3AW8A

Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
366
structure length
360
Chain Sequence
b'MIGILGGGQLGRMLALAGYPLGLSFRFLDPSPEACAGQVGELVVGEFLDEGALLRFAEGLALVTYEFENVPVEAARRLEGRLPLYPPAKALEVAQDRLREKTFFQGLGVPTPPFHPVDGPEDLEEGLKRVGLPALLKTRRGQALVRTEEEALEALKALGGRGLILEGFVPFDREVSLLAVRGRTGEVAFYPLVENRHWGGILRLSLAPAPGASEALQKKAEAYALRAMEALDYVGVLALEFFQVGEELLFNEMAPRVHNSGHWTIEGAETSQFENHLRAVLGLPLGSTAPRGQSAMVNLIGEKPPFAEVLKVEGAHLHWYGKAVRPGRKVGHITLRRDGLKALEEGLARLSRLVSELPWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title Crystal structures of N5-carboxyaminoimidazole ribonucleotide synthetase, PurK, from thermophilic bacteria
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 107
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3aw8A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aw8A01
4FE2A 5LOVF 4YB8B 4I50F 5HV6A 4FGRA 2Z04A 2YL2A 2FPPB 1PX2A 4O4HF 3VOTA 5IYZF 3BFPA 1AUXA 4L1KA 4DLKA 3JRWA 2W70A 2CZGA 4EABA 2YRWA 2ZDQA 4IHJF 4O84A 4O2BF 3TINA 1KJIA 2FPIB 2DZDA 3ORRA 1UC8A 4O7TA 3TIGA 2NU7B 5LXTF 2YZGA 2XCLA 1I7NA 1EUDB 2PVPA 3WNZA 4M9UA 4M98A 1KEEA 1KC7A 4TV9F 5JQWA 4YAJB 4O86A 2W71A 3GIDA 3OUUA 4HNUA 2HJWA 2R86A 3K3PA 2WYOA 1VBHA 4FFPA 4MAMA 1SCUB 1WR2A 4MV7A 1JKJB 1DIKA 2ZDHA 4IWYA 3Q2OA 4HQ6A 1ULZA 4O82A 1AUVA 3RFCA 1W93A 5CA1F 3KALA 2W6QA 2NU8B 3BSWA 4O2AF 4O7VA 1CQIB 5CB4F 5K2MA 4M99A 4EGJA 2VPQA 4ME6A 3RV4A 5JH7F 5J2TF 1M6VA 2YZNA 3R5FA 4MA5A 1M0WA 3VPBA 4IZOA 5C8YF 4O7RA 2R84A 1GSHA 2V5AA 3KAJA 2V59A 4I55F 3MJFA 1B6SA 2SCUB 3R23A 1W96A 1Z2PX 2XD4A 5H80A 3JRXA 3DF7A 4MV6A 5DMXA 1JDEA 5BMVF 2W6PA 3HB9A 1CS0A 1BNCA 4GGMX 4HNVA 3KAKA 3BSYA 2C00A 4EA8A 2GQRA 2YZMA 3K5HA 3OUZA 1KJ8A 1DV1A 3K5IA 1CQJB 2VQDA 4O4JF 2W6OA 3JZIA 3Q1KA 3MWEA 1KBLA 4MV8A 2YS6A 2R7MA 4O7YA 2IP4A 4EGQA 1E4EB 3BSSA 2I80A 4FFMA 1CE8A 3TW6A 4ZQIA 3HO8A 2NPOA 1EHIA 5C1OA 4O4LF 4EA9A 1VKZA 5JVLA 5JVDF 1EUCB 2W6ZA 4TV8F 1OBDA 1VBGA 2FPGB 2GPWA 2ZDGA 2R7NA 3VMMA 1GLVA 4WBNF 1I7LA 5KX5F 1UC9A 3WO0A 4IWXA 4FU0A 2W6NA 5CAEB 3N8DA 5HBRB 3VPCA 1KJ9A 4MV3A 2FB9A 3NUAA 4TUYF 3QFFA 1DV2A 2R87A 2I87A 2X0SA 5GONF 3G8CA 1A9XA 2HGSA 1E4EA 4E4TA 5C1PA 1T36A 3UFXB 2I8CA 2P0AA 2NU9B 5FNVF 2YZLA 4ZI7F 4O7LA 5CA0F 3V4ZA 2CNUA 3AW8A 1OBGA 3U55A 3JZFA 1B6RA 1Z2NX 5EZYF 4EA7A 2GQSA 2YWVA 4XX0B 1M0TA 4O7NA 2PBZA 2QF7A 3U9TA 2PN1A 4NYEA 4FFRA 3N6RA 1BXRA 2DLNA 4O7ZA 3AX6A 2GLTA 2R7LA 2NUAB 4FFNA 4HNTA 2VHEA 4MA0A 2GPSA 4XYMB 4YJ2F 4J6EA 3R5XA 3BG5A 1JLLB 1Z2OX 2R7KA 3ETHA 4EAAA 4O81A 4ZOLF 1C3OA 2Z02A 5KKNB 1KJJA 3G8DA 3WO1A 4O7WA 4O7SA 5I47A 3V4SA 4XZ3B 3R9RA 4QSHA 1PK8A 1EYZA 1GSOA 2CNVA 5LA6F 1EZ1A 4M9CA 4EG0A 3TIIA 3HBLA 4C5BA 5LYJF 3SE7A 2DIKA 3GLKA 5J2UF 4C5CA 4O83A 4Y8VB 3ORQA 4DIMA 4YBZB 1GGOA 5LP6F 2YRXA 2YW2A 2YYAA 3RUPA 4YAKB 5D8DA 3U9SA 1A48A 3LP8A 5JQGF 2CNQA 2YS7A 3VPDA 4YJ3F 1KJQA 2FP4B 2DWCA 2J9GA 2VR1A 4RZQA 4XYLB 2QK4A 1IOWA 4HR7A 3KREA 1IOVA 1GSAA 4IIJF 4WD3A 3ETJA 2OLSA 1JDBB 3MWDA 1KUTA 4FFLA 1C30A 3RV3A 4O4IF 4I4TF 3E5NA 2V58A 5BPFA 5BPHA 3I12A 3U54A 4ZHQF 4MV4A 4FFOA 3LWBA 3R5HA 4MV1A 2R82A 2R85A 4MV9A 3TQTA 4C5AA 2NU6B 2W6MA 3VA7A
chains in the Genus database with same CATH superfamily
1GCOA 1KAEA 1VG1A 1NU8A 3RU7A 2JGMA 1II8A 4FR5A 2QA5A 5TMDA 4DLUA 1FFEA 3QWBA 5EMNA 3T99A 3UJ9A 1B93A 1PR3A 2NSJA 1H2XA 1I3MA 3LW7A 4WLEA 1PX2A 4AKIA 3QVUA 4O4HF 4LWPA 3IEUA 3SYTA 5KVCA 4KR0A 2J5KA 4MGZR 2YKGA 2VG8A 2BFNA 1YCGA 3MINA 1HORA 5HFJA 4HLQB 3D6NB 5JATA 2WHQA 1JF8A 4CIBA 4B71A 1RE1A 4DFDA 2ONZA 2NNWB 2CDNA 1CKEA 2YTZA 2Z2IA 2B25A 3VZSA 2B0JA 4ER6A 2ZTLA 4HT3B 4XDZA 1FA9A 1M75A 2BBOA 1D3AA 3N7AA 4LJLA 4P7GA 3J81k 5JNWA 4FN4A 4F96A 5FJJA 4KNYA 3FWPA 3VJKA 2HBYA 2JI8A 4EX7A 1RRGA 1TYCA 2CDAA 5C18A 1FUUA 3ILVA 1AS3A 3TTUA 3AFMA 5EWJB 1U4OA 2GFQA 3IDFA 4K28A 2AC2A 2L82A 3GBVA 1CUCA 1AJEA 1AQUA 1E8DA 2X1MA 4IDOA 5KVSA 3IDQA 1RCTE 2O1EA 1EDOA 3ND9A 4EUSA 4DHWA 2BTQA 3ZXSA 2BRUC 4EKDA 3OOHA 2DY0A 2XT0A 3OFVA 4JUIA 4D8UA 2BI8A 3UCXA 1RVDA 3WTCA 4F84A 2EV9A 3HUDA 2P7IA 1INLA 2B0CA 1GGFA 2I34A 2MR6A 4HNGA 4M98A 3QXXA 1ECBA 1XV5A 4IDAA 4GKJB 3CG4A 2RI0A 3RABA 3ZZUA 4E15A 3PQ3A 3UKDA 4NZNA 3ZLVA 5A4JA 4CLRA 4Y9SA 1JPJA 2F8SA 1J8FA 3W8DA 4RJJA 1A97A 4FINA 3V8BA 1T1JA 1MNAA 4ZEVA 3P2OA 4JELA 3VU9B 2WF7A 3IMEA 1R5NA 2FSVC 1RYHA 3BIOA 3K3PA 3ITNA 4PGAA 2X23A 4TL9A 4URHA 3CEHA 3BILA 3O0TA 3F5DA 1D2RA 3LUPA 3NRCA 4OQEA 1UM9A 5EIOA 1YC5A 4F9TA 3U5TA 4D2IA 3FPGA 1GQSA 3EOAI 4AS2A 2UYOA 4YRTA 1SBNE 4R3UC 2X0RA 5AQ1A 4V39A 2TMYA 2PLAA 5DLQC 3UYKA 2E9SA 3NWEA 3PDHA 5JDIC 4Y2SA 5JVDA 4PVDA 3ZU5A 5BSMA 4PU0A 4AQ7A 4H0NA 1ZY2A 2VWQA 3LHFA 3THRA 2I33A 1OREA 4OM8A 4XVRA 3EISA 1Z5OA 1A3GA 3QYPA 1C8VB 4P92A 2OKGA 3VRHA 5JYEA 5DHQA 4EUHA 4HUTA 5LOVB 2DABA 1NXQA 4YAIA 9MHTA 5JWOA 3QEMB 1GUBA 2ET6A 5LP1A 4D79A 2X9GA 3E3AA 1ZXLA 3C39A 3LLMA 4FD2A 4LHSA 3BKWA 4WKBA 4JJ8A 4BVLA 4RV5A 5DYTA 3CE6A 4GQIA 4M9RA 4O2AF 1VI5A 4M22A 4AX4A 4NNJA 1N75A 3BAAA 2YWHA 3BXZA 3GJRA 5FI5A 1UOOA 2IGBA 4BVEA 1NW7A 2E85A 4AP9A 4NCKA 4US0R 3UK0A 1ZUD1 3L46A 4RIHA 1Z4LA 4URZR 2GQ0A 4BLPA 5ILOA 1VSBA 9GPBA 1H1LA 3O8CA 3GUVA 1UBMS 2Y92A 2YDXA 