2ZDHA

Crystal structure of d-alanine:d-alanine ligase with adp and d-alanine from thermus thermophius hb8
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ADP and D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 96
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdhA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdhA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdhA01
4EGQA 5K2MA 1T36A 1VBHA 1PK8A 3V4ZA 4MV3A 4YAJB 4O7WA 2NUAB 4HR7A 4HNTA 1C3OA 3WO0A 1E4EB 1GSHA 2FPGB 3E5NA 3ORRA 4YBZB 5JQWA 5JH7F 2W6MA 4IWXA 2VR1A 2YL2A 2NPOA 4DIMA 3BSWA 1PX2A 5HBRB 2GQRA 2R7LA 2W6ZA 1I7LA 4L1KA 1KUTA 2R7MA 1JDBB 3R5HA 2YRXA 3MJFA 3BG5A 3K5IA 3AW8A 4O7VA 3TQTA 2R86A 4C5CA 3MWDA 3BSSA 4IHJF 4RZQA 4I50F 3NUAA 4MAMA 2XD4A 1W93A 5CB4F 4FU0A 2FB9A 2YZMA 3VPCA 4TV8F 4C5AA 2FP4B 4M98A 4MV4A 1Z2OX 4O84A 3TIGA 4O81A 5JVDF 1EHIA 5H80A 2GPWA 3DF7A 2SCUB 1KC7A 3OUZA 2FPIB 4I4TF 5CAEB 2Z04A 1CS0A 5KX5F 4O7YA 3ETHA 2WYOA 4O86A 3LP8A 2YS7A 4FFMA 4IWYA 1EYZA 3VOTA 1BNCA 4FFNA 4YAKB 3TIIA 5LOVF 1A9XA 1GLVA 3TW6A 3HO8A 2W6NA 4ME6A 1DV2A 2XCLA 2R87A 3BSYA 3WNZA 4M99A 1SCUB 3VPDA 3U55A 5BMVF 2IP4A 2YRWA 2YZGA 4O4HF 3JZIA 3ORQA 3Q1KA 1KEEA 1IOWA 1OBDA 1EZ1A 2W6QA 5LXTF 1EUDB 4MA5A 4O83A 4MA0A 2V59A 2R85A 2W70A 3VPBA 1EUCB 3KREA 3R9RA 5C1PA 2QK4A 1KJIA 2W71A 3TINA 2YYAA 4TV9F 2GQSA 2HJWA 2YW2A 5CA0F 2YZLA 4XYMB 2NU8B 4I55F 3K5HA 2NU7B 5D8DA 5LYJF 2DIKA 1BXRA 4O2AF 3AX6A 4EGJA 2J9GA 1AUVA 2YWVA 4XX0B 3I12A 2YS6A 4NYEA 4O4LF 5DMXA 3K3PA 4O4JF 1OBGA 2VQDA 2W6OA 1Z2PX 5EZYF 3KAKA 1A48A 2V58A 4O7NA 3G8CA 3N8DA 4M9CA 4HNVA 4FE2A 1VBGA 5KKNB 5LP6F 3HB9A 3Q2OA 4ZQIA 3OUUA 2R84A 5BPFA 1B6SA 4DLKA 1E4EA 2R7KA 3SE7A 1GSAA 2X0SA 4HQ6A 1JDEA 5FNVF 3R5FA 4ZHQF 4WD3A 4YB8B 2DWCA 4IZOA 1JLLB 1M0TA 4MV1A 3KAJA 4QSHA 2CZGA 2I80A 2VPQA 3RV3A 4EA8A 2R82A 1B6RA 5GONF 2CNVA 5LA6F 5HV6A 2R7NA 5JQGF 1ULZA 5C8YF 3JZFA 2GLTA 4FGRA 4IIJF 4EA7A 4FFLA 3N6RA 4FFOA 5JVLA 4O7SA 2GPSA 2DZDA 3U9TA 1KJQA 2VHEA 3UFXB 1KBLA 1VKZA 4O7TA 4YJ2F 4FFRA 1IOVA 1KJ9A 3HBLA 5J2UF 1C30A 4O4IF 3VMMA 2C00A 4ZI7F 1JKJB 2V5AA 2R6FA 4EA9A 2ZDGA 3LWBA 4M9UA 2NU6B 1M6VA 1GGOA 3R5XA 1KJJA 2W6PA 4XYLB 2DLNA 3G8DA 5I47A 5C1OA 4GGMX 3RFCA 1GSOA 2NU9B 3WO1A 4EABA 2I8CA 2YZNA 5CA1F 2ZDQA 5J2TF 1KJ8A 3GIDA 3V4SA 2FPPB 4O2BF 1DIKA 2I87A 2OLSA 4O82A 3BFPA 1Z2NX 4FFPA 4YJ3F 4MV8A 3MWEA 4MV7A 4O7ZA 1CE8A 4HNUA 4MV9A 2PN1A 3U54A 3U9SA 2QF7A 2CNUA 4EAAA 1CQJB 4E4TA 1I7NA 3ETJA 1CQIB 4O7LA 4WBNF 3R23A 4C5BA 1UC9A 2CNQA 4Y8VB 2ZDHA 4ZOLF 4J6EA 3GLKA 1WR2A 4XZ3B 5BPHA 3QFFA 1M0WA 3JRWA 3KALA 4TUYF 3VA7A 2CQYA 2HGSA 2P0AA 4EG0A 2PBZA 1DV1A 2Z02A 1W96A 1UC8A 2PVPA 3RV4A 3RUPA 4O7RA 5IYZF 4MV6A 1AUXA 3JRXA
chains in the Genus database with same CATH superfamily
5HUHA 4BV2A 1JPVA 3UT0A 3G2PA 3QJYA 2GPAA 4EBBA 2FQWA 2RDJA 1YB2A 1PAUA 1Q12A 3BPSA 1ZA2A 4GVXA 1GTVA 3I92A 3RS8A 1M1XB 1EK6A 4ED6A 3HV2A 3IO3A 2CVHA 3N0WA 5CLGA 4BMVA 5EC8A 3NC1C 2F6RA 1Z5VA 5EY5B 4ARAA 2AG0A 4DUZB 1XMIA 2ZETA 1G19A 621PA 4B84A 1KFBB 4TRRA 2FUNB 1WXIA 3SXUB 3W5SA 2ZWIA 1NX9A 1O8BA 2ZVPX 4Q9KA 1NVUQ 1V8BA 1JJAA 2BFAA 3ZVNA 1PFQA 2PX6A 4Q1CA 1FSZA 3HGMA 2AOWA 4MEJA 2P65A 1XN1A 1RKQA 1P3DA 3OQVA 3HCRA 1U9CA 1GLNA 3OMWA 3D6FA 2FZWA 4EUFA 4ZODA 3A25A 1ZL2A 1W1IA 1MAAA 3KQKA 1PRYA 1CVLA 1W2HA 4DQNA 4A3FG 4C0KA 2R1ZA 2O3QA 3EZ6A 4OXQA 3QLVC 5LYYA 5I3ZA 2AFIE 3IVRA 3ZU3A 5I8ZA 1OWLA 2ZYDA 1Q20A 4XTRA 2PT7A 3LY8A 1QGED 3VISA 3HJTA 3F46A 4ETIA 1DRWA 2GXAA 4Z4EA 4JJKA 1KEKA 4CM9A 3H9UA 2D00A 1T8RA 1Y7IA 3DV2A 4EVQA 2GFIA 3OEYA 4GIBA 4KYTA 1OVMA 3GAFA 4ITUA 3I6BA 1G7CA 4Z4IA 5I5YA 1EGAA 1ZAUA 2JFZA 4KSCA 2YUIA 4QNMA 4H7EA 2I76A 5AXCA 4LYHA 4R2XA 3ZWNA 3I39X 3JYQA 2RGWA 1WF6A 5LBIA 1TRHA 4FQ7A 2WUDA 2IPMA 4RY8A 3HA7A 3R0QA 4BFVA 3AHHA 1NWCA 3SVTA 4CU2A 5REQA 2O0MA 4GLFA 2JJ1A 5KJFA 1O0SA 3AUYA 3L6UA 1YBHA 1K7FB 2J41A 4KWIA 4PLFA 2O4CA 2FSVC 4B5LA 1BX3A 4NZPA 4KN5A 5LIRA 4RM2A 2MT9A 4HQ0A 1ECJA 5HCNA 4FEYA 3WIDA 3CKYA 3NQ41 1DXOA 2NIPA 1QCCA 1OXXK 5G4KA 1ZNYA 1S6YA 3BQ9A 1DBPA 5DV9A 3PNBA 3DC7A 1RACA 3FFBA 5B7QA 4CJXA 5HA5A 4DDUA 1CHDA 5ALQA 3Q8WA 3V8PA 2VNSA 2JDIA 5CAEA 2G5CA 2XNJA 3C97A 1KVQA 3V97A 1RAHA 3PR2B 2L0XA 2WE8A 2QQEA 1V8FA 1MQ9A 2NV0A 3E81A 2HGXA 4BP9A 3N8IA 4BTVA 2Y2VA 3STXA 1R8SA 2HTEA 4KMMA 2HL6A 1T9GS 2OB2A 2FRXA 1WRBA 5F4BA 1R0KA 3FBWA 3IQWA 5AIAA 3KZOA 3AUKA 2E2IA 4YJ3F 1W1UA 4YJKA 4IDGA 4E2ZA 2BUBA 2PX3A 4LXIA 2CVZA 3L0DA 1T4MA 4RS4A 1JEQA 4FT2A 5D6NA 2UXDH 1YH3A 3LQYA 5BP7A 1XQWA 1RTTA 2YY6A 3PP8A 2HLNA 4HBZA 1TQ6A 2FAXA 5JNLA 3FGPA 4GVPA 1LVGA 3ZV4A 3F6RA 2J3LA 2JKYA 4RA6B 2KB0A 3QI2A 5KG4A 221PA 5FX2A 4XYMA 2V1XA 3HEMA 2HU2A 1U6IA 3L1UA 3O9MA 3AFHA 2HK6A 2ATEA 1CUEA 1C0KA 2A67A 4W8OA 3D02A 1Y9JA 1GQFA 1P0FA 4Y2VA 4TWJA 2B1RA 2WQZA 3MRTA 2GM5A 3WGQA 4GGOA 3DA8A 3TW7A 5FAXA 4D2IA 3UMRA 2XQGA 2VWHA 4CLXA 1U0JA 1P4JA 2L69A 2G1KA 1SD1A 2AMVA 1N57A 5GWXA 1BGXT 3OMXA 1XB2A 5ALXA 1E92A 3GW8A 3GJ7A 1CUXA 5C4MA 1ZIPA 2FW0A 1HF3A 2D2XA 5IDVA 2W7TA 3CA8A 3K30A 3MIZA 3WMEA 5B6IA 4KIWA 4WY2A 2F8LA 5KAMA 2JFGA 3UAZA 