1A48A

Saicar synthase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
305
structure length
298
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
publication title The structure of SAICAR synthase: an enzyme in the de novo pathway of purine nucleotide biosynthesis.
pubmed doi rcsb
molecule tags Atp binding protein
total genus 97
structure length 298
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 1998-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1a48A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1a48A02
4U9AA 3DDPA 2B9IA 3EHAA 1IA9A 2C5YA 4YZMA 3SXRA 5HGIA 3KVXA 3N4VA 4FKRA 3D7ZA 3F3TA 5KZIA 2IZTA 3ZEWA 4MQ1A 5A3XA 5AAFA 5AP3A 3HLLA 4E1ZA 3KXGA 4M67A 5HO8A 3ZSIA 4C33A 3LXLA 3O51A 4TN6A 3C1XA 1ZY5A 2OI4X 3ORIA 2YITA 2ZM3A 1RQQA 4ARKA 4QP2A 3KK8A 4QMZA 4FTAA 4MBJA 3DB6A 2B55A 2QCSA 4IWPA 5BPHA 4EOIA 3PXKA 3ZTXA 4GT5A 4FEQA 4LGHA 1I7NA 4JS8A 2ITWA 4FL3A 2GTMA 2XM9A 4DFNA 2WOUA 3FSKA 5LOVF 4L43A 4QYYA 2WTKC 4YTIA 5CAQA 4GU6A 3GIDA 3FC2A 3L9MA 4FNWA 3ZSHA 3I6UA 3A2CA 4FSWA 5ANKA 4HYUA 1Y8GA 4BTMA 5KCVA 2PVKA 4L7FA 3SX9A 3TXOA 5JGAA 4FTIA 1ZY4A 2H9VA 4FFNA 4ZSGA 4A9YA 2E9NA 4D4SA 4IIJF 4E6AA 3JVRA 2CZGA 3D7TA 5IA2A 2PBZA 5KMMA 2HZ4A 3KALA 4FU0A 1U59A 2PMOX 3VC4A 5LOHA 1A9XA 4YZ9A 5BVNA 2FYSA 3EQRA 3R01A 4TZRA 3E8DA 5M55A 4C61A 4CEGA 5BVEA 3WNZA 5L2WA 2G2FA 4I92A 2BKZA 3Q52A 4FZDB 3WO0A 4E5BA 2XIXA 3EFKA 5LVLA 5LMKC 3SRVB 5BVOA 4S31A 1JDBB 3KRXA 4DLJA 5IPJA 4QYFA 3EWHA 5EYKA 3KCFA 3P78A 2WMRA 3DPKA 4I4EA 5HCYA 3DA6A 4XP3A 2EVAA 5CENA 1NVSA 5F1ZA 5KBRA 2GQRA 3PE1A 4FZ6A 4OTRA 5FP6A 2FH9A 3K3IA 4KIQA 1WBWA 4OR5A 1R39A 5CEMA 3OEFX 3B2TA 2W6ZA 1V1KA 4B0GA 5K4IA 2Y0AA 5JQWA 2GMXA 4BCHA 2R4BA 3GFWA 2GNHA 3IOPA 1GIJA 2C1BA 3NUAA 2HYYA 3SXFA 4XG6A 4AZSA 4BF2A 4HGEA 3ZUVA 2CHLA 2RL5A 2W96B 3MY5A 4IAAA 4KBCA 4DTBA 2VTOA 1A06A 1OPLA 3VF8A 2ZDHA 4H1MA 3ODYX 3WZJA 3FI2A 4YO6A 5L6PA 5HG8A 5K5XA 2H34A 5ETCA 2OSCA 3JPVA 4RA5A 1M2QA 4RZQA 1MQBA 1M52A 3PXZA 4JNWA 4OTDA 4P5QA 2OJ9A 2QODA 3PSCA 4UEUA 4E5AX 2G01A 3JUHA 3GU5A 4YTCA 4ZTNA 4DF3A 4TT7A 4B9DA 4BGGA 4OTFA 3DZQA 4IACA 4MNFA 3HRFA 4BDBA 3F5PA 1R0EA 2ZV9A 5EI6A 3UNZA 5FBNC 3PJ2A 2ZVAA 2JKOA 3G33A 4YJRA 4B7TA 3BGQA 2V0DA 4OBQA 2R0IA 4O86A 2EUFB 4I6FA 1PX2A 3WF8A 4RJ5A 4Y95A 5AP5A 2OFVA 4FT7A 3UODA 3L1SA 1KV1A 3QTWA 2YS7A 4WG4A 2R3FA 4EK3A 3KXNA 2W1ZA 3BLQA 4X6RA 3R9RA 3ACJA 3PIYA 1APME 3WF7A 4FSYA 4DG0E 2WTDA 4K18A 1Q8WA 2XKCA 2V62A 2R3JA 2UZWE 3L8XA 1KE9A 2XIRA 1GOLA 4O38A 4YP8A 3WILA 1KE6A 2W6PA 3NUUA 3T9IA 3OTUA 2BTRA 5HX6A 3F3WA 2WIPA 2QONA 4TYIA 5CANA 2VTPA 1KC7A 1LEWA 4I23A 4HQ6A 3C4CA 5AUVA 4C5BA 2P2HA 3C0HA 2OKRA 4TNBA 3HZTA 3V8WA 4EGJA 1UVRA 1WR2A 4AZVA 2OK1A 3Q6WA 4AT4A 4AZEA 5HLNA 4MQ2A 3GXLA 4ME6A 3ZDUA 3OHTA 1XWSA 4ZJIA 3NNXA 3OBGA 4A06A 3TV6A 4Z55A 3PXQA 3QRUA 3V51A 2HZ0A 4IM3A 1EH4A 4GIIA 2KULA 3DXQA 4FIGA 5KMOA 1PK8A 2YYAA 1P4OA 2RKUA 3SQQA 3LCSA 1YOMA 3ZFMA 4I21A 4QNYA 5EYMA 3VAPA 2JLDA 3ZBXA 1XO2B 2E9OA 3IONA 3OS3A 1UKHA 1Z5MA 4NM7A 3PUPA 3TG1A 1SVGA 5CTPA 4KWPA 4RLLA 2O3PA 3KA0A 3QFVA 3VW6A 4EYMA 3CBLA 3DAKA 4MWHA 2BRHA 3AGLA 3CJFA 3R6XA 4G17A 3BYMA 4BDDA 2HW7A 3PP0A 5LXMA 2XP2A 2XB7A 2OU7A 3Q9WA 3FI3A 1CS0A 3Q2MA 4IBMA 1S9IA 2QOCA 3OWLA 5FTGA 4M3QA 3FMJA 1ZYCA 2BAQA 4Y85A 3P7BA 2O64A 3Q2JA 5EM8A 2WQBA 4I5HA 2PVHA 2JBOA 4CVAA 2CKPA 3TW6A 1GZNA 4G16A 2C47A 4AGWA 3HA6A 2XK6A 5HTBA 2VX1A 4QQTA 1J3HA 4GFOA 4R5SA 4USFA 5I9WA 5BYLA 3PWDA 4A9TA 2IVVA 4JDHA 4BY9E 3C5UA 2WTIA 3NW5A 4LRJA 5IH6A 3QL8A 3UOKA 4I3ZA 4RT7A 3BEGA 4J8NA 4O7LA 4IIRA 4EK8A 4HNTA 1BX6A 2JKQA 5D1JA 2VX0A 1AGWA 2C30A 3FYKX 4IC8A 4AN3A 5BVKA 5IA5A 4CSVA 2IPXA 4CNHA 5CASA 1O6LA 2GNJA 4ZOGA 1OBDA 3LJ0A 3UO4A 4BCJA 5L8KA 1BL7A 4LUDA 1OIUA 3EMGA 4KUJA 1W93A 5AUWA 4BCPA 5TOZA 2FPGB 2DZDA 4NYEA 4ID7A 2XZSA 4LYNA 4ERWA 4I5PA 4IWQA 1KJ8A 5H80A 3QTZA 3CQUA 3PY3A 4V0GB 5DMXA 5E8VA 1QMZA 4WNMA 3RHXA 5KMNA 3Q2OA 3COHA 3E92A 3WZEA 3DTCA 4CFFA 5FGKA 3BWJA 2QOFA 5HU9A 3OZ6A 1WFCA 2CNVA 3GFEA 1XH4A 3AOXA 4IEBA 4EHEA 3KXMA 2VTRA 1W0XC 3FZ1A 3ORPA 4FL1A 4YZBA 1KWPA 5KZ0A 3VUIA 1PXMA 4YJNA 1YKRA 5I9XA 5HLWA 4BICA 4YJ2F 2FPPB 3BI6A 4M14A 4AP7A 3UC4A 1NVRA 1M7NA 3SW7A 1K3AA 2QK4A 3UPXA 3KU2A 3IECA 5CSVA 3SG8A 3UE4A 4D2RA 1OKVA 2XM8A 3ANQA 3QYWA 2WQNA 2XEZA 3MV5A 3R7OA 5IUIA 3ZCLA 1WVWA 5KHXA 4EHGA 1EUCB 2JKKA 4BGHA 2PVPA 3VA7A 1IOVA 3P7CA 1JKJB 2WQMA 2J5FA 3RAWA 2IW9A 3KN6A 5BUIA 2CN8A 2CGXA 2I0YA 3MYGA 4JBVA 5EFQA 5LMKA 2XVDA 5C8NA 4U42A 1ZXEA 3CEKA 3QA8A 4XYFA 4RGJA 4W4XA 4U8ZA 3R71A 5H8GA 1E9HA 4FTTA 5M57A 3U9CA 5CU6A 4DH1A 1WBPA 4AA5A 3EJ1A 4F08A 4M68A 1E4EA 3P7AA 3FDNA 1Q5KA 4MX9A 3H9RA 3ORQA 1PHKA 2UUEA 5JRSA 4M69B 3EL7A 4JAIA 3RV3A 4ITIA 3QQKA 5CF6A 4YJSA 4MAMA 3GC8A 3CJGA 1FVRA 4DFLA 5JFSA 3Q5IA 3AC1A 3JS2A 2UW6A 4YAJB 4BCQA 4LM5A 4NWMA 4HVSA 4QMTA 4FT9A 1UKIA 5EDQA 3NW7A 4FBXA 4MKCA 2DS1A 4RJ4A 4RVKA 1S9JA 3Q4TA 4QTDA 2C0OA 3FI4A 3NNUA 5GINE 2X7GA 1YI4A 4FV5A 5DYJA 2YAAA 4FSMA 3R02A 2W5HA 3Q9XA 3TDWA 3DKCA 4W4WA 4CTCA 2I0VA 5E8TA 4MTAA 1IEPA 4O2BF 3VHKA 3QC9A 2JAVA 2W06A 4E5WA 2J0LA 2UW4A 4LGGA 1SVHA 