3AW8A

Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
366
structure length
360
Chain Sequence
MIGILGGGQLGRMLALAGYPLGLSFRFLDPSPEACAGQVGELVVGEFLDEGALLRFAEGLALVTYEFENVPVEAARRLEGRLPLYPPAKALEVAQDRLREKTFFQGLGVPTPPFHPVDGPEDLEEGLKRVGLPALLKTRRGQALVRTEEEALEALKALGGRGLILEGFVPFDREVSLLAVRGRTGEVAFYPLVENRHWGGILRLSLAPAPGASEALQKKAEAYALRAMEALDYVGVLALEFFQVGEELLFNEMAPRVHNSGHWTIEGAETSQFENHLRAVLGLPLGSTAPRGQSAMVNLIGEKPPFAEVLKVEGAHLHWYGKAVRPGRKVGHITLRRDGLKALEEGLARLSRLVSELPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title Crystal structures of N5-carboxyaminoimidazole ribonucleotide synthetase, PurK, from thermophilic bacteria
rcsb
source organism Thermus thermophilus
total genus 107
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3aw8A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aw8A01
4FFPA 2YZGA 2FPPB 2VPQA 2ZDHA 3RUPA 1DIKA 1A9XA 4O81A 2W6ZA 3R5HA 4TV9F 3VA7A 2YRWA 4O2BF 4HNVA 1VBHA 4DIMA 3TIIA 4RZQA 2R7NA 4FU0A 1PK8A 1KJ9A 5GONF 4FFOA 3QFFA 1I7LA 3OUZA 1KC7A 1UC8A 4M98A 2W6QA 4MV6A 2R84A 4TUYF 5BMVF 2FB9A 4EGJA 3KAKA 4EAAA 2XD4A 3KREA 4FFRA 1EYZA 1C3OA 3U55A 3V4SA 3Q1KA 3R9RA 4O83A 5CAEB 2CZGA 2W71A 1KUTA 4O7RA 3VMMA 2VQDA 3G8CA 1A48A 1GLVA 1C30A 2YW2A 3HO8A 2FPIB 5J2TF 4EA8A 3NUAA 4TV8F 1B6SA 4O7NA 2V58A 2W6PA 4C5AA 2R7MA 2NU9B 4M9CA 4EG0A 5CA0F 1KJQA 1GSHA 2YS7A 2OLSA 2ZDGA 4I4TF 1JDBB 1ULZA 2W6OA 3R5FA 2GPSA 1DV1A 4DLKA 2I87A 5FNVF 5KX5F 3U54A 4YBZB 1T36A 1GSAA 4O4IF 3KAJA 4IIJF 3GIDA 4C5CA 4O4HF 4XYLB 2I8CA 4O7WA 4M9UA 2R85A 2DZDA 3HBLA 4MAMA 4C5BA 3ORRA 3R5XA 3WNZA 3WO1A 5BPFA 1BNCA 3R23A 1UC9A 1M6VA 5C1PA 4FFNA 4FGRA 5EZYF 2Z04A 2YZLA 4ZOLF 4FE2A 3BG5A 2SCUB 1GGOA 4EA7A 2DWCA 4YAJB 3VPCA 4I55F 2PVPA 3JRWA 2R82A 5HV6A 1KJJA 1JKJB 1EUCB 4YAKB 3JZIA 4ZQIA 2R87A 2PBZA 3BSWA 2XCLA 3VOTA 3ETJA 2W6NA 4ZI7F 1PX2A 1B6RA 3LP8A 2C00A 4O7VA 3VPBA 4O82A 4Y8VB 1IOVA 3U9TA 2R7LA 5C1OA 4YB8B 1KJ8A 3K5IA 1OBDA 2ZDQA 4XX0B 3TIGA 1M0TA 5LA6F 5JH7F 3UFXB 5K2MA 2P0AA 4XZ3B 1I7NA 1EHIA 4EA9A 2YWVA 4XYMB 2YS6A 1JLLB 2I80A 3V4ZA 1SCUB 2VHEA 4J6EA 4IWXA 2QK4A 1CQIB 4O84A 3BSYA 2NU6B 4IZOA 4HNTA 1VKZA 4FFLA 1Z2OX 2FP4B 1E4EB 2W70A 3JZFA 4MV3A 5KKNB 4IWYA 2DLNA 4HQ6A 1E4EA 3RV3A 1CS0A 4EGQA 4FFMA 5H80A 2DIKA 2R86A 4MA0A 3E5NA 3I12A 5LOVF 2CNQA 4O7TA 1JDEA 2W6MA 3HB9A 4L1KA 3U9SA 5JVLA 2NUAB 5LP6F 2NU8B 1OBGA 2CNVA 2V5AA 1WR2A 4YJ2F 5C8YF 4MV7A 4HR7A 5IYZF 2X0SA 3TW6A 2GPWA 3AX6A 1AUVA 4O7LA 2CNUA 5LYJF 4O7ZA 3WO0A 1CE8A 4I50F 5HBRB 2IP4A 5D8DA 4WBNF 5JVDF 1Z2PX 4MV8A 2R7KA 5JQWA 2NU7B 3K5HA 1GSOA 4MV4A 1BXRA 4QSHA 2YZMA 1W96A 3BFPA 3ETHA 3SE7A 2GLTA 1IOWA 3BSSA 1EUDB 4IHJF 4O4JF 5LXTF 2Z02A 2YZNA 4YJ3F 2VR1A 5BPHA 2HJWA 1EZ1A 4MA5A 3G8DA 5J2UF 2FPGB 4O2AF 4HNUA 4GGMX 1M0WA 4MV9A 1CQJB 3MWEA 3RV4A 2YRXA 3K3PA 4EABA 4O86A 4O7YA 1VBGA 2QF7A 2PN1A 3Q2OA 2YYAA 3N8DA 3TINA 2HGSA 3ORQA 4E4TA 4WD3A 5CA1F 3N6RA 1W93A 3RFCA 1KBLA 3TQTA 3VPDA 5I47A 3LWBA 5CB4F 4ME6A 3DF7A 1KJIA 4O7SA 4NYEA 4M99A 3OUUA 2V59A 1KEEA 2J9GA 1DV2A 3AW8A 2WYOA 2GQRA 2GQSA 5JQGF 3MWDA 3MJFA 3JRXA 4O4LF 3GLKA 5DMXA 3KALA 1Z2NX 4MV1A 2NPOA 2YL2A 1AUXA 4ZHQF
chains in the Genus database with same CATH superfamily
4Q3AA 3KYHC 2X8BA 1V3VA 4MP3A 1KQGA 1R4ZA 1RI2A 3L0SA 1L7QA 4INOA 4M0MA 3CZ5A 1FDOA 4OH7A 3TZBA 3UMBA 1O8CA 2TMKA 4ZPJA 5B5SA 2YJ3A 3GFGA 2QZPA 1WPXA 1XEXA 4GMHA 2QMHA 4URUR 4NZOA 2YKGA 2CKDA 1YH3A 4I81A 2VC2B 4ZEWA 2JH8A 4KQEA 4EJSA 4CMFA 1FE8A 2O48X 5T4BA 1Z3CA 2WYWA 3KJXA 5B7GA 2P2LA 1KU0A 2VH1A 2ZRAA 4CIYA 3U3MA 2RFLA 3PXCX 4O5OA 3KS9A 3ENZA 3EZ7A 2RHWA 1U4NA 2QTFA 3GD7A 1BROA 1BQ3A 4JR0A 4Y1FA 1QIKA 5C4GB 4ECEA 3MTDA 1YQEA 3KR9A 4C20A 1LSUA 2WWFA 5FLEX 3IVXA 3NM5A 1BJTA 1Y3DE 3M5DA 3WQRA 2IU4A 5IARA 4KR2A 2O6HA 4RQAA 1GCIA 2JDIA 2YWHA 3WA6A 2NZYA 3AP3A 2NYUA 3EY4A 4D41A 4DCOA 5GIPE 2NV0A 1VHDA 2BTEA 5FV7A 1W4AA 1QH1B 1XOIA 4QHTA 3N5KA 2I2BA 1VJ1A 5IPFA 5F9HA 3EW9A 1NG9A 3T3NA 2XB2A 4L07A 1MA3A 4BX8A 3INGA 2CUZA 2LXNA 3P5BA 3UATA 1JBKA 1ZIPA 2ZE7A 4PONA 1OKKA 5C8XA 2BH2A 1VHWA 2HFJA 1QGED 4X44A 1TEZA 4N9QA 2ZVQX 3PKZA 1OI2A 1Y42X 2B36A 2VO1A 2YHIB 1CKNB 1FX0A 4UKDA 1EZZA 2P4EA 5IW8A 3WWOA 5IZCC 4U7DA 3LNCA 2YXDA 3IESA 1RR6A 1A3GA 2Z43A 3LF2A 5AW2A 4ZXPA 4B84A 1KBZA 4PBSA 1DWQA 2DBRA 2WFMA 4BIMA 2G04A 5B58C 3NV9A 3BFVA 4Q6WA 1ZH2A 5B4VA 5MN6A 2VQDA 3KPJA 1A48A 3RBVA 1RRVA 4ND7A 2IYQA 3DKKA 3G49A 4BQIA 3T7AA 3EGXA 3SHFA 5EMNA 5L3ZA 2AUNA 4QXPA 4TMZA 5TXGA 3VZQA 2HSJA 4L73A 3UMYA 4CQLA 2XITA 5ADUS 1I13A 4H77A 3OM1A 2Q3LA 1JG1A 3I2GA 3M3HA 1IZZA 4XM0A 4MLDA 4PF1A 1OBVA 1HO3A 1GU0A 2OBYA 4MTCA 2WILA 3BL8A 4BQFA 2AJ8A 4OHMA 4F1WA 1N7GA 2RB4A 1HKHA 1GSHA 2JHPA 4QHSA 3F7TA 1GFWA 2FFQA 2BR3A 1ZIOA 3TRIA 3MJSA 5DPMA 1S0UA 2AV6A 1WW2A 2XQFA 3D1LA 3IUPA 3JQAD 3KC2A 4GRIA 3TLKA 4PPQA 4A8PA 4MW6A 3N8HA 2K6GA 4L74A 1ULSA 3KOWA 4OGKA 3I8SA 3B9PA 5TQVA 5BRJA 1JEYB 4Z4HA 2FV8A 4LUCA 1UP6A 3BHIA 4Q4AA 1GARA 1RWOA 4B4WA 1A8UA 4RPHA 1VPEA 1A7JA 5CPBA 4RVUA 2H57A 2XUPA 1BDMA 1YDEA 4G1VA 1ZK3A 2YJZA 3UJ8A 4DIBA 3IP7A 2J9RA 3D7MA 4QFMA 4YALA 1FP4A 3ISJA 3MBKA 2OL4A 4U2GA 3JAKB 3WJ7A 2ZI7A 1A9ZA 1XJQA 3DC7A 4L50A 2P3OA 