1XDNA

High resolution crystal structure of an editosome enzyme from trypanosoma brucei: rna editing ligase 1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
265
structure length
265
Chain Sequence
QSDFSPYIEIDLPSESRIQSLHKSGLAAQEWVACEKVHGTNFGIYLINQGDHEVVRFAKRSGIMDPNENFFGYHILIDEFTAQIRILNDLLKQKYGLSRVGRLVLNGELFGAKYKHPLVPKSEKWCTLPNGKKFPIAGVQIQREPFPQYSPELHFFAFDIKYSVSGAEEDFVLLGYDEFVEFSSKVPNLLYARALVRGTLDECLAFDVENFMTPLPALLGLGNYPLEGNLAEGVVIRHVRRGDPAVEKHNVSTIIKLRCSSFMEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA editing ligase MP52
publication title High resolution crystal structure of a key editosome enzyme from Trypanosoma brucei: RNA editing ligase 1.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Ligase
total genus 75
structure length 265
sequence length 265
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1xdnA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1xdnA01
3NBYB 1XDNA 3GDEA 3BABA 5FPOA 1CKNB 4E6NA 5D1OB 1DGSA 5DISC 3JSNA 4DRFA 3VNNA 4EFBA 3KYHC 4LH6A 3NC0B 3BAAA 4PZ6A 3TY5A 1B04A 1A0IA 1XK5A 3TY9A 3JSLA 1V9PA 1CKOA 2OWOA 4PZ8A 4PZ7A 3S24A 2HIXA 1VS0A 2HVQA 3GB8B 3W1GA 4UFZA 3L2PA 1FVIA 5D1PA 1P16A 3QWUA 3TY8A 3UQ8A 1CKMA 4UCUA 4UCRA 4UCOA 2HIVA 4UCTA 2VUGA 1P8LA 2Q2TA 3NBZB 4EEQA 4UCSA 3RTXA 1TAEA 1TA8A 4GLXA 3RR5A 4CC5A 1S68A 3BA8A 3PN1A 4UCVA 5FPRA 3W5OA 2Q2UA 4LH7A 2HVSA 3W1BA 1X9NA 4CC6A 3BA9A 1CKNA 2CFMA 5D1OA 4EQ5A 3GJXB 4EFEA 2HVRA
chains in the Genus database with same CATH superfamily
2Z04A 2F4VH 3GDEA 3FKIA 5KFOA 4J9PA 5FNVF 5C4XG 2UU9H 5DG7A 1VBHA 2R87A 3H40A 2HDKA 3MJFA 5EWFA 1I2KA 2V4RA 2BQ3A 4JV1A 4QSHA 5IT9W 3VPDA 2W6ZA 5KFGA 1EKFA 5KT4A 3GTJA 1IYDA 2FPGB 2R86A 3TIIA 1BJTA 4Q8EA 3LULA 3WWHA 4LF9H 1EYZA 1RYSA 4BXXG 4DRFA 1BXRA 4FM9A 4ECRA 3TQTA 4A3EG 4TVIA 4RUAA 2DZDA 1OBGA 1M0WA 4C5CA 4E4TA 5C44G 4YP3A 3H3VH 1KT8A 2OH2A 1CS0A 2DABA 3V4SA 4ECVA 2UUCH 3BAAA 3Q8PB 4PZ6A 3RAQA 3I4MG 2R7KA 5I5XA 5EWGA 3HXLA 2X0SA 3JRXA 5LOVF 1M7JA 3G8DA 3WWIA 2PMZE 4A3DG 5FLMG 4WD3A 5IWAH 2OWOA 1PK8A 3KHRA 3JZIA 3H4DA 4PZ7A 3U9SA 3S24A 2W9CA 3ETHA 5DAAA 5DQHA 4DV0H 1V4YA 3RB4A 3KREA 4M7EA 1N34H 3GB8B 3KAJA 2R85A 5JH7F 2Y4RA 4QIWA 2FLPA 2E2IA 2CW7A 4YBZB 1I94H 4UFZA 3L2PA 1TWFA 4O82A 1AUVA 1FVIA 2AU0A 4XYMB 2UXDH 4A3IG 3EPIA 4JXUA 2J9GA 3U0GA 3QFFA 3V6HA 5HBRB 2BQUA 5KG2A 3QWUA 4YR2A 3L4KA 4MV7A 3TY8A 2J6SA 2YZGA 4GKJH 4J9SA 2GLTA 4A2BA 3MFIA 2HHHH 4JI5H 4O7YA 4I55F 3RJ0A 4NZNA 1WRVA 2V5AA 3R9RA 1KJIA 3R23A 4A3KG 3GLKA 1M0TA 1RJRA 3RAXA 3PZPA 3QQMA 2R92G 3SE7A 2XIGA 2UUBH 1DIKA 1UC8A 5KFAA 3MR3A 4U6PA 4IRDA 4DR6H 4UUGA 5JQWA 2YRXA 4A3GG 1ZAUA 2Q2TA 2W7PA 4DV3H 4HNVA 5CAEB 3R5FA 5CM0A 3TW7A 5JQGF 3T1YH 3CQZA 3E5NA 1EZ1A 2WAQA 2UVVA 2HGSA 4ZOLF 4LFBH 3OSNA 3HKZA 3OTOH 1EHIA 5KFJA 3LWBA 2ZDGA 5KFDA 2XD4A 5BYBA 5LYJF 5BMVF 3PR4A 4QIWE 3HOXG 2RF4A 3PW7A 1VBGA 2W70A 1S97A 1GLVA 4YJ3F 3GTMA 2VPSA 3WNZA 2WB1A 1S68A 2GQRA 4BBSG 4TM5A 2ZGIA 1RK5A 2R8IA 1T3NA 4BY7G 2ZDQA 5DG9A 3VMMA 5I60A 3GIMA 4LH7A 3H4BA 1DV2A 4J9MA 3PW5A 1SFOA 3GTQA 1X9NA 2X5RA 3BA9A 2P0AA 5I5WA 5CA1F 3G6XA 4C5BA 4Q4CA 5L1JA 4MA5A 1XMQH 2V9WA 1E4FT 3KAKA 5BWRA 4X65H 2JEJA 2R8KA 5FD6A 4O84A 4YB8B 4DV6H 4I4TF 4DV2H 3PO2G 2ASJA 4EBDA 2HVRA 2RGRA 