4J8MA 4PWNA 2PZ5A 4RIWB 2HY0A 3RPRA 2ETMA 3TV7A 1GNGA 4EH3A 1XR1A 4I4FA 3NNVA 4M0YA 4DEGA 5HBRB 3D5WA 3MB7A 4FTUA 4OTIA 4U79A 5HD4A 5IDNA 4FFRA 3OEZA 5B2LA 1J7UA 1H0WA 2HELA 4D0WA 3DZOA 1IRKA 3NUNA 5L3AA 2HK5A 3ZDIA 3CQEA 5IEYA 3SA0A 1NT2A 4YJTA 4RRVA 2PY3A 2X6EA 2PVNA 5LMBA 3D14A 4X2JA 2H96A 2WMVA 5F9EA 2HW6A 1PKGA 2CSNA 4J95A 4AAAA 4C5CA 1OECA 2XNMA 1U5QA 4FEVA 4II5A 3RK7A 2WHBA 3M2WA 3C4FA 4E4NA 5AV3A 3VS7A 4JQ8A 1H4LA 4DFZE 3TNQB 2YZAA 3ET7A 4PTGA 4EH5A 3NMUF 3DF7A 2WELA 2AYPA 4EJ7A 3ZHPC 4YU2A 5DVRA 5HIBA 2B7AA 2VO6A 5CU0A 3PXRA 5KNJA 4XOZA 2W9FB 4U80A 5E1SA 4Q9ZA 1CMKE 3FY0A 3MPAA 3HNGA 4L42A 4C58A 3EQIA 4DT9A 5DI1A 1EZ1A 2QF7A 1Q4LA 3RNIA 3TWJA 2X9EA 3WE4A 2R87A 3CPCA 4UY9A 5H8EA 5CVFA 2C5OA 2NU8B 2HWPA 4BKJA 1Q3WA 2V55A 3QWKA 2YDIA 5ITAA 1H1WA 1W83A 4F1MA 4IDVA 3TDVA 3U87A 3QXOA 3H3CA 4FV8A 2GPSA 1R78A 3AMYA 4O7NA 2C6KA 4GJ3A 5DHJA 2CCIA 3HA8A 1H07A 4EH6A 2A0CX 2Q0BA 2JFMA 5DIAA 3MTLA 5DG5A 3TINA 4FX3A 4QMYA 2OZOA 3K5VA 3LMHA 4XBUA 4PDPA 3FXXA 3COMA 4E4LA 3NGAA 4BCGA 1A48A 3A8WA 2FSLX 3U9TA 5AWMA 3V01A 2I8CA 3CR0A 2CGVA 4JDKA 3GQIA 4WG3A 2R7IA 4PL5A 3I79A 4H3QA 3M11A 4FTMA 3DAEA 4PP9A 1Y91A 5AUUA 4MNEB 1JOWB 4QMNA 5IDPA 2JITA 1H25A 3GGFA 3MWDA 4QMMA 2BVAA 3QZFA 3EQGA 3F7ZA 3TACA 5FP5A 1U54B 4C4FA 1OL2A 5D9HA 3AW8A 3MY0A 4FKSA 2R7MA 2XCHA 3ANRA 4GU9A 4GVAA 2QU6A 4EOQA 3V4SA 4EOLA 3N4TA 2EU9A 1O6KA 5CVHA 5ICPA 4X3JA 4APCA 5HHWA 2A2AA 4YBZB 2B1PA 3NUXA 2ITOA 4J97A 3ZMMA 1UWJA 3OTVA 5FDXA 3FHIA 4FT5A 4I6BA 5HNBA 4E93A 4FKTA 3WBLA 4F9BA 4D58A 3SD0A 4BBEA 4EGQA 3U9SA 3I0QA 3LE6A 2PYWA 5E8SA 3KMWA 4JT3A 4MA5A 4FL2A 3KVWA 2VGPA 4XG8A 1QL6A 3Q60A 4W8EA 4O4LF 2CNQA 1MRUA 3MFUA 2PUNA 4BB4A 2F2UA 3R9OA 5IISA 2QG5A 2UW7A 2B54A 4FSRA 4FKOA 1BXRA 2VTNA 4QYGA 3LHJA 5FXSA 4ZJJA 5HO7A 4IZ7A 5M4UA 3WIKA 4K0YA 3IOKA 4UWYA 2W0JA 4G3DA 4KD1A 4ZS4A 2WTJA 1BI7A 3NWWA 3G8DA 3RTPA 2QD9A 3H0ZA 4HPUE 4IVAA 3RCDA 3VULA 4FVRA 4IM0A 4AQCA 4R3PA 1HOWA 3SVVA 2LGCA 3GU6A 4ZI7F 3R8ZA 2C3IB 3AXWA 3QD4A 4MXXA 1P2AA 3R2YA 3CS9A 4RJ6A 2BDWA 4UBAA 2BROA 4J98A 2WO6A 2VRXA 3U55A 5HICA 3GU4A 3ZUTA 4QMUA 4FUYA 4L3PA 3MVHA 4XX9A 3ZC6A 3PZEA 4C38A 4CT2A 4EOKA 3SGCA 4FG9A 4IZ5A 5HESA 2XS0A 1XH6A 3DFAA 4I20A 4W4VA 5EKOA 2Z7SA 3DK6A 4A9RA 4RWIA 4MCVA 4ZTQA 4ERKA 5EZYF 2XKDA 2XYUA 2VAGA 4F7LA 3GC9A 5M4FA 1TQMA 2PU8A 5GIPE 3R00A 2QR7A 5E90A 2VTHA 2QO9A 4EHVA 4TKSA 4CMTA 5CU3A 2BDFA 1J7IA 1ZMUA 5AA8A 4R7HA 2J0KA 3ODZX 3ZEPA 5E8ZA 3IW4A 2O63A 2BAJA 2OZAB 4EBWA 4L6QA 5J9YA 2W70A 3UO6A 2QNJA 5CWZA 2UZLA 3KRLA 3GP0A 3A4PA 4TWCA 1OPJA 2JKMA 1VYWA 4BTJA 4TYGA 3QQGA 2I40A 3UOLA 4D9TA 3R1SA 1Q8ZA 3MH2A 3TNWA 4DFUA 4EC9A 5J2TF 4QMSA 1RE8A 1UU8A 1XBBA 2W05A 2ETRA 3E87A 1M2PA 3FAAA 2J6MA 3BHHA 4QPAA 3KRWA 5AUYA 4HYIA 3F9NA 5JSMA 5JT2A 1VKZA 5AAGA 4WO5A 1URCA 5J9LA 1OIQA 4JQ7A 4P5ZA 3R9NA 2GHLA 2IO6A 3UVPA 5K4JA 1Q8UA 3FL4A 2GSFA 3RPOA 2VO3A 5HE3A 3LFEA 3MSSA 4GT4A 4KNBA 2VPQA 2V58A 4YJ3F 4A07A 1ND4A 2PMLX 4QPSA 1Z2PX 5JVLA 3FZRA 4DH3A 4FE2A 3UDBA 2X81A 3EN4A 4M9UA 5LWMA 2BZKB 3BU5A 4C59A 4HJOA 4F99A 2PK9A 4O0VA 4FK6A 3CTHA 4QQCA 4J53A 4OBOA 2C6EA 5HE0A 3MH1A 1CTPE 4APPA 3VNTA 4BIEA 3PP1A 2BRGA 4O27B 1Z2NX 2PUIA 4LQMA 4IB3A 4TPTA 3MPTA 3R04A 4JR3A 3AT3A 3F66A 3SRVA 3UGCA 3ZH8A 4TWNA 1KE8A 1YWRA 5T3QA 5JH7F 4LUEA 2PWLA 3CKXA 3WF9A 1H0VA 3GOKA 4ACDA 3RV4A 3PA4A 4BDJA 3HV4A 4F0IA 3AX6A 4YAKB 4RMZA 3GB2A 2VTQA 3FZSA 4TUYF 3G0EA 5HBHA 5KHWA 4PQNA 5EK7A 3BHTA 4U0IA 3TNPC 3ZC5A 2GHGA 2R0UA 2R3NA 3PDTA 1TKIA 5ANEA 2P2IA 4DLIA 1KJIA 2YM4A 5A4EA 4M12A 4RFMA 5IQCA 1JSUA 1Q99A 4V04A 3II5A 3WARA 2C6TA 3P5KA 3PJ8A 4FIFA 2OIDA 2QKWB 2Y8OA 4ZZOA 2CN5A 1BI8A 2A1AB 2X7FA 4JQEA 4YTHA 4BI2A 5DT4A 4S2ZA 3JXWA 4KSPA 3CLYA 1Q8TA 5ACKA 5KKRB 2WU7A 1V0BA 5KKNB 1OITA 2R3OA 3DKOA 5EKNA 3V5JA 4TTHB 3IGGA 5CU4A 4IC7A 5BVWA 3UIMA 4E73A 5AV4A 4IVDA 3VUDA 4DLKA 4E20A 4ZS0A 2YAKA 5BUEA 4AWIA 5LJJA 2PZPA 3ZBFA 2OFUA 1H1RA 3C51A 3COIA 1STCE 3SOCA 5EH0A 4DG2E 4EH7A 2QO2A 3ZUUA 5I4NA 3TUCA 1T36A 2YJSA 1KE5A 3QKLA 4PP7A 4UN0C 4J52A 5D10A 2IVSA 5DPVA 5L6WL 5JFXA 1Q3DA 2YCRA 3FMNA 4MV6A 2QG7A 3Q4CA 4BCOA 1KEEA 3OFMA 2NNWB 3KULA 5FTOA 3S00A 4F64A 1FBNA 3A8XA 3LFFA 3NUYA 4I6QA 4NTTA 4GG5A 1C30A 2V59A 1BUHA 2ERZE 1SCUB 2DIKA 2HIWA 1PXIA 2BHHA 2ZJWA 3D5XA 4QMVA 4J1RA 4CCUA 2YS6A 1FPUA 4F9YA 2WMWA 3ITZA 3RPVA 5EQPA 2P55A 5CA1F 2ITVA 3PVWA 3KAJA 4WIHA 2C0IA 4FKPA 2GLTA 5L8LA 4NIFB 3WE8A 2VTSA 4QQ5A 5ANJA 4IAIA 3W2SA 3AC3A 1O6YA 1YHWA 3QTQA 3DBDA 3E8NA 4GRBA 3HGKA 3PE2A 4FKJA 1KV2A 1UA2A 2R5TA 2R3MA 2VN9A 1DAWA 2QU5A 2FSMX 3SDJA 2BPMA 4J7BA 4PTEA 4FFMA 2J5EA 2R3RA 1KOAA 1OUYA 1XH9A 5AADA 2XD4A 5HD7A 1YRPA 2XEYA 1GIIA 3FMKA 3HDMA 3R1YA 3ZZWA 5IQIA 4K2RA 3UZRA 1SVEA 2IZRA 2ITYA 4FV7A 1PXOA 4NU1A 4TY1A 4J71A 4BIDA 5A6OA 4BZNA 3GBZA 4GV1A 1W82A 2OO8X 4O83A 4C2VA 3UIUA 2WKMA 2X39A 2XBJA 3IK3A 4HVHA 3MVMA 5AV2A 3VRZA 1YOJA 5EQYA 1X8BA 5JGBA 4JR7A 3C0GA 3SLSA 4ZXTA 4XLIA 3MVJA 4DG3E 4K6ZA 1GAGA 1LP4A 2XYNA 4L01A 4ZTRA 4ACGA 4IADA 1OKYA 2YN8A 2XNBA 3C5IA 3QHWA 4IQ6A 3U4WA 3RAIA 2DQ7X 4IH8A 3NYNA 4DGOA 3LJ1A 2R3QA 1CE8A 3NW6A 3PIZA 4Z9LA 