2YZGA

Crystal structure of d-ala:d-ala ligase from thermus thermophilus hb8
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-ALA:D-ALA Ligase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 79
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzgA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzgA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzgA01
5FNVF 5C1PA 4FU0A 4O4LF 4O4HF 3U9SA 2QK4A 4GGMX 3RFCA 1BXRA 1VBGA 1PK8A 2W6NA 4HR7A 1M0WA 2R87A 3JRXA 4MA0A 4MV6A 4RZQA 3DF7A 1JDEA 1B6SA 4IIJF 1KC7A 4TV9F 1OBGA 3OUZA 3R5FA 1AUVA 1GGOA 4YB8B 1JLLB 1PX2A 5IYZF 4M9CA 5EZYF 3KAJA 4MV3A 4FFLA 3U55A 4C5AA 5H80A 4HNUA 2YRXA 1EUDB 3BSYA 2SCUB 2R7KA 5LP6F 2VPQA 4O7TA 2YZLA 4FGRA 2DWCA 5GONF 3JZFA 2W70A 5CA1F 3N6RA 3HBLA 2NU8B 2FB9A 5K2MA 3TIIA 2ZDGA 3K5HA 1GSOA 4FFRA 4FFNA 3KALA 1IOWA 4IWXA 3WO1A 3RUPA 5KKNB 4M99A 3LP8A 3BSSA 4IWYA 4O7LA 5KX5F 4I4TF 1KEEA 3R9RA 2PN1A 3ORQA 5HV6A 4XZ3B 4HNTA 4O82A 2FPGB 4ME6A 2I8CA 2CNUA 2R7NA 3QFFA 1GSHA 5CB4F 1KUTA 1KJ8A 3TQTA 4EG0A 2VHEA 1C3OA 2DIKA 3BFPA 1CE8A 3K3PA 1EZ1A 4O4IF 1BNCA 3VPBA 3VPDA 4I50F 4YBZB 1CQJB 4HNVA 5DMXA 4ZHQF 3ETJA 4ZQIA 2R7LA 2GLTA 4IHJF 4XYLB 1Z2OX 2FP4B 3V4SA 2PVPA 3MWEA 2NU7B 3N8DA 5J2UF 2QF7A 4WBNF 5LOVF 2YW2A 3HO8A 3Q2OA 2V58A 5JQGF 3OUUA 1EHIA 1DV2A 1Z2NX 2XD4A 4YJ2F 1M6VA 4O7YA 2YZMA 2R7MA 1CS0A 5LYJF 5LA6F 2J9GA 2HJWA 3HB9A 1JDBB 2GQRA 3VPCA 2FPIB 2Z04A 2CNQA 3I12A 2GPSA 1C30A 1OBDA 2R6FA 4YJ3F 2NU9B 2YS6A 3U9TA 3RV3A 1UC8A 4MAMA 2NU6B 2YS7A 1W96A 5JQWA 1E4EA 5CA0F 1SCUB 4O84A 3E5NA 3R23A 1KJJA 2YWVA 4ZI7F 4XYMB 4O4JF 1Z2PX 3VMMA 2C00A 4YAJB 4EA8A 4M9UA 3WO0A 3BSWA 2ZDQA 5JVDF 2CQYA 4EGQA 1KJ9A 1W93A 4TV8F 2YL2A 4O7NA 4C5CA 4O7ZA 4MV7A 2VQDA 5C1OA 3MJFA 4O7VA 4EABA 4IZOA 3K5IA 1KBLA 3VA7A 1ULZA 2VR1A 1I7LA 2IP4A 2V59A 1A48A 4O86A 4EA7A 3MWDA 1WR2A 5C8YF 1VBHA 3TW6A 3RV4A 1T36A 2OLSA 2W6OA 2R85A 4EGJA 3AW8A 3GLKA 4MV1A 2DZDA 1AUXA 2Z02A 4MV8A 1GLVA 3TINA 3ORRA 2NPOA 4M98A 4NYEA 2NUAB 5CAEB 5HBRB 5BPHA 1A9XA 4FFOA 2YZNA 3GIDA 3Q1KA 5JVLA 1B6RA 2CNVA 4DIMA 4O2AF 4L1KA 2PBZA 3ETHA 3VOTA 1DIKA 2HGSA 5D8DA 2GPWA 1KJIA 4ZOLF 3JRWA 4I55F 2CZGA 1EYZA 3R5XA 4O83A 3V4ZA 3AX6A 3NUAA 1DV1A 2WYOA 1E4EB 3UFXB 4TUYF 4MV4A 2W71A 4FE2A 2YYAA 3KREA 1I7NA 4O7WA 5JH7F 4J6EA 2I87A 1IOVA 4HQ6A 3BG5A 4YAKB 2GQSA 1EUCB 3LWBA 5J2TF 3JZIA 4Y8VB 4EA9A 2W6ZA 2P0AA 4E4TA 1UC9A 2ZDHA 2R86A 2V5AA 2FPPB 4QSHA 4O7SA 4MV9A 4FFPA 4XX0B 1VKZA 2DLNA 3SE7A 5BPFA 1CQIB 4O2BF 3KAKA 1JKJB 2W6MA 4DLKA 2I80A 2X0SA 5LXTF 3R5HA 4O7RA 3G8DA 4O81A 4EAAA 4WD3A 3U54A 1KJQA 3G8CA 2W6PA 5BMVF 4FFMA 2W6QA 2YZGA 4C5BA 1M0TA 5I47A 2XCLA 2R84A 2YRWA 1GSAA 3TIGA 4MA5A 2R82A 3WNZA
chains in the Genus database with same CATH superfamily
3BRWA 4OA5A 4OHPA 1ZMBA 4BTEA 3A14A 3WKCA 2BZ1A 2GYWA 4AI6A 3DFZA 2F4VH 4FLMA 5HSGA 4IPTA 2A9OA 4NULA 2ZS7A 4IDAA 2YX1A 4U2EA 3LY7A 2IDZA 2ZAOA 4YUVA 1D2HA 4L57A 3AHJA 1ZWLA 1WXQA 4DTIA 1E1MA 2NZVG 5ICSA 1PEDA 3H1PA 3M6WA 5FQNA 4GPTA 5DEOA 1KP2A 4DSAA 2FX2A 5AT1A 1T8PA 2ODNA 1QGAA 3DTTA 3RPEA 3D2CA 2BELA 4L4UA 2K2QB 4BNHA 5IM4F 3G0IA 2W4MA 4PZCA 3B2NA 4ER0A 5I5SA 1GNRA 4ENWA 2H16A 4Y98A 1YJAA 2JJ2A 2HG8A 1GL3A 1TVCA 2VPXA 4BUCA 4HQLA 3TSZA 2VZ0A 3IHTA 3G8BA 2MMGA 1FYEA 1X0VA 4IHAA 4J9KA 2FZKA 2WYHA 2IYNA 5SYAA 3SU8A 4YMTA 3TW8A 1G3MA 2B2XA 5EJ2A 3KTFA 4M8SA 4FB4A 3KWLA 1POXA 3HDQA 1E3DA 1P72A 3E1KA 1U2DA 5D87A 4YB8B 3ZCTA 5KNCA 1GRNA 1PX2A 5D1OB 1ZCFA 2WZDA 2P2DA 3KJIA 5CXXA 2Y0BA 4RIFA 3HYRA 2VZEA 3S5JA 3WLJA 1UXOA 2I71A 1D9ZA 4MPJA 4WDQA 2H3EA 1X92A 3JWPA 3DNMA 2UVPA 2XZDA 2H0AA 2WT4A 4LX8A 2QN8A 1T8TA 1YS1X 4S1WA 2AC4A 4CMIB 4LFBH 4F2HA 2PE5A 2X1LA 2Y4NA 1FQKA 1ZVVA 3WWDA 3RASA 1CE8B 3CG4A 2I1WA 1WCXA 5CX1B 2J6CA 4UCFA 4RVDA 3P0FA 1SEPA 1EIZA 2FR0A 2PS0A 1SXHA 1BQ3A 4ECSA 3NC0C 4LF4B 2CDAA 3HLKA 2ZW9A 2HA6A 4NP6A 4E09A 1WW3A 1BTOA 2ZYWX 1W36D 5GONF 4L6CA 4TN1A 3R2JA 5DG8A 4TMZA 2Q5OA 1NATA 3V48A 4DL4A 1PUIA 4ZMBA 4EZBA 5BWMA 3FTEA 1TRHA 4RB2C 1LA2A 1G3IA 4KXXA 1GNLA 1E96A 2E6KA 3T5TA 4UQLA 2A2ZA 1X1AA 4AFNA 1QTNA 2GJ9A 4O6VA 4OAOA 4GI7A 4UHJA 4EENA 1IOWA 4Q44A 1EHCA 4FKBA 3RS9A 2VNAA 2VDUE 1UC5B 1SOUA 4RCNA 3S6JA 3LI2A 2ECPA 2OFOA 2QP3A 3OT1B 1D2AA 2HM7A 4Q02A 4RA9B 4YH1A 1KQNA 5FTMA 4XYLA 2C5BA 4IQGA 1YH3A 4R8MA 3ZBPA 4CTNA 1P7CA 1SFOA 4GZLA 2QM0A 4LF5B 1GFIA 1J5EH 4B7XA 2BFWA 4YUZA 2JASA 3ESYA 3NUGA 3Q6MA 2WDZA 1ZMXA 1DS6A 1QH8B 3DZBA 3EGIA 5CLQA 4JI3B 2B6NA 3O9VA 2BFFA 5KFWA 4ML3A 1GZ6A 4YP0A 3ECCA 1JE0A 3ETLA 4OGKA 3WL7A 4QFCA 1W4RA 1DKOA 2FK1A 2OGWA 1Q2UA 3FNIA 3GRUA 2QTVA 3W0LB 1V8FA 1E5VA 4U7WA 3VH3A 3HJGA 4EUSA 1SIOA 3E27A 3GTLA 4HGYA 4B4KA 4RU9A 4IDPA 4J94A 1R16A 4DQXA 1IK4A 1QIEA 2I8CA 3GJ8A 3HABA 3OZSA 8ABPA 3DQZA 1GHTA 4TKUA 5GY7A 3N2YA 2VO1A 1GSHA 1QGDA 1MPXA 3P2IA 4WLNA 5LB4A 4LN1A 4GI5A 1UBMS 3EMDA 3NC1C 3TSCA 1BX0A 5GIPE 3UAGA 3VU0A 1RXWA 5L6LB 3HOZG 3ISVA 1LDMA 2CUTA 3K94A 3Q6NA 2X13A 4YGXB 5EXDA 4JWTA 3ZUPA 4QICA 3S24A 1NSFA 1RJFA 3TR0A 4UVHA 3IUQA 4YMIA 2JVIA 3GT4A 3H1TA 2JZCA 2GF0A 2VH2A 2PKYX 2G0TA 4GBMA 3LZ6A 1QDLB 4MVXA 