2ZDHA

Crystal structure of d-alanine:d-alanine ligase with adp and d-alanine from thermus thermophius hb8
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ADP and D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 96
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdhA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdhA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdhA01
4MV6A 3U55A 3VPBA 3HBLA 4MV4A 4TV8F 3GIDA 2YW2A 3OUZA 5BMVF 1AUVA 5D8DA 3RFCA 3ORRA 3WNZA 2VHEA 4HNUA 4O4LF 1JDEA 2FB9A 2YYAA 1T36A 2HGSA 1CE8A 3RUPA 1KC7A 4FU0A 4MV1A 2V58A 5CA1F 3BSSA 4O82A 1VKZA 3TINA 3R5FA 4O7RA 4EABA 3BSYA 3GLKA 4O7ZA 2W6NA 1DV1A 4M98A 2QK4A 4O7WA 4E4TA 3U9SA 4YJ3F 1I7NA 4FGRA 4J6EA 4HNTA 4O4JF 2OLSA 2NPOA 5K2MA 4O2AF 5JVLA 5JVDF 2NU9B 3R5XA 1KUTA 2GLTA 1UC9A 1A9XA 4MA5A 1PK8A 1KJ8A 4O7LA 4MV7A 3R9RA 5KX5F 3K3PA 3VA7A 2R7KA 3VMMA 4O4IF 2GPSA 2R86A 2HJWA 2VPQA 2GPWA 3LWBA 3KAJA 4TUYF 4I50F 3V4SA 3TW6A 4YJ2F 2YZNA 5H80A 2J9GA 2PVPA 3K5IA 2R6FA 2YZGA 3MJFA 3R23A 3UFXB 2P0AA 5LA6F 5JH7F 3N6RA 1C3OA 1CQJB 1W93A 3QFFA 5EZYF 4ME6A 5DMXA 1WR2A 2FPIB 3V4ZA 4O7NA 2YWVA 5LP6F 4FFMA 2R87A 3JRXA 5CB4F 4IWYA 4FFRA 1OBDA 2W71A 2XCLA 1M0WA 1KBLA 4HQ6A 1SCUB 4TV9F 2I8CA 2ZDQA 4NYEA 2X0SA 2C00A 5BPHA 2VQDA 1A48A 3G8CA 2Z04A 2CQYA 1CQIB 1GSAA 3G8DA 2YL2A 2YZMA 4FFLA 4EGJA 5LOVF 4O83A 3TQTA 1B6RA 2R7NA 4GGMX 1AUXA 3JRWA 4MAMA 4O81A 5C1OA 2WYOA 3N8DA 4EGQA 4I4TF 5C1PA 4XYMB 4YB8B 1PX2A 3DF7A 5FNVF 4M9CA 4YAKB 2CNUA 3KAKA 2V5AA 2R7MA 4O86A 5C8YF 1M6VA 2PN1A 3Q1KA 1JLLB 1VBGA 2FPGB 1CS0A 4IWXA 3JZFA 2PBZA 5LYJF 1JDBB 2W6QA 3U54A 2CZGA 4ZHQF 5J2UF 2I87A 5IYZF 1BNCA 4FE2A 4O2BF 3E5NA 3BFPA 5GONF 1ULZA 1B6SA 1E4EA 2W6PA 2IP4A 2XD4A 2FPPB 4FFPA 3BSWA 2NUAB 4WBNF 3RV3A 5KKNB 1GLVA 2DWCA 4EA9A 2W6OA 4EG0A 2VR1A 4DIMA 3ETHA 2YRXA 5BPFA 2R82A 3SE7A 2I80A 3KREA 3AW8A 3R5HA 4O4HF 2ZDGA 4YAJB 1VBHA 4ZI7F 3I12A 5J2TF 2DZDA 3AX6A 3BG5A 4MV3A 1GSOA 3KALA 1DV2A 2FP4B 2YS7A 2W6MA 4IZOA 4EA7A 2R7LA 2ZDHA 4MV9A 4QSHA 4Y8VB 4ZOLF 3VOTA 1GGOA 1Z2OX 3LP8A 4C5BA 2GQSA 1KJIA 5I47A 4C5AA 1KJJA 4O7YA 3JZIA 3MWEA 1C30A 1W96A 2DIKA 4O84A 3HO8A 4EAAA 4ZQIA 4DLKA 5CA0F 1BXRA 2CNQA 4M9UA 2W6ZA 1Z2NX 5JQGF 3Q2OA 1IOVA 4I55F 1E4EB 3WO1A 1KJ9A 2YS6A 4FFOA 4MA0A 2QF7A 3MWDA 2V59A 5JQWA 4XYLB 4HNVA 1UC8A 2GQRA 2SCUB 1JKJB 2CNVA 1KEEA 2NU7B 1I7LA 4XZ3B 1GSHA 4C5CA 2R84A 4M99A 3VPCA 2Z02A 3TIIA 4O7TA 2W70A 1IOWA 4O7SA 1Z2PX 5CAEB 4FFNA 2YRWA 4WD3A 2DLNA 4EA8A 3HB9A 1EYZA 1OBGA 1EUCB 4YBZB 1DIKA 4IHJF 3VPDA 5LXTF 3RV4A 1EUDB 2YZLA 4O7VA 3ORQA 5HBRB 2R85A 4HR7A 4IIJF 1EHIA 3WO0A 2NU8B 1M0TA 4L1KA 5HV6A 3NUAA 1EZ1A 4MV8A 3TIGA 3OUUA 4XX0B 3ETJA 3K5HA 1KJQA 2NU6B 3U9TA 4RZQA
chains in the Genus database with same CATH superfamily
4PCVA 4GX2A 3FYUC 1P3Y1 2CCJA 4F4ZA 3ZLBA 4DM7A 1JHDA 1DXHA 1E6WA 4TZTA 1V95A 1CKNB 3JQFC 3MGBA 5BR7A 3HACA 5IWAH 1PW7A 3DEZA 1YBAA 2O2EA 2EATA 3BK2A 4GMKA 2FZEA 3DA8A 3KKMA 3V6MA 4C1BA 5AI8A 4ZPXA 1O5IA 1OFTA 5KYGA 3LQQA 4DUZB 3KG2A 2ZYGA 1UT8A 3GHHA 2A88A 3I4NG 1JF8A 3AB7A 3IE0A 3KEQA 1XNRH 5CT6A 5IC4A 4LTDA 4RPIA 1MEJA 2YY5A 5SZKB 2OXEA 1AB6A 5C53B 2IIBA 5HJ2A 4DBVO 1JIXA 2OGZA 2NVOA 1SOUA 3DP9A 3LGXA 4DG9A 1TTTA 2QXUA 2HIGA 5FUYA 2H4WA 4DL5A 1KKMA 4Y2PA 3C7KA 1PFKA 1JXLA 1UP4A 3EEYA 1H22A 2IGBA 1ORHA 2WU0A 4HYKA 4JGBA 2QRVA 1CQPA 3RAXA 4JI5B 4CM4A 4G1MB 3RRMA 2WABA 3FUWA 1X7HA 2QLTA 3FYUA 4RK4A 3WIBA 1M7HA 5E1OA 3DT8A 4APMA 1EHCA 5CNMA 5AWFC 1GV0A 5GOTA 4UBNA 4ENRA 2IHZA 3FR7A 2HNAA 5E7MA 3ZTTA 1L2TA 2P0AA 3F3MA 2I4NA 1RSZA 1CQJB 2V4UA 2EFGA 4W8OA 3MR5A 1P1KA 2XQVA 1F14A 1KIFA 1U1IA 4IVQA 4LF9B 3CY6A 1QH8B 3X2SA 3S40A 2FSFA 1R0BA 2O1SA 4ENUA 3R3HA 1Q0HA 5EXXA 1KRWA 4L7QA 4TVBA 1UM9B 3OPXA 3GTPA 1V71A 2R2AA 4MUGA 4BECA 1ZHQA 5G40A 3RM3A 4ESOA 4R01A 2J3HA 2OGUA 5KTYA 3RJZA 4C7OB 2I5PO 1RQLA 3CEAA 1GDTA 1NMSA 1XGKA 1F6DA 3QKWA 2GS9A 3MCTA 2J5BA 3U48A 2NZYA 4XUEA 3TY5A 2ZCVA 1PR6A 5CG2A 1XPRA 4O4HA 3UMMA 4FQ5A 1KS2A 3BC1A 2LDBA 5CJ2A 1M34B 2V97A 4AQYH 3LH5A 4Z2YA 2R11A 3D8NA 4IG9A 5I4IA 4KAXA 4R6XA 3W6NA 2FXIA 3B48A 3FHCB 2IPOA 1UKZA 1P8LA 3IOBA 4E2WA 1NOJA 3KQTA 2OVBA 1TK9A 3OCVA 4D4GA 3SHTA 2HREA 4B3BA 3L8YA 5CM0A 1J8VA 4BTEA 4EB3A 1JFFA 2BZSA 2IXTA 5D51S 2DTDA 3UJCA 5CLJA 5L1JA 5WRFA 3FAZA 1KY2A 1GTJ1 4FC7A 5L6MB 4NXMH 2NSHA 4JROA 2X0KA 3FJYA 3MWEA 1GGNA 4M8IA 3MGCA 3AUXA 3BXGA 5EP1A 1WXGA 5C4MA 1PT9A 2WVJA 2FY8A 5IXYA 3I04A 4YRFA 4UCFA 2AOWA 4NKRA 1SKBA 1W59A 2IYXA 1L6IA 3IKTA 4A1OA 1YWGO 3TQOA 4IV8A 2QTTA 1VI5A 4RHUA 3E53A 3MGAA 4MQ4A 3KKNA 3ZE0B 3O1HB 3B5IA 3IBCA 2H4ZA 1EG7A 2HXYA 2WTMA 4EJ0A 5IM4F 4LX8A 2XA2A 4BMZA 1F8UA 4ZT3A 1OXSC 3DCNA 2FMKA 3U4GA 5IS2A 1D2CA 1JB1A 3DS8A 4YMGA 1JAZA 4PR0A 1NXXA 3WYGA 2VL7A 3MB5A 1GAEO 4F6CA 1NC1A 4LRXA 5A7HA 3I62A 2C20A 1E18A 1C4KA 5KJEA 3NOQA 4E03A 1SQ0A 1PJ8A 1QNFA 2P5SA 5GJWC 2WF8A 3GA7A 2KSQA 4JV5B 4GPIB 3QU7A 4NFSA 4TMXA 1FP6A 3V8MA 4MJ3A 1TA8A 2VWQA 4A0RA 4PLZA 3OZIA 2O07A 3DBOB 3TRIA 5KFAA 2IYRA 3SBXA 1J2TA 4YCBA 1CE8A 4EQ5A 3RDPA 3JASB 2G71A 2NP7A 4M87A 2XVZA 4BFWA 1A9PA 1UPFA 