2ZDHA

Crystal structure of d-alanine:d-alanine ligase with adp and d-alanine from thermus thermophius hb8
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ADP and D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 96
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdhA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdhA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdhA01
1M0WA 2I8CA 2P0AA 2NUAB 4I50F 3RV4A 3OUZA 4ME6A 2FP4B 4IWYA 4FGRA 1T36A 3VOTA 3UFXB 1I7NA 4GGMX 4MV6A 5I47A 4I55F 5LOVF 4HR7A 3BSWA 4O4LF 4MV3A 2YW2A 2QF7A 5KKNB 4O2BF 2YS7A 4NYEA 3WO1A 5BPHA 5CA1F 4EAAA 4MAMA 3AW8A 4WD3A 4IIJF 3LP8A 5LA6F 2DZDA 2GQRA 3KAKA 4O7ZA 2R7NA 1KEEA 1JLLB 4EA7A 2W6MA 4MA5A 3N6RA 2YWVA 4FFMA 3KREA 5BPFA 2W71A 2YS6A 2FPIB 2FB9A 4IWXA 2OLSA 4EG0A 2R7KA 2Z02A 1GSHA 4M98A 4TV8F 3HO8A 3G8DA 2ZDHA 1EUCB 1WR2A 4RZQA 2W6QA 3RFCA 4HNUA 4E4TA 4O81A 3K3PA 5CAEB 4QSHA 2NU8B 3U9TA 4O84A 1EZ1A 3SE7A 5CA0F 4O7YA 1B6SA 4MA0A 4WBNF 3TINA 1KJ9A 1PK8A 2GPWA 2Z04A 5HBRB 1BXRA 4FFNA 4EABA 2NU6B 1KBLA 3G8CA 5LXTF 1KJIA 3QFFA 4TV9F 1C30A 2VR1A 1KUTA 2ZDGA 5CB4F 3HB9A 2NPOA 5JQGF 2YRWA 4TUYF 2R84A 4HQ6A 3VMMA 1UC8A 5BMVF 4O83A 2R82A 1JDBB 1EHIA 3BFPA 1VKZA 3VA7A 4O4HF 3RUPA 2VPQA 2PBZA 4EA9A 2W6ZA 2GPSA 4O2AF 3VPCA 5JH7F 5KX5F 4XZ3B 3MWDA 1I7LA 5K2MA 5HV6A 3R5XA 1KC7A 3R9RA 5JVLA 5J2TF 1GLVA 3HBLA 2I87A 5H80A 5LP6F 2NU7B 4XX0B 1GSAA 4O7SA 2YYAA 2R87A 3OUUA 2DIKA 4YB8B 2YZMA 1EUDB 2R85A 2R6FA 1AUXA 3VPBA 5C8YF 1IOVA 5LYJF 3RV3A 1CS0A 4EA8A 2R7MA 2GLTA 3U9SA 3ETHA 1ULZA 1VBGA 2X0SA 4EGQA 2W6PA 2IP4A 5FNVF 3ETJA 3K5IA 1Z2OX 4L1KA 1M0TA 4YAKB 5D8DA 4ZQIA 2CQYA 1VBHA 4FFLA 1OBGA 3U55A 4XYMB 2FPPB 4EGJA 2VHEA 4C5CA 2C00A 4O7WA 2J9GA 4O82A 1DV1A 4C5AA 5EZYF 2W6NA 2XCLA 1M6VA 2PVPA 3KAJA 3NUAA 1E4EB 4YAJB 1IOWA 1B6RA 3K5HA 4M9CA 1AUVA 1OBDA 2VQDA 4Y8VB 4XYLB 4FE2A 3I12A 3GIDA 2YRXA 4YBZB 2ZDQA 2XD4A 2W70A 3TQTA 1SCUB 2CNVA 5DMXA 3VPDA 4IHJF 4ZOLF 5IYZF 2YZLA 2YL2A 4O86A 2FPGB 4MV9A 2W6OA 2R86A 4DLKA 2V59A 4FFRA 4C5BA 4MV8A 1A9XA 4FU0A 4O4JF 3R23A 3JZFA 1W96A 4ZI7F 3E5NA 2V5AA 2DWCA 1UC9A 2I80A 1E4EA 3U54A 3BSSA 1CQJB 1C3OA 3BG5A 4HNVA 1KJ8A 4M99A 3LWBA 2GQSA 1Z2PX 1Z2NX 3MWEA 3ORQA 5GONF 2NU9B 2HJWA 5JVDF 1DIKA 2WYOA 2V58A 3Q2OA 4O7LA 4YJ3F 3GLKA 1JDEA 2DLNA 3ORRA 3V4SA 1KJJA 3JRXA 3DF7A 3TIIA 4YJ2F 2CNQA 4O7RA 4MV1A 2CZGA 1CE8A 1GSOA 4MV4A 1CQIB 3WNZA 3AX6A 5J2UF 4O4IF 1BNCA 1KJQA 3KALA 3R5FA 5C1OA 3TW6A 5JQWA 3N8DA 1EYZA 4HNTA 3V4ZA 1GGOA 2HGSA 2SCUB 4M9UA 2CNUA 4O7NA 2YZNA 3JRWA 3BSYA 4DIMA 1DV2A 2PN1A 2QK4A 3JZIA 3R5HA 2YZGA 1A48A 4O7TA 5C1PA 1PX2A 1W93A 4IZOA 3MJFA 4I4TF 4ZHQF 1JKJB 3Q1KA 4FFPA 4FFOA 4J6EA 2R7LA 4MV7A 3TIGA 3WO0A 4O7VA
chains in the Genus database with same CATH superfamily
5KFJA 3B70A 1TKBA 3EC1A 1DC6A 3L01A 2OCKA 2O3JA 3RRBA 3N75A 2QJRA 2IS1A 1KETA 4F6RB 1FDTA 3MOGA 2CLHB 4N3NA 5DGIA 4OLBA 5CYGA 2XADA 5B36A 2E2IA 2FEXA 3G8BA 2WI8A 4ME6A 2GAAA 3QSYA 2RHGB 2VBGA 4R8RA 5AW5A 2HVSA 3FPBA 4HHEA 4XR4A 1O6ZA 2A0FA 1JBQA 2QZPA 1KGSA 3VDMA 4CW7A 4ESVA 3BMOA 3ZWPA 4R1SA 1NNLA 2EGGA 3HXKA 4HAXA 4UPDA 4DOMA 3BFVA 2AJDA 3NC4A 3H9JA 1YQTA 2ISSD 2Q5CA 3GT0A 4GGMX 1GGHA 3ZCPA 1G5TA 1G21A 2R5FA 3H5VA 4DRYA 3K0EA 4M88A 4MV6A 4EKEA 3BA1A 1HNNA 2QN2A 3JQEA 5EXSA 2FQ1A 4JLBA 3EGWA 4N8EA 2PD6A 2XQGA 1RQRA 4KO2S 3I8OA 4GKBA 3GTJA 5KAMA 3RPEA 4D8XA 5I5VA 3PQ5A 4R40A 4P4GA 2OCPA 4X65B 3KQQA 2H1SA 1UDXA 2CW7A 1TC1A 4UTRA 1AH2A 1DWOA 1N1DA 1AOXA 3LY8A 2JGLA 3A3KA 1FFSA 2XR1A 2D5BA 1F8FA 4A6DA 2BWJA 2JBAA 3ZHCA 2L0XA 1GY8A 1UWLA 2CLSA 2J30A 1AXRA 2EYUA 4MVXA 4X6LA 3SQDA 4QGFA 1MB4A 2B30A 3D8NA 3L93A 1U6KA 4B45A 1GOTA 1YTLA 4Y1RA 2HO5A 1LRKA 5BORA 4I66A 3OZ7A 4KAJA 3LWNA 2HEIA 2XZPA 3BHMA 3GJQA 5BWCA 2CXQA 4M7RA 4EVIA 2ZJ8A 4JUZA 5KWSA 5KYWB 1M1YE 2O0MA 4JUDX 4O7ZA 2R7NA 1KEEA 1P4RA 1I9CA 4NONA 4PQGA 1RIIA 4EFMA 5EIXA 3DBLB 4HQKA 4AKHA 2GAIA 1GZSA 2P35A 4JLSA 1S2LA 1E2BA 4GRIA 1LNZA 3IDAA 3ANLA 2D1RA 5BNFA 2FB9A 2C5SA 3QWFA 1L7BA 2XDWA 4OMCA 2Q1YA 4XYEA 2FZ4A 3ROKA 3ZYCA 4YMGA 2XODA 4MAFA 1QWSA 3OESA 3PJEA 3CSWA 3NWOA 4A03A 3F3MA 1FFEA 4LWZA 3MUNA 4P35A 3GNLA 1WHSB 2TRSB 3DR5A 4FS3A 3SJ7A 3W6ZA 4CMEA 3KETA 1UPAA 4LIPD 1O5OA 1IN1A 3TRHA 1FS5A 2DTDA 1W85A 4G9GA 2RKWA 5JCXA 2P9BA 1SQFA 2GYUA 4LRTB 5KVSA 3HO8A 3G5TA 4FFVA 4WUVA 3DHYA 2GRUA 3NOVA 3LPDA 2OZPA 2ZWMA 2SBTA 3C4VA 4V0RA 1VECA 1WQ4A 1ZC4A 4PNHA 1SHJA 1XTZA 2FPRA 4U6SA 4E7OA 4DR1B 4IIEA 2R8XA 2NSYA 2IYUA 3ZHZA 1Z07A 4IPTA 1VXRA 3PGA1 1IBKB 3W1VA 3QENA 1E3QA 4KJZA 3LBHA 5DIFA 3VO9A 1NRJB 2UVWA 1S10A 3I9JA 4OXYA 3FG9A 1T6YA 5FD6A 4N1AA 4YAJA 1ZNWA 4JWKA 3IILA 1VA4A 2JAPA 4AY4A 3AY3A 1EZ1A 2JHAA 2G6BA 4BNDB 1DQRA 1OXXK 1RZVA 3I9OA 1VKOA 1U1DA 3LL4A 2DY0A 1Q17A 3UTCA 4DM7A 3THXA 4WLOA 1V11A 3DBRA 3LC1O 4JV5H 4MHOA 2Z8ZA 1RE0A 3PA6A 1N2CA 3EHDA 2EERA 3L1JA 4MUYA 1N5KA 4AJ9A 1I4WA 4DWOA 3FMFA 3AF0A 3C8HA 1QIGA 5FTNA 2XKAA 4ZYLA 5K5EA 5L1KA 2F7SA 1R8SA 4KZKA 1C1HA 4WAUA 1W5SA 4G0XA 4DPMA 5FNVA 2DUJA 1J49A 3RROA 4TPKA 3SFVA 3W79A 2HQBA 2R96A 2ZYAA 4NEGA 1Z47A 4LF4B 4NATA 3R0IA 