2ZDHA

Crystal structure of d-alanine:d-alanine ligase with adp and d-alanine from thermus thermophius hb8
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ADP and D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
total genus 96
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdhA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdhA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdhA01
4O83A 3G8CA 2VPQA 1PX2A 1B6RA 1VBGA 2P0AA 4MAMA 1EYZA 5BMVF 2NU9B 5C1OA 4EGQA 1OBGA 2R7MA 3RFCA 4HR7A 5FNVF 4EGJA 4ZHQF 3HO8A 2YYAA 3TQTA 5LA6F 2NU7B 3KALA 4J6EA 4I55F 2W71A 1UC9A 3MWEA 5JQGF 1PK8A 1GGOA 1KC7A 2NU6B 3V4SA 2YZMA 3G8DA 4FFMA 4O2BF 3WNZA 1WR2A 2VR1A 4EABA 4ZI7F 1VBHA 1Z2NX 3E5NA 4RZQA 5C8YF 2W6OA 4L1KA 4O7YA 1KBLA 4FE2A 2CNUA 4I4TF 3GIDA 4EA7A 4MV4A 3N8DA 5HV6A 4FGRA 1GLVA 4C5BA 1KJQA 4WD3A 1B6SA 2DIKA 3R5FA 4M9CA 4O7SA 4O86A 1JDEA 2ZDGA 4XX0B 1BXRA 1T36A 4MV7A 2I80A 1C3OA 3KREA 4O82A 1KJ9A 4EAAA 5CB4F 1AUXA 5CA1F 2W6NA 3HB9A 2NPOA 4YBZB 2YZLA 3OUUA 3TIIA 3BG5A 4Y8VB 3N6RA 4TV8F 5KKNB 4YAJB 5C1PA 5LYJF 2XCLA 3ORQA 3JZFA 2R87A 2GQRA 4XYMB 2CNQA 1JDBB 3SE7A 1IOWA 2YZNA 3K5IA 4O7WA 2YRWA 3KAKA 4ME6A 1M0TA 2GLTA 2R84A 3I12A 3R5HA 3MJFA 2VQDA 5IYZF 3RUPA 1CS0A 3HBLA 1EUCB 5LOVF 4TV9F 2I87A 3TINA 2R82A 4M9UA 3MWDA 5CAEB 2Z02A 2WYOA 1DIKA 2ZDHA 4IWYA 1W93A 5CA0F 4HNUA 4NYEA 2CQYA 2X0SA 3AW8A 5JH7F 1Z2PX 2NUAB 2I8CA 2QF7A 4FU0A 4FFOA 4EA9A 2HJWA 1DV2A 2GPSA 3LP8A 4HQ6A 3BSYA 1BNCA 2YS7A 1KJIA 3KAJA 2CZGA 4O7NA 4HNVA 4MV1A 1OBDA 1CE8A 2R7LA 4ZQIA 1A48A 3WO1A 3UFXB 2HGSA 4YJ2F 1DV1A 2YZGA 2YW2A 5DMXA 4FFPA 4O4IF 2R7KA 3RV3A 4TUYF 1ULZA 3GLKA 5KX5F 2GPWA 2J9GA 4O7LA 3K5HA 5HBRB 1GSOA 1KEEA 4QSHA 5H80A 2CNVA 2W6ZA 4IWXA 3ETJA 3TIGA 4O4HF 3VPDA 4C5AA 2YRXA 3Q1KA 4MV6A 2SCUB 2V58A 4MV3A 1C30A 2ZDQA 1JLLB 1A9XA 4DLKA 5D8DA 2R6FA 3R5XA 4O2AF 4C5CA 4IIJF 1GSAA 2YWVA 4EG0A 3BFPA 4O4JF 3TW6A 1CQJB 2FP4B 3K3PA 1UC8A 4IZOA 4O4LF 3VMMA 2YL2A 5JVDF 4MA0A 2W70A 2OLSA 4O81A 5EZYF 1M0WA 4FFRA 5I47A 3ETHA 3R9RA 2GQSA 3Q2OA 3JRWA 5LP6F 5BPFA 3WO0A 3R23A 4XZ3B 1CQIB 5K2MA 5LXTF 1EZ1A 3AX6A 1KJ8A 2YS6A 4FFLA 4WBNF 1JKJB 3OUZA 5J2TF 4M98A 4GGMX 3LWBA 2V5AA 5JVLA 4HNTA 2W6QA 1EUDB 2C00A 4DIMA 1E4EA 4ZOLF 3NUAA 2FPGB 1I7LA 5J2UF 4O7ZA 4XYLB 2DWCA 2W6MA 4YJ3F 2R7NA 3JRXA 1KUTA 1Z2OX 4M99A 2QK4A 2W6PA 1SCUB 3U9TA 3V4ZA 2PN1A 3BSWA 2PVPA 4E4TA 1EHIA 3U9SA 3VA7A 4O7RA 4FFNA 1I7NA 3DF7A 4I50F 2Z04A 2DZDA 3ORRA 2XD4A 4O7VA 1AUVA 4EA8A 3U55A 4O7TA 5GONF 4IHJF 3U54A 1VKZA 2IP4A 4YB8B 2NU8B 1GSHA 4MV8A 3RV4A 3VPBA 1M6VA 2FPPB 2V59A 2FPIB 1IOVA 3JZIA 3VOTA 3VPCA 2PBZA 5BPHA 1E4EB 3BSSA 4MV9A 4O84A 2R86A 4YAKB 5JQWA 4MA5A 3QFFA 2VHEA 2FB9A 2R85A 1KJJA 2DLNA 1W96A
chains in the Genus database with same CATH superfamily
4BNZA 4IIFA 1W5FA 4NR0A 1DCMA 4DPKA 4P4SA 4Q4HB 4LSXA 3AVQA 3KJEA 3VBEA 3V2IA 2EBHX 3RBAA 4PO1A 3ESYA 3AH8A 2Y76A 2LVBA 1NRWA 1V4BA 3MYYA 4AKIA 3RHSA 1NKSA 4HGNA 4S0ZA 1T3ZA 2BEUA 3CPEA 1Z22A 1Z5NA 3QPVA 5KOHA 1HYHA 3B7PA 3DDWA 1GL7A 4QUGA 1FFEA 4RDCA 1RKXA 1BROA 2IHUA 1B3BA 5J2UB 1DPGA 4WZBB 1ZJZA 3ZN2A 1EH5A 1QCCA 5C8YB 1MC1A 1QWOA 1BE6A 1D1PA 3MR6A 4HUTA 1RXWA 1Z5UA 2XOKA 2AQKA 4A0FA 4LBZA 1DT3A 3DYBA 3G0HA 4X1OA 2F67A 3DLIA 2OUIA 5JR3A 2AXEA 1FNDA 1C7FA 1NJGA 4PGHA 3D7NA 1W47A 4BTEA 2MMCA 3KE8A 4UDNA 4OJYA 5KNDA 5H3LA 4YCMA 1DDIA 3WC4A 1G7TA 1CDZA 2R4UA 2OXCA 4J1TC 3H2SA 3D4LA 4PLFA 4P80A 4WK0B 5EP3A 5BR7A 4F4DA 3IB6A 4B3XA 1NVGA 1P1IA 3MJFA 2Z30A 2X86A 4IFIA 3VR6H 4L0MA 2P3QA 2O4CA 3GTPA 3OTIA 1NUHA 5LIRA 2FG7C 2Y3IA 4RNDB 2ZR8A 3M6LA 5J47A 4P54A 2W8LA 3IEIA 3KQYA 3RK4A 2OO3A 2P2NA 1ZAKA 2B3TA 1M10A 3K96A 1TB4A 1SXQA 2Q6LA 1DDOA 3E4DA 3JWPA 4HFJA 4EBEA 4GDMA 1HI9A 3T9FA 3Q41A 1HE8B 1KBOA 4EEQA 1V8DA 4TGLA 3WLQA 2R8JA 2FP3A 4CDGA 1WPRA 2EERA 1VG9B 3WO1A 3IB3A 1E61A 1U0RA 3PI6A 3STYA 3TIFA 1VE6A 3WL6A 3F96A 4FJ0A 4B6FA 4GT1A 3HJAA 3T1HB 4OX9Y 1EK0A 2A0FA 5EJ8A 5EWEA 4DV4B 3L8ZA 3VUEA 4C6RA 1KSJA 1N7GA 5AVWA 1XD2B 5DF1A 5KOJB 3ZZTA 1L4BA 3LFUA 3RYIA 2G25A 5KU1A 1ZMOA 3PDJA 1EK5A 1UP4A 4V0SA 1XCBA 4PGMA 4KC0A 1DTEA 8OHMA 3M33A 2D5LA 1ZOOA 4L50A 3F78A 2ADMA 3PWZA 2P9CA 4C7JA 2XGGA 1X9NA 2BGTA 5FYQA 4W5JA 4ZOLA 1IN1A 1RBZA 4KCGA 5EZYF 4GLLA 4AIRA 1F6BA 2AFVA 1XHFA 3PE4A 5B7PA 1ABBA 3EH2A 1XOIA 4F1WA 1TYEB 1WU7A 3A9WA 2PLRA 1EZ1A 1ZBDA 3OU7A 1QTQA 1S0MA 2WV9A 4YRPA 3LWBA 4TVIA 5IC5A 1A7UA 1OROA 3FA2A 2VJMB 2ZXUA 4FFBB 1JMVA 2X6TA 4RSMA 5DGAA 1ESNA 4WLFA 1CR2A 4YJ3F 3BXHA 3FG9A 3LGAA 2UUAB 4JU9A 3BL8A 4AX4A 5AVTA 2CFIA 2KBEA 3D6AA 3KKLA 3GJ8A 4ILKA 3I2YX 3EXAA 3LXMA 2FX3A 1KSHA 2C2DA 4WI1A 1XAHA 2K4MA 2ZZMA 5EXTA 4U1RA 3NS7A 4DC1A 1T13A 2OCPA 3EVTA 2H7YA 3X2FA 2CHFA 5DASA 4LJ9A 4FNAA 4GEGA 3RQIA 1RJFA 5IAKA 1CDDA 2BHNA 1TW2A 4OF4A 3WNCA 5A2QW 4LY6A 4IEIA 3BIFA 1P1HA 3DMFA 3DQPA 4PIMA 2H3HA 1QG0A 3ZY3A 2PE5A 4FBLA 3MCVA 4BEVA 2Q3JA 2IP1A 3F97A 1FYXA 4DNQA 4LMBA 4JI0H 1LDYA 2JA6G 2FPSA 5A5DA 1P9RA 5CCXA 3HEMA 4YV1A 2I4TA 4XEUA 4O1IA 4FLFA 4S1TA 5AVXA 4NJMB 1HT2E 2XYGA 4OKNA 4RMIA 4IP0A 3F47A 4DJDC 2OXFA 1QYXA 3KWMA 5ALJA 