1A48A

Saicar synthase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
305
structure length
298
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Atp binding protein
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
publication title The structure of SAICAR synthase: an enzyme in the de novo pathway of purine nucleotide biosynthesis.
pubmed doi rcsb
total genus 97
structure length 298
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 1998-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1a48A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1a48A02
4XHKB 4LFIA 4RLLA 3VS3A 3LWBA 1TKIA 2VTLA 3OP5A 2YM7A 3I12A 4FV9A 3VS5A 2RG5A 4UY9A 4I4FA 4QYHA 4PUZA 4GG7A 3H3CA 5FBNC 1GGOA 4IHJF 1CTPE 3EIDA 4MV9A 5K4IA 1NA7A 5AP4A 4EORA 3DV3A 3HV6A 1YRPA 3ODYX 4MD8E 4BYJA 4KIPA 4A06A 3MWEA 4IVCA 4BHNA 3A8XA 5E92A 4M14A 4IB5A 2WOUA 3VBXA 2J0MB 3PFQA 4O7YA 4MHAA 3RTPA 5CSWA 1MRUA 3FUPA 1SM2A 4FTNA 4D4RA 4EK3A 5GONF 1XKKA 4ZEGA 3PSCA 2EVAA 2OSCA 4CT1A 2ITNA 4HZRA 4L46A 1FMOE 5AIRA 1OPLA 2W5HA 1JKJB 3MESA 2C6TA 3QCYA 4IC8A 3KRLA 4PMPA 4RWKA 5BYZA 4K11A 2XK6A 4EUUA 4MBLA 4F70A 2VRXA 3VVHA 2VTMA 2IPXA 3F7WA 4AA5A 4D55A 4Y8DA 4D58A 3R1YA 1OBGA 3GQIA 5IISA 4YP8A 5LOHA 2V7AA 3IO7A 5CEKA 2YN8A 3PY1A 5KO1A 2X4ZA 2CHLA 3HMIA 4QMOA 3LFFA 2GDOA 3S95A 5IA4A 1JWHA 4ZOLF 3D14A 4A07A 2JDRA 4YLLA 4FV4A 2FSMX 4CTBA 3QRUA 3A7IA 4FT3A 4NU1A 5CAVA 4UZDA 3WI6A 1L8TA 4C02A 4AOTA 4AGWA 2OXYA 5I9UA 3TDVA 3WBLA 1VYWA 2F2CB 2GHMA 1Y57A 3ENMA 3GEQA 4O2ZA 4OTGA 4A4LA 2QOLA 3R71A 4IWDA 3GCSA 2P33A 2YCSA 3UDBA 1Z2OX 2P55A 3PA5A 4H1JA 2QG7A 3TKHA 3ZRKA 2DWBA 1W98A 3RWQA 3BQRA 3EN9A 5AUXA 3WYYA 5IEXA 2HWPA 2CDZA 4FL2A 5HVKA 4FK3A 2R84A 3NUYA 4F7SA 1R0PA 4HR7A 4IIRA 1JKLA 4B6LA 4B8LA 2VNYA 4BCNA 5CS6A 5DFPA 4EOMA 5C8YF 4AOJA 3L9LA 2OZAB 1JQHA 5CVFA 1BI8A 3MB7A 3CIKA 2HOGA 3RWPA 4FVQA 1JLUE 2AUHA 2PY3A 2B9HA 3ZTXA 1R1WA 3KULA 2G9XA 1SVHA 4E1ZA 4J52A 3LJ2A 3QWJA 2ZV8A 3KXXA 2UW8A 4KD1A 2UZTA 3CSVA 3CCNA 5FEDA 4DH8A 3RPRA 2C0IA 4ZMEA 2WTWA 3EN5A 5DHJA 2PN1A 4LV8A 4A4XA 5EFQA 2WMVA 3N8DA 2OIQA 3SD0A 2R87A 3FXXA 3CXWA 4ME6A 3TJDA 3D2IA 4HCVA 3KY2A 3W8LA 5AUYA 4AA0A 1PXOA 2F2UA 4D4VA 2W6QA 3MWDA 3JUHA 3V6RA 3GIDA 4TWCA 3LXNA 3CPBA 2C6EA 3W1FA 2OFVA 5KKRB 2DIKA 3BPRA 2NRYA 3QQJA 4C37A 2G2FA 5EM7A 2AYPA 3OTVA 4GYGA 3P7BA 2UZEA 3I5NA 4C5CA 2Y8OA 4IAFA 3CKWA 4F63A 1B39A 4J95A 4IB3A 1M2QA 2PVLA 3ITZA 4Y5QA 2YRXA 2GNGA 4RWIA 4FODA 3D15A 4FKQA 3D4QA 4LUEA 3KF7A 4I22A 3POOA 3QTIA 3RINA 2C47A 4IACA 3U51A 2FO0A 4J8MA 4DH1A 2PPQA 3P79A 4IADA 4L9IA 4TNBA 4M69B 1WBOA 4PL5A 1P4OA 3AX6A 4GVAA 4OW8A 1GSOA 4ZJVA 3TINA 3BKBA 2GLTA 3TIIA 4GU9A 3IPHA 5C1QB 3SGCA 4BI1A 2VTAA 3NNWA 4PDPA 3C1XA 4P5QA 5ETFA 2W6OA 2OF2A 4G6NA 3BWFA 4ZI7F 3V8WA 4UEUA 3UBDA 5IUIA 3CPCA 4WNMA 5CSPA 2IVTA 4EK4A 3F82A 4NJ3A 3DOGA 3UNZA 5JGBA 1W96A 3T3UA 3RAKA 5C4KA 3MWUA 3VS7A 2VZ6A 4QP4A 1OL1A 3NX8A 3E8NA 5BVKA 4CG8A 2IZSA 4QSHA 2YAAA 2UVXA 3MW1A 4GIHA 2JGZA 3MIYA 5F4NA 4WUNA 3LXLA 4D1SA 4AW2A 1P5EA 4GK4A 2QLQA 3OCTA 4HW7A 3QA0A 4PDSA 4JDKA 4YTIA 5GIPE 5HE2A 3VS6A 3ZLWA 4NFMA 3GU5A 1KJ8A 4YHFA 3NNUA 4C58A 2RFDA 2CKPA 2VTIA 3DZQA 4JVGA 5AV3A 4IDVA 2ZDUA 1CQJB 3FBVA 2GCDA 3R1QA 3UIMA 3DBFA 3F5XA 1YXVA 3KCFA 4ORKA 1H1PA 3LW0A 4DCAA 3HV3A 3W32A 4QMTA 2VWVA 3FKLA 1WBNA 2HY81 1RE8A 4YAKB 3ULIA 3QQUA 4BZOA 3FXZA 4JR3A 1W8CA 4UB7A 4QMWA 4DEEA 4MH7A 3DA6A 4MXZA 3KKVA 2ZYBA 3QYWA 1OIUA 3DFAA 3D7TA 2JIUA 5FDPA 4GMYA 2JAMA 4NM7A 4R78A 4XBRA 5CYIA 2I0YA 5EOBA 4GFMA 5LP6F 1WR2A 4RVLA 5CU3A 3W33A 2OIDA 5LMBA 3DK6A 3CTHA 4JBPA 2QG5A 5KE0A 4DLKA 2BROA 3VWAA 2IW6A 2WO6A 1AGWA 4WBOA 1GZ8A 5AP6A 4O6EA 4DN5A 1WVYA 2XEYA 1JDBB 1H0VA 1XH7A 1GIIA 4C4HA 3H30A 4FKIA 1JVPP 4P4CA 2ONLC 3PLAE 4YJSA 3WOWA 4C33A 4II5A 5J95A 4PL3A 4EHGA 3WF6A 3WF9A 2WMAA 3Q5ZA 5IQAA 2J0IA 4BIEA 3T9IA 1EZ1A 5AWMA 1M17A 3W8QA 1OMWA 2Q83A 3LXKA 4FKJA 3QCSA 4E6QA 1YW2A 4ERWA 5AV1A 2VQDA 2X1NA 4I6QA 5CEQA 5EZYF 3WE4A 3QD3A 1HOWA 4V05A 3VHEA 2ZAZA 5B0XA 2YS6A 4NW5A 3LAUA 4FYNA 4ZY4A 5HBJA 1RQQA 2BKZA 1LR4A 3I7BA 4RVKA 5KMOA 4ZZNA 2XBAA 4CFVA 3TUDA 3EN6A 3EZRA 3Q9WA 2UW9A 4FMQA 3LFQA 4WO5A 4YC6A 4YPDA 3ZEWA 5HO7A 2PVPA 4FUYA 3MPMA 4EH3A 4QRCA 4RVTA 4JRVA 3IGGA 1H1RA 3Q4UA 4EK5A 2X8IA 3VBTA 2JKOA 4MWHA 2QOHA 1PW2A 5KZ0A 3U6JA 5EH0A 4U7ZA 2B53A 5HIDA 2GHGA 2IP4A 2GQSA 4O6LA 4MTAA 4WHZA 4ZJIA 2C5VA 2ETKA 4BDBA 3N6RA 5AUZA 3TL8A 4BBFA 3F5GA 1KE6A 3CD3A 1OKVA 3DKCA 3ZHPC 4C34A 4YHTA 4EL9A 4F99A 5BVNA 2RFNA 4FT5A 2FB8A 3PJ3A 4XNEA 3AC5A 2YZAA 5H8EA 4AA4A 4P5ZA 2UW4A 1M7QA 3JVRA 3M11A 3OUKA 4O82A 4BI2A 3ERKA 4F7NA 3F61A 2B0QA 3ODZX 3PVGA 1H08A 4G6OA 1PJKA 3FMMA 1E1XA 2KTYA 4IFGA 5A14A 4HQ6A 3RKBA 3NW6A 2ZMDA 4UBAA 1UU9A 3V01A 3QQHA 3FAAA 4MVFA 2IG7A 4BCFA 4A9RA 4IAZA 3R7EA 4M9UA 1Q61A 2BIYA 3HP2A 1JOWB 2XK8A 3NUXA 4DGOA 2V59A 2I0EA 2F57A 3BYUA 1F3MC 3LZBA 4ZY5A 1PMUA 4E73A 4C4GA 3F2NA 4YO6A 5ANEA 2HGSA 3BWJA 4IE9A 3DY7A 5LVLA 1ERKA 3ZSGA 4O4JF 4GSBA 2J5EA 4V0GA 4O7VA 3DXQA 4D1XA 3HLLA 1CSNA 2B1PA 1JNKA 3QHRA 5HO8A 5IH6A 1APME 5EM8A 2UZOA 3Q96A 3R1SA 2XYUA 3LM5A 3ZLYA 3K54A 