3AW8A

Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
366
structure length
360
Chain Sequence
MIGILGGGQLGRMLALAGYPLGLSFRFLDPSPEACAGQVGELVVGEFLDEGALLRFAEGLALVTYEFENVPVEAARRLEGRLPLYPPAKALEVAQDRLREKTFFQGLGVPTPPFHPVDGPEDLEEGLKRVGLPALLKTRRGQALVRTEEEALEALKALGGRGLILEGFVPFDREVSLLAVRGRTGEVAFYPLVENRHWGGILRLSLAPAPGASEALQKKAEAYALRAMEALDYVGVLALEFFQVGEELLFNEMAPRVHNSGHWTIEGAETSQFENHLRAVLGLPLGSTAPRGQSAMVNLIGEKPPFAEVLKVEGAHLHWYGKAVRPGRKVGHITLRRDGLKALEEGLARLSRLVSELPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title Crystal structures of N5-carboxyaminoimidazole ribonucleotide synthetase, PurK, from thermophilic bacteria
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 107
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3aw8A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aw8A01
4GGMX 3BSWA 2HGSA 3G8DA 2PN1A 4M99A 4MV3A 1W96A 2IP4A 1ULZA 1W93A 4HR7A 2W6QA 4C5AA 1BXRA 3OUUA 2Z04A 4O81A 1VKZA 5JVLA 3R5XA 4MV1A 4YAKB 2DIKA 2YL2A 2NUAB 5C1PA 5HV6A 3U9SA 1Z2PX 3ORQA 2V58A 4O4IF 2WYOA 2FPPB 1E4EB 4DIMA 1KUTA 1B6SA 3E5NA 3RUPA 3R23A 3VA7A 5BMVF 4O7RA 3JZIA 3I12A 3RV4A 3RV3A 3MWEA 4DLKA 2YZMA 1JDEA 2VPQA 3GLKA 1E4EA 3KALA 2I80A 4YJ3F 1T36A 5CA1F 4FU0A 2YZNA 2QF7A 4I4TF 1OBGA 1M6VA 1IOVA 3LWBA 3BSYA 2W70A 4YAJB 1Z2OX 4O84A 4I55F 4MV6A 2R82A 2CNUA 2I8CA 1CQJB 5J2UF 1EYZA 2ZDQA 3V4ZA 2YZLA 4ME6A 2W6OA 2YYAA 5JVDF 2R85A 2VR1A 2R7MA 3SE7A 2FPIB 3VMMA 4O7NA 5J2TF 1EZ1A 2W6ZA 3JRWA 3TW6A 4IWXA 4O7WA 3Q1KA 1DIKA 2YW2A 1M0WA 4C5BA 1UC8A 5JQGF 5DMXA 2GPSA 1KBLA 4C5CA 4IIJF 1JDBB 1SCUB 4IZOA 1C3OA 4HNTA 1JLLB 2DZDA 3RFCA 3ETJA 4WD3A 4TV8F 1KJQA 3KAKA 2I87A 3ORRA 2DLNA 4TV9F 2NU6B 2J9GA 4YBZB 5IYZF 4O4JF 1GLVA 2R7LA 2CZGA 1GGOA 5KX5F 1EUDB 2W6MA 4FFPA 1PX2A 3WO1A 3GIDA 4XYMB 4O4LF 4M9UA 1KC7A 4FFRA 3VPBA 5BPHA 3DF7A 1A9XA 4FFLA 5LXTF 2R86A 1GSAA 3G8CA 4MV4A 4FGRA 4EGJA 1OBDA 1EUCB 4ZOLF 3WO0A 1Z2NX 1AUVA 2R7KA 1KJ9A 4ZHQF 5H80A 4RZQA 2DWCA 2XCLA 1KEEA 4Y8VB 4WBNF 5C8YF 5C1OA 4M98A 4MA5A 1CE8A 2GLTA 2V5AA 2ZDHA 4EGQA 2VHEA 4XZ3B 4J6EA 3JRXA 2ZDGA 1IOWA 3BG5A 4FFNA 2YS7A 3NUAA 4EAAA 5D8DA 2YRXA 4O2BF 1GSHA 4O83A 1I7LA 4FFOA 5GONF 2R7NA 2YZGA 4HNUA 1I7NA 1UC9A 3QFFA 3R5HA 4O7YA 3Q2OA 4O7TA 2GQRA 4EA7A 3TIIA 5JH7F 1VBHA 4HQ6A 4EA9A 2Z02A 1KJ8A 3BSSA 4IHJF 2V59A 4MV9A 4FE2A 2X0SA 3VPCA 4EG0A 5BPFA 4O86A 3UFXB 2P0AA 4FFMA 2W71A 3JZFA 3WNZA 5LA6F 5LYJF 1A48A 4ZI7F 2R84A 4YJ2F 5JQWA 2FPGB 1VBGA 2YS6A 2NU9B 3TIGA 5HBRB 3R5FA 1KJIA 4MAMA 4XX0B 4QSHA 3VOTA 1WR2A 3HO8A 4O7SA 4YB8B 3HBLA 4EABA 5FNVF 5I47A 3AW8A 2HJWA 3OUZA 1KJJA 4TUYF 2OLSA 2PBZA 3K5HA 3V4SA 3K5IA 2GPWA 3N8DA 1JKJB 4I50F 4O4HF 4IWYA 4ZQIA 1GSOA 1PK8A 4EA8A 1C30A 5CA0F 4HNVA 3TQTA 2QK4A 4O7LA 2SCUB 4MV8A 3TINA 3MWDA 2GQSA 2YWVA 2PVPA 2YRWA 3U54A 2CNQA 4NYEA 2C00A 5CAEB 2R87A 4XYLB 4MV7A 3ETHA 5K2MA 1AUXA 5KKNB 3AX6A 1EHIA 2CNVA 3KREA 1CQIB 4MA0A 3N6RA 3BFPA 5EZYF 1B6RA 2XD4A 3U55A 1BNCA 2NU8B 2FP4B 2W6NA 5LP6F 3MJFA 5LOVF 3KAJA 4E4TA 2VQDA 1M0TA 5CB4F 2NPOA 1DV1A 3R9RA 1DV2A 4L1KA 3VPDA 2NU7B 3U9TA 4O2AF 3HB9A 2W6PA 3K3PA 4O82A 3LP8A 1CS0A 4M9CA 4O7VA 2FB9A 4O7ZA
chains in the Genus database with same CATH superfamily
5GY7A 1V2GA 1E0SA 1TU4A 4TYMA 4F5DA 1SFRA 4ZT7A 1WXDA 2FAXA 4K3VA 4X90A 2IP4A 1HOTA 2H9AA 1ULZA 3B9BA 3CEHA 4ZEVA 3EIFA 2W6QA 4HYTA 2AN3A 3B5EA 3R5KA 4ERNA 3RS7A 3B85A 4JGBA 1FDVA 4RD0A 1U9CA 1PV2A 5LZ4A 5A02A 3Q9NA 4DRFA 1TK3A 3QJ5A 4BMPB 4LF5B 5AKLA 3WNQA 1AVTA 3A26A 2F9LA 4PO9A 2D1SA 1I3LA 3HB0A 1YA4A 2ZTUA 1E9BA 3II6X 2W93A 1FFCA 5DASA 3RJTA 4DLNA 4H9GA 3BTVA 3N74A 4Z2YA 3S1AB 3C3AA 1II0A 4D8TA 3H5AA 3T9AA 1AX9A 3PF8A 2QN7A 3R0VA 3O8OB 3AVYA 1DTWA 1XLVA 2JDID 4LJ4A 3AHCA 3ANMA 1E3JA 5GIOE 5C1PA 3HCWA 2RHRA 2R9VA 4FNGA 1T2EA 3W5SA 5EP1A 4TMTA 2Q7XA 1O9BA 1PG5A 5BSFA 1JECA 4HFRA 3IE1A 5AOAA 3OZ7A 1E7YA 1P1JA 2GN0A 4YMUA 4MMZB 1AHNA 3ETDA 1PNQA 3DBHB 2GAAA 1I3MA 2WJGA 3NONA 3GFGA 1CR6A 2XTMA 2JRCA 5BV2P 2V6MA 3HXPA 3VJLA 2RHOA 3ZX4A 5AW6A 4DS3A 1CUGA 3ONVA 2XB4A 2VKQA 5KSWB 2Z2JA 4NMXB 5BMVF 4WN9B 5ALEA 1KMMA 4XIGS 4RIIA 1LLUA 1RU3A 4M9QA 2HO4A 2C77A 4MPDA 5LWQA 1R9MA 1WBBA 3L0IB 2QTZA 1R3DA 1N7IA 4I1SA 3AINA 4KLCA 1EFPB 2HIGA 3RS8A 1TA9A 3LT1A 4U7DA 1TK9A 3IQEA 2Q8NA 2Q5OA 3N70A 3ENQA 3IPAA 4FHCA 4MQ5A 5DXAA 1BCRB 4HC4A 3UMGA 4U6NA 2AKEA 4AXXA 4CIDA 3MWEA 4XOIA 3C3PA 5K7SA 3S3TA 1GKKA 8LDHA 3BWBA 4JIMA 4CTMA 4TMFA 3ED1A 2HAEA 1YR2A 3AT1A 1GUFA 1QTNA 3IQFA 5ENVA 3NO4A 4AURA 2WVGA 2XGOA 4H7HA 3VR5D 3PQ5A 4PZDA 3H5TA 4YECA 2VPQA 1UKVY 2AJTA 1KP2A 1PR3A 5CR5A 2DT5A 2IBMA 3COZA 4OM7A 1TB4A 5FOWA 4LGCA 5CA1F 2RGYA 3NC4A 2C8LA 1UEIA 2M6RA 1DHRA 3I9LA 1YZ3A 3N3BC 2PMFA 4IV0A 4RANA 1UWKA 4QPZA 1YB2A 1SQ5A 3DVQX 4JI7B 2H5JA 4M9ZA 1M7BA 3PWKA 1Y7TA 4IGFA 3IVMA 4Q21A 2HK9A 4RO0A 4WERA 1YZQA 3UWMA 1QVZA 3NIWA 3C6KA 4UCQA 5KNCA 1QP0A 4D4GA 3R0QA 1SBTA 2FFRA 1DKUA 2ZIEA 4X1YA 2VDWA 4UZFA 4RTQA 2RIPA 1EK5A 3SC2B 2DULA 4W8OA 1F4PA 3FMPB 4YUAA 2NM0A 5H82A 4C3OB 2FZLA 1X13A 2PH1A 1F5SA 5D5QA 4AF8A 2HA7A 1IWPB 2X1LA 5FLXA 3GRAA 3HA2A 3ZU2A 4YDHB 1W4RA 1Z88A 2A0FA 4K9QA 3QSYA 3FN4A 4JQCA 2DX7A 4PX3A 2INGX 4IIUA 4MVJD 