2YZGA

Crystal structure of d-ala:d-ala ligase from thermus thermophilus hb8
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-ALA:D-ALA Ligase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 79
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzgA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzgA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzgA01
3Q2OA 4RZQA 5GONF 3GLKA 5BPFA 3U54A 1IOVA 2GQSA 4MV6A 3KAJA 2R82A 3R9RA 3QFFA 2CNQA 4FE2A 4FFRA 1SCUB 3V4SA 4M9CA 5CA1F 3AW8A 2NU8B 3R5FA 4FU0A 4YBZB 4IIJF 5LP6F 3R23A 4IHJF 3N8DA 5IYZF 1EUDB 2FPGB 2YYAA 3RFCA 5CB4F 2I87A 3JZFA 1ULZA 3E5NA 2VR1A 1GSOA 4FFNA 1T36A 1UC8A 1VBGA 1GSHA 4C5AA 1C30A 4IWXA 3HBLA 1CQJB 1DIKA 1VBHA 2YZGA 4O7NA 2YZMA 4J6EA 4EGJA 3KREA 5J2TF 3KAKA 4O7LA 4YAJB 4I4TF 1EHIA 2W70A 1W96A 5LA6F 4O82A 3V4ZA 3K5HA 2X0SA 4O7RA 3VPCA 5K2MA 2V58A 3ETHA 1DV1A 1CE8A 2YRWA 4XYMB 4O2BF 3G8CA 1E4EB 1I7NA 3ORRA 3TIIA 2W6QA 3NUAA 5CAEB 3RV3A 3U55A 3VMMA 4MV8A 1KBLA 2V5AA 4QSHA 4GGMX 2ZDGA 2FP4B 5J2UF 4M98A 5FNVF 4O4LF 5HBRB 5KKNB 1JKJB 2FPIB 4WD3A 4TV9F 2Z02A 4YAKB 5JVLA 1KJ9A 5C8YF 4XYLB 3HB9A 1IOWA 1B6SA 4IWYA 2HJWA 1CQIB 4XZ3B 4YJ3F 3RUPA 1JDBB 2NU6B 1AUVA 2VQDA 4MV4A 2YS7A 4MV3A 2SCUB 5KX5F 4Y8VB 4ZOLF 4EAAA 4ZI7F 3MWDA 3BSYA 4DLKA 4IZOA 3GIDA 3R5XA 4FFLA 1M0TA 3BSWA 5BPHA 3TIGA 3MWEA 1BXRA 4MA0A 3WO1A 2DWCA 2XCLA 3K3PA 2W6OA 4EGQA 1I7LA 1EZ1A 2GPWA 2PN1A 2NPOA 4E4TA 4O7YA 3TQTA 1WR2A 5LOVF 1GSAA 2VHEA 5JQGF 2R87A 4O84A 3U9SA 4C5CA 1C3OA 1CS0A 1EUCB 3BFPA 2OLSA 2DIKA 5JQWA 1KC7A 1KJ8A 5JVDF 5D8DA 2J9GA 5H80A 1M6VA 4EA7A 4MA5A 3LWBA 4O7VA 3VA7A 3VOTA 3VPBA 3N6RA 5LYJF 4XX0B 3LP8A 4NYEA 3ETJA 2CZGA 4O4IF 4HNVA 1UC9A 2I80A 4HNTA 2QF7A 3MJFA 2R84A 2R7MA 4I55F 4EA9A 4M99A 2I8CA 3AX6A 5I47A 2CNUA 4O86A 4O7SA 4DIMA 5LXTF 4MV7A 2GQRA 3SE7A 2W6ZA 3TW6A 4O7ZA 1B6RA 4EA8A 4MV1A 2P0AA 1AUXA 4MAMA 3I12A 4O83A 4O4HF 1JDEA 3JRXA 3ORQA 3WNZA 2QK4A 3BSSA 3HO8A 1KUTA 3JRWA 3OUUA 3BG5A 1VKZA 1A48A 1KJIA 1Z2PX 2W6PA 4L1KA 2C00A 3U9TA 4HQ6A 1JLLB 5DMXA 3KALA 4ZHQF 4ME6A 4HR7A 4O7TA 1KJQA 4TV8F 4O4JF 4WBNF 1E4EA 1Z2NX 4TUYF 3K5IA 4ZQIA 1M0WA 3G8DA 2FPPB 4FGRA 2Z04A 2R7NA 2YZNA 4O7WA 2NU9B 4M9UA 1KJJA 4YJ2F 1BNCA 1W93A 2W6MA 3DF7A 2ZDHA 2W71A 2VPQA 5C1PA 2PVPA 2YZLA 2R7LA 2YS6A 1KEEA 2R86A 4YB8B 5CA0F 2GPSA 4FFMA 4EG0A 2DZDA 4O2AF 2CNVA 5BMVF 4HNUA 4FFPA 2R7KA 2FB9A 1A9XA 2CQYA 2NUAB 3VPDA 1DV2A 2GLTA 4MV9A 4O81A 1GLVA 3WO0A 3TINA 3OUZA 5JH7F 2XD4A 3Q1KA 4FFOA 1EYZA 2YWVA 2YL2A 3UFXB 3R5HA 2YW2A 1PX2A 2NU7B 4I50F 4C5BA 1OBDA 1GGOA 5EZYF 2R85A 4EABA 2ZDQA 3RV4A 1OBGA 2IP4A 2R6FA 5C1OA 3JZIA 2WYOA 2V59A 2W6NA 2PBZA 1PK8A 5HV6A 1Z2OX 2DLNA 2YRXA 2HGSA
chains in the Genus database with same CATH superfamily
1XRJA 4RYLA 5C7OO 1T8PA 3LF2A 2P9TA 3X43A 1CY2A 4QBHA 4RZQA 1BJRE 4M8IA 5GONF 1SCQA 1M34A 4EYQA 4OTZA 5J23A 3U54A 2HPAA 3TE6A 4DV7B 4EBCA 2AQIA 3ONEA 3PIIA 2C7GA 1U28A 3D2AA 2JEYA 1DXYA 3JY6A 4H1VA 3MWYW 1Y8RA 4IH9A 3HNOA 3QFSA 3U3OA 1EVQA 1IM2A 4CHIA 5B1IA 5B7QA 1NJ1A 1C9NA 3ML1A 5GONA 1HLGA 2EZTA 3QHPA 3L8EA 4ANFA 1VM6A 2XUZA 3W6NA 5JCJD 1XCOA 4MWSA 4AYTA 1YQXA 3OIDA 3QKRA 1C5KA 1Q0UA 3NX4A 3VTFA 4C7MA 4ED9A 2VNIA 4DYHA 4I5FA 3IR6A 2F43A 4FNGA 1ESCA 1B41A 3C4VA 4DUPA 2J7PA 3U7IA 3OZTA 3QZ7A 2Z6VA 4A3IG 2PGJA 4C0KA 2IMWP 1BJTA 1E96A 3FZNA 4ZYYA 1HWYA 2G5TA 4G8CA 2VJQA 4MWBA 7YASA 3FSJX 4DA8A 1E3LA 2J87A 1P44A 3GIWA 2P9BA 4ON9A 4I99A 1AS2A 1JX6A 1RFLA 2VJLA 3M2PA 2Z3VA 2VWGA 4DR1B 2Z6AA 5EN4A 2XRZA 4UEWA 2Z1DA 2QYZA 1R37A 4DDHA 1Z7WA 5EWEA 3TN7A 4FEGA 2OCYC 3ZH2A 1E2IA 2XGQA 2VUUA 3P0RA 1OBHA 1ZSVA 4HFRA 2NP6A 1BVUA 2J3EA 2UVDA 1GYFA 1VBHA 1HO3A 2RGGA 4O7NA 4W1RA 5BYBA 3HBMA 3QMVA 3RG2A 8OHMA 3T12A 5KTPA 2QLFA 5JNSA 2AGVA 3ZGOA 3A4MA 5BWRA 4KWEA 5DSTA 2UU9B 3LX6A 4DKJA 1ZHQA 1UT8A 2UVWA 2JFBA 2JGNA 4N41A 2O8DA 5C4XG 1ZAKA 1I4DD 3G2LA 1K89A 3RGGA 1TJ4A 4ENVA 2QN1A 3DMHA 1AXRA 1YVUA 4P1ZA 2FEAA 5TXGA 4L22A 3U56A 3ENKA 4JB0A 3G7UA 2I4MA 3GJ7A 2PKEA 1TJ3A 1JG7A 2VDVE 1H2EA 2O7QA 5BN4B 2IE8A 1COWD 1AMNA 3WIUA 2QMOA 2IIVA 2NUPB 4M89A 2VQEH 4J9LA 1KY2A 1T26A 3EEYA 2YTZA 1LNQA 4C2MA 1VB5A 2GBPA 1K2WA 2HF9A 2Y6VA 3GYBA 3P5SA 5GMOA 3CT6A 4BVKA 5JYCA 3WLAA 4GRDA 5JAIA 1P3DA 2G06A 5LA6F 4FMBB 1XDGA 1EM8A 4L9SA 5B2EA 5J4LA 1WQ3A 2YXNA 4P4TA 4DR7B 1EINA 4MPPA 4QUBA 3D6AA 1E59A 4BQEA 1YRBA 4DZTA 2UZAA 4DCTA 1CDDA 4G6ZA 1SOAA 1D2NA 2Q6VA 2OC9A 1RM3A 4KACA 2CJXA 2F4VH 1AKQA 5CLGA 4IZHA 3Q3VA 4Q18A 5DISB 1XDWA 1XD8A 2VAMA 4RU9A 1NE2A 3KOOA 2R8PA 3CNLA 3R9KA 4IVPA 4OU5A 4YTEA 4IRCA 3IVAA 2RBEA 4C89A 1X80A 4D0GA 2C1EA 2FE3A 2H92A 3F5FA 5JXHA 3VI3B 2WJ4A 3ZE9A 4S05A 1Q11A 3ZW8A 3B7WA 1G8GA 4KPYA 4IHQA 3DZJA 1N9KA 2HMWA 1YJQA 1DEHA 4Y9UA 2NO4A 3T3MB 4HUJA 4D25A 3JZDA 1P1RA 4BQQA 1I7NA 4JOSA 5FH9A 4LHZA 3LL7A 4QNNA 4KIFA 5KFDA 2JIZD 3IKJA 1Y3HA 4ENSA 1SEVA 4UVIA 4LHWA 1S89A 2JFOA 3N2YA 3NJRA 3G0GA 2AMYA 1Y5LA 2D1TA 2E89A 4I1OA 4CQMB 4CTJA 2J7KA 2YHUA 1NJFA 4J0KA 3UUFA 1GTMA 4DQVA 1AQNA 4GQIA 1HQKA 3ILVA 2YJGA 2FW7A 2OM2A 3SHVA 4JXKA 3AHHA 3AP1A 1JDVA 1GO2A 3D8UA 