1XDNA

High resolution crystal structure of an editosome enzyme from trypanosoma brucei: rna editing ligase 1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
265
structure length
265
Chain Sequence
QSDFSPYIEIDLPSESRIQSLHKSGLAAQEWVACEKVHGTNFGIYLINQGDHEVVRFAKRSGIMDPNENFFGYHILIDEFTAQIRILNDLLKQKYGLSRVGRLVLNGELFGAKYKHPLVPKSEKWCTLPNGKKFPIAGVQIQREPFPQYSPELHFFAFDIKYSVSGAEEDFVLLGYDEFVEFSSKVPNLLYARALVRGTLDECLAFDVENFMTPLPALLGLGNYPLEGNLAEGVVIRHVRRGDPAVEKHNVSTIIKLRCSSFMEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of a key editosome enzyme from Trypanosoma brucei: RNA editing ligase 1.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Ligase
molecule keywords RNA editing ligase MP52
total genus 75
structure length 265
sequence length 265
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1xdnA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1xdnA01
2CFMA 4LH6A 1CKMA 3NBYB 4E6NA 2Q2TA 1V9PA 1S68A 1XK5A 1TAEA 2VUGA 3UQ8A 3BA9A 1CKNA 3VNNA 4GLXA 1X9NA 2HVRA 5FPOA 1VS0A 2HVSA 3L2PA 2HIXA 3JSNA 3GJXB 4PZ8A 4DRFA 4EFEA 4UCOA 1P16A 3GDEA 4UCTA 3QWUA 3W5OA 2OWOA 5FPRA 1CKOA 5D1OA 3TY8A 3W1GA 4LH7A 2HVQA 5D1OB 4CC5A 3KYHC 5DISC 1A0IA 4PZ7A 4EEQA 4PZ6A 3S24A 3W1BA 2HIVA 1CKNB 1P8LA 1DGSA 3JSLA 1TA8A 4UCRA 1XDNA 1FVIA 3GB8B 3NBZB 4CC6A 3PN1A 4UCUA 1B04A 3BA8A 4UFZA 2Q2UA 3BABA 4EQ5A 4UCVA 5D1PA 4UCSA 3TY9A 3RR5A 3NC0B 3RTXA 3BAAA 4EFBA 3TY5A
chains in the Genus database with same CATH superfamily
1R9TA 4JI4H 1KC7A 5JH7F 2AU0A 1WSCA 4QW8A 3N43B 1ET0A 4I50F 2UVVA 3R5XA 4JV2A 3BACA 2XD4A 2BQ3A 5DAAA 2DLNA 3U9TA 5KG1A 3RBEA 4DR6H 2FLNA 4LSAA 5C1OA 1I3QA 1WH2A 3WNZA 4B3TH 4J9SA 3SE7A 5BWVA 2R7ZA 1FJGH 1JXLA 3I4MG 2X0SA 3ORRA 1IBMH 5DLFA 5DMXA 4DL4A 1Y1WA 3GIDA 4L1KA 4DQNA 5JQWA 4O3NA 2UUCH 3J7AK 5KG2A 2HIVA 2A1HA 2CQYA 4LFCH 3HOYG 2W9CA 4YBZB 3K3VA 2DABA 3TIGA 3H20A 2W6OA 4IIJF 1CQJB 1B04A 4EEYA 1Y1VA 3FKIA 4FFMA 2W6MA 3TY9A 1KJ8A 3PW4A 5DG7A 3RB3A 4CMFA 3TIIA 2FPGB 4R8UB 4O3QA 4A3KG 4X65H 3DAAA 4DL7A 3RGXA 4FE2A 4F4ZA 1GSHA 2C22A 2DPIA 3T9FA 5EZYF 3UQ8A 3NGDA 5BPFA 1EYZA 5FPOA 4DAAA 1BXRA 5KG0A 2WB1E 2XGQA 4ECYA 4XX0B 3TEKA 5T14A 5EWGA 1V51A 4F4WA 1N34H 2R92A 4MV4A 4IZOA 3UZOA 2OWOA 1UNNC 4QWDA 3MR6A 2YWVA 4DR5H 2YZNA 3JAMW 2YYAA 4U6PA 3T5JA 5D1OB 2Z02A 4RB0A 5KG3A 4EYIB 2R8IA 2W9BB 2Z04A 5EWEA 4LF9H 4K0KH 1GGOA 4MV8A 1FVIA 2QYZA 4A93G 4LF5H 3SNOA 2UVWA 2E2HA 5CR5A 2Q2UA 2C00A 3V6HA 4BWSC 5KFWA 2JEFA 4QW9A 2PBZA 1SYXB 1N48A 3HB9A 3R9RA 2NVXA 3E5NA 2FK1A 1A48A 2YW2A 4JI7H 4NXNH 1I50A 4EYHB 5DQGA 5IYCG 1C30A 4NZOA 2CKZB 4PWQA 2Y0SE 3MWMA 2BQRA 2VR1A 2Q7DA 3HT5A 3QFFA 3TINA 2FE3A 4BBSG 3OHAA 3G6VA 2VUMG 2ZM6H 5KKNB 4LF7H 2NU7B 2R85A 3LULA 4J9OA 2ASLA 2YZLA 4MA0A 4DLKA 3ETJA 4ECQA 3T9EA 3LP8A 1P8LA 3GLKA 3WO1A 4B3SH 4FS1A 3T5LA 3CQZA 1T3NA 1WCMG 2YRXA 2W6PA 2DAAA 2ZJTA 4A2BA 3JRWA 2UVRA 1RYSA 3RUPA 1RK6A 4BBRG 2JA8G 5CM0A 5C3EG 4O7SA 4E6NA 1N56A 4DV6H 3G8DA 4DV3H 1TAEA 4IRKA 2R93G 1CKNA 2JEIA 5K2MA 2CZGA 3T9AA 1VS0A 3G6YA 1EUDB 1JDEA 3GTQA 5CA0F 1DV1A 2E2IA 3BQ2A 2IA6A 4FFOA 4CE5A 1SFOA 3BQ1A 2R8KA 1BNCA 1Y1VG 5KFKA 5HBRB 3KHHA 3W1GA 2ZGIA 4C5AA 2GLTA 2XCLA 2NU6B 1A0IA 2XGPA 4FU0A 2FMAA 1RYRA 2C28A 2VQDA 2WDTA 4O86A 2R7KA 4CC6A 