4DTKA 5KMJA 3PA3A 4Y8VB 4RBLA 3VF9A 5HORA 5M51A 2WPAA 3EN7A 1F0QA 3NUPA 5LP6F 3ORNA 1PJKA 4JL9A 5C8KA 4BDAA 3QUPA 2BMCA 2X4ZA 4FOCA 4PDYA 3IDBA 4XBRA 4XLVA 5DR9A 4CTBA 4O4IF 2R3IA 3LJ2A 4BHZA 5CF4A 3P79A 3WF5A 5HZNA 5CEPA 2ONLA 5KBQA 3VJOA 3E62A 3ZLYA 3ZONA 2PVFA 1WMKA 3ZM4A 5D7VA 2GFCA 3GT8A 4O0YA 2RGPA 4X21A 3CKWA 4BTFA 4PY1A 4O6LA 2VWXA 3H9FA 3C4WA 3W8QA 2X8IA 2PPQA 5A9UA 3I81A 3TTIA 5JQGF 4NW6A 3LLAA 4XG4A 5J8IA 2DLNA 4NL0A 2REIA 2Y9QA 3F3ZA 3OC1A 4AGCA 3F3UA 4LV8A 3QTIA 2AC5A 1SZMA 1BMKA 3PPZA 4EI4A 3G90X 4QTBA 1JPAA 3AC8A 1ZARA 3OF0A 3VS1A 5CZIA 3EQHA 3F5XA 5AUXA 1P5EA 2J50A 3MB6A 4MXZA 2NP8A 1GZ8A 2HOGA 4R3RA 3IQ7A 1Y6BA 3Q32A 3D2IA 1GIHA 4G5JA 3FLQA 3CD8A 3AT2A 4L8MA 4O7ZA 2F9GA 4C37A 3DJ5A 3GCPA 4L45A 3IKAA 4EUUA 2BZJA 4BYIA 3UMWA 3Q5ZA 4G6LA 4DEEA 2LAVA 2FGIA 4FNZA 5GONF 4IZOA 3TZ8A 5JZJA 3FQHA 3B8RA 3NSZA 5IH5A 3V8TA 2W5BA 5LVOA 3U6HA 3ZFYA 2GNLA 4HGSA 1WAKA 3EYHA 4M7IA 5C26A 4BDKA 3DKGA 3EZRA 3VUGA 5KO1A 2R86A 3LFAA 2XF0A 4KSQA 2WXVA 4WBOA 5EI2A 1Y8YA 2VR1A 3R0TA 4X3FB 3CXWA 4YLKA 4A7CA 4ANLA 5HNIX 4DEAA 3QFFA 4BDIA 4RX7A 4YZNA 4EJNA 2R9SA 2JIIA 2VU3A 4PUZA 4S34A 5LCKA 4B99A 3MBLA 3UQCA 1JLUE 4AFJA 5DEWA 4F7JA 2NUAB 1OL1A 3EQDA 2HAKA 4O84A 3VVHA 1GZKA 4YTFA 3QRIA 4B8LA 4F0GA 3OD6X 3RJCA 1OL7A 2RG5A 3HAMA 3N51A 3HBLA 5EHOA 1BLXA 5H3QA 3E5NA 1XHAA 3ZLXA 3BYSA 3K5HA 1DI9A 4AX8A 1K2PA 3AD6A 2W5AA 4I93A 3VUMA 2W1EA 4NFMA 3QGYA 3K54A 5DNRA 2J4ZA 4P2KA 3R8MA 2HENA 2OBJA 4QTEA 2OICA 4HCTA 3UYTA 5HVKA 3FI8A 4MD8E 3VS0A 4YNOA 4ZLZA 3OT8A 2BIYA 5CQUA 2QHNA 3AMAA 3HMIA 4FEUA 4NFNA 3UP7A 5HX8A 2VQDA 1FMOE 3GOPA 5IQGA 3IW8A 3BZ3A 2XCKA 3HX4A 2G2IA 1B39A 4EH4A 3JZIA 4HCUA 4FV9A 3I12A 3MS9A 3V04A 3QYZA 3AQVA 1ZMVA 4C34A 4ZSAA 2PZYA 2HY81 4I0SA 3NZ0A 4PL4A 4XUFA 1WBOA 4NTSA 3TZMA 4QRCA 1URWA 2QLQA 2X6DA 4FVPA 2FP4B 1YQJA 4NKAA 4ZY5A 4FNYA 2B53A 4G3FA 2R64A 5E92A 4MWIA 1Z57A 1ZOHA 2PVYA 3FLSA 4XOYA 2VWBA 2UVZA 5M4IA 5A4QA 2I7QA 1AUXA 1UU7A 3OWPA 1M0WA 4CV9A 3O8TA 3R8PA 2I0HA 4KBKA 4YBKA 4CXAA 4G5PA 4USEA 3SHEA 4MYGA 4JBOA 4XV2A 1ATPE 4F09A 3EQFA 5JN2A 5J1WA 2BDJA 3W2OA 2OXDA 1VBGA 4YJOA 3MW1A 3FSFA 2W71A 3MY1A 3PRFA 4FTLA 2YM8A 4U41A 5GHVA 2VTMA 3U6IA 1PMVA 3NUSA 2IZSA 4QP9A 4IAYA 4CG8A 4IHJF 3LFSA 3P0MA 3PTGA 2XK4A 5H9BA 4C3FA 3E64A 1VYZA 3ELJA 4L1KA 2GS2A 2XKFA 1PXPA 3KY2A 2IW8A 3NR9A 4OTGA 3A99A 4ZMFA 4KBAA 2C5NA 1H8FA 4PRJA 3BV3A 4PMTA 2Y4PA 4I4TF 3BE9A 2RIOA 5M06A 2XNNA 2YWPA 3WZDA 2ITQA 3EFWA 4I5CA 3DXNA 2PE0A 3E3PA 1W84A 3SV0A 3ZZEA 3A60A 2ZB1A 2YCSA 1Y57A 5EOLA 2HJWA 3OUZA 4MXYA 4BHNA 5KKRC 1KJ9A 4D9UA 2WQOA 2ZV7A 5JZNA 3C0IA 4KKGA 2QLUA 4N4SA 4H3PA 3UC3A 1PXNA 4RWKA 1GGOA 4J96A 4AU8A 3ZSGA 4FZFB 1B6CB 3JRWA 3OROA 1OIRA 4U44A 4E26A 3FLWA 3FZPA 3T9TA 3QGWA 3HDNA 4QYEA 4B6LA 1ZOEA 4WUNA 3BBTB 3R2BA 4XCUA 5HCZA 1ERKA 2CJMA 4DH8A 3SE7A 3ORRA 5C1PA 3JYAA 3QKMA 4R1VA 2QOLA 3EIDA 5ANDA 3ZS5A 1ZWSA 1U46A 2J0IA 2J9GA 3FLNC 3PYYA 4FYNA 3Q04A 5ANGA 4QP6A 5EW8A 4WOVA 2YRWA 2R82A 4E6CA 4MA0A 4X2KA 2ZM4A 3KKVA 4HNIA 4ACMA 2PN1A 3OXTA 4CLJA 3I1AA 3FBVA 3W8LA 3R1NA 2DWCA 4O2PA 4RC3A 2IVTA 2PVMA 4LOQA 4AW2A 5FDPA 4X2GA 3U8WA 4M84A 4GSBA 2YERA 3MFSA 2XNPA 3FE3A 3PVUA 4JDIA 1VBHA 3O96A 3QZHA 2OG8A 4MNEA 2W6QA 3IGOA 4DYMA 2YDJA 5DR6A 3V8SA 5AV0A 1Y6AA 3OUNB 4MXCA 4E4TA 2OJIA 2W6NA 1IAJA 3LCDA 3PXFA 3A7IA 5AX3A 2JIUA 3QQFA 3TV4A 2X8DA 3RM6A 4BR3A 4HGLA 4UWCA 3VMMA 5CS6A 3V5LA 3EQPA 4NT4A 4FNXA 3W1FA 5A4CA 5DRDA 5AM6A 5H2UA 4KB8A 4R5YA 3I0OA 2QVSE 4IVBA 4L3JA 3OY3A 3OUUA 4U3ZA 4EH9A 2J9MA 2UW5A 4IX5A 4RIOA 3G6GA 4U6RA 4ZY4A 2AUHA 1I44A 3FPMA 4FG7A 4D1SA 3T8OA 3RWQA 5AP4A 3DJ7A 3NLBA 2EB3A 3S2PA 2YM7A 4DBNA 4YPDA 2YIWA 4R77A 3R7YA 1TQPA 3VQHA 5IA0A 1R0PA 3HKOA 4FFLA 3GNIB 2IP4A 2QOOA 4IMYA 1MUOA 2DYLA 4J99A 5FXRA 1SNUA 1H26A 2YJRA 4XG9A 4YGAA 3QCYA 3HMMA 4K9YA 2CGWA 4Y83A 5CF8A 5E9EA 5KX8A 3UJGA 4HCVA 4C5AA 1B6RA 4UB7A 3OW4A 1EUDB 3FXWA 4JOAA 1YXVA 4TW9A 5LMAA 3QHRA 4YLLA 3DLZA 3K5UA 1KOBA 4AACA 1ZRZA 2XCLA 4JDJA 4L00A 4O2ZA 2XMYA 5IYZF 4LRKA 2PZIA 4O7WA 4H36A 4M0ZA 5C4LA 1KBLA 2UVXA 4N70A 4CKRA 4LI5A 4O7TA 5EHYA 3C4XA 5E1EA 3HEGA 5BQ0A 4ANQA 1Q97A 3JVSA 2YZMA 3RWPA 3VS5A 1MRYA 2QOQA 2R3HA 3A7JA 3BLHA 2F4JA 2B9FA 3R30A 4NJ3A 2WMQA 4IB1A 3BEAA 4G3CA 3R9DA 3BCEA 3GVUA 4D28A 3WF6A 4WNPA 2OF2A 5CF5A 5AA9A 1WVYA 2R7BA 4A9UA 4DH7A 4EYJA 5T68A 2F7ZE 1AQ1A 4EQMA 4FV0A 4WD5A 3O2MA 4FTRA 2BFYA 3NYVA 2YHVA 1JVPP 2C5XA 2BZIB 4ZJVA 3QUEA 2WNTA 5DRBA 3T3VA 1J91A 3A7FA 3KF4A 4FIIA 4M8TA 5ANIA 4LL5A 5IQAA 1Z2OX 4YC8A 4CFNA 4MD9E 2PUPA 2HCKA 3JY9A 2OZAA 4ZSJA 3U4UA 3HP5A 2WTCA 4D2SA 4EEVA 4DBXA 3CIKA 1BKXA 3LFNA 4IANA 3Q3BA 1AUVA 3IDCA 2EXCX 4MEDA 3HMNA 4BI0A 3PG3A 1XH8A 2OXXA 4EOPA 5IQFA 3OW3A 4AUAA 5GJDA 1UNLA 3ERKA 4B4LA 2BRBA 2VTIA 2UZDA 4RIYB 3BQCA 2P0CA 3GENA 3CTJA 3QLFA 3LXNA 1VZOA 3HUCA 4JG8A 5CI7A 1ZOGA 3JR1A 3HP2A 4AA4A 4C4JA 3AGMA 5C1OA 3UQGA 4DEDA 4L52A 5GJGA 2ZV2A 5LXTF 4R6VA 5IEVA 4W8DA 2YDKA 4FG8A 2CNUA 2BALA 3RP9A 3C50A 4BTKA 1FQ1B 1JQHA 1SYKA 4NK9A 4YBJA 5CEQA 3OWKA 3WYYA 1SMHA 4GK2A 3VWAA 3F5GA 1FGIA 3LXKA 2YZLA 3C4ZA 3RMFA 3BHVA 3LW0A 3VHEA 