3GB8B

Crystal structure of crm1/snurportin-1 complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
294
structure length
267
Chain Sequence
b'SMEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLALPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-1
publication title Structural basis for leucine-rich nuclear export signal recognition by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 69
structure length 267
sequence length 294
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11538 Snurportin1 Snurportin1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3gb8B00
3W5OA 4DRFA 1TAEA 1VS0A 4E6NA 5DISC 5D1PA 4UCSA 1P8LA 1XK5A 4PZ6A 1CKOA 3BA8A 2Q2TA 4UCUA 4UCTA 3S24A 2HIXA 3QWUA 2CFMA 1DGSA 3TY8A 3UQ8A 3PN1A 1CKNB 4PZ8A 5D1OA 4UCOA 3L2PA 1A0IA 3GB8B 3BAAA 4UCVA 2HIVA 1FVIA 4GLXA 3W1GA 5D1OB 3BA9A 2HVRA 1CKNA 3KYHC 3GJXB 3NBYB 4UCRA 2OWOA 3TY9A 5FPOA 3JSLA 1X9NA 3RTXA 1V9PA 4UFZA 3GDEA 3BABA 3RR5A 3W1BA 1S68A 2HVQA 5FPRA 3VNNA 2VUGA 4EFEA 3NBZB 1CKMA 4EQ5A 1B04A 2HVSA 4CC5A 2Q2UA 1P16A 4LH7A 4PZ7A 3TY5A 4EFBA 1TA8A 3NC0B 3JSNA 4CC6A 4LH6A 4EEQA 1XDNA
chains in the Genus database with same CATH superfamily
3JRXA 3W5OA 2EIYA 4TV9F 4DIMA 5LP6F 3N8DA 3KREA 5GONF 5DISC 2ZGIA 2HG8A 4M9UA 5BWWA 2V59A 2IP4A 4YJ2F 1XK5A 3I12A 4FE2A 4XYLB 1KJJA 5BWTA 4FGRA 4MV6A 5BMVF 3GLKA 2PBZA 3PFFA 2DIKA 4WBNF 2W6OA 2CNVA 2CZGA 3OUZA 4UCUA 4UCTA 5CE8A 1W96A 5BPHA 4HN2A 1KUTA 3S24A 5LOVF 2CFMA 2YYAA 1ET0A 1DGSA 5KS8A 3T7AA 1A0GA 5C8YF 3R5HA 3TY8A 3N6RA 4O83A 3DF7A 1EKVA 3PN1A 5BPFA 3KALA 2DZDA 4K6NA 4CKCA 3T99A 3UZOA 4ZHQF 4UCVA 4GLXA 5LYJF 2I8CA 2DABA 4NYEA 1IYDA 1CKNA 4TUYF 1PK8A 3TW7A 1CQIB 3KAKA 4FFLA 4FFMA 5HBRB 4O7VA 1GSHA 2OWOA 3TY9A 2FPPB 1EZ1A 4TV8F 1KJ9A 4Q4DA 4WHXA 4HNTA 1X9NA 5I5TA 4CMDA 5HNEA 4ME6A 5CA0F 2R7NA 4DQNA 3K5IA 5CB4F 1SCUB 4CKEA 4YJ3F 4GLWA 3K3PA 2Y4RA 2YS7A 5D8DA 1CKMA 1GGOA 1B04A 2HVSA 4HQ6A 1W93A 1C30A 4O2AF 3U54A 1OBGA 2COGA 5I5WA 3WO1A 4EGQA 2YZGA 2W6NA 3TY5A 4I4TF 4C5AA 4CC6A 2R7LA 