4BX9A 2HLNA 4DB2A 4ND8B 3IE0A 4UPDA 1HYBA 2FK8A 1N6LA 3T4EA 4JU9A 3CO0S 4W8GA 3LFHA 2NPFA 1F6DA 4BFZA 1RXEA 1CIJA 3B8HA 4CN8A 5T4BA 3HGTA 3PUKA 2IS6A 3J80W 2EXXA 2W6ID 4RVNA 3V4VB 4G1BA 1H0RA 3Q12A 3O7MA 2WU0A 1E66A 1OC4A 2XADA 3BDIA 3A32A 3KOZA 1K7SN 4X65B 2QQFA 2PYIA 5FIUA 4CF7A 8MHTA 4J1TC 3FJOA 5CVDA 4LQCA 1T4BA 1DWOA 3H5NA 1SC4A 5C35A 1UWLA 2E87A 5JD5A 1LV8A 1XQWA 3ZWBA 5L1JA 4IQFA 2XXBA 4DS3A 4GX5A 2E55A 1AX9A 1XROA 2X86A 2G1JA 2JL1A 1UODA 2FSVA 3PXEA 4EB6B 2G7MC 5EY5B 4GX1A 3OF3A 4I50A 1FVIA 5LJLA 4R2KA 2JAWA 3OUUA 5F7XA 1RQGA 1FLAA 1DGSA 3AILA 3UMSA 4DLSA 2XD4A 1RRPA 4JVOA 1ND5A 1M6VA 2F3QA 2XJ9A 4KNVA 4R2IA 4LMPA 4LC1A 4ZOAA 1U1FA 1NLFA 2RAFA 4S12A 2Q4RA 5IVIA 2WD8A 3FFAA 3FOCA 2G25A 3QGMA 1NQAO 1ZC4A 3C85A 2QE6A 1FB5A 2NAPA 3D6UA 4KQIA 1UT6A 3GRYA 4WKOA 1DX9A 3P5SA 2AUNA 5EZ6B 3BL8A 2O52A 4WVLA 5IYDG 3GMIA 5I4IA 2HJWA 4P36A 5DQGA 3A6FA 5CDFA 3Q7QA 2R8OA 3UHJA 4LYYA 3GC6A 1C1DB 4IJUA 5HF9A 5EWLB 3TW0A 2NTEA 3ZGNA 2B5WA 1SD5A 2BGJA 4H6WA 1BVRA 2PS1A 3FKIA 3OUTA 4GXNA 3SQDA 2RK4A 2NU9B 1HNZH 4P7FA 1WEHA 1VI2A 1G41A 2EFGA 2MWMA 4XRRA 4B45A 1Z4JA 1T4GA 5CHYA 3KQNA 2JCBA 2WB1A 2FUG6 1BWSA 2I65A 3V1MA 3BDVA 1CNFA 1LPNA 1Y7TA 4DNXA 2YNMC 4KFRA 3RROA 4DR3H 2PGAA 3ROXA 4JUBA 1DPGA 5KVCA 3AIOA 4ZVRA 3L1JA 3H3VH 2C4TA 2DOKA 2ZE5A 3FGNA 3DAHA 3LT2A 4NJEA 3N0VA 2GBCA 2AGQA 3B6IA 1IZYA 3DFKA 3R3HA 5IP9G 2FR8C 2MSCB 2ZSIA 3DMYA 4KLRA 5CDSA 2L0XA 6YASA 2BGMA 4MTEA 2WHRA 3L0CA 4MUBA 2M6LA 1IRIA 1ZC3A 4FYHA 2IBSA 1E7RA 1KDRA 4KHPB 4FX5A 3SSNA 1XX6A 2FNAA 3DEKA 4K28A 3WLEA 1OPXA 3VMMA 1TK2A 2DLCX 3NRJA 2FLVA 1MGPA 1JLKA 2OVBA 3LCUA 4MRMB 5JAOA 1K68A 3AI2A 2C9DA 4MP3A 3T41A 4F5WA 4IJVA 2XTZA 1T25A 1E2UA 2FQWA 2A9PA 2TECE 2CFMA 2IYAA 3CSWA 2E1PA 2ZBFA 4IW3B 5B1DA 3RBEA 3TQSA 4C7BA 2ZXFA 1KJ9A 2J3EA 2L18A 1W4BA 2I6XA 4K9OA 4R2MA 3RBVA 5HJ2A 3EGOA 1B14A 3K3VA 5IXJA 1ISFA 1RWWA 2CHUA 4P58A 4D3YA 3PL5A 3HBAA 3FUUA 1VHQA 5KTTA 2BGGA 1EUZA 4JNKA 1Z7GA 4JEIA 4GQBA 1C0IA 2X9LA 4FZRA 3MQFA 1WCV1 3LLVA 3EPRA 5K45A 2H1HA 4PG6A 3RTDA 1GR0A 2Q3CA 2XGOA 1LY1A 3BT7A 5EE1A 2J3LA 3OURA 3TVYA 2QY6A 1Y8ZA 3RVKA 3VAZA 1KOGA 3U7EB 1NP6A 1PZEA 4F4FA 4DRZA 2FSPA 3WLHA 4JKOA 2PZKA 1T2CA 4Z3OA 3B1JA 1ULZA 1VKHA 3OLXA 3COSA 1FP2A 1SRRA 3TLGA 2HA2A 4HXYA 5LJIA 1U7OA 1KSFX 1QCYA 2I62A 2ZRFA 3C1AA 4XGQA 3OBBA 3K70D 4MUHA 5DRYA 6Q21A 4A1OA 1T3GA 3EQ7A 1D9XA 1R00A 3ORFA 5BN4A 2F8TA 1A9PA 4EHIA 1EKPA 1H1LA 1ZK0A 3HZZA 1FMLA 1YVPA 4JB8A 4B6JA 5LNK6 3QVJA 3SDBA 2ZQYA 4BC1A 5HBGA 4YJHA 3IP6A 1SRQA 2RHWA 1BXZA 4BXXG 1YQ9A 1Z6TA 2VOJA 3PRJA 1YZFA 2I91A 4PLWA 4RU1A 1D0VA 2B4YA 1UK9A 2IU4A 2V8OA 5ALPA 2Z02A 3UK1A 2C2KA 4QYXA 1JXMA 4QM7A 1AKMA 1V6SA 5IJ0B 1DJQA 3RLIA 4WTOA 3LHFA 2SKDA 1IQPA 2J6IA 1I2AA 1UBJS 4JR0A 2QR3A 3E3MA 5I01A 1WHSA 1H1TA 2FLPA 1ZH2A 4ECXA 1Z0DA 1ES9A 4A2AA 2B8EA 1UQTA 2P4QA 2PZLA 3E9RA 1F0KA 5KG1A 2UXCH 4FEGA 4G2NA 1W1UA 3VKVA 1YCGA 3AU9A 1FDVA 2WIAA 2VIIA 3H20A 2XRFA 3B1KA 3WGTA 3RFFA 4PSDA 4H0NA 1T94A 3A4LA 3THYB 2DUJA 2NUTA 1AKUA 4DNQA 4E33A 5F77A 1X7YB 4KVAA 3UJBA 1E0KA 1DKRA 2HMVA 3M5CA 4FP9A 5JCXA 3OZUA 1EKFA 1LW6E 4HDMA 4HWKA 1LNQA 4JI7H 1UEIA 1RWKA 2IYUA 5EMLA 2IZZA 5HCIA 4R40A 2EERA 4PINA 2A1HA 2ZAIA 3BTSA 3HY6A 5J4LA 3PRYA 1HYHA 5DN9A 1ILEA 1H05A 1T10A 1K75A 1TPYA 2CLFB 1SNYA 2ONCA 3KKMA 4AL4A 4ZI3A 1BWQA 2HA3A 2QD1A 4QBIA 4ADSG 5IJZA 1P5ZB 2HHHH 3BXOA 4ZYYA 1DAKA 2WOOA 1JXOA 2AI2A 2ZJ5A 4F2DA 4CODB 4QWAA 3KK0A 3BGVA 4DV0H 4LDQA 1MR3F 2DSTA 3KQQA 4D9KA 1WF3A 1CKEA 1ZMOA 1QYIA 4D45A 1QF6A 1NMYA 1E79D 4ZV9A 4HEHA 3K35A 1ANKA 2JAHA 2WVAA 2G1UA 3FWPA 1X38A 3KOUA 1FE8A 2CZGA 1LDNA 1U8XX 3PX3A 4RY0A 2C7RA 3ZNOA 2AG0A 4WV3A 1YRLA 3EGXA 3QLEA 4HO1X 3UICA 2UAGA 3K6KA 4L5CA 5BOSA 2IE0A 2CV2A 4CTJA 2VNHA 2DFKB 4H31A 3TEJA 1ZR2A 1OAKA 3GFFA 2IH5A 3LTEA 1IBRA 3KB6A 4K9LA 3HY4A 2WUVA 2WE7A 4MV4A 4AZ3B 2FQYA 2Z98A 1JDVA 3EF1A 4LXXA 4DJAA 1N56A 2X4IA 3K9QO 3R6DA 3L46A 4JXXA 1ECPA 4HDSA 3UKDA 1B76A 3G6KA 1WCMA 1R0WA 4DA9A 1AUQA 4NNJA 1BXGB 1M72A 3TLJA 1P18A 3FMFA 3K8ZA 2YZ2A 5DIZA 3TCKA 4HWGA 3EXFB 5ADHA 1B00A 4LECA 2ZKLA 4YXWA 3ZDYB 3U7HB 1AKYA 4M6WB 3HKZA 4LCBA 4LJLA 1D2MA 2IYZA 2IVFA 3DTVA 3I6QA 4ZAZA 4MCIA 2RH5A 3BE8A 4RVOA 4ZC1A 4RV4A 1M5TA 2ECKA 4AP9A 2WR8A 3AR9A 1P81A 4C05A 4OK5A 3TTYA 1W5AA 5KTNA 1SJ9A 4GR9A 4G36A 3X1DA 2JA6A 2C0CA 4C4XA 1UKEA 4JR1A 2ASLA 1HYEA 2JKVA 2O1SA 2QGZA 3E6AA 3K05A 1XLVA 2X8JB 5AI9A 5FBZA 1UK6A 4R8UA 2XGPA 1HOTA 3MGKA 1U31A 1CUDA 2BP7B 3LY5A 2BKAA 4Q4AB 5AIBA 3F6CA 2C5LA 4EGCB 3PZRA 2R86A 3BHNA 2W42A 4C89A 1V5FA 1OE0A 3D3WB 4FBTA 4QE3A 3OLYA 5KSPA 4CLRB 1T0PA 1WD7A 3LLCA 5LU9A 3JAMA 1VE6A 3BXFA 3UEOA 4C2AA 4BFTA 3DM5A 5HGXA 1P5RA 2AEFA 2P4SA 3NEJA 4P2GA 4YRTA 3UCFA 4GKAA 4RFVA 4ZOBA 3QY9A 1KI8A 1ZD5A 1JJIA 5BPFA 1Z2DA 2X7XA 3JZDA 1QIMA 2VCEA 1TDJA 3OY2A 4YRJA 1FW6A 4CGZA 2PV0A 3VPGA 2QVGA 1V6AA 1FUYB 1UPCA 2Q3DA 3EEYA 3G2MA 4OFXA 1U0EA 4J1TA 3BHMA 1ZNYA 3K9HA 2O2ZA 2Z4RA 4MZXA 1PJ8A 2EATA 3S8MA 3WFIA 5KTSA 3QVOA 121PA 4FS8A 5TQ2A 4CKZA 5GZ3A 2VDJA 1L1QA 2Z4TA 3A37A 4YDRA 4O81A 4AURA 5HJ5A 1Z6QA 4AICA 1GGMA 