4CD0A 2XKCA 3RPSA 4OUCA 3I81A 4KSPA 3VS0A 4FZFB 3QTXA 3OVVA 2Z60A 2OBJA 5ANOA 5JFSA 5KUPA 3LMIA 1YWVA 5EOLA 4XG3A 4L3PA 5JSMA 4DLJA 3A99A 5EDPA 1K3AA 3OOMA 5C1PA 5HG5A 1YDRE 2C30A 3IGOA 3O96A 5HIEA 4FOBA 3OF0A 4GG5A 3KAKA 5D7VA 4IZAA 2W1IA 4XH6A 1B38A 1Q5KA 2GPSA 2HZIA 3TNIA 3ZUTA 2VX1A 4EC9A 3EKKA 5LWMA 2JDOA 2X39A 1BI7A 5HNBA 5C1OA 1P14A 3FQEA 3BHUA 4FSTA 3GENA 5JT2A 2OJJA 4CCUA 2B7AA 3KGAA 5EQEA 3RHXA 2R3LA 4XRJA 1C30A 4RMZA 4L00A 4C4EA 1OPJA 5DPVA 4M84A 5JN2A 1W93A 4F65A 3JYAA 2R3NA 2W9ZB 1IASA 2W1CA 3ORRA 3BLRA 4RX9A 4AAAA 4AT5A 4BGGA 1YI4A 3PY0A 4AXAA 3SLSA 3U55A 2IVUA 4I50F 4O0TA 4Z9LA 3P9JA 2CLXA 3DK7A 4QQJA 1PXJA 4G3GA 4JG7A 4CFWA 2YZGA 4EGQA 4R7HA 3R5FA 3EFKA 3U9SA 1PX2A 3R04A 4TYGA 4LQMA 5HG8A 3AT4A 5FDXA 4QMMA 5AM6A 1MQBA 3D0EA 3QUPA 5DR6A 2UZDA 1PY5A 3QC9A 4I0RA 5AJQA 5C03A 3VUGA 5KX8A 2XCKA 5HIBA 5B2LA 2V5QA 2FGIA 2VTRA 3OROA 3FY0A 4YLKA 5HKMA 4AFJA 3I0QA 3R7YA 3TIGA 3HRBA 1OKYA 1Q8TA 4IH8A 3EH9A 3KRJA 3OY1A 4BHZA 5HU9A 2IZUA 3PP0A 3I7CA 3UQFA 4DLIA 2X0SA 3NPCA 1U54A 4XYLB 3O17A 4ZXTA 4LMUA 4U8ZA 1OIRA 3OTUA 4JRNA 4RJ7A 5M06A 4F0IA 2H9VA 4U97A 2WTIA 3GFWA 2B4SB 3IS5A 2IO6A 4TYHB 4CNHA 5JZJA 4JJRA 1WFCA 2JC6A 3BHTA 4ZTHA 4NM5A 3QLGA 3VRYA 5E8UA 3MH3A 3KREA 2GMXA 3L9NA 2ZV9A 3CE3A 3WF8A 1EHIA 2VTOA 5HCZA 4X3FA 3BCEA 5CAQA 4FNWA 4GCJA 2HXLA 2QLUA 4JX3A 3ZDUA 4YB8B 4G6LA 4FA2A 4F6UA 4YTFA 2PZRA 4PDOA 5LXTF 1Q41A 1S9JA 4BCKA 4FKPA 3PXFA 3FPQA 4EZ5A 1CKIA 2IVSA 4DT9A 2I1MA 1XH5A 4YAJB 2OWBA 3C13A 1VKZA 4TYEA 2R3MA 5IU2A 1H25A 4BDDA 1LPUA 4FZ6A 3RCDA 5KNJA 2HY0A 5CAUA 4ASDA 1OECA 2I0HA 3BV3A 2O5KA 4FFRA 3V8SA 5IPJA 2W05A 4MBIA 2VO3A 3QU0A 5EDQA 2BAJA 4U9AA 3TV6A 5K9IA 3LCOA 3Q6UA 2C6OA 3QCXA 1PXIA 2W5AA 3TWJA 4BDCA 3QQKA 3DTCA 2HCKA 4ZSEA 4YZMA 1A48A 4XBUA 2JFMA 4E20A 2G2HA 4Q5EA 4ANSA 5I9VA 3U54A 3SG8A 5T68A 2J9GA 4GH2A 3KN6A 4P90A 4AT3A 2BAKA 4AU8A 2Y9QA 1YHVA 1Q4LA 4RC4A 3ZFXA 3OBJA 2XP2A 1PKDA 2IZRA 3FQHA 1BKXA 4F9CA 3QX4A 2JDSA 1Y6AA 4MNFA 2C68A 3RAHA 4PY1A 2QC6A 3DQWA 4KKGA 2OIBA 2R3RA 4ITIA 4QNAA 5JMSA 2X7FA 5HD4A 4FFPA 5I4NA 3LQ8A 4O7LA 4DFLA 5CU2A 3JVSA 2X4FA 1SZMA 3TKUA 2I80A 2REIA 4FSRA 4XG7A 3VN9A 2YS7A 4BBEA 2YZLA 3CLYA 5DA3A 2WIHA 4U81A 4YZBA 3UYSA 3V6SA 2F4JA 4IVBA 1GOLA 5C4LA 1B6SA 3RNIA 5LWNA 3FMEA 5DEYA 2C6IA 3LLAA 3LHJA 4PV0A 5GJFA 3V8TA 3TTIA 4ZLZA 5KMKA 4WRSA 4X0MA 2QK4A 2F7EE 1DV2A 1P2AA 3F5UA 4TV8F 1GSAA 3Q2JA 4QMXA 1GNGA 1KJ9A 4JS8A 5AP2A 2JLDA 3PVUA 3EL8A 2CNQA 4KB8A 5LVOA 3DZOA 4OBOA 3CQUA 5EHOA 3H9RA 3TACA 4DFBA 3WIGA 2QO9A 5EK7A 2OG8A 2BDFA 3HMOA 1G3NA 4I4EA 5J2TF 3E87A 4DE4A 1A06A 1VJYA 4TYJA 4BTMA 3GC8A 2X7GA 4K0YA 4G1WA 5HBHA 3FLYA 4FV7A 3C0IA 1K9AA 3VS1A 2JBPA 5EM6A 3QD4A 4O21A 4FTRA 4QMZA 2NU9B 5D11A 4M12A 3RK7A 3CS9A 4BCIA 4CFNA 3GU7A 4GFGA 2PVYA 5IQEA 1O6YA 2GPHA 2UZWE 2RL5A 3R22A 4IX4A 4J53A 2CGUA 4UXLA 4WG5A 3ZLXA 3UC4A 2ITQA 5M53A 1IOVA 4AN9A 3RALA 3KVWA 5A9UA 2G1TA 2PZPA 2RGPA 2BALA 2CKOA 4QQ5A 3UIUA 4FUXA 3UQGA 3RM7A 3PPKA 2NUAB 3DDPA 1V0OA 5DIAA 3LMHA 1J7UA 3V5QA 3UQCA 3ETAA 1ULZA 2J6MA 4AZFA 2GSFA 3QUDA 5ICPA 1SYKA 2W1ZA 2YRWA 4HJOA 4S30A 3TXOA 3BZ3A 1UU3A 3QD0A 5CT7A 4TNDA 3TIZA 4E5BA 4JT3A 5C27A 5CF6A 1Y8YA 3PWDA 2W70A 4LMNA 3VJOA 2Z8CA 3NS9A 2X6DA 2BZKB 3CY3A 4OT5A 2ONLA 3ANQA 3A4PA 5KKNB 3V5JA 5HQ0A 2WTJA 4YJ2F 3UODA 3UG2A 2YISA 4F4PA 2QVSE 4ASZA 3HV4A 4ACHA 4FTMA 2QCSA 2QURA 3MVLA 2PMLX 3RUPA 1WBPA 3EL7A 3R8LA 3HAVA 3FSKA 3OWKA 4GK2A 4TY1A 4YSMA 4F1TA 3E8CA 3UVRA 4D0XA 5E4HA 4XMOA 4R1VA 5LARA 2O63A 1MRVA 1ZRZA 3FLZA 2ITPA 3FMJA 5DN3A 3SV0A 4IB0A 2E9PA 3DJ7A 1IAHA 5TKDA 4D5HA 5F20A 2NU6B 5J1VA 4DGLC 3HBLA 3KN5A 3ORXA 5DT0A 4K1BA 4J1RA 3RK9A 3A7GA 3PIZA 1NT2A 2ETRA 4FFOA 4IWQA 2ITTA 4DTKA 4OGRA 5BUJA 3G8DA 3KFAA 3QC4A 3AGLA 3Q4TA 2JITA 3FL4A 2UW6A 1UV5A 5J87A 2YACA 3VUMA 2IZTA 4F09A 3RV4A 4K2RA 4BKJA 4E4LA 4YJ3F 3QRKA 4QTEA 1MUOA 2W1GA 3PYYA 2GS7A 2R9SA 3UOHA 3U9NA 4OR5A 3L8VA 2R64A 1ZYDA 3VBWA 1KE8A 4JAIA 3W10A 5KMLA 1YXTA 1FVVA 3FLNC 3R83A 4XG6A 2SRCA 2W99B 4I1ZA 1UKIA 2NP8A 4RJ6A 4EWQA 5DR9A 3F3TA 4EYMA 5A46A 4EZ7A 5CF4A 4FKVA 2PMIA 4IM3A 3ZXZA 4DTBA 1WZYA 4XP0A 4EOKA 4O0VA 4EQUA 2Z04A 2OFUA 4GK3A 2BMCA 3KMWA 2UZUE 3CQWA 4RQVA 2VTJA 4L43A 4UX9A 3FDNA 2OH0E 2CZGA 4YU2A 4GKIA 3LFDA 4GT3A 4FNYA 3ZUVA 3NCGA 4DTAA 5E8SA 2HYYA 1FQ1B 1NXKA 1OGUA 3ZC5A 3MH1A 5A6OA 4IWPA 2G01A 5BVWA 1YHSA 3W2CA 4DH5A 5IG1A 1LUFA 4NL0A 5A4LA 3NAXA 5M4CA 2FB9A 2WPAA 3T9TA 4DF3A 3PXYA 4TRLA 1WBWA 1YOJA 3FMKA 4J97A 4X2GA 2PVRA 2CNUA 5AAEA 3QZHA 4ACMA 3BYSA 3QKKA 4XZ3B 3H0ZA 2ZV2A 5DT3A 5AUUA 4FTTA 4OBPA 1TQPA 3QCQA 1ZYJA 1GZOA 1ZXEA 2R3GA 5L6WL 4EBVA 2C3KA 2YWVA 4Z3VA 3JZFA 3O51A 2C0TA 4MAOA 3FV8A 4Y83A 2VO0A 3DAKA 3K3JA 3Q6WA 4BGQA 3MS9A 1OITA 4PDYA 5CEOA 2BRNA 1ATPE 1QL6A 2WQMA 2XJ2A 3PDTA 4NIFB 4F9AA 3P1AA 4V04A 4QNYA 2R7IA 2FP4B 1OL2A 3F3WA 4TN6A 3WO0A 3PJ2A 2A19B 3UYTA 5KZIA 1B6CB 4G34A 4TKSA 4EH8A 3L8PA 1JPAA 3D5UA 4L67A 4HYSA 1WBTA 4QMVA 2W71A 3Q2OA 5M51A 1YWRA 1EH4A 3OUUA 3CC6A 3QTWA 4EKLA 3ZO2A 3L9PA 4ASXA 4XLIA 2VNWA 2J90A 2OICA 3KRWA 4S31A 5IMEA 4FZDB 4ZIMA 3MJFA 4DH3A 1GZNA 1FVTA 2PE2A 4I23A 4KWPA 