4GEOA 1YHSA 1VR2A 4ZHQF 4XS2A 2IZUA 5IUGA 4GUEA 3CY3A 4R3CA 2VNYA 2VWZA 2FA2A 2YZGA 3TUBA 4U43A 5K9IA 4Q5EA 3MJ1A 4BBFA 4Y73A 5FEEA 2WTKB 2JDVA 3IDPA 4Z16A 2A19B 2XK8A 5ETAA 4LRMA 4DFYA 4F65A 4FFPA 1H1SA 2I1MA 2A4LA 3B8QA 4D0XA 3VS3A 2J90A 1UNGA 4IWOA 2F7EE 3LMIA 4FKQA 2CDZA 3PJ1A 4ENXA 4IM2A 4PV0A 3H10A 4O0RA 3E8CA 4HNUA 3QRKA 5M4CA 4XG3A 2JIVA 1NXKA 4FVQA 2ITPA 4Y5QA 2XIZA 4U45A 2BRMA 1I7LA 3P23A 3R1QA 3HAVA 4O2AF 2W99B 3C7QA 3CD3A 3R63A 1OB3A 2Y6OA 3DKFA 2I87A 4UZHA 5HIEA 4UALA 1OKWA 3OVVA 4AXAA 3JRXA 4O81A 5AP6A 4FEXA 3EQBA 4OLIA 4AFEA 5A4LA 3D15A 3UYSA 4MV4A 2W1DA 5DT3A 1WCCA 4FKWA 3BYVA 3W18A 4ASDA 4AZWA 3UQFA 5DGZA 4EORA 3TIGA 3W16A 4FTOA 1CSNA 1H1PA 4HNFA 2GNIA 3MI9A 5LVNA 4TYEA 5GJFA 2E9UA 4MV9A 4EC8A 3VQUA 2OWBA 2XK3A 4FSZA 4EG0A 2VTJA 1WBTA 3R22A 4UYNA 3P1AA 3GLKA 4DGNA 3MIYA 5B7VA 4YC6A 3QQUA 1PMNA 2UZNA 4PL3A 2J0JA 4GIHA 1DV2A 1OL5A 4GT3A 1G8AA 4ZIMA 2XNEA 2ONLC 3U9NA 5AIRA 4ASXA 2YZNA 3KREA 2C3LA 5ETFA 1FVVA 5HV6A 2Y4IB 4C3PA 4AGDA 5JGDA 3UZTA 5E8YA 1U4DA 2GTNA 5DA3A 1IA8A 5F95A 1A9UA 3KCKA 3O7LB 4CRSA 2XIYA 3FUPA 1UU9A 5EDRA 4D4VA 2JD5A 3DXPA 3U54A 4DIMA 3G51A 1LEZA 1UWHA 2ZV8A 3BYOA 4HYHA 3L8SA 1NW1A 3RAHA 3KF7A 2OJFE 1KUTA 5C27A 3DAJA 3G9NA 3VIDA 4NW5A 1ULZA 4O7VA 4ZTLA 4DTAA 4EKLA 3QRJA 4HPTE 2W4KA 3EN6A 3LKMA 1YWVA 4L9IA 2OJJA 2YEXA 3UIBA 5TO8A 2Z8CA 4P90A 2H6DA 3R21A 2BUJA 3PJ3A 1B38A 2C6LA 5AP1A 1JLLB 4PMMA 2RFEA 4JX3A 4CMOA 2NU7B 3GC7A 3PY1A 3DCVA 4L7SA 4TNDA 4CFMA 4LV5A 4ENYA 3HV5A 5CSWA 2YIQA 5CAEB 3UOHA 3QD3A 3I7CA 1Q8YA 3AD5A 4MD7E 3D5VA 3LCKA 3R7UA 1CQIB 2PVRA 4XV1A 4IJPA 2W1IA 2I80A 5FEQA 3FMMA 5B2KA 3ZO1A 4C3RA 3BPRA 2OH0E 2YACA 1RJBA 3DK7A 5TR6A 1RDQE 2ITZA 3RK5A 5DOSA 4TL0A 3MH0A 4C4HA 2IJMA 3V6SA 2VX3A 3TKIA 4ZAUA 1VJYA 4MHAA 3TJCA 3DV3A 4BCIA 2WQEA 3BX5A 4ONAA 4RX8A 4BC6A 2YM5A 4H1JA 4QMXA 3ETAA 4C2WA 4XG7A 4F6SA 4YUQA 3HYHA 2C68A 3RGFA 1ZYJA 4RX5A 3BYUA 2RFSA 2ESMA 4OTQA 1UU3A 4UZDA 2XJ1A 3HRBA 3R7EA 3DTWA 4IB5A 4XRJA 1XQZA 2PHKA 2WEIA 3QTXA 4RZVA 2QR8A 1PY5A 5D41A 1PKDA 2PSQA 4IJ9A 4XRLA 4MAOA 1HCKA 4U3YA 4I5MA 3VS6A 4E7WA 4EKKA 2W6MA 3DY7A 2QHMA 1OUKA 1OPKA 4CFUA 4E6DA 4IZAA 4YO4A 4RVMA 1YDSE 1YW2A 4IX6A 4EQUA 5JH6A 4Y8DA 4AW0A 2JC6A 5F4NA 4CFXA 5IZFA 1NY3A 4DCEA 2C5VA 3QU0A 5D12A 3AC4A 3VJNA 3Q1KA 4C62A 4BGQA 3VS2A 2O8YA 5CT7A 4DEHA 3AT4A 1M0TA 5IA3A 2V7OA 5IH4A 4UXQA 5KE0A 4L3LA 2ITXA 4HVIA 2CPKE 3QA0A 3EL8A 2WB8A 2VTLA 4N57A 4OBPA 4DITA 3MJFA 2F2CB 4GMYA 4N6YA 4AOIA 4TYHB 3HB9A 2CMWA 2JGZA 5CLPA 4FKLA 4KS7A 1IASA 2UZBA 5AP2A 4Y46A 4QTAA 4CKJA 2GPHA 3IW6A 4RX9A 1P14A 2VWIA 2ZOQA 5JQ5A 4AT5A 4V05A 2YW2A 4WT6A 1MP8A 3G0FA 4NH1A 1T46A 4D1ZA 2C1AA 5GIOE 5C9CA 5FUTA 1M17A 4QP1A 2PE2A 4O0WA 3FPQA 2R7LA 4FK3A 1LR4A 1ZLTA 1OIYA 1JKLA 3QAME 5IF1A 3AG9A 3MA6A 2X0GA 3A4OX 2W6OA 2OIQA 3EYGA 1ZMWA 4I0RA 5C4KA 4RQKA 3QALE 1JSTA 3R7VA 4ANMA 3TNIA 3DBFA 4KIPA 4F4PA 5CSHA 4AOTA 3E63A 3RFCA 1YDTE 2HWOA 3O0GA 3UG2A 3VBYA 1DM2A 5F20A 3ZXTA 5EDPA 2OJGA 4A4OA 2GNFA 3PA5A 4O0XA 4RQVA 3BE2A 3KFAA 4DHFA 5I5ZA 3Q4UA 3HO8A 1OZ1A 3Q96A 4OT6A 3SW4A 5BPFA 4RFYA 5CAUA 2J7TA 4F7SA 3C9WA 2OLSA 4X3FA 5TT7A 2BTSA 3VBTA 4TWPA 3I4BA 1XJDA 3GEQA 3O23A 4Y5HA 4DEIA 4DINA 4HGTA 3WYXA 5FNVF 2F57A 4GYIA 4QMOA 4EK4A 5EOBA 3EZVA 3KEXA 3THBA 3V3VA 1GSHA 3ETHA 4YURA 5I9ZA 1PF8A 1GSAA 5LYJF 4ZTHA 4S32A 2ZAZA 3ORMA 3NYXA 3KXZA 4YJUA 3R5XA 3UVQA 1GJOA 3QF9A 2X2MA 1R3CA 1YDRE 2XIKA 4A9SA 5BYZA 3ORTA 4FR4A 4ZSEA 5IA4A 4K1BA 5BMMA 1SM2A 2ZDUA 3WO1A 1ZYSA 2VD5A 2JBPA 4FUXA 5DWRA 4BDFA 4C35A 5JK3A 1JSVA 1KJQA 2VZ6A 5DLSA 5CY3A 5CXZA 4X2NA 1PRYA 2Q0NA 3NYOA 3TIYA 3G8CA 2C6OA 3HMPA 3F3VA 1JWHA 3IW7A 4FV1A 2X8EA 3UVRA 4GK4A 5AUTA 5IMXA 3BU6A 2WIHA 5C8MA 4CFVA 4I1ZA 4CGAA 4FSNA 5HKMA 1KSWA 3I7BA 3OOGA 4YZDA 4MV1A 5J87A 3GCQA 2XRWA 3QCQA 4DFXE 3NPCA 4XG2A 3KGAA 4XMOA 4EH8A 5KMLA 3P4KA 3DS6A 3BU3A 3V5PA 2Z02A 4YB8B 4KABA 3TZ7A 2BHEA 4QOXA 4UX9A 2IN6A 5DN3A 4S30A 5FTQA 2ZMDA 3UFXB 1FINA 4WA9A 3TKHA 4BDCA 4DN5A 2BR1A 5H8BA 3ZYAA 2F7XE 2FSOX 5A46A 5CAVA 3UG1A 4AN9A 1OKZA 4IAFA 4FYOA 4CZUA 4NSTA 5HCXA 2Z7RA 3PVBA 3OCTA 5HG5A 4BCKA 4QQJA 4IX3A 2HZIA 5IMEA 3QTSA 1L8TA 2Z60A 2WMXA 2GHMA 2B9HA 3FQEA 5DT0A 3R7IA 1OGUA 2CKQA 4YSJA 4H39A 3H4JA 5AV1A 3ZOSA 4D55A 4H58A 3VBVA 1CDKA 3TKUA 4EZ3A 4F0FA 4NM5A 4PNIA 4IWDA 4E4MA 4EUTA 4AGUA 4JLCA 3V5TA 5JQ8A 3OBJA 3G9LX 2WFYA 4JXFA 3E88A 4OT5A 5HBEA 2WAJA 5LARA 4W4YA 4FKIA 5CNNA 3TI1A 3ZXZA 4WRSA 3D83A 4BVUA 3BQRA 3K2LA 4K33A 4B8MA 2YABA 1OBGA 3PIXA 1SNXA 4G2FA 3L9LA 3RHKA 1M7QA 3OUKA 4FGRA 4RG0A 3U6JA 4FV6A 3T3UA 4QT1A 4A4XA 2UW0A 4O82A 4GCJA 3R83A 3DT1A 3DB8A 5HIDA 3LWBA 3ZRLA 2WD1A 3CPBA 3ROYA 3S4QA 4UXLA 4C02A 5JRQA 4Z7GA 3VBWA 3QCXA 3CY2A 4D1XA 5JFWA 1DV1A 3PWYA 5LCJA 2XRUA 4JIKA 4G34A 4FTJA 2R3GA 3SOAA 3R5FA 2VWVA 4XV3A 3QTUA 5CU2A 2BZHB 1AD5A 5BX0A 3HRCA 4CG9A 2H8HA 4FKUA 3WZKA 5AP0A 1QPEA 2WOTA 4DGMA 3UOJA 2JEDA 3D0EA 5FLFA 1YHVA 3FHRA 4XNEA 3D4QA 5L8JA 4BCMA 3SXSA 1IOWA 3P08A 2C4GA 2NPQA 2Y4IC 1RW8A 2FSTX 3JY0A 1FOTA 3NRMA 4IW0A 5CT0A 4QP8A 4BZOA 3TIIA 3V4ZA 3PJCA 5K5NA 1GZOA 1H27A 2P3GX 4V0GA 3QRTA 3ZFXA 4O96A 