4I9UA 3Q41A 1J2EA 2D1FA 4P86A 1F3LA 3CO0S 1VLHA 3OO0A 2FKAA 3U9SA 3IMKA 5JCOA 3K8YA 3ILXA 1PZFA 5JS1A 3K9FC 1WMSA 3B1WA 2GD0A 2X5OA 2AQ4A 3KQHA 4O7LA 3GFVA 4FCTA 4UFPA 1QR6A 1QRUA 1YZYA 3MWKA 1ZVQA 5T4FA 1GUBA 4ZO7A 1W1IA 4B6OA 4PE5B 4HXEB 1MC8A 4ICIA 3FIJA 4BAGA 4RVHA 4PSKA 1KRXA 4OJNA 3TCXB 5EY5B 2JLCA 3GCGA 5HQ3A 721PA 4H2DA 1SZJG 1LA2A 1OFUA 2B25A 4OGKA 1Z47A 3FGPA 5HGJA 2IUUA 4JOBA 1K6EA 2B2NA 2ERYA 2JI9A 4UOQA 3V4VB 4FN5A 2Q0SA 5IARA 1NVVQ 2C98A 4NECA 2VXCA 5TF0A 2CXNA 1ADCA 2ATEA 5LDDC 4CKBA 2FPPA 2O7QA 2VAPA 5KFPA 3I37X 5FWXB 2A59A 1XRMA 4V0MA 3D5EA 3HJAA 1XL1A 5JSYA 4D41A 1GXSA 1WPRA 3PQ2A 4H4CA 4M3NA 3AHDA 3CBGA 3V1UA 4M1MA 4D0RA 3ZNNA 4R9UC 2FZCA 5LIPA 3RFXA 2HK7A 3AHIA 4L5JA 2BTQA 3TLAA 1SWWA 5CVVA 1J8YF 1TDJA 5C8VA 1XHEA 4QQ8A 3IAXA 4TS9A 3K0KA 5BR8B 2ILTA 5HOQA 1OOEA 1SELA 2FHSA 4R1MA 1EVQA 1PG5A 2DLCX 1BFDA 1D0SA 4NBKA 3RUAA 3L7CA 3UMYA 1YZLA 1I4EB 1ZU5A 3ANNA 5AW1A 3KS9A 1EGAA 4RNMA 5AHWA 1L4HA 3ZK9A 1H5NA 3H2ZA 5K0ZA 3PNYA 3O6VA 2OGWA 1FW6A 1GKYA 4U2DA 5FWDA 2RGBA 4WKOA 4B73A 2B61A 2XADA 4W5RA 2Q5LA 2OBFA 3I5AA 1T4GA 2WF7A 4OTZA 4KK4A 8LDHA 1YNSA 5AKEA 4DIKA 1SG6A 2PX5A 4DNXA 1EINA 3EIOA 4J75A 3LQYA 2C61A 3DMNA 1CY7A 1USIA 2SKDA 4ZHQA 3JPYA 4A73A 4BPRA 5G3YA 3TRHA 2JA8G 1XUOA 5HF5A 3C85A 5CBPA 1U7TA 3T4PA 2HVRA 1BXRA 1VL1A 1PFYA 3RI3A 3WJAA 1C7RA 1IJKA 3L82B 3M1IA 3IR6A 4A0GA 5ALIA 1OH6A 1U2PA 4A3EG 5A4FS 1N2EA 3A4MA 3VAZA 4S1OA 1YT5A 2PYDA 1NW8A 4PWZA 3LUHA 3MQFA 3M5DA 5KUTA 2GKOA 2ISSD 4H6PA 5EE1A 2PMWB 3LBAA 5K09A 4EA8A 4YP5A 3JAWA 1TQ8A 4PHCA 2HCJB 1L3BA 3W5IA 2O8EA 3DEKA 2F9LA 3ZE6A 3FTNA 1JHZA 1JSRA 4NOJA 2VOBA 1L8XA 3GDFA 5EXTA 4ZIRA 4QUKA 2ZZMA 3PCRB 2IHBA 5BVHB 4N0PA 3HYCA 4J0DA 4NCXA 1M83A 1IN8A 2Z95A 1QPGA 4Y6GB 2UU9H 1L1EA 4LOKA 2KI5A 3GPLA 3BILA 2VAXA 3IJ5A 3DULA 3OWHA 1IZYA 5IU6A 4M0UA 4I46A 1KO5A 5B4VA 2HDHA 4Z3OA 3RUPA 3AINA 1MLDA 4CE6A 5KYXB 4IXWA 2I2DA 1G2PA 4H1HA 4TYMA 4BGVA 3R5FA 2CWDA 4LYJA 4RZUA 1N2CB 3MNFA 5I7VA 2AJLI 3EPHA 4CMBA 3IP6A 1RM4A 3TEKA 3JQ6A 3NUGA 2Q8NA 1JEYA 4KE8A 5FDFA 1I7NA 3UKOA 2XMBA 1ZQ1A 3V2UA 2OKCA 1XMOB 3B53X 1NJ8A 3ER9A 3GH1A 1ZNZA 3DBIA 5H5JA 4GKKB 2CDBA 1JHQA 4JUCA 2ZJAA 1GQSA 2AFIB 4RSHA 1RJDA 2ZJYA 2ID9A 5FF9A 4PXYA 3KVRA 3NATA 4R31A 4DEVA 1DG3A 2ZBUA 3BMQA 2GCEA 3FPBA 3L5OA 4LJ5A 3KOZA 5JO9A 1EG2A 1KDZA 4DC0A 3R23A 1TJ3A 4Y0AA 5LA6F 1PS0A 2BKEA 3T41A 3RRXA 1XZEA 1E79D 3WNCA 4ED9A 2FSGA 4X3PA 3DMHA 1R50A 3MRSA 2I1VB 5C1IA 2RFLA 2PIDA 2WILA 4HLDA 4PZUA 1W36D 2WAAA 3JSLA 5AUQA 4YUVA 4BQFA 2NQ2C 4AC9A 3UWKA 1ZSNA 4MGEA 3CEPB 4S1VA 4H6WA 2OV3A 1ID8A 2C2KA 2HMAA 3TBHA 5JFTA 1Z75A 2FWJA 2ZYIA 2B82A 2OO5A 3DD1A 4J4TA 2JKVA 3AESA 3WKCA 1YIDA 4B84A 3UJPA 1TM7E 3DOHA 1VZ2A 2ZR0A 1XXHA 3H4DA 4K2HA 3OLCX 1U1EA 2PN1A 2J87A 4IXDA 5LZ2A 4TTJA 2DT8A 4QPCA 5FTLA 1Y7PA 2X1VA 4DEXA 4S1NA 4W1RA 3LFTA 3KCQA 2GERA 3H1EA 4L9RA 4ACBA 3HXMA 4QNNA 4O4JB 2RGEA 1T36B 1H5QA 3KSDO 5A1JA 1P4RA 4P4LA 1TEZA 2GCNA 1XMIA 2BHTA 2VQFB 1ONSA 2GXSA 3DXFA 4XR9A 4DLLA 1PN3A 4HMQA 2ZS8A 4L4UA 3SKYA 3CPSA 2JCGA 4RIHA 5CYFA 3AW8A 1HETA 3I8XA 5G53C 1KP3A 2JGFA 3ZI4A 4HTFA 5B1DA 2CXSA 2GZMA 2X6RA 1P2FA 3ESCA 1NXVA 4RIEA 4JMPA 2XMGA 3MYRA 3UJNA 4AUKA 2ZBDA 2XUFA 4ERXA 4EL0A 4JYAH 4FBTA 1R88A 1YKSA 3ZV5A 4B17A 1MH9A 1DBIA 1UKEA 3ZCRA 1D2MA 3SFZA 1RHJA 3EQ6A 2ZIVB 3JWIA 4XJSA 3BTOA 5CFLA 1TVEA 1DOHA 4JUDX 1A8IA 4M1EA 1SU4A 5EYPB 1GPNA 3G3EA 4QT0A 1CY1A 2I2CA 2XDQA 2JCVA 2BFWA 4RE6A 2X8BA 3ZI0A 3RIXA 4GQIA 4HWTA 4KVGA 4BBAA 1ISGA 4XYLB 1WUHS 4HRVA 2JRCA 3WMXA 2BC9A 2IITA 3COJA 4CEJB 5G4KA 2ZRGA 4ZAGA 4LTNA 1OFGA 1VMEA 1NYRA 1K4YA 2REOA 3ADBA 1T0JB 3VOSA 3HKEA 4HMPA 3WNBA 1Z6XA 5B6JA 4HDAA 4J16C 1NATA 4LY0A 4F60A 4RKYA 1C9YA 1EZ1A 1SGWA 2Z8YA 3TQIA 5D85A 4DSAA 1XNRB 3ZY6A 4AMZA 5LYJB 3HE3A 4US2R 1D0VA 3AKEA 3A6FA 4QDJA 3OIUA 2I9PA 5HF8A 3NWPA 3ZDAA 3F46A 2IHJA 1OZAA 4C01A 2O03A 2ZS7A 3WNZA 2TMYA 1WSWA 2P8SA 1JMKC 4D98A 3UB2A 4WNYA 1Z83A 1M0SA 4EVSA 5F78A 1IJBA 2OORC 7REQB 3PW4A 1H65A 1MAHA 4DA9A 4XVCA 4RZIA 4B75A 3QE3A 3PI6A 2P4QA 3GILA 5TE9A 4YMHA 1DBQA 4ESVA 3PL5A 2C4WA 1J2YA 5GM2A 1D5CA 2DPXA 2AR0A 3H1FA 2VDVE 3DQQA 2AOTA 4KAAA 4YO8A 7MDHA 3ADKA 5K8LA 5ELLA 3TGPA 2A2ZA 4DR4B 1DQYA 3PVXA 2IWHA 3QPDA 1NBWB 3VZBA 2I4TA 2Y4OA 3DBHB 2FMUA 2C1XA 1PTKA 2IYVA 1U8UA 4MUFA 4IDBA 1NHWA 2IYSA 4ONEA 3MS7A 1NW9B 4E94A 3DT9A 1F8XA 1KL7A 4KIFA 5AXDA 3TTXA 2OVFA 2PX4A 4RM2A 1IY1A 4V02A 3X1JA 1KZ6A 4Z4FA 4ZO9A 3HJNA 2H48A 3I4FA 4EKGA 1JXAA 3AXSA 4LKRA 1IQUA 1BO6A 1UBTS 5TQ2B 4J49A 5CDFA 3OA0A 5IN4A 3CNNA 1PVOA 3TKYA 1CR1A 4BMOB 3I9V1 2WWHA 2BM8A 1IZ7A 1NLMA 2CJWB 3DOFA 3NTUA 1O97D 5FO1A 1D2HA 4XXHA 5ESDA 3INRA 4CKEA 3CE6A 3DSRA 4DR1H 3I9JA 4KN8A 4C0HA 3DTVA 3RD5A 1YAJA 4RYDA 5BRAA 5DI9A 4EI9A 5BYBA 2DFPA 3I2JA 5DNCA 3FPGA 4G97A 4UEWA 3E9MA 3GUHA 2Y4NA 1IEVA 2X2FA 3SEAA 4ZCQA 2JHPA 2XZDA 2OOSA 1ORDA 2EBUA 2VG8A 2BFCB 3H3VH 5KVQA 1XMQH 5DBEX 1QK3A 4XUCA 2CLOB 3BWMA 3R41A 3BBPA 3B6EA 4R2HA 1GLVA 3IUJA 1PJLA 1W4CA 2GPBA 3GO4A 3HSYA 3UC9A 3WFIA 1KORA 1RAEA 3FCYA 4FKZA 2BH2A 1D1TA 3K9QO 2WYUA 3D1VA 4G07A 3L46A 