1XDNA

High resolution crystal structure of an editosome enzyme from trypanosoma brucei: rna editing ligase 1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
265
structure length
265
Chain Sequence
QSDFSPYIEIDLPSESRIQSLHKSGLAAQEWVACEKVHGTNFGIYLINQGDHEVVRFAKRSGIMDPNENFFGYHILIDEFTAQIRILNDLLKQKYGLSRVGRLVLNGELFGAKYKHPLVPKSEKWCTLPNGKKFPIAGVQIQREPFPQYSPELHFFAFDIKYSVSGAEEDFVLLGYDEFVEFSSKVPNLLYARALVRGTLDECLAFDVENFMTPLPALLGLGNYPLEGNLAEGVVIRHVRRGDPAVEKHNVSTIIKLRCSSFMEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords RNA editing ligase MP52
publication title High resolution crystal structure of a key editosome enzyme from Trypanosoma brucei: RNA editing ligase 1.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 75
structure length 265
sequence length 265
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1xdnA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1xdnA01
2HVRA 1VS0A 1B04A 3TY8A 2HIXA 1TAEA 3TY5A 3JSLA 4UCSA 4DRFA 3L2PA 4UCTA 1CKMA 1FVIA 1DGSA 4LH6A 3RTXA 3BA9A 5D1OA 5D1PA 4EFBA 3KYHC 3RR5A 1CKOA 1A0IA 4EQ5A 5D1OB 3S24A 4UCRA 3NC0B 3GB8B 2Q2TA 2HVQA 4UFZA 4UCOA 5DISC 3W1GA 4PZ7A 2HIVA 5FPRA 2Q2UA 1P8LA 3BAAA 4UCVA 4EEQA 4PZ6A 1XK5A 5FPOA 4E6NA 3W5OA 1XDNA 3TY9A 1V9PA 3GJXB 4EFEA 3BA8A 4GLXA 4LH7A 3JSNA 3NBYB 3QWUA 1X9NA 1S68A 3NBZB 2CFMA 1CKNA 4UCUA 1P16A 2OWOA 2VUGA 1CKNB 2HVSA 3PN1A 3UQ8A 1TA8A 3VNNA 4CC5A 4CC6A 3BABA 3W1BA 4PZ8A 3GDEA
chains in the Genus database with same CATH superfamily
5DQIA 3PO3G 2BQRA 3VA7A 2BQUA 5JVLA 3SE7A 5J2UF 2J6UA 5I5VA 3KHRA 2XGPA 2PBZA 4NXMH 5KFZA 2PMZA 2UVUA 1IYDA 3TY8A 2DPIA 4LFCH 5CB4F 1TAEA 4B3MH 4FFRA 4FGRA 5BR8H 1I94H 4A2AA 2W7OA 4UCSA 2RDJA 4YP3A 3I4MG 4O7ZA 4J9NA 3H40A 4O7WA 1I6UA 5LA6F 3KHGA 1R9TA 2UVWA 4NZNA 4MV7A 5LP6F 1CKMA 4O82A 1S0OA 1B6SA 4AYBE 4A3JG 3OHAA 5I5TA 5F9LA 4O7YA 2HHHH 3KREA 5KFPA 2R92G 1GO3E 4O83A 3Q2OA 1DV2A 2FK3A 2W8KA 2IP4A 2XD4A 1L2ZA 1OBGA 4M0JA 5I60A 1RK5A 4LSAA 3BA9A 4NZOA 5FJ8G 2ASJA 4JV5H 3Q8QB 2SCUB 2VQDA 5DG8A 2YZMA 4A3MG 2ABJA 3KYHC 2Y4RA 4QIWE 3RR5A 1KJ9A 3RV3A 3V4SA 1A0IA 2J6TA 5JQGF 2UUAH 4RNOA 4J9RA 3WO1A 1GGOA 4DL3A 4A3DG 3RBDA 2PN1A 3M9NB 3MJFA 1GLVA 3WO0A 5IWAH 4RU9A 1KEEA 5LMUH 2C22A 4C5AA 4UCRA 3NC0B 3H4BA 3PW0A 2C2EA 4Q8EA 4GLWA 4UUGA 2EJ3A 4MV4A 4UFZA 1W96A 3UZBA 3AX6A 5BMVF 4QJFA 4F4WA 2JEFA 5C4XG 4F4ZA 3T99A 2EJ0A 3G8DA 5K3WA 3W1GA 5CR5A 1Y1VG 4U7CA 4PDBA 2COGA 1P8LA 5BWVA 2R84A 4ECRA 4ED2A 2R93G 3K5IA 1EKPA 3MFHA 2JEGA 3GTPA 3ORQA 4FFMA 3N8DA 2C2DA 1VBHA 3FMAA 3BQ1A 4DV4H 4A3KG 3PVXA 1DIKA 2DLNA 4MA0A 4RZQA 5IYZF 4QW8A 4O7NA 4O3QA 1KT8A 3N40P 4O2BF 2FLPA 3KALA 2YW2A 3JZIA 3CVZA 2VUMA 2P0AA 2YRXA 4DL5A 5KG0A 3KHHA 3HKZE 2VUMG 3BG5A 1SEIA 2R92A 4MV8A 2GPSA 2W9CA 2EJ2A 5BWRA 4Y8VB 4RAZA 4DV6H 2V59A 2R7NA 4RB2C 5IT9W 5BWTA 2IA6A 2R85A 3BQ2A 1N33H 4FBUA 2ASLA 5KG4A 5LMNH 3QWUA 1N32H 3M4IA 3GIQA 5IYBG 2UVVA 3F8NA 1C3OA 2W9CB 3OHBA 1RYSA 4J9MA 3KAKA 4MV1A 4XYMB 1ET0A 1I7NA 4DR6H 1A3GA 4DUYH 5L1KA 4ECYA 4O3NA 4AQYH 3J7AK 4UCUA 3H20A 4B3RH 1P16A 1T94A 2YS6A 5BWUA 2BQ3A 3M9OB 3LWBA 1J5EH 5KKNB 5L9XA 5C5JA 5FD5A 3TW7A 3ETJA 4A3GG 5JUMA 4HYKA 2JA5G 2J6SA 1KJ8A 4ZHQF 2VPQA 3T5KA 3PW7A 4KHPH 3PZPA 2GQSA 5L1IA 3UQ8A 1CE8A 5I47A 