4EEQA 2COJA 1G2WA 1AUXA 4MAMA 4MV3A 5BYAA 1EUDB 5HV6A 3U9SA 2YZMA 1DAAA 2ABJA 4HNUA 1TAEA 4UCSA 2FPIB 5JVLA 2R84A 5I5UA 4O84A 4MA0A 1JDEA 2C00A 3AX6A 2QB5A 4PZ6A 2I87A 2ZDHA 2DAAA 3JZFA 4DAAA 3QQMA 1EYZA 3UZBA 3JRWA 2V58A 5C1OA 2HHFB 4HR7A 3TW6A 5J2UF 5DGIA 1CS0A 2FB9A 1OBDA 5C1PA 3T9EA 4QSHA 3T54A 3U55A 2HJWA 2YL2A 5I5VA 5D1OA 3ETJA 5BWVA 4Q4CA 2YZLA 1WR2A 3NUAA 4O4HF 3L2PA 5I5SA 1DV1A 3OUUA 3LWBA 2GLTA 4XZ3B 3HBLA 4O82A 5I5YA 2P0AA 2V5AA 5CM0A 4CE5A 2NUAB 5D1OB 4XYMB 4FFPA 2R82A 3SNOA 3WWIA 2HVRA 4O7RA 5JVDF 3QFFA 4UCRA 2YWVA 2YRWA 5K2MA 5BWXA 3RV4A 1GLVA 4PBCA 1A3GA 3WO0A 1BXRA 3DTFA 4O7WA 3ORQA 5LXTF 3RTXA 2YZNA 4UFZA 4TM5A 3TIIA 4O7ZA 3BABA 3RR5A 3T9BA 1S68A 2HVQA 3DTGA 1VBHA 3BG5A 3NBZB 4C5BA 4CC5A 2NU6B 3VPCA 2CNQA 2FP4B 4NZMA 3HB9A 1I2KA 2VR1A 3G8DA 4YAJB 3UFXB 1IOWA 2DWCA 2ODTX 1CE8A 4LH7A 3RUPA 4EFBA 1VBGA 3AW8A 3JSNA 2X0SA 2Z04A 4LH6A 3DAAA 4MV8A 3SE7A 1XDNA 4DRFA 2W6MA 2X5RA 2YW2A 2HGXA 4YAKB 4E6NA 1Z2OX 4I55F 3V4SA 3JZ6A 2R85A 5I60A 4MV1A 2GQSA 2YS6A 4UUGA 1CKOA 4M0JA 5I5XA 3TIGA 2EJ3A 4FFNA 2GPWA 3TQTA 1M6VA 3Q1KA 3BA8A 5DAAA 1C3OA 4FFRA 3U0GA 4NZOA 5K3WA 2W6QA 4CHIA 4O7SA 4IZOA 1E4EB 5FNVF 2HGWA 2HIXA 4O2BF 2WYOA 4O7YA 2XCLA 5BYBA 1ZAUA 3U9TA 5KX5F 1KBLA 5EZYF 2NU9B 1T36A 5E25A 2HHFA 3T9DA 1GSOA 1KT8A 2HDKA 4UCOA 3RV3A 4MA5A 1A0IA 1M0TA 3R5XA 3WWHA 2R86A 2DLNA 1EKFA 1KC7A 5BWUA 3HO8A 3W1GA 5CR5A 4I50F 4EGJA 4ZI7F 4O4IF 5JQWA 3VMMA 2QF7A 3KYHC 3RFCA 4O81A 2GPSA 2I80A 1IOVA 2W71A 2PN1A 2R7MA 3LP8A 2YRXA 2EJ0A 1Z2NX 2Q7DA 3R5FA 4NZNA 3GIDA 4YB8B 5FPOA 4XX0B 3JSLA 4CMFA 1UC9A 1BNCA 4Y8VB 3TINA 3TEKA 1I1KA 4O4JF 3MJFA 1V9PA 4HNVA 3G8CA 3UYYA 3W1BA 5FPRA 3VNNA 1B6RA 1DIKA 2VUGA 3K5HA 1JDBB 2A1HA 1VKZA 4EQ5A 1GSAA 1UC8A 4O7LA 1B6SA 2XD4A 3VA7A 1P16A 3R9RA 2HGSA 3KAJA 1CQJB 1AUVA 1JLLB 4PZ7A 3BACA 5I47A 1TA8A 2R87A 3NC0B 5CA1F 4IIJF 3CEBA 4FFOA 1I1MA 1I2LA 4MV4A 2VPQA 1Z2PX 2QK4A 1A48A 2VQDA 5DMXA 1VS0A 5D1PA 2ZDGA 2PVPA 4E4TA 3LULA 3R23A 4IWXA 1P8LA 4ZOLF 4MV7A 1A9XA 2SCUB 2ZDQA 3LQSA 5H80A 3HT5A 