4IGFA 2B63G 3ST7A 1E4YA 5DDIP 1NN1A 4WNCA 2HPVA 2Y0PA 4UU1A 2C3YA 4K8RB 1EBBA 3EEOA 2V4QA 1OJ7A 3NYRA 3Q6IA 1EJ2A 3JR7A 3RABA 3IUNA 1QHGA 4D4IA 1MT3A 1EI9A 3O2SB 3TPFA 1V41E 2ZYRA 1CYEA 1VRVA 5CB6A 4BLUA 2M6LA 2FRDA 2JLVA 5AW0A 3JZDA 2WWWA 1D9XA 4QBGB 5KOHA 2WTXA 4XWYA 5A0VA 2ZSHA 3PC8C 1BXGB 5IUNC 1IB0A 2I3DA 3INTA 4RJKA 5DNUA 2WP8J 4M6WA 3NTXA 2FHPA 4RSGA 2G9ZA 5JOQA 2ZT7A 3ZVKA 4GXQA 1VHDA 1VZ3A 3UA4A 5CD1A 1KQOA 3KQQA 4QXQA 3OCWA 2XLBA 4UZEA 5ALWA 3IVCA 4ER5A 4E2YA 5C81A 3U3XA 1M1NB 5HR5A 1C3JA 4M8KA 4RTKA 5KJ1A 5L3VA 4OGGA 1U3UA 1KP9A 4DV3H 4HK4A 2JAQA 4CMKA 4RS4A 1UFRA 2R47A 3KSBC 5LVAA 2C77A 4A8TA 1S3FA 4TKVA 2ZWPA 4IM7A 3VAAA 4AF8A 1F5NA 1O8CA 2YYAA 3O03A 2GAFA 2PJDA 4GO1A 1TT5A 3VDQA 1ZFNA 2C4UA 1TCCA 1X9GA 5HYVA 2QSJA 3DFMA 4WKNA 2VLBA 2H52A 5C80A 3AM5A 3K1TA 4GNRA 4M98A 1W36C 1BD4A 1UQRA 4G5HA 1U7WA 4IR7A 1WMBA 3FW1A 2GLTA 3DO6A 3UW1A 1S8NA 1LVUA 4U39A 3CZAA 4OA8A 4MS4B 3K3PA 4TKUB 3ZXSA 4XVHA 3O4VA 4QOSA 5LD2C 5F9NA 2I4MA 3Q3IA 3TIXB 3IXQA 2PSJA 3DBLB 1GO3E 2VH5R 3T95A 1C1DA 1P16A 1UJBA 1I3QA 3VX3A 4BQRA 1P2DA 2KMLA 1E0KA 2F9FA 1A4IA 2NVYA 5IAOA 3L8HA 4ARIA 4ZT7A 5HOEA 4J0CA 4KKVA 5GJBA 4BNDB 1SUFA 4BWFB 1T9BA 4ZYVA 5CGQB 1PJAA 2OAEA 3N05A 4QRDA 2B8WA 5KT3A 2CFTA 2QN8A 3UJ8A 1NN3A 1HZZA 4DUGA 3SYKA 1CDDA 3MPUA 4RH1A 5ICGA 3L7OA 1P5RA 3B9RA 5FI1B 4IILA 5HUJA 5HS6A 4BBZA 1HNWH 4TM7A 1WU8A 1NKVA 1QHYA 4LF8H 2J5KA 4LHSA 5ADVA 2QRUA 2PKWA 1PT6A 3ADOA 4J91A 4JT8A 4J2HA 4GMXA 3STWA 4JC5A 1KAGA 4EG8A 1LX6A 1AT1A 3BWYA 4ZVKA 3BFJA 2IVFA 2JF0A 5D3ZA 1G8HA 4L95C 1T35A 1MX1A 3T1YB 1P0PA 4F4HA 4RMGA 2J3LA 3EUAA 4NCIA 1N2OA 3SY8A 1QYDA 4EPXA 1GTL1 2VNAA 1ESZA 4MOWA 2QZPA 3RWOA 3VVLA 5K3DA 1Z38A 1N6RA 4AU1A 1T5DX 1V1JA 2QTFA 3O3CA 4PYOA 1N7IA 3PA6A 2Q5QA 4WOBA 4OCZA 5MN5A 4URVR 1FX0A 4E09A 3CXUA 4HNSA 4LGMA 4O3RA 4WY2A 2PBFA 2WF6A 3SJBA 3HEAA 1K6JA 2ZSKA 1SHLA 4NF2A 2FJ0A 4DMCA 5I8PA 1GFWA 3WWPA 1N3YA 3NUQA 2XTMA 4DLRA 4A8JA 4FYPA 1ZIOA 4XD7A 1A5TA 4NY1A 1R9MA 1DC7A 1WSBA 5BWRA 2G4VA 3PFBA 2YCLA 5LB2A 3THOA 1Q7EA 4RJLA 3UB3A 2R65A 1JZTA 3K8ZA 3FKJA 5LZ7A 3HKZE 1JU3A 3GDEA 5U9CA 3UCEA 4AG5A 1Y8RA 1Y3BE 2QPAA 1WXQA 1QVWA 4NVRA 1O6ZA 3A6ZA 3CW2A 3NT4A 2IX9A 3L77A 3MJEA 1SU8A 1X1DA 3PFCA 4RPGA 5EHXA 2R97A 4RORA 1UMBA 4OQEA 4UPDA 2H1CA 2WF5A 4UBKA 5AKKA 2AGOA 1AIPA 1LZLA 2Z3VA 4N54A 3DR3A 1OA0A 1ZQ9A 4RHYA 5IW8A 5BSKA 2CUTA 1OFVA 3W5HA 2B4KA 5M2QA 3B3JA 2UU9B 2GQRA 3E7DA 4KN5A 2YJTD 1W6UA 1THGA 5KFKA 4LCJA 4ZMSA 4G3IA 2VBGA 1OJLA 5IBPA 5ALKA 3O0TA 1P72A 2IPAB 1KI6A 1OBFO 1S1CA 3PFKA 1B26A 1YS9A 3GIQA 4RTNA 3QU4A 5BSWA 4R8LA 2HK9A 1JBQA 3DHYA 1JLHA 2IOHA 3PEYA 1G5FA 4LZJA 4BMYA 3ILVA 3GGGA 1DMSA 3M83A 3UMSA 4MVYA 3OUZA 5BMVF 3CC8A 3T9FA 4PY2A 2O6HA 5AJWA 3WZLA 1SC9A 2XDWA 3CF0A 4R0NA 1LX7A 2IHUA 5CYPA 4DUYH 4O4LF 2A86A 4NS1A 2HUPA 2IE0A 3K9NA 4BLWA 1A9SA 3PEEA 1XNQB 2VDKB 3WP1B 2P6RA 4YO7A 3EDRA 4R9VA 2VZEA 2P7IA 4YS6A 1JEQB 2E6KA 4KJZA 1TZJA 4OIFA 1UZAA 2YBEA 1WUTA 3RC2A 1ZINA 2VPYA 5KYYA 2Z5VA 3SD7A 4FXPA 1A0OA 2B0CA 5IAGA 2N1BA 2HZ7A 4B40A 2ACVA 3VU9A 1E58A 4IBOA 1GZ7A 3QMWA 1T26A 5AW9A 3MJVA 2WJYA 1U4OA 2JEOA 1O97C 1VMDA 5BYKA 4HYQA 2O50A 1T1GA 3P9NA 1P77A 2PL3A 1FSPA 4IF6A 1AS3A 1AN0A 2ZBRA 2VK1A 1HFJA 3BKWA 4L9SA 9LDTA 3L8CA 1G55A 1YUBA 4ZVUA 1BMFD 4M0KA 3H75A 3V97A 1OFIA 4ME6A 2BDTA 2IZZA 2EX4A 2CNWD 2VJNA 4I5FA 2HPHA 4JLAA 1KPIA 4ESEA 4XDZA 2XCLA 1TUBA 3M1LA 2I67A 1ENOA 1ONBA 1LRKA 5AP9A 2PJRA 3SGLA 4HUJA 1JSZA 1J23A 4UCTA 3GTGA 5K51A 1CP3A 4ZWNA 3U0VA 3TLCA 3G2HA 3EXG1 4IVRA 3ZBTA 4NH4A 2A58A 4OO3A 4PPGA 4XIJA 1BVUA 4FILA 2W2XA 4GQAA 5L3QB 1ZL0A 3OIGA 1GFSA 3AHCA 1FC0A 3VGJA 2WLSA 2RB5A 3BJEA 1EXWA 1I4LD 4TQRA 3HJHA 1ISJA 3IV9A 4YX9A 5KFHA 1I4TD 2JGDA 2FVXA 1KDTA 4JUAA 5JALA 4D56A 1U2TA 3O4GA 1T0BA 2C29D 1LNSA 1MJGA 2CZGA 2XBLA 4O3FA 4FE3A 1N56A 4QASA 1JR6A 1NQTA 2X77A 2JBWA 1Q0ZA 2V3CC 1AMUA 4OU4A 3RREA 1XCJA 3B6IA 1BXKA 2Q6TA 3VI3B 4HOYA 4YRZA 2ZRNA 4X44A 1VJCA 3TLBA 2BV3A 5FYQA 1ZK3A 2Z1DA 1ZUD1 1OQAA 3WHIA 3AONB 3OM1A 2JB9A 4FT4A 1ZAKA 4Y2UA 2W6OA 3OICA 4Z1MD 1WS6A 3ETHA 3V46A 4C9BA 3NZEA 5EKUA 3IELA 4RDIA 3FHTA 1UK6A 5J2TF 4H0CA 2ENUA 5KNCH 3AEUA 2H5JA 2QORA 4JP1A 4KXVA 3KC2A 3U3RA 2HPZA 4UU8A 4ZOLF 2XSZD 5BWWA 3D4BA 4PFSA 1XTTA 3HCOA 3JPWA 3UPDA 3UOWA 1GGOA 1MFPA 3HI4A 5LA6B 1F9EA 3EC7A 4B0OA 1B0UA 3WK9A 1YR8A 3C39A 5E9AA 3KUUA 1XTRA 5ER6A 2WM3A 3TLGB 1TO2E 1SCIA 4OQXA 3INYA 3R9IA 3IDQA 3B13B 5FWNA 1G8YA 3UT6A 1T4MA 3NTQA 2PSEA 1R37A 4O7SA 3DKRA 3EZ7A 3G8AA 1AK2A 3IMCA 1V2HE 4ETNA 1XCMA 4YMTA 2WJ6A 3BWDD 4NCKA 4MVJA 4QOJA 2HDOA 4YR9A 4TOIA 1DQPA 2ZYSA 5CNJA 4U3JA 2X9GA 4AZ3A 4JXXA 1R8XA 3AUTA 5HA5A 1I13A 5ITSA 1HYGA 3ABOB 2VQSA 3S24A 1F8FA 4IQ4A 3D7KA 2K6GA 4LCEA 1KO4A 1SUIA 3DAGA 1GYFA 4NJMB 2C7PA 1BHQ1 3PWTA 4FU0A 5C8DA 3O8CA 1HDGO 5GTDA 2XUKA 2JJ2A 2QE7D 2H4XA 1YZKA 4WCDA 2AQHA 1CQJA 1I33A 4TXMA 1I0ZA 4BB6A 1WCWA 5I9NA 3OE1A 2AV6A 4UQPA 4AKGA 3V8EA 2ZWIA 1DJOA 4ZGWA 4X7PA 4NYMQ 4FSDA 1CJSA 2Y93A 3DEFA 3G0CA 3AH8A 1M1XB 4A0QA 3WLMA 5AUPB 4LEIA 2HQBA 5KFNA 4RABA 4E14A 2CK3D 2CZQA 3JD0A 2YVKA 1C81A 