4S04A 3TZHA 2GA9A 1WHSB 2ZGIA 1XVAA 3OCJA 4U6NA 4D8VA 4BX9A 1E59A 1PI3A 1PL8A 2BEUB 2I8LA 2ZI9A 4YR7A 3I76A 2YWFA 3GUZA 4XCXA 2FSVA 1GPJA 4OM7A 3FPHA 4DNPA 3PFCA 3BL6A 2Z2JA 2L18A 3KT6A 3B2QA 4EI2A 1SIBE 4ZODA 1U0LA 2YC2C 1Z36A 4R05A 1VYTA 4MVCA 3TLGB 4EYQA 5B1IA 4ZJYA 3K9FC 4GLXA 4U7JA 1O94A 4E5NA 1UKVY 3UCFA 3B1KA 3BREA 4ZYUA 3HJUA 1Q95A 1ATIA 4MIYA 1GZ4A 2AMLA 4GS5A 4XIGS 5FWAA 4DFDA 1P29A 2BBTA 4FYYA 1PWZA 5JCOA 1X80A 4FE2A 3CLKA 3CRVA 4B6SA 4Q1AA 1CIVA 1OD6A 5HF5A 4DXAA 3FXAA 3DEYX 1CETA 4R1TA 2RE8A 2EZ4A 1EVYA 3V9AA 4GI3A 1JN0A 2PXAA 2R6R1 1KFEB 3TBFA 4E4RA 4XIYA 4FNAA 4RSRA 3VR5D 1IBRA 2H4YA 3PG5A 1DJMA 4Z6KA 4XWAA 2PRKA 2VPYA 4IYJA 1L6IA 1UKEA 3CS3A 3R3ZA 3FBGA 5FBRB 1IJBA 1PFGA 1T5TA 1X86B 2ODBA 1J49A 4JJEA 4JGIA 3L06A 1VE3A 1GPDG 5A9TA 2YV3A 3X1KA 3K9NA 3ACBA 1K6XA 4Q7MB 2VPWA 3BCSA 3F7NA 5EKSA 3MZ0A 4XUEA 2FPWA 4B34A 3OKPA 5HGJA 3L0DA 3W5JA 1USKA 4QAQA 4L9RA 4B35A 4AY6A 5AUNB 1KYXA 2IVFA 1KF0A 1BXRB 1KPGA 1PX2A 1UBJS 1YU6A 2JD1A 3DOUA 4GC9A 4H17A 4AK9A 5AIAA 4TMWA 2C83A 4TV9A 5LP1A 4J0DA 4CKBA 1JR3E 2CBZA 2QAIA 1D07A 3HBJA 1J99A 2V6GA 1XO1A 4INJA 3I37X 4JLAA 2H2WA 3DE2X 4ICIA 1ZRHA 3KX2A 3LHKA 3OLYA 1L7MA 3RIGA 3V42A 1W76A 3F7MA 3L84A 3JQEA 3P4YA 2X2FA 3SHQA 2EKZA 2WC1A 4GX1A 1MKYA 3ANMA 2Q9CA 3LS2A 5HMMA 5FTWA 5K0ZA 2VDOB 4ENQA 3T5DA 4P32A 4PG5A 2A4MA 1F3OA 3SLRA 3GFRA 4ARIA 1PT6A 1VYUA 1YD7A 3UT6A 1BD3A 1SCNE 4ZD6A 3TRHA 2EW1A 5HKLA 3AGPA 2G77B 3L8EA 4RKYA 4H16A 5FV4A 1HQKA 3JAMA 3GI1A 3SXJA 3DOCA 2WZQA 3W1GA 1VIMA 5HDQA 4EHKA 2OECA 2ZWOA 4FT2A 1M54A 2FPRA 2LVBA 1J24A 1BHJA 3LIIA 1X1RA 5JH7F 2J4CA 5DYYA 2EOAA 4ESVA 1AIPA 4HDNA 3FZQA 3M6AA 4DV3B 1AQIA 3K94A 1ST3A 2BBWA 2GRJA 2X4IA 3T8YA 4X91A 1MHPA 2COJA 2QX7A 4YRFA 5IXJA 2VJMA 5I4CA 1GGEA 1XMJA 3MB8A 4FR5A 5SZKB 2AOWA 1M2OB 3BWVA 3CGWA 3PQ4A 1M7GA 1MAUA 1YRLA 4GX2A 4U3JB 3N28A 4HQRA 1JLLB 4EB6B 4XLTA 4AZ3A 1NWCA 2O6LA 1KI8A 3W4JA 1XU4A 2PQMA 2QMZA 1I2ZA 4URYR 4AULA 1VJGA 1ORRA 5CTJA 3W78A 4ZEVA 1IQUA 1HF3A 1HFEL 1BX3A 4WN9B 4JBWA 4G2NA 1I7PA 4WGFA 1KDTA 5AVOA 1YFKA 4ZV7A 1PF7E 1YMVA 3D2CA 4IHAA 3WRXC 3LTNC 5JH7A 2RBKA 1JWAB 2OUIA 3FR7A 1DAEA 4KIWA 4K0KB 1GEGA 3LOQA 3TLBA 4E6EA 5E7IA 4U0KA 3BWXA 1FNCA 3LQ4A 2E82A 4NQZA 3TLAA 1K8YB 4LQLA 1QWSA 2GBIA 3H1PA 2O2YA 4NSNA 4HG2A 4LHXA 3C5CA 4US0R 1M7BA 4DMLA 1RVV1 2H3HA 5G0WA 1I1LA 4WNAB 3ZHCA 3MUEA 2IWHA 2A0FA 1LLDA 4KIUA 3D7SA 5EYPB 1CZRA 2W0MA 2CWDA 2G07A 1KEEB 4DLTA 1KTIA 2H0QA 3ADKA 1I5EA 5DX8A 2O06A 4FBMA 3KHUA 3Q40A 2CL7X 3ILVA 5FFMA 2WJHA 3IOBA 1PBNA 2PT5A 4B80A 3PDIA 2IU0A 3ZLTA 2CVQA 5C8VA 3AF0A 1V3UA 2G76A 2UDPA 1IY8A 2UV8A 3H2ZA 1K08A 4BVAA 4WKNA 7REQA 3WAGA 3GMIA 2VBGA 2A5JA 4W4TA 5DE3A 4O4HA 4D9CA 2VZ0A 5JANA 3R8XA 4M1SA 4C2BA 1CR1A 4ON9A 1EK2A 4GI5A 1AA6A 4HWOA 2XNCA 1XU7A 1JF8A 2GT1A 3U7QA 3E7DA 3L02A 3L05A 2AQ8A 4R5HA 4E2FA 3AR7A 4HDCA 4JEMA 4WOBA 3UJPA 3AX6A 1MIOA 4TKLA 1US8A 3H42B 4KHZA 3UJCA 2QL9A 4NI5A 4XDZA 1GZHB 4MW5A 2OMKA 4XD7A 1NT4A 2AWNA 4AURA 2QORA 4MPPA 2W8BB 3R3YA 3U0GA 2AJTA 2JGNA 3DZDA 4MYRA 4OI2A 4QOEA 4AP6A 3EQ9A 4X0EA 3I6MA 4CNBA 1HWYA 1YA4A 1V43A 1GPNA 2VNAA 3BF7A 2NO7A 4DA7A 4DM4A 3NFRA 5JWRA 3VGPA 5DASA 4G07A 3FSEA 3RF6A 3C3YA 4FLFA 2FGJA 4NC9A 2FSVC 5KYGA 4G5RA 1K06A 4PINA 2XOKD 3KYBA 4LTDA 2PBLA 3T52A 1TZKA 1J0CA 2OEPA 4WCFB 5FPSA 3RTCA 4QARA 1CUCA 1DBIA 2FVXA 1AK2A 1TM7E 2PLAA 5I7UA 5TE9A 4DR2B 1JFTA 2HIXA 3OWOA 1W5SA 3VKVA 5JPIA 3K5HA 4KGZA 3S7TA 1RZVA 3HU1A 1EXNA 4XIIA 1MD9A 4C4ZA 4EP1A 2AHOA 1PTJA 4MK4A 1IWBB 4QSHA 4WNYA 3KB6A 1A5SB 4MVJE 4MKXA 4U7PB 3BFPA 2A5YB 3U0VA 4M0DA 4GOOD 4I8DA 1RZ3A 2ANBA 1U7OA 3CPHA 3OZXA 4POOA 5BVHA 1Y80A 2C99A 3BXPA 4FZVA 3RTGA 2G4VA 4L6CA 1EUDB 1BMFD 2RH4A 3K1JA 4IVPA 5LXTF 1VXOA 1A5TA 2NP6A 2ZPUA 2VTBB 3R9WA 1JE0A 2AN3A 1XEFA 3BWEA 5A02A 1ZA1A 4E5UA 1UJMA 2EG5A 4LPKA 1M76A 1ILWA 1P44A 4HXFB 5F7XA 1B26A 1P4GA 4QO8A 2GZRA 3QVSA 4TTJA 3RB8A 2C7PA 2Q99A 3DONA 3GGPA 1WLSA 2RJ3A 3T7TA 1M0WA 2J4FA 1SKUA 4XGQA 4UATA 3TOCA 1G8FA 2WRZA 1QZZA 1F14A 1MEOA 2Z09A 3GD5A 1VZ3A 1YVRA 5AP9A 3FHOA 1QH8B 4UAUA 4ZU6X 1THZA 2BZ0A 3WGQA 4BNZA 1G41A 2EJTA 4GW3A 2GJKA 4RGQA 1O0BA 1YI8A 3P8ZA 2G0TA 2LPMA 4BLUA 1RRKA 2FXVA 1AF4A 4NG4A 1VBGA 1GUBA 4N5HX 5MFPA 2RKWA 2C4HA 3RJZA 4PZAA 2NQTA 4ZVQA 1V8OA 2FSFA 5F64A 3ZDZB 1GQRA 3PXUA 2V7TA 1JQAA 3CRNA 1ZQ9A 4LXYA 1HEIA 3TINA 1LS6A 1N2CE 2B3TA 5BNZA 2HA4A 1S1MA 4JD5A 4JZYA 1B74A 4F0JA 2MOKA 4MQ6A 2GF9A 2AC7A 1OLUA 5LZ7A 4FZ5A 3N7AA 2PX0A 4CHIA 2R6JA 4F1KA 2C5SA 1KY2A 3ICCA 3JW8A 1L7XA 4CTJA 3MN1A 4F12A 2D1YA 3U2QA 1PZNA 4UUNA 4KFCA 1TRHA 5EJ2A 5JSQA 2X14A 1PR6A 1GLGA 3ASUA 3DGFC 3SDBA 3V2IA 1DT5A 3HZHA 1CUXA 2WT9A 1Z6GA 5EJIA 1GNVA 3QG1A 2FWMX 4ZTBA 4E5YA 3ASVA 3NU1A 1MO2A 4HVTA 4WK0B 3RD5A 2NSLA 3ZU2A 3R7WA 4OJNA 2XVYA 3BXOA 4IHKA 4ND4A 3V1NA 4DQUA 5CA1B 4NFSA 5BSEA 5D3MA 4HGNA 4G0OA 4KO8A 2Q7DA 3BGIA 5CVDA 3ZZNA 4GM4A 3P2OA 4EPYA 1MJNA 3KKPA 4FMDF 4A2PA 1AKVA 1ZXLA 4CUKA 5EP4A 4O25A 3QYPA 4JEUA 2BJWA 3BBLA 3S29A 1BA2A 4CBVA 2G82A 1PDOA 4OF4A 3KQUA 4DNQA 2WV7A 2UYHA 2H85A 4UEWA 2V7QD 1VIVA 4P93A 2BMVA 3E61A 4ZIRA 5KJFA 1AH2A 5K45A 3FKSD 1GZ7A 2XVZA 1FTNA 