2Q2TA 2CNUA 4YBZB 4L1KA 4JXUA 4O4LF 4CKBA 5KKNB 3MWDA 1KJQA 3QWUA 4IWYA 3WNZA 1KJIA 2Z02A 2W70A 4EG0A 1I1LA 4O86A 3UQ8A 1KTAA 1CKNB 5FR9A 4RCNA 2R7KA 1E4EA 4PZ8A 3T9CA 5BWRA 3GB8B 1EUCB 3BAAA 4C5CA 2EJ2A 5IYZF 2HIVA 1FVIA 5J2TF 3T9FA 3BA9A 1WRVA 1I7LA 3V4ZA 3CSWA 3VPDA 2OLSA 3E5NA 3ORRA 1JKJB 3GJXB 4O7TA 3NBYB 1EHIA 4O7NA 1DV2A 5JQGF 3SGIA 4IHJF 5DGHA 1PX2A 3WWJA 1KJ8A 4DLKA 4TVIA 3GDEA 2FPGB 1ULZA 4RZQA 4MV9A 5CAEB 2NU8B 2COIA 5LA6F 3Q2OA 4EFEA 4ZQIA 1IYEA 2GQRA 3JZIA 2Q2UA 3ETHA 2NU7B 3VOTA 2J9GA 4FU0A 5JH7F 2W6PA 2W6ZA 3MWEA 1M0WA 3VPBA 1EKPA 1I7NA 3T9AA 1KEEA
chains in the Genus database with same CATH topology
3W5OA 4DRFA 1TAEA 1VS0A 4E6NA 5DISC 5D1PA 4UCSA 1P8LA 1XK5A 4PZ6A 1CKOA 3BA8A 2Q2TA 4UCUA 4UCTA 3S24A 2HIXA 3QWUA 2CFMA 1DGSA 3TY8A 3UQ8A 3PN1A 1CKNB 4PZ8A 5D1OA 4UCOA 3L2PA 1A0IA 3GB8B 3BAAA 4UCVA 2HIVA 1FVIA 4GLXA 3W1GA 5D1OB 3BA9A 2HVRA 1CKNA 3KYHC 3GJXB 3NBYB 4UCRA 2OWOA 3TY9A 5FPOA 3JSLA 1X9NA 3RTXA 1V9PA 4UFZA 3GDEA 3BABA 3RR5A 3W1BA 1S68A 2HVQA 5FPRA 3VNNA 2VUGA 4EFEA 3NBZB 1CKMA 4EQ5A 1B04A 2HVSA 4CC5A 2Q2UA 1P16A 4LH7A 4PZ7A 3TY5A 4EFBA 1TA8A 3NC0B 3JSNA 4CC6A 4LH6A 4EEQA 1XDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5O A;  4DRF A;  1TAE A;  1VS0 A;  4E6N A;  5DIS C;  5D1P A;  4UCS A;  1P8L A;  1XK5 A;  4PZ6 A;  1CKO A;  3BA8 A;  2Q2T A;  4UCU A;  4UCT A;  3S24 A;  2HIX A;  3QWU A;  2CFM A;  1DGS A;  3TY8 A;  3UQ8 A;  3PN1 A;  1CKN B;  4PZ8 A;  5D1O A;  4UCO A;  3L2P A;  1A0I A;  3GB8 B;  3BAA A;  4UCV A;  2HIV A;  1FVI A;  4GLX A;  3W1G A;  5D1O B;  3BA9 A;  2HVR A;  1CKN A;  3KYH C;  3GJX B;  3NBY B;  4UCR A;  2OWO A;  3TY9 A;  5FPO A;  3JSL A;  1X9N A;  3RTX A;  1V9P A;  4UFZ A;  3GDE A;  3BAB A;  3RR5 A;  3W1B A;  1S68 A;  2HVQ A;  5FPR A;  3VNN A;  2VUG A;  4EFE A;  3NBZ B;  1CKM A;  4EQ5 A;  1B04 A;  2HVS A;  4CC5 A;  2Q2U A;  1P16 A;  4LH7 A;  4PZ7 A;  3TY5 A;  4EFB A;  1TA8 A;  3NC0 B;  3JSN A;  4CC6 A;  4LH6 A;  4EEQ A;  1XDN A; 
#chains in the Genus database with same CATH topology