5IWAH 4RZQA 4A3DG 4O84A 5LXTF 3I12A 2HGSA 4NLGA 5BWUA 4O7TA 2YZGA 3RR5A 3L4KA 1HNZH 2FP4B 3KAJA 1E4GT 5DG8A 2ATLA 4ECZA 1TWFA 4R8UA 4RB2C 2FK2A 3KHLA 5LL6b 3WWJA 1EHIA 2DZDA 5DLGA 4GLXA 4O7YA 1W96A 5EWFA 5I5SA 2V4QA 1J5EH 2RF4A 4O82A 4RUAA 4YQWA 4Q8FA 2WE6A 5C8YF 4YR3A 4F50A 1IOWA 1B6RA 4UCOA 4XYMB 4DIMA 4J0MA 3UYYA 4A3LG 5KFYA 2GPWA 4TM5A 5BYAA 1KT8A 4IHJF 4CC5A 1TWGA 4YB8B 2ABJA 2RGRA 4LFBH 3FMAA 4IWYA 5KFDA 5KFPA 4X66H 2NUAB 3S24A 3VPBA 2SCUB 1E4EA 2CNQA 3OSPA 2V58A 4O2AF 4XZ3B 3KHRA 5KT5A 1XDNA 2R8GA 3HOWG 1I2LA 2EJ2A 3K5HA 5FD5A 1JLLB 5C1PA 2J6SA 4DUZH 2VPQA 2W70A 1A0GA 3U0GA 4IR1A 2NU8B 4ECUA 3J81W 3RTXA 4J9PA 3WWIA 5FR9A 3TY5A 4EFBA 2CFMA 4NYEA 4JV0A 4DV4H 4FFRA 4ED2A 4JYAH 5IP7G 3EYYA 1IOVA 1V9PA 4E4TA 1E4FT 4RAYA 5KS8A 2WAQA 3G6XA 4Q4DA 2HHFB 5KFZA 4WD3A 4HN2A 3H4DA 3OTOH 4ED1A 2AGQA 1EKVA 4PBCA 3U55A 4HYKA 4EFEA 3GJXB 2J6UA 1VAJA 1XMOH 2KSWA 1E4EB 2DWCA 1KTAA 2QF7A 3BG5A 5DGIA 3TW7A 4U7CA 3OHBA 4J9QA 3GTGA 4A3BG 4DR7H 4WBNF 3EPGA 4LF4H 5DISC 3N8DA 4FM9A 5JVDF 5CE8A 2E5LH 3EPIA 1OWTA 3VMMA 4ED0A 1JKJB 3RB6A 4ZI7F 2WYOA 5BPHA 4MTEA 2C2DA 4GLWA 4O7VA 4UCUA 3H3VH 1S03G 3WO0A 5KFAA 4O7RA 4UCSA 2V5AA 2FLPA 2HHHH 4A3FG 2C2RA 3H4BA 4QWEA 5CAEB 5EDWA 4BY1G 3LQSA 5KG5A 4RNOA 3GTOA 2PVPA 5KG7A 4DR3H 5L1IA 4QSHA 3VPCA 1BJTA 2CW8A 3JZIA 4JUZA 3AW8A 4RUCA 4DR1H 2W8LA 2JA6A 1JIHA 4DUYH 4MTDA 4RAZA 4RCNA 4A3JG 2C35B 3PW2A 5IT9W 4NZNA 4O4JF 4K6NA 4QIWA 3V4SA 3N40P 3GILA 2R8JA 3AX6A 1K1QA 3H0GG 5KFLA 1MZBA 4ED6A 4DL2A 5KT7A 3VOTA 4RZRA 2IP4A 4HNUA 3VPDA 5KFGA 4FFLA 1CE8A 5LA6F 5BWRA 2CW7A 4C2MA 5E25A 5KFSA 3RJ0A 2AGOA 2JA6G 3SI8A 4MV3A 4DL5A 2COIA 4M9UA 3PO2G 2W6ZA 3DTGA 2VQEH 1GO3E 2B63A 3KXYT 5C5JA 4O3PA 1N36H 1IYDA 3HBLA 4EQ5A 5KFJA 4YR0A 3M9OB 4IAJA 3NC0B 3HXLA 1G2WA 4Q0YA 5LMUH 4GC7A 5DGAA 1S10A 1W93A 2XC9A 2J9GA 2W71A 2VA3A 2RGVA 4DV7H 2W6QA 3JRXA 3PFFA 4R7RA 5H80A 2WB1A 5HNEA 2NVYA 1DAAA 3IG0A 4A3MG 5FLXW 5BWWA 2Y0SA 5BYBA 4C5CA 4X62H 5KFHA 2R92G 1I2KA 3PW7A 3VA7A 1L2ZA 4DV0H 1KJIA 4DV1H 3DF7A 5DGHA 2OH2A 3FDSA 4Q44A 5KFVA 4F4YA 4YR2A 3RBDA 4A3CG 4MV9A 3V4ZA 2VOBA 1A9XA 4ZQIA 1M7JA 4UCRA 4IRCA 4ED7A 4I4TF 3JZFA 4YAJB 2V9WA 4ECRA 3BJYA 2UXCH 5KFEA 1VBHA 3TQTA 5D8DA 3BAAA 5IYBG 1XMQH 2I8CA 2EIYA 2JA5A 2J6TA 4MV6A 3HKZA 5L1KA 1XK5A 4YAKB 5J2UF 4CMDA 3KALA 4KHPH 2R87A 1I7NA 1WR2A 2I80A 1DIKA 2HDKA 1OBGA 3T9CA 2O03A 4J9MA 2YS7A 4EGJA 2PN1A 3KHGA 1KJJA 3CVZA 4JI5H 3FKIG 2HG8A 3K3PA 3ORQA 5HV6A 2V4RA 2FPIB 1GLVA 1P16A 4O83A 3QWUA 2PMZA 2B63G 4TVIA 2YL2A 4QWCA 4PDBA 4DL3A 1CKOA 4ME6A 5D1OA 5CA1F 3T99A 4ECXA 3MR5A 4DR4H 5L1JA 1RJPA 3HKZE 4ED3A 5JUMA 2XCPA 2MCTA 2GPSA 3W1BA 3PW0A 1WCMA 1TA8A 5EOYA 4EBCA 2IMWP 3R23A 3HOXG 4XYLB 3WWHA 3UFXB 1RJQA 3GTLA 1TWCA 2YZMA 4O3SA 2V59A 1GSOA 4UCVA 4O7ZA 4HQ6A 3T9DA 4Q43A 5IYZF 4BXXG 1JDBB 1GYFA 2HGWA 3T7AA 5LYJF 4JI3H 1PX2A 4EG0A 5KFIA 4RB1A 5KFQA 1X9NA 2W7PA 2HVRA 4FBTA 1WRVA 3PO3G 2YU9A 4I55F 4EGQA 3M4IA 2W9CB 4IRDA 3T1YH 3MR3A 2PMZE 2CNUA 3I4NG 3HO8A 4MV1A 5KG6A 5I47A 3GIPA 4JI6H 4YP3A 4O3OA 2EJ3A 4I7HA 2FB9A 1I7LA 1B6SA 1SEIA 3OUUA 3GIMA 1DGSA 3MR2A 2ALZA 2R93A 1DV2A 4O4IF 5KFOA 2AGPA 4JI1H 1KJQA 4GC6A 3BA8A 4UFZA 4JXUA 2R8HA 1ZETA 2M05A 4YJ2F 5D1PA 4NXMH 5KFRA 2EJ0A 1I94H 2Q2TA 1I1MA 4C5BA 