3AW8A

Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
366
structure length
360
Chain Sequence
MIGILGGGQLGRMLALAGYPLGLSFRFLDPSPEACAGQVGELVVGEFLDEGALLRFAEGLALVTYEFENVPVEAARRLEGRLPLYPPAKALEVAQDRLREKTFFQGLGVPTPPFHPVDGPEDLEEGLKRVGLPALLKTRRGQALVRTEEEALEALKALGGRGLILEGFVPFDREVSLLAVRGRTGEVAFYPLVENRHWGGILRLSLAPAPGASEALQKKAEAYALRAMEALDYVGVLALEFFQVGEELLFNEMAPRVHNSGHWTIEGAETSQFENHLRAVLGLPLGSTAPRGQSAMVNLIGEKPPFAEVLKVEGAHLHWYGKAVRPGRKVGHITLRRDGLKALEEGLARLSRLVSELPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title Crystal structures of N5-carboxyaminoimidazole ribonucleotide synthetase, PurK, from thermophilic bacteria
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 107
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3aw8A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aw8A01
1CS0A 4MV6A 1A9XA 3TINA 2GPSA 2Z04A 4TUYF 4ME6A 3TIIA 1UC8A 1OBGA 2P0AA 3U9TA 1I7NA 1E4EB 2GLTA 3VA7A 1AUVA 3E5NA 3R23A 2YW2A 4FFMA 5D8DA 1Z2PX 3UFXB 3JRWA 2V59A 5J2TF 2VHEA 1DV1A 2W6OA 4O82A 5KKNB 2R82A 3RFCA 5JQWA 4O7YA 2R87A 3HBLA 4TV9F 4C5CA 1EUCB 3N8DA 1M0TA 2W71A 5GONF 2CNVA 3I12A 2CZGA 4E4TA 2VR1A 4MV3A 4IIJF 2YS6A 3TQTA 4XYMB 1BNCA 1C3OA 3ORRA 4O7NA 2NUAB 1W96A 5CA1F 5JVLA 2NU7B 2W6MA 4GGMX 1ULZA 2V5AA 4IZOA 5BMVF 4EGQA 4HQ6A 4MV1A 4YAKB 2YWVA 5LYJF 3ETJA 3JRXA 4O7WA 1IOVA 4HR7A 3KAKA 4I50F 5HV6A 3ETHA 3WO0A 2R7MA 1JDBB 2R85A 5IYZF 4XZ3B 4O83A 2V58A 3RV3A 3KAJA 4I4TF 5EZYF 5LP6F 2IP4A 4EAAA 2HGSA 3QFFA 1VBGA 2HJWA 1Z2NX 5LXTF 2YZGA 1KUTA 1OBDA 4O4JF 4HNVA 3VOTA 3JZFA 4FFOA 3LWBA 3BSYA 1M0WA 2NU6B 2VPQA 1GSAA 4O7ZA 4O7VA 3GIDA 2FPIB 2PVPA 3BG5A 1CE8A 1UC9A 2Z02A 4HNUA 4IHJF 3OUZA 1KBLA 4QSHA 3BSWA 1DIKA 3OUUA 4EG0A 1CQJB 3K5IA 1Z2OX 2YRXA 4RZQA 4DLKA 5K2MA 1C30A 5JQGF 4MV4A 3VPBA 1AUXA 1JKJB 3TW6A 5JH7F 3WNZA 3KALA 2W6PA 3K5HA 4WBNF 4C5BA 2NPOA 1W93A 2CNUA 1BXRA 4O2BF 2NU9B 5JVDF 5CA0F 1WR2A 1JLLB 2I80A 2I8CA 4MV8A 3BSSA 2OLSA 1KJ8A 5LOVF 3RUPA 2R86A 3LP8A 1KC7A 3WO1A 1GGOA 4M98A 3RV4A 5HBRB 2GQSA 2WYOA 1EHIA 2FPGB 4O84A 2VQDA 2ZDQA 2DLNA 3N6RA 2R7NA 3SE7A 2YZLA 4O4LF 4O81A 2PN1A 2YL2A 1KJIA 2ZDGA 4ZI7F 4IWXA 4XYLB 4J6EA 5C1OA 4EA7A 3GLKA 2W70A 5J2UF 2W6ZA 4O4HF 2QF7A 2R84A 1DV2A 4MA5A 4YJ2F 3Q1KA 4IWYA 5C8YF 3AW8A 3R5FA 5FNVF 1PK8A 3VPDA 4O7TA 2YRWA 3K3PA 4FFPA 1A48A 4O86A 2GQRA 3V4ZA 4FFNA 4WD3A 3MJFA 4TV8F 2YYAA 2YZNA 3AX6A 3R5HA 5C1PA 3U9SA 4HNTA 2SCUB 3TIGA 1KEEA 5H80A 1IOWA 2DWCA 3BFPA 4FE2A 2QK4A 4MAMA 2YS7A 4O4IF 4O7RA 1I7LA 3R9RA 2YZMA 2ZDHA 1VBHA 1KJQA 3G8CA 5CB4F 4I55F 2R7LA 3ORQA 3VPCA 1EUDB 4YB8B 3JZIA 4C5AA 3MWEA 3DF7A 1CQIB 4XX0B 4Y8VB 2PBZA 1PX2A 1GSHA 2DZDA 4EABA 4EA9A 1VKZA 2FB9A 4FFRA 2DIKA 3U54A 2J9GA 3Q2OA 1E4EA 4O2AF 3G8DA 1GSOA 4FGRA 1M6VA 2I87A 2C00A 4ZHQF 4EGJA 5KX5F 4YAJB 5CAEB 4EA8A 4YBZB 4YJ3F 4DIMA 1T36A 4M99A 3V4SA 1JDEA 1B6SA 1EYZA 3MWDA 3HO8A 3KREA 2GPWA 2XCLA 4NYEA 5LA6F 2NU8B 4ZQIA 4MV9A 4M9CA 4FFLA 5BPHA 2W6QA 3HB9A 2CNQA 2FPPB 3R5XA 4M9UA 5I47A 2R7KA 1B6RA 2FP4B 2W6NA 4L1KA 4ZOLF 4FU0A 1KJJA 5DMXA 5BPFA 1SCUB 2X0SA 3NUAA 1GLVA 4MV7A 4O7SA 3U55A 1KJ9A 4O7LA 4MA0A 2XD4A 3VMMA 1EZ1A
chains in the Genus database with same CATH superfamily
3THYA 4BNHA 2RC5A 3EOBI 5K3DA 1SXJE 3MGAA 4AZSA 4QJ3A 5I6DA 4CR8A 3ZV3A 3QYJA 2DH6A 2VHCA 2Q6IA 4G37A 2OVFA 1K3TA 5EJAA 2HR1A 2P11A 3FNBA 4EW6A 1X6VA 4BO9A 1ESDA 3B53X 1P5HA 1K2WA 1QZXA 2JDIA 2JRCA 3IVAA 5DRTA 5KVSA 1DLIA 4BJ6A 3U61B 3UG6A 3ONVA 3T9CA 1KPIA 1EXNA 5I51A 4C01A 2OGUA 3GZTB 3GRUA 4G24A 4Z9BA 2RIPA 1DQRA 3DAGA 4TLBA 3KB2A 4IH4A 1D4FA 1ZOOA 2LVBA 2OG1A 4RY0A 3OE5A 1L7BA 2QMHA 3CNEA 5HF9A 4DUYB 4TKMA 4YO8A 2DQSA 3DULA 4D9FA 1IUPA 1HDCA 4GIBA 5BVGB 1Z7GA 3D5EA 4TX1A 5FPPA 3ONEA 2DE0X 2GSDA 4OLJA 4Y18A 5KYTA 3BDIA 3COSA 1A7JA 4DWWA 2H59A 4LZAA 2FLWA 4CLEA 5FFMA 1AQLA 1T8WA 3D7NA 2NAPA 2VHEA 4D44A 5EP4A 3JQ8B 1MX9A 4Z99A 4B34A 4G2NA 5CAEA 1HNZB 3PD7A 2JIBA 1KA9H 2C94A 4IHAA 4U6QA 3JQGA 1Z6GA 3WHLA 3M89A 1JBEA 1REQA 4CV1A 4AICA 2AQ8A 2ID8A 3OM9A 5GV8A 4EBBA 1JMKC 4KIGA 1DTSA 5ALEA 3KLOA 3ZZNA 4BMZA 5IWAB 1NMZA 4IO1A 1TAUA 3HDJA 1PD0A 1C2YA 3IEIA 4CIAA 2ZTHA 2QPLA 4EJSB 2RKOA 3GT0A 1M76A 5EUCA 4H3HB 4OQMA 5LMZA 5IABA 4JA2A 4NZMA 1C4KA 1Z39A 2FGJA 4HZUA 1H9CA 1XRPA 1O8BA 2DGDA 2W71A 1F14A 1NP3A 2VA9A 3WLRA 3ER9A 4HWOA 1KSHA 2CNVA 3FD8A 3KAQA 1GZ3A 1LPOA 3VX3A 1WEHA 2V74B 2YHAA 3EIEA 5LOVA 1P8LA 3ES9A 2VR1A 4JBWA 2CW5A 2VJLA 1G9XA 1A9QA 2WLSA 3D7KA 3B6JA 3QW4B 5FO0A 2OCYC 1OH8A 4TLAA 4O4HB 1A8SA 3M5WA 3PQ5A 1VDMA 2HU5A 3TRIA 4O7NA 1JWAB 4ZDIA 5LR6A 4LS3A 3OEHD 3U4CA 3B82A 3GLUA 5F35A 1QOPB 4ATNA 4D99A 3CF4A 4ZOQI 3D8NA 1CNEA 4QFBA 4QDOA 1RYZA 4L3VA 5KYNA 3ZY2A 2J0SA 2IOHA 3FGOA 4RNCA 2MINB 4C4OA 4IGFA 3I2YX 3W9SA 3QMMA 1TK2A 3ZJUA 1I14A 1MMFB 1MQ8B 1P3JA 1U5BB 3NORA 1IHOA 5ALKA 5IJXA 3VUFA 3WGYA 2QRVA 5LYJF 3F1KA 1E3MA 1PR2A 4JBXA 1I1NA 1SQSA 2PVSA 2Q8QA 2ZE6A 1M66A 1QCCA 1P45A 3F47A 4I4NA 4ASUD 4HUTA 4TVSA 1XPRA 3IBFA 2CXRA 3C41J 5EJ9A 3S81A 1QP4A 5ECWA 2CF6A 1VPVA 2V8BA 1KJZA 1T29A 3KSRA 1XDWA 1BMQA 4F1KA 2JHCA 1EUYA 4WOJA 1HWYA 1TTQB 2Q9BA 1EVKA 1Z4OA 4C0AC 1GA1A 4Q7MB 2XTAA 5C37A 4G63A 1DRUA 