4OHCA 3BD7A 3ADBA 2FZ4A 1XDZA 1Q22A 2DWOA 1CTQA 3L49A 3PLNA 3ZCRA 1IZ0A 2ZXFA 4JUAA 4HJRA 1XO1A 4BNWA 1AGXA 1J42A 3CLKA 1JG2A 1ZN8A 2YW9A 3FCUB 1JHOA 3TLGB 2H0AA 4HBGA 1TCUA 1RBZA 3PEYA 4IEEA 3DR3A 4IZOA 4XTCS 5C8YF 1LVUA 2CYAA 5IDWA 4CPDA 1YB7A 2VJOA 2C4HA 4D4LA 2D7DA 2GTPA 3L8YA 1DAPA 1WXFA 2VUUA 4TRRA 3I2IA 5BR7A 5KTNA 2OD7A 3SSAA 4L9AA 1CVIA 3R9WA 2RBGA 3AF5A 3AP1A 2EJVA 2QUAA 3R7DA 1F8GA 3ZBQA 1GSHA 2V5AA 1G4HA 3KTDA 2DGDA 3AINA 2QD1A 1GL9B 2FMTA 4MVXA 3AB3A 2P6PA 1LPOA 3U37A 3IE0A 1VJ5A 2EVWX 1KI2A 3AY7A 3N0TA 3VTFA 3WK9A 2PWZA 3S6JA 4JJKA 5FPOA 1FDTA 1OA0A 3BDIA 3FKSD 2QL6A 2FDCA 3SI7A 3WADA 1JBQA 4LOKA 1IPHA 1DOZA 1FLVA 3HDGA 3S2SA 1RMTA 1Y1TA 2B8NA 3KT0A 1SCUA 1X7HA 3OAAA 5DSXA 2GK3A 3IXQA 1LB1B 3UJ8A 3E4DA 3IHLA 4MV6A 1CUDA 4CE6A 1CIJA 1EDZA 1T9AA 3QIAA 1XB2A 5JCZA 4HG2A 1SGWA 4ZCIA 2Q49A 2WJWA 1QRSA 5CBKA 4ND1A 4NPAA 2WG2A 5CYPA 3BHIA 5HCUA 4TT8A 2VQSA 1S1MA 4WPGA 1JI0A 5AVTA 4NPCA 1VCIA 4B4KA 1PFKA 4QOFA 4RIGA 4DAEA 1MDBA 1VG8A 1V39A 2FH5B 5BSRA 4HAIA 2ZVQX 4GQBA 3OZUA 4CHIA 2A0KA 2O3QA 3TLZA 3C8MA 3TGLA 4M0LA 3OZCA 4BNYA 4M0PA 4LE0A 4U2FA 1GNPA 4AMYA 2GQRA 1KY5A 1D4AA 2J4DA 3BSFA 1J0AA 1U0NA 5DBIA 1LBHA 2RB4A 3N28A 2GN2A 4ABYA 1J09A 1E2PA 1S3IA 2YIDA 2QUIA 3O75A 2CNOA 5CURA 2VQDA 2EIYA 3LX6A 3F7OA 3IBGA 4GC9A 1YKGA 5B1DA 5AVUA 3ZEIA 2IOFK 3RS3A 2A5FA 1DXOA 2CHQA 1AG9A 2ACVA 2XIJA 3H65A 3GFOA 4FIZA 4HKTA 4AJPA 4CWAA 4TTTS 3HLKA 2GBGA 5JNSA 2AJTA 2XWJI 1X7WA 5JDCA 3HB0A 5AK3A 3K94A 4RTLA 1T0IA 2PKQO 4EGQA 3PRYA 5E0KB 2IY9A 2HJGA 2QRUA 4CM4B 3HVIA 3P4YA 4BYMA 1A4UA 1IUNA 2Q6TA 3EGVA 5FOTA 3QU5A 2AJLI 3SYNA 3QVMA 4ID9A 3QOFA 2Z6AA 1SELA 3BPSA 2FWJA 1JJBA 3D3NA 421PA 2FPRA 5GQSA 2J3QA 2R6JA 3E0QA 3DM9B 1LF5A 4MUGA 2PJUA 4J8PA 3VZCA 3GA7A 4Z4QA 1SBQA 3OPQA 4X95A 5LDDC 1JAZA 2ATXA 4WXYB 5I7OA 3AVTA 2RKBA 5HPYB 4KUEA 1PJCA 4XSHA 4N5LA 1PVVA 1RQ2A 3HGTA 1UDWA 2H07A 3JWHA 4ZQHA 4R7TA 3W7AA 3BBLA 1NLMA 1T2VA 4ZVPA 1V3QE 1KR5A 4RPIA 1NQWA 5AT1A 5EAIA 4US2R 3G9UA 4IXDA 3KJNA 2XEDA 3ZE2B 3L6EA 5IT0A 4Y6GB 4ND7A 4Q18A 4HDMA 3A3YA 3NBQA 4GX0A 3KOWA 4QFBA 4ZKEA 2XNKA 2EKQA 4CKZA 2R8ZA 3HV0A 2QQEA 3CE9A 3KZMA 4GBGA 1UEXC 3IRUA 2MSLA 3KLNA 4P98A 4KITB 2O8BA 3VYUB 2XAUA 3DXYA 1RYZA 1K08A 1NMSA 2ZZNA 3BL6A 4I50B 1SIOA 5HX7A 2PSFA 1DX4A 3O26A 4B3BA 1U8ZA 2Z56A 4RPCA 1N2CE 1SZCA 1QZZA 4KBYA 3WL8A 1FNCA 3SR4A 3HN6A 2P9TA 3IUEA 2HPHA 4PXAA 1X39A 2DPYA 4DLWA 5FLKA 3BRWD 2HAEA 2J9ZB 2OLEA 3PUZA 4JLAA 3NHLA 4LSZA 3KOYA 3AVQA 5IUKC 1TTHA 4EDHA 1E92A 1E79D 2P67A 5CLLA 2W93A 4WXHA 2I6FA 4DANA 2EZ8A 3CR8A 3HVJA 3GB8B 2DBRA 4FHDA 2JRLA 3JQ9C 3C7CB 1KPIA 2BLLA 2O2YA 4MROA 2P69A 1KU0A 2B8JA 2PL1A 2JFQA 4YJ3A 4ARBA 3EBOA 3G1TA 2XNJA 1BDMA 3BWYA 1VJ1A 3HZOA 4D9EA 2DWQA 2ZRHA 3A1UA 1O96B 2A0WA 2BN4A 4V24A 2P2SA 1EFPA 4GXRA 4L5BA 4ROTA 3B20A 5E4YA 3H5OA 3ZW8A 4GYYA 5JAPA 1KYIA 2QY9A 4JLWA 3AKCA 4DRXA 1RDFA 5EJ4A 2AOTA 4EHHA 2ZBDA 4R83A 5B1EA 5FNVF 1OXBB 3HJAA 5AHWA 1IXSB 1DINA 1DUVG 3E58A 3H2SA 4BX3A 5LXTB 2OBBA 4C04A 4ZAZA 2BFMA 1BGXT 3ESDA 3UMBA 1YS7A 1DHRA 3KETA 1RZUA 4LNUB 4DCJA 4AMBA 4OQPA 3VH1A 4Q7MB 1AKUA 1VSVA 2W2NA 3ZQ4A 4CUKA 1HX7A 3H1GA 5DI9A 3SC2B 3RTDA 3KUUA 4HAOA 4KB5A 2GWHA 5E95A 3SS8A 4GOLD 3OZWA 3WB1A 5FPRA 1N32B 1N34B 4AURA 2R8YA 2OT3B 3LHSA 1NBAA 1N4AA 5MGNA 4JASB 5ECWA 3ZYCA 4XX0B 1GQOA 1EUQA 4D4GA 3T3DA 2H4XA 2PRZA 4RC9A 2X13A 5EYPB 1NLYA 1Y7TA 3DDZX 5KTOA 2FAXA 1NLUA 1LW7A 1N2BA 2IW1A 4Q4JB 4KZKA 1I1KA 5D86A 5DX8A 4X1KB 2GBCA 1VS0A 1K6MA 1G38A 1VA4A 3B89A 4LDJA 5L8VA 3MS4A 4PC7A 4TVKA 1IZZA 1N6PA 2XE4A 3KX2A 5F12A 5AVZA 1ZXXA 1O95D 4DJDC 1FS5A 3CRQA 5EUQB 4KR2A 3P2YA 1E64A 2GJ8A 2C7BA 2XT9A 2XB2A 4XM2A 3A0UA 2REOA 5EIAA 3CZ5A 3DKVA 3W7BA 4N7JA 1U7ZA 4JJIA 4Y7CA 1GNRA 4F4IA 2VJMB 1QRRA 3R0QA 5HFNA 2HIGA 2XJ9A 2PZEA 1SU6A 2IU0A 2COGA 1MTOA 1U28A 1V4NA 2JIPA 4ANFA 5FPKA 3TNJA 5GGXA 1OXXK 4EJFA 1LPSA 3SGLA 3W90A 2I2BA 5AW4A 3PTAA 1Q21A 1FUIA 3H0EA 3N3AC 3HUUA 4FCWA 4I9UA 3ETHA 4F6CA 2D5AA 4XYLA 1MC4A 1QIDA 3IJPA 1BO6A 4I9NA 3DLTA 2XDQA 3RAGA 3OJFA 3T54A 1KJJA 1IL0A 1JPVA 4NY1A 8AT1A 1IBLB 1S01A 3RR5A 1DRJA 2CFCA 2OBXA 3MF4A 2C4VA 3CT6A 5A3RA 4LYYA 2PUCA 1AM4D 1CEXA 2PGLA 3T5GA 2GUWA 3ABOB 1H2HA 5FLEX 2WQZA 2JLWA 3UV7A 2LXNA 3G2NA 1E1LA 4XIIA 4YI5A 1FVXA 4G07A 4D6YA 3G0BA 5SYAA 4QU5A 5KSOA 1M0SA 1NJ6A 3U3MA 3TIIA 1UPTA 4YRIA 3EYWA 5IN5A 5CYOA 2JAXA 4C5BA 1H05A 3TQOA 1UK9A 2J32A 3O3CA 5BN3B 6ABPA 1P73A 3GQVA 4N7RA 3I4FA 3KOZA 1YVRA 2IP2A 4P2BA 1DJLA 4TMYA 5B7NA 4GT1A 1DOHA 4AJNA 4AI6A 2I3GA 1X1TA 3OD5A 4PYIA 3QX7A 3ZE6A 3ZYZA 4O83A 3EPKA 2OPHA 2KM1A 3ORQA 4Q37A 3LQKA 5ALGA 3S8YA 4XWTA 4ZQBA 3J81A 2Z6UA 1MAUA 2H0RA 2HJ9A 4NIMA 1KETA 3G9TA 3R0IA 3WJ7A 5JEEA 2CLIB 2ZIAA 1OHHA 3OQOA 4Q01A 3MLAA 3FYDA 3OPYB 3SXJA 1L8OA 1MJGA 1CB7A 2AHOA 1NY5A 4UULA 3VYVA 3NNSA 3F74A 2NXNA 4R0NA 4L76A 4FTWA 3TRIA 4MJXA 3NJ4A 3KQVA 3UZBA 5AO9A 1FFBA 5J23A 2X8BA 3RRMA 4QU9A 3IDAA 4LIPD 5CVJA 5JI3E 1KS2A 1SY7A 3B85A 1Z0IA 3V1KA 1DTWA 3K2EA 2JKYA 3L41A 2YMPA 3RU9A 3IQIX 1ZZEA 3QY0A 1PGJA 1EVKA 1RRPA 3I64A 1QLWA 4MW6A 5LUBA 3ROGA 5JAUA 2VSNA 1DJQA 1K6JA 1X13A 3N2GB 1Q6YA 2KE5A 5E9WA 2CCKA 3NTRA 