2ZDHA

Crystal structure of d-alanine:d-alanine ligase with adp and d-alanine from thermus thermophius hb8
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ADP and D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 96
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdhA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdhA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdhA01
1C30A 5KKNB 2GQRA 1M0WA 2R85A 4O4JF 2R6FA 2HGSA 2Z04A 2ZDQA 3K5IA 1VBHA 4IHJF 3RUPA 3RV4A 2GLTA 2PBZA 5I47A 4FFNA 3JRXA 4HNVA 4RZQA 4O82A 2DZDA 1EYZA 5LYJF 1PX2A 3TW6A 4FFOA 2R7NA 4YAKB 3KALA 3E5NA 4O7RA 4FU0A 4C5AA 2J9GA 4O84A 2OLSA 3I12A 1GLVA 2PVPA 4O7NA 1EUCB 2C00A 2YZNA 3K5HA 3R5FA 2YS6A 5CA1F 1UC9A 1CQIB 3BG5A 3OUUA 5LXTF 4O2AF 1WR2A 4QSHA 2GPSA 4Y8VB 4IWXA 4IWYA 3AX6A 4YAJB 1Z2OX 2Z02A 1E4EB 3VPDA 4DLKA 4O7VA 3WO0A 5H80A 5CA0F 4MV9A 4YBZB 4EGJA 4M9CA 1UC8A 2FPGB 4YJ3F 3NUAA 3LP8A 2R86A 4FFRA 1JDEA 2DWCA 2VHEA 1A48A 2QF7A 4O7TA 3JZFA 4IIJF 4O4HF 3UFXB 1DIKA 2QK4A 4EG0A 4YJ2F 5CAEB 3ORQA 4L1KA 3U54A 2NUAB 2V5AA 4E4TA 3LWBA 1W93A 1DV2A 3ETJA 5J2TF 1JLLB 4MV7A 3V4ZA 1T36A 4HQ6A 1CE8A 4MV4A 2ZDGA 4O7ZA 1BNCA 1GSOA 5EZYF 4J6EA 4O7YA 2NU8B 3WO1A 3VPBA 5C1OA 2V58A 2YRWA 4ZHQF 2WYOA 4GGMX 2R7KA 4HNUA 4EABA 3ORRA 3AW8A 3KAJA 1KJ9A 2I80A 3G8DA 1I7NA 3GLKA 4M99A 2R87A 1ULZA 5JH7F 2YS7A 4O2BF 3SE7A 1W96A 1C3OA 4NYEA 1EHIA 4XX0B 5HV6A 1B6RA 5JQGF 2X0SA 5DMXA 1AUVA 5J2UF 2FP4B 3MWDA 5CB4F 5KX5F 2W6QA 1A9XA 3U9SA 2CNVA 2P0AA 4HNTA 4I50F 2NU9B 3R23A 2I87A 2GPWA 1VKZA 2YYAA 1PK8A 4ZOLF 3HO8A 4ZI7F 4FGRA 3HBLA 3KREA 5GONF 2W70A 2ZDHA 2V59A 3VOTA 2VR1A 3R5HA 3VMMA 3WNZA 1AUXA 1OBGA 1BXRA 3JRWA 4EA9A 1KJIA 3OUZA 2W6ZA 1KJJA 3K3PA 4MA5A 4EAAA 1EZ1A 2HJWA 4I4TF 4DIMA 3VA7A 1GSAA 4MV3A 2FPPB 1KC7A 4XYLB 2VPQA 4MV1A 4XYMB 2XD4A 2YL2A 4EA8A 2CZGA 5C1PA 4C5CA 4FFPA 2R82A 3ETHA 4MV6A 4O7WA 2YW2A 4O4LF 5LOVF 3HB9A 4FFMA 3VPCA 2I8CA 1GGOA 2XCLA 3R9RA 2NPOA 4O81A 2FPIB 5D8DA 4MV8A 3U55A 3QFFA 1KJQA 4TV8F 1M6VA 5LA6F 2NU6B 1IOWA 2W71A 3TIIA 1VBGA 4WD3A 2SCUB 3TQTA 1GSHA 4HR7A 4M98A 2YRXA 2R7MA 3Q2OA 2YZLA 2GQSA 5LP6F 2W6PA 2YZGA 3BFPA 2W6MA 5BPHA 4WBNF 3TINA 5HBRB 4MA0A 1CQJB 2DIKA 4O7SA 1JKJB 1KEEA 3BSSA 1Z2PX 4FFLA 2YWVA 1KUTA 1OBDA 2W6OA 4TV9F 3JZIA 3TIGA 1SCUB 1EUDB 3Q1KA 4ZQIA 4I55F 2CNQA 2FB9A 1B6SA 3RFCA 4ME6A 5IYZF 4TUYF 4IZOA 4C5BA 3V4SA 4O4IF 5FNVF 3N8DA 4XZ3B 1KJ8A 2DLNA 3MJFA 1CS0A 5BMVF 3GIDA 4EA7A 3KAKA 3RV3A 4EGQA 5JVDF 3R5XA 2CNUA 1M0TA 5C8YF 1I7LA 4MAMA 1Z2NX 2IP4A 2VQDA 2CQYA 4O7LA 4M9UA 3DF7A 1DV1A 3G8CA 5JVLA 5BPFA 1KBLA 5K2MA 3BSWA 2PN1A 1IOVA 1JDBB 3N6RA 4O83A 1E4EA 2YZMA 3BSYA 2R7LA 3U9TA 2NU7B 2R84A 3MWEA 4FE2A 4O86A 5JQWA 2W6NA 4YB8B
chains in the Genus database with same CATH superfamily
3IP9A 1JDJA 1BMDA 2EYQA 4R8KA 3T3DA 1SVSA 3CRMA 4LFAB 1T36B 3KVYA 3RBXA 4YUWA 1IMJA 4L8LA 5I7UA 2HGSA 2ZDQA 1W36D 4TS1A 3TOSA 4WBSA 4ECTA 2IVZA 2JW5A 3ZIAA 1T2EA 2HA5A 1PD0A 3C3BA 3NBQA 2Q4RA 4X91A 3VR4D 1PV4A 4ON9A 2LCIA 4QHYA 3IDZA 1KYVA 1NKSA 1XLTC 2OFPA 3TTVA 1EG2A 1H3FA 4M9RA 3DJYA 2H65A 3N44B 3E23A 4P3OA 2XMDA 2DABA 1H42A 4HNVA 3SSAA 2OWDA 4IJKA 5FPQA 2IJGX 2P2ZA 4EITA 1EDEA 5CEEA 3FKSA 5E6SA 2W8LA 3UYKA 2PUEA 2XVAA 5IYZA 2YINC 2R6R1 4GBMA 3IT0A 2ERXA 4QXQA 4FP9A 4R68A 4DCGA 2VUSA 1KS2A 2QLTA 2VJLA 2WLSA 2FUG6 4C0KA 2RBEA 1NXWA 2M9MA 4A1OA 1B8NA 4U7TB 2FK2A 2RBKA 4R1OA 5DGXA 5AJHA 3EX7C 4B2PA 1UFVA 1YZLA 2YYSA 1TK9A 2OHJA 4PHGA 3SBDA 2HADA 5ES3A 3TB6A 1FFYA 1B8OA 3E2PA 4B31A 4DM4A 1J5PA 1T1SA 3JWHA 2WBLC 4DIDA 2C00A 2C5LA 3EXFB 4TZKA 5I51A 2C4UA 1XN1A 2ZJ3A 3KU4A 1Z63A 3F6EX 3ASUA 2R48A 3H2SA 4UAVA 1MH1A 2O2XA 4PWZA 4E1VA 4X65B 4QSHA 3V1MA 2W9XA 3VO9A 3VKWA 2X3UA 1Z35A 4XVHA 1NI4B 4PCAA 2F43A 2WQ7A 4AJOA 3UJBA 3C2QA 2CZQA 1Z4NA 1PVVA 1NBMA 1WLYA 5EMJA 1PEKE 3AI7A 2Q6KA 5FA5A 4EWLA 5FBVB 2Z02A 1B04A 2G9QA 2L82A 5GIOE 1OVGA 2O0HA 2GR9A 3CW9A 3GBVA 4XGRA 5GWXA 4ZAWA 1DQPA 1DPGA 3BBPA 4N40A 4COOA 3B48A 4ZODA 2PSHA 2QRPA 4JWTA 1LSUA 1ZOPA 1DKQA 3CURA 2DBRA 4QXAA 4E11A 1TEHA 4B81A 4ZDWA 4RTPA 3OLVA 4G8JA 1W52X 3GEIA 3EXIB 1NAHA 4FJ1A 2NIPA 5GQSA 4F91B 2VXCA 4G84A 4WKPA 2R4TA 3OQIB 3IODA 2R9VA 1QYCA 4KUHA 1NN1A 3QLEA 4J7AA 3IPAA 3JYQA 4HVAA 3QVGA 3NKLA 4BV9A 4ETMA 1UK6A 4DBLE 4ANFA 2DWCA 4OHFA 1ZMXA 2WDZA 2NPIA 3DAAA 1CUFA 3OCJA 1TA8A 1NBHA 1A48A 3BXHA 3OF3A 5DYTA 2WT8A 3PUKA 1E20A 3HM9A 3IP7A 3ZZMA 2NSLA 1BN6A 1QV7A 5I9IA 4IEFB 4EMTA 5F3WB 1SHZA 1JA9A 5TARA 5EOVA 1MIOA 4F2PA 1XDWA 3QHQA 4LFBH 2FKNA 2QTRA 4P36A 5C1BA 2P3OA 3EDCA 3KSDO 4N7MA 5A0VA 4ASUD 4CKYA 4HY3A 5IWCA 3RW9A 2AK2A 5FBKA 2RGWA 3TX6A 2ZVDA 3VZQA 3VC7A 5KPJA 1NSTA 3D2AA 4EBDA 4Q9KA 2ACVA 1JHAA 4Y6OA 4TTJA 1XHEA 2JEFA 5ED4A 1NYLA 2FFAA 3Q3VA 3RU9A 1OBOA 1S8FA 5ALLA 4ZFNA 2J87A 5JCXA 4U2BA 3CJTA 3TEFA 3VSDA 1C81A 2LIPA 4PG5A 5G0SA 3RAQA 1QK3A 1R10A 5FPRA 4DR5H 2ODTX 2BMFA 3ROKA 4AI6A 5A06A 2GEVA 3UF0A 3AVWA 4ZVLA 3U61B 4NXNB 1SU7A 3UK6A 3FNIA 1RQ7A 4IDGA 3UXMA 5D7NA 4HKTA 1CE8A 4TT3A 3K9QO 2PTGA 4PFJA 3VGJA 3DM9B 3F6RA 3ZIDA 5JT1A 3SVZA 1NPYA 1WUTA 3QMWA 1ZJJA 3LUPA 