2JLQA 4EECA 1AMNA 3NFYA 3K6KA 1GAQA 3OEED 4JSYA 2OA0A 1FJGB 2RCYA 3OCCA 1THTA 4X1OA 1VP3A 4XZ3B 1JJBA 2AN9A 2JFXA 4E07A 3LUDA 3V7WA 2WD9A 3NTOA 5A0FA 5E8RA 4I4TF 1QVAA 3LXRA 4GZLA 1FDVA 1E1KA 1NYLA 3ZR4B 2AOVA 2IP4A 1JAIA 1MHPA 4N7JA 1HG0A 1Q44A 4JMLA 3P2JA 4CLDA 1Y3FE 1J20A 3T4UA 4CF6A 3DOFA 5ELXA 3PU6A 2NOAA 4G1UC 4BRWA 5BQ3A 1RRGA 2ODEA 3KQPA 1E3EA 2DULA 3GGJA 3LQYA 3RYIA 4ZI2A 3ZLBA 4BO0A 1UIRA 2PRZA 2CYAA 821PA 4NDNE 2R8PA 4JXKA 4NFLA 1QBKC 3TL6A 3BJMA 4HNVA 3PKJA 2JCSA 2WWXA 3H1TA 4HAOA 2OO7A 2C2MA 4RKEA 3FTFA 3T4EA 1GPUA 3I6BA 3GNLA 1B0PA 1ZUD1 3RBVA 4L8GA 1ISMA 3LLUA 4GPTA 2HGXA 4OAPA 3O8NA 3RJMA 1AQIA 2NZVG 4IFIA 5JAZA 3TMKA 3W79A 1KAMA 1VLVA 2PK3A 3N28A 5AI5A 2LZ0A 1Y8ZA 1P6QA 1XZEA 4JGGA 3WQSB 4AJLA 3EVTA 1M0WA 2VPQA 1GZHB 3DR5A 3EDCA 3VNSA 3K73O 2IYLD 4US0R 1YB7A 2NO1A 4O1IA 3MELA 4X90A 3R9WA 1NUAA 3D2AA 3H0KA 4FFDA 4ZRMA 2Q5CA 1EH5A 2E82A 1X0XA 1I10A 1VJRA 4CEHB 2D0DA 4R7ZA 2C2HA 5BXQC 1HDYA 3D0RA 4OGLA 1FMTA 1IJBA 1RP7A 2HLDA 2Z4TA 5BN1A 2R7AA 1DKOA 3NR2A 2AQKA 3D4LA 2WMOB 5DTRA 1KE2A 3X3HA 3GCGA 5L3RA 2ZW9A 4QPDA 4ZOEA 1RQGA 1T0BA 3HY3A 4LRQA 4ZAYA 3JATB 3TGLA 4Y98A 1CQJB 4IZ6A 1M6HA 3ZE1B 2CL5A 3ZHOA 4TVKA 4AJOA 2GJKA 3L0CA 1UDXA 5A02A 4B6FA 3VH3A 3CTPA 2OHHA 4GQBA 3GLFE 2P2YA 1C30A 4WGFA 3GY0A 3T1VA 1U7PA 3SC3A 4CQMA 5KX5B 1VB3A 5F12A 4AKSA 4EUFA 4CTJA 1HFWA 1HMPA 4N65A 4U2KA 1WHTA 2P6PA 3OFJA 4K9MA 2MCFA 1FY2A 2A84A 1WV0A 2ZQZA 1SVOA 1I32A 2NTNA 4NBKA 3N9IA 4EGSA 2BF7A 1JA1A 4X24A 4BLQA 2V1UA 3VNNA 1AHNA 2XE8A 1BS2A 1WZCA 1WXGA 2PLRA 2ZAMA 3H75A 1BXRA 3EZXA 3P5SA 3QFSA 3EIOA 4BYMA 5JS7A 4DRZA 1IUNA 4KE6A 5FUBA 2X7XA 3N74A 4JEHA 1F6WA 1OV4A 2GVDC 2OKCA 2AR0A 2ZRDA 4M89A 5DSXA 3RD5A 4AK9A 4JLWA 2QRPA 1T0PA 5DB4A 3TCNA 1TPZA 2H1FA 1I2ZA 3H86A 1AHHA 3W5UA 3U26A 1QC5B 2NU6A 4LCEA 4PANA 4KR2A 5DGXA 1U3DA 3GEDA 1H9AA 3BSSA 4HWKA 5IHPA 2LPMA 421PA 4YUYA 3DDSA 5K0FA 3O4JA 1ECCA 3ESYA 1D7AA 1FDUA 3G2KA 3MUFA 5DXFA 5HJ7A 2C8KA 4J0QA 2QQ5A 3NJ8A 3UK2A 1VQ1A 3Q72A 2G06A 1M8KA 4IO0A 3PRJA 4GO1A 3C7TA 2WTAA 1GG5A 3C6XA 5F3RA 2XDYA 4PLGA 4BCBA 1DIAA 1QQAA 1H93A 2P62A 4CE6A 2FXIA 2HGZA 1F5NA 1R37A 1PE0A 3NCTA 5E1OA 5D2CA 1MG5A 5K51A 2NUPA 3IP6A 4DCOA 1HT3A 4HLUC 5ALNA 1XYVA 4F04A 3GGDA 1G8YA 3N3BC 4TMYA 2R6DA 3GD7A 4JDPA 5A5FA 5G0WA 3PKZA 5CXSA 4FHFA 1LVUA 1VYHA 2D5IA 4YCMA 1JKJA 2K7FA 1MQ9A 1I3CA 2XMCA 1GIAA 2CBGA 3AC0A 1DIOB 5FRDA 5FPYA 1TUBA 4HTFA 4OHUA 4P38A 1GSIA 3M9XA 4E2YA 2GMWA 4I3FA 5T3YA 3L0IB 3TVYA 4BV3A 1L7DA 2P2CA 4R71A 3G2IA 2FI1A 1CC1S 3OLYA 3M34A 3EK2A 1DIRA 4OL0A 3AF1A 4J0KA 2RHLA 1PJAA 1Y9EA 1Z16A 2JCYA 2QT9A 3FCYA 2PTGA 3HCFA 4HQ0A 4JFAA 4BOYA 4ZYWA 3HRIA 1VL2A 1M72A 3BSFA 3ZI7A 2H48A 2XUIA 3DMGA 1N2JA 3VNBA 4DAEA 1GCAA 3U4IA 1UWLA 5BR8B 4IDHA 3IHWA 2Z30A 2YFHA 3PFCA 4CCWA 4ARCA 4L72A 2HIHA 4L2IB 4WSOA 3P9IA 4L5AA 2H54A 2XD9A 2E5LB 3B7GA 2Q3EA 2CSXA 1RQPA 4V0QA 3WNVA 1UFRA 4MYHA 3LT4A 2QJOA 5F4BA 2WAMA 3TZLA 3W06A 3WK9A 3W04A 3RS5A 4XSGA 2IDKA 4NE7A 5JYBA 2PGNA 2NUTB 1JNXX 1WUTA 1JH9A 1D0SA 1NN3A 1W2GA 2JI7A 4UE2A 4EZBA 1OSNA 1N3LA 3NKFA 3D8HA 4UDNA 4ZP1A 1K06A 3LBIA 1D5CA 3ZXXA 4EVSA 3WAJA 2X0IA 3LDUA 1TKCA 2BKUA 2BCJQ 5EWJA 4F5DA 2FSIA 3NFRA 5JSZB 2PX3A 4IZHA 1AGRA 2BJHA 1SEPA 2JIZD 3FCXA 1EP2B 1MA0A 3KO8A 3QPAA 2PXHA 3L93A 3CF6R 2IEDA 4V3BA 2ZJ8A 2BTEA 2L2QA 2HSDA 3H4IA 5T4EA 5GONB 5FLYA 3LCRA 1F9EA 2VDMB 3QEMB 3TI7A 1PNQA 3V48A 4NX2A 3B1VA 1ADJA 4FCCA 1MLDA 4MB0A 1A3GA 2YVKA 5LP6C 4PPQA 2DTXA 2JFOA 1JEAA 1CUHA 1SUBA 2QY9A 3HEAA 1GQQA 3AESB 3I34X 1B8PA 4MYCA 3T61A 5F7XA 3I2GA 3PJRA 4FSHA 1TYZA 1X7XA 1YR7A 2Y1GA 1AUQA 3NHJA 3QOWA 3PNYA 4M3NA 4PYKA 3S4YA 4UVDA 3SJCA 5CA1B 2HT1A 3DDNA 1L5GB 2JLBA 3HCDA 2FPKA 1VLQA 3WK7A 1TW2A 5GADl 1T3TA 4GWGA 3BWBA 3QI7A 3WSWA 3B8EA 3G9UA 1WY5A 2HSEA 1M1NA 4HH3C 5FL7D 3ZK7A 3CSWA 5ICCA 4OLHA 5AW6A 1DWUA 1I5EA 2NU8A 1WMFA 3AR9A 2JCVA 4H7PA 5BQFA 3QE0A 1ZY2A 4H27A 5K8CA 4H2DA 3HXMA 1A9TA 3NC0C 5KTTA 4DADA 3BFPA 3NANA 1TZMA 1PLKA 3CMCO 2YS7A 2CLOB 3M70A 1GITA 5CT8A 2J31A 4ZVPA 3DH0A 3O9VA 2RGRA 2YXBA 4MW4A 3Q40A 4A7PA 2PCLA 2YXDA 4C2BA 2ID7A 2RBKA 3IP9A 5HFNA 1KO8A 2CT8A 1T9BA 1MC1A 4P4SA 2C1ZA 1OXMA 3PUIA 5FD8A 4EZEA 3UK1A 1WOMA 2Q3FA 5KNDH 5KYYA 3CTMA 3EF3A 2Z9BA 1EVQA 3CG0A 3OPQA 3R0ZA 1G38A 1YQDA 3HN7A 1SVKA 2RH5A 4P3NA 1KBOA 2RKBA 3QKSA 2RHRA 3ZNQA 1DGSA 3G82C 4Q4HA 4CG0A 4FGUA 1R66A 4C5AA 4OFBA 4B6OA 1QZUA 1VJTA 3UY4A 3ZVKA 2PBZA 4RA9A 1V9PA 2K6GA 4RU1A 1GSHA 3H0EA 4KR0A 3VHXB 1RQNA 4BNDA 4MKZA 2AI3A 3M7IA 1J0BA 1IBRA 1NF2A 1QKIA 4WEOA 2MMCA 4UE6A 5I5UA 3AVXA 3BRSA 4ZAXA 1FSSA 1I3MA 1OWOA 1VHDA 1X1BA 3N2IA 3C74A 3P9PA 4L5YA 4OQFA 1G20A 4TWIA 4YBRA 2J9GA 3NNSA 5EJFA 3ZC3A 3KFVA 2DBVO 1ECGA 3F6CA 1TFUA 2AOUA 3K35A 3IHTA 3LTEA 4OYYA 4BGUA 1G8PA 1B14A 1DXHA 2I87A 4QXQA 5AKLA 1I1OA 1PJLA 2DQZA 4OHOA 3N07A 3SIRA 1M0EA 3WDSA 4ZHQF 3KTOA 5C5CA 3RRYA 5LBIA 2QX9A 3PFNA 2D2XA 3KOOA 1G3MA 1VXOA 1D9XA 3KJNA 4LH6A 5EJMA 1ORWA 5LYJA 4NBWA 4AAYA 5L7TA 4O2LA 1WZUA 2P4QA 3Q10A 4LF6B 4UBOA 1DVRA 2VQSA 5HNEA 2VTDA 2V54A 1XJCA 5AVOA 4MQLA 2AXQA 2HRCA 2WI8A 3DYBA 4MKRA 4BQSA 3TR0A 5A2GA 2XVZA 4M99A 4MCHA 1IPEA 1JXQA 