1Z7BA 4TRMA 2OV4A 5DZSA 2IS4A 5DSZA 4U2EA 1KFEB 1Z63A 4CI0B 4M9SA 5T14A 3AMVA 2WF5A 3HSYA 1U63A 4JT4A 6REQA 4UREA 3UKDA 3NB0A 2A88A 4XYBA 4O6VA 3EDRA 4ZO9A 8ATCA 3OT1B 4CG0A 3I9JA 1JKJB 1Y1VA 4V03A 3SF0A 3E9MA 5E3HA 1JBEA 4H6WA 4L5CA 1R74A 1GT91 3TIFA 4YB8A 2BOVA 3QWUA 3I6ZA 3F46A 3LRXA 4GAEA 3T4PA 1CVRA 2VDWA 3EA5A 3G3EA 1CU1A 1KJYA 1QGDA 3A11A 3CH5A 4NE9A 4GXRA 5EFZA 3T3PB 5JD6A 5LWHA 2IS6A 4JVMA 2G67A 2NAFA 3K2IA 3IUPA 4MKXA 3A9WA 2CLKB 4YV2A 1RQ2A 1KJZA 2CHGA 2DQZA 3BWYA 4GUDA 1OXMA 3EPIA 3H04A 5IKMA 3KVNA 1TAUA 2H31A 1NNSA 4MJXA 3K0BA 4E7PA 1FFEA 2F43B 4NCBA 1Q57A 5EZYA 1H0HA 2AF4C 2BF7A 3VO9A 4QXPA 4RB1A 2EIXA 1X1BA 1XB2A 3QUQA 2IKQA 1DIRA 3BHJA 2YU9A 1CUIA 4IRXA 5GWXA 5LMNH 3TB4A 1KQNA 4Y9SA 1DCTA 2JZCA 1TJ5A 1K3FA 3DDHA 4J49A 2G36A 1T9CA 3QENA 2R6GA 4LSAA 2JFQA 4RNOA 3RAPR 4HNHA 3ZV4A 1KEKA 3CLKA 5JADA 1FTYA 4R81A 4C06A 2WE7A 2GEFA 4AQYH 3C6QA 4Z4HA 2Q21A 1KVUA 2YOGA 2DJ5A 3A4YA 2YIDA 4FB5A 3LAWA 3L8GA 4K86A 2PH7A 3GFRA 4U39A 1T0UA 3ZIUA 4E5PA 4A2BA 3H87A 1BKDR 3A9TA 4ND5A 5JSFA 3MGAA 4ZOEA 1CNEA 1J4AA 1FQKA 2K5UA 3RS4A 3SY8A 1HNZB 1P2TA 5TRTA 1Z4JA 5F9HA 3ZS9A 3U3MA 1UR5A 2VA9A 4YRIA 5IVDA 3A1DA 2AOXA 3CX3A 3FPCA 4HNAB 4MW1A 2TSYB 3PPYA 2BKLA 4ZT6A 1BX3A 4C3VA 1KVQA 4F8YA 1XVTA 5CFLA 5JT1A 4U0JA 4ZOLA 3CZPA 2BCJQ 3X2SA 2HMSA 2J4DA 4NPCA 3IP3A 2XIJA 2HIVA 1IU9A 3MINB 1E3IA 4M1SA 2XF8A 2C0CA 2C7PA 1SUIA 2NUPA 4EYOA 2HIHA 2CVQA 2XVMA 3LGSA 4Y98A 5FO1A 4K0KH 3TUIC 3KWJA 1X0VA 3HKDB 3Q10A 4K03A 4PPYA 4DLXA 3UPTA 3E23A 2K87A 2ZUUA 3VNBA 4BO9A 5BSHA 1S2LA 3T9BA 5A5EA 1CFJA 1RM5A 2ZRFA 3C39A 3OPMA 4RC9A 2H9IA 1NG1A 2Q5FA 1T2EA 3BICA 3NH9A 5CJ2A 4OLBA 3RB6A 2ABJA 3DT9A 4UCRA 3LUJA 2FJ0A 4I0WB 4KYVA 1MX5A 4KH1A 3EZGA 4Y2TA 4F46A 2NO6A 1D3AA 4Y1EA 2Q5IA 1OB5A 1J42A 2XYVA 4RZRA 1UP7A 3MFIA 2XOXA 4RCZA 1E2MA 1E7WA 2WB1E 2A9JA 2I99A 2OHFA 1X80B 1NRXA 5FFFA 4BO2A 3HVRA 4BXOB 2EJ2A 3U9SA 4L0DA 1QP8A 4LMYA 5EVCA 3I5AA 4BTEA 4COKA 1GAEO 1LY1A 3JWGA 4PYKA 4RAOA 1L7XA 3ZXIA 3IQDB 5KDLA 2HCJB 1W46A 3LUAA 4WHMA 4Y1RA 1EVIA 2IODA 4TTVA 5B3KA 3PGMA 5AKLA 2DU8A 4QNRA 3MRSA 2XMQA 3WZLA 5UKDA 2EZ4A 2B4QA 5EXXA 3TJMA 5FT9A 5J1TB 3ZK7A 3V4OA 1BWRA 3CLVA 2WIJA 3D1LA 4XR9A 3U0GA 5JUMA 1K2VN 3SZGA 3K09A 2EJ0A 4WE3A 5SYNA 4UUOA 1XWWA 3DKIA 4EDHA 1NONA 4RETA 4IDFA 2HQSA 4RJLA 3GEPA 4BVHA 5ENVA 5I4CA 3DL0A 1T36B 4E14A 1HUQA 1Y7TA 4RPKA 3N6RA 4HFJA 1AUOA 2G7MC 4HEJA 2F1JA 4QJ5A 3OQMA 2NUAA 2LE0A 1J0BA 5KSZA 2X8JA 6REQB 3QQ5A 3ZX4A 2HJHA 3LPAA 3OX2A 4OXNA 2AQKA 4X6UA 3DVSX 4RTPA 4YI3A 4HH3C 4TTQA 4Y9TA 2XNDD 5EHIA 2O2YA 2WPDA 3VPHA 1SCNE 4O4JB 2X0JA 4W7SA 1G4AE 1HEYA 3LU1A 1MOPA 4D46A 2VDWB 1A8QA 2VQ3A 2YWRA 5CVUA 1UXKA 1T6YA 1HT0A 2QL5A 4Q9AA 5FOWA 2JCXA 3UFXA 4FFVA 2H4ZA 2AQ4A 5CDYA 1QHFA 1DAOA 2Y4NA 2YRFA 4I1PA 4KV9A 3MG9A 4W9NC 4E08A 5FTMA 2QHXA 1Y14B 1L4YA 1DDIA 1RI3A 3ANSA 4OJYA 521PA 5EZYB 4KLCA 4OYRA 3V8MA 4FYPA 2QVBA 3VPAA 4KMMA 5I5WA 1RBQA 3IPLA 3WNVA 4DV6H 4AU1A 5BNTA 1VLHA 4G9EA 3LM8A 4MV7A 5DIFA 3TLKA 2XC9A 1VMAA 1ZXBA 4FDAA 2GKOA 4K26A 4PHHA 3IAUA 4EW3A 5LDDC 1Z47A 2E87A 1LQTA 1FXWA 1WXGA 3H2SA 4G65A 2QRLA 3HDJA 2OB2A 5F23A 4QLAA 3VOAA 3NKFA 1GNQA 2XH8A 3Q3HA 1VSUA 4XM1A 1A5TA 1LBTA 2GGSA 1GT6A 2QDKA 5KJ6A 5IM4A 1LK7A 3QBJA 3B1XA 4HQRA 3KV1A 5AK3A 1GCAA 2Y1OA 3LMLA 4RY8A 3TEJA 1RXVA 1SA0A 2OP0A 2WTXA 3K9HA 3SBOA 4Y67A 4RMGA 2PSHA 3W8DA 2BMWA 2WR8A 4D2IA 2WKQA 3OY2A 4LGMA 1J9EA 2QX4A 1KJIA 5AJTA 4HNAA 2W6PA 2AX3A 5FO0A 4EYKA 4HDSA 2KMLA 1JLMA 1UT6A 3AHFA 3DQPA 3UH1A 4Z4IA 2W2OA 4LI3X 4HNGA 1VHJA 3L7IA 4HQ6A 3OTIA 2X9QA 4D9JA 4FXOA 1EB9A 3N7TA 3RRXA 4EUNA 1FRVA 1M76A 4XQEA 3SJZA 3TXYA 1HK7A 4NSNA 2FMHA 4TVOA 3K70B 1VSTA 1UMKA 3LCUA 4RD4A 4RNDB 1J33A 4J94A 4HYTA 5F9MA 3KJFA 3F67A 4MLCA 4PC3A 5F78A 4C0JA 4WBNF 1UPCA 1Q1BA 1P75A 2WJ6A 1Z83A 5JS2A 4A8TA 2IEGA 5KNCH 3WX0A 2HK8A 4GLFA 1QH8A 5CLQA 5KTMA 3LBAA 3JAWA 4UFPA 2H00A 2OXIA 3A3PA 1CERA 2ZPTX 3FFTA 2ZP1A 3M5WA 4WEOA 5TF4A 3GLFE 3ACDA 5LQMA 1HFKA 3WDKA 2R6R1 4EUHA 2HBZA 3BXHA 2ZR0A 4JLSA 1D7OA 3CEJA 4P7FA 3IDAA 1N2EA 1GVNB 1HDYA 2GAOA 3TY9A 5DV9A 2B1QA 3T7KA 1PSWA 4BC0A 5CG2A 4BXOA 4KNYA 4UVGA 2P2YA 2W71A 4S1PA 4UDOA 3DD1A 1FFXB 1N0HA 1VBMA 1QGUB 2R7LA 3EOZA 3M5DA 1B26A 1FU4A 2O1SA 4YXFA 5IKPA 4NL4H 4QDKA 3EVNA 4Y1RB 1L5LA 4A3GG 3RR2A 5TS2A 5ISMA 1XVIA 1QYCA 2Q7DA 2I4OA 1UNNC 3HKZE 1KAMA 2VT6A 4XFJA 4XUDA 5EC8A 5EUMA 2PUFA 3DHWC 2XDQA 3H0GA 2IYPA 2HHCA 1L5NA 4FDTA 3CTPA 5CCDA 3J81A 3KX2A 4KB5A 5CLFA 2XVZA 4RM2A 2GETA 2GFQA 1ILWA 4TWZA 5HF6A 3WBBA 1BX0A 5GJBA 5I7EA 5CDUA 1VPLA 3KZMA 1Q12A 5AKHA 5C8XA 2AJ8A 2VHUA 3AEUA 2CLMB 4G26A 2W7OA 4BNLA 1SOWA 3FFWA 4NBUA 2BFFB 1KYIA 1Y4DE 2P40A 4NESA 3ZY3A 4DR7H 3SI7A 2PEYA 3MHTA 4QM7A 4AS3A 1XMXA 1RHMA 2NUAB 2OG2A 2P5UA 2GLTA 1XR3A 3H99A 1T2DA 3WKAA 2NOAA 2AMLA 2X8JB 2Y9MB 5CFNA 1U11A 3HU2A 3E7PA 4RV9A 2OILA 5F12A 3W1BA 2VYFA 4LNAA 4TT3D 1O5IA 1M2OB 2WAOA 5JAZA 2C7BA 4RH1A 5TIIA 2R6JA 5CT5A 4DUGD 1UBNA 3E8SA 3NRCA 4F6RA 1NMSA 2QUIA 4HATA 2VYCA 4UUNA 1C1DB 3D2CA 1GDHA 2Z09A 1RWQA 2JPDA 3PFHA 4IVNA 4Q3AA 1O08A 4JJ7A 4UULA 