1M1YE 4NOMA 5AKLA 4J2OA 5KNBD 1FNDA 3VPBA 3C3PA 2OFXA 1Y9JA 4M4SA 1JFLA 1KETA 1P0QA 1TAHA 1DMSA 2H4JA 3ZLVA 1XQYA 1QKJA 1N2OA 1OA0A 2HA0A 2OT3B 2YJGA 3DA8A 3ESCA 3OOWA 2JEOA 3FYCA 4REQA 4M0MA 2O3UA 2OV1A 3C6XA 1LX6A 2I91A 1G8PA 3MFQA 4LXYA 2DXIA 1RP1A 2QR5A 3FFBA 2WINI 3B5EA 4MI3A 1NBOA 1O96A 1XTSA 2DT8A 3DEIA 3I8XA 4KGVA 2G88A 3BX1A 1OWTA 4K9QA 4ZV9A 2Y1OA 4IQGA 3S8YA 2UZAA 4IUBS 4JU8A 3ANLA 1U0BB 2DAPA 3PTAA 3DQQA 4XA8A 2Q0HA 2BMVA 1HRKA 2ZBGA 2WM3A 5C34B 2X41A 2W0MA 4Q82A 4RH1A 3PQ4A 1OLSA 1XCBA 2HWXA 3O8QA 5E25A 3SDZA 1QRSA 1A9PA 4DEYA 2OXRA 3RTAA 2GETA 4LJ8A 2JANA 2YJ6A 4PAOA 1BS9A 4JBXA 2FX3A 1KHHA 1WNFA 4CF7A 2JGDA 2X1MA 4QOIA 3J81k 2EF0A 1KYXA 3HR7A 3EC7A 1PJ2A 1CW2B 3HKEB 3IEIA 4MRAA 1AQUA 4XDZA 5DMXA 1RKVA 3WDMA 2XVYA 3L1VA 3AIKA 2V74B 3RSSA 4NARA 3T0FA 4NU8X 5J2UF 3ZE0B 3SKXA 1BIFA 2GXQA 2X7HA 3BMCB 4Q1CA 2I6TA 1Q20A 2O4UX 4UM5A 4WXMA 1PWHA 2HU5A 3JQFC 3PF8A 4OQXA 3PXGA 1OI7A 2AC7A 3LT4A 3TKAA 3VVCA 1X92A 4UCTA 2FX2A 2IZZA 4GX0A 4U6NA 4LNUA 2NQTA 4EBEA 2JIPA 1LDBA 2Z1DA 3H9CA 3M7IA 4R0NA 4TVIA 1RYSA 5DH9A 5HFAA 4EF6A 2D0DA 1VIMA 1U0EA 4RQBA 3GD7A 4OF4A 5DKFA 1KRWA 2VN8A 2PKXA 4WESA 2COJA 4DR3B 1XD2A 1N57A 2CUTA 2FQWA 3SY8A 1I0LA 4B33A 1PR1A 3GROA 3JAWA 4RL4A 3FY4A 2YYAA 3UIEA 7YASA 1PU2A 1UXGA 2YQ5A 3PYLA 4XD7D 5KOYA 4B71A 1H3EA 2I7VA 3DT8A 3N87A 4AJIA 1P6XA 4J9OA 4JVLA 1DFHA 3GA5A 2HGXA 3EZYA 4M0KA 1OFHA 3LHKA 1GPH1 2FEOA 5I9NA 3VDRA 1QX3A 2BI8A 1Q1QA 4B7ZA 1QGYA 1L4MA 2Z8XA 2FGKA 4JNKA 1GTSA 1HA3A 2XT6A 4YO7A 1BE8A 1DAGA 1Z8NA 2B1GA 2OAGA 2LDXA 5K7SA 4PF1A 1EFRD 1ZN7A 3FPHA 1YQXA 1V3TA 3FYUB 3R0IA 2GPJA 2C9CA 3L0SA 4MUHA 2CEKA 4REMA 2AH5A 3GA0A 4PC6A 3JAMW 3VC2A 3DAYA 1WZNA 4Q43A 5HK9A 5JHGB 3HUEA 1A5SB 4H7HA 3L6OO 1RJDA 4EYQA 5IKMA 2NV0A 1J8FA 4PPNA 1ULAA 4QPNA 1QHHB 3R9IA 5DM60 1OXMA 4RZHA 5LBTA 4Q03A 1IBRA 3R09A 4H16A 3RNOA 4A2PA 1YFKA 1J8DA 5KFWA 2JNWA 1EBBA 1ZM9A 4NOKA 4DREA 3DUFB 2EGHA 5J2UA 4ARIA 4OMDA 3VH4A 3DFUA 2OR3A 2P7HA 1ML4A 1VSTA 2GN4A 3M6MD 1KYYA 4FDVA 1YMQA 1GGEA 5DM2A 1OFUX 1BEUB 1RU3A 4YAGA 4DQNA 3BTSA 3KLPX 4PIVA 3AB3A 1K6XA 3G2OA 3SEQA 3ZGOA 2X6TA 1WQ4A 3KPYA 2H00A 3O7MA 4JDPA 4TN1A 1G2OA 4UDXX 3LZCA 4XYLB 4URHA 5E1MA 3SIWA 2WUEA 4NY1A 5JROA 5K0GA 4RJLA 4RLSA 2PMZA 4XYMB 5TPWA 5DI3B 1SUFA 4Q21A 2YL2A 3O4JA 3DE2X 2YHUA 4IBOA 3SVLA 1M83A 2AN3A 1ICEA 3G1TA 2ISCA 3D6HA 2HGWA 4M0EA 2NO7A 4RMNA 4HAUA 4JFAA 4PFKA 4X85A 1ONSA 4X66B 1EAYA 3WJ1A 1R0SA 3JQ9A 5AW2A 2MOKA 2EG9A 4JJAA 5BXQC 3KUUA 2WRZA 1P3Y1 5LUBA 1HYBA 1MJFA 2O0JA 1GGOA 1G0OA 4P92A 3QWAA 5TMEA 1PW7A 4FT4A 2NYAA 4C29A 5EHNA 1D0SA 2HIXA 1Y5RA 4MXDA 1KOFA 3AF1A 5DNWA 2CMHA 3SR3A 4DDHA 1ZGJA 1R4NB 1Q17A 1ZJ6A 3HFGA 3G7SA 3L41A 5FX2A 2QRJA 4JT2A 4NBLA 2SICE 3PYXA 4JP3A 3QF4B 1RAIA 1LVHA 2APJA 2BEKA 4P34A 2OHGA 4RU1A 4X93A 1C0IA 1E7SA 1YRQA 3PT9A 2NXEA 4RADA 1Z5GA 1UBJS 2XTMA 3DTVA 3GAFA 1SVIA 3DEAA 3LI2A 2ZQZA 1UKCA 3SI7A 1J5XA 1P1RA 2CNOA 2IMWP 4K2HA 5LA6F 4WUVA 3NEAA 4YGYA 4DV0B 5BQOA 5IF9A 1E2GA 5T8KC 2V0NA 2FE1A 4NBWA 5CX1A 5TQVA 4B75A 2HJ9A 2ZRMA 2WU1A 3L1HA 1F12A 2QUAA 1XTUA 4IYJA 4NSNA 4BWGA 3JQCA 4ZA2A 2X0KA 1M1NB 1GSHA 4XARA 4U6SA 3RJTA 4DCUA 4TLCA 4TKVA 3TZCA 1MAVA 2HZ7A 4J0JA 3CVOA 5EP4A 4MR7A 1MG0A 4Y2QA 3FZYA 4UUBA 3D4PA 4DXDA 3ND5A 3GMIA 3U3ZA 3FGNA 4F3YA 4J1SA 1P77A 4A82A 4OQQA 2QUJA 5EYPB 3A3OA 1FA9A 1YXMA 3TNJA 2JA6G 2GEDA 5BNTA 5K0BA 3QPBA 2OBBA 4AIIA 3CWCA 4KQ9A 1IXRC 4G0OA 3VZBA 2C9BA 3C16C 4D81A 3O90A 4WOKA 4PDBA 5JDIC 1PLLA 4FGLA 2PL3A 2UUBB 3OQJA 3OO0A 1ADFA 2RF4A 4JBIA 1JKJB 2FXIA 4EX7A 5INTA 2ZOSA 1SKQA 1FP4A 3QEOA 2XUHA 3AY3A 1SXPA 3L7DA 1YONA 1RCTE 1WPXA 2VWHA 3IB3A 1MHPA 1RKQA 1M1XB 3ZE8A 3FF1A 3IP3A 4AWAA 2WIFA 4LMPA 4QYIB 1MO6A 1XDZA 1EX9A 2CFIA 2FOLA 3GGOA 4B5LA 4BLWA 2F1RA 2MYUA 1XP8A 4BN5A 3ELYA 3PA8A 4BU0A 1LC3A 1GADO 1DX4A 2GJSA 1KC1A 2FPUA 1O6CA 3H4IA 1WDTA 5FTLA 2QXYA 2Z9BA 2IYLD 4PWQA 3JX9A 3QVMA 4RD3A 4ZYTA 4OU5A 1T4GA 3EF0A 4OJMX 2XW6A 2OPHA 2GN9A 2M1ZA 2VCYA 3CPJB 4FOTA 3HCPA 1I33A 5HJEA 1X38A 3JSLA 2FRDC 5KFJA 5L7WA 2FPRA 3AGQA 2RAUA 1MOPA 4AECA 2D8MA 1P44A 4CKBA 4BE4A 2CVHA 4AT1A 2I54A 5NULA 3HEMA 3PUVA 2CBXA 3TM5A 1K7XB 2PMDA 5L40A 1OX6A 2VDKB 2QGZA 2QWXA 2ZSFA 1HFWA 3VR6D 1OH6A 1WB4A 1O5TA 2F59A 4Q7LA 4C7OB 3ZU3A 1CF4A 3LQRA 4HNGA 2HGZA 2W43A 3K2IA 1GA1A 1I5OA 3OZRA 1I1QB 2UVWA 4YCLA 2I65A 4BYGA 5KTYA 3COJA 1SUDA 5M3BA 1Z0KA 2MMGA 2J5XA 3B1JA 3FJOA 2FEKA 3N8NA 1DXOA 1DVRA 1MDBA 3OCWA 4O08A 4YR7A 4KFCA 5J4VA 4HNSA 4CE5A 2JA2A 3VPGA 2FPPA 2WIDA 3N74A 3VC3A 3ZHYA 3P94A 2Q5FA 1CV2A 1MJGA 3IPLA 4HTFB 1QMPA 2ZSDA 3IOYA 1R64A 4Q0YA 1LUAA 1UMBB 3HN7A 4Y0VA 3RS5A 1QC5B 1OAKA 4IIYA 4KAAA 3EZ6A 2QQFA 4LJAA 3PT5A 4M7EA 2AMYA 3OPYA 1E0KA 1IN6A 1JE1A 2JVIA 2NADA 3H2BA 4JI4H 1YH3A 5ER6A 3G23A 2B3TA 3GRRA 2CNUA 4TKUB 1K86A 1PR6A 5C8YF 3IBFA 4DMFA 1I6LA 1NVGA 3RTCA 3ABZA 1NW6A 2EJVA 3GFBA 5KFGA 3TTTA 4GVPA 2RH4A 2IQ5A 4KSBA 4BASA 3KHLA 4S05A 2BJWA 1VCMA 3RWOA 2R93A 4XAQA 3U26A 1G4HA 2DUMA 5ALGA 5LYJB 1T3SA 4XQ0A 4XI9A 5IJ0A 5ISMA 5KT3A 3KZXA 4Q24A 5KOIA 2AC4A 1LVUA 1QK5A 2VDNB 4IXNA 3ZE2B 1NU6A 