2FKAA 3IX7A 4HDSA 4PFSA 1ZKMA 5HS4A 1TQ8A 1XMSA 3EVBA 4FQ8A 3DFUA 1FNDA 3OBIA 3X1YA 4EG7A 4YAUA 1RTTA 5BN5B 4A1FA 4JA0A 2BISA 3DDOA 4HXEB 3QVKA 2FN9A 5M5BA 1ZD5A 4YDQA 1DC6A 3P2EA 4M8IA 5D85A 3DR3A 2ZZKA 4WPGA 4I4TA 1TF5A 5CDUA 5EJ6A 4OI2A 1QPGA 1MB9A 2W6QA 1I1MA 4N01A 1SXJD 2WJGA 3OQ1A 3H3XA 4D42A 2PUJA 3INGA 3LLSA 4A9AA 1UP4A 3ELYA 1XZNA 5TDHA 2C31A 2GESA 4OIMA 5J1SB 4GDFA 2A9KA 1KDTA 3ZWMA 1IE3A 2EJ0A 1VRCA 2OVBA 4ND7A 3ICVA 3ZDCA 3EZGA 2QL7A 2FE4A 4Z4FA 3EIQA 4DLXA 4EYKA 4B3HA 4YT2A 1XI2A 2AOTB 1BA3A 2KLBA 4J3JA 4CJXA 1X8KA 4NDAA 3T3NA 1HFEL 2VHZA 4FSXA 4OREX 3O3MB 3RSGA 1NUUA 1R6DA 3WKAA 2XW6A 2RK3A 3KOWA 1XZFA 2CVQA 4EGFA 5D86A 4FOLA 3WKEA 1N9GB 1IIBA 4JKIA 5K05A 5KTNA 3NBZC 1OTYA 1OXUA 2F43A 8GPBA 4HL6A 2YICA 3LL4A 1E62A 1A9XA 1NYTA 2BVNA 3CPEA 3L8DA 3NS7A 2IX9A 4NZNA 1W8IA 2QX8A 2XDQA 4ALIA 2ACVA 1TE2A 3BGOS 2Y0EA 2E1PA 4FT2A 4AKTA 3UMVA 4QVIA 3AY0A 3RF7A 3X1DA 1ZRNA 2VQ3A 3NDPA 3WGNA 1USUA 1UXJA 1V8OA 5JOQA 5AKXA 2QR2A 4V0NA 4Q9KA 5DSTA 1EFHA 4MS3A 1AKVA 4ND8B 1XFDA 4G07A 3RU3A 2ZXFA 1NLMA 2OAEA 2W83A 3P4XA 1R4AA 4JJKA 4DV7B 1ODSA 1Y98A 2JATA 2JJQA 2XWQA 4LKOA 1QFZA 5IHXA 1DTWB 1RLTA 3G1TA 2LE0A 1PJ8A 2VYQA 3UFXB 3KZXA 4RPGA 1TZ2A 4YAIA 1EQ2A 2EWMA 4Y2UA 4D4MA 4PZZA 2LUOA 2E18A 3IVXA 4V0KA 2H63A 3ICWA 3QNWA 4HUJA 4U6NA 3B51X 2ATCA 3RBXA 4WKCA 5T57A 4JI2B 5TF0A 4QUGA 1M0SA 3OU6A 2CMDA 2FP4A 2PGAA 5M3BA 1Q57A 1ZRMA 2FOLA 1L4GA 3K8YA 4H7KA 3VR2A 1U9IC 1ZNWA 4WY2A 3HU5A 4Y1GA 5DWVA 5F2OA 3RHFA 1GEEA 3JV7A 3ZWDA 1QVVA 4Y3UA 1ZHFA 1J22A 1GQSA 3G17A 3GIWA 1UWCA 1QFXA 2G5TA 3DAFA 1DEKA 1HDZA 1NM5A 2YIDA 4JJGA 4BZZA 2GLXA 4C0WA 5JZSA 4H08A 3H9EO 3IKVA 3R20A 4M9ZA 4MW6A 1VGRA 5DF1A 3H2HA 4UHKA 3ZEAA 5B7GA 2EZ8A 3A4VA 1ZLXA 3ESXA 3PYMA 5IDQA 9LDBA 1GTG1 2HOQA 2VRBA 1J2UA 3LG2A 4HGRA 3S2SA 2WINI 2Y0BA 3FFXA 5EMHA 4B44A 2ZYIA 2BI8A 3M3DA 1ZW6A 2I6UA 3A11A 3G7UA 3MGCA 4EHAA 5CM8B 4Q1EA 4NCXA 2E4YA 1YIOA 3W9YA 5C35A 2X6QA 1N9ZA 4DSUA 5BSFA 2WKSA 2TMGA 4U2DA 4KI7A 5B1IA 3PR3A 3CLVA 3NBYC 3X2EA 2Z08A 5AQ1A 3MRVA 4RSMA 1LD3A 2CD7A 1PU2A 1V6SA 2FEAA 2I66A 1UBFA 5EA2A 1FZTA 1QHHA 4MSUA 5TQVA 4LECA 5CT6A 3QWUA 2WV9A 3OIYA 3HSKA 3FVVA 1I3KA 1YBMA 4Q1VA 3Q9UA 4RGBA 3CLTC 1U65A 2C97A 2DSTA 1XP5A 1UJNA 5ESWA 3QX7A 1ANKA 4DGQA 5CDYA 2BSQA 1RP1A 4QG7A 3FYDA 3CNLA 2VS1A 1ADGA 3UUEA 4B3CA 2UU9B 3AF4A 1LLDA 1IOVA 3MLEA 1NDQA 2JW5A 1NWCA 1SRQA 2I7VA 4NBTA 4QXPA 1QYIA 4DLWA 1U7WA 2O8CB 1Z73A 5L7YA 3SFVA 1NW3A 3UM9A 1BGXT 3K70B 1MJGA 1MEOA 2RHGB 4RXUA 5CT9A 4MRAA 4HAWA 2K5UA 1OYWA 5TVGA 1KVRA 5JE8A 3S2FA 2XOKA 1NR5A 1N57A 2GFIA 1G20E 1XCLA 3FZEA 4PYNA 1QNFA 2H5EA 1H2FA 3BCUA 3IE0A 3TJZA 4L5CA 1II0A 1W5EA 4QLOA 4R1MA 2C3OA 4H7DA 3E61A 5EZYF 1JG1A 2W2LD 3ETLA 5EEGA 4NH0A 3G2JA 3BCRA 2ZRMA 4V0OA 4EF5A 3AVWA 1PK9A 3REOA 1OLSB 3PNLA 1T6ZA 1DG3A 3QFFA 2V03A 1T1EA 1G21B 3FBTA 3H3FA 3OICA 3GOQA 2YR0A 3SM9A 4NV0A 5D01A 1PK7A 1ZXXA 4PIPA 3RIEA 4B6QA 2VXYA 3HUDA 3GRAA 5DYWA 4G2TA 1FIUA 2O1WA 2QRQA 2JB9A 3IC5A 2LKDA 3AEQA 4J49A 1P0MA 3EDRA 5DGHA 5J5AA 3RG8A 3C3PA 3U4MA 4BQQA 4G8CA 2BP7B 2WUVA 2MSWA 1OVMA 3ILVA 2P91A 4WINA 4XWGA 2DABA 1ESCA 3JWGA 3TXAA 3N53A 1HZJA 4PLTA 5B3JA 5AUNB 3BL6A 3B8HA 3B36A 4O7VA 5BYAA 3FOCA 1BWSA 1CKOA 1GZ6A 2WJZB 3I1FA 4IIYA 4OHKA 1OBCA 4HX2A 5AVXA 1C7RA 1CE8A 2ABJA 1T1GA 3MYYA 3OHPA 1QYXA 4MDYA 1EUQA 5IW8A 1ZU5A 4PBTA 2Z02A 2WIDA 3KXPA 1T5LA 3FA2A 1QGYA 1LC3A 1MB2A 2DAPA 2HPAA 3LE8A 4YNBA 4IHJF 3W05A 2J0UA 4OB6A 5BYJA 3A36A 4Q4CA 1JSZA 1BW9B 3OQVA 4D9GA 3GNSA 4MJ3A 2VPZA 5LDHA 2Q0HA 3EXG2 1KDZA 3JSAA 2JDID 5FLXA 1N7GA 2JKYA 4LYGA 1DIKA 4FFBB 4QFCA 5KO2A 3C3AA 3FMIA 3VSAA 3H8SA 4YCLA 2OBLA 3IDFA 3B52X 1RE0A 5EHGA 1Z2OX 2P77A 4DIOA 1DRJA 2XMGA 2FOXA 2RHOA 3UPDA 2H3HA 4XQGA 1ZK4A 3NAZA 1U0FA 2C61A 2O2JA 2J0VA 1JQLB 4UEOA 4C0SA 3AUSA 1GEGA 3ZDQA 3E70C 1VPEA 2JLUA 3QLJA 4GFDA 4O4LB 3WMWA 2J5BA 1GKUB 1LSSA 4DBZA 5M29A 3NAGA 4ZAVA 2EEPA 4P0PB 2QTCA 3FWNA 2FRXA 2IZZA 1FUEA 4NPAA 5DHRA 3GH3A 4MMZB 2R48A 4Q7LA 4I66A 4ZJUA 3U9LA 4CKYA 1N8SA 6PFKA 2Z1MA 5KKCA 1ZYUA 4IEEA 5TT1A 4JLJA 2V7TA 1PQUA 1U7OA 1WR2A 2X13A 3D31A 1QRTA 2PZ8A 4TWRA 4QUAA 4TTRA 3V42A 3W6UA 3BGSA 1XCJA 1SBQA 1TCAA 3IAFA 3KNZA 1F8FA 4AO6A 4ZTUB 3K5PA 1K3FA 1A2OA 1FQWA 2XECA 3T5MA 1ZA1A 6YASA 5BSWA 4FWTA 4B48A 1E3TA 2C78A 1X2EA 3ZWVA 5TQ0A 4DAOA 5I7UA 3VMMA 1EWVA 2D00A 4Q5IA 4ZO9A 3TSYA 1B8UA 1DLJA 1GPBA 2BN4A 2H2HA 4D4IA 2QLNA 2Q4EA 5GMOA 3M3PA 2QZPA 4DM4A 3CLRC 1SUAA 4XW2A 4E1AA 2FEKA 2Q0SA 4RUKA 4I9GA 3QLTA 3SP1A 1KR2A 3VU9A 4CT0A 5CBPA 5FIUA 5IX8A 2BHNA 2BF4A 4ZOLB 1KC7A 3AV3A 4ND2A 4Q1BA 2ESRA 4CRWB 1VKOA 1ADBA 1J0XO 1JPNA 1S1CA 5D3KA 1XLVA 2IP2A 4JB8A 1WKVA 1AA6A 1XP8A 5MFPA 1VE9A 5IVIA 4D8UA 1KYIA 1S2MA 3HC7A 1EFPB 3OZIA 3WI7A 3NVMB 4PNEA 2YY7A 1ULHA 3LUPA 5ALWA 1JIQA 2A35A 4HJXA 5IBPA 5KYUB 4B6RA 5BYBA 1KU6A 3DEIA 3F5MA 5KNLA 3NU1A 2F48A 1L6IA 4LBZA 1LS6A 1OIXA 4LE1A 5H9VA 3X1ZA 1XNHA 1E99A 4ECAA 1U02A 1I4TD 3F6EX 3ENNA 5IJAA 4Q3LA 5J58A 4R0MA 3CYFA 3N6RA 5C7IO 1H6AA 1D9ZA 1F2TB 4FVTA 4C89A 3G9XA 3TD2A 2IW1A 2HI0A 2BGWA 2YZLA 1HC7A 3HU3A 4MYSA 4YACA 1FPMA 4V1CB 1LI5A 4JUAA 3PRKE 5HQJA 5KU1A 1T10A 2IRWA 