4UBLA 3W90A 1BDIA 1KFEB 1QKIA 3DE6X 1NW7A 3ESBA 3O4GA 4FE4A 4L4ZA 4OXXA 4RW0A 3FDFA 5CHEA 3RNLA 4X20B 5FUMA 1P5FA 1MAAA 2R11A 2WTEA 3HCCA 4AWAA 4H3HB 4TV9F 2CFTA 5GWXA 1YR7A 1YIOA 1F0KA 4O4HA 1AMOA 4LYGA 3MEQA 4UQOA 4OB6A 1Y4UA 3M5WA 3P4YA 3WGTA 3JYHA 1G5FA 3CF4A 1YQQA 3WA6A 4P4TA 3HFGA 3IHWA 5LDDC 4Z54A 3OZSA 3HK2A 3IAS6 3IV6A 1C7RA 4CVNA 2JJYA 2ZIXB 3VTZA 3RJ9A 5LMCA 1SG9A 1J8VA 3KYHC 2COIA 1QK5A 2GCNA 1CKNA 2RHWA 3DAGA 4OBEA 1FNMA 4IDBA 1J33A 3GV5B 4OSEA 3SYNA 2WM2A 1DJLA 1EHIA 3K5PA 2ODPA 2N46A 3ZVLA 2WIJA 3IJ5A 3KUXA 5J1SB 4Y8VA 2WIAA 4AT1A 1Z0ZA 1ZVJA 4DZRA 2Q4EA 2V4UA 3DV2A 3R20A 1NV8A 4DLWA 4KXNA 4TM8A 4TTVA 2C88A 5FA6A 1Z29A 3SEAA 1R15A 1R5JA 3STXA 5ESXA 4HXYA 2HH9A 3R0VA 3Q12A 2OZKA 3PR1A 3PICA 2F17A 4JGGA 2DR2A 2YQ5A 4JB3A 1ZX1A 4M37A 4Z2YA 2H4JA 4ECZA 2R8YA 1JKFA 3TRKA 1XNHA 2RC6A 4EQZA 1WZCA 4P3YA 3GJ0A 1W0KA 4MIKA 3MINB 3UOGA 3K0KA 4UPVA 4F46A 5AFSA 4LKRA 3U4HA 3L05A 5KDDA 4FS8A 5JS2A 5JXJA 2IH5A 1J0AA 1SVKA 4RYLA 2E4AA 4Z99A 2EF1A 1BROA 1X1BA 5DK4A 5H0IA 2P5YA 3WYFA 3GNSA 4NHEA 1I0IA 3G5UA 5FQNA 3GEHA 2VZ8A 1GN9A 4BNXA 1TEVA 2ZRCA 3K0HA 1G8SA 3TTYA 1J9ZA 2DIKA 1L5MA 4E6PA 4Q37A 1IJFA 1R37A 4UAJA 3GRVA 4ENWA 2QDKA 3C74A 5F98A 2J41A 3ABSB 3ILXA 2OV2A 3TDNA 1RR6A 3TKLA 1BWSA 2C2MA 1LS1A 1J0EA 3ZYZA 4KQ1A 4JXUA 1CUJA 2YOGA 4R1LA 4WZAE 3OY2A 1CDOA 4JR1A 3R9KA 3FKIA 3HN2A 3RWBA 4HFRA 2BPOA 4G24A 3LLUA 4PHFA 1SXQA 1M6WA 4Y0NA 5IJ0B 3D02A 4NXMH 3ZBPA 1YXMA 1Z7WA 5TMDA 4AJEA 2GM4A 3Q8SB 2YKGA 3V7FA 1AO3A 3BABA 4PZPA 4E2YA 4YT2A 1RWVA 4LF4H 4BO9A 3CCFA 4XGKA 2EAUA 4ZVMA 4L1KA 5ARDA 5ELMA 1IVNA 2E7ZA 2A59A 1E8NA 4F45A 2H59A 3GJ8A 1EAMA 4F4CA 2I3DA 2NG1A 3QMMA 2HRQA 3RBEA 2BFWA 2QYSA 2R6DA 3GDOA 3I6BA 1TCBA 1OBGA 1I6UA 4IJ5A 4XYMB 4N3GA 3AETA 1ZCBA 3O94A 4PONA 3O9MA 1EFAA 4EFEA 1OTXA 5GV7A 2EJBA 1GO2A 2JDIA 2P1ZA 2PUHA 4BNVA 1GTSA 1VKHA 1YNOA 4CODB 4NU8X 5F76A 4JENA 1N7HA 3WXMA 1GZ7A 2D5IA 5JXIA 4ZYVA 1D7AA 4MYCA 3BIOA 3SEZA 3GQCA 3O8RA 3D0OA 2JLSA 2DJIA 2C4WA 3LT4A 2BFDA 3RREA 1MC5A 1J00A 4GI3A 3VMFA 3RSFA 3WFJA 3JY6A 3WA7A 1PTJC 3AGQA 2A1TR 1E98A 1OLSA 3BMNA 3H9UA 4B09A 3NGDA 1DEOA 3IELA 1BOFA 2BDTA 3B51X 1CERA 1J6UA 5B64A 4AY6A 3GRYA 5HXAA 3B8HA 1Q21A 4ECVA 1Q1NA 3EAGA 4AYXA 1Y9DA 3N8KA 3QLTA 4EG3A 4OVKA 3DNFA 1YBAA 1JQBA 1RHMA 2FWAA 2ZAGA 3BGWA 4HDNA 1HO3A 1B6GA 3JAWA 1QX3A 1BCRA 5ECDA 3RLFA 4DTIA 4E4RA 5JNRA 1DEHA 1MUUA 4RZSA 3WBJA 2A3RA 1P1KA 2IT1A 3DL4A 2RGRA 3MFHA 1JI0A 1H8EA 2DR3A 3ZTWA 1Y80A 2CGEA 3BB4A 3EC7A 2LTAA 2JNWA 4BO6A 5BWOA 2O5CA 1WQ3A 1Y1QA 2F1JA 2EIXA 3B2EA 4X90A 3UGTA 4F9EA 1D6NA 4OHWA 2P4SA 3HDVA 3I12A 1Q22A 4DDHA 4H77A 1TF2A 4UNIA 4KUHA 2UUBB 1MV5A 1E0KA 2GWRA 3CB4A 3V7WA 2W70A 4YCAA 4EUKA 4BGDA 5DNYB 4EFBA 3B6MA 4GOMD 1Z0FA 2R60A 1WHSA 3S29A 4F9TA 4ZOBA 3JZ6A 1Q3KA 3RYIA 3BEDA 5HJEA 1OXVA 2XNHA 2JEGA 1O08A 1BCRB 2X0RA 4ED8A 5I7UA 3DV9A 5FA5A 1Y3CE 4YJ2A 2ARKA 2EC5A 3SK0A 2FHPA 4JJGA 1BDBA 3P9RA 4GIBA 3FMOB 2XKBA 4YMTA 1QC5B 1SEIA 4I4IA 5EUQB 4J9UE 4BHTA 1YQ9A 1U11A 1J21A 1MXHA 3TMAA 3O4FA 3ENKA 1YUBA 3KTFA 5I7SA 2DH5A 5D2CA 4RB3C 2JA5G 4TQ9A 3BQMB 4YAEA 5EEHA 2WILA 2VC2B 4UBMA 5EJ7A 3VU9B 5K6AC 1VG8A 2V7EA 2BH2A 1OAAA 4ZZ1A 3MQ4A 5J40A 1FNNA 4RADA 5K0TA 4CF4A 2CHQA 3UMGA 4ALIA 5BOSB 2XQVA 4X85A 2E18A 3OO1A 3QVVA 4RTJA 1H2AS 1JXQA 5KQMA 3EGDA 5JI2E 4ZRDA 1KKLA 4JLDA 2MR6A 2QTCA 1JDSA 4N47A 1IOZA 5JDCA 3A6DA 4OOFA 4QTTB 1QHIA 3DLPX 4XYMA 5CFLA 5IXSA 2PRIA 4R0MA 2XYHA 4DV6B 1JR2A 1YVUA 2ODTX 2HK6A 1PFVA 4B8ZA 1VL8A 3GN1A 3GBSA 3HKBA 2X6TA 4FJ2A 3O8BA 4UVDA 3A6PC 1EDOA 1FVFA 3OD1A 4FPXA 3PYLA 5E95A 2YJ4A 3VHRA 1EKPA 1E6WA 3I83A 2E2WA 3QEAZ 4I14A 4K9KA 2VF5X 1OA0A 1UDCA 1AK2A 2Q8NA 3U54A 5JNWA 1NJGA 4RZUA 5LUBA 1T15A 1U7OA 1G8GA 2R8RA 4G41A 3ND8A 2J0UA 3P9CA 1XDGA 5C3MA 2O54A 2FMTA 3Q3GE 2DBYA 4D74A 3F90A 4H18A 5CR5A 4MKHA 4Q18A 4YAFA 5LC1A 3VKFA 2FK2A 3MWEA 1T8PA 3CNEA 3HDGA 4L75A 2V96A 3EXG1 5JVDF 2PSSA 1NZJA 5FL7D 2WYOA 1BMTA 3FTNA 1ZGJA 2QP3A 2FP3A 1X3SA 1CG6A 4JLMA 4LSAA 1KK2A 4JJIA 5ESDA 5KOYA 1A9RA 1T2VA 2ZZKA 2GO1A 1IAVA 2PBFA 3DEYX 3E7DA 1YUNA 3KV3O 1SCIA 1OKKD 3Q3CA 2CJWB 1JQJC 3FX2A 5LBUA 4A3IG 5CR9A 1KMHA 1LC3A 4J9NA 3GMDA 1PJAA 2DLNA 4IEFB 1WCMG 4AQ7A 3X1YA 3ZQUA 1QPGA 4YP6A 3Q0EA 2QENA 2X9GA 3EXEB 4FIDA 1WW8A 4ED6A 4CMAA 2PR7A 2CNQA 1A9OA 1M7GA 4ROSA 2FYTA 1VLHA 3S1LA 1LGYA 2W8KA 4KIWA 2BZGA 5DRYA 1T3GA 3BBPA 3MWFA 3I3OA 1KBZA 3Q9LA 5EWLB 1AGPA 2BT4A 2ZBRA 5JR3A 3LQYA 5TB5A 4U7DA 2RC5A 3HM9A 1OZAA 2W93A 4BY1G 2H4FA 2VHCA 3KJGA 4M0LA 4NYMQ 5KSPA 5CCDA 4F1KA 1UEXC 4TN5A 1OA1A 5TT0A 4A27A 5FP0A 3G0HA 1U0JA 3T34A 2HK7A 4IAOA 4MHSA 4CI0B 5FX2A 2NSHA 3E82A 5JV5A 5F3WB 1HDXA 2WABA 4P7GA 2NXEA 2W8ZA 4QODA 2AYYA 5IK2A 2PWAA 3VZSA 2I91A 1YDEA 4K86A 4OQXA 4CFZA 3ZGNA 3RGXA 2HCBA 1XAJA 2VF7A 2RGNC 3AOEA 3IHTA 5DDIP 1CD5A 5KTYA 4RAZA 1C80A 1TQDA 2ENWA 4TROA 3VZBA 2JA7G 1BAPA 1EFVA 2Z4SA 3D7SA 3K2BA 4JLNA 4RV5A 3MCWA 3BQ2A 4G37A 5L51A 4DSOA 3BB3A 3KYJB 2QV7A 1LW7A 3L8EA 4FDLA 2GF2A 4MW5A 4NK4A 1I0ZA 2I6XA 1DEKA 1ZUHA 1RBYA 1VE6A 1AKRA 2X14A 2XB4A 3KYCB 3I28A 3P52A 4LRSB 4A2CA 4O0LA 