2I4LA 2QTZA 5HUQA 2VDWA 3RSZA 3HN6A 4JLMA 1APBA 3WJ2A 4NEQA 3U7GA 2X4GA 1LLUA 3RFXA 4XVCA 3F8SA 1GILA 2PU7A 1YVRA 2VZ0A 4S1VA 1RPZA 2CJWA 4RA9A 4YV1A 3IQDB 1PNTA 3EC1A 4OCZA 1CS0B 3S2ZA 4OLBA 3AZOA 4HB2A 1Q15A 1B0PA 1W25A 1JLHA 2O05A 3G13A 3ZHUA 3PK0A 4CCAA 1N6IA 1FQJA 2W2KB 4IIJA 3TD6A 1GPNA 3V4FA 1J09A 1NZDA 4OK5A 3G6VA 1HOTA 4TZ0A 3HKBA 2V96A 3OE7D 2WJ3A 3THOA 1ZCFA 3Q8LA 2RI6A 2PX4A 3A4TA 3SIPA 4ENQA 4OP1A 4U7GA 2RHDA 3SQNA 1AK2A 1YR6A 1UFQA 3CEHA 2QMOA 4FINA 4UNIA 2FK1A 3V9PA 4G8BA 5MN6A 2DBZA 3Q2KA 3ENVA 1HMPA 1GG2A 5JVDB 2JS7A 3NKFA 3OPVA 1F6DA 4D46A 5TIIA 2AJBA 2FQQA 2IDJA 5D5QA 1AZTA 2Y3IA 3ISVA 2GKGA 4ECZA 4G5HA 4WGFA 4UD6A 1SY7A 2PBZA 3PL1A 3WA6A 1UBOS 1P16A 2EL7A 1P2FA 2FSVC 3I1JA 4LRTB 4EUFA 2XWQA 3E5HA 3UJAA 4BNUA 1T5BA 4Q37A 3U7QB 1MD9A 4X3PA 2QN2A 2A9JA 1A8HA 2VEOA 4FMDB 2Z95A 4C6RA 1XLVA 4QNMA 2P11A 1PJ8A 1QGDA 3ELWA 3G5LA 4TTRA 1YC2A 2G1AA 3CG0A 4GVXA 3K35A 4XIFA 3ZE1B 3OH8A 3FTNA 2JLSA 1Y7HA 3BZWA 3O4VA 3OMWA 4CM1A 2XMPA 4TXNA 3V2IA 4EHAA 4JV5B 5DQGA 1EKPA 2QSJA 1AGYA 3EEIA 2TMKA 2ZJFA 1Y4DE 3USCS 4OEHA 3MA0A 5HS6A 4DAAA 1B76A 2OENG 1RBZA 2X22A 4JOCA 4M1YA 3RSOA 2IGBA 2D62A 2XDWA 4GS5A 1PTKA 4L9RA 4XWYA 4ALIA 4BKRA 3F98A 4A6PA 4WMLA 3TZHA 3GGGA 5KSZA 1CERA 3DAOA 4FU0A 3A1FA 2DUUA 1MN6A 5FYDA 4NDNE 4RD4A 1N8NA 4JJZA 3SC2A 2HHFA 2NLOA 3W34A 4O7NA 2JAPA 3JTMA 3N59A 5FOXA 4Y2UA 1ZYUA 2AG8A 2Y1EA 3AC0A 3MQ2A 3BBLA 3EMDA 4CM3A 1QC5A 3WYNA 3I2JA 1ZCZA 4RHFA 4CT5A 1WABA 3AEYA 3IX7A 4C03A 1JPNA 4DG9A 2BFBB 2NZYA 1N1DA 2R7ZG 2AWNA 1R8JA 3FVRA 1XJ5A 4I14A 4D9CA 1CDDA 1YTUA 1FXWA 1W4RA 3C3XA 3PXCX 1RAEA 5EHXA 4Q1VA 5JPCA 3IQZA 4YMSA 2QLNA 3WB2A 3EN0A 4K9NA 2QP9X 1RAAA 2FJ0A 1JG2A 3WIBA 1ID8A 3IT1A 1B4DA 2JFZA 1KXJA 5LOVA 1S8NA 1I30A 3Q7QA 3VNNA 3CN7A 4MQEB 4WZAA 4FW8A 4PGFA 4GC5A 2PCJA 1VLZA 2B25A 4CIAA 2G40A 3MC1A 1JIXA 5F52A 1K4YA 3EWNA 3QKSA 1Y4SA 4YBZB 1DQSA 2EW1A 1LLDA 3HB1A 4BVKA 2R5FA 2XB8A 1UODA 5H8WA 1YBHA 1VPTA 2WSLA 4FR0A 3C4JA 4DM7A 3NT2A 5CDGA 2ZWIA 1CY8A 4MP8A 2DUJA 4KE6A 5HGXA 4MVXA 4F8JA 1AMNA 1YF3A 2NWQA 1WHSA 4MTCA 2VAPA 2HMAA 3EQ9A 3PCTA 3T9CA 1XD2B 2VQFH 1X3SA 2WG2A 3T7AA 2HMWA 1AY0A 2JIMA 5ALYA 1IHPA 5KU1A 3W4JA 4DV7B 2W2VA 4RU9A 2I4MA 5D1NA 4QHSA 4R3UC 4MAAA 1YZUA 2GDJA 2MTBA 5B6JA 2XDQB 4OQLA 5DEIA 2VZLA 1IC6A 4Z7QB 5MN4A 3PQEA 1CKNB 1N2BA 4V38A 3DLPX 3P0IA 4FHDA 1B0ZA 3NHJA 1BGVA 3GBSA 1IZ8A 1X7ZA 3MAAC 4G37A 1UFKA 3JVVA 4AJNA 4J07A 3I6BA 3CLUD 2C7OA 1NVKA 3A06A 2Z43A 4G97A 1KJZA 2ZUCA 5F12A 3MFIA 5IT9W 2DH6A 4KPUA 1Y1KE 4RF5A 2V5AA 4J3JA 5KYUA 3PENA 4C7KA 2QY9A 2HOQA 1KAOA 2VAXA 5L9AA 2PXXA 5CD1A 3LX8A 3L0CA 4E46A 1C7RA 2ZI4A 4EHIA 5FQOA 1X7XA 3P19A 1ZA1A 1TDJA 4WZ6A 3ZN2A 5J2TF 1B43A 1ZRNA 1SD2A 2FEAA 4R8UB 2GFIA 2GZRA 2V7PA 3IMFA 5EKTA 4BNFA 2GAIA 1O9BA 3KT6A 4II2A 1KWKA 1JSCA 1XFAA 4KIWA 1KY3A 4RK0A 4WCFC 4WA8A 3CNNA 1Z6XA 3GL9A 3TDKA 3ZK7A 3F3YA 1DC6A 3IEXA 4PO1A 4N0PA 4YWJA 4RH0A 3LYHA 4EUEA 1NF2A 4W9NA 2YWXA 1KYWA 3F8WA 4HZIA 4FDAA 4JLBA 1GYQA 3M4YA 3BD8A 3AP2A 1E9SA 2AI3A 3WLFA 5K01A 4ZQBA 4JQSA 3C7AA 4L3WA 3NBZC 4EYKA 3B3AA 4GGMX 4NE9A 3PO3G 3CNQS 4QDKA 1NW4A 1Q44A 4UTNA 3KXYT 1QOZA 4X71A 4OHWA 4BCDA 4G1EB 1SHLA 3WSVA 2CYBA 4NZYA 1WSBA 3PP8A 2HWYA 4G2TA 1KYQA 1T0BA 1NIJA 3OM9A 4J0QA 3FMGA 1L5ZA 1NRXA 1U8CB 1V71A 2HFKA 3G49A 3IIIA 1XYVA 3H04A 3K0KA 7MDHA 4FGKA 3I5MA 4P2BA 2PUBA 2YS7A 2QBYB 3CC8A 5JADA 3IA7A 5HQJA 3LY5A 4OXYA 2J3LA 2AHRA 2L17A 3D3JA 4BV3A 4Q4JA 3VR0A 4V0LA 5I7RA 4IQFA 3ZJUA 2Z3ZA 1DX9A 1WJGA 3G2KA 5HV6A 4WVFA 4WBNB 3OFND 5DBEX 1COWD 3EWAA 4GR5A 2ZWOA 4YALA 2C84A 4DJAA 2H1VA 4GNKA 1Q3HA 4MITA 1PG5A 4I8IA 4ZHSA 2OO5C 4IS2A 4DG5A 3GYBA 3LT5A 3ZH2A 5I01A 4E5YA 4DUYB 2X0SA 4NI5A 2P6NA 2P9EA 5AM0A 1KMQA 2WTAA 4QXRA 3L8FA 1TCBA 1RWBA 5TRTA 3S1SA 4IXMA 4HZUB 1UJCA 5JLJA 4HDNB 1O8CA 1V51A 4WK4B 3I1YA 5CH8A 4C3OB 4DLVA 2UKDA 1VKJA 3CUYA 4J16A 3W7VA 3OAAA 3LCMA 1DCKA 1KYZA 2UVQA 1OR8A 2VWGA 4HRVA 3Q0IA 1FFXA 4G9EA 1FF9A 4KOAA 4D8TA 5DN6D 1XMVA 4LDNA 1NOKA 1DG3A 3RR2A 2WDPA 3NM5A 4QPPA 4DARA 3QYAA 4RZRA 3KVVA 3KKOA 4PM4A 3G9UA 1PWXA 3AHIA 2HJGA 4YPOA 4UHEA 2BBSA 4EL0A 1OI4A 3HOZG 3PPIA 2QM7A 3ESQA 4P93A 3H1PA 2BFNA 3ZHSA 4JI8H 2JI8A 3GF4A 2IXGA 4EB0A 4MYTA 1RT9A 1GCAA 1TIPA 1INLA 1Y4UA 4RXUA 3QU5A 4L5JA 4WCFB 5CCXA 1G20E 2ZYVX 1AMUA 4ZOAA 1AXEA 1EFLA 4PG8A 3RIHA 5JW6A 2J5QA 2QU8A 2REOA 3L4EA 2FKAA 3NB0A 5CA0B 2O2JA 4AJEA 2C5AA 1HT2E 5CGQB 3N75A 2VNSA 3IR7A 4RORA 4UXHA 4C30A 3NIBA 3LQ4A 1YB4A 4JLSA 1JJVA 1DEAA 2JGIA 1JV2B 2F43B 3IUSA 1NJFA 4N0DA 4NATA 3UQYS 1CEXA 3SSMA 3ZXYA 2QG4A 5JRDS 4MHOA 1PS8A 1OREA 5KOHA 3AF6A 1CLUA 4Z3DA 4KIFA 2H2FA 2QN1A 4L72A 2OO7A 4LX8A 2YH2A 4EPWA 4DV4B 2X1LA 1LLCA 1TTQB 1GNRA 4HXYA 4QJ4A 2HHHH 2ZI3A 3COSA 3THWA 4CEIA 2A0WA 4KQ6A 3ZQKA 121PA 4Q93A 4XZ3A 2P9FA 5SYMA 3RC7A 3VAAA 2BRUA 3X0DA 3ZK9A 3KQUA 5HIAA 1G8FA 1G7TA 4I4TF 2XYGA 2E85A 5DSTA 2IA6A 3PGXA 4A2QA 1UOOA 2QRZA 4AN0A 4FM9A 4B4UA 3C4QA 3FKIA 2LGJA 3JD0A 1XZAA 3OIUA 4GSLA 2C5EA 5AW9A 2VH2A 4EQ6B 4AUNA 1N2EA 2JI6A 1I50A 3KB2A 3O31A 4PR3A 1QIHA 4XH9B 1MKYA 1E3WB 1L7RA 1TKCA 2CL6X 