5K0CA 2Q7XA 2APJA 1Q0UA 1TM7E 1FDSA 2I78A 1J06A 1XSEA 1JEQB 5SZKB 5C4MA 1CW2B 3RR5A 3S27A 2QB5A 5T3UA 2IH5A 3HKDA 2BEWA 2ZDGA 2V4MA 4KQ2A 3QYFA 1PWEA 2PUGA 2Q3JA 3GN1A 4YHBA 1JLRA 3LT5A 4LQLA 4NCJA 2XODA 5CFQA 4WESA 2FUEA 1RYNA 1Z4NA 3FNHA 3KOUA 4LYHA 5EFOA 1N7IA 1L4HA 1P19A 3FPJA 2FX5A 1MENA 2IA5A 4UFPA 1R9MA 3ZJ5A 4FJ0A 4EPWA 2AWOA 4HB4A 4OK5A 2OMKA 2YJ3A 4Q21A 2XKAA 3DTTA 4HQFA 4RJJA 1HE4A 4B3JA 4DC1A 4DV1B 1BDIA 4KO4S 2V1XA 1YAJA 4B7UA 4O4HF 3L6CA 2XQJA 3TX2A 3WWDA 3AHDA 2ZB8A 2X2EA 1DV2A 3DXXA 5TMEA 5AW0A 1DDGA 1ST2A 1E2FA 4LDQA 4GNKA 1GRNA 3AERB 3EGXA 3K2QA 4J7UA 4L7VA 1ZUIA 4HUQA 4K8OA 3IVMA 2HHAA 4A82A 4HWGA 1GGEA 5FNVF 1Z37A 3BA9A 1YQ9A 2YASA 4Y2GA 4EY8A 1OW3B 2HLHA 4PAGA 2WUWE 1R0ZA 2ECPA 5A71A 3A1VA 4GX0A 4KITB 2RBEA 1PDOA 3HWX1 4HEHA 2G1UA 5COBA 1HSOA 1Q3TA 1KS2A 5DJ5A 3SU8A 2L17A 3JAKB 3DGEC 5E7MA 1SVSA 3DL7A 3S2ZA 2YY6A 5DO9A 3ZI0A 2QE6A 3JYPA 1XA4A 1KVTA 4LYAA 2I2CA 5AW8A 2C8VA 1TQ4A 5FNZA 1DKUA 3GB9A 3UWPA 4Q7QA 3QY9A 2PQMA 4BQEA 4YRFA 3G9TA 5BW8A 3MMZA 2PYDA 1JDZA 1HY3A 2YHIA 4XEUA 3AEKB 4OP1A 5U9CA 1AE1A 1OU0A 6Q21A 3LJKA 4YP1A 1JFFA 2HLDD 3D6FA 4GI3A 3FKSA 4FHDA 5E7JA 3MJ4A 3AI3A 3BABA 1Q5PA 5EIAA 2GCIA 1M2VB 5EI5A 4DB4A 2QL6A 1N5LA 5I7OA 4FR5A 1PBTA 4JL5A 4B2PA 1QK3A 3D8SA 4RCVA 4ZOCA 4WV3A 2J9ZB 4TS9A 3AXSA 4GOOD 4X1YA 4UVHA 4WNYA 3EXHA 2H7YA 1MORA 1FS4A 2OOSA 2VI5A 3CZ9A 2EFEB 4TQUS 4AF7A 2R4TA 4CQMD 4WL0A 1COZA 4NCHA 5E4YA 1GRQA 3WYAA 4N76A 1B76A 1L8QA 4MI9A 1OTHA 3H6GA 1VBHA 2C8LA 4EEXA 3BD8A 1LBQA 4NU6A 4ZT4A 1PKXA 4RSHA 3LS2A 1FBTA 2AHOA 1WSBA 1V5IA 1NNUA 3BAFA 1BD4A 2ZSJA 1C50A 2JGIA 1W1UA 4LHXA 4R83A 4BBJA 4DLZA 1Y4SA 1CUIA 2LNDA 4PLHA 1SIWA 2EOAA 1CJUC 3KE8A 2GEJA 1HLFA 2HWKA 2YV2A 3LGSA 1TMKA 3NIDB 2IS1A 2DQYA 4OFWA 3TPFA 1LW6E 2EW1A 4Y8VB 2WDZA 4L02A 2OHFA 2RJNA 3VHLB 4GOLD 1ATIA 3QYAA 4AF6A 4L6CA 4R9VA 3F6SA 3IAAA 1ONPA 1G9TA 1WAMA 4B2LA 3A9WA 3CG4A 3GLRA 1ZRHA 1LDMA 2XNSA 4ZZ0A 1N7JA 1IHDA 1Q1QA 1VKZA 3EF0A 4BB5A 3PFWO 4JITA 3K1AA 2CXSA 4BWVA 4XOIA 1KI8A 1DB3A 5CM0A 2FQWA 2RH8A 1HKHA 3MWGA 3QKRB 4OYLA 3WHPA 1CETA 2QRNA 4PEVA 2BJVA 4NAHA 1YH3A 5F7ZA 5ELMA 3WKCA 5HUHA 2DAAA 3AR6A 5GJVC 4F2GA 3P4UA 4CDRA 3FM9A 1A7UA 1UJ6A 2BBWA 4I1RA 2A9QA 4N03A 3UK0A 5FBHA 1GQYA 3OOSA 1ZC4A 1QHYA 4XCQA 5C34B 4RTOA 3VU3A 5KX5F 4BASA 5CAEB 4ABTA 1NYRA 3DV0A 3RAEC 1QAOA 4H16A 1A2BA 1SUSA 3PP8A 5I4IA 4RZHA 1XK5A 3A4YA 3C70A 2PWYA 4UBNA 5CDTA 1XA3A 1PT9A 3VDMA 3SM3A 1E0DA 2O2IA 2IPAB 3RTEA 1SXGA 1UL1X 3DNFA 1UCFA 1XEAA 1HZZC 1SCBA 2HF2A 1MEJA 2C92A 2ECQA 3JQ9C 2JGNA 4M2LA 2LCQA 5BXYA 3EGCA 1QV9A 3ZDDA 1ST3A 1A0IA 4S1PA 1BDBA 1ZL0A 2QUIA 1OXBB 1I9CA 3BXOA 4QXAA 4B9AA 4WXEA 2GA8A 3GG9A 5EIBC 3QEAZ 3C6KA 1WM1A 4ZO8A 1FQJA 1CQIA 1RWBA 5LC1A 4EM6A 5EZYA 2IUFA 2OAQ1 2NO0A 2XGMA 3BWEA 3DFIA 3K9BA 3LOPA 2NX2A 1YGYA 3UB3A 2DETA 3FCEA 3AT1A 3ZW8A 3R5XA 1WZEA 3IIKA 1JTVA 3K53A 3ND8A 1UZLA 4IHKA 1H3FA 5KDLA 3ND6A 1S0UA 1JEEA 4X8HA 3W2IA 4X62B 4GS5A 5EJ8A 1I80A 4M83A 3SZMA 2VN8A 4AJ9A 1P7YA 1OA1A 3CWQA 4JCOA 1KJJA 3UO8B 3OWHA 4B6PA 1ONOA 4CIXA 1DC8A 2REOA 3BX1A 1WDLA 3NWPA 1SCUB 1HQCA 3JXEA 1SAYA 4MWGA 3EVEA 5DWQA 4ERNA 4TTQA 2ZSDA 3IAM1 3RRXA 3BFJA 1G3QA 2D54A 3LVFO 2FA9A 5SZJA 1LSUA 2W2XA 4L50A 1DNPA 4BNZA 3KWJA 3OZEA 3SOPA 1QGZA 1L0BA 1TYAE 4UZFA 1GJRA 4IOJA 4YBZA 3SC2A 4S0XA 4NQRA 2BMVA 2RSLA 1MBZA 5DBIA 5IVDA 1XRLA 1CUVA 2GJ9A 2QUAA 3NHWA 1TB4A 3O1IC 3O7WA 4I1IA 2LBPA 4JJZA 4TZ6A 3CMMA 3KQLA 2Q2WA 2W2TA 3COZA 1SC3A 3FR7A 1SY7A 3LX8A 4IHJA 3OC6A 1VI2A 1C9DB 2PH1A 3WFZA 3WLHA 3VU1A 4WKBA 2QTHA 3ZOZA 1GCIA 1ZBQA 3JQAB 4F96A 3QE4A 3NZEA 5DM60 3V1NA 3PC8A 4GICA 6CHYA 4DLSA 1V2GA 5BUQA 1NJ8A 5BW4A 3PJFA 2HU8A 1F4PA 1T9ZA 3LNTA 1QHFA 5CDSA 4ZMRA 1QWSA 1QONA 1X77A 2Q3HA 1YDMA 2A7XA 1V16B 3BE5A 3QVSA 3BFXA 2LP4Y 3QWAA 1HBJA 2MSLA 2XOEA 4JN6B 5I5SA 4IILA 1H2ZA 5AW3A 2HVRA 3T7TA 4GRDA 3T94A 1A76A 3BOSA 4E51A 4ZVNA 1ABBA 3EX7C 3FPAA 3HG7A 3O8QA 3PTAA 4CWAA 1E1NA 3PGVA 4XYBA 2Q9UA 1GGJA 2IEZA 3OY7A 4LTDA 3WL6A 1CUSA 3KD2A 4NV3A 5DK4A 3FPSA 3RRJA 4O7YA 3RYFA 4CMDA 3IIEA 1DCMA 1SBZA 4X41A 3UAGA 4C7VA 1XALA 1GGVA 2FCAA 3UCXA 2P4UA 3PEWA 4DJJA 4LMPA 1MP0A 4RL4A 4B8WA 2V7UA 4DYHA 3TFQA 4RK6A 3F71A 2GCEA 2OK8A 2QN7A 1TM1E 1JGTA 1W4LA 2JGKA 2JJYA 4OSPA 4R7TA 1VTKA 1XHFA 5GONF 1M34B 3KOMA 1KAGA 4HN2A 2I2FA 2IHVA 1L7RA 2ZBRA 1RU3A 3LZCA 4GLJA 3SI7A 4EHBA 2BKXA 4KK4A 2EIYA 1HDIA 3WIOA 1RCTE 2AFHB 3L7JA 2XQVA 1ZI6A 4DJFC 4JOCA 4RZUA 4C4TA 2G82A 1LTKA 2Q4RA 1Y8AA 4YDRA 5FPKA 1P2VA 4AQYB 5I01A 1TQ6A 4B80A 1BNCA 3FROA 3RFFA 4MYTA 1X38A 2X8LA 3H2JA 2WWRA 2NUAB 5CA1F 4M37A 1Q17A 3JD2A 4HTAA 5CNMA 4DIEA 4P2BA 2CXTA 2XKJE 2WD7B 1H0KA 1PZFA 3DBIA 4FHCA 4R69A 5JMTA 3V8VA 3VDQA 4L4ZA 3OQNA 1PD1A 1ACMA 5AHXA 1RFLA 2OM2A 1HO3A 2PL5A 4NARA 4ZAZA 3C3EA 1KHHA 2Q2OA 4CBVA 3L18A 3O3CA 4DILA 1VFPA 4Q00A 4X7RA 4UCTA 3HH8A 4PN3A 1J8VA 4H4CA 4LOJA 4BFVA 2ZIEA 3G5TA 3PQCA 5J4KA 4IHQA 5HMMA 2RHDA 3NETA 4NFHA 3JQ8A 3BEOA 4MRSA 4EUNA 4DJ5X 3IQXA 3O4IA 1D0VA 3U16A 1A9SA 1CF4A 1ATZA 2JGJA 3FCUB 3LK7A 4RENA 1XDDA 3WO0A 3HWSA 2ZJ4A 3O8LA 2VJDA 2GN1A 2J3QA 2IHBA 3FVRA 1TKBA 1GPYA 3CVJA 1QAMA 3C3XA 4TWBA 