1ULZA 3R5XA 1S9FA 4O7ZA 4QWDA 5C8YF 1XDNA 3LQSA 2C00A 5KG7A 2WAQE 4RNMA 2W6PA 5DG8A 4JI8H 3HKZE 4TQRA 5E25A 4ECZA 3I4NG 2W7OA 5C5JA 1JLLB 1CKNB 4DUZH 2YRWA 5KFLA 1VAJA 1GYFA 1DGSA 2W9BA 4KHPH 5KS8A 2Z02A 5DISC 3JSNA 3FMAA 3GTPA 3MWDA 4EG0A 3ETJA 5KX5F 3RF2A 4DL5A 2C2DA 3BQ0A 4IRKA 2R8GA 2R7NA 1KJQA 4PBCA 3Q1KA 2J6TA 2VA2A 4RCNA 4O3OA 3GIPA 3RBEA 4EFBA 4DR3H 3SI8A 1RYRA 3OUUA 4FE2A 1HNXH 1IBMH 1G2WA 3NC0B 3BQ2A 5IP9G 3KXYT 5KG0A 2COIA 3WO1A 4RNOA 1GO3E 3M4IA 4F50A 2CNQA 2MCTA 1Y14B 5I5YA 4A3CG 1Z2OX 1PX2A 4GLWA 4ZI7F 4XZ3B 3JSLA 2VPQA 5BPFA 4QW8A 4QWBA 4RU9A 1JX4A 3NGDA 1CKOA 4PZ8A 3K5IA 5IYDG 3PW4A 5J2TF 2AGQA 3T1HH 4FBTA 3V6JA 4FFLA 2ABJA 2WDTA 1VS0A 2HVQA 5BWUA 5L1KA 3U54A 4X66H 2QK4A 4DV4H 1TWHA 4J9KA 1HR0H 4ED2A 2IP4A 2QB5A 2V4QA 5IYZF 4DAAA 2NU6B 2FMAA 4TV8F 2RDJA 1JDBB 1JKJB 5D1PA 3TW6A 2ALZA 2DPJA 1P16A 2IMWP 2FB9A 4LFAH 3JAMW 1I50A 3QZ7A 1KJ9A 4J0MA 5DQGA 4CE5A 4B3MH 1SEIA 2W9CB 2W71A 2JEGA 4EGQA 3N8DA 1KBLA 2CNUA 2VQDA 3U9TA 4JV2A 3N6RA 5I5SA 4IWXA 2GPWA 2SCUB 2YZNA 3JZ6A 1V51A 4J9LA 1L2ZA 1TWGA 4RB1A 4DR1H 4UCOA 4YY3H 1I1LA 4L1KA 3EPGA 2J6UA 2Q7DA 4EBEA 2IBKA 5KFNA 4F4WA 4O4JF 4MV8A 1RJPA 3RGZA 4A3MG 5EZYF 4EEQA 1IBLH 2R8HA 5D8DA 5IYCG 1I1MA 4CMDA 5KG4A 3KHGA 4F4YA 4ECSA 2FK3A 4MV1A 1W93A 3RTXA 3C0FB 5L9XA 4Q45A 4FFOA 4M9UA 5GONF 1DAAA 2WTFA 1O75A 5C1OA 2VQFH 2CNVA 3J81W 4DR4H 2R92A 1SCUB 3N42B 2RDIA 4FS1A 4AYBA 1FJGH 1WCMA 4WBNF 1ZHQA 5KT6A 2EJ0A 3SNOA 1BNCA 4J9OA 2NVXA 3VPCA 3BA8A 1A3GA 3PN1A 1T94A 5KFYA 4C5AA 5DLFA 4LFCH 4FFRA 4R8UB 4DL3A 4K0KH 4RB0A 3BJYA 1VKZA 3DF7A 4RAZA 5KFKA 2YS6A 1I6UA 2NU9B 3AYHB 1UC9A 2A1HA 1WCMG 5KFPA 2UXCH 1AUXA 5KFFA 4A3BG 2HGXA 1T36A 5KFBA 5BWXA 3HB9A 2YYAA 4JUZA 4ED7A 3HOYG 4R8UA 2R84A 1A0GA 4ED8A 5D1OA 5I5UA 1ET0A 4FFMA 2WYOA 5KFUA 2UUAH 5KKNB 4NLGA 2JA6A 3PFFA 1UNNC 1EKVA 4B3SH 2YL2A 4O3PA 3CEBA 5DGAA 3K3VA 3L4JA 4CKCA 1Z2PX 3NBYB 5KG6A 4YAJB 3N44B 4RNNA 4QWEA 4FU0A 3GTLA 4LF8H 3CVZA 1C3OA 3M9NB 2R93G 3T9EA 4RUCA 3GQCA 2CW8A 5FPOA 4JV0A 4EBCA 1S0OA 2JA6G 5KT7A 4QWAA 4MTEA 5LA6F 3HOUG 1KUTA 5KFWA 5EOYA 4K6NA 2NVYA 5DLGA 2W6OA 4E6NA 1SYXB 4ECYA 5LL6b 3HO8A 4AYBE 3I12A 5HNEA 4PDBA 3HOVG 5JUMA 3Q8QB 3GV8B 1WH2A 2FK1A 4MA0A 2C22A 4HN2A 5FLXW 2JA7A 1M6VA 3VNNA 5KFCA 2JEIA 1EUCB 1KC7A 4O7RA 1WSCA 1MZBA 4QW9A 2XCAA 1OWTA 3T5LA 5K2MA 5T14A 1HNZH 1KTAA 3BG5A 1Y1WA 3KYHC 3U55A 3T5JA 2C28A 3MR2A 3PW2A 2R7LA 5FD5A 4DLKA 4MAMA 4QWCA 2JA7G 4O7WA 4DL4A 4Y8VB 3G6VA 1B04A 5KFQA 1A0IA 4DR2H 4DR7H 1XK5A 1I7NA 2W9BB 1JIHA 4IAJA 4O7TA 4ED6A 1Y1WG 1JXLA 2E2HA 4Q43A 2FLLA 1B6RA 5FR9A 1E4GT 3GIQA 4JI4H 4MV9A 4RB2C 2HG8A 4PWQA 4OX9H 3MWEA 1GGOA 1C30A 5I5TA 2ATLA 4NXMH 2CZGA 4YQWA 2C2RA 4CKBA 1W96A 2FJZA 2Y0SA 5CB4F 4JI2H 2WB1E 3PVXA 3GIIA 1K1QA 3Q2OA 2FKLA 4HQ6A 2VUMA 2CKZB 5BPHA 4FFPA 3J80W 4GC7A 4B3TH 5BWWA 4JYAH 2W6QA 3JRWA 5KG3A 1ZQ7A 1CQJB 3PO3G 1IOVA 4TV9F 4Q8FA 2FK2A 3RB0A 4JI1H 2VUMG 2M05A 5K3WA 2YW2A 4UCUA 2JA5G 3TQ1A 4HR7A 5I5VA 5KFTA 3DTFA 4YHHH 1EUDB 3LMLA 3V4ZA 1N48A 3Q8RB 1HNWH 1J5EH 4DL6A 2B63G 1N33H 5BR8H 4RB3C 1I7LA 4O7SA 2QF7A 2EJ3A 4YJ2F 2W6NA 2HJWA 4DR5H 4JI0H 4JI7H 5L1IA 3GIKA 4FGRA 4FS2A 3G8CA 4UCSA 5F9NA 3T9BA 3M9MB 2NU8B 4EGJA 3VOTA 2YZMA 2W57A 1E4EA 2R7ZG 4LF7H 2Y0SE 2GQSA 2VQEH 