3VBEA 4IKOA 1U0GA 2P9CA 2OBMA 2POQX 3HOWG 3AHHA 3C8ZA 3LWDA 3B1FA 4H6PA 4Q4HA 1R8QA 4UMDA 1CNMA 4RFSB 5AVTA 4A0FA 1N7HA 1GITA 3OWOA 3LXRA 4WN9A 4D02A 3NALA 1QAQA 4KXMA 4X3CA 2B98A 2YUTA 5BVHB 3PFKA 1BA3A 1PTJA 3G6YA 1VLHA 3JZAA 2IOYA 5JAUA 3SBEA 4FFMA 4Q12A 1KQ3A 3NUQA 4LVUA 4EVSA 4Z9AA 5ALDA 2P0YA 3R9RA 2H2AA 2DG2A 5JJBA 3L5OA 3HOUG 4LDAA 5IWAH 2NSYA 2CFRA 4JA0A 1L1FA 3GLQA 2XC9A 1NMEA 1X1SA 2JI9A 3ANSA 1T8SA 4WJZA 5DRTA 3A6PC 4MVJE 3BORA 4PFQA 1RDFA 1XMJA 2XUAA 4O3QA 4IDBA 1J8VA 5AJTA 1ZVKA 5F9LA 1E7MA 1XC7A 1LDYA 1A0GA 2GVDC 2I1VB 2OP0A 2YIVX 1LF5A 3A4YA 3OLCX 2H9IA 1U0SY 3Q8QB 5CVTA 3V6HA 5KUTA 2UU9B 4A8JC 2WFAA 4KHZA 3QSYA 3T7IA 2SECE 4BATA 2VYVA 3LSTA 3ACBA 1W4CA 3DZCA 4QVGA 3ZU2A 3GTLA 1GTL1 3PSHA 3ZWWA 1E94E 2ERCA 2ZITA 1C7QA 3EB9A 4FGSA 4WKOA 3ZWOA 2GM5A 1JHQA 2Q3MA 3NH6A 4JIGA 1IH8A 4WBXC 4YK7A 2CKDA 2HZBA 1TB4A 1G5HA 1Z8FA 2M6RA 3FCCA 4D3YA 4LJYA 1J07A 4RM2A 1R66A 4QT4A 4URVR 3WNVA 2W5UA 4QWCA 4ER0A 4GW3A 1DKNA 1LBTA 2RGDA 3OZTA 2XIQA 3LUBA 4QQ8A 3E1SA 3C98A 1EH5A 3QVTA 4ODIA 1JL3A 4OHCA 3VSAA 2Y0SE 3UMRA 1RAGA 2V7XA 3V7WA 3DTVD 4M0CA 4AG6A 4UHDA 4O6VA 3HGQA 4NJOA 4MGKR 3CNHA 4F4WA 4MR8A 3AWIA 4GQAA 4JXUA 4DRZA 1GKLA 2H4YA 4BBJA 5EXXA 2BV3A 4F5DA 4MGIR 1KSHA 4OAPA 2QN6A 3C24A 4EL5A 2XZDA 3BPSA 3U13A 2WMDA 5IT5A 4LOKA 2MSCB 2EIHA 2BZ1A 1L7EA 3RUEA 2DTDA 4AO6A 2X8LA 3H1GA 4LAFA 4RO0A 4Y2TA 4TV9F 3X2FA 3BXFA 2DLDA 3U3KA 3UGKA 1YZKA 4ED3A 3UUGA 2W9AA 2GNOA 4BFTA 1W8DA 5MDHA 1G5QA 4NBSA 1SXHA 4KDFA 5F9HA 5AW6A 2FWMX 2OHVA 2Q2OA 3C5HA 2IWHA 3AGPA 5JOQA 1N5RA 1ZESA 4QE3A 5DGDA 1ABFA 4GQBA 1WDLA 3T9AA 2ZBPA 3KXLA 1R0KA 1HKUA 4HEA6 4HN9A 1P7YA 3H5OA 1PS9A 2AOTA 3H6GA 4ID3A 2QQGA 1E3MA 1DKMA 1SZDA 1GQ2A 3LIIA 2O8VA 3UMFA 3W77A 1RI2A 4WRRA 3FOZA 5IYZF 4BIMA 4TLDA 2CFSA 4OG2A 3H4BA 5C53B 2C03A 1TU3A 1NOJA 3D3EA 3VR4H 5IHPA 1ZEJA 1ZUNB 3SJBA 1Z62A 3H5LA 1NMZA 1H0HA 2GASA 3P9SA 1QV6A 1N36B 3PU6A 3AEUB 2BY4A 4NPCA 4GLWA 3H5WA 5LNK6 1JIUA 3WL7A 1MRZA 1ZH8A 3L7MA 1E3EA 3WZLA 3PC4A 2J30A 3NP7A 1Y1RA 4XPIB 2PZAA 2YBEA 3BE6A 4F71A 1XZJA 3ENWA 2RI0A 5DXAA 2VTDA 1CS0A 1DT5A 2G77B 3OQ6A 4GMGA 4MP6A 3U09A 4ARZB 3M4IA 1CY0A 1GQSA 2WAAA 1QP0A 3HU3A 1P74A 3GV8B 3DEJA 3OSUA 4UM9D 4BWFB 3A3KA 4CLXA 1H93A 2P3QA 2X1VA 1C7EA 1HFJA 2P6RA 4CKCB 3NIWA 3PDWA 4O2AA 4U5XA 3JQAD 1LRKA 4YRLA 1EM8B 3WFZA 3J81A 3RT9A 3WBFA 1FJXA 3DNPA 1NX9A 3BD9A 5KT5A 3OIGA 2FPLA 2VNAA 3K0FB 1A5BB 4K3VA 4D2IA 5GV7A 2UZ0A 3BEDA 4MVWA 4MWEA 5JSKA 4E22A 1N1EA 4TT8A 3R5XA 3NTLA 2XT0A 1YDWA 1ZRSA 3AVOA 1RRKA 4ZVMA 2XCQA 3DWIA 4QVKA 1SHKA 2PUHA 4PQEA 4AO7A 5LNK1 1XDSA 2I8AA 3D5EA 4MB6A 1U65A 1VE9A 1B00A 4M9UA 1RS0A 2TMYA 2YZ2A 5PGMA 4Q0MA 4F7DA 1TUBB 3T7CA 4MINA 5A7FA 4A73A 5IZ4A 1HQCA 1UK7A 1EB9A 3COVA 1NDHA 3INNA 1B14A 1J0EA 3L7AA 2ODAA 5JVLA 4FC7A 5BPFA 2PKEA 4Q3CA 3WGTA 5B6PA 1ZN2A 2TMDA 5FWYA 3HYLA 1QGAA 2YBDA 3CCFA 1R0WA 3KXIA 3N8GA 2HLDA 1D6JA 1XALA 3KJHA 3TNYA 2YVLA 4KR0A 2NO1A 4L75A 4KMOA 1VHDA 3SR0A 1QCCA 1VRCA 3ORHA 4DT1A 1BHO1 1QS0B 2HMVA 2WHPA 3CBQA 3FG9A 4G5QA 1L4FA 2HRBA 4QJ5A 1ZVMA 2FE4A 3O8DA 1H2BA 2WPDA 2NVWA 3AR5A 4IXDA 2G8LA 3O4FA 3VH3A 2XUZA 3AETB 2FY8A 5DGIA 1OJ7A 3V4PB 5LP1A 1Q2UA 4N54A 1OYVA 1IXYA 5EWLB 1Z13A 1KAGA 4L4XA 3RQIA 1MO4A 3DE5X 1PGQA 4NMLA 2H4ZA 4YB8B 1NQVA 3BJZA 3PR2B 3L49A 2H31A 1COZA 3KBBA 3KKLA 4Y2YA 3BACA 3PG5A 4ZEOA 2P9YA 1QYIA 3CZ5A 4Y2XA 3EGDA 4JBHA 3UAZA 5ARCA 4A26A 1O1YA 4AP9A 3GLGA 4NBNA 4PXAA 1Y80A 2HB6A 1XMQH 3KDAA 4MQFB 1C1HA 1QVAA 2XZLA 1P17A 4ZANA 4F2WA 3LVFO 3U3JA 4A91A 1UT6A 4CCWA 5HJ7A 1XNHA 3MWYW 3JY6A 1I7DA 3B2QA 3VO1A 1CUYA 1KTVA 4BQPA 5A4IS 3V7UA 3O21A 1ATZA 1G3UA 5SY4A 3W3AH 5EE1A 2HA7A 2WSBA 3MGGA 2WWTA 3FZQA 3PRYA 3TZKA 3GG2A 3B60A 3AUFA 4GE0A 5HE8A 1JMVA 4Y2RA 4H4EA 3V5NA 4WECA 3AEQA 4GPAA 1SUAA 2EW8A 4RA6A 3DEFA 5HG0A 5CYPA 4ECVA 1PEYA 4D98A 4KNVA 4X90A 4BNHA 1E63A 2DBYA 4LF5B 1KP3A 4US1R 4XRGA 1J70A 1LKZA 2IY8A 1R37A 1H8ED 1EGAA 1HYQA 5ICSA 3DBVO 3E7PA 1MP0A 4RK4A 3HRKA 3VDNB 3PQ7A 4HLDA 3ULKA 1NU8A 2BQUA 1HZZC 1M72A 3GH3A 4GKAA 5KJEA 2C8VA 4W5TA 1OIVA 4E07A 3K70D 2NGRA 1T5LA 2W2NA 4IG9A 2YCHA 4AD8A 1S6YA 1SOAA 4KACA 1KFJB 2XA2A 3VPHA 3GNLA 3I61A 4YXWD 2PVPA 1X7DA 2VHVA 2WICA 2O19A 3TIFA 3REGA 3R5FA 2GXUA 2XCAA 5D01A 3EDQA 3BG5A 1TYZA 6REQB 2PRKA 2X8JA 4NV1A 2EXXA 3FMPB 2YIJA 3H2KA 2ZEJA 5DYGA 4ZTUB 1RBQA 2DSTA 5EMHA 3EOZA 1UAYA 1KE2A 3U0BA 3B6ZA 5CA1A 5C0OE 5D3MA 2A5LA 4R5MA 1C3XA 1CUWA 1QQAA 5EGNA 1SKYE 1P8AA 1FNCA 5CT5A 3GZ4A 1CUIA 1IL0A 2B92A 4J1QA 1RYYA 1TX4B 1Y8RA 3C1UA 4B9AA 3KQOA 4FNOA 2RARA 3UJCA 3CX4A 3WKCA 4MS4A 5TB5A 4M53A 3IE1A 4E5MA 2JPDA 2DY1A 5BR1A 4OB8A 2QTVB 5FP0A 4AMBA 1P9WA 1GPDG 5A5EA 4H15A 1W5TA 2AOTB 3KELA 4DANA 3M82A 1WXEA 1P1FA 4YI5A 2BC9A 4EGJA 2ANCA 2DGDA 3FDFA 1FUYB 4GBED 4N82A 1AV7A 4GMXA 4DV3H 4LS3A 5ALZA 1HSOA 3FNEA 1WWKA 1LV8A 4RZ2A 4KWIA 4HAOA 1NRJB 5G2OA 4LZAA 1EGVB 4GPEA 3L7LA 2HU7A 3LOQA 3WP0A 4FFRA 5ELXA 3FCOA 5AM3A 1JI0A 3TE6A 4ZCIA 5ITSA 3HU5A 2HWUA 3T9DA 3QOFA 1ZCJA 4DRXA 1EAMA 1MVNA 2IHJA 2AKAB 2HA6A 2VSFA 1HNWH 1HETA 4NZ9A 3L6RA 5F76A 4LSWA 4DUGA 1QLJA 