1NC1A 3KLPX 5CLLA 1W9HA 1N33B 4R9UC 4CQLB 3JQAA 2LCFA 2QP4A 4QGHA 4ZI3A 1EFPA 1YVRA 2X77A 1XT6A 1KTAA 3V8EA 4HTAA 1YDMA 2HDOA 2JGMA 2OESA 2G88A 2C7RA 2H4JA 4GPIB 2VDLB 3ZVMA 4JWKA 2D74A 2YVKA 1L7RA 1BN6A 3EODA 4C30A 1UFOA 2IPXA 4GGOA 1AA9A 2W6IA 3H4MA 5SZIA 4Q7KA 2OQVA 4DA0A 4QIWA 3OQMA 2H6EA 2BFDA 4MYDA 1NY6A 3T7KA 1RQXA 5DLFA 5CYOA 1V1RA 4QUHA 2EQAA 4UXIA 1JHXA 3MSXA 1P0MA 1G60A 4JLJA 4U2DA 3CZPA 5EKDA 3ESCA 3HBJA 1Y34E 1J2TA 2BVNA 1E1DA 2FZLA 4N3AA 5DE3A 3PQ6A 4JQZA 3OTHA 5J4YA 4IWYA 5DYNA 1OC2A 1RQGA 3GGGA 5F7ZA 4BQPA 2UDPA 1C81A 1AKWA 2FE1A 3CGGA 2HHLA 4HZUA 1Q3KA 3WMRA 4UPEA 1N0HA 1Q1EA 3P4YA 2CSXA 1AB5A 1NMXA 3QE3A 3T99A 1YK0A 1ICIA 2Z9DA 2YQZA 3WZ2A 1I6MA 2YTZA 4IIYA 4NCIA 3F7NA 5G0VA 1YVPA 4ZREA 3UAOA 3VGPA 2VXBA 4RTMA 3KQSA 4S1VA 4DR5B 3JAWA 2PR2A 1A9TA 1XB2A 1ADBA 1WCXA 4IG4A 3EEOA 2UVPA 1K9VF 1UKVY 1K2WA 1XLTA 4YPFA 4PAOA 3A25A 1UEXC 2XUHA 3CF6R 1P80A 3B9BA 1HUQA 3D3EA 3FJ1A 4RFVA 1ZZGA 1NJ6A 3STWA 3M0EA 3UZBA 3CT4A 3D64A 3G02A 3DTYA 4C4RA 1IPEA 1BXRB 2PPLA 3WB1A 3INNA 4KNWA 3PQ8A 2WB2A 2VOEA 3E15A 1C9MA 2WUFA 1P9LA 1IHYA 2HREA 4QJ4A 4AUMA 3SR0A 2N75A 5FLKA 3JPYA 4X71A 1T8WA 1A5TA 3T4XA 3LCRA 4QGBA 2O8EB 3QVGA 4GWLA 4BAGA 6PFKA 1TT5B 1O95C 2ZUDA 1NF2A 1PVVA 2GNPA 2IP2A 2WF7A 4R2KA 4ZU6X 1UDXA 1CXZA 4FSXA 3II6X 5BVGA 2GX6A 3V7NA 3V4FA 5BWMA 4LF8H 2BPOA 3S8MA 5J1TB 1D09A 4TL6A 2Z6AA 1ISMA 3FF1A 4G24A 2I62A 3IQXA 3TD9A 1PV4A 1X0XA 1PSWA 1YV9A 4IFEA 4V1CI 1XZDA 3R0VA 4JR1A 4D4LA 4ZVNA 4RYLA 5A5FA 4ZVKA 5FORA 3CRRA 3R0ZA 2Q1SA 2OK8A 3ETNA 3KHTA 5FRDA 2QRQA 1FMLA 2B3DA 1GDHA 4PC2A 5KT3A 5FOUA 4DVJA 2HHAA 4RD3A 1G20E 2QAGC 4IGEA 3AF3A 3R9WA 4B2PA 1AO0A 1HTWA 4BWSC 3WQQA 5ELMA 4N8DA 3IQZA 4H1TA 5KTNA 5DBGA 4RQUA 3JWJA 3VR4H 1H6AA 1NVEA 4FYXA 4S1OA 1J90A 1SQ5A 1A7AA 5K0TA 5E7MA 1UBRS 3TEKA 1AKEA 1RYDA 2H1HA 4F46A 5M3BA 3CH6A 4W9MC 4UUPA 1WR2A 3DFUA 1WCMG 4GVPA 4A27A 5DNYB 4LHYA 2WTNA 1IN8A 3OOEA 1NUSA 2ON6A 4A5SA 4QYIA 3T5CA 2PGLA 1KZ4A 4R2LA 2GARA 1GN9A 2C4WA 1CY2A 4ZC8A 5KVSA 1E77A 3OEWA 2WJWA 2DIKA 4MGEA 4MRPA 5D1OA 5K45A 3R7LA 4CMGA 2ZVDA 1DAKA 3DOCA 3GFRA 1SB8A 4QPNA 3UGQA 3WYEA 4L9WA 5CA1F 4NI5A 4E1AA 3S5JA 1TAUA 1GAWA 2XAAA 1JGTA 4TYQA 4DLYA 3CX4A 1ULBA 3ORFA 1IK4A 2HK8A 3IAS1 4A8JA 1IOWA 4DDMA 4YRJA 1TQ6A 4KMRA 1OF1A 2W9BA 1Z0IA 2HGWA 3KHKA 5U4XA 2UAGA 3EXEB 3PHJA 1RJEA 3H5AA 4ZRMA 2IYFA 3WZMA 4I0WB 4JLBA 4AJ9A 2ZGVA 3WGMA 3K9HA 2CFCA 4DLBA 1RXUA 2K7ZA 1H1TA 4KE8A 1SVIA 4E1VA 3AI7A 2X8JB 4NFYA 2FMKA 1E79D 2HFKA 5IYCG 1K89A 1DXYA 1R6AA 3K35A 4G1MB 3WB9A 1U11A 3A6FA 3C14C 3QTBA 4PCLA 1J4AA 3NVKI 4P32A 4RY8A 4BP9A 4FS3A 3FVVA 3GLRA 4OAPA 3O4FA 1SQ6A 2JHAA 2NP6A 4JJZA 4DRYA 5IC4A 3B5EA 2H29A 3PDUA 3P0RA 5EXPA 4P92A 3X1DA 3UG7A 5TR9A 1E1MA 2V9ZA 4CTMA 2G83A 2QYOA 2ZU6A 2EWWA 3P1JA 4AO6A 2W6ZA 3IE2A 3B89A 3Q6IA 2SCUB 1B6TA 1GKLA 2WWTA 3JXEA 2ZDQA 5LXTA 3W5CA 2NYUA 5KNBH 1TVKB 2GPBA 1B76A 1G3MA 2EKQA 4HVTA 1CEYA 4O81A 2E5FA 5I7EA 3LTNC 4DV2B 4AJEA 5FOTA 5EWJA 1AXRA 5AUNB 4S1NA 1D0IA 4WZAA 3WO0A 1CY6A 3AR2A 1NQOA 2YHIA 3ZR4B 1X7WB 3N2LA 1Z5VA 4XJXA 3PVXA 4ND6A 3HYRA 3DMNA 4X6UA 2CF6A 2V5AA 1NXXA 1DZ3A 1YJQA 1MR3F 3T95A 3RU7A 1RJDA 4ZC1A 1EDBA 3KYDB 2QE7D 3G2JA 4IDOA 4TMYA 4HNGA 1KK0A 3NB0A 4XB6B 2F3TA 4KXMA 4UTNA 2V5UA 2I1WA 5HNEA 1W34A 3EUWA 1WPGA 4FI3C 4EO7A 2QEQA 3GFQA 2V59A 4UUBA 4HSGA 1C3XA 4YT4A 4HGRA 2WFLA 4H9GA 3UXYA 4Y9DA 3FM9A 4AROA 4L22A 2DLDA 3WDMA 4JSRA 1OZHA 5A6VA 3WWPA 4MPPA 1YQQA 4QIHA 5EESA 2V96A 3F2IA 1PGOA 3SZ3A 4D26A 2DKNA 1Z2EA 3H75A 4TTJA 4A6EA 1RHJA 3I2HA 2WKRA 3BXXA 3RS7A 2A9KA 4XOIA 4CKBB 1QK5A 5A3SA 1T9CA 1E2KA 2QTCA 4GMXA 1P0QA 4B71A 1UC9A 1DQNA 2KLHA 4PRYA 3W5HA 2GA8A 2VQEB 2E89A 1IDOA 1MC8A 1BJTA 3WNZA 5F98A 3VZRA 2GILA 2GJ8A 3HRIA 1M2HA 4EYHB 2RGAA 3QMVA 2HZBA 4QVGA 3AI2A 1CUEA 2FMTA 3HO1A 1RXIA 2PGOA 2BFAA 2JFWA 2E4UA 1XRQA 3A1FA 3UK7A 1M1NA 3PC4A 2EVWX 5HZHA 3BRWD 2I9PA 5IVDA 5GV8A 3LW8A 2VRBA 3OHBA 4O86A 2H5IA 4MUJA 4CNBA 1O7JA 3B6EA 4S24A 3RYFA 4BTLA 4RGVA 5JAOA 2W90A 3PJFA 3WIBA 2UZAA 1E3LA 1V1MA 4DC9A 2CCGA 3ZDDA 2VNHA 2E4XA 2Q21A 2HVQA 2O2EA 3T5BA 5E9AA 1OSNA 3LJKA 4HFNA 3N5CA 3EXHA 4GI2A 4MVYA 2VK1A 3NKFA 1YSCA 2AOXA 3CF4A 4C2UA 4RGQA 3VYUB 3IX7A 2AVDA 2O1WA 4YUAA 1MBZA 2A2ZA 3L8DA 3CZ9A 2Q4TA 5IMBA 1MAUA 3X44A 2R79A 4AJ2A 1VHDA 1Y7PA 4FWTA 3UTDA 5ANRB 1KY5A 2ASEA 3N0TA 2Z02A 3N6VA 3M5DA 1GL9B 4LDAA 3PEWA 1UJMA 3PC8A 5J5VA 4H1HA 2V7GA 1DV2A 3R3WA 4TS9A 1NRIA 4Y7DA 5BSKA 5L1IA 4BIIA 4FUQA 3ZIDA 5K3BA 5T7BA 3L46A 2PX6A 2NAPA 4GX5A 1FSZA 1GQFA 1VBNA 3ER8A 3FAZA 2JDIA 4MZXA 1YS9A 3CVUA 4DT1A 5SICE 1H0SA 3I58A 3SJBA 4V03A 1QBGA 4CGZA 3CM0A 2J6TA 1RTKA 1DO2A 1F4LA 5AI5A 1LJLA 5NLLA 4X94A 4A26A 4OGFA 2AMJA 3GLHB 3EGOA 5ECWA 2JZOA 2H2FA 1GT6A 3PUWA 5A4DA 4AK9A 3NBZC 1DBWA 3BHIA 1W1IA 4UM9D 1YI1A 2O2IA 5CEFA 4D4JA 4LJ4A 2RJNA 4YXWD 2GF0A 3QUQA 1ZCFA 5D5QA 2EJ2A 1B8NA 4AZVA 1NMEA 2Y9MB 1D0SA 3I28A 1HBJA 3EEQA 2PVSA 3EH1A 4BDSA 1J8DA 5GM2A 1QR6A 3I76A 2G82A 4KRXA 5C0OE 5BSEA 4GGMX 4JD5A 1YZQA 2NX2A 3EVEA 3LUCA 2QOEA 1HT0A 1EZ4A 2DR0A 4XYLB 1T15A 3AO0B 4GWGA 1JP7A 3TO5A 2CDAA 