 3JRX A;  3W5O A;  2EIY A;  4TV9 F;  4DIM A;  5LP6 F;  3N8D A;  3KRE A;  5GON F;  5DIS C;  2ZGI A;  2HG8 A;  4M9U A;  5BWW A;  2V59 A;  2IP4 A;  4YJ2 F;  1XK5 A;  3I12 A;  4FE2 A;  4XYL B;  1KJJ A;  5BWT A;  4FGR A;  4MV6 A;  5BMV F;  3GLK A;  2PBZ A;  3PFF A;  2DIK A;  4WBN F;  2W6O A;  2CNV A;  2CZG A;  3OUZ A;  4UCU A;  4UCT A;  5CE8 A;  1W96 A;  5BPH A;  4HN2 A;  1KUT A;  3S24 A;  5LOV F;  2CFM A;  2YYA A;  1ET0 A;  1DGS A;  5KS8 A;  3T7A A;  1A0G A;  5C8Y F;  3R5H A;  3TY8 A;  3N6R A;  4O83 A;  3DF7 A;  1EKV A;  3PN1 A;  5BPF A;  3KAL A;  2DZD A;  4K6N A;  4CKC A;  3T99 A;  3UZO A;  4ZHQ F;  4UCV A;  4GLX A;  5LYJ F;  2I8C A;  2DAB A;  4NYE A;  1IYD A;  1CKN A;  4TUY F;  1PK8 A;  3TW7 A;  1CQI B;  3KAK A;  4FFL A;  4FFM A;  5HBR B;  4O7V A;  1GSH A;  2OWO A;  3TY9 A;  2FPP B;  1EZ1 A;  4TV8 F;  1KJ9 A;  4Q4D A;  4WHX A;  4HNT A;  1X9N A;  5I5T A;  4CMD A;  5HNE A;  4ME6 A;  5CA0 F;  2R7N A;  4DQN A;  3K5I A;  5CB4 F;  1SCU B;  4CKE A;  4YJ3 F;  4GLW A;  3K3P A;  2Y4R A;  2YS7 A;  5D8D A;  1CKM A;  1GGO A;  1B04 A;  2HVS A;  4HQ6 A;  1W93 A;  1C30 A;  4O2A F;  3U54 A;  1OBG A;  2COG A;  5I5W A;  3WO1 A;  4EGQ A;  2YZG A;  2W6N A;  3TY5 A;  4I4T F;  4C5A A;  4CC6 A;  2R7L A;  4EEQ A;  2COJ A;  1G2W A;  1AUX A;  4MAM A;  4MV3 A;  5BYA A;  1EUD B;  5HV6 A;  3U9S A;  2YZM A;  1DAA A;  2ABJ A;  4HNU A;  1TAE A;  4UCS A;  2FPI B;  5JVL A;  2R84 A;  5I5U A;  4O84 A;  4MA0 A;  1JDE A;  2C00 A;  3AX6 A;  2QB5 A;  4PZ6 A;  2I87 A;  2ZDH A;  2DAA A;  3JZF A;  4DAA A;  3QQM A;  1EYZ A;  3UZB A;  3JRW A;  2V58 A;  5C1O A;  2HHF B;  4HR7 A;  3TW6 A;  5J2U F;  5DGI A;  1CS0 A;  2FB9 A;  1OBD A;  5C1P A;  3T9E A;  4QSH A;  3T54 A;  3U55 A;  2HJW A;  2YL2 A;  5I5V A;  5D1O A;  3ETJ A;  5BWV A;  4Q4C A;  2YZL A;  1WR2 A;  3NUA A;  4O4H F;  3L2P A;  5I5S A;  1DV1 A;  3OUU A;  3LWB A;  2GLT A;  4XZ3 B;  3HBL A;  4O82 A;  5I5Y A;  2P0A A;  2V5A A;  5CM0 A;  4CE5 A;  2NUA B;  5D1O B;  4XYM B;  4FFP A;  2R82 