1GCAA 2HDOA 2LNDA 3UH0A 1J7JA 1YXMA 1OH8A 5B1IA 5IVHA 3LPLA 1F9AA 2DPXA 2JLCA 2Q62A 2Q1XA 3PBKA 4P31A 4XARA 3S4YA 3LDAA 4K1XA 4D3SA 3OQOA 1F0NA 1VHTA 1ZR4A 1VPTA 4N5MA 1ECFA 3UPUA 2W7TA 3H05A 4HDRB 5L4SA 4O7NA 2ZBVA 4LXIA 1WSWA 2GD2A 4CETA 1DXOA 3PFGA 4JQZA 1JF8A 2ZSDA 2UVDA 4Q6BA 4XJTA 5CMLA 4MDEA 1XLUA 3W5VA 4YV2A 4YC7A 2IU0A 1R2QA 4O7WA 3L3BA 2BRUC 3VYVA 1B0ZA 1KRWA 3RUFA 4OLAA 4KH1A 2GCOB 3LULA 4K3UA 1IJFA 1C0PA 1VMEA 2PRJA 4RWZA 1R6AA 2H2DA 1FFXB 2B8EA 5D5PA 3IERA 4KQEA 1KEVA 1MOPA 3THXA 1YZHA 4PYQA 2FGKA 4EDHA 1I3CA 2GETA 4DCJA 5K6AA 3V32A 2NLOA 1JDBB 1J8YF 2VQEB 1DOAA 4CC6A 3WZMA 3PC6A 4ZQGA 2MINB 2B3TA 3LLUA 4UUMA 1K3TA 3D59A 1YJQA 3D8RA 2WKQA 4YJ3B 1GPKA 5B58C 1EXWA 2LIVA 2QRPA 2ZRIA 3GCXA 5ALVA 1OH7A 2PKEA 1HURA 2BMJA 3IB6A 2ACVA 5HJ2A 5BVHB 3K2IA 1KC3A 1Z4JA 5I8PA 2DHEA 4LHXA 4RK6A 1H6AA 2D06A 3FPBA 3MCUA 5DWVA 2XJ9A 3OO1A 5K6AC 2ASVA 1Y6JA 2Q2TA 2VP6A 1OX4A 3AP2A 3B9RA 4M49A 4EKEA 5JYEA 2UZ1A 5A5FA 3TI7A 4JYZA 3JAKA 1Y9EA 4UPEA 1MRZA 3ENZA 4JYPA 5DCUA 5CDHA 1XAGA 3P9YA 5IHXA 1ZNXA 2X0JA 3BGSA 3IKVA 1WXEA 4URZR 1X8JA 5JWOA 3I5YA 3DDSA 1QK4A 3KKQA 3LFUA 1E62A 4H2DA 4DLTA 5EJ4A 1Z83A 4YHHB 4B87A 3DNPA 3LGXA 2FZCA 4D1YA 5K9ZA 2NNLD 2UXDB 2Z1DA 1Q1BA 3OOYA 5IXYA 2Q5LA 5IC6A 1XCJA 3WMFA 1GNTA 4QEKA 3HYTA 3E2MA 2O2YA 4QTZA 3DVLA 4FFRA 5EN4A 3JQPA 3OZWA 1YMVA 2QRVA 4J7AA 1QK5A 2HXSA 3WDLA 4JA2A 5CBKA 2MT9A 5CLFA 4OA5A 4UPVA 3C3YA 3QYPA 4WN3A 4J0KA 4F6CA 5KVAA 1GO2A 1A4UA 3C6XA 5FWAA 5HEKA 1EJ0A 3MBKA 1P72A 1SVUA 2BONA 2YHIA 3GDFA 4BB0A 4AI6A 2GTHA 1MV8A 1SKYB 4DE5A 2G04A 4X3CA 3OY7A 5JZBA 1JQDA 4D8VA 2EOAA 4I6JA 5DGTA 3X1ZA 4ZCMA 5K0EA 2ZRCA 6NULA 4D8UA 3ZCSA 4F5YA 3VHXA 4NS4A 1AN0A 1JR3A 3BS4A 2JCXA 2VDLB 3UENA 1C9KA 3MMPA 4O1MA 2CV0A 2ZI6A 3OSUA 2FVYA 3ZU3A 4EFLA 3NM5A 1BGWA 2NYUA 2QUKA 2GFIA 3AM4A 3MF4A 1GLNA 4FFWA 2HADA 1FRVA 5E7QA 1CUUA 4JJFA 3REQB 3H83A 2CL5A 2PH7A 3HVHA 1W9MA 3W79A 2FR0A 4ARUA 1RJGA 1U3UA 3PNQA 4RF4A 2YJZA 3B89A 3DM5A 3EFHA 3CKLA 2CUZA 3A9RA 1QNLA 1VMDA 4N3BA 1IRXA 3DWEX 1MUUA 2Z4SA 2WVJA 3R6TA 2MCFA 4R1QA 2VDKB 4FFNA 1MJGA 1SUAA 3H9CA 1ZUWA 3QU4A 4LPSA 4AY4A 1WV1A 1Q3TA 4W7HA 2XYRA 5FBRB 1P1FA 2P90A 4P7FA 1KQNA 4EG6A 3QI2A 4NICA 3BGWA 3FWHA 4I2NA 3TE7A 2H4XA 2Q2OA 5AVKA 5J63A 1MOZA 4O83A 1TVEA 1XX6A 1IHOA 2VLBA 5AM0A 3I5UA 5I7VA 1EG2A 2HV8A 3WWJA 4GM0A 3OZBA 4X60A 1WQ1R 1YZUA 3GFTA 4X71A 1IG3A 4BVLA 3K35A 3F5FA 4N7MA 5FV7A 4OU4A 3ZOZA 3DAOA 3PWSA 4MW4A 4WKNA 4B48A 3LX5A 2DHRA 4EENA 2AB0A 3V42A 2QZPA 3CRNA 5DHAA 2E18A 3UHPA 1IAQA 4IFEA 4BASA 5EE5B 2OLKA 3OE4A 3PUZA 2PQMA 4L15A 5D3MA 1JEEA 2H65A 3KWJA 3TWOA 3W5OA 2BZSA 2PX6A 2PL3A 3G02A 2O05A 3QGMA 1GPH1 3VR5H 1NLFA 4DR2B 3CZAA 5CVUA 3L18A 1FUUA 1XFAA 2QV7A 4EA9A 3ZD7A 3K5PA 3ETNA 3IVCA 3N7AA 4JVOA 2AHOA 3ED5A 3MTAA 3AF6A 1RMQA 5AKXA 4IVQA 4BNFA 1WUJS 3ZWYA 2JAXA 3A58B 3H04A 2OCDA 1WBJB 1UBRS 3WZLA 4GVXA 4RFLA 4M1WA 1YJXA 3ZWMA 3BQMB 3R3ZA 3VO1A 2IZ1A 4KIFA 1FYFA 1Y9JA 3FPAA 1IN5A 3WGQA 2JLRA 1YQ9A 2L17A 3KT6A 4GUDA 3GGCA 3KKOA 2P65A 4JLBA 4TROA 3F5DA 4HLNA 1X6VA 2P0AA 2GA8A 3BK7A 1HRDA 4TUYA 1YU9A 2Z3ZA 1WX1A 4LKOA 2JI9A 3FVTA 3BYZA 4N9QA 4WLEA 1XZCA 1I6WA 1KMIY 3QEMA 2JJ1D 3QTBA 4Z54A 2EG5A 5SY6A 1H42A 4R1UA 3NGXA 2J6HA 4BN0A 1MAUA 5JFTA 4KGVA 3BE6A 3HGTA 4K9LA 1QYVA 1QZXA 5ALRA 3ZWQA 3QYFA 4LXHA 4RORA 2I2AA 4ANFA 3T3EA 2JLYA 4KSBA 4DMMA 2PL5A 1BWPA 1O03A 4J49A 4DMCA 4N41A 2QN3A 5TT1A 2F9MA 1FK8A 1PEAA 5CH8A 1WR2A 2ZBFA 4MVWA 1XXHB 3MS2A 2VATA 5LZ9A 1QWSA 4RU1A 2CCKA 2ZFUA 4O33A 1Z3CA 2P4SA 2WBLC 4BIMA 4EABA 1DAGA 3DFZA 1PT5A 2GF2A 5HCNA 3D2BA 3EQ6A 3MINA 4OYYA 4ZYVA 4RULA 1E32A 2GHIA 4ZZIA 3DV0A 2F55A 1CRZA 1F14A 2OP1A 2AN9A 3ODGA 3FZQA 2J6IA 1PJRA 2OEPA 3R44A 2UUPA 2ZBUA 4JYCA 2Q6KA 1V8FA 4RDXA 1RXVA 5JZVA 2AMVA 3V4SA 3EG5A 4ZEWA 4WVFA 1P44A 5CM8B 2EC5A 3WIEA 1DKLA 3L7BA 2VSXA 4S3MA 1RLUA 2QVGA 2QP9X 3N8DA 1NT2A 2QPLA 3DNFA 4G1BA 3NDJA 2ORED 2A4MA 1TAGA 3X1KA 4B71A 4EL0A 3A6FA 3K20A 2PGIA 4ND6A 1M0EA 2V1UA 1H4SA 3EARA 1BTOA 3EPRA 1M8PA 1Z6AA 4RIFA 1JS1X 2X77A 4GX2A 4KXWA 4BV3A 5CBPA 3ZBTA 4PCLA 2ZULA 3LCRA 4DG8A 1Q1EA 2PUBA 2FZVA 1GGJA 2JK1A 4NZMA 1BYUA 2SKDA 5DDIP 1G9TA 3P2MA 1C30A 2YHBA 3DAHA 4EM6A 4HNVA 2WWHA 1KY3A 3O73A 1PQYA 3W2GA 4D0GA 2O5EA 1QRSA 4GHWA 4BJ3A 3NBFA 1ZAYA 2GF9A 3AW9A 4L8LA 1XYYA 1SVOA 3QVKA 1GG2A 4G86A 4F84A 5DWDA 1BZYA 5CXUA 3Q9SA 3BJRA 3H3XA 1R8SA 1ZBQA 3FVRA 2ZIZA 4UTRA 3OFJA 5DCYA 4DNPA 5KPDA 1DPGA 2OG2A 3MT7A 3L6RA 3U9LA 4DYVA 1G7SA 4Q00A 1XR3A 1K0UA 1Z5WA 1WSAA 3OZFA 4J2HA 1SUWA 5JSKA 3EGIA 3TEJA 4QRIA 5C37A 2BY4A 1HI9A 1OJLA 3D31A 2OQVA 5DEIA 1CS4C 1RW4A 1NXQA 4WKCA 2XUQA 4RE6A 2JCYA 4F7WA 4BE9A 3KDAA 1SUSA 4F45A 5JFGA 2EIXA 3UGJA 3U1BA 2FOLA 2ZR7A 3VR3D 1NMQA 2NSHA 2EKBA 4DSOA 1JEQB 4XR4A 4RZ2A 4Y9SA 2ZS7A 1UMDB 2NTEA 4L76A 1HZJA 2Y4NA 3QBTA 1EHIA 4QG7A 4GG1A 4KODA 4ARIA 1RWXA 5FEMA 3MJDA 1GAQA 1E6MA 1HRKA 1VLLA 3EEYA 1ZI8A 3AF2A 1BW9A 3NUGA 3VDQA 4XDGA 2DPGA 4MLZA 1WQ3A 1C9YA 4ALIA 1I1KA 4MI1A 2XD4A 3WXMA 1PWEA 2QE6A 5GZ1A 4Z9FA 3U4QA 4BFVA 2A94A 1ZD2P 1P7VA 2DOKA 1MB4A 2ZK7A 5KSZA 2J0SA 1DCFA 1ZUIA 3HR8A 4CKBB 3OVMA 2ATEA 2NXJA 3PTLA 2GWRA 