2ZDHA

Crystal structure of d-alanine:d-alanine ligase with adp and d-alanine from thermus thermophius hb8
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
319
structure length
319
Chain Sequence
b'MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ADP and D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 96
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdhA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdhA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdhA01
4RZQA 2NPOA 2YZNA 3TIIA 1B6SA 2YYAA 3OUUA 4IWXA 2WYOA 3WO1A 5EZYF 3V4SA 5JVDF 5C8YF 1UC9A 4MV8A 5HBRB 4M99A 1CE8A 3GLKA 3R5XA 4XX0B 1VBHA 4EA7A 2W6OA 5K2MA 3TINA 4O86A 3VPCA 4O83A 3WO0A 2CQYA 1EYZA 3UFXB 1I7NA 5D8DA 3KAJA 2YS7A 2R87A 1VKZA 4XZ3B 4QSHA 2GPWA 1C3OA 3Q2OA 1KJIA 5CA1F 5J2UF 1Z2OX 3TIGA 4XYMB 5J2TF 4YBZB 1IOVA 2DLNA 4ME6A 3N6RA 1KJ8A 1M0TA 1AUVA 2I87A 3RUPA 4WD3A 4O7TA 2R7NA 4FE2A 1OBGA 2FB9A 2I8CA 3BSSA 4O81A 1DIKA 5GONF 4O84A 2YRWA 3GIDA 3G8CA 2FPGB 2DIKA 1EUDB 1E4EB 4GGMX 4O4LF 1KJ9A 3BG5A 2CNQA 2X0SA 5JQGF 4EAAA 2R7LA 3R5HA 2R84A 2CZGA 3K5IA 2YWVA 2I80A 3TW6A 1W93A 4EG0A 1C30A 4IWYA 1GSHA 2R85A 4IZOA 4WBNF 2XCLA 3RFCA 1GLVA 4O4IF 3G8DA 4ZQIA 5CA0F 3JRXA 5H80A 2W6ZA 1T36A 4MA5A 3KAKA 2VR1A 2ZDGA 5I47A 1KJQA 4MAMA 2R86A 3TQTA 2C00A 2P0AA 2Z04A 3WNZA 2DWCA 4O7ZA 2YW2A 2HGSA 3V4ZA 4YAJB 2FP4B 2R7KA 2ZDHA 5LP6F 1JDBB 1PK8A 3RV4A 4MV6A 2FPIB 5JH7F 2W6QA 1JLLB 4FFLA 1IOWA 4C5CA 4FFOA 1GSAA 2VPQA 1UC8A 2YS6A 4HNVA 5FNVF 4TUYF 4YB8B 4ZHQF 1CQJB 2VQDA 4IIJF 5CB4F 4FFNA 3AW8A 2YZMA 3AX6A 3VA7A 3JZFA 2R82A 4J6EA 4C5AA 3HB9A 2W71A 4MV9A 4O7RA 2GLTA 4DIMA 1Z2NX 4MA0A 3MWDA 5LXTF 1AUXA 3R9RA 2W6PA 5KX5F 3K5HA 1B6RA 4O7YA 1KJJA 2PBZA 2PVPA 2W6NA 1ULZA 1A9XA 4HQ6A 1KUTA 3VMMA 1GSOA 2YZLA 4NYEA 4HNTA 2QK4A 1EZ1A 4O7VA 4MV3A 3OUZA 4FFRA 3Q1KA 4C5BA 2W6MA 1EUCB 4O7LA 3QFFA 4FGRA 2R7MA 2W70A 5JVLA 4FFPA 2XD4A 4O4JF 3I12A 5LA6F 4MV7A 2R6FA 2GPSA 3BFPA 5DMXA 3R23A 2QF7A 4O82A 3ORRA 1Z2PX 4I4TF 3NUAA 3LWBA 4MV4A 4YJ2F 4O7SA 3JRWA 5C1OA 4EA8A 3JZIA 4EGJA 1VBGA 2GQRA 4IHJF 1CS0A 4HNUA 2VHEA 4YJ3F 3VPBA 4ZOLF 1WR2A 4TV8F 2NU8B 2FPPB 2NU6B 5BPHA 2YL2A 2OLSA 4O4HF 5C1PA 5HV6A 4M9CA 4ZI7F 3R5FA 4TV9F 1A48A 2J9GA 3U54A 2DZDA 4FU0A 4O2AF 5LOVF 4M9UA 1W96A 2YRXA 1M6VA 2PN1A 3ORQA 5BMVF 5LYJF 2NUAB 3MJFA 3U9SA 2CNVA 4DLKA 2V5AA 4I50F 4EABA 4I55F 2NU9B 5KKNB 2NU7B 3U55A 2V59A 3U9TA 2HJWA 4EA9A 2Z02A 1E4EA 3KALA 1JDEA 3LP8A 3VPDA 4YAKB 3ETHA 5CAEB 1GGOA 3DF7A 2GQSA 3RV3A 4M98A 3HO8A 3HBLA 4O7WA 4MV1A 1KEEA 4EGQA 3BSWA 5JQWA 1BXRA 2CNUA 2V58A 4HR7A 2YZGA 4L1KA 1BNCA 1SCUB 3MWEA 4Y8VB 1KBLA 1CQIB 4O2BF 1OBDA 1PX2A 3KREA 1M0WA 1EHIA 1KC7A 4XYLB 2IP4A 3BSYA 1I7LA 1DV2A 3SE7A 3ETJA 3K3PA 3N8DA 5IYZF 5BPFA 2SCUB 1JKJB 4FFMA 4E4TA 1DV1A 4O7NA 3VOTA 3E5NA 2ZDQA
chains in the Genus database with same CATH superfamily
2JG3A 3TIIA 3A27A 4DNOA 3HOZG 4RJJA 4PTZA 3WJ1A 2B63A 3F8WA 5ERXA 2OO5C 4OP1A 1UMCA 2Q3JA 5PNTA 1QXSA 5E0OA 4XPIB 2H1CA 1N0IA 1NJGA 4PC7A 3UFXB 3ZI7A 4NFHA 1V35A 4FE4A 5B57C 4R2JA 4F1WA 5LIPA 2I76A 2DQKA 4BP8A 5EQFA 1Q1AA 3GQBA 4GP6A 4J0DA 1ZQ1A 2C4HA 2VHVA 3ERCA 1XRRA 3EW7A 2A86A 3OCJA 1S0NA 1OBGA 1L7NA 1ZDMA 1EX9A 2GJ9A 4CQLB 4GZ5A 2FUNB 5FUVA 4YACA 4MRNA 4R0MA 5B12A 1II8B 3OPQA 3JR7A 4H1UA 3QBEA 1T3HA 3MAAC 3GVXA 2SNIE 2DIKA 4A3SA 4DL2A 4MIOA 3MELA 1XLTA 4YJGB 4HADA 4A3CG 3BE5A 1FRVA 2FK3A 1ZOSA 1E3IA 2D74A 1ZQ7A 1UOOA 1DHRA 1SOVA 1V43A 4XW2A 4RVNA 2CHQA 2JGDA 3OA0A 1WMAA 3ISJA 3B9QA 2ZU6A 1T5TA 1MH9A 2GKGA 4U2KA 5KNDD 2RJ3A 4BX2A 2Z04A 2ZRFA 4ZPJA 3JALA 2BF7A 5JJLA 1RXCA 5LP1A 3L7LA 3IVCA 3BAAA 5AVZA 4LCEA 2PLWA 5JH7F 4WCVA 5JFOA 4HB0A 1DKRA 2Q07A 4G41A 4RIIA 2BI7A 2FQXA 3ABRB 3JAKB 2JZCA 1R6UA 4I55A 4LXGA 2JLRA 1AQLA 1M2EA 4K1XA 3TRFA 2WQ7A 4PAMA 1J1UA 2AXNA 4PO9A 4KTTE 3HB9A 1UDWA 1P6UA 5CR5A 1KRXA 4J7XA 4C0LA 4WNAB 4OK3A 5KYNA 1T25A 5AW2A 5EE5B 4BAZA 3FSJX 1R8QA 1TRKA 5EXTA 3GAMA 2DHRA 1I6LA 3OQJA 2NVBA 4XYLA 1F1JA 4PFJA 5FFMA 1Z07A 4GEGA 1YK1A 1YZFA 2QLLA 3RSFA 1SZCA 4BNIA 5TMEA 3OE1A 3T0IA 4RHXA 1F0KA 1HLDA 3SQLA 4R51A 2J67A 3DLTA 3K16A 4O4JF 2PUAA 3HVRA 1DKUA 1JTVA 2CJFA 4JHXA 4H60A 4DMCA 1CV2A 3IDAA 2H52A 3QF4B 1TM2A 1XD8A 2EFGA 4NG5A 1K0UA 3TG8A 4OHXA 3PHJA 4K9OA 4CLEA 2PV0A 2EP7A 4AW9A 5U4XA 4OU4A 1RC8A 3KSRA 5FL3A 3IL2A 1T8PA 2AOTA 2DMRA 2YCLA 2WV9A 5KCMA 1SY7A 4CDGA 2XTZA 1E7SA 2ZRJA 3MN1A 4QO7A 3EIUA 3CLSC 4M9CA 2FZLA 2QRNA 2K4MA 1K4YA 1JYFA 4CFZA 4PAOA 1PJLA 1J42A 4B3SB 2ALZA 3AYHB 5BOVA 4ECSA 3E9EA 5KYVA 3UG7A 3SZUA 3U6KA 4D43A 3SDBA 4ZQCB 4C6RA 1WY7A 2AZMA 2I03A 3GR6A 5LZ5A 2AN9A 4RD6A 3S4YA 4CYMA 2I1QA 2IZ1A 1KDYA 4NYJR 4U9IS 5DRYA 3K6SB 3S2YA 2JIZD 4FEGA 3C45A 4RVCA 4YMHA 3EXEB 2V0NA 2BSQA 3ED5A 3BRWD 2GYVA 5FYDA 4DR4H 1A3CA 5AW6A 1BQ3A 3ONWA 4FE3A 3GMSA 2WQZA 2B1QA 3Q5EA 3Q1LA 2JAQA 2EG5A 3WWIA 1IZ7A 1QU3A 2IWRA 4RJTA 3PNMA 3WK8A 2AG0A 1GRRA 2WJZB 3CMCO 1O95C 5CM0A 3TAUA 1N75A 1AN0A 1YBFA 3CZ5A 3IILA 3SYLA 5FAXA 3AF0A 2ENWA 2PH1A 1PD1A 1RI3A 1G7RA 2DKNA 3NVDA 2C4MA 2GJ8A 3U17A 2F3SA 4FNOA 2DULA 4BQNA 1NOIA 3GEDA 3U3JA 4WH0A 