3QLEA 2YW9A 1N6PA 3GCWA 2BDUA 4WADA 5F52A 2C3YA 3SC3A 2H4HA 3Q4GA 2IPMA 1I4TD 3V8PA 1E64A 2NMVA 3PUKA 1MC1A 3GWZA 2GKSA 1S2MA 4MGZR 4BRWA 3TY9A 5I51A 1VKNA 3N2EA 1EH5A 3KTFA 4LZWA 4MJXA 2DETA 1RHQA 1ZMBA 4CFSA 1J07A 2OSBA 3ETDA 1G55A 5DMXA 2VPZA 1IEQA 2OE2A 3TYXA 2OXRA 5CVVA 5KC8A 1E9VA 3HDTA 1NR7A 5M7EA 3GJTA 3L7CA 4TM7A 5GOTA 4N4AA 3P96A 5CK4A 2IS1A 1GDTA 5IAEA 3VKFA 1EXWA 4RCVA 1EFVA 3PUJA 4JL8A 1CFJA 1KI9A 2NZUG 3RGGA 2FPPB 2PX5A 2ZYVX 1E2DA 3HH8A 4HLUA 4UE3S 5DEOA 3RUPA 4AJPA 1GXSA 2ZW9A 1P1CA 3SHTA 3HB5X 2VP4A 3BTOA 1U2PA 3PUHA 1LZKA 5JOQA 1DRUA 1U4OA 4EKIA 1BXZA 1MOZA 3KQYA 4KZKA 3HSKA 4WBXC 1N8NA 3RNOA 3MWFA 5JCPA 5LKRA 3IDQA 2V9ZA 1I1KA 2D5AA 2X1HA 3IQFA 2QTWB 2Q2NA 4HDSB 2EQAA 1CW2B 4Q1DA 1M1YE 1Y1KE 3FCXA 3ZVNA 1KJ9A 1I2AA 5HSGA 1V11B 5F73A 1T2FA 4C0XA 2R1VB 4FFBB 3DMDA 4TT8A 2QRMA 1V8BA 1TKBA 1FIUA 2Q9BA 3FOCA 3AESB 3P9PA 3TOSA 5IG2A 5EJ6A 4O2BB 4NH0A 3Q3VA 2IYPA 4MW1A 4TLEA 2W9XA 2X0EA 3M1LA 3D5TA 4RELA 4CMKA 2Q8PA 1GL3A 3CBGA 1ZNXA 3TWOA 4AU1A 3IL2A 1E9RA 2OBFA 2NTEA 3VNRA 5AFSA 4H6XA 2CB0A 2JCVA 3Q3CA 3UK2A 3QPCA 1SXHA 2VJPA 5GONB 8ABPA 1N1MA 3P19A 1VFNA 2X2OA 3CVJA 1LWOA 1PE0A 2CJWB 4OA8A 3RVNA 4CM8B 3PEYA 4ITVA 5CLJA 4FGWA 4IKPA 5K1ZA 1ZK4A 3WKDA 5ALKA 2ZRQA 3ON5A 3CURA 1FU8A 1T9CA 1UPFA 4RPKA 4GR5A 5CGZA 3EDMA 5BOSB 4C3UA 2WU0A 3DNPA 3WYCA 3GEMA 2QXUA 3PUVA 3WHIA 3D3QA 1W8DA 4LRUA 1N77A 1K3FA 5IKMA 3Q1KA 3LQYA 3D4BA 4LXGA 4BU1A 5AHWA 4O4JA 1NI3A 5DM60 5EFZA 4IDHA 2BPOA 3DHNA 1EWYA 3B7WA 2ZJ7A 1L5MA 3PSAA 4JA0A 1GZDA 4NPCA 1WOYA 2IL1A 2QV0A 2GD1O 3THOA 1EJ6A 2H5JA 3MBIA 3WFJA 1NLYA 2MINA 2OMEA 4AG5A 4X7RA 2AD5A 1U7WA 4QWWA 4TWAA 3OA0A 4OHUA 4EM6A 2WU4A 4W63A 1ODIA 3I83A 3JWPA 5CDFA 1W36B 2BCJQ 2GCNA 3T54A 2V58A 1XN4A 2W6PA 3CE9A 3A37A 4WKPA 3W79A 4ROTA 3UAGA 4M9CA 3I34X 4ARUA 3DMYA 3ICWA 4DJAA 2BN4A 1CF9A 4J91A 1L5SA 1F5SA 5YASA 2A78A 4DDKA 2JGIA 3DE6X 2DKOA 1QS0B 2JNWA 4KDFA 4UBIA 1FLVA 3DUFA 5E2AA 4A6PA 1R37A 3H18A 2QJTA 3HJBA 3PGMA 4CKCB 2WKPA 3RRZA 2I66A 2ZSKA 3K92A 4OA5A 4TZKA 3HNPA 1ADFA 3IA2A 1DADA 3N87A 4Q01A 4BFWA 4LWQA 1IXSB 1JEQA 3HUFA 2NXCA 1DV1A 1FLNA 4ZAFA 2WHXA 1RLOA 3NYWA 3Q8XB 3T7KA 5FBVB 4ER7A 4WCDA 2A8YA 2I6TA 4KN9S 4D82A 5KTYA 3PXBA 3QNMA 5CA0B 1JH9A 1XP5A 2AG5A 3HWSA 1WDWB 1MQAA 3P9NA 5HRCA 2GKGA 2WWXA 3AZOA 3IULA 3M4XA 3CV3A 4ZVKA 3GIDA 2F9MA 4RETA 4UCTA 3RS3A 3X1DA 4RK5A 2BYTA 4PR3A 2COEA 1IUNA 3ZI7A 3L8FA 3I01M 1ECBA 1NIJA 1LPNA 1NKVA 2I1QA 3U3ZA 5JS6A 1ZM7A 1T15A 3Q5DA 3GT7A 5AH0A 3A7EA 1JMVA 3PHIA 3VR1A 4WAUA 3Q98A 1XD8A 1JJFA 4Z1MA 3TNJA 2P6OA 4UBNA 2HA7A 2P5YA 4CIVA 4D56A 3U19A 4JI7B 2C20A 5IXSA 2P9BA 3KJGA 4TROA 1CEXA 1CUZA 1GVHA 3HXTA 1WR8A 4J9UE 1KOLA 5JNLA 4NZZA 5F76A 1G7RA 1KERA 3E81A 1J2UA 1I9GA 1JEEA 1OGJA 1RMTA 2GFHA 3FWHA 4N7BA 2WFLB 3F6BX 5KYYA 3W5UA 1D3AA 3P97A 4RMNA 5KBYA 3LI2A 2PUDA 1KGSA 1IWPB 4IBOA 3CCBA 3VNAA 2ZUBA 3K0AB 4ZOAA 4H6PA 3X1WA 4MRAA 3FKQA 3HZZA 1R4NB 3EMDA 5EXEA 2G1KA 2RGAA 1GGOA 5KB3A 1T1RA 2V3WA 3K1ZA 4PG6A 2GBLA 1BE1A 1NF9A 3D6TB 4TL7A 3QEJA 3EDYA 3P9QA 1ARZA 2CC2A 3HBMA 2R1ZA 3VSEA 2ZI6A 1YL5A 2UYGA 4KLCA 3ROQA 1C7EA 1PHRA 1EB8A 1K27A 3RWOA 3I28A 2E85A 1GTL1 1FVHA 3QU4A 4RVNA 5EZYB 3QFTA 5KYXA 3BYZA 3B1XA 4UCWA 1GZVA 5DV9A 1YZ3A 1YK1A 3M6VA 2DAAA 2Q4TA 3OAAA 4MW2A 3WYDA 5BUQA 4U6QA 4BQEA 3RO7A 2CXQA 4CL0A 4GPZA 2YV2A 4RHEA 2XUZA 4ERNA 5JFOA 1G18A 4AJ4A 1CULC 1JFLA 1KY3A 1SH7A 1D2RA 5CM9C 2NUTA 4TVKA 1GA1A 4NAVA 1X74A 2B69A 5AJTA 2N1MA 4CQNA 3YASA 1B3BA 4RZSA 5B2FA 1XMIA 2REBA 1NU6A 4DV2B 1IBKB 5GQSA 2PUAA 4YI3A 2ZZNA 3CVWA 1A95A 1DC3A 1F51E 1XCPA 3KVNA 4FR2A 3W2IA 3JPYA 3K96A 1GGMA 4C0WA 4DC1A 3G0DA 1ULHA 2R66A 3BAFA 3VHQA 4FHEA 2HH9A 1YRHA 1UAGA 4S1TA 2Q29A 3RUAA 1GEEA 3SEQA 4EARA 1FUIA 1NXVA 2TMGA 2Y2UA 3GEGA 4K9OA 1B8OA 3LG2A 2C29D 5FTNA 2I4LA 3AM4A 5KYWA 1MNQA 2LRHA 2YNMA 3EIXA 3C4JA 4HT3B 4HLUC 7AT1A 1QP4A 3TD2A 1NVFA 1GTSA 4UVDA 5DM0A 1WWKA 2BISA 1YBVA 3BA9A 2K2QB 2MSDB 3G2NA 4MEAA 3I9FA 1XZPA 3CN9A 1KJ8A 3MQFA 3ZHTA 3A3NA 4MHOA 3U5ZB 1X8JA 3HDYA 2JAQA 4UTVA 1R0CA 1YC5A 3TGPA 2BE9A 4XX0B 1G5RA 4IV0A 3QLJA 4RFSA 1DQYA 1JB9A 1VBFA 4GEKA 5AI9A 1P2BA 3OQ1A 3TW7A 2DBZA 1DJPA 3FGPA 2H1FA 1WPGA 4G1FA 5JD5A 1OAAA 3GBSA 4BL5A 1OB2A 1H2BA 3A6LA 4DANA 3CX6A 4KH1A 2GVZC 4HEHA 3AW9A 4CR6A 2PD4A 3AEXA 2IZOA 4E2ZA 2JCBA 1EGVB 3TIFA 5ITVA 3G0CA 2TMYA 4I1PA 3AVWA 1ADGA 1XCBA 5KYKA 4RA6A 4AUMA 3HY6A 1AY0A 2I80A 4UULA 1KO1A 4E08A 4OFWA 1XD2B 2OCIA 3JZ6A 3RAEC 4O84A 1VP3A 1JH8A 1NBAA 1KMMA 2EKLA 3HUTA 1XNJA 4QYXA 1Z12A 4E6PA 2XNDD 5DWDA 1E98A 7MDHA 4CMGA 3O8BA 4GYYA 2F90A 4ABTA 1PWYE 1V1RA 1GGHA 1WSBA 2JIOA 3R6WA 3DR5A 5CYPA 4QYWA 4YQZA 2PKQP 4N0EA 4YA6A 5MGNA 1KI3A 1FPMA 1I2LA 3PJEA 5JNTA 2QZJA 2ZKIA 3FY4A 3QBVA 5CYOA 1QKJA 4QGHA 2B7BA 1C7JA 2AXEA 3JS5A 2ZS9A 3AU9A 3DP9A 2OKGA 1KJNA 2AUTA 4UCSA 5H3LA 1O97D 3T7DA 1XGKA 2A0YA 3F46A 5U4QA 1J39A 5KU1A 4X65B 5LC1A 5L3QA 4IKOA 3GJXB 1U0FA 3I04A 4CU2A 1Z06A 5T41A 5L4SA 2JW5A 3AR2A 1JDPA 5DNAA 1Q50A 1IIRA 1ZK2A 3BCHA 3GGOA 4N40A 3SWWA 4U8GA 4WE3A 2PZMA 2VK1A 4KQCA 1VE6A 4Y1RA 2RGBA 4PNEA 2I3AA 2JIRA 2Z5LA 2CE2X 3E5HA 2CNQA 2N1BA 4E94A 1Y7IA 2FDXA 4O7TA 