2PVFA 1Q62A 1FGKA 4PP9A 4BN1A 4AE6A 3PPJA 4TT7A 4HZSA 2R3PA 2B55A 4O7TA 4X2FA 2BRMA 3LIJA 4APPA 1H4LA 2UW5A 2HENA 3FZTA 5IMXA 3TI1A 1GAGA 2QOBA 3VPBA 4QP1A 4YZCA 5DYJA 4HVDA 1UU8A 1PXMA 4XRLA 3R6XA 4U42A 1XBCA 2YDJA 3BYOA 4WG3A 5DR2A 5ACBC 4BCGA 4ZS0A 2WYOA 4EC8A 3P08A 2XIKA 3AMAA 5DRBA 3GU4A 3MFRA 3QXPA 4QP3A 1CS0A 2J0KA 5EDRA 4EOQA 2C5XA 3O8UA 5L2WA 3ROCA 5KHWA 3FMHA 5IEYA 2XIZA 3GOPA 4DGMA 3R9NA 3DKGA 2XK7A 3H9OA 5D10A 3O0GA 3CR0A 3QTZA 4YNEA 4EJ7A 3DAEA 2ZMCA 5GINE 4U79A 5D12A 3KXZA 3NYNA 1JSUA 4BTJA 1VBGA 4YURA 1OUYA 4OTRA 3ZSHA 4DEBA 2JIIA 1QPCA 4JAJA 4YTHA 2GS6A 3VUIA 4RX5A 1H07A 4L01A 4M68A 3IOKA 3PJCA 5HI2A 4DIMA 4HNTA 5FP6A 3QQGA 2XJ1A 3R1NA 2XS0A 4D4YA 4MX9A 4QYFA 2FSLX 3M42A 4DITA 4CG9A 3PXKA 4I20A 4MNEA 4Y85A 5JEBA 3VUDA 2QOQA 3NW5A 4ALVA 3L1SA 2YA9A 1PK8A 4G31A 2YEXA 3AC2A 4QPSA 5HESA 3TNWA 4AE9A 2OLSA 1M2RA 3VUHA 1XBAA 3MA3A 5DNRA 3UO5A 2XCHA 3FLQA 4O0UA 3AW8A 4ANLA 4ZTSA 4FIIA 2V22A 4AF3A 5AP1A 4ONAA 1NVRA 5DVRA 4M67A 3W2RA 4AFEA 5L8KA 3COIA 4IAKA 2X6EA 2NRUA 3BX5A 2VGPA 4AUAA 4JR7A 5BPHA 3F3UA 5ANGA 2Z7LA 2JKKA 2CKEA 4E8AA 4U0IA 4ERKA 4MXXA 2G2IA 4GIIA 5ANIA 4I5MA 4ZLYA 4OT6A 3FEGA 3MVHA 3VF8A 4AGCA 5H9BA 2W4JA 5A4EA 2ZB0A 5EI6A 2W6ZA 1R39A 5M44A 4YJVA 1U54B 3R21A 4CMUA 4E5WA 4I21A 2BHHA 2QR7A 3KMUA 2YWPA 4XV3A 2WTDA 4O22A 3LP8A 3OT3A 4LGHA 5F95A 4XV9A 3QLFA 5AAFA 1SVEA 1UA2A 3OEFX 3OXTA 4MV7A 4YJRA 2BHEA 3BGQA 3IW5A 2XH5A 3ORZA 3NNXA 4GVJA 4KNBA 4EI4A 2C4GA 2O2UA 2XRWA 4F64A 5A6NA 5KKRC 1BNCA 1EYZA 3BG5A 4LM5A 4EH6A 5M57A 3EKNA 2WZJA 3ZO4A 4X3FB 4CMOA 3VMMA 4M0ZA 3ZDIA 3REPA 1Q24A 1ND4A 4O81A 3EFJA 5E90A 3DU8A 3HX4A 1SNUA 1CKJA 4KRDA 4U43A 2BILB 4O7ZA 3Q9XA 4QYYA 5EYKA 3PSBA 2WEVA 2YFXA 3NEWA 1OIQA 4BCJA 5BX0A 3BV2A 3DLZA 3R30A 4HYUA 4AZEA 1SCUB 3BQCA 1YDSE 1YXSA 4NCTA 5CTPA 5CSHA 5AMNA 1Q97A 1E4EA 5CNNA 3EQFA 3V5TA 1FMKA 4CFFA 5HLWA 4KRCA 4RX8A 2XK9A 3KU2A 4GYIA 1Z5MA 4FTQA 5DGZA 1R0EA 4IAIA 4NYEA 5KX5F 4ACGA 4BBMA 3QL8A 4WBBB 4X6QC 5I9YA 4NKAA 2QQ7A 3N4VA 2P0CA 5HG9A 2VWXA 2W4OA 4LG4A 1DM2A 5IYZF 3QGYA 2V0DA 3W16A 5IQFA 3DQXA 1ZMVA 3FLWA 5HTBA 2NU8B 5TO8A 4TWPA 3NVMB 1OL5A 1IEPA 3HEGA 3FZRA 4ZSJA 3DKFA 4B9DA 3ZZWA 1OPKA 3OT8A 3ORPA 4G17A 1PXPA 4JBQA 4XG9A 5F9EA 2R7BA 3G6HA 4BY9E 5IQDA 4R5SA 1CKPA 4HGLA 1M0WA 4G16A 3NUSA 2YM3A 4F0GA 2VX3A 5C8KA 5EQYA 4CTCA 3PIYA 3P7CA 4J7BA 2WMRA 2PVKA 2E9UA 1I7NA 4IVAA 4A9YA 4Z55A 4RJ8A 2NO3A 5L2IA 1JSVA 3MTLA 4O0WA 2Y6OA 5FBOA 3N51A 5DOSA 3EQGA 4DFXE 2PU8A 4MXCA 3ZZEA 3DBQA 2WMUA 4JQ7A 2VTNA 4O27B 4FKGA 1G5SA 4YC8A 4R3RA 3S2PA 4IX5A 4GU6A 3ORQA 2FVDA 2HELA 1QMZA 5EI8A 2VWUA 2OKRA 3GFEA 2Y6MA 3NRMA 4FE2A 2JKMA 2UUEA 3FI3A 1V1KA 5CI6A 3SAYA 3E64A 2WFYA 2WQOA 4WNPA 1SVGA 4IHPA 4FX3A 3VA7A 3BHHA 4UYNA 3Q4ZA 4BZNA 3OUNB 4BDKA 1X8BA 4WNKA 3RPOA 5BMVF 5CU4A 4O7RA 1FINA 4FVRA 3GNIB 3GOKA 2PZ5A 4CGAA 4Z16A 2XK3A 4R5YA 4IZ5A 4NT4A 4U41A 5GHVA 2B9FA 3OOGA 2SCUB 1KE7A 2UV2A 3R5XA 4K9YA 3V5WA 5BVFA 3KXGA 4USEA 1BMKA 2BTRA 5HD7A 5M09A 4JI9A 3WF5A 5M4IA 4RWLA 3QALE 4QYGA 1HCKA 2HK5A 3H9FA 3SE7A 4FEXA 4FG7A 4R7BA 4JXFA 3BI6A 4ZTLA 3ETJA 5J7HA 2PUPA 2VX0A 3COMA 3DS6A 1Q8YA 5CT0A 4HNVA 4GT5A 1OB3A 3TNQB 4F1MA 3PIXA 4FEVA 4NM0A 4GT4A 4DEDA 1XR1A 2F9GA 2WKMA 4FC0A 2H34A 2XKFA 3NIZA 4M15A 5DLSA 5H3QA 4W4VA 3N4TA 2VO7A 3SRVA 4D0WA 2GS2A 1I09A 3EQHA 2XK4A 5CQWA 2Y4PA 3CTQA 2OK1A 3JY0A 3MDYA 5E1EA 5IDPA 4MK0A 4U3ZA 1GJOA 4FYOA 2Y0AA 2DS1A 3NUNA 4XOZA 1J1BA 3OEZA 4XX9A 3UIBA 3K3PA 1E1VA 2VD5A 3MFUA 4AX8A 4MXAA 4BICA 4EH2A 3PWYA 3ALNA 5IUHA 5M4FA 1C3OA 3GCQA 1REJA 3G5DA 4YC3A 4CT2A 3AMYA 1F5QA 3F6XA 4QOXA 4JDJA 4QQTA 2UZBA 4PMSA 2ESMA 4DFUA 1XO2B 1PMVA 1J7LA 2J7TA 3UOLA 4YR8A 3N9XA 3WZJA 3C0GA 4D28A 4E4NA 4UN0C 5J9ZA 3EZVA 2QODA 3R00A 1ZOEA 5HG7A 2V58A 4ZK5A 3LM0A 3VO3A 1UNHA 5DRDA 2W6MA 2VWIA 1AQ1A 1ZAOA 3MBLA 4NH1A 4RIWB 2ZV7A 3V5LA 4MEDA 2W17A 4FTOA 1Q8ZA 4FNZA 3ZUUA 3V4SA 3W55A 3E5AA 3QYZA 4BGHA 3COHA 1W84A 5ANDA 3VS4A 5H8BA 4L3JA 4FIJA 2X9EA 3DT1A 4L44A 3R8UA 5BUIA 5E1SA 3RGFA 2P0AA 5D1JA 4RC2A 5CI7A 5AP0A 4ZJJA 3GCUA 4EOLA 4MA5A 4FR4A 3QGWA 3WNZA 4L1KA 3A60A 2ITWA 1LP4A 4EOJA 2QNJA 4V01A 4K77A 4BDFA 4EQCA 5JH7F 3F69A 3BE2A 2YDIA 1IOWA 2BRGA 5CSVA 3PSDA 4QP2A 4GL9A 5KMIA 3DJ5A 3HNGA 3K5IA 2AC3A 2W4KA 3ZFYA 4JG6A 4HNUA 5HVYA 2C5YA 3GCVA 4H39A 1M7NA 3V4ZA 3JXWA 5AM7A 4F9WA 3DXNA 4EG0A 2CLQA 3FL5A 1BUHA 2UW7A 3KXMA 1GIJA 4L7SA 5CXHA 1Q8WA 3FYKX 4FTAA 4ITJA 4F08A 4F0FA 2BKKA 3GCPA 5CANA 3CD8A 3QKLA 1O9UA 3SA0A 4QMLA 1R78A 5AA8A 4B8MA 5DI1A 3UFXB 2FUMA 4U80A 3S00A 5CENA 4XX0B 2VV9A 5D7AA 1TVOA 2Z2WA 3SW7A 4QMUA 4FZ7A 3Q5IA 5J9LA 4I5HA 2CGVA 5HEZA 2W0JA 5BPFA 4O96A 3RP9A 2C6LA 5HU3A 1Y91A 3BLQA 4WT6A 4FK6A 3Q4CA 2ERKA 3AG9A 5E9EA 2XRUA 3HMNA 5E8YA 5ANKA 3HA6A 1IA9A 2QKWB 2WQNA 4FV6A 4U3YA 3O23A 5LQFA 4S33A 3PLSA 3BYVA 5AX3A 2V5AA 3VQHA 3UMWA 3FE3A 5KMJA 4FTLA 2JEDA 4L42A 3MYGA 5CLPA 4PX6A 3ORKA 1T45A 2VU3A 4W8EA 5C9CA 4FTJA 3VIDA 3WZEA 4QMQA 4FFNA 3HKOA 1WVWA 4BZDA 1U59A 3RVGA 2XEZA 3G51A 3TEIA 3SVVA 2WAJA 4XV1A 4Z7GA 4YUQA 2XNMA 1NW1A 1AD5A 3KCKA 4IZ7A 3PXRA 4IBMA 2WU7A 3FI4A 3NDMA 5AX9A 3NIEA 3UPZA 