3B6KA 1YHYA 1P0QA 1R6VA 2DWPA 3IGFA 4X44A 1AURA 1ZD3A 1EJBA 3IBGA 4GPEA 3WICA 1V9CA 1E2LA 2W6PA 1RLIA 2XWSA 1VYTA 2X4GA 1VL5A 2H9AA 3FGOA 4R8SA 3W1GA 4P7KA 4RPKA 5CYPA 1CWUA 2KBFA 4O02B 3ED1A 1S7GA 4X1KA 2BEWA 4KOAA 2P69A 1W8IA 2ERYA 4QYIB 3AUAA 2YN4A 4A03A 2HBZA 1ISHA 1Z0KA 2PMKA 3CEMA 3CXRA 2FX5A 5F98A 1D0IA 3QKUA 4JI2H 2TMYA 1M3SA 2WILA 5CT6A 1GSAA 1U2EA 1YB2A 2VTDA 1BG6A 4NFLA 1WSDA 2D0PB 3D5EA 2ZSKA 4JQCA 4BLWA 1N25A 2HD4A 3H0GA 3CLUC 1DIHA 1P1HA 2BSAA 1YDGA 4G0QA 4TZTA 1TUGA 2CFIA 5DLPA 3BJRA 3OSUA 1OZHA 2R5WA 2J67A 3RVDA 5ALYA 2BR5A 4BASA 2B2NA 4OYYA 4QL3A 3QHAA 5KUTA 1ZIPA 2ZRNA 4GM4A 1QOQB 1J8MF 2FN3A 4YT5A 1DWQA 5GINE 3EC1A 3L3BA 4UMDA 1JNYA 1X2EA 1VGQA 1M0WA 2OT3B 3DO8A 4J9UE 3EFHA 4OMCA 3QU9A 5B3LA 1T91A 1XFDA 2C2MA 2YNMA 4WBNB 3HFRA 4MA0A 3C8DA 2QJOA 1GIAA 1FTSA 4RZQA 2WQZA 2Y92A 5AW9A 3WIOA 3IR7A 5JNVA 1W75A 4E1VA 2DBVO 3BRSA 6ADHA 3AF0A 1WW8A 3V1KA 5ICCA 3A2NA 2FMKA 4KQJA 4PF1A 5K3FA 4E03A 1L5VA 1R8JA 3K9BA 2EJUA 3VZPA 3NDJA 2PSHA 2D5AA 5DN6A 4DT1A 5DNUA 1J7JA 4N54A 1YR3A 3U3RA 2PY6A 1Y8AA 4EY7A 5AW2A 4PM4A 1SXIA 4JI7B 1QORA 1OC2A 1SA0A 2V98A 4M9CA 3UQYS 5TDHA 2HU8A 4ZVVA 5EZYF 2VHWA 3L0ZA 5BV1A 1GQFA 2O7RA 4KYIB 1CDZA 4FEAA 4TV9A 3VVCA 2BCEA 4G8JA 2ZR8A 4Q4AA 4TT3D 2GPJA 3ICWA 5HF8A 5KVSA 1NI5A 5KFDA 3OI7A 1PNVA 2PT7A 1MIOA 3GU3A 4D6PA 1PN3A 3SHQA 4EG4A 4MWGA 3CX6A 2HQ1A 2K87A 1T1RA 2HIMA 3PE3A 5CIWA 3GRAA 3ENZA 3L02A 5CURA 5AKIA 5C4GB 1UQRA 4WSOA 4C0HA 1UEJA 1XZJA 1H6BA 2R66A 4X6YA 2G08A 5ALWA 3W1WA 4BQQA 3PG5A 3HXTA 1TIBA 4MR7B 4XW2A 1WNFA 1WDLA 2FG6C 3LKBA 2YHAA 5TY0A 5EKTA 2VF8A 4GOND 2AFIB 3CNEA 4Q3BA 2V4ZA 3F7NA 3GH3A 4CKCA 4DQLA 3H04A 2VYND 3A3OA 4Q7LA 5DK4A 3GVHA 1U5CA 5LFAA 1RHKA 3QA3E 2NO9A 1SKUA 3C8ZA 4PE5B 4D9FA 4BPBA 2YUIA 1RAEA 3CUWA 1K6XA 5C7YA 2HMYB 1NMEA 2G4VA 1U7TA 3QXHA 5D6OA 4P3NA 1A9TA 3A1TA 2WFLB 3T9BA 1JVBA 1GYFA 3OT4A 4L95C 1R8SA 2D7CA 3BE4A 1MG0A 2P62A 1UIMA 4F8JA 4KWCA 2FR1A 2BYTA 3MMSA 2A7XA 2WHXA 3U1VA 4DZZA 3TQ1A 2GK4A 2GSWA 5EINA 5B55A 3GLIA 1QV9A 4W82A 2P9JA 3DHNA 4ZZIA 5TQ0B 3O38A 3PNYA 4PAWA 2GWRA 4ARZA 4D5GA 4DXAA 3QQMA 1VZ2A 4G5OA 2VS1A 5HJEA 4NMMA 4ZYZA 4W7IA 1VL1A 1G21E 1SC3A 1KGSA 4QBFA 5BWWA 5FI0B 3RIEA 2V6FA 3WJ7A 4EPYA 1KMCA 4PY2A 4AQDA 3SM9A 3AHDA 3GEHA 4RY9A 3K8OE 1GFZA 2AQKA 3VZDA 2DE0X 3WRVA 3M6VA 5CX4A 3EVDA 1QP7A 4NPCA 3RSQA 3EWIA 2MSWA 4X7MA 3O74A 2RB5A 3DAOA 1K27A 4L74A 3RT9A 2E6UX 4ZICA 2EW2A 2BZSA 4JT9A 4Q7KA 1JFTA 1XKTA 1U1DA 2OG1A 3CU5A 2BE9A 3DE7X 4QYIA 4U7TB 4WFJA 1TJ5A 4B3CA 1I0ZA 4PX3A 4RD4A 3A6PC 4YAGA 1C9KA 1OAOA 1YI8A 2H5EA 4TXLA 2NX2A 5I8WA 3EGDB 3I5AA 4X97A 1U0FA 1KQPA 1NQ5A 1ZJYA 3IIEA 3L7YA 4S35A 3SJAA 4A3EG 3SVLA 4I1RA 4QQRA 4EG0A 2G06A 2N1BA 4TVOA 4XOUA 4YT4A 3NT5A 3GRCA 4JB3A 9LDBA 5HIMA 3SR4A 2R7ZA 2VA8A 4RWZA 1XRPA 4LFBB 2ZRKA 2NV0A 4LFCB 2P8SA 2C5SA 1P8LA 4YJ2A 1IH8A 1EZ1A 1OF1A 4J4HA 4H7FA 3HCOA 3N74A 2CKMA 4N5HX 3IMKA 1E0DA 1MX1A 3PHBE 3PN1A 4MRPA 3H7AA 1GPNA 2CHVA 2QBYB 4P0TA 4XIIA 4TKUB 3DV2A 1H9BA 2QRMA 2VG8A 1JMKC 5KOIA 1G3QA 3J7TA 2OM2A 4CN9A 5DMXA 4PBTA 4ZHQF 4A6DA 1KYTA 2DFLA 1XPJA 3W3AH 4Y6QA 1Z68A 2P6MA 3SR3A 3ZDEA 1CQWA 1XD2A 2O1XA 4NG5A 3UANA 4OSOA 3UZOA 2XUQA 3ICVA 3W9YA 4IHJF 7ABPA 1OHHA 5EUMA 2NUPA 5A3SA 3T5JA 3I01M 4EHNA 2QXYA 3FUCA 1I3CA 1P2GA 1V3QE 3K9GA 4A16A 1MCZA 5MHTA 3UPTA 1YT5A 2C78A 3V4SA 5DISC 1Z83A 2DH5A 2ZE8A 4IOJA 4W8HA 5F1KA 4BFSA 3UJNA 3QVXA 4R68A 1SCDA 2ZJTA 1L0BA 3ZWDA 4C4TA 2A8YA 4ED0A 1LBIA 1G7SA 1Q0HA 3CS3A 4G1MB 2AE2A 2I66A 3N8IA 5ALLA 8LDHA 3DEAA 2HDKA 4DDUA 1B2RA 3SIXA 5JRDS 2R6ZA 5BXQC 1AS3A 1CKMA 3KJQA 4KBFA 4A0QA 1PZHA 5ULLA 2GUWA 4U9HS 1C41A 3QYFA 5GZ1A 1RFGE 1ECGA 3WGNA 3RK1A 4CG1A 4ZPJA 3O8BA 1RM5A 1VHWA 3CF6R 1OX6A 4YV2A 1DX4A 2ZS8A 3M89A 5AJYA 4RD6A 4ZAFA 2CLMB 4KQKA 2QRGA 3JQCA 3A4YA 3ASZA 3AHIA 4R8KA 1D09A 1R6DA 4HRYA 4CFZA 4B0PA 5AW0A 1TA9A 5LA6F 5T8KA 1R4MB 4EW3A 3KNZA 3VR4D 1OLUA 1FTQA 2VEOA 3CVYA 1HL3A 1CUHA 1ADFA 3I04M 1PWEA 4TQUS 5THQA 1UBGA 1QV6A 2X0FA 1TI7A 4DR2H 1BGXT 5EGSA 2EW1A 1DXHA 1ZEMA 3JZMA 1IEVA 1A5ZA 2BUAA 3DEJA 3GMDA 4YCBA 4JV0A 1P5FA 5HWSA 5T7BA 1XP8A 3SJBA 1X1TA 1UC8A 2ZCUA 1WB5A 1GYRA 1VP3A 5CPBA 2C5HA 3OCXA 4O4HB 1TLLA 1U11A 3RVPA 1N75A 2X6QA 4NU0A 1NU6A 5E1MA 4K8OA 1QWOA 5KFIA 3M4NA 2XBMA 4O33A 5JQWA 2J09A 1LCIA 3BS4A 1EVIA 4B79A 5IPFA 4UCOA 4IKOA 2ACEA 1N57A 2W2VA 4D9JA 5K8CA 3GQVA 4UASA 1T9AA 3VMFA 5HW0A 5CYFA 3L1UA 4C7XA 3DLPX 1E2BA 1PV2A 3FPCA 4HWOA 3WK5A 1L7AA 3ENNA 2E48A 4EHDA 2X8LA 4AWXA 4C0XA 4FHFA 3V4OA 1LH0A 1A9QA 1QXSA 2G4LA 4NF2A 3H9BA 3ZHTA 2LIVA 3A7DA 2F00A 3FNHA 3OC0A 1HLFA 1AHNA 1FTWA 1VLLA 4YAJB 2C3OA 2H5JA 2BDTA 4M9UA 4MGHA 4QOHA 4BJHB 2ZUUA 4DANA 1KH1A 2AG1A 1L4UA 2CDCA 2ZIAA 5AK3A 1F2UB 4U5QA 5E9WA 3QQPA 4D46A 2Q8PA 3BMOA 4R5MA 2YIVX 4CM6A 4EGSA 3DS8A 1E92A 2TMKA 3OU2A 4IDFA 4MHOA 1E5QA 5EESA 5G1NA 2B4RO 3ZE2B 4BE7B 2BN4A 3CRVA 2FN8A 4HPWA 4NE7A 3UKJA 1W93A 5KFNA 2XV1A 3ZCSA 2VF5X 2C59A 1TT7A 4TL6A 1IHUA 3HYCA 3MINB 5ICEA 3PCRB 1AV7A 3MRVA 4MWDA 3T12A 1GNSA 2LPMA 2OK7A 3FZEA 4QJ5A 2C99A 4QOFA 1CZOA 2VP0A 1UJNA 2OZLA 3P9QA 