3T7SA 3UFXB 1L1RA 3LO8A 5A0TA 4BFWA 4MX8A 4LDZA 1PX2A 1TCCA 2JI7A 1HFJA 1CEEA 2ONCA 3OEED 3LLMA 3C1OA 4FBUA 3P9YA 3ZCVA 2GA8A 2DEUA 2P62A 4Y8VA 2W9XA 1ISSA 5KT4A 2X2OA 3PUHA 3O74A 2PMZA 4XEUA 5FL3A 4DLNA 4F38A 3M9XA 1B8PA 5EGNA 4GGOA 5GV7A 5FV4A 4ARIA 1F8UA 1ZG3A 3FWZA 5C1OA 1WW8A 3Q5GA 3PE3A 3VXKA 4W6ZA 3DAGA 1DC5A 4O63O 3PW4A 2JLWA 4PHCA 4RHFA 1YA8A 3EARA 4MVJH 2LDXA 4K81B 2C2GA 1XL1A 3TZKA 3E3MA 2ZT5A 4E5VA 4RNMA 3EXAA 1AN0A 2BJVA 3BH6A 2HDKA 4UQLA 1KRWA 2ZETA 2FW6A 4JUDX 3FLEA 4DQNA 4OP3A 5HTKA 5BSTA 2VEDA 1JHOA 3D7SA 5LZ5A 3I92A 2R79A 3NHZA 5K7SA 1M5UA 1UFKA 3W1GA 3Q2OA 2Q8PA 3CZ9A 5F2NA 3L0SA 1I36A 1SA0B 2O6LA 5KFFA 1NC1A 3C4JA 3DXFA 2R1VA 3GGSA 3IP8A 4KLRA 4S24A 4E22A 2WTUA 2CV2A 4KVZA 5IVIA 5CK5A 4UJ3A 3HNRA 1DQPA 1IOVA 2HGXA 2G9ZA 1UT5A 3F3SA 5GZ6A 4M36A 1P9RA 1S9HA 1TO1E 1F4LA 1GARA 3CJTA 4R98A 3UWPA 3W5AA 1CETA 1G8PA 2FWPA 2IK8A 2OD7A 1UZUA 1E60A 2Y68A 3L7MA 2DY0A 4JLWA 3GT7A 3ZJ5A 3QA3E 3U1BA 5CIQA 3FZEA 3AW8A 1OB2A 1P4GA 4TTSA 1K6IA 3AM4A 1C80A 2XGOA 2Q4OA 1I6WA 1K7CA 1JH8A 3K8QA 2BZSA 2IUUA 2V7WA 4DCOA 1GNRA 1QOPB 4DEXA 2BFAA 3D4IA 1NUPA 1ZI9A 1RR6A 4JY7A 4QBKA 2O7NA 3BJIC 3EB9A 4IW3B 1E66A 2PZ8A 4QXMA 3W9BA 4MS4A 2P3LA 4L4SA 2HRBA 5GIOE 5J1SB 2A9QA 1RYRA 1AUPA 2C2XA 3HCAA 1PD1A 3K1YA 2ZBRA 1NOJA 3E5NA 2HQOA 1RAHA 2IYTA 2YVLA 2X0DA 2Q3DA 4D8VA 2CMKA 2EFJA 4UM7A 2YXBA 2Y9PB 1G1MA 4H3SA 1KFKB 2C4VA 1WDTA 3C41J 2G25A 1QYIA 3HJNA 2ONKA 2WAQA 2CBGA 5DGXA 4IWXA 4FOLA 1SU4A 3FPJA 4X8OA 1FDSA 3V9AA 2CNNA 3ZVNA 4TQSA 4L9WA 5A3VA 2ALZA 1B6GA 3MNFA 1U4OA 2FW9A 3D6NB 3X0DA 1NM5C 4NS1A 1T9DA 4GSLA 3RVJA 3FWHA 3IIIA 4F4YA 3RYIB 1S4MA 3IAM6 5J2TF 1TM2A 2VP6A 4LRWA 3RYFB 3S0JA 4QC2A 1JXOA 2CYAA 2R751 1IBCA 3FLAA 3IKLA 4DM3A 4N48A 2NZWA 3EBOA 4FD3A 3WFIA 5ECDA 3VSCA 4ASUD 3U09A 3P52A 2V7BA 1NXPA 1OAOA 2XQKA 3O8OB 4KW7A 4BV3A 2J30A 3A9RA 3AEUB 2WWIA 5BUCA 3F6RA 1G5IA 4MCJA 1MXHA 5EZSA 1QO9A 1YB6A 3N0WA 4MR8B 2W4MA 5BSVA 3OSZA 3FN4A 1SUBA 3KVOA 3P71T 1RK6A 1RD4A 1FP6A 3L43A 4N5HX 3AH8A 1N32B 1M2OA 3LHSA 2FGKA 4UCFA 3K6SB 3QZ8A 4L3OA 1YA6A 5DGBA 1FSGA 4PEVA 3ENVA 4ZAGA 4PWZA 3FZGA 2J5XA 3K2BA 4NJEB 4M0CA 5EY5B 5IP5A 3SZ3A 1NYTA 1M10A 3STWA 2G17A 2WVJA 3LG2A 5FTJA 3NYIA 5D3MB 2Q2QA 4K2AA 1LPSA 3E9DA 3SQXA 1Q3TA 2GAAA 3ZLTA 4R8UB 2NVXA 1XLWA 2K7ZA 1N2JA 4YAOA 3RKSA 4ZYZA 1EK5A 1G5RA 1G7SA 1LRJA 2HY7A 5F4BA 3ED5A 1BDHA 2ZSEA 3MUNA 2QJWA 3KG2A 4P31A 5LU9A 5E6SB 3R8XA 4JT9A 4QVKA 1E4EB 1N2CB 1QAQA 4KAJA 5I7AA 5KNBD 3OQIB 2CB0A 5KFXA 2A1HA 2RDJA 2BI4A 3OO0A 5I5XA 1M1YE 3QW4B 3PNVA 1VLLA 4JBXA 4DA6A 1SQGA 3MJEA 1QM5A 2XQJA 1XZMA 1Y89A 3BL8A 4GYWA 4CLOB 4HVLA 3DEZA 2H52A 3B36A 1G9XA 3G5TA 3A58B 2RBGA 4YLGA 1X7YB 2EKQA 1KBLA 3ZU3A 1U5BA 4NZNA 2W8BB 1EG2A 1KO5A 2VH5R 4FW9A 1U5CA 3C74A 5FWYA 2G9UA 1N2IA 1PGQA 1SNYA 2CW8A 3ZU2A 3BMNA 4DSZA 4RFVA 4WN3A 1TEXA 1MN6A 1OZHA 2XUKA 4A3SA 1VAJA 3KPJA 4D4JA 3ZLJA 3P2KA 5IUJC 2M1XA 1THGA 1KS2A 1MVLA 2QW8A 3GGOA 2XCAA 1GNTA 3NOQA 3ANYB 2R1VB 1T9GS 1V8DA 1U3GA 2HIAA 3PQ7A 3QEOA 5JO0A 2O8CB 2ZXUA 1VG0B 4GUAA 3H3JA 2OHXA 2J5QA 1WLYA 2IT1A 4NR0A 1Q6ZA 2WG1A 1MAAA 4TV9F 3WK4A 3RF6A 1IXYA 3OURA 4EITA 2AMFA 3FWYA 1M1XB 1VE6A 1PHRA 5FEUA 3NIFB 1CY8A 1STOA 3T35A 2B4RO 1H5UA 2X2FA 2H2DA 3FOBA 2PY6A 3MGCA 3CHYA 1Q7BA 1JXMA 4FUQA 3CJQA 3AI3A 3NH6A 4HNSA 4MP8A 4XI9A 4BLUA 4EKYA 4JL8A 5I7VA 4HTFA 3G23A 3KHTA 5BWVA 4LJ4A 3RT9A 2LCFA 2VWPA 4RB3C 1X7ZA 4GX2A 5DBGA 4ECTA 1UOEA 2WPDD 3PIDA 4QBFA 1ZC3A 1TW2A 4MRPA 4MDFA 4FZJA 2YHBA 1IDN1 2A3NA 2DHEA 2VATA 4XA8A 3E0QA 1VYUA 2PGAA 1H3NA 2NG1A 2WLSA 1P7YA 3PC3A 2WB4A 1XPJA 4TMWA 3UPUA 4JYMA 3G8YA 1E58A 3TWOA 2JFNA 4LH7A 2VSOA 4CC6A 1G5QA 2BEJA 3NEJA 1J7JA 4DCUA 1GTSA 3AUFA 4IQ0A 4XQ0A 1TECE 1FVOA 1RE0A 4WZBA 1AUVA 1RZ3A 1AZWA 3K0CC 1FRZA 2ID4A 1UDCA 4OYYA 2ANCA 4EYIB 4DBLE 2CUKA 5AM2A 3AJEA 2H7CA 5HZMA 5K05A 4RGQA 1EX6A 3A7EA 3TGWA 3U80A 2O7RA 2JK1A 1ANKA 2A0YA 4ZCRA 2Z5LA 4CE5A 5JY1A 3GFOA 5FRDA 4M1WA 3VTAA 3KFVA 1UK7A 1WF6A 3GVIA 2C7OA 1Y8ZA 3NV9A 1W5TA 1VJ0A 3AB8A 1YZVA 2NZVG 2X8WA 4YJKA 4GC7A 3UKOA 4CMEC 4D9KA 4QJBA 4YUZA 2CKMA 4UARA 2Q3JA 3DKVA 1GA4A 2QP9X 1NBOA 3DMDA 3JATB 4FLFA 4IJUA 5A4KA 3HN6A 3SD7A 5K0TA 3KTAB 4DLTA 2EXXA 1J09A 4GH5A 4BNWA 3SZUA 1KE1A 1Y48E 5HPYB 1B8OA 5DM60 2J6TA 4X1YB 5KX5B 2XTZA 5ENZA 1YUNA 2Q1UA 4HPJB 2HG8A 1DAHA 2CK3A 4WZ6A 3SEQA 1T3SA 2OGTA 3JASB 1I3QA 3E53A 3FYTA 3G85A 2AYYA 3N5CA 3PXDA 3HP1A 4JX9A 4MR8A 4ZYWA 1V16B 5CA1A 1C9KA 2Z8YA 2C1XA 5T67A 1RJRA 3UT6A 5C5CA 1WSBA 1MTZA 2Y71A 3VR4D 4M4SA 3K6SA 1XA4A 5AMXA 3JAKB 2NN3C 3E84A 4PIPA 1YS4A 3FBGA 2C5AA 2YJTD 3GYGA 4I4NA 1Z8DA 4RH3A 1XQXA 3P4UA 4UM5A 3TLGA 1HNWB 4NYJR 2J9FB 3PEEA 1QQ6A 4S1OA 2G1UA 2P1ZA 5BOVA 2ZB8A 4NH0A 2DFKB 1PJAA 1UDRA 4NYIQ 1B00A 5EMKA 5EZ5A 3WGYA 3Q7QA 4M1TA 4B73A 3LF1A 2HMYB 1AN9A 2J3MA 4R8UA 1EDDA 3GUZA 4ZQGA 2ZB7A 2MHCA 5AQ1A 5HOEA 1JU3A 3EEOA 1G2WA 4C7XA 2NU8A 4NXMH 4HUQB 4AUEA 1D2GA 1YBMA 3SYTA 4PZCA 1II9A 1NJ6A 4L85A 3LD9A 4X61A 2CVOA 4WLFA 5CA0B 4YJFB 1RRVA 2DPGA 1ZBDA 3KUUA 5ALGA 1KC7A 3OQIA 4N8SA 3OM9A 4MR9B 4QOFA 3BGDA 4RVNA 1P62B 