3J80W 2AN5A 4ZVPA 5KFUA 2XI4A 4XWOA 2YINC 2XHEA 1RKBA 2B69A 4YP7A 4IDEA 4LXGA 4OHZA 4QBKA 1XTUA 4L28A 4CG1A 1Z2CA 1UL1X 3T5JA 2RGXA 4TWZA 4JU8A 1X80B 1AF7A 1CJBA 4ZK2A 3WFIA 3GQBB 1JR6A 4R8UB 3MAAC 4OAQA 4EF4A 1R4MB 3JZIA 5DU2A 3ZW7A 4IKEA 1KQPA 3SHQA 3N39C 5F1PA 5KOHB 1WDTA 1KYQA 3L8FA 5SY9A 2AYZA 5CA0A 4V1CI 4RVDA 3MPOA 2XITA 3I61A 3H04A 3FKIG 3CBGA 3HRKA 3KUKA 3TTUA 3WYNA 2WNIA 3ZGLA 1BTOA 4D8WA 1P1IA 2BTQA 3RTEA 5DTQA 4IZOA 1L0BA 2ORVA 2QMZA 2XSZA 3ACBA 3IAFA 3RIYA 3TLBA 4OKNA 1HE4A 1EPUA 2FPXA 3QUCA 1QHEA 4I4NA 1E9DA 3CPEA 3MFYA 5C7IO 3HZRA 4BTLA 2ZJFA 3EDYA 1WNFA 3IDSA 4L27A 4E46A 4RK1A 3X3HA 3DFMA 2OBFA 1E6EA 3RRFA 4Z7NB 1BCSB 1TT7A 4DJAA 1Y8ZA 1FZTA 1E58A 1HE1C 4AI6A 1BVUA 4CM9A 2JCGA 2QTMA 2ZWVA 3ACCA 4OYHA 3V00A 1Q0LA 5JCZA 4NOLA 4M6WA 2BHRA 1GUBA 2DBRA 4IIJA 3C1TA 2XBUA 1SUBA 1UC4B 2V7XA 2OTCA 5DX8A 1YFZA 3N8IA 4ZYTA 2D1SA 4JJAA 3PW4A 5E9WA 3N2KB 5TPWB 1MF7A 1XU4A 3UMSA 4GLFA 3G79A 4PBSA 2ZEJA 1W4ZA 3NXKA 3BOSA 2ONKA 1AZTA 4LBYA 4LBVA 1IZ9A 1UBJS 1ORRA 1PL7A 1E6LA 4BCBA 1H2HA 4PRZA 3GIWA 2D74A 4TKLA 3QX3A 3H1BA 4Z49A 2V8BA 1RLJA 1JQLB 3Q85A 4YPVA 1C7EA 1UBOS 1EHYA 2Q0XA 3QEMA 5CDFA 2PO5A 2AU0A 3QUQA 3NTXA 1P9OA 4QQKA 1JI3A 3C3MA 5ENZA 3T7RA 5HYVA 3WQRA 3PR5B 4A3GG 4LGVA 4LZWA 4MVCA 3AF5A 3WLMA 1P7CA 4BBRG 3PTZA 4YCBA 4PN3A 1AQJA 4D96A 4N5DA 3OPYI 4X24A 4BS9A 1A0OA 3PXUA 4ZCSA 4CNQA 2OCYC 4R2LA 4MVJD 2C2GA 5ISMA 4FCWA 1J23A 3X1DA 4W7HA 2JA6A 4MAMA 1S9DA 1USUA 1V1RA 1ZM3A 2QRPA 3CZ5A 3DVLA 3UV6A 5J2UA 4PNZA 4AY2A 2H7CA 1DT3A 2JJQA 2ZYGA 4WZBE 3ZWYA 4RSRA 2TMYA 3OKAA 3IULA 4FZ3A 4PAWA 3ZWXA 4B79A 2PR2A 5IABA 3AO0B 1SXPA 2EKDA 2PMZA 4QU5A 3KAKA 3ULKA 1R5BA 1HNXB 1RYHA 1PJ8A 2PKWA 1ISMA 2YQ4A 3CN7A 2Y9MB 3NHAA 4B6FA 5IFLA 4HS9A 1QGYA 1HR0H 4X1OA 3UJAA 1NQ5A 4PNPA 1BXGB 4YP5A 1UOEA 5C37A 1XXHE 1IZ0A 4IFEA 2C1EA 2BEVB 1BSVA 2GFHA 3J81W 1J2RA 1XOIA 1XXHA 4H31A 5PNTA 5JSUA 1VL2A 1CUHA 4C22A 3PRHA 4Q3DA 4E11A 3HDHA 4JLWA 4WI1A 1X8XA 5ES4B 3OD5A 4ZOQI 4M0FA 3TLYA 1B0UA 1Z5WA 4RTLA 3IVXA 3WNQA 3GLRA 1WVMA 4IV8A 3T4EA 4B3SH 2XJ4A 1IATA 4PPNA 5IT9W 3G1WA 2QI9C 5AXCA 4BB6A 4QGSA 1WDWB 2ZDHA 1XL1A 5E1OA 4TUYA 5EHQA 2OG1A 2BRUA 1DBIA 2ZPAA 3C0KA 1NYQA 3M1IA 2PXXA 4PYMA 4R51A 5DFAA 3AF2A 3T8YA 2HIHA 5ED4A 2W6QA 1WSWA 3HWWA 4FNGA 4YDHB 1HK7A 2QRVB 2QTBA 3A3OA 3C7AA 1XTTA 3I05A 4WKCA 4X00A 2J3HA 3RVJA 3UOAB 4AKTA 3UH0A 1HOXA 4GZLA 3VR0A 2CXNA 2HQOA 5B4VA 4TQGA 5ALSA 1Q0QA 4MWZA 1RYMA 4OSPA 3WK9A 3RYFA 5A4JA 1ZA1A 3SDZA 1XTPA 1WXXA 4O7YA 2PBRA 1DEXA 2QSUA 3IAM6 5EP2A 2J87A 3LCVB 2OYRA 3W3ZB 2XZTA 3GIMA 1GQFA 3ESDA 2OXRA 4Y0VA 1X19A 4HBGA 4URUR 2X13A 2RHTA 1IN8A 1YE3A 1PK8A 4N6OA 4IVRA 3NC1C 2G5GX 3GTLA 4S1PA 1EK6A 3H3JA 1JZQA 1RKVA 1GGEA 3BIJA 3KV1A 4G2TA 3IBYA 4MPPA 4PGHA 1A8UA 1BXRA 4G3XA 5GM2A 3V9PA 4JLVA 5AVTA 1N34B 2IYAA 2OAP1 1QGAA 1RMTA 1K6JA 3UAGA 4FX2A 1AUQA 3TJZA 2P2ZA 3A2MA 2P4QA 3CISA 4XD7A 5BQOA 2ZB8A 4K9NA 1YI0A 1B14A 4RL6A 3L7IA 3P2IA 1BIFA 4C2UA 3R40A 3NEYA 4QWCA 1G20E 4QWBA 2DWPA 1K66A 1JAZA 3A6JA 1C30A 1X9GA 3CG0A 3A9SA 3DC7A 3DT8A 4OSOA 3BB1A 2O8CA 1RPZA 2X5XA 4FQ5A 4WRRA 3GV0A 1VOTA 3FWYA 4B0PA 4WECA 5BV1A 2WJZB 1YS9A 1M3SA 2ZFUA 1BYIA 3ESAA 3TQSA 4TUYF 1F06A 1NUSA 3CJTA 2VAWA 3E22B 4D3SA 4QFBA 2JARA 3Q8WA 4XH9B 1JA9A 1XMXA 3AIMA 1GFWA 3CLTD 3U62A 4RTKA 3A06A 2REBA 5MF6A 1OHHA 3W7AA 2Z58A 4CFYA 3QNWA 1WQ1R 1FU4A 5D5PA 4AJIA 4ZQGA 2EJUA 1BXKA 2M98A 5TQVA 3QZ7A 4AJPA 4BJ3A 5JXWA 5DN9A 5FR2A 2LZ0A 2ZTUA 1IM8A 1T26A 1I0LA 4BRUA 5BWTA 1T8TA 4JNKA 2OBYA 4N9QA 4Y1GA 4KW7A 1O3YA 4KSBA 4AW9A 5BURA 3JXEA 4HAUA 1YKGA 4QUIA 1ZHHA 4ZMBA 3GEEA 1YULA 4HDQB 1U7XA 3QFRA 1WRVA 3SXPA 2X76A 4RHFA 5HFAA 4YXWD 1KWGA 4RCNA 2Q3HA 4EPXA 9MHTA 4AKIA 1ZOLA 1LFDB 1QXSA 4UE2A 4UHCA 2C2ZA 5C7YA 5KTKA 1SCKA 4BNJA 3HJGA 3MBKA 2XCIA 3LXRA 3FPKA 4RF2A 4Z86A 5HCIA 5GV8A 4CEJA 1JS1X 4CNBA 1XTRA 4DV1B 1AKEA 1Q5PA 1FRQA 2UAGA 2VF2A 4JR2A 4EQ6B 1Z4MA 3QVMA 3KXYT 1H8HD 3PXCX 1U8CB 1WVIA 3AJDA 3QG5A 5AI0A 2G9NA 3K94A 3RC9A 3FHLA 1KR2A 5FD8A 2Q5JA 1ORVA 5LP6F 2DSNA 3KEOA 4O1HA 5AK5A 4BVLA 1L4KA 2R1TA 1LBTA 1DC3A 3KKQA 2L17A 3TOVA 5LZ9A 1M2WA 1Z08A 3C6KA 4JI4H 1YJXA 3NI2A 3BA8A 3E3AA 3GLIE 4ERNA 1DWUA 1GLGA 3LA8A 4YV2A 2IZ6A 1Z82A 3WWIA 2BIFA 1MDFA 2HF7A 1HT2E 3DDWA 3OCXA 4AZ0B 1HLGA 5IMSA 4OUDB 5KSOA 2JLYA 5B4TA 3USZA 4DCSA 1XQ1A 3DL7A 3NHLA 4XWWA 5LYJF 1YC5A 1JDBC 3GTPA 3AY7A 3TLXA 4U4AA 2YFHA 4OY3A 5TEWA 1TIBA 1C9EA 1O97D 4H1VA 4PZLA 4M0JA 4X7MA 4YFVA 1ULZA 4CF3A 1NSTA 1VBGA 2VWPA 2XMGA 1DXYA 3ENVA 3T7JA 1M1ZA 2X0SA 2H7VA 3AMVA 5IZCC 2OBBA 1FFDA 4P4SA 1Z6XA 3EGXA 1H6DA 5IYZA 1U9JA 4ZYYA 1B8UA 1E5TA 1ZITA 3K5IA 3MJEA 4MW2A 3U7EB 3F3YA 4FYYA 4HWRA 4J3NA 2ZWOA 4B83A 4D9NA 2BFDB 1E59A 4U7WA 2NX2A 3KXPA 5DISC 4K81B 3WX0A 5DN6D 5IC5A 2CQYA 1OZ0A 1UPFA 1MIOB 3SYRA 4C21A 1EE2A 1FFGA 2FLVA 1VJTA 3DEAA 4EK9A 2J08A 1EVKA 4V2IA 1VJGA 2XBLA 3NHPA 2YMQA 2JIDA 1B6TA 4R31A 5DGTA 2V4QA 1ZBQA 1IOLA 2XOKD 3SVLA 2DPIA 1H2RS 1LY1A 1X92A 2F1HA 1PV2A 2E5LH 1KE1A 4GX5A 5GJCA 1HNXH 4LF6B 1OC2A 1DIAA 3QJYA 5FWYB 3T5HA 1AQ6A 4Q4JB 4O82A 2W8BB 1XEXB 1P5ZB 3ILHA 