1A48A

Saicar synthase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
305
structure length
298
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of SAICAR synthase: an enzyme in the de novo pathway of purine nucleotide biosynthesis.
pubmed doi rcsb
molecule tags Atp binding protein
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
total genus 97
structure length 298
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 1998-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1a48A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1a48A02
4CFVA 4QRCA 1PXIA 4MWIA 1MRVA 5F95A 4U3YA 2BR1A 3PE1A 3E87A 3E8DA 3PLAE 4I4TF 1SVEA 1UU8A 3DGKA 1OM1A 2ITTA 3CTQA 4EJ7A 3T3UA 3ZBFA 4ALUA 2P33A 1MQ4A 2WELA 4QMSA 4XX9A 3TN8A 1XH9A 3GBZA 2VTQA 3I7CA 4QQJA 3ZO3A 4YTFA 3HX4A 3E63A 4LMUA 2PN1A 4HJOA 1QPJA 3WF6A 1MUOA 4K11A 4KS8A 3NNUA 4V04A 4AZFA 2JBPA 5D1JA 5HIEA 3FMKA 4FUXA 3LFNA 4ANQA 2WTKB 2VWVA 3N6RA 1ZZLA 4L9IA 3UQCA 4CXAA 2X7GA 3NEWA 4QQCA 5C1QB 3GU8A 3EHAA 4ENYA 2F4JA 4KSQA 4Q2AA 4M12A 2R3HA 2CPKE 4FSZA 3F5UA 4FYNA 5LMKC 4EQCA 2ACXA 3GEQA 5T68A 4YPSA 4C35A 4CVAA 1QCFA 3CPBA 4F9WA 3CKXA 4WG5A 5ACBC 1BKXA 4JLCA 4KKHA 3RHKA 3TG1A 4XG2A 4AZVA 3FKOA 4C4IA 1I7NA 3IPHA 3A60A 4MXAA 3FLYA 5JMSA 4BIBA 3E5NA 5I9ZA 5BQ0A 4FFRA 1KUTA 5BPFA 2WTIA 2Z7RA 4XCUA 5T6KA 1DS5A 5JFWA 1PXKA 2HZNA 4I6QA 4D28A 5K4IA 4C4GA 1YDRE 4UXQA 4MXZA 5AUWA 2YEXA 5BUEA 4N70A 2OF2A 4TN6A 2E9VA 4QYEA 3R83A 4M13A 1OECA 5KZ0A 4LOOA 4M0ZA 3RGFA 3M11A 4IFGA 3UZPA 1TQMA 4MF1A 4AACA 4Z7GA 4ZHQF 3PVGA 4M14A 3R9NA 3W8LA 3EIDA 1XBAA 2CGUA 3D2KA 4ZTNA 3L1SA 3NWWA 4EONA 1OPLA 4YP8A 3T9IA 4ZTQA 4OGRA 4NJDA 5EQPA 3A4OX 3PVUA 1J7UA 1Q99A 2BAJA 4KNBA 4W8EA 4DFXE 5FDPA 3L9LA 3FBVA 5LMAA 4MEDA 2O64A 4FVRA 3S4QA 3BE9A 3IO7A 1I44A 1JLUE 3GU6A 4HVIA 4YZNA 2HIWA 5G1XA 2V5QA 3DKGA 3F7WA 3E8EA 3QYWA 3GFWA 2XK8A 4OW8A 4FUYA 3K5VA 2X9EA 2Y4IC 4FEVA 5KX8A 4QP1A 1AD5A 3VS3A 4BDHA 5IQFA 4N0SA 1XO2B 4K8AA 3QQUA 2GS2A 2VNYA 3UVQA 4FKWA 3MJFA 3HLLA 4TZRA 4IVCA 4BCHA 1KE5A 3PJCA 4C33A 3PJ8A 3Q6UA 3R02A 3KULB 5HEZA 5A6NA 2GQSA 5HD4A 1R1WA 3G5DA 4IANA 1BNCA 3MIYA 4EOOA 3AGMA 3QZHA 3R7IA 1PMEA 3VBYA 4E5AX 4EH5A 3KQ7A 1KE7A 3I7BA 4R3RA 3VUDA 5ANDA 3P86A 5A4LA 4D5KA 2JIVA 4XG9A 2GTNA 2R82A 2P55A 2PMOX 4FOBA 3RPOA 1BXRA 3UIUA 2QO9A 1JQHA 5A54A 3RPRA 4J8NA 4IM2A 4PF4A 4ZTRA 5HLPA 3MSSA 3EYGA 1J3HA 4Z9LA 3TUCA 4NFNA 1U46A 2X2LA 3BEAA 5DPVA 3MTFA 5HG7A 3UP7A 1CKJA 5IUGA 2YDIA 1M14A 3HV7A 5JFXA 4EUTA 3ZUUA 4F0GA 3ZO1A 3DBQA 5DR6A 5D7AA 2WMSA 3RCJA 4DCEA 4O2ZA 3CBLA 1RQQA 2E2BA 4IW0A 5CT7A 2VNWA 3TKUA 1Q8UA 3QXPA 3DTWA 3MY5A 4FKQA 4OT5A 3R5XA 4WUNA 3LP8A 1XBCA 4ZOLF 2XKFA 2B9FA 2GNIA 2OKRA 4TYHB 4YAJB 2B53A 4DG3E 2WGJA 2PVPA 3OZ6A 4ME6A 5DMXA 1KE6A 4IWQA 3EKKA 2C6KA 4E6QA 3R1YA 1IA9A 4RJ3A 4YC3A 4BCMA 5IA3A 2Y4PA 3RVGA 3O50A 3CGFA 3R0TA 4FKSA 4QPAA 4IB5A 1Y6BA 3I60A 4HNTA 2Y7JA 2YIYA 1E1XA 3MWUA 2QOFA 3ODYX 4TKSA 5E92A 3TNPC 4CRLA 4D0XA 5JGBA 5CSXA 4Y5HA 2CJMA 3LMIA 4B7TA 3GENA 3DXPA 3NUYA 1B6SA 4KABA 2WTWA 1PF8A 3PRIA 4QP8A 2QOOA 3DAJA 3IGOA 3DFCB 4K1BA 4XP3A 4EH4A 3TIIA 3LFAA 2HGSA 4EH9A 4ONAA 3EQCA 4QP2A 3V8WA 4AOTA 5L2IA 2BDFA 4XRJA 3BU3A 4YJTA 5HESA 4BYJA 3I4BA 4ACCA 4O2BF 2UZDA 5HTCA 2QF7A 2YIRA 5JN2A 3NW6A 3BHVA 5LVNA 4U80A 4F99A 3C4ZA 5BMVF 2W1IA 4FNZA 4B99A 3OTVA 1WCCA 1PW2A 4F1TA 3VN9A 1YOLA 2XNOA 4G16A 4EH8A 1B6RA 4X0MA 3BG5A 4N57A 2ESMA 3DA6A 4DITA 5IA0A 1J7LA 4C59A 4WO5A 3I0QA 3ZHPC 4U41A 3MWEA 1OL5A 2H9VA 3TCPA 3ZDIA 4FX3A 3S1HA 4ZSAA 4PNKA 4I6BA 5M55A 4WG4A 5L8LA 1YRPA 4ZK5A 3PPKA 4FODA 3WF7A 5IA1A 4LRJA 4Y83A 2UW0A 4Q9SA 3VS1A 4JX7A 5JK3A 4IH8A 3FXXA 1YXSA 2X2MA 3I5ZA 3DV3A 3QTRA 3RTPA 4CLJA 2SCUB 4J8MA 4IACA 5EOLA 4I0SA 1SVGA 3BHYA 2RFSA 4YZDA 4QSHA 1X8BA 3QQJA 2V58A 2IW6A 3IGGA 5FTGA 3U6HA 4U40A 1O6KA 2P0CA 5CALA 1IA8A 4K9YA 4A06A 4L43A 5HO8A 2FPPB 2X0GA 3A7HA 4H36A 4QTCA 2GPSA 2W6PA 5DVRA 3DPKA 2NNWB 3G51A 3UP2A 4TYIA 4EZ5A 1JKTA 5J9ZA 1UKIA 2CKQA 1KOAA 4WRSA 3D0EA 4ZTSA 3V5PA 3W16A 1JSTA 5C8YF 2ZDHA 1ZXEA 4E73A 5H8BA 4KUJA 2OK1A 3QXOA 4YTCA 5J5SA 5IZFA 2VR1A 2W9FB 4FTIA 4RA5A 3QBNA 4RQKA 3RPSA 2O65A 3C5UA 2PY3A 4DFNA 5JGAA 4GH2A 3HRCA 5IA4A 1NA7A 3NNVA 5IU2A 4LL0A 5L6OA 1A06A 3MDYA 2ZOQA 3FYJX 4DEGA 2YS7A 3TKHA 4PUZA 4PTCA 4YHFA 2G2FA 4E8AA 3QCQA 1AGWA 2X9FA 5E8TA 4F7JA 5JGDA 2JITA 2A0CX 2R3KA 1OZ1A 2X6DA 3DTCA 3VQHA 4F63A 2VN9A 4BGQA 4IAAA 2ITZA 3OY1A 4EOQA 2Z2WA 4GJ2A 4G3CA 4R1VA 1K9AA 5EFQA 5E8XA 4CLIA 4AF3A 3Q9XA 2XEYA 3GC9A 3OEFX 2GS7A 2R3IA 3R21A 1WBWA 3GU5A 4X3FB 4GT3A 4G9RA 4I5PA 5KMKA 4USFA 1JAMA 2HWOA 2C5VA 3SHEA 3DBDA 3O0GA 4GS6A 2IG7A 3PZEA 4TRLA 5J9YA 3QUPA 5HNGA 5LOHA 2B9HA 4FL1A 4ASEA 1XH7A 3F69A 5TOZA 4DIMA 3QTXA 4ANLA 3AD6A 5KKNB 2VTMA 4I4EA 4X2GA 5BNJA 2G01A 3QZFA 3NYOA 1IR3A 5GINE 5JVDF 4DGOA 2XCHA 2GPWA 1FOTA 3CR0A 3BYSA 5F1ZA 4DGGA 5IA5A 2WOTA 3REPA 4ZTMA 2XCKA 3R04A 5E8SA 2BAQA 5DI1A 3R7YA 4BCKA 3BWJA 1OUKA 3EZRA 4JR7A 4L53A 3ZO4A 4TL0A 3SG8A 3I6WA 3DOGA 4FIGA 2XNBA 1YKRA 3LW0A 3VBWA 4F0IA 3TW6A 3F61A 4YJQA 4YTIA 4UY9A 5CU0A 3BIZA 4JBPA 4BCOA 3D7ZA 3FMHA 1WBOA 5B0XA 