1XDNA

High resolution crystal structure of an editosome enzyme from trypanosoma brucei: rna editing ligase 1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
265
structure length
265
Chain Sequence
b'QSDFSPYIEIDLPSESRIQSLHKSGLAAQEWVACEKVHGTNFGIYLINQGDHEVVRFAKRSGIMDPNENFFGYHILIDEFTAQIRILNDLLKQKYGLSRVGRLVLNGELFGAKYKHPLVPKSEKWCTLPNGKKFPIAGVQIQREPFPQYSPELHFFAFDIKYSVSGAEEDFVLLGYDEFVEFSSKVPNLLYARALVRGTLDECLAFDVENFMTPLPALLGLGNYPLEGNLAEGVVIRHVRRGDPAVEKHNVSTIIKLRCSSFMEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA editing ligase MP52
publication title High resolution crystal structure of a key editosome enzyme from Trypanosoma brucei: RNA editing ligase 1.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Ligase
total genus 75
structure length 265
sequence length 265
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1xdnA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1xdnA01
2Q2TA 1XDNA 4LH7A 3UQ8A 3GB8B 2Q2UA 3BABA 4E6NA 3RR5A 3QWUA 3TY5A 3NC0B 3BA8A 3NBYB 4UCSA 4GLXA 3TY9A 2HVQA 1B04A 2HIXA 1XK5A 2VUGA 4PZ8A 1CKNA 4PZ7A 3NBZB 1S68A 3TY8A 5D1OA 3L2PA 3VNNA 4UCVA 4CC5A 2OWOA 1A0IA 4PZ6A 3BA9A 2HVSA 4LH6A 4EQ5A 4EFEA 4UCRA 4EFBA 2HVRA 2HIVA 1P8LA 3RTXA 5D1PA 3GJXB 5FPOA 4UCOA 4DRFA 3W1BA 1X9NA 4UCUA 1DGSA 4UFZA 1P16A 1CKNB 4EEQA 1TAEA 3JSLA 1TA8A 1CKMA 4UCTA 5D1OB 1V9PA 3PN1A 3W5OA 4CC6A 3KYHC 1VS0A 5DISC 2CFMA 1FVIA 3S24A 1CKOA 5FPRA 3W1GA 3BAAA 3JSNA 3GDEA
chains in the Genus database with same CATH superfamily
5IT9W 2CNVA 5BWRA 2WB1A 3UYYA 1GO3E 3ORQA 4RB0A 2ODTX 1T3NA 3H4DA 4OX9H 1I1LA 5L1LA 5KG1A 4RNOA 2R7ZA 1GYFA 2OH2A 4FM9A 5KFFA 1E4EB 3HT5A 2HG8A 3BG5A 2W71A 1WRVA 5EWGA 4EBDA 2JEFA 2JA8G 4LFCH 4DL2A 3V4ZA 5I5UA 3GTMA 2HGXA 3HKZE 4BXXG 5KFKA 3T5KA 3CVZA 3G6XA 5LA6F 4GC6A 4NLGA 2DABA 3G6YA 4TM5A 5BWXA 4A3MG 3RBEA 1KJQA 2R82A 3QFFA 5FNVF 1I94H 4E6NA 1V4YA 4A3BG 4A2AA 3CEBA 4Q4CA 3NUAA 1DV2A 2R85A 3KALA 3NBYB 5KS8A 5KFJA 3V6HA 4A3IG 4TQSA 1FJGH 1M0TA 3RF2A 1WCMG 5L9XA 4ED3A 4XYMB 1ZETA 4UCSA 5KFWA 3IG0A 1AN7A 3RBDA 2R7KA 3KTMA 1C3OA 4YY3H 4YB8B 1IOVA 2C28A 2R8HA 4FU0A 4O7SA 2HIXA 5KT7A 4DR5H 4M7EA 3SE7A 5D8DA 3AYHB 1JXLA 4PZ8A 3BQ2A 1CKNA 4BBRG 5DQHA 4DV5H 4WBNF 3IN5A 4ECXA 3I4MG 1VAJA 5K3WA 4ECTA 4DR3H 5KFYA 3NBZB 4ECYA 2DPJA 4JI2H 3MFHA 1S68A 4FGRA 4Y8VB 2YZLA 5KFCA 2GPWA 2CNQA 3ORRA 2NU9B 4YR2A 3FKIG 4AYBA 5LL6b 4UCVA 2V59A 3T1YH 4Q0YA 3MR3A 3OUUA 3TW6A 4CC5A 2XCAA 2AU0A 4BBSG 2FK3A 5DLFA 1EUCB 3BJYA 3H3VH 2XCLA 5IP9G 5IYCG 3LQSA 2W7PA 5LXTF 3BA9A 4IZOA 5L1IA 1A3GA 4ZOLF 2V4RA 1ET0A 4O7YA 3U54A 1KC7A 3U0GA 1K1QA 2CW7A 4YAJB 4HNTA 1RYSA 5K2MA 5GONF 4GKJH 3H4BA 1XMOH 3BQ0A 3EPIA 1J5EH 1HNWH 4TQRA 1UC8A 4UCRA 2VOBA 5KT4A 4WD3A 2CZGA 3PW4A 5BWVA 2W6OA 4NXNH 4JI5H 3PW2A 4FFMA 5KT5A 4RU9A 4LFBH 2PMZE 1P8LA 2ASDA 2E2HA 2EJ0A 1RJRA 5KFLA 3T54A 2W7OA 2FB9A 3KHLA 2XD4A 1VBHA 4I4TF 2UVRA 4DL5A 4UCOA 1FKAH 4Q8FA 1I50A 1VBGA 1KEEA 5FJ8G 2BQ3A 3TEKA 3T5LA 2C2DA 2UXCH 4UFZA 3TIIA 4FFPA 2WE6A 2WAQA 1P16A 4XYLB 1CKNB 4YAKB 3GILA 2BR0A 4J9QA 3PVXA 1R9TA 3U9TA 4DL7A 1TAEA 3CSWA 1TA8A 1AUXA 1AUVA 5BWWA 3H0GA 4JI0H 3KXYT 1B6RA 4UCTA 1I1KA 5LOVF 1V9PA 4RUCA 4DUZH 4R7RA 3MFIA 4X62H 5IYZF 3E5NA 3VOTA 4J9NA 2AQ4A 3LP8A 1SFOA 