1TAEA 2C2EA 3WWJA 2VA3A 3OHBA 1TA8A 2XGPA 2UVUA 4LF4H 4O81A 4GC6A 4GLXA 3N40P 3T9FA 2DPIA 4A93G 4HNUA 3MFHA 1TWCA 1I1KA 4CC5A 2PN1A 4X64H 3GILA 4X62H 5IYBG 3RIZA 2HGWA 4UCVA 3SGIA 3V6KA 2R7MA 3F8NA 3J7AK 3AW8A 3ORQA 4O3SA 5LXTF 2YWVA 3H0GA 2Q2UA 5KFZA 4U7CA 5KT2A 4ED3A 1S0NA 2FP4B 3FKIG 4F4XA 2HVSA 1K1SA 4IR9A 3W1BA 2RGVA 5BYAA 1GSHA 4CHIA 1GSOA 2XC9A 2I87A 4CC6A 3IN5A 3G6YA 1JDEA 3R5HA 4J9NA 4ZQIA 1K83A 2I8CA 1IOWA 3H0GG 4JV5H 1I2LA 2CFMA 3UZBA 1GSAA 4EQ5A 4YAKB 3TEKA 2BQRA 4O2AF 5KG1A 5IP7G 3WO0A 4ZHQF 3T5KA 4NZMA 3T9AA 1XNRH 3RB3A 4Q44A 4ME6A 4EFEA 5CA0F 3MWMA 4QJFA 2DIKA 3Q8SB 5DGBA 3MR5A 3HOWG 2XGQA 2R82A 4ECXA 3NUAA 2W8LA 4RZQA 4ECQA 2VR1A 3BABA 1XNQH 4LF6H 3CSWA 5DGIA 1IBKH 3UFXB 3TIGA 2FLNA 3GV5B 2ASLA 4YR0A 5DMXA 4A3LG 3RUPA 5LMUH 2DAAA 3T54A 1Y1VA 4I7HA 4O4IF 3DAAA 3T7AA 1CE8A 4BWSC 5JVDF 3JZFA 4FBUA 4HNTA 1A9XA 5D1OB 5BWTA 2CQYA 5LMNH 4CKEA 2ZJTA 4RAYA 4A2AA 4YR3A 3TINA 2R6FA 3KHLA 1FKAH 4ECTA 1Y1VG 2XCPA 4AQYH 3GV7B 5CE8A 2ODTX 3OSPA 4MV6A 4Q4DA 3N43B 3M9OB 5HV6A 5A2QW 2R93A 4LH6A 4DIMA 5I47A 1Z2NX 1DV1A 3GTOA 4JI6H 4NYEA 4O7NA 2FE3A 4BY1G 2EJ2A 3TY5A 5KFHA 2YZLA 5KFMA 1N32H 3TY9A 4APMA 4FFNA 1R9TA 1A48A 4ECUA 2IA6A 1V9PA 2PBZA 4O3QA 3OUZA 3FDSA 4Q0YA 3T9DA 2FPIB 3RFCA 2JEFA 2R8JA 2UXBH 5F9LA 4A3JG 4LSAA 4JI3H 3N41B 3K5HA 2EIYA 2I80A 2V58A 4O7LA 2HIXA 5DGHA 3EYYA 4ED0A 4DL2A 1OBDA 5KFXA 4IR1A 4O3RA 4J9RA 1RJQA 4J9QA 3BQ1A 4CMFA 4IRCA 2YCHA 3W1GA 3HBLA 5DQIA 2W9AA 3T5HA 2ASDA 2UVRA 1CQIB 3RGXA 1ZETA 3N6XA 4IIJF 4NZOA 3RV3A 5C1PA 4DV5H 2E5LH 2COJA 3T9CA 5EDWA 2AGPA 1I3QA 2AQ4A 5KFEA 4IZOA 3RV4A 4EYHB 3UZOA 5LP6F 1B6SA 3UQ8A 4RZRA 3MR6A 5FJ8G 4I50F 1N36H 4DV7H 1CKMA 3UYYA 3KTMA 4LMYA 4DQNA 3VPBA 5J2UF 4BBRG 3HT5A 1WR2A 4UCRA 2OLSA 4C2MA 5KG5A 1S10A 3IG0A 5CR5A 1B33N 3GTGA 5BWVA 2JA8G 3OHAA 1BGWA 4ETSA 2YU9A 2HIVA 1EKPA 4UCTA 2VUGA 3ORRA 4O4HF 4IWYA 1P8LA 2HHFB 4O2BF 2KSWA 1N56A 2WE6A 5KT5A 5KFVA 3HOZG 3NBZB 2DLNA 3GTKA 4EEYA 2O03A 2ZM6H 2GPSA 4R7RA 3GIJA 4DUYH 4F4ZA 2JA5A 3BACA 4XX0B 5KFRA 2W6MA 3RBDA 4O4LF 2HHFA 1S03G 2AGOA 2B63A 3K3PA 2NU7B 3RR5A 4TUYF 5JVLA 1RK6A 5L1LA 1S0MA 1AN7A 4O83A 5EWEA 4O7VA 4MV3A 2ZDHA 4O86A 2DWCA 2C35B 2QYZA 4LSXA 5C3EG 4A3FG 5FPRA 3PW0A 4B3RH 1KJJA 4MV4A 2VOBA 4DV1H 2COGA 3W5OA 3LP8A 5KT3A 3QZ8A 3KHHA 3AX6A 4ECWA 2UVWA 4M0JA 3KALA 1KJ8A 4EYIB 3DTGA 4XYLB 2XCLA 1E4EB 3H20A 2W8KA 3VA7A 4NXNH 1XMOH 4ED1A 2R7ZA 4LF5H 2PVPA 2V59A 3T99A 1TWAA 5KFIA 1CKNA 4O3NA 4HYKA 2FPPB 2BR0A 2NUAB 1IYEA 5H80A 2PMZA 4IHJF 3RB6A 4GKKH 3PR5B 5KFSA 4TQSA 4WHXA 2YS7A 3GJXB 1KEEA 4DL7A 4MTDA 1ZHSA 4G3IA 3GIDA
chains in the Genus database with same CATH topology
1Z2PX 3NBYB 2F4VH 1XDNA 3GDEA 3N44B 4RZQA 1XNQH 3BABA 4LF8H 3CVZA 2UU9H 1IBKH 4LF6H 4JI8H 2CW8A 5FPOA 5LMUH 4I7HA 5IT9W 4MTEA 4BWSC 1CKNB 1BJTA 5EOYA 4DUZH 4E6NA 5D1OB 1SYXB 5LMNH 5LL6b 4LF9H 1DGSA 1GYFA 2ZJTA 4RAYA 4A2AA 4KHPH 5DISC 3JSNA 3FMAA 4PDBA 4DRFA 1WH2A 4FM9A 3RF2A 1FKAH 5FLXW 3VNNA 4AQYH 1M0WA 1MZBA 1HNZH 4EFBA 4DR3H 3N43B 1HNXH 1IBMH 5A2QW 3KYHC 4LH6A 3NC0B 2UUCH 1Z2NX 3KXYT 3BAAA 5FD5A 4JI6H 4PZ6A 2HHHH 2FE3A 3TY5A 3M4IA 4DR2H 1B04A 2MCTA 1A0IA 3HXLA 4DR7H 1XK5A 1N32H 1Z2OX 4IAJA 3TY9A 4APMA 3JSLA 1V9PA 1E4GT 5IWAH 1CKOA 2OWOA 4PZ8A 4MV9A 