1XDNA

High resolution crystal structure of an editosome enzyme from trypanosoma brucei: rna editing ligase 1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
265
structure length
265
Chain Sequence
QSDFSPYIEIDLPSESRIQSLHKSGLAAQEWVACEKVHGTNFGIYLINQGDHEVVRFAKRSGIMDPNENFFGYHILIDEFTAQIRILNDLLKQKYGLSRVGRLVLNGELFGAKYKHPLVPKSEKWCTLPNGKKFPIAGVQIQREPFPQYSPELHFFAFDIKYSVSGAEEDFVLLGYDEFVEFSSKVPNLLYARALVRGTLDECLAFDVENFMTPLPALLGLGNYPLEGNLAEGVVIRHVRRGDPAVEKHNVSTIIKLRCSSFMEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of a key editosome enzyme from Trypanosoma brucei: RNA editing ligase 1.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Ligase
molecule keywords RNA editing ligase MP52
total genus 75
structure length 265
sequence length 265
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1xdnA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1xdnA01
1XK5A 1B04A 3GB8B 1XDNA 3NBYB 3BABA 2HVSA 3NC0B 4CC5A 4UCVA 3W1BA 3GDEA 5D1PA 4EFBA 3QWUA 2CFMA 4UCOA 4UCTA 1CKOA 1VS0A 5FPOA 1X9NA 2Q2UA 1S68A 4PZ7A 1CKNB 4PZ6A 2OWOA 1V9PA 1FVIA 4PZ8A 3S24A 4LH6A 4UCRA 1TA8A 4UFZA 1P8LA 5DISC 3TY8A 3BA8A 3BA9A 4EQ5A 3KYHC 1CKMA 3VNNA 3UQ8A 3BAAA 1P16A 2HIXA 2HIVA 3L2PA 4GLXA 2Q2TA 5FPRA 1TAEA 4DRFA 3TY5A 2HVRA 5D1OB 4EFEA 3PN1A 5D1OA 1DGSA 3RTXA 2VUGA 3NBZB 4CC6A 3TY9A 2HVQA 3JSLA 4UCSA 3W1GA 3W5OA 4EEQA 1CKNA 1A0IA 3GJXB 4LH7A 3RR5A 3JSNA 4E6NA 4UCUA
chains in the Genus database with same CATH superfamily
4FFPA 5KFXA 2W9CB 3T7AA 2FP4B 1E4EA 1KUTA 4J9NA 4HN2A 2A1HA 4EGJA 2CW8A 3MR5A 2YL2A 5C44G 4PBCA 3TQ1A 4O7WA 5KT3A 2Z02A 5D1PA 3PW7A 4UCTA 2R86A 3GIIA 1S68A 1DV2A 1T94A 4M7EA 2ZGIA 4O2AF 3GIPA 5L1KA 3WWIA 4CMDA 1ZAUA 4RZQA 4I50F 5LOVF 2C35B 1HNXH 3KYHC 4MV8A 3VNNA 4LF5H 2FLNA 1P16A 5DAAA 4JV5H 2GQSA 4GC6A 3AW8A 3RBEA 4EFEA 4YJ3F 2R8JA 1BXRA 2I87A 2V59A 4L1KA 1B6SA 3TY9A 3W1GA 2RF4A 4DV6H 1I1MA 4E4TA 4A3MG 3SNOA 3RAXA 5KFUA 4KHPH 3RF2A 4E6NA 1FJGH 1VBGA 4I7HA 2ASLA 3HOVG 2R7KA 4GC7A 3T9CA 1RJRA 3QZ7A 3T5HA 1I2LA 1M6VA 1BJTA 5LMNH 3HOZG 2PMZE 5KFSA 2UXBH 3W1BA 4FBUA 3LWBA 4YR2A 5DGAA 4FBTA 3PFFA 3HOYG 3KXYT 3Q8QB 3UYYA 2Y0SE 4PZ7A 4J9RA 1IYDA 5EWGA 1JIHA 1Y1WG 3CEBA 5K2MA 2VPSA 4DUZH 4DR4H 1UNNC 4DV4H 1GSHA 1VAJA 1Y1WA 3RTXA 3H0GG 4RUCA 2BQUA 5I47A 3MR3A 2HGWA 1KT8A 2CNUA 1KBLA 3TQTA 3Q8PB 4X64H 2YZLA 4ECSA 4Y8VB 5BPHA 5KT4A 2R85A 2IP4A 4HYKA 4FS2A 4LFBH 5EZYF 3AX6A 3GB8B 4G3IA 1PK8A 2HHFA 1SEIA 4ECQA 2HHFB 5E25A 2CW7A 1IBMH 2ODTX 4CMFA 4FS1A 1RJPA 1Z2NX 2CFMA 1KJQA 2GQRA 5BWWA 3PO2G 4IAJA 3IG0A 4Q8FA 3HBLA 3QFFA 2YRXA 3SGIA 3H4BA 3RV4A 3S24A 3RAQA 4LH6A 3UZOA 4DL6A 4RNNA 3VMMA 3RB0A 3HT5A 4HNVA 4LF7H 2Q7DA 4NZMA 4A3DG 4ECVA 3M9NB 1ZQ7A 3KHLA 4A3IG 5FPRA 2WYOA 2W8LA 4F50A 4ECTA 1L2ZA 3GIQA 2C2RA 3VPBA 2HHHH 4Q4CA 2FK2A 5DG9A 4ED1A 5IT9W 1JLLB 1KJ8A 2PBZA 4UCSA 2NUAB 2BQRA 3RV3A 3SE7A 2O03A 1A0IA 1EYZA 4DUYH 2ZM6H 4LSAA 2J9GA 3R5XA 4TM5A 1A9XA 5KFKA 1KJJA 3HO8A 5BR8H 4NZOA 3HXLA 3H4DA 3UFXB 1R9TA 3UZBA 5I5SA 4FE2A 2JEIA 2Z04A 4FFRA 4DR1H 5EWFA 1GSAA 1S0MA 4F4WA 5F9LA 4DR7H 4QWCA 4O3QA 1FVIA 4TUYF 5H80A 3AYHB 4UFZA 5DISC 5J2TF 5I5TA 5DG8A 3T9BA 4U7CA 4Q43A 5LMUH 3T1YH 4ECWA 3Q8SB 5KT6A 2W9AA 1JX4A 2HIXA 5C8YF 4YAJB 4O86A 3DTGA 5DGBA 