1QO9A 2JFHA 3RROA 3G13A 4L4SA 2CLMB 2A84A 5H5JA 2Y1CA 2P62A 1IZ0A 3T9DA 3PNQA 3TAUA 1Y1VA 1XCGB 1Z17A 4M6WB 5EYPB 4NS4A 1SK8A 4IYJA 1ZL2A 3HOYG 3RB6A 5G1OA 3ZDCA 3OZSA 1PYOA 3GXOA 2D5BA 1K0UA 1BDJA 4MV9A 4O84A 2JLWA 3ZGZA 4JOBA 2DQYA 3PFGA 4MUFA 3I8SA 5T8KA 2JF0A 1LPBB 3LBFA 4EFLA 4X1YB 5JPIA 5BWRA 4C01A 1ZUIA 4YQYA 3NPMA 2WTUA 4FOPA 2W7PA 1PW5A 4HO1X 3P45A 4U2KA 1OBGA 4Q3KA 5BY2A 2C8LA 4CMHA 1WSBA 2AD5A 5A9SA 1N2CE 5BMVB 4YHHH 4J0IA 1CUCA 2IEBA 4LPSA 2D0OB 5I48A 1WUJS 1ONOA 1WA5A 3AERB 1HV8A 3JD1A 1KDZA 3B1KA 4J0KA 3L8FA 4WBNB 1XZIA 3Q6NA 3GGCA 2RKOA 3SN6A 3VKGA 3TLGA 1Z4KA 4PLWA 2Q5IA 3OECA 3TLJA 1GGKA 1PLLA 2BGRA 2L18A 4LJAA 2WM8A 4EFDA 5KPDA 3HYLA 3TUJC 5C46F 3M83A 5ISMA 3Q8SB 3W5DA 1XKLA 1JDSA 3F9IA 4D79A 1GZ5A 3AUTA 2FEWB 2PX2A 2H5LA 1C9JA 1PKEA 5JNVA 2ZT8A 3P2EA 3FDSA 3T1YB 3F6PA 4LH6A 1YJCA 4MIEA 4BEJA 3E5MA 1ORTA 3UXEA 4DC0A 4FYVA 1U8YA 4RL6A 4HKTA 1M5RA 4GRDA 1U1FA 1NQ5A 1W0JA 1VBFA 3HC7A 1S0OA 1OT3A 2P40A 5ALOA 1MFPA 4ODIA 1A04A 1XA4A 5FPYA 4XI9A 3PL5A 1T3LA 1AUQA 5MDHA 2FW6A 3FMAA 4OD0A 4R8UB 2ENUA 5BQFA 5CM2Z 4J7UA 4R9VA 1C3OB 1JXLA 4Z4GA 2W7OA 1L7EA 1ZM4A 2WTBA 1ATZA 2R1TA 5FNVB 2QF7A 3TJZA 4O4IA 2I7DA 4QFBA 1WETA 3T1VA 3WJ1A 3B6ZA 1Y5RA 5C37A 3FMOB 3NMUF 3Q8LA 5KQSA 2YUIA 1LDMA 2ZAGA 3U7QA 4MULA 3G0CA 3OU2A 1K75A 4MGYR 1L5LA 3IUPA 4ZAWA 5L4NA 3Q7QA 4N39A 1KK2A 6GPBA 4II2A 3E4CA 5D84A 3F71A 1T6BY 2BTQA 4BO7A 2FZEA 3BHMA 3VR5H 1OCEA 3WK7A 3MWEB 4DJJA 1E2IA 1U5AA 3LY9A 2IKSA 3D8NA 4KN5A 3FTCA 4AFNA 2YWGA 2NQ8A 5HBRB 2JGJA 2Q1YA 4BLUA 4I81A 3E0XA 4AB1A 1P0PA 2OYRA 3THYB 4LF5B 2H18A 3G9XA 2O59A 4UD2A 3GVPA 3O1LA 4KGDA 3SKYA 1ZVVA 1PWYE 3ZE6A 4W82A 4MA0A 1Z75A 3J80A 1FK8A 2NVYA 4QU9A 1KIAA 2OAP1 4OUDA 4YCBA 1SBIA 4RIHA 1Y6ZA 2J9FA 4GP6A 3PNBA 1Q19A 4KQJA 3JQAD 5EMNA 4MZDA 1YBVA 1KI4A 4L8GA 3FOFC 4TTQA 4N9WA 2OZLB 1UZLA 3FNIA 3B1FA 2J0EA 4LZWA 4I3HA 1T4MA 5JI2E 4WN3A 3C8DA 2GBLA 1VMDA 1YQDA 3IULA 2WSLA 4ND5A 2Y99A 5CFLA 2HZ7A 3PDIB 2Q6KA 3U6KA 3MK31 1REQB 2IBTA 2P5SA 4AQDA 1I7NA 3PUXA 4YCSA 4ROSA 1RP1A 3LQQA 2FW9A 5BSHA 4YRQA 2Y1GA 2E2HA 1GNRA 4M2LA 3TSZA 3STHA 2EJ0A 3G49A 4MITA 4AJLA 2CXTA 1GXSA 3HB7A 4C7XA 3CZ5A 3VO1A 1V8OA 4AG3A 3S7ZA 1T3TA 4IKEA 5B6PA 1Y6FA 1KOGA 4RWZA 1DJPA 3B9RA 4YT5A 3LFHA 2XEXA 9LDBA 3NASA 3VH3A 4NLLA 4JLOA 3O31A 2YOHA 5AW5A 3HCWA 4M38A 2EYUA 2WE8A 1BEUB 4KH0A 4FGUA 4OP3A 1EM6A 2FVYA 1Z7WA 3SSMA 5H3CA 3U4QB 1NUUA 4KV9A 4A2CA 2I5PO 5KFVA 2HDNB 3U7RA 5F3WB 1OZAA 4ZI7A 2XGQA 4X5OA 1GG8A 1Q1ZA 2B63A 1C4WA 3B1YA 4CN9A 2QMZA 4H4DA 1EU1A 5DMHA 4LF7H 3K8OE 3WLMA 1J00A 4FKMA 2FEXA 3TECE 3QEMA 3UMGA 2O19A 4BFZA 3AR9A 3E9QA 5BOSA 2H2HA 4WJKB 1JBKA 1ZXXA 1XHEA 4LJSA 4EABA 2FR0A 2ABWA 1AM4D 4L1KA 1RJ9B 2GHIA 5HFNA 4EBCA 1NRJB 3KP1A 1OWTA 3N3AC 3A31A 4DR7B 4WH0A 2QVZX 1JLRA 1MDBA 1NDHA 3OHSX 1O5IA 1GLGA 4G09A 2CLHB 4P3YA 3AFOA 2BIFA 3LK6A 2HT1A 2GCOA 3GZJA 2LKDA 4Q0MA 1G20A 1R0SA 5CCBA 1DJNA 3DFKA 3BK1A 3G79A 4N0PA 1IB0A 1JXQA 2EBFX 1RQRA 3IBGA 4X7BA 3KSAC 1U9ZA 1K7EB 3FZEA 3UAVA 3OT1A 3N5KA 1YUMA 4DREA 4OL9A 4FGJA 4GE0A 4PVDA 1JU3A 1G291 3S2GA 4BXOB 4DV1H 2OXRA 4O3FA 2Z58A 1OH6A 2VBCA 5EXDA 4RCZA 3EVDA 4ZO8A 1TKRA 3NHAA 3DTVB 3HV0A 4BNFA 4TQRA 4DYDA 4MVJP 4M0CA 1ADYA 2HVRA 2QGZA 1RVV1 1XAIA 1CQWA 3UK6A 1U65A 4HZIA 2I1QA 3RQSA 5ESWA 1U0GA 2IYEA 4KQWA 1N2JA 2ZIZA 3K0BA 3AETA 1CRWG 2H00A 1KGSA 1QQ7A 3AWDA 4AZ3B 2PUTA 5TEWA 5FPKA 2AJCA 1G3QA 3VSAA 2C3YA 2GHTA 4WERA 4BP1A 4ZHSA 1UOQA 4XVRA 1XZMA 4E51A 1I36A 4R1QA 5D51S 2VT3A 4YA6A 1L5YA 2EQBA 3MAJA 2WF9A 1FXUA 1R8SA 1TUIA 3HH8A 3BULA 2G9RA 1BCRA 1WVMA 5AUPB 1NSYA 2PYDA 3RHTA 3D7SA 4YCJA 4ER0A 3IEXA 4DUGD 3UKOA 1ZMTA 3ED5A 3ZQ4A 2EZTA 3DBVO 1H9AA 4O3SA 3EQZA 4TQSA 1B1CA 2VF5X 4O4LF 3MN1A 1MB4A 5JAHA 1A8SA 4OIFA 4KNYA 4IO1A 3I8OA 2QD2A 2G8NA 1A2OA 4CN8A 2R8XA 4LV6A 2JFUA 3C8MA 1Q95A 1LB1B 2BM0A 1KU0A 5C3UA 1QTIA 4DV3B 4GXTA 3CF0A 4TMKA 3N86A 4G67A 1XI2A 4ZAZA 1KQNA 2Q9UA 3NYWA 4QU0A 4KZKA 4DBZA 1SCDA 4K9KA 2QD5A 3RT1A 3ZY4A 1KYQA 1GA1A 2BOVA 3BD6A 2IXTA 2FWNA 3I2FA 3RNLA 1XQXA 1RQPA 2V7XA 1U2GA 5IARA 3TFQA 3PW0A 1OJLA 4XASA 1CY1A 2R4TA 2I7TA 1RJPA 1IYDA 4O7VA 3DWFA 5JVDA 1RI4A 4JR0A 2PK3A 3MT0A 4KREA 4NPHA 2P2ZA 4JN6B 2VDQB 2RGVA 221PA 3IE1A 4ARZB 4PWZA 4LOAA 1MVNA 1I1QB 1RRVA 1OY1A 1SUBA 4HS4A 4KO4S 5I7SA 1J24A 3D8SA 2A7XA 1LTHR 1LPOA 2DT5A 2PUAA 2PD4A 4PR3A 3BGOS 3CVVA 3K1AB 3SEFA 3FMGA 4K7JA 5EUQB 1KC1A 1WSAA 3CN9A 3UYYA 1JVNA 2Y4RA 1Q0LA 2QYSA 3EW9A 2QHXA 2BWJA 1I7QB 5ILQA 2JNWA 3WWOA 4FDAA 2FWPA 3L2OB 3CCBA 2NG1A 4LDZA 1JFLA 1HNWH 2MYNA 5EMJA 2PNFA 1Z6ZA 1YQTA 2PMCA 3A1VA 3O26A 2OECA 2IYVA 3LP6A 1O96A 4KB5A 4BMCA 4YECA 3IA2A 2QTVA 1OOEA 1CUGA 4BWVA 1T5SA 4KE6A 2EZ4A 1F8GA 4OJMX 4DQDA 4FOTA 3AQIA 1Q57A 5K0CA 4CCSA 4LYHA 2RG7A 3WB2A 4FEYA 5KYYB 4Y0VA 4AYXA 1A8IA 4LDQA 2IKQA 1JEEA 3CUTA 1U28A 5JNSA 2HIGA 1C3LA 4TPKA 3ZKWB 1GNQA 3UC5A 3L4EA 4F45A 1JKXA 3RGXA 1ECPA 3ZZNA 4F6LA 5IRCD 4B6OA 1IEWA 1IATA 3ZWNA 2IYUA 4C2BA 2YBEA 1Y3BE 4NZNA 4R3UC 1KRWA 4UU8A 5CR5A 3NJ4A 4NC9A 3M1LA 1MQ9A 2QUIA 3ANMA 4NBUA 4NQZA 1QO0A 2IRWA 1STOA 3QY9A 1Y1WA 5HG0A 