1L4UA 4Z1MA 1QFMA 3DXFA 3WLMA 5HMLA 2XQIA 2EIXA 3QA3E 1FMTA 3BT7A 5TPWA 2A0FA 1UDRA 3CEBA 3B7PA 3BRQA 2QZSA 1JAZA 1OXTA 3QMWA 3NBZC 3ELDA 3EHEA 3OWXA 1FSGA 1X7WB 1NXSA 1E4OA 4L27A 1FLVA 4MWGA 1UPCA 3ICVA 3KQQA 5AVRA 3R9KA 3RJ9A 4W9RA 3W4KA 4RIFA 2VKQA 3ANNA 1VZ3A 4B3FX 3W7VA 2PGIA 2GRUA 2JI7A 2DWPA 4YRGA 5A4AA 3OT4A 5JY1A 1NNI1 3OURA 3IR7A 3ZU4A 4C4SA 2AXEA 4K88A 1JAHA 3VPFA 3N0RA 5CIQA 3VU3A 5BRNA 3BJEA 4UUNA 2VEDA 3P9KA 1SVOA 3UMFA 4EI2A 2J9ZB 3CVUA 4EYHB 4I9NA 5KT2A 1GTJ1 5DI3B 4N65A 2ZI3A 3JQGA 5KC8A 1LEHA 3K9BA 2RB4A 4LYJA 2WVHA 4HDKB 2ACEA 1NQVA 1Y98A 4Q44A 3S24A 3GJ8A 5A9TA 2PMWB 5DTEA 2HZ7A 3GCXA 3C6XA 1SHKA 1LFDB 4A0HA 4ZT2A 5FPSA 4RYLA 1W30A 5BR7A 1UMCB 4K7JA 3R09A 1PEDA 1V4NA 5CT9A 4LOAA 2YX1A 3DR3A 4DZRA 1EU1A 4OM7A 1UBMS 3M1AA 5ALFA 1GKIA 3DVAA 4P22A 3CN9A 1UXOA 2OVFA 1VGQA 3PIRA 3FMOB 10MHA 1TT7A 3F8NA 3TAXA 3GQBB 3CKLA 1XTVA 4HJXA 5COQA 1PW7A 3KBOA 3QXJA 5FA6A 2ODTX 1X6VA 5JO0A 4J1NA 3ZJVA 1ULHA 2PO5A 2XA2A 1FU4A 3W8EA 3I12A 2ZIFA 5K4HA 4UMVA 3H13A 1PQ4A 4KPGA 5DYIA 3CG0A 4B17A 3QKUA 5IX8A 4YT2A 3BAFA 3LVFO 3HUDA 1TIKA 4EW1A 1EWVA 3CH7A 4RUCA 4LV5B 1Q0PA 1Q7RA 2R6HA 2WF6A 2IDJA 3A9UA 4B3XA 3M5CA 3TTWA 3QLVC 5AFSA 5MN4A 1KNXA 2YXBA 2JGDB 1NSYA 1TVCA 3OEED 2KSQA 3DTYA 4ILKA 3G49A 3VOBA 3GTQA 1B3RA 1XYYA 4GBGA 3VH2A 4JFAA 1W44A 3FSRA 3T1HH 4M9RA 3TGWA 4JLKA 3T5HA 4YYEA 4COOA 3JALB 4UUGA 2A84A 4ENUA 3M1YA 4HRAA 1F12A 2JJ2A 4R9UC 1E1QD 2D1RA 1U0EA 2VT3A 4I55B 1RMTA 2Q27A 1WDMA 2OGWA 3BPSA 3TTVA 3Q9UA 5KBYA 3QLTA 2LP4Y 2GQSA 2CLIB 2C4VA 2B9EA 2PMZA 4CLXA 3CT6A 1XAGA 3KHKA 4M0JA 5CCEA 5E25A 3TVYA 5KHOC 1GDHA 2Y6UA 3NALA 2ZR7A 2XRMA 3QBTA 2BJWA 4KE7A 3KETA 5A5DA 4CE5A 3T4XA 1XKTA 2BBOA 1J20A 1JLKA 1SMKA 2OGSA 4LTDA 1D2MA 1P1KA 4XYLB 4B3MH 4WOJA 2PPVA 5FTMA 1T8RA 4LOHA 5T8KC 2IIPA 3P32A 1IG0A 2IIBA 4C03A 4R1QA 3I2KA 4F2PA 5CT8A 1JV2B 3F2VA 3L0CA 2UVPA 3FYUB 1QGYA 3IOEA 6ABPA 2QN9A 1NVMB 1BHJA 4G36A 1O9GA 3LX5A 3FF4A 4DR4B 3NBMA 3KQLA 4P92A 3PR4A 3ZOKA 3LCVB 4TTTS 3QE3A 5JCJA 3PCTA 2BC9A 2Y0CA 3BIJA 3OECA 4FYKA 1OUMA 5HDBB 3HJHA 3G2PA 2W42A 4CHIA 2NZ8A 1DJMA 4F04A 3C43A 4E7PA 2JFWA 1W47A 2XE8A 3DO6A 4HNSA 5ALMA 2AOTB 1B26A 1S10A 2QLTA 3K4HA 4LGVA 3WWJA 2QBYB 4YQFA 1JKFA 3TQ1A 1YAHA 4BXXG 3N3BC 1N2HA 4N82A 4P58A 4A2PA 3PYLA 3GTLA 2YOHA 3BRWA 2MMCA 3WWCA 4N01A 4ZZ2A 3H9QA 1UMKA 1JPJA 4Q24A 2YHSA 4YRIA 3B36A 4OHZA 4A6EA 3OO0A 5TF0A 4J49A 3TOCA 2A6PA 1QO0A 2NXJA 2C4TA 2DUUA 4I2VA 4CV0A 3BH0A 3RBVA 4ZDWA 1K4MA 4YDSA 1EK6A 5CIYA 1OSNA 3RHFA 3T3EA 1Z17A 4N8DA 4HX5A 1MA3A 1NGSA 3DFZA 2A1TR 5EHGA 2CMDA 3A7DA 5BWVA 3CUUA 2PX8A 3LXRA 3MHTA 3CO5A 1QV9A 1P1RA 2NVUA 1GNQA 1XZCA 2B8TA 3PC4A 3AL3A 5KNLA 2IUEA 2C00A 2FPLA 3UHAA 3PNQA 4OQLA 4YCNA 1H2BA 4UBMA 5B1EA 1RHQA 4NBTA 3O47A 3ZIDA 8OHMA 3CQ9A 2XLBA 2M6SA 1F6WA 4G4JA 3RVNA 1NJFA 2Z2XA 1M6WA 1H2XA 3IN5A 4P4NA 3HN6A 2EQAA 1XA0A 5FNVF 3EGXA 1CQJB 3CNBA 4NF2A 3U4HA 3OX1A 3W5JA 1B8OA 3F3MA 2INGX 2WLSA 4S2UA 4PS0A 4DLUA 1YU6A 1U1EA 3H3VH 2FFRA 1NW6A 3SR3A 1NQOA 5AOAA 3K5HA 3OA2A 2X0DA 3SI7A 3CLTC 1SVIA 1UT8A 3TCKA 4QW8A 2PX5A 1P60A 3KT0A 3QWUA 3OTIA 5TPWB 1ZH6A 1CZOA 2ATEA 3ZWKA 2A0YA 2P78A 1RP7A 1CXZA 3UMSA 5DSZA 2HF2A 1XYGA 5DP2A 1FYDA 1Y4ZA 1W5AA 4B7ZA 4D4HA 4NBSA 1UODA 2QI9F 3VFDA 4A7PA 4FINA 4OQYA 3A1CA 3V9AA 1DBIA 2R751 5ECYA 2ZB8A 4MJ7A 4ZAZA 2O3JA 1GUBA 1HXHA 1Z2CA 4LJKA 2KPOA 1GV0A 1YR8A 4M54A 1CS0A 5BW5A 3BK1A 2CF6A 5DGDA 5EUCA 3WYEA 4QLBA 2JIDA 5G40A 2E4VA 2JA2A 5B6IA 5D87A 4JJZA 2J9FB 3MJCA 1IB6A 2X77A 2ZWIA 5DLFA 5J2TA 5AM5A 4IRKA 4M7OA 2FMTA 3OSZA 2DFNA 3G8YA 1VI5A 1M6VA 4D25A 2R6R1 3ECAA 1L1QA 3HJRA 2UXCH 4U7HA 3EWAA 3X1MA 3RS8A 4G5RA 2O2XA 4COKA 2SICE 2YWCA 3N2NA 3LUCA 3WKAA 1DCFA 5HP4A 3NCHA 1DFIA 3T1HB 4GMKA 3DDCA 3V7WA 2Q99A 4RD1A 4IQ4A 1MA0A 4CG2A 3M82A 2YWEA 2IT1A 4FQ5A 3DVAB 2P9ZA 3E3LA 3LT0A 1TL7C 5C18A 1CRQA 2QNBA 4L8GA 1R4NA 1ZJ6A 2PZGA 3GFGA 4QTYA 4UUBA 3CLSD 3W3AA 3INTA 1FVOA 5JYCA 2RDIA 2FR8C 5L51A 2AT1A 1ELOA 1JG7A 2H4YA 3DZDA 2W9CA 4G5HA 2XVAA 1EP9A 4LF6H 4Q37A 4IDOA 1HNZH 3V9PA 4N7MA 5DB4A 1A95A 1V5GA 4J9LA 4B3MB 1NG9A 4TQUS 3LM8A 1HX7A 5CD9A 5DW0A 3FWPA 4RFSA 3PO2G 2C54A 5DN9A 3QPDA 1ETHA 2CLEB 1WB6A 2L17A 4N3AA 2OWDA 3DTNA 5J2UF 4UU8A 1SJ9A 4Z6KA 5KFIA 1PWZA 2PGOA 1QRRA 2XF8A 3VR5H 2CLHB 1H0SA 4ZCSA 2C4UA 1PZFA 2G08A 3VSEA 3CX6A 1Z7WA 1NKVA 4MUAA 1PFGA 4ZO6A 4XVRA 3BH7A 3MPUA 3GILA 3IP9A 4LE0A 1R0XA 4U9UA 3AK4A 1XP8A 1O95D 3VU8A 3O73A 1KJNA 2HA3A 2CB9A 3EWSA 1HG0A 3Q15C 1W1IA 3FTFA 1NV9A 5KU1A 3KZXA 3U81A 2G80A 4BO7A 3ODPA 1APBA 1A5TA 3OQOA 2NYVA 2KLBA 2CD9A 1T36A 4D96A 1VHQA 5B7GA 1BU8A 2J5BA 4IJQA 3G5UA 3RIYA 3GDWA 4O7ZA 4BQFA 4JT2A 4QDXA 1BWQA 4AX8A 4DJEC 4EFKA 5ES4B 1P2UA 3X0DA 1R0KA 2HNAA 2UVPB 4UPEA 3HXPA 2QRMA 1VKHA 2BZ1A 2V54A 3R2JA 3G9QA 1U3DA 1UOPA 3OESA 2PD4A 4RENA 4QBHA 1LC0A 4UD6A 2GJKA 3QE0A 5IYBG 5DQGA 5KJ6A 1S8FA 5BYKA 4JI5H 1DAMA 1O9HA 4ZARA 1NHGA 3FTEA 1P4JA 4FUTA 4OQ4A 1SCDA 4AI6A 4P4GA 3T3HA 5I3CA 1A9RA 2IXGA 5HGXA 2CXXA 4RGVA 5ICMA 1OBHA 4K28A 3SU8A 4NYIQ 4F96A 1A0GA 1L4EA 2H4JA 2IYVA 2IBSA 4MH0R 4EQ5A 5EWJA 1X0XA 5K05A 3CX7A 