4FCVA 1M5TA 4IR9A 4NY1A 3C15C 2YXNA 2ASJA 2FX3A 1E2KA 2XOEA 2FCRA 3GA7A 5D87A 4O84A 2F3QA 4INZA 1ZSYA 1T4CB 1AOXA 4QYTA 1I3CA 3LC0A 1PR0A 5FO0A 1U9JA 2IT1A 2Q0QA 5DTMA 3WTCA 4HFRA 3RRXA 2VBCA 1VA5A 5EMLA 3BRQA 1BNCA 3UK0A 3CM0A 3TIIA 5T41A 2H1RA 1DLJA 5BWWA 3LF2A 1E9CA 5L4LA 5IYZB 1P1FA 3HDJA 3H5LA 1DAGA 3GAMA 3AVWA 1Y4SA 4LZNA 2I2FA 1C9EA 1WVIA 2VBFA 5KOYA 5E6SB 1XTUA 3T9DA 2GAJA 4XM2A 3QFHA 5TS2A 5K09A 2J9FB 1H5QA 4PHGA 2P2GA 4KV9A 4HYEA 2WUGA 1PYGA 2PYDA 3AXSA 5EP1A 1EFKA 2LNDA 3K2EA 1JA9A 3MFYA 4LKRA 1EKPA 5BWOA 3VKFA 1K6EA 5GONA 3K8OE 2B1QA 1U63A 1PBTA 2OESA 3U7FB 4JI1H 1KI4A 4AURA 3NCHA 1B41A 2H6EA 4IIJA 3T9EA 2ORYA 4EB6A 3DWGA 4ZTBA 3IKTA 1TEVA 4ZQIA 1L7NA 2RGEA 3W9YA 5IWCA 3BDIA 3T7TA 2ZWOA 2IKSA 1MEJA 3JALA 4M55A 1MJGM 4MV1A 3KJNA 4QSHA 4CM4B 3HM2A 3UJPA 1SHTX 2OQRA 3HLTA 3A9SA 4CMEC 2C54A 5HIJA 4M8NE 2XIJA 2B37A 3A4NA 4Q4AA 1RYBA 1G9TA 3HVUA 4D3DA 3PLAE 2IYXA 1L7VC 3UH1A 4NXMB 5FBRB 1RLUA 4CKYA 3UANA 3IVGA 3OU2A 4C4ZA 3FN4A 2P2LA 2FEXA 4MARA 3PHHA 2PS0A 5EJEA 1KBLA 5J23A 1VDZA 3HDYA 2P6RA 4UVGA 2JGAA 3VNBA 1S3IA 2WJ3A 4DRZA 1QZZA 2R6FA 4QHTA 3OD1A 1LRLA 1W36C 2P3SA 5HIMA 1PZXA 4MGYR 4M37A 5IHPA 3MWYW 3VU3A 3GGGA 1LFDB 3PCTA 2Q1UA 1NONA 3EGWA 4MYTA 4CT5A 1E5LA 2EQ5A 2OCBA 2FJZA 2Y1OA 4ACAA 3GUCA 3AEQA 4RD4A 3VYSB 4P7GA 3L0CA 4UW9A 5AVXA 2D8MA 1N3YA 5M2QA 2WKPA 3J81W 5EQJB 4BNNA 1D04A 4Y1GA 3ZDDA 3EBOA 3VR4A 4HDKA 1IVYA 1MIOA 1W36B 2WM3A 2CDRA 3K6JA 3AEYA 4ND8B 4FW8A 3PQ6A 5GOTA 3CZPA 1YZ3A 4UQPA 2FJPA 3B13B 3PRJA 3TLJA 2IIQA 2DY0A 3KALA 2NXNA 2XCPA 2UZAA 3HFGA 1MNAA 4GXQA 4OHVA 4R1SA 5IN5A 3ZC3A 4QXRA 1DV1A 1Y4AE 4P0QB 3HV0A 5JCXA 2GPBA 1FFSA 5F35A 5KNCD 4EWLA 4WKGA 3AUXA 4BZWA 2G82A 1KWGA 2ZU0C 1YOBA 1BEZA 2ZTHA 3RYIA 3CSWA 5DEIA 4CQMA 3EE6A 4ZIRA 3U4AA 4YAJB 4XGKA 1YR1A 1G6HA 4NOLA 5LSAA 4C78A 1RXEA 3H6GA 3FHCB 4M9ZA 4Y9TA 4X3PA 2ZJZA 3JVDA 5HBRB 4RHTA 1V96A 2C5GA 1X87A 1NQXA 4C03A 1R3DA 2AG1A 4W1RA 4CCYA 1SBHA 3NV7A 1AKUA 5JD3A 4JLKA 3RSHA 4C7VA 1OIXA 4BV9A 1LK7A 2P9EA 4LRWA 3K94A 3BQ0A 2Z6AA 3JQ7A 2A92A 1NPTO 5B3KA 2AZXA 4G01B 5EKXA 4GW3A 1AN0A 4HSGA 1M34B 5I4CA 1ZETA 3UFXA 4W5QA 2AQHA 3VKUA 4X1KA 3L0PA 3BUSA 4BV8A 4KMOA 4LJAA 2X9QA 3C4VA 4X94A 3ZU5A 1T3NA 1S8OA 2XVZA 4MVJA 2B1IA 3V6HA 2QNBA 3DKRA 2CK3D 4TL8A 1PWEA 4QLAA 1VRCA 1AB5A 1LS6A 4B3TB 5CDGA 2Q9UA 4KTTE 3KT3A 1IWBB 4EUEA 5I9NA 3QP9A 1NFQA 2GF2A 1P5HA 1HG0A 2QZJA 4U2DA 3DLHA 1Z8HA 4D3SA 3M9OB 4GR5A 3ZIAA 1N2ZA 4HAXA 1Z6AA 1I6WA 1QZUA 5A02A 2Z5GA 1JXLA 3A7EA 4RY0A 2A7QA 3QVGA 4K9SA 2XLCA 4EHBA 1EUCB 2QRPA 5B1HA 3PK0A 4QLOA 4AJKA 5JCOC 1T2VA 3JQ8B 1OYOA 2PXAA 1J2EA 2Q29A 2VQFH 4DQDA 2YWRA 4ED8A 5CA1B 4BWVA 2R8ZA 4X1IA 4WK4B 1MOPA 4AYBE 3BE5A 2E9SA 4FJ1A 4PLZA 5BWCA 4IHJB 4S1NA 5JI3E 3H42B 1FFAA 3GHYA 2V8OA 4QTXA 2RJNA 5CGQB 4HWPA 5LP1A 5BWNA 1L7AA 4V1CB 1ZD8A 4CXMA 4QFMA 1R4NA 2JS7A 3KDAA 4G0OA 3I76A 4LIPD 3SQWA 2P3OA 5DISC 1BRMA 5HF5A 2W2XA 4EO7A 1SCKA 1PHPA 2CXQA 1P44A 3T5PA 4BN4A 2XQKA 3PR4A 4PF1A 3F6SA 3KPWA 4R9NA 1L5NA 4RULA 1P62B 1UJNA 1CF9A 5CMLA 1Y9ZA 4D8YA 4X8MA 4RPJA 2ATCA 4KYIB 3GUUA 1FYVA 4JI2H 4Z4GA 3EGIA 2FG6C 2X0KA 1CSEE 3D3JA 5IBRA 3COVA 5JWHA 5CB4A 4ZGGA 1SBNE 5TQJA 3DMHA 3HU2A 1JKJB 1XYVA 4IXDA 1UXHA 4GE0A 5DE3A 5DISB 4WBNA 2VH2A 3WWOA 2HIHA 1GTL1 2BV3A 3MHPA 3NEAA 2JLBA 4I5EA 5TVGA 2LDBA 4ZOLA 2NM0A 1AKTA 4GC6A 3CF2A 2XUQA 3QBEA 1GIAA 1B6GA 2JATA 4WN3A 4J9RA 2AD1A 4ERNA 1UJ6A 1T15A 1YKGA 2X5RA 1N2CB 4BVEA 3WWIA 4NI5A 1CLEA 2XYGA 3MWEA 1W85B 4I4NA 2V0CA 4P3KA 3MJHA 3Q8SB 1ACMA 3G0OA 1ZGAA 1M76A 2N9UA 1DC3A 1Y98A 3R23A 2XUGA 4KNYA 3PHCA 2ZBPA 4AKIA 3HWRA 4WIAA 3DUFB 4OO3A 3EA5A 3KB1A 1D9ZA 4XZ3B 1ICEA 1IZZA 3JRWA 421PA 4QNRA 1P0QA 3UJNA 2AX4A 1QIFA 4X00A 2FHSA 3D8UA 5DXAA 2OZKA 2W8BA 1ZH8A 1XEAA 1N6PA 1M2OB 2P0EA 8LDHA 3KT0A 4FC6A 5F3RA 2GT1A 4BB5A 3SR4A 2DWUA 1JAIA 4GI3A 3MTGA 4CLEA 1CQJA 2NPFA 4M83A 1ZCFA 2DG2A 1CQIA 2M2IA 4IHAA 3WRYC 4GOLD 5ARBA 3FMIA 1G21A 4RJ2A 3LG2A 1JKFA 3UZBA 2ALZA 1TM2A 3L49A 2C4MA 2PE5A 5LJIA 2JFVA 1NM5A 2OOKA 5CW1A 3R6DA 2YCLA 5FUBA 4MQEA 4JOCA 4PG4A 2RH5A 5HP4A 3H9QA 2Q9CA 1J21A 1W8DA 3W4JA 3RC8A 4H08A 1ZA1A 1YMUA 4BKRA 4YRZA 5IC5A 5KYWB 1OBFO 3PQDA 1I0LA 4EATA 4B6FA 2Q0HA 2AC4A 5CXSA 3VR6A 2FEAA 3AOEA 1BCSB 3QMPA 1YBVA 1YRLA 3I72A 4OUKX 5K1ZA 4AQYB 2W7PA 4URWR 1XPOA 4M60A 4PX5A 1MOQA 3V5NA 4BAUA 5BQPA 1YA8A 3VTKA 2FPMA 4XIJA 2MSLA 3MUNA 3HUUA 2DTDA 4MS1A 5JO9A 1EK1A 4O4HF 1SXGA 1KT8A 4ZANA 3G59A 5B2ZA 1AD2A 1PK7A 4BGVA 4EO4A 3LDHA 2HUNA 1DKUA 4JYZA 5COAA 1A3GA 2COUA 2O52A 3C4JA 4CHTA 3KB8A 3FPHA 3RKRA 1KJIA 1UMCA 2WYWA 3S8MA 4JUCA 4NBLA 5ADWA 4EITA 4JV2A 1G0OA 4Z0PA 3FPAA 1JIVA 3GLFB 2XCQA 2DPJA 4OXRA 3JZMA 2VYVD 3E9QA 4Q39A 1NW4A 4GKKB 3DDZX 4RE5A 5E1BA 2VP6A 3NYWA 4EDHA 1WUKS 3GWGA 1P4GA 3KQUA 3ZN2A 2H3EA 4ZVLA 1KMMA 1RWVA 2I2DA 1NMYA 2WU1A 2GRJA 2N3ZA 5DOZA 4Z7OB 3O21A 3IP7A 4NH4A 4QJ3A 4EYEA 3ZX4A 3TPCA 3TDNA 4ETNA 1MJ5A 4KN8A 2C0CA 1E3WA 2ZJ7A 5AVZA 5FTJA 3HR4A 3X1ZA 3ILVA 3CNQS 3TCNA 5E2AA 3GRFA 1UJ4A 3K72B 3EC7A 3VX3A 3MWDB 2W11A 4X64H 4OL9A 2R7NA 3JZ6A 1XDDA 4P82A 1JQJC 4S1TA 3VPSA 