2CDCA 3PX3A 1W59A 4DBLC 3MQ2A 2PZKA 2FHPA 1O9BA 1IEVA 1QR2A 1NC3A 2DFKB 3X3HA 4WLNA 4LAFA 3DCYA 1QJ4A 4U6SA 4JMPA 4JC5A 1PHRA 3DL2A 5ICCA 3QVVA 3NHLA 4UARA 2WBLC 2WDPA 3NAMA 1YZ3A 2QMQA 2CBGA 2CLIB 4OXRA 1TRHA 1D1QA 1SKBA 2A0KA 4X84A 3GHYA 4EHFA 2YWXA 3U26A 3AUFA 2K6GA 4DE5A 3GLFE 1QH8A 1YVUA 4EFNA 4HNQA 5FTKA 1E9VA 1XELA 3UY4A 3K9FC 4JV1A 3OQHA 1JEJA 4GXQA 4MQUA 4IV0A 1CLUA 3IV7A 1IU9A 2ERYA 1Y0BA 3MT9A 4BMPB 1UPFA 4YRGA 1FFHA 2BH2A 5FWXB 1XEXA 3DT9A 1ULZA 3MTQA 1BIFA 2ODTX 4OEHA 4Q1CA 5KFFA 1L5HA 1N8TA 1RJWA 4ZQGA 2FK3A 1UFKA 3PQ7A 1ADGA 4IQ0A 2QX4A 2ZE5A 2V58A 1PFVA 1V7QA 2B9EA 1ZQ1A 4C5CA 1EWQA 1AZWA 3P0IA 3C6BA 4B48A 3GBSA 1N9ZA 3DBLA 3SQWA 4G2TA 1HG0A 2ASDA 2CUTA 3GT4A 4DSAA 1V4YA 2P9EA 3B1ZA 4G1FA 4NQRA 4ZPXA 1V5EA 2EAUA 3Q7SA 1DSSG 3IG0A 1TI7A 3DYIA 4PM4A 6YASA 5FA8A 3LXRA 3ZK8A 4BIMA 4NZPA 3HJHA 3GG2A 2W6QA 1IFXA 2JLBA 1DBVO 5DCUA 4QARA 2ZB8A 4RH0A 5BURA 3T3OA 2OWDA 2Y27A 1FPQA 3K1YA 3G7SA 3GCWA 2Q6VA 2PQMA 4ZZ0A 2ZXFA 2DHEA 3DDHA 1VI6A 1DEHA 4IZIA 4JOCA 1QUEA 4UCFA 5T3UA 1X42A 2XD4A 4EKNB 3U55A 5EOYA 2V98A 1LDGA 1YMVA 4EUNA 4P84A 4YK7A 1GYFA 4YO7A 5AJVB 3TGLA 4NY1A 2ZUSA 1M2GA 2II6A 2ZG6A 3THXA 2JFNA 3CRZA 2Z2JA 2Y77A 4HK4A 1SHUX 2XY4A 2OM6A 1L8OA 4WOBA 1BVHA 2YY7A 2ORYA 5KVVA 1GARA 2B0JA 1NVFA 4WVLA 3OZUA 5IYBG 2ZREA 4X1KB 2IZ7A 2WWRA 4JYZA 1JIHA 6CHYA 3Q9UA 4FBGA 5ICMA 4G63A 2Q3HA 3FYTA 3C6MA 1CLEA 3T0FA 1GGFA 3T6KA 2Q3MA 4JYAH 4WKCA 3R7AA 1F2UA 3GROA 2F9MA 3WLIA 3KVNA 2H5JA 3CEAA 3LW7A 3RU2A 5B5SA 2A5GA 4JJ8A 4QU8A 4M3NA 3N0VA 4NYJR 1A88A 2QRPA 2D8AA 3PLRA 3H11A 4TX1A 1X77A 2WE7A 2RH8A 4HRYA 2JFFA 3OE7A 4K28A 4UZEA 4UXJA 1LC3A 3K9LA 3NM5A 3A37A 2NXCA 3F7MA 1ENOA 3E9NA 2XWJI 5FAKA 1VHLA 1XDGA 4YAUA 2XMCA 1FLVA 3RYCA 2P78A 4L27A 1MORA 3RJMA 2XNDD 5K5EA 2EIYA 4R1LA 2B8NA 3TNYA 4PEVA 5DI9A 1HO3A 1RWVA 2C9ZA 4N01A 2XMZA 4REQA 3F5SA 2JFYA 3K73O 1JXAA 2OHGA 3VNQA 5SY4A 1NUTA 2BCGY 4I5GA 2P5UA 1OKKD 5A04A 1N2CA 3NONA 4EVQA 3DS8A 3IP8A 3LLMA 3I6ZA 4HAUA 5CAEB 1F20A 3L49A 2C54A 1S97A 4Z4CA 1KR2A 4GKBA 2YRFA 2PAFA 3D4BA 2LD4A 4C4PA 2X7JA 2IUTA 3UMSA 1BWQA 3I39X 1WUYA 3UH1A 5DT9A 3AOGA 3T5TA 1JKIA 5LLDA 4KJZA 3RIZA 4MJ3A 1HDZA 1QF7A 2QMHA 3WL8A 2DMRA 4O2BB 3WJAA 1XROA 4AMGA 4DR2H 3WMXA 1KERA 3TZQA 2WFZA 4Y6OA 3AP2A 1N2EA 3OQ6A 4U39A 3K1TA 4PZYA 4IICA 5JYEA 2C82A 4YS6A 1NV8A 2BM9A 2BFFB 1XK7A 2JD1A 2WZCA 1A0GA 3GLKA 1AN9A 2Q0QA 1LCIA 2CLFB 2QTBA 5IYZA 2B82A 1AGNA 4LZPA 4RABA 3AUUA 2FMIA 1NLFA 1J1UA 2QBYB 4MIOA 4CVNA 4R9NA 3CQZA 3P9SA 1US8B 1S3IA 2Y4NA 1ZCZA 1Z62A 1OLOA 5AM3A 1RVDA 3MHPA 4TQAA 3NVAA 4BMYA 4XUEA 2F9LA 5JY1A 4AJKA 4CRWB 3EDYA 5D6OA 2C7VA 4NMXB 2YMLA 3NDJA 2Y0DA 3R40A 2C07A 4FX2A 5EJ5A 3OZIA 4GYWA 3UT5A 5A5GA 4JT9A 5CP8A 4LWZA 1CQIB 2MSNA 3DE2X 3RBDA 4NABA 4B7UA 4EY7A 3DL7A 5C18A 1V45E 2UVQA 1J9EA 4Q3AA 3R2JA 2P75A 5FR1A 5L9AA 4R0NA 2V3WA 3WRYC 3FCEA 3DHNA 4W5WA 3D3QA 3RRYA 3MMPA 1ZK1A 3P9KA 3HCPA 3Q2KA 1KAEA 4HYYA 3I53A 4O7RA 5KS2A 1FYWA 3EIOA 2JIZA 4ITRC 1XXHE 2EP5A 4MUAA 4REMA 3RK1A 2ZKIA 1GNPA 3FHJA 1R50A 2DFNA 2IHVA 5CGQB 4KFSA 3BCUA 4R81A 4R16A 3WI7A 2WD8A 2F62A 3KJQA 3HWWA 3CH7A 3PQEA 1T2FA 4C7OB 1GCGA 4C0HA 2XUIA 5KHOC 4AJOA 2AC7A 2AYXA 1NASA 5DX1A 3EWAA 2VA8A 3ZIAA 2HAEA 1QHHB 2EXXA 4E5YA 3SYTA 5AI4A 4Z1MD 1ZN7A 1EINA 3RS0A 821PA 3M6WA 1WCWA 4QDOA 3NHWA 2DQ4A 1Q12A 3KZMA 3FYUA 4F1JA 2VYNA 2H4FA 1KI3A 2WIBA 1E2NA 1GEEA 5BQOA 2GD0A 2C4TA 2D59A 2NIPA 2REOA 4Y2RA 2PUVA 1N92A 4B7AA 1K2VN 2W11A 4YP0A 2XDAA 2VR1A 1HDXA 3BH6A 3IXLA 4M1EA 4R51A 4C0XA 1YJ8A 4C3UA 5HM8A 3U7EB 5HE9A 5D1PA 1KI1A 1ECCA 2ZWOA 2Z09A 2XXAB 3RC9A 1PQYA 4YP1A 3QEKA 1U2EA 5EJMA 4Q4JB 1T6XA 4Q18A 3Q8RB 3D6UA 3MS4A 2A78A 4PLPA 2FE4A 1UM9B 4JKYA 3F9RA 4DSTA 4NCKA 4UFZA 2NVUA 3EBLA 3JATB 3C2QA 3BF8A 1H0RA 2M32A 3UGJA 3UQZA 3AIKA 5DQGA 3WWHA 2WF6A 3WAKA 4PFKA 1W44A 3GZTB 5K6AA 3G6VA 4L9SA 1FFGA 4X7PA 2IOYA 3NWOA 2O2DA 2H31A 2OHOA 4QQ8A 1NI3A 4XXHA 2REBA 3CNQS 2WE6A 4V2UA 3W6PA 3R3SA 2J9ZB 3TM5A 2B5WA 4O59O 2ZIEA 1XA0A 2I8CA 3CH5A 1M2OB 1ISFA 1XJ0A 4QHYA 2E85A 4G97A 4R1UA 1KFCB 3EPPA 1JLMA 1NMZA 3PFNA 1ZOSA 3RF2A 4HMQA 3GUYA 3IHWA 1AQIA 1JDPA 1JBQA 3W2IA 2YV2A 1SC1A 4ZTUB 1BFKA 2H1FA 4RDXA 4KEAA 4GM1A 4CFYA 4CLRA 1K8QA 4IZHA 5A02A 1NZFA 3E3MA 1B3RA 4DCPA 5CM9C 2R8IA 4TVSA 4DCMA 2RHMA 1RRFA 2ZS7A 4C4ZA 2J9GA 1MV5A 1G9SA 4MQ5A 3S6JA 3C1AA 1W36D 1Y1RA 1UXKA 1YD7A 3C48A 1Z45A 4F4CA 2IIPA 4RJ2A 3ZV4A 4HGQA 3SNOA 3S2YA 2R8ZA 2D7JA 4DRXA 4MV3A 3KQKA 1C30A 1RYMA 2VQ3A 4OHWA 1NUPA 2I3AA 1TAQA 1CVLA 4GC5A 2R6FA 3T1NA 5GMOA 1NONA 4O4JF 4UXHA 3JYLA 4OSEA 3O03A 2D62A 2RAPA 2VJNA 1AO3A 4BEBA 1WDMA 3MZ0A 5H70A 1XMIA 4LDJA 1LC0A 1TIKA 4NZ9A 4HTFA 2O07A 1LPNA 4GKAA 3UAYA 5H83A 3QXCA 1P60A 1T2NA 3EF1A 3DNPA 3H5LA 5LWHA 1IAQA 3GA7A 1U7WA 2PJZA 4FZRA 4URUR 5EWLA 2WP0A 3EVNA 4NBWA 2RDJA 1Y3DE 1KJYA 3ZWAA 2C5BA 3E70C 5CFMA 2IPNA 1YCHA 3CMMA 4QEDA 2E87A 4Z4EA 3BHNA 3VTFA 2YJ3A 2BGLA 3OIWA 2WDZA 2VDPB 2VWHA 3QMWA 4OHCA 4LY9A 4RZ3A 2PUGA 2AK2A 1A27A 3PBKA 3HKEA 3WBFA 2B4TO 4DJAA 2WV7A 2O8FA 1MJGA 3TK1A 1QV7A 5CD9A 5A71A 3D6FA 4J07A 5IUJC 2VXYA 1ZNXA 