4WTOA 4MYCA 1LC3A 1YIOA 3T41A 4ND2A 5B36A 5AXBA 5AVQA 1C30A 4AQYB 5HP4A 2ZSJA 3RSCA 4BEWA 2V3WA 3HM9A 4RENA 4AICA 1V26A 3THWB 1UBLS 3QIVA 4RANA 4N5HX 3M89A 3Q1LA 4YRRA 1PQYA 1L5QA 5JCJA 2MTBA 3K0CC 1A8QA 4Z53A 1LLFA 4LQ4A 2I3BA 2ATIA 1R4MA 4QNNA 4UE6A 2IS2A 3CV3A 2HCRA 2PT6A 3T3PB 1Y34E 1ZJ5A 2GNPA 3RTBA 3TLCA 1BOFA 1QANA 3HB4X 2X76A 2ZUUA 2BJVA 1N2CA 1UXKA 1JP7A 2FPMA 4C7KA 4CEJB 2XSZD 4RVDA 5JAIA 2GFHA 3KKPA 2IHNA 5FUYA 3RG8A 3MEQA 2GSWA 1OZFA 1G2OA 5D6OA 3WGVA 3IX7A 2HYDA 3LWDA 2IUYA 2X5NA 2F3QA 4CW7A 5I4BA 4MVWA 5CXXA 3W1WA 2DCUA 2HTFA 1XBTA 5JWRA 1GKYA 3GFFA 2GKSA 1V25A 2V6GA 2C78A 2UAGA 4PC2A 2P5SA 2ATEA 3WLRA 4UQLA 2YICA 1U0SY 4JSYA 3IQEA 2BGIA 2CUNA 1IZ8A 1VECA 2X3FA 5TQ0A 2QUJA 2KX7A 3GMTA 3NYRA 4OBXA 1M8FA 1QV6A 5H9VA 3VO1A 3FUVA 3VJLA 5BN4A 2ZAIA 2HHCA 1DAGA 5IYZF 1GCIA 1ZD8A 2BV3A 2NO7A 2XLBA 1QGDA 4P34A 4TV8B 5JCXA 3WX0A 2C9DA 1VBMA 3CUVA 1YQTA 1KYWA 2H1IA 3F2IA 1XK5A 4BC1A 4F56A 2FMFA 4MRSA 4XYBA 3WK4A 2WB2A 1T3ZA 3W5JA 4E08A 4XWGA 4N3NA 2GESA 4PLWA 4K2HA 4RHFA 3OC0A 5CB0A 2EC5A 1L5NA 5JJCA 3EXEB 1YTUA 3K9FC 2OD2A 2I1LA 5KX5B 4EYGA 1WVMA 3PV0A 1LK0A 3TE6A 4Q7LA 2YRWA 3MMPA 1UOEA 1AK2A 3ZWPA 5D3QA 4Z0PA 1Z47A 2ATCA 2IW3A 1P62B 3B6JA 3BE8A 1Y1QA 4RORA 5BY2A 2IY8A 1SD5A 4UM7A 1MEEA 5E4FA 1KJIA 4RGBA 1Z6QA 1AGRA 3F7MA 2DZDA 3EMDA 4MW9A 2I4LA 3NHMA 4ZV7A 2WFLB 5LMUB 3K0AB 1L4BA 3K16A 3Q4GA 1EMDA 3I1IA 1Y8RB 2WT4A 3O1LA 4FCCA 5BN4B 4C7BA 3NI2A 1TJ4A 3C6KA 4OKIA 2BRUA 2RKOA 3OQIB 2YZGA 4ZALA 2AD5A 1N25A 3S2IA 3EAFA 3DDUA 2D4AA 3IA2A 2BMVA 2JZNA 3C0KA 3JASA 4HEJA 4IUDS 5C31A 1G21E 3PZRA 3GFBA 2OM2A 1KY2A 1MDFA 4HYEA 3AI3A 1ZK3A 1V5WA 4RELA 3CRVA 2MYUA 3NEAA 3OOSA 3UQZA 1VM6A 3ZD8A 4F11A 2YBEA 2PUGA 1CJTC 2ZYAA 1TFUA 1WSWA 2ABJA 1BD4A 1BX3A 2GVZC 2IGTA 1GWNA 4P9NA 2ISCA 2QI9C 4DC9A 1XRQA 5JO0A 1M5RA 1NM5C 2FUNB 3SC6A 7REQB 1VL5A 1Q2XA 2IS1A 1E9DA 4QM6A 2XAAA 1QCZA 1TRHA 3AUXA 4JBNA 2W2QA 3ONWA 2AZ4A 4FFPA 2G5CA 1XDSA 3K53A 4IZ6A 4MGKR 3ZDZB 2WVAA 2I2DA 2BI7A 4XCQA 4HH4A 2W7TA 3QP9A 4DG5A 4I3FA 4ZT7A 2AQKA 3QWAA 1EM8A 2Y67A 4B3IA 4KFRA 4DQ0A 5L3RA 5A6VA 2FZWA 1WB5A 1Z6YA 3NPMA 2FSUA 3DHNA 1HDEA 4BVHA 1XMOB 3QPBA 1EUYA 1P4AA 3MFQA 2V96A 1A1SA 1N3IA 2YJTD 2B36A 2C84A 5CPFA 4YAGA 3NAMA 2DERA 2ZT8A 1AUVA 2R68A 1XU4A 4GPEA 2HOQA 4J7AA 3GOHA 4JGBA 4HNQA 4UFOA 5D1HA 3VUFA 1W93A 2PMFA 2WWWA 3W5CA 1T8UA 2IYWA 3WL5A 1DEKA 4RBNA 1VPLA 3B8EA 4F4HA 1ID1A 3ESQA 4G8JA 4QX6A 1Z0AA 2XTZA 3D7SA 3L4EA 4IQGA 4E2YA 1F3LA 2YRFA 2R00C 3DLCA 4QOIA 3RS4A 2J3IA 2VK1A 3GEEA 3UG7A 5B7QA 2E5LB 3RYCB 4PF1A 5IDYA 1P0CA 2WQ6A 3M1YA 2CKDA 1N7JA 3ANTA 3E03A 2FSIA 4J0GA 2A3NA 3QHQA 3IEIA 1U5BA 4Q1EA 2DKFA 5I8PA 2C2KA 1DBQA 3KU1A 2C7PA 3NGXA 2VPQA 3N2KA 3X1DA 3RV4A 4HEHA 3W77A 1ACLA 1P0IA 4Y30A 4L95C 3A2LA 3AUUA 2J4CA 2H63A 5ALJA 4DDWA 5L6LB 4MHTA 5ALUA 1JS1X 4OUDB 2YZNA 3VDXA 3C3CA 4MA5A 2XBMA 4BCDA 2I6GA 2PRSA 2Q27A 2IPOA 1C80A 1HFEL 1K6EA 2I4IA 2AWOA 1X8XA 1LTHR 2J9RA 3HZRA 4P3OA 1X9HA 5C2JB 3EVBA 1J06A 1X1RA 2FV8A 4NABA 4RHCA 1GP2A 1R5OA 1RHKA 3BTUA 2EBWA 1MR3F 5GJCA 4XSGA 4BUZA 5I3ZA 1F4LA 1R5JA 4UBKA 3RYHA 3JPWA 4OFXA 3FFAA 4PICA 3N58A 2C2BA 3ANXA 1N1GA 5CA0A 1JR3A 1P7ZA 3KEQA 3V7YA 1QQBA 3FSRA 3KPVA 3VV3A 4EB8A 1VYTA 1UWVA 5KDLA 3ZGYA 4W9MC 1Z2PX 1F48A 4YUVA 4E33A 1YHYA 2WJJA 4EFDA 4KGZA 4WADA 4WCFC 3GO4A 5G4KB 1OFHA 4IF6A 1BW9A 1QMGA 4N0DA 1P5FA 3B7WA 4E5KA 2DLDA 2WTXA 1VL2A 5DF1A 1DRVA 4BJ3A 3KYCB 1WCIB 4U6SA 4GLWA 3TLBA 3L7CA 5TMPA 1G42A 2HN9A 3M3HA 5LYJB 3VZQA 1T5IA 2DFDA 3HT5A 1V71A 4RH0A 2WLTA 2XCOA 4XM1A 4Y6PA 4XGKA 2OQIA 4OHKA 1OYVA 5LQRA 4U63A 1KL7A 1DJMA 1XVVA 3N70A 5EHZA 3SOZA 1BMTA 3PLAE 2NZYA 3WWEA 1NQVA 1T8YA 4DXDA 1TUBB 4OHMA 4QUKA 3L77A 1B6TA 1BG6A 1KMQA 3PGXA 3EUFA 4JKYA 4F86A 2A0XA 1K5GA 4MW4A 1PBTA 1KOFA 2GF0A 1ZCZA 1THMA 2ZGIA 4TKZA 2X8JB 2LR0A 3QV1A 4GFDA 2JJYA 1P44A 2XTMA 2I29A 3B1KA 2IVZA 4OJTA 1IDOA 4CQLB 5IAAA 3F3YA 1G20E 4PG5A 1TQDA 1DC4A 1IZ9A 1YIDA 2B20A 2PSHA 1KNXA 4G81A 4L78A 4AS3A 2YS6A 1W8IA 3IPCA 1S7CA 1ZNZA 3HNOA 3PJDA 4XJSA 4WN9B 4CMGA 1O5IA 5CDGA 4XR9A 2FN9A 1B04A 1M7BA 1WP9A 3D31A 3OZ7A 4FS3A 1QO9A 2AWNA 3DO6A 4DLYA 1NXXA 1Z83A 4PQGA 1SG9A 1SXJD 1UDCA 4GE0A 4YV1A 1U7DA 1OZHA 1GV1A 2DM6A 2KSQA 1QZXA 1WDMA 4XJTA 4Y2UA 4PYOA 2RB5A 3GH3A 4BNHA 3IERA 1OLUA 2ZTSA 1E2MA 4O4IB 1GRNA 3L0ZA 4DRFA 4R2KA 1TKRA 5JBQA 4D96A 3CX7A 4RA6A 3RWMB 1ZH4A 1M2VA 1U8UA 4IDFA 5I8WA 1TYAE 4OK3A 4F21A 2ZRIA 2ZR9A 3FBTA 3RRZA 2X40A 3OH8A 3T5TA 4LXYA 2OFPA 2BHRA 3OX2A 2BFOA 2A86A 4K9PA 1VMDA 3OM0A 4H0CA 4IHQA 2LCQA 3A8TA 3GI1A 2EF1A 3V8PA 4JJ4A 2CV2A 3W9BA 3DVAB 2JKVA 2R7NA 1R0BA 3H2GA 2EX4A 2Q0HA 4YCMA 3AV0B 4JLVA 3SQWA 2Q3FA 4GWGA 2H6EA 1V47A 3AOEC 3Q41A 3TAUA 3ZV7A 4RTMA 3P4XA 3K9BA 1J2JA 2MINB 2F90A 5TGZA 3V55A 5JS6A 5K3FA 4C4ZA 5ALWA 3V8VA 3Q0TA 2JBHA 5HKAA 4Q9LA 1ZGCA 3WVNA 4HNSA 1HOXA 1L1QA 5AVRA 4AD8A 3P2MA 3FWNA 1IJFA 2QXTA 4C21A 4WK0B 2CXRA 3HZZA 4Z0HO 5C0OE 5EJ9A 3BK7A 1PZGA 5INTA 1MOPA 4BAGA 2C9BA 1QPZA 2B94A 2C97A 3EULA 4BN5A 5L95A 2C9YA 1BCSB 1T9ZA 5ETJA 3UPUA 4U00A 3U17A 2CUZA 2AI1A 4JOCA 1S3FA 1JHAA 1KC3A 2XXBA 4DWOA 1Q7RA 4H6VA 1TMKA 3UAGA 3G3EA 4S0XA 