1TWHA 2YZGA 1Y1VA 2XIGA 1TA8A 3MR5A 5KFHA 4B3SH 4ED8A 2ALZA 2R93A 5KFWA 3W1BA 4DLKA 4FU0A 2DWCA 2XC9A 4IIJF 1C30A 1G2WA 2DIKA 4QSHA 4LMYA 1VS0A 4B3TH 3R5HA 5KG3A 1I1MA 3N43B 4DR3H 1ZETA 4A3LG 2GQRA 1K1SA 2HIXA 4O7VA 3KAJA 3KXYT 4WBNF 2YYAA 3RF2A 3GQCA 3G6XA 3TIIA 3TW6A 3T5HA 4X65H 2CNQA 2AGOA 2VA2A 4NLGA 5I5SA 4A2BA 4EBCA 3LQSA 2DAAA 4O81A 5BYBA 2PVPA 3L2PA 5KG5A 4DV3H 4GKJH 4ECQA 4I7HA 3OSNA 4O4IF 4MV6A 3GIJA 4AYBA 2R7MA 1RJPA 5KFFA 2W9BA 4DV2H 4DV5H 4XYLB 3H3VH 3GIIA 3N42B 3SI8A 2HDKA 1Z2OX 5IP7G 5KFXA 4RUAA 4CE5A 3RUPA 1EUCB 4LH6A 4TV9F 3K5HA 4HN2A 3Q8PB 3AW8A 2R8HA 5K2MA 5LOVF 2W9BB 2OH2A 3V6KA 1BNCA 3MWMA 4QIWA 4GC7A 4JI1H 4YR0A 2W9AA 2FP4B 5DQGA 2NUAB 4YHHH 2ODTX 4J9LA 3BACA 4YAKB 2JA5A 4DL4A 4HQ6A 4R7RA 3H0GG 5KFLA 4YQWA 4TUYF 3EYYA 3T1YH 4A3IG 2JA8G 1HNXH 1CS0A 3GIMA 3GB8B 1SFOA 3JRXA 3EPIA 5KFIA 4MA5A 5EWFA 2HVQA 2R7KA 2UUBH 4ED0A 4X66H 2FLLA 1XNRH 5BPFA 3PFFA 5I5YA 2HIVA 3OUUA 5FPRA 4IRCA 3DTFA 2FPIB 4FS2A 2FK1A 5KFEA 1KJIA 3IN5A 4EEQA 1SYXB 1WH2A 1W93A 5KFDA 4PZ6A 4EG0A 4QWEA 3MR3A 1WCMG 4ECZA 1S10A 1S03G 4C5CA 2UXCH 5HV6A 5CE8A 2YWVA 5EOYA 4ECTA 2JA6A 5DAAA 4C5BA 5EDWA 4MV9A 2V58A 4BBRG 4EYIB 1XK5A 4RB0A 4GKKH 2JA6G 2DABA 1T36A 1OWTA 3VPCA 4DAAA 2YS7A 2E2IA 2AU0A 1XDNA 3TY9A 5KFGA 4ZOLF 2COIA 4O7TA 3LMLA 5JQWA 5C8YF 2UVRA 1EHIA 1V9PA 4EFEA 5KFAA 4YJ3F 3R9RA 5IYDG 5KT6A 2XCAA 2NVXA 4EGQA 1UC8A 2Q7DA 3RFCA 4WD3A 3GV7B 3G6VA 1KJQA 1EKFA 2RGVA 4FE2A 3JSNA 4QWBA 3RB0A 1EYZA 1JLLB 2I87A 2R86A 3WNZA 4APMA 5KG2A 2WTFA 3HOWG 2JEIA 1X9NA 4OX9H 2R6FA 2WB1A 1S68A 3PW5A 2ATLA 1EKVA 2CFMA 5CA0F 2PMZE 2V5AA 2RDIA 4NYEA 2R87A 3GTJA 2WDTA 3H0GA 3OUZA 4R8UA 1AUXA 4DR2H 4JYAH 2R8IA 2OWOA 2HGSA 1TWAA 3QZ8A 4ED7A 2BR0A 4QWCA 4Q4CA 2HVSA 4FBTA 2I80A 1GSAA 5J2TF 4FM9A 5LXTF 3U9TA 1I1KA 3GIDA 4CHIA 3RBEA 4R8UB 2C00A 5DG9A 3QZ7A 1IOVA 2FKLA 3HOXG 3EPGA 3VNNA 4RCNA 2VA3A 3HOVG 3GTMA 5BWXA 4CC6A 4ZI7F 4DL7A 3BABA 5FR9A 1KBLA 4LF9H 1BXRA 5KG7A 4BBSG 1WCMA 4RNNA 4DR7H 3T9AA 5DMXA 2V4RA 3GILA 4FS1A 2AGPA 4JI6H 1Y1WG 3MR2A 4ED1A 4QWDA 2YZNA 4Q45A 1B04A 4QW9A 4A3FG 4CMFA 2C28A 4IWXA 2NU9B 5KFBA 3OTOH 2VQFH 4A3EG 3TY5A 3JSLA 5KFQA 2UU9H 4BXXG 1JKJB 1WR2A 4DRFA 1I50A 3RAQA 3OSPA 2V9WA 4IRDA 1A48A 1E4FT 5A2QW 4LF7H 3BQ0A 3ETHA 2VPSA 1RK6A 3CQZA 5DGHA 4YBZB 1S97A 3ORRA 3G6YA 2XCLA 4O4JF 4UCTA 4HNTA 4J9SA 1S0MA 2CZGA 1EZ1A 4XX0B 3HOYG 4O84A 3HXLA 2OLSA 5DGBA 5C1PA 3T9FA 5FLMG 1S9FA 3TIGA 5DQHA 4ECXA 3RTXA 1HR0H 2F4VH 1Z2NX 1I7LA 3RAXA 3MWDA 4J9PA 1IOWA 5IYCG 2W7PA 3JZFA 2ASDA 4C2MA 3RIZA 4DV7H 4ED3A 1N56A 5EWEA 4EFBA 3QFFA 3U54A 4O4HF 4MTEA 5L1JA 2E5LH 5HBRB 4RUCA 1UC9A 4CKBA 4EQ5A 4F50A 2FMAA 3J80W 1IBMH 4BY1G 4EYHB 4O4LF 3WWHA 1B33N 3RB6A 3HOZG 1RJRA 4RAYA 4Q8FA 2ZDGA 2W6ZA 2W6QA 2GPWA 4HR7A 4O3PA 1KUTA 4XZ3B 3GTKA 2X0SA 2W57A 2FLNA 5KT3A 4LFBH 3CEBA 2FE3A 2HGXA 3RJ0A 1E4EA 1VAJA 4U6PA 3Q8SB 2MCTA 5IP9G 4DV1H 1ZAUA 1Y1WA 5DISC 4PZ7A 4J9OA 2W6NA 2ZDHA 4IHJF 5D8DA 2Q2UA 2NVYA 1BJTA 4JV2A 4LF4H 4UCVA 1XMQH 2W6PA 4IRKA 1T3NA 3WWJA 1E4GT 5E25A 3GV5B 1AUVA 3SNOA 3Q1KA 2WAQE 5CAEB 3R5FA 4O3OA 1CQIB 4EEYA 3NUAA 5FPOA 3WWIA 3V6HA 4JV1A 5LYJF 2W8LA 2J9GA 4FFLA 3BJYA 4JUZA 3L4KA 3DAAA 4YR2A 1I2LA 3H4DA 4ED6A 5KFJA 4NZMA 4MTDA 5KFCA 2DPJA 3MWEA 2ZM6H 1CQJB 