4ZAVA 1NF9A 4XGQA 5IN4A 1X8LA 4OI2A 4LQDA 5KJCA 2J3JA 2QWXA 4P7JA 2WAQE 2PKXA 3EZ9A 4PZ8A 1KZ6A 3OM8A 2F17A 4P82A 4MI1A 4EVIA 2ZRCA 1P7PA 5TSDA 5FBWB 1JQAA 3QXJA 3TQFA 4QPZA 3RHZA 5HUQA 1FU7A 5KC9A 1T6ZA 4ZO7A 3R6GA 5A6SA 3ZNOA 3FMVA 3IT0A 1I9CA 5KT7A 4ECQA 4JXKA 3WFZA 3LKDA 3CVWA 3AFHA 4V39A 5DFAA 4AJIA 1UK7A 2B25A 1O2DA 4NCJA 1E89A 2OILA 2JIRA 5H9VA 4BP3A 2KHZA 2WZQA 1S8FA 1VBHA 3P2IA 5JS2A 1E7RA 3S24A 4QUJA 1Z6TA 3RSFA 5EXXA 1JTVA 3BMOB 3HJCA 1HWYA 5C1DA 4AS1A 4I6EA 2GZAA 5KJ1A 1SUDA 3KYCA 2GPTA 3CFYA 1PF7E 1BYIA 4XX1A 2JGIA 4TVKA 1ODLA 4KXXA 4ANFA 1C7QA 2VSFA 4AQYB 3QHPA 1RTTA 2XQFA 8ABPA 2RBEA 3GIIA 3K0FB 2ZE6A 2BEVB 2AZ4A 4M9ZA 2IDZA 5AHRA 1RWBA 4Y8VB 3ZWXA 1EZZA 1P3Y1 3A6GA 3ZTWA 5JCJA 2FPGA 3HXPA 2GQRA 3QVLA 3ONWA 2YZNA 3H4BA 4YMSA 1B8OA 1W85B 2ZRQA 4RPKA 3SSNA 3T3MB 5ALYA 4I19A 4D8YA 1KPIA 2PL1A 1R15A 3EIQA 3TQSA 3UICA 1XVTA 2XBMA 3SY8A 4OYHA 3DOOA 4QPDA 5DN6A 4BY1G 3EXIB 1LPAB 2YS7A 1XEWX 3KTOA 1IE3A 1JR4A 1AMOA 2GPYA 1D9ZA 2JBAA 3KSRA 5KG4A 3IBFA 3KT0A 1U0EA 3QWIA 1NULA 3GJRA 4JWTA 1A98A 2DTEA 2HXSA 3Q40A 4RAZA 2CVFA 1FSFA 5LQKA 4B3RH 4DR3H 4TRNA 4J0CA 1GV0A 2IU6A 4XIYA 4WCVA 2C98A 4G5GA 3KCQA 3CYFA 2BN4A 4KPUA 1QFSA 4AY3A 1G6OA 1FUUA 4QX6A 1EWYA 4H6VA 5BVHA 2AFHB 3GJQA 1L7AA 1XMQH 4FW8A 1SUPA 2ZWAA 3EFHA 1TTQB 4IV8A 5DAAA 2YWRA 3GUVA 5D6NA 2AX3A 5KYWB 4HQFA 4P3NA 4LUCA 2PXXA 1VRWA 4G4GA 3QUBA 3LXUX 4HFRA 3B3AA 3BB3A 3UOWA 1DEOA 4HDRA 2UUOA 4GC9A 3DMPA 2PV7A 3HFGA 2J5KA 5BWWA 1CWUA 2YKGA 1UBSB 2P1RA 1QAOA 3TF5A 5IVIA 4I9HA 1T9ZA 4PO3X 3TQIA 2MWMA 1QZUA 4RXTA 2O8VA 2XDWA 1Q22A 3GLFA 3FF4A 4DS3A 3U48A 1J99A 4Q44A 2IZ6A 4TV9B 1MA0A 2RI0A 5HE8A 2FOXA 3ELBA 3FY4A 4LOKA 4KE9A 1ZHOA 4CKEA 3BORA 4ZEOA 5IASA 3ZGVA 4Y9UA 2P6MA 5ICEA 2KYRA 2O1SA 3TI7A 4ZYWA 1DGSA 5L45A 4JI3H 4PQFA 5CXXA 1VS0A 4EHIA 4K3VA 3ED1A 4HVAA 1LK5A 4D99A 1CW2B 3CLKA 3CGWA 4GH5A 4XJTA 1CZUA 1Q0RA 1F6WA 1AUVA 4BNMA 4CE6A 2VS1A 3NWPA 4O1HA 3ZGLA 4UU0A 3F0TA 3O8RA 3L7BA 4NE7A 3LO5A 3KWFA 3PSHA 2G72A 9LDTA 4I9UA 3N9IA 3GLGB 3EOZA 3C3KA 2VH5R 721PA 3L1VA 1CNMA 4ZU1X 1KBZA 1Y63A 2JK1A 4B2IA 4EBFA 1W29A 3VSDA 5KTRA 3HI4A 3AEKA 3TWOA 2WHQA 4H77A 4MAMA 4ZT7A 3CG0A 3H1TA 4PLZA 1ZM9A 3SQXA 4A3EG 4LH7A 3VR2A 1Z28A 2GHQA 1S8NA 3NDBB 5B3AA 3TLKA 2NPFA 5FIUA 2V45A 2MSCB 3I9JA 3Q8WA 2NT4A 3TZBA 1VGRA 5I7RA 5BWCA 4PIVA 2QUAA 5D7BA 1ZOLA 3CLRD 1L4KA 3ZV3A 1SRQA 4EJ6A 4ENQA 2JB9A 2V03A 1RWXA 4RC9A 2HRZA 4C6TA 4F4UA 4JI6H 4HDSB 1IZ8A 2I8LA 4BFCA 2EGHA 1GLVA 3EDOA 2PSFA 3AVOA 1NATA 2ZSIA 2OLJA 1KARA 2OT3B 1DLJA 2XTMA 1S2MA 4Y6RA 2GVZC 2A3RA 1ZQ9A 1LV7A 4LSGA 3OPYA 1JQLB 3U6BA 3IBYA 3W5UA 3KB6A 1D0VA 4UDXX 1ORVA 3IKTA 3UOGA 2QG6A 5COBA 1J7JA 3N70A 4FN4A 2XT6A 1ID8A 4D9HA 1FFAA 3KR1A 3QITA 5CYPA 4JSYA 1L9XA 7REQB 4HXEB 5HKLA 1R4AA 1DBQA 1E3DA 3TOZA 1ZNWA 2XGMA 4RD1A 2MT9A 1HYEA 4M7RA 5CXUA 4JKIA 5LZ5A 4DBVO 1WXHA 1AKYA 3TRJA 5DNUA 5TY0A 5HKOA 5CBPB 5F3DA 3OLQA 3NUGA 3QRWA 1U02A 1HKUA 5I9MA 4YP5A 4E70A 3LC2O 1SOVA 1G8PA 4MWBA 2CDBA 3JRNA 2N1MA 3PXGA 2XOKD 4BJ3A 4CQMB 3RADC 2CL7X 4Q4AA 5B4VA 1QIKA 5J63A 4B34A 2ZTMA 4N0QA 2FYTA 2WW8A 5TQ2B 5AKLA 3C3MA 3ZX4A 5EE9A 2AN1A 1AQLA 1DIRA 2PRKA 4F3CA 1U2DA 5A9TA 5KNDD 5TX7A 3P0EA 1X92A 5JDIA 3AY7A 3OFSA 2BGWA 2V97A 4MINA 4CF6A 1SOWA 3ZVNA 2B4QA 1SD1A 4E5VA 5A7HA 1T8YA 1KNQA 2F7SA 4M0FA 3SFZA 3HZRA 1SUFA 3VHXB 4YRZA 4K0KB 3RB8A 2QLTA 3TE6A 4A0QA 3UT0A 5B1YA 3I0NA 1JHOA 2R48A 3BXOA 1R8JA 1I13A 1N2HA 1Z4MA 4X8MA 3KB2A 4KXVA 1K0FA 1L7XA 3FOZA 4J1SA 1OXUA 5L4LA 4R1PA 5GJVC 3N7UA 4WLEA 3L04A 2YXLA 3H86A 3U3RA 1OTXA 1CKNA 2NZWA 4A2QA 2BMWA 1EEHA 4JR2A 4CTKA 1PTKA 4OP2A 1KH1A 2C4VA 4PWYA 1BKDR 2FLVA 2JIQA 2X6QA 2PSHA 5M34A 1S3SA 2JZNA 3U9TA 4AO7A 3IHTA 2DP4E 1IG3A 1LSSA 4MVWA 5DNEA 3PR3A 1D3AA 2PLFA 3DA8A 1OFGA 4J16A 3VC2A 3T61A 4G0NA 2NU9A 5FI5A 2ZEJA 3WQRA 3K6SA 2ZAMA 1K4KA 2JA5A 4YUYA 2RIRA 3SVTA 4H60A 3W2GA 1RHUA 2CNDA 2O7SA 5LDDC 3RWOA 4EF6A 1C1XB 3QYAA 3IIKA 4UE6A 3JVUA 2EW1A 4E4RA 3HBAA 4O1MA 5KU7A 7AT1A 4EO4A 2ZR9A 1MW9X 2ZBFA 1N2IA 3BCRA 1BHJA 3ASZA 1ZUWA 3LBNA 2B9VA 4BU0A 4GOMD 5H82A 1VMKA 4UW9A 3DE4X 3SYKA 1C0EA 3HNOA 2GXQA 3ZQUA 3W90A 4JUZA 3VR0A 1ZHFA 1UBUS 3VVCA 4B35A 4EM6A 4U02A 3ZY2A 1MT0A 5CJPA 3TX6A 1C3JA 2QAGB 4RJKA 4HAOA 2NO4A 3WSWA 1XRLA 3NBYC 3VU9A 4RB3C 2WUVA 2OQ2A 3HKBB 4RZXA 2MSEB 4Q7LA 2QJRA 5I5GA 1L7VC 3CUVA 2ZWPA 4KUEA 2HQ1A 3BXFA 5F51A 1UFRA 3DAYA 1XXHA 3K4QA 2YIJA 5G0WA 3DOUA 3X1WA 1KWKA 1S3GA 2VHVA 4QFCA 4C4OA 3I9OA 3NATA 4X66H 4CCAA 2GPJA 4KN9S 2R60A 3GCGA 1Z5GA 4BAZA 3LT2A 1AE1A 5ARDA 2XNSA 2R6CA 3C5VA 5CB4F 3I0MA 4C4XA 1VYHA 5AP9A 1QFZA 2XUOA 1E0SA 5TARA 1VCNA 4LF7B 1Y5MA 2Y6VA 2YHUA 3B7GA 4Q1VA 1OFUX 1N5KA 1UK8A 2ZRMA 2QD1A 4CIXA 4J29A 4KSBA 3WL5A 4N1AA 2G1JA 1QKJA 4JBYA 3HOZG 1V4VA 3KBOA 4CL0A 4JLKA 5KNCH 2AG8A 3BKWA 2Y1DA 4UUGA 5AJYA 1JT2A 4CL8A 5JXGA 3QP9A 4RTJA 3F3SA 3EXG1 5JH7F 3SYRA 4M9RA 4FU0A 5ECGC 5F52A 3FSJX 4QBKA 1D4AA 3DZKA 3F9CA 5LMUH 2HJWA 2WY2D 1EQUA 2A5FA 2XVZA 4MHSA 4QREA 4FS1A 5JUMA 4TYPA 2JEIA 1C4XA 1NMYA 3C5WP 6REQB 4ESVA 3JSAA 2FOLA 4P3PA 1KKMA 5CJ2A 1NKVA 1B0PA 4RIEA 