3C4EA 4BZDA 5A54A 3FC1X 3BG5A 3BV2A 2G1TA 1LPUA 3MTFA 4M13A 2Y7JA 4EH2A 4LOPA 1M2RA 4EOJA 4F9AA 2WMBA 3ORLA 4X0MA 4XYLB 5DEYA 4RIXB 4DH5A 4JRVA 5CX9A 4ZK5A 5J7HA 4NZWB 4O0SA 3MFRA 1Z9XA 3RCJA 2P4IA 3PZHA 3OP5A 3PLSA 2HXLA 3GCSA 4XP2A 5I9VA 1DIKA 2IVUA 1NVQA 3KULB 4CKIA 1W8CA 1ZZLA 5J5SA 3KMMA 2CCHA 4AN2A 4CLIA 1DS5A 2IWIA 4RC2A 4YJQA 3LLTA 4UYAA 1VEBA 4G9RA 3DOGA 4QMQA 4F9CA 2XK9A 2CLQA 1CKJA 5BVFA 4PDSA 3F88A 4D4YA 2XJ2A 4JG6A 3S3IA 1L3RE 2UW3A 4U97A 3IO7A 3BRBA 4RA4A 1JAMA 3KMUA 5AM7A 3BHYA 3TM0A 2B9JA 3D94A 3DGKA 2W1HA 4NM0A 4ZP5A 3WOWA 3LCOA 1FMKA 3GC0A 3QZIA 5CEIA 5M53A 3P86A 4C0TA 3G15A 3FL5A 2QO7A 3OWJA 4FV3A 3QX4A 4ITJA 4G6OA 2C6MA 4FC0A 4FIJA 4XP0A 5T6KA 3RPYA 4D5KA 1V0OA 3VW8A 2UZOA 4QMLA 1G5SA 1WZYA 5I9UA 5M08A 4KAOA 4PTCA 2X1NA 4LL0A 4U5JA 3EKNA 2QOBA 2ZDTA 2DWBA 2XNGA 3F2NA 4BDGA 4IFCA 4XX0B 2O5KA 3UZPA 4ZOLF 4KINA 1YI3A 4KKHA 2X2KA 1MQ4A 4F63A 5JFVA 3PVGA 1R1WA 3EFLA 3QQLA 3BELA 3HV6A 4AW1A 4OTHA 3QWJA 3E5AA 3O50A 3MWEA 4FV4A 2J0MB 4I22A 1H00A 5EM5A 2FO0A 2X9FA 3DJ6A 4I55F 4NUSA 2JAMA 5A4TA 5E91A 2CGUA 4F1TA 1JKTA 4R1YA 4RIWA 3PPJA 3TTJA 4G3EA 5A14A 5CEKA 2ZM1A 4TWOA 3ALNA 2WTVA 3CGFA 4CZTA 3S0OA 2XH5A 4C7TA 2VUWA 2SCUB 2PTKA 4NCTC 4DT8A 4GG7A 3UBDA 4PMPA 2X0SA 5CA0F 2XUUA 2YM3A 3OMVA 2Z7QA 3D7TB 4Q2AA 4WRGA 4XJ0A 4PNKA 5IG1A 3QQJA 3NEWA 3DU8A 2ACXA 5HI2A 3G6HA 4HW7A 4O4JF 5FXQA 4D4RA 2WTWA 3HMOA 4M15A 3NNWA 2ETKA 4ITHA 3MIAA 1KJJA 4IE9A 3Q9ZA 4FT0A 5BNJA 2BIKB 2ZDQA 2WMAA 2YIYA 1Q62A 4AE9A 3DBQA 4JBPA 5KUPA 4QMPA 3PSBA 4E8AA 5J2UF 3NIEA 4GKHA 2W1CA 4EL9A 3F6XA 2X4FA 3GCUA 3MVLA 1M6VA 3W55A 4F70A 3VUHA 4CT1A 5K3YA 3ZO2A 4TV8F 2G15A 4F7NA 4L44A 3FY2A 1BL6A 3W32A 4QP7A 4TYJA 4NKSA 3TQTA 1YOLA 2J2IB 4HZRA 3N4UA 4E4XA 5KMIA 3VRYA 4DA5A 2YCQA 3KAKA 3CC6A 4KA3A 4JBQA 4FSQA 5CZHA 1YVJA 2YWVA 3AMBA 2V5QA 3CSVA 3DDQA 3PFQA 5E4HA 1DI8A 5E7RA 3ULIA 4AT3A 1XH5A 3POZA 1M14A 4FODA 4BDHA 3I6WA 1OI9A 3EN5A 4ANSA 3UIXA 5D11A 4QNAA 4CQEA 2GQGA 5G1XA 5IU2A 2OF4A 2UW8A 4X7QA 5JMSA 3ORZA 4RIYA 3MN3A 3CTQA 2C69A 3MA3A 4KRCA 5EI8A 3TCPA 4YR8A 4EQCA 5EM6A 3UPZA 3TJDA 4BCFA 1QCFA 3O7LD 3R8LA 3E8EA 1OMWA 3LCTA 4QP3A 3RINA 3QQHA 2VTAA 3OOMA 3ETJA 4JAJA 4CMUA 4OW8A 4IFGA 5EQEA 2R3LA 2C3JA 3NIZA 3TUDA 4JIAA 5IA1A 1PYEA 2PZRA 1ZAOA 2OGVA 4AZFA 3FWQA 5D7AA 3L8VA 3QXPA 5EW3A 4EOOA 3MWUA 4JG7A 1W98A 5HE2A 4F9WA 1U54A 3P9JA 3IPHA 4DFBA 4Q5HA 3FMHA 3O8UA 4RVLA 4NJDA 5CYIA 4ZZNA 5G6VA 5LQFA 5CNOA 4FZAB 4BN1A 4EOMA 1REJA 1W7HA 2BAKA 2VO7A 4FKGA 3S95A 3NVKI 2QQ7A 4LOOA 4BIBA 4R7BA 4WBNF 3QLGA 3QKKA 2ZMCA 5LWNA 1Q41A 3TL8A 3BGZA 1J1CA 3FLYA 3LQ8A 4O91A 5AFVA 5J1VA 3ZRKA 4MV3A 3G5DA 3KQ7A 5FBOA 1Q24A 5HU3A 4FEWA 5CB4F 3HV3A 4WKQA 1QPCA 4LMNA 3W2RA 5JVDF 3BGPA 5JKGA 5BUJA 5AAEA 5CAPA 2Q83A 5IEXA 4FTKA 4NM3A 4Q9SA 3NCGA 4EOSA 2YL2A 4CD0A 3RAKA 4PX6A 3F82A 4XZ3B 3L8PA 3D2KA 2BRNA 3ROCA 5ETIA 2O2UA 3SKCA 3N8DA 3DQXA 2PUUA 5IQHA 3JZFA 3R23A 4GJ2A 3NVMB 4OTWA 4ASZA 1REKA 3RPSA 1CKIA 3F2AA 3MGYA 3C13A 1XBAA 2OIBA 2ERKA 4ZZMA 4EWQA 5IQBA 2G9XA 5EYCA 2PMNX 3MFTA 2YFXA 2VNWA 1CQJB 2P0AA 2NRYA 5TKDA 3F5UA 2E9PA 4YZCA 3TNHA 3I5ZA 4YPSA 3BIZA 2YIXA 4USDA 3K3JA 2GCDA 4ORKA 5L2IA 2AC3A 4I6HA 3FEGA 5FRIA 4KRDA 2QOIA 4C4EA 4I50F 2WYOA 1E1XA 1H24A 3V5WA 1YI6A 4JX7A 2B52A 4RJ7A 3FKOA 3S1HA 3RK9A 2RFDA 3E7OA 3M1SA 3DBEA 5CALA 3GU8A 4ZTMA 1J1BA 2GFSA 3EH9A 3MH3A 5CAOA 2VWYA 5AX9A 3EFJA 4I94A 4AF3A 2W17A 3HUBA 2VWWA 3W2QA 4OUCA 1H08A 2EB2A 3VO3A 5C1QB 1PXKA 2QKRA 2BKKA 3VBXA 1PMEA 2R7KA 4GVJA 5M56A 3A62A 4L46A 3TEIA 4CV8A 2E2BA 3FXZA 3D5UA 2V5AA 4HNVA 3OXIA 4RFZA 2WEVA 1CKPA 2EWAA 1PMUA 3KK9A 4KIOA 4ZY6A 4TV9F 3LFDA 4O6EA 2W1FA 5LVPA 3FQSA 1FGKA 3W2CA 2GU8A 2CLXA 4X6QC 4IHPA 2G2HA 2HZNA 4BI1A 2R85A 3TIZA 4YNEA 4H3BA 3ATSA 4C36A 4QSHA 1G3NA 4BYJA 1YXUA 5AJQA 3HECA 4RLKA 4YHFA 4AE6A 1TVOA 3I5NA 5M09A 3EB0A 1EYZA 4I24A 2V22A 3BHUA 3LM0A 4O7SA 4RSSA 2ITTA 3NDMA 5ACBC 3REPA 4AZTA 4FSTA 2W1GA 5M07A 4I41A 4GK3A 2C00A 1H28A 3LQ3A 4G31A 2ITUA 1E1VA 3LOKA 3VN9A 3R73A 1DAYA 3FKLA 1T45A 2GS7A 3GU7A 4JI9A 2VWUA 5C01A 2NU9B 4X3FC 2ITNA 1ZYDA 3M42A 3H0YA 4WNOA 5E8UA 4RPVA 2PVJA 2Z2WA 3ID6C 1K9AA 4JVGA 4AA0A 4GFMA 4D5HA 2WMTA 4FTNA 4WHZA 3LFQA 5AEPA 2YA9A 2C6DA 1IAHA 2FB8A 1OVEA 1WBVA 4G1WA 3TZ9A 3UTOA 2CKEA 2C6IA 5CVGA 3V5QA 3UP2A 3F61A 4TXCA 4FGBA 5LA6F 1QPDA 2XJ0A 1U5RA 3O71A 4FIEA 4IDTA 5HVJA 3SAYA 3O17A 4K77A 3COKA 4QMWA 1YXSA 4YSMA 3Q9YA 1PYXA 2RF9A 4FT3A 4FICA 1WBNA 3R28A 4FFOA 2JDOA 4P7EA 1B6SA 3KRJA 4G3GA 4QYHA 4L53A 2CKOA 2VO0A 3NAYA 5BMSA 2FPIB 4MBIA 2UZUE 4NCTA 1Q61A 2A27A 1HCLA 3FMLA 4L67A 1LUFA 1MRVA 2E9VA 4DEBA 4EONA 2UZTA 4XHKB 1YXXA 4G9CA 5EM7A 2FB9A 4TYHA 3NCZA 3OCGA 2R2PA 4O22A 2EXMA 2ZDGA 3KXXA 4GS6A 4LG4A 3FJQE 5EG3A 1CM8A 1JKKA 3UMXA 3EQCA 2BFXA 3L9PA 4XEYA 4CRLA 3ACKA 4EK5A 1UNHA 3LFBA 5DH3A 5L2SA 3VOTA 2R7NA 4PDOA 4ASEA 2IW6A 4ALWA 1BYGA 4C4GA 1IG1A 5CXHA 5HNGA 3BKBA 3LPBA 3ZM9A 2W9ZB 3F7WA 4FSUA 4WNKA 5AIKA 4PMSA 2O65A 3OCSA 4QTCA 4FKVA 4O0TA 4RC4A 4IAKA 5E8XA 4JRNA 2C3KA 5HTCA 4MH7A 3ENHA 3ALOA 1FVTA 2UZVA 3LFCA 3A7GA 4LFIA 5HG7A 3EKKA 1JKSA 4ALVA 5HQ0A 2KTYA 4ZSLA 