2IL1A 2YWXA 3LUCA 3OE4A 4MR9B 3UEOA 2ALJA 2JANA 1A9YA 3F0TA 4IV8A 4FHZA 4ZMSA 3U9TA 4TS9A 1JLMA 3CR8A 1VKZA 4BU0A 2W90A 4OFZA 3EIHA 1IB0A 1E0SA 3TBKA 2C00A 2QMOA 2WOJA 4N3BA 1S2DA 3EVFA 2FG7C 2VXYA 3C4QA 2GI4A 1WCIA 3PLNA 2DR2A 3HVJA 2V97A 4TUYA 1PI3A 4YCDA 4JV1A 4UPDA 4XA8A 4BAZA 2NP6A 2IUFA 2WDZA 3FJYA 3AXTA 2WP8J 1FTGA 4XDYA 1XP5A 1GTMA 4KO8A 2XUJA 2I6FA 5TF4A 3QJGA 4HNUA 1V95A 2FE3A 3GZNB 4BDSA 4GH5A 2AJCA 4A26A 3B5JA 1XK6A 4X63A 5FD8A 1H2XA 4QUDA 4CRWB 4JI7H 4KQWA 4KE7A 3R76A 4GBJA 5BQ3A 1UZAA 5F7JA 5IYDG 1FF9A 2H4XA 3G2KA 2X9VA 4JA0A 4YCCA 2WZQA 4GI1A 2O8BA 3UW3A 3QE3A 3C8MA 5K5EA 4OD0A 2LW7A 3QF7A 4BQPA 2IJGX 3ENZA 3N7UA 1J97A 2CE2X 4YJDA 3TUZC 3I1FA 3PL5A 2BP7A 2AEMA 4KEAA 3OZRA 4N9QA 2YHSA 2P7IA 3GTQA 3NHSA 2X7XA 4DBLC 1GR0A 3LOPA 3W4KA 3GFSA 3DDSA 3D7RA 3D6MA 2CHEA 5KKCA 1V1MB 2NGRA 2CVFA 5FOTA 8ADHA 3VDXA 2A35A 3AR9A 1KHTA 1CF2O 1YL7A 3FMPB 4DYDA 4NHOA 5FL3A 3OT1B 5BSGA 4D9BA 1EQUA 3CLVA 4C4YA 2NTNA 2MCTA 2ZIAA 4L27A 4JLUA 1SBZA 3HJHA 3SOZA 3WQQA 1FVOA 3I01A 4R7GA 5LLTA 1EXMA 5MN5A 4QODA 2RF4A 1JX4A 1EVYA 1JN0A 2ZYTX 3LUFA 4M98A 2HCJB 1DO2A 3VKGA 3IP5A 2QTNA 1XRNA 2C8LA 3CEHA 2WAMA 2E89A 2BCEA 5KQRA 3ROTA 2KWIA 4LFAH 1Y8QB 3GCDA 4L8WB 3T1VA 3QLEA 1NR1A 2P1ZA 3N41B 1J5EH 1OXKB 1GPAA 2A4MA 4OP3A 3D31A 3D0KA 2W6NA 1HOXA 2LGJA 1CY8A 2WPDA 1DV2A 3TY9A 2IOFK 2WF6A 2AQ4A 1P1IA 3AR3A 5AUOB 2I33A 2YVKA 3UHAA 3HP1A 2VQEB 3DZKA 2VUUA 4K6FA 3CRNA 3NASA 3T3HA 4IIBA 3RIYA 1V1RB 3KU4A 1XLUA 4FOPA 1U3GA 1UODA 2VT7A 3D3QA 1TTQB 1N92A 2C0QA 3ZZTA 5AI5A 5AI0A 4YAWA 4CLOA 4FOTA 2WQ6A 4LMAA 1HWYA 1P6QA 1WWKA 2HCTA 3C3JA 4B2PA 1XVUA 2F7SA 4BTLA 2XNCA 1FUIA 2IHJA 4M0LA 4AG5A 4F93B 2Y76A 1WUIS 4YCNA 4ZRMA 3EIFA 3BGWA 4BUCA 2EG9A 3SLKA 2VRBA 2COEA 5C8ZA 4U7GA 1QV7A 5J2UA 2H92A 5A9TA 3DVAB 1SULA 2BWJA 1C81A 2ANCA 4N5MA 3W2IA 4RTNA 4A3BG 2AZ4A 4FX5A 1V2HE 4UVIA 3FVQA 3RFTA 4GKAA 1G8JA 4R8UA 3IAM1 4FMCB 5AKJA 1XVAA 1H0SA 2XDQB 2QI9C 2C9CA 1F0PA 2OILA 5C8YF 4ICIA 1A98A 2NO5A 4J0HA 4DE5A 4O63O 4YT5A 3KV3O 2FN8A 1KZ9A 5ECYA 3DEJA 3EXAA 2W93A 4G8BA 1PYOA 4C4XA 2QX6A 3PUVA 3DDOA 1KMIY 3P45A 3ZDFA 4XIFA 4CF4A 3AU8A 1KORA 3H8WA 3LOQA 1XALA 1AE1A 4S0ZA 3IODA 3LVFO 1V45E 2FOIA 4TMVA 1WBBA 1Q1ZA 4ZU6X 3C3KA 1QIGA 3B1VA 1EDOA 2P4SA 3DBRB 1GZ6A 5J2TF 3WWYA 1HMPA 1N8NA 1Z15A 2JCXA 4CM5A 4BZZA 1QG6A 4QFDA 5JALA 4DB4A 1IVSA 2PBRA 4R40A 1KHHA 4W99A 4GWKA 1J0BA 2NAPA 2WM2A 2XUPA 4LBVA 5DH9A 1BH6A 3PW7A 4EG5A 2R5WA 3X1WA 2J8ZA 4ASUA 1XPJA 3ND7A 1NRJB 4TOIA 4RZXA 1E3LA 2UZ1B 2JD0A 2PRZA 4AJEA 3GA0A 4PCUA 4Q8FA 4OQ4A 2B3TA 2FW6A 1OH8A 1TQ8A 3EYYA 1TXGA 1EHCA 3DE4X 3A6ZA 4DRYA 2C9DA 4JK3A 4C76A 5TY0A 1UC5B 1ACLA 2X15A 3ZQUA 4OX9H 5JSZB 1WBDA 5A4DA 2LPMA 1X38A 3MF4A 2R1VB 1CBUA 5EA2A 3GJ0A 2PL1A 1F2TB 3K53A 1KVSA 2YOFA 5M7EA 2E1RA 2J4CA 5CTJA 1Z6TA 4D0NA 1MB3A 2G5PA 3VJKA 3VC7A 1NW7A 4R3NA 4ENRA 3R3XA 1KR2A 4O2BB 4PYOA 5A5FA 1C1HA 4OHMA 4TVSA 5CPBA 3KUDA 1SIUA 1KFCB 1C7JA 3VV3A 2LP4Y 2VXBA 2BEWA 5GQSA 2J3DA 5AM4A 4G4SP 1NLMA 1SCQA 3T5BA 3FKQA 3MPOA 2P9HA 1EK2A 1X7HA 1NYRA 1L8XA 3RKSA 2PO7A 1F8XA 4RD2A 1KFEB 3MSXA 4FFMA 1Y8ZA 1QUEA 3MTIA 4BNYA 2JA7A 3I4FA 4I55A 1SYXB 1IEQA 4QQRA 3QE2A 4W6QA 4XWAA 4L4SA 3IP8A 1C3EA 3AJEA 3KQYA 1QPGA 4MQLA 4RTMA 4PZZA 4LWZA 4LV5B 3K9GA 2CNKA 4JI0H 1DPGA 4Q03A 6ABPA 3DM9B 1DT5A 1G98A 3P9PA 4FSHA 4Y2XA 3H5RA 2GHRA 4K6OA 2Z57A 5F9HA 1F9EA 4OI4A 4L74A 1WOYA 1OU4A 1JHVA 1VB3A 2GQSA 4LSAA 1JVNA 4OKNA 5FWXA 2PZKA 2GN8A 3QOYA 4FYYA 4BKOA 4BX0A 3JQFA 2FJUA 3LH5A 2H52A 2XYPA 3I04A 3PCRB 5FPOA 2Q62A 3G9TA 1QS0A 1CUHA 4DSUA 1A1SA 1U0BB 1Z47A 2P2ZA 4F4HA 3EFOA 3PUZA 1SELA 4K6CA 4AECA 2PUAA 4WZBB 4MVJI 4H2DA 4KSYA 1GPUA 3EXFA 2JGDA 4MKXA 1E0AA 3SDZA 1GNRA 1M75A 3SE7A 4RAZA 4P5PA 5K03A 1Z2AA 3UMVA 4ZXFA 3R5FA 4H1TA 4CCSA 3L8YA 4GQAA 1R6DA 2ZITA 3TAXA 1E8DA 3TZQA 4COKA 5I8WA 5IEBA 3GTGA 4BKPA 1Y42X 1NVAA 5P8WA 3DVQX 4R7RA 3MINA 3ABSB 3B3AA 1W88A 3RVSA 3VAYA 2ZJTA 2NO7A 4B4KA 5A3SA 4HJXA 3RQIA 4UHHA 3MB8A 4PAOA 5EIHA 2QM8A 2I5PO 3HJBA 1JR3D 4Y2HA 5LP6C 3Q3GE 4TWIA 3DZCA 3B6EA 3OIYA 1C7FA 1QRDA 2YJNA 3WGYA 1CULC 2FPIA 4RHFA 3EIQA 4AXBA 2XA9A 4INOA 2ZIUB 3GWZA 4HQRA 1K6MA 3S1AB 1XYYA 3K6RA 1R0ZA 4Y6QA 2O8EB 2I3GA 4LYJA 4RD6A 1BOFA 1BFKA 1NU8A 1CR2A 4G0YA 4RJTA 4HKTA 1IIRA 1VFPA 1CHNA 5EXDA 1Q84A 1N3BA 2O2YA 3ADDA 2PWZA 2CNLA 3U9SA 2JCYA 2W9AA 2E87A 1OGYA 5AW3A 3OVMA 4PSVA 4K8OA 4F4YA 1Q92A 3ZH2A 4UFPA 3DTFA 5DT2A 2R66A 4WCFA 2GM3A 4DL6A 4JL5A 4YRSA 2ISQA 3B2QA 3TGLA 1DDOA 1S0OA 3AESA 4KVAA 1K7YA 4ZHSA 3K7EA 2HLDA 5FFNA 5IJAA 4OREX 4RY9A 5AKXA 2PZMA 1KPIA 1MTZA 3C24A 4CQJA 3GYBA 4D4HA 5DGIA 5AW9A 4MROA 2GEFA 4DZRA 1WMDA 1IAQA 4MWGA 1NVDA 3O4VA 2A9PA 2WB1A 3K1TA 2Q7OE 2G4CA 2YVQA 4QA9A 4DLLA 2ZQ5A 1W59A 2BM1A 2WAOA 4L2IB 3ZI0A 2CMKA 4DR1H 3OX3A 5D3QA 1AZLA 1RM4A 3NDRA 1QKKA 1SEPA 4CM6A 1L5MA 3R5KA 2RMKA 2PUJA 4AYXA 2EFEB 3JYOA 4ZMBA 2ZBGA 2QD4A 1ZW1A 3PU6A 4X60A 4FZRA 4J94A 1BOOA 4MR8A 3KLOA 2C3UA 1BHQ1 4DR5H 3DT8A 4I5IA 3AUTA 4IEFB 5ESWA 3C6XA 1N36B 2HLPA 2Y4OA 4QICA 4IDEA 3M4ZA 4JJZA 4LRQA 2ZW9A 2OVFA 1UXIA 3Q3VA 4HAYA 1CDOA 2JG3A 