5KFUA 1GSOA 3VPDA 3SGIA 4Q44A 2XCPA 3TINA 3BA8A 4MAMA 5BYAA 2UXBH 3R5XA 5KFSA 3RGZA 4LH7A 4YB8B 4JI2H 3QQMA 4LF8H 1XNQH 2COJA 4DQNA 1DAAA 1VBGA 3DTGA 3NBYB 1V51A 3CSWA 3RGXA 4PBCA 5KFNA 1UNNC 5DGAA 1JDBB 3NBZB 4X62H 1EUDB 1BGWA 4EBDA 2DZDA 5EWGA 2W6MA 4O7LA 4TM5A 3GIPA 2V4QA 4F4XA 2C2RA 1AN7A 2R7LA 5C3EG 3LP8A 4CMDA 2R7ZG 5GONF 5KT2A 4O3RA 4NXNH 3GTOA 2VUGA 2JEJA 4BY7G 4O7RA 2W6OA 2CNVA 3N41B 1WSCA 3GV8B 4TV8F 4JI5H 2GLTA 5KFMA 4EBEA 3HKZA 4K0KH 3U0GA 1ZQ7A 3LULA 3FDSA 4IWYA 4F4YA 2EIYA 5DGIA 1B6RA 1M0WA 4I50F 2CKZB 5KG6A 4M7EA 1DV1A 2Y0SE 3VMMA 1SCUB 2ZJTA 4YR3A 1KTAA 3HO8A 4Q43A 2NU6B 3PR4A 2UUCH 4DUZH 5DLFA 1O75A 1HNWH 3HOUG 4DV0H 3IG0A 3T54A 2HVRA 4ETSA 3I12A 4YAJB 3T9CA 5HNEA 2C35B 3T1HH 2AQ4A 1Z2PX 5BWWA 2KSWA 4IZOA 3L4JA 4WHXA 4CKCA 3PR5B 2FPGB 2I8CA 2VQEH 3K3VA 4TVIA 1IBLH 3T5JA 3M9MB 4IR1A 4FFNA 4JI0H 2HGWA 2FPPB 3J81W 2NU7B 1I2KA 2FK2A 4IR9A 4M9UA 4O86A 1IYEA 2Z04A 3KHLA 4JI8H 2X5RA 3RV4A 2YZLA 1PK8A 5JH7F 5KFTA 3DF7A 1PX2A 3UFXB 1KC7A 4LFAH 4L1KA 4MV3A 4K6NA 1Y14B 5DLGA 3HB9A 3MR6A 5I5XA 4ECWA 1JXLA 3GTQA 4JV0A 3RB4A 1FVIA 1DGSA 4J9QA 3GTLA 2O03A 3FKIG 1N34H 2R8GA 4J9KA 2B63G 4JI4H 3GIKA 4DR5H 1ZHSA 4RZRA 3NGDA 2WYOA 4HNUA 1S0NA 3UZOA 4GC6A 2R7ZA 5D1OA 4E4TA 5D1PA 1RYRA 3AYHB 2CNUA 3HBLA 1M7JA 4O7SA 4O2AF 2RGRA 3U9SA 1CKOA 5CA1F 2WE6A 3T9EA 4A3BG 2XGQA 3JAMW 1OBDA 3T9BA 4DL6A 1N36H 4LF5H 1I1LA 5D1OB 3TQTA 3I4NG 4JXUA 3S24A 1MZBA 2R8KA 2AGQA 5KFYA 4A3CG 1IBKH 2HJWA 3U55A 3UYYA 3PW4A 2Q2TA 1GSHA 4DL2A 2QB5A 2YL2A 3E5NA 5FD6A 2YCHA 4I4TF 4UCOA 5KT4A 2VOBA 3VPBA 2FB9A 4ME6A 5I5WA 3HT5A 4EGJA 5KT7A 5KT5A 2FJZA 2JA7G 2W71A 3V4ZA 3Q8RB 4PWQA 4JI7H 4DR4H 1GYFA 3N6RA 2WB1E 3BAAA 3GLKA 1JIHA 1RJQA 1ULZA 3N6XA 4LSXA 3JRWA 2ZDQA 4RNMA 5CM0A 1M6VA 5KFOA 3MFIA 1TWGA 2YU9A 5L1LA 5T14A 1HNZH 2ZGIA 2R82A 5FLXW 4ECUA 2WAQA 1FKAH 2HHFA 4X64H 1TWCA 2M05A 2QK4A 5KS8A 1JDEA 4E6NA 3VOTA 1TWFA 4ECVA 4A93G 4IAJA 3TEKA 3JZ6A 3W5OA 1WRVA 3KTMA 2RF4A 4TQSA 4YJ2F 4O3SA 1VKZA 2YRWA 2VR1A 1A9XA 5BPHA 3GJXB 5LL6b 1JX4A 3G8CA 1FJGH 5KX5F 2HHFB 5KFVA 4FFOA 4GLXA 3FKIA 2IBKA 2B63A 1N48A 1I3QA 3T5LA 2CW7A 3R23A 5KG1A 1K83A 4QWAA 3K3PA 1K1QA 3T7AA 4JI3H 1M0TA 5F9NA 5DG7A 4I55F 5C1OA 1CKNA 5FNVF 5H80A 3N44B 5KFKA 5C44G 4TQRA 4Q4DA 2W70A 4CKEA 3PW2A 4BWSC 4DIMA 1E4EB 5JVDF 1V4YA 2CQYA 5KFRA 3C0FB 2IMWP 4HNVA 4G3IA 3PO2G 4FFPA 2E2HA 2HG8A 5I5UA 1KJJA 3T9DA 4Q0YA 2NU8B 2QYZA 2Z02A 3TQ1A 3RB3A 1XMOH 1A0GA 1CKNB 4RB3C 2UXDH 4J0MA 2R8JA 2QF7A 4LF6H 4YY3H 2A1HA 3PN1A 2JA7A 4ZQIA 2CW8A 3GTGA 5EZYF 1ZHQA 3V6JA 4CC5A 2Y0SA 4RB1A 4DR1H 4ECSA 4PZ8A 3GDEA
chains in the Genus database with same CATH topology
1O75A 1HNWH 4DR7H 4DV0H 3IG0A 2HVRA 4LMYA 4ETSA 1VS0A 4B3TH 3T1HH 4JI6H 4NXMH 3N43B 1Z2PX 2KSWA 1B04A 3L4JA 3TY8A 2VQEH 2HIXA 3KXYT 3KAJA 1TAEA 2VQFH 4B3MH 3K3VA 3RF2A 3OTOH 3TY5A 1IBLH 3JSLA 5BR8H 1I94H 4A2AA 2UU9H 4UCSA 4DRFA 4X65H 4JI0H 4LF7H 1E4FT 5A2QW 4A2BA 3J81W 3L2PA 4DV3H 4GKJH 1I6UA 4JI8H 2VPSA 4I7HA 4MV7A 4UCTA 1CKMA 4LFAH 3DF7A 4DV2H 4DV5H 3HXLA 3N42B 2HHHH 1Z2OX 1FVIA 1DGSA 2O03A 4LH6A 3RTXA 1N34H 1Z2NX 1HR0H 2F4VH 1L2ZA 4JI4H 4DR5H 4LSAA 3BA9A 1ZHSA 2WYOA 3RIZA 4DV7H 4JV5H 5D1OA 5D1PA 3MWMA 4EFBA 3KYHC 4MTEA 2E5LH 4LFCH 4JI1H 3RR5A 2RGRA 1CKOA 