5TKDA 5GIPE 3WILA 3ZYAA 1R0EA 3DFAA 5EM6A 1R78A 3R73A 2PVJA 5FTQA 4E4TA 2BZJA 1WZYA 3W2OA 3VVHA 2R84A 2HYYA 2ZJWA 2C68A 2ETMA 3E64A 2JKMA 3RAHA 5DFPA 2UZLA 4QMVA 1EHIA 1UU3A 4GK4A 3TINA 4FKPA 2YZLA 3O7LB 3A99A 3FLSA 2W06A 2IZUA 2GS6A 4ZXTA 2WMQA 4BTJA 5LP6F 1CKIA 3P1AA 4FG7A 4QOXA 1H8FA 3ORTA 3CY2A 4FIHA 4EWHA 2WNTA 1CDKA 1Z5MA 2ZAZA 4IAKA 4B4LA 2R3GA 4RIXB 4I1ZA 3TZ8A 4EH2A 4HOKA 5BVDA 2Z04A 5KMNA 5LWMA 3KFAA 4C5AA 1EH4A 2C3KA 3TTJA 4FSNA 2W5AA 1XR1A 4EK6A 2WMRA 3PJ1A 4G5PA 5BVKA 2A2AA 2WQNA 3LCOA 2XUUA 5HTBA 1PMUA 3CY3A 3KMUA 5KBRA 5HG9A 3EL8A 3GGFA 3ZDUA 4DCAA 2X8IA 3NYNA 5IH6A 2W1DA 3QRTA 2W96B 1PMNA 2GNHA 3UG1A 3E7VA 1I09A 4FG8A 2XF0A 3PJ2A 4UXLA 3WZUA 4YJPA 4EK4A 3HV3A 4D9UA 1BL7A 5AUXA 3EL7A 3PIXA 2YIWA 4X21A 5KNJA 3AQVA 4U9AA 4J95A 4J99A 3KRLA 4H3PA 4XP2A 2WPAA 4JBQA 3NAYA 4RVLA 1KJIA 4JAIA 5KX5F 2WB8A 4ANBA 3O8TA 3L8VA 4CT1A 4DG0E 3WYYA 3A8XA 4ZSEA 4KKEA 4XYFA 1T45A 2Y6OA 2YM8A 2ZB0A 4I0TA 2PZRA 1GNGA 2YDKA 2JLDA 2ZDTA 3GCQA 4EWQA 3MH3A 1I7LA 4E5WA 3FWQA 3PXZA 3VUGA 2J7TA 1H01A 3TKIA 5ICPA 4ZAUA 1ULZA 5E8VA 3R5FA 3Q4TA 2XP2A 5EM8A 1NVRA 2YWPA 3PRFA 2JEDA 2X7OA 5AV3A 3KY2A 1HCLA 1SZMA 3MA3A 3MTLA 3AC3A 5HCXA 5D7VA 5DT0A 2VWXA 3GU4A 4XG8A 4CKRA 4ZJIA 3UTOA 4E4LA 4C38A 4LYNA 3OW3A 3TNHA 3GP0A 4FTTA 4NKAA 2W5BA 3BX5A 3CE3A 4CKJA 1M2QA 2IW8A 4BZDA 2NU6B 3FMNA 4FKUA 1UV5A 3U9TA 3IKAA 2W1HA 3K5UA 4C36A 1NW1A 2OLCA 4GT4A 3JVSA 4M15A 3EQHA 3JPVA 1OGUA 3R8PA 4QYYA 2RIOA 3ODZX 1JKKA 4FEQA 4YZBA 4F7NA 4YZMA 4CCBA 4CKIA 4EOSA 4ZOGA 3DAEA 2UW8A 2EB2A 4O91A 2YISA 3ATSA 3Q2OA 2I87A 3KVWA 3NVMB 5HBJA 2FSLX 3UPZA 2XD4A 3M2WA 4KS7A 5ANGA 4UV0A 3RPVA 2WXVA 3LMGA 3QD2B 4HYHA 2R87A 4BI2A 3E8NA 4AA0A 4CG9A 1CM8A 2YW2A 3V5QA 4EKLA 4E4XA 4RWJA 3HZTA 3FJQE 4FK6A 4I22A 5E1SA 3UFXB 2H6DA 4D1ZA 4XOYA 4U97A 1LP4A 4C4EA 4NUSA 5C01A 3KGAA 4F64A 4NW6A 3NUSA 1YXTA 2J2IB 4KBCA 3MPAA 4FTOA 1PHKA 3JYAA 4E6DA 4EHGA 3FY0A 3DK3A 2G1TA 2QI8A 3OUKA 4U45A 2SRCA 4D2SA 4Z7HA 4K33A 1JKLA 2QOIA 4DINA 5CA1F 4EK3A 4PDYA 2W5HA 2QODA 4K0YA 4RC4A 2XM9A 3LCTA 1KJ8A 4MVFA 2QOKA 4RX8A 5J2UF 3CLYA 4RIWA 3H0YA 1WBSA 3MIAA 4RFYA 4EBVA 1Z2OX 4BN1A 2XNNA 3DQXA 4TYJA 5JFSA 2O3PA 4RVMA 4YLJA 2JFMA 2XYNA 3EQFA 5DHJA 3KRJA 4CMUA 3LXKA 2WEIA 3WI6A 4F09A 3NW7A 3R22A 4NM7A 4GT5A 1Y57A 5IMXA 3SE7A 5I5ZA 4PL3A 2JDOA 3LLTA 3VS5A 2J5EA 2VTTA 4EOLA 3NIEA 3R8LA 1STCE 4GRBA 4GG7A 2XNPA 3R8VA 3FE3A 2KTYA 4IZ7A 5KBQA 1DV2A 3PXKA 1SVHA 3MJ2A 3VF8A 3O71A 1EYZA 3GVUA 2EXMA 5LCKA 3FLWA 4PTGA 5HE0A 3NAXA 2ETRA 3AT3A 3CPCA 3FKNA 3MFRA 4HGEA 4LG4A 3SW4A 4I41A 5HBRB 2PUPA 3G8DA 5KMLA 4EKKA 2I8CA 4MA0A 3BKBA 4WBBB 3ROYA 5AP5A 4MXOA 3SD0A 5DGZA 4FSRA 3ZFYA 3F88A 2QQ7A 2UW3A 2B54A 4YZCA 1DV1A 3E7OA 3ALOA 1W8CA 3F2RA 2AC5A 4O27B 4OT6A 3CC6A 5EQEA 5AP2A 4C3PA 4C62A 4BDIA 5CAPA 2CZGA 3SRVA 4L7FA 4YB8B 4O6LA 3KC3A 1WBPA 2VGPA 3AC1A 3EQPA 5DG5A 4D4SA 3SVVA 2HW6A 4NM3A 3SGCA 2DIKA 4EH6A 4TWNA 1Y8YA 3OW4A 5FLFA 4O4HF 4NCTA 5FDXA 1BL6A 1NT2A 4FFMA 2GPHA 4FTLA 4II5A 2RGPA 4UYAA 2UVYA 5FTOA 3U9CA 2F9GA 2RFDA 3DNDA 5E7RA 3KXGA 5JH7F 4PNIA 3FI4A 3TJDA 2OSCA 3Q2JA 4XS2A 4C2VA 3IW8A 4GMYA 4PP7A 4DT9A 2QOQA 3O23A 4FL2A 3ZS5A 4G34A 3MESA 4D4RA 3RAKA 2PYWA 2YFXA 2R3OA 2VAGA 3WF8A 5IQDA 1Q3DA 4N4SA 5FEDA 3V3VA 2J9MA 1YOJA 5HCZA 2UW9A 2ITXA 1KC7A 5C8MA 2V7AA 5CAEB 3FZRA 4RWIA 4EYJA 4J96A 2JKOA 1S9JA 4A4LA 1C30A 2JFLA 1Z2NX 3HAVA 1U4DA 4FSUA 5M4FA 4C2WA 3HA8A 2YS6A 2J90A 2CNVA 4IFCA 4DTBA 3BU6A 5AP6A 4C34A 2R7BA 2OIQA 2GFSA 1PXJA 4G3FA 5DIAA 4ZJVA 4NM5A 2R3QA 4C4JA 3MS9A 5HVJA 4C4HA 3GXLA 4O0RA 3RK9A 2J51A 2YZAA 4R5SA 4I5MA 4Z16A 3FZSA 2QCSA 3ALNA 3ANRA 3PDTA 3WZJA 3BYOA 5EW8A 4AT3A 4X2FA 3UZRA 2FB9A 3HBLA 5I0BA 3WZKA 3LAUA 2CMWA 2C4GA 3IS5A 2F2UA 2OJIA 3VW6A 2X6EA 5ANOA 4Q5HA 3U9SA 4BICA 4BTKA 2WO6A 4JDIA 2JIIA 3P4KA 3A4PA 1OBDA 3RAIA 4A4OA 5EKNA 5M06A 4LQMA 5A6OA 3Q9WA 4DC2A 4RGJA 5JKGA 2UZOA 4RVTA 5IQIA 5CEIA 3TJCA 4O7VA 1ZY4A 3R7OA 1FGIA 4MBJA 3H4JA 1LEZA 3TZ7A 3KULA 2J4ZA 4FKJA 4JG7A 3FMEA 4RZQA 1U59A 3ZZWA 4RJ5A 3NR9A 4O0UA 1Z9XA 2UZUE 3LOKA 2HCKA 2QG5A 5L3AA 4TWCA 4NZWB 3UOJA 4G6OA 3Q60A 4AT5A 4EJNA 1PXPA 3NUUA 4JI9A 4TNDA 3PJ3A 5HE3A 3RPYA 3S3IA 4OTDA 1IOVA 2WQEA 2BCJA 3PFQA 4YJNA 3V5LA 2PVFA 2FSMX 1H27A 3DB6A 2RFEA 3ZUVA 4IZAA 1REKA 2V7OA 3OCGA 1ZARA 2CKOA 5J2TF 3ORPA 3KRWA 2OZOA 5AUYA 4CZTA 3UNZA 4IC7A 4FT9A 1V0BA 1J91A 5HO7A 2Q83A 2BUJA 5BYLA 4FBXA 5C4LA 2G2HA 1PRYA 3DCVA 3IQ7A 3ET7A 5J7HA 5CA0F 4PWNA 4O7SA 5EYCA 3LMHA 1GY3A 4XOZA 1VBHA 1H24A 4FKGA 1PXNA 1E9HA 2UW4A 3HB9A 3B8QA 3O8PA 2ITQA 2R4BA 4IDVA 4R6VA 4APPA 4YC8A 2HXLA 4TW9A 3BQRA 5C8NA 2W7XA 2XK3A 5C1OA 4GV1A 4F1MA 2VTRA 3FXZA 5D41A 4XV9A 5CEKA 3R1NA 4KIQA 3DXNA 4YLKA 2UVZA 1FMOE 1WBTA 5ANIA 2BRGA 5DR9A 2WAJA 1Q97A 3HRBA 2ONLA 5C4KA 3DBCA 3HEGA 5L2TA 1URCA 2W99B 4X6QC 4O86A 5CU4A 5KMOA 2J5FA 2R3NA 1WAKA 3Q04A 1ZRZA 4TT7A 1LEWA 1GZKA 2Q0BA 2WHBA 5BMMA 2OXXA 3FUPA 4JQ7A 3IECA 4J97A 3TACA 5L8KA 2A27A 4PMTA 4WBOA 3I81A 5EHYA 5DEYA 5FP5A 3CD8A 3O8UA 1BI8A 2QC6A 4I3ZA 3AMYA 4CMOA 4QYHA 5K9IA 1QPEA 2CGXA 3V04A 4FTQA 2R2PA 2PZPA 1H0WA 2C3JA 3EQBA 3LM0A 5CNOA 2QK4A 