1QE0A 1JPVA 4Q18A 2J33A 2BMVA 2PGLA 1NBMD 2NPOA 3WTBA 1BQ4A 1ACMA 4NLLA 5F7ZA 4XVCA 5HDQA 1YRBA 4Q3BA 3ICQB 1CULC 4TM7A 4E2YA 2QL9A 2P69A 5HQJA 5I4IA 3FGZA 5KKAA 4UNRA 3E18A 5JCJA 1SU7A 2WTUA 3W8NA 2A9RA 2PUEA 2PZBA 2W11A 2IGTA 3GELA 5LDDC 1SWWA 5LB4A 5KYXB 4JLJA 3R5TA 4ZEOA 5G0TA 5BO5A 1PV4A 4JSRA 2QXUA 4PF1A 3QU2A 2BFCB 2VG8A 3LP8A 1EDZA 1TJ3A 4CM8B 1KEKA 1EJ6A 1BO6A 1R5NA 3SU8A 3URKA 1E61A 2GDZA 1KO4A 3KKMA 4LWQA 3BJZA 4M2LA 5L7WA 1JLRA 5JYBA 1W96A 4CMJA 5E4YA 2AZTA 3H5VA 3OHSX 4JNCA 1XC7A 1QONA 4MLDA 4NCKA 4RGBA 4GI1A 4YMSA 5FWXA 2CSUA 4XI9A 2HQRA 5IASA 5FUYA 4OSOA 1OPRA 1ZK2A 4B43A 4QZVA 2FW6A 2R6CA 4HNRA 1S3IA 4BP3A 2C58A 3NALA 1FRQA 2FFJA 3AR8A 3FSRA 2AK3A 4M7PA 1P4RA 3C39A 1O57A 2PGXA 3ZD9A 4XQEA 1HV8A 3F5SA 4D8WA 1DSSG 3O03A 4A2QA 5B57C 4WKGA 1OKKD 1WD7A 1X7YB 3ENWA 4FJ0A 5K1ZA 1O4VA 1CY0A 3VKUA 3R5XA 2D1QA 2IHZA 3PRYA 2HWKA 1T6ZA 4M7WA 4YNBA 5DMHA 3RFTA 1I2AA 1XP8A 1J8VA 1M5RA 5JRZA 1PR2A 2GHQA 1E0AA 2AFHB 2ABWA 5CH3A 5FX2A 1MD9A 4EPRA 1VSUA 3EIEA 1IDOA 3D7RA 3WBFA 3JASB 3EIQA 3LUPA 1DB3A 5ALWA 4D4JA 4EY7A 1FQOA 3CLSD 3DXXA 3HY3A 5JASA 1WL8A 2W2KA 4KN8A 4BFXA 2COKA 2IEZA 4KI0A 1KK3A 5FUBA 3LL7A 5A62A 2DQSA 4WESB 5EWLA 3UG7A 2VHUA 4OQXA 2VK8A 5JXIA 4DABA 2VWPA 1VDZA 1Z6XA 3K71B 3D6TB 1NXVA 2HWXA 4ZVVA 3R9KA 3L8MA 4GBJA 2WYOA 1W85A 1Y80A 2D4AA 2CCJA 2LV8A 2VJDA 2Y1GA 4ERXA 3QHAA 1FP4A 2Y1OA 4UJ3A 4R1LA 2RK6A 5H4GA 4UVGA 4XVRA 4C7KA 5BY2A 5AVRA 3C3WA 1SBZA 4UNNA 3J80A 4FCWA 4W9MC 3U0VA 4D5EA 9LDTA 3X1YA 1MH9A 5F21A 3H2KA 1O5IA 1ZRNA 2X9LA 1WVGA 2Z3VA 1KYXA 3L92A 4YRAA 4YLYA 4LE2A 3ETCA 4EUFA 3H1BA 3UWDA 1EBUA 1NAHA 1YHNA 1IOZA 3EF1A 1DUSA 4MUEA 3CUSA 1EE2A 2JL1A 1QX4A 4M37A 4AF7A 1TO6A 2Y2UA 3M81A 1IL0A 2HIHA 1L4HA 1YD7A 2OXRA 3K0FA 1RWBA 1J2YA 2BL4A 2WOJA 3C3XA 2BYTA 2P6MA 3VSEA 2DGDA 2ZYHA 4QJ3A 4A6PA 5JVDA 4KNYA 4FGSA 2PKRA 3H6HA 4AF6A 4EX6A 5DSXA 3AEZA 4Y2XA 1YFLA 1MF7A 2IODA 3M6XA 3Q4GA 4NZZA 4EPYA 2EP5A 3L49A 3MEQA 3O0TA 4QQ8A 4G41A 1HTWA 1COZA 4H35A 2YIDA 4JLWA 1RC0A 3R0ZA 4MMYB 1YWGO 3D0QA 1P80A 2H8GA 4BEBA 3OLCX 3GFQA 1U5BA 5JNSA 2W70A 2FPMA 2C3OA 2P2NA 3AM5A 2EARA 3FBTA 4N65A 1XCMA 1MENA 1UZLA 3PV0A 4R2JA 5GJBA 1FS4A 2VJMA 4C1NA 4K9OA 4QX6A 1HYHA 1KVRA 1XMSA 3IVRA 3MA0A 3C6MA 2H2GA 2ZJ6A 5JQGA 4OI0A 4AMBA 1E58A 3GPBA 1K89A 3QFRA 4WLFA 2VS1A 2VOEA 4GOKA 4RGVA 3ZY4A 4EMTA 2AFIA 5I9NA 2ILTA 4ZMBA 2FVXA 1EYZA 3T7AA 1G20B 4IDBA 4PLGA 4Q1FA 4JP3A 1FFHA 3AUUA 3PQ4A 2UUCB 3TN7A 4D0SA 1ZP6A 1J2JA 1G8GA 3L1VA 4MHTA 3KUUA 4RV5A 2JW5A 4YAIA 3ZI0A 3BMOA 4TV8A 1W34A 5A0FA 4NFHA 3U3OA 1JXMA 2AJCA 2VR1A 3RTDA 3K1YA 3ONFA 3W8FA 4TL9A 1NNUA 5T3UA 2EGHA 1NW3A 4B9AA 1M9NA 3WL3A 3BC1A 3L7KA 4LXXA 2IXDA 1JAHA 5TARA 2FWRA 1TJPB 4E30A 3QEAZ 3VR6A 1DOHA 2ZUSA 4PG7A 3L77A 4JL8A 3NM4A 1NR5A 4KPFC 2YW2A 4C5BA 3GLHA 2HT1A 3DV9A 4UXHA 1DOZA 1A9PA 1RKBA 2JGRA 2ZAIA 3CGGA 3D7KA 4OJMX 2BUBA 1F17A 2KBFA 2XUGA 2CBZA 3OECA 4U6SA 4UUQA 2R0QC 3OH8A 4KREA 4GI7A 1BCSA 4LJLA 4UVEA 1W0KD 5FLYA 4ER3A 1RQRA 1KARA 2O8NA 5ED4A 4DIBA 3HU5A 5DK6A 3R7DA 5JJKA 3AY7A 4YWJA 3S8EA 2Z43A 1FTSA 4OKIA 3GA7A 3ASYA 4P35A 3QVUA 3FTEA 3OQBA 3O91A 1RC1A 4P9NA 2FQWA 1T10A 3ITEA 1W75A 2VJAA 4Q4DA 3BH0A 2JATA 4GPIB 4KSYA 4MX8A 2PBFA 4PZUA 1XD2B 4UBNA 3W9UA 4NENB 1UK8A 3LD9A 4WX2B 2ETVA 4HL6A 3QEOA 3ROGA 4DUZB 3K1AB 2VJLA 4D96A 4DEYA 4NMLA 2EZ9A 2PH3A 4ETWA 5F3RA 3H4VA 4ZOLA 3A7EA 1Y82A 2FA9A 1IUKA 2GXQA 3VDMA 1V1RB 5KUTA 3I9V1 4C0WA 4BQEA 5EZSA 2FZ5A 3ICPA 5KJEA 5BV8A 1VPEA 4R2IA 2CXUA 4CBVA 1NFQA 2Y0EA 4C0HA 3GIDA 2WV7A 3DZBA 3JQFC 3OJXA 4ND1A 3TL6A 4DQNA 2ALJA 5CB6A 5HKOA 3IOMA 3THWA 1W2WB 2JRLA 2ZB4A 1WOYA 3EXHB 2OFWA 3EVZA 1TUIA 1D6SA 4WI1A 1ZL2A 3L01A 3I30X 4I1OA 3KTAA 4YP7A 2QY9A 4ITUA 4KEAA 2HBZA 3ETGA 3S28A 4JVSB 3TLYA 4EB3A 1UFVA 3BGVA 1CUXA 4HBGA 4MWEA 5A03A 1I6LA 1TMYA 3AVWA 1KZ7B 2OP0A 4Z9YA 2JGDA 3IAHA 3D3WB 3O82A 5BW5A 4FC6A 2GK4A 3UJ9A 2A3RA 3FLMA 4B74A 5L3QA 4RS4A 2QX4A 5EIAA 2ZRDA 4Y9DA 2OC9A 4LOJA 5AI0A 4TS4A 4M3NA 2RB4A 3NDPA 4LVNA 2HC9A 4DUGD 1NVVQ 2VUSA 4OG2A 1WO8A 4LDNA 1E9VA 2AC2A 2HZ7A 2ZPTX 4UKDA 1YVPA 2WF5A 5FPSA 3WGHA 4ZTUB 3U56A 1E2PA 3LF1A 4H0FA 4EFNA 3G2HA 4ZO6A 1RQPA 3TQFA 4PZ6A 5KYNA 5JRJA 2XCLA 1OU0A 2AQ8A 4X5OA 4S1NA 2WIFA 1T6BY 4IYRA 1D3AA 1E63A 5IVDA 3IKTA 4EATA 1ADFA 1D2HA 5CFMA 2WWVD 1V96A 3TKYA 2Z8XA 4XYGA 3KEFA 4RVHA 5I5XA 4WFKA 5K4GA 1NV8A 1KDYA 2HOQA 3HKBA 1B14A 2ZRBA 3HZHA 2ZZKA 1U4OA 1C3LA 2JVKA 3P5SA 3PUWA 1NBEA 4XD2A 4X61A 3IB3A 4EX7A 5KHAA 1QBKC 2LE0A 5DHRA 4JROA 4DVGA 2AOWA 5JO9A 4YI3A 3STXA 3JXEA 3R7LA 5GJVC 3U0GA 1QH1A 2WSYB 4DL9A 3VHQA 4KX3A 1QFJA 3BL8A 4NFYA 2I0FA 4U2FA 4J6EA 3KPVA 1KBQA 1N6KA 1W0JA 2JFXA 1QHFA 2P9CA 2IDMA 2NZVG 3BHNA 3PVCA 3UCEA 4BL5A 2PX4A 3LX4A 2FXIA 1R5JA 3JR3A 3DYVA 1GARA 3IP1A 3S68A 2QE7D 2IGBA 3OBBA 3A6DA 3ASVA 4EHKA 1KWKA 5D8DA 1DEKA 3C15C 1KZGB 3HADA 3ANYB 2JCGA 3VZQA 1EMDA 2NZYA 4G84A 3UV7A 9LDBA 5HQTA 2H1WA 3MJEA 3FDFA 1ZGBA 3EGCA 5KYKA 1QH9A 5WRFA 1YIOA 4I81A 1UC9A 1DAEA 1OYVA 2Q5FA 2ZYWX 3FOWA 3B12A 4MI3A 1KDVA 3VJKA 3H3FA 1LBHA 1GTG1 5LA6A 3O38A 5ULLA 1O0CA 3I76A 2PUFA 2PYDA 2JA2A 1T9KA 1EGVB 5ALYA 3G0OA 3QVLA 4RBNA 3LW8A 