1S03G 4FE2A 5EZYF 3GIJA 4M9UA 4QIWE 4JI8H 2Y0SA 1N34H 4O2BF 3VPCA 2R8GA 4YP3A 3PR4A 3K3PA 1FVIA 3I12A 3T5JA 4JI3H 1L2ZA 4CKBA 4U7CA 2XIGA 3BAAA 3JSNA 4O7LA 3U55A 5KFXA 3Q8RB 4NYEA 4ED8A 4PDBA 2R92A 4F4ZA 5DGAA 2HJWA 1VKZA 1TWCA 1E4FT 3BQ1A 4O3OA 5KG0A 4QWEA 3GIMA 2R93G 5DG9A 3G8CA 4A3LG 2Q2TA 2YW2A 4F4WA 4Q43A 3GV7B 2AGOA 1M0WA 2XGPA 1CS0A 1GSHA 2VQDA 4IWXA 3N40P 3HOUG 2YS6A 3GB8B 3V6KA 1W96A 2V5AA 3PFFA 5KT2A 3GIKA 4LF4H 5KG6A 3GIDA 3BABA 4FS1A 2JEIA 4O3PA 5KG5A 4X64H 5DQGA 3LULA 3PW7A 4GC7A 2DIKA 1K83A 2VPQA 2J6SA 2AGPA 3LWBA 3TW7A 2W9CA 4IR9A 4LF6H 1XNRH 5C4XG 1EKPA 3QWUA 5FR9A 3T9BA 4CKEA 3TY5A 2I87A 5KG3A 5FLXW 4AQYH 2IBKA 4ED6A 1ULZA 2JEJA 4IRDA 4J9RA 4FFOA 5H80A 5CR5A 1OWTA 1IBMH 5CM0A 1B33N 1Y1VA 1RK6A 4RNNA 4C5BA 5JVLA 2W8LA 4ED1A 1S0NA 1GSOA 3TY9A 5DGBA 4QWAA 4O3RA 3EYYA 4YJ2F 4FS2A 2YZGA 3DF7A 5KT3A 2X5RA 3R23A 3T9CA 2FJZA 4RZQA 4C5AA 2JA6A 3VPDA 3J7AK 5LMNH 4A93G 2HGSA 2IP4A 1E4GT 3GQCA 5DAAA 5FD5A 4APMA 4DUYH 1Z2NX 2COGA 2NU6B 3WO0A 4XZ3B 1O75A 2C2RA 4YJ3F 5DGIA 3QZ8A 1KT8A 2X0SA 1PX2A 2XCPA 4F4XA 5F9NA 5D1OA 3L2PA 3RIZA 3VNNA 1EZ1A 3Q2OA 2YYAA 4A2BA 1I2LA 5KFPA 2FE3A 3F8NA 1EKVA 3K3VA 4ED2A 5CA0F 4MV1A 2FK2A 3ETHA 5I60A 4PZ6A 1JKJB 3T7AA 3H20A 2VUMA 3N42B 5KKNB 4RNMA 4A3FG 4HNUA 1S10A 4ECUA 4IRKA 2HVSA 4FBUA 2R7ZG 5KFHA 1I1MA 3MWEA 4JI4H 2ALZA 2FLPA 4L1KA 5CA1F 2W9CB 3V4SA 4I50F 2HDKA 5EOYA 4MA0A 4ED7A 2VA2A 2WB1E 4DV0H 2GPSA 2W57A 2HVRA 3RB0A 4JV5H 2NVXA 3Q8QB 3JRXA 4O7NA 4O7RA 2DPIA 3H40A 5DG7A 2IA6A 2R7LA 3UZOA 3G6VA 3RTXA 5KFNA 2JA5A 4O3NA 4FFNA 4O4HF 2JA7A 3WWJA 5FPOA 4FFRA 3AW8A 4C5CA 3MJFA 4NXMH 2WTFA 3M4IA 4MV9A 3GV8B 2C2EA 2R6FA 4UCUA 2M05A 2GQRA 2F4VH 2VA3A 3RB4A 5DMXA 3PW0A 2ATLA 4ECRA 2W9BA 1I7NA 2UUCH 4YR0A 2W6ZA 3PO3G 2I80A 3U9SA 4EGQA 2ZM6H 4EEQA 4QJFA 3JZ6A 4HYKA 4B3SH 2KSWA 4IR1A 2VR1A 3HOYG 4RB3C 4JXUA 3T5HA 1N48A 3JSLA 4J9SA 5D1OB 1KBLA 3QZ7A 2W6MA 1KJ8A 1EYZA 4R8UA 3ETJA 3OUZA 3TIGA 1CQIB 3CQZA 2YZMA 1BNCA 4ECQA 2DLNA 5FLMG 5I5SA 4CE5A 2ZDHA 3R5HA 4WHXA 4DV3H 5KFSA 5DISC 5CE8A 5FD6A 3GTKA 5JQWA 2RDJA 2UVVA 5KG2A 3G8DA 5HV6A 2V4QA 5FPRA 5DLGA 5KFMA 3GTLA 3W1GA 5J2UF 1DGSA 1EUDB 4NZOA 5KFAA 1TWHA 4IWYA 5JH7F 4I7HA 5IYDG 1Y1WA 2HGWA 4JI1H 3MR5A 4LFAH 4QWDA 1Z2PX 1I3QA 4ECVA 4O2AF 3UZBA 2ZDQA 1S9FA 2E5LH 2UUAH 4MV7A 4NZNA 1IYEA 2NU7B 4MV6A 4O7VA 4QW8A 2UVWA 4DR4H 4O7WA 4AYBE 2ZJTA 5KFRA 3RGXA 4KHPH 2HHFA 4O3SA 4RZRA 2UXDH 1I6UA 3T99A 3T1HH 5LYJF 5C44G 2Q2UA 2NUAB 3N44B 4LSAA 4J9LA 5DG8A 5DGHA 3OHAA 2FPIB 1RK5A 2R84A 2RF4A 5T14A 3Q8SB 4ECWA 4FBTA 2W9BB 4ZI7F 4DV2H 3T9FA 1GGOA 2CKZB 1EHIA 4O7ZA 4QW9A 2WYOA 1B6SA 2QK4A 1CQJB 1ZAUA 3BA8A 3MR6A 2R8JA 4JUZA 5KFTA 2ASLA 2R87A 4JI6H 1RJQA 2QB5A 5JQGF 1IBKH 4GLXA 4MAMA 5HBRB 2RDIA 3Q8PB 1ZQ7A 2Y4RA 3K5HA 2GLTA 2NU8B 1SYXB 3PR5B 3GTPA 1KTAA 4A3KG 3KREA 1B04A 1JLLB 2W6PA 4MV4A 5I5XA 4RAZA 3H0GG 2XC9A 4GKKH 1XK5A 2VUGA 3HOZG 4JI7H 2B63A 3JZFA 3M9NB 4X65H 3GV5B 2MCTA 3J80W 3PO2G 2WAQE 4EYHB 4RAYA 4U6PA 1E4EA 1WH2A 4DV6H 5BPFA 4DL3A 2YCHA 4DV1H 1XNQH 3TY8A 1JIHA 1Y14B 3VPBA 4O4IF 4O4LF 4QSHA 1Z2OX 4CHIA 1N56A 3HBLA 3BACA 2VQEH 4LF5H 2NVYA 3JZIA 5KFDA 1N32H 4PWQA 2FPGB 4PBCA 2OWOA 1A0IA 2P0AA 3HKZA 3LMLA 2R92G 2Q7DA 2Y0SE 1UC9A 2EJ2A 5I5TA 4ECSA 2E2IA 2R8IA 2BQRA 