3JZIA 5HVYA 4CTBA 4BCNA 3FZ1A 2XIRA 1PXLA 4NH1A 1TVOA 2O2UA 4FTNA 3QQGA 1YHWA 4DHFA 4YNEA 1RE8A 2WMVA 4EC9A 1JKJB 3OF0A 4EUUA 3CP9A 2XS0A 2CCIA 3V8SA 2XH5A 5HG8A 2DLNA 3OROA 3TT0A 3FKLA 2XK4A 3R2BA 2QG7A 4PX6A 4D1XA 4MQ1A 3O2MA 4JBVA 3ZO2A 1MP8A 1ZYJA 4KA3A 4NYEA 5CEQA 4O4IF 5FD2A 3EFWA 2Q0NA 5EHOA 1Q3WA 3MYGA 3C9WA 3DJ6A 2XM8A 1ND4A 2BALA 2YRXA 4G5JA 2O5KA 4L3JA 1Q8ZA 4RJ8A 4J71A 3CD3A 3G6HA 1YW2A 5DWRA 5CX9A 4AZTA 4BTMA 4AAAA 2YZGA 4MNEB 3QKLA 5EH0A 3RP9A 5DT4A 2VWUA 4DH1A 2HK5A 1YXXA 5EDQA 1R39A 2I7QA 4FKTA 4KAOA 5HQ0A 4YJOA 1H00A 4W4VA 4NM0A 5EOBA 3DLSA 2ZMCA 4Y72A 2XRWA 4H1JA 1IRKA 4L67A 3VMMA 2J0LA 3PA5A 3LCDA 3Q32A 4ACGA 1BI7A 5HKMA 1YI3A 3MVJA 2BAKA 3M1SA 4NJ3A 2C6IA 4RIWB 1FVVA 3ID6C 4O7LA 1YWVA 4LRMA 1YWNA 1OL6A 1ERKA 3UVPA 4IX5A 3VS4A 3DLZA 4OUCA 1KBLA 3QCSA 3R00A 4MV3A 2XJ1A 4R77A 3NNWA 2IP4A 3ULIA 2PMLX 3FMJA 5AEPA 4FZDB 1RJBA 4YBJA 4F9YA 3F6XA 4RLKA 3BGPA 3D5XA 2VUWA 3G9NA 4H3QA 5BVWA 5AV2A 4AQCA 1BLXA 3PP1A 2VX0A 2CNUA 2VX3A 4MKCA 5EDRA 3K5IA 1V0PA 4FTJA 4V01A 3RFCA 4XNEA 3ZCLA 4GIIA 4BI0A 5CTPA 3PSCA 5AFVA 4D9TA 4FVQA 4KB8A 5CF4A 2Z7SA 3E93A 4L45A 4MV7A 2UUEA 3CXWA 3G2FA 1XWSA 3DDPA 4WG3A 3VOTA 5CWZA 2CKPA 1NVQA 2HELA 3DU8A 2BILB 5TO8A 2JC6A 2Y6MA 2F7ZE 5HX8A 3KA0A 1F5QA 2GNFA 1W93A 4HR7A 2IJMA 2ZM1A 5EHLA 3RI1A 4HVSA 5K4JA 2VWBA 3KEXA 2RL5A 3LFBA 1ZYCA 3PY1A 1PX2A 1B39A 4I5HA 2BIKB 3QUDA 2R7NA 3R9DA 4G31A 3EB0A 3GI3A 2BRNA 3QALE 5IDNA 2JBOA 3ORIA 4BDCA 1J1BA 2P2IA 2WMXA 4KRCA 3V5TA 4F1OA 2ZDGA 2OIBA 5C03A 3C4FA 3E5AA 3FQSA 5IEXA 4DLKA 4DEEA 3C51A 3D9VA 5CZIA 3I1AA 4BCQA 3BLHA 4FTMA 4KIOA 3NW5A 4GSBA 3K5HA 4FV9A 5CF6A 5AWMA 3SA0A 3GT8A 3KN6A 4H39A 4I94A 4DN5A 2WTVA 2CCHA 3ACJA 4RQVA 4HVHA 4QMXA 2PVYA 2WMUA 3UYTA 1YOMA 4DF3A 3BBTB 2R3PA 4HNFA 4DA5A 3AMBA 5TT7A 3JY0A 4WRGA 4RWKA 2BZHB 3VBQA 2PVRA 2RFNA 4JG8A 4IM3A 4FICA 4D55A 2W6QA 4JRNA 4AA4A 5CXZA 5CB4F 2VWZA 4DFUA 3VBVA 3VQUA 1JVPP 1PXMA 2R64A 4IAYA 1FPUA 3L8SA 3HYHA 3TWJA 5LXMA 3SLSA 3EZVA 4KBAA 4QPSA 4DH5A 1G8AA 3I6UA 3LKMA 3VWAA 2WU6A 4C3RA 3LJ2A 4FV7A 3R71A 2DYLA 4IDTA 3ZTXA 4PV0A 1DM2A 2BIYA 2OW3A 3CCNA 4E93A 1SYKA 5CI6A 5IUIA 3R6XA 3OC1A 4FIIA 1Q5KA 3UMXA 2WMAA 5HHWA 3AT2A 2PWLA 3FZOA 2PMIA 3P9JA 4HYUA 2HAKA 2JDSA 3Q2MA 4YHJA 2YCQA 5AIRA 4FKIA 4BDEA 4BDKA 4C3FA 2PSQA 2YRWA 5FG8A 2X0SA 3HRFA 3KAJA 3W2SA 5GIOE 5E91A 3FAAA 1CQIB 2QU5A 5CXHA 1CE8A 2WMBA 1UNHA 5DA3A 3WZEA 2FVDA 4RWLA 3P78A 3BLQA 3QTUA 5CU6A 4YLLA 2GQRA 3OBJA 2FSOX 4NWMA 2YM5A 1NY3A 4GJ3A 5I9YA 1ZYSA 2HY81 4C61A 4ARKA 3EN6A 4O82A 4IVDA 4IHJF 1H1WA 3OS3A 4I50F 4PY1A 4NKSA 1M7QA 1OKYA 4L1KA 4L01A 3LQ5A 4CFXA 1JWHA 3PE2A 5ETIA 4L44A 4P7EA 2ZYBA 1YHVA 2JDVA 2GHMA 4E20A 3UZTA 3QQKA 2DZDA 3R30A 5M57A 4BR3A 3H9RA 2BRMA 3OXZA 4FNXA 4AZWA 1DAYA 4PQNA 5HIBA 3U87A 5HG5A 3UDBA 4DEAA 4IWPA 2BRHA 3LM5A 4O96A 4FEUA 1ZWSA 2W4KA 3OOGA 5D11A 5HBEA 4F9AA 3E88A 2XIZA 5D10A 1GAGA 3IG7A 3OMVA 4ZEGA 3R8UA 3UO5A 4E5BA 1PYEA 2QOLA 3FI3A 2FB8A 5CZHA 1CKPA 1ZMWA 3MVHA 5H8EA 3II5A 1OIRA 5BUJA 5HLWA 2NU8B 4AE6A 3WE8A 1GZNA 3HKOA 4CMTA 2C5YA 3QCYA 4JIAA 1VKZA 2P0AA 4CEGA 1VJYA 1REJA 2C6EA 4MD7E 3HUCA 4FFLA 3N4VA 2IVSA 3GNIB 3BYMA 3SC1A 5CAUA 4O7NA 1WFCA 4F9BA 3OWJA 3KAKA 3K2LA 3CJFA 3FHIA 4MXXA 5DEWA 4R5YA 2I0HA 2PUIA 3LJ1A 3V01A 2C47A 3MH2A 4ZZMA 2OU7A 1W82A 3G15A 4RSSA 5BVEA 3KALA 5FXSA 1PKGA 4HCTA 3OXTA 4GW8A 4IB0A 1J7IA 4JT3A 2XNGA 4I4FA 4C37A 5B2MA 5ANEA 4HGTA 1PK8A 2FA2A 3EQIA 1XQZA 3PTGA 4MCVA 2PUUA 2YM6A 1LPUA 2V22A 5G6VA 3UYSA 2IO6A 5M09A 3L9MA 2O8YA 3GC0A 4DFZE 4B9DA 2E9PA 3ZLWA 4QNAA 2VO0A 3EN5A 3LXNA 3H10A 2CNQA 1WR2A 2FPIB 3Q53A 3MFUA 3OG7A 4J52A 4OTFA 4FT3A 3DK7A 3RV3A 2WTCA 2HY0A 3AC2A 2V62A 3VPBA 2CDZA 3SXRA 3KL8A 4BHZA 4EK8A 5JZJA 5EKOA 4W4YA 4FT0A 3VRZA 2VTNA 3W2CA 5IQCA 2Z7QA 2PULA 2BROA 3V6RA 2OH0E 3H9FA 3ZMMA 1GLVA 5KE0A 4IVAA 3G6GA 4DEHA 2FPGB 3GCPA 3K54A 1JLLB 5HLNA 5M4CA 3FQEA 2WQBA 2YJRA 2LAVA 3RMFA 2EB3A 4G3DA 4IHPA 4FVPA 3TV7A 3TTIA 1BX6A 4EOIA 3VIDA 3KXXA 4CV8A 4EC8A 5LMBA 3UNKA 1P2AA 4QP4A 2ETKA 4DG2E 2VTHA 4JR3A 2JDTA 2G2IA 2VTAA 3LFCA 4TY1A 3ERKA 4F9CA 2GLTA 4ZZOA 4LV5A 3FPMA 5ETFA 3UVRA 5LA6F 5AA9A 5C26A 3COMA 3HP5A 5DRBA 2GU8A 3OD6X 4I6HA 4OTGA 3QA8A 2O63A 4KRDA 5DE2A 4XYLB 4O7RA 4C5BA 3BHTA 4A9YA 2YCFA 2JDRA 4GYIA 4AGCA 4AW1A 2ZB1A 3W2PA 3Q3BA 4QTBA 4ZSGA 4DGMA 3JRWA 4PL5A 3G8CA 2JKQA 4U0IA 3QTIA 4NT4A 3KK8A 3WNZA 1QPCA 2W6NA 3ETHA 2Y0AA 3ORZA 5JZNA 3UOLA 1YWRA 2IN6A 1O9UA 4QP7A 3MH0A 2OICA 4E6CA 2J0JA 3WO1A 2QU6A 1JBPE 4QQ5A 1OBGA 3OY3A 3ZH8A 4P2KA 2YJSA 5BYYA 4IWDA 2B1PA 3MB7A 4FI1A 5A9UA 5B7VA 2V59A 1GSAA 2DWBA 2YA9A 3SQQA 2Z60A 4CSVA 3NVKI 1QMZA 3VAPA 3NUPA 4L7SA 1GZOA 1Q24A 3H3CA 5FBOA 2BDWA 4ITJA 1UNLA 4MH7A 4MA5A 4QMQA 3UE4A 2E9OA 2GNLA 4CT2A 4DBNA 2E9NA 2OJJA 2PVHA 2I1MA 3MW1A 3OBGA 3KRXA 4FIEA 4NL0A 4ACHA 3BZ3A 4GFGA 4FV4A 5E9EA 3ULZA 5JEBA 3EOCA 5CSHA 3R8MA 4DGNA 5AP7A 3D7TB 3QWKA 1JDBB 2C00A 2ZV8A 3R7UA 2CKEA 4U44A 2ERKA 4AGWA 1Y91A 3CQUA 4JNWA 3LFQA 3QKMA 4GCJA 3OUZA 5CY3A 3FDNA 4KIPA 4QMPA 4FKLA 1H1RA 4ZIMA 2UVXA 4FV5A 4R7HA 4C4FA 5HIDA 1Q41A 4IVBA 3TIYA 4AT4A 5IEYA 2R7IA 3VS0A 