3RGWS 3KU1A 4IH9A 5KCZA 3M89A 5AKEA 2EERA 1KVUA 3DDWA 1G8SA 1D2MA 3LKDA 4UMFA 2M1ZA 3FOWA 5ALWA 5JH7B 5LMUH 4EFLA 4LXTA 3FPEA 4Q34A 4M6WB 5BN5A 1SY7A 4C07A 5HHTA 3F7OA 4HGPA 5FF9A 4J3JA 4IDQA 2YASA 1PEAA 4OXYA 3U48A 1G18A 1IHOA 1NIPA 1PWYE 3HZHA 3IDFA 3NYRA 2XADA 2VSXA 2YWVA 3ZPXA 4RZ3A 1E1MA 3W5HA 3LQ4A 1P29A 5FUMA 1L7EA 2YINC 2Z56A 4AP6A 3TIVA 1WTAA 5KPJA 3S5JA 3ZHBA 5IKPA 2YUTA 5DM60 5FTKA 2V7BA 3EEYA 4CBVA 3EQ6A 2X0SA 4AKTA 2H1OA 2VP0A 2WJYA 1WZCA 1OASA 2Z0MA 5AOVA 1GZ7A 2XCRB 1B4DA 3PC6A 5KQMA 2F90A 4L9RA 3AFNA 4C3UA 1QG2A 5MF6A 5LOVB 3HDHA 2AGQA 2BTQA 1H5UA 4TQGA 1CRPA 5JSKA 1OH6A 2F8MA 2R8OA 3TOXA 2AWNA 5AKIA 2HSDA 2YHIA 4C43A 2V0NA 2HJHA 4BQQA 3A0RB 1HNZH 2ACEA 2XKBA 3FLEA 5GTDA 5ESRA 1XIVA 4C2AA 4DXHA 4AF8A 1M9NA 1R0YA 3OBBA 5KG1A 4KRGA 4WQMA 2Q9AA 4KO4S 1Z16A 4I4LA 4G37A 2UYOA 3T5JA 4J7XA 5DGXA 4RKQA 4DCNA 4KWEA 2YFYA 4WZAA 1O58A 3HOVG 1CZRA 1C9DB 5IC4A 2JIDA 2DU8A 4B2LA 1R6UA 3GZJA 4YP5A 1JYSA 2HEIA 1JTEA 3C5HA 5AOBA 5FTWA 2ZB8A 3SC2B 1T94A 1RYRA 3DO6A 4GBMA 3JQGA 3I9V6 4UPVA 3G5LA 5MFZA 2B1GA 4IX9A 3HDQA 2H2FA 3H05A 1F2UA 4TTSA 2XD9A 1AHNA 2EF0A 4F9FA 5F4ZA 3S40A 3VAAA 3SICE 2XUKA 1L5ZA 2GM4A 4YAUA 5LCXA 4BMNA 4QTUB 2Q0SA 4XLZA 3UMSA 3SM3A 4AZWA 3RIMA 2C9OA 2FVXA 3FTDA 3NM6B 1H23A 2LIPA 4TLAA 4XSHA 3H0KA 3SKYA 2KYRA 3OLYA 3MIIA 4H1VA 2IH2A 4PBTA 3A3NA 1DQNA 1JT2A 2IHUA 4U6NA 1DUIA 1G8MA 5DI9A 3WBKA 2EZ8A 5FBQB 3PE4A 5ICMA 1MABB 3NNNA 2D0IA 1POXA 1ND5A 2FR8A 3IMGA 5THXA 4L5CA 1Z5GA 1XTQA 2GYWA 1OTXA 4KQ1A 4A10A 821PA 1J00A 2QGZA 2XXAB 3IPLA 4AMBA 4YROA 4F06A 1ZJ6A 3RC7A 2JI4A 2OGSA 5AK5A 5TMDA 1AB6A 3KXIA 2FZCA 1HLGA 1Y5IA 4MV4A 1GGHA 3WK5A 2WTAA 4BNLA 3F67A 3GVHA 1WXEA 5CXXA 1M1ZA 2W2KB 2D1YA 3IE2A 1K7CA 1F7UA 1SOAA 3A6KA 1PJZA 1NXTA 3PUHA 3T5TA 3ONNA 5EUQB 1Q50A 2PD6A 3PNQA 3OPVA 2MMGA 2PZEA 2CLOB 4YAKB 3A06A 3CO5A 3HKBA 1WB5A 3MNFA 2IEBA 2IU4A 1AQJA 2AEFA 3WLOA 1MHPA 5KC8A 3OIWA 4EKGA 2O2HA 3GJ8A 3U1TA 2FMXA 4W7HA 1FP4A 1N0HA 1CJVC 4ND7A 4A23A 5AJYA 3CUVA 1MAWA 4K6KA 4FGWA 2DUWA 4DKXA 5ALMA 3VPGA 4BU1A 5HZHA 4Q7EA 3I8OA 2NSJA 3SU8A 5LYJF 1ABFA 2ONJA 1AUVA 1N6IA 3VDQA 1OYWA 2I62A 3FYHA 4EYHB 3SYTA 3L7CA 5CGZA 2R4QA 3F5DA 4GI2A 1YQXA 1X2EA 4D97A 3TCKA 3ZGYA 1JAYA 1CJBA 3CCBA 5EIOA 4LZPA 4K9PA 1JQDA 1GTJ1 2A2ZA 4ZVNA 2V1UA 2B63A 4GPEA 4HXEB 5JADA 4PO9A 2AWOA 1K1EA 4G0ZA 4N49A 1LX6A 2C2GA 2IHVA 3SBDA 5JAIA 2HCFA 3SVZA 4WD3A 1Z0IA 4KREA 5HUJA 1V5EA 4QJFA 1QFXA 2IW1A 3ZE0B 2RHTA 4DA9A 3RRFA 3WNCA 4LVOA 4KKXB 1RXIA 1Z45A 3M1YA 3KZKA 1QU3A 4TQSA 2W4QA 1PLJA 4Y7DA 1LRJA 5MDHA 3RAFC 2I6GA 3GRAA 5K8VA 1Z7WA 4K6HA 4EB8A 4J9NA 4LSWA 4GP6A 1H0KA 4CLRB 2VDRB 4L3OA 1IM2A 2Z30A 2LKDA 3NUQA 4EUHA 4Q1EA 4LJSA 4P3OA 4M89A 4C7MA 4JLNA 1VIVA 3DJYA 5EZ6B 3H8SA 1ZXBA 4CI0B 5JAMA 3IB6A 3EMVA 1CUJA 1ESDA 4W5RA 2A3RA 4OM8A 4DHEA 3VR5D 1UMDA 1JLLA 5ILOA 3FTCA 3KG2A 3IRVA 3NHYA 2B63G 3KUUA 4G36A 1QO0D 3PCXA 4WOKA 2W6ID 4AKGA 4WX2B 2DPIA 1IXZA 3QG1A 2PRJA 2ZM6B 4QOJA 2H1WA 2D0DA 4KQMA 1FDSA 1E9RA 1HYQA 3AF4A 1TWHA 1DU4A 4XR9A 5K0NA 2J4DA 2PN1A 1SA0A 4JI6B 3HZRA 1G8PA 4ZO9A 3L7MA 2H59A 2PPVA 1X8XA 3IOMA 1UBEA 4D9GA 3B1XA 2VTBA 5FAKA 1R8YA 2OV4A 2Z2IA 4FBUA 3D5EA 2ZJ3A 2ZRFA 2FEWB 4BNXA 4I6JA 4GKJB 2OB1A 4B3MH 1JU9A 3QPDA 4MWOA 2D0PB 2F2TA 2P9FA 2OG2A 2QTVB 2VZLA 3JD2A 1PTJA 3JQDA 2BRUA 4XX0A 2Q5CA 1CY0A 2WSIA 4WVFA 3S24A 4KVGA 5IUJC 3BF7A 1SHLA 1DBRA 3GPDG 4PSUA 4QDUA 2FPGB 2KI5A 1YMQA 2JAQA 4A3SA 2OXRA 4HN9A 4C3OB 3QVTA 1URPA 4ECRA 4YYZA 1K2WA 521PA 1B33N 3B53X 3S27A 4B71A 4YP9A 2E3JA 3RJ5A 4G26A 2DFVA 4Q3BA 3AF3A 3FJ1A 3MCAA 1L7DA 1P7YA 2NTYC 3AG6A 1QX3A 3R5HA 1CVRA 3MGKA 4N8DA 1KI6B 2IHKA 1GKUB 4QGAA 2XMGA 3FD8A 5CBPA 2YYYA 3OX1A 4HI0E 1X2BA 3AUUA 1O08A 1WLSA 3FDZA 1AV6A 4W7IA 2JFXA 1AKNA 3N2KA 4H6WA 4C7XA 2C2WA 3UK6A 2C2ZA 3H5TA 4KHZA 1DCKA 1IN7A 1KQOA 4HNAA 3ULKA 4RWZA 4TMYA 4F9TA 5JEDA 4RUCA 4JNCA 3SN6A 1ZH4A 3T4EA 1XVVA 3C1TA 2FV8A 1TK2A 1T34A 4RFVA 5AK6A 3T35A 3KQQA 4R8KA 3JATB 2IP4A 3B3GA 3QOFA 5EWLA 4KE6A 2I6SA 3KJIA 4O1HA 4RESA 1NI5A 5FV7A 3HU5A 5LXTF 3JASA 2W2LD 3WRVA 1NMSA 1FDWA 3QBDA 5KI6A 4P7JA 2OAQ1 4G5XA 4DDVA 1NJ1A 3IE1A 1ULTA 1BWQA 2H1LA 1XJ5A 2IGBA 3GJXB 4TYPA 1XZMA 1E6KA 1PS8A 1G20E 1NYQA 2X5NA 4C7JA 3M81A 3KYCA 3IBFA 3WL5A 4RB3C 4MRVA 4UU0A 3IQDB 4P3NA 4UJ3A 4Z53A 5BSRA 1W94A 3U40A 1WSWA 4RVHA 4N5HX 3A04A 1GFZA 5HYVA 4O1MA 1NZJA 3JQ9A 4X95A 1P31A 4V0KA 5FLXA 1O6CA 1THTA 3WMRA 2ERXA 4C4PA 1AN7A 2ZIEA 2XW6A 3RVQA 1NXVA 2QW1A 1ULZA 3M49A 1O97C 4DQKA 1T1IA 3B6IA 4V0ME 2YN2A 4GL4A 4EEYA 1YA4A 2ANBA 4WXMA 1L8QA 4NTZA 2G77B 1Q22A 3R8CA 4LE2A 1KY2A 5TQ2A 2P2DA 2R92A 2YQZA 4NE9A 3JQQA 4B80A 4EA9A 2EJ0A 2C1EA 4UZSA 4UBNA 1TTTA 3EPLA 1GEGA 4IVRA 4LRTB 4V0LA 1N2OA 3QGMA 2KX7A 4H59A 3W79A 5ARDA 4B73A 5I4IA 1JJ7A 2ODPA 3WB2A 3U31A 2I4IA 2QPTA 3ZD7A 1RWXA 4DDHA 4HOYA 2R65A 4ZN6A 2WVHA 4B4DA 1DT3A 4DUYH 5CD9A 4EBFA 1VAJA 5K4HA 5LBTA 4DCGA 3T5HA 3TR5A 1U0OC 1P0IA 2ZE5A 3IA2A 3LK7A 4NYIQ 3UOGA 2Y9PB 3GG2A 3AVYA 4AJOA 2C2BA 1P1KA 3OCVA 3HDGA 1U02A 4B7XA 2IHBA 4N1AA 5EHIA 4CW7A 4C5BA 1O87A 1P9OA 2V55B 3S4YA 4WGFA 