2OEPA 2IEIA 2W6ID 3C98A 3TN7A 1IZYA 2GHRA 2PKRA 4FMCB 1WDKA 2HVSA 4P8RA 1ANKA 1N57A 4DV1B 3LYAA 4R5HA 1GFZA 2IHKA 1SPBS 4P4GA 1X1DA 1ZGJA 4X8HA 1C0PA 5DM4A 5G4KA 3RJ5A 3RSQA 1EX7A 1SB9A 9GPBA 5BQPA 5IULC 3OCYA 4WGGA 3A32A 2CHGA 5FOSA 3IIIA 5C7IO 3ZGNA 2C5SA 4G5RA 5FADA 4I6JA 2P4UA 1J8YF 5EEGA 1SFRA 1GCAA 4DL5A 4HH0A 4QW8A 1L1FA 5JSFA 3I9V1 3GEIA 3LLUA 4BQSA 2UYOA 5JANA 4QOEA 4UBKA 1V26A 1J8MF 4OHPA 1E1YA 3QZUA 1MEOA 5GWXA 3E9EA 2Z56A 1NVDA 1RAGA 2O3JA 3NQ41 4YBZA 3TZCA 1Z6GA 4HEJA 4GPD1 2ORIA 1AGPA 4E07A 4I4CA 2PGJA 3E23A 4L8YA 1C7JA 4J9QA 3DXZA 5GINE 1R8YA 2VCEA 3TB6A 1VHWA 3E22A 1HZZC 3KVRA 2Q1UA 2DHRA 3ZHSA 4OJQA 4CF7A 4NARA 2D5AA 5KKCA 1IC6A 1ML4A 3LPAA 1TF7A 1VA5A 1YRHA 4D9NA 3GQBA 2D5IA 3NHJA 3ZI7A 2IUYA 3QNUA 1D7AA 1YZUA 1D5WA 5EDWA 2WJYA 2R86A 1P9WA 4M54A 1H94A 2PSEA 2HLPA 1WP9A 1XQVA 1CIVA 3NC4A 2G1AA 1INLA 4CM6A 3IVMA 3PUVA 1IQPA 3G2IA 5JTUA 4JJIA 4PZPA 2EF1A 1P77A 2ALZA 1XNJA 3NTXA 1J06A 3K9QO 4K9QA 2PAAA 4TKVB 4EI8A 2WU1A 3MC1A 4ZOAA 2OGZA 1NOKA 1GPMA 1RXEA 2P0YA 2YYAA 3RIHA 1PJLA 3MWYW 4JL8A 1GRNA 2E18A 1UDRA 4B40A 3CUEF 2DEUA 4G0WA 4W8GA 4I55B 2HA2A 2DHQA 1U3FA 1E7WA 2ECQA 2BP7A 4IXNA 4FHGA 3H17A 2Q5HA 3OTQA 3UAWA 4CJXA 3Q4GA 2QP3A 2JAWA 3OE1A 2XEDA 2OD7A 2W42A 1FPMA 2DABA 3P4UA 2H7XA 3LOPA 1FFSA 4I4TB 1CBUA 1PJ3A 4OSOA 4JI4H 5ENVA 1U3WA 3UJNA 1R8QA 4X64H 3FDXA 3BCHA 4AUKA 2WAQA 3PCXA 1YR7A 4INZA 4LF6B 3G23A 1FX0B 3HJRA 1W25A 2QRVA 1HNWB 3QPCA 3Q15C 4JLDA 4GZLA 4K9MA 3NHMA 3NM6B 4RV9A 5AKKA 1LLCA 3Q3EA 3SU8A 3EPLA 1R4NA 4Q3DA 2XCIA 1FTNA 1V51A 1X7XB 1NXQA 2G5CA 4KQEA 3VFDA 4L5YA 3A3YA 3P27A 3RJZA 4CZ2A 2O6HA 2BCEA 3NOVA 1XJ5A 1ZNQO 3VPSA 1E1KA 2XUFA 4M0EA 4IIEA 3MJTA 1DC8A 1Q6ZA 4KMMA 4GLWA 4YRBA 4RYDA 4GPBA 3RVPA 1IBCA 2F3QA 4YB8A 4Q7MB 3BJYA 1KF0A 3QHQA 2JGLA 3W4JA 1GNLA 1U8ZA 5EVJA 2XYRA 4EF5A 4D8UA 2Q8QA 1EBFA 3T9AA 4OATA 2LUOA 4I14A 3WFJA 2J3HA 3QVTA 5KBYA 1ZH0A 3FPCA 2J6SA 4QWAA 5I5TA 1UJ4A 3TAXA 3SOPA 2GN6A 2HGSA 4TSFA 1TL7C 2XNHA 4BJ5A 1SBYA 4FILA 2OCDA 1BMFA 5JSYA 1T2EA 3EZXA 4OH7A 4PAMA 1THZA 1WULS 1XU4A 1EJ2A 1ZK3A 3ABRB 2RJ3A 1XVAA 5ALFA 2AUTA 1Z2CA 3UHOA 1XJQA 4IAJA 3PEUA 3P9XA 2NUTA 2Q4DA 2JFGA 4ZICA 3ZU2A 4FEEA 1Z68A 4PSAA 3O92A 1J21A 3B60A 1L7PA 2QR5A 1XVLA 4BV9A 1J0AA 1RBQA 4B2YA 3R5XA 2V0GA 3JQBA 3SXPA 2R92A 1UBOS 1JL3A 4D0LB 5K3FA 1KYTA 3CJTA 3H5OA 2QP9X 2JLSA 1T36B 1N5OX 4U7JA 2PQ2A 2X4LA 1BOOA 1GUFA 3NBZB 3VX4A 3HADA 1QHFA 4DAOA 3B38A 1E94E 4XZ3B 3QE4A 1Z39A 3FDZB 2OOKA 4GQAA 3KX2A 3ONVA 4Y67A 4UHCA 2ZOSA 3KOMA 1ZAUA 4UAJA 2EARA 4B3SB 1GDTA 5B3LA 3DZDA 1KZ9A 5BNWA 2BFPA 4TS1A 4WXHA 1NI4A 2JAPA 4RMHA 5L1JA 2XUQA 1DG9A 2DULA 3RSOA 2BEWB 3V7UA 3LIIA 4Q02A 1JH9A 3U40A 4ZGGA 1TGVA 3W5IA 2BQUA 4ZIRA 4XGRA 4L2IB 3SVZA 2ZRBA 1G7CA 4PHTA 4ECYA 2HSJA 4L0DA 2AKEA 1YRYE 3HGMA 3DWEX 4DLPA 1DWQA 1OBFO 5BN5A 4R8LA 4L3OA 4DCTA 4OQXA 4DTCA 4NX2A 4WK2B 1XMOH 4P2BA 4R7RA 4KIWA 1VIVA 2WNSA 2PKQO 5ALWA 1OLXA 3CVOA 2MINB 1X0VA 4UFNA 2ATXA 4NONA 2NO5A 2HN9A 3GFOA 2P90A 4Z9AA 4EJMA 4R7GA 4D4HA 1LV8A 2RGYA 4FDUA 2XA1A 3FN4A 5JNWA 3F46A 5FUQA 3HJBA 1G8MA 4KGXA 5AJXA 4DQLA 1ZOIA 5CTJA 1BDBA 2IJGX 5HTOA 1J0EA 1T25A 1CZRA 2K5UA 2GESA 3V8NA 5K7SA 2JLAA 1QM5A 2FI1A 2CK3A 4IJUA 1FNCA 3GFBA 1E9CA 4EA7A 1KYIA 3CMCO 3ACDA 2Q3DA 3N8DA 4E5DA 1E3JA 5ALIA 1FW6A 3C6KA 4OREX 2J0UA 1FXWF 2K87A 3FHOA 4BQIA 1GL6A 2CMKA 2QPOA 5AJUA 2NUBA 4DDUA 3L0PA 3N59A 2FDXA 1APBA 2B21A 1LLFA 2ZBEA 3CN7A 3EFBA 3CS3A 3SC2A 1YTLA 1BD4A 4IIBA 2VP5A 1K63A 3QPUA 4IUCS 4XWYA 3HY4A 4I3FA 3V7WA 4UTXA 1KJZA 4KQFA 4GSYA 1SYXB 4K6GA 1DIAA 3IODA 1F0KA 1SCUA 5JEDA 1WVGA 2X5KO 1CS0A 1N6PA 4IZ6A 4RK6A 5HQJA 2XYVA 2J0SA 4HNUA 1OAOC 4FJ2A 3VC3A 4YRFA 1UJCA 2RB4A 4PGGA 4RVFA 1AGRA 2R0QC 3VAYA 1OFIA 1GAXA 2VYQA 2ZLBA 2ZFUA 4JT8A 1X7ZB 4I66A 4CCWA 1VLMA 1HQCA 4QBHA 1P7CA 3ANXA 4HH4A 3NBYB 2ZJBA 2AGVA 1CFZA 4UHKA 1NBHA 4DNXA 4G8DA 4NZZA 3QVWA 4I1PA 2EFYA 2NTEA 4HP8A 5FPRA 5FJIA 2VRWA 4DMUB 1E6MA 1VDZA 3VPGA 2FXVA 3V5NA 5EI5A 1MX3A 2N1BA 1FYVA 1JFRA 3K5PA 2D0IA 3LKZA 2Q3BA 5BN4B 5B3KA 4JITA 2HRBA 3ZW9A 3GTQA 3GNQA 3PYLA 3TLAA 1TA4A 3LCJA 4YR7A 1ZA2A 4D3SA 4BGDA 4PCUA 4DLRA 2JJQA 2AR7A 4IIJF 2ODBA 1U8FO 4EMUA 4TV8B 2JLZA 4HUQA 3A4VA 4FJ1A 4IOMA 3AMVA 2AR9A 2DPGA 2OAGA 3MRSA 2QB5A 3R9XA 3C39A 2IPMA 1RMTA 2GZSA 4DR2B 3PU6A 3SQDA 3TLZA 3E7WA 1N8NA 4RUAA 4HLUC 4AS3A 4KVGA 4WGFA 2MIIA 4GX2A 2ZTSA 5DGBA 5HIMA 3L41A 1SHTX 5AO9A 2QI9F 4P31A 1YKFA 5EIBC 4FKZA 4LY3A 3E7PA 3GJZA 5JBNA 3WKAA 1XVVA 3JPWA 4DXDA 2I2DA 1H2FA 2O1EA 2Q7XA 4Q4LA 2GVNA 1Z18A 2JDID 3EGXB 3H87A 4DG5A 4JXUA 1Z06A 5DP2A 5IYDG 4KK4A 3I64A 3ASUA 2V54A 5BRJA 3IQFA 3V8QA 1GU7A 3QLVA 1LRLA 4W9RA 4HF7A 5DV9A 4A2BA 4DWOA 2BRUA 4FQ5A 1VLJA 2ZUTA 2J9RA 4QBFA 5FULA 2JA1A 5FP0A 4JI0B 5JHHB 4URZR 1LPSA 1YIOA 2BGUA 1JX4A 5JJKA 4IXMA 4ZJUA 3HR4A 3UV7A 3NUQA 3A4LA 3TDKA 3KT3A 4FDMA 5FAXA 2DPMA 4M88A 4GR5A 1RYSA 3F73A 2IHBA 5LKAA 1JJIA 5EWMA 3IR5A 4DCOA 2VJOA 3KB8A 1W5BA 3IJRA 1UZNA 4XSVA 2VA3A 2GTPA 4CE5A 2YC2C 4CM9A 1U9IA 1WDLA 1PEYA 1L1QA 4L5JA 1U0TA 1TWAA 2X7HA 2DUNA 1L5RA 3KDSE 1V6AA 1QH1B 3LLVA 2UXDH 