2WE6A 1A0IA 4YHHH 4EQ5A 3J80W 1IBMH 3JAMW 2UUAH 4R7RA 4RAYA 1N36H 4LF5H 3EYYA 3T1YH 5D1OB 3S24A 5IWAH 1HNXH 1MZBA 5LMUH 4UCRA 3NC0B 3GB8B 2W57A 2Q2TA 4LFBH 2HVQA 5FD6A 4UFZA 2UUBH 2FE3A 2YCHA 4UCOA 4X66H 3RJ0A 2VOBA 4DV1H 4DR3H 1FJGH 2MCTA 1XNRH 5DISC 3W1GA 4PZ7A 2HIVA 4PDBA 5FPRA 4JI7H 4DR4H 2Q2UA 1P8LA 4LSXA 3BAAA 1IBKH 1BJTA 3N6XA 4LF4H 4UCVA 1XMQH 4EEQA 1SYXB 1WH2A 1E4GT 4PZ6A 1S03G 1HNZH 2UXCH 3FMAA 5EOYA 5FLXW 4DV4H 1FKAH 4RZQA 4MV9A 4X64H 1XK5A 5FPOA 4E6NA 4RB0A 4GKKH 3N40P 4IAJA 3W5OA 3KALA 1XDNA 3TY9A 3L4KA 3CVZA 4MTDA 3LMLA 2ZM6H 1V9PA 3GJXB 4EFEA 1SEIA 5LL6b 3BA8A 4GLXA 4RAZA 4DV6H 2UXBH 4RB2C 3RGZA 5IT9W 4LH7A 2RGVA 3JSNA 2CW7A 4JI2H 1N33H 4LF8H 1XNQH 3NBYB 4APMA 5LMNH 3RGXA 3QWUA 1X9NA 4OX9H 3M4IA 1N32H 4JI3H 1M0TA 1GYFA 1S68A 3NBZB 4X62H 1BGWA 3F8NA 2CFMA 1CKNA 3N44B 3KAKA 1AN7A 4BWSC 2WDTA 4DR6H 4DUYH 3C0FB 4DR2H 4AQYH 3J7AK 4UCUA 3H20A 4JYAH 4B3RH 1P16A 4Q0YA 4NXNH 2OWOA 2VUGA 2HGSA 1XMOH 1J5EH 1CKNB 3N41B 5FD5A 2HVSA 4RB3C 4JI5H 2UXDH 4J0MA 4FM9A 4LF6H 4YY3H 4K0KH 4KHPH 3PN1A 3UQ8A 4B3SH 2XIGA 1TA8A 2CW8A 4M7EA 3VNNA 1M0WA 1ZHQA 4CC5A 2ZJTA 4CC6A 4RB1A 4DR1H 3BABA 2UUCH 4LF9H 3W1BA 4PZ8A 3GDEA 4DUZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVR A;  1VS0 A;  1B04 A;  3TY8 A;  2HIX A;  1TAE A;  3TY5 A;  3JSL A;  4UCS A;  4DRF A;  3L2P A;  4UCT A;  1CKM A;  1FVI A;  1DGS A;  4LH6 A;  3RTX A;  3BA9 A;  5D1O A;  5D1P A;  4EFB A;  3KYH C;  3RR5 A;  1CKO A;  1A0I A;  4EQ5 A;  5D1O B;  3S24 A;  4UCR A;  3NC0 B;  3GB8 B;  2Q2T A;  2HVQ A;  4UFZ A;  4UCO A;  5DIS C;  3W1G A;  4PZ7 A;  2HIV A;  5FPR A;  2Q2U A;  1P8L A;  3BAA A;  4UCV A;  4EEQ A;  4PZ6 A;  1XK5 A;  5FPO A;  4E6N A;  3W5O A;  1XDN A;  3TY9 A;  1V9P A;  3GJX B;  4EFE A;  3BA8 A;  4GLX A;  4LH7 A;  3JSN A;  3NBY B;  3QWU A;  1X9N A;  1S68 A;  3NBZ B;  2CFM A;  1CKN A;  4UCU A;  1P16 A;  2OWO A;  2VUG A;  1CKN B;  2HVS A;  3PN1 A;  3UQ8 A;  1TA8 A;  3VNN A;  4CC5 A;  4CC6 A;  3BAB A;  3W1B A;  4PZ8 A;  3GDE A; 
#chains in the Genus database with same CATH topology
 5DQI A;  3PO3 G;  2BQR A;  3VA7 A;  2BQU A;  5JVL A;  3SE7 A;  5J2U F;  2J6U A;  5I5V A;  3KHR A;  2XGP A;  2PBZ A;  4NXM H;  5KFZ A;  2PMZ A;  2UVU A;  1IYD A;  3TY8 A;  2DPI A;  4LFC H;  5CB4 F;  1TAE A;  4B3M H;  4FFR A;  4FGR A;  5BR8 H;  1I94 H;  4A2A A;  2W7O A;  4UCS A;  2RDJ A;  4YP3 A;  3I4M G;  4O7Z A;  4J9N A;  3H40 A;  4O7W A;  1I6U A;  5LA6 F;  3KHG A;  1R9T A;  2UVW A;  4NZN A;  4MV7 A;  5LP6 F;  1CKM A;  4O82 A;  1S0O A;  1B6S A;  4AYB E;  4A3J G;  3OHA A;  5I5T A;  5F9L A;  4O7Y A;  2HHH H;  3KRE A;  5KFP A;  2R92 G;  1GO3 E;  4O83 A;  3Q2O A;  1DV2 A;  2FK3 A;  2W8K A;  2IP4 A;  2XD4 A;  1L2Z A;  1OBG A;  4M0J A;  5I60 A;  1RK5 A;  4LSA A;  3BA9 A;  4NZO A;  5FJ8 G;  2ASJ A;  4JV5 H;  3Q8Q B;  2SCU B;  2VQD A;  5DG8 A;  2YZM A;  4A3M G;  2ABJ A;  3KYH C;  2Y4R A;  4QIW E;  3RR5 A;  1KJ9 A;  3RV3 A;  3V4S A;  1A0I A;  2J6T A;  5JQG F;  2UUA H;  4RNO A;  4J9R A;  3WO1 A;  1GGO A;  4DL3 A;  4A3D G;  3RBD A;  2PN1 A;  3M9N B;  3MJF A;  1GLV A;  3WO0 A;  5IWA H;  4RU9 A;  1KEE A;  5LMU H;  2C22 A;  4C5A A;  4UCR A;  3NC0 B;  3H4B A;  3PW0 A;  2C2E A;  4Q8E A;  4GLW A;  4UUG