1GLVA 3EQBA 4LOQA 4F7JA 3E3PA 3GXLA 5CX9A 4L7FA 3F5PA 4G3CA 3R2BA 1URCA 4O0XA 4N6ZA 2J4ZA 5JVLA 2GNLA 3G0EA 3NYXA 4O7NA 1M0TA 3DDQA 2R2PA 2WMXA 1RW8A 3DB8A 3OCGA 3AT2A 2YJSA 1Z2NX 4EK8A 2ZDTA 4RJ3A 2JIVA 3NCZA 3HUBA 3QTSA 2YITA 4AQCA 4FIEA 3TNHA 2XVDA 4I0TA 4WNOA 3S4QA 3TV7A 2OJGA 2XZSA 2VPQA 4MKCA 3FLSA 4RT7A 1S9IA 4MBJA 1KOBA 2XMYA 3BHVA 5CZIA 3R5HA 2O8YA 3KXHA 3Q3BA 3Q32A 3RAIA 4J99A 1VBHA 4I55F 4O86A 2UZLA 2OF4A 1RDQE 2P3GX 2X0GA 2YDKA 3E62A 4Q9ZA 2CCIA 5LOVF 4QP6A 5IUGA 3WO1A 4H3BA 2YZNA 3TT0A 4A7CA 4IJ9A 1Y8GA 3R9DA 4C59A 3DBCA 4F7LA 3HRFA 2QF7A 3GT8A 3Q2MA 4I24A 4UALA 5J1WA 1ZYSA 4CFUA 4MV3A 3A7FA 1XHAA 5JZNA 1IR3A 2OZAA 3R01A 4NFNA 2PE0A 2PULA 3P86A 1NY3A 4ZQIA 4J98A 2HZ0A 4C4IA 3KVXA 1OM1A 2GNIA 3IW6A 5AP5A 2B52A 2XA4A 3QQFA 4PTEA 3WZUA 2IJMA 3S1HA 1KJJA 3BU5A 4G2FA 2XKEA 4HGTA 3ZXTA 4FSMA 4XG8A 3TTJA 1WVXA 1OKWA 4XP2A 3VRZA 2R86A 4AW1A 4AOIA 3TW6A 3FHIA 3K2LA 4ARKA 4HVSA 2VO6A 3D83A 2W1FA 4L45A 5AIKA 2ZDQA 4JX7A 3QUEA 3I6UA 3C0HA 4KS7A 4YNOA 3EB0A 4FT7A 2J5FA 3CJGA 3PRFA 2QOIA 5LVPA 4ZHQF 1KC7A 1GY3A 4CLJA 2FSOX 3GI3A 3EQIA 3OFMA 4EKKA 3DF7A 1JKKA 3G9NA 1JBPE 3DB6A 4QMPA 4B7TA 3KALA 4ITHA 1PXKA 4AW0A 3D7ZA 5DH3A 3VPCA 3QA8A 4HVHA 3WILA 4KKHA 1KE9A 3MSSA 3IK3A 3KULB 3DK3A 4U44A 3I6WA 3TQTA 1H1SA 4MV8A 5HORA 1KUTA 5M07A 2C5NA 4KA3A 4USFA 4USDA 4BB4A 4W4XA 4Y95A 3QZFA 1Q8UA 4YJNA 3V04A 5AAGA 2G15A 3LFAA 5FLFA 3F7ZA 3HGKA 4E6AA 1FPUA 5FUTA 4LUDA 1HCLA 3PXZA 3AD4A 3KRXA 4O0RA 5JGDA 4C5AA 1XH8A 3FZOA 4E93A 3O8PA 5J5SA 3B2WA 1T36A 2GTNA 2VAGA 4U45A 5ITAA 2JKQA 3VHKA 5A54A 3IG7A 5LYJF 1EUDB 4OTFA 4XG4A 5H2UA 3LQ5A 5B2KA 1CM8A 4TXCA 4DT8A 1PYXA 3W2OA 4LI5A 3A2CA 2QOFA 4FFMA 3BU3A 2UVZA 4LV5A 2IN6A 3P5KA 4MWIA 4FOCA 4LRKA 4OTIA 5E7RA 5HX8A 3UZTA 1AUXA 2GQGA 3B8RA 4KABA 3ZRLA 3MA6A 1PYEA 5FXQA 4AGDA 2OJ9A 4IZYA 4PRJA 4FV2A 2YJRA 1K2PA 5DWRA 2C3JA 2EU9A 2OXXA 3K3IA 1FGIA 4BF2A 3RMFA 5EG3A 2ITUA 4C2VA 4F1OA 5HBRB 5CZHA 4E5AX 2R7MA 1UWJA 2RFSA 3AGMA 3PA4A 3OC1A 4FSUA 4MQ1A 1JLLB 2Y7JA 2OXDA 3FY2A 4GW8A 4A4OA 3WIKA 3CJFA 2YM5A 2ETMA 1H1WA 5L2TA 2Z7RA 3M1SA 3U6HA 5K3YA 1KSWA 3U87A 3Q53A 3DBDA 4Q2AA 4IAYA 4EH9A 4C4JA 1WMKA 2CKQA 3VUKA 5HCYA 3UC3A 4WOVA 4OTDA 4ZSLA 5EKNA 5M56A 3EWHA 2QKRA 4BDIA 4BYIA 2OU7A 4MYGA 3QQLA 4W8DA 2PVNA 5CWZA 3JS2A 3P0MA 3UVQA 3VC4A 2R7NA 4CKJA 4I93A 5ANJA 1JDEA 4BIBA 1YQJA 2RKUA 2VWWA 3F3ZA 4BDJA 5CAPA 3QRJA 4FTKA 4ZSAA 1YXXA 3G15A 1KV2A 1KEEA 3CGFA 1F0QA 4RVMA 3RAWA 1YHWA 4UYAA 5BQ0A 5HGIA 4ACCA 4PNKA 2CGXA 4QTBA 4FT0A 3BBTB 3ZCLA 4RFYA 4AWIA 1U46A 2XNNA 4FEUA 2QHNA 4I92A 3UGCA 3A7HA 3C5IA 4HCTA 4BIDA 5JVDF 2PVMA 1XH6A 4BR3A 1WAKA 1XBBA 3K5VA 5FRIA 3R8VA 4GUEA 4MF1A 5CEMA 2X9FA 1Z2PX 2DYLA 4YHJA 5CEIA 3D7TB 4IMYA 4QMNA 5LMAA 4F9YA 2R3HA 5HE1A 1MP8A 2PUUA 1OUKA 3ZSIA 3GUBA 4I0SA 4BDAA 1UKHA 5TF9A 2BZIB 4NTTA 5FTOA 4FL1A 4AG8A 3G2FA 1DAYA 5CY3A 5AV0A 5BMSA 3BBWA 3IECA 3F9NA 4HYIA 4ZAUA 3BGPA 4NWMA 5JQ5A 4EBWA 1OIYA 2ERZE 1PMEA 1XH9A 3PA3A 1DI9A 2R3IA 4FKOA 3LJ1A 4K33A 3TNPC 5IA1A 1VZOA 2J9MA 3IOPA 5H80A 4PWNA 5E8WA 2BFYA 4O7WA 4D1ZA 3LKMA 1PXLA 3T3VA 1YI6A 2JDVA 2PUNA 4LGGA 4NW6A 1Y6BA 2ITXA 4L3LA 3R7IA 5I9WA 3TV4A 2R82A 4TTHB 2GTMA 4N70A 3PE2A 5HX6A 4YZDA 1ZZLA 4LOOA 2ITYA 4RLKA 1QPDA 2C00A 2WMTA 2XM8A 3ZM9A 3H10A 4LYNA 3O50A 3U4WA 4YPSA 3BIZA 2RF9A 2P2IA 4FEQA 4RIXA 4M7IA 4FV1A 2QI8A 5H8GA 2O0UA 3C4FA 3EN4A 3FZPA 4L8MA 4RJ4A 4AP7A 3BHYA 5FM2A 1OI9A 3G90X 5EM5A 1QPJA 5L8JA 5L6OA 4FKLA 4JOAA 4QP9A 5E8XA 5G6VA 1SMHA 4ZMFA 1BL7A 4HPTE 4RRVA 2YL2A 3NUAA 4YTCA 4I3ZA 3EQDA 3HAMA 1T46A 3UNJA 3ATSA 2R4BA 3UIXA 3RPVA 3NSZA 4I41A 4E4XA 5EHLA 5GJDA 1BXRA 3QFFA 2CGWA 3PY3A 4EONA 3TIYA 5CF5A 2YZMA 1YDTE 2WMQA 3POZA 5A3XA 4DBNA 3FWQA 1OKZA 2J0LA 4I5PA 2R3QA 4ASEA 4EHZA 4AN2A 4DGNA 5K5NA 2WQBA 2YIXA 4DFZE 3HZTA 1TQMA 2YCFA 5IQBA 2HW6A 4ACDA 3ZLSA 3GC0A 4QT1A 2CSNA 4UZHA 1FBNA 3C5UA 5ACKA 3ZH8A 2XIRA 4IVDA 5JRQA 4RZVA 3MJ1A 5KMMA 1PHKA 2QONA 3UJGA 3UOJA 4Y5HA 4EHEA 1OVEA 1V0PA 1PKGA 3DNDA 3IDPA 5EI2A 1YOMA 4J8NA 5CSXA 2XKDA 1GZKA 1YVJA 2BFXA 1H01A 4X2KA 3U9TA 3C9WA 4EQMA 4FG8A 5KBRA 2HAKA 2C6KA 2GFSA 5GIOE 3ETHA 3UPXA 4EHVA 3R0TA 4ZOGA 4XG2A 1STCE 4O4HF 2BRBA 5FXSA 2WEIA 2YHVA 3UZPA 4CEGA 3KQ7A 5D9HA 3W18A 3ORIA 5M08A 3AC8A 3FC2A 3R28A 3I4BA 4FZAB 4E6DA 4C7TA 2RFEA 3TZ8A 4QPAA 1LEWA 4XYFA 1KBLA 5CXZA 3R02A 4AW5A 2R3FA 2B54A 4V0GB 3RFCA 3C7QA 4FNXA 2QOOA 3OHTA 5HE3A 3U4UA 1CMKE 4FTCA 5FEQA 4CLIA 4EOPA 5BPYA 3FMNA 4MXYA 5CU6A 4MXOA 3AMBA 3RPYA 5KHXA 2WB8A 4PQNA 4MV4A 2OZOA 2X81A 4EJNA 4BI0A 5BVDA 4JLCA 3ELJA 3VBYA 4CSVA 3ZM4A 2CN8A 4G5PA 2FH9A 4L68A 5C01A 4NJDA 2A27A 3QAME 2H8HA 4DEGA 4W4WA 2W96B 3GC9A 4FKRA 4UWBA 1GIHA 2C6MA 4RFMA 3AD6A 5LXMA 5CA1F 3HUCA 5FP5A 3QWKA 4LRMA 4CZTA 1H28A 2QO2A 2Q0BA 3HDMA 4EH7A 5HZNA 4DINA 3TZ7A 3C50A 5HCXA 4RFZA 5CQUA 2BR1A 3ANRA 3AT3A 5C26A 3LCDA 4H36A 4OTWA 2UVYA 3FZ1A 1XWSA 2VN9A 2CJMA 4KAOA 2KULA 5IF1A 4E6CA 3CTJA 3OWLA 4BDEA 4M13A 3GLKA 4L53A 5IQHA 2IWIA 2PWLA 5LMKC 3E92A 3PPZA 3THBA 2CN5A 2Z02A 2BDJA 2HXQA 1ZZ2A 3GGFA 2W7XA 2PE1A 3UO6A 4TYHA 3Q9ZA 5AEPA 3TG1A 5A4TA 4B99A 4ZP5A 3JR1A 2F7XE 3OG7A 