2FEOA 4D92A 4FGZA 5HK9A 1HLFA 1LW7A 1J56A 4OMCA 2HM7A 4MP8A 4ZOEA 4DHWA 3A8TA 4YCAA 1SB9A 1AKTA 1JDUA 4RVCA 1D1QA 1J5EB 4HZGA 1LBEA 1XI2A 1P73A 4HZUA 5HIJA 3V8EA 4EK9A 1NQXA 1JUDA 1I0ZA 4R1MA 4RDXA 5E0KB 5LQNA 4KUGA 4DDUA 4QJ5A 2V7UA 4WJZA 3A14A 5AYVA 2ZUEA 2CFIA 5DRYA 3JALB 5EMJA 4ISBA 4HH4A 3HJRA 3BJMA 1X3SA 4UDXX 4A92A 5IVHA 3SZOA 1YV9A 1GGFA 3PS9A 3T06B 3T7CA 4WFKA 1K66A 1U2GA 2RMKA 1KEPA 4R5MA 1M2NA 4FYIA 3QFSA 1TU4A 4CQMD 3CH7A 5D1PA 2PMBA 3DTVD 1OFVA 4HJXA 1FFWA 2ZWIA 5DWVA 1GZ6A 2CCGA 1YR6A 1RACA 2JC3A 4G65A 5KAPA 2O8EA 1XEXB 1KSJA 3CRMA 1DS6A 1QFYA 1VA4A 5K0SA 3OT1A 2W2VA 2Z2YA 4EJSB 2R7KA 3H5TA 3W3ZB 3LBIA 4BNKA 4TRMA 1P2DA 3G2KA 2WICA 3GRFA 4N3CA 1AXRA 4KGDA 3CW2A 3G9TA 4QDZA 3RAJA 3RC9A 1CKMA 3M1AA 2W6CX 3STVA 2DUUA 1DBQA 5FI5A 2H16A 4P4NA 2Z6UA 4I55A 1JLHA 4EHAA 5EIAA 2F3PA 3LECA 4K0RA 3TQFA 3DCYA 4BO4A 1NZFA 2K87A 5A4AA 4MVYA 5JC1A 3ERCA 1U8ZA 4AJHA 1C9YA 2FZGA 2VAWA 4UOEA 1I94B 4FOTA 4HEA1 3E05A 1O87A 2DBVO 2HZBA 3RTEA 2B9VA 2RKBA 1P4JA 3GP8A 2F2TA 3KCQA 1MB3A 3UXEA 4L22A 2O2DA 4C3VA 3LZCA 5KOHA 1ID8A 2Q6KA 2CHUA 2X9GA 4BO8A 1SGWA 3N6XA 3BULA 1YACA 3K5WA 3RVSA 5CG2A 3WQSB 2QY9A 1TK9A 2D1FA 1W5EA 1PD0A 2LV8A 4E4YA 2J3LA 3TF5A 4P3NA 4B17A 4LCEA 3KJHA 2FPKA 3RI3A 1PZHA 2BT4A 1FX0B 4NBNA 2OQVA 4C4XA 1O6ZA 1OX5A 4CMBA 1IDOA 4G4SP 4F46A 5FEMA 1II8B 4AP9A 4F6CA 1CX9B 3SYNA 2IYLD 1RADA 3RT7A 3AUKA 4EO4A 4FGKA 2R1TA 3L7MA 5HFAA 1C2YA 5EHXA 1CQJA 1T9DA 5AW8A 3GQBA 4PZEA 4YCDA 2VYNA 4YLYA 3TJZA 2CFMA 4GAEA 1T2CA 5TPZD 1HRDA 2B34A 1DCKA 3JQDA 3QMVA 3F9RA 2X8JA 2Q27A 3EGXB 3P0EA 4MLZA 5G02A 4MUAA 3AR9A 3QOYA 3C7AA 3A9UA 3R77A 1QG4A 5FBQB 4QQKA 4CQLB 1BEZA 2HU5A 3W77A 1UKBA 2O2HA 3O84A 5I7HA 1VIAA 3LPMA 1R3DA 3A1DA 5FLYA 1BRTA 1NV9A 2VHVA 3HDQA 3PD0A 3MJHA 4KTTE 4C6SA 3AR3A 4EW2A 2CV0A 5B53A 2AMFA 3HHEA 2YNMC 3PPYA 1TM3E 3EIFA 2OHFA 4IEFB 4P7KA 1P2VA 4TLMB 5HFJA 3KU4A 5LBUA 1D7AA 2M2IA 4LJAA 4XFJA 5I47A 4WZBA 4OHOA 5KSYA 1WL8A 1YVPA 1L5LA 4G37A 4Q4LA 1W34A 2GOYA 5LIRA 3NOOA 3C87A 1ZRSA 3DF7A 3PC3A 4YAGA 4NBVA 3PX7A 3D8BA 2ZJ8A 3GLHE 3O8QA 3EMKA 4QXRA 3TDNA 4D4GA 2PCLA 4KB5A 4HN4B 2QGFA 3HU3A 3UK6A 1TE2A 3T99A 3DZIA 4MOWA 5DNYB 2VDRB 3C8UA 4JYPA 4NEHB 2I7XA 4GKBA 1C0EA 2AE1A 3H2KA 1W52X 4EMUA 4FJ2A 4XYEA 2QD5A 1FP4B 3G1UA 4IKEA 2CNKA 1CP2A 4G8JA 2QP9X 5MDHA 4UAVA 4C06A 1PGJA 4UMEA 3WYBA 4EG6A 2Y6VA 4CKXA 3D0OA 2XWPA 2X77A 1X1AA 1D04A 2W6IA 4IQGA 3W6UA 1BGWA 1WY7A 1WZIA 4FDAA 5KAMA 2WTMA 3IPCA 6GPBA 2H1IA 1WPRA 5DHFA 3TX6A 4I99A 4BFVA 1LI5A 1NMZA 3RUHA 2OO7A 2V7WA 2V8BA 3FN4A 4P22A 1FL9A 4KXFB 4N5MA 2Q5LA 1DUVG 4L3WA 2WTXA 1A50B 4H0CA 1H6CA 4MQBA 4GVPA 3FIUA 3O92A 1QE3A 1M33A 3OBIA 1P4RA 1M9NA 2Y1GA 5K3SA 2XUIA 3S8MA 4B5KA 5ADVA 4GPTA 1AKYA 1VCOA 1P9WA 2CMFA 2FFBA 3DZFA 3LRPA 3WYFA 3Q88A 3F6RA 3DLAA 1XUOA 2QAGC 2UUPA 4RU1A 4HDRA 1CIPA 3GJ8A 3QHAA 3LC0A 4ETIA 3VOSA 2GO7A 3M9XA 3NNSA 2CLIB 5KJ1A 2ZM6B 4BDSA 2PMWB 2PZFA 2JJMA 1IPHA 3G1TA 3HP4A 1IMOA 4FMBB 3JWHA 2VPQA 1NX9A 5ADWA 1SD5A 4WZAE 3NNNA 5IUJC 2X0IA 4R9SA 2W6ZA 4COKA 4D79A 4GP6A 3R5HA 3D2BA 3T7RA 2JJYA 3IP8A 4YJ2A 5C8YA 2H7CA 4XRRA 2RGCA 4CETA 5EEGA 1RYMA 1WEKA 3T4UA 2YWXA 1MO5A 3O73A 1I33A 1VSQA 2RHTA 4URVR 5IN4A 5EJMA 3D8NA 1V6AA 3QFCA 3IR5A 2WF5A 4PRYA 1S8OA 4EI8A 2GAAA 1UM9B 3VVCA 3DSRA 3LCJA 4RY0A 3VTAA 1NW7A 4OKIA 3RS5A 1Q57A 1I7LA 3PD1A 3QVGA 4R9VA 3IEVA 1GCOA 3EPKA 1MXFA 1DARA 3F3YA 2EBWA 3G6KA 4D0RA 1YVDA 2HU7A 4Q37A 4TV9B 5IH3A 3PRKE 3PD7A 2ZB2A 3NTLA 4CZ2A 5JVDA 3S44A 4BKOA 1IULA 2GERA 1RWBA 1SUWA 1VPVA 3UG6A 1GPH1 3U4IA 3BN3A 3ISTA 5THQA 1BN6A 1XDDA 2GD2A 1E2HA 2P2NA 4GMXA 5CCEA 2B8TA 3U62A 1Z22A 1Q15A 4OGGA 3A4NA 5BQOA 4MDYA 2PQ6A 3GJZA 5ITZA 3K72B 3N70A 4RXUA 2CUTA 2QP3A 4C04A 1F12A 4HNRA 4ND8A 1N5LA 3V8MA 3SQWA 3GH1A 4OMUA 2HDKA 4EPRA 2AZDA 4CMDA 4FFRA 1EYZA 5K8LA 3BA1A 4QKQA 3VR4D 3DDZX 1U2DA 1P5RA 3B60A 2KHZA 3NUQA 3DHYA 4WNCA 4QUBA 2C3UA 2OCYC 1YAJA 2VPIA 3VI4B 4E07A 4UPVA 2II6A 1EAMA 1NT2A 4DDVA 4KI0A 3FLMA 4YUXA 2RCNA 3CR7A 1JSXA 2YQ4A 4UFZA 2NP7A 1EU1A 4LYFA 3QVXA 4ZMRA 3GYGA 1ISGA 2D8AA 4BTEA 2OD7A 2YW2A 1SOWA 1ZBQA 4LVCA 2JIZA 2D54A 2JFBA 4YTEA 1O97C 2VQFB 3TQOA 2Z3ZA 2OCXA 2PK3A 4AZ3B 3IKTA 1NNI1 4KYTA 1C41A 1ML3A 4EG0A 2IHKA 2QL6A 1C1XA 1I30A 4JLSA 5HF8A 2ETXA 1ZH4A 4D3DA 5A5GA 1YHNA 3BB1A 3AUUA 2OLSA 2VZ9A 1GNSA 1QO0D 4QX6A 3UK7A 4YRZA 5L53A 1E8NA 5TRTA 4C0SA 3W6ZA 3NVAA 4FFSA 3E7WA 5BYAA 4HEQA 1K7SN 4ODIA 1FU4A 4M76B 1YZUA 1PAUA 3N2ZB 4MLCA 3COVA 4ZANA 5G41A 1ZSNA 4N5IX 1PVOA 4EFNA 5H9VA 4BAUA 2QMUA 3UMSA 3GVPA 3C43A 2HJHA 3A6KA 4TT3A 4BNJA 2Q5EA 1C7IA 4FCTA 4BV2A 3IPLA 1GSAA 3VPXA 1DXOA 4MMZB 1FPQA 3O31A 3DULA 4QOSA 5H8WA 2YQ5A 2I6QA 3O8RA 2GK3A 3IOYA 4MKHA 4BNLA 3GB9A 4AY3A 4HVLA 1XU9A 4NICA 1JS1X 5L9AA 1M0EA 2GZ2A 1A27A 1A5ZA 1PWEA 1ZKDA 4O1MA 4ZOCA 1OCEA 4QU5A 3QLVA 1M5TA 3UAZA 2EZUA 2HJRA 4IJMA 1UBSB 1IN6A 1Y1RA 1FS6A 3FDZB 1SK9A 3H3JA 3QMWA 4J49A 5FNVB 4AZWA 1LJLA 3PDIB 1DP4A 2FQQA 1N5RA 2O7VA 1REQA 2JEZA 3G9QA 4Q4JA 1J6UA 2Q5OA 4ALMA 5LWQA 4CKEA 1Y5LA 3KTAA 1U3WA 2PKRA 2HMWA 2A9VA 2DY0A 3D43A 3K16A 5LLSA 1CRWG 5A71A 3NAMA 3UBTA 1X2EA 3KKLA 2FN8A 4E2WA 4JITA 4MVJM 