3VR6H 3ZVLA 2ACKA 4OMCA 4BFSA 4IRKA 4HMOA 5E1DA 4D4MA 4OK5A 3N8IA 3MQ2A 2ZJ0A 4ID9A 1C3JA 4P22A 2XAAA 4B3BA 1X7YA 3LWBA 4DUYH 5U9CA 1U5BB 2C5BA 1JALA 1E9FA 2W8BA 2YV2A 3EA4A 5FPPA 3ZR4B 5DNUA 4E7OA 2BZ1A 4XWYA 4HAXA 1II0A 2GBGA 1G16A 1Z6ZA 4MIOA 3VVBA 5A4MS 2X4DA 1X9HA 3G5MA 2ONZA 4LHXA 4X8HA 2RKBA 3T0FA 5ICSA 1M5TA 3BGSA 4ZVMA 4N0DA 1W0KD 4URYR 5JD5A 1KK0A 2JGIA 4RQBA 3TX6A 4PWQA 4OHYA 1WBDA 4PG6A 4UKDA 5F33A 5AVYA 5TVGA 3O1IC 4WAUA 2PH3A 5F7OA 3TVYA 2OY0A 4NAVA 3OOYA 1UC9A 2X8LA 5F5XA 2I80A 2QUAA 1PR0A 1U7PA 1XJ5A 3G9TA 4PLZA 1QIMA 4K5QA 2PH1A 1G3IA 1XTVA 3IMGA 1ORRA 4J7CA 3ZXSA 5JNRA 3CXUA 3Q41A 3I8OA 1YDWA 1FSSA 2R84A 3B6EA 4IDNA 5ALEA 5D51S 2ATLA 2UYYA 4BWVA 4JI4B 4ZALA 5HG0A 2O3QA 2Q5LA 3FFXA 3THOA 4BMYA 2C2OA 4BQFA 2OHOA 3COYA 2FVYA 3QJ5A 3AKZA 4BC1A 1DTSA 1XAGA 3DEIA 3M6UA 3PUXA 1Z0ZA 4POAA 1T94A 4YRTA 1JBKA 2J9YB 4QA9A 4U4AA 3HB1A 4YY3H 4K88A 2UXBH 3LLUA 3QWBA 5AKEA 3VHLB 2OGWA 1Q17A 5LQAA 2PIDA 4FFWA 4BYMA 1KH2A 1T1IA 1WUIS 2ODPA 3OP1A 2ZUWA 3IQWA 5DBHX 2BQUA 4Q7MB 2SHKA 2H4JA 3EXG2 4TKMA 4W4TA 1JDTA 2X3FA 4LC9A 1YKGA 4G0YA 4FE7A 4JEMA 1K6JA 5J2UB 3DFIA 3KAQA 3VGPA 4CUKA 1IXSB 4D6XA 4LZAA 2B8WA 2H0QA 3U37A 5AW0A 5IU6A 1S3FA 3QELB 3LK7A 2J0SA 4EMUA 3GHYA 3QVGB 3X1JA 3EVCA 4E30A 3PLAE 4E31A 4NWIA 2QPAA 5BNWA 1CDEA 1MRZA 1MX1A 1SUAA 4CFSA 3DL4A 5GONB 2V7PA 4ER0A 3U61B 3PVSA 2IL1A 1VMKA 3E6AA 1HM5A 3QITA 2YHAA 3C98A 3WDMA 4B82A 3I1IA 2WT8A 4PYLA 2GRAA 3C3EA 4INPA 1EEHA 3AIKA 3SOPA 2VJCA 4ZOAA 4LZOA 1G98A 4G0PA 2IYFA 2DKOA 4M46A 1QO7A 3KTAA 3WZMA 1I2CA 4MDYA 4WFJA 3WB0A 1P7ZA 1P0IA 4DPLA 2R8HA 2ICAA 2OSVA 5BVGA 4X1YA 5JSYA 5FUXA 4B4OA 4EHDA 5KX5A 3ADBA 4ZHQF 2Q1TA 1VPWA 2FQWA 2Y0CA 2YINC 4N47A 3ZW7A 1PJ4A 3GMTA 1GXSB 2IW3A 1P1HA 5T4BA 5KPDA 3C8HA 3SGIA 3EE6A 2H2GA 3H83A 4PC1A 1FU8A 3ZZ0A 2C99A 3B9RA 1PT6A 4MROA 4EGSA 4CXMA 2W8KA 3P0EA 3SSNA 5DFAA 2HK9A 2GILA 1E3QA 4ZQIA 1CDOA 1FSFA 2OXCA 4QICA 5CJJA 5KAPA 3QBTA 3ZZMA 4AJEA 3QFTA 4BFZA 2HL6A 3BBPA 3QYPA 5J4KA 3THWB 5C8VA 2OBLA 1RMQA 4KPUB 1BCSB 1E89A 2PKRA 2QM8A 1F9EA 3HXPA 5E9WA 3GC6A 4JS0A 4XJXA 3UC5A 1JDZA 3AOEA 4HSEA 2I55A 4UHJA 1RKUA 2RGVA 1EFTA 3CC8A 4A6DA 5IDQA 2IH5A 2MYUA 5K99A 4K46A 3KS9A 1GZ5A 4A3CG 1EH5A 3M6MD 2LNDA 2WWYA 1H4QA 2OBBA 4DVGA 2J0QA 2FFHA 3ZDYB 5C1PA 3B3AA 3C3PA 4A3DG 2Y3IA 4HUQA 5DI3B 3M1LA 4AULA 1TMOA 2ZTLA 1Q19A 4ED6A 4YJFA 3MBOA 4NIMA 1DZ3A 1P0QA 4BB9A 1ZM2A 4KFTA 2D7CA 4P54A 3L2PA 1A69A 1JSZA 4IOLA 4MGIR 1Y1LA 3IT3A 4BNNA 2PX8A 4GI7A 5JCOA 1Q74A 4XVRA 3X1YA 2DERA 2PMFA 4NAHA 2CNKA 4YASA 3WGLA 2D5AA 4B9AA 4L75A 1DXQA 4YR2A 2EFYA 2Z3ZA 3GEHA 4Y2YA 1IN1A 4WOBA 4ZJYA 4FFPA 2CZCA 4O4LA 2O48X 2NYRA 2QIOA 3L8CA 4HQLA 1G20A 2OCPA 2GPNA 3CZAA 1TOAA 1RAFA 5AH0A 5IYCG 1ZUD1 1I2DA 4PLHA 3VPDA 4MV9A 2G1AA 2IXTA 1Z0DA 3LPMA 4LVCA 5DX1A 3QHAA 3SNKA 5TGDA 4HT3B 2DM6A 4V0MA 3BS4A 3H20A 3ZD7A 5A4DA 2QRGA 2WWWA 4F93B 4LY3A 4M53A 2Q6KA 1Q7EA 3MCVA 4XQ9A 1SUSA 1U8TA 5JH7F 1V6AA 2R93A 2PKQO 2XWJI 3X1MA 4RHXA 2ID9A 1YVPA 4HEHA 1EQ2A 4BLVA 4FFOA 5J58A 1OH7A 3ZQJA 1DJNA 1KJNA 3OZAA 5KHOC 3RM3A 1JSLA 3T9EA 4UFNA 1N2GA 2V8BA 2Q5OA 3LUHA 3LOUA 1QQ7A 5KOHB 4ZMRA 4GKJH 1IBMH 5ITVA 1QIKA 5E4JA 1LDYA 2KBEA 3H3VH 3T5MA 2WMYA 3F6YA 4L16A 2XXJA 4ZTUB 5E0KB 3P4XA 5J4HA 1A4IA 1LVGA 3PA6A 1TK2A 4G97A 1V7ZA 5DYIA 1HDZA 4MUKA 4CMGA 3KOUA 4CMCA 3WLKX 3QQPA 4CCAA 1HZJA 3PKJA 3DLAA 2OECA 4X64B 3EXG1 3BWBA 3MMXA 5JROA 1V51A 4F1KA 2BLNA 5KYUA 4DWVA 5J2UA 1DU4A 1RPNA 1GAQA 2REOA 4P3NA 3GELA 3ZWMA 3RBDA 2CDRA 1YTLA 2FPWA 2VL7A 3CEAA 3FTQA 4HMPA 4D3SA 4PGHA 3K70C 2COJA 3GIKA 2WYOA 4UNIA 2GD0A 1MPXA 1CF9A 3PGVA 4HH0A 4YN3A 1NXWA 4IKOA 1TAQA 4UW9A 3MSCA 2A58A 4KSYA 4OA8A 3BQNB 1I3MA 1EAMA 2QR2A 2FFBA 3KKLA 2EIYA 3L82B 4KXWA 2CXQA 4UD6A 2WNSA 3OH8A 5LC1A 1YR3A 2BFCA 5EPUA 5JASA 1CUUA 4FTWA 1ADGA 3T4XA 1E4FT 3OTOB 2ZSDA 1J5XA 3DE0X 1EUCA 1QE5A 5TPWB 3UANA 1MG0A 1T8SA 5KFUA 1GGFA 1NVKA 5EFOA 3R0QA 5JMTA 2BELA 3I9NA 3ITEA 1YAJA 3OJOA 2V8OA 3DOCA 4ZI5A 1U9CA 1GAXA 3CRQA 4NLGA 2VP0A 4E5MA 3WGNA 4OHCA 3QVUA 3JV7A 4X7RA 2B5VA 4ZC8A 3HI4A 1IK6A 2G40A 3FNGA 2IV2X 1ZK0A 3A14A 1SXHA 4PPQA 4AJKA 2UUCH 3RAXA 2RG7A 5JMOA 5KC8A 3RGWS 2ZGIA 4QRDA 3VR5D 3WYDA 3ZDAA 3AYHB 1H69A 1PLLA 2MINA 5MGBA 4QODA 3HL0A 3TI7A 3ROMA 5FORA 2F3RA 2D13A 3F5DA 4N5DA 5D3KA 5C5JA 2JI8A 1LPBB 3RUAA 4TX1A 2VUMG 1ZGAA 2JJ2A 3GQCA 5KG4A 2DT8A 2D0PB 5DQIA 3F2VA 3KSUA 3PUVA 1X77A 3V42A 1T5TA 3GJ6A 2BTQB 2PU7A 5DJ5A 3M9OB 2GDJA 3QKIA 1F20A 1TU3A 3L6OO 4MYTA 1IWPB 1PX0A 1Y0BA 3LT1A 3PI7A 1LPMA 2DCUA 2BT4A 2OE2A 3PXEA 4EARA 5IMBA 4OGLA 3TLEA 3WLHA 3JWJA 5C7YA 1NPTO 1WW2A 5DI3A 2DRIA 5KTNA 1M2HA 1ORHA 3A4NA 4D4IA 3IC5A 1MFPA 3MFHA 4O3OA 1GV1A 2C4UA 4QQ8A 3HR4A 4IS2A 4Z4GA 3H2HA 3KDPA 3TS1A 1L5MA 1P2GA 2P2GA 5E8JA 3HUUA 4RMHA 4B6SA 2GEUA 2BKVA 3TTYA 4R0MA 4L0CA 1CYEA 4GXQA 2UXDH 3WA7A 2VQFB 3RS7A 1HOXA 2AQHA 2D62A 4E1AA 1NXXA 2D06A 1OMOA 3OE7D 3UK6A 2ETVA 1DKLA 1NBAA 1ZOLA 3GRVA 4K9OA 4O4LB 5ESDA 5FUQA 3LS2A 2XUJA 2I4LA 3KTOA 3UPDA 5IX8A 1UMDB 1ZNXA 4FHEA 2WAXA 3VR2D 4JYAH 2BPOA 2ERXA 1OH8A 2HEIA 4QHSA 3COSA 4G9GA 