1W83A 3VBQA 3T8OA 3SKCA 4X2JA 3O7LD 2GFCA 3V51A 5JFWA 1ZY5A 3FKNA 4KUJA 4MAMA 1P4FA 4TYIA 3O7LB 5AUWA 3ROYA 4IW0A 2C1AA 2C1BA 2CPKE 4FTIA 4KSQA 2WMSA 3AD5A 4YJQA 5HVJA 4XP3A 2XJ0A 3FJQE 2R0UA 4HNIA 4R7IA 3NVKI 1KJQA 1UWHA 4C35A 1TQIA 3I1AA 2X2MA 3OCSA 4FU0A 3BE9A 3OXIA 3VS2A 3BU6A 2HIWA 2OO8X 4ID7A 3MFSA 4RJ5A 4DFYA 4YSJA 5AADA 1BL6A 4CFMA 1JAMA 3SC1A 4YJUA 5ETIA 2WQEA 4DA5A 5EHYA 4N4SA 2J2IB 3UG1A 1Q99A 2X8EA 4Q9SA 4X3FC 5EYCA 5LVMA 3K5UA 4FT9A 5CNOA 3OY3A 5JGAA 4YBZB 3V5PA 4RBLA 3UMXA 3R9RA 1NVSA 1PF8A 2UZNA 2WTKC 4M0YA 3FPMA 5CALA 3FI8A 2YM4A 3N4UA 5HLPA 4BDHA 3E93A 3I0OA 5FQDC 1FVRA 4QTAA 3LPBA 2WTKB 4D2SA 2W6PA 4O2AF 3GC7A 3LE6A 3OZ6A 4IM2A 3EQRA 4O0SA 5EQPA 3G6GA 4FIHA 4LL0A 3MY1A 3DGKA 3TZ9A 2H96A 4U40A 2X2LA 3RJCA 4IX3A 2YIRA 1ZOGA 4ENYA 3ZO1A 2VR1A 3NYOA 4DFNA 3AC4A 5B2MA 4C4FA 3ACJA 3P4KA 3JY9A 2PVJA 3E8DA 2DWCA 4O91A 4DBXA 2ACXA 3MY5A 1M6VA 2Q0NA 4ZS4A 4AS0A 3SQQA 2I40A 3MPAA 4YZNA 1DAWA 2ITVA 5EYDA 2XF0A 4GUBA 2ZM4A 4NZWB 2PMOX 4MD9E 5KMNA 4IDTA 1ZOHA 1KV1A 5D41A 2X8DA 3KAJA 3KK8A 3COKA 2V7OA 4QTDA 4FKWA 4MCVA 1PRYA 4WSYA 1YOLA 5DBXA 3TKIA 3MGYA 3VNTA 5AUTA 2WMBA 5J8IA 3DXPA 1ZMUA 2EB3A 4ALWA 2EXCX 2HW7A 3LFEA 4AZWA 5B7VA 5CU0A 4E26A 4H3QA 4NM3A 4TW9A 5LJJA 5GJGA 2QD9A 5CVHA 3IDCA 3P23A 5TR6A 5A4CA 3ORLA 3FC1X 2PMNX 4L52A 2I8CA 4CV8A 3QXOA 1XJDA 5HNGA 4HVGA 3E8EA 3RI1A 4JG8A 5BMMA 4DEIA 3MY0A 2VWBA 4RC3A 4QTCA 3RZBA 4F6WA 2EWAA 4Y73A 4DG0E 5HTCA 5IZFA 2P4IA 4HVIA 4W4YA 3ZMMA 4AT4A 3ZFMA 3DAJA 1SNXA 2ITOA 1WCCA 2Z7QA 3HV5A 3MPTA 3V3VA 5JQGF 1PMNA 4YLJA 2VTTA 4JBOA 1M2PA 5HLNA 5TT7A 4RSSA 2WXVA 4KS8A 4XCUA 4YJPA 4FKSA 4GV1A 3WE8A 2A2AA 3FZSA 3EJ1A 4FGRA 3KEXA 3ID6C 2OGVA 3EQCA 2ITZA 2NNWB 4FSNA 5HICA 2YIWA 4J71A 4N6YA 3M2WA 3ORNA 1A9UA 4X7QA 3WZDA 5IEVA 4FSWA 5HHWA 4WRGA 1W82A 2I7QA 3U9CA 3L9MA 2VTSA 3E7VA 4EWHA 4Y8VB 2WTVA 2A0CX 3NGAA 2O65A 3II5A 4TV9F 1REKA 3OW4A 3E3BX 2BVAA 2E2BA 2GNHA 3I60A 3RHKA 5E8VA 4EOOA 4XUFA 4DG3E 1KE5A 1W7HA 3IW7A 4H1MA 4RZWA 5T3QA 4C2WA 2E9NA 3R2YA 3FI2A 3OUZA 3TUCA 3HL7A 2LAVA 4BDGA 3D9VA 1FOTA 1J1CA 4P2KA 3IONA 3KXNA 3PG1A 4HGSA 4RPVA 5G1XA 4BC6A 4MV1A 4OBQA 1W0XC 3PRIA 3WF7A 4PP7A 1IG1A 4KIQA 3TUBA 5EYMA 2GHLA 4BCHA 3ZBXA 2C3LA 3C4EA 4TWOA 3P78A 2VWYA 3NW7A 4FIGA 5FD2A 4JQ8A 3RCJA 4ALUA 4PL4A 2HZNA 3K5HA 2QU5A 1H26A 2W1DA 3O71A 3UP7A 4ZLOA 4HCUA 1ZY4A 3A4OX 4G5JA 4N0SA 1ZLTA 5JH6A 3GU6A 4CFXA 3KB7A 4I94A 2X2KA 4WUAA 3P7AA 3C4ZA 3LQ3A 2UW0A 3SXFA 5JFXA 3W2SA 2C0OA 3NUUA 4XS2A 5FGKA 2EB2A 4E7WA 4E4MA 2ZDGA 2ZJWA 2PSQA 5JK3A 3G8CA 5ETAA 3LVPA 4JIKA 3R7OA 3PXQA 5F94A 5L8LA 2FPIB 4RZQA 3CKXA 3NLBA 3ORMA 4GFOA 4KIOA 2PYWA 3PG3A 3ZS5A 4EH4A 4DEAA 3Q52A 4DG2E 4OLIA 5FG8A 2C3IB 4U5JA 2W06A 3CBLA 4JQEA 3QHWA 3CP9A 4H58A 4I6BA 4YBKA 5M55A 5AV2A 4PNIA 5DT4A 5CEPA 3H4JA 2I87A 4JNWA 2QU6A 1A9XA 2HWOA 2OI4X 2WIPA 4FI1A 2DQ7X 3SXRA 1R3CA 3W2PA 4CKIA 3GQLA 5FM3A 3ZU7A 4EH5A 2ZM1A 3IQ7A 4HPUE 4R3CA 4KBCA 4ZY6A 4D5KA 4LRJA 2GU8A 5JKGA 3E63A 3OS3A 5C8MA 3JRWA 2Z7SA 4X21A 1DIKA 2WTCA 1JSTA 1U5QA 1JKTA 4UWYA 4D4SA 4EGJA 4UWCA 3VF9A 1XH4A 3FQSA 4O4IF 2YW2A 2FYSA 2VTQA 4A9UA 4DC2A 3E88A 3LJ0A 3PVBA 4RIXB 1LEZA 3KK9A 4O0YA 4RIYA 3TDWA 4UXQA 1VR2A 3CQEA 3MI9A 2YCQA 4PF4A 3F88A 5DE2A 3VAPA 3FHRA 1O6LA 4RG0A 4FTUA 4YO4A 2ZM3A 3F66A 3HRCA 3ZO3A 4I6FA 2O3PA 3TJCA 4TPTA 2PVHA 3EYHA 4R1YA 1VYZA 3EQPA 4CZUA 5CA0F 3IDBA 2PHKA 3PJ8A 2FPGB 5IA5A 2XUUA 3R7VA 5K4JA 3G33A 4QQCA 4G3FA 2J0JA 3BLHA 4G3EA 2B9IA 2PL0A 2QOKA 3BGZA 4EUTA 4J96A 1U4DA 3DJ6A 1J3HA 4DGGA 3ZYAA 1I7LA 3LXPA 4EZ3A 1IA8A 2YCRA 3LLTA 2HZ4A 2BDWA 4F9BA 3R23A 5J2UF 2LGCA 1BX6A 2DUVA 3MFTA 4PTCA 4ZZMA 5CASA 3E5NA 4PMTA 3G0FA 3ULZA 1VEBA 2BCJA 2XB7A 4C3FA 2VTPA 5JQ8A 4BCPA 4O83A 3MVMA 2I0VA 3UTOA 4C3PA 4TWNA 3WYXA 3S3IA 3Q04A 5LVNA 1H27A 5CAOA 4ZTNA 1M52A 1URWA 5DG5A 1OL7A 4C0TA 1GSHA 4X3JA 3ZBFA 2NPQA 5AUVA 5EKOA 4L6QA 5AP7A 1U5RA 3QRTA 2WGJA 3A61A 4RQKA 5I9XA 3S0OA 3I5ZA 3SDJA 1Z9XA 5LA6F 4FBXA 4O2BF 3KF4A 4MQ2A 4UV0A 2FA2A 4S32A 4WIHA 4CMTA 5IDNA 5T6KA 3FMDA 3SHEA 4C38A 4KINA 4YGAA 1Q3WA 1YWNA 4PMMA 5AP3A 2R3JA 3CEKA 4XOYA 3BYMA 3HECA 4O38A 5GNKA 5HE0A 3PVWA 4K6ZA 4TL0A 4YJTA 2JD5A 2VGOA 4AGUA 4NSTA 4ZTQA 2BZHB 2AC5A 2XNEA 1DV1A 2BPMA 4ANBA 2DLNA 4NUSA 5CVGA 3ZOSA 1E9HA 4IQ6A 4M3QA 3DKOA 3QTRA 4HNFA 4RIOA 1YKRA 3A8WA 3NZ0A 1MQ4A 2B9JA 4S34A 1QPEA 2V62A 4FV5A 5CB4F 3FYJX 3L8SA 4TUYF 4RWJA 2V55A 3C4CA 4XEYA 4O7SA 4DHFA 1UNLA 2QO7A 1AUVA 3KC3A 2HJWA 3OWPA 2IW8A 3VOTA 1MRYA 5LMKA 2XYNA 5EW9A 1H1QA 2C69A 3CY2A 3UP2A 3JRXA 5CF8A 2EUFB 4XYMB 5IQGA 2WNTA 4XJ0A 3WZKA 2QOCA 3F3VA 3C51A 3HVCA 5ETCA 5CAEB 2OLCA 4ANQA 4CV9A 2XBJA 2XM9A 1OBDA 1QCFA 3IW8A 3SG9A 3VQUA 2W6NA 2BUJA 3UE4A 1ZARA 1H24A 2EXMA 1UU7A 3LCTA 4M97A 3HP5A 4C5BA 3ZRMA 2W5BA 4D9TA 4D9UA 4YBJA 4IB1A 1WBSA 2W1HA 4WD5A 3FXWA 3MIAA 4FV8A 3LFNA 3OD6X 2X7OA 2A1AB 1L3RE 2GPWA 1ZWSA 5IH5A 4MNEB 3TCPA 4FFLA 1KWPA 4ENXA 3RV3A 3NAYA 2YABA 3IW4A 5D8DA 3FSFA 4IEBA 2R85A 3ZEPA 3QX2A 4Y46A 4F6SA 3BEGA 1UVRA 2JAVA 5BVEA 3CGOA 4FGBA 2GQRA 4FEWA 3EFWA 3G9LX 2GNFA 2P2HA 3MH2A 3RM6A 3UOKA 4FSZA 4FSYA 4EEVA 5BYYA 4KBAA 5L2SA 