4H2DA 4XVUA 3K6KA 2WAQA 4B2YA 3WGKA 3VNRA 4P8RA 4RXMA 1CVLA 1SVKA 4MCHA 3HCCA 1NX6A 4Q1CA 5AJYA 2O8BA 2A8YA 4YH1A 2DSTA 4EA8A 2DUJA 3RS0A 2AB0A 3QPVA 4POOA 1ORHA 2GERA 4U00A 2O5CA 4UQPA 2HPHA 2XDQB 2X3UA 2SKEA 3O74A 1JX6A 3TDMA 2GEFA 2NVUB 2D62A 2NU9A 3PIIA 3MIIA 1D09A 4HLNA 3KEOA 2HHCA 3O3CA 2GJSA 1R18A 3FOAA 4WXYB 3I2YX 3RRZA 1XZPA 4MS3A 2PN1A 3DMHA 4PIPA 2D0IA 5BV2P 2QT9A 4HK4A 3I62A 2XMBA 4EABA 3DR5A 1ZUHA 3LA6A 5B7QA 3HCNA 4BVEA 1L8AA 4LJRA 4TT3A 4B9AA 3AVYA 1RC1A 4GMDA 3R76A 4NZZA 3HKBA 3H97A 3U60B 5T14A 4M0UA 4UXHA 4W8OA 2ZUWA 3ZIUA 5IT4A 1R5NA 1JEDA 4WOKA 2CUTA 3B3GA 3VZCA 2X8WA 3X1DA 1ULUA 1WD7A 2UXCB 2Q0XA 1YB5A 4RQTA 4U7DA 1C8VB 4PFQA 5IYCG 2C4KA 3GY0A 1ZD3A 3G2LA 3VU9B 4J1QA 2I54A 3BREA 1CJMA 3MFHA 3JX9A 5L40A 4DV0H 1MVLA 4AM8A 4ZTUB 3FNBA 3HO1A 2WTNA 3NKLA 5HQ3A 3RFXA 6REQB 1N9ZA 3K8ZA 4DQ0A 3KVRA 1P3JA 3KLPX 2F1IA 5DISC 5JVDF 2GDJA 2WSMA 3DMDA 3R5XA 1UT5A 1YHZA 1CJVC 4P80A 1J0XO 2H16A 1JEQA 4NEGA 2XY4A 3PVSA 1AZSC 2NZ2A 2Z5GA 2Z5LA 1FA9A 1VE6A 1XUOA 4LQCA 2YS7A 5JE8A 3HXKA 2GD0A 2XMZA 1N2EA 4HYKA 2HWXA 5KWEA 4LF6B 4TS4A 1TM4E 4M0LA 2IYUA 1UBUS 1FY2A 3PXXA 2B6HA 3BE4A 2QZJA 3P9QA 4DFDA 2QVZX 1GD1O 1K6IA 1Z3IX 3A7EA 4GVXA 1A0IA 6Q21A 2Z4TA 1M6VB 3ZY4A 2W8BA 2JANA 4ZVTA 1QDEA 3E9NA 4ACBA 3Q3JB 3IFSA 4AYBE 3OEHD 3U3ZA 1Q0TA 1QQTA 3OKPA 3CRW1 1EDZA 1LFAA 1TXGA 3VC2A 3CPHA 4JBYA 3KYBA 4WE3A 3IPAA 1UEIA 5BWWA 3ISTA 4P4UA 1KI8A 1AG9A 4X95A 3AILA 3H86A 1C3JA 3AUAA 4F5EA 1UBCA 4UAJA 4TX1A 4R8UA 5JNSA 3ZCUA 1XXHE 1QOPB 5ELMA 1R4NB 1H2HA 2FPKA 3NV7A 4P53A 2ZSIA 4AWBA 2H2IA 1HTWA 1IXKA 2FHPA 1C7EA 4PHFA 4LI3X 4G0YA 3DT6A 2GZAA 1RQGA 2VJPA 3SZRA 2W2PA 1WG8A 2Z56A 2W9CB 2J7KA 3G17A 1X1RA 1VMAA 4QOIA 5KI6A 2Y9PB 5DOVA 4Q4AA 4F6CA 3U19A 3H9JA 3G9ZA 2QTBA 4QYWA 2W7TA 1DIGA 4ZJUA 4Q4JA 5LL6P 1JJIA 1CY6A 2DFVA 1UR5A 1SCBA 5JYEA 1GPNA 4RFSB 4MHOA 3ZIAA 5K8JB 4Z4IA 4KN6A 4J0EA 1ZD9A 4UCUA 1I7SB 1R6TA 3HCFA 4C4XA 1B7GO 3GV0A 2WDZA 3UO8B 1EK5A 3HJTA 3AJRA 1J8MF 3RAEC 3UXHA 2EGHA 2GBPA 4CLOB 3UUEA 4PYKA 4YBRA 1NMEA 3DCNA 4Q21A 4JI5B 1U7XA 4N9QA 2EWVA 2N1MA 4HL6A 3RIHA 3A9TA 5EHQA 3OU6A 1W5BA 3IURA 2XSZA 3IDFA 2AZ4A 3WNQA 2A3NA 3NOQA 5EESA 2RAVA 1XFAA 4MUFA 4MV7A 4P3OA 3Q8XB 1RK5A 3UWDA 3FJOA 1XTIA 1NAHA 5EWGA 3CZCA 3UQYS 4H6WA 4TM7A 2CSUA 1FTSA 1EVEA 2ZTUA 1YR7A 1I1LA 1QQ7A 1L5MA 2GQRA 5H1YA 3N8GA 3L8YA 1QF9A 3EE6A 4QDZA 4J0JA 3G8BA 3SJBA 3WGQA 4E6EA 3IAM1 2C0CA 2J0QA 1TFUA 1I7QB 4TTQA 3CBQA 2V6FA 1E2JA 1BE6A 3CKKA 4RFVA 4XGKA 3I6IA 3G6YA 1U5BA 1OGYA 1F7VA 2FFQA 1SHLA 2AC2A 3CLTD 1RJRA 4P7KA 1FW6A 4B3BA 4GL2A 3IUEA 3DTVA 3BIWA 1U9IC 3TIXB 3BIOA 4EHIA 1UBJS 2ONKA 1J7KA 4P9NA 4IDFA 3BZWA 2NXCA 5HE8A 3P71T 1YB4A 2OGZA 2V5VA 2OV6A 4F1JA 3HO8A 2CLLB 1QOZA 3SKYA 3KPWA 5FUMA 3ICCA 1Z4PX 4ZVRA 1WB5A 1BNCA 2WYVA 4JB3A 3B6MA 1PWYE 3H11A 1PFUA 3DL0A 1WDTA 2A35A 3ZXSA 3KZOA 1TUGA 3PG5A 1B74A 2DFKB 1G2QA 1XXLA 2GHTA 2GCNA 3SJCA 3GLIE 5LVAA 5EWJB 2NO5A 1Z6GA 3BD9A 3LBYA 4EL5A 4K6HA 3UMCA 3DV2A 3WFZA 2ZUSA 5P21A 5H5JA 3E58A 3R0JA 5FOVA 1UBNA 1BCRA 3CVZA 3V4SA 2N1BA 3EIWA 3E2IA 2E6KA 3RTXA 1DCMA 4ARIA 4KNWA 1R3UA 4CI0B 4DV0B 2IOHA 3HCBA 1I4OA 4N12A 2ST1A 4TQAA 5K3WA 1HA3A 3AY3A 1VXRA 3USCS 5TGZA 4QSHA 3ELYA 1WBBA 2X0IA 3A11A 4EKGA 4RNNA 1E18A 1E2BA 4OA8A 3HOWG 1XAHA 2FEXA 4Z7OB 3A6EA 1KS9A 3WI7A 1WNTA 3KB2A 4MARA 3DOOA 5L1IA 5FADA 2WP0A 1IWPB 4WV3A 2XYPA 4O59O 3OUTA 4QQ8A 2G1PA 3M34A 1HMYA 2D1TA 1EPUA 3TR5A 5L8VA 3OIGA 1MCZA 4D98A 4MYTA 2IVFA 3BXGA 5LCXA 1F2TA 4QWCA 6AT1A 3I9MA 4IV5A 3HKBB 1L3CA 3VC3A 1J2JA 4ZALA 3VKHA 2XWJI 2BP7A 5F21A 5AKKA 2C2MA 3CUKA 1E2UA 3KP1A 1KAEA 3RSZA 4XGQA 3EQ9A 4IHJA 2JHFA 4QDJA 2GDZA 2Q5CA 1C1XB 4EEQA 4HZGA 4QWMA 5SZKB 4IGKA 4YLYA 4KVZA 1X92A 4OXRA 4BAGA 5AVXA 1NLFA 1P39A 1C7JA 1VIDA 2OAEA 1N8SA 4ZI7A 5BSGA 4EMBA 3DPUA 5EIEA 4YT8A 2NUAA 3SN6A 3SOPA 4LZJA 4X61A 1JXQA 4FFLA 1Q12A 2W0SA 2WYHA 3S55A 3KUKA 1UC8A 4DDKA 2RG7A 1T8YA 2FPRA 2COEA 3B1KA 3TLEA 4B3JA 4NNJA 4BTLA 3A1VA 3EASA 1AGXA 1BW9B 1F0NA 2Q4RA 5AYVA 1VGVA 3IKVA 1EWKA 2AMLA 3VC1A 1K6EA 3GHYA 5DBIA 3MWDA 3M4NA 1Z37A 5CT4A 3TQIA 3E35A 2JAXA 1SIOA 1U3TA 3KDSE 3OIWA 4A8HA 5LKAA 1KUTA 2ZYWX 3GJ4A 2YYZA 1NF8A 4P3NA 3G2IA 1J9GA 3KCNA 3KYCA 3WA6A 3V1KA 4QOFA 4B4KA 1KF0A 1S0MA 3EPJA 5K3EA 1NI4A 2QX7A 3LLSA 3BJIC 2BMDA 2LKCA 5IUNC 4DY6A 4PLPA 1CDDA 4XVCA 4UE2A 2QORA 3VV2A 1JALA 1SBHA 4PYMA 2C2OA 2D1FA 2VUUA 3NVKI 1Z0FA 1KARA 4DDHA 2AHOA 4EEKA 5CDYA 3VPBA 4PG5A 1I6WA 1NYLA 3V8NA 3GLGE 4DMKA 1VPDA 3NGXA 2JBWA 1C14A 3SXPA 3EF3A 4H7JA 4OUDA 3PGVA 3VNQA 2V3CC 5C9ZA 4A6PA 5K9ZA 1Z0AA 1BTOA 4EZIA 5KYXA 4M89A 2B7LA 3O5AA 2BF4A 1ULSA 3ZWWA 5AXBA 2ZXFA 3THWA 4OKIA 4EBCA 3O7WA 3Q8SB 1V16A 3R3HA 5CB0A 1O6GA 4UVEA 3HKZA 2R96A 1G38A 3UCEA 1IN7A 3QELA 3ZN2A 2Z8YM 2WUDA 2WF8A 4Q4JB 4ZPXA 4O1MA 4FDUA 1BHQ1 4XCXA 2VJLA 4NYMR 1WCXA 1HDXA 3WJ2A 5LM3A 1KEPA 4G8JA 4LEIA 1AV6A 4JBGA 2G82A 2YYYA 5CXUA 4L5YA 2JL1A 3NATA 1JDNA 1Y5RA 4OHKA 4CZ2A 5CP8A 4QPZA 5L4NA 1U2SA 1ZA1A 2A1UA 1YQGA 4HDMB 2BFPA 1COWD 2BT4A 5K3FA 4CL8A 3BORA 1KZ9A 1DEKA 3AUUA 1Z35A 1V47A 1N36H 4HGYA 4FKMA 4DV7H 3CISA 