUA 3L8SA 4JLCA 4E4XA 2HIVA 3V5TA 3HO8A 4I4EA 3JSNA 3OUNB 4X2GA 3ULZA 3F2NA 2RFNA 1CDKA 5IQFA 4M69B 4FT0A 1K3AA 1VZOA 2WTJA 4DEDA 3TUCA 2X4FA 2HZIA 4TM5A 4O2BF 4FIIA 1OZ1A 4MBLA 5AV1A 3O8UA 3EYGA 4BCKA 4ZLZA 4XG2A 5AEPA 4FKLA 4H36A 2V0DA 4FIJA 2XK7A 2ITWA 1PXLA 5A9UA 2JDSA 1IRKA 1S9JA 2ZFYA 3JXWA 3E8EA 1FGKA 2JGZA 3PJCA 3Q6WA 4C3RA 1CKMA