2HENA 5IYZF 3PY0A 5AAFA 1M17A 4WKQA 4A9RA 1DI9A 3IK3A 5M4UA 4TWOA 3HA6A 3HECA 1YQJA 2FUMA 3OCTA 4O0YA 2ERZE 4RC2A 4Q9ZA 4DT8A 4RIOA 1WVWA 4FFNA 3RK7A 2H96A 1JDEA 4RX9A 3ZEPA 3VJNA 2W6ZA 5IQBA 5F94A 2QKRA 2ZDUA 4ERKA 2ITVA 5DOSA 3COHA 4S32A 4ZS4A 5E4HA 4P4CA 5D12A 3D2IA 2YAKA 1YXVA 4IADA 4GUBA 1PMVA 3FEGA 2CGVA 2ZM3A 3GCUA 4WT6A 4FSYA 4C5CA 5IEVA 1MRYA 2W1GA 3KCKA 2R7KA 3S0OA 3RINA 4FV3A 4QYGA 4RZWA 1OKWA 3QC4A 4XUFA 3QZIA 3A7GA 5BUIA 2BHHA 2UV2A 4PL4A 4YZ9A 4DH8A 3BLRA 3QGYA 2X4FA 4WSYA 1M0WA 5JT2A 3HP2A 2ZMDA 3QQHA 4IM0A 3ZSIA 3FSFA 2P2HA 4AA5A 4AZSA 3QRUA 2NRUA 3FC2A 2YHVA 2W05A 3MH1A 4O0SA 2I0EA 3A61A 1S9IA 3QGWA 3PXFA 3QLGA 3ZC5A 2R85A 4IQ6A 4ZLZA 4MV9A 5AX3A 3UG2A 2FGIA 3O51A 4YURA 2BZIB 4P5ZA 3P7BA 2YITA 4C0TA 5HZNA 4BGGA 4CFUA 3CEKA 2ITWA 4U43A 3FI2A 4M84A 4AS0A 1OIYA 4QMNA 1OIQA 5ACKA 5TR6A 3COKA 4YPDA 2Z7LA 2XJ2A 4BB4A 2XNEA 3BELA 5EK7A 4F65A 3QD3A 4MBIA 4MD9E 3L8PA 1UKHA 2JKKA 2C6DA 5LVMA 3NX8A 3NUAA 4UB7A 1H25A 3E3PA 2I6LA 3FI8A 5C9CA 3SRVB 3CQWA 5HX6A 5KKRB 4YAKB 3HVCA 1H07A 2B7AA 1NVSA 3EKNA 2OXDA 2WIPA 3F82A 3THBA 3UODA 3V5JA 5FM2A 3UC3A 4YNOA 1W7HA 3QFFA 4UWCA 3KXNA 3IDCA 4FV0A 5DBXA 1MRUA 2WQMA 3E92A 3GUBA 5GNKA 3R01A 2BHEA 3WO0A 2HZ0A 5GHVA 3V4SA 4FK3A 1SMHA 4JIKA 4U79A 1WVXA 3LIJA 4H58A 3UOKA 3WF5A 4FA2A 1E4EA 2XKCA 1MQBA 4JOAA 4EGJA 4O2PA 2CN8A 4F08A 5LXTF 4FV6A 1VR2A 2R9SA 4G9CA 5A4TA 5KZIA 2J6MA 4F70A 1VZOA 1XH6A 2WTKC 3SOAA 4LM5A 5E1EA 5LARA 2BKKA 4QT1A 2CN5A 3D83A 2FO0A 3POOA 4TXCA 4O0XA 5CSWA 5H2UA 4EQMA 5CVHA 2RG5A 3PXQA 1P14A 3FXWA 2QNJA 4H05A 2YL2A 4JRVA 4LL5A 4LV8A 3SDJA 4B8LA 1H28A 4FTKA 4AGDA 4IX3A 4AOJA 4MNFA 5I9XA 4ZJJA 4G1WA 1U54A 4HCVA 1KSWA 4PDSA 5IG1A 3NYXA 4FC0A 4JL9A 4KSPA 5J8IA 4ZY5A 1LUFA 4FIJA 4AE9A 5E8WA 5A4EA 3U8WA 3TNIA 4D58A 1OL2A 2XBAA 4JDHA 4Z55A 5AM7A 3GIDA 3PLSA 2J0MB 3O96A 4S31A 4IAFA 3BGZA 3AD4A 4RZVA 1XHAA 1UWJA 2W1ZA 4A4XA 5BX0A 4BY9E 4DFBA 3BU5A 1O6LA 3GB2A 3ACKA 3JS2A 4MXYA 4F4PA 5C27A 5CU3A 4DFLA 4EHZA 2VTOA 2C1BA 3NRMA 3LFEA 2HZIA 1EUDB 4MTAA 3FQHA 3RM6A 2W6MA 1SM2A 3V5WA 2NP8A 4DBXA 4BCJA 3RUPA 4XHKB 3DJ5A 2DUVA 4L6QA 2WTDA 1OL1A 4FG9A 2I0YA 2WKMA 5DRDA 5DT3A 3PPZA 5M51A 1M2PA 2BFXA 4IAIA 5H80A 2XK6A 2YWVA 5HD7A 3HMMA 4EOJA 2GMXA 4G2FA 3UBDA 3QL8A 3ZONA 3SG9A 2C3LA 3TQTA 4O7TA 3VPCA 3F3UA 2ZDQA 5AADA 4MBLA 5FP6A 4JQ8A 4AGUA 3PUPA 4E26A 1H26A 5KCVA 4QP9A 3BBWA 3FL4A 4IC8A 1UU7A 5AUTA 1KE9A 3B2WA 3COIA 1VYWA 4LFIA 5AP1A 5EI2A 3AG9A 3QA0A 1CSNA 4FKOA 1ZAOA 2YAAA 5KMJA 3G9LX 4XBUA 1KEEA 4YJSA 4M97A 1UU9A 4MV4A 1JNKA 3S95A 3W33A 1KJQA 1K3AA 2H34A 4WA9A 4Y85A 4DAWA 4ZMFA 2R0UA 2ONLC 3LLAA 5EG3A 3ZC6A 3MJ1A 4BDFA 4ZLOA 1T36A 3MVMA 4UWYA 3UMWA 5M53A 4B6LA 5CYIA 2B0QA 3LVPA 4NU1A 2C6LA 4DH7A 4O7YA 4WNKA 2ITUA 4YC6A 2ZV9A 4CFFA 4QYFA 4I93A 4YBZB 4ZTLA 3EJ1A 3TM0A 4A07A 3NMUF 2X39A 2YM7A 3JZFA 2VWIA 3QRIA 3UGCA 3BI6A 2UZVA 3TDVA 2PMNX 2WU7A 1OKZA 4I0RA 2PK9A 3LFSA 3Q96A 4RJ6A 5EM7A 3HV4A 3GLKA 3C13A 2NU7B 3TDWA 5L2WA 2VPQA 2Z02A 3RALA 2IZSA 4RMZA 4QNYA 5JQGF 3KKVA 4L3PA 1J1CA 2X1NA 2WOUA 4CD0A 4JX3A 3S2PA 4HYSA 3QC9A 3NPCA 2NRYA 4E7WA 3QD0A 1P4FA 3HGKA 3KCFA 1Q8YA 3POZA 4RVKA 3VUKA 4BCGA 5KMIA 5DNRA 1M6VA 4FZ6A 4BGHA 3SW7A 4TV9F 2REIA 3LJ0A 4LGGA 4YO6A 5IQEA 4NTSA 2FYSA 4RIYB 4UN0C 4FT7A 2QOBA 4BC6A 2B52A 2UZBA 3N9XA 4CQEA 3ORQA 3ETAA 1OMWA 3F5PA 3DKCA 5ANJA 3EN4A 4DE4A 4M67A 3QTSA 3ZU7A 5CEPA 4LUEA 1XBBA 3U9NA 4XV1A 4WNMA 2YIQA 4YTHA 3U51A 5EW3A 5CEMA 1SNXA 4YJUA 3HMOA 4ZY4A 5J87A 4FZFB 5FEQA 5CEOA 5IF1A 2VTIA 2WMTA 3BHUA 5EDPA 2R5TA 3QHWA 3WIGA 4E6AA 2OZAB 4U7ZA 4UZDA 3Q1KA 2PPQA 3WIKA 4OTQA 3TXOA 4OTIA 5ETAA 5HNIX 2X8DA 3AC5A 3OHTA 4EZ3A 4QMTA 4ORKA 2GSFA 3SKCA 3KMWA 2R7MA 2ITPA 3U4WA 3ZM4A 4FZAB 4N6YA 2OIDA 1FQ1B 4ZZNA 1KWPA 5AIKA 5E8YA 4W8DA 4PRJA 5IUHA 2F57A 3ZBXA 3TL8A 1FVRA 4C58A 3R23A 3W2RA 4FU0A 4I92A 2IVTA 2W4JA 3G33A 4I6FA 3TUBA 3QF9A 2I0VA 3VJOA 3QTQA 4D2RA 4ITHA 1V0OA 3D5UA 3GC7A 2YN8A 4EEVA 4EZ7A 2PVMA 2WYOA 4AN2A 5HI2A 4YJ2F 5IH4A 4HZSA 4AW5A 2R3LA 4I24A 1R0PA 5DLSA 3ZXZA 1M0TA 3D15A 3TNQB 5CAQA 4RA4A 2OH4A 3CS9A 4AX8A 4L00A 4EHVA 5CANA 2J50A 1TQPA 4ACDA 2QHNA 4ZTHA 4BVUA 4MV1A 3VRYA 4LMNA 1H1SA 2WTJA 2VO7A 1A9UA 1BYGA 4MAOA 3F2NA 3UO6A 3E3BX 4FTRA 3E62A 3FY2A 4X2NA 4EOMA 5AP3A 5AV0A 5LMKA 4J1RA 4IB3A 3KN5A 4NCTC 3F3VA 2Z8CA 3LXLA 3BWFA 4M9UA 4G17A 4O4LF 2G15A 4FKVA 1CMKE 4V0GA 4DEDA 1BUHA 4ENXA 3SAYA 2GCDA 4EORA 1O6YA 5ETCA 2C5OA 4D4VA 2VTSA 3VBTA 5BPHA 1OVEA 4FFOA 4FV8A 4PTEA 2HWPA 4DGLC 3R63A 4EI4A 2NUAB 4DH3A 2YERA 2QO7A 3FLNC 4YBKA 3RJCA 3PYYA 5JFVA 1VEBA 4CRSA 4UX9A 1FBNA 4BF2A 3P0MA 3PSDA 5A3XA 5IPJA 5L6PA 2RG6A 4YSJA 3BCEA 4F6WA 5GJFA 4CV9A 4MNEA 2BZKB 3F5XA 3PXRA 4RLLA 3R7EA 2WMWA 1Z2PX 3K3PA 3UC4A 4M68A 3SOCA 5AAGA 4GVJA 3WE4A 2R86A 3DDQA 1E4EB 3MV5A 3PP0A 4R1YA 2IZRA 2C3IB 2DS1A 2X2KA 3OTUA 3QCXA 3UO4A 5H3QA 1PJKA 2OFUA 2G9XA 2XRUA 4ZSJA 3DQWA 3V6SA 3W10A 4K18A 5A14A 2GTMA 2WEVA 3D5VA 3EFKA 4I23A 4FGRA 2BMCA 3HO8A 4EL9A 5AV1A 4FZ7A 2XNMA 3HAMA 4XJ0A 1URWA 3GOKA 2EVAA 4R7BA 4XH6A 5J1VA 2XEZA 1HCKA 1IOWA 4HQ6A 3MGYA 3W18A 3IOKA 4F6SA 3DY7A 2OO8X 2BPMA 4YJ3F 