4Q0YA 4RB2C 4JI4H 2UXBH 4OX9H 4PZ7A 4LSAA 3S24A 3N41B 4JI3H 3T1HH 4DV0H 3EYYA 2HIXA 1VS0A 2HVQA 2WDTA 4M7EA 3GB8B 3KAJA 4NXMH 4X66H 4JI2H 4DV4H 2CW7A 1HR0H 2YCHA 3W1GA 4B3TH 3J80W 3RGXA 4UFZA 3L2PA 1I94H 4JYAH 1FVIA 3N6XA 5D1PA 1P16A 2UXDH 4LFAH 2E5LH 4DV5H 3JAMW 3QWUA 4J0MA 3L4KA 3TY8A 4MV7A 4B3MH 4JI1H 4GKJH 1SEIA 3UQ8A 4A2BA 4JI5H 1N36H 4DV7H 3RJ0A 1CKMA 4UCUA 4LMYA 4YHHH 3L4JA 1M0TA 3LMLA 2XIGA 1HNWH 4UCRA 1J5EH 2UUBH 1N33H 1L2ZA 5BR8H 3IG0A 4RB3C 4DR6H 4RB1A 4DR1H 4UCOA 1BGWA 4YY3H 4ETSA 2HIVA 4UCTA 2VUGA 4DR5H 1P8LA 2Q2TA 4JI0H 2KSWA 4DV3H 2WE6A 4JI7H 3NBZB 3RGZA 3T1YH 4EEQA 1IBLH 4UCSA 2O03A 2ZM6H 2HGSA 4R7RA 4LFBH 2W57A 4DUYH 3OTOH 2RGRA 3RTXA 3C0FB 4LF7H 2VQEH 1TAEA 2VQFH 1O75A 1S03G 4DR4H 1TA8A 3J81W 4LF4H 3N42B 4GLXA 3RR5A 2VPSA 3N40P 1FJGH 1ZHQA 1AN7A 4CC5A 1S68A 4X64H 3BA8A 4X62H 3PN1A 4LSXA 3RIZA 4UCVA 5FPRA 4LFCH 4B3RH 3F8NA 3J7AK 2VOBA 4DV1H 3W5OA 4K0KH 2Q2UA 4RB0A 3DF7A 4RAZA 1I6UA 3KALA 4LH7A 2HVSA 3W1BA 2RGVA 2UXCH 1X9NA 3H20A 4NXNH 4CC6A 1XMOH 3BA9A 4LF5H 1CKNA 4JV5H 2CFMA 1XMQH 5D1OA 4EQ5A 1N34H 2WYOA 1E4FT 2UUAH 3KAKA 4X65H 4GKKH 5FD6A 3GJXB 1XNRH 4DV6H 4B3SH 4MTDA 1ZHSA 4EFEA 3MWMA 4DV2H 2HVRA 3K3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBY B;  1XDN A;  3GDE A;  3BAB A;  5FPO A;  1CKN B;  4E6N A;  5D1O B;  1DGS A;  5DIS C;  3JSN A;  4DRF A;  3VNN A;  4EFB A;  3KYH C;  4LH6 A;  3NC0 B;  3BAA A;  4PZ6 A;  3TY5 A;  1B04 A;  1A0I A;  1XK5 A;  3TY9 A;  3JSL A;  1V9P A;  1CKO A;  2OWO A;  4PZ8 A;  4PZ7 A;  3S24 A;  2HIX A;  1VS0 A;  2HVQ A;  3GB8 B;  3W1G A;  4UFZ A;  3L2P A;  1FVI A;  5D1P A;  1P16 A;  3QWU A;  3TY8 A;  3UQ8 A;  1CKM A;  4UCU A;  4UCR A;  4UCO A;  2HIV A;  4UCT A;  2VUG A;  1P8L A;  2Q2T A;  3NBZ B;  4EEQ A;  4UCS A;  3RTX A;  1TAE A;  1TA8 A;  4GLX A;  3RR5 A;  4CC5 A;  1S68 A;  3BA8 A;  3PN1 A;  4UCV A;  5FPR A;  3W5O A;  2Q2U A;  4LH7 A;  2HVS A;  3W1B A;  1X9N A;  4CC6 A;  3BA9 A;  1CKN A;  2CFM A;  5D1O A;  4EQ5 A;  3GJX B;  4EFE A;  2HVR A; 
#chains in the Genus database with same CATH topology
 2Z04 A;  2F4V H;  3GDE A;  3FKI A;  5KFO A;  4J9P A;  5FNV F;  5C4X G;  2UU9 H;  5DG7 A;  1VBH A;  2R87 A;  3H40 A;  2HDK A;  3MJF A;  5EWF A;  1I2K A;  2V4R A;  2BQ3 A;  4JV1 A;  4QSH A;  5IT9 W;  3VPD A;  2W6Z A;  5KFG A;  1EKF A;  5KT4 A;  3GTJ A;  1IYD A;  2FPG B;  2R86 A;  3TII A;  1BJT A;  4Q8E A;  3LUL A;  3WWH A;  4LF9 H;  1EYZ A;  1RYS A;  4BXX G;  4DRF A;  1BXR A;  4FM9 A;  4ECR A;  3TQT A;  4A3E G;  4TVI A;  4RUA A;  2DZD A;  1OBG A;  1M0W A;  4C5C A;  4E4T A;  5C44 G;  4YP3 A;  3H3V H;  1KT8 A;  2OH2 A;  1CS0 A;  2DAB A;  3V4S A;  4ECV A;  2UUC H;  3BAA A;  3Q8P B;  4PZ6 A;  3RAQ A;  3I4M G;  2R7K A;  5I5X A;  5EWG A;  3HXL A;  2X0S A;  3JRX A;  5LOV F;  1M7J A;  3G8D A;  3WWI A;  2PMZ E;  4A3D G;  5FLM G;  4WD3 A;  5IWA H;  2OWO A;  1PK8 A;  3KHR A;  3JZI A;  3H4D A;  4PZ7 A;  3U9S A;  3S24 A;  2W9C A;  3ETH A;  5DAA A;  5DQH A;  4DV0 H;  1V4Y A;  3RB4 A;  3KRE A;  4M7E A;  1N34 H;  3GB8 B;  3KAJ A;  2R85 A;  5JH7 F;  2Y4R A;  4QIW A;  2FLP A;  2E2I A;  2CW7 A;  4YBZ B;  1I94 H;  4UFZ A;  3L2P A;  1TWF A;  4O82 A;  1AUV A;  1FVI A;  2AU0 A;  4XYM B;  2UXD H;  4A3I G;  