1Z4LA 1X74A 4L07A 1EDZA 2NG1A 2VPWA 4G36A 3BKXA 3V2UA 2OWEA 5K0FA 3ZDQA 1NM5A 3WISA 1EWRA 1T8WA 1RJEA 5KFZA 3PC3A 4ZAZA 5BQ5A 3UFXB 1WHTB 1Z0JA 3KJXA 4WCFA 5CR5A 1A2OA 2CMKA 4Q3AA 3DBHA 4A3LG 2QQ0A 1FJHA 3BXEA 3IQGX 4J0EA 1TD9A 3FFAA 1G38A 4AZ0B 3HKBB 4EG0A 3UPUA 1G3QA 1WZ2A 5D1PA 2ODWA 3OKAA 3PQ3A 4PS0A 2FDCA 2EBWA 3HB5X 1VL2A 4TL7A 2ZP1A 2BCJQ 2DQSA 2EQ5A 4DF3A 1X3LA 1G6OA 1YRWA 1ORHA 1V39A 3FYUC 3G68A 4IMIB 3LDFA 4X7PA 3RFTA 3HO6A 3U2QA 5K8LA 2N47A 4G86A 2HRRA 2Z8YM 3RLIA 3UHAA 5EERA 2IYPA 4JLJA 4QBFA 1K66A 5EC8A 5LZ4A 4HWPA 2KBFA 3ZJVA 4JYAB 3QY0A 2FZKA 3HSYA 3RE1A 5AJWA 4NENA 4BVFA 1RPAA 1BMFD 2J1LA 4CTOA 4UTXA 5IN4A 5H5JA 2G1JA 3U7RA 3ZVKA 4MJLA 1X7GA 1IY9A 1WUJS 4PZAA 4E4YA 1DWQA 1A04A 2V7UA 1SRQA 3VNQA 2JGFA 3OZDA 5CVUA 1XBTA 4J6EA 2Y1GA 3LKBA 3MUFA 4B3DA 2PXCA 4KRYA 2UZ4A 2XTAA 4W5NA 1SB8A 1JDNA 2QM3A 4X63A 4C0XA 1WH2A 1CJKC 3DS8A 4R5HA 3IQXA 1UMDB 1GTZA 1W30A 1ZKMA 2XMRA 3DE4X 4URWR 2O48X 2RGBA 3DMTA 3EXG2 1P2DA 1ZBQA 1FY2A 1Q95A 2IYXA 1G20B 3FIUA 1XR3A 4DKXA 2NQ2C 3IHWA 1GO2A 4EELA 4ED1A 3FVQA 3E9MA 3KJQA 3JD2A 2B5OA 4FR5A 4O63O 1N3LA 3MHPA 2B69A 2A1HA 2I80A 2IHYA 3CQ9A 4I5EA 4OGLA 3LF1A 1VYHA 2QTAA 1ITZA 4GRIA 4BV2A 5IVKA 4QYMA 3G0BA 1RQ2A 2D3WA 4C4RA 1VYUA 4G41A 4OIFA 3RVSA 4ZVNA 3TW8A 1UBNA 1G8YA 1H2ZA 4FJ0A 5BSHA 4HXFB 5T57A 4HSEA 1U2TA 4NABA 3DP9A 5C8XA 4LJSA 4WNYA 4X1IA 4JQZA 4BNXA 4DR2H 2CN1A 2NSJA 4RESA 1OYWA 1QCYA 4GMFA 1T24A 1SCAA 1HNNA 3OE1A 2ZSBA 2BKVA 2QVCA 4EYGA 4C4ZA 3FPEA 4YROA 2CSUA 2IF0A 1OSNA 4A3EG 1PDOA 2HPZA 3QXCA 5LXTA 4MRPA 1AUVA 4O4LA 3JQ8A 4F4JA 1U8TA 4GL4A 5B1IA 2XNJA 1M6EX 5K3DA 2RH9B 3OPMA 5ER9A 4HH3C 5IH3A 4DWOA 2ZE6A 4JWKA 2HAEA 1WULS 5FJ8G 1S8AA 3LY7A 5DM0A 4CKBB 3PNLA 3MWKA 4EJSA 3ZGNA 1IM2A 1EWTA 1Z29A 3OZ7A 1GKUB 5DISC 4RC9A 3KV1A 1VLVA 2Y8EA 5ECYA 1KQGA 1PQWA 1I94H 3FYHA 4CIWA 1L5HB 1ZUIA 3R23A 4EX6A 3IULA 4KBGA 4WAUA 3QJGA 4U00A 4TVBA 3W1WA 4AZSA 5L4NA 3JYPA 4U9IS 1P7CA 2V7QA 2C0PA 4RDHA 4R16A 2H0RA 2ZKLA 1O96B 2ZVQX 3TOXA 4CM8A 2IBMA 5JZBA 1I7PA 4BY9E 3EXHC 2QX4A 1XE3A 1H69A 1RYDA 2XF8A 3JTEA 3KXPA 1O94A 1VDMA 4QODA 1FNMA 4KRFA 2OUIA 3DBHB 3IAHA 3KREA 3WP1B 2RJOA 2AUMA 3H13A 3ZW9A 1OMOA 2R7AA 1FMLA 1ZZEA 2AK3A 4RENA 3DTVB 1L4LA 3GFGA 5FNVB 2EBHX 3FWZA 3TD9A 1CUXA 2YJZA 4C88A 1L4EA 5DHQA 4DDKA 1HFEL 4MKXA 3VMMA 5AM2A 3ESRA 3RS7A 4Q15A 1G6KA 1SCUA 1RQPA 2YXDA 1SA0A 1R4NA 3A1SA 1BCSB 5L1IA 1UPFA 2PRJA 3AINA 3PR1A 2ZT7A 3A25A 2V3VA 2QUHA 5C31A 4DJFC 2W83A 3LA8A 2D5BA 4Q4DA 1V3VA 5EINA 4CTJA 2ASDA 1XVUA 1KQPA 2JD1A 1FDUA 1U5AA 2BEUA 4PGGA 1M2KA 4AUMA 4EG8A 5CFRA 5BSMA 3Q3IA 4EUNA 2JIRA 4ZU6X 3I58A 1B23P 4MA4A 4MQBA 4UU1A 2WHXA 1M75A 3ZWPA 1MAAA 4Z9XA 3O8CA 2UYYA 1KZ9A 3NHUA 2Q8QA 2QD3A 5DW0A 3R3HA 3SHQA 3VR5A 2GUWA 1ZFNA 1Y8CA 1E92A 2VK2A 3K1YA 3PI7A 1BXGA 2C9YA 4KR7A 2ZGIA 1R18A 4H1VA 3A9WA 3VA7A 2YHSA 2GBLA 1RPJA 4IIEA 5AJVB 3W7BA 3WE7A 1ZR2A 1YI0A 5K8TA 4P53A 1P60A 4MV3A 4OUKX 5CK5A 3G59A 3OECA 3WGQA 2OWOA 4NENB 1CETA 3DDUA 3PW2A 4FYYA 2HRCA 3DL0A 4TTVA 4B82A 3U17A 4YDRA 2VAWA 1R15A 3PN1A 1Q1NA 1P4JA 3NIDB 4Q4JB 1C4XA 2E4YA 1ECLA 3B1XA 2HHAA 4S1PA 1FDOA 3EQ8A 3ES9A 3AILA 3PEFA 4LYAA 3KSMA 4C5CA 1AN9A 4RCYA 1QIGA 3RS9A 3ETHA 2P91A 3RB4A 4DCVA 1YACA 1UZAA 4YC7A 4RTOA 1RQLA 2HHJA 3K1ZA 1JZTA 2D5IA 2WIJA 3EDOA 1YB2A 3GHHA 4P4SA 3GVCA 2Z2JA 2Q07A 2WUWE 5F23A 4CI9A 3VPCA 5EIBC 1RD4A 3O5AA 2DQ4A 2PL5A 3P96A 2FPSA 2DF8A 4OB7A 1N5JA 3FROA 4Y3UA 3TK1A 4MK4A 5JSZA 3U4AA 3SXPA 3H4MA 5IAEA 2YV3A 4A93G 4OQPA 4TRMA 4KL8S 5A1TA 3NHWA 1M2EA 3WLIA 2WHQA 4LJ7A 2Q46A 4CBVA 2PSEA 4LSZA 1YJAA 5JJ5A 4TV8F 4PYIA 3SF8B 4H3KB 4MEJA 5FL7D 1KTIA 3DMDA 5C7IO 4W7HA 4WDQA 1QCDA 3TZ6A 5TX7A 3W3AD 1FQKA 3FPFA 3KK0A 3LT0A 4MW5A 3GLUA 5I7SA 3HNOA 1M2FA 4J9MA 5MF6A 3O8RA 4IX9A 1R27A 1H9BA 4NCHA 3RYTC 4TVSA 2A0KA 3MWDB 1XL0A 2BLNA 4HNAA 4L95C 2BGGA 2C3MA 3DT6A 2RDMA 3CMCO 1JS1X 1ZIPA 5LZ8A 4D3DA 4BGVA 4A16A 1J99A 2OKCA 3PS9A 2QVYX 4IHKA 2BQRA 5ALUA 3OKCA 2HDNB 3AL3A 4GR4A 4GXTA 3TLAA 4B3TB 3R3ZA 4P9NA 2RAPA 3A9TA 4J9KA 5LP6F 2IEGA 2YIMA 4HS9A 3TCKA 1G5IA 1NXXA 4BLOA 1JNXX 1G8HA 2AQ8A 2UVPA 3FLBA 3GRVA 1H8HA 1N3BA 2CDBA 2J0VA 2JJMA 1DDIA 3M83A 3PFNA 4IP0A 2Y4NA 3KUDA 1DCFA 3PC7A 4BWYA 1X1EA 1MORA 1ABEA 3HXLA 4FS3A 1N56A 4BNZA 5JALA 2JGNA 1QQTA 1UBLS 3KKMA 4HL6A 4ITUA 5CW1A 2B37A 4JMPA 3QZ8A 3JWPA 2W2KA 3SM9A 1QHNA 4EMSA 1B8UA 1NNLA 1YR1A 2WE6A 5DLFA 1DE0A 2AD1A 1N75A 2HLDD 3EG9A 3BSSA 3HKEA 4XB6B 4J0GA 4UCOA 4TZTA 3B7GA 4RHUA 4X41A 4EB8A 4O3PA 5BSWA 3BKWA 2QPTA 4RA9B 3AL2A 1NF9A 1ORTA 3PHBE 1MXFA 4NLGA 1B41A 5IC4A 1QRUA 1W85B 1OILA 2WVHA 3GJ7A 3IAM6 3G7UA 3ITDA 1EE1A 4R7TA 3LFTA 3BULA 4XQEA 1OLXA 2A9VA 2VBIA 3NR2A 3RFFA 1CC1S 4W5HA 1OOEA 1VKRA 1LBQA 1L8AA 1TJYA 4HQNA 5FKJA 4ZCSA 1Z6TA 1ZGGA 2A57A 2P40A 3L4BC 3C7TA 3S8MA 4KQJA 3VQTA 2ZJ2A 2CNQA 1B15A 4F86A 4N8EA 5JQGA 4IDQA 1ZN8A 1V4NA 4HAWA 3EGXB 4JT4A 3GARA 3DAHA 4GZ6A 3IUMA 1RHMA 2DFTA 2H59A 4O3RA 5EOYA 3IMKA 1CKOA 2JHFA 3JQAA 4GXNA 5K51A 5FBHA 5B7NA 4BWVA 1DRVA 1ELOA 1MOSA 2VF4X 3A1DA 4GOND 1ESCA 1Z5VA 1V7PC 4IOLA 1I1OA 5HTOA 4I46A 2CFMA 