3AC4A 2CGWA 3JXWA 3HNGA 4PMSA 1L3RE 3HDMA 4M3QA 5H8GA 3T3VA 4GU6A 4Z3VA 2W71A 3JRXA 1JKSA 1VYZA 3LHJA 4ID7A 3ZSGA 4KBKA 5AP4A 3BEGA 3F3TA 3Q5IA 3NYVA 3O17A 3U55A 3CGOA 3HV5A 1ZOEA 2VO3A 4QMYA 4YJVA 1JPAA 3F66A 4QTAA 3ZZEA 3PG3A 4W4XA 4DLIA 4BCPA 3ZXTA 4MXCA 1B6CB 3H0ZA 4RG0A 3TV4A 4OTWA 1SCUB 2YABA 3LE6A 2C6MA 3EWHA 3L9PA 2C5NA 5EQYA 1TQIA 2XMYA 4UZHA 3A2CA 3CTHA 2OFVA 4BDBA 3S00A 1QL6A 3NCGA 1EUCB 4HPTE 5LVOA 4OLIA 4GUEA 5FRIA 3GQLA 4IZYA 4O21A 3SXSA 4E4MA 3UIMA 1W84A 4BIDA 2X4ZA 4YR8A 2GNJA 1XKKA 2HXQA 5D9HA 3MY1A 4TTHB 2FP4B 2VX1A 2CSNA 4ALWA 1P5EA 4UEUA 3HUBA 3MVLA 4EH7A 5FUTA 2EU9A 4OR5A 4BDAA 4RPVA 4ERWA 4IWOA 2E9UA 5IDPA 3MPMA 5BPYA 5HICA 3KK9A 1Q4LA 1ZY5A 3HDNA 2WZJA 3QQFA 4I5CA 3P23A 5C1PA 2AC3A 5IQHA 2F7XE 4ZLYA 5CF8A 3NGAA 2WFYA 3SX9A 3ZFXA 1H4LA 4J53A 4BZNA 3FHRA 3RZBA 3TUDA 3AMAA 4KWPA 4RBLA 5JQ8A 3FL5A 5T3QA 2WQOA 4IZ5A 5M56A 4EG0A 3FC1X 5FBNC 4J98A 2PE1A 2QLUA 3FLQA 4UALA 1T46A 2QOCA 4ZSLA 3I79A 4FNYA 4PDPA 5AJQA 3VNTA 2YYAA 3R5HA 1CTPE 1OI9A 4XP0A 5EYDA 2ITNA 4GKIA 2OLSA 3CKWA 4WNPA 1FGKA 3PZHA 3VULA 3QX2A 4L42A 4I55F 1WBNA 5HVKA 1H1PA 3PIZA 4ACMA 4JDKA 1GGOA 5DH3A 5M44A 2GQGA 2BTSA 5DN3A 4O81A 5LOVF 3OWLA 5EW9A 5FQDC 3A62A 5C8KA 1W83A 4A9UA 3U6JA 4OTRA 2W6OA 1YVJA 4J7BA 4BRXA 4FNWA 4XG6A 4YGAA 1GIHA 5FEEA 5CF5A 2J9GA 2CLXA 3W1FA 3AX6A 5M08A 4Y8VB 1Q61A 4BI1A 3HMNA 3IDPA 2Y8OA 2VTPA 4C02A 1PXOA 4JG6A 2OGVA 5CU2A 5IQAA 3IW6A 4M8TA 2FH9A 4F7LA 1DAWA 4CGAA 3NS9A 1U5RA 2C69A 2XZSA 3DBEA 3QX4A 2OBJA 4FYOA 4AFEA 4HVDA 4IEBA 2VZ6A 3F3WA 3KMMA 2C0OA 4IE9A 4ALVA 5A4CA 2GDOA 2QKWB 1UNGA 5EI8A 2UZNA 1W96A 4Y8DA 3FMMA 1U5QA 4JBOA 4FSQA 1KV1A 2XBJA 4BBEA 4IZOA 4XX0B 4R7IA 2ZV7A 2UZWE 3JY9A 3D7TA 3OT8A 3HL7A 3E8CA 3QRKA 5AV4A 3MFTA 3VUHA 4AW2A 3PA3A 3MY0A 4BDJA 3Q4ZA 4HNIA 1ZOGA 5AAEA 1E1VA 1G8SA 3V8TA 3ORKA 3QRJA 3K3JA 4USEA 3ORNA 3Q9YA 4HGSA 3C4WA 2NPQA 3QZGA 3OEZA 3EFJA 3EN9A 4O83A 2FSTX 3ZRMA 1F3MC 5BVFA 4EHEA 2PE0A 4AXAA 5LCJA 2PBZA 3G0FA 2B4SB 1YDSE 4RJ4A 1UA2A 4MD8E 1Z57A 4X7QA 4Y73A 3QKKA 4FTCA 4XV3A 4ZI7F 1NXKA 3VW8A 2KULA 2W1EA 4XYMB 5HV6A 4H3BA 4QMWA 4AWIA 3QYZA 2W1FA 4X3FC 3UIBA 5LVPA 3A7IA 3EQRA 3N51A 4G6NA 4XV2A 4HVGA 4GVAA 3W2QA 4ZY6A 3KREA 2HW7A 4X3JA 3OUNB 4QMLA 3HMIA 2OG8A 3NNXA 4O84A 5I4NA 3ETJA 3AOXA 3DZOA 3ENMA 3WBLA 3H9OA 4EBWA 3VS6A 3UQFA 4FL3A 3R8ZA 2HZ4A 5HE2A 1Q8WA 4M7IA 4GK3A 4CFNA 3VUIA 1IASA 2GHGA 3QQLA 4YO4A 4P5QA 5LYJF 2AUHA 3G0EA 1OITA 3MWDA 4R78A 2ITOA 4K77A 4XLIA 2PUNA 3LPBA 2DWCA 1EZ1A 3BQCA 3GCSA 5CQUA 1PY5A 1YHSA 4U81A 3GU7A 5TF9A 2OJFE 2PHKA 3A7FA 4FR4A 2R0IA 5BMSA 4O0VA 2J0KA 3LFFA 3DB8A 4JDJA 4O0TA 5CASA 2YIXA 3GFEA 3P7AA 5KKRC 2A1AB 2VU3A 3R2YA 4RFMA 4RT7A 1TKIA 3VS2A 3FPQA 4ZS0A 1A9XA 3VHEA 1OPKA 3QHRA 3U6IA 5A4QA 3DBFA 4FV1A 1GZ8A 3R9RA 1G5SA 4FMQA 5CAOA 2GFCA 4PMPA 4AUAA 3AT4A 3RWQA 2A19B 5HE1A 4LRKA 4WIHA 3KVXA 4EQUA 5BYZA 3OOMA 4OTHA 3Q9ZA 3UJGA 5K5NA 2QR8A 4L3LA 3W55A 4YUQA 4LOQA 4BKJA 1DIKA 3FZTA 3A7JA 2QO2A 4IJPA 1Y8GA 1ZMVA 4O7WA 4RJ7A 4AZEA 2XCLA 4P90A 2DQ7X 3DNEA 1XJDA 1YXUA 3F9NA 3V51A 5E90A 2XK7A 4CCUA 1WMKA 3PVBA 3WARA 5ITAA 5KHWA 4BBMA 1WVYA 5L8JA 3PIYA 4RRVA 2YZNA 3OVVA 1G3NA 2EUFB 2QONA 2V55A 3LFDA 3PA4A 4ITIA 4V0GB 4MAMA 5CAVA 3RCDA 2XIYA 4MV8A 5M07A 3MFSA 2ITYA 4FIFA 1OKVA 4O4JF 2IZTA 3ORLA 4IBMA 5I9UA 3U54A 2W4OA 3QUEA 4CNHA 1KE8A 3EFLA 4FT5A 4ZP5A 3G90X 5E8ZA 1C3OA 2C5XA 2VO6A 1PKDA 4XG7A 4Y46A 5ANKA 3P79A 2YM4A 2UZEA 4ZMEA 1XH4A 4YSMA 5BVOA 4EK5A 4NW5A 4FFPA 3RAWA 3CIKA 5HCYA 2R3FA 3P5KA 4GU9A 1OPJA 3PSBA 5AM6A 3RWPA 4AN9A 4DFYA 3LWBA 3JVRA 4Y5QA 2IPXA 1JSVA 2VWYA 4WOVA 5H9BA 4TV8F 4WBNF 5EZYF 1LR4A 5DYJA 2OI4X 4NTTA 1BMKA 4BCFA 3KXZA 1KV2A 4FGBA 4TPTA 4O0WA 4F0FA 3Q6WA 5JRQA 5CSVA 5AUZA 3UOHA 5KMMA 1W98A 4IX4A 4UWBA 3TZMA 2PU8A 2UW5A 2XB7A 3IONA 4GFMA 4RIXA 3ZLYA 4DLJA 1YDTE 1IEPA 2W0JA 4RX7A 4A9SA 3MN3A 4MQ2A 3T8OA 3W8QA 2XJ0A 5F20A 5IQGA 4LUDA 4Q5EA 4AN3A 3NDMA 4BBFA 3DF7A 4CG8A 5CVFA 3DK6A 5K3YA 5IH5A 2NU9B 4FEXA 2X8EA 2YCSA 2F2CB 1GSHA 4U3ZA 4ANMA 2PVLA 3NZ0A 1GJOA 2RF9A 4BCIA 2CLQA 3F7ZA 3RM7A 2QR7A 4NFMA 3UPXA 2VTLA 1KJ9A 2C30A 3EH9A 4QTDA 3TNWA 3IW4A 5IISA 3BV2A 3C1XA 1Q62A 2PE2A 3GC8A 2R7LA 3AC8A 5GJGA 2ZM4A 2I40A 4W4WA 2JGZA 4OBQA 2X7FA 1JOWB 2X81A 3C7QA 5F4NA 2V0DA 4F6UA 2YDJA 1HOWA 3CJGA 3M42A 2IW9A 2P3GX 3RK5A 4APCA 5JQWA 4LI5A 2R3MA 3B8RA 4V05A 4DEBA 3O7LD 4RIYA 4BDDA 3NIZA 4GL9A 1XH5A 4S30A 3RHXA 3LQ3A 3ZLSA 5LVLA 4AFJA 2GNGA 1XH8A 3FLZA 3D94A 3ITZA 4QMZA 2UZTA 3ENHA 5JH6A 3H30A 5LQFA 2W17A 4G3GA 4XBRA 3P7CA 3Q4UA 3WZDA 4TYGA 4D5HA 5KUPA 4GG5A 4H1MA 3FYKX 3LCSA 2HJWA 3HV6A 3ATTA 4U42A 1FMKA 1PYXA 3C4EA 4PMMA 3BYVA 1IAJA 5CQWA 3ORXA 4WNOA 4IIJF 3FMDA 2C0TA 3JUHA 4AP7A 2UW7A 3OWPA 5I9VA 4D4YA 3R28A 3EMGA 3R1SA 3N4UA 3R9OA 4LGHA 3OCBA 4RC3A 3RKBA 3KU2A 3NUNA 2W9ZB 2UW6A 2BVAA 4A9TA 3I12A 1ZLTA 3GOPA 4JS8A 4B0GA 3VS7A 3RNIA 1ATPE 4Y95A 3ZRLA 5K5XA 2VWWA 1FVTA 2YCRA 2EXCX 3D14A 3L9NA 5HBHA 1OB3A 2W1CA 4U5JA 3VHKA 5AUVA 4FTUA 4ZQIA 5J1WA 4ASXA 1APME 3TIGA 3OT3A 1OIUA 1L8TA 4YU2A 2CHLA 3QWJA 5GONF 3VC4A 3GQIA 4O7ZA 2VRXA 2A4LA 5JVLA 1YI6A 1KOBA 4XEYA 3ORRA 4WHZA 