5T14A 4DV5H 5KX5F 2VA2A 4QIWA 4CC6A 3PW4A 3QZ8A 3Q1KA 4JI2H 3M9OB 3GV8B 1CKNA 1WRVA 1BGWA 4MV7A 4O7LA 2AGQA 1I1LA 1N34H 2Y4RA 2NVXA 1EZ1A 1XDNA 1K1SA 4IRCA 2UU9H 4DR3H 2R92A 2NU7B 4YAKB 2ABJA 1IOWA 3R9RA 4BWSC 4JI7H 3K3VA 3CQZA 3BQ0A 2CZGA 4ME6A 1SYXB 2XD4A 4O4IF 5KG7A 3ETJA 4FU0A 1V9PA 4RB1A 4TQSA 3KHGA 1CS0A 1P8LA 3BA9A 2UUCH 3NUAA 4XX0B 2MCTA 2DPIA 1SCUB 4JI8H 4AQYH 5FD6A 5KFTA 4JI4H 5KT5A 3J80W 1WH2A 2ATLA 2UUAH 2CNVA 2V4QA 5I5UA 4ED8A 5JUMA 4EG0A 1IYEA 4EBCA 4JV1A 1JDEA 3GIMA 1DAAA 1CQIB 2UVUA 3JSNA 5KFVA 4LSXA 4A3KG 2B63G 2COGA 3HKZA 3RFCA 3H0GA 1CE8A 3Q8RB 4ED3A 4XZ3B 2R6FA 2WE6A 3PZPA 4A3GG 5LA6F 3L4JA 3OSNA 4O4JF 1M0TA 2GPSA 3JZFA 4NZNA 3EYYA 4O7SA 4O4HF 2VR1A 1VS0A 2YS6A 1XNQH 5KFGA 2JA5G 3VPCA 5A2QW 4IR9A 4IR1A 2FLPA 2OLSA 3LMLA 3N42B 2W9CA 5KFOA 3EPIA 3BAAA 4J9LA 2HIVA 4TV9F 2XGQA 5DLFA 3ORQA 2CNQA 4DLKA 3PR5B 2DPJA 4QWDA 1E4GT 4F4ZA 1KJIA 4CKBA 3I4NG 4EYHB 4BXXG 2WB1E 2C2EA 1GYFA 2HVQA 2QYZA 4J9PA 2JA7G 2C00A 1WSCA 4ECUA 1AUVA 4RZRA 3C0FB 3BQ2A 2BR0A 2IMWP 2GLTA 3MR6A 4CHIA 1XK5A 1JXLA 4A3EG 3BACA 4ECRA 2YS7A 2W71A 2YRWA 2FK3A 2PVPA 2ASJA 4MA5A 5I5WA 4EFBA 1OBGA 5FPOA 1KC7A 3RJ0A 5FLXW 2J6TA 3KALA 4RB2C 3MR2A 4X65H 1XMQH 1CKNB 1VKZA 4IZOA 5EWEA 1TWAA 5KFMA 4YP3A 2UVWA 4QWEA 3OHBA 3GV7B 4O7ZA 2CQYA 4JYAH 2VUMA 2W6NA 4O81A 5BMVF 3NGDA 5KFBA 4NLGA 3TY5A 2HVRA 4K0KH 1ZHQA 1IBKH 4XYLB 5JH7F 3MWEA 5BWRA 5JVLA 5C1PA 2YZGA 3N6XA 3RUPA 2CKZB 4K6NA 5KFAA 3G6VA 3LP8A 2QK4A 4C5CA 1OWTA 4FFMA 4GKKH 3E5NA 2JA8G 4I4TF 2Q2TA 2PMZA 3ETHA 1WCMA 3M4IA 2XC9A 4F4XA 3G6XA 2YW2A 5FD5A 4O7VA 2SCUB 2R8GA 3GTGA 2JA5A 3T54A 2F4VH 1N33H 4MV1A 1B33N 2WB1A 3CVZA 3MFIA 3K3PA 2I80A 4O83A 4LF6H 2XGPA 1A3GA 5I5XA 5KFZA 2JA6G 2VUMG 4A2BA 4DV3H 1TA8A 3N8DA 4O7TA 2M05A 2UXDH 2AGOA 3GLKA 4IRKA 3CSWA 5FR9A 3UQ8A 2AU0A 2IBKA 5KKNB 5L9XA 4JV0A 4ZI7F 4MV9A 5CAEB 4C5BA 4R8UA 4R8UB 3PN1A 2E2HA 3MJFA 4YJ2F 1Y1VA 2V4RA 4A3JG 3PR4A 3GQCA 5J2UF 1EKPA 3K5IA 3QQMA 3W5OA 2IA6A 2R8KA 4UUGA 5C5JA 1J5EH 2ALZA 2R87A 3DF7A 1I50A 1M7JA 4RAZA 5KFWA 4CE5A 2UUBH 1RK6A 1V51A 2P0AA 4YQWA 5KG1A 3V4ZA 4X62H 2W9BA 1EKFA 5KG2A 3GILA 1K1QA 3R5FA 5LP6F 4Q45A 3T99A 3DTFA 3G8DA 5BWUA 2JEFA 3RIZA 1N36H 4CKEA 2WDTA 2WAQA 2W7PA 1X9NA 1ET0A 4M0JA 1PX2A 2HDKA 3MFHA 4DR5H 4RB3C 2QB5A 4RAYA 5KFFA 4GLXA 4A3BG 2XCLA 4A3CG 1TWCA 4QWBA 5DQGA 4MV3A 2JA6A 2FB9A 4MAMA 3N44B 5DQHA 5KFJA 5IWAH 2VPQA 4EYIB 5I5VA 4FFNA 2JA7A 3BQ1A 3N41B 4JI6H 1EUDB 4X66H 2W6QA 3FMAA 1M0WA 3RR5A 1WR2A 4UCUA 3U9TA 3OHAA 3R23A 4CKCA 3OSPA 2RDIA 4RNMA 2R93A 4A93G 2PN1A 4IIJF 4RCNA 1Z2OX 3I4MG 1GSOA 1I1KA 3I12A 5DG7A 4YBZB 2HVSA 4TV8F 1HNWH 4MV4A 2W57A 1RJQA 1W93A 3KAJA 5DGIA 4IHJF 3QWUA 5CB4F 1XMOH 2VA3A 3GTPA 5KG6A 2DLNA 4HNUA 1TWGA 3LQSA 3OTOH 3VA7A 2ZJTA 1OBDA 3KTMA 4JI5H 2FKLA 3HOXG 1E4EB 2R7MA 3F8NA 4YR3A 2J6UA 1TAEA 4QJFA 1HNZH 1JDBB 4DRFA 4JXUA 2V9WA 3ORRA 3WWJA 4FFLA 4DV0H 1HR0H 4FGRA 4LF4H 2HG8A 4J9QA 4DV7H 4QW8A 4BBRG 3VPDA 4QSHA 3U9SA 4EEQA 4LH7A 4BY7G 1O75A 3V6HA 4DL3A 5CM0A 4O3OA 3GIKA 4XYMB 4F4YA 2JEJA 2GPWA 1G2WA 5GONF 1S0NA 1S10A 4J9MA 5BPFA 2W70A 2W7OA 4MTDA 3M9MB 4JI0H 1Z2PX 2DABA 3JRWA 3MWDA 3L4KA 1CKOA 3JZIA 4O2BF 3FKIG 1I6UA 2X0SA 4DAAA 2WTFA 2NU8B 3T9AA 3TIIA 1JKJB 3TIGA 5JQWA 4JUZA 4ED7A 4GLWA 