1HPLA 1RZ3A 1N6NA 3CA8A 3SJCA 2YJNA 3H8WA 4B83A 1GR0A 5G4LA 5DBHX 5KFIA 1SKYB 4MYTA 1ND6A 4NG4A 2EWVA 1NLYA 3WGVA 1Y5IA 1ZKMA 1L8QA 1ONNA 4BMXA 1I32A 5CJJA 1YRWA 4DZTA 2JLYA 3VGJA 1S10A 2QM8A 3GIDA 1L0BA 2RGEA 4B8WA 3ESXA 4RXMA 1M1YB 2OK7A 3C70A 2J5QA 1K8YB 2QRLA 3ABSB 3A3OA 1OYOA 3WIEA 4D3FA 4U7FA 2W2TA 4UHEA 3ZJYA 3GILA 2XSZA 3IMCA 3KUUA 4N3BA 1UBMS 2Q6IA 3DO5A 4RY2A 1VP3A 5E2AA 3LDUA 3HY6A 1EE9A 4Y9SA 5AUOB 2HA4A 3C74A 3AVVA 5A7FA 5DHUA 4RPGA 2CXHA 1CDOA 3ANLA 1P5RA 4TL7A 1GTL1 4IRKA 4RZRA 1G64A 1QCYA 4US1R 2P9YA 4ME6A 1PT6A 5IM5A 5G41A 3NGLA 2OR3A 2NZVG 1YB4A 4LYDA 2EJWA 1ATIA 1H1DA 1TJYA 2EV9A 2RGXA 4RAOA 3TOXA 3RRZA 3UHAA 1T9BA 5KDOA 5IJXA 4D5GA 2WT4A 1C8KA 4K9PA 4UBLA 5ALRA 1C1YA 4NCHA 4GQBA 3CKLA 4F9EA 1EGAA 1ESZA 1JW9B 4FFVA 3UXMA 1CT9A 3B6IA 3FSGA 4LRTB 4Y1FA 1X7YA 1KOFA 1K4YA 4XVQA 3BA6A 3EX7C 1JEQA 4DTIA 4N03A 2FEKA 3T1OA 1SC6A 5AH0A 4QULA 1X1AA 4FUTA 4LBWA 5BN3A 3NT2A 3SFVA 2OB2A 1U0SY 1RC1A 2H7VA 3UUEA 1DGQA 4JUDX 1R0LA 3F1LA 1NL3A 2W8BB 4F4WA 4ES6A 1IK6A 4J7AA 3ZHXA 4YR3A 1SNYA 4N4AA 2DYKA 4OX9H 4BPRA 1W0JD 2IC5A 1N5MA 2GYYA 5DPMA 5F9MA 4QBIA 2NU7A 1R4MB 2RHTA 3NTLA 5CA0A 2BHTA 2GRJA 1Y7IA 4B4UA 4TXHA 5FD8A 5D8DA 1VSQA 4LZOA 1W19A 4G0ZA 1GSAA 1PVDA 4BS9A 2P41A 4H1UA 4PG8A 3RD5A 1GTG1 2A5LA 2ZE7A 4G84A 4BO2A 1EKPA 4GFDA 4EGFA 2XOXA 1XZPA 2YVUA 3KE9A 3HRKA 2J85A 1N56A 5FR9A 3GTLA 2PIDA 1VMAA 4MMZB 4AJHA 4EYEA 2UVDA 4ZGBA 4YJFA 5CDGA 1EFLA 3WDKA 4LF8B 3WJ2A 2O4UX 3EG9A 4XX0A 2EQ5A 3TSCA 4C0BA 3DAGA 1G5RA 1AZTA 2P4HX 4DB2A 3P4XA 1NZJA 2Z43A 2W22A 1ZUNA 3GPBA 1I5EA 1H6BA 4MW1A 4MVJE 4CIYA 2IYNA 1ZA1A 1QU3A 1QS0B 4Q4HA 1DMRA 2QE6A 3ZEAA 3EWIA 3EGVA 3FGZA 4NENB 4NOMA 4XA8A 1JJVA 1X15A 3N58A 5ADHA 4OLJA 1XGKA 4B3BA 1K6EA 2E1RA 3TVDA 1NUAA 2GM4A 3VSEA 3STTA 1VCOA 1XCJA 1L7OA 1DMSA 2QRJA 3SEAA 3SC6A 3DDNA 3EJWA 4OBEA 1E4EB 3OJXA 2GSWA 1OGJA 1KQFA 5BWOA 1Q0SA 3DTTA 5C53B 2FSIA 5JC8A 1Q7TA 1RADA 4Z53A 1NF8A 4JNCA 1AA6A 2I1LA 2HG8A 4XQCA 3I9NA 3UB2A 5JCOC 1G6Q1 1I8TA 1O97C 3LZ6A 2VDRB 3NANA 5DHSA 3MRXA 2RHRA 4L57A 4QPJC 3OLVA 3DV9A 4CEJB 5C8YA 3CLTC 3VDRA 2YC4C 3ADBA 3OBBA 2VRCA 3KEQA 1DIBA 2GM9A 3FCCA 4O0MA 1SFOA 2W2LA 2W71A 3NOXA 1KDVA 5B2FA 4KDEA 1TZBA 3GIJA 3RYTC 3T5JA 1DC3A 5F9NA 3ZZ0A 5BRAA 3IP1A 2NU6B 1SHJA 2P6OA 1II8A 3PIDA 3HXKA 1LLQA 3L7LA 1TADA 4JIGA 2XQKA 4BCDA 4Y9TA 3H2GA 1K68A 2D4AA 3OIFA 1MIOA 4GOND 5CIWA 5HQ3B 3U1BA 3RUAA 3K5WA 3C41J 3ZU6A 5CYGA 2C59A 3HU3A 1JB9A 3GLHE 1JFVA 5AHWA 2ZSEA 4BO5A 2OD2A 4UMEA 4E13A 4JBGA 4M0DA 5BNTA 2IFTA 4EBDA 2ENWA 2DT8A 5BYJA 2PX3A 2ATVA 3ACCA 1PVOA 3FPHA 4XIJA 2PH1A 1E5DA 1YJXA 3AKZA 4UD6A 4KITB 1GOTA 3JQ7A 1Z25A 1D4ZA 3QE0A 4G85A 4JP3A 4BNYA 2GUGA 3OD5A 1FUYB 4IR1A 1ZEJA 1FP4B 1JHMA 5KFAA 1B16A 3PGXA 1D2NA 3P2OA 3ESRA 2G71A 3RODA 2GFQA 4GLOA 2Q62A 5LQMA 5C81A 1IIRA 3YASA 3JQDA 4LRUA 5L3QB 2HPAA 4WCFC 4G0UA 2GO7A 2C9BA 2H52A 2XECA 1CUZA 1SJ9A 2Q3FA 4U5XA 5C9ZA 1VPEA 3E58A 4DIUA 9ABPA 4AMBA 3PC3A 1ZISA 5LCXA 3UMRA 3Q87B 5CCDA 2FPOA 2O2XA 3E8MA 1TC2A 1ZH6A 3KKMA 5JJIA 3BWYA 1W48A 4HMOA 1RSZA 3Q72A 3BICA 4URFA 3PB3A 3T9EA 1CUBA 1E5TA 3QTTA 4AY5A 2YFQA 4RW0A 4EJSA 1RZVA 1EWRA 3ZVRA 1A9ZA 2A5JA 1GSOA 3KUXA 3H1GA 5JISA 4LCEA 5IUNC 2VJMA 2JFZA 3OPXA 1W73A 5ER6A 4WA7A 4W7HA 2W00A 4ARCA 3OQPA 3GIKA 5LC1A 2R44A 3ZBPA 4NYIR 3Q8QB 3JZMA 1OAAA 4EUHA 4KOAA 4PX5A 1II9A 3E7DA 2QY6A 4MW7A 2OCIA 4OHVA 2VBIA 1Y14B 3KZCA 1Y4UA 4IIVA 4IQ8A 4DR3B 1P0CA 2C2MA 3ETEA 4A36A 4WK6A 5KVAA 2O48X 3QWHA 3LK7A 4G1UC 1AHNA 3OOYA 4EW6A 3IP3A 1NG1A 2NNLD 1VYVA 2I7VA 3B5IA 2CW8A 1F0YA 2H06A 2O20A 3OJEA 3VXKA 2P2GA 4NFHA 4Z8XA 4X41A 3IPRA 4XWGA 2XMBA 5HMMA 3EVBA 3LE8A 3FYHA 3OZXA 4JASB 2DE0X 3BZBA 4DNFA 4MXDA 4IRMA 4NJMA 3CZRA 4RPLA 2VNKA 4I8DA 1OFUA 5FCDA 3L8HA 1GPYA 1XZ8A 3DV0A 1S1MA 3U19A 3WMEA 4IH1A 2RHOA 1F2DA 3AIOA 4HV4A 3PJGA 2DF8A 3BM5A 4CQLA 1RXSA 3R3UA 2OKCA 1SUCA 4EY3A 3R7NA 5IXSA 1MO2A 4GDFA 3WS7A 2YHAA 3EMBA 4ZYXA 2WJ4A 2KSQA 4AC9A 4KLAA 3IAM1 4RELA 3SYLA 3OFNA 2ZWMA 3EF3A 4EKDA 1Y5LA 3EIFA 1Q44A 1Z6XA 2DPIA 4HMPA 2BMDA 2IYZA 2PKYX 4OKIA 3DUWA 1U5BB 4GI7A 1X2EA 4BLSA 2OSBA 4CLHA 1Z2NX 5FPPA 3H19A 1JG6A 3RFXA 1B0ZA 2HMWA 3F4KA 1KO8A 1QE5A 5D5HA 2X4GA 1A95A 5KREA 4YCAA 1LNZA 2JLCA 3KXYT 3VVLA 4B3DA 3QBJA 2JJ2A 1WZIA 4DL3A 4COOA 3D7LA 1PFUA 1WCIA 3C16C 1YK1A 1GQSA 1F17A 1KZYC 4R71A 5JATA 4NBRA 2H85A 5GONB 1ABEA 3I62A 1FNBA 2P9HA 3RJTA 4FS8A 4CR8A 4YUWA 3TIIA 3GJ3A 3HWSA 3HFJA 1M6WA 4H27A 2JAQA 3A6HA 4CPDA 5AM2A 4GPEA 2H1IA 2C2BA 3KQUA 4U9HS 2QN2A 2WR8A 4D6YA 4YRLA 3WE7A 2C42A 4PBSA 1U2RA 4LTDA 3TD2A 4C0QC 2HCJB 2HIVA 1UQTA 1U8AA 1RK5A 1RLUA 1EUCB 3CO0S 1ADFA 5E8RA 3QEBZ 4R1NA 1C4OA 1LRJA 1J49A 1RYNA 1W8DA 1FOEB 1XWIA 4IW3B 1JPNA 3PC7A 2C8VA 2BUBA 4O3QA 4HJRA 4FINA 3CTMA 4QQNA 1IUOA 3OSZA 1F0PA 4WEOA 2BSQA 4HPWA 4ZJYA 1R0KA 1TM4E 4CV3A 4OH1A 3DFFA 1IM2A 3OT5A 2F8LA 3FUWA 2J45A 1PBTA 3WAJA 2W2KA 3K2BA 4A3BG 3NOOA 1QO0D 3OQJA 5L3ZA 3UWMA 3CZMA 4ZVRA 1DWUA 3JQQA 1VKNA 2CNWA 4NPCA 1CX9B 4LJLA 1XMXA 2O8EA 2QXUA 2ZIAA 3OQIB 1QPZA 3EFEA 4L73A 3O0TA 1YACA 4HUJA 3LCUA 2NP7A 1EUYA 1XZGA 1UC8A 