2W1EA 3ALOA 3DLSA 3C4XA 2R3OA 4QP8A 4BCMA 4K8AA 4BTFA 2XCLA 3AQVA 1ZYCA 4C36A 4G3DA 3EHAA 2QHMA 2BIKB 3PE1A 1DI8A 2ZB1A 2BAQA 2OJFE 4MD7E 3NYVA 4G9CA 5FTGA 5IA3A 4OTQA 4YJOA 2XNBA 2W9FB 3GU8A 4FIFA 4IJPA 1YI3A 4YMJA 2RIOA 3TN8A 2YERA 4CRLA 2J51A 5IA0A 5LCKA 3HMPA 3HB9A 3ENHA 3IKAA 3LCKA 1OZ1A 4WKQA 5TOZA 5I9ZA 4JL9A 2F7ZE 2XNGA 4GJ3A 2ZOQA 3HYHA 4R77A 4IAAA 3UNKA 4GJ2A 4MV6A 3F2RA 3GB2A 4I5CA 4FSQA 4O4LF 3R8MA 4KKEA 4HGEA 4EOSA 2JFLA 5AFVA 4O84A 4QMSA 3QKMA 3AC1A 1IAJA 1H8FA 1M14A 2FSTX 4B4LA 1CQIB 4HOKA 2BZJA 3ATTA 3OXZA 4NCTC 3PJ1A 4AZTA 3HDNA 2ZDHA 2XIYA 2GNJA 3MH0A 4QP7A 3VW8A 1B6RA 3R63A 4NKSA 4BCQA 4IZOA 4C61A 1E4EB 4CVAA 3LFBA 1V0BA 4AZVA 1G8AA 2IVVA 2YIQA 4QO9A 2CCHA 3D94A 4IANA 5FTQA 1WBVA 2YM8A 2J50A 2R5TA 3QZIA 4G9RA 4IFCA 4BVUA 2WELA 5IA2A 3AC3A 4D2RA 5L6PA 4BRXA 2OJIA 3MV5A 3ZC6A 3KRRA 3GP0A 3DTWA 2C5OA 2O64A 5AA9A 4IM0A 2CMWA 3HA8A 4YZ9A 1G8SA 4RX7A 3SXSA 3A7JA 4CXAA 3JZIA 3R8ZA 4QYEA 5HBEA 5HNIX 3UO4A 4ZSGA 4DAWA 4AACA 4WBNF 3PUPA 1PXNA 5A4QA 3SW4A 5FXRA 2YIYA 3RK5A 5L3AA 3PZHA 3D2KA 3BEAA 3W2QA 4IWOA 1NVQA 4XLVA 2A4LA 1OL6A 3B8QA 3LFSA 3QBNA 4FVPA 3Q9YA 4NTSA 5FEEA 3DFCB 2PUIA 4EOIA 4U6RA 4XV2A 2DZDA 3UZRA 2NU7B 2R3KA 2PK9A 3EYGA 2FPPB 5F1ZA 4I4TF 1ZMWA 2H6DA 2YAKA 2YM6A 3JPVA 3LCSA 5E8ZA 5IQCA 4E4TA 4TZRA 4FG9A 4WG4A 4DCEA 1JKSA 2F49A 3H0YA 1H00A 4JDHA 4C62A 4GEOA 3QTQA 3GBZA 3OBGA 3SOAA 4GRBA 4FKTA 3VULA 5AV4A 3ORTA 3R9HA 4FV0A 5JRSA 4FV3A 3TM0A 3QTUA 1IRKA 3Q60A 5KCVA 2OW3A 5EW8A 4AN3A 3NUPA 5I5ZA 4DYMA 3EFLA 2ZVAA 3O8TA 4DEHA 1BYGA 3FMLA 5I0BA 2JDTA 2I6LA 3MB6A 4IX6A 2XIXA 4O2PA 2WU6A 4DH7A 4LL5A 4EYJA 3DNEA 3ZONA 4I6HA 2R7LA 3QD2B 1Q3DA 4S2ZA 2BRHA 3OW3A 4K18A 3R9OA 1UNGA 3ET7A 3UVPA 5KBQA 2XD4A 4GKHA 2CNVA 4FL3A 5BNJA 3LOKA 3FKOA 4FICA 4GS6A 4FKUA 3OWJA 3WARA 2VWZA 3QF9A 4JBVA 1J91A 1BLXA 5K5XA 3BELA 2PTKA 3MVJA 3PTGA 1CE8A 3ACKA 4R3PA 3EN7A 3NNVA 3R7UA 3SOCA 2Y4IC 1O6KA 4IIJF 3D5WA 3D5XA 3R73A 3HO8A 3MTFA 4X2NA 2UW3A 3D5VA 3VJNA 5EW3A 3KA0A 5BVOA 2Y4IB 3MN3A 3SX9A 2QR8A 4CCBA 3EMGA 4H05A 1YXUA 4PTGA 3HV7A 4EK6A 2C6DA 3R8PA 4N57A 3SRVB 3NWWA 3U8WA 2VUWA 3F2AA 4QMYA 4RIWA 4CRSA 1I44A 5M4UA 3OCBA 2XNOA 3L8XA 3AXWA 4A9SA 1XQZA 5JFVA 4H3PA 2JBOA 2BTSA 5E91A 3LMGA 4AZSA 2OH4A 5IH4A 4KBKA 2IW9A 4IC7A 3DPKA 1J7IA 4NK9A 5DMXA 3EOCA 3I79A 3PZEA 3QZGA 2WOTA 5BUEA 2E9VA 5HV6A 1Z57A 3KL8A 2WMWA 4JDIA 3VBVA 4CQEA 4RGJA 4ANMA 2WHBA 5J9YA 4ZTMA 4Z7HA 1CDKA 3TZMA 5LCJA 3U6IA 2XNPA 3DCVA 4OTHA 1KJIA 5JQWA 2E9OA 2VTHA 3QRIA 4BTKA 1EUCB 1RJBA 2PBZA 3O2MA 4LOPA 3B2TA 4RA4A 4M8TA 3OMVA 4BCOA 4RA5A 4Q5HA 5IQIA 4ZTRA 3QFVA 2YYAA 5E8TA 2PZYA 3C4WA 3DBEA 4WA9A 3LFCA 4A9TA 3NMUF 3Q1KA 3NR9A 4MA0A 5BYLA 3BRBA 1KOAA 2WD1A 3A62A 3HMMA 4X6RA 4ZZOA 3PP1A 2R0IA 5DEWA 4R6VA 1H0WA 4CKRA 2UZVA 3E7OA 4APCA 3GVUA 4Y72A 2R7KA 3AOXA 4HYHA 4JIAA 3KMMA 1DS5A 4P7EA 3VW6A 3MJ2A 4C3RA 5C8NA 2PZIA 4RIYB 2RG6A 4B0GA 5FNVF
chains in the Genus database with same CATH superfamily
4XHKB 4LFIA 4RLLA 3VS3A 3LWBA 1TKIA 2VTLA 3OP5A 2YM7A 3I12A 4FV9A 3VS5A 2RG5A 4UY9A 4I4FA 4QYHA 4PUZA 4GG7A 3H3CA 5FBNC 1GGOA 4IHJF 1CTPE 2XALA 3EIDA 4MV9A 5K4IA 1NA7A 5AP4A 4EORA 3DV3A 3HV6A 1YRPA 3ODYX 4MD8E 4BYJA 4KIPA 4A06A 3MWEA 4IVCA 4BHNA 4UCUA 3A8XA 5E92A 4M14A 4IB5A 2WOUA 3VBXA 2J0MB 3PFQA 4O7YA 4MHAA 3RTPA 5CSWA 1MRUA 3FUPA 1SM2A 4FTNA 3W0SA 4D4RA 4EK3A 5GONF 1XKKA 4ZEGA 3PSCA 2EVAA 2OSCA 4CT1A 2ITNA 4HZRA 4L46A 1FMOE 5AIRA 1OPLA 2W5HA 1JKJB 3MESA 2C6TA 3QCYA 4IC8A 3KRLA 4PMPA 3W1BA 4RWKA 5BYZA 4K11A 2XK6A 4EUUA 3RNYA 4MBLA 4F70A 2VRXA 3VVHA 2VTMA 2IPXA 3F7WA 4AA5A 4D55A 4Y8DA 4D58A 5I5SA 3T54A 3KIOC 3R1YA 1OBGA 3GQIA 5IISA 4YP8A 5LOHA 2V7AA 3IO7A 5CEKA 2YN8A 3PY1A 5KO1A 2X4ZA 2CHLA 3HMIA 4QMOA 3LFFA 2GDOA 3S95A 5IA4A 1JWHA 4ZOLF 3D14A 4A07A 1TFFA 2JDRA 3UDSA 4YLLA 3KYHC 4FV4A 4CC5A 2FSMX 4CTBA 3QRUA 3W0RA 4LDTA 3A7IA 4FT3A 3WWHA 4NU1A 5CAVA 4UZDA 3WI6A 1L8TA 4C02A 4AOTA 4AGWA 2OXYA 3AKLA 5I9UA 3TDVA 3WBLA 1VYWA 2F2CB 2GHMA 1Y57A 3ENMA 3GEQA 4O2ZA 4OTGA 4A4LA 2QOLA 3R71A 4IWDA 3GCSA 2P33A 2YCSA 3UDBA 1Z2OX 2P55A 3BL9A 3PA5A 4H1JA 2QG7A 3TKHA 3ZRKA 2DWBA 1W98A 3RWQA 3BQRA 3EN9A 5AUXA 3WYYA 5IEXA 2HWPA 2CDZA 4FL2A 5HVKA 4FK3A 2COGA 2R84A 3NUYA 4F7SA 1R0PA 4HR7A 4IIRA 1JKLA 4B6LA 4B8LA 2VNYA 3TMOA 5CS6A 5DFPA 4BCNA 4EOMA 5C8YF 4AOJA 5I5WA 3L9LA 2OZAB 1JQHA 5CVFA 1BI8A 3MB7A 3CIKA 2HOGA 3RWPA 4FVQA 1JLUE 2AUHA 2PY3A 3BA8A 2B9HA 3ZTXA 1R1WA 3KULA 2G9XA 1SVHA 4E1ZA 4J52A 3LJ2A 3QWJA 2ZV8A 2COJA 3KXXA 2UW8A 4KD1A 2UZTA 3CSVA 3CCNA 5FEDA 4DH8A 3RPRA 2C0IA 4ZMEA 3UQ8A 2WTWA 3EN5A 5DHJA 2PN1A 4LV8A 3HT5A 4A4XA 5EFQA 1UC9A 2WMVA 3N8DA 2OIQA 3SD0A 2R87A 3FXXA 3CXWA 4ME6A 3TJDA 3D2IA 4HCVA 3KY2A 3W8LA 5AUYA 4AA0A 1PXOA 2F2UA 4D4VA 2W6QA 3MWDA 3T99A 3JUHA 3V6RA 3GIDA 4TWCA 3LXNA 3CPBA 2C6EA 3W1FA 2OFVA 5KKRB 2DIKA 3BPRA 2NRYA 3QQJA 4C37A 2G2FA 5EM7A 2AYPA 1X9NA 3JSLA 3OTVA 4GYGA 3P7BA 2UZEA 3I5NA 4C5CA 2ZGIA 2Y8OA 4IAFA 3CKWA 4F63A 1B39A 4J95A 4IB3A 1M2QA 2PVLA 3ITZA 4Y5QA 2YRXA 2GNGA 4RWIA 4FODA 3D15A 4FKQA 5I5TA 3D4QA 4LUEA 2Q2TA 3KF7A 4I22A 3POOA 3QTIA 3RINA 2C47A 4IACA 3U51A 2FO0A 4J8MA 