1NUUA 1U6IA 5AKLA 3H2GA 3OZDA 4FFNA 2ZR0A 3E0XA 4JJKA 4LGVA 3Q5GA 1OAKA 1QBKC 5D51S 5K3DA 5IDQA 1S4MA 3GOQA 5BRNA 3TAHA 3WLAA 2IYEA 2QRHA 2ZWPA 2DPXA 3M83A 4UZFA 4ZOLF 5DGXA 3B78A 3KO8A 5DRTA 3UM9A 3DOIA 4QVGA 3J80A 3UT5A 3EAGA 1US8B 3HB7A 4ZOBA 1KVTA 2PGDA 4D3ZA 5CITA 5CHEA 2WSYB 2JZNA 5K6RA 4FHDA 5JISA 4JKYA 4IDCA 3BF8A 3UB2A 2FK7A 5J47A 2EGGA 5JDIC 4B85A 2ODWA 1I5OA 3STUA 4H3SA 5IKXA 3GAFA 3VPCA 3W1BA 1BKYA 2R8YA 1YR3A 2DFTA 3G7UA 4LWOA 4M49A 2XXBA 2SCUA 2YBDA 3IBGA 4F96A 5FDFA 1BVHA 2RKOA 1TU0A 4A10A 3GPDG 3IFSA 5E3HA 2LCFA 3EUEA 1SUAA 1T8RA 1JKJB 1X7WA 2B8EA 3R9KA 2Z1MA 2ZKLA 3BBPA 3MD9A 4B81A 2GPYA 5JR3A 1YAHA 1ZXBA 5JJKA 1DPGA 4Q4DA 2YJ5A 4KWCA 3REQA 4MEJA 4F9TA 5A5EA 1ADCA 4R0VA 1U2SA 1ZICA 2A6PA 2AEFA 3PPWA 5IULC 2P90A 3MT8A 1PQUA 3KHKA 5EIBD 5FNZA 2IXAA 2C4TA 2AIRA 2JGEA 2UZ3A 3PA8A 4DA0A 4D9IA 1T9GS 4KQMA 1G17A 1E9EA 1KRHA 4UFPA 4R69A 2O14A 2PZJA 4NBTA 5MF6A 3CR8A 4Q82A 1QIHA 1DQPA 1RXCA 2AMVA 2VXOA 3D7RA 3ET5A 4LE1A 1XQ1A 4LK2A 2R68A 2OWEA 5CDGA 5BVHB 2ZEJA 1F7VA 1HLGA 2GBFA 1JLMA 3L40A 2HNBA 1HFWA 1RXYA 3FMVA 3WL3A 3M4NA 3M4YA 2P3SA 1HI9A 2RHCA 4FYMA 3SNKA 1XLVA 4P36A 3QWAA 1G8KA 4YMIA 1MX5A 5HBGA 1RYHA 2A0UA 5AI0A 3E9QA 2R6GA 4V0OA 3T61A 3A31A 3AHFA 4YPVA 3ECCA 1RMQA 1XZ8A 2V4MA 3ZS9A 1D2EA 1OZGA 3LDUA 5DW3A 5LIPA 3UH0A 4HB3A 1FNDA 1MAHA 4J3NA 1L7VC 1XKTA 4DMRA 3UJAA 3MJDA 4BE4A 5IC5A 3BH7A 1BCSB 1OY1A 1Q83A 2AXPA 3OEEA 2PS3A 5ED0A 2AI3A 1QO9A 4FEEA 5SY4A 3W2GA 4EGAA 5BORA 3U31A 3EVDA 1CIJA 4G8DA 4MWSA 4RZ2A 4YLEA 2YZ2A 2WW8A 1KI2A 4DYDA 2NO1A 1IAQA 2BZSA 4XW2A 1P4HA 1CY4A 3QOFA 3DXXA 5E1MA 1F3LA 1C80A 3R7FA 4D4IA 1HE5A 1XZKA 2DUNA 3B6EA 5KNDD 4W1QA 5A3JA 4EF6A 4V0QA 4CIDA 4RPLA 1GG8A 5DHSA 2YZKA 3GJ3A 4EA6A 4LGCA 4JBXA 4KFUA 3EXHC 3CFYA 2FPIA 5FQNA 3RU2A 2P2DA 4F06A 1VLLA 2EP5A 3H2SA 3QF4A 4GC5A 2WHEA 4J7XA 2XBUA 4EYEA 5C9ZA 5KTPA 2VHEA 3LDHA 4DB4A 1EVEA 4BQNA 2OG1A 2ROQA 2VLBA 3EVGA 4GMFA 1Z2AA 1OLUB 2V9PA 1Y8RA 2XB8A 2VKTA 3B6ZA 3R7DA 2QGZA 2PLRA 4F3YA 2GEVA 1HDRA 3HWX1 3ETCA 5H0IA 3SR3A 3KJZA 3R7AA 4HFNA 4LSZA 4QTTB 3S27A 2DT5A 2HNKA 4EHBA 1I2CA 1KSFX 2BFOA 3OPMA 1Z8HA 3GQVA 3VR6A 3OPXA 2YFYA 1XLTA 3H2JA 3JATA 4E3ZA 5H9WA 4UCOA 1KP3A 2CZCA 3E1SA 3LIPA 3UPDA 5DISC 1AD2A 1WCV1 2WOOA 3P2YA 4R1SA 4H59A 4YMHA 1D0VA 3K2QA 4FFMA 3AFMA 1FMFA 1VS0A 4GX5A 2WF7A 3OC0A 4ZVLA 3TTTA 5ADHA 5EKDA 2P9EA 1YVEI 1B7GO 5H5JA 2XJ9A 1O6GA 3OQNA 2AJCA 4PSCA 3OU6A 4G0MA 5FEUA 1ENPA 1TMOA 2CK3D 4IOJA 1JAXA 3OQPA 4MI9A 5TGTA 4GBED 1JQKA 3ZCXA 5EHNA 3PC8C 1VGRA 3EIQA 1QGZA 2C0PA 3ONNA 1V6CA 3ZIAA 2BJHA 3L2OB 1KOJA 2PL3A 3DE3X 2AW3A 3IILA 3LX8A 2L2QA 4PCVA 5EXTA 2QLBA 3L18A 1HM5A 3AETA 1Z38A 2ZIWB 3NBKA 5JARA 2AKEA 3C3DA 1SPXA 3R0QA 5ILQA 1E66A 2XTJA 4UCFA 1EHCA 2HA3A 4CR8A 5TMPA 4YMLA 4HR7A 3FCSB 1QB7A 3DVLA 4DVJA 2NU8A 4IX1A 4ALKA 5L45A 5ER9A 4C14A 3CUWA 2Q3MA 4W5HA 1W1IA 3TY8A 3PIIA 2WU1A 4D80A 4K05A 5JNVA 2VAPA 4I0WB 1PD1A 4I3HA 1EFVB 3VO8A 3DLBA 2PXHA 3T1NA 1CQWA 3F67A 1XALA 1Q84A 2XYRA 1G98A 1W88A 4KWHA 4JQYA 2COKA 3IEMA 1DOHA 1GXSB 3EGDA 4NYIQ 4JP1A 3DMPA 5FP0A 4AQDA 3MFYA 4YAFA 2PSSA 3C4QA 3U3OA 1FVXA 4UBLA 3OTGA 3Q3JB 4AKTA 5KPJA 4OX9Y 1GGVA 1QVWA 4M0FA 5J4YA 1TNDA 4UBMA 1ETHA 2CLMB 1QFMA 3URKA 1NOIA 4LVOA 3NOVA 1X7XA 1HR0B 1ORDA 2OZLB 3KYCA 3JQ9A 1G59A 1MG5A 2QE7A 1CUEA 2VHTA 4G25A 4BKUA 2OC4A 2DPLA 3DFZA 3R3SA 4A4DA 4XVRA 3NEAA 1ONPA 3MJTA 2D5CA 1D0SA 4NKRA 4WZ6A 3A1EA 4RCZA 1ZD4A 2C4NA 2AFHA 1X19A 1Z2CA 4G84A 4TXMA 4FB5A 2W4IA 1QIGA 2N47A 3H19A 4G24A 1RS0A 4PSAA 3ZV5A 1QOZA 3O2QB 4ZCRA 2NT3A 1BDHA 1QLHA 2FGKA 1EZ1A 1YU9A 3LF1A 5L7WA 2GRUA 4UCUA 2VDJA 3IUBA 1KU6A 1KK1A 2EP8A 5J2UF 4AO8A 2I91A 4LOAA 1I7SB 4JEIA 3FOBA 1UAAA 1YE3A 1E3WA 4D8XA 3C3KA 3MEQA 1P6XA 4D5EA 2ZM5A 3OIUA 1NFQA 1BGVA 1D7OA 3P0JA 2DRIA 2O4CA 5B4UA 1H2XA 3PEWA 1Q7BA 5JSFA 4J1NA 2I9KA 4O4JB 3SIPA 4YJ3B 1J22A 4L75A 1CUFA 1Q1BA 1FUUA 3FJ1A 3SVLA 3DYIA 1PJAA 1SG6A 1U3UA 4Q9KA 1R0WA 2R6HA 5HILA 3BDAA 4DCNA 5AM4A 3ZOZA 2VHXA 4KP7A 4AMYA 5KSPA 4B9AA 3PQFA 1YNSA 3THYA 4TZ0A 1NN0A 4CT4B 2WHPA 2O20A 4Y7DA 4HSEA 5DGTA 1N5IA 2QRZA 1R0KA 4L02A 5BWOA 5J2UA 4P7GA 3V2GA 2HGSA 4ZCIA 3TGWA 1CKEA 2GEUA 2P8SA 2H1LA 3NUZA 5G0SA 5L7YA 2YICA 5KWVA 4KQHA 3RK4A 3BRSA 4HTFA 1X7DA 1N9GA 2GK4A 3DBIA 2FHPA 3KD3A 3T4PA 5A4IS 3R5TA 1F8UA 4OQNA 1AHNA 2QUHA 2SHKA 3TRKA 1VGQA 1NKTA 1EP2B 2AEEA 5FO0A 4AYTA 1U0OC 2EJ3A 3U48A 4NX2A 3KZKA 4G8CA 1LFDB 1RMYA 1XTUA 4B6RA 3O8OB 2P5SA 2WIAA 3AFIA 4DLVA 3IAAA 4KLAA 4L9SA 1JEQB 3PXAA 1Z6YA 1UMCB 5TLSA 2GM3A 2P75A 5LJLA 1KHHA 2Z8XA 2H7YA 3VQTA 2AKYA 2IFTA 4LDAA 1KYIA 4UDNA 1KNQA 3CKMA 4JJFA 3N86A 1KBQA 1QHNA 3IODA 4WERA 2V0NA 3OUTA 3CKLA 5DTQA 1ITZA 1SU7A 2CNNA 2VHQA 1IJFA 2AT1A 2YYSA 2PR2A 4LYDA 3A26A 2VNIA 3KQPA 3QP9A 3IQHX 2ZBUA 4KV7A 1JI3A 1COWA 1PL6A 4EGCB 4YDQA 4LF5B 4FYJA 1UFRA 4KIGA 4AO6A 7YASA 1T8SA 2B21A 3A9WA 1EDEA 2GPAA 1GYQA 3KSZO 3NORA 4BB6A 3BQ9A 1QC5A 2E4YA 1AS2A 5F9FA 3CTMA 4Z54A 1M2HA 1PZXA 1TL7C 2FU5C 1MJ5A 3LQRA 4XE5A 5FL7D 1U9ZA 4Z4GA 2XAAA 2IWRA 3T5GA 1HL3A 4M36A 5AW5A 1WW8A 4UXIA 2VP6A 3QX8A 4BFTA 1SCIA 4B3HA 5I9IA 1YUMA 3LNTA 2DJIA 4GBGA 3BHMA 2FWIA 3CU5A 