2R84A 3MFIA 2JA7G 5KT3A 1A3GA 2UU9H 3PR4A 2JA7A 5I5UA 3UZBA 1V4YA 1Z2PX 3JSNA 4DRFA 4IWXA 4PZ8A 4Y8VB 4DV2H 4MV7A 3T54A 1Y14B 5DQIA 4UCTA 2YS6A 4M0JA 5KFFA 3QZ7A 5JQGF 4QWAA 3U9SA 3KREA 2QK4A 4PZ7A 1ZHQA 4O7WA 5DQHA 4ECVA 4PZ6A 4YY3H 2UXDH 4CKBA 1CKNB 4A3EG 4JI2H 4CKEA 3NBZB 4ECTA 2UUBH 5C4XG 4ZOLF 3H0GA 5CB4F 3OSNA 3T5HA 4O3RA 2R7NA 4A3IG 1Y1WG 2UUAH 1TWAA 5KFBA 3GIJA 3H40A 1T36A 2R7MA 3MWDA 1FKAH 4RB3C 2VUGA 5FLMG 4RNNA 2C2EA 2HHFA 3BA9A 4MA5A 1KBLA 2FKLA 4APMA 1N32H 2R6FA 4FFNA 2R86A 3N6XA 4QWBA 4HNVA 4JI0H 3MJFA 2RDJA 4JV5H 3GDEA 3BQ0A 5GONF 2HJWA 1CQIB 1AUVA 4YJ3F 5L1LA 4F4XA 4B3MH 4JI8H 1ZQ7A 2WAQE 1M6VA 2ZDHA 2VPSA 4DL6A 3T9BA 1KEEA 5F9LA 4J9KA 3GTJA 1AUXA 3PN1A 5I5TA 1T94A 5IYDG 4Q45A 1S0MA 3Q8SB 1HNXH 2UVUA 3HOUG 5I5YA 2COGA 5BMVF 5K3WA 5KT6A 4LF6H 3NBYB 3GIQA 3GIKA 1VBGA 5J2TF 3V6JA 3RAXA 2JA5G 3HOVG 4LMYA 4TUYF 1EKFA 3LWBA 3L2PA 4J9NA 4O81A 1N33H 1HR0H 2COJA 3SGIA 4JV1A 2ASDA 2WTFA 2ASJA 2GQSA 2F4VH 3HOZG 5LP6F 1UC9A 2R7ZG 3Q8PB 1C3OA 2HVSA 1OBDA 3N6RA 4TV9F 2QB5A 4ECWA 1ZHSA 3IN5A 1XNRH 3KTMA 3RB4A 4GKJH 1S0NA 3N41B 2JEGA 5I60A 1Z2OX 3PZPA 2RDIA 2GQRA 3RF2A 4Q4CA 3GV7B 4ETSA 1PK8A 3GB8B 4RNMA 1EUCB 4J9LA 1S0OA 1VKZA 4YHHH 1I6UA 2VUMA 1K1SA 4EBDA 1I1KA 1HNWH 4HNTA 2ODTX 5C44G 2VQFH 1BGWA 3GQCA 4LF8H 4A3GG 1KUTA 3GTMA 2OLSA 2HGXA 2R7LA 3M9MB 4LH6A 1CKMA 3JZ6A 2VA2A 5JVLA 2X5RA 5FJ8G 2AQ4A 3T1HH 4MAMA 1CS0A 4WHXA 4UUGA 5KFMA 4LFAH 4QIWE 3QZ8A 3RB0A 4QJFA 3V6KA 3LMLA 2FJZA 5KFUA 4M7EA 4ECSA 1TWHA 3RAQA 3J80W 3AYHB 1KJ9A 1I1LA 5KFCA 3R5HA 4FS2A 5FPRA 4A2AA 3RIZA 5IP9G 4AYBA 4TQRA 3U54A 1ULZA 4FGRA 1RK5A 5KG4A 3GV8B 3DTFA 4O2BF 1S9FA 4O7LA 4CHIA 2UXBH 3Q8RB 2W7OA 3GTKA 3PVXA 5L9XA 4B3RH 5KFTA 4GKKH 2CNVA 4DR2H 2ZDGA 4EBEA 2JEJA 3C0FB 1EZ1A 3F8NA 2BQUA 1S68A 5F9NA 3G8CA 1RJRA 3VNNA 2FK3A 3MWEA 3KAKA 5KX5F 3N42B 4O4LF 2HIXA 3Q8QB 1ZAUA 4TV8F 1IBKH 2Y4RA 1UC8A 3CEBA 2ZDQA 4O7NA 5KFNA 3RV3A 4OX9H 5A2QW 2W8KA 5I5XA 4Q8EA 3TY8A 4X64H 1IYEA 4LH7A 4DV5H 2XIGA 1GSAA 1JX4A 5DG9A 3GV5B 2W9BA 4G3IA 2NU9B 3GIIA 3N44B 4O4HF 3M9NB 2W6NA 1EKPA 4ED8A 5LOVF 1XNQH 2IBKA 2FLLA 4FFPA 5BWXA 5KFXA 4CKCA 4LSXA 3RFCA 3CSWA 2W57A 5I5VA 1AN7A 1S97A 4AQYH 1Z2NX 2W9AA 1IBLH 3K5IA 2FPPB 3QQMA 4RU9A 1K83A 4HR7A 4ZHQF 3TW6A 5DGBA 3NUAA 4FBUA 1O75A 5KT4A 3Q1KA 3L4JA 3R5FA 4J9RA 2I87A 3W5OA 4BY7G 3TQ1A 4NZMA 4AYBE 2P0AA 1M0WA 2HVQA 2R82A 4EEQA 3KYHC 3MFHA 2XCAA 3T5KA 5I5WA 4IR9A 5FNVF 5FD6A 3JSLA 1SCUB 2DPJA 1B33N 2YCHA 2YRWA 3OUZA 3PW5A 5BR8H 3GTPA 4TQSA 3BABA 3Q2OA 3PR5B 3ETHA 5KT2A 5BWTA 2BR0A 5LMNH 3RGZA 3RV4A 1M0TA 2DIKA
chains in the Genus database with same CATH topology
3KAJA 1E4GT 4LF6H 3NBYB 4JI4H 4RB2C 1XK5A 4LMYA 5LL6b 3N43B 3KALA 4GLXA 2O03A 2UUCH 4KHPH 1J5EH 3L2PA 4JI5H 1N33H 3CVZA 1HR0H 2WE6A 2F4VH 4DR6H 4UCOA 1P16A 4J0MA 3QWUA 4LSAA 1WH2A 4B3TH 2HVSA 1CKOA 5D1OA 2RGRA 4CC5A 1FJGH 4DR4H 4LFBH 1IBMH 1ZHSA 3FMAA 4X66H 1HNZH 1XNRH 4GKJH 3S24A 3N41B 2MCTA 3J7AK 3W1BA 2HIVA 1Z2OX 4LFCH 5EOYA 1TA8A 3RF2A 3K3VA 1XDNA 4ETSA 3GB8B 3H20A 5FD5A 1B04A 4YHHH 4DUZH 1HNWH 4UCVA 2VQFH 3TY9A 1BGWA 3J81W 3RTXA 4LF8H 4EFBA 3TY5A 2CFMA 4LH6A 4DV4H 4JYAH 1CKMA 4X65H 1I6UA 3EYYA 1V9PA 1E4FT 4RAYA 3RGXA 4PDBA 4JI3H 3UQ8A 3T1HH 4RB1A 1X9NA 2HVRA 5FPOA 3OTOH 