4GLWA 4DH1A 2PPQA 3P79A 3NBZB 4IADA 4L9IA 4TNBA 4M69B 1WBOA 4PL5A 1P4OA 3AX6A 4GVAA 4OW8A 1GSOA 4ZJVA 3TINA 3BKBA 2GLTA 3TIIA 4GU9A 3IPHA 5C1QB 3SGCA 4BI1A 2VTAA 3NNWA 4PDPA 3C1XA 4P5QA 5ETFA 2W6OA 2OF2A 4G6NA 3BWFA 4ZI7F 3V8WA 4UEUA 4GLXA 3UBDA 5IUIA 3CPCA 4WNMA 5CSPA 2IVTA 4EK4A 3F82A 4NJ3A 3DOGA 3UNZA 5JGBA 1W96A 3T3UA 3RAKA 5C4KA 3MWUA 3VS7A 2VZ6A 4QP4A 1OL1A 3NX8A 3E8NA 5BVKA 4CG8A 2IZSA 4QSHA 2YAAA 2UVXA 3MW1A 4GIHA 2JGZA 3MIYA 5F4NA 4WUNA 3LXLA 4D1SA 3L2PA 4AW2A 1P5EA 4GK4A 2QLQA 3OCTA 4HW7A 3QA0A 4PDSA 4JDKA 4YTIA 5GIPE 5HE2A 3VS6A 3ZLWA 4NFMA 3GU5A 1KJ8A 4YHFA 3NNUA 4C58A 2RFDA 2CKPA 2VTIA 3DZQA 4JVGA 5AV3A 4IDVA 2ZDUA 1CQJB 3FBVA 2GCDA 3R1QA 3UIMA 3DBFA 3F5XA 1YXVA 3KCFA 4ORKA 1H1PA 3LW0A 4DCAA 3HV3A 3W32A 4QMTA 2VWVA 3FKLA 1WBNA 2HY81 1RE8A 4YAKB 3O5AA 3ULIA 3QQUA 4BZOA 3FXZA 4JR3A 1W8CA 4UB7A 4QMWA 4DEEA 4MH7A 3DA6A 4MXZA 3KKVA 2ZYBA 3QYWA 1OIUA 3DFAA 3D7TA 2HHFA 2JIUA 5FDPA 4GMYA 2JAMA 4NM7A 4R78A 4XBRA 5CYIA 2I0YA 5EOBA 4GFMA 5BWRA 5LP6F 1WR2A 4RVLA 5CU3A 3W33A 5BYBA 2OIDA 5LMBA 3DK6A 3CTHA 4JBPA 2QG5A 5KE0A 4DLKA 2BROA 3VWAA 2IW6A 2WO6A 1AGWA 4WBOA 1GZ8A 5AP6A 4O6EA 4DN5A 1WVYA 2XEYA 1JDBB 1H0VA 1XH7A 1GIIA 4C4HA 3H30A 5I5VA 4FKIA 1JVPP 4P4CA 2ONLC 3PLAE 4YJSA 3WOWA 4C33A 4II5A 5J95A 4PL3A 4EHGA 3WF6A 3GJXB 3WF9A 2WMAA 3Q5ZA 5IQAA 2J0IA 4BIEA 3T9IA 1EZ1A 5AWMA 1M17A 3W8QA 1OMWA 2Q83A 3LXKA 4FKJA 3QCSA 4E6QA 1YW2A 4ERWA 5AV1A 2VQDA 2X1NA 4I6QA 5CEQA 2EIYA 3WE4A 5EZYF 3QD3A 1HOWA 4V05A 3VHEA 2ZAZA 5B0XA 2YS6A 4NW5A 3LAUA 4FYNA 4ZY4A 5HBJA 1RQQA 2BKZA 1LR4A 3I7BA 4RVKA 5KMOA 4ZZNA 2XBAA 4CFVA 3TUDA 3EN6A 3EZRA 3Q9WA 2UW9A 4FMQA 3LFQA 4WO5A 4YC6A 4YPDA 3ZEWA 5HO7A 2PVPA 4FUYA 3MPMA 4EH3A 4QRCA 4RVTA 4JRVA 3IGGA 1H1RA 3Q4UA 4EK5A 2X8IA 3VBTA 3T9EA 2JKOA 4MWHA 2QOHA 1PW2A 5KZ0A 3UDZA 3U6JA 5EH0A 3VPDA 5BV3A 4U7ZA 2B53A 5HIDA 2GHGA 2IP4A 2GQSA 4O6LA 4MTAA 4WHZA 4ZJIA 2C5VA 2ETKA 4BDBA 3N6RA 5BWVA 5AUZA 4CMFA 3TL8A 4BBFA 3F5GA 2HVRA 1KE6A 3CD3A 1OKVA 3DKCA 3ZHPC 4C34A 4YHTA 4EL9A 4F99A 5BVNA 2RFNA 4FT5A 2FB8A 3PJ3A 4XNEA 3AC5A 2YZAA 5H8EA 5BWUA 4AA4A 4P5ZA 2UW4A 1M7QA 3JVRA 3M11A 3OUKA 4O82A 4BI2A 3ERKA 4F7NA 3F61A 2B0QA 3ODZX 3PVGA 1H08A 4G6OA 1PJKA 3FMMA 1E1XA 2KTYA 4IFGA 5A14A 4HQ6A 3RKBA 3NW6A 2ZMDA 4UBAA 1UU9A 3V01A 3QQHA 3W5OA 3FAAA 4MVFA 2IG7A 4BCFA 4A9RA 4IAZA 3R7EA 4M9UA 1Q61A 2BIYA 3HP2A 1JOWB 2XK8A 3NUXA 4DGOA 2V59A 2I0EA 2F57A 3BYUA 1F3MC 3LZBA 4ZY5A 1PMUA 4E73A 4C4GA 3F2NA 4DQNA 4YO6A 5ANEA 4M0JA 2HGSA 3BWJA 4IE9A 3DY7A 5LVLA 1ERKA 3ZSGA 4O4JF 4GSBA 2J5EA 4V0GA 4O7VA 3DXQA 4D1XA 3HLLA 1CSNA 2B1PA 1JNKA 3QHRA 5HO8A 5IH6A 1APME 5EM8A 2UZOA 3Q96A 3R1SA 2XYUA 3LM5A 3ZLYA 3K54A 4CD0A 2XKCA 3RPSA 4OUCA 3I81A 4KSPA 3VS0A 4FZFB 3QTXA 3OVVA 2Z60A 2OBJA 5ANOA 5JFSA 5KUPA 3UZOA 3LMIA 3NFFB 1YWVA 5FPRA 5EOLA 4XG3A 4L3PA 5JSMA 4UFZA 4DLJA 3A99A 5EDPA 1K3AA 3OOMA 5C1PA 5HG5A 1YDRE 2C30A 3IGOA 3O96A 5HIEA 4FOBA 3OF0A 4GG5A 3KAKA 5D7VA 4IZAA 3UZBA 2W1IA 4XH6A 1B38A 1Q5KA 2GPSA 2HZIA 3TNIA 3ZUTA 2VX1A 4EC9A 3EKKA 5LWMA 2JDOA 2X39A 1BI7A 5HNBA 5C1OA 1P14A 3FQEA 3BHUA 4FSTA 3GENA 1I2LA 5JT2A 2OJJA 4CCUA 3NBYB 2B7AA 3KGAA 5EQEA 3RHXA 2R3LA 4XRJA 1C30A 4RMZA 4L00A 4C4EA 1OPJA 5DPVA 4M84A 5JN2A 1W93A 4F65A 3JYAA 2R3NA 2W9ZB 1IASA 2W1CA 3ORRA 3BLRA 4RX9A 4AAAA 4AT5A 4BGGA 1YI4A 3PY0A 4AXAA 3SLSA 3U55A 2IVUA 4I50F 4O0TA 4Z9LA 3P9JA 2CLXA 3DK7A 4QQJA 1PXJA 4G3GA 4JG7A 4CFWA 2YZGA 4EGQA 4R7HA 3R5FA 4UCSA 3S24A 3EFKA 3U9SA 1PX2A 3R04A 4TYGA 4LQMA 5HG8A 3AT4A 5FDXA 4QMMA 5AM6A 1MQBA 3PN1A 3D0EA 3QUPA 5DR6A 2UZDA 1PY5A 3QC9A 4I0RA 5AJQA 5C03A 3VUGA 5KX8A 2XCKA 5HIBA 5B2LA 2COIA 2V5QA 2FGIA 2VTRA 3OROA 3FY0A 4YLKA 5HKMA 4AFJA 3I0QA 3R7YA 3TIGA 3HRBA 1OKYA 1Q8TA 4IH8A 3EH9A 3KRJA 3OY1A 4BHZA 5HU9A 2IZUA 3PP0A 3I7CA 3UQFA 4DLIA 2X0SA 3NPCA 1U54A 4XYLB 3O17A 4ZXTA 4LMUA 4U8ZA 1OIRA 3OTUA 4JRNA 4RJ7A 5M06A 4F0IA 2H9VA 4U97A 2WTIA 3GFWA 2B4SB 3IS5A 2IO6A 4TYHB 4CNHA 5JZJA 4JJRA 1WFCA 2JC6A 3BHTA 4ZTHA 4NM5A 3QLGA 3VRYA 5E8UA 3MH3A 3KREA 2GMXA 3L9NA 2ZV9A 3CE3A 3WF8A 1EHIA 4CMDA 2VTOA 5HCZA 4QEBA 3BCEA 4X3FA 5CAQA 2EJ2A 4FNWA 4GCJA 2HXLA 2QLUA 4JX3A 3ZDUA 4YB8B 4G6LA 4FA2A 4F6UA 4YTFA 2PZRA 2HIVA 4PDOA 3W0PA 5LXTF 1Q41A 1S9JA 4BCKA 4FKPA 3PXFA 3FPQA 4EZ5A 1CKIA 2IVSA 4DT9A 2I1MA 1XH5A 4YAJB 2OWBA 3C13A 1VKZA 4TYEA 2R3MA 5IU2A 1H25A 4BDDA 1LPUA 4FZ6A 3RCDA 5KNJA 2HY0A 5CAUA 4ASDA 1OECA 2I0HA 3BV3A 2O5KA 4FFRA 3V8SA 5IPJA 2W05A 4MBIA 2VO3A 3QU0A 5EDQA 2BAJA 4U9AA 3TV6A 5K9IA 3LCOA 3Q6UA 2C6OA 3QCXA 1PXIA 2W5AA 3TWJA 4BDCA 3QQKA 3DTCA 2HCKA 4ZSEA 4YZMA 1A48A 4XBUA 2JFMA 4E20A 2G2HA 4Q5EA 4ANSA 5I9VA 3U54A 3SG8A 5T68A 2J9GA 4GH2A 3KN6A 4P90A 4AT3A 2BAKA 4AU8A 2Y9QA 1YHVA 1Q4LA 4RC4A 3ZFXA 3QWUA 3OBJA 4AAYA 2XP2A 1PKDA 2IZRA 3FQHA 1BKXA 4F9CA 3QX4A 2JDSA 1Y6AA 4MNFA 2C68A 3RAHA 4PY1A 2QC6A 3DQWA 4KKGA 2OIBA 2R3RA 4ITIA 4QNAA 5JMSA 2X7FA 5HD4A 4FFPA 5I4NA 3LQ8A 4O7LA 4DFLA 5CU2A 1DAAA 3JVSA 2X4FA 1SZMA 3TKUA 2I80A 2REIA 4FSRA 1A3GA 4XG7A 3VN9A 2YS7A 4BBEA 2YZLA 1S68A 3CLYA 5DA3A 2WIHA 3NFGB 4U81A 4YZBA 3UYSA 2F4JA 3V6SA 4IVBA 4HN2A 1GOLA 5C4LA 1B6SA 