3K5HA 1CKMA 2RGVA 2YCHA 3GIJA 1S9FA 2UVRA 2BQ3A 4LFAH 3GTMA 2W6ZA 4JI1H 4GKJH 4Q0YA 5IP9G 2HGSA 2FPPB 5KT2A 2Y0SA 5HBRB 4ECYA 3NBZB 1A0GA 2ZDGA 1BNCA 2XCAA 2R82A 5KFIA 3RGXA 3H40A 4DV1H 4APMA 3TW6A 4DV2H 3LULA 4LF9H 4DL2A 3PO3G 2XIGA 4DQNA 4O3NA 4B3RH 2YWVA 2C28A 1W96A 4WBNF 2FMAA 1B04A 3JAMW 2NU9B 3SI8A 2W8KA 2B63A 2FE3A 4UCVA 2W6OA 4J9SA 4UCOA 3KHRA 2ZDHA 2R92G 1C30A 2EJ3A 4YB8B 3TY8A 4A2AA 5DLGA 5CE8A 3TEKA 4RUAA 2C22A 1S0OA 4IRDA 5C3EG 2XCPA 4DL5A 1IOVA 2R84A 1N48A 3N40P 1A48A 2X5RA 1VBHA 3V6JA 3TINA 4RB0A 3BJYA 3PW2A 1DGSA 2VUGA 2UVVA 1I2KA 4MTEA 4BY1G 4MA0A 1I3QA 4LF8H 4NXMH 3U54A 2R7ZG 4M9UA 3HOUG 2VQEH 1B6RA 3GJXB 1V4YA 5L1IA 2J6SA 2EJ0A 4EGQA 3U0GA 3VOTA 2E5LH 1E4FT 1XNRH 1C3OA 3BG5A 5CR5A 3T9EA 4HNTA 3PW0A 1I7NA 1WCMG 5KT7A 1I94H 1ZETA 1FKAH 2RGRA 3NC0B 4DR2H 1GLVA 3T5JA 3EPGA 3RB3A 1CQJB 3GDEA 2R7LA 3KHHA 1N56A 1K83A 5KFLA 2KSWA 4JI3H 2W6PA 5KFRA 4AYBE 1KTAA 3GTJA 4YHHH 3T5KA 3RBDA 1UC9A 2DWCA 4O82A 4EBDA 3WNZA 4PZ8A 2NU6B 3Q2OA 2JEGA 4UCRA 3WO1A 5IYBG 3KREA 5I5YA 5BYBA 4C5AA 5KFPA 3RB4A 1N32H 3H20A 4LMYA 4IWXA 4O4LF 5EDWA 5JVDF 2R7NA 4PWQA 5DQIA 4LFCH 2OH2A 5KG3A 3U55A 1ULZA 2C2DA 1TWFA 5FNVF 4ETSA 2AGPA 4U6PA 5KS8A 4QWAA 5HV6A 4WHXA 2VOBA 5KFYA 3R5HA 5KFHA 4ED0A 4O3PA 2DIKA 3HB9A 3WO0A 1Y14B 3DAAA 2R7ZA 3GTKA 5C4XG 4EEYA 2COJA 3BABA 4CC5A 4QIWE 1EUCB 3N43B 3MWMA 5KG0A 1S97A 4O7YA 2V5AA 5D8DA 2Q2UA 3V4SA 5IP7G 1EHIA 4PZ6A 3GV5B 4DIMA 2VQFH 5JQGF 5KFCA 4HR7A 1I7LA 5EOYA 5IYCG 4O3RA 2DZDA 5I60A 4I55F 5FLMG 3J7AK 2VQDA 5L1JA 1SFOA 3H3VH 3WWHA 4B3SH 2FJZA 2YU9A 2R93G 1EKVA 4AYBA 2EIYA 5KFNA 1RYSA 3GTLA 1GGOA 5CA0F 2YYAA 3JSLA 4HQ6A 4TVIA 5KFDA 3PW5A 4NXNH 1S03G 4DR6H 2FPGB 4ZHQF 1DV1A 4ED2A 4A3LG 1T36A 3T1HH 2EJ2A 2FPIB 4ZOLF 5K3WA 2ASDA 3NBYB 5F9NA 3N6RA 1RK5A 1Y1VG 5FJ8G 2FK1A 3T9DA 4TQRA 5IYZF 5LYJF 4J9OA 1KEEA 4B3MH 3JZ6A 3RGZA 3KAKA 3GIDA 5KG4A 4O7NA 4Q4DA 5DMXA 2YZMA 2QF7A 2R8IA 5HNEA 5IYDG 4DL4A 4EQ5A 4WD3A 3OUZA 4J0MA 2RDJA 3FKIA 1ZHSA 4J9KA 3PVXA 2YZNA 4FM9A 4Q8EA 2ZDQA 5C1OA 5BWTA 2I8CA 2W9BB 3J81W 5KFQA 3G6YA 3JRXA 3T9FA 4RU9A 1T3NA 4FFOA 5DGHA 5BYAA 1TWHA 1AN7A 2COIA 3OUUA 4QW9A 3IN5A 2WAQE 2DAAA 3RB6A 4ECZA 3HOWG 5CA1F 4O3SA 4IWYA 1KJ9A 1GO3E 1AUXA 4YY3H 4EBEA 2NVYA 3HKZE 5KFEA 4O84A 5BWVA 5L1LA 4A3FG 2E2IA 4C2MA 3G8CA 1DIKA 2AQ4A 2W6MA 5KG5A 4OX9H 4B3TH 3GTOA 2V58A 2OWOA 4BBSG 3FDSA 3V6KA 1UC8A 3T5LA 3BA8A 4ZQIA 4YR0A 4R7RA 1MZBA 2HGXA 4NYEA 3L2PA 2FLLA 2HJWA 2UXCH 1IBLH 1RYRA 4JV2A 4PDBA 5D1OB 3GTQA 5LXTF 5D1OA 3TW7A 4ED6A 4DL7A 2R8HA 4RNOA 5LL6b 4O7RA 4ECXA 4Q44A 5BWXA 4MV6A
chains in the Genus database with same CATH topology
1N34H 1E4FT 1XNRH 1XDNA 2CW8A 1I94H 4X62H 1FKAH 2UU9H 4DR3H 3NC0B 4DR2H 2RGRA 4JI6H 4B3RH 3GDEA 4BWSC 5D1PA 4JI7H 3K3VA 2KSWA 4UCTA 4JI3H 1SYXB 4YHHH 3RIZA 1S68A 2WDTA 1N36H 4M7EA 1X9NA 1V9PA 4PZ8A 4RB1A 4UCRA 4DR5H 1P8LA 4RZQA 3BA9A 4RB3C 1HNXH 3KYHC 2UUCH 3VNNA 4RAYA 4LF5H 4GLXA 1P16A 2MCTA 3H20A 4JI8H 4LMYA 4JV5H 4AQYH 5FD6A 4JI4H 3N44B 3J80W 1WH2A 4EFEA 2UUAH 5IWAH 4LFCH 3N41B 4ETSA 4X66H 3TY9A 3W1GA 2VOBA 4DV6H 4KHPH 3FMAA 3RR5A 3JSNA 4E6NA 1M0WA 4UCUA 3RF2A 4LSXA 4I7HA 1FJGH 1Z2OX 2WE6A 3L4JA 1BJTA 3BABA 5LMNH 2HVSA 2UXBH 1HNWH 4CC5A 3W1BA 1M0TA 2W57A 3KAJA 3EYYA 3KXYT 