5CQWA 4GW8A 4A4LA 2W4JA 4BCNA 5BMVF 2XA4A 4ACHA 2GPWA 2GQSA 2VTTA 4IVCA 5E8WA 3OXZA 2WU6A 3QD0A 3R8UA 2R84A 3RI1A 5IUHA 2HXQA 3DBCA 3N9XA 5CEOA 3VS4A 3CP9A 2I0EA 2XBAA 2RG6A 3OCBA 4H05A 4RJ8A 1XKKA 2O0UA 4MV8A 3Q53A 5AUZA 3DNEA 4MXAA 1IR3A 4U81A 4WUAA 4X2FA 4EZ7A 3HL7A 3PLAE 5HE1A 2NRUA 3NX8A 3QTRA 4V01A 3QD2B 3KL8A 4U7ZA 5EHLA 4E6QA 5J9ZA 3E93A 2XKEA 3F2RA 2X2LA 4TRLA 4C4IA 4WG5A 3IW5A 3OT3A 2OXYA 1YXTA 3MDYA 3RZBA 2BILB 5L2TA 4ZLYA 5HVYA 3VPCA 4P4CA 5M44A 3E7VA 2OW3A 2R3PA 4BDEA 1G8SA 4EWHA 2PE1A 3FZTA 5DBXA 5DR2A 4ACCA 2ZB0A 3U51A 2HGSA 3VPBA 1PXLA 2UW9A 3IG7A 4AS0A 3MESA 3ORKA 2W7XA 3OG7A 4R78A 3KB7A 4YJVA 4AG8A 5I9YA 4EK6A 4GKIA 4HOKA 3ZLSA 4U40A 5I0BA 3DFCB 3VBQA 4PF4A 4EZ5A 5IQDA 3FZOA 4L68A 1OM1A 4XV9A 3UO5A 4FOBA 4UWBA 1ZZ2A 5ANOA 1V0PA 5CSXA 2Z7LA 3A7HA 4O7YA 4YHTA 5DFPA 3ZRMA 5HBJA 3PXYA 1GY3A 2NO3A 3H9OA 4ZTSA 2UV2A 3EOCA 4G6NA 1F3MC 4ZLOA 4HZSA 3FLZA 2YM6A 3QBNA 1PW2A 4KKEA 4MBLA 4OGRA 4S33A 3RALA 3CQWA 2XK7A 4R7IA 3ATTA 3NS9A 4YHJA 4YMJA 5BPYA 3LP8A 3VUKA 3ZO4A 4BBMA 4K8AA 4BRXA 3R9HA 3ULZA 3ZU7A 3DK3A 4CCBA 1W96A 4EHZA 4Z7HA 2Z04A 1WVXA 3AC5A 4FIHA 3FV8A 2XNOA 3DQWA 5HLPA 4GUBA 5FEDA 2QI8A 2JDSA 2YIRA 2RFNA 4FV2A 3B2WA 5KMKA 2GNGA 5BYYA 2VV9A 4IZYA 5LVMA 3ORXA 4ZMEA 2YRXA 3K5IA 3AD4A 3QC4A 2OLCA 4DGGA 3R8VA 3RM7A 5HG9A 2DUVA 2B0QA 2GDOA 5B0XA 4DC2A 3LMGA 4FI1A 4YC3A 4ALUA 4I0TA 2PULA 3F69A 5FG8A 2FVDA 2FUMA 4ANBA 4ZQIA 3KXHA 3LVPA 4RJ3A 3MPMA 4GH2A 4RZWA 2NU6B 2UZEA 1GSOA 4FZ7A 3PRIA 1UV5A 1TQIA 2BCJA 2I6LA 2QOHA 3E3BX 3O8PA 3PG1A 2WMSA 3QUDA 2IG7A 3H30A 4FTQA 3L9NA 5FQDC 3WIGA 3WZUA 2PVLA 3LQ5A 1JDEA 1NA7A 4IB0A 5CSPA 2VGOA 5FD2A 3V6RA 1KE7A 2YCFA 3KRRA 5EYDA 4N0SA 3POOA 3SC1A 3AC2A 2SRCA 4MVFA 1C3OA 2QC6A 3FKNA 5AMNA 2R3KA 3PPKA 3CGOA 3MJ2A 4FMQA 4DGLC 4RWJA 4RVTA 4F1OA 4IX4A 2W4OA 4YLJA 4AOJA 5D8DA 4F6WA 5TF9A 4WBBB 4FA2A 5JEBA 1GLVA 2WGJA 2QURA 3A61A 4UV0A 5BVDA 4DE4A 5F94A 1BNCA 1WBSA 4GFGA 4M97A 5J95A 4RWLA 4QP4A 3Q6UA 3KN5A 2J51A 4EBVA 1JNKA 3OY1A 4Y72A 3RVGA 4O0UA 3K3PA 4HYSA 1I09A 2Y6MA 3BLRA 1O9UA 4MF1A 2B4SB 2PMIA 2JDTA 5AP7A 5IQEA 1YWNA 3GI3A 3I60A 3HV7A 3PY0A 5HEZA 3TN8A 4IAZA 3FYJX 3LZBA 4WSYA 4XH6A 3GQLA 3GUBA 3KC3A 3LM5A 1J7LA 4LMUA 4ZEGA 4DCAA 1PXJA 3ZLWA 5DE2A 4YJPA 4JJRA 3UNJA 3DLSA 3SG9A 3BWFA 3G2FA 3BBWA 4O21A 1F5QA 4MXOA 2YISA 4GL9A 4FTCA 4N6ZA 2ZYBA 3LAUA 1JBPE 3WI6A 1E4EB 1H1QA 5A6NA 3FMDA 3QCSA 4GYGA 4RIXA 3CCNA 1EHIA 4MK0A 2C0TA 3RUPA 4O7RA 1OL6A 2JDRA 2QOKA 2OH4A 3TT0A 2WMUA 4MV7A 3EN9A 3NAXA 3ZO3A 3QZGA 4K11A 4DAWA 3HVCA 4KS8A 1P4FA 3CE3A 3DNDA 2F49A 3GCVA 3N6RA 4XYMB 2PL0A 2WZJA 5L6OA 5CI6A 1XBCA 3W10A 4AW5A 5B2MA 5C8YF 1QPJA 2X7OA 5KX5F 5C03A 3UNKA 2P33A 4HVGA 1H01A 3FMEA 3W2PA 2V7AA 5FM3A 4HVDA 3PSDA 4QO9A 5EW9A 3LXPA 4F6UA 4HR7A 3Q4ZA 2GS6A 3ENMA 3R5HA 3LIJA 3QX2A 4O4HF 3D9VA 3W33A 4Z3VA 3IS5A 5GNKA 5FM2A 3RKBA 1XH7A 4CFWA 2UVYA 2JFLA
chains in the Genus database with same CATH superfamily
4U9AA 3DDPA 2B9IA 3EHAA 1IA9A 2C5YA 4YZMA 3SXRA 5HGIA 3KVXA 3N4VA 4FKRA 3D7ZA 3F3TA 5KZIA 2IZTA 3ZEWA 4MQ1A 5A3XA 5AAFA 5AP3A 3HLLA 4E1ZA 3KXGA 4M67A 5HO8A 3ZSIA 4C33A 3LXLA 3O51A 4TN6A 3C1XA 1ZY5A 2OI4X 3ORIA 2YITA 4PZ8A 3TY8A 2ZM3A 1RQQA 4ARKA 4QP2A 3KK8A 2HG8A 4QMZA 4FTAA 5CR5A 4MBJA 3DB6A 2B55A 2QCSA 4IWPA 5BPHA 4EOIA 3PXKA 3ZTXA 4GT5A 4FEQA 4LGHA 1I7NA 4JS8A 2ITWA 4FL3A 2GTMA 2XM9A 4DFNA 2WOUA 3FSKA 5LOVF 4L43A 4QYYA 2WTKC 4YTIA 5CAQA 5I47A 4GU6A 3GIDA 3FC2A 3L9MA 4FNWA 3ZSHA 3I6UA 3A2CA 4FSWA 5ANKA 4HYUA 1Y8GA 4BTMA 5KCVA 3KYHC 2PVKA 4L7FA 3SX9A 3TXOA 5JGAA 4FTIA 1ZY4A 2H9VA 4FFNA 4ZSGA 4A9YA 2E9NA 4D4SA 4IIJF 4E6AA 3JVRA 2CZGA 3D7TA 5IA2A 2PBZA 5KMMA 2HZ4A 3KALA 4FU0A 1U59A 2PMOX 3VC4A 5LOHA 1A9XA 4YZ9A 5BVNA 2FYSA 3EQRA 3R01A 4TZRA 3E8DA 5M55A 4C61A 4CEGA 5BVEA 3WNZA 5L2WA 2G2FA 4I92A 2BKZA 3Q52A 4FZDB 3WO0A 2VUGA 4E5BA 2XIXA 5D1OA 3EFKA 5LVLA 5LMKC 3SRVB 3DTGA 1EKFA 5BVOA 4S31A 1JDBB 3ML1A 3KRXA 4DLJA 5IPJA 4QYFA 1XMLA 3EWHA 3T9EA 5EYKA 3KCFA 3P78A 2WMRA 3DPKA 4I4EA 5HCYA 3DA6A 4XP3A 2EVAA 5CENA 1NVSA 5F1ZA 5KBRA 2GQRA 3PE1A 4FZ6A 4OTRA 5FP6A 2FH9A 3K3IA 4KIQA 1WBWA 4OR5A 1R39A 5CEMA 3OEFX 3B2TA 2W6ZA 1V1KA 4B0GA 5K4IA 2Y0AA 5JQWA 2GMXA 3UZBA 4BCHA 3QQMA 2R4BA 3GFWA 2GNHA 3IOPA 1GIJA 2C1BA 3NUAA 2HYYA 3SXFA 4XG6A 4AZSA 4BF2A 4HGEA 3ZUVA 2CHLA 2RL5A 2W96B 3MY5A 4IAAA 4KBCA 4DTBA 2VTOA 1A06A 1OPLA 3VF8A 2ZDHA 4H1MA 3ODYX 3WZJA 3FI2A 4YO6A 3P5JC 5L6PA 5HG8A 5K5XA 2H34A 5ETCA 4EQ5A 2OSCA 3JPVA 4RA5A 1M2QA 4RZQA 1MQBA 4LDTA 1M52A 3PXZA 4JNWA 4OTDA 4P5QA 2OJ9A 2QODA 3PSCA 4DHIB 4UEUA 4E5AX 4DHZA 2G01A 3JUHA 3GU5A 4YTCA 4ZTNA 4DF3A 4TT7A 4AXDA 4B9DA 4BGGA 4OTFA 3DZQA 3W5OA 4IACA 4MNFA 3HRFA 4BDBA 3F5PA 1R0EA 2ZV9A 5EI6A 3UNZA 5FBNC 3PJ2A 2ZVAA 2JKOA 3G33A 4YJRA 4B7TA 3BGQA 2V0DA 4OBQA 2R0IA 4O86A 2EUFB 4I6FA 1PX2A 3WF8A 4RJ5A 3W0PA 4Y95A 5AP5A 2OFVA 4FT7A 3UODA 3L1SA 1KV1A 3QTWA 2YS7A 4WG4A 2R3FA 4EK3A 3KXNA 2W1ZA 3BLQA 4X6RA 3R9RA 3ACJA 3PIYA 4CKBA 1APME 3WF7A 4FSYA 4DG0E 2WTDA 4K18A 1Q8WA 2XKCA 2V62A 2R3JA 2UZWE 3L8XA 1KE9A 2XIRA 1GOLA 4O38A 4YP8A 3WILA 1KE6A 2W6PA 3NUUA 3T9IA 3OTUA 2BTRA 