4YR0A 1X7ZA 1T0JB 4UHHA 1WW2A 4AMZA 1Y1WA 3U31A 1TAQA 2BFAA 3G79A 1GZVA 4LHVA 1I33A 4B4DA 2R5NA 3LKZA 2NP7A 1U5BB 2PSEA 4WEOA 1VYTA 4FDTA 3IDSA 1POXA 2D4HA 4N03A 1KQGA 1ZIXA 3DTVB 3NAZA 4BUJA 3VZQA 1EB8A 5EVJA 3PU6A 2V6IA 1EINA 1TF7A 3C6BA 3F4LA 1VSBA 2D54A 4O2RA 1Q2UA 3EGOA 1KY3A 2OCXA 3IA7A 2MSWA 4DEVA 4MUHA 3DOEA 3NAQA 3OLWA 2HA2A 4U6NA 1HUQA 4RAQA 4QXMA 2IW1A 3PDCA 1I0ZA 1BE0A 1X1SA 3CZMA 1IBCA 1MOZA 2Y1LA 4L5AA 3CRMA 3UJAA 1DEXA 4GOKA 4DQLA 4LOIA 5A4KA 2YFKA 1QAQA 4CG1A 3CGWA 3L0OA 1H2EA 4EO9A 4LDAA 1UXHA 3H3XA 4RF3A 1OZAA 1WCIA 4R9SA 4ETNA 2WHYA 5HF6A 3SWWA 5KYTA 3EXFA 4Y6GB 1FSPA 3GA0A 1BCRB 1OX5A 2QM7A 1U7TA 4MR8A 1VE7A 2GBLA 5H4GA 3U4DA 2A1IA 2A0WA 3GXOA 4IIJF 5TC4A 2WHRA 2YZMA 2RH5A 5EHXA 1JSLA 3CF2A 2H00A 3L41A 1M0SA 2OQ2A 3NGDA 4HC4A 5AJWA 4X65H 3QV2A 4LF4H 4W1PA 2EFHB 4XVHA 1FYXA 3BTUA 3QYFA 1DI0A 3PFCA 3D8TA 3FZQA 5IM4A 5IP5A 1LSUA 2UVDA 1KJJA 2CFCA 4UREA 2HEIA 4KUGA 1UUFA 1NRIA 2W2KA 4DCOA 3G2HA 1P7WA 2R5WA 1F17A 1MHPA 4J7AA 2AMYA 1A5AB 1IY9A 1E89A 4RZ3A 2G3YA 1JWBB 1XEWX 3RW9A 1X7XA 1Z7GA 4FYWA 5AXDA 2Q21A 5BOSA 1F06A 2J08A 4FR0A 5DMXA 3OQPA 2HJ9A 1DRUA 3ZYCA 5C2JB 2DHCA 4BMSA 2QN8A 3OSPA 2BP7B 1L4KA 2GTPA 5J5CA 3KV3O 2YNMC 4BJ5A 2PNFA 3KU1A 2QT1A 4IHJB 2AG5A 1TJ4A 3PKJA 4MHSA 4BV8A 5A6SB 5A3JA 3GJ7A 1JAXA 2A94A 1MRZA 3MTJA 2WF9A 3B9BA 5CB6A 4PZ8A 1DBVO 1IZYA 1HFEL 2NZUG 1ONSA 3PQ5A 3FSGA 3ADDA 3NZEA 2BEUA 4FU0A 2DP4E 1NVGA 5H83A 2E5WA 3WR5A 3VOAA 2NUAB 2Y8EA 4Z2YA 1DZ3A 2C2YA 1D04A 1KTVA 2J32A 2CDCA 4N3GA 4HLCA 3N53A 2AHRA 2V59A 4EGCB 4LF5H 3ZGZA 5AJZA 1AGNA 3S29A 3I9V6 3CS3A 4GYYA 3K53A 2QUJA 4MQ6A 5AIBA 1G17A 2NSDA 5K51A 2RKWA 4ARAA 1A1SA 4LJLA 3HJGA 1RIIA 3PPXA 1MT3A 4K9LA 2XE6A 3MWDB 3EIFA 1SBQA 4DR6B 2QQGA 1ONPA 3IUNA 1DOHA 4GL4A 5DTRA 2QJTA 3AI7A 4RACA 2ILTA 1Y4DE 3LS2A 4BMCA 4NRDA 1ZO8A 5K3OA 4FYXA 1CJBA 4FR5A 2WHPA 1C5KA 3DAYA 3QX3A 1AHPA 1NI4B 3A4TA 2CLDX 2VT6A 3WO1A 1J0CA 4CL0A 4E5DA 4MUMA 3KSBC 3W7AA 1EP2B 4QARA 3GJ3A 5JAOA 4XRGA 2IEZA 5C7LO 1JU3A 3NNSA 1FL9A 5CLIA 3PGA1 4Y1EA 2B1IA 3P9YA 1O5TA 2WTBA 2JH3A 5LDHA 1HYBA 3MGCA 5LUBA 1VKZA 1GFZA 2JFNA 4FHGA 3GLHA 1YL6A 3FB4A 1TYDE 3LTEA 5ITZB 2HGXA 3VU0A 2IUSA 3EG5A 3KHUA 3UKJA 1CZUA 5DI9A 1VKOA 1C2TA 4FE7A 1AQ6A 1N36B 4OUDB 4LV8B 2QE6A 5KYXB 4EFBA 4P4TA 3RBAA 3THWB 1PKEA 1T2FA 4C7OA 5GONF 3OZ7A 1O7JA 1P18A 1V16B 4F4YA 3NMUF 3LT4A 5DM60 4BMPB 1QH9A 1E3TA 1YZKA 3IDQA 4LC0A 1UJ6A 1SOMA 1SXPA 2E21A 3MJVA 2I78A 5DU2A 2W2TA 1PDVA 4NCXA 1BN6A 3CEMA 3HI6A 3TGPA 2IEIA 4RK5A 3UJ7A 3DC7A 2GO7A 5A9RA 3P2KA 4ZQFA 2GT1A 4OLJA 3SX0A 3DMFA 3H9GA 3WX0A 4KP7A 4D79A 3URMA 1VLJA 3HT5A 3MLEA 4M0EA 3AHCA 1EFAA 5FTJA 1ZXLA 2SHKA 3JYOA 2P0AA 4D92A 3N76A 3V4LA 1K8YB 2XBUA 4IOMA 4TV9A 2VHQA 3KOZA 4B9EA 1X15A 4DQUA 1G64A 3AEZA 5FWDA 1LGYA 4N0QA 2A1UB 2DQZA 1IXZA 2CWWA 3O0TA 5K3FB 2H1OA 2HFKA 1KMHA 5GINE 1TAHA 3LIIA 1GHTA 4ARCA 3AZOA 3OF5A 4HAZA 4I3HA 2VDMB 2VDVE 4I0WB 4ZMSA 1T9GR 2QRGA 1QGZA 4Y1RA 1X7ZB 5F33A 3GGGA 4G0UA 4H59A 2GN9A 5ICGA 3BA6A 3EEYA 4D4KA 1VFNA 1K86A 2VPTA 1TAEA 5FJ8G 2DR3A 1HMPA 4JEHA 2ODPA 2ZWMA 1TZMA 5A0VA 2FW6A 1W4CA 1RCUA 4B5LA 4W5JA 1O89A 2XODA 4X65B 3ICWA 4US1R 1PJCA 4LF4B 3A2LA 3WSTA 4ND8A 4DF3A 1KO8A 3GEBA 4GPAA 2V4UA 2GZ1A 5ENDA 4MGZR 1BE1A 3N8HA 4KIGA 2F4NA 1XTJA 3ZKWA 4RWZA 1U65A 3LYAA 4X62H 3D5QA 5EE0A 2QNIA 5EZYA 1KHHA 3RYFB 3HXMA 1AT1A 3ZH2A 3M5PA 2X9VA 1YDHA 2D0PB 4ZEVA 4BZXA 1CUJA 5TSDA 1RSZA 3LQYA 1RI5A 1Z12A 4WASA 3GRRA 4FGJA 4R0NA 1YJAA 4NU5A 3JD0A 1G8FA 5E7MA 2FCAA 1AS3A 3RS5A 1LDYA 5HRAA 3K2BA 1Y1SA 2QAGC 5B3LA 4KWCA 1PYGA 4B46A 4OLAA 1N2CA 3PUKA 2P2ZA 3OJWA 5IAEA 5DNEA 4BNYA 3UJBA 4CV3A 3L02A 5A5EA 2DOKA 2P3OA 3OI7A 1Z33A 3EXFB 8ADHA 2PLRA 4DA4A 4QECA 2GYWA 4JU9A 3IBYA 2QE7D 4HEHA 1MO3A 3U3XA 3ESAA 1FYWA 4GKKH 4EX7A 3BACA 1IM2A 8AT1A 5HSGA 1Q1QA 4D0SA 2XITA 3V4VB 3GHHA 5L3SB 2BMWA 3L0SA 2JGNA 4J0QA 3TR6A 2KLHA 3IKJA 4LF5B 3M9NB 4PPGA 4RO0A 5FOTA 4Q02A 2W2KB 1QMGA 1BMFD 3BSYA 5LBUA 1LBHA 2ZI9A 1OZ0A 4HFMA 3HCPA 1DNPA 2P5SA 3TLZA 1X77A 2P2NA 3IGFA 4DNFA 5TT1A 3H9BA 1RKUA 4MR9A 1VIYA 2PZMA 4J9KA 2ZDQA 3AVOA 3S81A 1VB5A 3EVGA 2GI4A 3NH6A 1UPTA 5AK4A 2XB9A 1X7XB 4HN9A 1NIPA 3R5JA 3FAKA 5U1PA 2OV3A 3PDUA 4ZI3A 1U1DA 3T5GA 3USES 1NR7A 1ORWA 3N42B 2DETA 1GQ2A 2Q0QA 3NX4A 3U4CA 5D8DA 3FCUB 2H11A 3P2EA 1GLNA 2LDBA 1CR4A 1J99A 5IVDA 3E8XA 1L4LA 1NY5A 2JK1A 4IW3B 3SD7A 1R88A 1K1SA 4BCDA 3R5TA 5T64A 4C30A 3BN3A 4F9EA 4NCBA 1REQA 3AVWA 5JRDS 4Q93A 3W77A 2ZI5A 4I1IA 3V6JA 3NANA 3R3WA 3RFUA 1VPTA 1TKBA 3V2UA 2I4OA 1UWKA 3EOAI 4LGYA 2ZCVA 1O5OA 2PBRA 1RM5A 2J0EA 3EFHA 3RUDA 1JN0A 4DGSA 2QL6A 1JFFA 3UMVA 1T3TA 2H57A 3KQHA 1CKOA 4R2HA 1GQSA 3DPSA 4HAWA 3CA8A 5IG2A 3JWGA 1CY2A 5KNDA 3HU3A 1MOSA 4Z9XA 2OWOA 5C8ZA 5KJCA 3W78A 3T7KA 4LOLA 4Z0PA 1WSBA 2DC1A 1P45A 2W6ZA 3CRZA 5K6RA 2QWXA 1CUVA 4MA5A 1V71A 1DWUA 1M33A 4OJYA 3ZZMA 1CR1A 2GEBA 3X43A 3FN4A 5KFQA 5KTKA 1G4AE 2QW0X 2BEVA 5FD8A 3ZEAA 2WHPB 2CMGA 3ROPA 3ZJ5A 2X0NA 3PFGA 1VPWA 3U3KA 2OL4A 3PDHA 3F8SA 1GGFA 1E8MA 4FM9A 4NHEA 1TJNA 4WW0A 4IVNA 1I32A 1AQJA 3AP1A 2EFJA 3ISVA 1AO3A 4RETA 3PZBA 2WIBA 