3JSXA 5K3FB 4DDTA 5M7EA 3I4MG 1MB2A 1TQ4A 2DFVA 2Y93A 4X92A 4DV3B 2FPGA 1OIXA 1YL6A 3S68A 5HPYB 1L5MA 1JEYB 3SEZA 3WK9A 2EF1A 4LX0A 4TLMB 3MFHA 4FMBB 1DAEA 4JLKA 2RF4A 1OGIA 1FFCA 1WDTA 3E03A 4HMPA 4OHKA 4U1RA 4LZWA 4DCGA 1A7AA 4KTTE 1Q3HA 5K0TA 4X1YA 4D82A 3DBHB 1TA8A 1C80A 1JA9A 1PDVA 3IV6A 4WUVA 5LZ5A 1VECA 3EIOA 5K5EA 4BCDA 4GWGA 2MOKA 4FZ5A 1T0BA 2Y4OA 2HAEA 1D5CA 5GAJA 1KAQA 1TX4B 3LQYA 4RSMA 5CLIA 2C2XA 2BFOA 1DU4A 1QIJA 1TAHA 2GMWA 2O8NA 2W2QA 3B7PA 3DWFA 5FOWA 3LF1A 4IV0A 3STUA 4QU8A 3BGWA 1GKKA 3I3SR 3A9VA 4OLJA 5E4TA 4BDSA 3IRVA 1ZAYA 1T36A 1A9SA 1H2HA 2REOA 4P22A 4PRZA 5JRJA 2LWIA 3F6RA 2C4KA 2QORA 4HQ0A 3DOOA 1OXVA 2WM8A 5IC5A 5H4HA 5E6RA 4B4OA 3WOHA 2Q9CA 2QENA 1E4FT 3HKDA 2EJ0A 1HL7A 5LN1A 1CR4A 4HFJA 2QSJA 1QTIA 4CDNA 2VT2A 4QDKA 1DBQA 3PO3G 1YCDA 4RTSA 1P4SA 1K5PA 4HAZA 4DBLC 1OLXB 2FW1A 3PYLA 4V0SA 5LOVA 1RDFA 4KGVA 2E4YA 4HQKA 3LX8A 1U1CA 3OEWA 3C14C 1OVGA 1A2OA 1I3QA 3I6ZA 5CAEB 3B85A 2Y76A 3CUVA 5CH5A 2GARA 4D3ZA 4D8UA 4H77A 1Z0JA 3RYFA 1C3EA 1B23P 1K3FA 2CMDA 4NZOA 1AXEA 1JQ5A 2R3SA 4MGYR 2A78A 1U0RA 1UDXA 2PGOA 1QG4A 2HLDA 5K0LA 3W5JA 3ZC3A 3Q5GA 1P2BA 4PZUA 1GNTA 3NUQA 4FR5A 4YMGA 4FD2A 5JCJA 4MUGA 2DKFA 3CONA 4I9NA 4IFBA 1QZXA 4Q37A 2NXNA 1C7EA 2Z58A 4BS9A 3TNLA 3VJLA 1V5EA 2ZIWB 5HDQA 2X0RA 1SUDA 3CTPA 1U5BA 3KZNA 1NXWA 2B36A 4QJ4A 1EFRA 4OJTA 4PNEA 3M4XA 1U1IA 2VA3A 3ZUGA 4UUGA 5NLLA 2VSOA 3RDPA 3VOTA 3N75A 1A8IA 4LXYA 1PVVA 1UXIA 1BHQ1 2K2WA 2PZMA 2E5LH 1TM2A 2WJAA 3CJRA 3GZ4A 3IMEA 4GSKA 5ERGB 2DR3A 2X8JA 1XQXA 2V7GA 2X22A 1KJIA 3C3XA 3K7EA 1ZJ4A 4QZVA 1AHPA 1HOXA 4O3OA 3DF9A 1A2QA 3EWNA 1A7JA 4E31A 3K5WA 5G0UA 1AMOA 1LK5A 1NVMB 1VJDA 1SELA 1WUIS 1YS6A 1CTQA 1Y6ZA 2FYTA 2C57A 2XVAA 3KE8A 4MI9A 2CNNA 3T7AA 1GPBA 3LECA 3ZGOA 1CUBA 1XD8A 2FPKA 2HYIC 1W8DA 1Z6ZA 1CY4A 2V6BA 3ZWCA 1TYCA 5F33A 4F4HA 3L0SA 2DBRA 2GS9A 5BSFA 4JLAA 1U2DC 2GOYA 3RYCB 2HF7A 4D3DA 4NHEA 4LMRA 2OECA 4EKGA 4YR7A 5BN5A 4YRRA 4G8BA 4LH7A 3AUXA 4J07A 3TXXA 3EUEA 2AGPA 2WKSA 4BNWA 2JHGA 4JV1A 3MINA 5TPWA 3M34A 3NEAA 4QGAA 2R60A 2VPIA 3KXLA 4XCXA 5H70A 3TQIA 5C34B 5BOSB 1N92A 1OWNA 2B1QA 2CZQA 3EYWA 4KHZA 1O96A 1Q77A 4LXQA 3DE5X 4M1TA 5ER9A 3LPAA 4XD7A 5FBWB 4DWVA 4BJ5A 3S44A 1LC3A 4QOGA 4RV5A 2H2DA 2IY8A 1WU7A 3EGDA 4MYUA 4C4SA 3PQ5A 1XTTA 3GNLA 1AKWA 4KN8A 5KFYA 2FLWA 4F85A 2ZDHA 4NQZA 3U4CA 1KIFA 3ZY2A 1U8AA 2PUFA 1BZYA 3AUUA 4EW6A 4F12A 1NUAA 1GITA 2UVVA 3A3YA 4KMOA 1KO7A 3KZMA 4JI0H 1QHXA 1DAIA 2PSDA 4MS1B 5TXGA 1H4SA 4N01A 2GF9A 1S9DA 1G9TA 1RCFA 1V45E 1X87A 4FGKA 3KP1A 4FKMA 2WG2A 4KE8A 3F74A 4OAQA 3C1OA 4DLXA 4XDYA 1REQB 3KKLA 1G20B 1WRVA 1K2WA 1FS6A 3SC2B 1W0JD 4O2BA 3P52A 5DHRA 1CQIB 3Q3EA 3W2HA 3TFOA 4AUKA 5IS2A 3HS3A 1DFIA 2XZLA 1W2GA 2P79A 2C8LA 1YRWA 2G80A 3LE8A 4OYRA 4BX3A 4EM6A 1Z6YA 2V4RA 1Y9AA 2H0RA 4I1VA 4JFAA 3D2BA 3Q7PA 2C9BA 4TWAA 2GZSA 2GYYA 2RB4A 3AINA 4TVBA 4ZK2A 5IBRA 4F3TA 1SVMA 3OZCA 4ZCIA 5EJ4A 1CY1A 2ZIXA 1YD7A 2J9FB 4GBED 3UJCA 4FGUA 3SICE 3SJ7A 3W05A 2V1UA 1XEXB 3FCAA 1G5HA 5KT3A 1R8XA 1RJEA 1SBYA 2ZRDA 1NVVR 2AQ4A 2CHEA 5CJPA 1XU7A 3YASA 4B6EA 1XTUA 4GMHA 5D3MA 3U61B 1U81A 2G04A 3H3XA 2J8ZA 2ORIA 1NXQA 3N7TA 4R16A 2ZBPA 3N05A 4L5YA 4Z2YA 4FFMA 2HLPA 2VPWA 1ONOA 3GBVA 2J9YB 5C44G 2B4AA 1E99A 1OPRA 4M8NE 4UVGA 2R8PA 3FB4A 3PC3A 1L5QA 1XMQB 4GRDA 2HWUA 1DI0A 4GKJB 3KQHA 1ZI8A 3OQIB 2VN8A 1MABA 3IELA 1KC1A 2FDRA 4MR7A 2C83A 3GCXA 5K8IA 3TIGA 1Q1NA 4QSMA 1Z5UA 4B3TH 2VJPA 4CIBA 4PO3X 5CNMA 5T8KC 2PWPA 3EBOA 3BQ0A 1A8PA 1SQ5A 3ET4A 2XMSA 3ZW8A 5KG0A 5FPKA 3B89A 3I2YX 3IOYA 3UFBA 3L01A 4EB8A 4FIDA 3ZXYA 2QYTA 1FFBA 5DGCA 1DAGA 1PW7A 4AX8A 4CKBB 1TYBE 4C04A 2LCQA 3U37A 1SOMA 2B6HA 3N2NA 4UARA 5CDFE 1PYDA 1JEJA 5NULA 1OFVA 4R9RA 3SF8A 4MS3B 4GLWA 1JE1A 1RWBA 5AVSA 1THTA 4ZEVA 4NXMB 2IYXA 4M7OA 3HRKA 3W5DA 3VVBA 1SHUX 3VU8A 5KO2A 2VF2A 5EJ5A 4CEHA 3PC6A 4QVGA 5I4KA 4C3ZA 1K97A 3ZIAA 3VO9A 3GGDA 3SSOA 3CUUA 1K0UA 2W9XA 2QL6A 5FORA 3TLEA 5FWDA 4Q4JA 3GLIE 1JP7A 4UXJA 4QLBA 1NBME 4Z3DA 5J4HA 5D3KA 2QYHA 4C30A 4JJKA 4HN4B 1DSSG 1IBSA 2B8JA 1H94A 2PXCA 2ZSJA 5JALA 5C51B 2AD5A 3QPWA 3U0BA 2WZBA 3IEMA 1ZG3A 3H18A 3DR5A 3LVBA 3AV0B 3UGTA 4JB2A 3O2QB 5DNVA 3I01A 4Y2PA 1LWNA 4ND1A 3WMXA 1J2YA 3QMVA 1M67A 3CWCA 3LQ1A 1NM5A 3BGSA 2F1KA 4EFBA 4E14A 4X1OA 3I05A 1JFFA 1K6IA 2G5CA 1VKNA 3PX7A 2JBAA 3UY4A 1YR9A 4G0ZA 2JFBA 5E1DA 1ID1A 3HFGA 2DTDA 2WIBA 4NYIQ 3IXQA 2O4CA 1W29A 1BA2A 3U7FB 1A1SA 4HHEA 2RGRA 2DC1A 1D6NA 2J3DA 3I39X 4MINA 1Q1AA 4FFBA 2DWCA 1NPTO 1E5DA 1WA5A 1P4GA 2CNOA 1QUEA 5C8XA 4LF8B 5EHZA 2X7HA 3OA0A 3GJQA 5HBRA 3HNOA 4MCJA 2WUEA 4Z9FA 4TRRA 1N2CA 4W5RA 1PL0A 1Q2XA 1WTAA 3BWDD 1NVVQ 2PD3A 3CKYA 1T5IA 3DTNA 5IEBA 5JJ5A 4ARIA 1BEZA 4ZAWA 1S02A 1SU4A 4DSTA 4F11A 2R8ZA 2AJCA 2LUOA 2DAAA 2WSBA 5IULC 4OUDB 4WEQA 1TWGA 2C4NA 3IA2A 1ZM9A 1R2QA 1U2SA 4ZGWA 2ZP1A 2O3TA 2PUTA 4FDAA 2D0OB 4YPOA 1EFHA 1N9GB 4GPD1 2E49A 3C74A 3NBZB 1AKEA 4BFWA 1C3LA 3IVXA 1GPAA 2ODTX 4MEBA 4CYMA 4ETIA 5JTUA 3WGOA 3JQDA 4QIWE 3LPNA 3ONFA 5IBQA 4JI2B 3QTTA 1OX4B 4IJKA 1GGHA 1T9ZA 1PE0A 3RGXA 1ATZA 2J3MA 2QJTA 2YWXA 