1W49A 2O0MA 1IONA 3FCOA 3FTQA 3KM0A 5L45A 2C99A 1SM4A 3RS8A 1ETHA 1RXVA 4PXAA 1P9LA 1G38A 1LPBB 3F6PA 1OXXK 3EZ9A 1EDBA 4NBUA 5AVWA 1TX4B 1V9SA 3KPUA 4EEYA 2XX3A 2EZTA 1AY0A 3EXFB 3LF2A 4B7XA 4Q4JB 2WEKA 4B3IA 1WEKA 3OZGA 5TGTA 1FFBA 2BONA 3PQEA 2Z6UA 1ZJ6A 2XPCA 3QNWA 4DR1B 1WKBA 3PXEA 1XD2A 3IKJA 3LZCA 3IVAA 2WU3A 2W9CB 1CVRA 1CUEA 1V45E 2YFYA 4GWGA 1AQIA 4F04A 3GP3A 4JWKA 2BUBA 5KTRA 1YU9A 2W9BA 3KTOA 1JDUA 4ED1A 3GMTA 3PPYA 1QWSA 2BM0A 3C1TA 3EB9A 2Y6UA 5HF6A 2WVHA 4QLBA 2GCGA 2JEZA 5BV2P 3NNDA 4BJ5A 5KU7A 3D7LA 2BCGY 1FMJA 1JAXA 1XMQB 2CBZA 2WYOA 1ZXBA 3CZ9A 3HWWA 3WRYC 1JFSA 1JSXA 3H3FA 1YFZA 5JYCA 4PBSA 2HU5A 5G1OA 5JWHA 5BT9A 1T6BY 3TE6A 1AKUA 5LQUA 1Q7GA 5DGCA 3G2MA 4Z0TA 5ALFA 3A6DA 4W5OA 5DNWA 3K1AA 2YHIA 4R9SA 2XQIA 3FI0A 2Z3WA 5AM1A 2P4HX 1XYGA 1Q1ZA 2OGTA 2FLPA 1LLCA 1QRAA 3K94A 4ZCLA 4AUNA 4X94A 4RPJA 1CD5A 2WRZA 3TRKA 1SPBS 1E2KA 2AZTA 1WAMA 1MPTA 2GLXA 2BI7A 3QVJA 3GB9A 1NBOA 1JAYA 4DTCA 3RRFA 3BORA 3A1TA 2TMKA 2VNIA 3PHHA 4ZODA 1GSOA 2NTNA 2NAFA 5F4BA 5FB3A 1REQB 2VHXA 5ALSA 3C7AA 2IEZA 2FEMA 1LV8A 2QZ9A 3WBBA 1IDOA 3QWHA 1WHTB 4BASA 1USGA 1NVTA 3JAMA 1GP2A 3IH5A 3WRYA 4DARA 1RVDA 1M1YE 4G5QA 3TR0A 3CRW1 5BW4A 3ZS9A 2J3EA 3N2EA 4IKPA 1CDEA 4UVGA 1FNNA 1ZJ5A 2AZMA 3AB3A 1YS6A 3ROQA 3NBFA 2ZI9A 1TVKA 2EKLA 2G70A 1IBSA 1ZK0A 4EBFA 3MN1A 4BO8A 3H2YA 4HNVA 1ABBA 2ANCA 2FR8C 1SKQA 4HXYA 3DEHA 5CFPA 4OXIA 3ZU3A 3N6VA 2W42A 3KOOA 5ILGA 3PLAE 3SLGA 4O7TA 4TTQA 4LV5B 2Q6OA 2RH4A 1NQAO 1M2WA 3ZWAA 4DN6A 3T7RA 1X14A 1O87A 1NAIA 3L6RA 2XA1A 5CT4A 1AA9A 3BMOA 5JJLA 3JQFA 4MGYR 4DA6A 4LRTB 1S8FA 5IFLA 3SX2A 2IC5A 3GH3A 2XTAA 4G5SA 2EJ2A 2GEKA 3HFSA 3AF1A 4TMWA 1G7TA 3NU1A 3HBMA 4AX8A 1U2SA 1J1ZA 5CDSA 1XQ1A 3QKRA 1IPFA 5FA8A 4NRDA 4ZJUA 4EBEA 4UXJA 2REQA 1RJPA 1JDEA 4DQKA 4J9QA 1RAFA 2W90A 5BSUA 4JJGA 2YFHA 5NLLA 1GZ4A 3D2CA 1G66A 3EGDB 3OETA 5TV2A 5DULA 4C21A 1ZR2A 4HEA6 1VECA 1W9MA 3T7JA 2QA5A 2YJ5A 1T2AA 4G8BA 4LVCA 4EF5A 3ECCA 5FYDA 5KFGA 1O95D 3VPAA 3V1YA 4EHAA 3O93A 4RUKA 4NBNA 2ZS9A 3DVQX 4RL6A 1BKYA 4L8FA 4C2UA 4E15A 2QM0A 5FWXA 1Y9JA 5E25A 1RHUA 3CSDA 2DF8A 3IEMA 4M0LA 2VF8A 2BEVB 1OX4B 4QYMA 4YCDA 1GILA 2QDKA 2CB9A 2XB9A 5EJ2A 5BWBA 4TT8A 3I73A 2MT9A 1G19A 4LF8B 4RCYA 1F2VA 4I5IA 5ENZA 3T5PA 5KYNA 4AJ2A 1T2FA 4UAJA 1C29B 4O59O 1GYRA 2VK2A 4RY0A 3KB8A 4GBMA 2R7AA 4KWCA 4LBZA 2OCXA 3K2EA 1EK2A 4J9MA 1ZIYA 1RPAA 4L22A 2CNBA 4HUQB 4I3GA 1U11A 1W30A 4JLMA 1HO3A 4IRKA 1WETA 2VRBA 3HJUA 2MMGA 3FOZA 4AS1A 3DVSX 1VKJA 1YDHA 4UDXX 1YZGA 1X7XA 2DBVO 4V0NA 5AVUA 4MZDA 3LT1A 3HYLA 3OTIA 1KAEA 3J81W 4FNAA 3FROA 2X13A 3IYLW 1E94E 1YE5A 2VC2B 3D6MA 4MV5A 3HGTA 2JD0A 1M6HA 5AVZA 3FBGA 3VSEA 4BYMA 1YU6A 1ZMOA 2VT6A 3NOXA 4JH0A 2CW7A 3N8DA 3UJ6A 2YXDA 1C1XB 4H3SA 2FV8A 4OOFA 5DLYA 3R0VA 4C4TA 1EMDA 4NV0A 2D4HA 2ZTVA 3IPXA 3O5AA 2AEFA 4OBEA 2HIMA 1NF9A 5SYMA 2M6SA 1YA8A 2XCTB 3WWOA 4JSRA 2ANBA 1U0FA 1XDNA 4MWGA 4BVAA 4U4AA 1QCYA 3NWJA 1RI4A 3O94A 3LL4A 4PANA 2ZJ8A 5JNUA 2AWOA 3TOXA 3CUVA 1DINA 3FBWA 2WD8A 3OFVA 5LLDA 2HGXA 5LP1A 3VJKA 3IAAA 3AEXA 2O3RA 1NX6A 3BGWA 4QEZA 3TD6A 4OL9A 3OTWA 4TLLB 2JD2A 5K3SA 2Q7DA 4ZDKA 4IJ6A 3TRJA 4YIKA 5IJAA 1XRRA 2X7XA 2JA5G 4Y7DA 5AI6A 2GFHA 3C41J 4QD3A 4ZOBA 5EHGA 2YRFA 2NV0A 4FEAA 5GZ6A 1VE9A 4FHEA 3ILSA 1JMYA 1G5TA 4V0QA 4LHEA 1MVLA 1Y5IA 2J4DA 3DPUA 3N7TA 1JPVA 5CDHA 4WV3A 2P1RA 4BO0A 3TSZA 4GWLA 2WB1A 3GJ3A 1KF0A 5CMLA 1NZFA 4C22A 3CG0A 1I7PA 1NBMA 2ATLA 2WKWA 5I5VA 1OIVA 4F92B 3UICA 1LRJA 5KYXA 1VFNA 2WD7A 2XF2A 4KQMA 2VJQA 2BFDB 5JQWA 3E8XA 1PSWA 4C29A 1E1LA 2RI6A 1QAOA 1JHXA 3PR5B 4DLVA 4DUYB 4P53A 5JXGA 2Z02A 2NV6A 3GLQA 4HB3A 3FFWA 3LY7A 1XX6A 2FLNA 2YRWA 5E2BA 2H2DA 1WY7A 3BE8A 4P92A 2LCQA 1U5BA 3THYB 1ZUNA 4WBSA 3Q3HA 4BFLA 3LUBA 1A4XA 4HDOB 4TL6A 1GWNA 4HVLA 1GUAA 2R8JA 2DH5A 1N8SA 2AMYA 4UDYX 2PD4A 2AMJA 1VJTA 4LJKA 4A5OA 2AFIA 1M76A 1S2GA 1GU0A 2C4HA 4RF4A 3F0TA 1R27A 3ONEA 3U7FB 3TLYA 1VG8A 3PIRA 4GPAA 4YP0A 3LDGA 2Y1KA 1KJZA 1ZJYA 2NO0A 4D8TA 1C41A 3NBAA 3DNMA 1CR4A 3DKIA 4H60A 2BIFA 3FF4A 1BQ4A 3WDLA 1ZI6A 4PONA 3PNLA 3K92A 1UZLA 4WW0A 4ZOAA 5D87A 4J4HA 3LQ4A 5AUNB 5JPCA 2AUMA 1D4AA 3JWPA 2GILA 3Q72A 3UK2A 2FUCA 3ZCTA 3UZOA 4RU9A 1OBCA 1WNTA 2AT1A 3EGIA 3SDZA 4TVKA 4QATA 1XKQA 3IP5A 1II8B 3FHOA 2OCPA 4PBTA 2O7SA 1WZIA 2X1MA 5FUQA 1FMFA 3BD7A 2QT1A 1Z62A 2G76A 3AYXB 4LJYA 3U5TA 3P96A 2XQGA 3G2JA 3KJNA 1SXJB 1RP1A 4AICA 1E9BA 3ZE7A 4U63A 4FDMA 1BKSB 1XQYA 4FGWA 4O02B 1ENYA 1PZEA 4PNZA 3FTFA 3S29A 5KG4A 2OK7A 3ZQKA 4NU8X 3D3KA 1ZK4A 2J3IA 1D4FA 2A9OA 1LS1A 1YJBA 4I1YA 5B4TA 1V6AA 2PSFA 4DIDA 2BGGA 4MS1A 1OTHA 3FWPA 3FD8A 4F21A 3I1YA 5GONB 3RTAA 2B9VA 4EMSA 1HKHA 4LZWA 4O4JA 2P1DA 5GIOE 3ISVA 2XH8A 2XITA 4Y3UA 2Q5CA 2VI5A 1YDGA 5KJ6A 4F9FA 3O91A 2QMEA 5AT1A 4M7EA 1HURA 5HMLA 2JC3A 4RWEA 3ZWQA 1CEYA 4BQOA 1XWWA 3C3EA 1T5SA 3L8EA 3PQFA 4TYWA 5BMVB 2WSBA 1UPAA 5DHAA 3QF4A 1W4LA 4DPLA 4INJA 3FSRA 4O4LB 2BHLA 4A3FG 2ICAA 3IJPA 1E3TA 3HDGA 1TWAA 4BNTA 4IEIA 4EPTA 3OIWA 1ZOLA 2CL5A 2ZE5A 3U3DA 5LNK1 2WIKA 4JLKA 3N3AC 3SMQA 3FFXA 2JCSA 2C3PA 4B3SB 3WQHA 3NJ8A 3JQ8B 