4LFAH 3M4IA 4EFEA 3GJXB 3LMLA 4M7EA 3T1YH 2KSWA 1XMOH 1N34H 4DR7H 3J80W 2OWOA 4DR5H 5FPRA 4A2AA 3JAMW 3RIZA 4LF4H 5D1OB 4JI6H 5DISC 4RB0A 1GYFA 4I7HA 4FM9A 1SEIA 2E5LH 5LMNH 4DV2H 4LF9H 4K0KH 1DGSA 2UXBH 2WYOA 4MTEA 1FVIA 4LF5H 4UCUA 3BA8A 4UFZA 2Q2UA 1S03G 4BWSC 4B3RH 5D1PA 4UCSA 4DR2H 1SYXB 2HHHH 4GKKH 4NXMH 3C0FB 3F8NA 4NXNH 4JI7H 1I94H 2Q2TA 1S68A 4DR3H 3VNNA 2UU9H 1BJTA 2CW8A 3MWMA 4DR1H 3KAKA 3N42B 1Z2PX 2HIXA 3JSNA 4DRFA 4PZ8A 4DUYH 4MTDA 4MV7A 4RAZA 2FE3A 1IBKH 5IT9W 4UCTA 4OX9H 3N40P 2ZM6H 5A2QW 4LF7H 1MZBA 3TY8A 4X64H 4LH7A 4DV5H 2XIGA 1ZHQA 4PZ7A 2UXDH 5FD6A 4PZ6A 2CW7A 4YY3H 3RJ0A 1CKNB 1P8LA 4B3SH 3N44B 4JI2H 2VQEH 3NBZB 3KXYT 2UUBH 1N36H 2ZJTA 4A2BA 4EQ5A 1XNQH 5LMUH 4JI1H 4IAJA 3NC0B 3HXLA 4Q0YA 4LSXA 2UUAH 2W57A 1AN7A 2RGVA 4DV7H 4E6NA 1Z2NX 4AQYH 4R7RA 4DV6H 4RB3C 2VUGA 1TAEA 4DV3H 3IG0A 4APMA 3BA9A 1FKAH 1CKNA 1IBLH 1N32H 5FLXW 4X62H 1VS0A 3N6XA 1O75A 4JI0H 1L2ZA 4DV0H 3L4JA 4DV1H 4JV5H 3W5OA 3GDEA 3DF7A 4JI8H 4B3MH 3W1GA 1M0WA 2HVQA 4EEQA 3KYHC 1A0IA 2VPSA 2VOBA 4MV9A 3JSLA 4UCRA 2YCHA 2WDTA 4CC6A 3PN1A 5IWAH 4RZQA 5BR8H 1HNXH 3BABA 2UXCH 2HGSA 3L4KA 3RR5A 3RGZA 3BAAA 1M0TA 1XMQH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFM A;  4LH6 A;  1CKM A;  3NBY B;  4E6N A;  2Q2T A;  1V9P A;  1S68 A;  1XK5 A;  1TAE A;  2VUG A;  3UQ8 A;  3BA9 A;  1CKN A;  3VNN A;  4GLX A;  1X9N A;  2HVR A;  5FPO A;  1VS0 A;  2HVS A;  3L2P A;  2HIX A;  3JSN A;  3GJX B;  4PZ8 A;  4DRF A;  4EFE A;  4UCO A;  1P16 A;  3GDE A;  4UCT A;  3QWU A;  3W5O A;  2OWO A;  5FPR A;  1CKO A;  5D1O A;  3TY8 A;  3W1G A;  4LH7 A;  2HVQ A;  5D1O B;  4CC5 A;  3KYH C;  5DIS C;  1A0I A;  4PZ7 A;  4EEQ A;  4PZ6 A;  3S24 A;  3W1B A;  2HIV A;  1CKN B;  1P8L A;  1DGS A;  3JSL A;  1TA8 A;  4UCR A;  1XDN A;  1FVI A;  3GB8 B;  3NBZ B;  4CC6 A;  3PN1 A;  4UCU A;  1B04 A;  3BA8 A;  4UFZ A;  2Q2U A;  3BAB A;  4EQ5 A;  4UCV A;  5D1P A;  4UCS A;  3TY9 A;  3RR5 A;  3NC0 B;  3RTX A;  3BAA A;  4EFB A;  3TY5 A; 
#chains in the Genus database with same CATH topology
 1R9T A;  4JI4 H;  1KC7 A;  5JH7 F;  2AU0 A;  1WSC A;  4QW8 A;  3N43 B;  1ET0 A;  4I50 F;  2UVV A;  3R5X A;  4JV2 A;  3BAC A;  2XD4 A;  2BQ3 A;  5DAA A;  2DLN A;  3U9T A;  5KG1 A;  3RBE A;  4DR6 H;  2FLN A;  4LSA A;  5C1O A;  1I3Q A;  1WH2 A;  3WNZ A;  4B3T H;  4J9S A;  3SE7 A;  5BWV A;  2R7Z A;  1FJG H;  1JXL A;  3I4M G;  2X0S A;  3ORR A;  1IBM H;  5DLF A;  5DMX A;  4DL4 A;  1Y1W A;  3GID A;  4L1K A;  4DQN A;  5JQW A;  4O3N A;  2UUC H;  3J7A K;  5KG2 A;  2HIV A;  2A1H A;  2CQY A;  4LFC H;  3HOY G;  2W9C A;  4YBZ B;  3K3V A;  2DAB A;  3TIG A;  3H20 A;  2W6O A;  4IIJ F;  1CQJ B;  1B04 A;  4EEY A;  1Y1V A;  3FKI A;  4FFM A;  2W6M A;  3TY9 A;  1KJ8 A;  3PW4 A;  5DG7 A;  3RB3 A;  4CMF A;  3TII A;  2FPG B;  4R8U B;  4O3Q A;  4A3K G;  4X65 H;  3DAA A;  4DL7 A;  3RGX A;  4FE2 A;  4F4Z A;  1GSH A;  2C22 A;  2DPI A;  3T9F A;  5EZY F;  3UQ8 A;  3NGD A;  5BPF A;  1EYZ A;  5FPO A;  4DAA A;  1BXR A;  5KG0 A;  2WB1 E;  2XGQ A;  4ECY A;  4XX0 B;  3TEK A;  5T14 A;  5EWG A;  1V51 A;  4F4W A;  1N34 H;  2R92 A;  4MV4 A;  4IZO A;  3UZO A;  2OWO A;  1UNN C;  4QWD A;  3MR6 A;  2YWV A;  4DR5 H;  2YZN A;  3JAM W;  2YYA A;  