3QWUA 3N43B 3MWMA 1XMOH 1VS0A 2Q2UA 1XNQH 4PZ7A 4PZ6A 2VQFH 3OTOH 5A2QW 5EOYA 2ZJTA 3LMLA 3N42B 4JI5H 2VPSA 3BAAA 2HIVA 3F8NA 4DUZH 3J7AK 4DR4H 4JI0H 1TAEA 4DV4H 1HNZH 4DRFA 1N32H 4B3SH 3RTXA 4DV0H 1HR0H 1E4GT 4LF4H 4DV7H 1GYFA 2HVQA 3JSLA 4NXNH 4EEQA 1S03G 4DR6H 4X64H 4LH7A 1O75A 3C0FB 3T1HH 4LFBH 1XK5A 3GB8B 3NBYB 1SEIA 1IBMH 2CW7A 4MTDA 4B3MH 1Z2PX 3L4KA 4EFBA 5FPOA 2CFMA 1Z2NX 3RJ0A 1CKOA 5FLXW 3KALA 4IAJA 3IG0A 3KAKA 3RGZA 1CKNB 4X65H 4RB2C 1XMQH 1I6UA 3S24A 4LH6A 4EQ5A 4LF7H 4LFAH 2YCHA 1CKMA 2RGVA 4J0MA 1ZHSA 4FM9A 4JYAH 5FPRA 2WYOA 3TY5A 2HVRA 3J81W 1ZHQA 4JI1H 4GKJH 4K0KH 1IBKH 4Q0YA 2HHHH 1L2ZA 2HGSA 3N6XA 5IT9W 3NBZB 3RGXA 4UCSA 1AN7A 4DV1H 4APMA 4DUYH 2O03A 4DV2H 1A0IA 4GKKH 4LF9H 2XIGA 4LSAA 2Q2TA 2ZM6H 3M4IA 5FD5A 1B04A 3JAMW 5BR8H 3HXLA 4YY3H 2F4VH 2FE3A 4UCVA 4DR1H 1N33H 3CVZA 4UCOA 4LF6H 4OX9H 4B3TH 4DR7H 2OWOA 4A2AA 1FVIA 3TY8A 2UXDH 4A2BA 4DV3H 1TA8A 4UFZA 5DISC 3T1YH 5LMUH 3BA8A 4R7RA 3UQ8A 3L2PA 1MZBA 2HIXA 2UXCH 3N40P 1IBLH 4PDBA 4MV9A 4RB0A 5D1OB 3PN1A 5D1OA 1DGSA 2VUGA 4DV5H 4LF8H 4MTEA 4NXMH 4CC6A 4MV7A 5LL6b 3W5OA 4JI2H 1J5EH 1CKNA 1BGWA 2VQEH 3GJXB 3DF7A 4RAZA 2UUBH 2E5LH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XK5 A;  1B04 A;  3GB8 B;  1XDN A;  3NBY B;  3BAB A;  2HVS A;  3NC0 B;  4CC5 A;  4UCV A;  3W1B A;  3GDE A;  5D1P A;  4EFB A;  3QWU A;  2CFM A;  4UCO A;  4UCT A;  1CKO A;  1VS0 A;  5FPO A;  1X9N A;  2Q2U A;  1S68 A;  4PZ7 A;  1CKN B;  4PZ6 A;  2OWO A;  1V9P A;  1FVI A;  4PZ8 A;  3S24 A;  4LH6 A;  4UCR A;  1TA8 A;  4UFZ A;  1P8L A;  5DIS C;  3TY8 A;  3BA8 A;  3BA9 A;  4EQ5 A;  3KYH C;  1CKM A;  3VNN A;  3UQ8 A;  3BAA A;  1P16 A;  2HIX A;  2HIV A;  3L2P A;  4GLX A;  2Q2T A;  5FPR A;  1TAE A;  4DRF A;  3TY5 A;  2HVR A;  5D1O B;  4EFE A;  3PN1 A;  5D1O A;  1DGS A;  3RTX A;  2VUG A;  3NBZ B;  4CC6 A;  3TY9 A;  2HVQ A;  3JSL A;  4UCS A;  3W1G A;  3W5O A;  4EEQ A;  1CKN A;  1A0I A;  3GJX B;  4LH7 A;  3RR5 A;  3JSN A;  4E6N A;  4UCU A; 
#chains in the Genus database with same CATH topology
 4FFP A;  5KFX A;  2W9C B;  3T7A A;  2FP4 B;  1E4E A;  1KUT A;  4J9N A;  4HN2 A;  2A1H A;  4EGJ A;  2CW8 A;  3MR5 A;  2YL2 A;  5C44 G;  4PBC A;  3TQ1 A;  4O7W A;  5KT3 A;  2Z02 A;  5D1P A;  3PW7 A;  4UCT A;  2R86 A;  3GII A;  1S68 A;  1DV2 A;  1T94 A;  4M7E A;  2ZGI A;  4O2A F;  3GIP A;  5L1K A;  3WWI A;  4CMD A;  1ZAU A;  4RZQ A;  4I50 F;  5LOV F;  2C35 B;  1HNX H;  3KYH C;  4MV8 A;  3VNN A;  4LF5 H;  2FLN A;  1P16 A;  5DAA A;  4JV5 H;  2GQS A;  4GC6 A;  3AW8 A;  3RBE A;  4EFE A;  4YJ3 F;  2R8J A;  1BXR A;  2I87 A;  2V59 A;  4L1K A;  1B6S A;  3TY9 A;  3W1G A;  2RF4 A;  4DV6 H;  1I1M A;  4E4T A;  4A3M G;  3SNO A;  3RAX A;  5KFU A;  4KHP H;  3RF2 A;  4E6N A;  1FJG H;  1VBG A;  4I7H A;  2ASL A;  3HOV G;  2R7K A;  4GC7 A;  3T9C A;  1RJR A;  3QZ7 A;  3T5H A;  1I2L A;  1M6V A;  1BJT A;  5LMN H;  3HOZ G;  2PMZ E;  5KFS A;  2UXB H;  3W1B A;  4FBU A;  3LWB A;  4YR2 A;  5DGA A;  4FBT A;  3PFF A;  3HOY G;  3KXY T;  3Q8Q B;  3UYY A;  2Y0S E;  4PZ7 A;  4J9R A;  1IYD A;  5EWG A;  1JIH A;  1Y1W G;  3CEB A;  5K2M A;  2VPS A;  4DUZ H;  4DR4 H;  1UNN C;  4DV4 H;  1GSH A;  1VAJ A;  1Y1W A;  3RTX A;  3H0G G;  4RUC A;  