2YTZA 4RMHA 3GLTA 3W8FA 4F2GA 2EJVA 4UEQA 2W8LA 2FTKE 1ZA2A 5J40A 1FY2A 2XNDA 1R74A 3V8BA 3GJ8A 2ZZNA 4OJTA 3LPDA 1U0OC 3MIZA 3LM8A 3E3NA 3WSWA 3ZGNA 1D6NA 4V39A 3CCBA 4LY9A 4B3MH 1D3AA 4JX8A 3C7TA 2LIPA 4FD3A 3N2KB 1NGSA 2GZAA 4PGFA 4F8YA 5FTKA 1CS0B 4UDOA 1P5JA 1SIUA 3R0ZA 3DLHA 3UQZA 4KRYA 3AL0C 4QXRA 3GP5A 5E3JA 2OO3A 1RHMA 1Q7TA 2HLPA 4B6FA 3V7WA 4HB0A 1WB9A 4PNHA 2A0WA 1T9HA 5FUBA 3RVSA 5JQGF 1SCUA 5HK8A 1PT8A 4C4RA 3K0EA 4Y7CA 1FDVA 2FFRA 7REQA 4B1FA 4WESA 1I1OA 5DQHA 1ZIXA 2WG2A 3NETA 2RDJA 3QPVA 1AK1A 3ZD7A 1O95C 3T1QA 1ZN8A 1MFZA 1ZY2A 4WVLA 1ZRMA 1IK4A 4GVLA 1RJRA 2FG6C 4QU0A 1CRLA 3F3YA 4X85A 2WU1A 3RGXA 2H29A 4HDMB 5K0CA 3WLRA 2VHVA 1WSCA 2DHQA 5BN5A 1ZH0A 2B99A 1KYTA 4A5SA 4CEHB 1FP7A 4J0IA 3BF8A 4UFOA 4BNMA 4U6SA 4UCVA 4YR2A 4R69A 4RSMA 5AXCA 3EF0A 2GCOA 1I3KA 3VX4A 4G8CA 1H9BA 4LVNA 4OFXA 5ALDA 4J1TC 4RQTA 4JLDA 1BHSA 4N9WA 5B1IA 4PZ9A 5ELXA 3BREA 3ORHA 5KFOA 4NX2A 4W9MC 4HD8A 1ZYUA 5KG5A 2X7HA 2QLJA 4LTMA 3U1BA 4ED0A 4Q7JB 4D5EA 1WV1A 1F1JA 2VRCD 6YASA 4GOND 1X77A 2UVVA 1KTVA 1GTZA 5J2TB 4YJ3F 1LB1B 4HNTA 2ZB4A 3DCYA 3I45A 3ZZMA 4RKQA 4PCLA 3L05A 4RA9B 4ZOLB 1EWYA 4EY8A 4MV7A 1UOEA 4G5XA 4OI4A 2IKSA 4QWCA 3EW9A 3A9CA 1S2DA 3I3SR 3BB3A 4O5OA 2GHTA 5KT2A 4JXUA 2CXUA 1S89A 2VNSA 4V24A 1I4WA 3RG2A 3NANA 2XAUA 3QYJA 1H2EA 4MITA 1H4QA 2VP3A 2G9NA 3MWGA 3SZLA 2DHDA 4KGXA 2YIJA 1OTYA 1TKBA 2DKOA 1WR2A 1CRWG 4TSFD 1FJGB 1E2FA 4CXMA 2C9ZA 2W57A 3WLTA 3CWCA 4YBZA 2VYVD 2RHBA 4F71A 3HNOA 3X3HA 1KFEB 2X0SA 2COIA 1TZBA 4CF5A 3OG9A 4FOSA 1FTSA 2WUVA 4NFHA 1DMRA 3R7NA 3C1OA 4BLVA 3CBQA 3EXEB 4JQSA 1K5PA 1NVUQ 3OLYA 4WA7A 1TM4E 2PUHA 4XYMB 3UW3A 4D42A 3SIPA 4N7JA 3ZEAA 4BRSA 2XR1A 4RVOA 1EFAA 4OMFG 4LKOA 1VBGA 2GBLC 1TOAA 2CHEA 3K31A 1UJ4A 3AKDA 4D9JA 5AOAA 4X6LA 2FDXA 5IWAB 3L7LA 5BORA 1JDNA 1M73E 2FMXA 4WADA 1RZ3A 1IVSA 1O94D 3I34X 4YRCA 3A26A 3BDVA 4ZI3A 3UFBA 5C1DA 2WZDA 2QR3A 2I0FA 2DWCA 4G3XA 3QE9Y 4TQ9A 2H2HA 2QN1A 2ZI5A 1USWA 4BO9A 4U9IS 3RS9A 4I36A 1ODSA 2IYNA 1LU9A 1GPKA 4MVJI 5HK9A 2X14A 3AUKA 5EMNA 5H81A 2G9UA 4C2BA 5H4GA 1XTSA 4A2WA 4FX5A 3ZVNA 4DVJA 4X71A 3HU1A 1Z0AA 2ACKA 4KH0A 4HGQA 2QQFA 1LBIA 3BB1A 1UDWA 2PJUA 3ZDYB 3R74A 1N1GA 1DHTA 3EMDA 3WA7A 1JKXA 4HH4A 3VR2D 1UXIA 1HM5A 2H2FA 3E23A 1N48A 3LUPA 4WOPA 4AJ1A 5L3ZA 3L5KA 3D81A 4L3VA 1NBIA 4LDPA 3E82A 2MWMA 1WXEA 4D6XA 4JKYA 1YZHA 3B60A 3G23A 3IN5A 1XDDA 4J16A 1F0NA 1IOWA 3H99A 3MR6A 1ZJZA 4A2PA 4Q9KA 4ZEXA 5D7NA 1Z06A 4ZU1X 1GN8A 3MW8A 4D92A 3RV4A 3VBEA 4DG8A 3OJWA 4P7GA 1RYBA 3LT4A 5IVPA 2NU8B 2OAP1 2CMKA 5HIIA 5LJLA 2XCSB 2UDPA 2V7TA 4Q4CA 1G21E 1MHPA 4R84A 5JATA 2YV5A 2P27A 2DQZA 4NL4H 4LJ8A 4ID9A 2QPOA 4X62H 2O3QA 4IJKA 3RJMA 3JQDA 2OORA 3QFCA 3AHJA 3LHKA 4QPJC 3THSA 5IAEA 4J29A 1UKYA 5EWMA 3H4IA 2Y8EA 2L69A 4A3MG 1OAAA 2DHEA 5EQFA 2PA0A 3SSNA 2V74B 1FA9A 4NG5A 1A9ZA 2CYBA 2AD5A 4HH3C 4HB4A 1QF7A 3BSYA 2PUVA 2QTRA 2VHQA 1ESCA 1FSGA 2PO7A 4BXXG 1AKMA 4W5JA 1LPSA 4IGAA 4J6EA 4POAA 4AQYB 3WRWA 4TVSA 2I1QA 2AVDA 4R9RA 4KXXA 1HOTA 4Z54A 2BOVA 1GTG1 1M8PA 2ABWA 1FXUA 4YJDA 1FL9A 5CT5A 1TF7A 1JDPA 1O58A 3L4BC 1W88A 3CF4G 1RWMA 2C8VA 2P3QA 1KTAA 4JBHA 4KLAA 2VUSA 4MVCA 5EZYA 3HL0A 6AT1A 3C43A 2XGJA 5CLIA 3FUTA 4G4IA 1GM5A 1CU1A 5IJXA 5TX7A 3GPDG 1RAHA 2FPXA 1SHTX 1WDMA 1RADA 3NO4A 2J9GA 4ZOQI 1Q20A 3DLIA 4YP1A 4NXMB 3W5OA 3BDIA 1JFVA 1Y4UA 3ZJTA 2WP0A 3WWZA 5IKEA 4DCGA 3DFZA 1FFAA 2VF5X 5IDVA 3NHYA 5JPIA 3E7XA 2AYZA 5AVKA 2PGOA 3OIYA 3UWSA 1Y1KE 3TH5A 5EERA 3HCDA 4LYAA 4PAGA 4F11A 4NLLA 1EM8B 2GN0A 1L7AA 4M1YA 1TCVA 4FFBB 2BL4A 2A9VA 3WIUA 2MR6A 4ITVA 3FMGA 2PX2A 2QGNA 3CNHA 3JQEA 1Y8QA 4ZOCA 4ZYXA 4RKRA 1N6PA 3HXOA 2QJFA 3VPGA 1VTKA 3I3OA 3N2ZB 3UJBA 2C8JA 3B1YA 3BQ0A 1N25A 3AVWA 3QEKA 1FP4A 3E9NA 1DCMA 4IAOA 2E5WA 1KZ4A 3E5NA 5DX8A 3BFPA 4RB2C 1NRWA 1PQUA 1BS9A 2P7HA 5KIAA 5A2QA 2VPXA 4Q05A 3UYLA 3LUCA 1JHYA 3X1MA 2JLRA 3PZBA 3FHLA 4ZEMA 4B34A 3QE0A 2B3DA 3W7VA 3OUTA 4A6XA 4PZDA 1N36H 4Q9JA 3VR1A 2C54A 1FFDA 3K9BA 3HLKA 4IZOA 3L1HA 3OMWA 1QC5B 4XWAA 2VQ3A 3Q6NA 4BFSA 5AVXA 5LQSA 3ZNPA 3B7PA 3Q0EA 1TA9A 3E5RA 2PMCA 4HRXA 3NBYB 2DERA 3P19A 4REOA 3UAYA 2HMYB 4YV7A 2JFNA 5EDWA 4GIBA 1U8YA 1N57A 5JBQA 4QELA 3PC8A 5I9MA 1K66A 3GCDA 1DKLA 1BVRA 1YOVA 5EJMA 4ZRNA 2VT3A 5TS2A 1XP5A 2V3VA 5ALRA 1F2UA 2JA5A 2DAAA 2H8GA 3KKEA 5A4JA 4UOZA 4KQ2A 2FK3A 4G5RA 3RASA 4AYBE 1LDYA 1GPYA 3NKLA 2OT3B 4Z0PA 2FNAA 2Q0QA 1QK4A 3SHOA 1J33A 4DYVA 5TLSA 1PNOA 4F2HA 2NYVA 5IYDG 4XD2A 3S2ZA 2LVBA 3P2MA 2OHJA 2ILVA 3B8HA 4MKHA 4YRBA 2J30A 2ODEA 1FTNA 4JJ7A 4MUHA 3EWSA 1SOWA 1YCDA 3GEMA 3PDHA 1E79A 1KYIA 5D84A 3CH6A 5TR9A 2I4RA 3QM1A 3CPJB 3ZS8A 1M6VB 2BR4A 2AKEA 4TWAA 4HFMA 4JK3A 2RJ3A 3SYMA 3ZWBA 1Z8DA 4OHPA 3OE5A 1BZYA 1WO8A 4J4BA 5CLFA 4JGIA 1E3LA 4RNNA 4M36A 2A0UA 1LSUA 5I7RA 5CCXA 4YAJA 1SPXA 1IQ0A 3N5KA 3IAS6 1ZUHA 1P75A 5MDHA 3R3YA 4JI8H 2WINI 4LZPA 3QEJA 4DBLC 2D3WA 4ZQCB 3B3GA 1SQGA 4C2TA 4I8DA 2NO9A 3DB2A 4A16A 3CYFA 4IFIA 5T3UA 4NULA 4BPBA 4ENPA 2R68A 2QNBA 1X1SA 1YTLA 4I2NA 4F3TA 3N28A 2HBRA 1YQDA 2H57A 2P6PA 3M0EA 5C9ZA 1Z63A 2G0AA 3RGWS 2YZKA 1U9IC 1RCFA 