1FP7A 4G5QA 4ZIRB 1H2WA 2SKCA 2FAXA 1CJMA 4J9MA 3HI6A 3K8OE 5KB3A 3RADC 2NP6A 2CD7A 1XD9A 1DXHA 3CW2A 2CCGA 2XCLA 4P82A 4OX9Y 3EBOA 3NTQA 2ZJZA 3S55A 1E94E 4EYOA 2H00A 5LMUB 2QZSA 3KTAB 4RVGA 4FMDB 3E9DA 4K26A 5HIMA 4IICA 5JMPA 3DZBA 5JRZA 2DH6A 4FCVA 2V7QD 4R6WA 3HVKA 2GYYA 4G2NA 4HVCA 1DRWA 3LHSA 4X7PA 2NTVA 3IURA 2NU8A 3ZQ4A 4XDHA 3WLPA 1RXEA 5KFCA 2F4NA 4WNYA 3AIKA 5JTUA 3EC2A 1X1QA 4R7ZA 3VKGA 3NKVA 3NHSA 4LV8B 3U61B 2ZRGA 1OAKA 2B3DA 1GTL1 4DLRA 3FDXA 1OBDA 3OZXA 5LKRA 4JX8A 1FRVA 3JWIA 3UA3A 4WJZA 4A10A 2QQGA 4AS2A 4Y9RA 1I94B 2ZANA 4PICA 4LX0A 5JCJA 3GJXB 3UHAA 4KHPB 2J0SA 1ZM9A 3QIVA 4QIHA 3A6FA 2I6FA 2H92A 1YSCA 2YJGA 4PAMA 4UVIA 1QM5A 5TARA 3KKMA 4O8CA 1MORA 2GA8A 1NR7A 4Q3OA 1FTNA 1PZGA 1V96A 4X65H 2ZSIA 5D1NA 4ZJPA 1Z2DA 2YU9A 1MIOA 4Q39A 3PUWA 3AJ8A 1FEZA 4GX1A 4L6IA 3DFFA 2UDPA 4MTEA 1Z4IA 3AERA 4S1NA 3RRYA 2ON6A 2OSBA 3KZ1E 4G5OA 1UK8A 4U7FA 1QZUA 3FMVA 4RZ3A 1N8NA 1W8IA 2NXNA 4Q3EA 4RLQA 1ULUA 5DX1A 1Z3CA 5F5XA 3EUWA 2ZUWA 3JRNA 1M75A 1FXSA 3RVBA 2F55A 4NOMA 4J3JA 3PJRA 2BFAA 4XDZA 2FMKA 1IJKA 4YAKA 3IQWA 1Q14A 2PTHA 1Y4DE 2V65A 3JARA 4UEJA 5AXBA 3IEUA 4K0RA 1Z74A 3SXJA 4A0FA 2ZUBA 2Z3VA 1YR1A 3NASA 5BVHB 4V0LA 4HDSA 4W7IA 5F12A 3VPAA 2EG9A 1NI4A 3OICA 1D4ZA 2KBEA 1D2NA 4ZPJA 5DWQA 3WRVA 4YCMA 4UKDA 5DTMA 2WSBA 4IJMA 2IQIA 1KA9H 1FIUA 4IR7A 1QYIA 4ENVA 3ADCA 1MBZA 1YDMA 3D1LA 1Y14B 3G17A 5AW7A 3RVKA 4JUIA 1ICIA 1L1FA 3AWDA 4JI7B 1IDOA 1V41E 1FJGH 1QVZA 5DW0A 5CM9C 3B3AA 4FS1A 4R0NA 2HIGA 3MT9A 4W8HA 1MPXA 3T1OA 1XYGA 1D9ZA 4IRXA 4NXNH 4GWKA 3PQ4A 1T1IA 3PQ8A 2Q2OA 4GL2A 1QO7A 3G6XA 2QD2A 3E23A 3IS3A 5E4JA 1QHGA 2P5UA 5K3CA 2PIAA 4JC0A 1WPRA 4AAYA 5HKOA 4Z4IA 1H5QA 521PA 5ECGC 3TQQA 1IVSA 1LDGA 5EZQA 3AEUB 2WJPA 3CMMA 2W9BA 5IYCG 3Q6IA 1WSCA 3QJGA 3UG6A 1QP7A 4II7A 1L5YA 1O87A 2IYTA 5FLMG 2OESA 2X4IA 2WSMA 5KOHA 3HDYA 5K0NA 1CZNA 1JR3A 4KIJA 4NQZA 4UUOA 4X0EA 4CDNA 1NG1A 3M1AA 1E3SA 3OC6A 3QKRB 3DOIA 4PYNA 4DT1A 1T9GR 4Y2UA 4B74A 5KG7A 2DP4E 2YOFA 1IK4A 1SD2A 3CB2A 4TLAA 3SEFA 2WV7A 3KSDO 1ZUD1 2V8OA 5KFYA 2G77B 2FSIA 2GK3A 3ET4A 3GFGA 3PD1A 5A7GA 4I5GA 3KEMA 1EGHA 3DTTA 4V39A 5D3QA 5DQHA 1WULS 1HLPA 4R4JA 4UCWA 3UFBA 4YRZA 3J81k 1Z73A 2FJ0A 2BF7A 4IO0A 2WE8A 3GF4A 1QAMA 4K8OA 1GNQA 4U63A 1C1XB 3MTBA 3BICA 1L6IA 1NATA 3V1YA 1ISGA 2XQKA 1C4KA 3ZJVA 1KYYA 1XJWA 2C03A 2PQ6A 2VUSA 1N2JA 3KEQA 2RCYA 4QDTA 3RABA 4ZI2A 1M5TA 1TJNA 1TGYA 1E2KA 3AM3A 4J76A 1E7SA 2X1HA 3P0HA 5CM2Z 1FSZA 2V7UA 4LDNA 4G1UC 1EVLA 3SR4A 3OKFA 4MV4A 5DPMA 2PMBA 3I9NA 5FV7A 1C30B 2EG5A 3PLNA 5A05A 3W2IA 3AC0A 3ZCVA 1QFZA 2LRHA 4MW1A 4CKWA 3DSRA 2Z5FA 5E8JA 1R0YA 2YVAA 3VSCA 3RRZA 3MJDA 3LLCA 5TE9A 1BNCA 1J2YA 3AKCA 3ZV4A 1C0IA 1K27A 4Z9YA 5HDBB 4BLTA 2YWXA 1U7PA 2IEZA 5HF8A 4XM2A 1F7VA 3R5FA 3O7MA 1E2FA 3QVJA 1IEVA 4HN4B 3TSWA 4OBXA 4DKXA 4EKIA 1U94A 1OWOA 1YONA 2JATA 1G55A 2OKCA 3GG9A 3I1IA 4QG7A 3PL1A 1KK0A 3Q3IA 5FO0A 4TKMA 3UB3A 5H3CA 3PC7A 1SKUA 3N3BC 4B33A 4ZU6X 1UWVA 5KDOA 2IY8A 4F7DA 1O6FA 1KI4A 3QU5A 1XZCA 4TYYA 2HLNA 2QUKA 1G3UA 2ATEA 3ASUA 3NM6B 4ZZ2A 3WLSA 5E25A 1BWQA 5DRTA 1E2NA 2Q9BA 2GRJA 3BSYA 2H4YA 1F2TB 2HJHA 1YR6A 3O3CA 3ABRB 1XF9A 1FNSA 2IITA 3VM6A 4CUKA 3U16A 4CG3A 1DBSA 4MRVA 1DADA 1U8TA 1YT5A 1WETA 5K3WA 2OWOA 2OGUA 3SOPA 2P9FA 1H22A 3Q8RB 2DPGA 5BSUA 1DHRA 4Y6SA 2XE6A 4UUQA 4BVHA 3Q3HA 2XX3A 3VJLA 1PJZA 3UHOA 3O1LA 5IKMA 2W48A 2BTOA 4WHXA 5A2QW 1BS1A 1ZXLA 4L15A 4MWSA 3R24A 3W8EA 1UC5B 4WK4B 1QF6A 4ES6A 5JS6A 1ZGZA 1W36D 1RJ9A 4CMEC 1C8LA 1DOHA 4MUJA 4UDNA 3B85A 4X41A 5PGMA 3ZDEA 3R09A 1JAHA 2JKZA 3H40A 2V7TA 4GUDA 2O1XA 3JQAD 5AO9A 5L7TA 3BZUA 3D8UA 2CVOA 1H2XA 2ZUVA 3C45A 3KDSE 1AS3A 1E9FA 3C24A 4X3OA 4AJOA 4RVUA 3HNPA 2B9EA 4Q3NA 5IN4A 4P0QB 4C7OB 4V3BA 3G23A 2O7SA 1XVLA 3LUCA 3NALA 4DLTA 4OHYA 3F71A 1DTWA 4G8DA 5LZ8A 1A3GA 3GRUA 4E6NA 1T9GS 2B7CA 2RAUA 2WFZA 4X66H 3LP6A 3AY0A 3TFWA 3MRSA 1R8YA 1TM2A 5G0WA 3HCBA 4J9VA 2F3UA 4TZ6A 3TX6A 2NTYC 2WJ6A 2RB5A 3N2EA 2P0AA 1T34A 2L19A 2EFHB 2WYVA 1A0IA 1ZEJA 5BN3A 2Q2UA 2AJBA 4WXMA 4I50F 1Z45A 1XHFA 3WL4A 3R76A 4EJMA 3ND9A 4DV0H 1NPTO 1FSPA 1P2TA 1PVVA 2HXYA 3VU0A 2W2OA 3IAAA 5IXJA 1PBTA 5J4VA 2R93G 2YFYA 1OAOA 4Z9FA 3BQNB 3VOTA 2AOXA 2B4TO 3C6MA 3JSXA 3ZDRA 1JIHA 1OPXA 3UAXA 3HNOA 4B3JA 1HURA 1L5GB 5K8IA 5T3UA 4BWFB 2DETA 3UA4A 1K86A 5BSFA 1IULA 2YJNA 3IBFA 3HYLA 3L46A 1WBDA 1I2AA 3OTGA 4BFVA 1O7JA 1OTYA 3WZMA 5KYXA 3CCCA 3SXUB 4B47A 2X3FA 3TF5A 2C9BA 2C29D 1YDHA 2QSZA 2R1ZA 4MQBA 3VNBA 4QC2A 5BN4B 3IQHX 4ZXFA 1TD1A 2B61A 1XZHA 3F49S 2H29A 5ESWA 2X6QA 4XEUA 1CY7A 1IYDA 4Y6RA 2UVVA 3B6KA 1JDUA 1MP0A 3LPAA 4RMGA 4B2IA 1NMYA 2J45A 3H3FA 2IHJA 3NVMB 4GI1A 3WGUA 1R6BX 1XVIA 4KXXA 1ECJA 2VT2A 3N53A 4MVJM 3IEIA 2Z09A 3EVGA 1R64A 1QZZA 1DGQA 2AHRA 2VEOA 3EWIA 4CL0A 2H2WA 1FMLA 2AH5A 2ID4A 2ONCA 3M49A 4GP7A 5JNTA 4GLJA 1E89A 4HYQA 5J4YA 3A58B 5FR9A 3MJTA 1E3DA 4JVMA 1X1CA 3SE0A 4QLOA 2CCJA 1H2FA 3MS4A 4P58A 4AO7A 4BQFA 4PNEA 2XD9A 1QYVA 2D0DA 4R68A 4UFZA 2YWHA 4G0WA 3OQNA 4LK3A 4FFMA 1EUCA 1IHPA 5DHAA 4KR9A 4QELA 5D3KA 4X45A 2F3SA 4Y2SA 1LQUA 2QYTA 3ORHA 5THKA 