5FOSA 1RPZA 3K2IA 1ZD9A 4Y2RA 3OEHA 3VNBA 2QEQA 3S2UA 3GLKA 4LF4B 5FUMA 5DCUA 5KYYB 1DQRA 4HDMA 4P6VF 3ROGA 2EFEB 3HTXA 1KO8A 2WJ4A 2XIQA 1B6GA 3DT6A 4MCIA 3GC6A 1VJRA 3HABA 1DMSA 1D4ZA 4MDEA 1Q0HA 1F0NA 1Z37A 3I6ZA 2XT0A 3TNDA 4YX9A 1UK7A 5DTEA 3TFOA 3UHJA 1WXGA 4RAQA 5SZJA 3T7EA 3WGJA 4F85A 3WGVA 4AECA 2Y0BA 8MHTA 1PK7A 1NE7A 4JOBA 2EIYA 2PCJA 1OX6A 4WLVA 3AFNA 3LZDA 4TQUS 1RQRA 5DH9A 4DSUA 4O81A 4CCAA 4JUBA 5K0NA 1P0CA 3C97A 1HYGA 1JEDA 1FW8A 1G4AE 5KYXB 2IPAB 2ZB7A 1W19A 1X87A 8LDHA 1XC7A 2DPMA 1GAXA 1WOMA 2P6NA 3MHPA 4HNVA 1GD1O 2AOUA 3NKFA 2QTAA 1E69A 1YOBA 2C9BA 2IK8A 2RAVA 2XUOA 2G71A 4CKWA 4EKGA 3C8HA 1XTIA 2ZXFA 1P9NA 2H5EA 3K20A 5FPTA 4D97A 4XOIA 4DIFA 2NUTB 2G08A 4Z8YA 1WMAA 3DWFA 1EFPA 1TQ2A 5ALGA 2H0AA 2CJPA 4B4UA 1ZL2A 5J3JA 1ZUWA 4X7BA 3AERA 1GDHA 1VLQA 3CRZA 4FJ0A 4IFEA 2F4NA 3VDQA 3T3HA 2Y4RA 3SXPA 2H4XA 4TN5A 1LRKA 5IM4A 2FSPA 4FDLA 3OPVA 4M1YA 1VL6A 3DLTA 4BMOB 3FSRA 3SQXA 3WTBA 3S8EA 3QGMA 3VNVA 4TXLA 1N2HA 2EP7A 5DP2A 2V9CA 1CS4C 2KM1A 3GPBA 3L8CA 2D62A 2DQZA 2ZWMA 1Q7RA 3A11A 3GAAA 2HVSA 1E20A 3EG5A 3VR2A 4CLOA 2VTDA 1PYGA 1ULTA 4JX8A 4PO3X 2Z83A 4L72A 4R4JA 5FBZA 3O21A 1AKRA 4F3RA 3OZTA 3K0CC 3STWA 1Z62A 4RFSB 4X1KA 3V4SA 4LWZA 1N75A 1VMAA 5KTOA 3PWKA 2GNAA 1OBCA 1FTSA 1H93A 1TUEA 2C9CA 2IXTA 1UXJA 3DZHA 5DTRA 1Q1ZA 2HIMA 1SXJA 2FRXA 4G4SO 1LLFA 4OK3A 4R2HA 3WGGA 4LZNA 2HMYB 2NVBA 1Q7CA 2R8OA 4HS9A 2OM2A 2R5NA 2Z1NA 1FSSA 2GCOA 3MTGA 1I4WA 1V5GA 2ZYGA 3JQ9C 5JSYA 1QRTA 1ZCFA 1FB5A 5HNEA 4LDRA 2BGJA 4B2YA 5BURA 5EPUA 5A04A 5KUTA 1LV7A 4C01A 4CF6A 2O8FA 2BFFA 4Y98A 4M0UA 5J2TF 4RA6B 1NLZA 3ZCPA 3RAPR 1CY6A 2D5IA 3ZWQA 4GMKA 2MDTA 2VXBA 4GNRA 3EFEA 4XKJA 4F6RA 1A1VA 2QD2A 5JCJA 5U4XA 4ZP1A 1R66A 4MGKR 4W5NA 2GBGA 3IVGA 1M6YA 4V0MA 4B3SB 2ZG6A 1OIXA 3WWEA 3H8WA 2PWBA 3SX2A 1NBME 3IRUA 1V1RB 2D0DA 1JSLA 1MPTA 2GJ9A 4FE3A 1XQ9A 1P5HA 4FNMA 5BSMA 1CUHA 4D9GA 4CL8A 4O33A 1ZAUA 1JGTA 2F1IA 4I9NA 1XZCA 3HY3A 1NFRA 3GVCA 1Y48E 1AOXA 1PR0A 3E3MA 3WLSA 1JHDA 2PX3A 3K70D 3NBYB 2G80A 2YV5A 2PZLA 3AZQA 3DMNA 4S0ZA 5DM1A 4MQ5A 3CH5A 3T94A 3UBMA 9ATCA 2HOQA 1WVIA 5CXUA 3OICA 5I8ZA 4YT4A 4WT7A 2XNKA 4DARA 4DEVA 2HV9A 5AOAA 2QDXA 3V6MA 4IIJF 3HZRA 2QR3A 4QPDA 3I5XA 4XYLB 3CXRA 3OJEA 4H2DA 4ZREA 5AW1A 5HPYB 1R88A 3H17A 3QWIA 2D3TA 2VHCA 3TQRA 1H5UA 4GRAA 5BRAA 1TQHA 5TX7A 1RBMA 4GPBA 3GUUA 4GXQA 1VECA 4C5BA 4ARBA 1QGAA 3LT4A 2HMTA 5H3CA 5FPYA 4RPGA 1R18A 3HS3A 1EESA 2A1UA 2QUZA 4BLPA 4PPGA 1ZY2A 3G68A 3EZXA 4EZBA 3PFNA 1JWLA 2HAEA 3IQWA 2NO4A 5DBOA 2VLIA 3E82A 4C2AA 2BKAA 1F17A 2CLKB 1G21E 2GEBA 2WZCA 1MT3A 5B7QA 5BXYA 1NRXA 5ENZA 2FKNA 1BNCA 1ISRA 1RTTA 2PS9A 3BRWD 3I9LA 5EVJA 3AEQA 1P61B 1RQPA 2IZ5A 4YP6A 4Q9HA 4YRKA 5JXIA 5E3IA 1BC5A 5J43A 1XMSA 2OHIA 4L4XA 4DYHA 4EQ6A 2XMRA 2HK8A 4LQ4A 1QU3A 3AH8A 4XCVA 4TYMA 3TQSA 4JAVC 1NAHA 4CLXA 1KQFA 5KWIA 1WETA 4RCNA 3NBZC 1SC9A 2JFHA 3CG0A 3CEAA 3HDHA 3ROZA 1RW4A 821PA 1U3FA 2BKUA 4G0NA 4I1VA 4RD3A 4HPWA 1YCFA 4DA8A 3S1AA 2OCPA 2XYPA 2FOLA 2GLXA 3IHWA 5JSKA 5DNCA 4UNNA 5F2NA 1U9JA 4QL3A 4HMQA 4LJ4A 4QTUB 1T0JB 4ZQFA 3MLEA 3RYTC 4R9UC 3V33A 5AVSA 4M8SA 2G5PA 3H04A 3ZE9A 4C1NA 3ZLUA 4FTWA 3HWWA 1LVHA 2Z4RA 3T38A 1G291 2DCUA 221PA 5E4JA 1K92A 5AXBA 5T6MA 3ZWBA 4XWTA 1JJBA 1V7ZA 3AUXA 3KK0A 3B6MA 4HNSA 4YUVA 5LQCA 3LUPA 3I92A 1PS9A 3CO0S 3Q15C 3TXYA 4HYTA 3T3EA 3ILSA 4GLOA 3BZUA 4JI6B 1Z4IA 1XTZA 3X1JA 2C8JA 3KPWA 1Q3HA 3E3LA 1QIMA 3GEIA 1U3DA 4B45A 4I55B 3ICEA 1AJEA 3F6PA 2QPOA 4Q15A 2QMYA 3HL4A 2WTEA 3PLRA 1JAHA 2ODEA 1NHGA 3BK2A 2BGNA 3ZY2A 4W9NA 1Z34A 4B3GA 5BQ5A 1CZKA 2P40A 3ITEA 3G79A 4EEXA 2RGUA 4RGVA 4ZQBA 5JU6A 4N3AA 4W1PA 1MX3A 3OQOA 2WMOB 5LQAA 3I4FA 2HKIA 1XPJA 1BU5A 3PUWA 4EYKA 8GPBA 2C8VA 2CFSA 1BWRA 1C29B 2F1KA 2XTMA 5ILOA 3PWSA 1XZIA 1SEVA 3ND7A 2X1LA 4Y8VA 3QEOA 2Y76A 2HR1A 3PIDA 1S2LA 5F98A 3DQQA 3O0DA 1QQTA 3T1VA 2O8BA 1LBTA 3MWLA 4LPSA 2OK7A 2QQEA 5HE8A 3CZQA 2Z2ZA 3FPBA 3OVMA 3QJGA 4EEQA 4KLZA 1GJRA 3FWZA 3UZBA 2G63A 3OQVA 2P30A 5ECYA 3SD7A 2ORIA 2RI1A 3N8NA 4GKAA 4PXSA 2W48A 3IC5A 3WLPA 2OG2A 4MW0A 4FM9A 2FSSA 2R1TB 4JMLA 3B48A 3S81A 1FXWF 1XDUA 2VDWA 3GQBB 4MTLA 1UJNA 3KPVA 1C8KA 2X3YA 3D8RA 1KYQA 4BIIA 3LW8A 4Y9DA 4BO1A 2OBNA 3DVQX 2B82A 3JAWA 3W8FA 3O83A 1JALA 1PR9A 2Q3DA 4JLKA 3RAGA 1XTBA 4OBWA 4AUKA 5BUZA 4GUAA 5AQ1A 1XZMA 1E5TA 4AY4A 2FA9A 3KWJA 2O0JA 5HZHA 4PR0A 4M46A 2UVQA 1NG1A 4KN6A 1SCJA 1OA1A 2OSVA 1C2TA 1XVLA 2P9QA 4PTLA 1RKQA 4C7XA 5A2GA 3CJRA 1GM5A 5CLIA 3EWNA 1OFIA 2E48A 1GNTA 2VYCA 1ZCAA 2YWJA 2ATIA 1P2TA 1GSIA 1T3HA 1ESDA 2VZ8A 1GPBA 4AKSA 4MRRA 3RF7A 4BZWA 4PLWA 1JR3D 3H7AA 1BQEA 1P75A 1DTEA 2FPUA 2PGIA 4ENTA 3WGTA 1H0HA 1FXWA 4BMNA 3MUFA 1YJ5A 1MENA 4S35A 5BV2P 1C3XA 1QDLB 1Z0SA 4IWYA 5F1PA 4G0VA 5LQMA 3GT4A 5E7MA 3F1LA 1E4EA 1QGYA 2OENG 4HRYA 1XXHB 3SYKA 4RAOA 3WP0A 4BNTA 4DLLA 2HK9A 3MRSA 1U8XX 1KP9A 2FFAA 2AMYA 2IUEA 3USES 4FJ1A 4JXKA 4E0BA 1A76A 2JKVA 4IEIA 2Q1TA 4ZVMA 2AYZA 2JD0A 2B98A 3G2QA 4TQAA 4UHHA 4TMKA 3V97A 2HW8A 3OFVA 1RJGA 1FCJA 3IBCA 5CRIA 4B5LA 4YJKA 5JI2E 2C54A 2JGDA 1MQ8B 5DYIA 1QRRA 1AK9A 3RVJA 1BGXT 1J0AA 3H1FA 2QN6A 1E7WA 2VP5A 5KX5A 2IIVA 4F4HA 3DAFA 1SVOA 1JDEA 4QELA 1GPKA 4N8DA 2I2XB 4F45A 3PR3A 2KS6A 3F9IA 1E6MA 4G85A 4NYJQ 5CTAA 4H7HA 1H1LB 2IYNA 4HGZA 4MRMA 1RRCA 2IIQA 2XODA 3AKYA 4HDQB 4C78A 1PK9A 4QE3A 1B15A 1V5EA 2QNRA 3KV3O 3SBEA 1N5DA 1BSVA 3PENA 5KOYA 5CR9A 1G20A 1IHXA 2VHJA 5ALDA 2BFAA 1VLZA 2FSUA 2IOQA 2WJYA 1XRLA 3B6KA 3AUAA 3AHIA 3C1AA 1QBGA 4MULA 5JLAA 5THXA 4BZZA 4HDRB 1AUVA 4JL5A 3WIDA 3OF2A 4ESOA 3ZCTA 5DLPA 4PQGA 4X45A 4IDGA 3HDVA 3NV7A 4XWYA 3E9ZA 4D3YA 3PC2A 1V9SA 3LV8A 5BN4B 1I1QB 5LBIA 1TA0A 2QDKA 1KIFA 4KMSA 2G1UA 4WASA 1ID1A 4M0KA 3QX7A 5HBRB 1DAHA 3CN7A 4I7EA 2FFRA 2YINC 5ENDA 5DM4A 1I8TA 4YJ2B 5C8YB 5LVAA 1MORA 4MV8A 2FMKA 1F0YA 4WWHA 3QW4B 3G5AA 4NU6A 4UM5A 5EKXA 4RE6A 5DI9A 2Y68A 1ECGA 1YZVA 2EC5A 4D25A 5KQLA 3A10A 1IPEA 3AIMA 4JOSA 1EJ0A 1TVCA 3C3AA 4YVFA 2XXAA 3DZJA 4P7FA 4M86A 1O96A 4L76A 3ROEA 4BB0A 4ZYLA 4POAA 4X62B 5EWMB 3VUEA 2ZQ5A 3FCOA 5K8CA 5DK6A 1Q12A 2QAJA 4GBJA 1JIUA 3DO6A 2W42A 3H83A 1GUDA 2YMLA 3ETHA 4G1EB 4OXKA 5KTKA 2EL7A 5EMLA 5JVDB 1EFTA 1A9SA 2X40A 4E1AA 2VSQA 2X3FA 1KH3A 3PQCA 3V8BA 1LF0A 4KLNA 5FO1A 1TLTA 1LSSA 1BVRA 1QUEA 1YMQA 1XDSA 1ZH6A 2OILA 4QYIA 3F74A 3DBRA 3T9FA 3P0HA 4KCGA 3SR0A 2C84A 3RT1A 5ITZB 1AO3A 4R1UA 4KXYA 5DYGA 4EG1A 4UM7A 1FQWA 3MWEB 2GGSA 3THXA 4CEIA 3AI2A 4RVFA 3VR6H 5JD3A 3A1CA 3PR1A 3ZK8A 4ND8B 4A23A 1N2GA 1VL1A 1K6EA 3W5DA 3TAXA 1U65A 1TYZA 4O02B 1CUGA 5CP8A 4LRYA 3RTXA 3E2PA 2FPGA 1WBBA 1P9LA 5LU8A 1TK3A 4ER3A 4DLUA 1G8YA 1PYOA 1UXOA 5DSXA 5LU9A 1Y6RA 1JLKA 2P9CA 1BKSB 5B1DA 2ZRHA 2JFNA 4HGPA 3LK6A 4QBFA 2YRFA 4YPOA 3ECAA 1K1EA 3NC1C 3EWIA 5AIBA 4YHHB 3O3OB 4KXXA 4C7MA 2QF7A 5BWRA 4QQ8A 4Q1BA 1GITA 1CHDA 1Q44A 4D3XA 3VH3A 3R5KA 2YASA 3GLGA 1AM4D 3DBOB 3TLYA 3K70C 2ST1A 3OP1A 4U2KA 2WLSA 4K6GA 1DC4A 3OZFA 4XYMA 3RC1A 3N8DA 4GKKB 3NP7A 5LZ5A 4WD3A 3HB0A 4JWKA 2GN2A 3NWEA 3V2UA 3UAYA 4IXWA 1C1XB 1X6VA 3WWHA 3GB8B 5D1OA 1D1SA 1KQ3A 2ESRA 2XQIA 3LLCA 4MVJD 1ZGZA 4HUJA 3U4DA 4U2EA 4DQ0A 5A4JA 5E9QA 2QZ9A 2QLLA 4YK7A 5T67A 2JLCA 1XNHA 2FPOA 5IVIA 4F5YA 3NDBB 4AWXA 4U5XA 1KI6A 1RQLA 4BMVA 4CCWA 4BGIA 4CM6A 3LWBA 2CB9A 2IDJA 2W2KA 4ENVA 4KYVA 3JSNA 4NABA 1KJIA 1XPUA 1U7PA 4HO1X 2RHOA 1SOUA 1E1LA 1Z6QA 3BCRA 3O74A 3LQFA 4IIYA 3RVQA 4F4JA 3D54D 3HVRA 3EVAA 2G9RA 2OAGA 2ZIUB 1IXYA 2HHHB 1RNLA 3WK4A 1XSEA 4JJZA 1YZYA 2IE8A 5AHRA 3LCVB 1R2QA 1I36A 2A1IA 4CW7A 3KWFA 3TQQA 5AO9A 1RM4A 3BB3A 1I32A 1FDWA 3EDQA 3HHPA 3IVCA 3LCCA 4IF4A 2BHLA 5F78A 3WGOA 4JNKA 5DLYA 1L3CA 2X7JA 2WP8J 9GPBA 2GD0A 4TSKA 5HHTA 1RQ2A 4LX0A 4F60A 3AW8A 1FC0A 2ZCJA 1I3CA 3VKWA 4X61A 2ZJ4A 3B7PA 2ZOSA 1KMNA 1RJEA 3QXJA 5CB8A 1FBTA 3EIWA 3I05A 2EKPA 3MJFA 2BFBA 2HCBA 5D3KA 5M3BA 1P3DA 4FYHA 4RH0A 1JJVA 2XB6A 1ZNZA 2ZQYA 2AB0A 4Q39A 4S24A 2P7HA 4OREX 3C15C 3OY2A 2MYPA 3ND5A 1WSAA 1MEEA 3AQIA 3OCZA 1I3NA 4GI1A 3JASB 2OT3B 3LHFA 1Y4DE 4B7UA 3UJ6A 2XGOA 3U6KA 1NUAA 4YYZA 5BMOA 3T1HB 3UT5B 2BTOA 4KUHA 2PX2A 1K0FA 4IAOA 3KD2A 1AGXA 4M1QA 1T3LA 4N18A 4M0CA 3WMGA 4BRUA 4ZHQF 1W7AA 1YL7A 1U7DA 2FN7A 2XD9A 4C3OB 5KTTA 2EV9A 3KOZA 4IGKA 3VDMA 5EL0A 1VL8A 3BWBA 3HCEA 4B3CA 4MAFA 4FN5A 1U5CA 4YJFA 1DIKA 1YTUA 4RANA 1TKRA 1E1RA 5ESWA 1SUFA 2QQ5A 1KQOA 5BN3B 3GMSA 1V9PA 2ACVA 4TYQA 1BX0A 4S1NA 1JJIA 3PWTA 4ARZB 1JP7A 4C7KA 4P38A 4HAYA 3TDKA 3WRWA 4CEHB 2NAFA 3UC5A 3AVPA 1FFAA 2D74A 4UEJA 2EJBA 1QP7A 3S24A 2B0JA 4XQEA 1G6OA 5BVGB 3FJYA 3WHLA 4L8LA 2L69A 4HUQA 1Z7GA 4YRDA 3P26A 5BNWA 4GPIB 4PQYA 3SDSA 1PZMA 3OJFA 4Y1GA 1O6CA 5DLEA 3ZCQA 4Q7QA 2VWQA 1Q77A 2Y3IA 1UIRA 1CZOA 2C2GA 4ZHQA 3ER9A 1N2XA 2BMWA 3QKWA 5EMHA 3OTOB 2Q0SA 3BXXA 2I1LA 3UA3A 2JJ2D 2PS0A 4M4SA 5TMBA 4ER0A 1GYPA 2WPDD 1KDPA 2J3QA 4TUYF 1DIBA 3NHKA 4M1OA 5GV7A 5GVSA 1O9HA 1EE9A 1TAGA 5BMVF 3IVRA 1JZTA 1KI7A 4OSEA 4RGBA 4ZT4A 3RNLA 5IBQA 3GN2A 4A8TA 2POCA 3NEJA 5KNLA 4RPCA 4DUZB 1ATZA 1WPQA 3PX3A 1ETUA 4IRMA 2GXQA 5BXQC 3UPTA 1QG0A 4PU0A 1Q1GA 4R2KA 2PZ8A 3SLGA 3UAOA 1BW9B 2ZETA 4YQEA 1F8XA 5JNWA 4P83A 3LFUA 1VIDA 3A04A 4O0MA 1TCCA 4MQEB 4IRXA 4UOQA 4QBKA 4LC9A 2CJFA 5H1YA 5ALNA 2VYVD 1C7ZA 2IEYA 5J59A 3N05A 4JYCA 3FRHA 3F90A 1EQAA 1AKMA 2A3RA 5FYQA 2KB0A 2FE1A 2GCEA 3NTVA 3UF0A 3UYYA 4F72A 5IAOA 5FB3A 4CTOA 3R9RA 3LX5A 2BFMA 4UU0A 4YONB 4J0CA 4BCBA 2F8SA 4KBYA 4W9RA 4UDYX 2Z95A 2OZEA 3OQJA 1VE1A 1AB5A 5KINB 2OORC 4IVNA 4EHLA 5BMVA 3TO5A 3ZTTA 3VJKA 1P0IA 2GHTA 3ELYA 3FYSA 3KEQA 2VF8A 3QYJA 2DC1A 4JQSA 2G0AA 3CVUA 2YJTD 2FPIB 3U0BA 3H8SA 4E11A 4RTKA 5EHIA 3CSUA 4K87A 5G1PA 1TOAA 4BAGA 3NHSA 4XB2A 4BRZA 2ZJZA 2O2EA 3WL7A 2C98A 4IILA 2NU9B 2FEWB 4NRDA 4EI9A 4ZHSA 4KC0A 3H9UA 1Y8RB 1Z15A 5K05A 1N36B 3JPWA 2AKAB 4L3VA 4DIKA 2D7DA 1SBCA 1DWOA 2E4VA 2YFKA 1OIWA 3FGZA 4MS4A 2D1SA 1GCUA 3MCTA 4HNGA 5FIUA 3WRYC 5K0GA 1JDBB 1JDJA 1HT3A 3DDCA 4QYMA 3TL2A 5F23A 1NQUA 3IV9A 5IJ0A 2R8XA 3PNPA 4YMTA 4G4JA 3JATB 3TE7A 4KVFA 1OPRA 2PWZA 5CT6A 4B3TB 1L7PA 2W2NA 1E1QD 1RYZA 1Z07A 3P5SA 3NZEA 1ZIYA 3PE6A 1HG0A 2C7GA 2JFOA 5FI3A 3JSLA 4YP7A 5IH7A 5LNK6 2NUPA 5I7SA 4RTMA 2W2PA 3N59A 4H7PA 3WK6A 5A0VA 4ITRC 2JI7A 1MC5A 1DRKA 3ICOA 5LZ4A 3I6IA 4DLBA 4H7KA 1L5ZA 5HZKA 3RT9A 1JA1A 5ICMA 2A5FA 1U28A 3RSZA 5I5GA 4KE6A 1IN8A 3V2HA 3ZW8A 2C8LA 2C92A 