3EPI A;  4JXU A;  2J9G A;  3U0G A;  3QFF A;  3V6H A;  5HBR B;  2BQU A;  5KG2 A;  3QWU A;  4YR2 A;  3L4K A;  4MV7 A;  3TY8 A;  2J6S A;  2YZG A;  4GKJ H;  4J9S A;  2GLT A;  4A2B A;  3MFI A;  2HHH H;  4JI5 H;  4O7Y A;  4I55 F;  3RJ0 A;  4NZN A;  1WRV A;  2V5A A;  3R9R A;  1KJI A;  3R23 A;  4A3K G;  3GLK A;  1M0T A;  1RJR A;  3RAX A;  3PZP A;  3QQM A;  2R92 G;  3SE7 A;  2XIG A;  2UUB H;  1DIK A;  1UC8 A;  5KFA A;  3MR3 A;  4U6P A;  4IRD A;  4DR6 H;  4UUG A;  5JQW A;  2YRX A;  4A3G G;  1ZAU A;  2Q2T A;  2W7P A;  4DV3 H;  4HNV A;  5CAE B;  3R5F A;  5CM0 A;  3TW7 A;  5JQG F;  3T1Y H;  3CQZ A;  3E5N A;  1EZ1 A;  2WAQ A;  2UVV A;  2HGS A;  4ZOL F;  4LFB H;  3OSN A;  3HKZ A;  3OTO H;  1EHI A;  5KFJ A;  3LWB A;  2ZDG A;  5KFD A;  2XD4 A;  5BYB A;  5LYJ F;  5BMV F;  3PR4 A;  4QIW E;  3HOX G;  2RF4 A;  3PW7 A;  1VBG A;  2W70 A;  1S97 A;  1GLV A;  4YJ3 F;  3GTM A;  2VPS A;  3WNZ A;  2WB1 A;  1S68 A;  2GQR A;  4BBS G;  4TM5 A;  2ZGI A;  1RK5 A;  2R8I A;  1T3N A;  4BY7 G;  2ZDQ A;  5DG9 A;  3VMM A;  5I60 A;  3GIM A;  4LH7 A;  3H4B A;  1DV2 A;  4J9M A;  3PW5 A;  1SFO A;  3GTQ A;  1X9N A;  2X5R A;  3BA9 A;  2P0A A;  5I5W A;  5CA1 F;  3G6X A;  4C5B A;  4Q4C A;  5L1J A;  4MA5 A;  1XMQ H;  2V9W A;  1E4F T;  3KAK A;  5BWR A;  4X65 H;  2JEJ A;  2R8K A;  5FD6 A;  4O84 A;  4YB8 B;  4DV6 H;  4I4T F;  4DV2 H;  3PO2 G;  2ASJ A;  4EBD A;  2HVR A;  2RGR A;  1ULZ A;  3R5X A;  1S9F A;  4O7Z A;  4QWD A;  5C8Y F;  1XDN A;  3LQS A;  2C00 A;  5KG7 A;  2WAQ E;  4RNM A;  2W6P A;  5DG8 A;  4JI8 H;  3HKZ E;  4TQR A;  5E25 A;  4ECZ A;  3I4N G;  2W7O A;  5C5J A;  1JLL B;  1CKN B;  4DUZ H;  2YRW A;  5KFL A;  1VAJ A;  1GYF A;  1DGS A;  2W9B A;  4KHP H;  5KS8 A;  2Z02 A;  5DIS C;  3JSN A;  3FMA A;  3GTP A;  3MWD A;  4EG0 A;  3ETJ A;  5KX5 F;  3RF2 A;  4DL5 A;  2C2D A;  3BQ0 A;  4IRK A;  2R8G A;  2R7N A;  1KJQ A;  4PBC A;  3Q1K A;  2J6T A;  2VA2 A;  4RCN A;  4O3O A;  3GIP A;  3RBE A;  4EFB A;  4DR3 H;  3SI8 A;  1RYR A;  3OUU A;  4FE2 A;  1HNX H;  1IBM H;  1G2W A;  3NC0 B;  3BQ2 A;  5IP9 G;  3KXY T;  5KG0 A;  2COI A;  3WO1 A;  4RNO A;  1GO3 E;  3M4I A;  4F50 A;  2CNQ A;  2MCT A;  1Y14 B;  5I5Y A;  4A3C G;  1Z2O X;  1PX2 A;  4GLW A;  4ZI7 F;  4XZ3 B;  3JSL A;  2VPQ A;  5BPF A;  4QW8 A;  4QWB A;  4RU9 A;  1JX4 A;  3NGD A;  1CKO A;  4PZ8 A;  3K5I A;  5IYD G;  3PW4 A;  5J2T F;  2AGQ A;  3T1H H;  4FBT A;  3V6J A;  4FFL A;  2ABJ A;  2WDT A;  1VS0 A;  2HVQ A;  5BWU A;  5L1K A;  3U54 A;  4X66 H;  2QK4 A;  4DV4 H;  1TWH A;  4J9K A;  1HR0 H;  4ED2 A;  2IP4 A;  2QB5 A;  2V4Q A;  5IYZ F;  4DAA A;  2NU6 B;  2FMA A;  4TV8 F;  2RDJ A;  1JDB B;  1JKJ B;  5D1P A;  3TW6 A;  2ALZ A;  2DPJ A;  1P16 A;  2IMW P;  2FB9 A;  4LFA H;  3JAM W;  1I50 A;  3QZ7 A;  1KJ9 A;  4J0M A;  5DQG A;  4CE5 A;  4B3M H;  1SEI A;  2W9C B;  2W71 A;  2JEG A;  4EGQ A;  3N8D A;  1KBL A;  2CNU A;  2VQD A;  3U9T A;  4JV2 A;  3N6R A;  5I5S A;  4IWX A;  2GPW A;  2SCU B;  2YZN A;  3JZ6 A;  1V51 A;  4J9L A;  1L2Z A;  1TWG A;  4RB1 A;  4DR1 H;  4UCO A;  4YY3 H;  1I1L A;  4L1K A;  3EPG A;  2J6U A;  2Q7D A;  4EBE A;  2IBK A;  5KFN A;  4F4W A;  4O4J F;  4MV8 A;  1RJP A;  3RGZ A;  4A3M G;  5EZY F;  4EEQ A;  1IBL H;  2R8H A;  5D8D