1P1CA 3SSNA 4IIHA 2JFZA 4CHTA 3D3QA 2Q29A 3NAQA 4H4DA 1X70A 4ZI3A 1LZKA 2F90A 3AHEA 2J0UA 4UUAA 4AZ0A 4ZCTA 3E61A 2JGKA 3NBUA 4XCQA 4AO8A 3B53X 4P2BA 5AWFC 4DF3A 1XTZA 5A3SA 4PQYA 4FR0A 2ORWA 1VG1A 5ALMA 4DUYB 2W2OA 3B78A 4P38A 1RTTA 5F64A 4UM9D 3TLCA 1U2GA 2H4HA 2LZ0A 2PVSA 5JSQA 3NWJA 4A2CA 2C98A 4WNYA 4G1MB 2JGNA 1XTKA 1EGHA 3U7EB 2GK7A 3QVWA 4IV5A 2C9OA 4AB1A 1FW8A 1FXWF 3TTUA 1XWWA 3KYHC 4MUHA 5BNFA 3R3WA 1IZYA 3ROTA 5JMTA 1BWQA 2G83A 3N2ZB 5FWNA 2I66A 2FSFA 1SR8A 5CD1A 1MW9X 1F4LA 3AFNA 1JV2B 4G97A 1J21A 3WKCA 1HDEA 2C2ZA 2RHLA 3KFLA 1ZNZA 1R50A 1U2GC 4FWIB 5E6UB 2XT9A 1ULAA 2YS6A 2E4VA 3FHCB 4RZSA 5EA2A 3ZY2A 1QGZA 5FL3A 2IXBA 1V5WA 4FONA 3H19A 3UXMA 1DAFA 3DDUA 2QAGA 1NC1A 3ESDA 4D7AA 1BG6A 3D7NA 1KQGA 4LF8B 3PYXA 3EIHA 4II2A 3EZ7A 1RQ7A 4R0MA 5B2FA 3T9BA 4YRJA 5LQAA 2X23A 3NU1A 1NJ1A 3DEAA 4OXXA 1K68A 4DA8A 1U1GA 5TPWA 3LBNA 4BWVA 3RH0A 3BXEA 1XB2A 4XJVA 2QD2A 3T1OA 3FTQA 1ZI6A 4EFDA 3IUEA 3ZYZA 1HTBA 1NI5A 1CLUA 3K8OE 5K0NA 3W4JA 1ZK3A 3GH1A 1QRAA 4DJJA 5BR7A 1TUBB 2OZLB 1UFOA 1NW4A 1WV0A 1G8MA 3UKJA 4C6TB 1P3JA 2DVMA 5BNTA 1PGNA 1ZA2A 2BM1A 3EGEA 2H85A 3UGKA 3WQBA 2JFBA 1Q7GA 2HL6A 3KLPX 2W43A 4OXKA 4UMFA 4CQMA 1IYEA 121PA 1LCIA 1VMAA 3D7LA 5KWVA 2V74B 2JI6A 3WB1A 2I1LA 1CJBA 1X80A 2AKAB 1NPYA 3D1JA 3OWOA 2Q5HA 3PNBA 5ADUS 1LDYA 1VJGA 1AA6A 3AFOA 4C4PA 4ZD6A 4JHLA 1RFGE 3AIIA 2JEYA 2XB9A 2IT1A 4OM8A 1Q1QA 4JB2A 4FMCF 4KJZA 2WR8A 3PHLA 1M83A 3DONA 4KQMA 2FY8A 4LZNA 1RBYA 4R6XA 5FPPA 3PRJA 4GP7A 2O8FA 1QVVA 1U3DA 2AXQA 5KKCA 3E2PA 1MB9A 2Q21A 1B6GA 1IBLB 1FSZA 2QK4A 1R6XA 2C0PA 3AF1A 3I9KA 1VE6A 3N58A 4LRYA 3N7UA 1Y5IA 3EMVA 3F5MA 4YAKA 4YRIA 4NQRA 3ELWA 4W8HA 1FUKA 5CT5A 2X2OA 5TSDA 4DGSA 4UDXX 2HLHA 2G0AA 1C0LA 2CLLB 2ZUWA 4LNUB 1DNPA 3G5AA 1NFRA 5G3YA 2YRWA 1CR0A 1MEOA 3QUQA 5JH7A 4W5QA 421PA 1T0HB 4UCTA 2HI0A 3CF0A 4DDWA 1AKVA 1ZUNB 2CMDA 2J07A 4NI5A 3ZIDA 3D5QA 1C3JA 3ELYA 5JNUA 2FV8A 4UU1A 1TCAA 5K0GA 2J08A 4FKMA 2K87A 4OHVA 4XDYA 1HX7A 1Q0TA 2FSSA 2I6GA 1M1UA 2WIAA 2QTVB 2ZS8A 5T4HA 2XGMA 3P9QA 1TEZA 3KYJB 2RGGA 3ZV4A 1GPLA 1COWD 2V7TA 1SCAA 3EZ9A 5K3OA 3GMDA 2AN1A 2QI9F 3DKPA 1H5NA 2DKNA 3RBXA 3CRMA 4UM7A 1UKYA 1R8JA 2VXOA 2XXBA 3W5JA 1CQIB 4IAOA 4U9HS 1KSJA 5D86A 4F9EA 2A8YA 4W7SA 4ECAA 1PZXA 3A1CA 3AETB 4G0XA 4EO4A 2HTFA 4E4YA 3GUUA 2NSYA 1O4WA 5UKDA 1XTUA 1UBJS 3K0AA 4I1PA 4PZEA 1U1IA 4MS3B 1YE8A 3TZLA 2CK3D 1KAMA 4LBVA 4E4TA 1PR6A 3DPUA 3EXG2 3G9XA 4MRNA 4Q7EA 2IC5A 4OJTA 3JQ8B 1X14A 3EQ2A 1F60A 3A4TA 3OP4A 3T9FA 1VBNA 3ESBA 3VX3A 4D6PA 3MSCA 2QGFA 4U63A 4DAEA 1G5QA 1P1IA 4JP8A 4KWTA 3KJXA 1Z7GA 1CUYA 4OF4A 1B6TA 1D9XA 3D7MA 2CMKA 2PX5A 4H3HB 4CMBA 1N9KA 4X7MA 3VKHA 1K2WA 2XOKA 5G40A 4D41A 5JZ9A 1Y7IA 1C4OA 4FBLA 5KU7A 3IKMB 3G1TA 1IHDA 1VYTA 3DFFA 1AE1A 4QUJA 5AICA 1A1SA 3I32A 2O1XA 2BE7A 1HWYA 3BCHA 4GGMX 1MG0A 1VG8A 3G8DA 3FFAA 1SULA 4GZ6A 4R51A 2IHVA 4TM8A 3Q0EA 5JR3A 4KR7A 1J1IA 4LA4A 5ALLA 1Q21A 2R1ZA 2K5UA 3GJ6A 3EGWA 3NX4A 2VC2B 2L69A 3TJZA 5IMBA 4F93B 1JAXA 3SQMA 2HIVA 1VSBA 1P2DA 3BWXA 1SQFA 4TOIA 3QXGA 3HJFA 2CXQA 4M4SA 1AKMA 2ODWA 2DFPA 5REQB 1JUDA 4GQBA 3SEAA 3BPSA 4TRRA 1QM5A 4NJOA 3G68A 3WL6A 4JLDA 2IXEA 5JVLA 1JMKC 4P7BA 1K27A 3G5MA 3H11B 3DXFA 3K92A 4F5ZA 1P0PA 5F2NA 4G5GA 4EKGA 2EJBA 4X3OA 2J7PD 4QGGA 4U7HA 2ZIGA 5IVIA 1WPRA 5FA6A 3RC2A 2HK6A 2CHQA 3M49A 4ZYTA 2LVBA 2OO5A 5JS8A 1GUYA 4OI4A 3SIWA 1OU4A 4LQDA 4Z9XA 5F78A 3ABIA 2AFRA 2I67A 2YQZA 3IP9A 3UBTA 1U65A 5CNKA 1EFHA 3I1JA 3W1EA 1TF2A 1E9DA 1H9BA 1XOIA 4LCJA 8ADHA 3KSMA 3OIUA 3PD0A 1L7AA 3HV2A 4B3RB 1JR4A 3L7MA 4DV7B 5FLKA 4HOYA 2JAUA 4X3PA 1KUTA 1X7XA 3FH0A 3DW1X 4GT1A 4LK3A 5HGJA 3E5NA 4N8DA 2JFYA 1M1NA 2H5EA 4FE7A 4HZUA 2OV3A 2FSVC 3H42B 4PSDA 1JAYA 5HMMA 2BM9A 1CUIA 3FIJA 4G5XA 3V1KA 3N76A 1EM8B 4BGVA 1WY7A 3VZRA 3VOBA 4I4CA 1T5BA 4EMUA 1G3UA 2FEAA 3FHTA 3VZSA 2HCRA 3O2SB 3V3TA 2FJ0A 3KQOA 4S05A 1G66A 3RV4A 1U1FA 5DBHX 5K3AA 3S8MA 5CIYA 5CUQA 1JSLA 1DKQA 2OA0A 2CYAA 2HJVA 3MRTA 4GPBA 2VYFA 3AEKA 1CJSA 5J2UA 2HDWA 3L2OB 5A4FS 2O19A 4CL8A 2PSEA 4X1IB 2PK3A 1LY1A 3PIDA 1NMXA 2IYZA 1UC4B 2ZJ7A 3C6BA 5LZ7A 1A9YA 1LF5A 2GZDA 4CZ2A 2GJKA 3EXEB 3HUFA 3M1LA 2E82A 2I2XB 5EZ5A 3ZZ0A 1IYZA 2ET6A 2CF5A 3HH8A 2GRJA 4CODB 1QOQB 2XVMA 5BN1A 1X1SA 4F6LA 5TEVA 4I4TF 5K0FA 3SKYA 4YV0A 1OBGA 3L9XA 2WG0A 3DO6A 3G0HA 3BL5A 1J8FA 1I3OA 2P7IA 2VRWA 3RWBA 1YBVA 1NURA 2HGZA 4TS3A 3ND8A 5JY6A 3OF3A 1XROA 4I08A 2OMEA 4D98A 1HFWA 4BMXA 2W6CX 5E95A 4MV6A 2ARKA 3GUCA 5K51A 3PTZA 1T26A 3ZU5A 2GVZC 3ZXIA 3F98A 5IM5A 1T9GR 3V46A 1NW7A 1YI0A 5HFNA 4W5HA 2W2TA 2J8ZA 3SM9A 2CLDX 3PGKA 1GZ3A 2BHSA 4RK0A 3QY9A 1KVTA 1W4AA 2Y6VA 4YFYA 4W5NA 1TX4B 5DI3B 4FINA 2QYOA 5JATA 2YYAA 4NDZA 3LC7O 3UQ8A 3B1YA 4BQSA 3M6FA 3NIGB 1QBGA 3OLYA 3NTOA 3UOWA 2QX7A 4HB2A 5IDXA 2GN6A 3FWKA 4WXHA 4QM6A 5DOVA 2VTEA 4YRMA 4XASA 5ERYA 3SYNA 2HWUA 2V55B 2PM8A 3IXQA 4IO1A 5LKAA 4F0JA 1IN1A 4C2UA 3ZVRA 4TS1A 4YP5A 4WZAB 2HHAA 4FN5A 5KWEA 1TAQA 1DTWB 1RBZA 1A8QA 2AC4A 3R76A 2BTEA 3CUVA 3T5BA 1GPUA 1V5IA 2VAMA 2FPSA 2PMBA 4YLGA 1SD5A 1PJ2A 3TTVA 1KZ1A 2B5WA 1S3FA 2H1RA 2BR4A 1QV6A 5JE8A 2R1TA 2H9IA 1O95D 3K0CA 1QIDA 3GPCA 