4WVLA 4NZYA 2IPXA 1U9YA 3ZWBA 1U3CA 1Z6XA 3KKKA 1J39A 4ISCA 4KE8A 1U7PA 3RJZA 4Z1MA 2R92G 2EX1A 2IOHA 1GLGA 4DJ5X 5KYYB 3ID6C 4I50A 4IIHA 3CZRA 4YAGA 2C04A 4TV8A 1NJFA 1H9AA 5EWMA 5G2OA 2BC9A 3H4IA 2I7TA 3K9BA 4DV1B 3W5OA 4URZR 1ZWKA 4NG4A 4MKIA 3Q41A 4Z4HA 5FHQA 3KL2A 4EGFA 1E1QD 3MS4A 3OH8A 5TS3A 5JLJA 4CTMA 4G5YA 4RPIA 1Q1QA 3ILHA 5F7ZA 1B2LA 1SQ6A 1K08A 3NUGA 3CXRA 3H5WA 3FTNA 4RLHA 5F78A 1OLUB 3PNPA 3RAJA 4MVJG 1BD4A 4FHCA 4I9FA 2QAGA 2CJWA 4B85A 1L5WA 2QLMA 3OFVA 4FZ3A 3NHWA 4PCLA 2WNIA 3DKIA 3WL8A 1E2PA 1YVEI 4KRFA 3T3OA 5IBCA 1VL0A 1H2WA 1FU7A 4HL6A 4QXPA 5KFHA 4BVGA 2E4UA 3WGNA 4YJGA 4R2KA 3NBYC 1BMDA 4XWTA 3FB4A 2JLSA 2HQOA 1YC5A 3WYDA 3MTBA 1KPHA 4N7BA 2OPBA 1Q0UA 2PMBA 4OBEA 2GKSA 2PAFA 5AK4A 2QQ5A 3OEHD 2PRSA 1B2RA 3GXBA 5F51A 1QRTA 4F3KA 2C7GA 1CNEA 4J9KA 4KRYA 4MDHA 3WNBA 3UKOA 3WGHA 3EPKA 5EINA 1SUAA 2YWHA 2IHNA 1G7RA 1LPOA 4V2IA 2VHWA 1JAZA 4RZSA 4I81A 3UV6A 3WK8A 5KDOA 4AJ1A 1ZH2A 5G0WA 3V2IA 4DQUA 3ND9A 3NBYB 3DQQA 1B8OA 2J9GA 2AGVA 2O1WA 1U7XA 1BDHA 1DWQA 3EXG1 1L5HB 3DDCA 4ZVSA 2I1LA 4JJ4A 4FOOA 2O3SA 2PGJA 3EGXA 4C89A 1FMCA 2GCPA 1HSZA 2OORC 2JF0A 1II9A 1NPYA 1QF9A 5DHFA 3JR3A 3M4JA 1MD9A 1SVUA 5BYAA 2NACA 1EPUA 3WB0A 4IO1A 3C0KA 2X0NA 3QHQA 3IPXA 1ELOA 4LJ8A 4DLXA 5FR2A 2YNMD 3KETA 4R71A 4BYMA 3IAS6 4I2VA 4YDSA 2COJA 1M2VB 3IOCA 1AQ6A 3QVMA 3GEGA 3CX6A 4EFBA 2VWGA 4URYR 2P40A 2PIDA 5E4JA 3W6NA 3N6RA 3PEYA 1IAVA 4YH1A 2CDBA 1O77A 2ZIXA 3MG9A 4P7FA 4YJ2F 5MFPA 3FTQA 3V4FA 3KHRA 4YV7A 3ZY3A 1N32H 2J5BA 4G1FA 2AG8A 5BSKA 1HDEA 3G5AA 4NBRA 1L4HA 2AK2A 4Z4CA 1N5JA 4XYLB 1FU8A 4E4YA 1CJUC 4RVNA 4K6GA 1Y9AA 2YMMA 2BAGA 1JH8A 3LM8A 1EFLA 5FOUA 4PPYA 4IJKA 3UJBA 1RQ2A 1XLTA 1SK8A 4L4YA 1HTWA 2ZUUA 2CXPA 5HNEA 3GFRA 3D5TA 1CE8A 2R2AA 5JFTA 1YTUA 4MTLA 3KB2A 4DR6B 3BRSA 4ND4A 3PEUA 2UXCH 1WEKA 4IIFA 1LFAA 2XWPA 5I7SA 1VSBA 3AU9A 1YBFA 4DNOA 4NCBA 1POWA 2WZBA 4LMPA 4NCXA 3PPVA 2RDMA 1UNNC 1RJ9B 1RRGA 1WB4A 4II2A 2VK8A 2V4RA 2J5RA 4UHJA 3W9UA 3HRHA 1NF9A 5LA6B 2I1WA 2JJ2D 2WG0A 3B12A 3EDOA 2VEOA 4WNYA 2YX1A 5KFAA 5CVUA 3WICA 2PJZA 3DAPA 3VNRA 3PWTA 4MV6A 4IBOA 1AUXA 4FCCA 3GIJA 4JOBA 2P8JA 1RPZA 1ZX1A 2IELA 1A9TA 2Q8PA 4B6GA 4Y1EA 2IFTA 1VXOA 2OQIA 1R6AA 5JPIA 2VP5A 4RL6A 1YCHA 4BVJA 3HJNA 1QIKA 3MS2A 2QUJA 3R2JA 1ZUNA 4Q4JA 4AUNA 4WH0A 4TV9B 2IV2X 1NC3A 2A84A 4DIMA 2HIAA 3SIXA 3T0IA 2O2JA 4MI6A 4J49A 1ID1A 3L6BA 5ALJA 4CPDA 4N7RA 1TAQA 1E32A 3PPWA 1LPBB 5BOSA 4ZICA 4K87A 5CRIA 3HMKA 4Q1VA 2AJBA 3O8LA 3UICA 4JYCA 3TLCA 4DIEA 3N2GA 1WDLA 2GCEA 4OHUA 4JJ8A 2I4RA 4R1LA 3MAJA 4ZEWA 4NE7A 2AYYA 4UPEA 2H4FA 1U1IA 3FCXA 3PG5A 3QYJA 3EOZA 4QEDA 1VCIA 2IYEA 4RCVA 2NN3C 2O54A 4GICA 2C3PA 2PV7A 1BXZA 3V4VB 2GZRA 1ULHA 5AW0A 1WKCA 4GX2A 4OGKA 2Y6VA 4FNAA 1SU7A 2ADMA 2BGRA 4ON9A 3L2PA 4LWOA 3HEBA 1FLVA 1T9CA 2QLFA 1HEIA 1KI9A 5C8XA 2ZRDA 5MGBA 3E82A 1UKZA 5JDCC 3BBLA 1E2HA 3Q7QA 2PDAA 1DTWA 4S1PA 1N0UA 1D4ZA 4TVBA 3EZXA 1FS4A 4XFKA 3QE0A 3RW9A 5JJCA 2WFZA 4C6RA 3B1WA 2PQ2A 2HJWA 2Q6VA 1QJCA 1V51A 2QRHA 1E5XA 1N5RA 3BWBA 4DV6H 3VO1A 2FFRA 1QYRA 2DBZA 3X44A 3U81A 3EMDA 2B6HA 3AT1A 4K88A 1IXRC 1OPXA 1C9NA 3UOWA 5E4TA 4NECA 4M8KA 3WNDA 3TVYA 4CMCA 3DW3X 1CDZA 2Z43A 2WJAA 3I73A 1IBRA 4IRDA 1M1NB 1BS9A 3D3EA 4OQNA 1FLNA 2FX5A 3RB6A 4KXYA 5IXYA 1XDZA 5JUMA 3HO6A 4YCMA 5SY4A 4ECYA 2VP9A 3CIFA 3T99A 4AJ9A 1QTNA 3L7AA 3O1IC 2HM7A 2HW8A 3B6JA 4Q7LA 3THRA 1VSVA 1PQ4A 4Y6LA 3GIWA 3LL4A 4YALA 5A03A 4PZ7A 2OY0A 1TFUA 4D57A 2VAVA 2CYAA 2NVOA 4MP8A 2ZJ6A 2FLKA 3ANYB 3Q7RA 3DFKA 4M1KA 1Q95A 1GQOA 1PUIA 1RJDA 1KR5A 4ZWNA 1UT8A 3AEXA 2VDMB 4LOAA 1V3UA 5CA0B 3CBQA 4MH0R 3SC3A 3ZVMA 3JXEA 4QX6A 4Q9LA 5F76A 2RHHA 3I2IA 3ESZA 3T4UA 4FCWA 1KJNA 1E6UA 4Z49A 1BN6A 4DABA 1PJTA 1N9GB 3OOSA 1S9HA 1W9MA 1HRKA 1N0IA 1P5ZB 1JYEA 4R16A 1JX6A 3GN2A 4NOKA 5C81A 1GGEA 3SD7A 3OKAA 3QVWA 2O19A 2X7HA 1XWWA 4D4GA 3FDXA 4BO1A 1AV7A 1U99A 3CY6A 2X2PA 2X0DA 3LMLA 1X8JA 5CXUA 5TLSA 4Q02A 5IT5A 4HHEA 1A4RA 3H6KA 7ADHA 5CCDA 1B74A 3GMDA 1WF3A 3U19A 3Q2IA 2EXXA 2EATA 3UYKA 1EB9A 2J0UB 3A26A 4RJJA 2EP5A 2XF8A 3SQXA 4RADA 3PGLA 1FMJA 4JLWA 4GL2A 3DAAA 1V71A 2XWBF 3VX4A 3DCJA 4E2WA 5F9MA 5GIOE 3L8GA 3FSGA 4HNHA 1SKUA 4ZT2A 5FLKA 2BKLA 4D80A 2QLNA 3KOZA 3WRXC 1Z08A 4DLYA 2NTVA 2PGLA 1TVCA 3ES9A 4DRXB 2YL2A 3RGXA 2J4FA 4G89A 1O89A 2WAQE 3JZAA 4YCJA 4YC7A 2EW2A 1XPRA 1IJKA 1SHJA 4O33A 4N65A 3OEEA 3A1UA 1XTTA 2YV4A 3I34X 4OQPA 4CFSA 2VDPB 3PNKA 1UXOA 5K3FB 1CR1A 5CVVA 3EXHB 1UBTS 5JS8A 3ZCRA 4DV5B 3PTAA 3NATA 4ZQBA 1DRKA 2WWWA 3BE4A 4XCXA 5LQKA 1BHSA 1HDGO 4EY8A 5GY7A 4H9GA 4U02A 1E61A 1TE2A 3WGGA 3L7IA 1T9HA 3UPTA 1Z2OX 3WZLA 4AWBA 3RC1A 3WYNA 2Q5EA 3FF1A 4Q45A 1RQ7A 3NH9A 4NPAA 1Y7PA 2F1HA 4DMLA 1P7CA 1ZQ9A 4TT3A 2ATIA 1NJGA 4BWSC 2F1JA 4S05A 3CVJA 3BMXA 3ME5A 2NZWA 1ZRHA 4PRKA 4W9NC 2HGZA 2BI7A 3A4VA 1ZGHA 4MKGA 4POAA 5K3SA 2B25A 3DE6X 3NBMA 3LFTA 4FI3F 4OP1A 1N33B 1SCUB 1TCVA 4ENTA 5AD1A 1LF0A 3HS3A 4BLWA 1H42A 5ADVA 3NEPX 2JKVA 1TU4A 3JZIA 1SIBE 2ZJ1A 3GUVA 4EI2A 3DD1A 1RQPA 4L95C 3V1MA 4DXAA 4G1CA 2BGTA 4FWIB 1QVWA 1VE5A 2A14A 1W75A 4TTPA 5DSZA 1NNEA 1GTZA 