1I5RA 4R7RA 1MNAA 4I9NA 4KV7A 4MYCA 4Q39A 4YO8A 4BVAA 3HEAA 3OZFA 1TVMA 5LQNA 5HSGA 3RSOA 1QKJA 4XARA 5KNDD 5JZSA 1K7EB 2P8JA 2NPIA 2P0YA 3F8TA 5EJ2A 4AWBA 1SUCA 5IAGA 5C7IO 4URVR 1I4OA 1Y8AA 3CUEF 2FF7A 3PGLA 3W2GA 3NJ8A 5DT2A 3KEMA 1M8KA 3DE1X 4GPBA 1KDRA 1YRHA 1I9CA 4IXDA 5L6LB 1FUYB 1L7RA 1YRQA 1JFFA 3BJRA 1ZGGA 5CFPA 2A59A 3ETHA 2IDJA 2PH5A 1V1MA 4RDIA 5J5CA 4XYMB 2J4CA 4X84A 5G0VA 2JJQA 2Z4SA 1UM9B 1UQRA 1C1HA 3W04A 1Q50A 4CR7A 3KB8A 3AZPA 4BNDA 1CNFA 5AM3A 2E6KA 3ESQA 2DOKA 4KU4A 3HT5A 4MKHA 3JX9A 2B1IA 1OLSB 4CLHA 4DMRA 5CAEB 3ABIA 4EW2A 2CSXA 2AZXA 3WWIA 1JLLA 4OI1A 4B6PA 1U90A 1NT4A 3U5TA 4XE5A 1QRRA 3C3MA 1S3GA 1ZITA 4PGGA 5CM8B 2G82A 3UCEA 5ICEA 2GBLC 2XEDA 3LKDA 5G2OA 5TS3A 4DR3B 4JXUA 1PJSA 1X39A 4OUKX 1U8FO 4D0NA 1LDGA 1Z6QA 4QSHA 4NATA 5KSOA 2GXQA 2FMFA 2WIKA 5BWUA 3AUXA 4IIVA 4QWMA 3TPFA 4M98A 2IY7A 2BFCB 3LX8A 3DWFA 1TUIA 4L6AA 5SY9A 4KAXA 4DDMA 5AUNB 2V6FA 1RXEA 8ABPA 5JTTA 1Y3CE 5AOCA 4KPFC 4CDMA 2O19A 3FNQA 1AK9A 3DDWA 3FMGA 2YHIA 3Q8XB 3OSNA 1I0ZA 1X7XA 4LOLA 4RX1A 1XOIA 3GFBA 4CLRA 2L19A 5ICMA 1SBZA 2R6HA 2CVPA 4IZIA 3FI9A 1Z56C 4CTMA 4DV5H 4MUXA 1X1DA 3DH0A 4ECAA 1P45A 1VPTA 3DCJA 4A3BG 2X0FA 3ICCA 5KVAA 4UVEA 3D8TA 1P0FA 3KYCA 2IOHA 2BD0A 1G8JA 1M54A 6AT1A 3ZDEA 4MW9A 1EFDN 1PI3A 2MINB 2OHIA 3L18A 4I2NA 4IGIA 5BN1A 1ODJA 2C78A 4KQEA 3GIQA 1SURA 2HJWA 3OJXA 4ZZ0A 1L4BA 1X1CA 1QGZA 2FWJA 3AFGA 2I2AA 3PR5B 2VAWA 2W93A 5C52B 2VK2A 2JA5A 3HLYA 3EN0A 2WVHA 3GV0A 5LKAA 3BXGA 3CUUA 2TECE 5A6SA 4P7JA 3DOEA 2CLIB 2VTBA 1T5IA 2A35A 2VDPB 4WKGA 1M3SA 1EDOA 2FCAA 1AB5A 4DV0B 2CFCA 4R1SA 3T7JA 1RRCA 4LXUA 5F9FA 5ESRA 1LLDA 1VHTA 1ECCA 3I1YA 2DQYA 2O0HA 2W9BA 1M1NB 2OR3A 2IEZA 3I1FA 4GU5A 4ZO8A 3F49S 3IODA 2ZWOA 3SQMA 3IULA 3O2SB 1NZFA 2QVYX 1J20A 5AYVA 2X0EA 1HURA 1RS0A 5LJIA 5LYJA 3IL2A 1W2GA 1DE0A 3PJGA 3NO4A 2IYOA 2Z0MA 4EVQA 4TZ6A 1W0JD 3FOAA 4FEYA 2CYCA 3NC0B 3C3DA 4FJ0A 2ZJTA 4R0VA 1FJXA 3TDKA 3Q2IA 4LF5B 1FDVA 1FW8A 2H2FA 2VSFA 3UA3A 2F64A 2GD2A 1YA4A 4BKPA 4UHDA 1M0TA 4FIDA 4KQCA 3F8SA 1SKYB 5CLIA 2PT6A 4ARSA 3AJ9A 2QLNA 3I32A 5C8DA 2XVXA 1KYXA 1UMDA 1BXRA 2Z4RA 4R2IA 1HR0B 1SG9A 1P4SA 3F1KA 5K9ZA 4LBZA 4A36A 4CDRA 1DJMA 4L4YA 3PL1A 3BREA 2I9PA 1O77A 4TVIA 4V0ME 3W0LB 5JALA 2WY2D 3W8FA 2CDNA 1JJVA 4DC0A 821PA 2GKSA 1R0CA 5AM4A 1F3LA 2F1KA 2YJ5A 2X6TA 2IPAB 3RREA 2NZJA 1L8QA 3C8DA 1SOUA 3IMEA 3E22B 4GYJA 4JR2A 2GJKA 2Q6IA 4L3WA 2ZSJA 3Q3IA 1DLIA 4DTIA 5LOVF 1Q0PA 1SRRA 1X38A 3EIXA 3HOVG 2R25B 3RS3A 3MOSA 3UJNA 3FDSA 4ZVPA 2B4KA 3V1KA 1R9TA 3HBJA 4HYEA 5AKIA 2CFSA 2W6JD 3TLXA 2DUWA 3NAQA 4XPIA 3GJQA 4C5CA 3C4QA 1V1MB 3JQ8A 3LYLA 4XYMA 5IC6A 4PIVA 3HVJA 1YQUA 3ZK8A 1GGJA 4GKKB 4GC6A 2GM9A 1OR8A 2BSAA 2VRNA 4HDKB 1Y80A 4R4JA 3CB2A 5B3AA 4PTLA 5FNZA 1A3CA 3O8RA 3GLTA 1E2LA 4FGKA 4BV2A 5DGTA 3QRWA 4HI0E 1TWHA 2GWHA 1OLSA 3WRYC 4N40A 3LYUA 3HZOA 4CN9A 2AG1A 1A3GA 3MLAA 5CAEA 2FR8A 1JU4A 1PG0A 1Z6YA 4ZJUA 2P65A 1C7JA 3QY9A 4H4CA 3SKXA 5F7XA 4EYHB 2Z3WA 3QTBA 2O3UA 4IGEA 1T3GA 1B0AA 3RS9A 4YPVA 4JP8A 1NRJB 1C0EA 3DOJA 4H1HA 1BGWA 3E05A 4AVYA 4EP1A 4HGZA 2CW5A 3D6TB 5LZ4A 5C4GB 4E3WA 1GUFA 3OQOA 3OEHD 3HCDA 1WCYA 3P2JA 4TLDA 3TQFA 4OUDB 2HU2A 3FY4A 4OY3A 2FRDC 4RJIA 4GLXA 1BW9A 1C0IA 1H2RS 1E4YA 2R4QA 3L6RA 3TBKA 1W4RA 3T94A 3VKWA 4HUTA 2O8FB 1YS1X 5BWWA 5HDBB 3B38A 4AG6A 1TU0A 1X7XB 3AJ8A 3U6BA 4Q3OA 1TIPA 1JXAA 2EEZA 5FUYA 4P3YA 2QAIA 4KXMA 5IT0A 3M4JA 4QFCA 2B82A 3DP7A 4DWWA 2J48A 4C1NA 1QZXA 2A5DA 4XWGA 4FP9A 2D8MA 2WHXA 3OT5A 1FSPA 1GNPA 3RWOA 1YDHA 2J85A 2OO3A 3F6CA 4IQ4A 4F9TA 5EJ4A 2I8CA 1T1EA 2H1IA 3TSYA 3OECA 1KHHA 1RKQA 4ZTZB 1XTIA 4Q02A 4EM6A 3A1SA 4BNUA 4FGSA 5B53A 4Q4AB 3GAMA 3E2PA 1U1DA 4JDUA 4QECA 1VLZA 2CNUA 1FFDA 5G0SA 4TSRA 2IEIA 1QGAA 5AHRA 2W0SA 5AQEA 2ZM6H 2RMKA 2YJNA 4QXAA 5G4LA 3TLCA 3WV4A 3OPYB 2IYZA 5LXTF 1IMJA 4X7MA 2I4IA 3HTXA 3T5PA 3IAS1 4QWEA 1EVZA 5AXAA 3BD9A 3TPCA 3W1WA 2X9VA 4KXUA 3LDAA 4QUDA 1ZICA 4B45A 4LXTA 1YI0A 4G8DA 1Z4IA 4ZVVA 4W5NA 3AR7A 4Y2SA 5K3CA 3AHIA 3UB4A 4NEQA 2E4YA 4MV1A 3X1XA 5BRJA 5IH7A 3S1SA 5AVUA 3OQHA 1MB2A 3NM5A 1TT7A 5IC5A 4RTLA 1PV4A 2ZS9A 1US8A 3RU2A 3U0VA 1NBMD 4F45A 5CB6A 4K40A 4LRSB 3SXUB 1IHPA 2A1TS 2OFWA 3V3KA 4EK9A 3TFOA 5F51A 4R7ZA 3EQ8A 3WAJA 4Q19A 5TMDA 4B5KA 4E21A 3CRZA 3KL4A 1OE0A 3U4CA 3CJRA 1KQOA 1H23A 2WIAA 4GZ3A 4HWKA 3VNRA 5CBPB 3R0XA 1JX4A 4Q8FA 2CXSA 2J08A 2WK1A 3BH7A 1OXVA 4KIUA 5G0UA 5FFMA 1KNXA 1SQFA 3Q11A 4ZCLA 1NUSA 2ZE6A 1ZK3A 1UJ4A 1SVIA 3GOHA 2E5FA 4BNMA 5IG2A 2GTPA 4QOHA 3ROZA 2XOKA 2OV1A 3ZE1B 3MPUA 5MFZA 1CQZA 3S8YA 2AFVA 4D26A 1DFGA 1DIHA 4TS4A 2NADA 1ODSA 1U1IA 5LP6C 4JQOA 2MU1A 1DC6A 4DLLA 3CRMA 3K4PA 2Q9CA 4G24A 1E32A 4IO1A 5CG1A 3GRFA 3R3HA 1CZNA 3ZU5A 1E2FA 2B2NA 2GMWA 5AD1A 2AR7A 1IUKA 3ONVA 3RK0A 3QI2A 3L0PA 4FGRA 3AETA 2B61A 2QN9A 1BA2A 3G6YA 3BX1A 4FQ8A 4LDJA 4X00A 3TR6A 3UWKA 4MCHA 4E4YA 3WMGA 3E22A 4FS1A 1GADO 4JOQA 1UFQA 1P5ZB 2DPIA 1DIOB 1ZIXA 2E4XA 1NQXA 4C7VA 1PE0A 4ZJPA 1FTWA 4B74A 3KYBA 3RB8A 4ZT7A 1I4EB 4JI5H 1NPYA 1W4AA 3V7WA 4A6XA 1UBMS 4KEAA 4LQLA 5ELMA 1FMLA 1O89A 3K9WA 4QGGA 