4IP0A 1U6IA 3NC0C 3Q7IA 3OOEA 1X1CA 2OBFA 1QTNA 5CK4A 3C6MA 2H4FA 3K0BA 1XLUA 5BWBA 5K8CA 1DWQA 2C3OA 3WSWA 1D1QA 4ARUA 2R8PA 3RYIB 2HPVA 1DIAA 1NA5A 4A0SA 5J63A 3EAGA 3RSGA 3T5CA 1RQXA 1EESA 1NVUQ 2UUPA 3OU7A 4P0TA 4HDNB 4AP6A 3BXOA 1IOZA 5F1PA 3F4BA 4LRSB 1BQ4A 4MP6A 3L7KA 1X70A 1SB8A 4HAXA 4QQRA 1JIUA 5MFZA 4TLCA 1X1QA 3LLVA 3DZBA 2BF7A 4GS5A 2PTHA 2JFBA 1XVUA 4LV6A 3PEUA 4H7KA 5B5SA 1WMDA 1KZ1A 2BI4A 1HDRA 5U9CA 1GTJ1 1JXOA 1FQOA 4QAQA 4OYHA 5JD4A 1DBSA 4KXMA 5DWDA 4WOJA 1PZXA 1Q19A 3AXTA 4Z5XA 1EUCA 1LRLA 4U6NA 1IULA 4CQJA 3NTQA 1FTQA 4BIMA 3CZAA 3KVVA 1XCJA 1VLLA 4RTJA 1B1AA 1NE7A 1JA0A 1OAOC 2MMGA 4OXKA 5BOVA 3OPXA 2PSEA 2GZSA 1DC8A 1H4VB 4O1IA 3RK4A 3KKZA 4E4YA 2CDCA 2V8BA 1I4OA 1TAHA 3BRQA 1NWCA 5HIKA 1JXAA 4MJ3A 4RHTA 4Q9DA 2XKBA 1I6LA 3GCDA 2QG4A 4MS4B 1BHQ1 4NCHA 2QD3A 4UFNA 2WY2D 1E1NA 4CL8A 2RONA 2PKQP 3HJRA 3EB9A 3L8FA 3CNQS 4B4DA 1AHPA 1Q20A 2H48A 4EY4A 2CLLB 3OPNA 4MB0A 3VR0A 1R0YA 4FFNA 2GAFA 1ZR2A 2HV8A 1SQGA 4ZHSA 1VJRA 3TQSA 3W5DA 1XKQA 3VKGA 3THXA 3H5WA 3QLEA 1M6WA 2YVQA 1LI4A 4DMRA 4KQ6A 3HV2A 1JIIA 3H7AA 3PXAA 4LY3A 2C3MA 4PNPA 5CA1B 2OC9A 1LVGA 1N7HA 4ZYXA 3WQHA 4QELA 2JFUA 4TRNA 1YJAA 5D7BA 2UUBB 1HDIA 2PRJA 1RXYA 2ZSAA 1F2UB 2H51A 2WKPA 3FKSA 3OCCA 4MKHA 4X85A 3I9MA 3QVGA 3SNHA 5KC9A 4H7FA 1A4XA 3SBEA 4LXXA 3P9CA 4J7XA 2WFMA 4GXQA 2VF5X 1VP9A 4YP9A 2IF2A 5M7EA 1WZEA 1ZLXA 2WP0A 4DNQA 2J07A 2ZIUB 3DFUA 5CB4B 4ARZA 4XXHA 4FT2A 3A4IA 2Q8NA 4HDSB 5G1OA 4H3KB 4BUCA 4ZFNA 2PUHA 4ZYUA 1I32A 3T1VA 4XFKA 1PK8A 3MSXA 4CKEB 4R05A 1EYZA 1CYDA 4JXUA 1E3LA 3UAVA 1II9A 1SKQA 4ZT5A 5C81A 2FQXA 2UKDA 2OGSA 4J4BA 3C70A 1WQ4A 3I1FA 5IFKA 3OMWA 1QH9A 1Y1KE 1U2GA 4BFYA 4K6MA 2WG1A 1SC1A 3SNOA 3DMGA 1NPDA 4NEHB 1NG1A 2YHIA 4Q4HA 3OEHD 5HS4A 3I30X 2OFWA 3SE0A 3MTJA 3MGKA 2TYSB 1Z56C 1V41E 2OFXA 2AZMA 1GO2A 3E23A 1MAHA 1A4RA 3HHPA 4UXIA 2OUKA 4CG2A 2ZYIA 3MA0A 1O5OA 3W1GA 3LAWA 2BM8A 3BCUA 3DMPA 3FOCA 3QKRB 3HFRA 5HILA 4ZI2A 4RCVA 4FXPA 3BQ9A 2R1UA 5DB4A 4I19A 1MO3A 4BAUA 3ESAA 4LVUA 2A4KA 2YC4C 4KBGA 1A88A 3BAFA 4MEBA 4CMEC 1AZWA 2WD7B 3D6AA 1Q0ZA 3OICA 2JFFA 4ALIA 1KWGA 3PU6A 5IX8A 2Q6VA 1RWWA 2VC2B 3EOBI 3OHSX 3K8ZA 3KU4A 1Z2EA 3W4IA 3W5OA 3NUZA 5CPBA 2DBZA 3A14A 4OJMX 1GN9A 4BVJA 1A48A 3L82B 1WXIA 2VO1A 3O4IA 5I7WA 2CFMA 4IQ0A 3X1XA 3E3LA 3GMIA 1ET0A 3I39X 1Y4DE 1US8A 4LRTB 3A25A 5BVGA 1Q0LA 3EH2A 3R9KA 1Z2DA 2G82A 3ON5A 1JTFA 5FR1A 3PGVA 2VR1A 4FGZA 4KE8A 4EVQA 1YQ9A 4O1MA 2NO4A 4ROSA 4CM5A 1DOAA 4KQXA 4H27A 5EKUA 4YJKA 1JLLA 3ZWCA 3WL4A 2ZOSA 3CVUA 4IIJF 2WWFA 4FZRA 4U8GA 1VJ0A 4IJ5A 4FZVA 4EEKA 3U0VA 2BEVA 3H5IA 2G4VA 3NNDA 3Q3VA 3TQCA 2I6UA 2FSSA 1USWA 4QECA 3S27A 4B6GA 4I4TF 3RHSA 3MOIA 3NM4A 1CBUA 3OY2A 1U0BB 1H9BA 3HCAA 5I7UA 3TW7A 4C4OA 1PWYE 2G9VA 4RZ2A 5AKHA 3SVZA 2GBIA 3C3AA 4MARA 1SUWA 1NNI1 4LF4B 4OL0A 3KPWA 2KS6A 4YJHA 4PRLA 3EA0A 1Y0BA 2RGGA 3PSHA 3E9DA 1JDZA 4DRYA 3HXLA 3CVOA 1HRKA 5REQB 4HH0A 1TEZA 1Y6RA 3RIGA 2C7QA 4AJ1A 5IAOA 3BA8A 2VRNA 4EG5A 3EZ7A 4I2VA 5JV5A 1Z73A 3ZZTA 5HVNA 3BRWA 4RIEA 2NU6B 1RI1A 1E79A 3QFSA 1G17A 3F9RA 3UJCA 2NSLA 5KAMA 4UXHA 5ALDA 2ZR7A 4PO9A 1AH2A 1KSGA 3V2GA 5A9SA 1Y1SA 3S99A 5K3OA 4I14A 2WNIA 4DUYB 5FOXA 1RNLA 4P4NA 5HOEA 3KQSA 3VOTA 1CJUC 2FLVA 2QRNA 1XAGA 2Z8XA 3OJ0A 4IIFA 1XEWX 5EUBA 3DCJA 2JJMA 2VWGA 1HOTA 1QORA 3QEKA 3MN1A 4O1HA 3WWJA 1ENYA 4U5XA 3KK0A 4GXNA 3MOSA 5C9ZA 4YALA 3ROXA 4D9FA 2ZAOA 3JQGA 5CM8B 4HYQA 3U16A 1WSBA 1T34A 4IJVA 3A4YA 4UDXX 3V4PB 4WJKB 2ONJA 2FZKA 5CFLA 4JAVC 5K3EA 2WWYA 4X8OA 2FP4A 1E5DA 3UOAB 3YASA 4MUKA 2V7GA 4JLUA 1ZONA 1KYXA 1PJBA 5GIOE 5A5EA 1PZEA 3FSJX 3I5MA 3V8QA 4JXZA 5AKYA 1G3QA 2J31A 3JALA 5JS8A 3E1SA 4RM3A 2GKOA 4NEGA 2D5CA 1JEQA 1QIKA 3FAZA 3T3MB 1M54A 4JIMA 3D64A 4ND8B 4HB2A 3HC7A 1IG0A 1U5CA 4LPKA 3KZ1E 3N8KA 5FTJA 2FKNA 2WWRA 3JATA 4FS8A 3AR4A 1QHHB 4TXHA 4Y0AA 1C4KA 3CX8A 4ZCTA 1N1DA 1P0MA 4EJSA 1FDWA 4YMLA 2ZRLA 1JTEA 1M6VB 2GFIA 3CO5A 4L0DA 3T1OA 1FDVA 3KP1A 4DYHA 5AJXA 1W34A 2Q3DA 3BABA 4L0MA 3H42B 3QBEA 4M9UA 2DBQA 4JKOA 4M1KA 1KDYA 3SSNA 3WAJA 2Y1EA 4BNVA 2UVDA 1IVSA 4GSKA 1LQUA 2O57A 3I6IA 4BXOB 4GOMD 2JGLA 1K5HA 1X42A 3U9LA 1P2SA 1O95A 5J59A 3UUWA 5KCZA 2V0NA 4CM8B 4HK4A 4PW0A 3T1NA 4RVGA 3IAM6 3AONB 1VIAA 2NYRA 4LOHA 1X8LA 3KR0A 3RHFA 4QGSA 3BTVA 3E22A 4JI0B 3FWYA 4NCIA 4ZYYA 1A2OA 3SK0A 2HSGA 4LECA 3TNYA 3U7IA 1R4ZA 3B6EA 4ND4A 3ZZNA 3KG2A 1TGVA 2I2WA 1QX4A 3FLEA 3SIXA 1ZJWA 3HYRA 4URWR 2GZ1A 2OWOA 4KOAA 4P6VF 5DTEA 4ARVA 4ER7A 2W8BA 5IF9A 4DIUA 4P22A 5BOSB 1ORIA 2D1RA 3AR8A 4BAZA 2IHZA 1RXEA 3Q2OA 1KHHA 2FWAA 4TKLA 4TLLB 3RFXA 1ZNYA 2G1AA 2ZJ3A 3QF4A 3A27A 4YMUA 4E7OA 4EMBA 4REQB 1ZOIA 3WOVA 1R12A 3KCQA 5G2OA 5CCXA 1J25A 4YAWA 4IOMA 3E53A 4CIAA 2IX3A 2ZT6A 1Z38A 2WP8J 3WZ2A 4DQDA 1OH7A 1FC0A 3DL7A 1O89A 3A9RA 3DUFB 5IBQA 3ZY5A 2EGHA 1H2ZA 3F2VA 3IQGX 1JSCA 2Q3EA 3ZWVA 1PNVA 1DLJA 5AKXA 1UP7A 1VHWA 2ALJA 2FYTA 4FLEA 5BW5A 1KZ7B 1BE8A 3S1AB 2BFWA 5J4YA 4LHYA 1U80A 1Z6TA 3D6FA 4KXLA 1K9VF 4GOKA 5JSKA 3CISA 4CF7A 1J8MF 4KNWA 1ID8A 4TM5A 4MICA 5K2MA 4TWZA 3U60B 1UMCB 1UBKS 3KLPX 3KPJA 3LRXA 4OJQA 4B4VA 4U2CA 4ME6A 1MH1A 2WUWE 4YJ2B 3T0GA 3OJXA 2NU7A 3FTCA 