2BQU A;  5I47 A;  3MR3 A;  2HGW A;  1KT8 A;  2CNU A;  1KBL A;  3TQT A;  3Q8P B;  4X64 H;  2YZL A;  4ECS A;  4Y8V B;  5BPH A;  5KT4 A;  2R85 A;  2IP4 A;  4HYK A;  4FS2 A;  4LFB H;  5EZY F;  3AX6 A;  3GB8 B;  4G3I A;  1PK8 A;  2HHF A;  1SEI A;  4ECQ A;  2HHF B;  5E25 A;  2CW7 A;  1IBM H;  2ODT X;  4CMF A;  4FS1 A;  1RJP A;  1Z2N X;  2CFM A;  1KJQ A;  2GQR A;  5BWW A;  3PO2 G;  4IAJ A;  3IG0 A;  4Q8F A;  3HBL A;  3QFF A;  2YRX A;  3SGI A;  3H4B A;  3RV4 A;  3S24 A;  3RAQ A;  4LH6 A;  3UZO A;  4DL6 A;  4RNN A;  3VMM A;  3RB0 A;  3HT5 A;  4HNV A;  4LF7 H;  2Q7D A;  4NZM A;  4A3D G;  4ECV A;  3M9N B;  1ZQ7 A;  3KHL A;  4A3I G;  5FPR A;  2WYO A;  2W8L A;  4F50 A;  4ECT A;  1L2Z A;  3GIQ A;  2C2R A;  3VPB A;  2HHH H;  4Q4C A;  2FK2 A;  5DG9 A;  4ED1 A;  5IT9 W;  1JLL B;  1KJ8 A;  2PBZ A;  4UCS A;  2NUA B;  2BQR A;  3RV3 A;  3SE7 A;  2O03 A;  1A0I A;  1EYZ A;  4DUY H;  2ZM6 H;  4LSA A;  2J9G A;  3R5X A;  4TM5 A;  1A9X A;  5KFK A;  1KJJ A;  3HO8 A;  5BR8 H;  4NZO A;  3HXL A;  3H4D A;  3UFX B;  1R9T A;  3UZB A;  5I5S A;  4FE2 A;  2JEI A;  2Z04 A;  4FFR A;  4DR1 H;  5EWF A;  1GSA A;  1S0M A;  4F4W A;  5F9L A;  4DR7 H;  4QWC A;  4O3Q A;  1FVI A;  4TUY F;  5H80 A;  3AYH B;  4UFZ A;  5DIS C;  5J2T F;  5I5T A;  5DG8 A;  3T9B A;  4U7C A;  4Q43 A;  5LMU H;  3T1Y H;  4ECW A;  3Q8S B;  5KT6 A;  2W9A A;  1JX4 A;  2HIX A;  5C8Y F;  4YAJ B;  4O86 A;  3DTG A;  5DGB A;  5T14 A;  4DV5 H;  5KX5 F;  2VA2 A;  4QIW A;  4CC6 A;  3PW4 A;  3QZ8 A;  3Q1K A;  4JI2 H;  3M9O B;  3GV8 B;  1CKN A;  1WRV A;  1BGW A;  4MV7 A;  4O7L A;  2AGQ A;  1I1L A;  1N34 H;  2Y4R A;  2NVX A;  1EZ1 A;  1XDN A;  1K1S A;  4IRC A;  2UU9 H;  4DR3 H;  2R92 A;  2NU7 B;  4YAK B;  2ABJ A;  1IOW A;  3R9R A;  4BWS C;  4JI7 H;  3K3V A;  3CQZ A;  3BQ0 A;  2CZG A;  4ME6 A;  1SYX B;  2XD4 A;  4O4I F;  5KG7 A;  3ETJ A;  4FU0 A;  1V9P A;  4RB1 A;  4TQS A;  3KHG A;  1CS0 A;  1P8L A;  3BA9 A;  2UUC H;  3NUA A;  4XX0 B;  2MCT A;  2DPI A;  1SCU B;  4JI8 H;  4AQY H;  5FD6 A;  5KFT A;  4JI4 H;  5KT5 A;  3J80 W;  1WH2 A;  2ATL A;  2UUA H;  2CNV A;  2V4Q A;  5I5U A;  4ED8 A;  5JUM A;  4EG0 A;  1IYE A;  4EBC A;  4JV1 A;  1JDE A;  3GIM A;  1DAA A;  1CQI B;  2UVU A;  3JSN A;  5KFV A;  4LSX A;  4A3K G;  2B63 G;  2COG A;  3HKZ A;  3RFC A;  3H0G A;  1CE8 A;  3Q8R B;  4ED3 A;  4XZ3 B;  2R6F A;  2WE6 A;  3PZP A;  4A3G G;  5LA6 F;  3L4J A;  3OSN A;  4O4J F;  1M0T A;  2GPS A;  3JZF A;  4NZN A;  3EYY A;  4O7S A;  4O4H F;  2VR1 A;  1VS0 A;  2YS6 A;  1XNQ H;  5KFG A;  2JA5 G;  3VPC A;  5A2Q W;  4IR9 A;  4IR1 A;  2FLP A;  2OLS A;  3LML A;  3N42 B;  2W9C A;  5KFO A;  3EPI A;  3BAA A;  4J9L A;  2HIV A;  4TV9 F;  2XGQ A;  5DLF A;  3ORQ A;  2CNQ A;  4DLK A;  3PR5 B;  2DPJ A;  4QWD A;  1E4G T;  4F4Z A;  1KJI A;  4CKB A;  3I4N G;  4EYH B;  4BXX G;  2WB1 E;  2C2E A;  1GYF A;  2HVQ A;  2QYZ A;  4J9P A;  2JA7 G;  2C00 A;  1WSC A;  4ECU A;  1AUV A;  4RZR A;  3C0F B;  3BQ2 A;  2BR0 A;  2IMW P;  2GLT A;  3MR6 A;  4CHI A;  1XK5 A;  1JXL A;  4A3E G;  3BAC A;  4ECR A;  2YS7 A;  2W71 A;  2YRW A;  2FK3 A;  2PVP A;  2ASJ A;  4MA5 A;  5I5W A;  4EFB A;  1OBG A;  5FPO A;  1KC7 A;  3RJ0 A;  5FLX W;  2J6T A;  3KAL A;  4RB2 C;  3MR2 