5TGZA 1Y3IA 4MROA 3TW4A 4BVJA 5TS3A 3GJ4A 5JXGA 2ADMA 3S2YA 1ZSNA 4DB4A 5E6SA 1LRJA 5TMEA 4U3JB 3PC8A 2BHTA 3T54A 2I34A 2W2LD 4JP5A 1RJDA 4J6FA 3QE2A 5KWSA 3BHMA 1E1LA 1HT2E 1AB5A 2IQ5A 4PX5A 1P6XA 1PT8A 4UHJA 3BTUA 5AR1A 2AMLA 4H3KB 3WGZA 3PXDA 1YE3A 2EJCA 1IEQA 2IOYA 5BWBA 5MDHA 3T3NA 4MWCA 1A69A 3WSVA 1W19A 3MRSA 1B04A 4HT3B 3DH0A 1SQ6A 4DMKA 4ZHQA 3IT1A 1PX2A 4LV8B 4LZAA 4NE7A 5TQ2A 5HS4A 2OBYA 4C7OA 1FZTA 3FROA 2CV2A 1DWOA 1M73E 2GESA 3MWEB 3MTIA 1KZ6A 4FNOA 3IMKA 1P73A 2QMHA 4QBKA 2KI5A 1SCUA 4DHWA 1I5RA 3T0GA 3KSUA 4S24A 5C8YA 3KJZA 1CHNA 5KMGA 4JJ4A 4NBTA 3TR5A 4XGQA 5LM3A 4KO4S 1M10A 1O87A 3QU5A 2XUZA 3VMFA 4MWTA 1GOTA 3IEXA 3KQQA 3C6YA 4B6JA 1U7WA 3GDEA 2ZBPA 2PL1A 5KNDH 2HYIC 3UAVA 2OXFA 5JU6A 1FVFA 2QPTA 1XDBA 1GSAA 1YB5A 3VPSA 3OFND 4WGFA 1YF3A 4ID9A 4PZYA 3D4IA 2BIFA 4QRDA 4XIYA 3JTEA 3PUJA 2WLTA 1QRUA 4M86A 4NFLA 4X93A 5I8WA 1TAEA 1TFUA 3D2CA 3O6VA 3SIXA 3ZK7A 3LPNA 1NBOA 4F2PA 1JKIA 2VDWB 2PZLA 2PPLA 1Z82A 4X1YB 1CIJA 5KTKA 4YRCA 1JG2A 4BCDA 3LYHA 5ALIA 4BPRA 5EJ7A 3EDCA 1PHPA 2WZDA 4XYMA 3GJXC 1VKRA 2C20A 3WB0A 3U19A 1AZWA 1IQUA 2ADFA 3B1XA 3IP7A 5AT1A 1OWNA 2WJPA 4B4WA 3DMRA 3SLRA 2CYCA 4GPEA 4DPKA 2R48A 4ENTA 1PZEA 1E9RA 4OAOA 3GYGA 3T5GA 1KEEA 5AHWA 1ESZA 2OVFA 1V7PC 3C5VA 4XWGA 3ZNOA 2O57A 2R6HA 1UJ4A 3ENVA 4AX8A 3ZGYA 3FVQA 1BXGA 3LW7A 1SC4A 3EA0A 2JIDA 5EGNA 3BWDD 3H1PA 1QQ6A 2CBXA 1U98A 4WL0A 4I1VA 3CUUA 4LOIA 4H7PA 2OOKA 2R25B 4HFNA 4HDSA 2J67A 3VC7A 2QLLA 3MQ4A 4CMFA 1QFSA 2H3EA 2VSFA 3IJ5A 3RYCA 2V54A 1Z16A 3O21A 4MVJF 2PGDA 2YHAA 4WACA 3ROEA 5LD2C 3DOJA 2B1IA 1SCDA 2B1GA 2XE6A 5H02A 1F2UB 1PX0A 2FW8A 3F96A 4NCBA 2V9ZA 3GUHA 5L45A 3Q3EA 5EPUA 1CSEE 4KXQA 4LHZA 1GTMA 2QTMA 1HBJA 2GO1A 4QU5A 1J5XA 2F1IA 1QE5A 5JPIA 3RREA 3U7HB 3QM1A 3THXB 1FXUA 4P4LA 5JBNA 2BJHA 1E8MA 1DKRA 5TMDA 2Z6QA 4K9RA 1NN3A 4BLOA 2QX8A 3F7NA 5JJLA 3TK1A 3KPUA 1R4ZA 1CNFA 1PFUA 3LYAA 4OHXA 4S1WA 1XMXA 2YZKA 4JJ7A 3A9WA 4OQQA 2Y71A 2AR9A 1V47A 5JS2A 1NMZA 4J4BA 1KFEB 4TV9A 3ADOA 4AT1A 1TUEA 1XZMA 4F9FA 3JSNA 1NUPA 4HDKB 2BDTA 3GZJA 3IUJA 4N39A 4O7TA 2EGGA 3KWMA 4NBWA 1QJ4A 1TD1A 4X8MA 2WE8A 2O8CA 1TVCA 4F96A 3C7DB 1C8VB 5EEGA 4ARCA 4B76A 2YCLA 4EQ6A 1OX4B 2PX3A 2JFNA 3L40A 3S24A 1ISGA 1LVHA 1MU0A 1TYZA 2UZ1B 1PO7A 2Z02A 5AVJA 1KJ8A 1KMNA 1R88A 3JAKB 5AJVB 4D82A 3VOAA 3DQPA 1YQUA 2QVLA 3SJAA 1NF8A 4REOA 2WUGA 5F1PA 3EE6A 4G4GA 4RM2A 1ZOPA 2G5PA 5LIPA 2IH5A 3U40A 3OCJA 3RVQA 3VPGA 1E89A 3VPCA 1NSFA 5BPFA 2GXSA 3C98A 3GK3A 4D9HA 1CQPA 1AMNA 1GJRA 2Z8YA 3MWKA 1X9IA 2XOEA 3D8UA 3IYLW 1GCUA 1N5RA 3O4IA 4KZPA 4OREX 1QCDA 4OCZA 1P7CA 1ZKDA 4YCAA 2FPKA 4OQNA 1A0IA 3TDNA 4C4OA 2QRVB 3VR4D 4B4UA 2OV1A 3AR5A 1TD9A 4NBVA 4AP9A 1OHHD 3FDXA 4FUQA 2X0NA 4NBSA 1CY2A 4N4AA 4YJGB 4LRQA 5BSUA 2XUIA 2GAJA 1WZUA 2FPGB 2YHIB 1ZMBA 4LH6A 1NI4A 1USGA 4KAFA 4OVKA 3THOA 4B4KA 1DT5A 1SBIA 4ENVA 4XW2A 3EEQA 1YCDA 1IG0A 2DC1A 5AQEA 4HS9A 3C5HA 3JVDA 1NJ5A 2QMUA 5AVOA 4AP5A 2IHYA 1Z0DA 3A9SA 2N9UA 5K8VA 1BE0A 4MAMA 1UPFA 2IZ7A 2Y1KA 3O3CA 1UBGA 3VHXB 3EEOA 4CEIA 3IO3A 1DPFA 1EBBA 1PQWA 4KVGA 5ILQA 5BT9A 3IVAA 5DRYA 4D0NA 2VF4X 4OOEA 1E3QA 2C54A 1UDWA 2V8OA 3L4SO 3MTGA 2XUAA 1Q19A 4DDKA 5DM0A 2OM2A 5ENZA 4EB8A 1EFAA 4M9RA 3Q8XB 4GMGA 4B85A 2BAGA 3LCJA 4X63A 2IV7A 4EI9A 3PSAA 5JBIA 5A5EA 5I47A 4MOWA 4QYSA 3A6KA 2BFFB 1CJCA 4RD2A 4L02A 2IS4A 5C31A 1OJ7A 3EWNA 5EL0A 5KOHA 1PL7A 1WU8A 3PB3A 4MUJA 1QIEA 1RWQA 3L06A 5DVZA 2B30A 3K4HA 5EIHA 4DNOA 3R9XB 2O8EA 3BABA 3KVOA 1GN8A 1HYQA 3AFIA 3KOMA 3TSOA 1H1LA 3NBYC 4BP9A 2X9NA 4DBVO 5C5DA 3GWGA 3RWOA 3N8NA 3D8HA 2AR0A 3CVOA 1VJ0A 4MPRA 5BQFA 3LCCA 2OGSA 2B6NA 2WT8A 2IF2A 2QU7A 1M2VB 5F4BA 2CVHA 4R1NA 3TDMA 2LUOA 2IU6A 2WYWA 2OFFA 3K9CA 1DAKA 3K53A 1Y8AA 1NHWA 1UK6A 1Q12A 1XZ8A 3FYUA 2O0KA 4PAQA 4PC1A 5CT6A 4FBMA 3P5BA 4YHBA 1HQYE 5GJWC 4YV7A 1KSFX 4RA9A 3CEJA 1GPJA 2GOYA 2VDQB 2W6ID 4ZT6A 2XY4A 1CJVC 2UVQA 3NGLA 2ZCVA 3KQYA 3IBSA 4Y2GA 5IJZA 1GDDA 3IOBA 4FDTA 4DWWA 3RS0A 3U3RA 4IMJB 5B7NA 3E0XA 1MDFA 4LMPA 1CVLA 1QGYA 1CHDA 1DGQA 2WNHA 2VDPB 4OLFA 5I9BA 3CT6A 3BBPA 4PEVA 3E4CA 2XAUA 3K0KA 4JJIA 2ZRKA 4RFSA 4L2IA 3FYUC 4ZHSA 4KACA 2V7BA 3GDOA 3ROPA 3HVJA 1CXZA 3B8EA 2D3WA 4B40A 4BVBA 5BN4A 4WNIA 3FOCA 5ILOA 1EFTA 2Z0MA 3ER8A 1I9CA 4G4IA 3SVTA 3UJPA 1GP2A 1GYQA 2AEFA 3F3YA 3RVLA 1LLCA 1NKTA 1U7XA 3RC3A 1J8QA 2OYSA 2GTIA 1ZXLA 2KLBA 5ADWA 4JQSA 2QB5A 1ORVA 1G64A 1E4VA 3D4OA 3DC7A 1N0VC 2IUTA 1X1DA 2A0KA 3OZRA 4HB0A 2G9NA 2X7HA 1WETA 2HJSA 2BEKA 2QTGA 3PRHA 5KC8A 2P62A 4JJ6A 3STVA 1PWZA 1QDLB 2V9PA 3ZWDA 2FDXA 2FF7A 2B83A 4MA0A 4BS9A 1ZM3A 4TUYB 2QNBA 3CH7A 1XJCA 4AJ2A 4NKRA 1B6RA 4BO5A 1FNCA 1F2VA 5KVCA 2IYTA 3CF6R 3PJRA 2HA4A 4PGGA 4BNXA 1Z8NA 2GJSA 2H3HA 3C7TA 3WXBA 3WICA 3O2QB 2QLTA 5C81A 2CLKB 3G9QA 1OR8A 2VNHA 2Z30A 2QPAA 3UJBA 4D3XA 1G2QA 1UDXA 2HA0A 1HZZA 3ONWA 4UTOA 4FB5A 4HY3A 5LP1A 3ITDA 2D8AA 4F11A 3T7CA 3RAGA 3U48A 3L0YA 4L1KA 1L2TA 1Y63A 1GR1A 2DRIA 1ZXBA 1FMFA 3VOSA 2HHFA 4Y18A 5K0SA 3NEYA 1ZICA 5AW8A 2WT4A 1T8TA 2O2ZA 1N2CA 2K4MA 3GD5A 2IWHA 1P77A 3OEWA 4Q7MB 3TFWA 3TECE 1T5SA 4DAAA 1YNOA 3WIUA 4YA6A 3P19A 1B0UA 3QKIA 1JT2A 2ZB8A 3CX6A 