4E5YA 1S2GA 3VGPA 2XITA 3TW4A 4XDZA 2DUMA 4AZ3A 3ZNNA 3QYAA 2M6LA 1EG2A 5ILQA 2R2GA 1MRSA 1GAWA 5HIIA 4YP7A 2P9JA 4PYJA 4KMSA 2ZT8A 2AW5A 2BPOA 4EFNA 4X65B 4KU4A 3EVZA 1F5SA 3MLAA 1JSCA 5C2JB 5E6RA 4NMMA 5L4SA 3EA0A 5F77A 4Q3NA 4MUJA 3F2IA 1VGRA 2HMWA 5EZQA 2EBWA 4NJOA 4IEIA 1II8A 1OBOA 1ZCAA 3CX3A 4QTYA 2ZSUA 1RJWA 3Q8KA 2Z3VA 5ES4B 5GINE 4BFWA 3NBQA 5DM1A 4GYWA 1PV2A 2YNMC 4REOA 4YS6A 1FFDA 3PZRA 2W6JD 3K73O 3TTYA 4E22A 4B3DA 2AOTA 4R83A 1PQWA 1IOVA 1O96B 3ET4A 2QJWA 3L8CA 1HDXA 4CEIA 3WIBA 4PWQA 3CJTA 1B8VA 5FJ8G 2PPLA 2PJUA 4IOJA 1AKYA 3AHEA 3HA2A 1R5NA 2BJHA 1SU6A 4BBSG 4IV5A 2IXTA 4CEHA 1O0BA 3UJDA 4CG1A 5IKOA 1K5PA 4WLNA 4EOGA 4U7TB 3UOAB 1PW7A 1CCWA 4XM0A 3RWBA 5A62A 2UVPA 2C9BA 3VRHA 1XZFA 2JHFA 4LRXA 2RE8A 5TJHA 3L8MA 4OI1A 1C8BA 1YOVA 3H13A 1AGYA 4GHWA 3DP9A 1U28A 1YRQA 1PGNA 1V8ZA 2PH3A 4XR4A 3GARA 5CH3A 4BGUA 4AO8A 4D6YA 2X5OA 2EJWA 3D7MA 3U49A 2DQZA 2XECA 4B32A 4F91B 2ZUTA 1J5XA 1X9GA 2HWWA 4LS3A 3KHGA 1Q3TA 2V4ZA 2Y0EA 3HP7A 4PHHA 3RV4A 4CV1A 3EODA 3RGGA 1GG8A 1Y6ZA 3TD2A 4J0QA 3ORFA 4KQKA 1P45A 1UJBA 1JMVA 2HO4A 3KNZA 1U2DC 2GEBA 3OBIA 4JBYA 4Z3KA 3C6QA 3F98A 2RAPA 3S44A 4ACBA 4BLOA 1JALA 4EFMA 4IWXA 3DMTA 5KT5A 3ER6A 3JQAA 4UREA 5FBKA 1PWHA 3AKCA 2OZLB 1JDBB 3LBFA 3SY8A 2PMEA 3P2IA 1T5SA 3A2KA 3G0GA 4ZOQI 2XOKA 4TWAA 1GYRA 2XVYA 1VECA 2WD7A 1CX9B 3M9MB 3A6GA 4P32A 1L0BA 1A8SA 5KNLA 1XNQH 3ELBA 1Y3FE 5U4QA 5B6PA 1W2GA 1RMQA 4WE3A 2JA7G 5K99A 4ZPXA 4TROA 1L7BA 4EFEA 5FA8A 4ROSA 5JT1A 1LKZA 5DLFA 5FWYA 2QORA 1QV6A 1YB5A 3FOBA 4P08A 4JVSB 3OX4A 5J5VA 4JBHA 3U56A 2IF2A 5CNJA 3A3YA 1J5PA 3P2OA 4HTFA 4REQA 4YPFA 5AQ1A 1E9VA 5JASA 4ECAA 4BCBA 1OBVA 3SDBA 3O3MB 4L51A 4BHTA 4P3YA 2ZJ5A 1GOTA 3V8QA 4AL4A 2RH4A 3KYDB 3EXIB 3V34A 1H1TA 4XQGA 5REQB 3P2JA 3B2NA 4L02A 4P81A 2PA3A 3E53A 2REQA 2VPPA 4FOSA 3I58A 3ROFA 3A2MA 3GGJA 1GNTA 3JQ6A 5BW8A 3BRWA 3EAFA 2ZUCA 5JY1A 5SZIA 1NOKA 1S2LA 3GFVA 4N54A 1DBVO 1Z37A 4BP8A 4OUDB 4D7AA 1C0EA 2IPAB 3AX6A 4OOEA 3MMNA 5ALPA 5E9QA 2QBYB 4O4JF 2XBLA 1KOGA 2PS1A 4TYWA 4KC0A 3AL2A 3I61A 4UFNA 4LDPA 2HRZA 5D5QA 4OQDA 1USGA 3Q8RB 1DJOA 2WIDA 4OMUA 3VKHA 2QW0X 4RMJA 3ZDRA 3COJA 4E46A 3OJLA 3MERA 1BMFD 1D9XA 3RIZA 3O94A 1J42A 2NVWA 5LZ8A 2CFRA 4PZAA 3C3CA 3RVJA 2HU8A 1JXOA 2JJQA 4NBVA 2R82A 1QTQA 1S2OA 4OLFA 4MQFA 4LQDA 3G6YA 2ZCJA 1S2NA 3LCUA 2CW8A 1F8FA 1JHRA 1YULA 4XIIA 4FFLA 3ZWVA 1A4IA 1JEQB 2G07A 4TM8A 1OZFA 3LQ1A 2Y93A 4F11A 4MIEA 3OTHA 2WF9A 3DLIA 2WAAA 4R5HA 5ULLA 2GEUA 1OXSC 5FJJA 2QYHA 3JQBA 2OD2A 3L0BA 5BUQA 1FS5A 4MITA 1AT1A 1JI3A 1SVIA 3TF5A 4X7PA 1A0IA 1WTCA 3VU1A 1WCXA 2W42A 4LMYA 5KFFA 2BTOA 2HU5A 2DCUA 2HWKA 1IHPA 4OHFA 5BT9A 1F4VA 4ENUA 3WIVA 4DNPA 2XQVA 4P7KA 5JSQA 3K4HA 1CB0A 1XAIA 3WGTA 1P81A 4B7UA 2LZ0A 1PSZA 2C7OA 5FIUA 4NRDA 4MO2A 3EVBA 3H6HA 1MF7A 3OQOA 3PXEA 1MQ8B 5CM0A 3V9AA 3ZYCA 2IYSA 1W30A 3EJ6A 3GJQA 3TKAA 4S24A 2V7UA 1SG0A 3DULA 1HA3A 3UQZA 2B92A 1LCIA 2LR0A 4K1LA 5K0ZA 1M0EA 3M6XA 4R54A 3SFZA 3HKDA 4K9OA 3ZI7A 1GUDA 1T1JA 2YYSA 4NBNA 2WT9A 1UAYA 3T5LA 1TT5B 2NUTA 3R6LA 2H8KA 1R9NA 5F2OA 1VHTA 2FKNA 1P80A 3KZXA 3EVNA 1E79A 4RHEA 4HR7A 1ZXXA 1NUPA 4JY7A 2PR2A 4TTTS 2R8EA 1RMTA 3E03A 3L0YA 4QHSA 1KIFA 4ALLA 1TECE 2X3FA 4YWJA 2IMWP 4QRHA 2Z58A 1BJRE 4QTZA 3AF0A 5AHRA 1MAHA 4ESEA 1GT91 4BVBA 4NBTA 2C0PA 1KE1A 3IUMA 3BGOS 3FUUA 4DDMA 2AHOA 3AY3A 1S10A 4YJFA 3DTTA 3LQ2A 3WL4A 3D4LA 1IBKH 3NPAA 2C7RA 4XVCA 3VPCA 5EXPA 5IJ0B 1PG2A 2PKYX 3U44A 3H86A 1ET0A 3BICA 3RU3A 1JFFB 3PA8A 4ZCTA 2WWIA 3C5WP 4JXXA 3VYWA 3IH5A 2BFBA 5GONB 4AK9A 2FKLA 3NKFA 1FRNA 3ZJVA 1O97D 1LA2A 2WA1A 4OFWA 5BSVA 4C4AA 3L7LA 3OOEA 1ZWLA 5JZVA 4R31A 4Q9AA 2RGNC 1UQRA 4J0KA 6LDHA 4EB6B 5I5EA 1JG1A 4LHWA 4XJVA 3Q7IA 2ZGIA 1TNDA 2O7VA 1GZ4A 4UU8A 3THXA 2G1AA 3V1KA 3RUEA 3AVUA 1W52X 4H3VA 5H16A 2QVXX 4TYMA 5DHAA 1YK1A 3VC3A 4UQLA 4Q4AB 5ELMA 1W7AA 3V6LA 2HC9A 4A2QA 2UVDA 2LCFA 4HGZA 1GNVA 3DE5X 1XUOA 2JA8G 3LS2A 3PJDA 4RPCA 2EWWA 1R74A 6ADHA 1O9GA 4NYEA 4O4LF 1KNQA 4H7IA 1VCNA 1GDDA 3HBJA 1ZCZA 4CTNA 1CTQA 3TXXA 1DTEA 1BKYA 2XAUA 3WKBA 3T1NA 4J9SA 1LBTA 3B7WA 3EOBI 4G0UA 3PS9A 3SFVA 4TSFA 1SM4A 5EJGA 2D2VA 1ZIOA 2IE8A 4XUGB 2JA6A 1OHHD 3I9LA 5DCUA 1U0EA 1SB8A 3WBBA 3ZZMA 4KGVA 3NGDA 3HMQA 3KLBA 4JROA 1F5NA 1WDKA 1HURA 1UL1X 2APJA 3ZE2B 4HDKB 3B7PA 4K0KB 3LYHA 4WDRA 2J7PD 1A88A 1WSCA 1GHTA 1M6NA 2RJ3A 3TXAA 4N5NA 2EW8A 2IZ7A 1Z7GA 1SRRA 2GWHA 3QE4A 1VSQA 5CFNA 1Z68A 3JYHA 3PITA 1P19A 4MVXA 1RYYA 3F1KA 3OZDA 4ZQFA 1C0IA 1XDUA 3KP1A 4RHYA 4EG1A 4LE1A 4ZCSA 5A2QA 1WQ4A 4WUVA 1LK0A 4ESOA 1WO8A 4BNIA 1KYVA 4LDNA 4D25A 4D8UA 1X70A 2QTBA 2DWQA 3CGGA 1DKLA 4RU1A 4ZIRB 1C3JA 2QZ4A 3RM3A 3W8DA 3KTAB 4A4DA 3GQBB 3EW9A 3PKIA 2RK4A 1KEEB 3CZCA 4QD3A 4P34A 4WLFA 1RC8A 4A3EG 1M8PA 5JO0A 1OX6A 5KO2A 3R3JA 4KR2A 3JRNA 4MV0A 3MOGA 2D1RA 1U5AA 5A5DA 5DYNA 1WUJS 3HACA 1MRZA 3K1AB 5DJ5A 4XDHA 1XTKA 2F4VB 1SCIA 2Q8NA 4YQYA 4L5AA 4R8MA 3ZD6A 4KFTA 3TUJC 1GPMA 3A1VA 2YWGA 4X84A 3TCXB 2C88A 3E61A 2H5JA 2VHXA 3FYDA 4H27A 1OLSB 3O2JA 2GA8A 4QO7A 3D1VA 4X1KB 4NCAA 4IDCA 4I1UA 3U3KA 4DMCA 4KXWA 1OLOA 1W4BA 3QLJA 