A;  5IYC G;  1I1M A;  4CMD A;  5KG4 A;  3KHG A;  4F4Y A;  4ECS A;  2FK3 A;  4MV1 A;  1W93 A;  3RTX A;  3C0F B;  5L9X A;  4Q45 A;  4FFO A;  4M9U A;  5GON F;  1DAA A;  2WTF A;  1O75 A;  5C1O A;  2VQF H;  2CNV A;  3J81 W;  4DR4 H;  2R92 A;  1SCU B;  3N42 B;  2RDI A;  4FS1 A;  4AYB A;  1FJG H;  1WCM A;  4WBN F;  1ZHQ A;  5KT6 A;  2EJ0 A;  3SNO A;  1BNC A;  4J9O A;  2NVX A;  3VPC A;  3BA8 A;  1A3G A;  3PN1 A;  1T94 A;  5KFY A;  4C5A A;  5DLF A;  4LFC H;  4FFR A;  4R8U B;  4DL3 A;  4K0K H;  4RB0 A;  3BJY A;  1VKZ A;  3DF7 A;  4RAZ A;  5KFK A;  2YS6 A;  1I6U A;  2NU9 B;  3AYH B;  1UC9 A;  2A1H A;  1WCM G;  5KFP A;  2UXC H;  1AUX A;  5KFF A;  4A3B G;  2HGX A;  1T36 A;  5KFB A;  5BWX A;  3HB9 A;  2YYA A;  4JUZ A;  4ED7 A;  3HOY G;  4R8U A;  2R84 A;  1A0G A;  4ED8 A;  5D1O A;  5I5U A;  1ET0 A;  4FFM A;  2WYO A;  5KFU A;  2UUA H;  5KKN B;  4NLG A;  2JA6 A;  3PFF A;  1UNN C;  1EKV A;  4B3S H;  2YL2 A;  4O3P A;  3CEB A;  5DGA A;  3K3V A;  3L4J A;  4CKC A;  1Z2P X;  3NBY B;  5KG6 A;  4YAJ B;  3N44 B;  4RNN A;  4QWE A;  4FU0 A;  3GTL A;  4LF8 H;  3CVZ A;  1C3O A;  3M9N B;  2R93 G;  3T9E A;  4RUC A;  3GQC A;  2CW8 A;  5FPO A;  4JV0 A;  4EBC A;  1S0O A;  2JA6 G;  5KT7 A;  4QWA A;  4MTE A;  5LA6 F;  3HOU G;  1KUT A;  5KFW A;  5EOY A;  4K6N A;  2NVY A;  5DLG A;  2W6O A;  4E6N A;  1SYX B;  4ECY A;  5LL6 b;  3HO8 A;  4AYB E;  3I12 A;  5HNE A;  4PDB A;  3HOV G;  5JUM A;  3Q8Q B;  3GV8 B;  1WH2 A;  2FK1 A;  4MA0 A;  2C22 A;  4HN2 A;  5FLX W;  2JA7 A;  1M6V A;  3VNN A;  5KFC A;  2JEI A;  1EUC B;  1KC7 A;  4O7R A;  1WSC A;  1MZB A;  4QW9 A;  2XCA A;  1OWT A;  3T5L A;  5K2M A;  5T14 A;  1HNZ H;  1KTA A;  3BG5 A;  1Y1W A;  3KYH C;  3U55 A;  3T5J A;  2C28 A;  3MR2 A;  3PW2 A;  2R7L A;  5FD5 A;  4DLK A;  4MAM A;  4QWC A;  2JA7 G;  4O7W A;  4DL4 A;  4Y8V B;  3G6V A;  1B04 A;  5KFQ A;  1A0I A;  4DR2 H;  4DR7 H;  1XK5 A;  1I7N A;  2W9B B;  1JIH A;  4IAJ A;  4O7T A;  4ED6 A;  1Y1W G;  1JXL A;  2E2H A;  4Q43 A;  2FLL A;  1B6R A;  5FR9 A;  1E4G T;  3GIQ A;  4JI4 H;  4MV9 A;  4RB2 C;  2HG8 A;  4PWQ A;  4OX9 H;  3MWE A;  1GGO A;  1C30 A;  5I5T A;  2ATL A;  4NXM H;  2CZG A;  4YQW A;  2C2R A;  4CKB A;  1W96 A;  2FJZ A;  2Y0S A;  5CB4 F;  4JI2 H;  2WB1 E;  3PVX A;  3GII A;  1K1Q A;  3Q2O A;  2FKL A;  4HQ6 A;  2VUM A;  2CKZ B;  5BPH A;  4FFP A;  3J80 W;  4GC7 A;  4B3T H;  5BWW A;  4JYA H;  2W6Q A;  3JRW A;  5KG3 A;  1ZQ7 A;  1CQJ B;  3PO3 G;  1IOV A;  4TV9 F;  4Q8F A;  2FK2 A;  3RB0 A;  4JI1 H;  2VUM G;  2M05 A;  5K3W A;  2YW2 A;  4UCU A;  2JA5 G;  3TQ1 A;  4HR7 A;  5I5V A;  5KFT A;  3DTF A;  4YHH H;  1EUD B;  3LML A;  3V4Z A;  1N48 A;  3Q8R B;  1HNW H;  1J5E H;  4DL6 A;  2B63 G;  1N33 H;  5BR8 H;  4RB3 C;  1I7L A;  4O7S A;  2QF7 A;  2EJ3 A;  4YJ2 F;  2W6N A;  2HJW A;  4DR5 H;  4JI0 H;  4JI7 H;  5L1I A;  3GIK A;  4FGR A;  4FS2 A;  3G8C A;  4UCS A;  5F9N A;  3T9B A;  3M9M B;  2NU8 B;  4EGJ A;  3VOT A;  2YZM A;  2W57 A;  1E4E A;  2R7Z G;  4LF7 H;  2Y0S E;  2GQS A;  2VQE H;  1TAE A;  2C2E A;  3WWJ A;  2VA3 A;  3OHB A;  1TA8 A;  2XGP A;  2UVU A;  4LF4 H;  4O81 A;  4GC6 A;  4GLX A;  3N40 P;  3T9F A;  2DPI A;  4A93 G;  4HNU A;  3MFH A;  1TWC A;  1I1K A;  4CC5 A;  2PN1 