4G0NA 3BFKA 1XNJA 4U7JA 2UVPB 4Y6GB 1SUIA 2GN0A 3BQ2A 1TKRA 2ZB7A 1Y4ZA 5J5AA 1KORA 1YJXA 4XZ3B 1BX3A 2BDUA 2OLJA 2P9GA 2Q1TA 3QE4A 2GEBA 1FDTA 2CYAA 3MCTA 3B89A 4Y1RB 4CTNA 1X9NA 2QTLA 3U7FB 1GPKA 1T4CB 3G89A 4EPTA 4HZGA 3ROXA 2Q62A 4F2DA 2R8HA 1RRVA 1PUIA 3T1NA 5JBIA 3OM0A 1U4OA 4O1MA 4B4KA 5FWXB 2Z5LA 4BXXG 4G65A 3EOAI 1ZXXA 3O91A 3IXMA 1JWBB 4B76A 3DZKA 3HR4A 4JT8A 1F8FA 3BCHA 5IC5A 1UKBA 1YZFA 3OX4A 1P2TA 4H6XA 2C94A 1TM4E 1C1XB 3P0FA 4KXNA 5KFHA 2BZGA 1K8RA 4JV1A 2JDID 2JHAA 1XRPA 4FC6A 1XZBA 3EVAA 3R3VA 4LOHA 5CA0A 2J5KA 2JFUA 3MMPA 4G1CA 1P18A 1BXGB 5EJMA 3WKAA 1S0NA 3R5KA 3FRHA 5CCDA 3RRZA 1F1BA 3GLRA 4PVDA 3WR5A 3LYAA 4DPMA 3FNFA 4ZQGA 1H9CA 4ROTA 3NS7A 3D8UA 1CUZA 1NKTA 3UTCA 3V6MA 5GADl 3OCYA 1GR0A 5DOZA 3SMVA 2NTNA 3HDYA 3WB1A 5CLIA 3HV0A 1W36C 4EGCB 5IDQA 3IL2A 4DAEA 4G3XA 5FEUA 1YQWA 1SRRA 4TMVA 1T4DA 3SMQA 4ND5A 1IOVA 1VB3A 1HKHA 1SXJD 5BWMA 4TRNA 2CNKA 2LW7A 3TF5A 3U60B 1E4EA 1JAYA 2PGXA 2J9FA 2AFIA 3Q5DA 5AI4A 1B6TA 1V7ZA 1GGJA 1K7FB 1US8B 2E1PA 2G04A 4F93B 5CM0A 1G7CA 2JHCA 3KU1A 3AFMA 1OHHA 5CT6A 2J3QA 2JD2A 4Q1EA 1SXIA 1N9GA 1ZD9A 3IVGA 1PLJA 5H3HA 3AVQA 2CC2A 2PD3A 3IJEB 2EYUA 4LXXA 3CHYA 3KEQA 2J6IA 1G42A 2WJYA 1DQZA 3SWWA 4O86A 4J0IA 3WRXC 5CK4A 3X1DA 4YDHB 1RBYA 4KI0A 1P39A 4NV0A 4MVJF 3M5DA 1QHYA 4PSKA 5ELMA 5TT0A 3HVRA 1IYEA 5AM4A 5A6SB 1ZEMA 3T7RA 4YMHA 1R6AA 2FHSA 2WF8A 3EPGA 4FBUA 2YFQA 4R7RA 2Z9CA 1CFZA 3AOEC 3H2ZA 3UMGA 3VSBA 3ZIUA 4ZAXA 2KW5A 1QF7A 5IXSA 2PS3A 2JLBA 4L5YA 5EAIA 3MUNA 5HM6A 3H84A 1DIBA 3OX2A 4IIVA 4ED8A 4S1NA 1Y7TA 5KDLA 4MMZB 2V4QA 3ACDA 1ISHA 2XIJA 3ZDRA 2XGJA 2ZAIA 2GKSA 3T35A 3TWOA 4N5LA 5G41A 1GQRA 4YAJA 2CL0X 3TD2A 2LWIA 3G2LA 4UUGA 2Y6VA 2IHZA 3F5MA 2HNAA 3JAKA 2COGA 3WIOA 3ZVNA 2Z2ZA 1ICIA 2AUTA 3O1LA 3ZTWA 2OORC 4LY0A 4CEJA 5JXIA 1N0WA 1GAQA 1HT0A 3CE6A 3UJ7A 4UCXA 1ENZA 1XTKA 1M34A 2WIAA 2PBRA 1NKVA 5AVSA 2WKSA 4YX9A 3G0GA 1K1QA 1ZCBA 3OT5A 3N9IA 4RTRA 3CSSA 4P32A 4CMEC 2OSBA 2Y1WA 3NHRA 3OD5A 4NYIQ 5F7XA 1DKOA 1GZSA 1KHTA 1F3OA 3C3WA 4R9SA 6PFKA 3W5OA 4FHCA 5B1SA 3HG7A 3WLAA 3OZUA 4C3ZA 5L51A 4J0KA 1G3IA 3PGA1 1UBEA 4HDKB 2CF6A 5BRAA 5JS8A 2EWVA 4LYJA 3OP4A 3P4YA 4G0YA 1EUCB 3K5HA 2MINB 1T6YA 4FMCF 5DHRA 2Q41A 2X6QA 3IKJA 4GP6A 5IDXA 3IESA 1WKBA 3HJNA 4ATNA 1NSYA 3FPCA 1HYGA 4OQFA 4J0CA 5CCEA 1IXKA 3ILVA 3LC2O 4HFMA 4EG5A 3MTBA 5EWJA 2WJHA 2ZIUB 2AMFA 2B0JA 2JGLA 4NYMQ 4DR1H 2PZLA 4OTZA 2ZRCA 1VCNA 4AKGA 2FMXA 2VHQA 3OZAA 1R0ZA 4BMSA 1EFKA 2OD9A 1WVIA 3EVGA 1Q1AA 3ILHA 3NHMA 1NPDA 1MAUA 2Q0XA 4NEGA 3G8BA 4BPBA 2JK1A 3UOGA 5AW1A 3PWSA 2Z4SA 3I9V6 4AKEA 4YRJA 3HE3A 3LUFA 1MPXA 4ISCA 4RVOA 3WAKA 3M34A 2OM6A 4WFJA 2C7QA 4TV8B 3F6PA 3TR5A 5BV7A 1M6HA 5U1PA 1DRKA 2J3EA 5CJJA 3RYIA 4E3WA 4L08A 5JXHA 2O8FB 5SY6A 2GVZC 2JEZA 1JEDA 4A8JA 3M2TA 5J23A 1JA1A 2IYAA 1NR7A 3JQDA 3LBFA 5MN5A 4DIEA 4TTIA 3C7DB 3DL2A 4DTIA 1ACLA 1YRAA 2NNWB 1L7AA 1PJSA 1QQ6A 3CPHA 1G8KA 1H2FA 1N1GA 3K92A 2PUWA 3OCXA 3G02A 2XYVA 4EY8A 4ZHQB 2W58A 4GL2A 1XTTA 1OT5A 1QIJA 1IBLH 1NYTA 1RTTA 2DWQA 4JT9A 4DNXA 2RE8A 4JCCA 3RYFA 3DDZX 1SIOA 3ONEA 3QW2A 1NULA 2WYWA 1FRQA 3EA0A 3JQGB 2X5NA 3PNMA 3QELB 3IN5A 1GAWA 3QEMA 2ZJYA 2ZUTA 4XVUA 4CEJB 5DJ5A 1RYBA 4KQXA 4ZYYA 1CS4C 2VNJA 3AUSA 3GDGA 4IIJF 1ISGA 3P9CA 3MR5A 1Q0LA 3HKZE 1CUBA 1K9VF 1U2DC 4HGNA 4JGIA 5AKYA 1VE1A 5JMOA 4K5QA 3SDBA 1JB1A 4UDOA 2CL7X 4XLTA 3QBDA 2YJ3A 5F9NA 4O4JA 2CLSA 1E1RD 1LBSA 1DTWA 2G0AA 2QYTA 1RYEA 4GWKA 4TTPA 3H20A 2V4ZA 1A50B 5KFFA 1S0OA 2JIBA 4KQHA 1MAWA 4QUAA 3RB8A 3U7QA 1XNQB 1MR3F 1PCXA 2YXNA 1WXXA 2DWPA 3STWA 2GCGA 3RWBA 1ND6A 1KU0A 2QQ5A 4E4TA 2VSOA 5I5TA 3PF9A 4PG7A 4CT0A 1CZNA 3PFCA 5FPKA 3L4JA 5JNSA 4JI6H 4FCWA 2XMCA 2B30A 1DV2A 2LR0A 3NRCA 5IT0A 3ICEA 3Q3JB 4CLEA 2VRCA 3RTDA 1F5NA 4NZMA 5A6SA 1H1TA 1HDEA 1R5OA 5BR8B 1WD7A 1ZAYA 4LWOA 1H4VB 3H9EO 1I01A 4XJTA 3W8EA 3EXHA 2Z6VA 4HWOA 1L8XA 4RF2A 1DO2A 1GCIA 2B99A 2P79A 4P80A 4O7ZA 1I3CA 1IN4A 1EP3B 3EUEA 2RDIA 1AKTA 1A0IA 2Y4RA 1MNQA 2C42A 2JA1A 2VSNA 2NU8B 3CUWA 4M7PA 5HIMA 2QORA 2JBHA 1PLKA 2OHFA 3CJRA 1ULBA 1UKAA 4NYJQ 1RHJA 2PX5A 3GAZA 4M1ZA 4OGGA 3EUWA 3JQBC 4JJFA 1E2LA 4LNAA 4YIHA 2I1LA 3BXZA 1T3HA 2EKDA 2GILA 1E0AA 3P45A 9ATCA 2AFIB 5FPSA 2X8JB 3G9TA 3DEHA 5F3DA 4AX4A 3CR7A 3D7KA 3FNGA 3L8EA 1ZH2A 4ZYWA 1KKUA 2QRHA 3NTRA 4BHTA 5FWNA 3TTSA 2P2LA 1KJ9A 2I6XA 4AMGA 2ZJ7A 3QXHA 4F7WA 2N46A 1CY4A 4RGVA 3EY4A 1GZHB 4MVJA 4EPYA 2R87A 2JC3A 1KE1A 1UPBA 3GZNA 4D9NA 3KQTA 4GG1A 4FYHA 4PCLA 3ZZUA 3SE7A 1DS6A 2BPOA 2O06A 2B1RA 3PUHA 1Y6FA 4DL2A 1FLAA 5IF3A 3BH7A 2RGVA 4MW1A 3ZLTA 4QYWA 2ZXFA 1C3OA 1SM4A 2O57A 3SU8A 1JEYA 2IUEA 1T15A 4YRIA 5EHQA 2Z3WA 4ECSA 4F4YA 3PDUA 3QBVA 1FFCA 3FHJA 4ZVQA 3K6SB 1C0PA 5JQGF 3PO2G 3H1FA 4JKOA 3T1TA 2GERA 4GRAA 2YDYA 5G02A 4CL2A 1OWLA 4Z0PA 2V9CA 2QE7A 5JZ9A 4X1KB 3UGJA 1D2EA 1REQA 4LECA 3S8EA 5EJ6A 1E69A 1RWVA 3RSLA 1Y1TA 3BA1A 1KQFA 2RJNA 3T7JA 2ZZMA 1QTRA 5CB4F 4A8JB 2TS1A 4EUKA 4GI1A 1R7RA 2VPZA 4YAIA 3IQHX 1ZL0A 2V4UA 2ZYGA 3D6UA 4FDMA 3K31A 4YFVA 2HTEA 2X40A 4BCCA 4IG4A 4KN9S 2B9EA 1RKBA 4DLAA 4CC5A 3KQLA 3GI1A 2BR4A 3PRHA 