3HB9A 4LH6A 4MA5A 3RV4A 3NGDA 3OSPA 2W8KA 3M9OB 4C2MA 2O03A 3N8DA 3WNZA 4EFEA 5I5VA 5I5WA 1UNNC 1ZHSA 4LMYA 2UUBH 1TWAA 1BJTA 3HOVG 4JV0A 3RB6A 2FPPB 5DQIA 4O86A 4HR7A 3TQTA 2COJA 4ME6A 5BYAA 1KJJA 5BWTA 2ABJA 5D1PA 1C30A 4ZQIA 5BYBA 3T9AA 3OHBA 4MTEA 2W9AA 1WSCA 4CMDA 4DR1H 1HR0H 2ASJA 5BMVF 1EKFA 5EWFA 1BXRA 5JUMA 3RB3A 4IRCA 4DRFA 3SNOA 3EPGA 2FP4B 1IYDA 3JRWA 3HOWG 4YHHH 3OSNA 5C3EG 4EGJA 2COIA 1WCMA 5EWEA 3GLKA 4F4YA 5HNEA 1Y1VG 2J6UA 4JV1A 2Z02A 2GQSA 4NZMA 4YBZB 4JV2A 1A0GA 1KUTA 3HXLA 4MV8A 4F50A 2EIYA 4DV7H 4LF9H 2JA6G 1IBLH 2R7NA 2YZNA 3RAXA 5KFGA 1A9XA 4J9OA 4JYAH 4ZHQF 4DIMA 3W5OA 1V51A 3RAQA 1T94A 4X66H 5IWAH 3KHGA 2UVUA 1SEIA 1VS0A 1JDEA 3TINA 5KFBA 2XGQA 1I2KA 3KHHA 4EEYA 2FKLA 3GTGA 4O84A 2PBZA 4Q45A 5C1PA 5CB4F 4CKCA 2A1HA 3FKIA 2C22A 3GDEA 4QWCA 5BWUA 5KFUA 1TWGA 2VUMG 5KFQA 2ZGIA 4K0KH 3FDSA 2I8CA 2PMZA 4ECZA 4YR3A 2IMWP 5C8YF 3TQ1A 2YU9A 5KFOA 4TUYF 2W6NA 1XDNA 4LH7A 1PK8A 5KFVA 3RV3A 5KG7A 4YQWA 4B3RH 1IOWA 3UQ8A 4J0MA 2FLLA 4RB1A 5EDWA 3VMMA 3K5IA 1A48A 2VPSA 2UU9H 3GTOA 3L4KA 1T36A 4DR6H 2VQFH 2EJ3A 2FLNA 2JA5G 2JA7G 1W93A 4FFLA 4UUGA 5KX5F 4RCNA 1RJPA 5BR8H 3OTOH 3AX6A 1N36H 1I7LA 5KFEA 3RR5A 1TWFA 1SCUB 3NC0B 3N43B 2FK1A 5KG4A 2ZDGA 1XMQH 4HQ6A 4TV9F 2HHHH 1HNXH 4A3CG 2CW8A 5L1KA 2DAAA 5C5JA 3GTJA 2YS7A 3C0FB 5BPHA 4QIWA 4BY1G 2HVQA 5F9LA 5L1JA 2OLSA 4EBEA 3JAMW 4O3QA 3PW5A 4A3GG 2V58A 1GLVA 2YRWA 2YL2A 1M6VA 5E25A 4J9PA 1JDBB 1KJ9A 1KJIA 4O83A 5I5YA 3N6XA 2C35B 3KAJA 4PZ7A 4MTDA 2W70A 5KFZA 2BQUA 3T9DA 2QYZA 3KAKA 3GTQA 1K1SA 2CQYA 3HO8A 1CE8A 4DR7H 1GSAA 2V9WA 4RUAA 1Y1WG 2AGQA 4G3IA 4RB2C 4CMFA 4EG0A 4Q4DA 4MV3A 3I4NG 4A3DG 1N33H 4BWSC 3T9EA 4IAJA 1ZHQA 4O7TA 4O81A 3KHRA 5A2QW 4R8UB 1S0MA 2R93A 4E4TA 4O4JF 1DIKA 3RFCA 3R9RA 4EQ5A 4LF8H 4TV8F 4B3TH 2R86A 1BGWA 5JVDF 1JX4A 3J81W 2JEGA 3R5XA 4B3MH 3N41B 3MR2A 2W6QA 4EFBA 4LSXA 4DV4H 3WWIA 3DTGA 4DAAA 2HIVA 3DAAA 3RJ0A 3WWHA 3V6JA 3UFXB 3R5FA 2QF7A 3QQMA 5KFIA 3GJXB 3SGIA 1MZBA 3FMAA 3GIPA 4M0JA 2YRXA 4DL6A 1S97A 2UXBH 5C1OA 3RGZA 1OBDA 2FMAA 2SCUB 3W1BA 3SI8A 2J9GA 4O82A 1X9NA 4ETSA 1DAAA 2PVPA 1M7JA 3WO1A 5KT6A 3L4JA 3Q1KA 4BY7G 1RYRA 2HHFB 4A3EG 1S0OA 4QWBA 3MWMA 3N6RA 2DZDA 4Q8EA 3DTFA 2WDTA 4IIJF 1G2WA 4Q44A 3VA7A 4XX0B 2C00A 1OBGA 4K6NA 4EBCA 2R7MA 4GLWA 4DLKA 4HN2A 4LF7H 1CKMA 5CAEB 2B63G 2CNUA 5J2TF 2J6TA 2DWCA 3RUPA 4DR2H 2PN1A 3GIIA 3PN1A 4J9KA 3MWDA 4CC6A 3KYHC 3HOXG 4DL4A 5IYBG 1HNZH 5LP6F 4DQNA 2R8KA 4IHJF 5IP7G 4TVIA 2RGVA 2CFMA 2YWVA 3M9MB 1WR2A 4I55F 3S24A 5I47A 3GIQA 5LMUH 4HNVA 1CKOA 4EYIB 4ED0A 3PZPA 2RGRA 4A3JG 4J9MA 2Z04A 1DV1A
chains in the Genus database with same CATH topology
4I7HA 5IT9W 4LFAH 4JI1H 4PDBA 4RB0A 1Z2PX 4K0KH 4OX9H 2E5LH 2UUAH 1E4FT 4MV7A 2Q2TA 1GYFA 4DR4H 4FM9A 1XDNA 4LH7A 1M0WA 2ZJTA 3RGXA 4B3RH 4KHPH 2UXDH 3N40P 3UQ8A 4J0MA 1I6UA 4RB1A 3T1HH 3GB8B 4LFCH 2Q2UA 3N44B 4LSAA 2VPSA 2UU9H 4LF4H 3CVZA 3L4KA 3BABA 4DR6H 2VQFH 4X64H 3OTOH 1I94H 1XNRH 4LF6H 5BR8H 4E6NA 4DV2H 3RR5A 2XIGA 4A2AA 3QWUA 4AQYH 5FLXW 3TY5A 2WYOA 3NC0B 3BA8A 3KALA 3N43B 3NBYB 1XMQH 1FJGH 2HHHH 1M0TA 3RF2A 1HNXH 4JI6H 1IBKH 2CW8A 4UCSA 4GLXA 1IBMH 3IG0A 1AN7A 1SYXB 3C0FB 4YY3H 3TY9A 2HVQA 3EYYA 1B04A 2HIXA 3DF7A 4RAZA 3JAMW 4DR5H 4M7EA 4GKKH 