2CV1A 1DNPA 3HQ4O 2GZAA 2WTUA 2NT3A 4EB6B 1BCRB 4HDCA 4JSTA 2G72A 1OC2A 4MJ7A 5B58C 4NDAA 4E07A 5G40A 1M0WA 2ECKA 2HFKA 3DE3X 3E82A 4BCCA 1SOWA 1TD1A 4F6LA 4X90A 3TBKA 4NS1A 1YNOA 4NBWA 4RZSA 1PAUA 3VSDA 4IIJA 5GMOA 4F4JA 3TRDA 4GPZA 3LX4A 4K6OA 5A62A 2EJWA 3R3VA 1Z33A 2JGJA 2P90A 1D4FA 1ESNA 3QJYA 5A9TA 1X9IA 3DAHA 3ETEA 3MJFA 1RXUA 2I55A 2N42A 4MO2A 3MD9A 1KFCB 1U6JA 2Z1NA 3CUUA 3NGMA 2AOUA 2RH9B 4I4TA 4URYR 3QSGA 4YROA 1GGMA 1VIYA 4N82A 4D8TA 2GJKA 2P9CA 2V7TA 3ID6C 2VEOA 1XLTC 3NTVA 4CMHA 3ZIAD 1NI5A 2PGDA 2VYND 1O6BA 3QYJA 2P65A 3MWKA 1ODCA 3IJRA 5BNFA 3SEZA 3SGIA 3SXUB 1ZA2A 1O6ZA 1YL5A 2IQIA 3EPLA 2PCLA 1A2QA 3B5EA 3RIHA 1MB0A 1W2GA 1XTRA 2WDPA 4OA8A 3SF0A 4BASA 5BRJA 5K5EA 4WINA 4DQXA 3LWNA 4PPFA 4W5NA 1WW2A 1E6UA 3ROZA 5FXMA 4ZV9A 4CIVA 1GPJA 4TYMA 5AIAA 4MW7A 5CYGA 5HKKD 2YY5A 1LZLA 1P9WA 3ZQ6A 2ODEA 4KVGA 2GSDA 4D9MA 1JJFA 1UKYA 6NULA 1E1QD 1GGKA 1R4AA 2FX5A 3GDWA 4IDEA 2O59A 1V9SA 2Z2JA 4H0FA 5LP6B 2C00A 4OREX 2WWVD 1Z5PA 4ZEOA 4TSKA 3RGWS 3TLAA 5IWAB 2D06A 3K5HA 3JTMA 1C9JA 2FSFA 3K6JA 4HAVA 4RESA 3B51X 4GMXA 1U0LA 1N2SA 2WABA 1CSEE 1KH3A 1JHPA 4GSLA 4R41A 4MCIA 1HDZA 3GEIA 3TKYA 1CJCA 1O94C 2BM9A 1E94E 5CDFE 2XSZA 4HTFB 1Q74A 1AA9A 2VYVD 1FS6A 1VMKA 2VZ8A 2RH8A 1XHLA 3Q1KA 1NX6A 2Y71A 3JQ6A 3R5KA 5KQRA 1L5VA 4M88A 3OECA 1NSFA 1FFCA 2PYDA 4XGNA 4GICA 4I5IA 1GTSA 4C7OA 2GGSA 1C29B 4DQLA 2VVTA 4RO0A 3RANA 4FI3F 3S2YA 4ZTUB 3QJGA 5IEJA 2QVCA 2QLFA 1S2NA 2GI4A 2HRQA 2GPYA 3V7UA 2DU8A 2D0OB 4MCHA 1RRCA 3DGFC 4ZGBA 2W6CX 3WA7A 3A9VA 3OM9A 5TT0A 4DEYA 1UZUA 2RGCA 1E18A 1K5PA 1VDMA 3G85A 4LV8B 1YRHA 4JYCA 3GLQA 4FWTA 3MB8A 1EVLA 2M1ZA 1DDGA 2PM8A 3G5MA 3OKAA 1TRKA 3DZGA 4QLOA 1RWOA 4CXMA 4YRAA 2CXXA 4MQ6A 1M1NA 4CGYA 3HDJA 3NANA 4TKUB 1YRYE 1NI4A 4O3MA 2VI5A 1YAHA 2W6ZA 3S0JA 1L7EA 2E3JA 2IYLD 1E2DA 3DOJA 3OZIA 1SEVA 3D1LA 3PQDA 1DRKA 1RQRA 4CR6A 1EI9A 4JV5B 4I1IA 3AHEA 4CE5A 4UE3S 2H7XA 3LOQA 1AURA 2EFCB 1VFPA 2BR4A 3JQPA 1RAAA 1A50B 1WZNA 2GJSA 4DF3A 1EBUA 3Q7TA 1L5OA 1BU5A 5HJEA 1SG0A 3HCNA 2ODQA 4LWZA 4MEAA 2YYZA 1GEGA 2WPDA 4GNRA 3PI6A 3LDAA 4UDNA 3SJCA 1E2LA 1K7FB 1CR1A 4ENRA 1Z3IX 1MTZA 1IYZA 3HYCA 3AQIA 4LF5B 4U2BA 2FR1A 2J3KA 3VVCA 3FRJA 2FG5A 3N8NA 1X1DA 1XN4A 4G56A 3HP4A 3GAMA 4FYJA 3WGMA 4CBVA 2C99A 1C8LA 1R0KA 4MHOA 2EKBA 3QTLA 2P9FA 3R5TA 2DP4E 1PO7A 2ZR8A 3DE1X 4RADA 4UMVA 3F7TA 4X8HA 5KWJA 1IB6A 1U7OA 5CFQA 5EFZA 5H4HA 1JA9A 1BWPA 5IARA 3FYUA 4QXQA 1HWYA 4A92A 1NPTO 3CCCA 5E2BA 1U1CA 2O8EA 2YJ6A 2JFNA 1A9XA 5G0WA 3HR8A 4PRYA 5CITA 3BE6A 2I7CA 3C3MA 4FE4A 4L9SA 3BC1A 5DXAA 1T36A 3ST7A 2OO5C 2HLHA 3JSAA 3GCWA 1YFJA 4D8WA 4QFCA 1Z8NA 4Z3OA 1NRWA 2HXYA 2P0YA 4YMIA 2JVKA 5HNKA 4KRGA 2O8CA 4I46A 3O4FA 3GXBA 1AU9A 2G6BA 4JHLA 4OMFG 2C9OA 5AI5A 3TDKA 3ZCVA 2PVSA 4D9CA 1WL8A 1QO7A 1FLDA 1TVMA 2V7XA 1RWVA 1MO5A 1SU8A 2IEIA 2VCHA 4MMXB 5EINA 3USZA 4R84A 3HFSA 2HDKA 3U55A 4K7JA 2OYSA 3EDYA 4ZVNA 1IYDA 1QK3A 1QPGA 4DV1B 2PLFA 1W4ZA 4R2WA 4V0KA 3CGGA 3P7MA 3ZNQA 2CY0A 2JGDA 4J0CA 1X2BA 4MR7B 5ICMA 5KQGA 1B8OA 5J2TB 3BERA 1OFUX 4IJQA 2WV7A 5NULA 3KQHA 4X84A 2IXGA 3JR7A 2F6RA 2OZEA 4LA4A 4DTCA 3O7WA 1U11A 1Z26A 4L6IA 4Z49A 2ZU0C 3AT1A 1ZIXA 1A7AA 4KQHA 3HNPA 1HNNA 3ACBA 4B8WA 3KXIA 1IMJA 2H0QA 5DIZA 1EINA 3C5VA 2GEBA 4LDQA 5K51A 5L7YA 1T2UA 2DWPA 2V9CA 2ZJFA 3AUAA 1V4VA 5AXCA 1GD1O 2XLCA 3EIQA 8OHMA 1DKNA 5HGXA 1WD5A 2CZCA 2RK3A 3KDAA 4ZVUA 3MJTA 1FX0A 2AS0A 5A0FA 4FMPA 1DLIA 1V8FA 4ENQA 2G25A 4Z4IA 1BQEA 1L4UA 3RK0A 3DDSA 2VP4A 3V2IA 2D6FA 3CX6A 3IT2A 1DAMA 1NMQA 1WA5A 2YWRA 3E9RA 3K9NA 4LYEA 4Q1DA 4Q3EA 5CLGA 4DCUA 4OO3A 2YX1A 1WUKS 1V5IA 2EWVA 4F06A 4PLTA 5CX4A 3GA0A 3MRTA 5UKDA 3W5HA 4BNXA 1VHQA 1T9GR 1FDOA 3A4LA 3PL1A 2M6LA 1EA7A 1CU1A 3TDMA 2IEDA 3EJWA 1C4WA 3F46A 4OHFA 3NDPA 5NLLA 2R7KA 3DKIA 2FWMX 4ON9A 5JYDA 4IHJA 4EJMA 4L4UA 2GVDC 4RPLA 5B2FA 1H0KA 4C7MA 1D2MA 1B14A 1NP3A 1H4TA 5T4HA 1I5RA 3UFXA 1JKFA 3GGCA 4PAMA 3ESBA 4MUJA 4C1BA 2WHXA 2GHQA 3K09A 1SR8A 1DMSA 2LKCA 1YOVA 4D99A 4OQLA 3U56A 3HU5A 4EFKA 3NMUF 1LPAB 1CJKC 1L5HA 4U7FA 1HTBA 3JV7A 4KN8A 2TECE 4EVIA 3N74A 2B8TA 3G9ZA 1OGIA 4PSAA 5B7PA 4BO7A 4MW0A 1ZNXA 4HYYA 1FU7A 1ZN2A 1GG2A 2F9MA 3NDRA 3RAFC 3ZDAA 3LSTA 5FBWB 3LGAA 4CEIA 1A9PA 2IK8A 1VIMA 1NJGA 2P4SA 1T2DA 3WB2A 1ICIA 4LJYA 4QAJA 3LTNC 4QOEA 1ZJZA 1S2IA 3QA3E 1SZJG 3WGHA 1SCDA 1P9OA 4I55B 4C4PA 1M8PA 3VPGA 1FRQA 3ZDYB 2H4YA 4S24A 2IITA 1IOLA 2QORA 3LY7A 3PF9A 3K0HA 4TZTA 2ZYGA 1VPEA 4ZARA 2DIKA 2Y2UA 2I4RA 3GLKA 1MXHA 3ANMA 1EQUA 1Z4MA 2D0DA 4WLUA 4XWAA 2Y1LA 1XMQB 2WAMA 3SPXA 5DFAA 2NV6A 1UANA 1T4MA 1PR0A 1FMFA 1XQVA 1BJKA 1YCFA 4NE9A 3ZWKA 2I4TA 1P1RA 3PTLA 1VJDA 3RT1A 1ZVJA 1FBTA 3A9UA 4MW1A 3AM1A 3MCZA 4GOND 2ORWA 3GG2A 3K6KA 4UCTA 3K30A 5CFZA 5T7BA 1WETA 4ZEMA 3AEQA 3OZXA 1FMJA 3H19A 4BQRA 1DUIA 1XD2B 3UC5A 4QREA 4B6PA 5K0LA 3GEDA 1Y5RA 1GJRA 1NW4A 1QNFA 1QLJA 1ULHA 4IIEA 2QK4A 4JI1B 1YB6A 3MTGA 4PLFA 1L7VC 3AFOA 1PFUA 4GYWA 4DYDA 2GM4A 4TMTA 5DX0A 3LF1A 5AJZA 2R1VA 5IDQA 2Y8EA 1YUNA 1VRVA 1WPRA 2OGTA 3PHBE 2XYHA 2ZUBA 5D3KA 4A0HA 2JRCA 5EJ8A 2XUHA 4LGYA 4HQOA 2OQRA 4O4JB 4P4SB 5CMLA 5DEIA 4EYOA 1BDJA 4GMFA 4F3NA 5K3WA 