A;  4X65 H;  1XMQ H;  1CKN B;  1VKZ A;  4IZO A;  5EWE A;  1TWA A;  5KFM A;  4YP3 A;  2UVW A;  4QWE A;  3OHB A;  3GV7 B;  4O7Z A;  2CQY A;  4JYA H;  2VUM A;  2W6N A;  4O81 A;  5BMV F;  3NGD A;  5KFB A;  4NLG A;  3TY5 A;  2HVR A;  4K0K H;  1ZHQ A;  1IBK H;  4XYL B;  5JH7 F;  3MWE A;  5BWR A;  5JVL A;  5C1P A;  2YZG A;  3N6X A;  3RUP A;  2CKZ B;  4K6N A;  5KFA A;  3G6V A;  3LP8 A;  2QK4 A;  4C5C A;  1OWT A;  4FFM A;  4GKK H;  3E5N A;  2JA8 G;  4I4T F;  2Q2T A;  2PMZ A;  3ETH A;  1WCM A;  3M4I A;  2XC9 A;  4F4X A;  3G6X A;  2YW2 A;  5FD5 A;  4O7V A;  2SCU B;  2R8G A;  3GTG A;  2JA5 A;  3T54 A;  2F4V H;  1N33 H;  4MV1 A;  1B33 N;  2WB1 A;  3CVZ A;  3MFI A;  3K3P A;  2I80 A;  4O83 A;  4LF6 H;  2XGP A;  1A3G A;  5I5X A;  5KFZ A;  2JA6 G;  2VUM G;  4A2B A;  4DV3 H;  1TA8 A;  3N8D A;  4O7T A;  2M05 A;  2UXD H;  2AGO A;  3GLK A;  4IRK A;  3CSW A;  5FR9 A;  3UQ8 A;  2AU0 A;  2IBK A;  5KKN B;  5L9X A;  4JV0 A;  4ZI7 F;  4MV9 A;  5CAE B;  4C5B A;  4R8U A;  4R8U B;  3PN1 A;  2E2H A;  3MJF A;  4YJ2 F;  1Y1V A;  2V4R A;  4A3J G;  3PR4 A;  3GQC A;  5J2U F;  1EKP A;  3K5I A;  3QQM A;  3W5O A;  2IA6 A;  2R8K A;  4UUG A;  5C5J A;  1J5E H;  2ALZ A;  2R87 A;  3DF7 A;  1I50 A;  1M7J A;  4RAZ A;  5KFW A;  4CE5 A;  2UUB H;  1RK6 A;  1V51 A;  2P0A A;  4YQW A;  5KG1 A;  3V4Z A;  4X62 H;  2W9B A;  1EKF A;  5KG2 A;  3GIL A;  1K1Q A;  3R5F A;  5LP6 F;  4Q45 A;  3T99 A;  3DTF A;  3G8D A;  5BWU A;  2JEF A;  3RIZ A;  1N36 H;  4CKE A;  2WDT A;  2WAQ A;  2W7P A;  1X9N A;  1ET0 A;  4M0J A;  1PX2 A;  2HDK A;  3MFH A;  4DR5 H;  4RB3 C;  2QB5 A;  4RAY A;  5KFF A;  4GLX A;  4A3B G;  2XCL A;  4A3C G;  1TWC A;  4QWB A;  5DQG A;  4MV3 A;  2JA6 A;  2FB9 A;  4MAM A;  3N44 B;  5DQH A;  5KFJ A;  5IWA H;  2VPQ A;  4EYI B;  5I5V A;  4FFN A;  2JA7 A;  3BQ1 A;  3N41 B;  4JI6 H;  1EUD B;  4X66 H;  2W6Q A;  3FMA A;  1M0W A;  3RR5 A;  1WR2 A;  4UCU A;  3U9T A;  3OHA A;  3R23 A;  4CKC A;  3OSP A;  2RDI A;  4RNM A;  2R93 A;  4A93 G;  2PN1 A;  4IIJ F;  4RCN A;  1Z2O X;  3I4M G;  1GSO A;  1I1K A;  3I12 A;  5DG7 A;  4YBZ B;  2HVS A;  4TV8 F;  1HNW H;  4MV4 A;  2W57 A;  1RJQ A;  1W93 A;  3KAJ A;  5DGI A;  4IHJ F;  3QWU A;  5CB4 F;  1XMO H;  2VA3 A;  3GTP A;  5KG6 A;  2DLN A;  4HNU A;  1TWG A;  3LQS A;  3OTO H;  3VA7 A;  2ZJT A;  1OBD A;  3KTM A;  4JI5 H;  2FKL A;  3HOX G;  1E4E B;  2R7M A;  3F8N A;  4YR3 A;  2J6U A;  1TAE A;  4QJF A;  1HNZ H;  1JDB B;  4DRF A;  4JXU A;  2V9W A;  3ORR A;  3WWJ A;  4FFL A;  4DV0 H;  1HR0 H;  4FGR A;  4LF4 H;  2HG8 A;  4J9Q A;  4DV7 H;  4QW8 A;  4BBR G;  3VPD A;  4QSH A;  3U9S A;  4EEQ A;  4LH7 A;  4BY7 G;  1O75 A;  3V6H A;  4DL3 A;  5CM0 A;  4O3O A;  3GIK A;  4XYM B;  4F4Y A;  2JEJ A;  2GPW A;  1G2W A;  5GON F;  1S0N A;  1S10 A;  4J9M A;  5BPF A;  2W70 A;  2W7O A;  4MTD A;  3M9M B;  4JI0 H;  1Z2P X;  2DAB A;  3JRW A;  3MWD A;  3L4K A;  1CKO A;  3JZI A;  4O2B F;  3FKI G;  1I6U A;  2X0S A;  4DAA A;  2WTF A;  2NU8 B;  3T9A A;  3TII A;  1JKJ B;  3TIG A;  5JQW A;  4JUZ A;  4ED7 A;  4GLW A;  3K5H A;  1CKM A;  2RGV A;  2YCH A;  3GIJ A;  1S9F A;  2UVR A;  2BQ3 A;  4LFA H;  3GTM A;  2W6Z A;  4JI1 H;  4GKJ H;  4Q0Y A;  5IP9 G;  2HGS A;  2FPP B;  5KT2 A;  2Y0S