2PL0A 2PTKA 1M2RA 3BGQA 4QTEA 3ELJA 1FINA 4QP3A 5B2LA 1AUVA 4JQEA 4TUYF 2QHMA 2VQDA 1WBVA 4BZOA 4L68A 4XG3A 2YM3A 3EYHA 4HW7A 5E8UA 5B2KA 3QLFA 5J9LA 4UYNA 4HNUA 2Y9QA 3WYXA 4MYGA 2EWAA 4EYMA 2ZV2A 4HYIA 3I0OA 3C4XA 3QTZA 5FXRA 3D4QA 3ZUTA 3KF4A 4X3FA 2OXYA 3LZBA 3AXWA 3Q4CA 4FKRA 3WOWA 2IVVA 3ZEWA 5LJJA 5GJDA 4OBOA 3ZM9A 1H1QA 4WD5A 3CSVA 3FMLA 4G6LA 4GEOA 3SV0A 4JJRA 5EI6A 1CQJB 4EGQA 1IG1A 1B38A 5HORA 1Q8TA 3UIXA 2H8HA 5M4IA 4O2AF 4X6RA 3ZOSA 4NK9A 4GFOA 5HNBA 3R9HA 4HNVA 3PY3A 2OZAA 1RDQE 5IA2A 4O22A 3TI1A 5FXQA 5JRSA 3W32A 4GK2A 2C6OA 4ASDA 5JQ5A 4HCUA 5AA8A 4JAJA 4K6ZA 3FZPA 4QMOA 3ZFMA 5CLPA 1QPDA 5EYMA 1V1KA 2WD1A 3OXIA 3MA6A 3EN7A 1M52A 2VTJA 2BKZA 1K2PA 3OFMA 4IB1A 4YHTA 4FTAA 2OJ9A 2O0UA 4I21A 4GKHA 4XG4A 4MV6A 4B8MA 3AW8A 3PG1A 3SXFA 2QOHA 3TZ9A 3C0GA 3OCSA 1P4OA 2C0IA 2JAMA 4FV2A 3ROCA 2J0IA 4FOCA 3C50A 3PXYA 1DI8A 4GIHA 1KJJA 4MWHA 3A8WA 4EOPA 4QMMA 2VGOA 4HGLA 3R1QA 4IIRA 5EYKA 1U54B 5EM5A 4X2KA 4BHNA 4KD1A 2AYPA 3VA7A 2OWBA 2BTRA 4PP9A 4JVGA 3PPJA 2BRBA 1GSOA 3DAKA 1GIIA 3KXMA 4HZRA 3T9TA 4BDGA 5AP0A 3QD4A 1UWHA 4EOKA 2QD9A 2XA4A 3ZSHA 5KO1A 4O6EA 2C1AA 2R3JA 3AD5A 3MI9A 3KF7A 2R3RA 3EQDA 2WIHA 2ZVAA 5F9EA 2C6TA 3HMPA 5D8DA 4XMOA 5HU3A 5AMNA 3MB6A 3NCZA 3Q52A 2PVKA 4JXFA 4NIFB 2P4IA 1IAHA 4C7TA 4IX6A 4M0YA 4CFMA 5CNNA 3OWKA 1R3CA 4ANSA 4FE2A 4MHAA 4AOIA 2PZYA 4YMJA 3DJ7A 4XLVA 2I80A 4R3PA 3ANQA 4FSWA 3TIZA 1JSUA 1ZOHA 4CFWA 4KINA 3TEIA 5HU9A 2V5AA 2XK9A 4MK0A 3QFVA 4AG8A 1GIJA 3ZLXA 3D5WA 5A46A 4E4NA 3FV8A 4S2ZA 3BV3A 5L6WL 4AU8A 1F0QA 2HOGA 4EH3A 3VBXA 2QLQA 4QQTA 1ZMUA 3QAME 5CENA 3GCVA 3UNJA 4WUAA 3UQGA 5KHXA 3DT1A 3LXPA 1VBGA 3NLBA 4GYGA 4IJ9A 3C4CA 3NUXA 4DEIA 1CS0A 4L46A 4FSTA 5I9WA 3NSZA 3IDBA 4D0WA 4OBPA 4CZUA 3R7VA 3DS6A 5JSMA 3BHHA 3ZRKA 3WF9A 2IVUA 4FEWA 4G3EA 3IOPA 2XIKA 4S34A 4NSTA 2QVSE 3TV6A 2F49A 2NO3A 3PWDA 3I5NA 4USDA 4X2JA 3B2TA 3OP5A 5AX9A 4RX5A 5BVNA 1AUXA 2PZIA 3U4UA 2BDJA 3AGLA 1YI4A 3BE2A 4S33A 5CVGA 5J95A 3VUMA 4D1SA 1OL7A 3DKOA 2GHLA 3K3IA 1GOLA 3C0IA 4N6ZA 4RFZA 5IMEA 3V4ZA 5FM3A 3DXQA 2JAVA 1AQ1A 2QURA 4BTFA 2XYUA 1SNUA 3LQ8A 4U8ZA 2YZMA 3OUUA 2LGCA 2JD5A 3N8DA 4PDOA 4IAZA 3C5IA 3P08A 3VF9A 4TYHA 4FSMA 4MX9A 3Q5ZA 4U6RA 3KXHA 4QMUA 4M69B 2Y4IB 2XVDA 4QP6A 3CTJA 3VO3A 2XIXA 3MPTA 4A7CA 4IMYA 1H0VA 5LWNA 4L52A 2OJGA 4CTCA 4R3CA 2XKEA 4E1ZA 2PVNA 2W70A 2BFYA 5AUUA 3DZQA 3CQEA 5HGIA 3EQGA 1OUYA 2XKDA 2B55A 4UBAA 3IW5A 1ZZ2A 4TYEA 3F2AA 4KKGA 3KB7A 4BYIA 4LOPA 3QTWA 2B9JA 4O38A 2B9IA 2VD5A 4TNBA 1W0XC 5L2SA 1H08A 5CSPA 3BPRA 3ORMA 4DTKA 4DYMA 1RW8A 1UVRA 4TWPA 3QU0A 3L8XA 4I20A 5DR2A 4XZ3B 2YACA 3F5GA 4ASZA 3N4TA 2IWIA 3RV4A 5FGKA 2PZ5A 1M7NA 1A48A 3C0HA 3FSKA 3BYUA 3BRBA 2JIUA 3KRRA 4L8MA 3F3ZA 2RKUA 4YJRA 4DTAA 5CT0A 4QO9A 2VV9A 4XRLA 1ZYDA 4BIEA 3JR1A 3DKFA 3MBLA 3PWYA 2OF4A 5CS6A 3IW7A 3LCKA 1Y6AA 2F7EE 4K2RA 4F7SA 5CI7A 5FNVF 4HPUE 3PVWA 4AW0A
chains in the Genus database with same CATH superfamily
4CFVA 4QRCA 1PXIA 4MWIA 1EKPA 1MRVA 5F95A 4U3YA 2BR1A 3PE1A 3E87A 3E8DA 3PLAE 4I4TF 1SVEA 1UU8A 3DGKA 1OM1A 2ITTA 3CTQA 4EJ7A 3T3UA 3W0SA 3ZBFA 4ALUA 2P33A 1MQ4A 2WELA 4QMSA 4XX9A 3TN8A 1XH9A 3GBZA 2VTQA 3I7CA 4QQJA 3ZO3A 4DHJA 4YTFA 3HX4A 3E63A 4LMUA 2PN1A 4HJOA 1KTAA 1QPJA 3WF6A 1MUOA 4K11A 4KS8A 3NNUA 4V04A 4AZFA 2JBPA 5D1JA 5HIEA 3FMKA 4FUXA 3LFNA 4ANQA 2WTKB 2VWVA 3N6RA 1ZZLA 4L9IA 3UQCA 4CXAA 2X7GA 3NEWA 4QQCA 5C1QB 3GU8A 3EHAA 4ENYA 2F4JA 4KSQA 4Q2AA 4M12A 2R3HA 2CPKE 4FSZA 3F5UA 4FYNA 5LMKC 4EQCA 2ACXA 3GEQA 5T68A 4YPSA 4C35A 4CVAA 1QCFA 3CPBA 4F9WA 3CKXA 4WG5A 5ACBC 1BKXA 4JLCA 4KKHA 3RHKA 3TG1A 4XG2A 4AZVA 3FKOA 4C4IA 1I7NA 3IPHA 4UUGA 5DISC 3A60A 4MXAA 3FLYA 5JMSA 4BIBA 3E5NA 5I9ZA 5BQ0A 4FFRA 1KUTA 2CFMA 2WTIA 5BPFA 2Z7RA 4XCUA 5T6KA 1DS5A 5JFWA 1PXKA 2HZNA 4I6QA 4D28A 5K4IA 4TVIA 4C4GA 1YDRE 4UXQA 4MXZA 5AUWA 2YEXA 5BUEA 4N70A 2OF2A 4TN6A 2E9VA 4QYEA 3R83A 4M13A 1OECA 5KZ0A 4LOOA 4M0ZA 3RGFA 3M11A 4IFGA 3UZPA 1TQMA 4MF1A 4AACA 4Z7GA 3T99A 4ZHQF 3PVGA 4M14A 3R9NA 3W8LA 3EIDA 5CE8A 1XBAA 2CGUA 3D2KA 4ZTNA 3L1SA 3NWWA 4EONA 1OPLA 4YP8A 3T9IA 4ZTQA 4OGRA 4NJDA 5EQPA 3A4OX 3PVUA 1J7UA 1Q99A 2BAJA 4KNBA 4W8EA 4DFXE 5FDPA 3L9LA 3FBVA 5LMAA 4MEDA 2O64A 4FVRA 3S4QA 3BE9A 3IO7A 1I44A 1JLUE 3GU6A 4HVIA 4YZNA 2HIWA 5G1XA 2V5QA 3DKGA 3F7WA 3E8EA 3QYWA 3GFWA 3W5OA 2XK8A 4OW8A 4FUYA 3K5VA 2X9EA 1ET0A 2Y4IC 4FEVA 5KX8A 4QP1A 1AD5A 3VS3A 4BDHA 5IQFA 4N0SA 1XO2B 4K8AA 3QQUA 2GS2A 2VNYA 3UVQA 2EIYA 2Q2UA 4FKWA 3MJFA 3HLLA 4TZRA 4IVCA 4BCHA 1KE5A 3PJCA 4C33A 1OGYA 3PJ8A 3Q6UA 3R02A 3KULB 5HEZA 5A6NA 2GQSA 5HD4A 1R1WA 3G5DA 4IANA 1BNCA 3MIYA 4EOOA 3AGMA 3QZHA 3R7IA 1PMEA 3VBYA 4E5AX 4EH5A 3KQ7A 1KE7A 3I7BA 4R3RA 3VUDA 5ANDA 3P86A 5A4LA 4D5KA 2JIVA 4XG9A 2GTNA 2R82A 2P55A 2PMOX 4FOBA 3RPOA 1BXRA 3UIUA 2QO9A 1JQHA 2HGXA 5A54A 3RPRA 4J8NA 4IM2A 4PF4A 4ZTRA 5HLPA 3MSSA 3EYGA 1J3HA 4Z9LA 3TUCA 3WWHA 4NFNA 1U46A 2X2LA 3BEAA 5DPVA 3MTFA 5HG7A 3UP7A 1CKJA 5IUGA 2YDIA 1M14A 3HV7A 5JFXA 4EUTA 3ZUUA 4F0GA 3ZO1A 3DBQA 5DR6A 5D7AA 2WMSA 3RCJA 4DCEA 4O2ZA 3CBLA 1RQQA 2E2BA 4IW0A 5CT7A 2VNWA 3TKUA 1Q8UA 3QXPA 