4XPIB 4FC7A 4QPNA 1I1NA 3JQ8B 4DGSA 2YS6A 4CMAA 4ENPA 3V1TC 2Z8YM 4HAYA 3BGIA 4HDKA 2OWOA 3MR5A 4MZDA 1P7CA 2QT0A 4GO1A 3UOWA 5HS4A 4DV5B 5HIIA 4NU8X 1WHTB 1K1SA 3NR2A 4CEJA 3AUAA 3FF4A 3Q5DA 4NXNH 4MS1B 3STHA 4QUIA 5EI5A 4Q6BA 4WXPA 3GTPA 4A2WA 2RK6A 1QIGA 5FULA 5JAUA 1HXHA 2VDOB 4GM1A 3OD1A 1K66A 3QXSA 3H65A 1Z4NA 1RCFA 1C9YA 1ZD5A 1EFRD 2VOJA 1ESMA 3PUZA 3WGHA 3PXBA 4Z7QB 5KTKA 3SOZA 3M9WA 3FPLA 1E1DA 1Y4ZA 4K9DA 1Z2CA 1SZJG 4RIIA 2G04A 1NT2A 4B7ZA 3EX7C 4MUNA 1X19A 3BCHA 5BQFA 1RQPA 2UVRA 4YMWA 3MJTA 1BW9B 1KP2A 4MP6A 4O4HB 3CF2A 1GNVA 1LI4A 5DHTA 4E1VA 2DWOA 3GFGA 2X7XA 2ZS7A 3RTXA 2JA7A 1YU6A 5KREA 2UZ4A 2AZ4A 3OE7A 4AFNA 2ZYGA 1CB7A 4OOFA 4JL5A 1A76A 1G8KA 1ZOIA 4H0NA 1TYAE 1EGQA 3N70A 1E0AA 3QV1A 3T7EA 4Q43A 4OYLA 3RB0A 3HJTA 1NXQA 1BRTA 3RYCA 5IRCD 2G9NA 4YVFA 3WISA 1ZCFA 3SWWA 3A1TA 4Y3UA 3PN1A 1FMCA 2YNMC 3UG6A 1I3NA 3FGZA 2Z2IA 3F90A 3V48A 1L8LA 4B83A 4ZOQI 1JECA 1TTPB 1LLQA 2WHPB 3A2MA 3ANNA 4HB4A 4R2LA 4DANA 2I7VA 3QBDA 5IC4A 5KHAA 5JC8A 2V0GA 5IZCC 1BHJA 5CYFA 1MB0A 1CJMA 1R0LA 2QG6A 3OZBA 3E9EA 4AP5A 1TUEA 3M9NB 5FWDA 2WU1A 4LPSA 1RLMA 2I6QA 2LGJA 1P16A 3ABOB 2IP4A 4I55A 3ZHYA 2XIQA 2A4MA 5CD9A 5KFEA 4MUBA 1JEYA 2PMEA 1XRMA 5CD1A 5EQTA 4KWTA 1E3WB 1QDLB 3RF7A 3NVKI 3O1JC 2Y67A 1WBJB 2PJDA 4I4CA 3HYCA 5HZKA 2P11A 1X13A 1UODA 3SQLA 3ZV6A 1AK1A 4K9LA 4BHTA 3L05A 3PK0A 3FCYA 1VP3A 4GICA 1J25A 5DLPA 2ZWAA 1OIXA 2OCGA 4OMDA 4CLEA 4KFCA 5CU7A 3A6GA 4JLKA 3KDSE 2NXWA 1US8B 2DULA 3DVAA 2DFTA 4HRVA 2XMCA 1FFWA 3CKYA 4R6WA 1SCKA 3RRMA 1TFUA 2XQFA 5KWSA 1QF6A 4CYMA 2A9FA 5ARCA 2QDXA 4W8HA 4ZAFA 1UK6A 3QI7A 4FYWA 2Z56A 3CNOA 1RT9A 5IJAA 1U2QA 4BO3A 4DJDC 5ALVA 2P9QA 2ZSUA 1KFBB 1HOTA 2VPTA 1H4VB 2WU0A 3DC2A 1BHQ1 2J3KA 2O5VA 4IXWA 4RD1A 5CITA 3ZS8A 1XZAA 3UJAA 1E2UA 4HVCA 1S3SA 1O1YA 2PANA 3H0KA 5FR9A 1TTQB 1VXOA 4JV5H 1D04A 3FOWA 2GNPA 4A2PA 2ZROA 3V4SA 2AI2A 3TZHA 1KEWA 1Y4UA 4GOMD 4RELA 1KY5A 3WKCA 4MDHA 4ETNA 5HJEA 4QOJA 2HYDA 3PVZA 4H7KA 2VEOA 4AX4A 4Z7NB 4JBYA 4KWHA 1CD5A 3T7CA 1II8A 4IIJF 4UEOA 3WBKA 2GZRA 1YR9A 4S3MA 4ZI3A 1E64A 1YS7A 2OWEA 4BO4A 1D1PA 1I14A 2XCSB 5FUMA 3KUKA 1U6IA 1UEJA 2YYAA 4DCPA 4UDYX 5IDWA 5L6MB 3F96A 2CV1A 2YOHA 3DMTC 2C2RA 3ANLA 4LDRA 1CZLA 3IRVA 3P9SA 4M0UA 4J9RA 4KXQA 4CNQA 2FJPA 3CSDA 4L08A 3Q8QB 1FS6A 5SYAA 3WWYA 3PQ4A 1OASA 2QLTA 4ZO7A 4OXYA 2P6UA 4ZVKA 4COOA 4ZYVA 1JPUA 2JZOA 2OCAA 4OKNA 2J3JA 1K92A 2A7XA 2XBLA 3H9BA 1UMBA 3JQFC 3JW8A 4Q12A 3OKFA 5F2OA 5IEBA 4EB6B 5JJKA 1QSGA 4JI8B 2QL7A 3EW7A 4O2BA 1QLJA 3INGA 2J0VA 3OESA 4Q47A 4QDZA 4M8SA 5B1YA 5SV2A 2NTYC 3H8SA 5P21A 1D1TA 1HL3A 1ZINA 2W22A 1WHTA 1JYFA 3IEUA 4MS1A 3C3AA 5DU2A 4GF5A 4BS9A 2RGYA 3FYUA 4QT4A 1XZHA 3CYFA 3W78A 1CUBA 1K5GA 2JH8A 2QRHA 1M9NA 3A2LA 1IAQA 2SKDA 3OOWA 2JVJA 4FKZA 1M67A 2G0NA 4KAAA 3UW1A 2ZIUB 2IZ0A 2EP7A 3VO1A 1DRJA 4XCXA 3QX3A 4YDRA 1TZMA 4TKLA 1FYDA 5AJWA 1E2GA 1X15A 3SN6A 2XWSA 4HGOA 1SIWA 2QTMA 4AKTA 1JT9A 4WCFC 1SO8A 5DASA 4DAAA 1TO2E 5FNVB 3TCXB 3D02A 4N8DA 4JP1A 1X42A 4N0EA 2EJTA 4RZ2A 3O1LA 4X0EA 5FADA 1SC1A 1O8BA 3QLVA 3AR2A 5AKJA 4KMOA 3GF4A 1J0XO 3PQ5A 1Z8NA 4OVKA 4AI6A 3V4PB 2BM0A 1Y6JA 2YXLA 4XFDA 4A7PA 2SECE 3EEIA 4RHTA 1K1QA 4UBNA 4MKGA 3IEIA 3U7JA 4X7BA 1VI6A 2HYIC 4L0QA 3GRRA 5EE0A 1PQ4A 5ALHA 4C76A 5C5EA 1B1CA 3BH0A 4KE7A 4LDQA 4Q66C 1UXHA 3NP9A 4OGKA 4OI4A 2F8MA 1D4AA 5AOBA 1RKBA 5IBRA 4ALMA 4OI0A 3AUTA 2OTCA 4YRNA 3REGA 1LNZA 1HNXB 1LX6A 5DSXA 1JJAA 3ESDA 1YBHA 5TQVA 2YIVX 2OFXA 3Q8KA 3ASZA 2NZ2A 4A3KG 1Z4PX 3B48A 3W9SA 3KP1A 4I55B 4DV6B 4JYAB 2QPLA 4JBGA 5EJAA 2O2EA 3CRVA 3FSGA 3W5JA 5EHXA 4YIKA 2Q4RA 3FRJA 3KHRA 3KB6A 4KWIA 2GCEA 1BO6A 1JFVA 2RGEA 3DXZA 1TM4E 3GDOA 4HS4A 4EL0A 2VJYA 1C3VA 1Z15A 4EYEA 2IEDA 5JANA 2ZREA 1U6KA 2JI6A 1KY3A 1N2HA 2C0PA 2C5LA 2WA2A 3BCSA 4GGMX 4OKSA 5C1IA 3BE8A 2XA1A 4YJ2B 3A10A 5DXAA 1P2VA 1NYRA 3I2YX 1YZQA 4PYJA 3PGJA 3QUAA 1Z4OA 1DQZA 1QB7A 2H06A 4JSTA 5EERA 1C0LA 4QBIA 3BHMA 3CKLA 3PGKA 4Z4EA 4HLDA 3O8CA 1O0SA 3V8QA 2EHJA 3W5VA 2G4CA 2FUG1 4YAKB 3I42A 3G5LA 5BNIA 1W1UA 1SG0A 3SU8A 3Q9UA 4XYLB 2VXCA 2O14A 1EGMB 4HN4B 4NCKA 4JI7B 2GEJA 4RZIA 1U2SA 1IN7A 3LCMA 4EGCB 4ZP1A 1A0OA 4ECWA 2GCOB 1IY9A 1JKIA 5LYYA 2Y92A 3D0OA 3RNOA 3UJ8A 4DYVA 1YCDA 1KTIA 4BB0A 1II8B 2D4HA 3JYQA 3N3BC 4XPZA 2AEMA 3OFVA 1E8NA 5ER9A 1XNJA 3WJ1A 5KO2A 1Z0AA 4Z4FA 1U1FA 5FR1A 3KHKA 5KFKA 1VB3A 1H6DA 3BXPA 1DEXA 3KSRA 1E5QA 1N6OA 4IAOA 4CC5A 2UZ0A 4LXYA 2CHQA 4YAFA 3RUIA 1V3TA 3JQCA 3C7KA 1RYNA 3N3AC 5KU7A 2B1JA 4LZPA 2Y0SA 2MTBA 5HXAA 1YIDA 3DHYA 3VR4A 5CB4B 2G80A 4AZSA 1LV8A 2JK0A 4OXIA 3TNYA 4L4ZA 2JBWA 2NU6B 4ND8B 2FK2A 2GS9A 2Y2UA 3FTPA 1XJ0A 2V4RA 4F50A 2V6JA 4KE9A 4OP2A 4QT0A 3ZV5A 1A9XB 1NUUA 1FRFS 2VTKA 1V39A 4FS2A 2ZRMA 3KLMX 4HF7A 4LQDA 4CM4B 1XKTA 1OTHA 1QH9A 2WSSA 4KDEA 2YS7A 4WNAB 1I10A 4LNUB 1Z73A 1WUTA 2AU0A 1F6BA 3UWDA 4TLCA 1LPOA 4GYYA 2I3AA 4LZNA 4MVJI 4N7BA 5T41A 4JUAA 4DCMA 4ZCTA 5LM3A 1RMTA 5I3ZA 2JLCA 4DTCA 4KX3A 2BHSA 1W6UA 1ST2A 3FYUB 3NW9A 3Q9LA 2E21A 1HQYE 1H2HA 3V1MA 3V8BA 2VF2A 3CLTD 1PYOA 4UTRA 3GMDA 3OC6A 1QIFA 1VZ3A 1XZQA 