4RZQA 1XK5A 2VUGA 4JI7H 3J7AK 4X65H 5LMNH 4PZ8A 2MCTA 1CKNA 1E4GT 2HGSA 3N6XA 4RAYA 3J80W 4DV5H 4PZ7A 3KAJA 5FD5A 4APMA 4MTDA 4DUYH 1Z2NX 1WH2A 4DV6H 1O75A 3KAKA 4DR3H 3NBZB 2YCHA 4JI2H 4DV1H 1XNQH 1S68A 3TY8A 4JYAH 5D1OA 3L2PA 3RIZA 3T1YH 3VNNA 1Z2OX 4DR7H 4A2BA 4UCVA 5LL6b 2FE3A 4Q0YA 2VQEH 4CC5A 3F8NA 4RB2C 3K3VA 4LF5H 1N32H 2OWOA 1A0IA 1N33H 4PZ6A 3LMLA 3H20A 4BWSC 3N42B 4IAJA 3BA9A 1ZHQA 1N36H 1HR0H 2HVSA 2CW7A 5A2QW 4LH6A 4EQ5A 4LF8H 4JI4H 2O03A 1XMOH 4EFEA 4GKJH 4LMYA 1ZHSA 4B3TH 1J5EH 2UUBH 1BGWA 1HNWH 1BJTA 4B3MH 4UCRA 5EOYA 2VOBA 3J81W 3N41B 4DV0H 2W57A 4EFBA 2HVRA 4LSXA 4DV4H 4NXNH 4JI5H 2HIVA 4JV5H 3RJ0A 4LFBH 1P8LA 3RTXA 5D1PA 3GJXB 3FMAA 1MZBA 4MTEA 4DR1H 5FPOA 2UXBH 3RGZA 4NXMH 4UCOA 4DRFA 3W1BA 3M4IA 1X9NA 4MV9A 4ETSA 1FKAH 4UCUA 3L4JA 2F4VH 4YHHH 1DGSA 2UXCH 4UFZA 2WE6A 3MWMA 1P16A 1CKNB 2UUCH 2WDTA 2ZM6H 4B3SH 4EEQA 2KSWA 3HXLA 4RB3C 1TAEA 3JSLA 1TA8A 4DV7H 4LF9H 4JI0H 4LF7H 1IBLH 1CKMA 4UCTA 3KXYT 5D1OB 1V9PA 4DUZH 4R7RA 4X62H 4DR2H 3PN1A 3W5OA 4CC6A 1S03G 3KYHC 4X66H 5IWAH 1HNZH 4JI8H 1SEIA 4DV3H 1N34H 1VS0A 5DISC 2RGVA 2CFMA 5FD6A 1FVIA 4JI3H 3S24A 5LMUH 2RGRA 1L2ZA 1CKOA 5FPRA 3W1GA 3BAAA 3JSNA 3GDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2T A;  1XDN A;  4LH7 A;  3UQ8 A;  3GB8 B;  2Q2U A;  3BAB A;  4E6N A;  3RR5 A;  3QWU A;  3TY5 A;  3NC0 B;  3BA8 A;  3NBY B;  4UCS A;  4GLX A;  3TY9 A;  2HVQ A;  1B04 A;  2HIX A;  1XK5 A;  2VUG A;  4PZ8 A;  1CKN A;  4PZ7 A;  3NBZ B;  1S68 A;  3TY8 A;  5D1O A;  3L2P A;  3VNN A;  4UCV A;  4CC5 A;  2OWO A;  1A0I A;  4PZ6 A;  3BA9 A;  2HVS A;  4LH6 A;  4EQ5 A;  4EFE A;  4UCR A;  4EFB A;  2HVR A;  2HIV A;  1P8L A;  3RTX A;  5D1P A;  3GJX B;  5FPO A;  4UCO A;  4DRF A;  3W1B A;  1X9N A;  4UCU A;  1DGS A;  4UFZ A;  1P16 A;  1CKN B;  4EEQ A;  1TAE A;  3JSL A;  1TA8 A;  1CKM A;  4UCT A;  5D1O B;  1V9P A;  3PN1 A;  3W5O A;  4CC6 A;  3KYH C;  1VS0 A;  5DIS C;  2CFM A;  1FVI A;  3S24 A;  1CKO A;  5FPR A;  3W1G A;  3BAA A;  3JSN A;  3GDE A; 
#chains in the Genus database with same CATH topology
 5IT9 W;  2CNV A;  5BWR A;  2WB1 A;  3UYY A;  1GO3 E;  3ORQ A;  4RB0 A;  2ODT X;  1T3N A;  3H4D A;  4OX9 H;  1I1L A;  5L1L A;  5KG1 A;  4RNO A;  2R7Z A;  1GYF A;  2OH2 A;  4FM9 A;  5KFF A;  1E4E B;  3HT5 A;  2HG8 A;  3BG5 A;  2W71 A;  1WRV A;  5EWG A;  4EBD A;  2JEF A;  2JA8 G;  4LFC H;  4DL2 A;  3V4Z A;  5I5U A;  3GTM A;  2HGX A;  3HKZ E;  4BXX G;  5KFK A;  3T5K A;  3CVZ A;  3G6X A;  5LA6 F;  4GC6 A;  4NLG A;  2DAB A;  3G6Y A;  4TM5 A;  5BWX A;  4A3M G;  3RBE A;  1KJQ A;  2R82 A;  3QFF A;  5FNV F;  1I94 H;  4E6N A;  1V4Y A;  4A3B G;  4A2A A;  3CEB A;  4Q4C A;  3NUA A;  1DV2 A;  2R85 A;  3KAL A;  3NBY B;  5KS8 A;  5KFJ A;  3V6H A;  4A3I G;  4TQS A;  1FJG H;  1M0T A;  3RF2 A;  1WCM G;  5L9X A;  4ED3 A;  4XYM B;  1ZET A;  4UCS A;  5KFW A;  3IG0 A;  1AN7 A;  3RBD A;  2R7K A;  3KTM A;  1C3O A;  4YY3 H;  4YB8 B;  1IOV A;  2C28 A;  2R8H A;  4FU0 A;  4O7S A;  2HIX A;  5KT7 A;  4DR5 H;  4M7E A;  3SE7 A;  5D8D A;  3AYH B;  1JXL A;  4PZ8 A;  3BQ2 A;  1CKN A;  4BBR G;  5DQH A;  4DV5 H;  4WBN F;  3IN5 A;  4ECX A;  3I4M G;  1VAJ A;  5K3W A;  4ECT A;  4DR3 H;  5KFY A;  3NBZ B;  4ECY A;  2DPJ A;  