3DTWA 3MY5A 4FKQA 4OT5A 3R5XA 4WUNA 3LP8A 1XBCA 4ZOLF 2XKFA 2B9FA 2GNIA 2OKRA 4TYHB 4YAJB 2B53A 4DG3E 2WGJA 3W0RA 2PVPA 3OZ6A 4ME6A 5DMXA 1KE6A 3PFYA 4IWQA 3EKKA 1TA8A 2C6KA 4E6QA 3R1YA 1IA9A 4RJ3A 4YC3A 4BCMA 5IA3A 2Y4PA 3RVGA 3O50A 3CGFA 3R0TA 4FKSA 4QPAA 4IB5A 1Y6BA 3I60A 4HNTA 2Y7JA 2YIYA 1E1XA 3MWUA 2QOFA 3ODYX 4TKSA 5E92A 3TNPC 4CRLA 4D0XA 5JGBA 5CSXA 4Y5HA 2CJMA 3LMIA 4B7TA 3GENA 3DXPA 3NUYA 1B6SA 4KABA 2WTWA 1PF8A 3PRIA 4QP8A 2QOOA 4DLJA 3DAJA 3IGOA 3DFCB 4K1BA 4XP3A 4EH4A 3TIIA 3LFAA 2HGSA 4EH9A 4ONAA 3EQCA 4QP2A 3V8WA 4AOTA 3U0GA 5L2IA 4UCOA 2BDFA 4XRJA 3BU3A 4YJTA 5HESA 2AEGA 4BYJA 3I4BA 4ACCA 3W0OA 4O2BF 2UZDA 5HTCA 2QF7A 2YIRA 5JN2A 3NW6A 3BHVA 5LVNA 4U80A 4F99A 3C4ZA 5BMVF 2W1IA 4FNZA 4B99A 3OTVA 1WCCA 1PW2A 4F1TA 3VN9A 1YOLA 2XNOA 4G16A 4AXCA 4EH8A 1B6RA 4X0MA 3BG5A 4N57A 2ESMA 2XAOA 3DA6A 4DITA 5IA0A 4DRFA 1J7LA 4C59A 4WO5A 3I0QA 3ZHPC 4U41A 3MWEA 1OL5A 3T9CA 2H9VA 3TCPA 3ZDIA 2EJ0A 4FX3A 3S1HA 4ZSAA 4PNKA 4I6BA 5M55A 4WG4A 5L8LA 1YRPA 4ZK5A 3PPKA 4FODA 3WF7A 5IA1A 2X5RA 4LRJA 4Y83A 2UW0A 4Q9SA 3VS1A 4JX7A 5JK3A 4IH8A 3FXXA 1YXSA 2X2MA 3I5ZA 3DV3A 3QTRA 3RTPA 4CLJA 2SCUB 4J8MA 4IACA 5EOLA 4I0SA 1V9PA 1SVGA 3BHYA 2RFSA 4YZDA 4QSHA 1X8BA 3QQJA 2V58A 2IW6A 3IGGA 5FTGA 3U6HA 4U40A 1O6KA 2P0CA 5CALA 1IA8A 4K9YA 4A06A 4L43A 5HO8A 2FPPB 2X0GA 3A7HA 4H36A 4QTCA 2GPSA 2W6PA 5DVRA 3DPKA 2NNWB 3G51A 3UP2A 4CHIA 4TYIA 4EZ5A 1JKTA 5J9ZA 1UKIA 2CKQA 1KOAA 4WRSA 3D0EA 4ZTSA 3V5PA 3W16A 1JSTA 5C8YF 2ZDHA 1ZXEA 4E73A 5H8BA 4KUJA 2OK1A 3QXOA 4YTCA 5J5SA 5IZFA 2VR1A 2W9FB 4FTIA 4RA5A 3QBNA 4RQKA 3RPSA 2O65A 3C5UA 2PY3A 4DFNA 5JGAA 4GH2A 3HRCA 5IA4A 1NA7A 3NNVA 5IU2A 4LL0A 5L6OA 1A06A 3MDYA 2ZOQA 3FYJX 4DEGA 2YS7A 3TKHA 4PUZA 4PTCA 4YHFA 2G2FA 4E8AA 3QCQA 1AGWA 2X9FA 5E8TA 4F7JA 3KYHC 5JGDA 2JITA 2A0CX 2R3KA 1OZ1A 2X6DA 3DTCA 3VQHA 4F63A 2VN9A 1DGSA 1I1KA 4BGQA 4IAAA 2ITZA 3OY1A 4EOQA 2Z2WA 4GJ2A 4G3CA 4R1VA 1K9AA 5EFQA 5E8XA 4CLIA 4AF3A 3Q9XA 2XEYA 3GC9A 3OEFX 2GS7A 2R3IA 3R21A 1WBWA 3GU5A 4X3FB 4GT3A 4G9RA 4I5PA 5KMKA 4USFA 1JAMA 2HWOA 2C5VA 3SHEA 3DBDA 3O0GA 4GS6A 2IG7A 3PZEA 4TRLA 5J9YA 3QUPA 5HNGA 5LOHA 2B9HA 4FL1A 4ASEA 5BWRA 1XH7A 3F69A 5TOZA 4DIMA 3QTXA 4ANLA 3AD6A 3NC0B 2VTMA 4I4EA 4X2GA 5BNJA 2G01A 3QZFA 5KKNB 3NYOA 1IR3A 5GINE 5JVDF 4DGOA 2XCHA 2GPWA 1FOTA 3CR0A 3BYSA 5F1ZA 4DGGA 5IA5A 2WOTA 3REPA 4ZTMA 2XCKA 3R04A 5E8SA 2BAQA 5DI1A 3R7YA 4BCKA 4DDIA 3BWJA 1OUKA 3EZRA 4JR7A 4L53A 3ZO4A 4TL0A 3SG8A 3I6WA 3DOGA 4FIGA 2XNBA 1YKRA 3LW0A 3VBWA 4F0IA 3TW6A 3F61A 4YJQA 4YTIA 4UY9A 5CU0A 3BIZA 4JBPA 4BCOA 3D7ZA 5DGHA 3FMHA 1WBOA 5B0XA 5TKDA 5GIPE 3WILA 3ZYAA 3UZBA 3BA9A 1R0EA 3DFAA 5EM6A 1R78A 3R73A 2PVJA 5FTQA 4E4TA 2BZJA 1WZYA 3W2OA 3VVHA 2R84A 2HYYA 2ZJWA 2C68A 2ETMA 3E64A 2JKMA 3RAHA 5DFPA 2UZLA 4QMVA 1EHIA 1UU3A 4GK4A 3T9AA 3TINA 4FKPA 2YZLA 3O7LB 3A99A 3FLSA 2W06A 2IZUA 1G8KA 2GS6A 4ZXTA 2WMQA 4BTJA 5LP6F 1CKIA 3P1AA 4FG7A 4QOXA 1H8FA 3ORTA 3CY2A 4FIHA 4EWHA 2WNTA 1CDKA 1Z5MA 2ZAZA 4AXEA 3W1BA 4IAKA 2EJ3A 3JSNA 4B4LA 2R3GA 4RIXB 4I1ZA 3TZ8A 4EH2A 4HOKA 5BVDA 2Z04A 2Q2TA 5KMNA 5LWMA 3KFAA 4C5AA 1EH4A 2C3KA 3TTJA 4FSNA 2W5AA 1XR1A 4EK6A 2WMRA 3PJ1A 4G5PA 5BVKA 2A2AA 2WQNA 3LCOA 2XUUA 1KT8A 5HTBA 1PMUA 3CY3A 3KMUA 5KBRA 5HG9A 3EL8A 3GGFA 3ZDUA 4DCAA 2X8IA 3NYNA 5IH6A 2W1DA 3QRTA 2W96B 1PMNA 2Q7DA 2GNHA 3UG1A 3E7VA 1I09A 4FG8A 2XF0A 3PJ2A 4UXLA 3WZUA 4YJPA 4EK4A 3DTGA 3HV3A 4D9UA 1BL7A 5AUXA 3EL7A 3PIXA 2YIWA 4X21A 5KNJA 3AQVA 2HGWA 4U9AA 4J95A 4J99A 3KRLA 4H3PA 4XP2A 2WPAA 4JBQA 3NAYA 4RVLA 1KJIA 4JAIA 5KX5F 2WB8A 4ANBA 3O8TA 3L8VA 4CT1A 4DG0E 3WYYA 3A8XA 4ZSEA 4KKEA 4XYFA 1T45A 2Y6OA 2YM8A 2ZB0A 4I0TA 2PZRA 4UFZA 5FR9A 1GNGA 2YDKA 2JLDA 2ZDTA 3GCQA 4EWQA 3MH3A 1I7LA 5CR5A 5I5SA 4E5WA 3FWQA 3PXZA 3VUGA 2J7TA 1H01A 2ZGIA 3TKIA 5ICPA 4ZAUA 1ULZA 3TEKA 5E8VA 3R5FA 3Q4TA 2XP2A 5EM8A 3T9DA 1NVRA 2YWPA 3PRFA 2JEDA 2X7OA 5AV3A 3KY2A 1HCLA 1SZMA 3MA3A 3MTLA 3AC3A 5HCXA 1CKOA 5D7VA 5DT0A 2VWXA 3GU4A 4XG8A 4CKRA 4ZJIA 3UTOA 4E4LA 4C38A 4LYNA 3OW3A 3TNHA 3GP0A 4FTTA 4NKAA 2W5BA 3BX5A 3CE3A 5I47A 4CKJA 1M2QA 2IW8A 4BZDA 2NU6B 3FMNA 4FKUA 1UV5A 3U9TA 3IKAA 2W1HA 3K5UA 4C36A 1NW1A 2OLCA 4GT4A 3JVSA 4M15A 3EQHA 3JPVA 1OGUA 3R8PA 4QYYA 2RIOA 3ODZX 1JKKA 4FEQA 4YZBA 4IWYA 4F7NA 4YZMA 4CCBA 4CKIA 3NFFB 4ZOGA 4EOSA 3DAEA 2UW8A 2EB2A 4O91A 2YISA 3ATSA 3Q2OA 2I87A 3KVWA 3NVMB 5HBJA 2FSLX 3UPZA 2XD4A 3M2WA 4KS7A 5ANGA 4UV0A 3RPVA 2WXVA 3LMGA 3QD2B 4HYHA 2R87A 4BI2A 3E8NA 4AA0A 4CG9A 1CM8A 2YW2A 3V5QA 4EKLA 4E4XA 4RWJA 3HZTA 1P8LA 3FJQE 4FK6A 4I22A 5E1SA 3UFXB 2H6DA 4D1ZA 4XOYA 4U97A 1LP4A 4C4EA 4NUSA 5C01A 3KGAA 4F64A 4NW6A 3NUSA 1YXTA 2J2IB 4KBCA 3MPAA 4FTOA 1PHKA 3JYAA 4E6DA 4EHGA 3FY0A 3DK3A 2G1TA 2QI8A 3OUKA 4U45A 2SRCA 4D2SA 4Z7HA 4K33A 1JKLA 2QOIA 4DINA 1P16A 5CA1F 4EK3A 4PDYA 2W5HA 2QODA 4K0YA 4RC4A 2XM9A 3LCTA 1KJ8A 4MVFA 2QOKA 4RX8A 5J2UF 3CLYA 4RIWA 3H0YA 1WBSA 3MIAA 4RFYA 4EBVA 1Z2OX 4BN1A 2XNNA 3DQXA 4TYJA 5JFSA 2HIXA 2O3PA 4QDVA 4RVMA 2JFMA 2XYNA 3EQFA 4YLJA 3KRJA 5DHJA 4CMUA 3LXKA 2WEIA 3WI6A 4F09A 3NW7A 3R22A 5DGIA 4NM7A 4GT5A 1Y57A 5IMXA 