A;  5HBR B;  4ECY A;  3NBZ B;  1A0G A;  2ZDG A;  1BNC A;  2XCA A;  2R82 A;  5KFI A;  3RGX A;  3H40 A;  4DV1 H;  4APM A;  3TW6 A;  4DV2 H;  3LUL A;  4LF9 H;  4DL2 A;  3PO3 G;  2XIG A;  4DQN A;  4O3N A;  4B3R H;  2YWV A;  2C28 A;  1W96 A;  4WBN F;  2FMA A;  1B04 A;  3JAM W;  2NU9 B;  3SI8 A;  2W8K A;  2B63 A;  2FE3 A;  4UCV A;  2W6O A;  4J9S A;  4UCO A;  3KHR A;  2ZDH A;  2R92 G;  1C30 A;  2EJ3 A;  4YB8 B;  3TY8 A;  4A2A A;  5DLG A;  5CE8 A;  3TEK A;  4RUA A;  2C22 A;  1S0O A;  4IRD A;  5C3E G;  2XCP A;  4DL5 A;  1IOV A;  2R84 A;  1N48 A;  3N40 P;  1A48 A;  2X5R A;  1VBH A;  3V6J A;  3TIN A;  4RB0 A;  3BJY A;  3PW2 A;  1DGS A;  2VUG A;  2UVV A;  1I2K A;  4MTE A;  4BY1 G;  4MA0 A;  1I3Q A;  4LF8 H;  4NXM H;  3U54 A;  2R7Z G;  4M9U A;  3HOU G;  2VQE H;  1B6R A;  3GJX B;  1V4Y A;  5L1I A;  2J6S A;  2EJ0 A;  4EGQ A;  3U0G A;  3VOT A;  2E5L H;  1E4F T;  1XNR H;  1C3O A;  3BG5 A;  5CR5 A;  3T9E A;  4HNT A;  3PW0 A;  1I7N A;  1WCM G;  5KT7 A;  1I94 H;  1ZET A;  1FKA H;  2RGR A;  3NC0 B;  4DR2 H;  1GLV A;  3T5J A;  3EPG A;  3RB3 A;  1CQJ B;  3GDE A;  2R7L A;  3KHH A;  1N56 A;  1K83 A;  5KFL A;  2KSW A;  4JI3 H;  2W6P A;  5KFR A;  4AYB E;  1KTA A;  3GTJ A;  4YHH H;  3T5K A;  3RBD A;  1UC9 A;  2DWC A;  4O82 A;  4EBD A;  3WNZ A;  4PZ8 A;  2NU6 B;  3Q2O A;  2JEG A;  4UCR A;  3WO1 A;  5IYB G;  3KRE A;  5I5Y A;  5BYB A;  4C5A A;  5KFP A;  3RB4 A;  1N32 H;  3H20 A;  4LMY A;  4IWX A;  4O4L F;  5EDW A;  5JVD F;  2R7N A;  4PWQ A;  5DQI A;  4LFC H;  2OH2 A;  5KG3 A;  3U55 A;  1ULZ A;  2C2D A;  1TWF A;  5FNV F;  4ETS A;  2AGP A;  4U6P A;  5KS8 A;  4QWA A;  5HV6 A;  4WHX A;  2VOB A;  5KFY A;  3R5H A;  5KFH A;  4ED0 A;  4O3P A;  2DIK A;  3HB9 A;  3WO0 A;  1Y14 B;  3DAA A;  2R7Z A;  3GTK A;  5C4X G;  4EEY A;  2COJ A;  3BAB A;  4CC5 A;  4QIW E;  1EUC B;  3N43 B;  3MWM A;  5KG0 A;  1S97 A;  4O7Y A;  2V5A A;  5D8D A;  2Q2U A;  3V4S A;  5IP7 G;  1EHI A;  4PZ6 A;  3GV5 B;  4DIM A;  2VQF H;  5JQG F;  5KFC A;  4HR7 A;  1I7L A;  5EOY A;  5IYC G;  4O3R A;  2DZD A;  5I60 A;  4I55 F;  5FLM G;  3J7A K;  2VQD A;  5L1J A;  1SFO A;  3H3V H;  3WWH A;  4B3S H;  2FJZ A;  2YU9 A;  2R93 G;  1EKV A;  4AYB A;  2EIY A;  5KFN A;  1RYS A;  3GTL A;  1GGO A;  5CA0 F;  2YYA A;  3JSL A;  4HQ6 A;  4TVI A;  5KFD A;  3PW5 A;  4NXN H;  1S03 G;  4DR6 H;  2FPG B;  4ZHQ F;  1DV1 A;  4ED2 A;  4A3L G;  1T36 A;  3T1H H;  2EJ2 A;  2FPI B;  4ZOL F;  5K3W A;  2ASD A;  3NBY B;  5F9N A;  3N6R A;  1RK5 A;  1Y1V G;  5FJ8 G;  2FK1 A;  3T9D A;  4TQR A;  5IYZ F;  5LYJ F;  4J9O A;  1KEE A;  4B3M H;  3JZ6 A;  3RGZ A;  3KAK A;  3GID A;  5KG4 A;  4O7N A;  4Q4D A;  5DMX A;  2YZM A;  2QF7 A;  2R8I A;  5HNE A;  5IYD G;  4DL4 A;  4EQ5 A;  4WD3 A;  3OUZ A;  4J0M A;  2RDJ A;  3FKI A;  1ZHS A;  4J9K A;  3PVX A;  2YZN A;  4FM9 A;  4Q8E A;  2ZDQ A;  5C1O A;  5BWT A;  2I8C A;  2W9B B;  3J81 W;  5KFQ A;  3G6Y A;  3JRX A;  3T9F A;  4RU9 A;  1T3N A;  4FFO A;  5DGH A;  5BYA A;  1TWH A;  1AN7 A;  2COI A;  3OUU A;  4QW9 A;  3IN5 A;  2WAQ E;  2DAA A;  3RB6 A;  4ECZ A;  3HOW G;  5CA1 F;  4O3S A;  4IWY A;  1KJ9 A;  1GO3 E;  1AUX A;  4YY3 H;  4EBE A;  2NVY A;  3HKZ E;  5KFE A;  4O84 A;  5BWV A;  5L1L A;  4A3F G;  2E2I A;  4C2M A;  3G8C A;  1DIK A;  2AQ4 A;  2W6M A;  5KG5 A;  4OX9 H;  4B3T H;  3GTO A;  2V58 A;  2OWO A;  4BBS G;  3FDS A;  3V6K A;  1UC8 A;  3T5L A;  3BA8 A;  4ZQI A;  4YR0 A;  4R7R A;  1MZB A;  2HGX A;  4NYE A;  3L2P A;  2FLL A;  2HJW A;  2UXC H;  1IBL H;  1RYR A;  4JV2 A;  4PDB A;  5D1O B;  3GTQ A;  5LXT F;  5D1O A;  3TW7 A;  4ED6 A;  4DL7 A;  2R8H A;  4RNO A;  5LL6 b;  4O7R A;  4ECX A;  4Q44 A;  5BWX A;  4MV6 A; 