A;  4X64 H;  3GIL A;  4X62 H;  5IYB G;  3RIZ A;  2HGW A;  4UCV A;  3SGI A;  3V6K A;  2R7M A;  3F8N A;  3J7A K;  3AW8 A;  3ORQ A;  4O3S A;  5LXT F;  2YWV A;  3H0G A;  2Q2U A;  5KFZ A;  4U7C A;  5KT2 A;  4ED3 A;  1S0N A;  2FP4 B;  3FKI G;  4F4X A;  2HVS A;  1K1S A;  4IR9 A;  3W1B A;  2RGV A;  5BYA A;  1GSH A;  4CHI A;  1GSO A;  2XC9 A;  2I87 A;  4CC6 A;  3IN5 A;  3G6Y A;  1JDE A;  3R5H A;  4J9N A;  4ZQI A;  1K83 A;  2I8C A;  1IOW A;  3H0G G;  4JV5 H;  1I2L A;  2CFM A;  3UZB A;  1GSA A;  4EQ5 A;  4YAK B;  3TEK A;  2BQR A;  4O2A F;  5KG1 A;  5IP7 G;  3WO0 A;  4ZHQ F;  3T5K A;  4NZM A;  3T9A A;  1XNR H;  3RB3 A;  4Q44 A;  4ME6 A;  4EFE A;  5CA0 F;  3MWM A;  4QJF A;  2DIK A;  3Q8S B;  5DGB A;  3MR5 A;  3HOW G;  2XGQ A;  2R82 A;  4ECX A;  3NUA A;  2W8L A;  4RZQ A;  4ECQ A;  2VR1 A;  3BAB A;  1XNQ H;  4LF6 H;  3CSW A;  5DGI A;  1IBK H;  3UFX B;  3TIG A;  2FLN A;  3GV5 B;  2ASL A;  4YR0 A;  5DMX A;  4A3L G;  3RUP A;  5LMU H;  2DAA A;  3T54 A;  1Y1V A;  4I7H A;  4O4I F;  3DAA A;  3T7A A;  1CE8 A;  4BWS C;  5JVD F;  3JZF A;  4FBU A;  4HNT A;  1A9X A;  5D1O B;  5BWT A;  2CQY A;  5LMN H;  4CKE A;  2ZJT A;  4RAY A;  4A2A A;  4YR3 A;  3TIN A;  2R6F A;  3KHL A;  1FKA H;  4ECT A;  1Y1V G;  2XCP A;  4AQY H;  3GV7 B;  5CE8 A;  2ODT X;  3OSP A;  4MV6 A;  4Q4D A;  3N43 B;  3M9O B;  5HV6 A;  5A2Q W;  2R93 A;  4LH6 A;  4DIM A;  5I47 A;  1Z2N X;  1DV1 A;  3GTO A;  4JI6 H;  4NYE A;  4O7N A;  2FE3 A;  4BY1 G;  2EJ2 A;  3TY5 A;  5KFH A;  2YZL A;  5KFM A;  1N32 H;  3TY9 A;  4APM A;  4FFN A;  1R9T A;  1A48 A;  4ECU A;  2IA6 A;  1V9P A;  2PBZ A;  4O3Q A;  3OUZ A;  3FDS A;  4Q0Y A;  3T9D A;  2FPI B;  3RFC A;  2JEF A;  2R8J A;  2UXB H;  5F9L A;  4A3J G;  4LSA A;  4JI3 H;  3N41 B;  3K5H A;  2EIY A;  2I80 A;  2V58 A;  4O7L A;  2HIX A;  5DGH A;  3EYY A;  4ED0 A;  4DL2 A;  1OBD A;  5KFX A;  4IR1 A;  4O3R A;  4J9R A;  1RJQ A;  4J9Q A;  3BQ1 A;  4CMF A;  4IRC A;  2YCH A;  3W1G A;  3HBL A;  5DQI A;  2W9A A;  3T5H A;  2ASD A;  2UVR A;  1CQI B;  3RGX A;  1ZET A;  3N6X A;  4IIJ F;  4NZO A;  3RV3 A;  5C1P A;  4DV5 H;  2E5L H;  2COJ A;  3T9C A;  5EDW A;  2AGP A;  1I3Q A;  2AQ4 A;  5KFE A;  4IZO A;  3RV4 A;  4EYH B;  3UZO A;  5LP6 F;  1B6S A;  3UQ8 A;  4RZR A;  3MR6 A;  5FJ8 G;  4I50 F;  1N36 H;  4DV7 H;  1CKM A;  3UYY A;  3KTM A;  4LMY A;  4DQN A;  3VPB A;  5J2U F;  4BBR G;  3HT5 A;  1WR2 A;  4UCR A;  2OLS A;  4C2M A;  5KG5 A;  1S10 A;  3IG0 A;  5CR5 A;  1B33 N;  3GTG A;  5BWV A;  2JA8 G;  3OHA A;  1BGW A;  4ETS A;  2YU9 A;  2HIV A;  1EKP A;  4UCT A;  2VUG A;  3ORR A;  4O4H F;  4IWY A;  1P8L A;  2HHF B;  4O2B F;  2KSW A;  1N56 A;  2WE6 A;  5KT5 A;  5KFV A;  3HOZ G;  3NBZ B;  2DLN A;  3GTK A;  4EEY A;  2O03 A;  2ZM6 H;  2GPS A;  4R7R A;  3GIJ A;  4DUY H;  4F4Z A;  2JA5 A;  3BAC A;  4XX0 B;  5KFR A;  2W6M A;  3RBD A;  4O4L F;  2HHF A;  1S03 G;  2AGO A;  2B63 A;  3K3P A;  2NU7 B;  3RR5 A;  4TUY F;  5JVL A;  1RK6 A;  5L1L A;  1S0M A;  1AN7 A;  4O83 A;  5EWE A;  4O7V A;  4MV3 A;  2ZDH A;  4O86 A;  2DWC A;  2C35 B;  2QYZ A;  4LSX A;  5C3E G;  4A3F G;  5FPR A;  3PW0 A;  4B3R H;  1KJJ A;  4MV4 A;  2VOB A;  4DV1 H;  2COG A;  3W5O A;  3LP8 A;  5KT3 A;  3QZ8 A;  3KHH A;  3AX6 A;  4ECW A;  2UVW A;  4M0J A;  3KAL A;  1KJ8 A;  4EYI B;  3DTG A;  4XYL B;  2XCL A;  1E4E B;  3H20 A;  2W8K A;  3VA7 A;  4NXN H;  1XMO H;  4ED1 A;  2R7Z A;  4LF5 H;  2PVP A;  2V59 A;  3T99 A;  1TWA A;  5KFI A;  1CKN A;  4O3N A;  4HYK A;  2FPP B;  2BR0 A;  2NUA B;  1IYE A;  5H80 A;  2PMZ A;  4IHJ F;  3RB6 A;  4GKK H;  3PR5 B;  5KFS A;  4TQS A;  4WHX A;  2YS7 A;  3GJX B;  1KEE A;  4DL7 A;  4MTD A;  1ZHS A;  4G3I A;  3GID A; 