4DMCA 3ZD6A 4IWXA 2OLSA 1U7HA 3O93A 2VYFA 1JHAA 4IQ4A 4WZAA 2E37A 1NJ1A 2AZXA 4HOYA 4M55A 3LZ6A 1GCUA 1ABEA 2EXXA 2PSJA 2O3QA 4BU1A 2K7FA 1C8VB 3U7IA 3L49A 1CUUA 1A04A 2LDBA 5D5HA 5KYNA 4JV1A 2NNLD 2C04A 2XMCA 3HVHA 2JFNA 3A10A 4IFIA 4ND5A 3RODA 3BWXA 1ZICA 4V2UA 3GGSA 5U9CA 2CLFB 2C3UA 3D43A 4MVJF 4C1NA 1ZN2A 1RXYA 3NOOA 3CJRA 1XMIA 2AWNA 3QUTA 2JB9A 4QOHA 1LF5A 4RZQA 3OF2A 3SD7A 1YZQA 3AUSA 4J8PA 2BSQA 4Y2PA 3H0EA 1CQIA 3PT5A 3RKUA 4CR8A 2Q3JA 1XUOA 1ISFA 4NBRA 1EVZA 1SKBA 2H0RA 2YWBA 3IAXA 2B5OA 1JN0A 2NO7A 4B4OA 3SOZA 4GI7A 3SE7A 2F1OA 4O4LB 2QQEA 3TVDA 1ONOA 4ROTA 3EFHA 4J0FA 4R1MA 3R7DA 1X39A 2RHLA 2BLNA 3IT2A 3ZIDA 4A3EG 2RBGA 5KJFA 2EWMA 2OBLA 2B4YA 4BMXA 1SVLA 2WZQA 5C1IA 3D3QA 4J1TA 2H8KA 1GUAA 2NO4A 3FI0A 2BI8A 1J99A 2DFPA 4F6RA 1Y9JA 2QTAA 2HUPA 3ZY3A 1IRIA 2B34A 3GI1A 1T6BY 3DA8A 3JQ9C 3JYOA 3R3XA 1TF7A 2NZWA 4B34A 4F5DA 2KJQA 3L2PA 1ID1A 1HYQA 1FXWA 3I9KA 4CZ2A 4O3PA 1HMYA 2B8WA 2EBHX 3K16A 3H13A 4L4XA 5EXXA 3RHZA 3HA2A 4C7KA 2H1OA 4BZPA 3QLEA 5IF9A 1T4DA 2NQ2C 1PR6A 3FB4A 3TAUA 5A2QA 1BGWA 1RYFA 4JB0A 2VR1A 1VLZA 4DLYA 2CHEA 4J3FA 1B74A 1YOBA 1Z22A 2ZRJA 5B4UA 3ZDFA 1FBTA 2GHQA 2PU7A 1CFJA 2XTNA 3H86A 5JSQA 5KHLB 2H0AA 3MTEA 1FU7A 2IDZA 5HTOA 4NU6A 2ATIA 2LCFA 5EY5B 2CYBA 2JGIA 2X5RA 2F43A 2JKYA 4O2BA 2BE7A 3DLCA 3OVMA 1RYNA 4FT2A 4FVTA 2OCIA 4TWAA 3SAJA 5BSKA 4FDAA 1OC4A 1K8YB 1CRPA 2C2DA 2D2VA 1PS9A 1E2IA 3COYA 4UBIA 3GP8A 4HAYA 1FVOA 2VN8A 4UTNA 1Y5NA 3IHLA 3MOSA 4UMEA 1GKKA 2HWKA 4ZGGA 4M7PA 1TA0A 3AUAA 2VPIA 3KWFA 3L43A 3NATA 3KHKA 3DLTA 5KX5F 1NBAA 4GFDA 1GNPA 5CLGA 5FORA 3CQZA 2XLCA 3QNMA 4QGGA 5DLYA 5EN4A 3T1QA 4OEHA 1EK1A 2VG8A 2G17A 3H5AA 4NF2A 3T38A 2GEUA 3OM1A 3VNRA 3W0LB 1XK6A 3M9MB 2N42A 3KQTA 4B85A 4KQFA 4LSGA 4JBHA 3RQSA 4IWNA 3KELA 3D6TB 4HQRA 4U7TB 3SX2A 2C35B 1C7IA 4BKQA 4F3KA 1N6PA 4DB4A 1USWA 3VR2A 2CLCX 4Q12A 4RLSA 5B55A 3GUYA 1PUIA 5CB0A 1SVNA 1NBMD 1GZ3A 3JQFA 1XAHA 3LBIA 3RM3A 2F9MA 3FD8A 1U9YA 3GAZA 1T10A 3M3DA 1E0DA 1L2TA 1KFBB 4A3BG 1MJNA 4B81A 2YYAA 3D8HA 4XVCA 1TFUA 4EDFA 1OSNA 3THWA 2W2LD 2WB2A 1LBEA 2BMWA 3K15A 4A36A 2ODEA 1E7WA 1UT8A 2AK2A 2AD5A 2FY8A 4D46A 5H02A 3H2YA 4NV0A 3ZWNA 4Z5XA 4DUPA 1TU0A 1SQ5A 1CNEA 2WAXA 1GRNA 3KX2A 1OILA 4GOOD 3FFWA 4NK5A 5BSVA 3GBPA 3ROPA 5HWSA 1GR0A 5IF3A 3TZEA 1EUDA 3FTCA 4ZICA 1IBKH 1H3NA 4PLWA 2Q4RA 3LOUA 4KDFA 1UDWA 2LCQA 3G13A 3VU1A 1Q0UA 5JNSA 2WSIA 1XALA 3CW9A 2QQFA 1DLIA 2XUDA 5AKZA 1MHPA 1QTRA 3BMOB 5JATA 2BCGY 5CVTA 2EJTA 2BN4A 3ETEA 2FU5C 1BHJA 1K8QA 2NZUG 3OM9A 2P4HX 5K4AA 5BWBA 3Q11A 4DV7B 2BFPA 2BFEA 4YP3A 2HPZA 3FUVA 3IRUA 1NIJA 3MTAA 4AU1A 4EJFA 4GMXA 3SQXA 2RKBA 1OXMA 2PGOA 5CCBA 3I6YA 3FHOA 2VH5R 4WVFA 5P21A 3C8MA 4N6GA 2QZ4A 1Q0PA 1SVSA 1NVXQ 3GJTA 3I0MA 3Q8LA 1LI7A 5EJ4A 4PC2A 3AKYA 5IWCA 2JK0A 1YASA 3ETNA 2DWOA 4CPDA 3HM2A 2P30A 2B1JA 2B4KA 5BWXA 1TA9A 2FSVA 4OHRA 1JIJA 4TVKA 3ECAA 2C00A 3ZE6A 3CV3A 1X38A 4QNNA 3AFNA 4NENB 1G4UR 3GLSA 4P5EA 2J9GA 1HE8B 1R4NB 3KD2A 3SSOA 3TKAA 3C7DB 4MCIA 1I2LA 2QTRA 4EOGA 4XWTA 2UXCB 2FW7A 1DJOA 3P2MA 1URPA 1VRVA 4QYTA 1IYEA 5FFMA 1N7IA 4M86A 1QGUB 3FDZB 3GD7A 1L8OA 3NYRA 5BSHA 5JASA 1P1CA 1NMZA 4GZ6A 4WY8A 2IF2A 2XGQA 3CX4A 4GPEA 1XU7A 4LTNA 2IOQA 2X8BA 4MJ7A 3ZW9A 1UMCB 1TM7E 4LEIA 2X0FA 1EG7A 2JAWA 3TD9A 3UUFA 4PGAA 1H23A 1ZRSA 4QPNA 3DLBA 3NC0B 1A88A 1RI3A 3WHPA 3AR5A 2HSEA 2Z2KA 4NZ9A 3V2HA 2B92A 4PF1A 4MJXA 3BMNB 4EGAA 4A16A 3EGCA 1N2BA 3GVPA 1O57A 2BFBB 4V0QA 1I1HA 5H7XA 5EPEA 4H7PA 5MDHA 2FZVA 1PDVA 3OOWA 2JIPA 3K2EA 4HLCA 3U0VA 1ADJA 4LF7B 4S3MA 2FW0A 3JV7A 5AXDA 3RB4A 4CIXA 1WHTA 4XIGS 1WSBA 2I7CA 4IUDS 5I5GA 4ZVOA 3T5GA 4QUJA 1TZBA 3ITEA 3CN9A 3L1KA 2JPDA 3T4PA 2JI4A 3CRNA 3U26A 1U98A 1Y1WA 1Z06A 4FM9A 3PGKA 4IUBS 4YRTA 3KAPA 1Y3AA 3M4IA 1DIBA 1KZ1A 1X2BA 4M89A 3OTOB 3OIVA 1CKMA 2ACVA 1IL0A 4PR3A 1M74A 2JG3A 4E03A 3JVIA 3V3TA 1QDLB 2GM5A 3RT7A 4K40A 3QM1A 4NYMR 2VUGA 3RFTA 2JFOA 4B7UA 3QBTA 1HE2A 1NC1A 4RABA 2CW5A 1GFZA 4NV3A 5ALDA 1WP4A 4ABYA 2HIAA 4TGLA 5HZMA 2G36A 1THMA 2XB8A 4EP1A 1EFKA 4HVTA 1FXWF 3DKPA 4NZNA 1NTOA 1UBFA 4TOIA 4UAGA 3G8YA 1KI9A 2VUMA 1N2CE 1PQ4A 2NVUB 4KAFA 2CZQA 3RK1A 2FPUA 2NUPB 2W58A 4D9MA 5C8YA 5GJBA 4JBNA 3HSKA 1NW8A 1ISIA 1DNPA 3JZAA 3DBIA 5BSEA 2A14A 4QZVA 1DPFA 5G53C 2BUBA 2CFMA 3P0EA 4MW7A 4KPGA 4FWTA 3NUZA 3OPYA 2VQSA 3DEKA 2REQB 5KT4A 5HTKA 1W96A 3QY0A 3LSTA 4ZI7F 1KYWA 1DFHA 1W88B 3FVWA 1WLSA 3M6XA 4J4TA 4IAJA 2AC4A 3GRZA 1MDBA 5EIOA 3KBBA 1V1MA 5AD1A 2P78A 3FOCA 3LMKA 3WKBA 4F2PA 4L4YA 1QYWA 2XAUA 3VZRA 4Y2QA 1KAEA 1O94D 1BZYA 4WESA 4JZYA 3CUYA 3D0RA 3JSAA 1Y0BA 3UN1A 4RK0A 3CVVA 3NVKI 4RLFA 2VK2A 4J90A 1PFWA 3AJRA 4EDHA 2XTJA 1VXOA 1DQPA 4AQDA 5LQDA 5FQOA 4U6NA 1EESA 2B2CA 4P3NA 4HZGA 1VE7A 3AEZA 3NKLA 3LHIA 3FJOA 1E7MA 2BI7A 2A5FA 3IIJA 2GPBA 2UKDA 1RZ3A 5A6SB 5KOIA 2ECPA 5LNK6 1IZ7A 1I80A 1P9WA 3D6MA 3EIXA 4UXHA 3EH2A 4ZVSA 1DS6A 3EEBA 1QP0A 1UFRA 2IYQA 4O3NA 2JHCA 4JLPA 4D79A 1E61A 1JQEA 4O7LA 2X9NA 1JDPA 1AN7A 5KFRA 1PJRA 2QTHA 2X4DA 4NS1A 4ZALA 3WBKA 4F5WA 1L5VA 4I4TB 5SY6A 3V4SA 2GN2A 4DV5H 1R00A 1XZDA 4PX5A 2D5AA 