4JI2 H;  3MFH A;  1S68 A;  4FGR A;  4Y8V B;  2YZL A;  5KFC A;  2GPW A;  2CNQ A;  3ORR A;  2NU9 B;  4YR2 A;  3FKI G;  4AYB A;  5LL6 b;  4UCV A;  2V59 A;  3T1Y H;  4Q0Y A;  3MR3 A;  3OUU A;  3TW6 A;  4CC5 A;  2XCA A;  2AU0 A;  4BBS G;  2FK3 A;  5DLF A;  1EUC B;  3BJY A;  3H3V H;  2XCL A;  5IP9 G;  5IYC G;  3LQS A;  2W7P A;  5LXT F;  3BA9 A;  4IZO A;  5L1I A;  1A3G A;  4ZOL F;  2V4R A;  1ET0 A;  4O7Y A;  3U54 A;  1KC7 A;  3U0G A;  1K1Q A;  2CW7 A;  4YAJ B;  4HNT A;  1RYS A;  5K2M A;  5GON F;  4GKJ H;  3H4B A;  1XMO H;  3BQ0 A;  3EPI A;  1J5E H;  1HNW H;  4TQR A;  1UC8 A;  4UCR A;  2VOB A;  5KT4 A;  4WD3 A;  2CZG A;  3PW4 A;  5BWV A;  2W6O A;  4NXN H;  4JI5 H;  3PW2 A;  4FFM A;  5KT5 A;  4RU9 A;  4LFB H;  2PMZ E;  1P8L A;  2ASD A;  2E2H A;  2EJ0 A;  1RJR A;  5KFL A;  3T54 A;  2W7O A;  2FB9 A;  3KHL A;  2XD4 A;  1VBH A;  4I4T F;  2UVR A;  4DL5 A;  4UCO A;  1FKA H;  4Q8F A;  1I50 A;  1VBG A;  1KEE A;  5FJ8 G;  2BQ3 A;  3TEK A;  3T5L A;  2C2D A;  2UXC H;  4UFZ A;  3TII A;  4FFP A;  2WE6 A;  2WAQ A;  1P16 A;  4XYL B;  1CKN B;  4YAK B;  3GIL A;  2BR0 A;  4J9Q A;  3PVX A;  1R9T A;  3U9T A;  4DL7 A;  1TAE A;  3CSW A;  1TA8 A;  1AUX A;  1AUV A;  5BWW A;  3H0G A;  4JI0 H;  3KXY T;  1B6R A;  4UCT A;  1I1K A;  5LOV F;  1V9P A;  4RUC A;  4DUZ H;  4R7R A;  3MFI A;  4X62 H;  5IYZ F;  3E5N A;  3VOT A;  4J9N A;  2AQ4 A;  3LP8 A;  1SFO A;  1S03 G;  4FE2 A;  5EZY F;  3GIJ A;  4M9U A;  4QIW E;  4JI8 H;  2Y0S A;  1N34 H;  4O2B F;  3VPC A;  2R8G A;  4YP3 A;  3PR4 A;  3K3P A;  1FVI A;  3I12 A;  3T5J A;  4JI3 H;  1L2Z A;  4CKB A;  4U7C A;  2XIG A;  3BAA A;  3JSN A;  4O7L A;  3U55 A;  5KFX A;  3Q8R B;  4NYE A;  4ED8 A;  4PDB A;  2R92 A;  4F4Z A;  5DGA A;  2HJW A;  1VKZ A;  1TWC A;  1E4F T;  3BQ1 A;  4O3O A;  5KG0 A;  4QWE A;  3GIM A;  2R93 G;  5DG9 A;  3G8C A;  4A3L G;  2Q2T A;  2YW2 A;  4F4W A;  4Q43 A;  3GV7 B;  2AGO A;  1M0W A;  2XGP A;  1CS0 A;  1GSH A;  2VQD A;  4IWX A;  3N40 P;  3HOU G;  2YS6 A;  3GB8 B;  3V6K A;  1W96 A;  2V5A A;  3PFF A;  5KT2 A;  3GIK A;  4LF4 H;  5KG6 A;  3GID A;  3BAB A;  4FS1 A;  2JEI A;  4O3P A;  5KG5 A;  4X64 H;  5DQG A;  3LUL A;  3PW7 A;  4GC7 A;  2DIK A;  1K83 A;  2VPQ A;  2J6S A;  2AGP A;  3LWB A;  3TW7 A;  2W9C A;  4IR9 A;  4LF6 H;  1XNR H;  5C4X G;  1EKP A;  3QWU A;  5FR9 A;  3T9B A;  4CKE A;  3TY5 A;  2I87 A;  5KG3 A;  5FLX W;  4AQY H;  2IBK A;  4ED6 A;  1ULZ A;  2JEJ A;  4IRD A;  4J9R A;  4FFO A;  5H80 A;  5CR5 A;  1OWT A;  1IBM H;  5CM0 A;  1B33 N;  1Y1V A;  1RK6 A;  4RNN A;  4C5B A;  5JVL A;  2W8L A;  4ED1 A;  1S0N A;  1GSO A;  3TY9 A;  5DGB A;  4QWA A;  4O3R A;  3EYY A;  4YJ2 F;  4FS2 A;  2YZG A;  3DF7 A;  5KT3 A;  2X5R A;  3R23 A;  3T9C A;  2FJZ A;  4RZQ A;  4C5A A;  2JA6 A;  3VPD A;  3J7A K;  5LMN H;  4A93 G;  2HGS A;  2IP4 A;  1E4G T;  3GQC A;  5DAA A;  5FD5 A;  4APM A;  4DUY H;  1Z2N X;  2COG A;  2NU6 B;  3WO0 A;  4XZ3 B;  1O75 A;  2C2R A;  4YJ3 F;  5DGI A;  3QZ8 A;  1KT8 A;  2X0S A;  1PX2 A;  2XCP A;  4F4X A;  5F9N A;  5D1O A;  3L2P A;  3RIZ A;  3VNN A;  1EZ1 A;  3Q2O A;  2YYA A;  4A2B A;  1I2L A;  5KFP A;  2FE3 A;  3F8N A;  1EKV A;  3K3V A;  4ED2 A;  5CA0 F;  4MV1 A;  2FK2 A;  3ETH A;  5I60 A;  4PZ6 A;  