3NM6B 4DIOA 1O0SA 5AVTA 3M1YA 4RFVA 3MS7A 1IPHA 1PAUA 1XAJA 3H17A 3IMCA 3LOQA 3LKBA 1UM8A 4Z7QB 3O2NA 3P4XA 5J58A 3EN0A 2BF7A 3A2NA 1TJNA 1VSQA 3KXPA 1JHOA 1DKNA 1XDWA 1CZLA 5AI8A 2CNDA 1X1RA 3OIGA 1VYUA 2RGRA 3H4MA 3NR2A 3FWPA 4ZT3A 1T8PA 4YROA 3AUTA 1Q1ZA 1QO0D 4IOMA 4C5AA 3IHWA 3K8QA 4NMMA 4UASA 3I9JA 4QBTA 2RBKA 1T2DA 4A10A 2GYUA 4X84A 4JI6B 1TC1A 2F8LA 3NLLA 2R66A 5BMVA 2Q3DA 3JATA 5CBPB 1VKZA 4KIWA 4J16A 4IRXA 3OEHD 1T2VA 3ZWKA 3WWPA 4GKAA 2PS3A 1C30B 1SVWA 2QMZA 1KTVA 3CT4A 4I4IA 5IKXA 4ZCQA 1OH5A 4RK5A 1N6OA 4WNCA 3ROKA 3PC4A 1RHUA 3IO5A 3JQDA 4X20A 3EPKA 2P2ZA 3BRSA 3FOZA 2XKAA 4ZRMA 1SHKA 2XT0A 1F20A 1LSJA 4PQGA 4RW0A 4BB6A 5BOSA 1UMCA 1S7GA 2OKGA 3MCWA 1J25A 1NVUQ 4ABYA 4D6XA 2YY6A 1FA9A 4LSGA 4LHEA 1SD2A 2RGAA 4J16C 5H68A 4NL4H 4AS3A 4PYOA 4IIXA 4ROSA 5JNTA 4RTSA 5C8XA 1CY7A 1KS2A 3O3MB 5FOUA 2J3IA 5LB2A 3UBMA 4QPDA 3WK8A 1AS2A 3VTZA 4DIMA 2RI1A 3TW8B 3ZS9A 1KP3A 4PC6A 4LV5B 1W35A 5G53C 4DLLA 1U9IA 1QUEA 2WM2A 3VR4H 3R23A 3VA7A 1AXEA 3FCSB 4TMXA 1CVRA 3DLBA 1KVSA 3GJSA 4GXRA 4YALA 3IELA 2LW7A 2OFPA 1QG0A 4NU8X 4XWTA 3OQJA 4BBAA 1Q5PA 1DLIA 1SCJA 2WHEA 2RONA 4YEDA 1MMFB 2ZYUX 5BYAA 3PGVA 1KI9A 4BO8A 3A36A 3CMMA 1ML3A 1C8LA 3CZ5A 3QVVA 1TADA 3ECSA 1W46A 1T2AA 4TTIA 5K0CA 3U4QB 2H52A 1JAZA 1JHRA 3WGJA 2BR5A 1GRVA 3IP5A 2HT6A 4MQEA 4CIXA 5CB8A 1Y1QA 2VK4A 3I37X 1YL7A 3VYSB 5DTMA 3NIFB 3U2QA 4XWYA 4U7JA 3P97A 4MRSA 4G8CA 1G8HA 1ADYA 1K4MA 1T34A 5EWJA 1I33A 2FX2A 3F5QA 5B4UA 2IH4A 1CV2A 3ELUA 4AJJA 1M54A 1M72A 3RAJA 3NGMA 1DTEA 1QCZA 4O4JB 3LQQA 4AZ3B 3DBOB 4Z9BA 2AJDA 4ZPXA 1RI3A 3F6RA 1M1XB 3W0LB 2AQHA 3E53A 4L4RA 3N86A 3ETEA 5IEJA 2GPNA 3HA7A 3FUVA 2O1EA 3ZLJA 4QODA 4O84A 1UBTS 3EQ9A 4DLSA 1RJFA 4YRFA 4DGQA 1CR1A 2C95A 3D6VA 4JLMA 4CLRA 5FQNA 2Q3HA 2OCAA 2RHMA 2BEVA 1RRKA 1T5HX 1GUAA 4MV5A 2JCBA 4TKZA 1WD5A 1V8DA 1JEYB 3MOSA 4BO1A 4UHCA 4PG8A 4ME6A 5FWXB 1SRQA 3NTRA 1DJPA 2ATVA 4O8ZA 1YZKA 3OJEA 1Q1NA 1Y33E 3NBQA 2MSLA 2Q41A 2WD9A 3ANSA 4WEQA 4D9NA 1SXQA 2R85A 4W8GA 3HP1A 1DG3A 3UW3A 1DO2A 4MS1A 2QRMA 3WWZA 4RABA 1IM8A 2J9FB 3I9V6 1NZDA 3ZJ5A 1WCWA 2DU8A 1VJ5A 2CJYA 1BKYA 3KD3A 3BREA 1N1DA 3GVPA 2WD8A 1KMQA 1I1QB 1A71A 3IAM1 4CKEB 3Q1KA 3R0JA 1ZA1A 3H2GA 3N2GB 1UWLA 4PRYA 2VHQA 1JVSA 1X8XA 4QHSA 1KOGA 2ZJ0A 2DBVO 1YZNA 2OHXA 4HH3C 4R9VA 5JECA 1IEWA 3T61A 1TL7C 4XM1A 4XX1A 4Y1GA 5EIXA 3EWIA 3K1ZA 1X9HA 4KK4A 1DG1G 1GAEO 1V3QE 1ZNYA 5KHLB 3HHPA 3D4LA 5EWLB 1XPRA 3GOHA 4EF6A 5DZSA 4DCMA 3CNEA 3W6UA 4JL6A 1HKHA 4BJ6A 1B7GO 3R7FA 3OTIA 1W85B 3TAHA 2O0JA 2H1IA 4ND2A 4UUPA 3I1FA 2F8MA 3GQVA 2PANA 3C3CA 4FIDA 2PGOA 4CXMA 1V7QA 3JTMA 4A0QA 4JXZA 5IHPA 2MYNA 3ORRA 1YCHA 4IDNA 2ZPUA 4PFKA 1GEEA 1J6UA 3P2IA 4FK8A 1TEXA 3PICA 3VBEA 4B17A 4ENUA 1L7DA 1BJKA 4V0MA 4X24A 2NT4A 4ZOBA 1O6GA 4BDTA 2XWJI 5BSKA 4DCUA 4OYLA 3T7IA 5IF3A 3UGQA 1UJNA 1UKBA 4IGKA 1H2RS 2H7XA 4I1RA 4Q4AA 3T3HA 4YCMA 5DM4A 1U4SA 2GXUA 4S0ZA 3WQHA 1Z4NA 3NJ8A 4ER0A 1BQ3A 5JWRA 3V97A 1GZ7A 2YY7A 4J0EA 5EQJB 2XGSA 1YASA 3HDHA 1MQAA 1OE0A 4A0GA 3KKKA 4P4SA 1NVKA 4CR6A 4OFWA 4CKCA 2C0QA 2Q50A 3CLHA 6YASA 3O4FA 1WB4A 2RI0A 2BGIA 3NHBA 4ZAZA 3T0FA 2MWMA 3FCXA 2DEUA 1DS6A 5TVKA 5KQRA 3NHJA 3HJBA 2FU5C 1ZL0A 1K3UB 5AHKA 5FEUA 4KO8A 5LXTF 2XZLA 3H2ZA 1QLJA 5L7YA 4P0PB 2W4MA 5EIBD 4OD0A 2WHQA 5HDBB 3JWGA 3S5UA 3WKDA 3ZQJA 4BE7B 1EXNA 5J4VA 1FSSA 2UYHA 3IAEA 5TC4A 1U5BB 3MJ4A 1VCOA 1VQ1A 2AR7A 4HD8A 4B3FX 5HUQA 1KZ9A 5CVJA 3WO0A 3QVSA 5AW2A 3JWIA 1UJBA 4JBLA 2I76A 2Q0QA 2Z2XA 4H1WA 5DV9A 2L0XA 4ZDWA 5JQGB 2OQ2A 2TMKA 3A3YA 4MSUA 3AKZA 4RENA 1JJBA 3CYFA 4FOPA 3DCJA 4O63O 2C1EA 2AFIB 2AUNA 3E22B 1BRTA 4WBNF 2NVUA 1S02A 2UVPB 1CUWA 1KEUA 3KCQA 4TTRA 1FZQA 3USCS 2B1RA 1QQAA 2EJ3A 4UW9A 2CL7X 3IPYA 5HMLA 1RYEA 3I04A 1UXOA 5J2TA 3BMOB 4BKQA 5MN6A 1DIAA 3Q0IA 3Q7QA 2DHQA 3OTGA 1EA7A 2OGTA 2WQZA 1J06A 4G1EB 5CT9A 4PN3A 1ZCZA 4B2IA 5DHUA 3W90A 3X2FA 1H9CA 3Q1LA 1LBSA 1GZVA 4L74A 3ZV5A 4GOXA 2QBYB 2BF4A 1HDOA 3ZWWA 1M34B 2R4TA 2ZWPA 3COSA 1GZ6A 1XVTA 1P8AA 1RYYA 1XZGA 1ZIOA 3RVOA 5CJPA 4A15A 1I4DD 2OB1A 1PYDA 5E38A 2WIKA 1F0YA 1A7JA 3DT9A 3MELA 3GLHB 1I30A 5EP3A 3WK9A 4C0QC 4JJZA 5FAKA 2XCTB 5I9LA 1N9GA 3DFKA 2PQ2A 4J1QA 3TJRA 2YRXA 2G1JA 1FFDA 5HZHA 3OTOB 1EAMA 2OCPA 4DC1A 1IK4A 1XO1A 2ZKIA 4PR0A 4TXHA 3EVDA 5ANRB 1N4DA 3MWFA 5HUJA 1NQOA 3TNYA 2YZGA 1AZSC 4HNUA 1L7NA 3RS5A 3RUHA 2ZT8A 5I48A 4Z0PA 3H7AA 3C8MA 3AI3A 3UATA 4E2FA 5IJAA 1XDNA 1JFRA 1PZMA 2DY0A 2D7CA 4NS1A 5DBIA 2GA9A 1B4DA 4XM0A 3GWZA 1ESNA 3Q2OA 1Z0UA 3KE8A 3NKLA 4GX0A 3OG9A 3A4NA 4TSFD 4EW2A 1D4ZA 2L2QA 3THYA 3PR3A 1NTRA 4E21A 4N7RA 1BDJA 5GGYA 1I4LD 1VBHA 2A86A 3CRW1 2XB2A 1QF6A 3L8YA 5HXAA 4DUPA 5BQ3A 4HXFB 3UXEA 4MI6A 3UJ6A 3MWLA 1ATZA 1MVNA 4I66A 2I78A 2DECA 1WP9A 1ISRA 4E3ZA 4GLWA 2OGWA 2WMYA 4O5AA 4IMRA 3OJ0A 4GWKA 2WJAA 3IUMA 4OQPA 1K5HA 4QNMA 1BDMA 1CUZA 2Q28A 3CNQS 3RT7A 3SHWA 3JD1A 4BTEA 1DADA 4G25A 3KX2A 2IV3A 3REGA 2PWYA 3L0PA 4MUXA 1XCLA 4INJA 3PFFA 3M5CA 2CFCA 2CVFA 5M04A 1LVGA 2I3AA 3PI7A 2Q2WA 2WWTA 4ISCA 5H3CA 2B8WA 2CXTA 2JFVA 5DN9A 4BO7A 3O1JC 3MTBA 2REQA 5IBRA 1S3GA 1S7CA 2YFQA 2ZWOA 3L7NA 3CEBA 3PIRA 4MRRA 3T1NA 2JGDB 2JC3A 4U7PB 