2PUWA 2ZBPA 4D8TA 4E12A 2DABA 3HOXG 1ZRSA 1VMIA 5IKEA 4LKRA 4O7RA 3GLHB 3V8QA 3B82A 1QFXA 4QYXA 1P77A 5EA2A 4DL4A 1Y4AE 4D9JA 1VJ1A 3ENQA 3ZDYB 1MJHA 1S68A 3MR2A 3HLKA 1KSFX 5HKLA 3WK9A 1A9SA 5KNDH 4K6CA 3LCUA 1Q44A 2OCLA 3STYA 1NWHA 4BBZA 4C7OB 4ECAA 4WFKA 1XVAA 4YI3A 2DWQA 5G1OA 3EZFA 2VJDA 3IBTA 2OV2A 4GMGA 4MWBA 1GGMA 4C4AA 1K83A 1OREA 1KDZA 4EM6A 2BTOA 3N9IA 1JLHA 3H5TA 1YU9A 1H1DA 2DPYA 1VBGA 1SVWA 2QPLA 2WWFA 3SYTA 4K2AA 4GE0A 1F4LA 1T4GA 4RAZA 4X62B 3R7DA 4NXMH 1YA4A 3UPTA 3GJ5A 2GHIA 1HDEA 3EBPA 1C2YA 5IABA 5IMSA 2DR2A 4AO7A 4JI8H 4KBFA 1LK7A 4F4IA 2H18A 4RB3C 3CVOA 3RF7A 4TV9B 2B2CA 1OF1A 5GM2A 4RY0A 3AIOA 4I7HA 4WXPA 2LW7A 3RIXA 4RY9A 3R7NA 4HD8A 1YF3A 4X64H 2JIZA 1S01A 1KMHB 1UBKS 1NXPA 3ZLBA 1OBOA 4F93B 2IIQA 4ACAA 2BTEA 1M1YA 1JIHA 4KRFA 3R4VA 3H6KA 5CVCA 3RC3A 1EHYA 3CR3C 2JA8G 4Y1RB 4Q6BA 2BRUA 4WXEA 4LVOA 4MLZA 2XB4A 4QX6A 1Y34E 1OZHA 1THGA 1NM5A 3KQWA 4WZAE 2YNMD 4GKKB 4C4TA 4V0SA 5C4GB 2O2SA 4ER5A 1T2EA 3W5OA 4UTPA 3CEAA 5BW8A 2GK7A 4G4SO 3GCGA 4ND8B 4MX8A 2PZAA 1NMSA 4BQIA 3ZKWB 3R3XA 4AJJA 1LPSA 4OGKA 3CX4A 2JAWA 3AM4A 5EZYB 1ZK2A 2VNSA 4B6PA 3DMTA 1VBKA 3UKDA 4RTOA 1E0SA 3RLFA 1KXJA 5C3UA 2BMEA 2EJ2A 4XQGA 2C7QA 4HOYA 1F0YA 2I2FA 4FFVA 3Q2OA 1NFRA 3TH5A 2AQ4A 3EBOA 4CMKA 4R1MA 1W48A 1HT2E 3MRXA 3GTKA 5MGNA 4ND5A 3TFOA 5BSKA 1M2JA 5P8WA 2YHAA 3EZGA 1N2CB 1EZZA 3AUSA 5I9LA 4OB7A 2W90A 4L07A 3WLAA 4NXNH 5I9TA 4M1QA 4ZWNA 4MYUA 3H8JA 3I61A 1YFLA 4P3XA 4BY1G 5LA6A 2VUHB 2R84A 1EM8A 2JIRA 4KXWA 4OX9Y 2J0SA 1PO7A 3WL7A 5KNCD 4YP0A 3QE2A 3B38A 1XKLA 5BWLA 2RI0A 1XPJA 3D6AA 3ZLVA 1GZ4A 4IDGA 2P62A 4O3OA 2XYGA 1NN5A 2FWIA 3LQ1A 4LJAA 1B16A 1CNEA 3JZMA 1ZVKA 3QEBZ 2E2HA 5UKDA 4ZDIA 1UDBA 4DYVA 2P67A 1I2CA 2J7PD 4RF4A 5FLXA 1TEZA 4HMPA 3PW4A 3ZDCA 3QG5A 4IH1A 3A25A 4CBVA 4MR9B 5BP7A 2QSYA 3KB8A 4ZEOA 1IVNA 4EO4A 3SHTA 5FR2A 2F00A 2I91A 2GAFA 4WKNA 3T4PA 3C8HA 3NEAA 1B42A 5CFZA 2X7XA 2VPQA 5JBQA 2WAOA 4LF9H 3S70A 1B93A 3G6KA 2VNIA 3V33A 4UM5A 3JQGB 1XA4A 5CCBA 3VISA 4RGQA 1K0FA 3JPWA 2Q2QA 2VPSA 3HUFA 2LXNA 4QRHA 3KTFA 3H1AA 4O7YA 1KQNA 4F8JA 1RJEA 2QLFA 2I9PA 3PJGA 3W5IA 3PW7A 2AEJA 2XUZA 1REQB 2AWOA 3EMKA 4F9GA 4FDVA 3I34X 3RGXA 1NQ5A 5IYZA 4LQLA 3UV6A 3M0EA 2R7MA 4XFDA 5JLJA 1OLXA 1V8OA 4I1YA 1ZVJA 2OV4A 2H1FA 4RZSA 1Z2PX 1Q17A 3OEEA 1QHHA 1JFFB 3KSAC 3H04A 2P6NA 1IXYA 2VP6A 3R6LA 4CMJA 4LGCA 3ESZA 1EG2A 4DR1H 2P9FA 2WFMA 4X1YA 5FOQA 4RH1A 1Y5MA 1T1JA 2CJWA 3NXSA 3I1FA 4JBXA 1E1QA 1B43A 4N5MA 3WDSA 3R4CA 4PSVA 4WLEA 4AUMA 2TS1A 3AI1A 4F6LA 3H16A 2BEVB 4LJ5A 3WXBA 5KB3A 3W34A 4QODA 2BQ3A 1UOEA 3T7CA 1IZ9A 2FDXA 1VKRA 4BNXA 1VL2A 5TARA 1KSHA 4NXMB 5J58A 3T1NA 3EC2A 3EGIA 2B0CA 3X2FA 4Y0AA 4JI8B 3JQPA 3FUXA 3LHSA 1R4ZA 3KYJB 1JI0A 1L4YA 4F1KA 1NVKA 2ZBDA 4TLEA 3EIQA 1CUSA 4EG8A 1GQYA 3KTMA 7ADHA 2L19A 4X64B 5KMGA 1YBMA 4NR0A 1CW2B 4QPJC 5EGSA 2F8MA 1AF7A 5JCZA 2OFPA 4MUNA 3L8DA 2AJLI 3GV8B 4A8PA 3W3AH 1TIPA 1DP4A 2IH5A 4QXAA 3DDNA 2R7ZA 4JVMA 1HZJA 1N5LA 3MUOA 3SC3A 4UFZA 2ZK7A 5LJIA 1U0GA 4YRKA 4RZQA 2Y1DA 4PGFA 4CGYA 3OZSA 2ZGIA 4C7XA 4YRFA 1HRKA 1R0RE 2XGMA 4LNAA 4OL0A 4MO9A 4YJDA 4J1SA 4B32A 4U7GA 1NR1A 3IP6A 1C3XA 1IHPA 2X42A 4B8ZA 5CB4A 3EA5A 2JFGA 2ZROA 1C7IA 1Z68A 2NG1A 1J2YA 4Y6LA 3KHLA 4WKGA 3TNFA 1M5TA 2HBRA 3X1ZA 3FPLA 2NV6A 4GR9A 2P68A 4D3SA 1I5OA 3WOVA 1J2EA 4EQZA 1YONA 4I19A 3IP1A 8LDHA 4AMYA 3ITKA 4EH1A 3VVMA 4BNJA 2OO5A 1E5DA 3KE8A 2DAAA 4YUVA 3UC5A 5HOEA 4QM6A 4FZJA 4CI9A 2Q2NA 5IULC 2FEMA 1AN9A 4HUQA 1MFZA 1E60A 2PXXA 5DGIA 4IIUA 3ROKA 3O2NA 1AUOA 5K8IA 1Z9BA 4PLGA 4NXNB 1FRQA 4CQJA 1A4RA 4YMWA 2DH6A 3FG9A 3EVBA 1WUHS 1ZOLA 4AUNA 3OCCA 5CTAA 4ZCIA 1O0SA 2FEWB 2D06A 1KYZA 4UTXA 3IAFA 5L45A 4EPVA 2PS0A 3IIEA 1WW3A 2VQ3A 2G28A 4TVKA 4WACA 1VI6A 5AKYA 1SG6A 4M1ZA 3RV4A 1FK8A 5CLFA 1JILA 4H9GA 4ED8A 1P2VA 2OV8A 3PRJA 3T4EA 2YS6A 1OQAA 4REMA 3HHPA 4RAYA 3UHPA 2P0YA 3VSCA 2ORVA 4U02A 5E1BA 1PQPA 2ZVDA 2VPPA 2BQRA 4IO0A 4PYNA 4RY2A 1T94A 1KSJA 1H2FA 2CE2X 3VMFA 5JPCA 2F7SA 3EVDA 2J33A 4OXYA 2Y4RA 3EGXB 4LF9B 3AM5A 1VJ5A 3HXTA 3N28A 1CZNA 4KQJA 3A58B 1V4YA 1EQ2A 2B9VA 4U2BA 1J00A 1L7VC 1O2DA 1UBRS 2H4FA 3IE2A 2IPAB 3IHTA 2YY5A 3C41J 4QU8A 1SZPA 1X8LA 4WINA 2CHUA 3OQVA 2CN1A 5EEHA 3I83A 3ZVLA 3GUCA 1CYEA 4IGAA 1XL0A 4X66H 4O82A 1MXFA 1EM8B 1VJDA 1ECLA 3V7UA 3TTUA 1NF9A 4BMOB 4KW7A 3DH0A 1RE1A 2WAXA 3W5AA 2QL5A 3SNOA 2LKDA 3T0GA 3HC7A 4RNMA 1A8IA 3Q3CA 1YB7A 3RSHA 4D3XA 1SA0A 3OJOA 1OJ7A 5A04A 4WHMA 4EB6A 2LTAA 4AJIA 5M04A 1CS0B 4U7WA 1UQTA 3TRHA 4DR1B 1A72A 5TV2A 1EDOA 5A62A 3PD0A 4DIDA 2PM8A 3LAWA 1Y42X 4WXMA 2XHEA 1HNZB 1Z5PA 3MCZA 4AB1A 5J2TB 4YJFA 2RGVA 4KRGA 2P35A 4GQBA 5I6DA 2AIRA 4RXTA 1DGQA 3GB9A 4PDBA 2F67A 3F6SA 1FFAA 1W6UA 3OKAA 1R16A 4QGGA 3HWX1 3RRYA 3HY4A 4E5UA 1NURA 1VLHA 5CM2Z 1T2AA 3U61B 5F7XA 4HDOB 3GD7A 3RTDA 5HBRA 4IMJB 3AUFA 3O4GA 2GM4A 3T7EA 3ZBPA 3DT8A 3QI2A 2QXUA 1L3BA 3VPAA 3U5ZB 1T5LA 1JAIA 3JASA 3MTGA 4MEAA 4ZVLA 1OLXB 2ZYHA 4LNUA 3GBSA 4TYPA 2BZ0A 1Z74A 2R93A 4OH7A 1TEVA 4L9AA 1SM4A 4J0IA 2H9YA 4B33A 4CMEC 3HVUA 1FMJA 5FTLA 5CHEA 1IOLA 1UC5B 3EGEA 5KG1A 4ZC8A 4WUTA 1CZHA 