3KJNA 3QI7A 1RRVA 1PJBA 1W5BA 1JR2A 3NHRA 4MPDA 1KEEA 3GIWA 2IHNA 1RMYA 3D6FA 4RD1A 1XTPA 3QU2A 2O8EB 2D59A 3EPGA 4YQFA 3AFIA 2HV9A 2R8GA 5HV6A 1UUFA 2I4OA 3OO1A 1S2OA 1ZUD1 3K1YA 1VDMA 3RC8A 1BJRE 1HY3A 3KQVA 1KY4A 5DBEX 5CA0B 1NU8A 1E3WA 1IBCA 4HNTA 1YU6A 2ZRHA 4ENVA 2FVYA 1UPTA 3P19A 3PQDA 3VO1A 4RTPA 5H3HA 1PFGA 4YHHH 4KXWA 3JALA 5DSZA 2P11A 3BMOB 3HU5A 4AZ0A 3DL7A 5LD2C 2XAUA 4IFTA 1JV2B 3H2BA 5CFLA 1PRYA 5F9HA 5CE8A 2BM9A 4WY5A 2OA0A 4ZDIA 3RFVA 1ZN7A 2O7QA 3LDGA 2B20A 2ZBDA 1YDHA 2P5YA 2KLHA 3MCVA 3WGKA 3CR7A 3H19A 1RQ2A 1S3IA 3LQKA 3QKTA 4NDNE 4RELA 2DIKA 2DPHA 4XIJA 3BFPA 2PFGA 1DKQA 3CTMA 4M6WA 5LQRA 5T4HA 1G20E 4C4YA 3GGOA 7MDHA 1CDOA 1SZDA 3IAS1 4QWCA 2C2RA 1QLHA 1TQ8A 1W1WA 2Q3HA 3BKWA 3ZHYA 2Y6VA 2G07A 5JFGA 3G1UA 3TDMA 1FFEA 2HTEA 3HY3A 4DT1B 3IAAA 1J2JA 1NR5A 2XJ4A 2BFBA 3GOHA 4KZPA 5IWAH 4MRNA 2XAAA 4M9ZA 4Q12A 4Q1VA 3EASA 5T6MA 2DWUA 4FNMA 2A67A 1ICIA 1X7ZA 4IDHA 2EX1A 1WXEA 2SNIE 2JJ1D 3LPCA 2QW8A 3R0QA 3RRJA 2I2FA 2G9QA 4D8TA 2H1LA 2WV7A 2X8WA 5BWUA 4OQMA 4HX9A 2GFHA 3L40A 1M0SA 4E4RA 2GVZC 3U3MA 1AM4D 4RF2A 3TLAA 4BYGA 3D4IA 1N2JA 3EPJA 4EX7A 2WZCA 1Z8DA 1A3GA 2VXBA 3B9QA 4PRKA 1ZZGA 2FUKA 2LVBA 2KHZA 3ZXUB 2C20A 4Q8FA 2ADMA 4A2PA 5MFZA 1NGSA 2Q4DA 1DCTA 1VKJA 3JQFC 2XBLA 3WTBA 5IASA 1N6KA 1VBKA 4P2BA 4G84A 3F71A 1N78A 2CB9A 2CBXA 3TEKA 1DWUA 1M8GA 4IRCA 1TK3A 1E7QA 2BVNA 2RHHA 2SHKA 4FN4A 2J0VA 3G6YA 1DUVG 2O2YA 4IGAA 1I32A 3THSA 2QTVB 3UG6A 3GTQA 3KEQA 1EVEA 3A6LA 1EHIA 4RDHA 5FOUA 3L8CA 1Z4PX 3EPKA 3KSBC 5ESRA 1H9CA 3QMPA 1DTSA 2CJXA 2XZTA 3CKMA 4LOHA 3W5BA 4JYZA 1K8YB 2H7CA 2M6RA 3FWKA 4O7YA 2VQ6A 3H0CA 3NB0A 1QK4A 4Q45A 2PL1A 2OYCA 4AAYA 2JDID 3AL0C 2R7MA 4G4IA 2AKYA 3H97A 4HKTA 2NG1A 3SLRA 4DPKA 4WI1A 3ZD8A 1IIRA 4C6HA 2VJYA 3A58B 5LYJF 2MYTA 3H2ZA 1V3TA 3JQPA 4JLDA 3W8NA 1C8VB 4A36A 1O9HA 2QROA 3WFZA 3GLHA 4B3BA 2GQRA 4URYR 4MULA 4UBLA 3RM3A 1J20A 3PTZA 1HTTA 3P2KA 1N2XA 2BHRA 3KVVA 4JI5B 3NAQA 4M2LA 5FR2A 5F23A 2WMYA 4PTLA 1W581 3T34A 1FVFA 1XZ8A 2Q6OA 4IWNA 4Z86A 4ECWA 4LZOA 1Z8FA 4JH0A 4RKFA 4DFDA 3S29A 3VGPA 3MBIA 3HZRA 1AKRA 1NNEA 2J07A 4JJ8A 1K8XB 2JIPA 1SCUB 2WG0A 3CZ5A 3OFVA 4E12A 4C2TA 2IP2A 3PWZA 2J3KA 2IHJA 4DRYA 3M9WA 3O83A 4YCLA 5L95A 1YZLA 1ISPA 4K1XA 3RSSA 2M2IA 4LJSA 3FVTA 4KQGA 3WJ1A 4PHTA 5IAGA 4DXHA 1JG2A 2G6BA 1Q17A 4GE3A 4BN5A 3GAAA 2OP0A 3LQ4A 1GZ3A 3D7KA 5KYWB 1OUMA 2OCBA 1XNRH 3EVEA 1ORIA 4Y6LA 5DEIA 1N0WA 4ZANA 2I4TA 3NTUA 1JS1X 1T3HA 1RCTE 3EZXA 3FRHA 3OPQA 3QVGB 3QY0A 2P2CA 3X1JA 4BKPA 1PGQA 3CZQA 4R5HA 4ITRC 3MEQA 3ASVA 4NU5A 5IKEA 3ZR4B 1RWQA 3K9WA 2VLBA 3PKJA 1KY3A 3MZ0A 4K6HA 2HH9A 2JEZA 4X90A 1E1RD 1U7XA 2EW8A 1KZ1A 1TM7E 3T99A 1QGUB 3JPWA 3OPYA 2TS1A 1PVDA 4K86A 5JWHA 4C3VA 2YTZA 4BQIA 4OHYA 4O7NA 2GBLA 1XDDA 3EIFA 3L6DA 3P9RA 5EJ9A 2YVLA 3ZV6A 2FK3A 1G7CA 4PSUA 4G01B 3L8FA 4QU0A 5BMOA 1G21B 3A70A 2OKCA 2QSUA 3ZK7A 5EIEA 5FEUA 2CW5A 1EBFA 3S2UA 2NYUA 3C6MA 4N0PA 2OWOA 3E5RA 2BTOA 4FI3F 3T5DA 1DMRA 1ORVA 1TA4A 1UJ5A 3K6SB 5DN6D 4X61A 3ZOKA 1RVDA 4I99A 4W6ZA 2AEEA 4KXQA 4INOA 1ZUWA 3K6JA 2X4DA 3DCYA 3AB8A 2JANA 4N82A 1EP2B 1P4RA 3PT9A 5GJBA 1QOZA 3GOQA 4J0IA 4DM4A 1FLDA 1ZVJA 2IP4A 2PKEA 3IODA 5ALKA 3V8BA 3TLKA 1Z22A 1QO9A 3W1BA 3TXAA 3ZE6A 1SUAA 5KWSA 3LIIA 1GPJA 2UVRA 1WPXA 5JSYA 3DZJA 1YR6A 2HBQA 1F12A 1XJCA 5BRNA 1K7YA 3MFYA 3AV3A 5E25A 3BB1A 4YBRA 5DRTA 3A31A 3TW6A 2E0IA 3WQHA 3PQEA 5EIAA 5HUHA 1DWPA 1Z47A 2RI0A 4LRTB 1RZRA 3GPDG 4F4JA 3M70A 2BEUA 3PDIB 4EGJA 1B73A 5IBCA 5I6DA 4EI2A 3PC4A 2DY1A 2I4IA 1WE2A 4IILA 4OQYA 4B3HA 3KEMA 2G5PA 3W7AA 4NC9A 1Y9JA 1YAJA 3Q10A 2E9SA 3KZ1E 1R1DA 1XI2A 2G71A 1VSVA 3HMQA 1BJTA 5EWEA 3PW2A 1K06A 4UDNA 1TKAA 5C8DA 2F3SA 1AH2A 1ND6A 4PXYA 4UEQA 3V6MA 1SXJA 3G82C 1UBSB 5C9ZA 1L5NA 3PFBA 1NM5C 1NQXA 2FZWA 1DZ3A 2ODEA 2WD7B 3A6ZA 3NASA 4FX2A 2Q6KA 5KU1A 2COGA 1YKSA 1YMUA 2PR7A 3SFVA 2H48A 3VYUB 4ARCA 3A27A 3NBMA 3PFCA 1VYUA 3GJ7A 5FO0A 2QPTA 4AMUA 4ARBA 1YFLA 1ESZA 2HCBA 5A5VA 1EGAA 4U2KA 1SIBE 2GJ4A 4NBNA 3VX3A 1QBKC 2WV9A 3D3NA 3G5MA 4PZLA 3DZKA 2W9AA 3RRNA 4CMCA 4FYWA 5BYKA 1YZ3A 4IAJA 1TMKA 2FN4A 2HBRA 1JIKA 1DG1G 1E60A 3VSBA 3PLAE 3DEFA 1U8ZA 1WZCA 2F7SA 4BB6A 4CQMA 2G72A 2FU5C 1RE0A 5JVLA 1DRJA 3DDHA 1G8KA 1P45A 4IGKA 4B3DA 4XCVA 3D8RA 2F3TA 2HN9A 4B48A 1LS6A 2IOQA 2R93G 5KNCD 2Q21A 1SU7A 3WLKX 2I7CA 2X77A 2Y66A 3FW1A 3SJCA 4CEIB 3TD6A 3HA3A 4TTAA 1F2UA 1J42A 2X4LA 1NNLA 2BGUA 2GVDC 1TZBA 1WWKA 1V2HE 4WT7A 4ZODA 3WWOA 1YZKA 2GCNA 4C7KA 3TQOA 5CFOA 4UCVA 4UDOA 5TF4A 5BSTA 4QM6A 2GPWA 4CT5A 1F38A 4TKMA 3FKSD 3OJXA 2HVSA 1P0PA 4I55F 5DYYA 4C21A 1UBHS 2PQMA 2JD1A 4M55A 1DC5A 4E5MA 1LU9A 2PZEA 3JTMA 4EOGA 2GAOA 3EF3A 4XB6B 4EWLA 2E21A 4I19A 2PKRA 5A9RA 4DG8A 2EZTA 3HCEA 1WZEA 1JPJA 1XCMA 1WKBA 4PCAA 4XTRA 1ZD2P 5JQGA 3U5ZB 1U9CA 5DLFA 1PK7A 2W48A 3G2NA 4FXOA 4TUYF 3HKZE 4ZT5A 4YBZA 2EP5A 3MCTA 1Z37A 3N87A 3PQ2A 3OPYB 4DNPA 4OBBA 5LMZA 3PFWO 1UR5A 3RVJA 4FM9A 4F7DA 2PZAA 1OASA 3KYHC 3H4TA 5ITVA 3IT2A 2QGFA 4IGFA 5A06A 2AGOA 4XX1A 4DY4A 3AH8A 4HX2A 4RETA 3MBKA 4RVFA 1UP6A 3PCXA 5EIOA 4BP9A 5J1SB 1MBZA 3KEFA 4WN9B 