4U6P A;  3T5J A;  5D1O B;  2Z02 A;  4RB0 A;  5KG3 A;  4EYI B;  2R8I A;  2W9B B;  2Z04 A;  5EWE A;  4LF9 H;  4K0K H;  1GGO A;  4MV8 A;  1FVI A;  2QYZ A;  4A93 G;  4LF5 H;  3SNO A;  2UVW A;  2E2H A;  5CR5 A;  2Q2U A;  2C00 A;  3V6H A;  4BWS C;  5KFW A;  2JEF A;  4QW9 A;  2PBZ A;  1SYX B;  1N48 A;  3HB9 A;  3R9R A;  2NVX A;  3E5N A;  2FK1 A;  1A48 A;  2YW2 A;  4JI7 H;  4NXN H;  1I50 A;  4EYH B;  5DQG A;  5IYC G;  1C30 A;  4NZO A;  2CKZ B;  4PWQ A;  2Y0S E;  3MWM A;  2BQR A;  2VR1 A;  2Q7D A;  3HT5 A;  3QFF A;  3TIN A;  2FE3 A;  4BBS G;  3OHA A;  3G6V A;  2VUM G;  2ZM6 H;  5KKN B;  4LF7 H;  2NU7 B;  2R85 A;  3LUL A;  4J9O A;  2ASL A;  2YZL A;  4MA0 A;  4DLK A;  3ETJ A;  4ECQ A;  3T9E A;  3LP8 A;  1P8L A;  3GLK A;  3WO1 A;  4B3S H;  4FS1 A;  3T5L A;  3CQZ A;  1T3N A;  1WCM G;  2YRX A;  2W6P A;  2DAA A;  2ZJT A;  4A2B A;  3JRW A;  2UVR A;  1RYS A;  3RUP A;  1RK6 A;  4BBR G;  2JA8 G;  5CM0 A;  5C3E G;  4O7S A;  4E6N A;  1N56 A;  4DV6 H;  3G8D A;  4DV3 H;  1TAE A;  4IRK A;  2R93 G;  1CKN A;  2JEI A;  5K2M A;  2CZG A;  3T9A A;  1VS0 A;  3G6Y A;  1EUD B;  1JDE A;  3GTQ A;  5CA0 F;  1DV1 A;  2E2I A;  3BQ2 A;  2IA6 A;  4FFO A;  4CE5 A;  1SFO A;  3BQ1 A;  2R8K A;  1BNC A;  1Y1V G;  5KFK A;  5HBR B;  3KHH A;  3W1G A;  2ZGI A;  4C5A A;  2GLT A;  2XCL A;  2NU6 B;  1A0I A;  2XGP A;  4FU0 A;  2FMA A;  1RYR A;  2C28 A;  2VQD A;  2WDT A;  4O86 A;  2R7K A;  4CC6 A;  5IWA H;  4RZQ A;  4A3D G;  4O84 A;  5LXT F;  3I12 A;  2HGS A;  4NLG A;  5BWU A;  4O7T A;  2YZG A;  3RR5 A;  3L4K A;  1HNZ H;  2FP4 B;  3KAJ A;  1E4G T;  5DG8 A;  2ATL A;  4ECZ A;  1TWF A;  4R8U A;  4RB2 C;  2FK2 A;  3KHL A;  5LL6 b;  3WWJ A;  1EHI A;  2DZD A;  5DLG A;  4GLX A;  4O7Y A;  1W96 A;  5EWF A;  5I5S A;  2V4Q A;  1J5E H;  2RF4 A;  4O82 A;  4RUA A;  4YQW A;  4Q8F A;  2WE6 A;  5C8Y F;  4YR3 A;  4F50 A;  1IOW A;  1B6R A;  4UCO A;  4XYM B;  4DIM A;  4J0M A;  3UYY A;  4A3L G;  5KFY A;  2GPW A;  4TM5 A;  5BYA A;  1KT8 A;  4IHJ F;  4CC5 A;  1TWG A;  4YB8 B;  2ABJ A;  2RGR A;  4LFB H;  3FMA A;  4IWY A;  5KFD A;  5KFP A;  4X66 H;  2NUA B;  3S24 A;  3VPB A;  2SCU B;  1E4E A;  2CNQ A;  3OSP A;  2V58 A;  4O2A F;  4XZ3 B;  3KHR A;  5KT5 A;  1XDN A;  2R8G A;  3HOW G;  1I2L A;  2EJ2 A;  3K5H A;  5FD5 A;  1JLL B;  5C1P A;  2J6S A;  4DUZ H;  2VPQ A;  2W70 A;  1A0G A;  3U0G A;  4IR1 A;  2NU8 B;  4ECU A;  3J81 W;  3RTX A;  4J9P A;  3WWI A;  5FR9 A;  3TY5 A;  4EFB A;  2CFM A;  4NYE A;  4JV0 A;  4DV4 H;  4FFR A;  4ED2 A;  4JYA H;  5IP7 G;  3EYY A;  1IOV A;  1V9P A;  4E4T A;  1E4F T;  4RAY A;  5KS8 A;  2WAQ A;  3G6X A;  4Q4D A;  2HHF B;  5KFZ A;  4WD3 A;  4HN2 A;  3H4D A;  3OTO H;  4ED1 A;  2AGQ A;  1EKV A;  4PBC A;  3U55 A;  4HYK A;  4EFE A;  3GJX B;  2J6U A;  1VAJ A;  1XMO H;  2KSW A;  1E4E B;  2DWC A;  1KTA A;  2QF7 A;  3BG5 A;  5DGI A;  3TW7 A;  4U7C A;  3OHB A;  4J9Q A;  3GTG A;  4A3B G;  4DR7 H;  4WBN F;  3EPG A;  4LF4 H;  5DIS C;  3N8D A;  4FM9 A;  5JVD F;  5CE8 A;  2E5L H;  3EPI A;  1OWT A;  3VMM A;  4ED0 A;  1JKJ B;  3RB6 A;  4ZI7 F;  2WYO A;  5BPH A;  4MTE A;  2C2D A;  4GLW A;  4O7V A;  4UCU A;  3H3V H;  1S03 G;  3WO0 A;  5KFA A;  4O7R A;  4UCS A;  2V5A A;  2FLP A;  2HHH H;  4A3F