1C9JA 4WESA 2AQKA 1FNSA 1RPNA 3Q5GA 4G9BA 2VP3A 1E7SA 1TAHA 3A1NA 1JZQA 2DHDA 4EKEA 1SWWA 5C7IO 1NXOA 5F1OA 3G85A 2WWVD 1U8CB 5BWMA 2DABA 1HE4A 1J0XO 5ESDA 1MA0A 3NT4A 2QHXA 1K9SA 3AEZA 5KCMA 4EFKA 4JXZA 3NTVA 4LHZA 2B8WA 4HZUA 2CXSA 4JP5A 1Z2CA 1U1FA 1E6MA 2QU7A 3KWFA 3VYRB 1TW3A 5DLDA 2XNHA 2CEAA 2ZS8A 2JLUA 1R9MA 1ZMXA 1PJCA 1K1QA 1JPNA 2UUBH 2Z5LA 3QVGB 1VDMA 1RE0A 4G1EB 4XVRA 3N7AA 1OKKA 3QPBA 2C9YA 1V26A 3KK0A 3GQVA 1EFRD 4BRUA 1E2FA 1MB9A 2XQJA 3GDEA 3OZUA 1A2QA 4P83A 1JWLA 4ARSA 4X1IB 4KXUA 1EYZA 5KT3A 4U0JA 1YQGA 3L7BA 3LPDA 1XZCA 2PT6A 2VKQA 1LPNA 1I1KA 5KHAA 2HA2A 2Q4TA 3H9JA 1EUYA 1H2ZA 1PTKA 3T3IA 5FWAA 3SGLA 6AT1A 3E7DA 4Q9NA 5T8KC 3LPNA 2Z1MA 1R4NB 3AB7A 1P8AA 2DXIA 5KSZA 3CW9A 2ZJYA 1EUDB 4RABA 2WJ4A 1XX6A 3RS4A 1YFZA 2B8EA 2WG1A 3II6X 2HY7A 2PGOA 2DR0A 4NNPA 3NOQA 2HIGA 2QX8A 1G2OA 4A6XA 1IY8A 1GQQA 2F1IA 2LRHA 1ZRMA 2BT4A 1ZH6A 2V96A 1UBKS 5CB4B 3EUEA 4UM8B 2PZAA 3OFSA 4TT8A 1IN4A 1I1HA 2ZTUA 3HWWA 1XTJA 2VYFA 2V3CC 4C0HA 3I0NA 1N5LA 5CVJA 3U7JA 3ZDCA 4ZAVA 2H2HA 3FR7A 1CUCA 1XRLA 3CF4A 4P92A 3PNVA 2ISCA 3UUGA 2DWCA 3D7LA 3CNNA 3HNRA 2FLPA 4HWTA 1WCMA 2E4YA 1L7OA 4GM0A 1IPHA 1SBTA 4E32A 1QKJA 4RFLA 1SKYB 2PGDA 4NU6A 3MWEB 3QSYA 3DHNA 1O4VA 1A82A 3PDCA 3RUHA 2C83A 3WK6A 3QKTA 3OQPA 1W0JA 1GN8A 5JISA 2DULA 3AILA 4MI1A 3KWJA 4CKWA 2WKWA 3SSOA 4BCDA 2IEIA 2GAOA 5DLEA 4XWKA 2RGYA 1JL3A 1OC4A 1E2BA 2DLNA 5JU6A 2X2OA 5C1OA 1XXHE 4QDOA 3L4BC 1IBMH 4ZT6A 1DFIA 3EB9A 3LX4A 2C4NA 4A3KG 2HSGA 1VBFA 2VTKA 1YDWA 2K4MA 2WDPA 3ITNA 1UPBA 3NR2A 2OC4A 4KGXA 1CF4A 4EK9A 1TVMA 2FGJA 1Z0UA 1X1QA 4KQ6A 7ABPA 2PMCA 1PNVA 4IDOA 1CVIA 3T34A 1DCMA 3IB3A 5LQMA 1GARA 1CQJB 3B1YA 3EVDA 1WY5A 2OBFA 5I51A 3K9FC 3ZUPA 3E7WA 4G0QA 3V4LA 3BZWA 1CQIB 1OI3A 3CNLA 3REQA 2V3VA 1SXJE 3DOUA 4ZHQB 3QLTA 4Q4HB 3F7TA 5C5CA 1DIHA 3KEOA 1H93A 5DOVA 4YUYA 1GEEA 1YTLA 2RI6A 1P91A 3GJXC 1AZTA 1CIVA 1VI6A 3AVOA 1KO8A 1B1CA 1DOZA 1KZHA 1GJRA 1PJ4A 2BUAA 3WWZA 1IY1A 1MZPA 1YS1X 5CK5A 5FP0A 3EIEA 4KV7A 4HZIA 2QD1A 4PCAA 2VFAA 4EJ2A 3WKEA 3O7WA 1NUSA 1LSSA 3PJRA 4UEJA 4F46A 3LHFA 5K6AC 1ECPA 5AHXA 4L15A 3RF7A 3U62A 3FHLA 1XTZA 2M1XA 2UUAB 2RD2A 4FNMA 5KFWA 2W9CB 1SIWA 4O7VA 2IVZA 1VIMA 3BSSA 1Q6ZA 4WEOA 3QM1A 1ZG3A 3COPA 1W93A 4JBNA 2Q5QA 3AGPA 1V11A 4ECVA 2G04A 1PT5A 4E5DA 3QELB 1YE8A 1ADJA 4W5WA 2KSQA 3UHFA 3ZE8A 2QZPA 3M6FA 5D3MB 1I9CA 5EIFA 4RF4A 4MRAA 3FCCA 1RYZA 5AUNB 4M7RA 5H1YA 2X0EA 4D81A 2FXIA 3E2IA 4PGHA 4X8OA 1EGQA 2IQ5A 4ZT5A 5CYOA 5D2CA 3VGJA 1LJ8A 2PJDA 5FTLA 2C2KA 3V6MA 1YQ9A 1S9DA 1L3BA 1FDUA 2C4TA 4IKEA 3RH0A 3AKYA 4TPKA 5CDSA 3D6AA 4PGGA 3MRVA 2L19A 2XE4A 1REQA 1E3WB 3ILXA 3EWSA 3RTEA 1A4UA 2YZ7A 4PYKA 2BY4A 4RK6A 3UA4A 2BH9A 1W9HA 5C8DA 3UT5B 4Q93A 1G6KA 3RLIA 1G17A 5JFGA 3SQOA 4H1UA 1UC4B 3HRKA 2PLFA 4XLTA 3QY9A 1Z6YA 4EHDA 3IXMA 4MYDA 1T36B 4DV2H 5HQTA 2CY0A 3BQMB 3H2JA 1H6CA 1WXWA 3INYA 2PSSA 2EF1A 3PXAA 3ZHTA 4PM4A 5BQFA 1GGJA 1HLFA 4JZKA 3EBLA 3H1FA 5BR4A 1M1YA 4HB0A 2CLKB 3MAGA 3NTOA 1H4VB 4LFBH 4KN9S 3ZWKA 2PTGA 4YCBA 2MR6A 4OQYA 1Z9BA 1JSZA 5CDYA 5DSTA 1EDDA 4NBUA 1RWNA 2ETXA 1D0SA 2F67A 3A14A 4RVCA 5E1OA 2Y1EA 3KKQA 4YONB 5ENDA 5LZ9A 4K6NA 1BWSA 2W43A 1M8GA 1CEXA 4BMSA 4RC9A 3PIRA 3GJSA 1GADO 2ZBRA 4IGAA 4WOCA 2V7QD 3PTLA 2DCMA 4G9EA 2DJIA 4TN5A 4HP8A 2NU6B 3H1AA 4XJXA 1J20A 1QP4A 1M73E 5G1OA 4XUCA 3VC2A 4PS1A 2F3TA 4FMDB 4LY6A 1US8B 3K8QA 5K3AA 4RQTA 5AVRA 4IXMA 2HQSA 3TLGA 3WB1A 2Y0CA 3PX7A 3A7DA 1HDRA 3HUDA 2BP7B 3TL6A 1C7RA 2Z2KA 2WDTA 4MWDA 4DGSA 1W5BA 1YQWA 1NBMA 3EHDA 4DDTA 1UK6A 1EMDA 5K0GA 3A32A 1Z4PX 1JT9A 2Q28A 2HHFB 2C42A 4GLBA 3V1LA 1QH9A 2GD6A 3TN7A 2REOA 1F17A 4ZZ0A 5CDFE 3EVAA 2BBSA 3EY4A 5DLQC 1E3MA 2HRDA 4D0RA 2YWBA 1M8FA 3CKMA 3OSZA 1CKOA 3JWHA 3QPCA 1BHJA 2CBZA 1RJQA 1J22A 3PKJA 2I55A 3L6RA 3RGZA 1DQZA 4TKUA 1GILA 1UC8A 3B6KA 2ZYHA 4NOJA 4NNOA 4LF6B 3DYBA 1XF9A 3T38A 4GQIA 2BHLA 3EMKA 4RHUA 1CETA 1TMOA 3INGA 3R9KA 5TQ0A 1X6VA 1U6KA 3DMFA 2OV1A 2F3RA 4E09A 2IIVA 1NU6A 1SR8A 5KX5A 1V6CA 4J8PA 4BO2A 1KP2A 2PLRA 1DAFA 4KQEA 2IZ6A 1BA3A 4YP3A 3N2ZB 3EFBA 1N2XA 2A0UA 1RSZA 3BJMA 4E08A 3WL7A 4MWSA 2CXUA 5ECDA 4WXRA 1TMGE 3LLMA 2AG5A 1MVLA 5I7VA 3BOSA 4GZ3A 3RB4A 1D2HA 4NCNA 3OTOB 4Q24A 1TF2A 2V03A 3T9BA 5ALSA 1KYZA 3MFHA 1JDJA 3GFOA 3TIGA 1UANA 2WWYA 4PFSA 1S0UA 1LVUA 4AN0A 4HFMA 4LQ4A 1WB6A 2QUKA 4CLOB 4HB2A 3FWHA 1J49A 4JV0A 3HYRA 5HRAA 2F59A 1ZL0A 4PYLA 4W5HA 2HAEA 4U7HA 5J1SB 1CJMA 1QAOA 1G3MA 3OOYA 4PGAA 2C99A 4L0MA 3OHMA 2YIDA 2SHKA 1Y81A 4UUNA 3N42B 2VA2A 4WN9A 2ECQA 1VCOA 4PQEA 3P7MA 5AVJA 5IT9A 4RB1A 1RTKA 2XNDD 3ZG6A 2A5JA 1XJCA 2IUTA 2F64A 4J07A 2OFFA 5EEGA 3LXXA 2HF7A 3MWFA 1MTOA 2BE9A 4UVHA 4D8VA 2GHQA 3SR0A 1G42A 3PW4A 2CMHA 4NENB 3LUKA 1YU6A 3ZWMA 3R9RA 5FO1A 4C87A 4R8UB 4F8YA 2C20A 4E6NA 4NJMA 1YJQA 4M7WA 2O8FA 1KSHA 2ZRAA 2CD7A 4WKNA 2QE7A 4D8WA 4ARBA 3PO2G 5DW0A 4L9AA 3Q3IA 5AUPB 1NRIA 4XWOA 3STVA 3W2HA 5JQGA 3HTXA 3IUPA 1TLLA 5I7RA 4BBPA 4NCKA 3WLTA 1TVKA 4WGGA 2V9ZA 4I0WB 1DEAA 2D8AA 4ZI7A 2YTZA 1MGPA 1PNRA 1VJ1A 3KELA 1EJ6A 2XUFA 4S0XA 3TNJA 1NV8A 3L2OB 1MJNA 3LA6A 2DKFA 2GBPA 