5HX6A 3F3WA 2WIPA 1ZYLA 2QONA 4TYIA 5CANA 2VTPA 1KC7A 1LEWA 4I23A 4HQ6A 3C4CA 5AUVA 4C5BA 2P2HA 3C0HA 2OKRA 4TNBA 3HZTA 3V8WA 2COIA 4EGJA 1UVRA 1WR2A 4AZVA 2OK1A 3Q6WA 4AT4A 4AZEA 5HLNA 1KT8A 4MQ2A 3GXLA 4ME6A 3ZDUA 3OHTA 1XWSA 4ZJIA 3NNXA 5I60A 3OBGA 4A06A 3TV6A 4Z55A 3PXQA 3QRUA 3V51A 2HZ0A 4IM3A 1EH4A 4GIIA 2KULA 3DXQA 4FIGA 5KMOA 1PK8A 2YYAA 1P4OA 2RKUA 3SQQA 3LCSA 1YOMA 3ZFMA 4I21A 4QNYA 5EYMA 3VAPA 2JLDA 3ZBXA 1XO2B 2E9OA 3IONA 3OS3A 1UKHA 1Z5MA 4NM7A 3PUPA 3TG1A 1SVGA 5CTPA 1ZAUA 4KWPA 4RLLA 2O3PA 3KA0A 3QFVA 3VW6A 3T9FA 4EYMA 3CBLA 3DAKA 4MWHA 2BRHA 3AGLA 1B04A 3CJFA 3R6XA 4G17A 3BYMA 3WWIA 4BDDA 2HW7A 3PP0A 5LXMA 2XP2A 2XB7A 5K2MA 2OU7A 3Q9WA 3FI3A 1CS0A 3Q2MA 4IBMA 5E25A 1S9IA 2QOCA 3OWLA 5FTGA 4M3QA 3FMJA 1ZYCA 2BAQA 1EKPA 4Y85A 3P7BA 2O64A 4Q4CA 3Q2JA 5EM8A 2WQBA 4I5HA 2PVHA 2JBOA 4CVAA 2CKPA 5C8YF 3TW6A 1GZNA 4G16A 2C47A 4AGWA 3HA6A 2XK6A 5HTBA 2VX1A 4QQTA 1J3HA 4GFOA 4R5SA 4USFA 5I9WA 2HHFB 4E6NA 5BWXA 5BYLA 3PWDA 4A9TA 2IVVA 4JDHA 4BY9E 3C5UA 2WTIA 3NW5A 4LRJA 5IH6A 3QL8A 3UOKA 4I3ZA 4RT7A 3BEGA 4J8NA 4O7LA 4IIRA 2COGA 4EK8A 4HNTA 1BX6A 2JKQA 5D1JA 2VX0A 1AGWA 2C30A 3FYKX 4IC8A 4AN3A 5BVKA 5IA5A 4CSVA 2IPXA 4CNHA 5CASA 1O6LA 2GNJA 4ZOGA 1S68A 1OBDA 3LJ0A 3UO4A 4BCJA 5L8KA 1BL7A 4LUDA 1OIUA 3EMGA 4KUJA 1W93A 5AUWA 4BCPA 5TOZA 2FPGB 2DZDA 4NYEA 4ID7A 2XZSA 4LYNA 4ERWA 3NBYB 4RCNA 4I5PA 4IWQA 1KJ8A 5H80A 3QTZA 3CQUA 3PY3A 4V0GB 5DMXA 5E8VA 1QMZA 4WNMA 3RHXA 5KMNA 3Q2OA 3COHA 3E92A 3WZEA 3DTCA 4CFFA 5FGKA 3BWJA 2QOFA 5HU9A 3OZ6A 1WFCA 2CNVA 3GFEA 1XH4A 3AOXA 4IEBA 4EHEA 3KXMA 2VTRA 1W0XC 3FZ1A 3ORPA 4FL1A 4YZBA 1KWPA 5KZ0A 3VUIA 1PXMA 4YJNA 1YKRA 5I9XA 5HLWA 4BICA 4YJ2F 2FPPB 3BI6A 4M14A 4AP7A 3UC4A 1NVRA 1M7NA 3SW7A 1K3AA 2QK4A 3UPXA 3KU2A 3IECA 5CSVA 3SG8A 3UE4A 4D2RA 1OKVA 2XM8A 3ANQA 3QYWA 2WQNA 2XEZA 3MV5A 3R7OA 5IUIA 3ZCLA 1WVWA 5KHXA 4EHGA 1EUCB 2JKKA 4BGHA 2PVPA 3VA7A 1IOVA 3P7CA 1JKJB 2WQMA 2J5FA 3RAWA 2IW9A 3KN6A 5BUIA 2CN8A 2CGXA 2I0YA 3MYGA 4JBVA 5EFQA 5LMKA 2XVDA 5C8NA 4U42A 1ZXEA 3CEKA 3QA8A 4XYFA 4RGJA 4W4XA 4U8ZA 3R71A 5H8GA 1E9HA 4FTTA 5M57A 3U9CA 5CU6A 4DH1A 1WBPA 4AA5A 3EJ1A 4F08A 3TW7A 4M68A 1E4EA 3P7AA 3FDNA 1Q5KA 4MX9A 3H9RA 3ORQA 1PHKA 2UUEA 5JRSA 4M69B 3EL7A 4JAIA 3RV3A 4ITIA 3QQKA 5CF6A 4YJSA 4MAMA 3GC8A 3CJGA 1FVRA 4DFLA 5JFSA 3Q5IA 3AC1A 3JS2A 2UW6A 4YAJB 4BCQA 4LM5A 4NWMA 4HVSA 4QMTA 4FT9A 1UKIA 5EDQA 3NW7A 4FBXA 4MKCA 2DS1A 4RJ4A 4RVKA 1S9JA 3Q4TA 4QTDA 2C0OA 3FI4A 3NNUA 5GINE 4UCSA 2X7GA 1YI4A 4FV5A 5DYJA 2YAAA 4FSMA 3R02A 2W5HA 3Q9XA 3TDWA 3DKCA 2ABJA 4W4WA 4CTCA 2I0VA 5E8TA 4MTAA 1IEPA 4O2BF 3VHKA 3QC9A 2JAVA 2W06A 4E5WA 2J0LA 2UW4A 4LGGA 1SVHA 4J8MA 4PWNA 2PZ5A 4RIWB 2HY0A 3RPRA 2ETMA 3TV7A 1GNGA 4EH3A 3T9AA 1XR1A 4I4FA 3NNVA 4M0YA 4DEGA 5HBRB 3D5WA 3MB7A 4FTUA 4OTIA 4U79A 5HD4A 5IDNA 4FFRA 3OEZA 5B2LA 1J7UA 4FJVA 1H0WA 2HELA 4D0WA 3DZOA 1IRKA 3NUNA 5L3AA 3W0OA 2HK5A 1V9PA 3ZDIA 3CQEA 5IEYA 3SA0A 1NT2A 4YJTA 4RRVA 2PY3A 2X6EA 2PVNA 3BL9A 5LMBA 3D14A 4X2JA 2H96A 2WMVA 5F9EA 2HW6A 1PKGA 2CSNA 4J95A 4AAAA 4C5CA 1OECA 2XNMA 1U5QA 4FEVA 4II5A 3RK7A 2WHBA 3M2WA 3C4FA 4E4NA 5AV3A 3VS7A 4JQ8A 1H4LA 3TYKA 4DFZE 2XALA 3TNQB 2YZAA 3ET7A 4PTGA 4EH5A 3NMUF 1A0IA 3DF7A 4NZNA 2WELA 2AYPA 4EJ7A 3ZHPC 4YU2A 5DVRA 5HIBA 2B7AA 2VO6A 5CU0A 3PXRA 5KNJA 4XOZA 4AAYA 2W9FB 4U80A 5E1SA 4Q9ZA 1CMKE 3FY0A 3MPAA 3HNGA 4L42A 4C58A 3EQIA 4DT9A 5DI1A 1EZ1A 3W0RA 2QF7A 1Q4LA 3RNIA 3TWJA 2X9EA 3WE4A 2R87A 3CPCA 4UY9A 5H8EA 5CVFA 2C5OA 2NU8B 2HWPA 4BKJA 1Q3WA 2V55A 3QWKA 2YDIA 5ITAA 1H1WA 1W83A 3W0QA 4F1MA 4DHJA 4IDVA 3TDVA 4TM5A 3U87A 3QXOA 3H3CA 4FV8A 2GPSA 1R78A 3AMYA 4O7NA 2C6KA 4GJ3A 5DHJA 2CCIA 3HA8A 1H07A 4EH6A 2DAAA 3S24A 2A0CX 2Q0BA 2JFMA 5DIAA 3MTLA 5DG5A 3TINA 4FX3A 4QMYA 2OZOA 3K5VA 3LMHA 4XBUA 4PDPA 3FXXA 3COMA 4E4LA 3NGAA 4BCGA 1A48A 3A8WA 2FSLX 3U9TA 5AWMA 3V01A 2I8CA 3CR0A 2CGVA 4JDKA 3GQIA 4WG3A 2R7IA 4PL5A 3I79A 4H3QA 3M11A 4FTMA 3DAEA 4PP9A 1Y91A 5AUUA 4MNEB 1JOWB 4QMNA 5IDPA 2JITA 1H25A 3GGFA 1WRVA 4QMMA 3MWDA 2BVAA 3QZFA 3EQGA 3F7ZA 3TACA 5FP5A 1U54B 4C4FA 1OL2A 5D9HA 3AW8A 3MY0A 4FKSA 2R7MA 2XCHA 3ANRA 4GU9A 4GVAA 2QU6A 4EOQA 2ODTX 3V4SA 4EOLA 3N4TA 2EU9A 1O6KA 5CVHA 5ICPA 4X3JA 3PFYA 4APCA 5HHWA 2A2AA 4YBZB 2B1PA 3NUXA 2ITOA 4J97A 3ZMMA 1UWJA 1XMMA 3OTVA 5FDXA 3FHIA 4FT5A 4I6BA 5HNBA 4E93A 4FKTA 3WBLA 4F9BA 4D58A 3SD0A 4BBEA 4EGQA 3U9SA 3I0QA 3LE6A 2PYWA 5E8SA 3KMWA 4JT3A 4MA5A 4FL2A 3KVWA 3RNYA 2VGPA 4XG8A 1QL6A 3Q60A 4W8EA 3GDEA 4O4LF 2CNQA 2HDKA 3BA9A 1MRUA 3MFUA 2PUNA 4BB4A 2F2UA 3R9OA 5IISA 2QG5A 2UW7A 2B54A 4FSRA 4FKOA 3RTXA 1BXRA 2VTNA 2A1HA 4QYGA 3LHJA 5FXSA 4ZJJA 3PN1A 5HO7A 4IZ7A 5M4UA 3WIKA 4K0YA 3IOKA 4UWYA 2W0JA 4CMDA 4G3DA 4KD1A 4ZS4A 2WTJA 1BI7A 3VPDA 3NWWA 3G8DA 3RTPA 2QD9A 3H0ZA 4HPUE 4IVAA 3RCDA 3VULA 4FVRA 4IM0A 4AQCA 4R3PA 1HOWA 3SVVA 2LGCA 3GU6A 2HVQA 3R8ZA 2C3IB 3AXWA 3QD4A 4ZI7F 4MXXA 1P2AA 3R2YA 3CS9A 4RJ6A 2BDWA 4UBAA 2BROA 4J98A 2WO6A 2VRXA 3U55A 5HICA 3GU4A 3ZUTA 4QMUA 3VNNA 4FUYA 4GLWA 4L3PA 3MVHA 4XX9A 3ZC6A 3PZEA 4C38A 3BL7A 4CT2A 4EOKA 3SGCA 4FG9A 4IZ5A 5HESA 2XS0A 