3O7WA 2VSNA 4DNFA 3SSNA 1QTNA 3HKEA 4G36A 4OXRA 4RCZA 1JU3A 1ZO8A 2R79A 1XZJA 2UZ0A 4LDZA 4YJDA 3USCS 1RXWA 5LQMA 4F2HA 1GSOA 2BZSA 1MG5A 4YMHA 3LA6A 2O2CA 1I2BA 4PSDA 3TOCA 1SUIA 3IYLW 4H17A 3C3JA 3AV0B 1QX4A 5K6TA 2GCOA 1XCJA 3LGAA 4IHAA 5CPBA 3UXHA 3ZS9A 4V1CA 1X8LA 4YYZA 2OHXA 2WZBA 4TYPA 5FI0B 1U3FA 2RAVA 2XE4A 4OV6B 2LD4A 3IDZA 2EZ8A 3OBBA 1GPNA 2H18A 2QUZA 1XMPA 3N8GA 4L5BA 3PNLA 1W94A 3GZNB 3R9XA 1OBFO 2ZIEA 1GGJA 3DHNA 1ILEA 1NRXA 2VF8A 1COZA 4HNTA 1JXAA 1OVMA 5ETJA 5JSYA 3ZK9A 1E5DA 1MT3A 4PO9A 3VBEA 1YHZA 4FGWA 3WE7A 1JFVA 2PTGA 2Z9CA 2PGIA 3ADKA 1UK9A 3H2HA 5DMHA 5ED0A 5AVZA 5KTRA 1I7PA 4KYTA 4GP9A 3IKMB 4PIMA 4EZBA 4B3RB 2XB6A 3FOAA 4IQFA 1L7EA 4G67A 2GN4A 4L5AA 4AMUA 1FZQA 2VRCA 4LAFA 3WAJA 1PD0A 1X9HA 3NP7A 2H1FA 3PUIA 4D3ZA 3FWPA 3KT8A 3Q5EA 4F71A 5WRFA 1Q1ZA 4BV8A 1QHHB 1N5LA 2E0IA 1JJAA 1VG1A 2P67A 4BO8A 4EJ6A 3VO1A 5F51A 4C2BA 3J81A 2WFLB 2H7XA 1S3IA 4BGEA 3S8MA 4EAQA 1XEAA 2YMLA 1XO1A 5FKJA 5T4BA 4EVRA 3ITDA 1GPLA 1V8BA 1PVDA 2VAVA 2YDXA 1IHXA 3WYEA 4C6TA 4Z7JA 8ABPA 2P41A 1XWWA 2Q0QA 5KFMA 1DKRA 3PIIA 4RKYA 2JA1A 3T9EA 4ZGWA 4ALLA 5CDHA 4WWHA 1BJTA 1X7XA 1EJBA 3OJ0A 3UJPA 4CMBA 4EY8A 3TG8A 3R9WA 4BFSA 3FROA 1CS4C 3O26A 1SCJA 1PWZA 4YUYA 4W5TA 5I5XA 3WGJA 2JI8A 5M7EA 1NNEA 1E3WB 1S89A 2DCMA 5K8TA 1BKDR 3GJZA 1QRUA 3ML1A 4F8JA 3F8NA 5CM8B 1N33B 4B8WA 1UXGA 2Y92A 3TIGA 2GLXA 1QAOA 1JHZA 1SKYB 2QX4A 1RABA 4MS1A 3W9SA 1SHZA 3AXSA 1R6TA 5JS1A 3NOXA 5I8WA 1VG0B 3U4GA 2WB4A 2OK7A 4DYVA 3E0QA 3QELB 1L4UA 1V6SA 3IFSA 3OQ6A 3IP5A 1ZI9A 3BXOA 1OT5A 3IJPA 3KNZA 4KXUA 1Q2XA 2AXEA 3L0SA 4QNMA 1OI3A 1TFRA 2AW5A 2H1WA 4M8NE 3CX6A 1MC1A 1Z0IA 3CRZA 3JVEA 1M2HA 2IYPA 2ST1A 3ZG6A 2WDPA 1N2XA 2WB1A 3FDSA 1P61B 3K2QA 4D9CA 2NZJA 1XRQA 1Y98A 5LMNH 1KTVA 1LDMA 1YDWA 3ENNA 3F0TA 2P3OA 2R1UA 3NDBB 3MERA 2H5IA 1WWKA 1MAHA 1T36A 2WSYB 3QEBZ 4IDFA 3OZGA 1PYOA 3CE6A 1ENOA 1QV9A 3EOZA 4O4LA 4Q44A 5IJ9A 1PGPA 4I1SA 5IAKA 5AQEA 2WUDA 3SC3A 1A1VA 1EFCA 3K9LA 4C1BA 5KNCA 1OJ7A 5C34B 3S7TA 3UATA 4JYAH 2DQ4A 4ARIA 3AKZA 1MQAA 1YO6A 2II6A 1AKVA 3KZCA 4Y2GA 2XXAA 3Q7QA 1E6MA 3EGOA 1ORWA 3GVHA 4X20A 5T8KA 4GMKA 4MVJE 4GSYA 1JG6A 4P08A 4N41A 2NYRA 2CHVA 1OGJA 4OHPA 1TM3E 4LJ4A 5JOQA 4BY9E 3DOUA 4AYTA 3THYB 3EZ9A 4HB2A 4DV4B 4FIZA 3G5LA 4A26A 2EW8A 3FSGA 3T12A 4EAAA 5C53B 4XJSA 3ZCSA 4QBGB 2A2ZA 3GDFA 3MGAA 3JR7A 1U0GA 3VKUA 4ASUD 3VVLA 5F52A 3PC4A 5DG8A 2CNBA 1N4AA 3WDMA 4B7CA 1RQLA 4BKPA 3AQIA 1I6MA 4QLAA 3EUEA 2IYFA 5KYXB 1P7WA 3UGQA 1NVMB 4KQGA 4DA0A 2WG1A 3UJ8A 2E4XA 2K7ZA 4JLKA 3A11A 4ND8B 4YX9A 5BUCA 4RIFA 5DLGA 4MMYB 3F6SA 4ND2A 5AVSA 1M34E 3C3EA 1EKFA 2BGRA 5HILA 4QXOA 2CFIA 2RDJA 2KLHA 2VDMB 3FNIA 5GM1A 3UCXA 2W7PA 4J0GA 4LH6A 3X1KA 3EXHA 2K87A 3NU1A 3Q0IA 1EU1A 4OXKA 5GTDA 3K92A 3BWVA 1TWFA 5EZYB 3IBGA 4WCVA 4NEHB 1XD8A 3FZQA 1YRHA 3H6GA 4NAUA 4C88A 1DX9A 1Q1QA 2GHIA 3DULA 3LC0A 5E3JA 4I1OA 1S9HA 4DMKA 3K9HA 3BX1A 1W36B 1XCLA 4WOJA 3VR6A 2Y8EA 4AP5A 4ZU1X 2P27A 3N44B 1KMHB 4BNMA 3N7AA 1N8KA 1U2EA 4QU9A 3C6XA 3HMQA 1G66A 4ZQCB 3L41A 2GDJA 4QM7A 1G0NA 2R62A 2HMYB 3EX7C 4DR3B 4HQNA 1S02A 3ITNA 1WA5A 4LYAA 3ZWOA 5I7EA 2XLBA 4R9VA 1PWEA 2ZTMA 3N42B 5JAIA 1UQUA 4BX2A 2UXCH 4YO8A 2GK6A 1FSFA 1DIHA 1V3QE 1VPLA 3FDJA 3TNDA 3KE9A 3LQ4A 3SGIA 4ALMA 4FEYA 1K3TA 5CG1A 3RHSA 3T0GA 4R71A 4MK4A 1YZGA 2ZU0C 2A1UB 4X54A 1GVNB 1TM5E 1SCNE 2B2XA 4HB4A 4DIOA 4F4WA 2PUEA 1N2EA 4DDWA 3TINA 1GR1A 2C2EA 3ICWA 3PXDA 1UDAA 1FUYB 1P7YA 2ZJ1A 4M0UA 4ZWNA 1RHUA 2ZSJA 4UOEA 1D5WA 5EJ8A 4OATA 5CD1A 2H5EA 2OECA 4RNOA 3GMSA 5G4KA 1IY0A 5ICEA 1AMUA 3TGPA 4NLLA 2Z04A 3MJSA 2ATCA 2A1IA 1DX4A 2C0QA 3PJFA 3RWOA 2PAFA 2GJ4A 2K5UA 3WS7A 3VZDA 4MUKA 3HB4X 4OHOA 3DZDA 5K01A 3G6YA 4LSWA 3MA0A 2VNKA 1G6OA 1OAOC 1PZHA 3DEHA 3LH5A 4JI8H 1KQNA 5E3HA 4DJTA 3ZCRA 1G3RA 4BQQA 3A6GA 3D5EA 1O89A 4H59A 5HOQA 4M46A 2Y4OA 4Y9SA 2DFLA 4ZZ3A 1GPAA 3T1YB 4Z2AA 3ROFA 5CLLA 2J3EA 4NE7A 4I9HA 4XD2A 4CEHA 3EAQA 1LVGA 2XZLA 3I42A 5J23A 2X2FA 3HCFA 3EYAA 4HAOA 1RJEA 2DKNA 3AKDA 2OY0A 4FONA 4MUNA 3VZPA 1IBMH 1SA0A 3A6KA 1F6BA 4DQLA 1ADGA 5L3ZA 3F5FA 2GJ9A 1Z5NA 4S0XA 2I6TA 1RC0A 3NHBA 1ICEA 1WCXA 3LS2A 3SG0A 2FPKA 3OECA 2ODWA 1R4NA 4UOQA 4CCYB 4D8TA 1FFAA 1TOAA 4A5OA 3QTTA 5JJBA 2AG8A 3T3NA 2JFZA 4ZTZB 3HDTA 5DBEX 3U81A 2C2XA 4HUJA 5DYNA 1IUOA 5DYGA 1IXSB 3G0OA 1MGPA 1PF7E 2V0NA 3USES 5ICGA 2WWYA 1TPZA 2QRHA 4JKIA 3WDLA 3MLBA 3OEHA 4D6XA 1KAGA 3CINA 4J7UA 2NUTB 1E5QA 4O2AA 5EI5A 5KX5A 1M6VB 2B6NA 1JSXA 4JIGA 4H7DA 4IG4A 4N7JA 3UJ7A 3TQ1A 3R9RA 2FG7C 1N2OA 2Y05A 3GP3A 2AN4A 2N47A 2VS1A 2IVZA 2X15A 5KYUA 2O1EA 1V1MB 4CTKA 4FOLA 1A9QA 2A78A 4RJKA 4BEVA 4NMLA 5A71A 1IHYA 1OZHA 4KE6A 3JALB 3HXQA 1YS1X 2GZHA 2O4CA 1QGDA 2OL4A 5IP9G 5E9JA 4TLBA 1TDJA 5TR9A 3TZCA 1BFDA 3ZDZB 5HP4A 2APJA 3ZLVA 4HGNA 3L8HA 2X19A 5EMJA 2XOEA 1UXKA 3DAHA 5FWXA 2HA6A 1NJ5A 2ALJA 3FBGA 3KKZA 3AFIA 1RQ7A 2R8BA 4L74A 4UXJA 4W9NA 1KRHA 3V55A 3D31A 1MC8A 1SUDA 1GP2A 3UTDA 5DNAA 1NN3A 2F3RA 3VRHA 2LIVA 3KQOA 1WOMA 3HACA 5EL0A 3C70A 4Q9IA 3U7JA 4DA6A 1T5BA 3J80A 4LYJA 1I8TA 3HCPA 3EEYA 3KL4A 4PTZA 1UKVY 3SM9A 3VR6D 