3A58B 1RWWA 1L5KA 5FFMA 4D79A 3FM9A 3ZU2A 3DEHA 3P9CA 1BIFA 3OIVA 1IWOA 4II3A 5HW0A 3JU3A 1JILA 4K6MA 4R81A 2XKAA 1YDFA 3MD9A 1GVNB 2IY8A 4MHOA 4LF4H 2NU7A 1V3VA 5D00A 3AY7A 1ZONA 4TMKA 2UKDA 2J0VA 3L5KA 4RY2A 2VHEA 4KQ9A 2F8TA 4U2CA 1Y3AA 4CM9D 4TS3A 4CG3A 4O4IF 2EGHA 4P3PA 1B7GO 1M6VA 3N76A 2ZIZA 5HRUA 3PFBA 2X86A 2HLHA 1FXWA 1AUQA 3H19A 4XIGS 3NVAA 5EJ8A 4YP1A 4L6CA 4YAEA 3RSFA 3EASA 4C4OA 3GHHA 4EARA 5KQSA 1FY2A 3DZDA 1IH8A 1L4LA 3NLLA 1GU1A 3OE7A 3LYUA 3HOWG 2ZRJA 4DSTA 2JJ1D 2XT9A 3PRHA 4PE5B 2Z3WA 1U8EA 3ZGZA 2Y05A 3QKSA 1QIEA 3L7OA 2EFDB 3WMFA 3C41J 2HNKA 3MTQA 3LYAA 3HOUG 1FNCA 1DXYA 1BTOA 4YRNA 4YRGA 2BJWA 3DEKA 3CQZA 1F2DA 1RADA 1ZM7A 2ID8A 5LVAA 4XPIB 1TPZA 3FI9A 4O2LA 1VMIA 3G7UA 1ISGA 3T52A 2H1FA 5EHGA 2Q27A 3DTNA 1SEVA 1WQ1R 3S29A 1BQ4A 3D1LA 1GA6A 1MW8X 5NULA 5IYZF 1ECGA 2HQBA 1EDBA 3N0RA 2XGJA 2OD7A 2JDID 4EGQA 1YDMA 3G8BA 1AQYA 3AIMA 1A8QA 3F6YA 1ESCA 3V33A 1DSSG 3G2IA 3OZSA 4F8EA 2DMRA 5K0LA 5BSHA 1L2ZA 3LRXA 4PX3A 3SLGA 2I4NA 4JLOA 1NGSA 3ZVRA 2JPDA 1N2HA 1A0GA 1SC4A 1LV8A 2V3WA 1L8AA 3LIIA 3MTDA 1U8YA 4R1QA 2OXIA 4C5CA 1WPGA 5G0UA 1U4SA 2B4TO 1ENYA 4MUFA 3P5BA 3PX3A 4AFNA 2BN4A 1E60A 2W9BA 3L0ZA 1C9KA 4C5AA 4Z9AA 2Q7XA 2AYXA 1D6MA 2GZDA 1OYYA 1U7WA 2ODBA 1QC5A 2WJVA 2O57A 4DR2B 3F4BA 1BVRA 4PXAA 3AIOA 3DOEA 1RWOA 5F33A 5IJ9A 1QONA 1MA3A 2V6FA 5ALYA 2EKZA 4RH1A 4JELA 1UFRA 5ER6A 1WXHA 2JCVA 4ZEMA 1TT7A 3BXFA 4O2AA 2QMEA 2JH9A 3DWEX 2CNDA 4QATA 5E7QA 4UBMA 4DBVO 4JQZA 3IP6A 4OYYA 3U7GA 1UBJS 1TMYA 1WXFA 1HY3A 1P8JA 3AL3A 3UMCA 1OBHA 2IU6A 3OAAA 4FGZA 4MO9A 4G1BA 3B48A 2R85A 2C5EA 2HXSA 1DOAA 3DPUA 1Y37A 3FH0A 5CFZA 1FNBA 3BWYA 4CE5A 1IMJA 4MTCA 4LQLA 3RK1A 4K9MA 4Q1DA 2BLLA 1ECFA 2FCAA 2QTLA 3MINB 3L4EA 2XSZA 2BR3A 4XD7D 5J9FA 4I8DA 2BGLA 4NMXB 3TZKA 4CHGA 1XJWA 4QSMA 4RZUA 1HRDA 1VC2A 3B8EA 3J7AC 2XDWA 3VJMA 4PQFA 2KM1A 3CMMA 3U26A 1YRWA 5B57C 3CB2A 1SKAA 3RS2A 4X91A 1K4KA 4HDRA 4B79A 2WHXA 2Z4SA 2Q2VA 2QLLA 2LTAA 1DBIA 1N75A 4FE3A 2UUCH 3NWOA 3Q3JB 5I5XA 1OTHA 4XLLA 3E2MA 3EC2A 1JHPA 2H08A 3DG9A 4I1PA 4R9SA 2ZYVX 2BR0A 2ONZA 2W98A 2GCNA 2PZJA 3ZBPA 3LT4A 1J7JA 1EA5A 2QX9A 3N0TA 3S2FA 5ITVA 1TCAA 1KI7A 1QWSA 3BQ2A 1V41E 4FD3A 3MMSA 2VTVA 3NTLA 2CB9A 1MMFB 3EXHC 4U2EA 4ESVA 2BQUA 1PD1A 3UXYA 1JLKA 3VOSA 3E23A 5CX1A 5DQIA 4BQFA 3QHPA 4WCFB 1EZ4A 1ODCA 1IHXA 3O74A 5K9ZA 2JFQA 2FRDA 3AESB 2BYTA 1RI4A 1JXAA 1MZBA 3G8DA 4XCQA 1Q15A 1KJZA 3RFCA 2B4KA 4IG4A 1SIOA 1DDIA 1O9BA 3BB4A 2X1MA 5CK4A 1I94H 3HCAA 1K0FA 1L2TA 1P73A 2BFEA 2GR9A 5IARA 2VHCA 2FPOA 2FPPB 4HPWA 4QIHA 3UWPA 1BVHA 1OH5A 5BRAA 1ZHQA 2QTGA 2QM7A 3ICQB 2QLTA 1U0FA 2QW8A 4R98A 5IXSA 2PCJA 1ZVKA 2QTFA 2VA8A 4GSLA 1ZUIA 2JA1A 4AY2A 1YO6A 2ABJA 4IKOA 3S8EA 1UOEA 3BHJA 5CVEA 1X15A 4B48A 1OZ0A 2RBEA 3Q7SA 1I2ZA 1KKMA 4QVKA 2HOQA 3ZGOA 1ZAYA 1USWA 1XMPA 3UAXA 4UHEA 4AYWA 2D7CA 3JRXA 1PF7E 4WNIA 1JNXX 1KIAA 3TRJA 4CMJA 4Q7MB 3RRZA 2ODAA 3H20A 4ZU1X 2ZUDA 4LAFA 4LGCA 4MR8B 1CERA 1HEYA 4U1RA 3D7KA 2XLBA 2HADA 4DCVA 1ECBA 4F21A 1T9DA 3F3MA 4I4TA 5CJ2A 1QVZA 2BGNA 4KX5A 1EFVA 4XWYA 5G1PA 3OZVA 2EIXA 3PQ7A 1TEZA 2IIPA 1H05A 5M5BA 5A0FA 1V9SA 3EH1A 1GG2A 4IINA 1AQUA 4DEVA 3PSHA 3UWKA 5JNWA 4IHJF 4KO2S 1XCJA 5K0CA 4P4GA 3PHJA 5GJWC 1F4LA 4FYVA 4KDCA 3FJOA 2ZANA 1LPPA 3FPGA 3KLNA 3QWUA 4AF6A 2PZGA 3O8OA 1P5RA 1BW9A 4ZTZB 3A6LA 2QQGA 1X9HA 1LLDA 4I4CA 1EKVA 1NBHA 4DM7A 4F92B 1B43A 3PWZA 4TTRA 1Z38A 5D01A 2UU9H 1NQUA 4RSMA 1OW3B 1T4BA 1JDZA 5DHUA 4AKEA 3L77A 1M2KA 3IOYA 1Z88A 2OFOA 4OJNA 3WJ7A 1G5RA 2VHZA 2XV1A 2QD5A 3D8HA 1U2EA 5EZYA 1Y3HA 3L92A 3DFMA 4Y1RB 2YZGA 3TAHA 4K2AA 4OQZA 3FCSB 3GBSA 2FP3A 3TQHA 4PFJA 3RU2A 1F2VA 1IXKA 3TLYA 3REOA 5BN3A 4TWZA 4B82A 2QRMA 1ZOSA 2PUCA 3ELYA 4CIAA 1MC1A 1W4CA 5DG8A 1ZKDA 4LJLA 1GPWB 4TXNA 4KOAA 3KJFA 4DR3B 1RVDA 1H2AS 2FPWA 1GGKA 2X6RA 1MO2A 4DQ0A 3P9QA 4IHQA 4R8RA 4MUYA 3B1FA 1GYPA 3I5XA 1KI1A 1QFMA 3EQ7A 4NX2A 5JANA 1U6JA 3EULA 2CHFA 3E9CA 3NXKA 3C5EA 5EKUA 2ZRQA 5FDFA 2PXCA 2E4AA 2P6OA 3Q7TA 1L4NA 3EPGA 4QELA 4UZFA 3WHPA 4B3BA 3NVMB 3GNSA 3KR0A 3OJOA 4K5QA 4QASA 3Q3CA 5JTUA 4TKMA 3OQ1A 1NMXA 2YDYA 1XDSA 5EJAA 1JDBC 3GOQA 2IODA 1F6WA 2EIYA 3O4FA 5L53A 3M4XA 4F5DA 4DUGA 1FUYB 3F73A 3L8HA 1NVGA 1UPTA 1WUYA 3AR2A 2FZKA 1C8KA 1TEHA 3LWNA 3JWJA 5H3LA 2V5VA 1F2UB 3PEEA 4XEUA 4OLBA 4DL2A 2PY6A 4G0NA 4GPD1 1E58A 2J3IA 2VNJA 2Q41A 4A1FA 1QH1A 5I5TA 4DLZA 1LJUA 2LBPA 3AVPA 3DWIA 4DRFA 3IURA 1RBMA 4CNQA 4OMCA 2E48A 1IYEA 5I5WA 4UCUA 5AOCA 4ZQEA 1BRTA 5IRCD 2XRFA 1FLDA 4XPZA 4BZPA 5KT6A 2PRIA 5ED4A 1I7SB 1V37A 1P2BA 4MDEA 2Q5LA 5AM0A 4DJAA 4JJ7A 1Z22A 2ZBDA 4U4AA 3R7AA 4DW8A 3L93A 3SI7A 1IQ0A 4BVAA 4OJYA 4NKRA 5AUQA 2IPLA 4X7BA 1PL6A 4HAVA 1UF9A 3HL4A 4BP3A 1AQNA 2R6R1 2IDMA 1OREA 4CMGA 3U0BA 4JASB 3UGQA 3R75A 3B78A 3MMPA 2XGOA 2RHRA 3A9TA 4MI9A 3BH6A 4YDQA 4ESHA 3MMZA 3B2EA 3TKYA 3IUJA 4ABYA 1P5JA 1JJFA 5C46F 2CXOA 4H7JA 1O6ZA 2OSBA 5FPKA 2QLBA 2HTFA 4A93G 1K7SN 1Y7TA 4B09A 3VPAA 3I64A 1QG4A 4BNJA 2E4ZA 1LDBA 4TWRA 4LPKA 3THWA 1HZZA 1BE1A 3AM5A 2V6JA 5A4AA 4LF8H 5JC1A 5DYYA 3HKBB 3L5OA 3RANA 5FPTA 1FE8A 4MWZA 3T