1XH6A 3DFAA 4I20A 4W4VA 5EKOA 2Z7SA 3DK6A 4A9RA 4RWIA 4MCVA 4ZTQA 4ERKA 5EZYF 2XKDA 2EJ3A 2XYUA 2VAGA 4F7LA 3GC9A 3SNOA 5M4FA 1TQMA 2PU8A 5GIPE 3R00A 2QR7A 5E90A 2VTHA 2QO9A 4EHVA 1EKVA 4TKSA 4CMTA 5CU3A 2BDFA 1J7IA 1ZMUA 5AA8A 4R7HA 2J0KA 3ODZX 3ZEPA 5E8ZA 3IW4A 2O63A 2BAJA 2OZAB 4EBWA 4L6QA 5J9YA 2W70A 3UO6A 2QNJA 5CWZA 5D1PA 2UZLA 3KRLA 3GP0A 3A4PA 4TWCA 1OPJA 2JKMA 1VYWA 4BTJA 4TYGA 3QQGA 2I40A 3UOLA 4D9TA 3NC0B 3R1SA 1Q8ZA 3MH2A 2XARA 3TNWA 4DFUA 4EC9A 2HIXA 5J2TF 4QMSA 1RE8A 1UU8A 1XBBA 2W05A 2ETRA 3E87A 1M2PA 3FAAA 2J6MA 3BHHA 4QPAA 3KRWA 5AUYA 4HYIA 3F9NA 5JSMA 5JT2A 1VKZA 5AAGA 4WO5A 1URCA 5J9LA 4DQNA 1OIQA 4JQ7A 4P5ZA 3R9NA 2GHLA 2IO6A 3UVPA 5K4JA 3TEKA 1Q8UA 3FL4A 2GSFA 3RPOA 2VO3A 5HE3A 3LFEA 3MSSA 4GT4A 4KNBA 3KIOC 2VPQA 2V58A 4YJ3F 2Q2UA 4A07A 1ND4A 2PMLX 4QPSA 1Z2PX 5JVLA 3FZRA 4DH3A 4FE2A 3UDBA 2X81A 3EN4A 4M9UA 5BWTA 5LWMA 2BZKB 3BU5A 4C59A 4HJOA 4F99A 2PK9A 4O0VA 4FK6A 3CTHA 4QQCA 4J53A 4OBOA 2C6EA 5HE0A 3MH1A 1CTPE 4APPA 3VNTA 4BIEA 3PP1A 2BRGA 4O27B 1Z2NX 2PUIA 4LQMA 4IB3A 4TPTA 3RR5A 4EFEA 3MPTA 5BV3A 3R04A 4JR3A 3AT3A 3F66A 3SRVA 3UGCA 3ZH8A 4TWNA 1KE8A 1YWRA 5T3QA 5JH7F 4LUEA 2PWLA 3CKXA 3WF9A 1H0VA 3GOKA 4ACDA 3RV4A 3PA4A 4BDJA 3HV4A 4F0IA 3AX6A 4YAKB 4RMZA 3GB2A 2VTQA 3FZSA 4EFBA 4TUYF 3G0EA 5HBHA 5KHWA 4PQNA 5EK7A 3BHTA 4U0IA 3TNPC 3ZC5A 2GHGA 2R0UA 2R3NA 3PDTA 1TKIA 5ANEA 2P2IA 4DLIA 1KJIA 2YM4A 5A4EA 2Y4RA 4M12A 4RFMA 5IQCA 1JSUA 1Q99A 3WWHA 4V04A 3II5A 3WARA 2C6TA 3P5KA 3PJ8A 4FIFA 2OIDA 2QKWB 2Y8OA 4ZZOA 2CN5A 1BI8A 2A1AB 2X7FA 4JQEA 4YTHA 4BI2A 5DT4A 4S2ZA 1P16A 3JXWA 4KSPA 3CLYA 1Q8TA 5ACKA 5KKRB 2WU7A 1V0BA 5KKNB 1OITA 2R3OA 3DKOA 5EKNA 3V5JA 4TTHB 3IGGA 5CU4A 4IC7A 5BVWA 3UIMA 4E73A 5AV4A 4IVDA 3VUDA 4DLKA 4E20A 4ZS0A 4GLXA 2YAKA 5BUEA 4AWIA 5LJJA 2PZPA 3ZBFA 2OFUA 1H1RA 3C51A 3COIA 1STCE 3SOCA 5EH0A 4DG2E 4EH7A 2QO2A 3ZUUA 5I4NA 3TUCA 1T36A 2YJSA 1KE5A 3QKLA 4PP7A 4UN0C 4J52A 5D10A 2IVSA 5DPVA 5L6WL 5JFXA 1Q3DA 3BACA 2YCRA 3FMNA 2COJA 2QG7A 3Q4CA 4BCOA 1DGSA 4MV6A 1KEEA 3OFMA 2NNWB 3KULA 5FTOA 3S00A 4F64A 1FBNA 3A8XA 3LFFA 3NUYA 4I6QA 4NTTA 4GG5A 1C30A 2V59A 1BUHA 2ERZE 1SCUB 2DIKA 2HIWA 1PXIA 2BHHA 2ZJWA 3D5XA 4QMVA 4J1RA 4CCUA 2YS6A 1FPUA 4F9YA 2WMWA 3ITZA 3RPVA 5EQPA 2P55A 5CA1F 2ITVA 3PVWA 3KAJA 4WIHA 2C0IA 1CKNB 4FKPA 2GLTA 5L8LA 4NIFB 4UCRA 3WE8A 2VTSA 4QQ5A 5ANJA 4IAIA 4CC6A 3W2SA 3AC3A 4IWXA 1O6YA 1YHWA 3QTQA 3JSNA 3DBDA 3E8NA 4GRBA 4NZOA 3HGKA 3PE2A 4FKJA 1KV2A 1UA2A 2R5TA 2R3MA 2VN9A 4F78A 1DAWA 2QU5A 2FSMX 3SDJA 2BPMA 4J7BA 4PTEA 4FFMA 2J5EA 2R3RA 1KOAA 1OUYA 1XH9A 5AADA 2XD4A 5HD7A 1YRPA 2XEYA 1GIIA 3FMKA 3HDMA 3R1YA 3ZZWA 5IQIA 4K2RA 3UZRA 1SVEA 2IZRA 2ITYA 4FV7A 1PXOA 4NU1A 4TY1A 4J71A 4BIDA 5A6OA 4DAAA 4BZNA 3GBZA 4GV1A 1W82A 5CE8A 1CKOA 2OO8X 4O83A 4C2VA 4CKCA 3UIUA 2WKMA 5BWVA 2X39A 2XBJA 3IK3A 4HVHA 3MVMA 5AV2A 3VRZA 1YOJA 4MUQA 1X8BA 5EQYA 5JGBA 4JR7A 3C0GA 3T54A 3SLSA 4ZXTA 4XLIA 3MVJA 4IWYA 4DG3E 4K6ZA 1GAGA 1LP4A 2XYNA 4L01A 4ZTRA 4ACGA 4IADA 1OKYA 2YN8A 2XNBA 3C5IA 3QHWA 4LV7A 5FR9A 4IQ6A 3U4WA 3RAIA 2DQ7X 4IH8A 3NYNA 4DGOA 3LJ1A 2R3QA 1CE8A 3NW6A 3PIZA 4Z9LA 4DTKA 5KMJA 3PA3A 4Y8VB 4RBLA 3VF9A 1XDNA 5HORA 5M51A 2WPAA 3EN7A 1F0QA 3NUPA 5LP6F 3ORNA 1PJKA 4JL9A 5C8KA 4BDAA 3QUPA 2BMCA 2X4ZA 4FOCA 4PDYA 3IDBA 4XBRA 4XLVA 5DR9A 4CTBA 4O4IF 2R3IA 3LJ2A 4BHZA 5CF4A 3P79A 3WF5A 5HZNA 5CEPA 2ONLA 5KBQA 3VJOA 3E62A 3ZLYA 3ZONA 2PVFA 1WMKA 3ZM4A 5D7VA 2GFCA 3GT8A 4O0YA 2RGPA 4X21A 3CKWA 4BTFA 4PY1A 4O6LA 2VWXA 3H9FA 3C4WA 3W8QA 2X8IA 2PPQA 5A9UA 3I81A 3TTIA 5JQGF 4NW6A 3LLAA 4XG4A 5J8IA 2DLNA 4NL0A 2REIA 2Y9QA 2HHFA 3F3ZA 3OC1A 4AGCA 3F3UA 4LV8A 3QTIA 2AC5A 1SZMA 1BMKA 3PPZA 4EI4A 3G90X 3L2PA 4QTBA 1JPAA 3AC8A 1ZARA 3OF0A 3VS1A 5CZIA 3EQHA 3F5XA 5AUXA 1P5EA 2J50A 3MB6A 4MXZA 2NP8A 1GZ8A 2HOGA 4R3RA 3IQ7A 1Y6BA 3Q32A 3D2IA 1GIHA 4G5JA 3FLQA 3CD8A 3AT2A 4L8MA 4O7ZA 2F9GA 4C37A 3DJ5A 3GCPA 4L45A 3IKAA 4EUUA 2BZJA 4BYIA 3UMWA 3Q5ZA 4G6LA 4DEEA 2LAVA 5I5YA 2FGIA 4FNZA 5BWUA 5GONF 4IZOA 1P8LA 3TZ8A 5JZJA 3FQHA 3B8RA 3NSZA 5IH5A 3V8TA 2W5BA 5LVOA 3U6HA 3ZFYA 2GNLA 4HGSA 1WAKA 3EYHA 4M7IA 5C26A 1A3GA 4BDKA 3DKGA 3EZRA 3VUGA 5KO1A 2R86A 4CE5A 3LFAA 2XF0A 4KSQA 2WXVA 4WBOA 5EI2A 1Y8YA 2VR1A 3R0TA 4X3FB 3CXWA 4YLKA 4A7CA 4ANLA 5HNIX 4DEAA 3QFFA 5I5XA 4NZMA 4BDIA 4RX7A 4YZNA 4EJNA 2R9SA 2JIIA 2VU3A 4PUZA 4S34A 5LCKA 4B99A 3MBLA 3UQCA 1JLUE 4AFJA 5DEWA 4F7JA 2NUAB 1OL1A 3EQDA 2HAKA 4O84A 3VVHA 1GZKA 4AXFA 4YTFA 3QRIA 4B8LA 4F0GA 3OD6X 3RJCA 1OL7A 2RG5A 3HAMA 3N51A 3HBLA 5EHOA 1BLXA 5H3QA 2HGXA 3E5NA 1XHAA 3ZLXA 3BYSA 1I2LA 3K5HA 4MV3A 1DI9A 4AX8A 1K2PA 3AD6A 4JXUA 2W5AA 4I93A 3VUMA 2W1EA 4NFMA 3QGYA 3K54A 5DNRA 2J4ZA 4P2KA 3R8MA 3TY9A 2HENA 2OBJA 4QTEA 2OICA 4HCTA 3UYTA 5HVKA 3FI8A 4MD8E 3VS0A 4YNOA 4ZLZA 3OT8A 2BIYA 5CQUA 2QHNA 3AMAA 3HMIA 4FEUA 4NFNA 3UP7A 5HX8A 2VQDA 1FMOE 3GOPA 5IQGA 3IW8A 3BZ3A 2XCKA 5K3WA 3HX4A 2G2IA 1B39A 4EH4A 3JZIA 4HCUA 4FV9A 3I12A 5I5WA 3MS9A 3V04A 3QYZA 5DGIA 3AQVA 1ZMVA 4C34A 4ZSAA 2PZYA 2HY81 4I0SA 3NZ0A 4PL4A 4XUFA 1WBOA 4NTSA 3TZMA 4QRCA 1URWA 2QLQA 2X6DA 4FVPA