G;  2C2R A;  3H4B A;  4QWE A;  5CAE B;  5EDW A;  4BY1 G;  3LQS A;  5KG5 A;  4RNO A;  3GTO A;  2PVP A;  5KG7 A;  4DR3 H;  5L1I A;  4QSH A;  3VPC A;  1BJT A;  2CW8 A;  3JZI A;  4JUZ A;  3AW8 A;  4RUC A;  4DR1 H;  2W8L A;  2JA6 A;  1JIH A;  4DUY H;  4MTD A;  4RAZ A;  4RCN A;  4A3J G;  2C35 B;  3PW2 A;  5IT9 W;  4NZN A;  4O4J F;  4K6N A;  4QIW A;  3V4S A;  3N40 P;  3GIL A;  2R8J A;  3AX6 A;  1K1Q A;  3H0G G;  5KFL A;  1MZB A;  4ED6 A;  4DL2 A;  5KT7 A;  3VOT A;  4RZR A;  2IP4 A;  4HNU A;  3VPD A;  5KFG A;  4FFL A;  1CE8 A;  5LA6 F;  5BWR A;  2CW7 A;  4C2M A;  5E25 A;  5KFS A;  3RJ0 A;  2AGO A;  2JA6 G;  3SI8 A;  4MV3 A;  4DL5 A;  2COI A;  4M9U A;  3PO2 G;  2W6Z A;  3DTG A;  2VQE H;  1GO3 E;  2B63 A;  3KXY T;  5C5J A;  4O3P A;  1N36 H;  1IYD A;  3HBL A;  4EQ5 A;  5KFJ A;  4YR0 A;  3M9O B;  4IAJ A;  3NC0 B;  3HXL A;  1G2W A;  4Q0Y A;  5LMU H;  4GC7 A;  5DGA A;  1S10 A;  1W93 A;  2XC9 A;  2J9G A;  2W71 A;  2VA3 A;  2RGV A;  4DV7 H;  2W6Q A;  3JRX A;  3PFF A;  4R7R A;  5H80 A;  2WB1 A;  5HNE A;  2NVY A;  1DAA A;  3IG0 A;  4A3M G;  5FLX W;  5BWW A;  2Y0S A;  5BYB A;  4C5C A;  4X62 H;  5KFH A;  2R92 G;  1I2K A;  3PW7 A;  3VA7 A;  1L2Z A;  4DV0 H;  1KJI A;  4DV1 H;  3DF7 A;  5DGH A;  2OH2 A;  3FDS A;  4Q44 A;  5KFV A;  4F4Y A;  4YR2 A;  3RBD A;  4A3C G;  4MV9 A;  3V4Z A;  2VOB A;  1A9X A;  4ZQI A;  1M7J A;  4UCR A;  4IRC A;  4ED7 A;  4I4T F;  3JZF A;  4YAJ B;  2V9W A;  4ECR A;  3BJY A;  2UXC H;  5KFE A;  1VBH A;  3TQT A;  5D8D A;  3BAA A;  5IYB G;  1XMQ H;  2I8C A;  2EIY A;  2JA5 A;  2J6T A;  4MV6 A;  3HKZ A;  5L1K A;  1XK5 A;  4YAK B;  5J2U F;  4CMD A;  3KAL A;  4KHP H;  2R87 A;  1I7N A;  1WR2 A;  2I80 A;  1DIK A;  2HDK A;  1OBG A;  3T9C A;  2O03 A;  4J9M A;  2YS7 A;  4EGJ A;  2PN1 A;  3KHG A;  1KJJ A;  3CVZ A;  4JI5 H;  3FKI G;  2HG8 A;  3K3P A;  3ORQ A;  5HV6 A;  2V4R A;  2FPI B;  1GLV A;  1P16 A;  4O83 A;  3QWU A;  2PMZ A;  2B63 G;  4TVI A;  2YL2 A;  4QWC A;  4PDB A;  4DL3 A;  1CKO A;  4ME6 A;  5D1O A;  5CA1 F;  3T99 A;  4ECX A;  3MR5 A;  4DR4 H;  5L1J A;  1RJP A;  3HKZ E;  4ED3 A;  5JUM A;  2XCP A;  2MCT A;  2GPS A;  3W1B A;  3PW0 A;  1WCM A;  1TA8 A;  5EOY A;  4EBC A;  2IMW P;  3R23 A;  3HOX G;  4XYL B;  3WWH A;  3UFX B;  1RJQ A;  3GTL A;  1TWC A;  2YZM A;  4O3S A;  2V59 A;  1GSO A;  4UCV A;  4O7Z A;  4HQ6 A;  3T9D A;  4Q43 A;  5IYZ F;  4BXX G;  1JDB B;  1GYF A;  2HGW A;  3T7A A;  5LYJ F;  4JI3 H;  1PX2 A;  4EG0 A;  5KFI A;  4RB1 A;  5KFQ A;  1X9N A;  2W7P A;  2HVR A;  4FBT A;  1WRV A;  3PO3 G;  2YU9 A;  4I55 F;  4EGQ A;  3M4I A;  2W9C B;  4IRD A;  3T1Y H;  3MR3 A;  2PMZ E;  2CNU A;  3I4N G;  3HO8 A;  4MV1 A;  5KG6 A;  5I47 A;  3GIP A;  4JI6 H;  4YP3 A;  4O3O A;  2EJ3 A;  4I7H A;  2FB9 A;  1I7L A;  1B6S A;  1SEI A;  3OUU A;  3GIM A;  1DGS A;  3MR2 A;  2ALZ A;  2R93 A;  1DV2 A;  4O4I F;  5KFO A;  2AGP A;  4JI1 H;  1KJQ A;  4GC6 A;  3BA8 A;  4UFZ A;  4JXU A;  2R8H A;  1ZET A;  2M05 A;  4YJ2 F;  5D1P A;  4NXM H;  5KFR A;  2EJ0 A;  1I94 H;  2Q2T A;  1I1M A;  4C5B A;  2R84 A;  3MFI A;  2JA7 G;  5KT3 A;  1A3G A;  2UU9 H;  3PR4 A;  2JA7 A;  5I5U A;  3UZB A;  1V4Y A;  1Z2P X;  3JSN A;  4DRF A;  4IWX A;  4PZ8 A;  4Y8V B;  4DV2 H;  4MV7 