A;  2EJ3 A;  4MV4 A;  4UFZ A;  1W96 A;  3UZB A;  3AX6 A;  5BMV F;  4QJF A;  4F4W A;  2JEF A;  5C4X G;  4F4Z A;  3T99 A;  2EJ0 A;  3G8D A;  5K3W A;  3W1G A;  5CR5 A;  1Y1V G;  4U7C A;  4PDB A;  2COG A;  1P8L A;  5BWV A;  2R84 A;  4ECR A;  4ED2 A;  2R93 G;  3K5I A;  1EKP A;  3MFH A;  2JEG A;  3GTP A;  3ORQ A;  4FFM A;  3N8D A;  2C2D A;  1VBH A;  3FMA A;  3BQ1 A;  4DV4 H;  4A3K G;  3PVX A;  1DIK A;  2DLN A;  4MA0 A;  4RZQ A;  5IYZ F;  4QW8 A;  4O7N A;  4O3Q A;  1KT8 A;  3N40 P;  4O2B F;  2FLP A;  3KAL A;  2YW2 A;  3JZI A;  3CVZ A;  2VUM A;  2P0A A;  2YRX A;  4DL5 A;  5KG0 A;  3KHH A;  3HKZ E;  2VUM G;  3BG5 A;  1SEI A;  2R92 A;  4MV8 A;  2GPS A;  2W9C A;  2EJ2 A;  5BWR A;  4Y8V B;  4RAZ A;  4DV6 H;  2V59 A;  2R7N A;  4RB2 C;  5IT9 W;  5BWT A;  2IA6 A;  2R85 A;  3BQ2 A;  1N33 H;  4FBU A;  2ASL A;  5KG4 A;  5LMN H;  3QWU A;  1N32 H;  3M4I A;  3GIQ A;  5IYB G;  2UVV A;  3F8N A;  1C3O A;  2W9C B;  3OHB A;  1RYS A;  4J9M A;  3KAK A;  4MV1 A;  4XYM B;  1ET0 A;  1I7N A;  4DR6 H;  1A3G A;  4DUY H;  5L1K A;  4ECY A;  4O3N A;  4AQY H;  3J7A K;  4UCU A;  3H20 A;  4B3R H;  1P16 A;  1T94 A;  2YS6 A;  5BWU A;  2BQ3 A;  3M9O B;  3LWB A;  1J5E H;  5KKN B;  5L9X A;  5C5J A;  5FD5 A;  3TW7 A;  3ETJ A;  4A3G G;  5JUM A;  4HYK A;  2JA5 G;  2J6S A;  1KJ8 A;  4ZHQ F;  2VPQ A;  3T5K A;  3PW7 A;  4KHP H;  3PZP A;  2GQS A;  5L1I A;  3UQ8 A;  1CE8 A;  5I47 A;  1TWH A;  2YZG A;  1Y1V A;  2XIG A;  1TA8 A;  3MR5 A;  5KFH A;  4B3S H;  4ED8 A;  2ALZ A;  2R93 A;  5KFW A;  3W1B A;  4DLK A;  4FU0 A;  2DWC A;  2XC9 A;  4IIJ F;  1C30 A;  1G2W A;  2DIK A;  4QSH A;  4LMY A;  1VS0 A;  4B3T H;  3R5H A;  5KG3 A;  1I1M A;  3N43 B;  4DR3 H;  1ZET A;  4A3L G;  2GQR A;  1K1S A;  2HIX A;  4O7V A;  3KAJ A;  3KXY T;  4WBN F;  2YYA A;  3RF2 A;  3GQC A;  3G6X A;  3TII A;  3TW6 A;  3T5H A;  4X65 H;  2CNQ A;  2AGO A;  2VA2 A;  4NLG A;  5I5S A;  4A2B A;  4EBC A;  3LQS A;  2DAA A;  4O81 A;  5BYB A;  2PVP A;  3L2P A;  5KG5 A;  4DV3 H;  4GKJ H;  4ECQ A;  4I7H A;  3OSN A;  4O4I F;  4MV6 A;  3GIJ A;  4AYB A;  2R7M A;  1RJP A;  5KFF A;  2W9B A;  4DV2 H;  4DV5 H;  4XYL B;  3H3V H;  3GII A;  3N42 B;  3SI8 A;  2HDK A;  1Z2O X;  5IP7 G;  5KFX A;  4RUA A;  4CE5 A;  3RUP A;  1EUC B;  4LH6 A;  4TV9 F;  3K5H A;  4HN2 A;  3Q8P B;  3AW8 A;  2R8H A;  5K2M A;  5LOV F;  2W9B B;  2OH2 A;  3V6K A;  1BNC A;  3MWM A;  4QIW A;  4GC7 A;  4JI1 H;  4YR0 A;  2W9A A;  2FP4 B;  5DQG A;  2NUA B;  4YHH H;  2ODT X;  4J9L A;  3BAC A;  4YAK B;  2JA5 A;  4DL4 A;  4HQ6 A;  4R7R A;  3H0G G;  5KFL A;  4YQW A;  4TUY F;  3EYY A;  3T1Y H;  4A3I G;  2JA8 G;  1HNX H;  1CS0 A;  3GIM A;  3GB8 B;  1SFO A;  3JRX A;  3EPI A;  5KFI A;  4MA5 A;  5EWF A;  2HVQ A;  2R7K A;  2UUB H;  4ED0 A;  4X66 H;  2FLL A;  1XNR H;  5BPF A;  3PFF A;  5I5Y A;  2HIV A;  3OUU A;  5FPR A;  4IRC A;  3DTF A;  2FPI B;  4FS2 A;  2FK1 A;  5KFE A;  1KJI A;  3IN5 A;  4EEQ A;  1SYX B;  1WH2 A;  1W93 A;  5KFD A;  4PZ6 A;  4EG0 A;  4QWE A;  3MR3 A;  1WCM G;  4ECZ A;  1S10 A;  1S03 G;  4C5C A;  2UXC H;  5HV6 A;  5CE8 A;  2YWV A;  5EOY A;  4ECT A;  2JA6 A;  5DAA A;  4C5B A;  5EDW A;  4MV9 A;  2V58 A;  4BBR G;  4EYI B;  1XK5 A;  4RB0 A;  4GKK H;  2JA6 G;  2DAB