1JKJ B;  3T7A A;  3H20 A;  2VUM A;  3N42 B;  5KKN B;  4RNM A;  4A3F G;  4HNU A;  1S10 A;  4ECU A;  4IRK A;  2HVS A;  4FBU A;  2R7Z G;  5KFH A;  1I1M A;  3MWE A;  4JI4 H;  2ALZ A;  2FLP A;  4L1K A;  5CA1 F;  2W9C B;  3V4S A;  4I50 F;  2HDK A;  5EOY A;  4MA0 A;  4ED7 A;  2VA2 A;  2WB1 E;  4DV0 H;  2GPS A;  2W57 A;  2HVR A;  3RB0 A;  4JV5 H;  2NVX A;  3Q8Q B;  3JRX A;  4O7N A;  4O7R A;  2DPI A;  3H40 A;  5DG7 A;  2IA6 A;  2R7L A;  3UZO A;  3G6V A;  3RTX A;  5KFN A;  2JA5 A;  4O3N A;  4FFN A;  4O4H F;  2JA7 A;  3WWJ A;  5FPO A;  4FFR A;  3AW8 A;  4C5C A;  3MJF A;  4NXM H;  2WTF A;  3M4I A;  4MV9 A;  3GV8 B;  2C2E A;  2R6F A;  4UCU A;  2M05 A;  2GQR A;  2F4V H;  2VA3 A;  3RB4 A;  5DMX A;  3PW0 A;  2ATL A;  4ECR A;  2W9B A;  1I7N A;  2UUC H;  4YR0 A;  2W6Z A;  3PO3 G;  2I80 A;  3U9S A;  4EGQ A;  2ZM6 H;  4EEQ A;  4QJF A;  3JZ6 A;  4HYK A;  4B3S H;  2KSW A;  4IR1 A;  2VR1 A;  3HOY G;  4RB3 C;  4JXU A;  3T5H A;  1N48 A;  3JSL A;  4J9S A;  5D1O B;  1KBL A;  3QZ7 A;  2W6M A;  1KJ8 A;  1EYZ A;  4R8U A;  3ETJ A;  3OUZ A;  3TIG A;  1CQI B;  3CQZ A;  2YZM A;  1BNC A;  4ECQ A;  2DLN A;  5FLM G;  5I5S A;  4CE5 A;  2ZDH A;  3R5H A;  4WHX A;  4DV3 H;  5KFS A;  5DIS C;  5CE8 A;  5FD6 A;  3GTK A;  5JQW A;  2RDJ A;  2UVV A;  5KG2 A;  3G8D A;  5HV6 A;  2V4Q A;  5FPR A;  5DLG A;  5KFM A;  3GTL A;  3W1G A;  5J2U F;  1DGS A;  1EUD B;  4NZO A;  5KFA A;  1TWH A;  4IWY A;  5JH7 F;  4I7H A;  5IYD G;  1Y1W A;  2HGW A;  4JI1 H;  3MR5 A;  4LFA H;  4QWD A;  1Z2P X;  1I3Q A;  4ECV A;  4O2A F;  3UZB A;  2ZDQ A;  1S9F A;  2E5L H;  2UUA H;  4MV7 A;  4NZN A;  1IYE A;  2NU7 B;  4MV6 A;  4O7V A;  4QW8 A;  2UVW A;  4DR4 H;  4O7W A;  4AYB E;  2ZJT A;  5KFR A;  3RGX A;  4KHP H;  2HHF A;  4O3S A;  4RZR A;  2UXD H;  1I6U A;  3T99 A;  3T1H H;  5LYJ F;  5C44 G;  2Q2U A;  2NUA B;  3N44 B;  4LSA A;  4J9L A;  5DG8 A;  5DGH A;  3OHA A;  2FPI B;  1RK5 A;  2R84 A;  2RF4 A;  5T14 A;  3Q8S B;  4ECW A;  4FBT A;  2W9B B;  4ZI7 F;  4DV2 H;  3T9F A;  1GGO A;  2CKZ B;  1EHI A;  4O7Z A;  4QW9 A;  2WYO A;  1B6S A;  2QK4 A;  1CQJ B;  1ZAU A;  3BA8 A;  3MR6 A;  2R8J A;  4JUZ A;  5KFT A;  2ASL A;  2R87 A;  4JI6 H;  1RJQ A;  2QB5 A;  5JQG F;  1IBK H;  4GLX A;  4MAM A;  5HBR B;  2RDI A;  3Q8P B;  1ZQ7 A;  2Y4R A;  3K5H A;  2GLT A;  2NU8 B;  1SYX B;  3PR5 B;  3GTP A;  1KTA A;  4A3K G;  3KRE A;  1B04 A;  1JLL B;  2W6P A;  4MV4 A;  5I5X A;  4RAZ A;  3H0G G;  2XC9 A;  4GKK H;  1XK5 A;  2VUG A;  3HOZ G;  4JI7 H;  2B63 A;  3JZF A;  3M9N B;  4X65 H;  3GV5 B;  2MCT A;  3J80 W;  3PO2 G;  2WAQ E;  4EYH B;  4RAY A;  4U6P A;  1E4E A;  1WH2 A;  4DV6 H;  5BPF A;  4DL3 A;  2YCH A;  4DV1 H;  1XNQ H;  3TY8 A;  1JIH A;  1Y14 B;  3VPB A;  4O4I F;  4O4L F;  4QSH A;  1Z2O X;  4CHI A;  1N56 A;  3HBL A;  3BAC A;  2VQE H;  4LF5 H;  2NVY A;  3JZI A;  5KFD A;  1N32 H;  4PWQ A;  2FPG B;  4PBC A;  2OWO A;  1A0I A;  2P0A A;  3HKZ A;  3LML A;  2R92 G;  2Q7D A;  2Y0S E;  1UC9 A;  2EJ2 A;  5I5T A;  4ECS A;  2E2I A;  2R8I A;  2BQR A;  3HB9 A;  4LH6 A;  4MA5 A;  3RV4 A;  3NGD A;  3OSP A;  2W8K A;  3M9O B;  4C2M A;  2O03 A;  3N8D A;  3WNZ A;  4EFE A;  5I5V A;  5I5W A;  1UNN C;  1ZHS A;  4LMY A;  2UUB H;  1TWA A;  1BJT A;  3HOV