A;  3T54 A;  1Y14 B;  5DQI A;  4UCT A;  2YS6 A;  4M0J A;  5KFF A;  3QZ7 A;  5JQG F;  4QWA A;  3U9S A;  3KRE A;  2QK4 A;  4PZ7 A;  1ZHQ A;  4O7W A;  5DQH A;  4ECV A;  4PZ6 A;  4YY3 H;  2UXD H;  4CKB A;  1CKN B;  4A3E G;  4JI2 H;  4CKE A;  3NBZ B;  4ECT A;  2UUB H;  5C4X G;  4ZOL F;  3H0G A;  5CB4 F;  3OSN A;  3T5H A;  4O3R A;  2R7N A;  4A3I G;  1Y1W G;  2UUA H;  1TWA A;  5KFB A;  3GIJ A;  3H40 A;  1T36 A;  2R7M A;  3MWD A;  1FKA H;  4RB3 C;  2VUG A;  5FLM G;  4RNN A;  2C2E A;  2HHF A;  3BA9 A;  4MA5 A;  1KBL A;  2FKL A;  4APM A;  1N32 H;  2R6F A;  4FFN A;  2R86 A;  3N6X A;  4QWB A;  4HNV A;  4JI0 H;  3MJF A;  2RDJ A;  4JV5 H;  3GDE A;  3BQ0 A;  5GON F;  2HJW A;  1CQI B;  1AUV A;  4YJ3 F;  5L1L A;  4F4X A;  4B3M H;  4JI8 H;  1ZQ7 A;  2WAQ E;  1M6V A;  2ZDH A;  2VPS A;  4DL6 A;  3T9B A;  1KEE A;  5F9L A;  4J9K A;  3GTJ A;  1AUX A;  3PN1 A;  5I5T A;  1T94 A;  5IYD G;  4Q45 A;  1S0M A;  3Q8S B;  1HNX H;  2UVU A;  3HOU G;  5I5Y A;  2COG A;  5BMV F;  5K3W A;  5KT6 A;  4LF6 H;  3NBY B;  3GIQ A;  3GIK A;  1VBG A;  5J2T F;  3V6J A;  3RAX A;  2JA5 G;  3HOV G;  4LMY A;  4TUY F;  1EKF A;  3LWB A;  3L2P A;  4J9N A;  4O81 A;  1N33 H;  1HR0 H;  2COJ A;  3SGI A;  4JV1 A;  2ASD A;  2WTF A;  2ASJ A;  2GQS A;  2F4V H;  3HOZ G;  5LP6 F;  1UC9 A;  2R7Z G;  3Q8P B;  1C3O A;  2HVS A;  1OBD A;  3N6R A;  4TV9 F;  2QB5 A;  4ECW A;  1ZHS A;  3IN5 A;  1XNR H;  3KTM A;  3RB4 A;  4GKJ H;  1S0N A;  3N41 B;  2JEG A;  5I60 A;  1Z2O X;  3PZP A;  2RDI A;  2GQR A;  3RF2 A;  4Q4C A;  3GV7 B;  4ETS A;  1PK8 A;  3GB8 B;  4RNM A;  1EUC B;  4J9L A;  1S0O A;  1VKZ A;  4YHH H;  1I6U A;  2VUM A;  1K1S A;  4EBD A;  1I1K A;  1HNW H;  4HNT A;  2ODT X;  5C44 G;  2VQF H;  1BGW A;  3GQC A;  4LF8 H;  4A3G G;  1KUT A;  3GTM A;  2OLS A;  2HGX A;  2R7L A;  3M9M B;  4LH6 A;  1CKM A;  3JZ6 A;  2VA2 A;  5JVL A;  2X5R A;  5FJ8 G;  2AQ4 A;  3T1H H;  4MAM A;  1CS0 A;  4WHX A;  4UUG A;  5KFM A;  4LFA H;  4QIW E;  3QZ8 A;  3RB0 A;  4QJF A;  3V6K A;  3LML A;  2FJZ A;  5KFU A;  4M7E A;  4ECS A;  1TWH A;  3RAQ A;  3J80 W;  3AYH B;  1KJ9 A;  1I1L A;  5KFC A;  3R5H A;  4FS2 A;  5FPR A;  4A2A A;  3RIZ A;  5IP9 G;  4AYB A;  4TQR A;  3U54 A;  1ULZ A;  4FGR A;  1RK5 A;  5KG4 A;  3GV8 B;  3DTF A;  4O2B F;  1S9F A;  4O7L A;  4CHI A;  2UXB H;  3Q8R B;  2W7O A;  3GTK A;  3PVX A;  5L9X A;  4B3R H;  5KFT A;  4GKK H;  2CNV A;  4DR2 H;  2ZDG A;  4EBE A;  2JEJ A;  3C0F B;  1EZ1 A;  3F8N A;  2BQU A;  1S68 A;  5F9N A;  3G8C A;  1RJR A;  3VNN A;  2FK3 A;  3MWE A;  3KAK A;  5KX5 F;  3N42 B;  4O4L F;  2HIX A;  3Q8Q B;  1ZAU A;  4TV8 F;  1IBK H;  2Y4R A;  1UC8 A;  3CEB A;  2ZDQ A;  4O7N A;  5KFN A;  3RV3 A;  4OX9 H;  5A2Q W;  2W8K A;  5I5X A;  4Q8E A;  3TY8 A;  4X64 H;  1IYE A;  4LH7 A;  4DV5 H;  2XIG A;  1GSA A;  1JX4 A;  5DG9 A;  3GV5 B;  2W9B A;  4G3I A;  2NU9 B;  3GII A;  3N44 B;  4O4H F;  3M9N B;  2W6N A;  1EKP A;  4ED8 A;  5LOV F;  1XNQ H;  2IBK A;  2FLL A;  4FFP A;  5BWX A;  5KFX A;  4CKC A;  4LSX A;  3RFC A;  3CSW A;  2W57 A;  5I5V A;  1AN7 A;  1S97 A;  4AQY H;  1Z2N X;  2W9A A;  1IBL H;  3K5I A;  2FPP B;  3QQM A;  4RU9 A;  1K83 A;  4HR7 A;  4ZHQ F;  3TW6 A;  5DGB A;  3NUA A;  4FBU A;  1O75 A;  5KT4 A;  3Q1K A;  3L4J A;  3R5F A;  4J9R A;  2I87 A;  3W5O A;  4BY7 G;  3TQ1 A;  4NZM A;  4AYB E;  2P0A A;  1M0W A;  2HVQ A;  2R82 A;  4EEQ A;  3KYH C;  3MFH A;  2XCA A;  3T5K A;  5I5W A;  4IR9 A;  5FNV F;  5FD6 A;  3JSL A;  1SCU B;  2DPJ A;  1B33 N;  2YCH A;  2YRW A;  3OUZ A;  3PW5 A;  5BR8 H;  3GTP A;  4TQS A;  3BAB A;  3Q2O A;  3PR5 B;  3ETH A;  5KT2 A;  5BWT A;  2BR0 A;  5LMN H;  3RGZ A;  3RV4 A;  1M0T A;  2DIK A; 