1E2UA 1V1MA 1V3UA 4NQZA 1TLLA 3ISTA 2ZBVA 1O6CA 4D45A 4EJ2A 3KAJA 4M86A 3LYLA 4O6VA 2G72A 4BO3A 5EESA 5B5SA 2X5RA 4D0SA 1UK9A 2AFRA 3K20A 4DC0A 3HI6A 1VI5A 3TG8A 2DT5A 1E3WB 2ONKA 4EG3A 1L3BA 1MGPA 4EAAA 2ZYHA 4UTZA 1H2XA 3GBPA 9ATCA 2IQIA 2P65A 4Q01A 4I46A 2C9MA 3BZBA 4O4HA 4OJYA 2OYCA 2D5AA 1U7DA 1XDGA 5CA0B 1JIKA 5KYYB 2GCOB 5TV2A 5TGTA 2I6QA 1KO5A 4DL9A 3LP5A 2QTBA 1GOTA 4NFYA 4GPAA 3RVOA 1AG9A 1E69A 4JHXA 3TZ6A 3L7LA 4KN9S 4AS2A 5FNVA 4BNLA 2MINA 3KQSA 5C5IA 4DR3B 1OWLA 2GM5A 4AY2A 1RR6A 1U5BA 1GILA 3U37A 3AM3A 5KDOA 2EF0A 1XU9A 5KU7A 1AMUA 3B1ZA 4MP8A 3ZGNA 2PRIA 3VYUB 1LX6A 4M1MA 4CIBA 4MKXA 4XQ0A 3AFHA 1G5TA 2N3ZA 4FYMA 2E37A 4UM9D 4BKPA 1G17A 3TPCA 1G1MA 4S1WA 1YIDA 5PNTA 1RADA 1YS2X 4KQJA 1DJLA 1O3YA 1N4DA 3ESRA 4MIYA 1AVTA 5A7HA 4FM9A 5KTKA 4W5QA 3HPQA 4OU5A 3EGVA 2RDMA 3EZNA 2BYTA 3EUFA 3ZLUA 1L4BA 1L6RA 1Y4ZA 2XF8A 3F3YA 5FHRA 4NOLA 4EG0A 1V3VA 1UC5B 4UM5A 3B13B 2NYRA 4XZ3A 4X8OA 1GZVA 3AHCA 3FTCA 3RK4A 4A10A 2G67A 1G8GA 1DAEA 1WKBA 3PQFA 4P34A 4P9NA 1OJLA 3NHSA 5EHQA 1W4ZA 3TSAA 1RAGA 3ZBUA 1P1JA 2F1HA 3AIOA 2V4UA 1WW3A 3BERA 5A3SA 5A04A 3I0NA 5CJ2A 1R2QA 2HNAA 1ZJYA 2W2QA 1MJFA 5A5VA 3G13A 5A0TA 4ZARA 4PGFA 3JS5A 2QT1A 1DFGA 1OAOA 4JL6A 3IV9A 4F4JA 3LULA 4B32A 5AW5A 2MIIA 3HJTA 4D46A 2EJ2A 1RYBA 1VYTA 1KOJA 2VAPA 1E5QA 2ODBA 3K16A 1I4WA 4G97A 4JYMA 3PXAA 5E9QA 5GJWC 5HCUA 4BB0A 4NIMA 1H2EA 3SS9X 1RNLA 4XUGB 4KGDA 2PMKA 1J09A 3EASA 1Q7EA 3WKDA 3VR2D 4C0KA 1OIWA 5C18A 1ZWLA 4RK1A 4WE3A 1I0IA 2TMKA 1M2FA 2X6RA 2XUQA 4D0LB 1XTBA 1O08A 1L1EA 2MR5A 2W58A 3HBAA 2XEXA 1HNNA 5CFZA 1WB9A 1Z5WA 3OOJA 4ZODA 3DLAA 4WBXC 1FLAA 3AXTA 1NOKA 4JR2A 4XM1A 3ZDEA 2GUGA 4QQKA 3O84A 3LKBA 5K3FB 1O4WA 1QX3A 1SUIA 2BKVA 2H2WA 1X87A 4FLEA 3TZHA 2X2FA 3WV5A 2YJTD 3DWGA 5ENDA 2FHPA 3KRTA 3FMVA 4CEHA 1ZJWA 3KBBA 2WYVA 4FZJA 3DSRA 1YASA 1YVDA 4YUAA 1QCDA 4RGVA 3QRWA 4N82A 4DJTA 1W5BA 1WXEA 1O9HA 3EMDA 3KTFA 4JDUA 3FPBA 2QRZA 4QFMA 2VTVA 4K1LA 4UUBA 1SC6A 5K6TA 1NU6A 1GA6A 4QHTA 3JATA 2A1TR 1E61A 1CQJA 3ILYA 3O2NA 2KLHA 3DHNA 2IK8A 4IY1A 4XIGS 1DBQA 5DW0A 5CFPA 1NP6A 3TD6A 1GTRA 4KPYA 4B3GA 1QE0A 3SNKA 5JPCA 3HT5A 2ZRQA 4G67A 4E09A 1EHIA 4TVIA 3FGNA 4LFBB 1Y63A 4OA8A 5KX5A 4BGVA 1DC7A 2QY6A 2EQBA 1HLPA 1Y5IA 3Q3GE 4OV6B 3LC2O 4K7JA 4OQDA 4CF5A 5IKOA 2COUA 4DGSA 1Z63A 2B35A 1Q83A 1OFTA 2OORA 3FRJA 4YRCA 2IOFK 2H00A 3P0EA 4KPGA 4DCCA 5CVUA 2QG4A 2YBEA 2I55A 3AB7A 2PUDA 4XCXA 1UT6A 5CYOA 3BH7A 3UWMA 3T5AA 4MEJA 3DOIA 3CRVA 1GNLA 2PQ2A 4AIIA 5CLFA 4JOBA 3JQ6A 2HBYA 1T13A 3P45A 5HIIA 4A6PA 2I8LA 3A1DA 3B9PA 3WWYA 4IXDA 4UNRA 5AOBA 3QF4B 4IQGA 4JYZA 4HRAA 1E59A 1SKUA 3TQSA 2DU8A 2EEZA 5DULA 1UPUA 4Q4JB 1FTWA 5KWIA 1KOGA 2P2GA 1MJGM 3ZWCA 4E70A 3T7SA 2X15A 4Z86A 2XOKD 2GI4A 2ZK7A 3AR5A 1DBPA 1PGQA 4E1BA 2VDVE 3ZEIA 2F1IA 4CR7A 1I7QB 2GD6A 3E1GA 4WXPA 3OQIB 4DMMA 2ZI3A 3IB6A 3WYEA 3LD9A 4KIJA 3MCVA 3CZMA 1A27A 2E5WA 2AX3A 4MHSA 2R84A 4KK3A 5B2FA 2NUBA 3PC6A 3VZPA 4FQ5A 4KXNA 2COIA 3OU7A 3P0IA 5IAAA 2RIRA 3HWWA 3PC4A 4LHSA 2CVZA 1FP6A 3S5UA 2NV2B 1UK7A 5CFMA 4NNJA 3DM5A 2AB0A 2VATA 4R4JA 4NMLA 4EGAA 4F9TA 3EIXA 3WHIA 4BMOB 4D26A 1KMHB 1XKTA 2VZ8A 4BQOA 1HG1A 1P1FA 2WWHA 4KNWA 2OD2A 5BNTA 3LECA 4K3VA 3Q1LA 4BPBA 4IWNA 1V3TA 1A8HA 4V39A 3ZU4A 3DC2A 3RTDA 1NT4A 2WIJA 3E9ZA 3I9FA 3KEGA 3QSGA 4RE5A 4D9HA 1JG6A 4YX9A 3CZRA 4PU0A 3BS4A 3ZD8A 5HA5A 1U8EA 1J25A 1BXZA 2AK3A 4QWWA 2WIAA 3KJGA 3PE6A 3DBRB 3TNDA 5HM8A 2HQSA 2GZSA 2JI4A 2ZITA 3FMOB 4D82A 3UJ3X 4E08A 1AM4D 1QG2A 1UOPA 1VHLA 1YMUA 3OKAA 4IJKA 4PO8A 5JT1A 4MO2A 1XD8A 1B8OA 1RWVA 3GFOA 2QUHA 4FYPA 1L7AA 2IY8A 3O31A 4WQMA 1P0IA 1T1IA 2AI2A 2GM3A 4IXMA 2CB0A 4KQKA 1L1FA 1W2HA 1JHMA 4U9UA 3PZRA 1K7XB 2OHXA 4CTMA 2XMRA 2ZS9A 4UTRA 4L2IA 1LRLA 3H65A 3O8BA 1YS6A 2A5FA 1PS9A 1ULBA 3L1HA 4PCVA 4PLZA 1NASA 1V7QA 3V97A 5ALXA 2OAGA 2KB0A 1X7GA 3O74A 2DWCA 3S29A 4EMBA 4F6LA 1WMDA 4JP5A 3D7SA 3QV2A 2DCMA 1MKYA 1J90A 5G4LA 4O3FA 2NUTA 1OILA 3RRMA 3KKQA 1CPYA 3R9RA 1RT9A 4TL6A 4RHTA 1GZDA 3J81A 3H2GA 2ZM5A 4MVCA 1DWQA 1FSFA 4GLOA 4JU9A 1QE5A 4FSDA 4D8YA 1ZN2A 1GN9A 1EDOA 1X7DA 2A8YA 1VGQA 3EUAA 1JEOA 5FOWA 1YZ3A 2DBRA 1EUDB 4YB8B 3A4LA 2C5LA 4AM8A 3ZS8A 4RPKA 4XX0B 3GHHA 4NI5A 4ZA2A 3X1XA 4F3RA 5HQTA 5GONA 4DTIA 3AVYA 1EIWA 3QEMA 1W36C 3QPDA 3DLCA 1PI3A 4O2RA 5TJ9A 4PW0A 5HF8A 5FOSA 1J39A 1R6BX 3V1KA 5HIMA 2HEGA 2FB9A 3PQ6A 3P9YA 2FW0A 3FNEA 3RSHA 3AESA 1XTRA 4E5VA 3OX1A 5LVAA 2ZM6B 1TGVA 3PDWA 3SFZA 5CR5A 3M1YA 4LQ4A 3F90A 4ZICA 5K6RA 3KJEA 5CA1A 4HAXA 3X1JA 3W3AA 4FGRA 1MW9X 1ZICA 2GF2A 4EH1A 2J5KA 2WG1A 4WCFB 3EMKA 4B7CA 1DAIA 2J4DA 5IF3A 1Q6ZA 5IXJA 3ADBA 3AVUA 4GI5A 3HCEA 3TRJA 3GZNB 2ZJYA 1EHYA 3JQ7B 2AVNA 4CM4B 3QGMA 3ZDXB 2IUYA 3EA4A 5EE5B 1W25A 4EA8A 2VDWB 4BQFA 2CWWA 3DL0A 4LC1A 4M1OA 4G85A 4OGFA 5FHQA 3RS9A 3UKOA 2UUAB 2H0AA 1YHZA 2XCRB 3D3QA 4NOMA 3MBOA 1C4WA 2CCGA 2R6CA 4KWEA 4II2A 5FV7A 2FWBA 1U6KA 4D81A 3TDKA 2ZULA 2GEFA 1ZOPA 2W00A 5FYDA 4QU9A 1TQDA 3WJ1A 3PZBA 4D1YA 2O8EA 1RC8A 1FUUA 3W2HA 4M0UA 4C6TB 3ZLJA 3V1YA 3WZLA 5AOCA 4IOLA 3R6GA 1R5NA 1E94E 4QTUB 5JJ5A 2GTHA 5BPHA 1HT0A 1K8QA 3FDZB 1GTZA 3G1UA 4S1OA 2YV4A 3SCZA 3VHXA 