2XUPA 5JPDA 3QE9Y 4ED1A 2CJWB 2AD1A 3P0EA 1ISPA 4IS2A 3WRVA 2DBYA 3LCMA 1PRYA 3PXCX 3VGPA 3VZBA 1O95A 3SQXA 4AKGA 1KRHA 3O31A 4BO5A 2OHXA 3RUCA 2GF9A 4HQLA 3TX6A 4OQNA 4XIJA 3ZDZB 3W6PA 2C31A 5FBLB 2FNAA 1JFLA 4MKHA 4PNHA 3V48A 2NSHA 4BV2A 2GSWA 3OHSX 1QO7A 4OFZA 3WMGA 3NC0C 4YJ2A 4B7XA 1QIDA 3OU7A 1J49A 3IQHX 2YXDA 4W5NA 1M6EX 2WFZA 3AETA 1CJSA 4A3IG 4B1FA 2XUOA 2C3OA 4G81A 1PG5A 3NT5A 1ISMA 3VKFA 2IXEA 1E0KA 2G8LA 2Q5HA 1JSCA 3LPAA 4NPAA 4K6NA 1YR3A 5LKRA 3AYXB 3U6BA 2I1VB 2P30A 1PZMA 4QPDA 3OHBA 1KOGA 2HDNB 3ZI0A 3HBMA 4FW8A 1ZK1A 1T36B 4C87A 3PW5A 2CNLA 4UPDA 1Q11A 5D85A 3T5KA 1FXWA 3NWOA 3DZ8A 2J3IA 1JZQA 2NO9A 5CB4B 4D6XA 2H2WA 2OSBA 4LY6A 4KDFA 3IHKA 3KIPA 4YP7A 1ABBA 1QYVA 1ZFNA 4YAFA 4A6XA 3WGIA 3PITA 1TUIA 2QR3A 1X1AA 2MCTA 3EF0A 4AS1A 5JQGA 1GL3A 1OX4A 1BGVA 3W2HA 3GV5B 2VWHA 3L9WA 1I1OA 4DWJA 3LUGA 1UBHS 2QTMA 4KIFA 1THZA 1MIOA 4UBKA 1DAPA 2QYTA 2PVCA 3JQ8A 1RR6A 1WCWA 4P5EA 1FUKA 1E9EA 3HCOA 3K0BA 1T4BA 4C0JA 3HOYG 4NEQA 1E2PA 4WY2A 1LI7A 1JG1A 1IPFA 2ZSFA 3QRWA 3HRIA 1PR2A 5BWBA 1GLGA 2PX2A 1NX9A 1AKRA 4IDDA 2O8BB 5KT7A 1EQAA 1JEOA 4H7HA 1GA1A 3OZFA 4AXBA 2WB2A 3N0TA 3WLJA 5AM0A 5SICE 1J70A 5KFHA 2WNHA 1I7PA 5K20A 4DLKA 4M8KA 3K94A 4LJ7A 3PQDA 3N5KA 4ZOQI 2NU9B 3L6DA 4RTLA 1E59A 4DQKA 3CB2A 1FDSA 1Y3HA 3M9LA 4MVXA 2JPDA 3QLVA 4G1CA 4MS3B 3E3NA 4ZGGA 3U3MA 4F21A 3G2OA 1E5VA 4UQOA 4E7OA 4N0MA 5FV7A 1I13A 4RKRA 1LPPA 1L5YA 2G1UA 3LKVA 3QIAA 1PZXA 1E20A 4AG5A 3V8VA 3KFXA 3ZS9A 3MTDA 4J9VA 1IN1A 2C97A 4YMGA 3GJSA 4PYOA 2RHBA 1V45E 4K6FA 1CS4C 2F64A 3V80A 4MIEA 4NFLA 4UE3S 3A4LA 2R68A 3N7AA 5IFLA 4JLSA 4P4LA 2H9IA 3N8IA 5DXJA 1RYMA 3SIRA 5C1BA 1Y37A 1RPJA 1TTTA 4XRRA 5IRCD 1PSZA 5KT4A 1BQEA 3KNZA 5MHTA 2RH8A 1M74A 3P7MA 2J3MA 4ZAWA 4NBRA 2J6UA 2WWVD 3I2JA 3DE2X 5A7HA 1G3QA 3C1AA 2J5RA 4RHFA 4JP3A 3TEKA 5HQ3B 3CXUA 4Q7LA 2QU8A 4NOLA 3GFQA 5EYPA 3REFA 2R87A 2EGGA 4G0NA 4YRNA 1XTSA 3PWTA 1SA0B 5T8KA 4I1RA 1O75A 3N6RA 1JEQB 3PPVA 4P83A 3SCZA 4HO1X 3OEHA 4HQKA 3B2NA 2WA1A 1B1CA 1AOXA 1KL7A 1LQ2A 4EB6B 3UYKA 1JGTA 4FWBA 1GZ7A 2BGKA 1RWMA 3N58A 3AB8A 3H5NA 3X1XA 4BX9A 1BOOA 3G3EA 3PXDA 3ZTYA 2DEUA 3DDWA 3NLLA 3B60A 3GIDA 3JVUA 1EGMB 4J76A 1JQBA 5I01A 4X1IA 5DMHA 4WNCA 4YJFB 3BXOA 4GGMX 4PY2A 3ONDA 4HEJA 4L7QA 4UD2A 2IP2A 2W8BB 4E1VA 5JRJA 3IDZA 1SXJC 4QU5A 5DWDA 4J3JA 3C3JA 1A9QA 1T3NA 4C3UA 2RD2A 3K2QA 4AS2A 2ECKA 4MDHA 2XB2A 2FK2A 1KVUA 2YV5A 3AGPA 1KZHA 5I47A 4TYQA 1J5PA 4WFJA 1E6KA 1X3LA 1ZG3A 2QMEA 4F9FA 4XIYA 5AKEA 5JCXA 3L7OA 2Z83A 5B4VA 4G0WA 5IDQA 1ZR2A 3TL3A 1X80A 3JASB 2PUDA 2OGUA 3IMGA 3UICA 3PI7A 3U4QA 2O2YA 1EJBA 4R8UB 2GPJA 4LNUB 4C4YA 4JIMA 1QGUA 1M6HA 4RM3A 2O07A 3I4LA 5PGMA 1KE1A 1CETA 1YMUA 1JQ3A 3UB4A 2MMGA 1Y3BE 1JT9A 4E09A 2W5UA 3ROXA 3RUHA 3NYIA 2E9SA 1VB3A 5EIXA 1E2NA 4Q4AB 5AJXA 2ZZMA 2Z8YA 3FOEC 3RHZA 3BF7A 5AVOA 4Q3BA 1F2VA 2D00A 4S3MA 3FDZA 3HY6A 1SELA 5FI3A 1OJLA 2E4AA 2Q3FA 5AVSA 1PF7E 5T7BA 2G4LA 4U2EA 1K98A 1KIMA 2C7PA 4IV0A 1XTPA 1VIVA 3J80A 5CGZA 4QA9A 1IDN1 5IUKC 1Q0RA 5IHXA 5CLGA 5CFMA 3ZU3A 2CFSA 3O92A 4JSRA 3GIJA 2NUBA 2ADOA 5A3SA 4YJ2B 5CK4A 1L7PA 4R71A 3PF9A 2DSNA 1KH1A 2ZRQA 4J43A 5I7HA 3DAAA 1SKMA 2R65A 1PHPA 3AHHA 3AETB 3HDTA 1NRXA 1V41E 4ENRA 3NBZB 1NP3A 3N3AC 1Y33E 4B4WA 1CPYA 1C3LA 2HA7A 1Y82A 4CCSA 1OZGA 2HXSA 4R8SA 4X8MA 4X93A 3BICA 2BJHA 5KFRA 2N47A 2PR2A 4A2AA 4MQEA 1XMJA 4D02A 1YCDA 4I55F 4BE4A 4ZU3A 3ETGA 4L0CA 5D7BA 2DB3A 2JLBA 1E3WA 1K06A 2EJWA 3I4FA 3IPXA 2CVOA 4JUAA 3AEYA 3DV0A 5DLQC 4F3RA 3P20A 1G3RA 4OAPA 1GILA 3ZDQA 1GL7A 3QYJA 3L04A 3WJ7A 2ZGVA 2I4MA 1JFSA 3V8PA 1H42A 4GOJA 2D2FA 5JQGB 3EW9A 5K6TA 1Q7GA 1JIXA 3G89A 4I6EA 2O23A 2WC1A 4HNRA 2CYCA 4X7MA 3LBFA 1XZDA 1O6BA 3QYPA 4LZOA 5K4GA 1LC3A 4ZK6A 5F5XA 3NRBA 4N7JA 3F7NA 2NPIA 2CYBA 3H11B 4RIEA 4FBMA 2IOQA 3JQ8B 1WUJS 4REOA 3W6ZA 3H0CA 3QFHA 4OMFG 4KI7A 4KDCA 1JVNA 2EARA 4K6OA 3WDKA 3EIOA 3AI3A 2VF2A 3R7SA 4BGDA 5IUJC 1WETA 4US0R 3UK0A 3DLCA 1O8CA 1XNHA 1ML3A 5E9JA 1DXQA 2OFFA 4KJXA 5FNZA 2A5DA 2CKMA 1O4WA 4JDPA 3C24A 2ACVA 1VS0A 2FR8A 1N56A 4MWTA 3O84A 4PQYA 2YIMA 4XWAA 2OG1A 3TNYA 4BMZA 1GAQA 1KI1A 3VZSA 5THKA 4RTJA 1OMOA 4IIYA 1QIMA 4YGXB 3GLSA 5JD6A 5FBRB 3G2QA 1YE3A 5B53A 5BN5A 1C7RA 4TYNA 2VF4X 1XNQH 3OJXA 4J1TC 4V0KA 1L7EA 4MTEA 3JYPA 1R6DA 3THXA 2R6CA 1YS2X 4L4UA 3F71A 1ULTA 4JI3H 3OTGA 2V7EA 4O0MA 3DP9A 2Q0HA 3K9NA 1SNYA 4QBGB 2VRBA 4HI0E 1L4NA 3TZEA 3QWAA 9LDBA 4Y2RA 5KQPA 1JEAA 2C3PA 2UZ1A 3W8FA 3HXOA 2ZS8A 1F2TB 3HYNA 3ZQUA 1G20A 1SQ6A 4MS4A 1KY5A 4ED2A 2D0OB 1DXYA 3PNPA 4RZIA 4UBLA 3N40P 4ZI5A 4BLUA 4MTLA 4WN9A 2Q2TA 3AL0C 4GSLA 5DULA 4D9MA 1WCMA 2ZCJA 2G9NA 4IJ6A 4DYDA 4DCSA 2LRHA 1RRPA 4ZI7B 4FYHA 2PUJA 3PNSA 1U94A 1Z26A 2TSYB 4ZVSA 4CV1A 2ZBEA 2EKLA 1OH8A 4C5AA 3PIDA 5HRCA 1GTSA 2O19A 2YVQA 4IOLA 1PR5A 2REQA 4LECA 1SHUX 4A23A 1YBHA 2ZYVX 6PFKA 1OV4A 1KYYA 4NLGA 4XWYA 2O5RA 1NT2A 3JWEA 2WTEA 1T5OA 1PJ2A 4LJYA 3C7TA 2BE7A 1IRXA 2JGRA 2YVLA 2PQMA 3PLAE 4EUFA 4X1IB 5FLMG 3QQ5A 5C37A 4RKYA 3EA0A 2IHUA 5AQ1A 4ZMRA 2HCTA 1JTEA 3KYCB 3NUAA 2Z2KA 4LV6A 2IU0A 4OMUA 2QDXA 3H5AA 1MV8A 4JV1A 1MNQA 