3OM1A 2ZRPA 1X7GA 4JK3A 2CMDA 4PICA 3Q8MA 2XTNA 4FCCA 1PNTA 3T5MA 4Z0TA 2ZCVA 5E4JA 4IFTA 4BX9A 5JS1A 4CMIB 1J8FA 3PYXA 4HL6A 1DQZA 2I3BA 3TKAA 4HNHA 5LP6F 1TPYA 3OOHA 5F2OA 1LI7A 1Y1SA 3BZUA 1VBMA 4TLAA 5IG2A 3EISA 1XU9A 2CE7A 3ODGA 3FPFA 1ZIYA 3IJ5A 1QHXA 1KIMA 3HKCB 4B6GA 3TTUA 4RXUA 1OXVA 3QOXA 3CWCA 4PTYA 3KLNA 3QSGA 4OTZA 4EI2A 1Z2OX 2PCJA 3U3XA 2IQ5A 1Y42X 3B7WA 5KG7A 4YQZA 1I5RA 2LPMA 4ZA2A 2X40A 4K9LA 2J5XA 2UYHA 4BVHA 3MJVA 3NRCA 4DLLA 3R09A 4OXIA 3ABOB 4J3FA 3LGSA 3HUUA 2AJ8A 1KETA 1KQOA 3GIMA 2F1HA 1NQWA 1FZTA 2ZYHA 3FNGA 3ZE0B 1XN4A 1T9KA 1Q0QA 2RGRA 2EG9A 4PY2A 1N3BA 3TOSA 4ZCMA 2QM0A 1JB1A 4GOLD 3UTCA 1TVMA 3FUTA 4YHHB 2V4QA 3ZHUA 4HAYA 3OF3A 1DRUA 1BQ4A 5BYAA 1A77A 3RARA 1WTAA 5REQA 1UH5A 2Q46A 3QVSA 1Q0ZA 1W7AA 2EZUA 5AK3A 2Q2NA 1K97A 1NP3A 4ZHQF 2YJZA 2HC9A 3C97A 1Z8FA 2PT9A 4BLPA 3BAAA 4RZHA 3AT1A 5A3JA 2HRDA 1QU2A 3WGLA 3EGDB 1T4GA 4YMUA 2E82A 1QDEA 2FUG6 2JW5A 4HWOA 1LDEA 1P7WA 4GU5A 1UPCA 3NG1A 3NBXX 4ONEA 2CNNA 3N2EA 3IMGA 2NZUG 2GD2A 3AXSA 1E7MA 1ZU4A 3FMIA 3PFCA 3ZD6A 2FQYA 1VTKA 4FGRA 4LIPD 5IMSA 2EGUA 3KQPA 4CKWB 4RK0A 3WLTA 2HIXA 4NICA 3EXEA 3IKLA 3GMIA 4E7OA 3UWDA 3ITEA 1GAJA 3LVFO 4PQYA 3WMGA 2RI6A 4MRSA 2WB4A 3X1MA 1UOOA 3K0AA 4LWQA 1AHIA 3RC7A 2X8JA 2ISQA 4RLQA 1PTJC 2J6CA 4V0LA 4D45A 3K09A 2CF5A 3SJ7A 1THGA 3CSDA 4XYMB 1S03G 2VL7A 3DE7X 5H02A 5JDCC 5CPFA 3JTEA 3V42A 4X7RA 4QWMA 2PMDA 1UZMA 4DV6H 4YUXA 1N2SA 3HUFA 3JYNA 3WFIA 1KZGB 3AV3A 4X66B 4EJ2A 3NIWA 5CT9A 4HGZA 3UB3A 1MJGM 4QAQA 3F8NA 3OE7D 1TEZA 1TYZA 1NU6A 2LRHA 3KL4A 3AFMA 5HW0A 1U94A 3BF7A 4N6GA 3PW4A 4N7JA 1NYTA 2YXNA 2PJUA 1Q7CA 1J42A 2SCUA 4RJJA 1SXJC 4F72A 3DAOA 4AXBA 1TVKA 2JGAA 1S2OA 4XYBA 4I7HA 3ICEA 3EIEA 4H7DA 3BJMA 4UNRA 3L6RA 1UINA 2VDVE 3SHOA 1UQUA 2JIDA 1QV9A 3AIMA 4HBGA 3E82A 4LNUB 2BYTA 4PHCA 4A15A 1GM5A 4HLQB 1X7WA 2XUAA 5H80A 4CFZA 5DG8A 4NK5A 3GDOA 2GK3A 4EG6A 1FW8A 1W4CA 4GL2A 5K0EA 2ONCA 2ZRHA 2Q27A 5LMUB 3TLYA 1A9QA 2WIAA 4LXHA 4MPRA 4LDNA 3KYDA 3AR8A 2M6SA 4CCYB 1GRRA 1IONA 4RB1A 3AJ9A 1JU9A 1GSIA 1TZKA 2H1LA 2V7BA 1O6CA 4RA9A 3TFWA 1WEKA 3O2NA 3AR5A 5BPFA 1GPWB 1O08A 1YVDA 1ODCA 4FS2A 4E08A 1Z6YA 1V9CA 4PZEA 4NMMA 2J5RA 2Q5JA 1EUDB 4K88A 4EIWA 2QKYA 3A14A 3AFNA 2Q2QA 3PXUA 1SA0A 1XPOA 4E6NA 4IOKA 4BMSA 5EQJB 3TMYA 2QIPA 2X0NA 2X22A 1SVWA 4BNJA 4QTUB 1NBOA 1Z7YA 2E1PA 4WXPA 1QYVA 1KFEB 1JDZA 5TIIA 3H1EA 4D9GA 5THXA 5ED4A 3GEDA 2AUMA 4EKYA 5H16A 5DHQA 1VKZA 1R6TA 1M6VA 2PKQP 4X60A 4CKBA 3NHYA 1Y6JA 2YV1A 2ZJ2A 5DHPA 3WB0A 5C8VA 1JR3E 3K6RA 4ISBA 4BFTA 2PBFA 4OXKA 3CXRA 6Q21A 4HN9A 3IE0A 4ZWNA 5JAQA 2HYDA 5ER9A 2GKSA 2G76A 1JEDA 2C97A 1WW3A 1Q21A 1RI1A 2AV6A 1Z63A 4YMTA 2Q28A 4O83A 4Y7CA 4HDOB 4Q3CA 4LCBA 3WIUA 2GRAA 3ANNA 4FBMA 2O8CA 1BD3A 1VKRA 1M2EA 3M7IA 1TAEA 2C1EA 4F06A 5BSFA 3BJRA 1OFHA 2INGX 4KXFB 2GJAA 2WJAA 4XVHA 1N6LA 5JXHA 4AO8A 1YJBA 4RHUA 1BS9A 3HCEA 4XFJA 2H1WA 4DNPA 3KU1A 5JFOA 1RRKA 4D9IA 4BBSG 1F6DA 4ER5A 2AC2A 1M66A 3G9UA 4G26A 5FO0A 2JIZD 3DE3X 2ZJAA 1XTQA 2V1UA 1XBTA 4M76B 3PFIA 4CMEC 1SKMA 1E5VA 2RC6A 4AVYA 3CEHA 4TYYA 3ZC3A 3ZTYA 5E0OA 3WBBA 4K9SA 1S8AA 1UWCA 1BKYA 4Q03A 2EJTA 1XQ6A 3BUSA 1UDCA 3U0VA 3GDEA 1NR1A 2JEYA 4D0RA 1NW4A 3D54D 4HQOA 4MTCA 3UUGA 3ZIAD 4LVOA 4RHCA 1FMCA 1ZQ7A 4R2JA 4JEMA 1LWNA 3BDAA 3T15A 3IQDB 2O8BB 2XQJA 4M37A 4M9XA 3AEUB 1O0SA 2MJLA 2OBBA 1YS4A 1CP3A 3TG2A 3QF4A 1WUTA 2HD4A 2VYND 1Z9BA 2Q07A 2IYXA 2PZBA 2AKYA 2AQ4A 4ECUA 4A2PA 1BMTA 1XALA 1EFHA 3MWFA 2R82A 4L51A 4ZZ2A 5A1JA 1BHSA 1OB2A 3W8DA 1R9TA 2XZPA 4JI4B 3AJRA 5LOVB 4IL5A 4KYIB 4WZBE 4X64B 4R8RA 1HTBA 5IKEA 3R0XA 5JQGB 2IXDA 3GLHA 4N12A 1VE1A 2GDJA 5LLSA 3MCZA 3A10A 1RWMA 3FVRA 4H31A 3N8GA 1Z4OA 2HHHH 3H2YA 2ONZA 2DBZA 4I46A 1VXOA 4I9NA 2C9CA 5FLEX 2ERCA 1XZNA 4S35A 2C22A 3HA5A 1DRJA 4DMFA 3HBNA 1OH8A 2AW3A 4O29A 1XZLA 4PDBA 4HB0A 1FTYA 2BEJA 2WKSA 1VPTA 3E48A 2OWEA 1IVNA 1P8JA 2R6JA 1QQBA 2VTBB 3CVYA 3RAPR 4DEYA 5HF9A 3W3AA 4FDLA 3WLEA 1YR9A 2X1MA 4QDKA 3HVRA 3CZCA 1GQQA 1YHZA 2B1RA 1QP4A 1QLHA 1XYGA 5IJ0B 4NDZA 1FYDA 1H2XA 1AD2A 3Q0IA 3UJAA 2WMOB 2BKEA 1AY0A 1AUOA 1Z83A 1C9KA 5JCZA 4MAAA 3FSRA 1DX4A 2GAOA 4O02B 4DNOA 3HXLA 2C95A 2HRRA 1T2UA 2AVNA 3ND9A 4M6WA 5EYPA 4C4YA 1IULA 2FSVC 2TSYB 4FFLA 2Q7OE 5L40A 2B4AA 1WKCA 4IIHA 2GAIA 2PM8A 1NGSA 4G23A 3L0SA 4HNSA 1L3BA 3C1UA 4DLUA 2PO5A 4LSAA 4X1YA 4OFBA 1K88A 3ITNA 1L8LA 5FOXA 4PAQA 2O2SA 1P6QA 5EIFA 4D41A 4DXHA 3L7KA 2QX9A 3MJCA 3WOHA 3B51X 2A6PA 3WG9A 3ZWDA 4UATA 5BMVA 1TECE 1UMCB 1C8LA 3NR2A 4WAUA 4ZVMA 4DCVA 3CBQA 3OHAA 2FN8A 2FUEA 1E4VA 1WSWA 1MGOA 4KDCA 3UMVA 4BVKA 4QDJA 4RETA 1C0IA 2HK9A 4P2GA 3FPJA 4JVSB 3PHCA 4FDVA 3ZLUA 4TRRA 4RA6A 2QTGA 4BVAA 3M89A 3CLVA 3SEQA 4BQOA 4DA8A 5A3RA 3TW0A 3VYTB 4DMMA 3PZRA 2VZEA 3QVUA 1F2VA 3V46A 5HZMA 3O21A 1CULC 2J5BA 2KMLA 1PU2A 2ZBPA 1RPTA 4INJA 1MPXA 3NXKA 2QTHA 4N8EA 3WL7A 4BGIA 2Z5VA 2O2HA 2KX7A 4KR3A 2JLRA 3I9MA 2XMSA 4FYPA 2PT6A 2G80A 1T5HX 5IBRA 1X70A 3PD7A 1II0A 1UC5B 5LBUA 4B80A 5LUAA 4WEQA 5KFZA 3IPXA 1UAYA 1KYZA 5HRUA 4V0QA 2C8KA 2AX4A 3WRWA 5IK2A 3IAEA 3QF7A 1IBMH 1JDEA 4R8UA 2HMTA 1Z0UA