1K5HA 4EY7A 3C2QA 1BE6A 3A6HA 3MERA 2E6KA 1LQ2A 2R7KA 1G2WA 1U2DA 1B6RA 5DNDA 4LX8A 1NY6A 1EJ6A 3A6GA 4EGCB 2C4VA 4ZOLF 3QQPA 1GPMA 4G4SP 5JCJA 5JHGB 5LLTA 3WQHA 1GNVA 1E9DA 3OJWA 5TEWA 2VNSA 3SQLA 3SQNA 4IVNA 4E5PA 2QYHA 4GECA 3RANA 4DDVA 2J85A 1FFHA 3HQ4O 4O7SA 4F6CA 1LEHA 4NEGA 2AH5A 1BN6A 4ZZ2A 2FE1A 5AM5A 3P96A 1PNTA 1GCGA 1V2HE 4JEMA 1XTKA 1XG5A 4B74A 3Q4GA 4Z0PA 2IVFA 5T8KA 3R5SA 3T3EA 4YO7A 3TIIA 4ABYA 1N3IA 5EPOA 2XT6A 4C07A 1S8NA 5ED0A 3THWB 2A9FA 1G8FA 1X1DA 2OZKA 4KE9A 2C4KA 1E4EB 3IKMB 1PJZA 4EG4A 3OFKA 4BLPA 1C3OB 2REXB 4J6FA 1R00A 1R1DA 2IZ5A 2VCEA 3TW7A 1B26A 4M8LA 3WK8A 4MUYA 3W9BA 2HNBA 3T7CA 3HE3A 1KMNA 2Q0QA 2BMDA 1A0OA 2BKLA 2VXBA 1H0SA 1Q14A 4OK6A 5DW3A 5E1MA 5AXDA 5T6BA 4EABA 1Y1PA 1SHTX 1F5SA 3PHCA 2O54A 3QLUC 3R24A 4DLVA 2P1ZA 4NABA 2HK6A 2FW6A 2YYZA 1I0ZA 1Q19A 2JVIA 3FKSD 4PAQA 5I45A 3ZZTA 2OGTA 4B7ZA 1BXGB 4WXRA 4G5FA 5FBWB 2D62A 2YDYA 2O3TA 4GAEA 4DDWA 2IU4A 3MWJA 1Z6QA 3LIIA 1ECBA 2CCJA 2ADFA 2XUHA 1ZNXA 4X64B 2J5XA 4JLDA 3BREA 4FEEA 5EIOA 1CZUA 1GP2A 2BFCA 4PZYA 1CY7A 3UMRA 2F4VB 3NOQA 4FKBA 3THSA 2HREA 3E4CA 3ETGA 1IAQA 3MD0A 5K0BA 4HKTA 4MUJA 3DGFC 4PYJA 1M8GA 1MVLA 1SD1A 1VG9B 2J5RA 2PMFA 4KH0A 3GW8A 2C83A 1N9GA 1TVMA 3AVOA 1SQ0A 3MPOA 1NXVA 5KQMA 1R8QA 1DINA 1ZEMA 2X77A 3LCCA 4ZVKA 3VNUA 2WVJA 4TRRA 1KFKB 3B6ZA 3CZPA 1K4KA 3SYKA 1W48A 4WJLA 3P9SA 4ZI7B 2R47A 2BI7A 2ZE5A 5EXTA 2R4UA 5KB3A 2YW9A 3QEJA 4YAEA 2DERA 2ZP1A 2VK1A 2BM8A 3FGZA 4ZT3A 1JS1X 1P33A 2X1MA 1UBRS 3DO6A 4ND8A 5H70A 3AR4A 3LUFA 3OPVA 9GPBA 2J45A 1HM5A 3OJOA 5B4TA 1DXYA 3WMFA 3LTNC 2IY9A 1PT6A 1JVSA 2WK1A 1I2CA 3INNA 3UH0A 3PVCA 4KO8A 4EY6A 1DTWA 5JVLA 1A50B 1GTMA 4LA4A 5BURA 3D0OA 3U1BA 5FPOA 3UFXA 4Z54A 2VBGA 1IN6A 1SOWA 4LDRA 2I7CA 1EE1A 3B6KA 4RFVA 4RHEA 2Z0MA 4U02A 1Y6RA 1DFHA 1Y1LA 1RIIA 2BUCA 4IIHA 2ZYUX 1XKLA 1EK2A 4MUAA 2O8FB 3BL5A 1FFBA 2PYZA 3PI7A 2X8BA 3OZWA 4BRZA 5JJKA 3PNVA 1DKNA 1Z88A 2GDJA 4OMUA 3TAHA 1QNLA 3NHAA 3EIHA 1JKFA 3GXBA 4I6JA 4KYIB 4PCAA 4A91A 2B7LA 2W90A 3JYHA 2OILA 2FZKA 4F3KA 3GPBA 1EJ2A 1G63A 3PK0A 4FYVA 1OLUB 3Q5GA 2EIXA 2PSSA 1G2OA 4U7TB 1FB5A 4PFKA 2VJAA 3ETHA 3P94A 5CRIA 4HLDA 5I7EA 1UJMA 5HR5A 3DZCA 3DUFB 4AWBA 2YKGA 4GYWA 3UN1A 4UPVA 3CVXA 1KK2A 1L5FA 1SB9A 1JDBB 1JLMA 1FDRA 3W8DA 2Z5VA 1HGXA 4N0EA 4RKWA 5DHTA 1A3CA 4O83A 2FZ4A 2ABWA 4LHVA 2B82A 2JL1A 5KUTA 4YC7A 3ZY5A 1YC2A 4KMOA 3VJKA 2H52A 4TTIA 2JGDB 4P8RA 4N47A 1V3QE 4IJVA 3VDXA 4R01A 1ABEA 1NVUQ 5CEFA 1KY5A 1VE7A 1ZISA 1V37A 1X1TA 2D3WA 3AY3A 4G3XA 3RS3A 1EESA 1MB3A 1TCCA 2O23A 2C54A 1O97C 1AKYA 1PNVA 3NYIA 1U11A 4ZV7A 4BGIA 2C58A 4F56A 4MVWA 1XRSB 1XTZA 2VZLA 1KYYA 2WTEA 3LVRE 3TEMA 3KUCA 3RSCA 4WLFA 4BUJA 5JZBA 2DC1A 3DPUA 3MWKA 4C76A 5LKRA 3PVZA 3QIVA 5CHYA 4MV0A 1SCKA 2QLFA 4RD0A 4HN9A 5CLHA 5D3QA 5JAOA 3ADCA 1CUBA 2PAFA 4ZVOA 2HO5A 4UAJA 5G2OA 2G9QA 3PLAE 4U2EA 3D43A 2IYPA 5AR1A 1X1QA 3VO8A 2B2CA 1DZIA 2EWWA 3WP1B 3BG5A 1CV2A 4F21A 2R1ZA 5AM2A 1WXWA 1OZ0A 1G16A 3QVJA 3UICA 1LRKA 3BCSA 2WAYA 4EHNA 1KJYA 4XYGA 3QU2A 5AUOB 2O8CA 4R54A 3RC1A 3A10A 1WETA 1FNCA 4OGWA 3BVPA 5I60A 3ZHQA 1Z0AA 3BSWA 1KDYA 2H85A 4JI3B 2QSYA 3NM5A 3TY8A 1BWPA 1LBIA 1FX1A 3CLSC 4Z8YA 4WDRA 1LPAB 2D74A 2EZ4A 2HBRA 1C9JA 3AQIA 3KJQA 3CJQA 1XMVA 1BFDA 2OESA 2H65A 2VP9A 3IP3A 4RZQA 3QUAA 2ZS8A 1HDXA 4TSFA 5BR1A 1VHTA 4Q7EA 1E58A 1RWOA 4IMJB 3AF6A 1KDRA 1LDNA 5THQA 3K9FC 2FR8A 4PO9A 1DWOA 1OLSA 4GKJB 3B7PA 3ECCA 1ZNZA 1G21A 1LU9A 1QTRA 3N0VA 1XNJA 4GSKA 3PB3A 1CYDA 4MRRA 3VC1A 1ODIA 4FOSA 2BT4A 4E6EA 2J7KA 3D6MA 1U0NA 3P8ZA 2W6PA 3K5HA 1F6DA 3B9QA 3B85A 2JG3A 2XUZA 2J08A 1DDIA 4WTOA 5KNCH 3HUTA 5C7OO 4XXHA 5CW2A 1RXWA 4A6XA 2NU9B 2IL1A 3LLMA 2Q62A 2BP7A 4Y6LA 3IAS6 1C3JA 4D4JA 2Y68A 4DLBA 5J4LA 5JWOA 1X39A 2VPWA 3LXXA 4ZD6A 4IOMA 1TX4B 5HCNA 2CE2X 3UMMA 2PRKA 1JLLB 1QGUB 4WFIA 3V1UA 1WXFA 3CO0S 4EK9A 2H07A 4DRXA 3P5BA 2WAXA 3OETA 3ZIAA 3TTTA 1DKPA 3LKDA 1E2BA 5EQJB 4IW3B 1TVKA 2EKDA 1ICIA 1U9YA 4Z3DA 2IF0A 4TKVB 5KI6A 3WGZA 4KIWA 3RS8A 1GZSA 4QRDA 4HJRA 1O57A 3HO6A 4W99A 3C3WA 1Z5OA 2IUUA 3CX8A 4C0QC 3GDGA 1F8GA 3LM8A 5HKKA 1BW9A 2EYQA 4G8JA 3C6QA 3BULA 4G1FA 4CV0A 2HLNA 3B48A 4B82A 1H23A 4HGPA 1YL6A 2RI0A 4QBGB 1DBIA 2RGWA 3TMAA 3OTIA 1TADA 3ZE0B 2F8LA 3RV4A 1HL7A 1I13A 1YZTA 4UMVA 5JWHA 4IG9A 3HFSA 3VYTB 2HFJA 5IFLA 3GLHE 4UAGA 2KYRA 4HVTA 2HXGA 3W7BA 2FPGB 3LUAA 1H0HA 1QJCA 3AHIA 3H4TA 1W30A 2V6IA 4G4SO 4P1ZA 3S2EA 3SHTA 4MLCA 4EY3A 2JGEA 2FUCA 2X5KO 4KVGA 5IT5A 2NXJA 1WZ2A 5AVJA 3BRQA 4CNQA 5SYAA 1KAQA 3NTRA 4TUYB 4DMRA 2DLNA 1G7SA 4LYJA 4Y2JA 3QI2A 2RKWA 5ALTA 5FORA 3GVHA 4QU8A 1ISIA 2NSLA 3AIIA 3NV9A 2NVWA 3EA0A 4FCWA 2G4CA 4P86A 3REQA 3VYVA 4IS2A 1JE0A 4GR4A 3E5HA 2HRRA 1RBQA 1P2BA 1EM6A 2D1RA 4KQEA 2QTFA 2Z4SA 1U0GA 4J16A 5D51S 3RT1A 5EN4A 3ZWYA 4GDMA 4XPZA 2H8GA 3ZPXA 1J9GA 3IOEA 4D4HA 1EP1B 2J8ZA 1E6KA 4GRAA 2GPJA 4Q3DA 2YL2A 3DMTC 1P8JA 2QIPA 3GVCA 1BEEA 2WNSA 4MMYB 4JFRA 4P6VF 4V0SA 4AMZA 4DQUA 5A4DA 1X7WB 1G5PA 1D2HA 1U3WA 4GYYA 4WUVA 4X44A 3RRNA 4BVLA 4CYMA 4CFYA 2PXAA 4RLHA 9ABPA 1YZNA 2DVMA 1Q7GA 1PL0A 2HSJA 4JYPA 5TMBA 1KO7A 3FCAA 5SY9A 1WHSB 4LH7A 2XVAA 2H1RA 4EQ6B 2BMFA 1FVHA 