A;  1T36 A;  1OWT A;  3VPC A;  4DAA A;  2YS7 A;  2E2I A;  2AU0 A;  1XDN A;  3TY9 A;  5KFG A;  4ZOL F;  2COI A;  4O7T A;  3LML A;  5JQW A;  5C8Y F;  2UVR A;  1EHI A;  1V9P A;  4EFE A;  5KFA A;  4YJ3 F;  3R9R A;  5IYD G;  5KT6 A;  2XCA A;  2NVX A;  4EGQ A;  1UC8 A;  2Q7D A;  3RFC A;  4WD3 A;  3GV7 B;  3G6V A;  1KJQ A;  1EKF A;  2RGV A;  4FE2 A;  3JSN A;  4QWB A;  3RB0 A;  1EYZ A;  1JLL B;  2I87 A;  2R86 A;  3WNZ A;  4APM A;  5KG2 A;  2WTF A;  3HOW G;  2JEI A;  1X9N A;  4OX9 H;  2R6F A;  2WB1 A;  1S68 A;  3PW5 A;  2ATL A;  1EKV A;  2CFM A;  5CA0 F;  2PMZ E;  2V5A A;  2RDI A;  4NYE A;  2R87 A;  3GTJ A;  2WDT A;  3H0G A;  3OUZ A;  4R8U A;  1AUX A;  4DR2 H;  4JYA H;  2R8I A;  2OWO A;  2HGS A;  1TWA A;  3QZ8 A;  4ED7 A;  2BR0 A;  4QWC A;  4Q4C A;  2HVS A;  4FBT A;  2I80 A;  1GSA A;  5J2T F;  4FM9 A;  5LXT F;  3U9T A;  1I1K A;  3GID A;  4CHI A;  3RBE A;  4R8U B;  2C00 A;  5DG9 A;  3QZ7 A;  1IOV A;  2FKL A;  3HOX G;  3EPG A;  3VNN A;  4RCN A;  2VA3 A;  3HOV G;  3GTM A;  5BWX A;  4CC6 A;  4ZI7 F;  4DL7 A;  3BAB A;  5FR9 A;  1KBL A;  4LF9 H;  1BXR A;  5KG7 A;  4BBS G;  1WCM A;  4RNN A;  4DR7 H;  3T9A A;  5DMX A;  2V4R A;  3GIL A;  4FS1 A;  2AGP A;  4JI6 H;  1Y1W G;  3MR2 A;  4ED1 A;  4QWD A;  2YZN A;  4Q45 A;  1B04 A;  4QW9 A;  4A3F G;  4CMF A;  2C28 A;  4IWX A;  2NU9 B;  5KFB A;  3OTO H;  2VQF H;  4A3E G;  3TY5 A;  3JSL A;  5KFQ A;  2UU9 H;  4BXX G;  1JKJ B;  1WR2 A;  4DRF A;  1I50 A;  3RAQ A;  3OSP A;  2V9W A;  4IRD A;  1A48 A;  1E4F T;  5A2Q W;  4LF7 H;  3BQ0 A;  3ETH A;  2VPS A;  1RK6 A;  3CQZ A;  5DGH A;  4YBZ B;  1S97 A;  3ORR A;  3G6Y A;  2XCL A;  4O4J F;  4UCT A;  4HNT A;  4J9S A;  1S0M A;  2CZG A;  1EZ1 A;  4XX0 B;  3HOY G;  4O84 A;  3HXL A;  2OLS A;  5DGB A;  5C1P A;  3T9F A;  5FLM G;  1S9F A;  3TIG A;  5DQH A;  4ECX A;  3RTX A;  1HR0 H;  2F4V H;  1Z2N X;  1I7L A;  3RAX A;  3MWD A;  4J9P A;  1IOW A;  5IYC G;  2W7P A;  3JZF A;  2ASD A;  4C2M A;  3RIZ A;  4DV7 H;  4ED3 A;  1N56 A;  5EWE A;  4EFB A;  3QFF A;  3U54 A;  4O4H F;  4MTE A;  5L1J A;  2E5L H;  5HBR B;  4RUC A;  1UC9 A;  4CKB A;  4EQ5 A;  4F50 A;  2FMA A;  3J80 W;  1IBM H;  4BY1 G;  4EYH B;  4O4L F;  3WWH A;  1B33 N;  3RB6 A;  3HOZ G;  1RJR A;  4RAY A;  4Q8F A;  2ZDG A;  2W6Z A;  2W6Q A;  2GPW A;  4HR7 A;  4O3P A;  1KUT A;  4XZ3 B;  3GTK A;  2X0S A;  2W57 A;  2FLN A;  5KT3 A;  4LFB H;  3CEB A;  2FE3 A;  2HGX A;  3RJ0 A;  1E4E A;  1VAJ A;  4U6P A;  3Q8S B;  2MCT A;  5IP9 G;  4DV1 H;  1ZAU A;  1Y1W A;  5DIS C;  4PZ7 A;  4J9O A;  2W6N A;  2ZDH A;  4IHJ F;  5D8D A;  2Q2U A;  2NVY A;  1BJT A;  4JV2 A;  4LF4 H;  4UCV A;  1XMQ H;  2W6P A;  4IRK A;  1T3N A;  3WWJ A;  1E4G T;  5E25 A;  3GV5 B;  1AUV A;  3SNO A;  3Q1K A;  2WAQ E;  5CAE B;  3R5F A;  4O3O A;  1CQI B;  4EEY A;  3NUA A;  5FPO A;  3WWI A;  3V6H A;  4JV1 A;  5LYJ F;  2W8L A;  2J9G A;  4FFL A;  3BJY A;  4JUZ A;  3L4K A;  3DAA A;  4YR2 A;  1I2L A;  3H4D A;  4ED6 A;  5KFJ A;  4NZM A;  4MTD A;  5KFC A;  2DPJ A;  3MWE A;  2ZM6 H;  1CQJ B;  5KFU A;  1GSO A;  3VPD A;  3SGI A;  4Q44 A;  2XCP A;  3TIN A;  3BA8 A;  4MAM A;  5BYA A;  2UXB H;  3R5X A;  5KFS A;  3RGZ A;  4LH7 A;  4YB8 B;  4JI2 H;  3QQM A;  4LF8 H;  1XNQ H;  2COJ A;  4DQN A;  1DAA A;  1VBG A;  3DTG A;  3NBY B;  1V51 A;  3CSW A;  3RGX A;  4PBC A;  5KFN A;  1UNN C;  5DGA A;  1JDB B;  3NBZ B;  4X62 H;  1EUD B;  1BGW A;  4EBD A;  2DZD A;  5EWG A;  2W6M A;  4O7L A;  4TM5 A;  3GIP A;  2V4Q A;  4F4X A;  2C2R A;  1AN7 A;  2R7L A;  5C3E G;  3LP8 A;  4CMD A;  2R7Z G;  5GON F;  5KT2 A;  4O3R A;  4NXN H;  3GTO A;  2VUG A;  2JEJ A;  4BY7 G;  4O7R A;  2W6O A;  2CNV A;  3N41 B;  1WSC A;  3GV8 B;  4TV8 F;  4JI5 H;  2GLT A;  5KFM A;  4EBE A;  3HKZ A;  4K0K H;  3U0G A;  1ZQ7 A;  3LUL A;  3FDS A;  4IWY A;  4F4Y A;  2EIY A;  5DGI A;  1B6R A;  1M0W A;  4I50 F;  2CKZ B;  5KG6 A;  4M7E A;  1DV1 A;  2Y0S E;  3VMM A;  1SCU B;  2ZJT A;  4YR3 A;  1KTA A;  3HO8 A;  4Q43 A;  2NU6 B;  3PR4 A;  2UUC H;  4DUZ H;  5DLF A;  1O75 A;  1HNW H;  3HOU G;  4DV0 H;  3IG0 A;  3T54 A;  2HVR A;  4ETS A;  3I12 A;  4YAJ B;  3T9C A;  5HNE A;  2C35 B;  3T1H H;  2AQ4 A;  1Z2P X;  5BWW A;  2KSW A;  4IZO A;  3L4J A;  4WHX A;  4CKC A;  3PR5 B;  2FPG B;  2I8C A;  2VQE H;  3K3V A;  4TVI A;  1IBL H;  3T5J A;  3M9M B;  4IR1 A;  4FFN A;  4JI0 H;  2HGW A;  2FPP B;  3J81 W;  2NU7 B;  1I2K A;  2FK2 A;  4IR9 A;  4M9U A;  4O86 A;  1IYE A;  2Z04 A;  3KHL A;  4JI8 H;  2X5R A;  3RV4 A;  2YZL A;  1PK8 A;  5JH7 F;  5KFT A;  3DF7 A;  1PX2 A;  3UFX B;  1KC7 A;  4LFA H;  4L1K A;  4MV3 A;  4K6N A;  1Y14 B;  5DLG A;  3HB9 A;  3MR6 A;  5I5X A;  4ECW A;  1JXL A;  3GTQ A;  4JV0 A;  3RB4 A;  1FVI A;  1DGS A;  4J9Q A;  3GTL A;  2O03 A;  3FKI G;  1N34 H;  2R8G A;  4J9K A;  2B63 G;  4JI4 H;  3GIK A;  4DR5 H;  1ZHS A;  4RZR A;  3NGD A;  2WYO A;  4HNU A;  1S0N A;  3UZO A;  4GC6 A;  2R7Z A;  5D1O A;  4E4T A;  5D1P A;  1RYR A;  3AYH B;  2CNU A;  3HBL A;  1M7J A;  4O7S A;  4O2A F;  2RGR A;  3U9S A;  1CKO A;  5CA1 F;  2WE6 A;  3T9E A;  4A3B G;  2XGQ A;  3JAM W;  1OBD A;  3T9B A;  4DL6 A;  1N36 H;  4LF5 H;  1I1L A;  5D1O B;  3TQT A;  3I4N G;  4JXU A;  3S24 A;  1MZB A;  2R8K A;  2AGQ A;  5KFY A;  4A3C G;  1IBK H;  2HJW A;  3U55 A;  3UYY A;  3PW4 A;  2Q2T A;  1GSH A;  4DL2 A;  2QB5 A;  2YL2 A;  3E5N A;  5FD6 A;  2YCH A;  4I4T F;  4UCO A;  5KT4 A;  2VOB A;  3VPB A;  2FB9 A;  4ME6 A;  5I5W A;  3HT5 A;  4EGJ A;  5KT7 A;  5KT5 A;  2FJZ A;  2JA7 G;  2W71 A;  3V4Z A;  3Q8R B;  4PWQ A;  4JI7 H;  4DR4 H;  1GYF A;  3N6R A;  2WB1 E;  3BAA A;  3GLK A;  1JIH A;  1RJQ A;  1ULZ A;  3N6X A;  4LSX A;  3JRW A;  2ZDQ A;  4RNM A;  5CM0 A;  1M6V A;  5KFO A;  3MFI A;  1TWG A;  2YU9 A;  5L1L A;  5T14 A;  1HNZ H;  2ZGI A;  2R82 A;  5FLX W;  4ECU A;  2WAQ A;  1FKA H;  2HHF A;  4X64 H;  1TWC A;  2M05 A;  2QK4 A;  5KS8 A;  1JDE A;  4E6N A;  3VOT A;  1TWF A;  4ECV A;  4A93 G;  4IAJ A;  3TEK A;  3JZ6 A;  3W5O A;  1WRV A;  3KTM A;  2RF4 A;  4TQS A;  4YJ2 F;  4O3S A;  1VKZ A;  2YRW A;  2VR1 A;  1A9X A;  5BPH A;  3GJX B;  5LL6 b;  1JX4 A;  3G8C A;  1FJG H;  5KX5 F;  2HHF B;  5KFV A;  4FFO A;  4GLX A;  3FKI A;  2IBK A;  2B63 A;  1N48 A;  1I3Q A;  3T5L A;  2CW7 A;  3R23 A;  5KG1 A;  1K83 A;  4QWA A;  3K3P A;  1K1Q A;  3T7A A;  4JI3 H;  1M0T A;  5F9N A;  5DG7 A;  4I55 F;  5C1O A;  1CKN A;  5FNV F;  5H80 A;  3N44 B;  5KFK A;  5C44 G;  4TQR A;  4Q4D A;  2W70 A;  4CKE A;  3PW2 A;  4BWS C;  4DIM A;  1E4E B;  5JVD F;  1V4Y A;  2CQY A;  5KFR A;  3C0F B;  2IMW P;  4HNV A;  4G3I A;  3PO2 G;  4FFP A;  2E2H A;  2HG8 A;  5I5U A;  1KJJ A;  3T9D A;  4Q0Y A;  2NU8 B;  2QYZ A;  2Z02 A;  3TQ1 A;  3RB3 A;  1XMO H;  1A0G A;  1CKN B;  4RB3 C;  2UXD H;  4J0M A;  2R8J A;  2QF7 A;  4LF6 H;  4YY3 H;  2A1H A;  3PN1 A;  2JA7 A;  4ZQI A;  2CW8 A;  3GTG A;  5EZY F;  1ZHQ A;  3V6J A;  4CC5 A;  2Y0S A;  4RB1 A;  4DR1 H;  4ECS A;  4PZ8 A;  3GDE A; 