A;  3SNO A;  3WWI A;  2HVR A;  4O7R A;  5JVD F;  3QFF A;  4UCR A;  2YWV A;  2YRW A;  5K2M A;  5BWX A;  3RV4 A;  1GLV A;  4PBC A;  1A3G A;  3WO0 A;  1BXR A;  3DTF A;  4O7W A;  3ORQ A;  5LXT F;  3RTX A;  2YZN A;  4UFZ A;  4TM5 A;  3TII A;  4O7Z A;  3BAB A;  3RR5 A;  3T9B A;  1S68 A;  2HVQ A;  3DTG A;  1VBH A;  3BG5 A;  3NBZ B;  4C5B A;  4CC5 A;  2NU6 B;  3VPC A;  2CNQ A;  2FP4 B;  4NZM A;  3HB9 A;  1I2K A;  2VR1 A;  3G8D A;  4YAJ B;  3UFX B;  1IOW A;  2DWC A;  2ODT X;  1CE8 A;  4LH7 A;  3RUP A;  4EFB A;  1VBG A;  3AW8 A;  3JSN A;  2X0S A;  2Z04 A;  4LH6 A;  3DAA A;  4MV8 A;  3SE7 A;  1XDN A;  4DRF A;  2W6M A;  2X5R A;  2YW2 A;  2HGX A;  4YAK B;  4E6N A;  1Z2O X;  4I55 F;  3V4S A;  3JZ6 A;  2R85 A;  5I60 A;  4MV1 A;  2GQS A;  2YS6 A;  4UUG A;  1CKO A;  4M0J A;  5I5X A;  3TIG A;  2EJ3 A;  4FFN A;  2GPW A;  3TQT A;  1M6V A;  3Q1K A;  3BA8 A;  5DAA A;  1C3O A;  4FFR A;  3U0G A;  4NZO A;  5K3W A;  2W6Q A;  4CHI A;  4O7S A;  4IZO A;  1E4E B;  5FNV F;  2HGW A;  2HIX A;  4O2B F;  2WYO A;  4O7Y A;  2XCL A;  5BYB A;  1ZAU A;  3U9T A;  5KX5 F;  1KBL A;  5EZY F;  2NU9 B;  1T36 A;  5E25 A;  2HHF A;  3T9D A;  1GSO A;  1KT8 A;  2HDK A;  4UCO A;  3RV3 A;  4MA5 A;  1A0I A;  1M0T A;  3R5X A;  3WWH A;  2R86 A;  2DLN A;  1EKF A;  1KC7 A;  5BWU A;  3HO8 A;  3W1G A;  5CR5 A;  4I50 F;  4EGJ A;  4ZI7 F;  4O4I F;  5JQW A;  3VMM A;  2QF7 A;  3KYH C;  3RFC A;  4O81 A;  2GPS A;  2I80 A;  1IOV A;  2W71 A;  2PN1 A;  2R7M A;  3LP8 A;  2YRX A;  2EJ0 A;  1Z2N X;  2Q7D A;  3R5F A;  4NZN A;  3GID A;  4YB8 B;  5FPO A;  4XX0 B;  3JSL A;  4CMF A;  1UC9 A;  1BNC A;  4Y8V B;  3TIN A;  3TEK A;  1I1K A;  4O4J F;  3MJF A;  1V9P A;  4HNV A;  3G8C A;  3UYY A;  3W1B A;  5FPR A;  3VNN A;  1B6R A;  1DIK A;  2VUG A;  3K5H A;  1JDB B;  2A1H A;  1VKZ A;  4EQ5 A;  1GSA A;  1UC8 A;  4O7L A;  1B6S A;  2XD4 A;  3VA7 A;  1P16 A;  3R9R A;  2HGS A;  3KAJ A;  1CQJ B;  1AUV A;  1JLL B;  4PZ7 A;  3BAC A;  5I47 A;  1TA8 A;  2R87 A;  3NC0 B;  5CA1 F;  4IIJ F;  3CEB A;  