1V8DA 4LHYA 2HIAA 4PCLA 4EA7A 1D8TA 2BGMA 2GZHA 3G0CA 4U7PB 4A2WA 4Z1OA 3ZQJA 1U7UA 1C9NA 2AFVA 2EDCA 3B3QA 2WEKA 4PVCA 4YAGA 1EGQA 4U2BA 3DTYA 5EZSA 4Z51A 3CRMA 2JLVA 4ZOLA 4MRMB 5E6UB 4MA5A 2V9ZA 3KKNA 4Q4AB 3LOQA 3Q3VA 1PGNA 4JIGA 2FAXA 5K45A 3GNTA 3UF0A 1DOZA 3VSDA 3DP9A 1Q20A 3BGVA 2L82A 4PF1A 3WGKA 1TTTA 3H5VA 3FETA 1EFPA 1PK8A 1J2JA 3DD1A 3PNOA 5A9TA 2YRWA 2WSLA 4LJSA 3GHYA 4NOJA 3DV2A 1WJGA 4RVSA 4WCDA 4O86A 2GQRA 3MAJA 5FT9A 5KYUA 4WI1A 1N2HA 4LF5B 2H3EA 2R1VB 1CRWG 1D2RA 1NQAO 3WK4A 3U40A 1AB5A 3OQOA 3RU7A 1L5HB 1AZTA 2WM9B 3NYRA 2W6JA 5T67A 1FZQA 3ZUPA 1F2TA 1O77A 2XDAA 3EXEA 2YOGA 4RXTA 4YS6A 3RC3A 2Y92A 3H7IA 4HS9A 2WWYA 4Y9TA 1I4DD 1Z08A 2ADMA 3RIGA 4JOSA 2J59A 4EMTA 5CB0A 4V1CA 5M7EA 3O9MA 2AZMA 4UUQA 4BQIA 3OG9A 4P80A 2VHJA 3M6FA 1GQ2A 4MTCA 3ILSA 3OLZA 3IDAA 4A5OA 3E05A 3JSXA 4N6OA 4HNTA 1RMTA 2Q5OA 4GM0A 3MJCA 3UMBA 1KR5A 1T2NA 2XUDA 3NXKA 5HE8A 1QTQA 2MT9A 1I1HA 1TU3A 4XRRA 4JENA 2I7XA 1MX1A 1CY8A 1Y81A 1F8YA 2DR3A 2HDOA 1KAHA 4KX3A 3VKFA 7GPBA 1FRVA 3ZU2A 1BDHA 3P4YA 3PX7A 1WIWA 2AL7A 3AL0C 3PEYA 4JI5B 4M22A 4NCKA 3ZJTA 4UE3S 2QJTA 2ODQA 5FR9A 1Y6QA 1X7YA 1XZAA 4MAMA 1Q95A 4PV7A 1ONSA 1FVFA 4PQRA 2ZUEA 3OJXA 4LCBA 4XM0A 1HK7A 3TBKA 2ZCJA 2WP8J 2V98A 2YUIA 4FGWA 1T8SA 1YSCA 4MDHA 3KELA 4P3KA 4WACA 1QO0A 2VWGA 3OM1A 3AERA 2OCAA 4LJ6A 3JY6A 3T6KA 4MW1A 1DUIA 1GL9B 3I53A 1ADYA 1E92A 2HCRA 2CHUA 5IN4A 1OIVA 1Y0BA 1TDJA 2O1SA 4GEKA 4PICA 5FA6A 2Q5IA 3ZZMA 3D4OA 5ITWA 4PYLA 5ADVA 3U6BA 5HRCA 4K6FA 4KUEA 2Q0XA 3E3LA 3BDVA 4E30A 3RAPR 2XT9A 2NSDA 3GUCA 1XN4A 2QTLA 2B1IA 5F98A 5JAIA 3ZD7A 3C6ZA 1Z8NA 4JLBA 5HQ3B 3JAKA 5A05A 4R40A 1XOIA 1PX2A 2YUTA 4J07A 5PGMA 3MA0A 2YVLA 3RE1A 1CKNB 4Z2AA 3HB1A 4QTZA 3A6KA 4OHMA 4D0RA 4G36A 4X97A 3U0BA 5BSEA 3UXEA 3Q8LA 1ZIXA 5JROA 5GM2A 4PNHA 4OATA 3NOOA 2ZVPX 3KV1A 1J99A 5ES3A 2XXAB 3R8XA 1G21E 1WMAA 5KOYA 3AEKA 1KEUA 1NVVR 1K98A 2NO7A 3AYZB 4KE7A 1OT5A 4O4JB 1FPQA 5EWMB 5EMLA 1NVAA 1Z0FA 2PUTA 1YQQA 2IXEA 3R0XA 4EKNB 3CVYA 1CF2O 4R1TA 2HWWA 1M2VA 3G7SA 1VLMA 3N0XA 1COWA 3N2YA 1T8YA 1YU6A 3U3XA 2H4JA 1XQYA 2AEJA 3BA8A 1D8AA 1QQ7A 3L1IA 3OFSA 1H4SA 1ENZA 2A1TS 1VJGA 2EYUA 4BZXA 2D4AA 1XAJA 3H9UA 4Q3KA 1R8SA 1KRHA 1UJBA 4DIMA 2FQ1A 3VNRA 3DO5A 5E3JA 4OX9B 2CEAA 4JT2A 1VSTA 5DPMA 1NAIA 3ZCUA 2ZPUA 5EQTA 2ZBEA 1PLJA 3Q7TA 4XI9A 5ALRA 5EE0A 3TE7A 4F12A 1JHVA 3GFQA 2LXNA 2OSBA 2Q46A 3HYLA 5ILQA 3ZW7A 4R41A 3B6IA 1TAQA 1Y34E 1GPNA 4DWJA 4IJWA 2P5UA 4YRAA 3OHSX 3C6MA 2YYSA 2O0LA 4M0PA 2HSGA 4GL4A 3MD9A 4NECA 3DDCA 3NGXA 4QBHA 2XOXA 3D4NA 1UAYA 4AD8A 2P3OA 3ZCXA 2VBIA 1C4OA 3FUUA 2IS6A 2KE5A 2BTQB 2E48A 4Y8VA 2OFFA 4RO0A 4AZ3B 1E6WA 2ORWA 1Z12A 1YDGA 2CNQA 2FPPB 2XCTB 2Y2VA 1EKFA 2JFWA 3WDKA 5CEJA 5AJUA 4MPPA 4O1MA 4TTAA 3KCQA 5L3SB 5BQ5A 1KIFA 1K3UB 2GEKA 2Y9PB 3QKRA 2R6AA 4JYBA 4LC0A 5ICFA 2Y0PA 2QG6A 3ZH2A 4C29A 1EI9A 1NVDA 1QUFA 5TB5A 1XQVA 4EB8A 1NGSA 3OPYB 5B6JA 1CZKA 3EGWA 1GLVA 1I6LA 4MIOA 4OHFA 5BQOA 4DA0A 5B1EA 2WJVA 2ZJAA 1V8FA 1FLVA 3DYVA 1PUXA 2GBFA 5AFSA 2VHXA 5A6VA 4MA0A 4NBUA 4YRJA 1YUMA 2WA1A 3ENWA 3LKVA 1YT5A 2P3SA 3ADOA 2PIDA 3HEBA 3ISJA 1GCOA 3OPXA 1GA4A 1YR3A 3UB4A 5AUPB 4L95C 3NBAA 1C3XA 4IIJB 2GN9A 2Z04A 1VKHA 1PNOA 2VG8A 3UGTA 1H1LB 1CJSA 1MIOA 2JEYA 5B58C 1DMSA 3U44A 1QYDA 1R88A 1TKRA 1M7BA 2A5YB 2B3DA 5CJPA 4DN6A 2PH7A 5ELLA 1VKRA 2H1VA 1U98A 1WLYA 3QE2A 5DM70 4CL8A 1KNXA 1KTVA 2EKPA 4GXTA 1U0TA 1SC4A 3I8SA 5EPUA 1SHUX 5EKDA 4REMA 5IDYA 3NDRA 4HT3B 2FUNB 3VHQA 3R5TA 2WB2A 5H68A 3ZN2A 3QA3E 1P5RA 3GMIA 4KH1A 4F4HA 5ITVA 5KJCA 1Y6JA 5E4FA 4LRXA 3EULA 3EWIA 2GN6A 3UANA 4DWVA 4YRIA 3CBGA 3GAAA 1KI3A 4MUGA 3QY0A 4QAJA 3WLAA 1YVPA 3KJZA 3FFTA 3DJFA 3GPCA 1EK1A 1DO2A 2PMBA 4IF6A 4KQWA 1S02A 2PX5A 4MJXA 5IDXA 1C9YA 2N75A 1V7CA 3LKZA 2GVNA 4BZPA 5DAAA 3MJEA 1A2KC 3STXA 5I7AA 1XRNA 3TBFA 3FBWA 3K72B 1WCYA 3VVCA 1IBMB 3VGPA 1SCUA 4YAOA 4S1TA 1EINA 2FMHA 1EVLA 1Z29A 2F3RA 2ICAA 3MHPA 3Q85A 5D1HA 2X2OA 3TH5A 5IN5A 3TXYA 3PJGA 5HZKA 2YMLA 4UARA 3G23A 1X14A 1E18A 2P6UA 3N8DA 3DZKA 1YVRA 1PUJA 3Q9SA 2BHSA 2QN9A 1RZRA 1RI2A 2YC4C 1VHJA 4KCGA 1F0NA 3RHSA 1A97A 2Z57A 4BMXA 4TYNA 4V0LA 1DRVA 1DX4A 1AXGA 1IHYA 2BLLA 2O07A 5EXEA 2QG9A 5K03A 2CZGA 2G6BA 2NADA 2QN8A 3EPKA 1RYEA 2C59A 1KXJA 3UZOA 1PX0A 5JXHA 1OROA 3BE8A 4FIZA 4FUTA 1Q91A 2YN2A 4JROA 3BRWD 3V3KA 1P5ZB 4AY3A 3KR1A 1GNQA 3TQTA 4OO3A 3P0JA 4NEQA 3WYDA 3TCXB 1YTUA 2MOKA 3JQAA 3TLKA 3TKAA 5AI6A 3K8OE 3SGIA 1O6BA 3N2KB 1OGYA 2DFDA 1U81A 1KKLA 2X3YA 4M76B 1FTQA 4OQZA 5AK3A 5C8YB 4JC0A 2VYCA 4AY5A 4CE5A 2ADOA 3F9IA 2QM0A 4KRGA 2CBZA 2IH2A 2BFOA 4IF4A 3ZCRA 3K0HA 4MS4A 5K3BA 1MDFA 1V16A 2IDJA 4TLEA 2J09A 2QM8A 4KR9A 4DR4B 3W3AD 1NI5A 2QUJA 2J9FB 2QVBA 2HD4A 1MVOA 3DKPA 3DQZA 3P2YA 2ECFA 4LXQA 2PS1A 3W4JA 4BE7B 3AR2A 3T3IA 1NVXQ 3JRXA 2JLYA 3QJGA 5CTJA 3SG0A 2FWMX 1QFMA 1TRHA 3MQ2A 1LFAA 2DHCA 3U6KA 3D6JA 3V1MA 4U2CA 4B83A 1N5DA 3T1YB 3CZQA 2OCDA 4B43A 5DZSA 4FGZA 4A8JC 5H3LA 1HYQA 2CDRA 1LDEA 4GKAA 1KZGB 3LQKA 3FAKA 1YIAA 4RVUA 4KLZA 4WK6A 3SAJA 3AONB 3ELUA 3SKVA 5CCBA 1UODA 4DHWA 3MJSA 1DIBA 1FNMA 2L42A 2COKA 4LOKA 4BKRA 1XCGB 2J4CA 5FCDA 2IBMA 5D6NA 4NJMA 