2B37A 1PUJA 2EEPA 3FBTA 3EIFA 1AV7A 4LHWA 5FPPA 5IDYA 3LVQE 5NLLA 3BHJA 3KKLA 2Q6VA 2WJGA 4U3JA 4J9KA 1I6LA 3K72B 3W2EA 5DO9A 4B8YA 1ZG3A 2HFKA 1WDMA 2OOSA 2X77A 3C1AA 3KXDA 5KKCA 1FJHA 3C3PA 5IXYA 5AUPB 1MAVA 1PK7A 4L8LA 1FVIA 3Q5DA 1E66A 1AGYA 1CUCA 2JGNA 4H6WA 3W5HA 4RKWA 4EZEA 5AIBA 2G40A 1MRSA 4IM7A 3R7LA 3T4XA 2P2NA 1DCFA 1VHDA 3HKEB 2I78A 3P19A 2V1UA 1PBNA 4RZ2A 4ECEA 1I94H 4KHPH 5ARBA 5AW8A 3RFFA 1KP3A 3RUDA 5ITSA 2CHGA 3DKRA 2DUWA 1VP9A 3P4UA 2Y1DA 2BKVA 2J9ZB 3AI1A 1NVTA 5LYYA 4HADA 1EB9A 1Y6ZA 3WL5A 2EX4A 2GM9A 2FOIA 1DKPA 1DT5A 1NW5A 2YX1A 1Y1VG 3BFJA 4GMGA 1EGQA 4YMSA 4AG5A 1Y89A 2FLWA 3L7AA 5IBCA 1VDZA 3JQCA 4KOEC 4CF6A 1X7ZB 2H07A 4RSHA 3H83A 2PXAA 1AHIA 5FBRB 4NQRA 1FK8A 4OO3A 3T5KA 5FYQA 1D1TA 4IG9A 1M6YA 5AK4A 3RJTA 4UASA 2IOYA 2XQJA 5K0JA 3LK6A 3L0BA 2QNRA 4HGOA 3QPAA 4B6OA 5F7XA 3DE2X 3AEQA 3F3SA 4DVGA 4ZT3A 3GVXA 2M6SA 1ZVMA 2IIVA 2HHHH 3TEJA 4H7IA 1TO2E 3D8RA 3LFUA 2Z56A 4DQNA 2X0EA 5DLQC 2BBSA 4D0RA 4RC9A 5DNVA 4GKJB 1XZEA 1B41A 3PEVA 4FGKA 3EPIA 4LNUA 5DXJA 1KMCA 4ECRA 3IALA 4FNMA 3MAJA 4U9UA 3OCVA 1OXTA 3ZZUA 4YCSA 4AS3A 1RRKA 4KDEA 1JPVA 4EBBA 2WVGA 1DTEA 3EVFA 5KX5B 5DM0A 3VC2A 4UUAA 3W1WA 4R9RA 4LMPA 2YIVX 2NTEA 4NCNA 3PLAE 1VMIA 2FN3A 4P80A 4PLTA 3AF4A 3OJFA 4LSXA 2IHKA 3CEAA 3QLJA 4WNAB 3VXKA 1PNTA 1T8RA 1NRIA 1S2MA 2P0EA 4ED1A 3G6WA 2Q5LA 1NTRA 3WKCA 5KNDH 2WZCA 4JVNA 2YRXA 5JCPA 3MUFA 2AVNA 2Y1EA 3GJSA 5GVRA 1GQ2A 3HTXA 2BKLA 4D3FA 2NXCA 2CBXA 3MFQA 3CQ9A 1L5LA 3DMTA 3D4IA 4MRPA 4LVUA 4EELA 2B4RO 5CVDA 4EKDA 2CJXA 5KU1A 2C99A 1P0PA 1NI5A 1G3MA 1QBGA 3THOA 1VMAA 2FH5B 2EARA 4GZ5A 3GFOA 5IYZF 1U1IA 2AXPA 1KIAA 3D0KA 3Q3JB 2ZJYA 2NUBA 4AURA 2H11A 3V8NA 1KSJA 1TYDE 1XL0A 3INNA 5IKPA 1LW6E 4ZANA 4O86A 2VYCA 3WYBA 1S97A 1N92A 1J1IA 5E6RB 3T9DA 2PMDA 2UUPA 4Q05A 1DARA 1USKA 1PWHA 4UEOA 4QXPA 1NFFA 4A0SA 5KMGA 4Q7JB 3AB3A 5CVCA 2V59A 2IZ5A 3E61A 1K5PA 4LHEA 2BEWB 4JLOA 4MR7B 2A5YB 4D57A 5JISA 1SBTA 5ALNA 1GN8A 4F2DA 5DT2A 3V3KA 1U28C 1UZLA 2NO5A 2EFEB 4ZO7A 2FR1A 2Q3BA 3WGLA 4CEJB 3QUAA 3E05A 2I4MA 1JMVA 2F8LA 4HJRA 2OILA 4TKUA 3N2GB 2PUJA 4PLZA 4ZPXA 3BWDD 4Y7CA 2PH7A 4L2IA 3MFIA 4Q7QA 3U60B 1C4WA 1E62A 5KT7A 2FE3A 3LKVA 5JLAA 2Q5QA 1AZSC 1D5CA 3INGA 4DA8A 5EWFA 3DGEC 3NVAA 1YKFA 1MRZA 4BRSA 4BNGA 1C8KA 2XMSA 3EOAI 1UC9A 3I2JA 3W8FA 3W6PA 1HNWH 3GGGA 4EMSA 4CHTA 4JASB 1CB0A 5JNLA 4X8LA 1L5QA 2ZRKA 1ONNA 4PCVA 5ERGB 2O14A 2UUCH 2FRDA 2ZSFA 3IV7A 3OU2A 5CYPA 1MW8X 4Q9NA 4HNVA 4C0QC 2JIZA 4MARA 3LWBA 3DO5A 3JQ8B 4QX6A 5IKXA 2FK1A 1T6ZA 4E2XA 5FADA 2HPVA 3T5TA 3F96A 3I04A 1N3YA 4WERA 1YIAA 1B42A 1SHTX 3Q72A 2JF0A 1PYGA 3ID6C 3LY9A 3OX4A 5J59A 4NRDA 1JEJA 4UHDA 4EY7A 2JI7A 4FMDF 3L4SO 1ODJA 4KRYA 2Z6VA 1TYZA 4L50A 5LB4A 4ZJZA 4QHYA 4WXYB 4A8HA 1S01A 1SO8A 2AJTA 1SKQA 1TQHA 3Q2OA 1YA4A 2EOAA 2RDMA 1QKKA 4MMXB 1NMQA 4QATA 1M2FA 4YI5A 3EEOA 1WS6A 3WIVA 3HP7A 4FYMA 4UJ5A 2ABJA 3DF7A 1M6NA 3A9RA 1V6AA 2DG2A 3I34X 3K8YA 5M3BA 3K9BA 1TF5A 2NXWA 3KXKA 2FLKA 3MSXA 3IO3A 4NC9A 3AUFA 4DQUA 2NV6A 4B48A 1YZUA 4IXMA 2R92A 3MK31 4HG2A 3RVOA 1OGYA 5CW2A 4B6QA 1VJDA 2HREA 1SUPA 5BSGA 4KREA 5KG2A 1XQ6A 3JATB 4OGWA 2IDKA 3R6WA 4RGQA 3CURA 3RAXA 1UBRS 2HSJA 1XMVA 2WWGA 4UCOA 3FLAA 4JELA 3U3RA 5FL7A 1SKMA 2QAGB 4YIHA 3LIPA 1DJNA 4REOA 1WR8A 2VF4X 2ZI9A 4DRZA 3I4FA 4JI5B 3AYZB 3K1AB 3V1UA 3H4DA 3VJKA 2OV3A 1U8ZA 3ASYA 4KIUA 4CUJA 5JVDA 4IDOA 5EP3A 2VCHA 3D6AA 1J0BA 4BX9A 4MVJG 4OGFA 2CK3D 5CW1A 5ALFA 4Y1RB 2BM8A 3JQ9A 4C7JA 4ZEXA 1XROA 5K0ZA 2FEKA 3KLOA 2CNUA 2E6KA 3V6LA 3UQZA 1U1FA 1RQNA 5A4DA 2FWPA 1A9TA 2QE7A 3OHPA 1GADO 4JQOA 2XYPA 4C6SA 1TWGA 3DCYA 1XZBA 5F7OA 1JHRA 1IQ0A 2B20A 3F9RA 4IHQA 4BV3A 2YYYA 2VP0A 1SZPA 4K6HA 3ZKWA 5FH9A 4MS3B 2UZ4A 4ZYXA 1BX3A 1DELA 3GTKA 1GTJ1 2NT4A 2R1VB 2V4MA 3LRPA 4PY2A 3O82A 4UXIA 3MD9A 1CNFA 2P65A 5IT5A 4HB3A 5CTAA 2WIGA 1A71A 2A57A 4W5HA 5EINA 1HL3A 2OK8A 4URFA 3I62A 1GAWA 4BZWA 1NL3A 1I3NA 1Z0DA 2FPIA 2NXJA 2RJOA 3GLHB 3ILVA 1T4CB 2BJWA 1G2PA 1W6UA 1Y8RA 2GJSA 2IYXA 4MSUA 3PDJA 4BLRA 1G98A 2O7VA 5HMMA 3QSGA 1VAJA 4NBLA 4YQEA 3FUUA 3QELA 1W34A 3I37X 2P7IA 5F9MA 5IUKC 5BWLA 2VHVA 1V9LA 1VBKA 2P62A 2Y67A 5KWVA 5GP1A 3SBOA 4DJ5X 5HKKD 2D13A 2OHJA 3GWGA 4MYHA 3H0GG 3DMHA 2KE5A 2AN1A 4RJ2A 1M54A 2ATVA 3GCDA 3HDQA 3R3WA 1R8JA 2VSXA 1F60A 4ISBA 4NJEB 5EUCA 5C32A 4CM3A 1CUWA 3N05A 4GOND 2QMOA 4XKJA 1QWOA 1BMDA 4I3HA 3UHFA 2QTVB 1CLEA 3M3PA 5IAOA 2IODA 1R7RA 3WMGA 4DCOA 2FWJA 4KGVA 2AI2A 2EZUA 5THXA 3CG4A 3HO6A 2ZQZA 1DEAA 5BY2A 1HX7A 2ILTA 2QB5A 1GUZA 3T7DA 1MZVA 3FFAA 4FS2A 2C1ZA 1JGTA 3GPLA 2VPZA 3D3EA 2V6MA 3RG8A 1S68A 1T2CA 3H9GA 4GVXA 2JRLA 3ZWVA 2Y4NA 4D4IA 4M9RA 4OJTA 2W2NA 4JN6B 3P9QA 5K8UA 2XMQA 1G6HA 1Z4PX 5C81A 2BYTA 1BDHA 4H3VA 4QLBA 4HMQA 4BPRA 4UTZA 3G9XA 2O7QA 2YNMC 2WTUA 1C0LA 4JXZA 3U0BA 2F90A 3PPVA 1L4LA 4DZTA 2W90A 4ZMSA 3RB8A 5JZBA 3OQMA 5HK9A 3VI4B 4I55F 1I32A 2XH8A 3MWKA 2EJ3A 2Y0DA 1QGOA 2O5EA 1E63A 3B60A 1M67A 3IC5A 1QUEA 3R0QA 4FSXA 2YH2A 4M3NA 4O4LF 4NMMA 3TE6A 3ENWA 5FBVB 5TMBA 2INGX 3GLIB 2MCTA 4LCBA 3F98A 1UM9A 2HBZA 2XMRA 5KG5A 2WMYA 4CI9A 4DRXA 