#chains in the Genus database with same CATH homology
 1N34 H;  1E4F T;  1XNR H;  1XDN A;  2CW8 A;  1I94 H;  4X62 H;  1FKA H;  2UU9 H;  4DR3 H;  3NC0 B;  4DR2 H;  2RGR A;  4JI6 H;  4B3R H;  3GDE A;  4BWS C;  5D1P A;  4JI7 H;  3K3V A;  2KSW A;  4UCT A;  4JI3 H;  1SYX B;  4YHH H;  3RIZ A;  1S68 A;  2WDT A;  1N36 H;  4M7E A;  1X9N A;  1V9P A;  4PZ8 A;  4RB1 A;  4UCR A;  4DR5 H;  1P8L A;  4RZQ A;  3BA9 A;  4RB3 C;  1HNX H;  3KYH C;  2UUC H;  3VNN A;  4RAY A;  4LF5 H;  4GLX A;  1P16 A;  2MCT A;  3H20 A;  4JI8 H;  4LMY A;  4JV5 H;  4AQY H;  5FD6 A;  4JI4 H;  3N44 B;  3J80 W;  1WH2 A;  4EFE A;  2UUA H;  5IWA H;  4LFC H;  3N41 B;  4ETS A;  4X66 H;  3TY9 A;  3W1G A;  2VOB A;  4DV6 H;  4KHP H;  3FMA A;  3RR5 A;  3JSN A;  4E6N A;  1M0W A;  4UCU A;  3RF2 A;  4LSX A;  4I7H A;  1FJG H;  1Z2O X;  2WE6 A;  3L4J A;  1BJT A;  3BAB A;  5LMN H;  2HVS A;  2UXB H;  1HNW H;  4CC5 A;  3W1B A;  1M0T A;  2W57 A;  3KAJ A;  3EYY A;  3KXY T;  3QWU A;  3N43 B;  3MWM A;  1XMO H;  1VS0 A;  2Q2U A;  1XNQ H;  4PZ7 A;  4PZ6 A;  2VQF H;  3OTO H;  5A2Q W;  5EOY A;  2ZJT A;  3LML A;  3N42 B;  4JI5 H;  2VPS A;  3BAA A;  2HIV A;  3F8N A;  4DUZ H;  3J7A K;  4DR4 H;  4JI0 H;  1TAE A;  4DV4 H;  1HNZ H;  4DRF A;  1N32 H;  4B3S H;  3RTX A;  4DV0 H;  1HR0 H;  1E4G T;  4LF4 H;  4DV7 H;  1GYF A;  2HVQ A;  3JSL A;  4NXN H;  4EEQ A;  1S03 G;  4DR6 H;  4X64 H;  4LH7 A;  1O75 A;  3C0F B;  3T1H H;  4LFB H;  1XK5 A;  3GB8 B;  3NBY B;  1SEI A;  1IBM H;  2CW7 A;  4MTD A;  4B3M H;  1Z2P X;  3L4K A;  4EFB A;  5FPO A;  2CFM A;  1Z2N X;  3RJ0 A;  1CKO A;  5FLX W;  3KAL A;  4IAJ A;  3IG0 A;  3KAK A;  3RGZ A;  1CKN B;  4X65 H;  4RB2 C;  1XMQ H;  1I6U A;  3S24 A;  4LH6 A;  4EQ5 A;  4LF7 H;  4LFA H;  2YCH A;  1CKM A;  2RGV A;  4J0M A;  1ZHS A;  4FM9 A;  4JYA H;  5FPR A;  2WYO A;  3TY5 A;  2HVR A;  3J81 W;  1ZHQ A;  4JI1 H;  4GKJ H;  4K0K H;  1IBK H;  4Q0Y A;  2HHH H;  1L2Z A;  2HGS A;  3N6X A;  5IT9 W;  3NBZ B;  3RGX A;  4UCS A;  1AN7 A;  4DV1 H;  4APM A;  4DUY H;  2O03 A;  4DV2 H;  1A0I A;  4GKK H;  4LF9 H;  2XIG A;  4LSA A;  2Q2T A;  2ZM6 H;  3M4I A;  5FD5 A;  1B04 A;  3JAM W;  5BR8 H;  3HXL A;  4YY3 H;  2F4V H;  2FE3 A;  4UCV A;  4DR1 H;  1N33 H;  3CVZ A;  4UCO A;  4LF6 H;  4OX9 H;  4B3T H;  4DR7 H;  2OWO A;  4A2A A;  1FVI A;  3TY8 A;  2UXD H;  4A2B A;  4DV3 H;  1TA8 A;  4UFZ A;  5DIS C;  3T1Y H;  5LMU H;  3BA8 A;  4R7R A;  3UQ8 A;  3L2P A;  1MZB A;  2HIX A;  2UXC H;  3N40 P;  1IBL H;  4PDB A;  4MV9 A;  4RB0 A;  5D1O B;  3PN1 A;  5D1O A;  1DGS A;  2VUG A;  4DV5 H;  4LF8 H;  4MTE A;  4NXM H;  4CC6 A;  4MV7 A;  5LL6 b;  3W5O A;  4JI2 H;  1J5E H;  1CKN A;  1BGW A;  2VQE H;  3GJX B;  3DF7 A;  4RAZ A;  2UUB H;  2E5L H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...