4KXXA 1CUBA 1YJQA 4DIKA 3NV9A 5BSHA 5JH7A 2BKEA 2IV2X 1RE0A 1DEHA 3TRKA 3WLSA 2AKYA 2C4NA 4YRMA 1CIPA 5C37A 1DARA 1WMBA 5JXIA 1OKKD 2DHQA 4LJSA 4XQEA 3SFZA 2CB9A 4U7JA 1QAOA 3D81A 3JCZA 4BE9A 2HWUA 3LWBA 4PBTA 1AN9A 1MO4A 4MV1A 4QDXA 5GOTA 2CBGA 3RW9A 1P2GA 3IJ5A 1QTRA 1YHNA 4J75A 1KPGA 4EGFA 3KL4A 3N59A 4MWBA 1CNMA 1WNFA 1ZD4A 4YP0A 4FFVA 4TQAA 3ED1A 3P19A 1NQOA 2CE2X 2GM3A 4OYLA 4EM6A 3QI2A 1NIPA 2YOHA 2DBVO 4KHZA 5E9AA 2LCFA 2GD2A 4WLOA 3MT8A 2HSEA 2AQHA 5A4IS 1I24A 1PG5A 4QHSA 3S55A 4GEGA 1HMPA 1NZDA 1IU9A 4CDGA 1GQRA 3G2JA 3MHTA 2EDCA 4KIUA 4EWLA 2AW3A 4XUDA 5DCLA 3ELDA 2FUG6 1CF9A 2GZRA 4F5EA 4UHFA 1AUXA 3VPSA 2FJPA 1Z07A 3D2CA 5EIBD 4ZN6A 1ZRMA 3O9ZA 2UYGA 3N0WA 2QENA 1E2QA 1OT5A 1BSVA 4G5OA 1N9GA 2IPAB 2BFCA 5K0JA 5FB3A 5G3ZA 1REQA 1LTQA 1Y8CA 3GNTA 3MTIA 2H3EA 1GEEA 2PXAA 1E0DA 2WVHA 5EKXA 2IT1A 1YQWA 3SHTA 1CUUA 1MOQA 1KDTA 3MHPA 3OPMA 3CF2A 4CJXA 1GXSA 3GMSA 4H77A 1P3Y1 3INNA 2H1SA 3I4LA 3RF7A 3VX3A 1ATZA 2G0TA 4IIUA 4MDHA 4XEUA 3N07A 5BWLA 1V3VA 2OCKA 2RAUA 3WIEA 1O77A 2PUJA 1YU6A 2FEWB 1WIWA 5F3DA 1DS6A 2H2IA 2C42A 2GPBA 5EGNA 1C7EA 3D0RA 3SKXA 1PV2A 5FO0A 3DR5A 1XZNA 4PPYA 4OAOA 2ZJ4A 1C7FA 1JEYB 1JSRA 1XELA 4FYPA 1Q3HA 3VC3A 2Q6IA 2PT7A 1T2NA 3DWFA 3TECE 1HDCA 3OIWA 4EB0A 2YJ5A 1P61B 3RHZA 1DE0A 2ABWA 4RJLA 3QPDA 3MT0A 4P81A 2QTHA 3WRXC 2W98A 5AW9A 4X5OA 4AO8A 5KOJB 2JBAB 3BWMA 3B9BA 1X7ZB 1KVTA 3NHRA 4K05A 5COBA 2VJYA 1BX0A 2GS9A 2O6HA 2V4UA 4WDRA 2R0QC 4ZAWA 1EBBA 4HB4A 3X44A 4EYSA 3CGWA 4PANA 2WE7A 5JJ5A 3U3DA 1UEIA 2I7DA 3BMOB 2IH5A 2ICAA 4DYVA 2QD4A 2QM3A 1JEAA 2EW2A 2P3SA 1CZUA 4RUKA 1IATA 1GPWB 1QVRA 3BXPA 3EGDA 4DR2B 2F62A 4RDXA 4YQEA 5JANA 2FFJA 5A3SA 1UMDA 1WSDA 1XTZA 4N9QA 3UAWA 5EE1A 1MJGM 1ULZA 4DBLE 2J41A 3FIUA 4DJAA 1ZAKA 1E69A 2ODWA 3V42A 4G1FA 1BZYA 2MU1A 2RHLA 1EVYA 4C6RA 1P1KA 1JB1A 1U9CA 1J6UA 1P2UA 1TZ2A 3U4MA 3GXOA 4FGKA 1D2GA 2O8FB 4D74A 3P1JA 2HWYA 1CNFA 3ZN2A 4AZ3B 4C2BA 2ZG6A 3LNTA 1JU3A 1VBFA 3I83A 1UT5A 2BFBA 4W6QA 1XTTA 4E1AA 2ODBA 5EJ2A 5TMEA 4N47A 4QKQA 1CQIB 2FW8A 1JYSA 4PZZA 4LSGA 3N7UA 2WOJA 2YUTA 4M3NA 1E32A 2J08A 5DYWA 5FPTA 3DYIA 1IY2A 1X77A 3IP5A 3OEHA 1YQUA 3OZRA 3HKEB 2XV1A 2QQFA 1P2DA 2WHRA 3OT5A 3H9CA 1IAVA 3W5BA 1P1FA 5J2TF 5AESA 4O08A 5SV2A 1VSQA 2DY1A 3VZRA 2QBYA 4JGIA 2JLSA 1ND5A 3R5FA 2WT9A 1JDUA 3DOEA 1F1BA 3KEFA 3OIGA 3CIFA 4A6XA 3UYYA 1KSHA 3H11B 1AA6A 2YMMA 3OIDA 4AX8A 2XXAA 1EVQA 1FPMA 1MPTA 1RR6A 4LRYA 4CLRB 3KQMA 1OZAA 5LZ9A 4OHPA 3PDWA 3NATA 3GG9A 3KYJB 4TXNA 3LUKA 2VXOA 1GPKA 4MWGA 4E70A 4EA6A 3ICVA 3R3XA 2JJQA 3T15A 4G0OA 1I2DA 5L3QA 2VDJA 3ZCXA 2WM8A 1H5NA 2QP9X 2O52A 2VXYA 1OA1A 4ZI7A 2PU5A 3QA9A 1W9MA 4CDMA 4P0QB 5L51A 4YHHB 3AJEA 1B00A 4G0MA 3S7ZA 3B60A 2YWGA 4IV8A 1S8NA 2SECE 5SZKB 2BHSA 4ZO9A 4DQVA 3OLCX 5CVTA 2P2NA 4FFSA 3DF7A 1FFSA 2GXSA 2XWQA 3BWXA 5AWFC 4OHVA 2BP7A 4RKRA 1DG3A 4TTJA 3RTAA 2ZWMA 1KOLA 1HY3A 1OI4A 3L4BC 3AHHA 3B7PA 4UHEA 1FJGB 3A05A 2JPDA 2OMKA 3DYVA 1FYWA 4RVNA 4Q21A 3UHAA 4ZAFA 1JPUA 2C3PA 3K0FA 4N65A 2PGNA 4FWIB 1Y1RA 1XIVA 1J0XO 2OO7A 1Y7LA 3WWZA 2PGIA 3I9OA 3F6PA 1QS0A 2ORYA 4XA8A 3KAKA 2TMGA 1E3SA 1HPLA 1QFMA 4UNQA 4R01A 2NU8A 2HHFB 1KARA 3B9RA 1TKAA 2QVBA 4F1JA 3KB2A 4G9EA 4ESVA 1ZM3A 2WJHA 3TW8A 2CFIA 2GNOA 2NM0A 2ZRJA 2Y0CA 3D8SA 3TGWA 3TLKA 4NZMA 4U0JA 1JDJA 3SSMA 3F96A 3K9QO 4RL6A 1PK7A 2H31A 1VPVA 3I01M 3WYBA 4LY6A 3MFYA 4BZZA 4MPDA 1SXQA 1K8QA 2ZBUA 4L5IA 1QNLA 1C1DB 4JROA 4NCAA 3I2JA 4LFCB 1JQJC 1W2HA 4GZLA 3WQSB 1CUFA 3OFND 2WZDA 2F1OA 1Y4ZA 1VYHA 1E3WA 4UCOA 2P30A 4MS1B 1DTEA 3ISJA 2ILVA 5DYNA 1E4EB 5H16A 3TRHA 4KYIB 1SUDA 3VR4D 1I2CA 3NIWA 1TAEA 4N54A 3TRFA 3RBXA 2YMLA 3VH2A 3SYRA 1H3EA 3HKBA 4H35A 5HNEA 1N77A 3VISA 4KNVA 4RW0A 1SU4A 2QG9A 1RIIA 3GNSA 4WFJA 3TLJA 3VC7A 3FJOA 1PCXA 1ESCA 1AY0A 2PIAA 3IH5A 4OP3A 4ZVTA 4YT4A 4P0PB 3NW9A 3K1JA 3EWNA 4U7DA 2QE6A 5EXPA 2F3PA 3SMVA 5I3CA 4R2LA 2EJUA 4JXKA 1AKQA 2APJA 2YXNA 4YRFA 3SHWA 4E5NA 5GVSA 1GDDA 5TVGA 1GGHA 3VAZA 2YV3A 4FFBB 1ZIPA 1QYIA 2QJOA 4MYHA 3G5TA 1I0IA 3UMVA 4JVLA 4KXFB 1HR0B 1EFHA 1G1AA 2WYIA 2XOEA 5AXAA 5BSUA 1YQEA 4F4DA 5HHTA 3IOMA 1EP2B 3E8SA 1XEXA 3UMSA 2L18A 4FNAA 3HRIA 4HD8A 1FJXA 1EP9A 3W8NA 1V1RA 3MW8A 5ALPA 1NUQA 4FHEA 2AW5A 3QUSA 1T35A 4K40A 4PRZA 4BQFA 5LSAA 5I5TA 1BXRB 2IP1A 3H17A 3QU4A 3U4HA 4B79A 4O4HB 2BFEA 1FMLA 2FW9A 5I9TA 2HA0A 1O4VA 2C58A 1VHDA 2W6NA 3H2IA 4C7JA 4E5SA 3RQIA 1A5ZA 1E9FA 2OV6A 4UOZA 2QRJA 4J0HA 1TUEA 2OHVA 5LQKA 1MT0A 3WMGA 1Q77A 4U9UA 1NJ5A 4UCUA 3V3KA 1K2WA 3QLTA 2FB9A 3VTZA 3I8XA 1BMQA 3JD3A 1QCCA 2G0AA 3FUTA 1NV9A 3IMFA 1N6HA 3LQQA 1AHIA 4FONA 4TWIA 1BXKA 1RWKA 2H4ZA 3KJQA 4RMHA 5CT4A 1N5DA 1ZICA 3ICPA 4YFYA 1TA0A 2PH5A 3PDIA 1M1UA 5DM0A 1YUBA 2Z43A 5CUQA 1NW5A 3T7SA 4AJEA 2W5UA 4NECA 2IXFA 1R74A 4E4TA 5B3JC 2RHHA 3ZK8A 1JG6A 4TLDA 5U4QA 3WGGA 1VJCA 4CRWB 2P0AA 3UJ3X 3V8MA 3LT0A 4B35A 3UFBA 1GG9A 3IKVA 3EDRA 3K35A 4QHYA 1ONPA 2GEVA 1HA3A 1T5BA 1I3OA 3FCAA 4BX9A 1V4BA 2UZ1A 1VE5A 1I10A 3MTBA 3B9PA 1N8TA 1KGDA 1Q1GA 3LSYA 2VAXA 4UNPA 1NQAO 1W87A 2ZUFA 1WV0A 1Q12A 3JZFA 3LCUA 1IK6A 3HUEA 3FKQA 3MQFA 4LKOA 2GILA 4TYQA 2VYQA 4AF8A 1LNZA 2SBTA 5EZYF 4ZCLA 