4GVPA 3RGWS 5JSQA 2ZT8A 3D6AA 1XAIA 2QX4A 5BSWA 2BQRA 2YHUA 2XR1A 2QB5A 2HIVA 5F9FA 3CSDA 3ELUA 3NFRA 3P9YA 3OEED 1RJ9A 5KFSA 3CW8X 4LCEA 4NCNA 4NBTA 2Z4SA 3GV5B 5H1YA 5DGHA 5TC4A 1UC9A 1WSWA 1Z6PA 3JQAB 4LYDA 3GUVA 4FDLA 3VJKA 1ODIA 2CXRA 2Z2XA 2KE5A 3BDAA 1JXQA 4EGFA 1YULA 2YWFA 1JAYA 1KJWA 3WHIA 2FPPB 2GO7A 3QE2A 4Q1CA 5E4FA 4UCUA 3P97A 1SO8A 4DQNA 1YJ8A 5ESXA 3BACA 1CZKA 2CNWA 1U7WA 2MSNA 2NZ8A 2ACWA 2XE6A 1HT3A 1OYOA 5CK4A 5C31A 1X86B 4M1EA 5B6IA 3H5RA 4BY9E 1NXSA 3FWYA 3DAFA 4DM7A 3P2YA 3CCFA 4MJLA 2AOVA 1VXRA 2HA4A 4L08A 4UU0A 1XKLA 1LTKA 3HDJA 3BWEA 2JGNA 1UKVY 1YXMA 2P9FA 5LLSA 3RRFA 5LU8A 2O57A 4L0DA 2XEDA 1Q95A 3ROQA 4KKVA 1QH1B 3LDHA 3D0QA 3MN1A 4L5JA 3FMAA 2P91A 5I7EA 1IOZA 3ZHSA 4CQLA 2YOHA 4MR8A 4G0NA 1Q12A 4EFDA 1V47A 3CN9A 4M1SA 1JYSA 3Q3VA 4DQDA 1LLQA 5TPZA 4ZTUB 3CH5A 3DEZA 3KZOA 5KSOA 4JDUA 4E5KA 2ZFUA 3DMTA 2O07A 3C0KA 3I52A 3CC8A 4PX5A 2B30A 2J7KA 4EMTA 2ZM6H 3V1YA 4PPNA 1W36C 3L7BA 1P31A 1PHRA 2EEZA 1QYVA 4A3IG 5EUCA 1S0MA 1RIIA 1SBIA 4DCNA 1I8TA 1X1EA 1O77A 1QYCA 1MIHA 1UJ4A 4P7BA 1L5RA 4GI3A 4LZLA 5CG2A 5JJIA 4YR9A 1KJZA 2GN1A 1OXSC 2ISQA 4WOBA 1KO4A 4NYIR 1U9ZA 2CLHB 4E2XA 4CE5A 2R84A 1Z5VA 3HJNA 3L04A 5D84A 3AHGA 3RO7A 1QMGA 3KJEA 5FBKA 1Z63A 2AN5A 1VRCA 2RJOA 1JMVA 1X15A 2FW6A 2JGJA 4TRJA 4II2A 2X9NA 1H0HA 1QC5B 2QTZA 4O3SA 1B4DA 2VUGA 1NT2A 2GH1A 4KXLA 3DYBA 2Q0XA 4EJ2A 2O2IA 1IN4A 1P2TA 1PU2A 1TU3A 4QGHA 4XR9A 5IN4A 4YAWA 3FCXA 5I5UA 4O4LF 2BF4A 5K8TA 4Q21A 2JEFA 4OGWA 4JI4B 1L7BA 1T2NA 1L4FA 1M1YA 4TS3A 3IAM6 5I5VA 1MO4A 2W6NA 3O8RA 1ST2A 4UE6A 1Z6XA 3TS1A 4JXKA 3U16A 1DRKA 1REQA 3FDZB 4IJMA 5DTJA 4DC0A 1BXKA 1KERA 4WJLA 1A97A 3QKRB 1AZSC 3IHWA 1PGPA 2UUCH 4MV6A 3R0IA 2OBFA 4R01A 2PX6A 4LA4A 4WERA 4EPTA 5HKKD 2WB2A 4N6GA 1L2ZA 1J8YF 3B2EA 3E58A 4YACA 5KQGA 2ID9A 3PVZA 5CT4A 5IC6A 3WWYA 4RVUA 1WCIB 1YFZA 2VUSA 3L4EA 2BISA 3P27A 4OL0A 3GEDA 3W8FA 5CG1A 1UAAA 4AS2A 5KNBA 1YS2X 2BKLA 1KOFA 4TMTA 5K4AA 2QX6A 3K70C 4N0QA 4PYNA 4BN4A 2PGNA 5BVGA 3ZHVA 2FQ1A 2Z1DA 3DONA 4IAOA 4TGLA 1LLDA 4MV3A 1Q0QA 4JJFA 1LUAA 3Q88A 3UHOA 1QC5A 1VFPA 3U55A 2OD2A 2IKQA 3I2KA 3USCS 1XTRA 3JALB 1A8SA 4M0JA 4LSXA 2JK1A 2LR0A 3JQGA 3ZHOA 4L8WB 5AI4A 3B82A 3OU7A 3RB8A 3WYFA 5FI5A 1KFKB 4DYDA 4Y9DA 2ACVA 2B8TA 1NMSA 2OCGA 4O2AB 1M2FA 4OBEA 3F90A 1FDSA 2GBLC 4JBYA 4ZU6X 4CM8A 4UBNA 1UJCA 3SXJA 3H6KA 4KR7A 1E3QA 1GCUA 4PHGA 3TMYA 3FDZA 4Y3UA 1E6MA 2DT5A 3VH2A 5KFUA 4H1HA 1E7WA 1Z18A 1TW2A 3MD9A 4O0LA 1T3LA 3EDYA 4G0PA 1UZNA 3NHYA 5C1BA 1TAEA 2PPLA 1SBCA 3CZ4A 4N47A 1T3SA 4ASUD 4F97A 5BQFA 1XK5A 2Q6VA 3FYUB 3H1BA 4GOMD 2BM1A 4TLCA 4KO8A 3F0TA 4MR8B 3FMIA 4IJ6A 1IB0A 1Z2AA 1PG0A 1KS9A 1OLSB 3MRXA 3QJ5A 3GLRA 5FTLA 4LV5B 1SCAA 1FCJA 3KALA 3EBPA 3VHXA 2H31A 3RUPA 1ADJA 2B61A 2O7NA 3PEVA 1IEQA 2A7QA 2WB4A 1IHYA 4ARSA 3PX2A 4JODA 4RCZA 1GEGA 4LEIA 4AM8A 1V37A 1AMNA 5TPWB 4QX6A 3X0DA 2XRZA 3VZQA 3VR0A 3CNNA 3ZDAA 4LRUA 3IAHA 4IDOA 1B0PA 4RVSA 3SMQA 3LDUA 3C3WA 1P2VA 1JJ7A 5K0FA 4QPCA 3DDZX 4TS9A 1R0ZA 1VSUA 1CRWG 4QBHA 2BCJQ 4DF3A 3FSEA 4NBSA 4Q9JA 2PN1A 3S2IA 3QSGA 1FKAH 1B1CA 3NT2A 3QHQA 3A6EA 4G56A 4QFMA 3A28A 3UW1A 3TZHA 3F6BX 5KYUB 4XZ3B 1QZUA 2R4TA 3QNMA 4UNIA 1G8MA 4R9VA 1G4HA 3EDQA 5GGYA 3JQRA 2G9ZA 3K15A 1YTLA 4N65A 4BFCA 1M6EX 2AMLA 2XITA 2B78A 2YWDA 821PA 1Y7PA 2L82A 4KQ6A 2JFVA 3GLHB 1HBJA 2P8JA 3BPSA 5DHFA 5G0SA 2G09A 2IYTA 2XUGA 3GDWA 3T3GA 4BZZA 3NOVA 4FHGA 4L8LA 5DM60 4ZK6A 1JLRA 3QOXA 1LSOA 3FHTA 3GFTA 4DV5H 1EVKA 4GSYA 4K81B 3GGSA 5F5NA 5T4EA 3HACA 3TOXA 3ZK9A 4DCSA 3OEHA 1YF3A 1TKCA 2ZYTX 1ISJA 3HKBB 4FNAA 2JGKA 3THOA 2UUCB 5DBHX 1T3TA 4ROSA 3CVXA 4G85A 3DAYA 1VYHA 2CEAA 2H4XA 4GI2A 4A73A 5AVQA 2Z9DA 1PQPA 4S2UA 2ZIFA 1KFJB 3AHCA 2O8FA 1XLWA 4NE2A 3N44B 3GTPA 1TO6A 4M1KA 4L78A 5FOVA 2A88A 2R6JA 4HH3C 4QQFA 4RK0A 3VSDA 1AV6A 3GT3A 4Z99A 4Q4HA 4P84A 3GJTA 4IJQA 4ER3A 5BWCA 2ZQ5A 5J2TA 2HPZA 2NO6A 1FW8A 2WHQA 3DP7A 4BE9A 3IERA 2YR0A 5D51S 3W8DA 1YA6A 1MX3A 1T8YA 5IABA 2HSEA 4YQYA 1GKUB 3SDSA 2GEKA 3RSGA 4QHSA 5JH7A 3ETJA 4ESEA 4U9UA 3DCNA 4BRWA 4DEXA 5JVDB 1IMOA 4X66H 1JAXA 2WHEA 5PNTA 4DV7B 1DEKA 1QYWA 1S2IA 4E30A 2EF0A 3CX8A 1I6MA 1MLDA 1X9GA 2JLSA 3RHFA 4F60A 1HNWB 2YJ5A 1KU6A 1SPBS 3DMHA 1X3LA 3U48A 3MGAA 4J03A 1CV2A 2HUPA 4JK3A 5TQ2B 2PVPA 3M3DA 3BQ2A 2C31A 4Q1AA 3DHYA 4BVEA 5J2UF 3CUTA 3EIXA 5HIJA 2PJDA 4CMAA 4HZIA 2K5UA 5LVAA 4IIUA 3R7AA 2RHMA 4L15A 1NHGA 4ZOEA 5BR7A 4R2JA 4H1TA 4R9SA 3RG8A 4A0HA 3Q9LA 1YZUA 2AI1A 1HNNA 1R6XA 1NVGA 4TKVB 4LPSA 1AN7A 1X80A 3OQMA 2O8CB 4G5XA 3VU9A 1I1OA 1YB4A 1THGA 1U0SY 2CXUA 2WNIA 4B83A 2CKDA 2GDZA 3ES9A 1VPLA 4QPJC 4AB1A 3HXQA 1BDHA 2WD9A 4Z9BA 1DLJA 1E3TA 1C4KA 1TYEB 3QZ7A 2PQ0A 2QVCA 4PZ9A 3DOUA 3PNOA 1GAXA 2PWBA 4FWBA 2ZJ4A 2BIFA 4RHEA 1K9VF 4TXMA 3UC9A 4ZYLA 3RF2A 1P44A 1X8LA 1JALA 1RWVA 2QJWA 1G16A 4L6IA 1CUZA 4RUAA 1LX6A 4H4CA 4UNQA 3M9MB 1RC0A 5CP8A 4AJ2A 1U2GA 1Z5GA 3V4RA 4UUQA 3G6VA 3NTVA 4CL8A 2V74B 4AKEA 3WB0A 1PDOA 2ZYUX 3UA4A 1UPAA 3ZI4A 4OP1A 2VTKA 3HKEB 3P9IA 4MEJA 3VR6A 2WQ6A 3FNGA 3TKLA 1PFQA 1F8YA 3B9PA 3I3OA 1NRIA 2SECE 2VCYA 3VH1A 