3RNIA 5LWNA 3FMEA 5DEYA 2C6IA 3LLAA 3LHJA 4PV0A 5GJFA 3V8TA 3TTIA 4ZLZA 5KMKA 4WRSA 4X0MA 2QK4A 2F7EE 1DV2A 1P2AA 3DTFA 3F5UA 4TV8F 1GSAA 3Q2JA 4QMXA 1GNGA 1KJ9A 4JS8A 5AP2A 2JLDA 3PVUA 3EL8A 2CNQA 4KB8A 5LVOA 3DZOA 4OBOA 3CQUA 5EHOA 3H9RA 3TACA 4DFBA 3WIGA 2QO9A 5EK7A 2OG8A 2BDFA 3HMOA 1G3NA 4I4EA 4QDEA 5J2TF 3E87A 4DE4A 1A06A 1VJYA 4TYJA 4BTMA 3GC8A 4EFEA 2X7GA 4K0YA 4G1WA 5HBHA 2OWOA 3FLYA 4FV7A 3C0IA 1K9AA 3VS1A 2JBPA 3BLAA 5EM6A 3QD4A 4O21A 4AXDA 4FTRA 4QMZA 2NU9B 5D11A 4M12A 3RK7A 3CS9A 4BCIA 4CFNA 3GU7A 4GFGA 2PVYA 5IQEA 1O6YA 2GPHA 2UZWE 2RL5A 3R22A 4IX4A 4J53A 2CGUA 4UXLA 4WG5A 3ZLXA 3UC4A 2ITQA 5M53A 1IOVA 4AN9A 3RALA 3KVWA 5A9UA 2G1TA 2PZPA 2RGPA 4LH6A 2BALA 2CKOA 4CKCA 4QQ5A 3UIUA 4FUXA 3UQGA 3RM7A 3PPKA 2NUAB 3DDPA 1V0OA 5DIAA 3LMHA 1J7UA 3V5QA 1I1MA 3UQCA 1CKOA 3ETAA 1ULZA 2J6MA 4AZFA 2GSFA 3QUDA 5ICPA 1SYKA 2W1ZA 2YRWA 4HJOA 4S30A 3TXOA 1P16A 3BZ3A 1UU3A 3AKJA 3QD0A 5CT7A 4TNDA 3TIZA 4LH7A 4E5BA 4JT3A 5C27A 5CF6A 1Y8YA 3PWDA 2W70A 4LMNA 3VJOA 2Z8CA 3NS9A 2X6DA 4EQ5A 2BZKB 3CY3A 4OT5A 2ONLA 3ANQA 3A4PA 5KKNB 3V5JA 5HQ0A 2WTJA 4YJ2F 3UODA 3UG2A 2YISA 4F4PA 2QVSE 4ASZA 3HV4A 4ACHA 2HHFB 4FTMA 2QCSA 2QURA 3MVLA 2PMLX 3RUPA 1WBPA 3EL7A 3R8LA 3HAVA 3FSKA 3OWKA 4GK2A 4TY1A 4YSMA 4F1TA 3E8CA 3UVRA 4D0XA 5E4HA 4XMOA 4R1VA 5LARA 4BJJB 2O63A 1MRVA 1ZRZA 3FLZA 2ITPA 3FMJA 5DN3A 3SV0A 5DAAA 4IB0A 3U0GA 2E9PA 3DJ7A 1IAHA 5TKDA 4D5HA 5F20A 4F78A 2NU6B 5J1VA 4DGLC 3HBLA 3KN5A 3ORXA 5DT0A 4K1BA 4J1RA 3RK9A 3A7GA 3PIZA 1NT2A 2ETRA 4FFOA 4IWQA 2ITTA 4DTKA 4OGRA 5BUJA 3G8DA 3KFAA 3QC4A 3AGLA 3Q4TA 2JITA 3FL4A 2UW6A 1UV5A 5J87A 2YACA 3VUMA 1KC7A 2IZTA 4F09A 3RV4A 4K2RA 4BKJA 4E4LA 4YJ3F 4Q4CA 3QRKA 4QTEA 1MUOA 2W1GA 3PYYA 4UCOA 1EKPA 2GS7A 2R9SA 3UOHA 3U9NA 4OR5A 3L8VA 1ZAUA 2R64A 1ZYDA 3VBWA 1KE8A 4JAIA 3W10A 5KMLA 1YXTA 1FVVA 3FLNC 3R83A 4XG6A 2SRCA 2W99B 4I1ZA 1UKIA 2NP8A 4RJ6A 4EWQA 5DR9A 3F3TA 4EYMA 5A46A 4EZ7A 5CF4A 4FKVA 2PMIA 4IM3A 3ZXZA 4DTBA 1P8LA 1WZYA 4XP0A 4EOKA 4O0VA 4EQUA 2Z04A 2OFUA 4GK3A 2BMCA 3KMWA 2UZUE 3CQWA 4RQVA 2VTJA 4L43A 4UX9A 3FDNA 2OH0E 2CZGA 4YU2A 4GKIA 3LFDA 4GT3A 4FNYA 3ZUVA 3NCGA 4DTAA 5E8SA 4WHXA 2HYYA 1FQ1B 1NXKA 1OGUA 3ZC5A 3MH1A 5A6OA 4IWPA 2G01A 5BVWA 1YHSA 3W2CA 4DH5A 5IG1A 1LUFA 4NL0A 5A4LA 3NAXA 5M4CA 2FB9A 2WPAA 3T9TA 4DF3A 3PXYA 4TRLA 1WBWA 1YOJA 3FMKA 4J97A 4X2GA 1WRVA 2PVRA 2CNUA 5AAEA 3QZHA 4ACMA 3BYSA 3QKKA 2XAMA 4XZ3B 3H0ZA 2ZV2A 5DT3A 5AUUA 4FTTA 4OBPA 1TQPA 3QCQA 1ZYJA 1GZOA 1ZXEA 2R3GA 5L6WL 4EBVA 2C3KA 2YWVA 4Z3VA 5CR5A 3JZFA 3O51A 2C0TA 4MAOA 3FV8A 4Y83A 2VO0A 3DAKA 3K3JA 3Q6WA 4BGQA 3MS9A 1OITA 4PDYA 5CEOA 2BRNA 1ATPE 1QL6A 2WQMA 2XJ2A 3PDTA 4NIFB 3CSWA 4F9AA 3P1AA 4V04A 4QNYA 2R7IA 2FP4B 1OL2A 3F3WA 4TN6A 3WO0A 3PJ2A 2A19B 3UYTA 5KZIA 1B6CB 4G34A 4TKSA 4DDGA 3L8PA 4EH8A 2X5RA 1EKFA 1JPAA 3D5UA 4L67A 4HYSA 1WBTA 4QMVA 2W71A 3Q2OA 5M51A 1YWRA 1EH4A 3OUUA 3CC6A 3QTWA 4EKLA 3ZO2A 3L9PA 4ASXA 4XLIA 2VNWA 4E6NA 2J90A 2OICA 3KRWA 4S31A 5IMEA 4FZDB 4ZIMA 3MJFA 4DH3A 1GZNA 1FVTA 2PE2A 4I23A 4KWPA 2PVFA 1Q62A 1FGKA 4PP9A 4BN1A 4AE6A 3PPJA 4TT7A 4HZSA 2R3PA 2B55A 5I5XA 4O7TA 4X2FA 2BRMA 3LIJA 4APPA 1H4LA 2UW5A 2HENA 3FZTA 5IMXA 3TI1A 1GAGA 2QOBA 3VPBA 4QP1A 4YZCA 5DYJA 4HVDA 1UU8A 1PXMA 4XRLA 3R6XA 4U42A 1XBCA 2YDJA 3BYOA 4WG3A 5DR2A 5ACBC 4BCGA 4ZS0A 2WYOA 4EC8A 3P08A 2XIKA 3AMAA 5DRBA 3GU4A 3MFRA 3QXPA 4QP3A 1CS0A 2J0KA 5EDRA 4EOQA 2C5XA 3O8UA 5L2WA 3ROCA 5KHWA 3FMHA 5IEYA 2XIZA 3GOPA 4DGMA 3R9NA 3DKGA 2XK7A 3H9OA 5D10A 3O0GA 3CR0A 3QTZA 4YNEA 4EJ7A 3DAEA 2ZMCA 5GINE 4U79A 5D12A 1FVIA 3KXZA 3NYNA 1JSUA 4BTJA 1VBGA 4YURA 1OUYA 4OTRA 3ZSHA 4DEBA 5E25A 2JIIA 1QPCA 4JAJA 4YTHA 2GS6A 3VUIA 4RX5A 1H07A 4L01A 4M68A 3IOKA 3PJCA 5HI2A 4DIMA 4HNTA 5FP6A 3QQGA 2XJ1A 3R1NA 2XS0A 4D4YA 4MX9A 4QYFA 2FSLX 3M42A 4DITA 4CG9A 3PXKA 1ST4A 4I20A 4MNEA 2QB5A 4Y85A 4UCVA 5JEBA 3VUDA 2QOQA 3NW5A 4ALVA 3L1SA 2YA9A 1PK8A 4G31A 2YEXA 3AC2A 4QPSA 5HESA 3TNWA 4AE9A 2OLSA 1M2RA 3VUHA 1XBAA 3MA3A 5DNRA 3UO5A 2XCHA 3FLQA 4O0UA 3AW8A 4ANLA 4PZ7A 4ZTSA 4FIIA 2V22A 4AF3A 5AP1A 4ONAA 1NVRA 5DVRA 4M67A 3W2RA 4AFEA 5L8KA 3COIA 4IAKA 2X6EA 3VNNA 2NRUA 3BX5A 2VGPA 4AUAA 4JR7A 5BPHA 3F3UA 5ANGA 2Z7LA 2JKKA 2CKEA 4E8AA 4U0IA 4ERKA 4MXXA 2G2IA 4GIIA 5ANIA 4I5MA 4ZLYA 4OT6A 3FEGA 3MVHA 3VF8A 4AGCA 5H9BA 4JXUA 2W4JA 5A4EA 2ZB0A 5EI6A 2W6ZA 1R39A 5M44A 4YJVA 1U54B 3R21A 4CMUA 4E5WA 4I21A 2BHHA 2QR7A 3KMUA 2YWPA 4XV3A 2WTDA 4O22A 3LP8A 3OT3A 4LGHA 5F95A 4XV9A 3QLFA 3W1GA 5AAFA 1SVEA 1UA2A 3OEFX 3OXTA 4MV7A 4YJRA 2BHEA 3BGQA 3IW5A 2XH5A 3ORZA 3NNXA 4GVJA 4KNBA 4EI4A 2C4GA 2O2UA 2XRWA 4F64A 5A6NA 5KKRC 1BNCA 1EYZA 3BG5A 4LM5A 4EH6A 5M57A 3GB8B 3EKNA 2WZJA 3ZO4A 4X3FB 4CMOA 3VMMA 4M0ZA 3ZDIA 3REPA 1Q24A 1ND4A 4O81A 1VLRA 3EFJA 3DU8A 3HX4A 5E90A 4UCTA 1SNUA 1CKJA 4KRDA 4U43A 2BILB 4O7ZA 3Q9XA 4QYYA 5EYKA 3PSBA 2WEVA 2YFXA 3NEWA 1OIQA 4BCJA 5BX0A 3BV2A 3DLZA 3R30A 4HYUA 4AZEA 1SCUB 3BQCA 1YDSE 1YXSA 4NCTA 5CTPA 5CSHA 5AMNA 1Q97A 1E4EA 5CNNA 3EQFA 3V5TA 1FMKA 4CFFA 5HLWA 4KRCA 4RX8A 2XK9A 3KU2A 4GYIA 1Z5MA 4FTQA 5D1OB 5DGZA 1R0EA 4IAIA 4NYEA 5KX5F