1NLFA 1VYHA 1YRYE 3ECSA 2XXBA 1URPA 4JVOA 4CEIA 4B6FA 1P74A 2VZ9A 5K0ZA 2J46A 5E6UB 1A2QA 4PO9A 4JV0A 5BPHA 1NMEA 1XCJA 3TIGA 1PWEA 2NVWA 3MWEA 2K2WA 2ROQA 3IG0A 3PXAA 4U2FA 3GRYA 1U2DA 4V2UA 5A5FA 3R5SA 3MIZA 4MGZR 5J2TA 1ZI8A 2O3SA 1SCDA 3LKZA 5FNVA 3LX5A 4EQ5A 1X7HA 5KS2A 4G25A 2PKXA 1TMKA 4PXAA 1QTRA 2NVUB 5CUQA 1RADA 3NIGB 3TVTA 2A9OA 5GGYA 4E2YA 3UMSA 3FKSA 1HX7A 4W1QA 4BNZA 3O03A 1O94A 4ZI2A 1QVRA 1U3FA 2Q1YA 3ANTA 1ZRMA 2F9LA 3H2ZA 2V7XA 3NEAA 1JR2A 2CKDA 3E2MA 3FNIA 5EKTA 1TZJA 2NNWB 2QZ4A 3H9GA 5ITSA 3D3QA 3LVQE 4P0PB 4XLLA 2OP1A 3RJZA 2J31A 3IV7A 1MUUA 4D3XA 4JIGA 4XVUA 4ZCPA 1GYRA 1Y4AE 5DKFA 4MVWA 1ZGHA 2B9VA 3PFBA 4N3GA 3RH0A 5KT7A 2WQ7A 3MSXA 5IULC 1CY7A 4RGVA 4OQMA 4JVSB 2P6OA 3RS8A 1QONA 1FF9A 2O2CA 4ZPXA 5DB4A 1CUCA 5D1PA 1J56A 2AUTA 2ZZNA 2RE8A 3W7BA 1YL5A 4ZVNA 3NMUF 4YRPA 2IZ6A 3R1IA 1TF5A 1DWUA 2QVGA 4OIMA 4TV9B 2H1LA 4Y18A 1I2LA 3ZLBA 5K8IA 5T4FA 2ZLBA 3A3OA 1S2IA 3UHJA 4C7JA 2I4TA 1ZUWA 2H57A 4QWAA 2YWFA 4ESOA 1MZBA 2GN0A 3QPUA 2YCBA 4JU8A 2WWFA 3VZSA 2BFBA 1RJPA 4B8YA 5LLTA 3RTCA 5HQ3B 4F2PA 3MTAA 3LXRA 5L40A 2ZCVA 4JJZA 4MP3A 3IXQA 5ED4A 3IV6A 5A2GA 4JXXA 3Q6MA 1G5TA 1EFRA 3IP5A 3W5CA 2IHYA 2M05A 2OKGA 4IPTA 4WZAE 4AP9A 2OCDA 4YAKA 2VDQB 3C3CA 3EEBA 2QEQA 1C9MA 3TLYA 3U3RA 5KQPA 2QVCA 4ZIRB 3H8VA 1D2CA 4BAZA 4M99A 4PG4A 1UEXC 2GCOA 4FLEA 2P9JA 3NKVA 3GJYA 3GXOA 2H18A 4H17A 4ZWNA 5ADHA 5I5YA 2B0CA 1WNFA 4GHWA 3M3HA 1Z16A 4IP0A 4JGIA 5E3JA 1CIVA 2Q1SA 4UNQA 1PL0A 5K6AC 1XUOA 1L3BA 2XZLA 4AKHA 1L5YA 3O38A 5LBTA 2RHWA 4ALLA 1K5HA 1H5NA 4P6VF 4O7SA 3ZCTA 2BFMA 5FPRA 1M7HA 1IZ8A 2ZXEA 3V34A 1T10A 4MUGA 5BSKA 1K6MA 3K72B 3DFFA 4A73A 1NNI1 4X9XA 4ECRA 4CM1A 4E5YA 3M4YA 3HA7A 4JI3H 1VG1A 2YCLA 1KYYA 5BSGA 1EP1B 3SDZA 4I1SA 1K6EA 5EXSA 1QH0A 3CO0S 3E0XA 5LN1A 4PLWA 1RLOA 2BUCA 5H82A 1GTL1 4NBNA 2VBCA 3LVBA 4CKWA 2V4UA 4XVQA 4QWCA 1K8ZB 5K8CA 3O0DA 5K3OA 2P6RA 4O83A 5BQ3A 3BABA 1BA3A 1JDEA 3JRXA 1ZP6A 2QBYB 4RNNA 2WT9A 4W9NA 4YK7A 3HJRA 1IWOA 1QDUA 4X92A 5FBWB 3ROXA 4QGAA 4O3SA 1CPYA 3OCCA 4Q0MA 2ANBA 5A5GA 1IUOA 1K9VF 3JQ7B 1Z8HA 3FCOA 2OV2A 3V5NA 2YVKA 2XPCA 3JRWA 4MQEB 1MH9A 4ABTA 4G23A 4M2LA 3RVRA 2O8EA 3NYWA 1Y3DE 3IQEA 4JENA 4RPGA 4X94A 1R6XA 1T5SA 5T6BA 1N2SA 4IOKA 4Q4JB 5KWJA 3MTBA 3TOCA 5HKBA 1NSFA 3CB4A 1GNLA 3CH4B 4GT1A 4I9GA 4WFKA 3ZEAA 2QSUA 1XEWX 1AHIA 2P3OA 2CFRA 4LG1A 1PNTA 1T5BA 2A33A 2RAPA 2NTEA 5U1PA 3MWEB 4OX9Y 3OTGA 2HDWA 1G21E 3EZ7A 3UQZA 5KNBH 2GPJA 2A9RA 3R77A 4K28A 2INGX 2AEFA 4TYPA 1XCBA 1YE3A 2UUAH 7GPBA 3I6MA 4CG3A 2KX7A 4I66A 5DN9A 4TXMA 4JCCA 4LOHA 2NVUA 2IBSA 3UV7A 4BBRG 3KQHA 2O2ZA 2VLBA 2ORED 3GRPA 5IYDG 1IQUA 1FFAA 4YJ2F 1ZRNA 2VJMA 1R50A 3FNHA 3LPDA 3U3JA 3PQ2A 4WERA 1SD1A 3K3VA 1NV8A 4ARZB 4EPRA 4EUEA 5ED0A 3DZKA 4OIFA 2QYOA 2GX6A 3I72A 4QRHA 2B7CA 3GG2A 2FP4A 4Q9IA 5LFAA 3SVZA 3VNUA 1PN3A 4MUJA 3STUA 3NC1C 3GARA 4OFWA 2PVPA 2ZRQA 5M29A 3W9YA 4YV0A 3A4IA 3K9GA 1JKXA 2JRLA 2ECFA 4PBRA 3GUYA 1JAYA 1GGNA 4MQ5A 3ZGNA 4DNQA 3CX7A 4W7IA 1PNRA 2BBSA 1VKHA 2WE6A 4F4XA 2POQX 3FCEA 3KV3O 3ROQA 1WZEA 2OO5A 1QRDA 3MJSA 3HU3A 3OIWA 5K6TA 1NBHA 4OFZA 1N1DA 3K0CA 4O2AF 1NYQA 2DCMA 3LCRA 4OQYA 3S68A 1Y6GA 3W7AA 2XB8A 3FDFA 2V0CA 3OHPA 3VTZA 1IEQA 1WTCA 3EQ2A 1ZL2A 5BYAA 2BM1A 2C07A 2JD0A 4DG9A 4V1CB 3RTBA 5KCMA 1U3DA 1TM3E 1YULA 2GRJA 2EYQA 3L1IA 1B33N 2CLFB 3NWPA 4UEJA 3R7SA 4RIHA 9ABPA 2ZUEA 1Q15A 2BFBB 3SK0A 3WBFA 1DG9A 1OX6A 1J0EA 3PFKA 2IU6A 1JEEA 1IEWA 4RVCA 3LO5A 4BMVA 3LBIA 4IIGA 3RBEA 5IXSA 4KR3A 2XD4A 3Q1KA 3A6PC 2ZB3A 2Z8ZA 4JL6A 3NNNA 3KE8A 4CN8A 4EECA 1S3IA 1PKEA 1WXHA 4E70A 5LQUA 4HLNA 2C5GA 2V9PA 4ZIRA 1FMJA 3MBIA 2G7ZA 3L77A 2NTNA 2UUCB 3KWLA 4FXPA 4OU4A 4EMTA 1X94A 1E9AA 2OLKA 3VJLA 3FWKA 3HXMA 5EZYF 5JIBA 4JQSA 4PYNA 3AVUA 3QY0A 2B20A 2ZVQX 2JA7G 1J0AA 4IHAA 3VR5A 1I6MA 1Z2DA 3HM2A 1BVRA 2GM3A 3FI0A 1CY6A 1YZLA 4Q3KA 4WCVA 1WLSA 2FN3A 4IL5A 5K3FB 3UWSA 3J7AC 4YCNA 1FVHA 2QVLA 4EFBA 3IAM1 4AYWA 1TWAA 1Z2EA 5B6IA 4UPEA 2Z4TA 3I8XA 2JJ2D 3U7FB 1XTZA 2GD1O 2JATA 3FUXA 5IASA 4NBWA 3MGBA 4V0LA 3GNLA 1AX9A 4ZEVA 1MPTA 1AKTA 1E3MA 2I91A 2OGSA 2QMZA 3MRTA 3PPXA 5HV6A 4J0GA 1CZOA 1GJRA 1KDOA 2HWXA 3MJ4A 3NTRA 1PZGA 2LKDA 3WWJA 3NTUA 3Q7TA 4G8JA 1V96A 2C31A 3ELUA 3K31A 5AVKA 4OATA 1ZJYA 2WYIA 1U0RA 3GLKA 2I2DA 4YACA 3L06A 1T0HB 2CMDA 2KWIA 4B6GA 3UVEA 3QIVA 2HCBA 3SNOA 1W5AA 1UZAA 4TS9A 1VIMA 3HH8A 2EGGA 2IF0A 5CM0A 4H18A 2ZTUA 5B58C 1WCIB 3NP7A 3ZQ4A 5GP1A 4QRIA 1VKRA 5AUQA 4CMJA 2VK1A 2GYYA 3OJWA 2ZUTA 1SCUB 1T24A 5J3JA 5L95A 2WP0A 3IHTA 3ZNOA 1XZLA 3TW0A 4DADA 1Z74A 2WTNA 2P7IA 1XZ8A 2NUTA 1WB9A 4BVFA 4DMFA 1QPZA 4N0MA 4YJGA 1CJTC 4DLZA 1UXGA 4PV7A 4Z49A 3HO1A 3U60B 4TPKA 1MG5A 3CXRA 3L6DA 3RBZA 1SWWA 3EIOA 3QKTA 5LQCA 2OZEA 5LUAA 2JCBA 3CEBA 2FRVA 1V95A 1BWPA 1F8GA 4FEAA 2HMUA 4KUHA 3R7LA 2O07A 1JEQA 2AA3A 1RIFA 2C9MA 2GR9A 4GMKA 4PZUA 4TKUB 5FL7A 4AKSA 5KYXB 3I2KA 4O02B 3A2NA 3F8NA 1L7MA 1SHTX 1EGAA 1G6OA 1EIZA 4M0DA 4NOJA 4UBKA 3FMVA 3UCXA 1B04A 4MPJA 1Q0TA 4I1UA 1OH5A 3IELA 2PXXA 3I30X 2RI6A 1OI3A 2A86A 4IG9A 4Q21A 3RUFA 4KFUA 2KE5A 4F9GA 2VQEB 