3R7LA 2GH1A 3Q8WA 1JFTA 4CHGA 1Z4MA 4I50F 4KLRA 3SYNA 3I04A 1CYEA 3RO7A 1E4YA 3S7ZA 3BXPA 5KDDA 4MUNA 1N2XA 1AGPA 3B9RA 1NRWA 4W5WA 3RUFA 1A71A 4FS8A 5LFAA 4ZK6A 4V1CB 2A5GA 3NOOA 4HDMA 4BVGA 1WPGA 3C15C 3HYNA 4IM7A 4MI9A 1G3RA 4URFA 2AI1A 3IO5A 2IPOA 5GOTA 3STHA 5KB3A 1TLLA 4RZIA 3GEPA 2ST1A 3JWGA 5KWVA 3PUJA 5I4KA 4UU8A 5CITA 3VNVA 4JI3B 3UAGA 2MWMA 2WOJA 3AF0A 1FS4A 1K6IA 2OFOA 2IBKA 3TAUA 1Y14B 3PIRA 3KOUA 3MELA 3CF2A 5HW0A 3L84A 4LXUA 2G7ZA 1I9GA 4A6DA 1TGYA 2B4KA 3GEGA 4OGKA 5IXJA 4P4NA 4QEZA 1AZWA 1FBNA 3GCZA 1K7CA 2EKQA 1SEIA 2PLWA 3P20A 3WNZA 4MJ3A 4QEDA 3JARA 5E7MA 5J5VA 3SX4A 5LM3A 3JRWA 1TUIA 4WOBA 2O8CA 4CTKA 5F4BA 1OBVA 4ARBA 4UDNA 5L6MB 4LF8B 3WL6A 4DCTA 2A4MA 3GEDA 3KS9A 4MYSA 5EUBA 5LZ7A 4L5AA 3EIXA 2GPTA 1U0NA 4HX5A 1U8AA 4ND4A 5FBQB 2J07A 1ZUHA 1ML3A 5AK5A 1DGQA 1YQUA 1NWHA 1EBFA 4PTLA 1KJJA 4EARA 4OXXA 3ETLA 5E2BA 4UNQA 3ZQJA 1G7RA 1WXFA 3EWIA 2G80A 3NGXA 5HZHA 2UXCH 1LWNA 1T9GS 3LG2A 3EUFA 4IW3B 3ZQ6A 1RCUA 4RVNA 4QUKA 1N33B 4DIMA 3OC0A 2FMHA 3W78A 4PYLA 5GINE 4BFWA 5ITWA 2NTJA 4CDGA 2R6ZA 1KBOA 1PVDA 1ECGA 3MCWA 3HKZA 4BC0A 5B12A 5KFYA 1P3JA 3OJXA 5KC8A 2V03A 3ER6A 5IJ9A 3FNBA 4PFSA 4B2LA 2VJYA 4ARVA 1XMSA 4J49A 3C45A 1OQAA 1TF7A 1FRFS 2CLMB 2ZG6A 1Q7CA 1XZNA 4GC9A 3J80W 3ZY3A 2PIDA 1LNQA 3PVXA 4EFDA 2QDKA 5EZSA 4O8ZA 5LOVF 2ZR8A 2O50A 3C6MA 1H22A 2YVQA 2YWDA 2H63A 3I92A 1YBAA 4BVEA 4X1KA 2M1XA 3X1YA 3RQSA 4I1PA 1SCKA 2XCLA 1ZVJA 2AFHA 2QRVA 1FLNA 2HRZA 2ZS7A 4HMPA 1PS0A 1A2BA 3T34A 6AT1A 4UFZA 5I60A 3K5WA 1QO0D 4D92A 1EFPA 4I9FA 4HAYA 4BNJA 4DUYH 3P27A 3ZGZA 4ZT2A 4K26A 1M0SA 2YFYA 4MW7A 2C0CA 4C89A 3REQA 3ZYZA 3N2YA 5FTKA 3TW8B 4R1NA 3AY0A 2V7EA 3KVNA 1M7HA 5HMMA 1UBRS 2Q8NA 3HJTA 3JYLA 4TWAA 1YZNA 4DA8A 4CWAA 3I2KA 4B8WA 1A4IA 3MB5A 5I9SA 4QULA 1V2HE 4RVCA 3LTEA 3VNAA 3GV0A 3ECSA 1WCWA 5C32A 3WJ7A 3GW8A 1LQUA 1IN8A 4PPFA 2GCPA 1YHYA 4ZYVA 2O5RA 3HABA 1Z7BA 4R1UA 3QYFA 4YJ3B 1YB6A 5DF1A 3PV0A 1F0PA 4M54A 4XW2A 1IEWA 1TA9A 5AHOA 4X97A 3NCTA 2ZM5A 3O1HB 3G5AA 5HNKA 5KWEA 4I1IA 3GP5A 3JQ9C 1OF1A 4AF6A 4KQKA 2X9NA 2A9KA 2M2IA 3SYRA 2EIXA 1EGMB 3VHRA 5EIAA 1XQ1A 3BAAA 3LHIA 4EKYA 3N3AC 5CBPA 1XDBA 4E5PA 1W76A 1G8AA 3ADCA 4YAKA 3MCZA 2IHUA 3KP1A 1SCDA 4I4CA 1XELA 5AI0A 1YBMA 4J0MA 2HSEA 3BMNB 5K6AC 4LF8H 3BJIC 1YD7A 3TTXA 1Z83A 1DG9A 3MQFA 1T43A 3UAWA 2YRFA 3W9UA 3WLNA 4N12A 3EJWA 4M8SA 4PSCA 5EJEA 2BSXA 4CIBA 1DARA 4JAVC 1Z4PX 3E22A 3QEJA 2BM9A 4M1MA 4E2XA 3R4CA 4UVEA 5JAIA 2D1FA 4DUPA 3CLRD 3A04A 2C2EA 2J6SA 2QE6A 2RIPA 2J33A 1LZKA 4ZQIA 4U3JA 5IJXA 3IAAA 1F9AA 3T54A 3U44A 4NMWA 2RKWA 3EH1A 3QKRB 1CX9B 5B7QA 3QFRA 4JV2A 1XROA 5JG7A 5LUAA 4DRYA 3LVRE 3SEAA 1H6CA 3RJMA 2UVUA 1W0JD 5J2TB 1C9KA 3NDJA 4AZVA 2IYNA 3PCXA 3OQMA 1OH5A 2YN0A 4I6EA 1YJBA 1OB2A 1L3CA 2A9QA 1FFSA 4IAJA 4BBAA 4L8GA 3V4SA 2PBFA 3H99A 2YVUA 2E2IA 2B20A 4Q02A 2AG6A 4B34A 1MDFA 2WWFA 5DM1A 5COQA 3S2FA 2FSPA 1O03A 4FB4A 4YJDA 5DWDA 3ZHBA 2BFDA 4NYMR 4ZO4A 5BW6B 3HWRA 1DZ3A 3VU3A 5A2GA 5JY1A 1T9CA 4DDUA 1U5CA 2WZQA 1EE9A 3D3QA 2YY6A 2DLNA 3VR4A 2A59A 5IVPA 4A0GA 1O75A 1V4BA 2DKFA 4HOYA 3OZIA 3QYJA 4N18A 1Z34A 3R8FA 1GAXA 3LLSA 3WL3A 4EKNB 1UK8A 2QUBA 1Q7BA 2X5JO 2P6OA 3DZ8A 1I6WA 4MVJG 3KSAC 3U4HA 4D4IA 3L4SO 2J3DA 2ZROA 3CEJA 3TY8A 4JLPA 3GD5A 4MQLA 5J4LA 2DR3A 1SWVA 3HNPA 2DR0A 4UQPA 3B8HA 3VDXA 1RYNA 3VOAA 4ZV4A 1V2GA 2ZI5A 3K4QA 4GOJA 2CV0A 2XUJA 4MO2A 1FSGA 2ZK7A 4R98A 4UNSA 5IU6A 2F64A 5IVDA 1DBWA 1XRNA 4PAMA 5FJJA 3OLZA 4CM9A 4NK4A 1Z0FA 2AJLI 3FTPA 2PU5A 1NF8A 2UYCA 2AXPA 4QBGB 3BE5A 1E4VA 4CIYA 4CQNA 2JAOA 4BKQA 1WZIA 2VZ9A 2FW8A 3T95A 4FEYA 3Q8KA 3JYOA 4W9RA 3UK7A 4W6QA 1QVVA 4DMCA 4ZDJA 4YUAA 5BO5A 4YV2A 3ZV6A 1FRZA 3DV9A 3F9RA 4IZ6A 3S6JA 3IKVA 3N6RA 2NXWA 1E3DA 4K1XA 2FLLA 3QU2A 1PBTA 5LU9A 1JJAA 2G4LA 3MLEA 3NIGB 4QQFA 3A37A 2W00A 2O23A 3HH8A 4EJSC 5HYVA 2A14A 1A88A 3AHGA 3EG9B 3KKKA 3Q6NA 4LDJA 4WZAB 4RNNA 3UBTA 1LBEA 4DLRA 4YQWA 2VK1A 1ABBA 5J2TA 4Q9IA 1HE3A 1N5MA 2OXCA 3MB8A 1CXZA 2BUCA 3EPRA 1S1CA 3FWPA 4KBYA 2K7ZA 4IAOA 1CD5A 1QIKA 4TWRA 4JGBA 4C6SA 3T3OA 3TR6A 1THGA 3FCEA 4Z9YA 3TQOA 1YDMA 5E3HA 3KHHA 1ZK1A 2H06A 4ZI7B 3M4ZA 2A88A 5CDYA 3CF6R 4ZMBA 1U9CA 4IO0A 1UZLA 3QU7A 5FCDA 1RSZA 2A5DA 3MS2A 3KJEA 2ZSUA 1KPGA 4BMCA 4CE6A 1U31A 3KB1A 3DMHA 3KZOA 2DFPA 1RAFA 1TM2A 3N2GA 3P1JA 4OHOA 4C1BA 5EE9A 3B12A 5B2EA 4PC7A 2WYUA 4WERA 4M1SA 2GCNA 5EYPA 3RABA 2R6FA 3M1YA 4ZQCB 4DS3A 3HJFA 4CQJA 2Q27A 5CNIA 3K5IA 3ZCPA 1VJGA 4IEIA 5BNFA 3LT1A 4LGMA 1ZQ9A 2GLTA 1O97C 1VRVA 4LYYA 1BYUA 4ZVRA 5K4AA 1NFFA 4D9IA 3Q4GA 2OMKA 3NONA 4NU5A 3ZR4B 3BWVA 4F60A 1DC8A 3I3SR 2KHZA 1ZJWA 4LBVA 1P2BA 3OJOA 2C4NA 2W2XA 3ZY4A 5IABA 5KHOC 4RAYA 4C7OA 2O3SA 4IRDA 1XWFA 5D1HA 5GIPE 1GZ6A 4C08A 4S0XA 4FCVA 2WDTA 1YL6A 4PHHA 3SVTA 1MJNA 5ECDA 1EYZA 1Z2EA 2EX0A 2WF6A 3FVWA 1YWGO 3M1LA 1JR3E 3O38A 2MR5A 3ZY5A 3J80A 4PZ9A 4NG4A 4RK7A 3SHWA 3UHJA 2H1RA 4YXWA 5ICGA 3AR7A 3RNLA 5I4CA 3SN6A 3EMBA 4ACAA 3IVCA 4HNRA 4JEMA 4Y2PA 4UBMA 1U7ZA 5H59A 1GARA 4PNZA 3X1XA 4IXWA 2O5EA 3I83A 2YVAA 2EF1A 3LP5A 2FI1A 3KEFA 1K8YB 2Y92A 5IS2A 2YX1A 3SYKA 4EO4A 