2R84A 3PI6A 2P2LA 4BJHB 1PFWA 1Z37A 1JXOA 3I5MA 2FRDA 1OD6A 2EL9A 4P3KA 1WDKA 4GZLA 5D1NA 3PUXA 2UAGA 4JJAA 3HL4A 1NNSA 1K7YA 2FN9A 2IFTA 2LIPA 2XQVA 1ZD4A 2G80A 1I7DA 1ECGA 1RYBA 4R6WA 2Y1CA 3FPHA 3TZHA 5IJ9B 3SR0A 3C41J 3KV1A 3JQ7A 3W9YA 3ZK9A 3TTTA 5CJ2A 4YRPA 4GKVA 5LLTA 3KPWA 4F72A 4Z53A 3FWYA 5G02A 1L5HA 2JLWA 1CNEA 1NUTA 5KTRA 4BGIA 1DFGA 2H16A 1G8SA 3BFKA 1WDLA 4W6ZA 2Y8EA 3H5LA 3RTBA 3KWLA 4ASUA 3K94A 3WNCA 5CEEA 4Q9KA 4L8WB 5HS6A 1JSZA 3DCNA 3HKBB 4CMDA 2YV5A 2YW9A 2MSNA 5AH0A 4TXLA 2OLSA 1J42A 4WOJA 2PBZA 5BVGB 5IS2A 1JA0A 1P8LA 5ERXA 1YAHA 4QFMA 1C2TA 4KXLA 5HSGA 4ZKDA 4F1WA 2JGMA 1LRKA 1T91A 3EDQA 1R10A 1JDPA 3CZ4A 1QH1B 1NA5A 2ZE8A 3FTCA 5HCUA 5K8UA 2RHDA 4BLUA 2FZKA 1P4HA 1SH7A 1SWVA 2V7EA 3DQZA 3NS7A 4PVCA 4TXNA 1J1UA 1SXJE 4IHJB 1U5CA 1XMIA 5LJIA 1PJ3A 2WHYA 4YASA 5D87A 4YO7A 5IH7A 2IYSA 3PDJA 3SYTA 3ET5A 2ONCA 3VR6D 1GEGA 5AKZA 4ZU1X 3PGA1 4ZQIA 1M8FA 1JHDA 3U61B 2GM4A 1GSOA 3W3AA 4V38A 2FSUA 3U7QA 4TRNA 3IKLA 3M9XA 5F5NA 1YDMA 3D5EA 3TIXB 5IANA 3CBQA 3TQCA 4HNQA 1GXSB 2VUIB 3FPFA 3QUTA 5JNLA 4RF2A 4KQHA 2AI2A 1TM5E 4IIEA 1XQYA 1E59A 4L50A 4LMAA 2Y1FA 2FHPA 1FLVA 1ZLXA 2EJVA 4ALJA 1U81A 4E08A 1S5PA 2A7XA 1PYOA 3OFKA 3U54A 4FHFA 4Q48A 3SYMA 1N9ZA 3UJAA 1PGPA 2IZOA 1TDJA 4AZ0B 1B2RA 4FCCA 4J7XA 5AJHA 1M2OB 4PZ8A 1DQZA 4FGKA 3DC2A 4RK4A 3RG8A 3SCZA 4DDUA 1BRMA 2PZ8A 2XQFA 5KI6A 5B1YA 4AMUA 4IEEA 4RMHA 5IC4A 2B92A 3H13A 4MV7A 1CW2B 4E3WA 3BQ9A 3L4BA 4V0OA 1XQ1A 3HN2A 3I9MA 3ZHZA 3SNOA 1NJGA 2I2DA 5EP4A 2RAFA 3QV1A 4L7QA 3FCUB 5G4KA 2NO4A 5KKNB 1USVA 2O2DA 3Q3HA 4Y6QA 5EUMA 1CF2O 2NU8A 2ZSKA 1PUIA 3QFTA 3SVZA 2O6HA 3UTCA 4DV0B 2GEKA 5EERA 5FPHA 4HDOB 4E6PA 1QRRA 3G23A 5ESRA 1NJ2A 4UNPA 4HH4A 1F8XA 3CX8A 1NP6A 4MW1A 4GZ3A 3U3MA 1R9NA 1REQA 3A6JA 1KHHA 4LRSB 3L4BC 1H8HD 2C4TA 4R7TA 2WYHA 1UP7A 1A2OA 1SCIA 1B8UA 3ZIUA 2WZQA 3IRUA 4ETMA 3U16A 1RZRA 13PKA 1QB8A 1ISPA 2J48A 3KWFA 3P96A 4H7IA 4R54A 3W9SA 3LHIA 3ZKAA 5JDCA 2P6NA 2QG6A 3QVGA 4MVJM 7YASA 5C18A 5T6MA 4AJNA 1D2MA 3VH1A 1UM9A 2R65A 3O74A 3IEKA 2QAGB 2XYVA 3COVA 3P8ZA 4QIHA 3R9RA 1MO6A 4NIMA 5CR9A 4F4DA 5LBTA 3VI4B 4CR7A 1U02A 4DCTA 1DJNA 4I6GA 4TVBA 4PRLA 4YX9A 2BEUA 1W47A 3K9BA 5HG0A 2FPRA 1RDFA 4P7KA 4B80A 4C0KA 3U9TA 5K2OA 1BMFD 3BBLA 4KQKA 1P4JA 2XIQA 2CL6X 5TPWB 3CN9A 4BBPA 5C1BA 1N33B 2TSYB 2BFAA 3IQZA 2CFMA 3P9RA 3OTQA 5JDCC 2G09A 4DIFA 5AI6A 3Q6MA 2NYRA 4JLNA 2FFHA 4OATA 5FJJA 1C9DB 1JGTA 1ESEA 1CS0A 1D2GA 3DB1A 2JBHA 3BXGA 4O7VA 1ZH2A 5AKKA 1JJ7A 4YRKA 2A5DA 2YFKA 3CKKA 1NVWQ 1SBNE 1QHHA 2P9HA 3BIWA 3I01A 1UZNA 1MAAA 2OXTA 1YTLA 3HEAA 5JAQA 2P67A 2ZT7A 4K7JA 4MV3A 4J2TA 3TBKA 3PX7A 3EF0A 3SPXA 3KZ1E 5JCXA 2XYHA 4Z3KA 5JARA 4DWJA 1G7RA 2Q8PA 2YDYA 2CLIB 1N92A 1UBSB 3BH6A 2EATA 3NVDA 4DBLE 2J32A 4UBJA 2ZYIA 2G71A 4EBFA 3AB7A 2RH4A 4YJFB 4P7GA 3D54D 2C04A 4Z0HO 4BVKA 2QRQA 4GLLA 5KNLA 4HLCA 4PYRA 3DTGA 2HDHA 4O81A 2Q6OA 4A27A 2O8FB 3WLNA 2PXCA 5F76A 3R7WA 4HJXA 4L73A 2B1QA 4WCFC 4EJSA 3B70A 2HYDA 3GN2A 7AT1A 1N5IA 3DE7X 4R8SA 3P2YA 4L4ZA 2ZWMA 1VM6A 2XE7A 4E09A 3ICVA 4WZ6A 4YAKB 1YOVA 2ZVPX 3RS2A 3RD5A 2B99A 4DNFA 1JEDA 1ODJA 2PAFA 1PVDA 1XHFA 2RHTA 3UWSA 4CQNA 1K8XB 3PD7A 2P3LA 1JPUA 3I8XA 4PSCA 3BZUA 1E3WA 3WG9A 2QN9A 4QUIA 3IV6A 4BLWA 3ZEIA 1OTHA 3EOAI 1JQAA 3HJRA 1GFIA 2IYWA 4ZRDA 2VRNA 1Y1SA 3TUZC 3UFBA 1Y9AA 2VTVA 1SUBA 1IJEA 1ZMOA 1DFIA 4R31A 4OQMA 2HSEA 1E6KA 1GRCA 3LAWA 5EUBA 3LQ1A 3SS8A 3FUTA 1LZLA 5FL7D 4B45A 3FYSA 1BWRA 4JMPA 3S0JA 5AM5A 1ZCJA 5A4IS 2L82A 4BTLA 4XD7D 1ZCBA 1WJGA 1QWOA 2D59A 2QEQA 3BA6A 3GCWA 2CLCX 2JNWA 3OU7A 1XT6A 3QJGA 4Q9LA 2Q1WA 3RUPA 1BJRE 1JN0A 3HO1A 3HKCA 4WW0A 1UOQA 3LL4A 3NNSA 2WKPA 5KAMA 4FEYA 3CWCA 1EP3B 1G21E 1KO8A 4JBIA 2WK1A 1EVEA 3B6MA 5FUQA 2C7OA 1Z8HA 4RA6A 2ACWA 3HRHA 4D0RA 1GNSA 2C3PA 1AT1A 2IYEA 3FM9A 4IDFA 2WABA 2CHEA 4Z1MA 5K8IA 5TEWA 1ZU5A 3N75A 2D0PB 1U0JA 5ELLA 5DB4A 3GJTA 4M7OA 5LDHA 2GNOA 4EGCB 2VP3A 3PEEA 2IEIA 7REQA 3K6SB 3GRFA 1L5FA 9ATCA 1FNSA 1W7AA 5I7WA 3LBAA 3AY0A 3P0FA 2V97A 3FFBA 3GIWA 4CLEA 5MGBA 5DYWA 4AM8A 1N6IA 1QGUA 4H16A 3NYWA 1XG5A 4A8JC 3OQMA 5I5YA 1KFCB 1T36A 1Z33A 1UKCA 3AL3A 3JQRA 2ZM6B 5JPCA 3ADDA 1FJHA 2QF7A 2VDRB 1QQ7A 1S2NA 1WCIA 2GN8A 3I09A 4JCCA 3K6KA 1JZQA 4CFSA 2P6RA 3OZVA 3TLGA 2DQKA 1EFRA 5AVXA 1RPZA 1N7GA 3GEDA 5F73A 3BD9A 4Y6SA 1UBHS 3F90A 1OBCA 2ADOA 2XMRA 4IOJA 2XA9A 3O2JA 4I8IA 5C53B 1TTQB 2G5CA 4GECA 1JG3A 1JHXA 4DZRA 3ZBQA 2BVNA 3BM5A 3BXFA 4BMNA 4PZZA 4OI2A 4MWSA 3TI9A 3DFIA 1VFNA 1FVHA 3TRIA 3BUSA 1PT6A 4C0JA 1SUCA 1TAUA 1ONSA 2NO7A 3L0DA 1JFVA 2GEUA 3V4FA 1VP3A 2NUPA 2PUVA 3V4ZA 4DCCA 3JD0A 1TMKA 4FQ8A 4N5LA 2ZBEA 4P54A 2ZRNA 4TKUA 5FI0B 4ZCIA 1OFUX 4RY9A 5KC9A 1K8YB 2ZBRA 3OCUA 3TS1A 2O54A 3NAMA 1V9LA 4K1LA 1T2CA 3V7WA 1VLQA 2RFLA 5JJIA 4HXGA 2VK2A 1JHYA 4NNOA 4TM5A 1A4IA 1I3KA 3H9QA 2R2AA 1DUVG 2XCOA 5B6JA 4CF7A 3UB2A 2A67A 3NBMA 4GR5A 2YASA 1EZ1A 1JTEA 3R4VA 2TECE 4QLAA 3OHMA 1MFPA 4LHVA 1BQEA 3CPHA 1P5HA 1FC0A 2OD2A 3D1LA 1J2RA 1X74A 4HNGA 3U3ZA 1L4NA 4IUBS 4C05A 2PUWA 2MOKA 2KW5A 2XMBA 5H3HA 3NH9A 1IU9A 1E2DA 1IIRA 2I2WA 3KXDA 4BAUA 3GLIA 2E89A 2O7VA 1JVBA 4CLXA 4QJ4A 1VRVA 2PA0A 