G;  4JV0 A;  3RB6 A;  2FPP B;  5DQI A;  4O86 A;  4HR7 A;  3TQT A;  2COJ A;  4ME6 A;  5BYA A;  1KJJ A;  5BWT A;  2ABJ A;  5D1P A;  1C30 A;  4ZQI A;  5BYB A;  3T9A A;  3OHB A;  4MTE A;  2W9A A;  1WSC A;  4CMD A;  4DR1 H;  1HR0 H;  2ASJ A;  5BMV F;  1EKF A;  5EWF A;  1BXR A;  5JUM A;  3RB3 A;  4IRC A;  4DRF A;  3SNO A;  3EPG A;  2FP4 B;  1IYD A;  3JRW A;  3HOW G;  4YHH H;  3OSN A;  5C3E G;  4EGJ A;  2COI A;  1WCM A;  5EWE A;  3GLK A;  4F4Y A;  5HNE A;  1Y1V G;  2J6U A;  4JV1 A;  2Z02 A;  2GQS A;  4NZM A;  4YBZ B;  4JV2 A;  1A0G A;  1KUT A;  3HXL A;  4MV8 A;  4F50 A;  2EIY A;  4DV7 H;  4LF9 H;  2JA6 G;  1IBL H;  2R7N A;  2YZN A;  3RAX A;  5KFG A;  1A9X A;  4J9O A;  4JYA H;  4ZHQ F;  4DIM A;  3W5O A;  1V51 A;  3RAQ A;  1T94 A;  4X66 H;  5IWA H;  3KHG A;  2UVU A;  1SEI A;  1VS0 A;  1JDE A;  3TIN A;  5KFB A;  2XGQ A;  1I2K A;  3KHH A;  4EEY A;  2FKL A;  3GTG A;  4O84 A;  2PBZ A;  4Q45 A;  5C1P A;  5CB4 F;  4CKC A;  2A1H A;  3FKI A;  2C22 A;  3GDE A;  4QWC A;  5BWU A;  5KFU A;  1TWG A;  2VUM G;  5KFQ A;  2ZGI A;  4K0K H;  3FDS A;  2I8C A;  2PMZ A;  4ECZ A;  4YR3 A;  2IMW P;  5C8Y F;  3TQ1 A;  2YU9 A;  5KFO A;  4TUY F;  2W6N A;  1XDN A;  4LH7 A;  1PK8 A;  5KFV A;  3RV3 A;  5KG7 A;  4YQW A;  4B3R H;  1IOW A;  3UQ8 A;  4J0M A;  2FLL A;  4RB1 A;  5EDW A;  3VMM A;  3K5I A;  1A48 A;  2VPS A;  2UU9 H;  3GTO A;  3L4K A;  1T36 A;  4DR6 H;  2VQF H;  2EJ3 A;  2FLN A;  2JA5 G;  2JA7 G;  1W93 A;  4FFL A;  4UUG A;  5KX5 F;  4RCN A;  1RJP A;  5BR8 H;  3OTO H;  3AX6 A;  1N36 H;  1I7L A;  5KFE A;  3RR5 A;  1TWF A;  1SCU B;  3NC0 B;  3N43 B;  2FK1 A;  5KG4 A;  2ZDG A;  1XMQ H;  4HQ6 A;  4TV9 F;  2HHH H;  1HNX H;  4A3C G;  2CW8 A;  5L1K A;  2DAA A;  5C5J A;  3GTJ A;  2YS7 A;  3C0F B;  5BPH A;  4QIW A;  4BY1 G;  2HVQ A;  5F9L A;  5L1J A;  2OLS A;  4EBE A;  3JAM W;  4O3Q A;  3PW5 A;  4A3G G;  2V58 A;  1GLV A;  2YRW A;  2YL2 A;  1M6V A;  5E25 A;  4J9P A;  1JDB B;  1KJ9 A;  1KJI A;  4O83 A;  5I5Y A;  3N6X A;  2C35 B;  3KAJ A;  4PZ7 A;  4MTD A;  2W70 A;  5KFZ A;  2BQU A;  3T9D A;  2QYZ A;  3KAK A;  3GTQ A;  1K1S A;  2CQY A;  3HO8 A;  1CE8 A;  4DR7 H;  1GSA A;  2V9W A;  4RUA A;  1Y1W G;  2AGQ A;  4G3I A;  4RB2 C;  4CMF A;  4EG0 A;  4Q4D A;  4MV3 A;  3I4N G;  4A3D G;  1N33 H;  4BWS C;  3T9E A;  4IAJ A;  1ZHQ A;  4O7T A;  4O81 A;  3KHR A;  5A2Q W;  4R8U B;  1S0M A;  2R93 A;  4E4T A;  4O4J F;  1DIK A;  3RFC A;  3R9R A;  4EQ5 A;  4LF8 H;  4TV8 F;  4B3T H;  2R86 A;  1BGW A;  5JVD F;  1JX4 A;  3J81 W;  2JEG A;  3R5X A;  4B3M H;  3N41 B;  3MR2 A;  2W6Q A;  4EFB A;  4LSX A;  4DV4 H;  3WWI A;  3DTG A;  4DAA A;  2HIV A;  3DAA A;  3RJ0 A;  3WWH A;  3V6J A;  3UFX B;  3R5F A;  2QF7 A;  3QQM A;  5KFI A;  3GJX B;  3SGI A;  1MZB A;  3FMA A;  3GIP A;  4M0J A;  2YRX A;  4DL6 A;  1S97 A;  2UXB H;  5C1O A;  3RGZ A;  1OBD A;  2FMA A;  2SCU B;  3W1B A;  3SI8 A;  2J9G A;  4O82 A;  1X9N A;  4ETS A;  1DAA A;  2PVP A;  1M7J A;  3WO1 A;  5KT6 A;  3L4J A;  3Q1K A;  4BY7 G;  1RYR A;  2HHF B;  4A3E G;  1S0O A;  4QWB A;  3MWM A;  3N6R A;  2DZD A;  4Q8E A;  3DTF A;  2WDT A;  4IIJ F;  1G2W A;  4Q44 A;  3VA7 A;  4XX0 B;  2C00 A;  1OBG A;  4K6N A;  4EBC A;  2R7M A;  4GLW A;  4DLK A;  4HN2 A;  4LF7 H;  1CKM A;  5CAE B;  2B63 G;  2CNU A;  5J2T F;  2J6T A;  2DWC A;  3RUP A;  4DR2 H;  2PN1 A;  3GII A;  3PN1 A;  4J9K A;  3MWD A;  4CC6 A;  3KYH C;  3HOX G;  4DL4 A;  5IYB G;  1HNZ H;  5LP6 F;  4DQN A;  2R8K A;  4IHJ F;  5IP7 G;  4TVI A;  2RGV A;  2CFM A;  2YWV A;  3M9M B;  1WR2 A;  4I55 F;  3S24 A;  5I47 A;  3GIQ A;  5LMU H;  4HNV A;  1CKO A;  4EYI B;  4ED0 A;  3PZP A;  2RGR A;  4A3J G;  4J9M A;  2Z04 A;  1DV1 A; 