5LJLA 4KR2A 4G4SO 3KYCB 1N9ZA 1O5OA 3I37X 5CDFE 5CT8A 3TVTA 3QVJA 2RGNC 4XCVA 1YR7A 2FETA 4G0UA 2E89A 4L76A 3C85A 1VJ0A 3INYA 1KVQA 3G5UA 4OI4A 1XQVA 1XO1A 3P2OA 4L22A 5LXTF 2VTBB 1WMFA 4F92B 3MERA 2WJWA 3UV7A 3S55A 3QVXA 1JEOA 3WAGA 5DP2A 5LL6P 4WZBA 3IR6A 4QUHA 4ENPA 3KFXA 3GNTA 4K86A 1C3EA 2BKAA 4E94A 3JQBA 2PX6A 1E9AA 4C0LA 3IT2A 4BNMA 4CIDA 1AO0A 2QRUA 1C2TA 4JI1H 1K0UA 4IV5A 4ZT6A 1E79A 3R5SA 3LCVB 4R2LA 5AIBA 3DBIA 3K2BA 4J0HA 4BKUA 2C97A 1OHHD 3ZNNA 3IIKA 1J49A 2ATCA 2CXSA 1RRFA 4D8WA 4NCJA 2ORYA 4JGGA 1K5PA 3KJIA 3PHGA 1N34H 4QWMA 1DZIA 1FTYA 5U4QA 2W93A 3RGGA 2FRDA 5BSUA 3R4VA 3COZA 5IJ0B 5IYDG 1IVYA 5KJ6A 4J9LA 4DUZB 2Y93A 4I0WB 3QBJA 1BX0A 3COYA 3AKZA 3AQIA 2H0AA 5HIJA 4V0MA 3GRYA 3B7PA 1W6RA 3HA3A 4HP8A 1JDEA 2A1UB 3GG9A 3EGVA 5JZVA 4OHYA 2BGMA 2GHTA 2VHEA 4XD7A 1N78A 3KHTA 5CIQA 2A3NA 3IVRA 3MD9A 3ROFA 1QUFA 1YI1A 2DRIA 1WP9A 4DLXA 4PLVA 1U0TA 3NT4A 3R3WA 1NDQA 1JG3A 1WBJB 3N41B 4LWPA 4CU2A 4MWBA 4CUKA 4PAWA 2D2XA 2W2PA 4YREA 4QSMA 1AUQA 3NTVA 3N07A 1XCJA 1XPJA 1FTWA 1E2EA 2CXQA 2ZRPA 1DC4A 4LXIA 4B80A 1GQOA 4NEHB 2Z5FA 3ASYA 5JFGA 3GH1A 1JVSA 1KDZA 3KKPA 1C1DB 1P0FA 2GAAA 1Q91A 2PGAA 4ZI2A 5E4YA 4LN1A 2Y68A 4OI2A 4P54A 5AK6A 3EWSA 2Z9DA 4L1KA 3QA9A 4IR1A 5E4TA 3A32A 1Z0SA 1MEEA 2WFZA 4R1TA 2QIOA 2YW9A 3WK7A 4EJSB 3LWBA 4DL6A 1PAUA 1RHQA 3EFHA 1W93A 2Q3FA 4YLGA 5BR4A 2Q1UA 3UENA 4OMFG 2JFWA 4MCHA 1CEQA 2VJDA 1PG2A 4AP5A 3VYUB 1UMCA 3SXUB 1E3WA 1T36A 3X2EA 2XSZD 1CIVA 3FB1A 1LK5A 4JMLA 4JX9A 4OY3A 4TXMA 3QUSA 2WK1A 3WLJA 3VU9A 3OF5A 3LL4A 4AY6A 4EY4A 5JTTA 4GICA 4I4TA 1KXZA 2JLQA 4WNIA 5E9QA 4BLPA 3H0CA 4TYNA 3RAJA 1Q0SA 5BWNA 3WGJA 4FFWA 3STXA 1M5RA 4ZHQF 1ESNA 2G5PA 4C0AC 1N5LA 3U4DA 1OLUB 2CWWA 3D02A 2JEJA 2Y0EA 3NC0B 3QKIA 1I2LA 1DCMA 2YNMD 4ENRA 1QIEA 1EFUA 1ZLXA 1ZY2A 1WDMA 4QIWE 1JP7A 1DQNA 2JFXA 2XTNA 4OPMA 4MMYB 4P4LA 2ZRJA 1MFZA 5U4XA 2ONJA 1RZRD 2WM8A 4TZ6A 2QYSA 1NQWA 4DL5A 4YMVA 2EFDB 1R6UA 4RTNA 3AMVA 1FDSA 3N2KA 5JMPA 4D5EA 2F4VB 1RZUA 3TQ1A 1UP4A 3DZBA 4BNDB 2YCBA 4CG3A 4UTOA 4LKOA 2XHEA 3H17A 4WLOA 4MKRA 1UJ5A 2F2TA 3O8LA 4QRIA 4TUYA 5K3AA 5DM70 1I80A 1N36H 4MQEA 1BH2A 1U3CA 1Y6QA 1XOIA 3IE2A 3W6UA 3G1WA 4N3NA 1O4VA 2KX7A 4PZDA 4PZ0A 2C07A 2KQUA 2XNCA 5CNKA 4O4IB 2WFLB 4TQRA 4E21A 1NMYA 2ZQ5A 1YHZA 4KUEA 3PLNA 4DA9A 5C3MA 3A0RB 3THXB 2H18A 4II7A 2H1OA 4K6HA 2XUDA 1Y7PA 3BM5A 4MKFA 5KWJA 3O0TA 1NG9A 3T3HA 4GVLA 1U0FA 2X58A 5EJ5A 5HVNA 4G4JA 4DWJA 5HM8A 3NASA 3L8YA 4EFNA 1OGJA 3S5JA 3D8HA 1EJ2A 1V45E 4UHJA 2ZAMA 1GQQA 1KO8A 1U0RA 3CPEA 4BE9A 4Q4HB 5EQTA 3IEUA 1DKLA 1GN9A 1M1NA 1CY2A 3U1TA 4BJ6A 1QRTA 3LCUA 1UBTS 1KY5A 1V1JA 3LVQE 2HHFB 1QLWA 3EQ2A 3PQ6A 5I5YA 2C58A 3EHEA 3QTTA 4PANA 5E7IA 3WMRA 2AZTA 3FJ1A 1EEHA 4QXMA 3VHLB 4PEVA 4BMXA 4ESVA 4OX9B 4V0ME 2L42A 3VTFA 4DB2A 3P8ZA 1S2OA 5FOQA 1NASA 2Q28A 4N3AA 2YN2A 3VU0A 1AF7A 3L6DA 4G1BA 2IYZA 5JE8A 1AC5A 1ONNA 1AKNA 5FL7A 3VU1A 3JWJA 1B0UA 1EK5A 3SJZA 1XZPA 3IUBA 2FA9A 3CZRA 5FPTA 1ND5A 1K6JA 1S9FA 2HLNA 1IE3A 3VHQA 2AA3A 3BHNA 3OIVA 1NJSA 4IGAA 3MMZA 3MTIA 4L7VA 4E31A 4NE2A 3ZDAA 2JLVA 1T2FA 1F2UB 2QQEA 3Q72A 4XGNA 1F4LA 3RSFA 3RBEA 3AF4A 1I4DD 3IHTA 2PYZA 4QU9A 1TCVA 1PNOA 3EK2A 4XVRA 3LULA 2IY9A 2C7RA 3PW0A 1SKMA 1T5OA 1D2NA 3ENNA 6LDHA 1Y3FE 2B61A 4NJMB 3HCBA 2HRDA 2G72A 1RK6A 4L74A 1H66A 4U6QA 3SQLA 1VDZA 3LUKA 3ZI4A 3IFSA 4XEUA 3DGFC 4QDJA 3GTJA 3ETEA 4G89A 4M89A 3TBFA 3NPMA 2CLIB 1MAHA 1HLPA 3H9GA 4NULA 1OE0A 2CK3A 4TTQA 3HP1A 1D4AA 1PZEA 2QR2A 2V8BA 1RQRA 3C6YA 3VPXA 4CM6A 2V6IA 1E3IA 4F5EA 4IL5A 2RCYA 2EZ9A 3LQ1A 4C06A 2ID8A 2V6MA 1SUWA 1Z2CA 2QL5A 5ILQA 1DIOB 3E0XA 3K94A 4QGAA 4BB6A 3MJCA 2UYHA 1JJFA 1U2PA 4KHPB 2ZWAA 3ZLJA 3GDHA 3E5RA 5EZYA 5JAZA 3BFXA 3VTAA 4J91A 4JBNA 3I5XA 4FDUA 2X5XA 3L18A 4LKRA 2ZUWA 3WL8A 4WADA 5TQJA 4DCSA 5BUSA 5T5QA 3DOCA 4D3SA 2QAJA 3BCRA 3D4IA 3GJTA 2AD5A 4N5IX 3F90A 2JAXA 5LMUH 1RWOA 3EDRA 2A86A 1VTKA 2VP9A 4UBLA 2MCTA 4N7BA 1W581 5CM2Z 5K4GA 3U5TA 1E0SA 3GIWA 5JY6A 1AUPA 2ECKA 2AG1A 2V7WA 4P3KA 3GGPA 5AW5A 4C20A 4OJTA 3VYTB 2Q6LA 5CURA 1EWKA 4PAQA 1D09A 1GG5A 1WS6A 2PH3A 4NRDA 2PLNA 5EY5B 4ALLA 1T9AA 5T7BA 3QJYA 2VOBA 2ODEA 2OH2A 1OXXK 2CCGA 2QOEA 1AS2A 2WD9A 2WUFA 1TPZA 2R8BA 3HADA 2YW2A 4B87A 4GU5A 3QEAZ 1ZD2P 4PS1A 3SFTA 1ONBA 1SC3A 3CLSC 4IXTA 4E14A 4IVQA 5DLEA 2BOVA 3TLJA 3WWZA 2Q0QA 1TA4A 3EG5A 1FYWA 2O0LA 1SBIA 3FLEA 1CQZA 1UKYA 2IZ6A 2QZ9A 2QUKA 3WHIA 2AG5A 4BAGA 4DR7B 3W5BA 2D4HA 4TUYB 4E1BA 4BVLA 4B3GA 4H7DA 1H6BA 2P4UA 5TQ0A 3F71A 3BGIA 3DDHA 4MV8A 1UZMA 1VA4A 2VDJA 2O0KA 3CH7A 4O3MA 2QNRA 3LECA 4FWTA 1QG4A 5C51B 2OHXA 4TSFA 1DHTA 4HV4A 4ZYZA 2QBYA 2RONA 4DA7A 2GLUA 2YV1A 3KSRA 5KEIA 1WW3A 4RBNA 2C5SA 2HDKA 1PIWA 1TCAA 3PHIA 2ZANA 4KNWA 4OBXA 5B4VA 1GL3A 3BGVA 1ISIA 5AM1A 2DWOA 3QBTA 3RC9A 4HO1X 4XJVA 4AJJA 4DIFA 3WNQA 4ZCTA 2I2XB 5KSYA 2B1JA 3DDOA 3TRHA 3ZJ5A 3RKSA 1TEXA 1HR0B 4WW0A 4D9FA 5CU7A 5DQIA 2H2IA 5HKLA 5BN5B 1D6NA 2WSSD 2H07A 1T3GA 2FSGA 1SKUA 3GDWA 3LQ2A 4W9NC 1BHSA 1CUVA 3MMSA 1IFXA 3A3YA 1WTCA 1UF9A 4OI0A 5KI6A 1TMOA 2MHCA 4AYTA 3GUUA 3KYHC 2IOHA 1DIHA 3KVRA 4EYIB