1ILWA 1QGDA 2B5VA 3F3YA 1QANA 1OXVA 1XCLA 3QTTA 2XZLA 4R7ZA 3UYLA 4N48A 4FJ0A 2XXJA 4HPJB 1PWXA 1A3GA 4KGDA 5IN4A 3QUQA 1ZS9A 3G23A 5CG2A 1DUIA 1S96A 2BL4A 3JQ6A 3URKA 4JVSB 2OD2A 4CFYA 1IAVA 3ROQA 3UJHA 4C6SA 1E9CA 1X80B 4I46A 3K20A 3N2LA 2BKUA 3CC8A 5BR4A 5ALKA 1E9VA 2YJTD 1WZIA 1QGUB 2HH9A 4DV7B 2P6MA 3BX1A 3CQZA 4LF8H 4CJXA 1NTOA 5BNZA 4NMHA 1HDCA 1FFYA 2PO7A 3AC0A 2YZGA 4KQXA 1KZGB 1IU9A 1UMBA 2E4YA 3KYIB 3QELB 2IL1A 4A3KG 3HVKA 1D0IA 1RTTA 1P1IA 3QEMA 3F2IA 3EQ6A 2OYCA 1COWA 1ZI9A 4ABTA 4ILEA 2Z2IA 2QTRA 2Z8XA 5AHKA 2BGIA 3SOZA 3FDZB 3ZDEA 4OQFA 2B7CA 3PO3G 4X7BA 3FR8A 1MJNA 2AKYA 2H1WA 4A92A 2CW8A 1P5RA 2XC9A 4NSNA 4IWXA 1G8MA 2XVZA 1SU8A 1LRKA 4UHJA 2BR3A 3EC1A 5L95A 3B85A 4P1ZA 4WTOA 2W6OA 2A9OA 4B8YA 4B7AA 1BH2A 5T4FA 4RCYA 4ZYYA 3ZK8A 1V4VA 2GNOA 4HRXA 1Z8DA 4L6IA 1RPNA 2G1JA 4DLPA 3AYZB 5H7XA 1VBMA 1KJIA 2ISQA 2CMKA 3PGKA 1YRBA 1UKEA 4L85A 2YDYA 4Z7JA 3CVYA 1Y5LA 3BEDA 1U0HC 5JEDA 5DGCA 4W5HA 3B3AA 1Z7EA 3HVHA 1RYZA 4KR3A 2WD9A 2NVXA 3PHGA 3Q9LA 4V2IA 1VKNA 1O58A 1NYQA 4UBOA 4DG9A 3PKZA 3A9CA 4O2LA 4HX2A 2A5JA 4IVPA 3TW6A 4EYGA 5CLJA 1YHYA 1M6YA 2IPOA 4R9VA 1T3GA 3WNCA 1PSWA 4R5MA 4K86A 3DV0B 1O08A 3J81k 4QQKA 1C9MA 2W2NA 3UQ8A 3HABA 5CYOA 3M4YA 1XNQB 3MERA 1NVTA 4E94A 2ZZNA 5HPYB 1SUAA 5AJVB 3F7TA 4U0KA 1ESMA 1R50A 3A9SA 4GBJA 1WS6A 4QOEA 4JI3B 5EXEA 3TXAA 2XGJA 1Q3TA 1ZCAA 1KTIA 1XWFA 5BSMA 2YW2A 4GT1A 2UVRA 1SU6A 1N92A 1G21E 4MWEA 4YAGA 3QEAZ 2O8CA 3V4RA 2GCEA 1MJ5A 4GO1A 2HDHA 2R8ZA 1X38A 3GDGA 1WF3A 1PYDA 1R6BX 4DKXA 1P1HA 2GCGA 2V03A 5BNWA 4RLSA 2ZPTX 3KWFA 5H9VA 1JLMA 4Q48A 3FJ1A 2IITA 2PL9A 5FJJA 1SOAA 3NAGA 2ZLBA 2NT3A 4UATA 3W90A 1WCIB 2Q3LA 2JIOA 4FW9A 1EDBA 2XIGA 1SXJD 2Z5VA 3D5EA 2AOUA 4MR8B 3WL5A 3HEBA 5L1JA 2W6PA 4WY8A 1IH8A 3DB2A 3HNRA 1T4CA 2I9KA 1B6RA 1L1EA 2WG2A 5KSOA 2R8JA 4CMEA 4FEAA 2QUBA 2UUPA 4C04A 1I2KA 2DJ5A 1EVKA 4M1KA 3MS7A 3VJLA 3W9BA 3LT5A 5BN5B 1TQ2A 1IFXA 3SVZA 4D9EA 3G2KA 1MV5A 3I45A 1JLSA 1IIRA 1TCBA 2XZPA 4QD3A 4HVCA 3FYTA 1CBUA 3RVPA 3THXB 3EYYA 4KIJA 5JNWA 1JA9A 3VR4D 5FO0A 4Y6PA 4A1FA 2ABWA 2OVBA 1FPMA 1ZUD1 3RVBA 3KXDA 2ZJ3A 4AQ7A 3T1TA 2FSSA 1E9FA 4MPDA 2UZ1B 3BIFA 2QZ4A 4G1UC 5BOSB 3DDHA 4GOLD 2VSXA 2WKQA 4D42A 2C2HA 2OKGA 4X6LA 4MS4B 4JUCA 4B6RA 1QIGA 2VJYA 1PL7A 3DC2A 4WN9B 2QVBA 2IUYA 4CMAA 1KERA 5KQGA 1P62B 2ZRKA 3KDPA 1GG9A 3K0EA 3F74A 3O4FA 3GZNA 1YL7A 4TN1A 3JTMA 3DYVA 2BEUB 3SICE 4MUYA 2OWEA 3GIQA 1GAJA 5IWAH 2HSDA 3GJXC 3IP7A 4L73A 1W4BA 3TY8A 1WPXA 1SKAA 3CMMA 3QBVA 2C1XA 2HC9A 4DARA 1EQUA 4OSEA 2OBMA 1QUEA 1RYBA 1SYXB 1TJ5A 1TCCA 1U9IA 2YMPA 2DPIA 3TCXB 4B6QA 2QXTA 4LF8B 3KB6A 2WU1A 3BM5A 2XB6A 2XNSA 1HE2A 1KI3A 4ZU1X 2QM0A 4BN4A 4OJMX 4IXTA 2GEJA 4WKOA 3BZUA 3ZHOA 2XUQA 4BJHB 3K8YA 5CFLA 3V8BA 2BGGA 2ODNA 5JXHA 1NULA 3KWMA 4DWWA 2WYIA 4E31A 3W6UA 2GN6A 5A71A 5B2ZA 1ZMXA 2A58A 1V51A 4ZVMA 4M9ZA 1IMOA 4R41A 1TA9A 5JG7A 2KMLA 4N8EA 1KI9A 5J2TF 1IOVA 2HTFA 4XB6B 3X1KA 3LNTA 1D0SA 4C21A 2KJQA 3GRKA 5DM4A 4BVJA 2GOYA 3MGBA 3E7PA 1ZICA 4MVJP 2IXFA 1GTRA 3HP4A 4EY6A 1DIBA 4AUEA 5DIZA 2C83A 5DGTA 1QZZA 1XRNA 4BKPA 4E2XA 1Q2XA 2VOBA 3EVAA 1OOEA 2RHTA 2XDWA 1E94E 4G9EA 4FILA 2VJAA 4DAOA 3QVXA 1UMBB 4D26A 2FR0A 2KQUA 2PSSA 1J07A 1FSFA 2NU8A 2D6FA 1GCUA 3QEMB 3J81A 2Q8QA 4RK0A 2FKNA 4EKDA 3PFHA 1Y14B 2AEFA 3KLOA 3BFXA 1C7QA 2V7PA 4Q9NA 2W2QA 5AUQA 1N8TA 1B6TA 4NKRA 2QMHA 3KQKA 1LU9A 3MLBA 4H1WA 1FCJA 1FFWA 5BYAA 1S3IA 2CLMB 2R8EA 3WIBA 2GRAA 4LOKA 1BMDA 4TTVA 4H18A 4MNTA 3UGKA 4FHFA 4BVHA 1LLDA 1U3UA 3AG6A 5AKGA 4X00A 3A04A 1WJGA 3QX9A 1VLQA 3FCEA 3M9XA 2QL9A 5FT9A 2X7JA 1BOFA 1EEHA 3QVKA 2A9JA 4DLAA 7YASA 2A0XA 5EKXA 2PWYA 4ADSG 3DNMA 3DCYA 4LZAA 5LLTA 2DQSA 3DWEX 4PCUA 2A4KA 2WBLC 1Z18A 4TSFD 3GFRA 5GGYA 2VXOA 2KX7A 5JPIA 3ZOZA 1V6AA 5DISB 4EG6A 3K96A 1XJWA 1A2KC 2J9YB 1F1BA 4LDPA 3ZZUA 2V0GA 2FW1A 3WBFA 2YUTA 3TQCA 3CH6A 4JB2A 5B58T 2JFVA 2C7VA 1JFTA 2QF7A 1WUYA 1FYVA 2ZUVA 2O05A 3WB1A 3HJAA 5KCZA 1ZI8A 3H75A 4GUAA 2OC4A 1EKXA 1PTKA 2X58A 1Q19A 4LQDA 5JAPA 5T5QA 3FPAA 2B7BA 3FIUA 3TSWA 1YKGA 1N3YA 1YHNA 5H02A 4RTMA 1ODTC 3IA2A 1X9NA 4BP9A 2OCIA 3L4BC 4TM5A 3O94A 2WIFA 3ZUPA 5DK4A 5F23A 2GYYA 2O8DA 1V8PA 2QE7A 3GIIA 1R8JA 1JG3A 1PWHA 1W25A 2JDID 5C7IO 2JEJA 2PEYA 4FPXA 2M6RA 2EDAA 2O8CB 1M2NA 4NP6A 3MGAA 5HYVA 4A3BG 2OORC 3VDXA 2PFGA 5LQMA 2XEDA 4C4OA 2JIMA 4A2CA 4DM7A 3VPDA 3B6ZA 1A1VA 2C9YA 3PFNA 1ENOA 1KZ4A 4JKIA 4WEQA 3IXLA 4FZVA 4LJSA 2XKKA 2H0QA 2JNWA 1NSFA 3B3QA 2IEBA 1BMFA 4I5EA 5JI2E 3GOQA 1UFOA 5IH3A 4DRXA 2AOUB 3UVEA 4F3KA 4N0PA 1D1PA 3VC7A 4JK3A 2BFWA 3LYLA 2ABJA 5IWAB 1SEVA 5EIOA 3QFSA 4QHTA 1V7ZA 1MDFA 1UH5A 5DNDA 2UAGA 2V98A 4I9HA 5T41A 4HFNA 4AX4A 1IUPA 4O25A 1UIMA 2IS2A 3PA6A 5DAAA 5K8UA 4ED9A 4NOMA 3TZ6A 4XM0A 4J4HA 5K2MA 3QJYA 3GVPA 3FFWA 4MUJA 2X4IA 4MWOA 1GZHB 4EBBA 5D5HA 1QO9A 4RCNA 5CIWA 4L0DA 3P9RA 1L5HA 4I3FA 1OX6A 1RYFA 1U0FA 1NXXA 4V2UA 3C5EA 2VZLA 5L3QA 3LQQA 1P9WA 4MLDA 4D9IA 2HJGA 2Q7XA 4CKXA 3VKGA 1TB4A 1X9IA 5AKHA 1X8JA 4E03A 3ZKAA 1ZSVA 3MS2A 5KOHA 3K1TA 2YY7A 2D1QA 2PGNA 5FPHA 3OLCX 3GZNB 5FIUA 1PQUA 5KSZA 4J9UE 3UJPA 5IF3A 1TWCA 