#chains in the Genus database with same CATH homology
 1Z2P X;  3NBY B;  2F4V H;  1XDN A;  3GDE A;  3N44 B;  4RZQ A;  1XNQ H;  3BAB A;  4LF8 H;  3CVZ A;  2UU9 H;  1IBK H;  4LF6 H;  4JI8 H;  2CW8 A;  5FPO A;  5LMU H;  4I7H A;  5IT9 W;  4MTE A;  4BWS C;  1CKN B;  1BJT A;  5EOY A;  4DUZ H;  4E6N A;  5D1O B;  1SYX B;  5LMN H;  5LL6 b;  4LF9 H;  1DGS A;  1GYF A;  2ZJT A;  4RAY A;  4A2A A;  4KHP H;  5DIS C;  3JSN A;  3FMA A;  4PDB A;  4DRF A;  1WH2 A;  4FM9 A;  3RF2 A;  1FKA H;  5FLX W;  3VNN A;  4AQY H;  1M0W A;  1MZB A;  1HNZ H;  4EFB A;  4DR3 H;  3N43 B;  1HNX H;  1IBM H;  5A2Q W;  3KYH C;  4LH6 A;  3NC0 B;  2UUC H;  1Z2N X;  3KXY T;  3BAA A;  5FD5 A;  4JI6 H;  4PZ6 A;  2HHH H;  2FE3 A;  3TY5 A;  3M4I A;  4DR2 H;  1B04 A;  2MCT A;  1A0I A;  3HXL A;  4DR7 H;  1XK5 A;  1N32 H;  1Z2O X;  4IAJ A;  3TY9 A;  4APM A;  3JSL A;  1V9P A;  1E4G T;  5IWA H;  1CKO A;  2OWO A;  4PZ8 A;  4MV9 A;  4Q0Y A;  4RB2 C;  4JI4 H;  2UXB H;  4OX9 H;  4PZ7 A;  4LSA A;  3S24 A;  3N41 B;  4JI3 H;  3T1H H;  4DV0 H;  3EYY A;  2HIX A;  1VS0 A;  2HVQ A;  2WDT A;  4M7E A;  3GB8 B;  3KAJ A;  4NXM H;  4X66 H;  4JI2 H;  4DV4 H;  2CW7 A;  1HR0 H;  2YCH A;  3W1G A;  4B3T H;  3J80 W;  3RGX A;  4UFZ A;  3L2P A;  1I94 H;  4JYA H;  1FVI A;  3N6X A;  5D1P A;  1P16 A;  2UXD H;  4LFA H;  2E5L H;  4DV5 H;  3JAM W;  3QWU A;  4J0M A;  3L4K A;  3TY8 A;  4MV7 A;  4B3M H;  4JI1 H;  4GKJ H;  1SEI A;  3UQ8 A;  4A2B A;  4JI5 H;  1N36 H;  4DV7 H;  3RJ0 A;  1CKM A;  4UCU A;  4LMY A;  4YHH H;  3L4J A;  1M0T A;  3LML A;  2XIG A;  1HNW H;  4UCR A;  1J5E H;  2UUB H;  1N33 H;  1L2Z A;  5BR8 H;  3IG0 A;  4RB3 C;  4DR6 H;  4RB1 A;  4DR1 H;  4UCO A;  1BGW A;  4YY3 H;  4ETS A;  2HIV A;  4UCT A;  2VUG A;  4DR5 H;  1P8L A;  2Q2T A;  4JI0 H;  2KSW A;  4DV3 H;  2WE6 A;  4JI7 H;  3NBZ B;  3RGZ A;  3T1Y H;  4EEQ A;  1IBL H;  4UCS A;  2O03 A;  2ZM6 H;  2HGS A;  4R7R A;  4LFB H;  2W57 A;  4DUY H;  3OTO H;  2RGR A;  3RTX A;  3C0F B;  4LF7 H;  2VQE H;  1TAE A;  2VQF H;  1O75 A;  1S03 G;  4DR4 H;  1TA8 A;  3J81 W;  4LF4 H;  3N42 B;  4GLX A;  3RR5 A;  2VPS A;  3N40 P;  1FJG H;  1ZHQ A;  1AN7 A;  4CC5 A;  1S68 A;  4X64 H;  3BA8 A;  4X62 H;  3PN1 A;  4LSX A;  3RIZ A;  4UCV A;  5FPR A;  4LFC H;  4B3R H;  3F8N A;  3J7A K;  2VOB A;  4DV1 H;  3W5O A;  4K0K H;  2Q2U A;  4RB0 A;  3DF7 A;  4RAZ A;  1I6U A;  3KAL A;  4LH7 A;  2HVS A;  3W1B A;  2RGV A;  2UXC H;  1X9N A;  3H20 A;  4NXN H;  4CC6 A;  1XMO H;  3BA9 A;  4LF5 H;  1CKN A;  4JV5 H;  2CFM A;  1XMQ H;  5D1O A;  4EQ5 A;  1N34 H;  2WYO A;  1E4F T;  2UUA H;  3KAK A;  4X65 H;  4GKK H;  5FD6 A;  3GJX B;  1XNR H;  4DV6 H;  4B3S H;  4MTD A;  1ZHS A;  4EFE A;  3MWM A;  4DV2 H;  2HVR A;  3K3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...