3PZRA 2X7XA 4BBZA 1SXPA 5COBA 2PT6A 1S01A 2XUKA 1LQTA 1QCYA 3FKJA 2QIOA 3O8CA 1QYXA 3UMJA 4B3RB 2B35A 4UAGA 4J4HA 2EZTA 3ZE2B 3C3BA 1DT3A 1XFAA 4YAJA 4PC7A 1LSJA 3AETB 1FJHA 1UC9A 1ULAA 1UOPA 1ZUIA 2PVCA 2P77A 1MX1A 4NHOA 2BGGA 4B2IA 1E9AA 2DUMA 3JQGB 5TARA 4DRYA 3M9LA 1I01A 2B4YA 3RREA 1T0UA 4LYGA 2PUBA 3T5MA 1FX1A 5ALSA 5LPNA 3JWIA 5K0FA 2VK4A 4KUEA 1Z8NA 1V41E 1G16A 3NETA 5FR2A 3OT4A 4AS2A 3IQIX 5KYTA 4KR3A 2PKWA 1WXEA 3L1VA 1RDFA 4INPA 4MB6A 1CUBA 2JFGA 2UKDA 1K7EB 1W88B 3PQ5A 4LDZA 1KR2A 4ZVRA 1BX1A 2JRLA 3L7KA 2XWSA 3OOSA 4EMSA 4LVNA 1K5GA 4LEIA 3S0JA 3UJ9A 1TCBA 4QOIA 3IAM6 4ZOQI 4IHQA 3T6KA 3CF4G 4QDXA 5J58A 3NYRA 3CF0A 2PRIA 2F67A 4OHBA 4QIHA 1FY2A 2R87A 1OLOA 4WQMA 6PFKA 1EFCA 4BNVA 4D8WA 3REFA 5J40A 3O9MA 4DKXA 1FMCA 2JATA 4LC1A 1TAQA 3AHCA 2RDMA 5JDCC 3OJLA 4B7XA 5DXFA 4E22A 5EIEA 1E2JA 1JVBA 1RJ9A 3KYCB 1GR0A 1EK5A 4KQGA 3VR5H 2HYDA 1X8LA 2CXTA 1ZEJA 2IYRA 1A96A 1HT2E 1L8AA 2X5XA 4NFLA 3TM5A 4YXFA 2XE6A 3GN1A 1KBOA 3W8RA 4YRIA 4C08A 1YK0A 2WIKA 4QD3A 4WK4B 4DV7B 4DIEA 3RC8A 5JYDA 3EUAA 4OKSA 2F59A 3CXUA 4NOMA 4UTZA 2DJ5A 4ZAYA 4TZTA 5FCDA 4CCYA 4W1SA 2IC5A 3FOWA 1G8PA 4E30A 3HCAA 2JAHA 4G5XA 2QNIA 3WLOA 4CVNA 5FTKA 4Q47A 4R01A 4HVCA 1AZSC 4XWKA 3C7DB 3G02A 3TBKA 4GFDA 3ZCUA 2QT1A 3NCTA 3CX3A 3BMQA 3LWNA 5EKTA 3LDAA 3K5IA 1GAQA 1N8SA 3DKIA 3UC9A 3ONDA 2R9VA 2IZ0A 3P20A 1F5NA 4X6YA 3F5FA 4KX5A 2VHYA 1NQAO 5K6TA 4BASA 3SS9X 3PLAE 1QWOA 2VSOA 3AJ9A 3CBQA 4BN4A 4MUGA 4LECA 1GKLA 1FTWA 1V16B 3AR8A 1JXAA 2I4OA 4RVHA 4UU7A 4XFDA 2IYFA 3HKDA 2ZYUX 5TS3A 3WOHA 4KFRA 4YC7A 1L4UA 1J42A 5K2MA 3HVIA 1HSZA 3MSXA 1LDMA 3LHIA 4OB7A 5DHTA 5F7JA 5H83A 2P0AA 2JFZA 4MW4A 1O95A 4ALIA 1K3UB 1RC0A 4A6DA 1ZJJA 5GJCA 4CQMA 1JSRA 4YECA 4EVSA 2PHZA 3DTVA 3JQ8A 2W2MA 3W7BA 7ABPA 1LZLA 5C51B 2JCGA 3VNUA 3KZNA 1E2UA 1LDBA 2YWDA 3WKCA 5BQXA 1HZZA 5FPOA 2HQOA 1Z88A 2IT1A 1MAVA 1NUPA 5F51A 1C3VA 1ZXXA 4HTFB 2Z6VA 3CRQA 3GFSA 5ENVA 1UXGA 4AMGA 4GPD1 3FFTA 2ZT7A 3ZU6A 1XZJA 3WV5A 3T1TA 1Z2OX 3DAOA 3I2IA 2FP4B 3RTBA 5I5SA 4R9NA 2Q3JA 3K8QA 3QFHA 4K9QA 4ZT2A 1OBFO 2DR3A 4B1FA 2QLNA 4MV3A 3CUYA 3GU3A 3LLMA 4M53A 2Z8ZA 4EVIA 1Y6ZA 3H3FA 3RIEA 3OZVA 1K2WA 1KZYC 1CQZA 3UGKA 2CNDA 5CDUA 4NYMR 3ZLJA 4FEGA 4TWBA 3HN6A 4LV6A 3QELA 4DLNA 3B5JA 3WXMA 1GA4A 2P5TB 1K5PA 1AO0A 5ALOA 2XKKA 1B73A 1IUKA 2J3HA 3FDIA 3EFOB 3GBPA 3KOMA 4J07A 4PE5B 4EFMA 2PSHA 1SO8A 4NIMA 1S68A 1XTJA 1QC5B 4Q02A 1Q0UA 3IUEA 1XL1A 3KJNA 3VI3B 4LFAB 4CF3A 3LUAA 4MINA 2JLAA 4TSFD 1ONOA 4DS3A 2APJA 1N2OA 4UTNA 3FNFA 4RKEA 4W9MC 4LXIA 3GLFA 3X43A 2VKQA 3RIHA 1OWNA 3O4HA 3VYRB 1DQZA 3H11B 1B0UA 2HQBA 5T6BA 3VH1A 3ZD6A 4OX9B 3K09C 1YQWA 4JLVA 3U9SA 1W4BA 2FUG1 2A5DA 2I7CA 1K8QA 2RK4A 1W73A 3AEUA 3P4UA 3Q6MA 3DPUA 1D6SA 4IMJB 3NM6B 4LDPA 5G3ZA 4BKMA 1ZVMA 4DQVA 3DL4A 3II6X 3NHYA 4HGQA 1QLJA 4Y6GB 4IUBS 5FWNA 4HDMB 3RSCA 2FRDA 5BV1A 3CISA 3WZ2A 2G36A 3VRHA 4QPCA 2GZMA 2CEKA 3D1JA 1XMVA 3FUTA 4RQTA 4GL2A 1V9LA 3OWHA 1GPUA 4MYHA 4BNUA 1IXRC 1RIFA 4JVSB 4H1HA 5LDHA 5FLXA 2AG8A 3HK2A 2CNUA 1EINA 4JCOA 2C1ZA 3FMOB 1E6UA 2B6NA 3LRXA 2OAP1 2OHVA 4OG2A 4PCLA 1CUDA 3WMXA 2OCGA 4PCAA 5BNFA 1VBKA 2Z6AA 3J7TA 4V03A 2WAMA 4ZZ3A 5MGBA 4I50F 5AJXA 2IP4A 1M7HA 3DDUA 3JQAB 4NTZA 2JK1A 4Q21A 3W1VA 4JGBA 1S3SA 4M8NE 4WBNF 1TLFA 3OETA 2OWDA 3KUXA 1S2OA 4BGUA 5DTIA 2VQEB 2AOUB 2WLTA 1SELA 2BI4A 2H52A 3FFWA 1J06A 1R6TA 3AUJB 3QU9A 4KXWA 5FUXA 3RE1A 3ZWWA 1YB2A 2NU7B 2ODPA 2CZQA 3HADA 1YGYA 4MQUA 4D4JA 1SXQA 1Y6FA 4PWYA 4BNYA 3GEDA 4W1RA 3LW7A 4DRXA 1VC2A 4X94A 4DQXA 1FQJA 2YR0A 4NVRA 1EFPB 2PUHA 3IURA 3DBLB 4TKZA 2XLBA 3ABZA 4UHFA 1UKCA 4F3KA 1V8DA 4HNHA 2VH2A 3SG0A 3BWCA 4NZNA 1RRMA 3PTZA 4TL9A 3RBZA 1KWKA 5EZQA 3T34A 3E22A 4Q9LA 3IP9A 1DOAA 1LF5A 3L41A 3PLNA 1NYQA 1E9CA 2ACEA 1S2DA 1DAIA 2BZ1A 3IAEA 3NHLA 4I9FA 1DUSA 1JXOA 3HV0A 1AXEA 5ERXA 3T4XA 1K98A 4WBNA 2F4VB 3BILA 2TS1A 1B14A 8ADHA 5F1KA 1BXGA 3OFSA 4KE7A 1YS2X 2ZANA 3O4RA 4I36A 1ISIA 1II0A 1U02A 3TJMA 1HC7A 1IG3A 5KQSA 3MAJA 4HC4A 5GJBA 1K9SA 2UVPA 2HBZA 4P58A 1YCGA 2XYGA 3L4BA 3DFUA 3I2JA 2J5RA 3OKFA 1DIHA 2C1EA 4GGMX 1TPYA 1RJWA 3LY8A 4LHEA 4NY1A 5CW2A 5IP5A 4Y2GA 1GZ3A 3R7SA 2W43A 4IDDA 1EVKA 1QHHA 2P78A 1XTRA 1SXJB 3IMKA 4N3NA 3ONWA 5DGIA 1XX6A 3GHHA 3R3JA 1T10A 2J31A 1RYNA 2GWRA 2NIPA 4NV0A 3T0FA 2GCOB 4ZN6A 3OQIA 3DM9B 1CBUA 1T5HX 3N9IA 2PBRA 1T2NA 4EW3A 1OYYA 2BGIA 1P31A 3JTEA 1J23A 4XYBA 4X95A 3UQYS 4J9VA 1NPTO 2OCKA 3BPSA 3BFXA 5ARBA 2JIDA 1FDTA 1RP7A 3WMFA 1CEEA 1FK8A 1CJBA 1IY2A 4ILKA 1VJCA 3KZOA 4CDRA 4LNAA 4TLLB 1O7JA 1PJCA 4Y2HA 1MP0A 5K01A 1EZ4A 4JB2A 4QDTA 3Q8MA 1R6BX 3ED1A 2A9FA 4Q3CA 1DLIA 3LP6A 2CCKA 4CKZA 2YV4A 4KL8S 3H4MA 5DIFA 4MDHA 3TZLA 3LSTA 4D4HA 5TQJA 5CFZA 4ERXA 3TPZA 2XADA 4FCVA 1M1NB 3PNOA 4KIFA 5CJPA 2JL1A 6Q21A 2W22A 5EJ9A 3F3SA 4ISCA 1M1ZA 4XYGA 4QM7A 2Q8NA 4MUJA 1O95C 5TR9A 4BO3A 4Y6QA 3WZLA 4OOEA 5FULA 2ISSD 4JUDX 3AU8A 4RIGA 4BFXA 2HO5A 1HFKA 2JRCA 1P0FA 4RPIA 1NLFA 2Q9UA 5AOCA 4QU0A 3OE1A 1PV1A 2E9SA 2G83A 3KQTA 4YR9A 4BNDB 4A9AA 3WFZA 1NKSA 1HZZC 1T1GA 2FZWA 4GI7A 4S2EA 2GQRA 3NHRA 1CUUA 4PO9A 3NX4A 4KREA 1YIOA 2Q0XA 3CUSA 2LUOA 3IKVA 4JSRA 2QZZA 3LQ2A