5AW8A 2CNDA 4ALJA 1O96A 3EDQA 1M2GA 3GJ0A 1HLGA 1RFLA 2HA4A 2OCGA 2BFEB 2DHRA 4EBDA 1U0EA 1KSFX 2AI1A 1JRLA 1ONNA 2HF2A 1DRUA 3JWGA 5C2JB 2VJMA 5FAKA 2IY9A 1O6FA 5LQCA 4EECA 1DIAA 1ORWA 1ZCFA 3HTXA 3NMUF 2XMSA 1XAGA 2FEOA 1O94C 4GM4A 3NAGA 3EVGA 5CB4F 4ND2A 2PZEA 1I3NA 4Y2SA 4HQ6A 2FDRA 1EUDA 3ZE8A 3NCHA 3PR4A 5EWJB 3ER6A 1RRMA 5BXQC 4Q4HB 1T1RA 4RKEA 4FEYA 621PA 2O8BA 3AJ8A 2QZ4A 3OZEA 3WQSB 3OZCA 1XQ6A 4QM7A 4EEZA 3LYAA 1VA5A 4KK3A 5LCXA 2OQVA 5EGSA 2UAGA 1X7ZB 1DIHA 4EJSB 2VP4A 3SSMA 3JW8A 4GBED 4YDHB 1BEZA 1XLWA 1MORA 3M6VA 2X6QA 2H92A 4KVAA 5CEEA 2ZAOA 4A26A 1CWUA 5H3CA 2VCHA 1ULSA 5JWOA 1W19A 3H0CA 1RBZA 1KK0A 3D6VA 4RVUA 1SD2A 1V43A 2VHCA 4LNUA 1EGVB 3I58A 4IWXA 2O8DA 4QFCA 3EQ7A 1TWFA 3JRNA 4GMGA 3B7GA 3KUCA 5EUQB 3WIVA 1IWOA 1KWKA 1DUIA 2Y05A 3ERCA 2AJBA 1X2EA 3F3KA 5GONF 3O8RA 3EHEA 4JLNA 3SBOA 2XHEA 4FB5A 5BMOA 3TLGA 3KU4A 2ECKA 4RPCA 1X38A 1RR6A 2QUIA 4N76A 4QJBA 3OPMA 3VSAA 2QD3A 4IKEA 1IOLA 3JCZA 4RNDB 4C6TA 3WHPA 3GWZA 4OPMA 5A3JA 1Z3IX 2LXNA 4AO6A 3SOZA 1WCIA 3OKAA 3HUEA 2XTNA 4B3XA 2Z2YA 2IYLD 3NKFA 5GP1A 2ST1A 4MV9A 5T6MA 3W90A 4OL0A 2L42A 3JATB 1OVGA 3F2IA 2J33A 3R6LA 5DJ5A 1B4DA 5J43A 1ATIA 2CYCA 2O2GA 1LK7A 3IIIA 1GHTA 2HMSA 3K2BA 3WWYA 4QIWA 1JMVA 2NZVG 4PFJA 1HSOA 3EEQA 5BN4A 2BELA 3BDAA 2AU0A 4L75A 1QFMA 3M5CA 2H1OA 4R8SA 1TK2A 3K1YA 3VH4A 2WYVA 3MJTA 3LZDA 4EX7A 3WGNA 4MQBA 4KDCA 1L5HB 4KNWA 2QE6A 2ZTMA 5BN3B 1Y6JA 2F1IA 3F7NA 3PIIA 3IB6A 1YFKA 2E2IA 1EYZA 1XEAA 1OBGA 3K6SB 4F8JA 1DX4A 4F4JA 1UQUA 3BJMA 1ZP6A 1CB0A 3K70B 1S03G 4CN8A 1ZN2A 1QORA 4MGIR 3LDHA 3K5HA 1XDBA 4MVJP 4X1YA 4DCMA 1SXJD 5AVRA 2FKLA 1YFLA 2OSBA 3O7WA 5A0TA 1E1DA 1AXGA 3GR6A 3IVGA 2CMDA 1IHDA 2WDTA 1QS0B 3IR5A 3A37A 1Q57A 1PZGA 1E9VA 1KK3A 3BSSA 3GEIA 3ZXUB 1L1FA 3O9ZA 3TTSA 1E62A 1XF9A 4AROA 2QOEA 2HQSA 4TMFA 3GVPA 4GXTA 3L1VA 3RIEA 2IIVA 2ZJZA 3C0KA 1Y7LA 2GXAA 4IYRA 2JAPA 1AVTA 3EH1A 2IP1A 5DG9A 2V03A 3P2OA 4ALMA 3ICCA 3CF2A 5F7JA 4Q4AA 4IJWA 2YIMA 5I48A 3EG9B 4WTOA 1E9EA 1T15A 5ENVA 4EDFA 4OQPA 3IEUA 4AK9A 3DL2A 1RYMA 1QPBA 5A5VA 3KB2A 3PGMA 2V7XA 4UOEA 2FPMA 2RGWA 2Y1CA 1T6XA 3QA3E 2FFHA 2GZ3A 4O3NA 1UJCA 1AC5A 2COJA 1ESDA 5REQB 5JQGB 4JYAB 5KNCD 1HK7A 3FLAA 2PVPA 2PWPA 1XRJA 3F5SA 5J23A 4JQZA 5FEMA 1YI0A 2FQ1A 3QXXA 4BCDA 1DEAA 3LPNA 2PSSA 5GGXA 5C7YA 1IVNA 1W93A 1L5QA 3LX4A 4D0LB 2W2LD 1JS1X 5EFZA 1IYDA 3CKLA 1TPZA 4WACA 1WSDA 1GZDA 3NVDA 3IO5A 3LL7A 2XC9A 1LWNA 4RK1A 4KZPA 3ODPA 2Z04A 5BSVA 3BX1A 1PRYA 1BOFA 4QQKA 4C1NA 1JWAB 1O5OA 1S2NA 2M32A 4LBWA 2C42A 4B32A 1GGMA 5KFYA 1XU4A 2ZUTA 5T4BA 1NXOA 3RWMB 4U7FA 1NF3A 3QBVA 1CKNA 3LRTA 1MEEA 5J5VA 1REQA 1SURA 3PE3A 4XSVA 5FADA 2JH9A 2QVGA 3QHAA 4XVQA 4RTJA 1UEXC 4LSGA 3C3CA 3EGWA 5K3AA 1PSZA 5JPDA 3L6BA 4HRYA 2EW8A 1WCMG 1LQTA 3W77A 1E2PA 5J1TB 1HDRA 1XVTA 1Q1EA 1M7BA 2CHUA 4PX2A 3TTUA 3SZ3A 3LNCA 3KBBA 3ZV3A 4YJ3B 2NO6A 1DQRA 5D5PA 3JV7A 3Q5EA 4WLOA 3PJFA 5CTAA 4B83A 5LWHA 3GRYA 2IYTA 4JBIA 4A7PA 2LP4Y 4DL4A 1MF7A 2CDAA 1TCAA 3WLEA 4IMIB 5KZMB 2ZAGA 3TRDA 4C30A 4IZIA 3I2IA 2JA6G 4JJ6A 1J0CA 4I1PA 4NE2A 3RAEC 1NP3A 3EYYA 3Q3VA 1GL3A 4JJ4A 1YE8A 2XEDA 4H59A 1DCFA 3NORA 3R7WB 4Z3DA 4RTPA 1MQ9A 4QEKA 1NR5A 4PYMA 1ODCA 4PPYA 1KNXA 1ZGGA 3T3MB 2XBUA 2WTFA 4PWYA 2CMGA 4CM3A 5MGNA 3VC7A 1KU6A 1UT6A 3HY6A 1Y1VG 4JU9A 2HR1A 4ZHSA 1QH8A 2OSVA 5BV0A 1EUZA 5JAQA 4PSUA 2E1PA 3UUGA 3R6WA 4CT0A 4X62B 1TKRA 3EEBA 1A96A 3TX2A 5EVJA 1UM9A 1SO8A 3THRA 4PLCA 4AW9A 5B58C 4W5NA 3K6KA 1S96A 1O8BA 3AR5A 1KI9A 1JPNA 4IGIA 5K3EA 2QSZA 1RLIA 1FSFA 1LH0A 4MQEB 2HGZA 4JL8A 5F12A 3M5WA 4C7OA 3L6EA 3OLVA 4MB2A 2O1XA 3NALA 5HP4A 5F51A 1G20B 4MMZB 3LA6A 1M0EA 1ZZGA 2ONYA 2I91A 2GKSA 1MP0A 3ULKA 3VYVA 4RY9A 1M34A 1H66A 3N44B 4B2PA 3H5WA 1TUIA 4ZCIA 4QBKA 2V7PA 3WX0A 1XRNA 2BMEA 3GIWA 3K5PA 1DAFA 3IE2A 1N5JA 2PU7A 3PYMA 4TYQA 4LIPD 3KTDA 1U9CA 4MYDA 4D81A 4K05A 1COWD 4PGAA 2RE8A 2CZCA 2FN4A 5JMWA 2HQOA 4ZALA 5JADA 3WFJA 3W5UA 3C8ZA 3KXYT 2VS1A 4BVEA 2P9CA 2ZTUA 2ZIFA 3X2EA 1U0TA 3MT9A 1DC3A 2X5KO 5FBQB 2CF6A 4D9FA 4HN4B 2GF9A 4FPXA 4TWRA 3RTGA 4ZVTA 3RQIA 1N32H 3G6XA 4XPIB 2QMUA 4UTPA 3WWIA 4YP9A 1WB6A 4L8YA 2HA0A 3RUIA 1TM2A 1G8PA 3ZHYA 4G9EA 3GZJA 3F8SA 4ENSA 2GVZC 1T5IA 4MB6A 1H2HA 1SBIA 3AOEC 1V48A 3EVFA 4G1BA 3DTFA 4YR3A 1Z5VA 1SEIA 3ZWYA 3WBFA 4X7MA 1I2LA 3QNUA 3ESDA 3DV9A 3AUFA 2SKEA 4RQUA 4I5EA 1M2JA 4PICA 5E2IA 1YD7A 4GRDA 1CUCA 2YWCA 4GVPA 5KAPA 4EGJA 2RF4A 5EIOA 4OHCA 3C70A 3NBQA 4PPFA 4Y2GA 3Q98A 2YHAA 5HFNA 3RS3A 2FEAA 4K5QA 2B8EA 2WU4A 3PR3A 1KMHB 3JASA 3Q1KA 4HNRA 3CEHA 2OD9A 1GZ5A 4JLPA 3VSCA 2V7GA 4DV3B 2OCDA 2OQIA 1MV8A 4OM7A 2CFOA 5EA2A 5FPPA 4M86A 1ULTA 1YVPA 4Y6LA 2IV3A 1RI5A 4ECZA 1MU0A 2GN8A 4FE2A 4XGRA 3DE1X 4ZVMA 2BGLA 1G17A 3CUEF 1P1IA 3I0ZA 2B63A 3QWUA 3DQPA 2IUEA 4IICA 1Z3CA 1NR7A 4ABTA 3Q1LA 1SFRA 1Y1LA 3BH6A 2VA9A 3QOFA 10MHA 3ZCXA 3U1TA 4D9BA 3F8NA 2ZITA 3RT1A 2OY0A 3A32A 3MFHA 3THYA 2OG2A 2R1ZA 1NUQA 5BV1A 4IUBS 3AU8A 4L9AA 2FP4B 2W6MA 3X1DA 1HR0H 1U8EA 3RFUA 1SXJC 3CE9A 1WZCA 4YRKA 2JGEA 4REMA 3CVZA 3QLTA 5I47A 4BKRA 1SB9A 2YDYA 2GM5A 1XTZA 4OHKA 3NNNA 3GFQA 