#chains in the Genus database with same CATH homology
 1O75 A;  1HNW H;  4DR7 H;  4DV0 H;  3IG0 A;  2HVR A;  4LMY A;  4ETS A;  1VS0 A;  4B3T H;  3T1H H;  4JI6 H;  4NXM H;  3N43 B;  1Z2P X;  2KSW A;  1B04 A;  3L4J A;  3TY8 A;  2VQE H;  2HIX A;  3KXY T;  3KAJ A;  1TAE A;  2VQF H;  4B3M H;  3K3V A;  3RF2 A;  3OTO H;  3TY5 A;  1IBL H;  3JSL A;  5BR8 H;  1I94 H;  4A2A A;  2UU9 H;  4UCS A;  4DRF A;  4X65 H;  4JI0 H;  4LF7 H;  1E4F T;  5A2Q W;  4A2B A;  3J81 W;  3L2P A;  4DV3 H;  4GKJ H;  1I6U A;  4JI8 H;  2VPS A;  4I7H A;  4MV7 A;  4UCT A;  1CKM A;  4LFA H;  3DF7 A;  4DV2 H;  4DV5 H;  3HXL A;  3N42 B;  2HHH H;  1Z2O X;  1FVI A;  1DGS A;  2O03 A;  4LH6 A;  3RTX A;  1N34 H;  1Z2N X;  1HR0 H;  2F4V H;  1L2Z A;  4JI4 H;  4DR5 H;  4LSA A;  3BA9 A;  1ZHS A;  2WYO A;  3RIZ A;  4DV7 H;  4JV5 H;  5D1O A;  5D1P A;  3MWM A;  4EFB A;  3KYH C;  4MTE A;  2E5L H;  4LFC H;  4JI1 H;  3RR5 A;  2RGR A;  1CKO A;  2WE6 A;  1A0I A;  4YHH H;  4EQ5 A;  3J80 W;  1IBM H;  3JAM W;  2UUA H;  4R7R A;  4RAY A;  1N36 H;  4LF5 H;  3EYY A;  3T1Y H;  5D1O B;  3S24 A;  5IWA H;  1HNX H;  1MZB A;  5LMU H;  4UCR A;  3NC0 B;  3GB8 B;  2W57 A;  2Q2T A;  4LFB H;  2HVQ A;  5FD6 A;  4UFZ A;  2UUB H;  2FE3 A;  2YCH A;  4UCO A;  4X66 H;  3RJ0 A;  2VOB A;  4DV1 H;  4DR3 H;  1FJG H;  2MCT A;  1XNR H;  5DIS C;  3W1G A;  4PZ7 A;  2HIV A;  4PDB A;  5FPR A;  4JI7 H;  4DR4 H;  2Q2U A;  1P8L A;  4LSX A;  3BAA A;  1IBK H;  1BJT A;  3N6X A;  4LF4 H;  4UCV A;  1XMQ H;  4EEQ A;  1SYX B;  1WH2 A;  1E4G T;  4PZ6 A;  1S03 G;  1HNZ H;  2UXC H;  3FMA A;  5EOY A;  5FLX W;  4DV4 H;  1FKA H;  4RZQ A;  4MV9 A;  4X64 H;  1XK5 A;  5FPO A;  4E6N A;  4RB0 A;  4GKK H;  3N40 P;  4IAJ A;  3W5O A;  3KAL A;  1XDN A;  3TY9 A;  3L4K A;  3CVZ A;  4MTD A;  3LML A;  2ZM6 H;  1V9P A;  3GJX B;  4EFE A;  1SEI A;  5LL6 b;  3BA8 A;  4GLX A;  4RAZ A;  4DV6 H;  2UXB H;  4RB2 C;  3RGZ A;  5IT9 W;  4LH7 A;  2RGV A;  3JSN A;  2CW7 A;  4JI2 H;  1N33 H;  4LF8 H;  1XNQ H;  3NBY B;  4APM A;  5LMN H;  3RGX A;  3QWU A;  1X9N A;  4OX9 H;  3M4I A;  1N32 H;  4JI3 H;  1M0T A;  1GYF A;  1S68 A;  3NBZ B;  4X62 H;  1BGW A;  3F8N A;  2CFM A;  1CKN A;  3N44 B;  3KAK A;  1AN7 A;  4BWS C;  2WDT A;  4DR6 H;  4DUY H;  3C0F B;  4DR2 H;  4AQY H;  3J7A K;  4UCU A;  3H20 A;  4JYA H;  4B3R H;  1P16 A;  4Q0Y A;  4NXN H;  2OWO A;  2VUG A;  2HGS A;  1XMO H;  1J5E H;  1CKN B;  3N41 B;  5FD5 A;  2HVS A;  4RB3 C;  4JI5 H;  2UXD H;  4J0M A;  4FM9 A;  4LF6 H;  4YY3 H;  4K0K H;  4KHP H;  3PN1 A;  3UQ8 A;  4B3S H;  2XIG A;  1TA8 A;  2CW8 A;  4M7E A;  3VNN A;  1M0W A;  1ZHQ A;  4CC5 A;  2ZJT A;  4CC6 A;  4RB1 A;  4DR1 H;  3BAB A;  2UUC H;  4LF9 H;  3W1B A;  4PZ8 A;  3GDE A;  4DUZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...