2GR9A 4MVYA 3QXXA 2FF5A 4FOLA 5DX0A 1OWPA 1QVZA 4M4SA 1CK4A 5I3CA 2GZRA 1W96A 4TZ0A 1BVHA 4MS1A 1I9CA 3NO4A 4NZNA 3IP9A 2H92A 3E5NA 1L1EA 3MK31 4J76A 5KKCA 1Z25A 4ZI7F 4L28A 3TE6A 1JX6A 2PLNA 3MFQA 3TVDA 3DPUA 3BEOA 3O84A 1U7DA 2DCMA 2WMNB 1UH5A 3FNBA 4EL5A 1GTZA 3S5UA 4BV8A 4Z49A 5AUOB 2QTAA 3N59A 3PHCA 2QXTA 4F96A 3SSMA 1H2XA 3ETCA 2XDQB 4Z1MA 4RIGA 2ZYSA 5K99A 2ZRAA 1K86A 1XEFA 3B60A 3LC1O 2V45A 3B6EA 1E9CA 4WXPA 5EKDA 3W90A 4EA8A 2CW7A 1C7QA 1A98A 1NVAA 4YCNA 3OPMA 2XWQA 4GZ5A 3M1IA 4YHHB 2DQKA 3FLAA 3NKFA 4JWKA 4Q9HA 3EC7A 1BQ4A 3ZJYA 5J2TB 2O54A 2QT1A 2VP4A 3QJYA 4JI8H 2P40A 3STTA 3KYDB 1QRDA 3KHHA 1NI4B 2BF7A 4XR4A 1MEEA 2QG4A 3QG5A 1I7PA 4WFKA 2IH4A 1D2NA 3GEIA 1G6Q1 5EWJB 4U6QA 1BGWA 4DKXA 4PN3A 1WPRA 2OFFA 3GPLA 1IONA 2IYWA 4O7ZA 2C9YA 1CFJA 3RVSA 1FZQA 3RBDA 1T5OA 4N0EA 3HRIA 4R1NA 4WDRA 1O57A 3QUCA 4NPAA 3RS3A 1QWSA 1KKLA 2ES4A 3HGQA 3OCYA 4JKIA 1KMQA 1R5OA 2XYPA 4KQCA 1A04A 4QJIA 3KDSE 4M54A 1ZBDA 1E18A 3RUCA 3C3AA 2KM1A 1H9AA 3UAXA 5HKBA 1C7FA 5ALDA 5IFLA 2VR1A 2LCIA 1JJVA 2NACA 2VATA 3AKZA 3ZE8A 3BAFA 4OHVA 3R3UA 4KFCA 4V2IA 3EDRA 4FYVA 2O2EA 3MWDA 1K83A 2QAJA 3T1TA 2FH5B 4EFLA 4B4VA 2IXFA 2PG3A 3KR2A 2INGX 3L07A 3O4JA 4L07A 4Q4JB 3OCUA 3QU5A 4ZT4A 3VR2A 3DV0B 1MW9X 4D8XA 2ANCA 4L9RA 5AUNB 3UYYA 2SKEA 5K0JA 5LZ4A 3EPHA 2ZTUA 5KG4A 3Q3HA 1CEXA 1KBZA 2QWXA 3L1VA 5IBPA 2G63A 2OLSA 4PIPA 1IFXA 4Q9IA 5CBPA 1IUKA 4IIDA 3JARB 1FUUA 2Q46A 4W1SA 5HM8A 3JVIA 2AWOA 4H3SA 1HFEL 1O4VA 1M10A 1XVLA 3HKCA 4JITA 1F3LA 1V8OA 2G40A 3T5PA 2IEIA 4AJEA 3ZKWA 2BFCA 3ADOA 3QVGA 4LUCA 4M98A 1DAPA 4BO5A 1A4RA 4WGFA 1P7PA 4PWYA 1O6ZA 1NIJA 2Y0DA 2C61A 1LI4A 4B6RA 4H1WA 3SVZA 4BMYA 3CNQS 3EC2A 1ISIA 1P9OA 1L5GB 3ZWQA 2WSLA 4ALIA 4LJ7A 4P3YA 5LB2A 3BCSA 5C5IA 2DPGA 3I9V1 2IU0A 3TRIA 4BQOA 4DCTA 1Q3TA 3F8TA 1LJUA 4YR0A 2BFMA 3JD3A 5KFEA 4DIDA 4UCXA 4CEJB 2VUHB 5JQGB 3QKSB 5GM1A 4JYAB 1C0KA 3RFXA 1X1CA 1XIVA 1H85A 1ACLA 1WTCA 3GIPA 4D9MA 1D1SA 5A62A 4N9QA 1H4VB 3GN2A 3GYBA 3FMGA 3ROGA 2QLFA 3WIBA 4ZFNA 2TYSB 1NXOA 3JVDA 4TXJA 1IXSB 4NZPA 5LQAA 3TEMA 1VJ5A 3HOVG 1Z73A 1RKQA 1UF9A 4IX9A 1MP0A 5KBYA 5MGNA 4X71A 2CJPA 2HJ9A 4IDEA 2B25A 4PAMA 4ETMA 1I7QB 5I7HA 2V3VA 1MAWA 4PIMA 3TZLA 1IE3A 3GWZA 4BAUA 2C2ZA 5BW6B 4D80A 1P61B 4LNUA 5I4CA 2OBBA 5ADWA 1CW2B 3HP7A 3KVRA 5CM2Z 1G9XA 3CMMA 3R74A 1HYQA 1W4LA 2NSLA 2V6JA 4P4GA 3WJAA 3CLSD 4BQFA 5AM2A 3QI2A 2PKCA 3VO8A 4OHUA 5KFHA 1T9GR 3V97A 5JXHA 3LM8A 1ZAKA 2QNRA 1KI4A 5BYAA 4X62B 2C2YA 2YFQA 4OOEA 3H5AA 4CFSA 1Z5NA 3E3LA 4O83A 3FBWA 5TGTA 2PGJA 1EGQA 3KKPA 1IQ0A 3BFJA 2P5TB 4OFWA 4CHIA 1OFGA 1RKXA 2H4FA 5AKJA 1FNDA 2DQYA 3URKA 2FFAA 2NQ2C 1IN6A 3KKZA 4YRQA 9GPBA 1OI4A 3KZXA 1KMHB 3ZQUA 1J9ZA 3ZJTA 1T4CA 3SBOA 1WDKA 4LVOA 5P21A 1GRRA 2OQVA 4OU4A 4ILKA 3AVUA 3R0XA 1RM4A 3E7PA 4JI0B 1HNXB 2YYAA 2AF4C 5I9SA 2WD7A 3S0JA 3KPYA 3A2LA 4UFNA 5ALXA 4C0BA 2NUTB 2QMZA 4ZCPA 4DADA 3ILVA 4L3WA 1C9JA 4D43A 2B7BA 2CD7A 5KNDA 3W6NA 3OHAA 1N5MA 3PQ6A 2HJGA 4K05A 3X1XA 4RBNA 5IHPA 5AW7A 4U63A 2X0NA 5CU7A 3LSYA 5DF1A 1PDWA 1W34A 2W0SA 4RF3A 2XD9A 3BHIA 1E4YA 3ED5A 2H2FA 3INGA 4N3NA 4Y9SA 5AJTA 3IIJA 1M7HA 1X7ZB 4ZMRA 1NI3A 4I9UA 2JA7A 4ZCLA 1COZA 3RU9A 4MQLA 4MKIA 4DR7H 3TZEA 4RK5A 4RIHA 2IA5A 1OA0A 4BNLA 3ESCA 1JJAA 1BAPA 1D8AA 3ZE1B 4BLPA 2CFSA 3KQWA 5KX5B 5AKZA 3K0SA 3O94A 2GXSA 5JV5A 5G3YA 1G5FA 4ZAGA 1P0CA 5BSVA 2HDOA 1PHPA 3PHHA 2FN9A 3OPXA 4RYLA 2QYZA 1L4MA 4AYTA 3RAFC 3T35A 2DM6A 1UM8A 1T6NA 3MOSA 4M38A 1VTKA 3SE7A 3X1WA 5AW1A 5LMCA 1USWA 1ZNZA 1B0ZA 1TIPA 5TGDA 4BLRA 5CITA 1UFRA 3BAAA 4IRDA 4B87A 2ONKA 4F1WA 4HZUB 1PQUA 2OESA 2H51A 3K5PA 4L0QA 3PIRA 4NJMA 4WXMA 3FMOB 5IMBA 1XMJA 5DG7A 1X7GA 4A3KG 1T3NA 3HCCA 4MQ6A 4WBXC 5AOCA 6NULA 2HRQA 1MN6A 1RPAA 1RTTA 4G5FA 1SXGA 4O7RA 1G17A 2JIBA 5KQSA 3CLSC 4ESHA 4TQ9A 1K4KA 3F8WA 1A8HA 1TKRA 1GZ5A 1TIKA 2JGAA 2AQ8A 1ADBA 4PYKA 3EBLA 3AT1A 4Y1RB 4CV3A 1VJ1A 5L7TA 3I64A 3VZSA 3H1AA 1DKLA 3AF4A 4RO0A 5TMPA 1V95A 3WK7A 3HN2A 4PFJA 4UHEA 3JYOA 2Y99A 3C5CA 2F62A 4G6ZA 3FTCA 5B1IA 5FOTA 2I9KA 1ZLXA 4OHXA 4CBVA 4EP1A 4EECA 4ZZ1A 2C9MA 1IEWA 3ZDRA 4Z4IA 1VA5A 4XH9B 4YWJA 4ATNA 1XQVA 3DV9A 3G2JA 1LX7A 2H7VA 1EINA 4OXNA 3UUGA 3ZHRA 1Q1QA 1EVZA 4Y2UA 3I04A 1SKAA 3J7AC 2C4VA 2HHFB 3WNBA 4ZEOA 1CJKC 5I51A 3VX4A 1QIHA 1SKQA 1U2GC 2MSLA 2YXPX 1E3MA 1MOSA 4A6XA 2PGIA 4BP8A 1OLXA 3ADBA 1C3VA 4MJXA 2DPYA 4GGMX 4C22A 3W2EA 1QHGA 3ACDA 4G8CA 4LRYA 3OLVA 2XE8A 3P96A 2Q2NA 3OF2A 2Q5QA 2J4FA 5B6PA 3U3KA 5KJ6A 1BJKA 1Q20A 1QFYA 1Z3CA 3AESA 2O2JA 3FX2A 2C4HA 1E1RA 2WJ4A 3NAMA 4R2HA 2CXPA 3NTXA 3TLMA 4H60A 2ZJ3A 4P33A 4BNXA 1N1MA 1HLGA 1T9HA 5FUVA 4R7GA 4D0SA 3RJTA 5DHSA 4IM7A 3UOWA 2EU8A 4F4WA 3OFNA 4IYRA 1B6SA 1ST3A 5BN3A 4I3HA 4K9QA 1SUFA 5KJ1A 3QF4B 2J5QA 4H6XA 5DZSA 1RPNA 3SYNA 4E5SA 1HDCA 3LTNC 5DHUA 3LHSA 1I1QB 3OUZA 1JG4A 3VKWA 1NJFA 1DRWA 2P0YA 1DUSA 3BMCA 4G5SA 3ZWWA 2W2KB 3OY7A 4U3JA 4EYSA 1SEIA 1QAOA 3KAQA 4R1SA 4ZVOA 3NMUF 1NQUA 3JQFA 4JASB 4JJ6A 4MQEB 5BYBA 3RJZA 3WR5A 4EUFA 2Q5JA 3I28A 5JFTA 2QTNA 2XECA 4CU5A 2JLXA 1SUBA 1W76A 3QPUA 5HMMA 1RXUA 1Y7IA 5JAIA 