4ZO8A 1O9GA 5KFVA 2BGWA 4LDAA 2O1EA 2BJHA 2FR8A 1FDWA 5FUWA 4X93A 4EK9A 3H1PA 3UGTA 1P1CA 1NQXA 5T7BA 4DY4A 4RTOA 4H3HB 2LKDA 5TT1A 1RP7A 3ZGOA 2X8JB 4GVXA 4Q7EA 5FTWA 1W581 2J9XB 4C76A 3Q0TA 2DX7A 2WFMA 1D8TA 5ALEA 3C24A 1HNWB 4TS1A 3C5CA 5KWEA 3HFGA 3DZHA 1JNYA 3B8EA 2OB1A 5FWYB 3RU9A 1OB2A 5AJTA 3WL7A 5FFNA 1NUTA 1SD5A 4F0JA 3IP1A 1D2GA 1BMFA 4Q7LA 4WRRA 1VPEA 1X87A 2KX7A 2GEBA 2GEFA 1IHUA 2CNWA 5LBTA 5FOQA 1ODIA 3DZCA 3RJ5A 4OMDA 4FIZA 5KWJA 2QYOA 3MRVA 1HMYA 3QHQA 1IPHA 3AILA 2QX6A 4CETA 3FVWA 2W6NA 3V8QA 5ADHA 2ZJOA 5K45A 4XSHA 4G4SO 2HOQA 2YXEA 3H2KA 2DTXA 4JA2A 4UHBA 2AC7A 4F2PA 2P77A 1I1LA 1V2GA 4MA5A 2PPLA 4J90A 4ECSA 4KDEA 2W58A 3UHJA 2WM2A 2HRCA 3LOQA 1WD7A 5KX5F 3BS4A 2H4YA 3JXEA 1KQ3A 4AURA 3QUSA 3E9QA 2PGNA 3VFDA 5BMVA 4U7DA 1E6KA 5DX0A 2WWXA 4OSPA 2O48X 4NBRA 4O4LA 3NASA 1Q44A 3H5IA 4LXYA 4KOEC 3PRJA 1K7YA 3K9HA 4JI0H 4OHVA 1SC4A 4YWJA 4QA9A 1MAUA 3L01A 3IMGA 1Q3TA 3EX7C 4Z9YA 4KQGA 1G4AE 4Z7QB 1P0CA 4C7XA 1R3UA 2DR0A 4Z1MA 2R6CA 4R1LA 4DUPA 3WRXC 4GLOA 2IUTA 4PRKA 2J41A 3QZUA 4YA6A 1GR0A 1KAHA 2R8BA 2WAOA 1SHUX 5BVHA 2JBAB 1RAAA 3LDUA 2XSZA 1L7MA 1JI0A 4CG2A 3LT5A 2D3TA 4G1CA 5FHRA 5DGXA 3O2QB 3GTLA 4MS3B 3KQPA 1E0AA 4MLCA 1Q0TA 4FIDA 3QUAA 4PU0A 3HBJA 1DJLA 3TAXA 1CS0A 4N8DA 1N2CA 2YIVX 3DHWC 4NBSA 5P8WA 4BX8A 1R9JA 2ZKLA 2SNIE 3RS0A 3CQ9A 3MCZA 3F1KA 4OQ4A 4AMUA 5CXXA 3VHXB 4WBNF 3VU8A 1HT3A 1P2VA 1VDMA 5AVOA 1QHNA 1Z8NA 4BV2A 3WRXA 4E6PA 2GYVA 4E6NA 4HYTA 1VMAA 4R1OA 2BM9A 5AVYA 4PIPA 3BT7A 1U2DC 3GV5B 2FWAA 3FNIA 4RV5A 3X2FA 1O77A 3HZHA 1TM5E 3VYRB 5BWXA 2R25B 4LNHA 1D4OA 4BVFA 4S3MA 1XZJA 3CZCA 1ET0A 2C5EA 4GS5A 4MRVA 3WZMA 2IYWA 4EYIB 4JBYA 4WK0B 1OGYA 2YJNA 3KEMA 1A9QA 3HBFA 4RH0A 2QE7A 2X4DA 3AERB 3HOXG 3IEVA 3KL4A 2QGFA 2ADMA 5CB4B 1UBHS 3K30A 1ZDMA 4F3KA 2I62A 1IMOA 3H04A 3GJXB 2PCLA 4QJ5A 3REFA 3KJIA 4UBLA 3LC1O 3JVVA 1Y5RA 4AG3A 5J2TA 1V4YA 2PFKA 4E32A 3D43A 2CK3A 5DNVA 4UMVA 4ZVSA 1VE6A 4RA9A 3U40A 4G8DA 3GJ4A 2X58A 1P7PA 1MTZA 3DEIA 3G1WA 2KE5A 2RBEA 1ZIDA 2JIQA 4GD3Q 3T12A 5KTNA 3IR7A 3JQGB 3ZCUA 4HO1X 4F1WA 3VZRA 3I4LA 3KWLA 4J7CA 3PXXA 4B71A 1T36A 2RHMA 3LSTA 1NI5A 2V7EA 2W0MA 1SC3A 3U26A 2EGUA 4JLBA 1U65A 3S1SA 1BGXT 3GEBA 1N6NA 1S9DA 4KLZA 2AYXA 5KINB 3IKVA 5BNZA 3IQIX 4LBYA 1Z12A 3IXMA 5L95A 4C4YA 1JG2A 4W1PA 4ZICA 1G2QA 2C57A 3OZTA 1YVUA 4PZLA 1X1TA 3ZIAD 4KQHA 4Q18A 2PYZA 5FLEX 1NSFA 1Y9ZA 3PJRA 1V1MB 3AK4A 1L1QA 1GTMA 4EB0A 4EEKA 2Z83A 2KSWA 1O9BA 4OA5A 1NPTO 1HDXA 1EU1A 3FMFA 1DPGA 6GPBA 5EYPA 3ZU2A 4FE7A 4KRGA 1GCGA 3CZQA 2CE7A 1Z5ZA 1VPVA 4L3WA 3EN0A 4OI2A 2OA0A 4Y2HA 2WOOA 1QH1B 4XYLA 5FHQA 4AYXA 2A84A 1L4LA 3T0GA 1NPDA 4JR0A 2HSDA 1EEXB 3RSOA 1NJFA 4W9RA 4CEJA 1F9AA 5CM9C 2QT9A 2ZJ7A 3UG7A 3U60B 3OJCA 2I65A 1ZRSA 5I5EA 2G1AA 4Q0YA 1E1NA 1CETA 3R3SA 2IXFA 4KB5A 2P0YA 3NYWA 2WSSD 5AI0A 5F1PA 3TD9A 3ND8A 2F1JA 5BO5A 1RM3A 1XVIA 3LCCA 2G06A 2IYAA 5CCEA 1YKFA 1IG3A 3ETNA 5LYJA 4JKOA 5EESA 2GFIA 2RGUA 3ZX4A 1K8YB 1JE0A 3DYBA 1N0HA 4KTVE 4DWOA 2VA2A 1GGKA 1SHJA 3H4TA 4MMYB 4YB8B 1C7FA 4AZWA 4Y0VA 4AKSA 1BMDA 2WHQA 3SYLA 3S2SA 2HV9A 2ZUWA 3M6IA 4KTTE 2VSOA 1U3TA 3OP1A 1FDUA 1I01A 4LPSA 3BICA 5AM5A 2HX1A 5B57C 1JYFA 2MJLA 4HF7A 2UZ1B 1FXWF 2VT7A 4QM6A 1W5TA 1YBHA 1JVBA 1L8QA 5H4HA 1IJEA 3KLNA 3A10A 5CB0A 1BU5A 3JZ6A 1XZMA 1QJCA 5IMSA 1CQWA 4NP6A 1ECPA 4LF5H 4DKJA 4RK6A 2RJOA 5LL6b 1SIBE 4L28A 3MUOA 4DJTA 1RU3A 2O2YA 5AKYA 3O2JA 2EX0A 1JP7A 1JXMA 2Q99A 4P6VF 4BMXA 3DBHA 3K70D 1Z45A 1Y8CA 4JT9A 3GLFB 5KFEA 3HCFA 4XDHA 2VF4X 1ZI8A 3S0JA 2ZDHA 1WCMA 2AMVA 5D3QA 1KERA 4AIIA 3NC0B 1ODLA 2ZYUX 3KLPX 4ZZ3A 3DV0B 4RELA 5EHIA 2G6TA 2WDPA 4O7YA 5B2EA 3VNAA 3QTTA 7AT1A 1A0IA 3ICWA 2I6SA 4WK4B 4DV2H 2QZSA 2JG3A 2OBXA 2JEYA 3PTLA 3I0NA 2P5UA 4HC4A 4M9UA 4MR7B 2OE2A 4J03A 4EIWA 4K9QA 1GPMA 5TQ2A 3UPUA 2Z0MA 4BJ1A 2QF7A 1O95A 3QVOA 4N8SA 2RHGB 1DLJA 3OCZA 3ITDA 1LW6E 2HRDA 2JA6A 2BYTA 1YB1A 4MICA 4G1EB 1Y5MA 2QX9A 3KAQA 1NVFA 4X90A 2CJWA 2ZQ5A 1OYOA 2C59A 4L5CA 2R85A 3O4FA 2EGHA 3C7CB 5EIXA 1CUJA 4X1IB 3O9MA 1PR5A 4BMCA 3RIMA 3B3QA 1WP4A 2GARA 1W76A 4J1TA 2YXBA 1IB6A 1Y1VA 4FLMA 2H54A 1SWVA 1Q95A 5BNTA 3KO8A 1RPJA 1N5MA 2XT9A 1LRLA 3B12A 1YA6A 1Z6GA 3U7QB 2BFCA 2R7ZG 3AV0B 2RGNC 3HXQA 3RAGA 5EWFA 1OROA 2BBOA 4Y9SA 2ECQA 4CF6A 2V58A 3KSUA 2LNDA 2MTBA 3X1WA 3LPMA 2D5IA 4KNYA 3R0XA 1W0CA 4X20B 2WJZB 3M6AA 1HTBA 2HSGA 3WV4A 1ZLXA 1J97A 4P93A 3GLHE 1MB3A 4G5YA 2O2SA 4CMEC 3L6DA 1IHYA 4RJ2A 1A9OA 1Z33A 1EM8A 4U0JA 4Y18A 3BVPA 2BJVA 2PMZA 1DARA 4A2AA 4BLTA 3T1NA 2WMNB 3PFFA 2VOJA 3BUSA 4J0HA 5CR5A 2A9KA 1ZHFA 2QAGB 4MYSA 3KUKA 1LLQA 1TVCA 3NBYC 3UZUA 4CM9D 4E12A 1VYUA 3EGEA 3UANA 4URXR 1BXGA 1BTOA 5ICSA 1Y4DE 3OPVA 4QZVA 3T4XA 2PLAA 3D5QA 3FMIA 3ZU5A 2AB0A 2ZP1A 1WOYA 2ZYWX 4CVNA 1HDEA 3VTAA 1RPZA 4YRDA 2PZFA 5EMKA 1S0NA 3QSYA 1H69A 5H16A 4CCWA 3DEAA 3MHTA 2OHOA 4BE7B 1A95A 3SVTA 3PR2B 1CUXA 3DEYX 5LMZA 4P5DA 4KLNA 2XVXA 3H17A 1M1NA 2YIDA 1ZMRA 5B1EA 2BCEA 4HFJA 4PWQA 1ZD8A 5IF3A 3CG4A 2EFCB 1PBTA 5K6RA 1K3TA 3DC7A 1P7CA 5HKBA 2GBLA 4DJAA 1FJXA 3T7AA 3LSYA 1BDMA 1HLDA 1ADBA 4QFMA 3H2SA 3GDHA 