3MNFA 3F8SA 4ZJPA 4CETA 3WNCA 1HUQA 3L9XA 2BGKA 4HYTA 4H6PA 1M34A 3AUUA 4ZVVA 3U3DA 4DQ0A 2EBHX 2XNKA 3BH6A 3AYXB 3HUEA 4B73A 1E5VA 1VGVA 1EAYA 3ANMA 5EIWA 2NACA 2VF8A 2ZUFA 1LBTA 2J67A 1CUAA 3VFDA 1NN0A 2UUOA 1OR8A 1VBGA 3HM2A 3MT0A 4BVEA 4KSYA 1X8JA 3L41A 1GL3A 4AS1A 2YZGA 1KUTA 4RLSA 5DLEA 1Z8FA 2W22A 1QTNA 3U4AA 1J0EA 2HL6A 4M0CA 5IWCA 4I19A 3L1KA 1XKQA 1MX3A 1F0YA 2XH8A 3EXAA 3K0CC 5LQSA 4E14A 4A73A 1D6NA 3T35A 3R1IA 3FTEA 3C3CA 2ZSHA 2DLDA 1KI1A 2WD7A 5JCJD 1JHAA 1GCUA 3HBFA 2JFPA 3MB8A 1RXYA 2Y6UA 2AN5A 4ZK6A 5JYCA 2B83A 4BX3A 4YECA 4W9NA 2ZTMA 2A9OA 5E25A 4HYQA 2YWGA 2P9BA 1A72A 4KO1S 2SBTA 5BVHB 4MQ4A 2DOKA 4UTNA 4Q19A 5FOUA 3JX9A 4YAWA 2IHNA 4YXFA 1S68A 1IOLA 1XXHE 1WOYA 1ZHHA 3IP8A 1RWNA 1NR1A 1TECE 4ZTZB 1TYBE 1NY5A 3RYHB 5DM0A 4IDPA 4MVJM 4ZYTA 1LV7A 1ZK1A 4N5DA 1RYMA 1UOOA 1EA5A 4ZEWA 2JIDA 4YXWA 5A1TA 3N59A 4G0XA 1PQ4A 4ANFA 4F7WA 2JLCA 3LFHA 4RY8A 2B78A 2GNOA 1VA5A 4PX5A 1EVEA 2PUHA 1E96A 1R6XA 3IO5A 1MNQA 1V6CA 1YBHA 3QHAA 2H17A 2YRXA 1W7AA 3NEPX 3IAXA 3PFKA 4M36A 7AT1A 3RHTA 1S8AA 1Y1RA 3LIPA 5G0TA 4F72A 3HYNA 1E3WA 5FPTA 5K6AC 1PYGA 1UJ4A 3LRTA 4YMGA 4FGKA 5JRZA 2R3SA 3E15A 1RBYA 1BXKA 4R81A 2AMFA 2HF7A 2QMEA 3GRZA 2I9KA 4EJ6A 2TYSB 4WMLA 3MCUA 4MVYA 2GCOA 1H1DA 3OLVA 4WLEA 5U1PA 4ZU3A 3RLIA 3BXFA 3TEJA 2CNUA 2BGUA 3W78A 4FI3C 2PGDA 3NVDA 5FTJA 2GZRA 3L8GA 3K30A 3R8FA 4WZBB 1JR2A 3D8RA 3U48A 5LQJA 2BEUB 3NRJA 4RNDB 3IJ5A 5EIFA 4E5SA 4RTSA 2Q07A 1PDWA 2B8TA 4LXXA 2BWJA 5IPFA 3DE4X 4U4AA 1UR5A 1PRYA 3QWHA 1RAFA 3S40A 4KOAA 3HGMA 3V80A 1W5AA 5ALDA 1KSGA 3IMKA 1CUDA 4LSWA 5JNSA 3BHNA 3U7HB 2WWWA 2F1JA 2DRIA 2VF2A 2GZMA 4I5DA 2Y1WA 4C43A 1OT3A 2K7ZA 2VJPA 3STUA 2XY4A 5JBNA 3WADA 1JLKA 4DNOA 4YR7A 1IDOA 4CC6A 2CL0X 4NTZA 3EGIA 4ZEVA 1NQXA 2XADA 4UJ3A 2CFCA 4LZNA 5T41A 2EZUA 2Q7OE 3QG5A 1S01A 2I4LA 4GOXA 1I36A 4KXYA 2FG7C 3HYRA 2FTKE 1P1RA 3HY6A 3T3MB 2RGCA 3NWJA 1CFZA 1LNSA 4IUYA 4ENSA 4G41A 1FYDA 4QJBA 4I6EA 3W5HA 1YCDA 3BJEA 5AHWA 5C7LO 5C1BA 5I48A 5K3AA 1RCFA 1YTLA 1M8JA 4IUCS 1DT3A 3NNDA 1ODCA 2QU8A 2W6IA 1K0UA 3S1AB 3W34A 4UCSA 4MPDA 3RROA 5GOZA 4C1BA 4MNTA 4B76A 3GXOA 2ISCA 5E38A 3LQRA 5FQNA 3WLFA 1P3DA 1VIVA 4R84A 2CLIB 5A7GA 4BBZA 3SE7A 1E8DA 1CJTC 1EKXA 2D1SA 2FRDA 2JIQA 2O2DA 4H7IA 2NQTA 4UAVA 5LUBA 1IN8A 1F4LA 2P9FA 1VOTA 4UZEA 5J40A 3ECSA 3TR5A 2UZAA 4MI3A 2JFNA 2VF5X 3IMGA 4J2OA 4Q6BA 4E2XA 2BH2A 3AHJA 1SZPA 1R18A 2BFEB 4J0JA 1P7VA 5C0OE 2GN0A 1ZCAA 2A0KA 4JQSA 4PYQA 4X3OA 2R97A 5J4YA 4PFQA 4DWOA 1NP7A 2HHCA 2GB4A 3FDXA 4ZI7F 2JKVA 4WAUA 1LUAA 4XYLB 1NW5A 2ANBA 4J6EA 1DQPA 4RA6B 4GG1A 5K3FA 1N9KA 3KEFA 2OC4A 2ZXEA 5C1OA 5EXSA 4D3FA 5BRNA 4DA6A 2R62A 2Y6VA 5B4UA 3GLKA 2CLKB 3OLXA 3KHKA 1CY2A 3M81A 4MCJA 4BEVA 1EXDA 1VBFA 2H2AA 4IUBS 5YASA 5KTYA 1GRRA 5BT8A 3FOZA 1ENYA 3AM5A 1BDMA 4CCYB 1D6MA 4F2WA 5G1PA 5JADA 4FB4A 3GLIA 3BD7A 3BMNB 3EXFB 5K3EA 1BZYA 1ZMBA 2VUUA 3TJRA 3ZDRA 2PWAA 3K32A 3OPNA 4C7MA 3V4VB 3GLQA 5AWFC 1I3NA 2E3JA 1WDMA 2FSVC 4X65B 4MV5A 4Q47A 4HS4A 4YRNA 4UQPA 2OQ2A 1EMDA 2P8SA 2AEEA 3C39A 3H5AA 5FLKA 2ZATA 1C9KA 3CINA 1E2IA 3WL5A 2H2DA 3AR8A 4LXTA 4YQEA 3DLIA 3ZWOA 1JFTA 4WNIA 4LNUB 4NULA 3UJ7A 2YYAA 3VYWA 3IE1A 2K4MA 1ZXLA 3C1UA 5KTOA 1ECPA 4EJ0A 3A9SA 1M34E 1JFLA 1U28C 1P4HA 1INLA 3BMCB 1O4VA 1AH2A 1I2DA 1ULAA 3FOBA 5FUYA 5SZIA 5KYVA 3ORYA 2PGXA 1C1XB 3ZY3A 4YUXA 1MABB 2HSWA 4TLMB 4GLBA 5IDVA 2DFLA 2J0QA 2ZYGA 3QF4A 2PX4A 3K70D 1RSZA 1NKTA 4FN4A 1TQ2A 3QOFA 3ZXSA 2H4ZA 5HK8A 1NW9B 1W5SA 2Z2ZA 5E6SB 2UV8A 3ED5A 4YRLA 5LBUA 5IXSA 3EGDB 3KVNA 2RHHA 3PC3A 1T26A 5ETJA 4M1TA 1TD9A 1O94A 3BEDA 3FDFA 3OQIA 4LRYA 1G2PA 4M1EA 4MZXA 4G9EA 4TSFD 3ZGLA 4F06A 3F2VA 1WSDA 3AOEC 3GJ7A 4GX2A 4IICA 4B4OA 1E1CB 4DIKA 4DZZA 4I50B 4O7RA 1TF2A 2BGJA 1MAWA 5IZCC 1Y3IA 3N75A 1NIJA 5GZ6A 3B3JA 2QTRA 4B75A 1FW6A 5E0OA 2L69A 5DOVA 1DEXA 3N2EA 4GI7A 3SVTA 5IRCD 3HXOA 5H8WA 3IQIX 4EB3A 2PZEA 4D9IA 4HH4A 1KMHA 1ZGHA 4HADA 1Z68A 1Z2AA 2XX3A 5IYZB 5C53B 3LW8A 3E8MA 2VSXA 2WC1A 1NMXA 1L5RA 4B6SA 1KEKA 3NH6A 3ZS9A 4BNWA 5L51A 1RM3A 2GWHA 2OV1A 3A1TA 3HFJA 4ODIA 1ZCZA 3PEEA 1QFJA 2FWPA 1X9HA 5H83A 2EW2A 2OCBA 4YUVA 2AJ8A 2QW8A 1O89A 1U8CB 4KYTA 1GPDG 3DBRA 4FD3A 4G5YA 3ZIAD 1VL8A 2QJRA 2N47A 3PEFA 2X4IA 4HEJA 1N8TA 2H1HA 4R68A 3ECAA 1PJSA 4U0JA 1CWUA 5AM1A 2VNIA 5BSTA 4JNKA 3EXIB 1YBFA 4ARVA 2HZ7A 5HKKD 4EY5A 1YBVA 4KRYA 1XAHA 3CM0A 1G7TA 2BEVB 2M1XA 1E89A 2CHEA 3FPFA 4LHZA 3BZWA 3URKA 2CXUA 3WGHA 3WAKA 3QPVA 3LUGA 3QPBA 3RUHA 4IVRA 4NE2A 1TAGA 2JAOA 3BTVA 4JJIA 3VC2A 4XVCA 2HRDA 1BN7A 1M54A 1YKFA 1VBKA 1H2HA 1OKKA 2BD0A 1TTHA 3ZWWA 2E4XA 3IUBA 1XQWA 4AURA 1YI1A 2A0YA 1VCHA 5HJ2A 2X0EA 1OYVA 4MUHA 4MITA 4OLAA 1G64A 1QR2A 1Z7BA 3MOSA 2WLTA 3EEYA 4AO7A 1ESEA 4K05A 1FP1D 5F77A 2HMWA 2HMYB 1RRMA 2PA0A 4QJ4A 3MTEA 4Z8XA 3S68A 3WA6A 4CG3A 2FWRA 3GFVA 4O8ZA 2CHGA 2D8AA 1BQ3A 4ER0A 1YQGA 2JH9A 2VDQB 5FI5A 1TJPB 2JCGA 1QIHA 5JO9A 3EARA 3H9GA 4ZCTA 1ACLA 3BHJA 2Q3MA 4POAA 1LLCA 5TNXA 3QFRA 4Q0MA 4YVFA 3U3ZA 4E03A 4OKIA 1EUDA 4RHUA 1SQFA 4PWZA 1FW8A 1M5UA 1N1DA 4GPBA 4XX0A 1L5NA 5INTA 1YQUA 2XAAA 2XRMA 4TLCA 4TS4A 4ZVMA 4OTZA 3ZDZB 3T38A 4ZCIA 2D7DA 2B1JA 2Q1UA