#chains in the Genus database with same CATH homology
 4I7H A;  5IT9 W;  4LFA H;  4JI1 H;  4PDB A;  4RB0 A;  1Z2P X;  4K0K H;  4OX9 H;  2E5L H;  2UUA H;  1E4F T;  4MV7 A;  2Q2T A;  1GYF A;  4DR4 H;  4FM9 A;  1XDN A;  4LH7 A;  1M0W A;  2ZJT A;  3RGX A;  4B3R H;  4KHP H;  2UXD H;  3N40 P;  3UQ8 A;  4J0M A;  1I6U A;  4RB1 A;  3T1H H;  3GB8 B;  4LFC H;  2Q2U A;  3N44 B;  4LSA A;  2VPS A;  2UU9 H;  4LF4 H;  3CVZ A;  3L4K A;  3BAB A;  4DR6 H;  2VQF H;  4X64 H;  3OTO H;  1I94 H;  1XNR H;  4LF6 H;  5BR8 H;  4E6N A;  4DV2 H;  3RR5 A;  2XIG A;  4A2A A;  3QWU A;  4AQY H;  5FLX W;  3TY5 A;  2WYO A;  3NC0 B;  3BA8 A;  3KAL A;  3N43 B;  3NBY B;  1XMQ H;  1FJG H;  2HHH H;  1M0T A;  3RF2 A;  1HNX H;  4JI6 H;  1IBK H;  2CW8 A;  4UCS A;  4GLX A;  1IBM H;  3IG0 A;  1AN7 A;  1SYX B;  3C0F B;  4YY3 H;  3TY9 A;  2HVQ A;  3EYY A;  1B04 A;  2HIX A;  3DF7 A;  4RAZ A;  3JAM W;  4DR5 H;  4M7E A;  4GKK H;  4RZQ A;  1XK5 A;  2VUG A;  4JI7 H;  3J7A K;  4X65 H;  5LMN H;  4PZ8 A;  2MCT A;  1CKN A;  1E4G T;  2HGS A;  3N6X A;  4RAY A;  3J80 W;  4DV5 H;  4PZ7 A;  3KAJ A;  5FD5 A;  4APM A;  4MTD A;  4DUY H;  1Z2N X;  1WH2 A;  4DV6 H;  1O75 A;  3KAK A;  4DR3 H;  3NBZ B;  2YCH A;  4JI2 H;  4DV1 H;  1XNQ H;  1S68 A;  3TY8 A;  4JYA H;  5D1O A;  3L2P A;  3RIZ A;  3T1Y H;  3VNN A;  1Z2O X;  4DR7 H;  4A2B A;  4UCV A;  5LL6 b;  2FE3 A;  4Q0Y A;  2VQE H;  4CC5 A;  3F8N A;  4RB2 C;  3K3V A;  4LF5 H;  1N32 H;  2OWO A;  1A0I A;  1N33 H;  4PZ6 A;  3LML A;  3H20 A;  4BWS C;  3N42 B;  4IAJ A;  3BA9 A;  1ZHQ A;  1N36 H;  1HR0 H;  2HVS A;  2CW7 A;  5A2Q W;  4LH6 A;  4EQ5 A;  4LF8 H;  4JI4 H;  2O03 A;  1XMO H;  4EFE A;  4GKJ H;  4LMY A;  1ZHS A;  4B3T H;  1J5E H;  2UUB H;  1BGW A;  1HNW H;  1BJT A;  4B3M H;  4UCR A;  5EOY A;  2VOB A;  3J81 W;  3N41 B;  4DV0 H;  2W57 A;  4EFB A;  2HVR A;  4LSX A;  4DV4 H;  4NXN H;  4JI5 H;  2HIV A;  4JV5 H;  3RJ0 A;  4LFB H;  1P8L A;  3RTX A;  5D1P A;  3GJX B;  3FMA A;  1MZB A;  4MTE A;  4DR1 H;  5FPO A;  2UXB H;  3RGZ A;  4NXM H;  4UCO A;  4DRF A;  3W1B A;  3M4I A;  1X9N A;  4MV9 A;  4ETS A;  1FKA H;  4UCU A;  3L4J A;  2F4V H;  4YHH H;  1DGS A;  2UXC H;  4UFZ A;  2WE6 A;  3MWM A;  1P16 A;  1CKN B;  2UUC H;  2WDT A;  2ZM6 H;  4B3S H;  4EEQ A;  2KSW A;  3HXL A;  4RB3 C;  1TAE A;  3JSL A;  1TA8 A;  4DV7 H;  4LF9 H;  4JI0 H;  4LF7 H;  1IBL H;  1CKM A;  4UCT A;  3KXY T;  5D1O B;  1V9P A;  4DUZ H;  4R7R A;  4X62 H;  4DR2 H;  3PN1 A;  3W5O A;  4CC6 A;  1S03 G;  3KYH C;  4X66 H;  5IWA H;  1HNZ H;  4JI8 H;  1SEI A;  4DV3 H;  1N34 H;  1VS0 A;  5DIS C;  2RGV A;  2CFM A;  5FD6 A;  1FVI A;  4JI3 H;  3S24 A;  5LMU H;  2RGR A;  1L2Z A;  1CKO A;  5FPR A;  3W1G A;  3BAA A;  3JSN A;  3GDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...