2WAQA 3OA2A 4D9HA 2M9MA 5EUMA 2OYRA 4DANA 4RENA 2I3BA 4BNLA 3T7SA 2H5EA 1YIOA 4FX2A 5LZ8A 2F3TA 3ZQJA 4BKOA 1WBBA 1BEUB 4AZSA 3LWNA 1V26A 1H6DA 1PL6A 4QGHA 5HM6A 3GRFA 3IALA 2UZ3A 1T5OA 1XEFA 3AI3A 4LGCA 4RMIA 5FOXA 5KFDA 4QWEA 3EF1A 3WC4A 3MT8A 4ZAXA 4MS4A 4TKUA 3BBLA 5JNVA 1UK9A 2N1MA 2BR3A 2JLSA 3NM6B 5EQJB 3I61A 4IFEA 4KFTA 3PC3A 5C5IA 3DBLA 3ACDA 1MN6A 1Q3KA 1Q17A 2AH5A 1QPZA 4JLVA 5HBGA 1OH7A 3TXYA 2AFHB 2OCLA 4CG1A 3W1GA 4MHOA 2HA6A 3H8SA 1R6VA 4PHHA 4IRDA 1V16B 2FGJA 3CSUA 3A14A 4GP7A 3B20A 5EJ4A 5ES4B 3OQOA 4BNDA 4YMVA 3B70A 1QV7A 1OPXA 5IM4A 5FJ8G 1AV7A 2AHRA 1EM6A 3TS1A 3VDXA 1RQXA 4BP8A 2DHCA 5DVZA 4HT3B 2V0GA 3S5UA 1R8SA 4QLAA 3W6ZA 4K9SA 1AZLA 1J2JA 4PYIA 3OVMA 4D80A 3KQKA 3I72A 4EUSA 2Q0HA 2FK1A 4LSMA 2OXTA 3FHJA 1YOBA 3E15A 4FFNA 1LDNA 4KVZA 4P33A 2CUZA 1ULUA 3ORQA 4EJSC 4N0MA 1Y1QA 1X1EA 3FNQA 4QG7A 1G4HA 2HDWA 1X8JA 3QA9A 1MZBA 3GPBA 3F78A 1A7JA 3CNOA 2QN6A 4EDHA 5AW7A 4LZAA 5MHTA 1UPCA 3N58A 4TN1A 4MV4A 2R8YA 1DKPA 4TV8F 2WVGA 3T9DA 1DBSA 4NYJR 3WR5A 1U8ZA 1Z4OA 4HFNA 4EZIA 1IEXA 2PUCA 3VVBA 4EAQA 3SN6A 5IVHA 2MSNA 2YYSA 2BGJA 2JD1A 4KGDA 2Y1EA 1ELOA 1A98A 3S55A 4YV1A 1F0KA 2JFOA 3WGTA 1LTHR 3W5CA 1IUKA 3SI8A 4DQ0A 2G7ZA 1O2DA 4BU1A 1KKLA 3MT7A 5DHTA 3M4YA 2CL6X 2ON6A 5A9TA 2EFYA 3VC1A 3L4BA 5EKSA 1BWSA 5BWNA 5FWAA 3T0FA 3AETB 3ZWOA 3IX7A 1G9SA 4TQSA 1Q16A 3RRYA 1K4KA 1X7ZA 3RLIA 1V5GA 1G3UA 1IVYA 3DH0A 3R7BA 2ZQZA 1NUUA 1DGSA 3NIWA 2W37A 3MWYW 1DZIA 3WLNA 4V3BA 1PBNA 1PJQA 4DFDA 4NPCA 4MW0A 1AKYA 3I01A 4WXPA 2PRIA 3LCUA 2W4IA 4KQFA 1NMQA 3CLVA 5CX1B 2ZU0C 2GAOA 1BKDR 1JU4A 5FP0A 1O4WA 1PNTA 2Z2ZA 3IIEA 2HRZA 4IVNA 3SC6A 1KWGA 2R87A 3JRXA 5DM4A 1V4BA 4GC7A 4X6UA 1CZUA 3AJAA 3OIVA 2I78A 3PHGA 4NYEA 3DTGA 4JJZA 5K5EA 4DF3A 3WDSA 2V55B 4Z53A 1KEEB 4WZZA 3IPCA 3HRKA 3VPFA 4QT4A 1XRQA 3WSVA 3CEJA 2PWYA 3K70C 4PO8A 2G5TA 4BB0A 4ITUA 4Z0NA 5T41A 1RC8A 2XGSA 2W2PA 1TIBA 5BUSA 2Q2NA 2FWRA 2QQ0A 2D0IA 1TECE 2G5PA 4EQ6B 2VDUE 5CEFA 2IODA 3HNPA 3UTCA 5CVTA 1FS4A 3HU2A 4JL6A 2J1LA 4D79A 1UWVA 5JHHB 4BP1A 4YAIA 2FPLA 1L7PA 3DE6X 1JEQA 4OLAA 2P3LA 3NWOA 5DHSA 4LY3A 2P2SA 4M1TA 6REQB 3V2GA 1DVRA 3IEIA 2OV2A 2GN6A 4UTRA 4MVXA 4BNKA 1R0KA 3OPYB 4B43A 4XFJA 1TO1E 5A62A 2CXPA 2LCIA 2D5CA 1EHYA 5KX5B 1HDCA 1O03A 4JN6B 3CKYA 4BO4A 2X0FA 4UXHA 3ONFA 1J56A 3NAMA 2YVUA 4QRIA 3I9FA 2O3JA 4PFKA 4ZVQA 1Y7HA 2BISA 4MGZR 1YVDA 3IURA 1CZLA 1F5SA 2OFOA 1JIVA 3U3KA 2NV2B 3WBKA 3R4VA 3LP8A 3CMMA 2WIGA 1KHHA 4D1YA 1QCCA 3ZYZA 4UTZA 1KBOA 2F62A 3TFQA 2QLFA 1LWOA 3CFYA 5G0UA 5KVVA 3KVVA 2ADFA 4GPBA 1T8WA 2VRCA 3MERA 1JWBB 5KFIA 1U4NA 3QF7A 3RH0A 2A7XA 5IKMA 3HN2A 3OJEA 2JIZD 2C7OA 2O05A 4K26A 3PITA 2HA3A 4M99A 4DQLA 1DBPA 2W70A 4NZMA 1PE0A 1R18A 2Z2JA 3BCUA 3FDZB 5L3QA 5E7JA 1CHNA 1TJ5A 3UJ7A 3U0GA 2AMLA 2UVQA 5H1YA 1WZNA 4BNIA 1WY5A 1NXQA 2VEOA 2OFWA 4GOMD 2WHEA 2BFNA 3GBSA 4DJFC 3EC1A 4OHXA 4PYJA 2NN3C 3WLHA 1IZ9A 1AGPA 4DCNA 1PEDA 2IYOA 2EKPA 1GADO 1T10A 4OHOA 1YHYA 5JDCC 4C20A 4UNPA 5A7FA 1HFKA 1M2FA 5AICA 2R8OA 3H7AA 4QUAA 1K2WA 5JQGA 4RAQA 2X86A 4LWQA 4TSFA 3ZH9B 1P7ZA 5HFJA 5CFNA 3A36A 4F5EA 1Z07A 1ZCAA 2GO1A 2VYVA 2J3DA 4WBNB 1W5AA 2ODNA 3ZLTA 2HO5A 1QIEA 2FZ5A 4BIIA 3ZHXA 1V25A 3SIRA 5IT4A 4JB0A 1ECCA 1QOPB 3GN1A 4LZOA 1KPGA 3HQ4O 5AESA 3ETLA 1ISPA 4I4IA 5BRNA 1HXHA 1RACA 3OOEA 3HXLA 2B3TA 3EODA 5FQNA 3AFMA 2C07A 5DEIA 2R8ZA 5LA6A 4ACAA 4EUHA 4YV2A 1U9IA 1NXPA 4GLFA 1QDUA 1J39A 3RQSA 1UBSB 4GH5A 4B3MB 1DXQA 1POWA 1P80A 4GSKA 2XCIA 2A1UB 3H5AA 1K9VF 3OCXA 4G84A 1Q0UA 3OESA 2GGSA 1UJ5A 2Y67A 4J94A 4A3GG 1P1RA 1K1SA 1H6BA 5B7NA 1X39A 3P4YA 4CM9A 1O94A 3CH5A 1VLVA 1ZZEA 3QZ8A 3W9BA 1Z6AA 1IQRA 4AULA 1Z4NA 3QQ5A 1RLMA 2IU0A 4F2WA 4OP2A 1JEEA 2IPLA 1SOVA 3SIWA 4BN0A 3FTCA 1TA0A 3SMVA 2Q2UA 1HTTA 3QENA 1MOZA 1OZGA 1DIBA 3RYIB 2C00A 5BPHA 4NEQA 1CKEA 3IL2A 4GYWA 4K0KH 4MIEA 1HSZA 3FOBA 3SFVA 4FSHA 4C4SA 3KOUA 3VNNA 1SJ9A 4P4NA 3V9AA 5PNTA 1QE0A 1Z36A 2A9QA 2OXIA 5DGBA 4YAWA 1TF2A 1E1RD 2GJ4A 1YAHA 4NJMA 2E0IA 4QEDA 1K6IA 3MQ2A 5A9SB 2WE8A 3A25A 3VR2A 4QECA 3V6JA 1OB5A 4N3CA 4LQDA 3ASVA 3WYFA 2YYYA 1Z4PX 3JD3A 4YLYA 3ZQ6A 1E2MA 1KO1A 1PP4A 5F9HA 4XLTA 1KEWA 5KWIA 4N3BA 4YBRA 5B3LA 4RDXA 3WLJA 1VHWA 5I9TA 4K9LA 1WH2A 2MCTA 4QGGA 3KR2A 4DV2B 1XPUA 4BGDA 5UKDA 2AG0A 1KI7A 4R71A 4EB6B 2RH8A 4ED6A 4QWAA 3A4NA 2FETA 5K3CA 1SCQA 3KPWA 4CUZA 1S2OA 1CUFA 2CLHB 3EUFA 4WVFA 4HDNB 4MQEA 2X40A 3HP1A 2KBEA 1GA4A 4B44A 4ISCA 4F45A 2ZSAA 4P7BA 3SKVA 1DAOA 3EXFA 5J4LA 4Q4JA 2R8EA 3CN7A 3DDOA 1LEHA 1DLIA 1XMPA 1PJ3A 1GUZA 4S0ZA 2XZTA 5LLSA 2ETVA 2W9CA 4QW9A 3WHKA 2CNQA 1J25A 4RX1A 1N2BA 1XEWY 3FVTA 4BQNA 4FDVA 1OFHA 2CF5A 2OC9A 1ZAUA 1VG1A 1JKIA 5FR9A 3A0RB 2IUSA 2GRAA 1YMQA 1FNSA 3EDOA 1FYVA 4H4EA 4OFZA 4LV6A 1CUAA 2IOYA 1H1DA 4URHA 1GGHA 2NU7B 2J31A 4IEEA 5KWVA 4JBXA 2ZETA 4KPYA 4IXNA 2DLNA 2RK6A 3IPAA 2C3OA 3D5TA 1FYEA 2EEZA 3BQ9A 4UTOA 3PYLA 2X5NA 3B9PA 3CZ5A 1N33H 1E5DA 1PWHA 4ZO6A 2AQIA 4R1QA 4C78A 1OHHD 5I3CA 3K3VA 3GUUA 2SICE 2VUMG 1E0SA 4KXFB 1E7RA 1NYTA 1XELA 4W4TA 5AK3A 3PCXA 3OFND 5DYTA 3U6BA 2HNBA 3FSEA 5MGBA 4L72A 4ZAFA 1X