4XD7D 4H7IA 1NJSA 4DRXA 3CUSA 4ZCQA 3E8MA 5B64A 2QL7A 1U2TA 3T1YH 1NRJB 4ZRMA 5A6SA 1UFVA 4QTZA 1J4AA 1FP4B 1TUBB 1C7RA 2OLJA 3HCWA 3L18A 2EZ4A 4HXFB 3B48A 5IXYA 5LP6F 1NQOA 3GUHA 2XZOA 5IF3A 2Y8EA 1PZNA 4CCAA 5LQSA 1XWIA 2XUOA 5FL7A 3ITEA 1QHNA 4B6GA 2ZZKA 4RAOA 4WN3A 1IWBB 2KI5A 3UMCA 4X95A 3T3EA 1Y1SA 2NAFA 3EDMA 3KLMX 1WQ4A 1S9HA 1EPUA 2OKGA 2B1JA 1MFPA 2VYNA 3O1HB 4W1PA 4Y9UA 5EN4A 3BIWA 3AYXB 1S2GA 2NU8B 3ABOB 4RQAA 2FB9A 1L6IA 1R0YA 4ZTBA 4CKBA 3WYCA 2ZCVA 3DZDA 3UMMA 4H3VA 3H3FA 4TTPA 1KU0A 2LCFA 4HLQB 1F2TB 1KTAA 4WIAA 1VLVA 1WXHA 4UUMA 5KFVA 3KHGA 1Y8RB 3GFSA 3O82A 1I2MA 3IULA 2HQRA 4MO2A 4MUAA 4RHTA 3WO1A 4MTDA 1A95A 1JKJA 4UBJA 3MCAA 4INPA 4RDIA 1XTJA 4IP0A 4AC9A 4DW8A 4DV0B 5K6AA 4FFVA 1TVMA 3D7NA 1DUIA 4Q6WA 1YC2A 4DABA 1RKVA 1SU8A 1XVVA 2P3QA 4C2UA 3THRA 3FWNA 4ALKA 4CGYA 3UAOA 2XC9A 2GK3A 3TGLA 3VPFA 2JC3A 3DL0A 3M6AA 1SQFA 1XRQA 2VRWA 3L6OO 3A4VA 3F3YA 3DD5A 3WGVA 3AZPA 1C2TA 1MNAA 4MQBA 1HEIA 2M1ZA 4GZMA 1LNZA 4GNKA 1FP7A 3SDZA 1YDEA 1UBOS 4KJXA 4RLFA 5FTNA 4RUCA 2RHRA 4C4OA 4YXWD 1NULA 2HK9A 2R8XA 3R20A 1KEPA 3KJFA 2YIMA 3HVKA 3RFUA 1O96B 1EM8B 1T5LA 2EZ8A 4WECA 1QRUA 4MWOA 3VPSA 1L8XA 2D0IA 2WWTA 2XB8A 4KQEA 3MCWA 4B6OA 1G2PA 3WLLA 3ZKWB 1W7AA 1XP5A 1WRBA 3N58A 4B9AA 2BH2A 2BH9A 3FVRA 4UTOA 2UXCB 4DCVA 4BBAA 1UJMA 3KUUA 4OEHA 4BKQA 1QONA 2LE0A 3HJRA 1SR8A 2QZPA 4EPWA 3NNSA 1JJFA 1X9IA 1C3OA 3PQ7A 1GG8A 3ZBQA 1L5HB 3CSUA 4I08A 3DEYX 3GH1A 3U3ZA 1HWYA 1LXCA 2ZJOA 4BVFA 3UBTA 4BLQA 1SVOA 3PR1A 2NO7A 3K3PA 2A6PA 2PS9A 2H00A 2WJ6A 3JQQA 4C7VA 1R6UA 1HTBA 3D6HA 5JS6A 3RAQA 1B2LA 2XQVA 1LF5A 3KT6A 3R0ZA 4KOEC 1KZHA 1RBZA 4CQLB 4Q9AA 5B1YA 1DO2A 4MB6A 4JA2A 4DKJA 2AR9A 1JTVA 1XHLA 3H2IA 2P9BA 5KOYA 4OTZA 4LXGA 4CMFA 5CLHA 5GOZA 4RNNA 3FOFC 2FSSA 5F3DA 3FZNA 1JEQA 1K7XB 4HDQB 4L4XA 4B09A 2PU5A 3RVMA 2QVZX 1UKCA 1ZITA 3B7WA 1KKUA 1NRXA 1J09A 1FP6A 1RAGA 1ZYUA 5EQJB 1QKIA 3L05A 4DV4H 2OCLA 2UVDA 1BMFA 1M8KA 1FLVA 4IDDA 1GA4A 3R40A 4MKFA 4O5OA 4DCJA 3OZDA 4TQSA 1H65A 3G0HA 3HR7A 3R6LA 1QNLA 3TL6A 3UYKA 3RSLA 4X66B 3MPOA 4WLVA 1ZP6A 2YW2A 1CZLA 1SAYA 3O91A 1B6GA 2IY9A 4WMLA 1QCZA 3GPIA 4WKPA 1FRVA 3RABA 2JJMA 4YJKA 4FLFA 1N5KA 3IG0A 2IPOA 3PRKE 1J8QA 5AJVB 2BI8A 2Z57A 3FTQA 4PYMA 5LMUH 2NVUB 1IYZA 3CEHA 4ZJZA 5HYVA 1G38A 4HYEA 4FR2A 4RC9A 4DCUA 5FTWA 2W8BB 1BHJA 2B4TO 1CY2A 4N5MA 1WUJS 4D02A 3WSTA 4EO4A 3BJMA 4J7CA 3LWZA 5AVXA 1SXJC 4AECA 3MWGA 3LUGA 1C0EA 4PRYA 1F2VA 1QR2A 5I5XA 1LTQA 2JFNA 1N6NA 4BEWA 1ATIA 1XMSA 1Y1PA 1GKIA 5KFPA 1X7DA 2Z5LA 3HB5X 2J41A 4N5LA 4KLAA 1H4QA 3LCRA 3FJ1A 3OSZA 3STWA 5FLXW 3U0VA 5HK9A 3JYHA 5BV7A 4UBKA 1ZJWA 3ICEA 2NOAA 2FPIB 1P1JA 2G9UA 2YWEA 5LOVB 2P7HA 2GPSA 3M7IA 3WHLA 1B8UA 3D4PA 3VTZA 2CMGA 1YQQA 4BQEA 1OBDA 1KR5A 1P9RA 3N53A 2ZJYA 3KD2A 3QVTA 3CIOA 1H6CA 5AESA 2BLLA 1XYVA 5CM8B 2VJNA 3K4QA 4OD0A 4RY2A 3SI7A 3RR2A 4ZEXA 2FFHA 4HNHA 3NGDA 2C98A 5D5PA 1ZU5A 2V4MA 2AXPA 2W5UA 4ZVMA 2YS7A 1L4NA 3VR4H 1USIA 2P9CA 4ILEA 4D26A 2L19A 5BW4A 1J22A 1J5PA 1QPGA 2OC4A 1EVJA 1V39A 1WM1A 4X64H 1X39A 2VDKB 4I1UA 4K2HA 5FRDA 3VOBA 3TI9A 4B3RB 4Y0VA 3GIKA 2JEJA 2C54A 1KJJA 2YRFA 3I6IA 1PFKA 3DFIA 1R9JA 1TJPB 3WMGA 5H3CA 2I4NA 2BJWA 3EDCA 2BJHA 3DBOB 3Q8QB 1NVDA 3LUHA 3NGXA 4PHFA 3EY9A 3PPXA 5HTKA 4QYSA 1NURA 1YS4A 3H65A 2GK7A 3WDKA 2I3ZA 4WCFB 5EERA 1GQRA 1L5YA 2GQ0A 2G9RA 2XCIA 3EMBA 4QULA 1I3NA 3TX6A 1KDZA 3V7YA 1CYEA 2ET6A 1JEYA 1XD9A 4HLDA 4NNPA 4O0MA 4EUNA 4F21A 2ZR7A 3KXPA 3HNPA 3PB3A 1LZLA 3SC3A 1CUGA 1DBVO 4MUFA 1UKZA 4A8PA 3IDSA 3KLNA 1CJMA 2YJ6A 3GGCA 2GLXA 1O08A 3HYLA 4PQYA 1BFUA 1IHXA 4GWLA 1E2DA 1RHMA 2XMZA 1QAQA 1QG2A 3GT0A 3HDYA 5E1OA 5DO9A 2HADA 3KHTA 3L8ZA 5KIAA 2GCEA 2XW6A 4IXTA 1VC2A 1IY9A 3M6XA 4LYJA 1J99A 1PJLA 3N2GB 5AXCA 4PLVA 3VFDA 2HGZA 2FMUA 4W4TA 2WU3A 4OU5A 1ZIYA 2AVDA 5ELMA 2VQDA 4JS0A 2R8HA 4EABA 1GSIA 2RGNA 1QVAA 3UWKA 5DCUA 1ZJJA 3ZPXA 1KBLA 3S2EA 4TN5A 4EQ6A 1PJ3A 4JOSA 3PXBA 4OH1A 5BR1A 5CFNA 5J58A 4XSVA 3L41A 3TIXB 1PQWA 4DAOA 4EHBA 1OKKA 4J1NA 3QJGA 3EFBA 1WO8A 4L51A 3ODPA 1YQWA 3GI1A 1UOOA 2QW1A 1DQNA 3PF8A 1PFVA 1YU9A 5BR8H 4EA7A 4CC6A 3KYCB 2WWVD 2QRJA 4RXTA 1RC1A 2QN7A 2Q1TA 3LQ2A 3ZNPA 5CDTA 2HJSA 2YHIB 3R24A 3PWTA 3ZH9B 2B9VA 1N8TA 2O23A 3IE1A 4YFYA 5FLKA 3WP1B 4ES6A 2X0KA 4Q1EA 3UYLA 2QY9A 3KYBA 5K3EA 5TV2A 5CVUA 1RRMA 2QUKA 4UBMA 3A11A 2X8AA 3GD5A 3U5TA 1SWWA 2JVJA 2RGYA 4O4HA 5A4KA 3DWEX 2R6R1 4R1PA 3GR6A 1Y89A 2DZDA 4EB3A 4A3GG 2IIPA 3IP3A 3PR2B 4YRCA 5KDOA 4HH4A 4DDMA 3D59A 3TINA 1UP7A 1V7ZA 4GE0A 3V7WA 5AI8A 4LE1A 4ASUA 4CT4B 4EPXA 5KQRA 5EFOA 2ZAYA 1G8YA 4LZZA 2O0LA 4CT0A 4JI6H 1PR0A 9MHTA 3OIYA 4M8IA 3RVQA 4LWPA 5KFJA 1J2RA 2UVQA 3DMTC 3V55A 4GKBA 4Y2YA 3UK0A 2OXRA 3TK1A 3O2SB 4CLHA 3ETDA 1UC4B 4JYCA 5HBRB 1V3VA 2I54A 2CLOB 2NU6A 2WHYA 3ILHA 3L9XA 2ZYDA 2J45A 4TYWA 5GVSA 2QS9A 4U2BA 4CEJA 4HS9A 1XU4A 5KNCH 2XCRB 3ZIAD 4XQ0A 4KAJA 1KAGA 2QR2A 4IO0A 4L4YA 4OQFA 3CFYA 1AA6A 2BQ3A 3RAPR 3WYGA 3ZY3A 3DKPA 4Q3DA 5SYNA 4C76A 1C81A 1V11B 1VSBA 2GXUA 4A1FA 5BQ3A 1ZL2A 2GM5A 4XRGA 1JIIA 3KXKA 3R9XA 1KPIA 4YI5A 1OXMA 3ETHA 2DP4E 3SI8A 2Z2IA