3TAUA 3W1WA 3F6YA 2GNAA 2JBWA 2GX6A 2HPHA 4IIJF 1WU7A 1TW3A 2YVQA 1JDVA 2ZJBA 1NXWA 1ODTC 3FVVA 3PGLA 4KLRA 4XGIA 3GFVA 4ZRNA 1Y6RA 4G6ZA 5EMHA 4UTXA 3UJCA 1U8CB 2JI7A 3VDRA 4HNTA 4COOA 5DCLA 4NBUA 5SZKB 5KNCD 1FFAA 4CLOA 4U2GA 4A91A 1FSGA 4S12A 3HCRA 3IXLA 2OZVA 4FZ3A 3V8RA 3VH3A 2PKYX 1TYDE 1F48A 1LLFA 3D3EA 2YHSA 2FW0A 2FWBA 4GRDA 4CQLA 1M1NB 5C8ZA 4HZUB 3ZDBA 2GM3A 5THKA 5KTYA 3F9CA 4HTAA 1M6EX 5JSZA 3GRKA 3DMYA 1X2EA 3LKDA 4I9HA 4P4GA 5DNDA 4MKGA 4ESOA 4RTKA 1KYWA 1GL7A 4MUBA 3SHTA 4RAQA 1ISJA 1VCIA 1XU4A 5CM0A 3STTA 4Q4CA 2V0GA 2ZWIA 5LQDA 3I6YA 4QQNA 4P58A 1KKMA 4TTSA 1N5LA 3E84A 4JJGA 5TE9A 5AFSA 1H0HA 3G2IA 4KTVE 5EIEA 2NSLA 2EBUA 3QEKA 1L1FA 1R0BA 3WP0A 4KMOA 5F7XA 4OAPA 2V7GA 5J2UB 5L6MB 2G0TA 3HWX1 3EGVA 5A3QA 2V9CA 3VKWA 5IN4A 5EG5A 5EKUA 4E2ZA 1OLSB 3OJLA 3F8TA 2E0IA 3MFQA 5ALZA 1HE3A 4EFEA 1L7BA 2XCQA 3AWDA 1OXVA 3UFXA 1S2LA 2GYWA 2EP7A 3QLUC 4WCVA 1XNRB 1GRQA 4LI3X 4O5OA 4GH5A 4K0RA 5DBGA 4U7GA 1K66A 3FMIA 2R4QA 3EUFA 2M9MA 4RM3A 4CTKA 3B5JA 5KPJA 5D3QA 3QA9A 4MV4A 3OZTA 1P9NA 3S6JA 2B37A 3TRHA 1XVAA 4HEQA 2YVKA 2NVOA 1EUCB 4TN1A 1SXJA 3FXAA 4RHEA 1W36C 1UIMA 1L6IA 3KT3A 4HUQA 5ESWA 3J81k 2IE0A 2Z83A 3Q85A 5ELMA 3WOVA 2R7KA 3W1GA 4QXAA 3NNNA 5KJ6A 4UATA 3SFTA 1NW9B 4PG6A 4RZQA 4DR3B 1EU1A 1OFUA 3L6CA 4AO6A 1XZLA 1NMYA 2ZXFA 1I6KA 4MIKA 3NPMA 3L5KA 1EM6A 3LPMA 1C0KA 1C1DB 1TJ5A 4QU9A 1SXJC 4U00A 4BB5A 3OTWA 5B30A 3R5JA 1Z47A 3GRVA 5ECWA 1FLAA 2GFQA 4MR8A 3H5WA 3H3JA 3ZQ4A 1OH6A 1Z0ZA 3C45A 4X1KB 3OA2A 1CY1A 1YDFA 3VVLA 6ADHA 2H4YA 2NQTA 3HTXA 2BFDA 1YRAA 1Q91A 2ZIFA 4QOGA 3RVNA 1IN8A 2H1FA 1JBKA 1Z0KA 3HZRA 4R5MA 2WIGA 4UM5A 4BNLA 4L4YA 3FW1A 2BT4A 2FW9A 5U4XA 4TWZA 2XDQA 2YWCA 4CV0A 3M2PA 4GSLA 2JIPA 3SHVA 3LHKA 4PNHA 1TZCA 3FYHA 1ZEJA 3COPA 3EZXA 3MQFA 1A50B 3W7AA 4BGUA 2PSFA 2QLMA 2AQKA 4KQ2A 3PN1A 1XEAA 1AQLA 2EKDA 2ZU0C 1ZVQA 2FRVA 4LDPA 3S40A 2P35A 4JXUA 1E1NA 1ZOIA 4AY6A 1NHGA 3DZJA 1ENYA 2JFPA 1FXWA 2WF6A 3ESRA 2R1TB 2O5VA 1F8FA 1TT5A 5A4AA 2G3YA 3K6JA 3FRJA 2P4QA 4AMZA 3GCGA 4D97A 1K4KA 2CKDA 3AFMA 4O7YA 1BWSA 2Y93A 5TT0A 1JFTA 2WP8J 1WNFA 1UIRA 2N42A 4BC1A 3I6BA 3CSWA 1WW2A 4QUKA 3Q7IA 4ALLA 4PNZA 1JR3D 1L9KA 1NONA 3O47A 1U8UA 5EE3A 3TSCA 1DP4A 1E5VA 2D0DA 3FGPA 3M9WA 3W6NA 1PV1A 1H2BA 2FWJA 3QVJA 3WRXA 3EDRA 4EVQA 1RD4A 2NO0A 1YS9A 2WTBA 1PP4A 3EVGA 2BTQA 2OUKA 4ENSA 1L1EA 3GLTA 3SSMA 3CLVA 1S2IA 3KFVA 1LW6E 3EXIA 5DYTA 4ZREA 4BQRA 4ZHQB 3GGOA 3F6PA 5TQ2B 4JDPA 2H2IA 4S35A 5FWDA 2NO6A 1AD2A 2HMTA 1H4QA 1YIAA 2OGZA 4I3GA 4MUYA 2RKOA 4WBXC 4C21A 4ZEMA 1SK9A 1XNHA 3V2IA 1OYYA 2F8TA 3GUZA 5A04A 3WRXC 1HETA 5JANA 1QNFA 4B6PA 2Q4RA 3RUIA 1UPCA 3EZ2A 1GVHA 1ODSA 1DQYA 4GLJA 2ATCA 4Q1BA 5LFAA 2YV4A 4G0YA 4KMRA 5KBYA 2W71A 3JZFA 2NYVA 3PFKA 1XNQB 1R8QA 3I92A 3RSSA 5K0TA 1KRHA 2ODEA 3CWQA 1KAOA 2JIOA 4L8FA 4QTYA 3MOIA 2AN4A 3V4VB 1UKZA 1DBIA 2HKIA 1EWYA 4KYTA 3V6LA 2J85A 2QW1A 1G2PA 1CZKA 3DE6X 3H2SA 3ICWA 4FZ5A 4P7JA 3VRHA 3L8EA 4FMDF 3T9EA 1UJCA 3CHYA 3MCAA 4WUTA 4QM7A 2UUBB 3GN1A 4OPMA 1P9WA 2OQIA 3HE3A 3L6BA 4KXNA 4DT1A 1TZBA 1FIUA 2B20A 1DC8A 1SY7A 1X1TA 2CD7A 2NU7A 4F56A 1KK0A 2Q2QA 3LGSA 3OZSA 4HWPA 1H22A 2RJNA 3EZNA 3L5OA 2ID4A 5B4TA 1T1GA 4D4HA 5HX7A 1KEEB 4FN4A 5JAIA 1DDIA 1QX3A 3AV3A 2AN5A 3C48A 3H4TA 3IPRA 4Q05A 4D9CA 4DBLC 3ZDCA 2CL0X 2VPTA 5AJWA 4YCDA 3RFFA 3J7TA 1BXGB 1DRVA 4DDVA 1U80A 4PLCA 5HK8A 4I4LA 4DQLA 5IX8A 2I91A 2I4LA 4IJ5A 2J5XA 4MEJA 3O83A 1S9HA 1VBKA 4HDSB 2DTEA 4UFOA 3S7TA 4D81A 3RYCB 3H7IA 4MVJE 2NU9A 4S04A 4A16A 5LP6B 5ITZB 3L7OA 2EQBA 1JKJB 4INPA 4E46A 4C4AA 4GP9A 3DYBA 3SQXA 1H1DA 4GM4A 2R6ZA 4IDCA 5KNCH 1MT3A 3N8HA 4E4RA 2W2QA 4YTEA 5I7UA 2XX3A 1WEKA 4NYIR 3TOVA 4FT4A 4OMUA 4RSGA 3AJ9A 5KS2A 1K92A 2NT3A 4OQZA 2FSHA 2J9YB 3OZGA 4D3YA 3EXAA 1D2EA 5E0OA 1DAIA 1GY8A 1U7ZA 3T4PA 1N34B 4TVKA 4G5RA 4RPGA 5DK4A 4C6HA 1UPUA 1HL7A 4DIEA 3ZZMA 2Q2UA 1AMOA 4DV3B 1J56A 1URPA 1YKFA 3KJGA 4WXRA 3UXHA 3F6SA 2DY1A 1JG1A 2QROA 2IYNA 4P08A 1THZA 3AU8A 4X95A 4OLBA 3R1IA 2FP3A 4GX5A 1WEHA 4HEA6 3ZE0B 4B6EA 1JU4A 4YQFA 1G19A 3QMMA 4H1VA 3GYBA 2HIAA 1EGAA 2ZGIA 3H9JA 2ZCUA 3G1UA 3QIVA 4URHA 3SXUA 4JUIA 4P0TA 4Z2AA 1GKYA 2BCEA 2O0LA 3C3DA 3IAUA 3L6OO 1CZOA 4XSVA 4OHOA 3TY5A 1I1NA 3CZQA 4MYUA 5EI5A 3NT5A 4NOJA 3F7OA 1M0SA 4D2IA 1K7XB 1A2BA 2DCUA 1SKQA 2OV8A 2HV9A 3SBOA 1U7DA 2JS7A 4RYLA 5G4LA 4Y30A 3TNJA 4AG6A 3EMBA 3K31A 5ILGA 1AK9A 1PKEA 4B83A 2GVDC 5K2MA 4FJ1A 2DKFA 3OM0A 3O7MA 1GUDA 5EZ6B 1UL1X 5K4HA 2OM6A 1UEXC 2WSMA 4PM4A 4NEGA 3GNSA 1MOQA 2JKVA 2YWRA 4DSZA 1FTQA 3KOUA 2SCUA 4NU5A 1I7QB 1HT1E 3PUHA 5AUQA 4L28A 3PDIA 3PK0A 3DEHA 3F7MA 3RROA 5AKEA 1J20A 2DHCA 3PKZA 2FZGA 2I8AA 2QNIA 3QNUA 4FDMA 4NOLA 1ZKMA 3IUBA 4XIJA 4OUDB 1VHLA 4N6NA 3U55A 4W9NA 4S2UA 1KS9A 2ZUUA 8ABPA 2HB6A 5AVWA 2NU8B 2QYTA 4PO1A 3FPGA 3LY9A 4ZT5A 3C8DA 4ZQCB 3RFVA 4BN5A 1LK5A 4NONA 5BNZA 1FDUA 1EIZA 4MB6A 2ZUBA 3TGPA 4KYVA 4HWKA 2H1VA 1N6RA 1JTVA 4DLXA 3AERA 1ZHFA 1DIRA 2XMSA 1WDMA 4LCBA 1FJXA 3QRWA 1QCYA 3D6HA 5AVSA 3UJNA 3W6OA 4OKNA 3AUFA 4LYJA 1BXRB 3EK2A 1MX1A 4EMSA 4CEIB 1ULBA 4WADA 1SGWA 1PWHA 1GT6A 3CCBA 3TZKA 1Z7BA 4ZZ0A 2WJWA 2BM0A 3QKUA 4W1QA 4EHHA