3SE7A 5I5ZA 4PL3A 2JDOA 3LLTA 3VS5A 2J5EA 2VTTA 3UDSA 4EOLA 3NIEA 3R8LA 5BWUA 1STCE 4GRBA 4GG7A 2XNPA 3R8VA 3FE3A 2KTYA 4IZ7A 5KBQA 1DV2A 1EKFA 3PXKA 1SVHA 3MJ2A 3VF8A 3O71A 1EYZA 3GVUA 2EXMA 5LCKA 3FLWA 3BL9A 4PTGA 5HE0A 3NAXA 2ETRA 3AT3A 3CPCA 3FKNA 3MFRA 4HGEA 4LG4A 3SW4A 4I41A 5HBRB 2PUPA 3G8DA 5KMLA 4EKKA 2I8CA 4MA0A 3BKBA 4WBBB 3ROYA 5AP5A 4MXOA 3SD0A 5DGZA 4FSRA 3ZFYA 3F88A 2QQ7A 2UW3A 2B54A 4YZCA 1DV1A 3E7OA 3ALOA 1W8CA 3F2RA 2AC5A 4O27B 4OT6A 2A1HA 3CC6A 5EQEA 5AP2A 4C3PA 4C62A 4BDIA 5CAPA 2CZGA 3SRVA 4L7FA 4YB8B 4O6LA 3KC3A 1WBPA 2VGPA 3AC1A 3EQPA 5DG5A 4D4SA 3SVVA 2HW6A 4NM3A 3SGCA 2DIKA 4EH6A 4TWNA 1Y8YA 3OW4A 5FLFA 4O4HF 4NCTA 5FDXA 4GLXA 1BL6A 1NT2A 4FFMA 2GPHA 4FTLA 4II5A 2RGPA 4UYAA 2UVYA 5FTOA 3U9CA 2F9GA 2RFDA 3DNDA 5E7RA 3KXGA 5JH7F 4PNIA 3FI4A 3TJDA 2OSCA 3Q2JA 4XS2A 4C2VA 3IW8A 4GMYA 4PP7A 4DT9A 2QOQA 3O23A 4FL2A 3ZS5A 4G34A 3MESA 4D4RA 3RAKA 2PYWA 2YFXA 2R3OA 2VAGA 3WF8A 5IQDA 1Q3DA 4N4SA 5FEDA 3V3VA 2J9MA 1YOJA 5HCZA 2UW9A 2ITXA 3NBYB 5C8MA 2V7AA 5CAEB 3FZRA 1KC7A 4RWIA 4EYJA 4J96A 2JKOA 1S9JA 4A4LA 1C30A 2JFLA 1Z2NX 3HAVA 2HDKA 1U4DA 4FSUA 5M4FA 4C2WA 3HA8A 2YS6A 2J90A 2CNVA 4IFCA 4DTBA 3BU6A 4GLWA 5AP6A 4C34A 2R7BA 2OIQA 2GFSA 1PXJA 4G3FA 5DIAA 4ZJVA 4NM5A 1A0GA 2R3QA 4C4JA 3MS9A 5HVJA 4C4HA 3GXLA 4O0RA 3RK9A 2J51A 2YZAA 4R5SA 4I5MA 4Z16A 3FZSA 2QCSA 3ALNA 3ANRA 3PDTA 3WZJA 3BYOA 5EW8A 4AT3A 4X2FA 3UZRA 2FB9A 3HBLA 5I0BA 3WZKA 3LAUA 2CMWA 2C4GA 3IS5A 2F2UA 2OJIA 3VW6A 2X6EA 5ANOA 4Q5HA 3U9SA 4BICA 1XMLA 4BTKA 2WO6A 4JDIA 2JIIA 3P4KA 3A4PA 1OBDA 3RAIA 4A4OA 5EKNA 5M06A 4E6NA 4LQMA 5A6OA 3Q9WA 4DC2A 4RGJA 5JKGA 2ODTX 2UZOA 4RVTA 5IQIA 5CEIA 3TJCA 4O7VA 1ZY4A 3GDEA 3R7OA 1FGIA 4MBJA 3H4JA 1LEZA 3TZ7A 3KULA 4M0JA 2J4ZA 4FKJA 4JG7A 3FMEA 4RZQA 1U59A 3ZZWA 4RJ5A 3NR9A 4O0UA 1Z9XA 2UZUE 3LOKA 2HCKA 2QG5A 5L3AA 4TWCA 4NZWB 3UOJA 4G6OA 3Q60A 4AT5A 4EJNA 1PXPA 3NUUA 4JI9A 4TNDA 3PJ3A 5HE3A 3RPYA 3S3IA 4OTDA 1IOVA 2WQEA 3PN1A 2BCJA 3PFQA 4YJNA 3V5LA 2PVFA 2FSMX 1H27A 3DB6A 2RFEA 3ZUVA 4IZAA 1REKA 2V7OA 3OCGA 1ZARA 2CKOA 5J2TF 3ORPA 3KRWA 2OZOA 5AUYA 4CZTA 3UNZA 4IC7A 4FT9A 1V0BA 1J91A 5HO7A 2Q83A 5BWVA 2BUJA 5BYLA 4FBXA 5C4LA 2G2HA 1PRYA 3DCVA 3IQ7A 3ET7A 5J7HA 5CA0F 4PWNA 4O7SA 5EYCA 3LMHA 1GY3A 4XOZA 1VBHA 1H24A 4FKGA 1PXNA 1E9HA 2UW4A 3HB9A 3B8QA 4UCRA 3O8PA 2ITQA 2R4BA 4IDVA 4R6VA 4APPA 4YC8A 2HXLA 4TW9A 3BQRA 5C8NA 2W7XA 2XK3A 5C1OA 4GV1A 4F1MA 2VTRA 3FXZA 5D41A 4XV9A 5CEKA 3QQMA 3R1NA 4KIQA 3DXNA 1CKMA 4YLKA 2UVZA 1FMOE 1WBTA 5ANIA 2BRGA 5DR9A 2WAJA 1Q97A 3HRBA 2ONLA 5C4KA 3DBCA 3HEGA 5L2TA 1URCA 2W99B 4X6QC 4O86A 5CU4A 5KMOA 2J5FA 2R3NA 1WAKA 3Q04A 1ZRZA 4TT7A 1LEWA 1GZKA 2Q0BA 2WHBA 5BMMA 2OXXA 3FUPA 4JQ7A 3IECA 4J97A 3TACA 5L8KA 2A27A 4JMQA 4PMTA 4WBOA 3I81A 5EHYA 5DEYA 5FP5A 3CD8A 3O8UA 1BI8A 2QC6A 4I3ZA 3AMYA 4CMOA 4QYHA 5K9IA 1QPEA 2CGXA 3V04A 4FTQA 4DHIB 2R2PA 2PZPA 1H0WA 2C3JA 3EQBA 3LM0A 5CNOA 2QK4A 3JZIA 5HVYA 4CTBA 4BCNA 3FZ1A 2XIRA 1PXLA 4NH1A 1IYEA 1G8JA 1TVOA 2O2UA 4FTNA 3QQGA 1YHWA 4DHFA 4YNEA 1RE8A 2WMVA 4EC9A 1JKJB 3OF0A 4EUUA 3HT5A 3CP9A 2XS0A 2CCIA 3V8SA 4BJJA 2XH5A 5HG8A 2DLNA 3OROA 3TT0A 3FKLA 2XK4A 3R2BA 2QG7A 4PX6A 4D1XA 4MQ1A 3O2MA 4JBVA 3ZO2A 1MP8A 1ZYJA 4KA3A 4NYEA 5CEQA 2HVQA 4O4IF 5FD2A 3EFWA 2Q0NA 5EHOA 1Q3WA 3MYGA 3C9WA 1UC9A 3DJ6A 2XM8A 1ND4A 2BALA 2YRXA 4G5JA 2O5KA 4L3JA 1Q8ZA 4RJ8A 4J71A 3CD3A 3G6HA 1YW2A 5DWRA 5CX9A 4AZTA 4BTMA 4AAAA 2YZGA 4MNEB 3QKLA 5EH0A 3RP9A 5DT4A 2VWUA 4DH1A 2HK5A 1YXXA 3AKLA 1R39A 2I7QA 4FKTA 4KAOA 5EDQA 4YJOA 5HQ0A 1H00A 4W4VA 4NM0A 5EOBA 3DLSA 2ZMCA 4Y72A 5HNEA 2XRWA 4H1JA 1IRKA 4L67A 5I60A 2J0LA 3PA5A 3VMMA 3LCDA 3Q32A 4ACGA 1BI7A 5HKMA 1YI3A 3MVJA 2BAKA 3M1SA 4NJ3A 1FVIA 2C6IA 4RIWB 1FVVA 3ID6C 4O7LA 1YWVA 4LRMA 1YWNA 1OL6A 1ERKA 3UVPA 4IX5A 3VS4A 3DLZA 4OUCA 5D1PA 1KBLA 3QCSA 3R00A 4MV3A 2XJ1A 4R77A 3NNWA 2IP4A 3ULIA 2PMLX 3FMJA 5AEPA 4FZDB 1RJBA 4LH6A 4YBJA 4F9YA 3JZ6A 3F6XA 4RLKA 3BGPA 3D5XA 2VUWA 3G9NA 4H3QA 5BVWA 5AV2A 4AQCA 1BLXA 3PP1A 2VX0A 2CNUA 2VX3A 4MKCA 5EDRA 3K5IA 1V0PA 4FTJA 4V01A 3RFCA 4XNEA 3ZCLA 4GIIA 4BI0A 5CTPA 3PSCA 5AFVA 4D9TA 4FVQA 4KB8A 5CF4A 2Z7SA 3E93A 4L45A 4MV7A 2UUEA 3CXWA 3G2FA 1XWSA 3DDPA 4WG3A 3VOTA 5CWZA 2CKPA 3W0NA 1NVQA 2HELA 3DU8A 4AQKA 2BILB 5TO8A 4NZMA 3TYKA 2JC6A 4CE5A 2Y6MA 2F7ZE 5HX8A 3KA0A 1F5QA 2GNFA 1W93A 4HR7A 2IJMA 2ZM1A 5EHLA 3RI1A 4HVSA 1XMMA 5K4JA 2VWBA 4CKEA 3KEXA 2RL5A 3LFBA 1ZYCA 3PY1A 1PX2A 1B39A 4I5HA 2BIKB 3QUDA 2R7NA 3R9DA 4G31A 3EB0A 3GI3A 2BRNA 3AKKA 3QALE 5IDNA 1XK5A 2JBOA 3ORIA 4BDCA 1J1BA 2P2IA 2WMXA 4KRCA 3V5TA 4F1OA 2ZDGA 2OIBA 5C03A 4JXUA 3C4FA 3E5AA 3FQSA 5IEXA 4DLKA 4DEEA 3C51A 3D9VA 5CZIA 3I1AA 4BCQA 3BLHA 4FTMA 4KIOA 3NW5A 4GSBA 3K5HA 4FV9A 5CF6A 5AWMA 3SA0A 3GT8A 3KN6A 4H39A 4I94A 4DN5A 2WTVA 2CCHA 3ACJA 4RQVA 4HVHA 4QMXA 2PVYA 2WMUA 3UYTA 1YOMA 4DF3A 3BBTB 2R3PA 4HNFA 4DA5A 3AMBA 5TT7A 3JY0A 4WRGA 4RWKA 2BZHB 3VBQA 3RR5A 2PVRA 2RFNA 4JG8A 4IM3A 4FICA 4D55A 2W6QA 4JRNA 4AA4A 4Q4DA 5BWXA 5CXZA 5CB4F 2VWZA 4DFUA 3VBVA 3VQUA 1JVPP 1PXMA 2R64A 4IAYA 1FPUA 3L8SA 3HYHA 3TWJA 5LXMA 3SLSA