3GG9A 3K5IA 5EFZA 2CDAA 3GAFA 4H1VA 4C06A 1IVYA 2REOA 1B8VA 3WC4A 1GPUA 3TMKA 3A1WA 4AN1A 1KWGA 3IQIX 5DWVA 1H93A 4DL6A 4RPHA 5E7JA 2SKDA 3PZPA 4LYAA 3FKJA 4XM1A 2MSNA 5JAHA 4JY7A 1HYQA 5F2KA 5FH9A 3C7DB 1RQ7A 1M83A 5AUPB 2FJPA 1JAYA 3FPEA 1TVMA 3V4ZA 3QUSA 4DJDC 2OHJA 3RBDA 1RRVA 3Q0EA 1KVSA 4EY8A 5M7EA 3PHCA 4F4UA 1S2MA 4CEIA 5HTKA 2DKFA 4FGKA 4K9QA 4MKFA 1TUBA 5GTDA 4NFYA 3OZIA 4R9RA 2OB2A 1OBCA 1HTBA 3NAMA 5H4HA 1IWOA 3HYSA 3D5TA 4LPSA 5JNUA 1RDFA 2A5YB 5E3IA 1U8CB 3TJZA 2E5FA 3JQFC 2BKLA 1VJTA 5FTNA 1AKEA 1BVUA 1VSQA 2W6NA 5B58C 3M89A 3LPDA 4JLUA 2LNDA 2ZSDA 1FDIA 3FPKA 5CXQA 3HI4A 4TYMA 2BIFA 2Q1YA 1B4DA 1DDOA 4FBGA 2FQYA 5IDXA 5DOZA 4WBNA 4CNQA 5BSWA 4HAYA 2O8VA 2BVNA 2A59A 4PR3A 1Z5ZA 2ZJ5A 2RB5A 3BWXA 1QZ3A 1T6YA 1RBZA 3LKDA 3KR1A 2JI6A 3KVYA 4WWHA 4EEYA 4AT1A 5A9SA 3F90A 5JZSA 2FV8A 4EYEA 2OBNA 1EIZA 2VHXA 3ZLTA 2NU8B 5GVSA 3B12A 3OFKA 2I2AA 2C03A 3RIEA 1EVIA 4AF8A 4BQPA 3NBUA 5FTWA 3KEFA 3C3CA 1ODSA 4FYJA 4BKMA 4RK7A 3M2TA 1R0WA 4RESA 1ORRA 4F4ZA 2YMLA 5EJ5A 4WNYA 3NEYA 1R5OA 2AK2A 4IDAA 4Y9UA 2X2PA 1U7UA 1E8NA 3ZCRA 2ZE8A 2JHAA 1E2LA 5IBRA 3F3KA 1RAHA 3S2EA 4P54A 2YNMA 2A57A 3JD3A 4OHWA 3K70C 4QIWE 1XKXA 2CEAA 4P3PA 4C08A 2GTIA 1GAEO 3U16A 2A2ZA 1QJ4A 4QUBA 4XKJA 4HB2A 3KREA 1M1YB 3ZY2A 4UBIA 3BHMA 1QE3A 5AKXA 4G4IA 5IF9A 1F8GA 4IHQA 4EY4A 1VG9B 3A2MA 4MYSA 1NXWA 4F06A 1T0UA 1LLCA 1T91A 1YZHA 5DT9A 4KBYA 1TK2A 1UP6A 1Z4NA 1QH0A 3AB3A 1OFTA 2CVHA 4IKPA 5B3JC 4RSRA 4RVUA 1RHRA 1X1CA 2EFEB 3L3BA 4WK4B 4EITA 1I50A 2W9BA 2BLNA 4HEA6 4N7BA 4C07A 4CF5A 3AKYA 3WLQA 3IP8A 4D41A 4DIBA 4PBCA 2OFXA 3AEQA 1AURA 1Z2DA 3EDRA 3AOGA 2HU7A 2MCFA 3TLGA 2MR6A 1NJ2A 3G0GA 1GQQA 3HLYA 1N2JA 2QRHA 2O8DB 4X3OA 3TY5A 1J8FA 4GE3A 4XUCA 3RLIA 2RGEA 1H4SA 1U1CA 3LC0A 2BR0A 3ZBTA 1M34A 1Y80A 4LA4A 2WTMA 3RG2A 2LVBA 5KNCA 1ZN9A 4RIHA 2D2VA 1A2OA 4ROTA 5ALTA 3DQZA 3T3NA 3GFTA 3ZE7A 1H2RS 4CC5A 5JQGF 1WB4A 3BCHA 2O8EA 4LXQA 2EZ8A 1E2HA 3LUHA 3E03A 4UCTA 4KQKA 2WWYA 4GD3Q 4OXXA 3E7FA 2J7PA 1K6XA 4DRXB 1E4YA 1TW2A 4TMXA 3OP4A 4G84A 3B78A 5LA6B 3TQQA 4IMPA 3HV0A 4UDOA 3TJMA 2QP3A 5EC8A 1Q6YA 4Q1FA 3IJPA 4BWFB 2DLCX 4HVLA 2AD5A 1YTLA 3JVDA 3VTFA 1NMXA 3KL2A 4B2LA 5KDDA 1JIVA 1UFVA 2N0SA 1WVIA 1NUAA 2PU5A 3AHDA 2D0DA 1Y8RA 2I2CA 1SC1A 3A1EA 1IBRA 4ARZA 4Q8EA 4APMA 4IR1A 3OY7A 3PX7A 3OJ0A 4DOMA 2OP0A 4D46A 4Y2XA 1YACA 5F52A 3ND8A 4JJ7A 4MVJE 2E2WA 3RB6A 1DRJA 3ED1A 3EG9A 4P5PA 3ADOA 2EL9A 4OVKA 3FCYA 2YVAA 1RRKA 4J6FA 1KK0A 1KPHA 4LRUA 3NEJA 2JD0A 4WOBA 5EZQA 4PGAA 1PZHA 4JX9A 2F3PA 2Z6UA 1L5HB 3QW4B 1NVVR 1PLKA 5KC9A 4EENA 4XQ0A 1ZPDA 5DTMA 5L3QB 1PQWA 1U0OC 4LMPA 3ONEA 3R8CA 1T4MA 3NDRA 3WWYA 4D0GA 5D3ZA 2D7CA 2FJ0A 1JQAA 3AU9A 1MEJA 2C04A 4QJ3A 3AY7A 1ZL0A 5CEFA 3D6NB 5KOHB 5LQNA 3KWJA 1AQNA 4RTNA 1NW7A 4L5BA 3W5UA 2IODA 4LW8A 1DC8A 1KAMA 4R8KA 4W6QA 4KITB 2WABA 1Z3CA 2H2GA 3PUHA 4OO3A 1W76A 2ZUFA 3ENKA 3ZWXA 3BHIA 2E37A 4KYVA 5IYZB 1P3DA 1QRAA 2FW9A 4IHJF 4R2MA 1YOBA 2BKEA 1EG7A 5C5IA 2PH5A 1YKSA 2X1HA 1JJFA 2JHCA 4OXKA 3PQ7A 4TSRA 4AZVA 1QHHB 3EDQA 1QG0A 4ZI7F 4MMYB 3TVDA 1PEKE 5DGHA 2ZSAA 4UZEA 1OWNA 1DEAA 2EC5A 3RVJA 3LNCA 4X1YB 2OO3A 1LLQA 4I81A 2H3EA 1LSJA 4L50A 1Z82A 4XQEA 4X8OA 4L74A 2FPGA 4R81A 3B1YA 2BAGA 3JZAA 3VSDA 4BY7G 3M8KA 2X9GA 3T5PA 1DT3A 3R8XA 4O8ZA 3PD1A 5IJXA 3DL7A 3T9EA 1MPXA 4KUHA 1HK7A 4U7JA 4XQ9A 4PVCA 1EB9A 3DAGA 3UT6A 5TJHA 2NTEA 2RGWA 3HCDA 2VJBA 4D7AA 2QAGA 4G65A 2CNOA 4S1OA 4GM0A 3IT2A 2HMWA 5FXMA 3FUUA 3HA3A 1Q3KA 2LWIA 3ZW9A 1BEZA 3IQXA 1XWIA 2XR1A 3OZCA 3GZTB 3HPRA 3DOHA 2O5VA 4H1HA 3O4RA 4EMSA 2VP0A 4UFNA 5KMGB 2WJWA 3T9FA 3C5WP 1PR1A 4DC1A 4WBNB 3EEBA 4ZKEA 1DXHA 1X7GA 1OPRA 3G9TA 2YXEA 4HJRA 1TK9A 3CKMA 2HCFA 2WG0A 1XI2A 2QX8A 4YONB 3SJ7A 3L8ZA 1Z4LA 1N6NA 1PT7A 3FFXA 4YO7A 4AYXA 3SF0A 4KO1S 5A9SB 2VDQB 3HRHA 2JFUA 5G02A 1PZEA 3CF4A 4TOIA 4DV2H 2CHFA 1KYXA 5LYYA 4FD2A 5C7YA 3A1SA 4HWPA 1MGPA 3FWNA 4TKVA 2IX3A 2Z08A 1RLTA 2OMEA 3BL5A 1SK8A 4QPNA 3DPIA 2X0RA 4KR6A 3FOZA 1QTRA 3NTXA 4C7MA 1G16A 2DFDA 4O81A 1TLLA 1WY5A 4OFXA 2QA5A 2R8KA 3MQFA 5IAJA 2V9ZA 5I60A 2B78A 1CEQA 3R5HA 4KFSA 4FWTA 1RYSA 4FLFA 1G42A 4II2A 3WMEA 1B15A 5A06A 1C1DA 2QX9A 5ENZA 2FQQA 3TTXA 4CCYA 5HJ7A 4Z3KA 4UHKA 2W93A 1U3CA 1NI3A 1PNVA 1JRLA 4OHMA 1N6IA 1KYVA 4L5IA 3WWEA 4OSPA 1R0CA 3FWYA 3GGSA 3CEJA 4HUQB 4K3VA 3B1FA 5IBCA 3U1TA 4BV9A 1UJ5A 3M6XA 1WKCA 4Y0NA 4UCOA 1NDHA 4LPKA 2HF8A 4DNPA 1VYUA 5T4BA 3HCRA 4X66B 5DHFA 1CY8A 2B92A 1Q7EA 3FKIA 2GPNA 4MWZA 5EL0A 1FZTA 1JHZA 2I7XA 3QOXA 2W9BB 3T5BA 5AVVA 3JD2A 5I9MA 2IEYA 1AQUA 4NV3A 1M2WA 4LMAA 5ED4A 3ZWDA 2V4QA 5ES3A 5DNVA 3ZV3A 4RH3A 3NPAA 1P6XA 2EXXA 1RI4A 3AEQB 2IVZA 1W8IA 3CR8A 4MGKR 2O3TA 2V9CA 3TM4A 1CYDA 3V32A 1L3IA 4Q39A 1OXSC 5LJLA 3F0TA 4ND3A 1V3UA 3P9XA 3FTNA 1M34B 5CT6A 3MTIA 4Z7QB 4PX9A 3GCDA 1CUAA 4ALIA 4D9GA 1DJLA 3ZHRA 1QIIA 3H0GG 4W5RA 3A6KA 3K1YA 4PZYA 1M66A 5C1DA 1EE2A 1QG4A 3GELA 1HM5A 4IRMA 4JYAH 4ZZ0A 2O8EB 3R7AA 2HQOA 1ZHSA 2VHZA 4GI3A 5C1OA 3QQMA 4HGOA 1II9A 1IE3A 5K8LA 5AK3A 4RB2C 1VE3A 4LSXA 4FIZA 4PFSA 3JD4A 1Y4UA 1PNQA 3GNTA 4EPXA 3OY2A 3WKEA 1RU3A 4LG1A 2YV2A