4FFO A;  1I1M A;  1I2L A;  4MV4 A;  2VPQ A;  1Z2P X;  2QK4 A;  1A48 A;  2VQD A;  5DMX A;  1VS0 A;  5D1P A;  2ZDG A;  2PVP A;  4E4T A;  3LUL A;  3R23 A;  4IWX A;  1P8L A;  4ZOL F;  4MV7 A;  1A9X A;  2SCU B;  2ZDQ A;  3LQS A;  5H80 A;  3HT5 A;  2Q2T A;  2CNU A;  4YBZ B;  4L1K A;  4JXU A;  4O4L F;  4CKB A;  5KKN B;  3MWD A;  1KJQ A;  3QWU A;  4IWY A;  3WNZ A;  1KJI A;  2Z02 A;  2W70 A;  4EG0 A;  1I1L A;  4O86 A;  3UQ8 A;  1KTA A;  1CKN B;  5FR9 A;  4RCN A;  2R7K A;  1E4E A;  4PZ8 A;  3T9C A;  5BWR A;  3GB8 B;  1EUC B;  3BAA A;  4C5C A;  2EJ2 A;  5IYZ F;  2HIV A;  1FVI A;  5J2T F;  3T9F A;  3BA9 A;  1WRV A;  1I7L A;  3V4Z A;  3CSW A;  3VPD A;  2OLS A;  3E5N A;  3ORR A;  1JKJ B;  3GJX B;  4O7T A;  3NBY B;  1EHI A;  4O7N A;  1DV2 A;  5JQG F;  3SGI A;  4IHJ F;  5DGH A;  1PX2 A;  3WWJ A;  1KJ8 A;  4DLK A;  4TVI A;  3GDE A;  2FPG B;  1ULZ A;  4RZQ A;  4MV9 A;  5CAE B;  2NU8 B;  2COI A;  5LA6 F;  3Q2O A;  4EFE A;  4ZQI A;  1IYE A;  2GQR A;  3JZI A;  2Q2U A;  3ETH A;  2NU7 B;  3VOT A;  2J9G A;  4FU0 A;  5JH7 F;  2W6P A;  2W6Z A;  3MWE A;  1M0W A;  3VPB A;  1EKP A;  1I7N A;  3T9A A;  1KEE A; 
#chains in the Genus database with same CATH homology
 3W5O A;  4DRF A;  1TAE A;  1VS0 A;  4E6N A;  5DIS C;  5D1P A;  4UCS A;  1P8L A;  1XK5 A;  4PZ6 A;  1CKO A;  3BA8 A;  2Q2T A;  4UCU A;  4UCT A;  3S24 A;  2HIX A;  3QWU A;  2CFM A;  1DGS A;  3TY8 A;  3UQ8 A;  3PN1 A;  1CKN B;  4PZ8 A;  5D1O A;  4UCO A;  3L2P A;  1A0I A;  3GB8 B;  3BAA A;  4UCV A;  2HIV A;  1FVI A;  4GLX A;  3W1G A;  5D1O B;  3BA9 A;  2HVR A;  1CKN A;  3KYH C;  3GJX B;  3NBY B;  4UCR A;  2OWO A;  3TY9 A;  5FPO A;  3JSL A;  1X9N A;  3RTX A;  1V9P A;  4UFZ A;  3GDE A;  3BAB A;  3RR5 A;  3W1B A;  1S68 A;  2HVQ A;  5FPR A;  3VNN A;  2VUG A;  4EFE A;  3NBZ B;  1CKM A;  4EQ5 A;  1B04 A;  2HVS A;  4CC5 A;  2Q2U A;  1P16 A;  4LH7 A;  4PZ7 A;  3TY5 A;  4EFB A;  1TA8 A;  3NC0 B;  3JSN A;  4CC6 A;  4LH6 A;  4EEQ A;  1XDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...