1PLJA 4UCFA 3KPYA 4JDPA 3BXEA 1WVGA 3PC8C 5A2GA 5IN4A 3IR6A 1KP2A 2EKLA 2Q4BA 5KNDH 2ZRCA 4A27A 4X65B 2XUPA 3EIFA 4PLGA 3J7TA 1FJ2A 2O5VA 2E4WA 1ZM7A 2O20A 1DXHA 2PN1A 4I81A 3PA6A 3T3IA 2Q1UA 5THKA 3WYGA 2NXWA 2OORA 3QEOA 4IW3B 1K3FA 1YJXA 2V4ZA 1XKXA 2WF8A 4CKWB 1S2OA 4KQWA 1OCEA 5GY7A 4NZ9A 1HQKA 1E1CA 4M1EA 1ZGJA 1CR0A 4QGGA 5CLQA 4ZO7A 3RRXA 1DQPA 4DDUA 3RF6A 2NV0A 1OX4B 3AGQA 1JMKC 4IDCA 3RVKA 1EFRD 5KSWB 5HRAA 2HU5A 2VOJA 1Z25A 3R7WB 3ROPA 2HMTA 3L8HA 1PF7E 2AMFA 1PL0A 1IONA 3KLOA 1HYHA 4UBMA 3H83A 1CRWG 4YRCA 1RI5A 5DYIA 3H2JA 4GP6A 3B53X 1E6EA 1F2VA 2IHVA 5ALKA 3T1QA 5FWXA 2CDBA 5FAKA 4RVFA 3IPLA 3EVGA 2PGAA 3EH1A 4O2AB 3FZQA 5IKXA 8MHTA 1W2WB 4ZOLF 2PZAA 1QONA 3ZIAA 4XRGA 4F93B 1V43A 1N2ZA 1H8HD 3LT1A 1BRMA 4U7PB 3MUFA 1PJ3A 4RHXA 4ZAYA 1QDEA 3VSEA 3LYUA 3ES9A 5K8JB 1Z75A 1BWQA 2D8AA 1GGEA 1WUHS 2JCXA 3E9MA 2YH2A 5CIYA 4KRXA 3G0GA 2TMKA 4PPGA 5JYBA 4PX2A 4D44A 2Q3CA 4L75A 4WLVA 1C9DB 4X63A 1MZVA 5DNDA 4L85A 2QTZA 2RHMA 4UKDA 5C8YB 2WIBA 2CXQA 4I99A 3H05A 2BUCA 1M1YE 2GPAA 3O91A 4N0MA 1C4OA 1E1QA 1L3CA 2GTHA 2QX6A 2X2FA 4KQJA 2ZBVA 4LMRA 2ZIEA 3B7GA 2BM0A 4QTTB 4RKYA 1NVVQ 2R48A 2QAGC 4GLFA 3UTCA 1R5BA 521PA 4BPRA 1ULBA 4L22A 1L7XA 1NJ8A 3A36A 1H5QA 3TFWA 5IZCA 4A73A 4HRXA 1PGPA 3N3BC 5H5JA 4KG7A 1GQYA 4P3KA 2RGWA 1PR4A 1IY9A 2VYVA 5KTSA 3CLRD 1RJWA 4C88A 2Z09A 1USVA 1P16A 1VI6A 3VYRB 2RC5A 1LSOA 3TZ6A 1KMMA 2Y1XA 3FSEA 2O2CA 3IQFA 1KH2A 2GASA 2X5KO 3LDHA 4MRMA 2Q6OA 2ZJBA 4UBIA 4YMSA 4KVZA 4M4SA 3Q7PA 2O8DA 2C1ZA 5AVOA 3L7DA 1WHTB 4QWMA 2W00A 2GBPA 1BVUA 1TFRA 4PHGA 1ESEA 2A0UA 2COUA 5LVAA 3PEWA 5P21A 3EXHA 2JANA 1LEHA 5EJFA 4K0RA 4H7DA 4FEEA 2I6TA 2PXCA 4OGGA 4RZQA 2CN1A 4RIIA 4XYLB 4TQ9A 3BGWA 4K1LA 1NR7A 1TEXA 2W58A 4FN5A 4M6WA 4Y9UA 2FQWA 2XZOA 3VKVA 4NH0A 1F8UA 2P6OA 5E6UB 4HDKB 3CS3A 4DLLA 5K20A 2RD2A 3LQYA 5BNTA 3ETJA 1CNEA 2I7VA 1GT6A 3PFFA 3URKA 4Q66C 3FTQA 1FNSA 1RQGA 3ELBA 2QIPA 4JBHA 1IEWA 1NXSA 4LMBA 4RD2A 2NTVA 1NKTA 3CZ9A 2PMDA 2AN1A 3LBYA 5JO9A 3C8DA 3LPDA 1ISMA 1NQ5A 1DKOA 2HWKA 1B2RA 3NIFB 2Z6QA 2GM5A 5HKOA 1Y33E 4B8ZA 3BICA 4GLXA 4LRUA 2IXAA 3MILA 4WRRA 3B3QA 1G64A 5K8UA 2OQ2A 3FFXA 1GQFA 2F1IA 3GU3A 5KNDD 5EE3A 2PSJA 5HJ5A 4WA8A 1T10A 4EFNA 1BHO1 2ZAMA 1LI5A 4DG9A 4C01A 2C3YA 4G0VA 3EG5A 1OVMA 3I37X 2CDRA 4LZPA 3ZI7A 5CDHA 1K7YA 4CCSA 3F6SA 3T7CA 5EXXA 3U3RA 2E55A 3UGKA 4YH1A 2OA0A 4XARA 4Q3BA 3TLMA 3AHGA 1I2LA 1Z34A 2OECA 5DHSA 1RMYA 5CLFA 3COWA 1NBME 2NVUA 4IJ6A 1HI9A 2VTKA 3ZS8A 1N2OA 4UOQA 3IVXA 2O1WA 1I33A 1KO8A 4OB7A 4LJ4A 3JWJA 2VHQA 3SQOA 1IBCA 1QQ6A 4OQMA 5K6RA 4MYRA 3ISTA 3QKWA 1GRQA 1N0IA 4BMXA 1TTPB 4PO3X 3CUKA 2JCYA 2DSTA 1ZUNB 2FSGA 1W581 1PZNA 3BF8A 4K2AA 3TOSA 1X8KA 4KWCA 1TZCA 4IEFB 1DCTA 1ZGBA 1BU8A 2BFDB 2Q1WA 1AIPA 1UXIA 4GOOD 1E6KA 1T6YA 4EHJA 1Z12A 3VNNA 4Q9JA 4J91A 2BSAA 1LPNA 4MRVA 2JC3A 1XKTA 3TZKA 1TA9A 3BHMA 3FCCA 2NQ2C 3O1HB 5KNCH 3L07A 3G2KA 4UM8B 1DIRA 1DEXA 1GGNA 2CCJA 5BQ5A 2ZJ6A 2AUTA 4PG4A 2VTBA 1KERA 3IEVA 1T3LA 1OFUA 2JAHA 2IYQA 2GNAA 3GJ5A 2NZJA 3I9JA 2I9PA 3Q8WA 3JS5A 3DL0A 4R6XA 4GDMA 4U8HA 2Q4EA 1WWKA 2FSHA 4XTRA 1VXOA 5EMLA 1QGOA 3LQFA 1LC0A 3CVJA 3TLEA 3LHIA 5DM60 4E6NA 1D4OA 3DZHA 4A0QA 3V4OA 2WMOB 4F9EA 5I4CA 1P5HA 3MJVA 1XYGA 1EXNA 4MXDA 4QGAA 1UWCA 2IYEA 2BGTA 2PAAA 3NT4A 3WYFA 2H5EA 3WGYA 5HJ2A 3PNMA 1D03A 1YR7A 1C9EA 1IQPA 3UK2A 5IBCA 4KAXA 3HTXA 5EXEA 4L02A 1DBRA 2F7SA 2H2FA 2VZEA 2Z6VA 3H5RA 4FEYA 4ZOLA 5H59A 3REOA 4O86A 2D8MA 1C0PA 4TN5A 3V8EA 4CQMD 2Q99A 2W2KA 5FNVB 4KAFA 4MVJD 1CUEA 1IY1A 2X58A 1JMVA 2CXPA 3BACA 3EFEA 4Q6WA 2H59A 4JQSA 1NURA 3GEPA 1V8PA 4U9IS 2FMUA 3OIYA 2ZTMA 2F8MA 3L0SA 3I53A 3UMGA 2UUOA 3DP9A 3OE5A 5AUNB 4F85A 1GZVA 1YK1A 4NC9A 1WUIS 2Q3MA 1G8PA 1KK1A 1XN1A 4TVBA 1H2RS 3QX9A 2R47A 1U8XX 3M4XA 3D4BA 3LZ6A 3ZGXA 1UBRS 3RVSA 1F2TB 3HWX1 2CXSA 2C4WA 1F8XA 4HQRA 1AHNA 2AUMA 5ICSA 4BNNA 2BEWA 2XW6A 1K89A 2WSLA 1Z6GA 3I42A 4HGYA 1LA2A 3EASA 5LNK6 3FWHA 3OJEA 2ZWPA 1OH5A 2OC4A 2XKJE 2WEKA 4ZP1A 5KVAA 1NVFA 2EX0A 4FILA 4E1VA 1DJPA 2R6FA 4WBNA 4DCTA 5HTOA 2B7CA 2HF2A 4DV6B 1EFTA 4HAWA 2ZATA 1CDDA 3BSWA 1HT1E 3RE1A 4D5GA 2I65A 3PYLA 1M1YA 3JWPA 1H5UA 2DKOA 4LJ7A 3WIUA 4ARSA 4D97A 3KKKA 1D1TA 3A2NA 5DNAA 1Y63A 5BR4A 1STOA 2EJ2A 3NDJA 3PEFA 4IDQA 2JEOA 4JWKA 4R9UC 4PE5B 3JSNA 1GY8A 1I2MA 3FYCA 4GR4A 5K8LA 4UAVA 4LV5B 4C0BA 1KBZA 1T25A 2ERYA 2W2PA 2ACEA 2QUKA 2OZPA 3FKJA 4RJKA 3UWOA 3PGKA 3GL9A 3OSZA 4ERNA 4CC5A 1Z06A 1HE8B 1TCAA 1JGTA 1AN0A 4LQLA 5KO2A 1VG9B 3D6JA 1M83A 2I1QA 2QJFA 2HYIC 1QF6A 1U9IC 2UYQA 3UICA 4BNDB 2V7PA 1EXMA 1N9ZA 1R50A 1VLQA 3GDOA 2FWNA 2QTVB 4I6EA 4O2LA 1J5XA 3D7KA 3CH6A 5EPOA 4ZC1A 1THTA 2B30A 2YOFA 4GI7A 1Z0JA 4PN3A 3RWOA 2FU5C 4FCVA 5TJ9A 5FUQA 5DWQA 3WWHA 4EDFA 3CX3A 4NJEA 4QARA 3C8ZA 1CZHA 3T7TA 1NNEA 2CUTA 1CUYA 1JG7A 5EY5B 1QHFA 2VWHA 2X22A 1ECPA 2AT1A 4MNTA 3B78A 2FY8A 5JMTA 3QHAA 4Q7QA 1CB0A 1U2DA 4HAYA 5H3HA 4EHFA 5AW2A 3EFOB 2OWEA 4RQUA 4TV9B 3ADCA 3F6YA 3SVTA 3A04A 3HGQA 1UAGA 3NLLA 5HUJA 3A6JA 3X1ZA 3I34X 5DE3A 3SC4A 2R65A 1YI0A 2WIFA 1H6AA 2EXXA 2Y6VA 4BIIA 1USKA 5E1DA 4FC7A 2YZKA 1K6IA 2GCGA 5CBPB 4EHLA 3VKHA 2VJPA 2CE7A 4NYIQ 