1S3GA 1RIFA 4G1BA 1PZNA 1ZCZA 2BTQB 1UPCA 3IBTA 3KWLA 5ABPA 6PFKA 1IUKA 2WT9A 2FN8A 4OHBA 2ZRDA 1FYFA 4IXDA 4ZV7A 4F04A 5BMVB 2RAFA 1DJPA 2YZ2A 1NSFA 3PQ6A 1YZTA 5CDGA 4O3FA 2JGRA 3P9IA 2QGNA 3SZUA 4L4SA 4LWPA 5DHFA 4QJIA 4UEKA 4DA9A 3EK2A 2QL7A 2QBYB 4MQEA 4RAQA 1G5PA 1GNLA 3K09A 4LJLA 3SZ3A 3NNDA 4AY3A 4DIFA 4W1SA 3RUAA 3QFCA 1CZOA 2F64A 4OX9H 4FW8A 2QLBA 2ASEA 4JWTA 1U6JA 1LB1B 1M2OA 4HH3C 2YWVA 1KHHA 1MO5A 4FLEA 4DXHA 2GCOB 4JCCA 2GVNA 3N76A 2OFXA 3JQDA 4ZOCA 1P9LA 4RS3A 2BGWA 3Q3EA 1MFPA 4DBZA 1U3UA 4PCLA 3CVWA 1VIYA 3KTDA 5IAJA 2NVYA 4ND3A 4A3SA 2Z02A 1DIGA 3KJQA 4JJ8A 4US1R 4JC5A 1ENPA 1XLWA 4Y9TA 2JLVA 1AKUA 3B1XA 3L7JA 2WQ7A 3LPMA 1E9SA 4N4AA 5JZOA 4PLGA 3PXBA 2Y66A 3PD7A 3CH6A 2MYTA 1KYXA 1U8UA 3FPLA 3WAGA 4S24A 2UZAA 3MQ2A 4RAOA 3TNFA 3RYCA 3G8DA 1N2CB 2QN8A 4OHUA 4V0KA 5B1DA 3TI7A 3WLQA 4DV5B 1WDKA 4XOIA 4JH0A 2HWYA 2WF9A 2ZJ6A 1SZJG 2VFAA 6YASA 4NS4A 4IIFA 5I9LA 5HNKA 4D4JA 3ET5A 2PFKA 4KVFA 2QE7D 1RWBA 3BGVA 5D1HA 2CV1A 4B3TB 3IB6A 3LBFA 1NJSA 2HG8A 1HY3A 4O81A 4HNUA 3K30A 4D43A 1QG2A 2O6HA 2I6SA 4F7WA 5IDWA 4KH0A 1VP3A 5G4LA 1CC1S 1L5WA 4PG4A 5J58A 2RHMA 1L5NA 5CFZA 3MBOA 2XIGA 5K6AA 2RDIA 3BGOS 4TMKA 3UWMA 1EE9A 5AVUA 3LVBA 2YWFA 3TR5A 3NDJA 5CBPB 2XWBF 1F2TA 1HDYA 3A9VA 3IR7A 4DTCA 1J25A 4EPVA 721PA 3PO3G 5FD5A 3CGWA 5DISB 2OOKA 3K6SB 1W8DA 1YRBA 4KYVA 2C9YA 4FJ1A 3V1TC 1H0HA 1CSEE 1GFIA 2HRBA 4HBZA 4UDYX 3JQGA 5DZSA 4B0OA 1GZUA 5A5VA 1XPRA 1ZSYA 4DAOA 3WP0A 1N2HA 2JH3A 2Y9PB 2E89A 2HQ1A 3ZXSA 2FZ5A 4MP3A 2D4AA 1LJ8A 1NBIA 4WMLA 4TM5A 3ISVA 3Q2IA 3U49A 3PXAA 5KI6A 4RD0A 4YREA 4ACBA 1KL7A 1ZK3A 3WL3A 1SR8A 1SA0B 2JS7A 2P6UA 3UAYA 1EVYA 1CUSA 1B00A 1B43A 1FS4A 1GPYA 1P19A 5I7AA 1E77A 1V25A 1ZL2A 1T35A 1OBOA 1QE5A 1SVIA 3NWJA 2CDRA 3W1GA 1LTQA 2A9QA 5DHRA 3H7IA 2Q5HA 3CVXA 1VIDA 2AFVA 4GBMA 4WXHA 2GS9A 3BAFA 1PQUA 3H05A 1YAJA 2G9QA 3R44A 4NWIA 5KG4A 4RMIA 5CVEA 5KYKA 2C5HA 3CF2A 3IP9A 1AQLA 1MX9A 3AR3A 2ZPTX 3FJ1A 4MWOA 1EQUA 4B44A 4C14A 3HP4A 4I9UA 1Q57A 4F4DA 2E2HA 4GI5A 2CXUA 3OIWA 5KDLA 4DG9A 1XX6A 1AQNA 2VPSA 3N2GA 3GTMA 5FOVA 4Z0TA 4W9RA 2EF0A 3HOZG 3GXBA 4WBXC 5F2KA 2COGA 4DRFA 2ALZA 2BEKA 2WHXA 2GNPA 3VA7A 2W83A 2ZBUA 4ILEA 1FC0A 4PU0A 1U2TA 1AO0A 4R05A 2BQUA 2IJGX 2W6ZA 2NVXA 1X7DA 4HX5A 1YRYE 2HPAA 3UCFA 5CDSA 4KKXB 5JDIA 2FFRA 4INPA 1VPWA 2PHZA 3WP1B 1S5PA 1T9BA 1T5IA 4RIIA 1JJ7A 5DHUA 4FSDA 1TQ6A 2IP2A 2XUFA 5J2TB 1IUPA 2FE1A 3I6QA 4AKEA 4NFLA 1O96A 4PFJA 4FLFA 3RC7A 4N9WA 3NHWA 4YRRA 2PMFA 4CL8A 3QPDA 1FPQA 3KVOA 3I5AA 1MEJA 4CM8A 3GLFE 3OIGA 1XLUA 4GRAA 1NQWA 4M0EA 4MPDA 2HV8A 2V7WA 4OJKA 3GFQA 3WRWA 2IELA 1Y6GA 3M1LA 2B1QA 2Q07A 3HUFA 4C30A 4LYYA 4F38A 1P8JA 4LY3A 4ZYUA 2DEUA 1ZNYA 2IUTA 5BT9A 2G71A 1HGXA 3U3MA 4JXXA 2AG6A 1Z9BA 2IEAA 4TMVA 5AVOA 2R7ZA 3GRRA 4WESB 4BECA 2QTNA 5LQNA 1CZKA 3E9QA 2FZWA 1Y7IA 3JZMA 4K9QA 5H59A 3N74A 3NLLA 4HZUA 5DM60 3B38A 1LNSA 3CX3A 2BR0A 2WDZA 3G49A 4XRRA 1FFYA 1JLMA 2IFTA 3IMGA 1YC2A 8GPBA 2OLEA 3DH0A 4G9EA 3TKYA 2IXDA 4C3UA 4ZEOA 2A35A 5D1OA 1V35A 4B6SA 3JARB 3NIFB 2R7ZG 2CZCA 4Y6OA 4HAWA 5BN1A 3VO8A 5A3RA 1ZAYA 1KYVA 5DGHA 4RKQA 1B7GO 3A28A 3NR2A 1W35A 4I46A 4PRLA 3UPDA 2Z83A 3AU9A 5C51B 1L1RA 1ZQ9A 2VYNA 4EGFA 4LFBH 4ODIA 4JOCA 3IP8A 2FPWA 1TAQA 1Z2OX 1JEDA 3PVZA 1E20A 1UP7A 4BX3A 1L5RA 4APMA 5DEIA 3DHEA 1R5NA 3RFXA 1S03G 1XTJA 3ZE2B 4X1IB 3JQFC 3KHHA 3M4XA 1FTSA 2HU7A 5KG0A 5LP6A 2Z6UA 3FR8A 4RBNA 3PGLA 1O0SA 1FU8A 4URYR 2Q49A 2WINI 3GGJA 3HFJA 3R3UA 3PQ2A 4V0ME 2HZ7A 3ZHOA 4Q34A 1KIFA 4TLMB 3PDCA 2ZP1A 1VHJA 1CUBA 3IP6A 4INOA 4OJNA 1KQGA 3T3OA 2J9FA 2O7NA 4OKIA 4QFDA 1YI1A 2FKNA 5AJVB 4ETMA 3FHTA 1PCXA 1W5TA 2HSZA 1Z28A 3SICE 3DO6A 2EL9A 2Q8PA 4QE3A 1W7AA 2Z2YA 2WFAA 2XGSA 1DV1A 1EKXA 5KFAA 3O0DA 1W4CA 3EVNA 1K5HA 3LVFO 3TRJA 2DT8A 3H2ZA 2GEKA 4BO2A 4ECSA 2PPLA 3EQ7A 4KG7A 1NVVR 2A3NA 4R1NA 3GZNA 4AX8A 1QKJA 1KZHA 3IMKA 5JEDA 3ZDCA 1T2NA 1WMSA 1SY7A 2IEIA 3AFGA 4WLUA 4DR3H 3Q7IA 4P81A 4X8MA 5AIAA 3VOAA 4MZDA 4KTVE 3V80A 1A8PA 3CM0A 3ZE9A 2WBLC 1HSOA 4DLAA 3WLTA 3OIUA 4NNPA 1D8AA 4RH1A 2Y6VA 4KMMA 3TE7A 3H11A 3TSAA 4ZEMA 2GKSA 4TMWA 2IIQA 1VLVA 4OQEA 4PSKA 1II8B 2BEUA 4G56A 1MTOA 2F1RA 3EULA 4XDYA 3GLFA 1GDHA 1K7CA 1BVYF 1T4BA 3F97A 4IJVA 2ZR7A 4I2NA 5JFGA 1DKLA 1GHTA 2AJLI 2Z1DA 1GWNA 1GEGA 2D5CA 1IWPB 5K0CA 4FE2A 3PVSA 1YZHA 3E3MA 4Y2YA 3OUTA 4RYDA 2C2HA 1OLUB 3IODA 3PE6A 3QXHA 4LJ7A 3SIPA 5AK6A 2IYWA 2ZDQA 2XD4A 1AN9A 1CS0B 1XTIA 1XCGB 3DBOB 3PNVA 5ALUA 3ZOZA 4EHIA 3BRWD 2LBPA 3AINA 5LA6A 2W0SA 2PX5A 3OMWA 3W9YA 4XWAA 3KYIB 1EZZA 2GF0A 2MYPA 3QHAA 4HDRB 2PZFA 5BSRA 3T5BA 3W4KA 3WK4A 4HEQA 1KDOA 4HLUC 4ZKDA 1QCZA 3ECCA 5DYWA 3KQUA 3EBLA 2AL7A 2OBXA 3V8QA 3VPSA 4LW8A 3OIDA 4AP9A 1MJGM 4G4SO 3QH4A 5CURA 4LF7H 4I5FA 4LXYA 4Q82A 1R6UA 1RYYA 5EXPA 1XK5A 5CFRA 1NY5A 1TAHA 3UPTA 1PZEA 1ZAUA 2QX7A 2I62A 1SU4A 2FW8A 1U9IA 3W2FA 2IPLA 4QFMA 2R86A 3HYTA 4H35A 4M54A 1PSWA 3CVJA 4Z9BA 1GGKA 1IXRC 2GAJA 5A3QA 2B83A 1W2WB 3I2HA 1IB0A 1W88A 2JH8A 5AH0A 4JI2H 2OXFA 2RIRA 2VT6A 3C6YA 3CUSA 4HAZA 4OYRA 2VTKA 4JVLA 2A8YA 4TUYB 5BR1A 5BUSA 3HA3A 3T5LA 4N65A