#chains in the Genus database with same CATH homology
 3KAJ A;  1E4G T;  4LF6 H;  3NBY B;  4JI4 H;  4RB2 C;  1XK5 A;  4LMY A;  5LL6 b;  3N43 B;  3KAL A;  4GLX A;  2O03 A;  2UUC H;  4KHP H;  1J5E H;  3L2P A;  4JI5 H;  1N33 H;  3CVZ A;  1HR0 H;  2WE6 A;  2F4V H;  4DR6 H;  4UCO A;  1P16 A;  4J0M A;  3QWU A;  4LSA A;  1WH2 A;  4B3T H;  2HVS A;  1CKO A;  5D1O A;  2RGR A;  4CC5 A;  1FJG H;  4DR4 H;  4LFB H;  1IBM H;  1ZHS A;  3FMA A;  4X66 H;  1HNZ H;  1XNR H;  4GKJ H;  3S24 A;  3N41 B;  2MCT A;  3J7A K;  3W1B A;  2HIV A;  1Z2O X;  4LFC H;  5EOY A;  1TA8 A;  3RF2 A;  3K3V A;  1XDN A;  4ETS A;  3GB8 B;  3H20 A;  5FD5 A;  1B04 A;  4YHH H;  4DUZ H;  1HNW H;  4UCV A;  2VQF H;  3TY9 A;  1BGW A;  3J81 W;  3RTX A;  4LF8 H;  4EFB A;  3TY5 A;  2CFM A;  4LH6 A;  4DV4 H;  4JYA H;  1CKM A;  4X65 H;  1I6U A;  3EYY A;  1V9P A;  1E4F T;  4RAY A;  3RGX A;  4PDB A;  4JI3 H;  3UQ8 A;  3T1H H;  4RB1 A;  1X9N A;  2HVR A;  5FPO A;  3OTO H;  4LFA H;  3M4I A;  4EFE A;  3GJX B;  3LML A;  4M7E A;  3T1Y H;  2KSW A;  1XMO H;  1N34 H;  4DR7 H;  3J80 W;  2OWO A;  4DR5 H;  5FPR A;  4A2A A;  3JAM W;  3RIZ A;  4LF4 H;  5D1O B;  4JI6 H;  5DIS C;  4RB0 A;  1GYF A;  4I7H A;  4FM9 A;  1SEI A;  2E5L H;  5LMN H;  4DV2 H;  4LF9 H;  4K0K H;  1DGS A;  2UXB H;  2WYO A;  4MTE A;  1FVI A;  4LF5 H;  4UCU A;  3BA8 A;  4UFZ A;  2Q2U A;  1S03 G;  4BWS C;  4B3R H;  5D1P A;  4UCS A;  4DR2 H;  1SYX B;  2HHH H;  4GKK H;  4NXM H;  3C0F B;  3F8N A;  4NXN H;  4JI7 H;  1I94 H;  2Q2T A;  1S68 A;  4DR3 H;  3VNN A;  2UU9 H;  1BJT A;  2CW8 A;  3MWM A;  4DR1 H;  3KAK A;  3N42 B;  1Z2P X;  2HIX A;  3JSN A;  4DRF A;  4PZ8 A;  4DUY H;  4MTD A;  4MV7 A;  4RAZ A;  2FE3 A;  1IBK H;  5IT9 W;  4UCT A;  4OX9 H;  3N40 P;  2ZM6 H;  5A2Q W;  4LF7 H;  1MZB A;  3TY8 A;  4X64 H;  4LH7 A;  4DV5 H;  2XIG A;  1ZHQ A;  4PZ7 A;  2UXD H;  5FD6 A;  4PZ6 A;  2CW7 A;  4YY3 H;  3RJ0 A;  1CKN B;  1P8L A;  4B3S H;  3N44 B;  4JI2 H;  2VQE H;  3NBZ B;  3KXY T;  2UUB H;  1N36 H;  2ZJT A;  4A2B A;  4EQ5 A;  1XNQ H;  5LMU H;  4JI1 H;  4IAJ A;  3NC0 B;  3HXL A;  4Q0Y A;  4LSX A;  2UUA H;  2W57 A;  1AN7 A;  2RGV A;  4DV7 H;  4E6N A;  1Z2N X;  4AQY H;  4R7R A;  4DV6 H;  4RB3 C;  2VUG A;  1TAE A;  4DV3 H;  3IG0 A;  4APM A;  3BA9 A;  1FKA H;  1CKN A;  1IBL H;  1N32 H;  5FLX W;  4X62 H;  1VS0 A;  3N6X A;  1O75 A;  4JI0 H;  1L2Z A;  4DV0 H;  3L4J A;  4DV1 H;  4JV5 H;  3W5O A;  3GDE A;  3DF7 A;  4JI8 H;  4B3M H;  3W1G A;  1M0W A;  2HVQ A;  4EEQ A;  3KYH C;  1A0I A;  2VPS A;  2VOB A;  4MV9 A;  3JSL A;  4UCR A;  2YCH A;  2WDT A;  4CC6 A;  3PN1 A;  5IWA H;  4RZQ A;  5BR8 H;  1HNX H;  3BAB A;  2UXC H;  2HGS A;  3L4K A;  3RR5 A;  3RGZ A;  3BAA A;  1M0T A;  1XMQ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...