3VNBA 1WXHA 4QVKA 2GWRA 3WICA 1P3JA 1KVRA 1CY0A 3IE1A 3WDKA 1YB2A 4Q9KA 1KZYC 1TK2A 1M10A 5JASA 4Q4CA 2QN7A 1KXZA 2XF2A 3LOUA 4R1QA 3GBSA 3SFVA 4A3SA 1NVXQ 2QT9A 1I80A 1L7QA 2A5YB 1PGQA 1O6FA 4D41A 2HK8A 2VHCA 4G5FA 4J29A 5D3ZA 5J4LA 4PNZA 2IU3A 5KHOC 1XFAA 1W1IA 1OKKA 1JQKA 2FXIA 3CH5A 2OSVA 2Z5FA 1W1UA 5T8KA 4OXYA 2H2WA 1CUWA 4K6NA 1YHZA 3U4QA 1G2PA 3O9MA 4CC6A 4Q5IA 2AZDA 2DYKA 4TL8A 1L8AA 4ZQFA 1Z8FA 5MN4A 4F45A 5IK2D 4LHZA 4PHFA 1NBMA 2WNHA 1ZD3A 4FDTA 3CY6A 5DXFA 2P6MA 4OBBA 2QVYX 4Z99A 3A1CA 4CT4B 2R7MA 1I1OA 3EG9A 3ZU6A 1HQYE 3W9UA 1NUHA 3WLJA 4QBFA 4R81A 5CLIA 4HPXB 4L15A 3EF3A 4MEJA 4KYUA 2AFHA 2KWIA 4FI3C 3UUEA 3JZDA 1D0VA 3E81A 3WKCA 2BDEA 4EFEA 4XE5A 3CN7A 1N5KA 4MLZA 4MQUA 2EG5A 4E13A 1I7SB 4FQ5A 5FOUA 4D56A 1CE8A 4BQOA 5DSZA 1NXWA 1S5PA 1FVHA 3LCCA 4I5GA 4Y2PA 3S2UA 1FMTA 3HACA 5A05A 3DPSA 4D0GA 4KR7A 4ZMBA 2QN1A 1EHIA 3L40A 3KWLA 5EWLA 4AK9A 4F92B 3H87A 2H1LA 5C1OA 2JF0A 4L9RA 2H7VA 1WZ2A 3EGXB 3LUDA 1MU0A 1Z7WA 1JJ7A 5TB5A 4WY2A 1TB4A 4HSGA 3RJ9A 3HO6A 1JWBB 3EQ8A 1KBOA 1PTJC 5D01A 1EVIA 1LI7A 2HXSA 2RK6A 1NXVA 4GPAA 3IDZA 4EY3A 4HATA 1ZMBA 5EI5A 1OPRA 1PP4A 3PFNA 4WERA 2BISA 2FCAA 4AJJA 4CLDA 4YV7A 2PUBA 3O0DA 2CD9A 4GL2A 2PKEA 1SXJC 3OTWA 1OAKA 1RLOA 1MG5A 4BMYA 2RK4A 4GGOA 4OH7A 1NW9B 1RKQA 4MQ4A 4RD1A 4BO8A 4QXAA 1Z7EA 5FTWA 3IBSA 5DBOA 1D8AA 2AR0A 3ZXYA 2Z57A 2C61A 4TMZA 1EFDN 2IPNA 2I1VB 3KSDO 1L7MA 1IK4A 1PV4A 2GXQA 2WIAA 3C6QA 4BFUA 5IYZB 4ZT3A 2MSDB 1RJGA 1IBSA 5BUQA 1NMEA 3OZAA 3H9EO 4N40A 3R7FA 4AIRA 3AXSA 3E84A 4DY6A 4LC1A 5TV2A 2D1SA 3GFVA 3HSKA 1NULA 4PLVA 4RA9B 1H0RA 3OD1A 4UTOA 5ALLA 1KIFA 1TNDA 1H1TA 1V8BA 5KYVA 1CX9B 4LK3A 1XFDA 4BLWA 5ALOA 2LWIA 5FDFA 4BP9A 5IM4A 1JJVA 5E4TA 2XA1A 1N1MA 5F35A 1C9YA 1KRXA 3EFBA 3PDCA 2AIRA 3JD1A 3QFCA 3JAKB 1PJRA 4YT2A 1RI3A 3DBHB 3QUTA 1W5SA 2ZBPA 5KYUA 2F43A 4HP8A 1XTPA 1ODTC 5BWRA 4NH4A 3OWOA 4JLNA 1YBHA 1FNNA 2ANCA 3IBFA 5C1PA 1YQGA 1Z5GA 3KEGA 5C4IA 1KQOA 2XDAA 3NDIA 4MUIA 3EQ2A 3LKZA 3RSFA 3ILYA 1OLUB 1KFJB 1JL3A 2AFRA 1CUAA 4OQZA 2NU9B 5DCYA 4YUAA 1Q3KA 3QW2A 4NENA 3WQQA 2HRCA 4GLBA 4LBVA 4RVHA 3CWQA 5MF6A 2A7XA 2ZXEA 3AKYA 2HNBA 1M2VB 4WOBA 1Q0HA 3ZH2A 4RULA 3SQDA 3D3WB 2A5LA 2X1LA 5EERA 5LLSA 1I4LD 3SS9X 3EGWA 3GJ7A 3PIRA 4JP5A 4PZ8A 4M1QA 1S1CA 1XD9A 1LLDA 1KI7A 1SC9A 2OENG 4Q4LA 3OQMA 3GIWA 4Q00A 1IJKA 3ZE9A 1ZJYA 2BGRA 3DXZA 2RJ3A 1K27A 5LN1A 1G0OA 1LBTA 2Q2QA 3WNCA 4NYIR 4UJ5A 2F4VB 1K7XB 3H5LA 2X2OA 1D6JA 2QGNA 3B2EA 1A27A 2QTNA 4O7NA 3E0XA 4UHBA 2C4TA 4WK4B 5FJIA 4DY4A 2P75A 4QBHA 3K9HA 2C5BA 2G07A 4AFNA 3KDSE 2C59A 3AP3A 5LZ7A 3NIGB 4ZZ3A 7YASA 3WR5A 4BV9A 2NUTA 2Q46A 5FPPA 1Y1LA 1NVWQ 3MT7A 3UBTA 1RXWA 1DAHA 2FUCA 3GPCA 2XMCA 4KJZA 5ULLA 4BNUA 2GLTA 1VPTA 4GRIA 1TU4A 2MSWA 3L0IB 2GHTA 4LOAA 1MKYA 2ZT5A 3AU8A 3BB1A 1KAMA 1CZOA 2P91A 4AG6A 1W5FA 3E18A 1RC8A 2BBSA 4XYMB 2R1ZA 2ZB7A 5ITVA 1P2VA 3IOEA 1QKIA 2H1VA 1S02A 5FL7A 5JC1A 4WE3A 3F98A 3OZGA 1J97A 4WW0A 2OTCA 3N8IA 5AJYA 3VAAA 5C3MA 1PQ4A 4KE6A 4KBFA 1Z2OX 1R6TA 2BTEA 2AF4C 2CZQA 1LK7A 1NF2A 5IZ4A 4MWZA 4FR0A 5FI0B 3R74A 5FQNA 1ARZA 1X7XA 3MUOA 4HWKA 2FXVA 1GTVA 4K6HA 3SM9A 4GVXA 1DDOA 2ZRFA 4HMOA 2H9YA 4V1CA 3JAWA 4I1VA 4EVSA 2ZBRA 4WNYA 3UPDA 5E3IA 1P4GA 3KOMA 1ZH6A 4Q03A 3L2PA 5K99A 4WOPA 1VCOA 2QZ4A 4BKOA 5DNUA 4XZ3B 1AHHA 1X7GA 3TI7A 3BA6A 4L73A 1CUXA 3R6LA 1T24A 4K9OA 4M1OA 1H2YA 3BJRA 3SZRA 2AE1A 4KKXB 3IR5A 2N0SA 1XMJA 5K3DA 3LKBA 4ZXPA 2QX4A 3DNMA 3A4MA 3M6AA 2GOYA 1M67A 2CNNA 5FWAA 4O02B 2QAGA 3A9CA 3D2AA 2QRQA 3FTPA 1P1CA 3S8MA 4BP1A 2ZLBA 4CCYA 3A3NA 1EHCA 5FTKA 3B82A 3SIRA 1KDZA 3RSOA 4EYQA 4N7MA 2GPNA 2R4TA 1Z68A 2QUZA 2JIBA 1BS9A 5A6SB 2RI6A 4B40A 2V65A 4DGQA 3K0SA 3D1VA 2PX6A 3IOCA 5F77A 2ZIZA 3KYDB 2NTNA 4ITRC 4RJIA 3B5IA 4M8KA 4Y6QA 5B1IA 5T64A 1ZS9A 3TIFA 3WRYC 1VB5A 2VDRB 2XZPA 4HSEA 2X19A 4TMKA 3TOVA 1O8CA 3OFNA 4XRRA 3RUFA 3QENA 1UDAA 2VRBA 5CYFA 1QRUA 1RZVA 1HQDA 5GJVC 4DV0B 1SQFA 2IDMA 1KT8A 4MVJG 5B37A 3VR4A 1T4CB 2JFXA 3AZOA 4B46A 1XEWY 4BKMA 4UFPA 2JK1A 3F7NA 1GQQA 3CLVA 1YDEA 2WHYA 3BMXA 4XJVA 2CNQA 1TT5B 2R60A 1CXZA 1SRQA 3SR0A 1J8VA 1JLMA 1AOXA 3FB4A 4FDLA 1P39A 1OTHA 3AEUB 2FN4A 3JQBA 5B1HA 3M6XA 5B12A 5KYNA 2V5VA 4I3HA 3D2BA 5JU6A 2ISSD 3QVGB 1P81A 3LFHA 1N6LA 1EZZA 3GJ4A 2K7FA 2J33A 4WD3A 1EFUA 2UZAA 4WCDA 3N2LA 3UJDA 1X14A 4FFLA 3VNSA 3TVTA 2FMXA 2EKDA 1Z3CA 3E35A 4NBTA 5H02A 5EWMB 1Q0RA 1CQWA 2ZRPA 2AXPA 5FEMA 2REXB 1ZIYA 3QXGA 2JCGA 5E2AA 4XB1A 3FX2A 2Q5OA 4ZHQF 1SBIA 1G5IA 1A8SA 1JSLA 4QDKA 3NTLA 2EGGA 4UTNA 3LIIA 1YQXA 1DFIA 1RTTA 4JP2A 2DJ5A 1E9CA 2FRVA 3L1KA 4KX3A 4Q4HB 1BFKA 5IC6A 1GYPA 2CMGA 2B4AA 3UO8B 4KN6A 1OQAA 2VDKB 1BEZA 1N5RA 2A8YA 1RQNA 4KH1A 3UT5B 5JNLA 3GLFE 1ZGAA 2HXGA 1FW6A 3A6DA 2GYUA 5I7SA 2R82A 4CG0A 3QWIA 4XSVA 5JG7A 3JQAD 2IPMA 3MCVA 1MJ5A 2V6FA 3FDZB 4HNAB 3JVEA 4AN1A 1R2QA 1XNHA 1K5DA 1BOOA 1KMIY 3LLSA 2AK3A 4PSKA 5GWXA 4EKIA 3TD2A 3C3WA 5HG0A 1P2FA 4PAGA 4ICIA 3L06A 1XDNA 2EGUA 4PO8A 3ONNA 5IKEA 3HRHA 2ZS7A 4HEQA 3JVVA 2ZUWA 5FTMA 3VPHA 5BVHA 3U3OA 2OZLB 3KT3A 1FSGA 4WV3A 2LZ0A 3N2ZB 2C96A 4PN7A 2B92A 3IIIA 2OWDA 4PG7A 5I7FA 5L7WA 4S05A 4KI7A 4OP1A 4NXNB 1F6WA