1QTIA 3DV2A 1R5NA 1XLTA 4NMXB 4BNVA 1RZRA 1DIKA 2YZGA 1R8QA 4LYAA 4MB0A 3EQ6A 4J6EA 4S04A 3OLWA 4NABA 1NDQA 3KAPA 3S2GA 1QVAA 3E9YA 4PR3A 4BNJA 3GPDG 3KREA 1IPFA 1RJQA 1M6EX 3GQBB 3MOIA 3NCTA 4BMPB 2FZEA 4B3MH 4OXQA 4R9RA 3DLHA 1A4RA 3W6PA 5KYYB 1JVSA 3PDIA 4Q1BA 5H16A 4ZXPA 3IUMA 1ZD2P 4OI2A 3BDAA 1SCBA 3H97A 3WHKA 3UQYS 4A0QA 4EF5A 4HV4A 3CINA 2P6PA 3OX3A 5EJIA 3ZBQA 3GAFA 2ZIEA 1KP9A 1BEUB 2OM6A 3QTTA 1SBQA 4KXVA 2ECPA 4BO6A 4BN4A 1UJ5A 3JQEA 1R64A 3GPBA 1YS2X 5J9FA 1U2GC 1J2EA 1CUGA 1GN8A 4BMCA 4CDGA 2IYSA 4PLPA 4X93A 5IH3A 3SIWA 1V2HE 1XZDA 3MJVA 5F3WB 3KT6A 1NP6A 2GK4A 3HXLA 3A4LA 2XMSA 3DM5A 3H5TA 3LY8A 4ZT4A 4FEEA 3TTWA 3C16C 2QGZA 4XW2A 4ENUA 1I32A 2XDWA 2ZYRA 3EVTA 4UM9D 4ZHSA 3G0BA 3UAXA 3L7LA 1RQLA 5FQNA 3H19A 4Q4DA 1YNSA 2TMKA 1JNXX 1F2UB 4UNRA 3PVXA 2GVDC 2YR0A 1NLMA 3LI2A 3NCHA 3WKEA 1G9TA 3KQSA 1NVVR 4A91A 5DG9A 3PC8A 4YJ3B 2BONA 4WV3A 2B83A 4KR7A 4N9WA 3T61A 1ZR2A 5F1KA 5KOJB 2EW1A 5DRYA 2QX7A 3K4QA 3W5SA 3KQQA 2FR0A 4YRJA 1BQEA 3VU9A 2RI0A 4QTTB 3BFVA 1CE8A 3EGXB 2RGRA 3PFFA 2NLOA 3FR8A 4B6OA 1L4GA 1P0MA 5H3CA 3CVWA 3KYDB 2FZGA 4O3MA 4KRXA 2QUZA 1THZA 2VT3A 1QZUA 4JHXA 3RV3A 2ZSAA 1Y1QA 4DA0A 3C15C 5DHAA 2O59A 5H3LA 3PWTA 2XJ9A 3AWDA 1LZLA 1YR1A 2AHRA 2BEVB 3CE9A 3HBAA 2DECA 2KSWA 4KQKA 4Q9KA 4BFTA 5BW8A 5IM4F 4NTZA 4PQYA 2YY5A 1XNHA 2P2DA 3HOYG 3CLRD 2V5AA 3P97A 3N87A 3GLIE 3KLPX 3AT1A 2FPRA 3DFMA 2O0MA 3LUCA 5J2UF 3ETDA 3IS3A 3BPSA 4X6LA 4PHFA 4RGYA 3EK2A 4OHRA 1ZW1A 2GCPA 2V7EA 4WKBA 4J7XA 1OA1A 2QAGC 1IOLA 4GP7A 1E6CA 3RHZA 3M1AA 4CQJA 2GN2A 1AGXA 2XJ4A 4N65A 1OBCA 2H4YA 1RBZA 2BEWB 2XYQA 4JI0H 1XYGA 2G8LA 3U13A 1CUVA 2BHTA 3CR8A 1XDNA 1IY2A 2XT6A 3QU5A 3VYVA 3AUSA 1UL1X 1WCIA 4NAUA 3UXMA 2YFHA 5M04A 3FAKA 4WXRA 5GADl 3TOXA 5LQDA 5FEMA 3CF0A 1OLUB 3X2FA 4KQ1A 3TEMA 4B2PA 2GBFA 1SCUA 2I6GA 4AG3A 2DUMA 3Q2KA 5DTIA 4CLXA 4AQDA 3ROGA 1E18A 1U2PA 2BR5A 1HE5A 2IHZA 3IP6A 1WV0A 4J9PA 4BMOB 5JSQA 1A9QA 1G6KA 3GLHE 3F5QA 3MVEA 4ONEA 3WL5A 5M7EA 2ENUA 3DWIA 5JEDA 1V9LA 1U80A 2YDXA 3EMBA 2XXAA 4QUGA 2PXHA 1AHPA 1TKBA 4RV5A 3T3IA 2Z58A 1P7PA 2M6LA 2ZIXB 4BX9A 4LMPA 2X1LA 3B6KA 1HDOA 1JEDA 1JEQB 2J4FA 3QE4A 1N57A 2CVFA 2WM9B 5KYXA 1X92A 1CKEA 2C4HA 5E1BA 2PWAA 3L7KA 5FPSA 3SQDA 3HUDA 3EXHA 2XE6A 1AY0A 1DO2A 1HL7A 1MQ8B 1NW4A 2HHFB 1NW9B 1WL8A 1Q3KA 2A1UB 3AGQA 3L07A 5HBGA 3VJRA 2RC5A 1KHTA 1O0CA 1VHLA 1YQDA 4BEJA 2N46A 3DMRA 3KYIB 4YAGA 3L0CA 3AYXB 2VZ0A 5KT6A 3G68A 1H2FA 3GDEA 3N28A 2WKWA 1X1RA 1U9YA 3PYXA 4YP3A 4HB3A 2HA6A 3GQBA 4MYUA 1VE7A 4R1UA 5FP0A 5JUWA 4L76A 4UTXA 4DQXA 4DRFA 1U7XA 2ZXFA 2W7PA 4RHEA 1OT3A 3RYTC 1KBZA 3KWFA 3SZOA 3MWMA 1LPNA 3PDIB 4RQTA 3ZV7A 5A02A 3ZEIA 2IXGA 3QKSA 1NY6A 2BAGA 3KZXA 4KO3S 1VXRA 2ZB4A 5DOZA 1IATA 4B4UA 5L3VA 3ET4A 2A30A 1TDJA 2ZRGA 3IOBA 3NHAA 2L18A 1JTEA 4YMGA 3U7HB 4D45A 3ZGXA 2X9GA 5I4KA 1MABB 4ZI7A 1JMYA 2ISSD 2FH5B 3MMZA 3RAFC 4OAQA 4CKCA 2FZLA 5DT9A 2XCLA 2O52A 5IJZA 4CEHA 1PWYE 1NVXQ 2C9CA 3ZNNA 1XI2A 1AXGA 1WX1A 4H6VA 3EGCA 3NOOA 2DPJA 1AMOA 3OEHA 2QQ0A 4KQMA 3FYCA 4PTYA 3DBIA 3T7DA 2YFKA 2HF8A 1T8YA 4Q6WA 1E0JA 2RJ3A 1YI1A 1RABA 2ZBFA 5C4IA 3C24A 4BUCA 4PSVA 3T3DA 4RULA 3EDOA 1YOVB 2NU9A 4O5OA 4X3PA 2DGDA 1NJ5A 1YCHA 3PQDA 3DEAA 2AR0A 3T7TA 1MX3A 3F9RA 4DL2A 3C1AA 2FP3A 3RIHA 3RAQA 5IJ9B 5HX7A 5FPOA 2JIDA 4QKQA 5IFKA 2G28A 2I0FA 3EPGA 1ELOA 1QG0A 1G6Q1 5EIBD 3WGGA 3WK5A 4F4CA 3JD3A 3VU9B 4DRXB 1XZGA 3K09C 4UBLA 3QVVA 2D1RA 3NAMA 1XF9A 1CE8B 3EGXA 4FYIA 4BY7G 2HD4A 1RHKA 4M6WA 4V02A 3PCTA 4R9NA 1QUEA 3GW8A 4O8ZA 4FCWA 4JLBA 3TRJA 4QDXA 5A4IS 1OT5A 4ZDJA 1Z4QA 3M83A 3I6BA 1LDEA 2GJ9A 2WILA 4RJ2A 4RHUA 2JA2A 5DCUA 3UNXA 1WEHA 2OVFA 1M6VA 2QX8A 1Q92A 2W2NA 4MYSA 1RRPA 2BEVA 2GZ1A 3KFLA 3U4AA 3ZLUA 1HG1A 4BCDA 5LIPA 2IZ5A 1PJ3A 1ADJA 1B4DA 3Q0EA 2ZSHA 3Q7IA 3ABQB 2ALJA 5DF1A 4W5QA 5LDHA 2BY4A 3BA6A 3CQ9A 2GOYA 5CNIA 3PNSA 2HCFA 3B1FA 5HJ2A 5KFLA 3SXPA 2HU5A 2GUWA 3HJHA 4F3YA 1A7KA 4GR5A 4KMRA 1BYUA 3HYRA 1GDDA 5DVZA 1ZYUA 1KT8A 2OORA 5E3IA 4P32A 3MCUA 1M6WA 1TX4B 3HN2A 3HVIA 4TM7A 1FFBA 2XCIA 1UOPA 2Y1LA 4HQKA 2BEWA 3EC2A 3I4FA 2XLCA 1H05A 3NXSA 2C7QA 2ZJ2A 3OY7A 4NYMQ 4MYDA 2XGPA 4Q0YA 4IIBA 5G3ZA 3QEMA 4MWCA 1NBME 2BLLA 2I7DA 2IQIA 4EVIA 3GIPA 1V5IA 3QBVA 1EEXB 4XCVA 4G4JA 2JDIA 1GPNA 4AQ7A 4DJJA 2VHYA 1P91A 3VJKA 1LFAA 1VKOA 4N4AA 3VSDA 3B3JA 2PWBA 1O75A 3HJAA 5DO9A 1F2TA 3CR7A 4BKUA 1LQ2A 2BZGA 2WWRA 1GUAA 1PZNA 4Z53A 1K3UB 1BC5A 1E98A 2A0XA 1ZJWA 1VCMA 2PQ2A 3TCKA 3OAAA 1FNNA 3R7AA 1W4BA 2ZIXA 3B1YA 2VTVA 2V9ZA 4X45A 3NRJA 3PFNA 1CUZA 2CXPA 4RVFA 1CB0A 5ALOA 4GRAA 4IF6A 3JQ6A 1Y98A 1UDBA 1BZYA 3K0EA 3KL2A 4WX2B 1HFEL 3HOXG 1GR1A 4GWGA 4HH1A 1PGNA 3M1IA 5ILGA 4CE6A 1Q5PA 2OPBA 4YV1A 4RD3A 1MZVA 2BCEA 4LF8H 3I12A 1UBLS 1XBTA 1ZCAA 2OK7A 1XTJA 3N0TA 1DPFA 4JKIA 2QK4A 1F6DA 4LI0A 2XQVA 2FZ4A 4JFRA 4QNMA 4C9BA 3CNEA 4AKGA 1Y3BE 2O8VA 3TEFA 4F4FA 1A95A 1T5HX 4I2VA 2PUAA 3IVCA 4IMJB 1E1RD 1QFMA 1X1TA 4J9UE 3VU1A 3D3KA 3P2OA 3QJYA 2X2PA 3G9XA 2Z95A 3RSCA 2YHSA 4GOXA 3HDVA 1T2UA 1XEFA 1ESEA 3HV0A 2N42A 4WDRA 5H3HA 1W5SA 4L1KA 5DLYA 1YU9A 2MSNA 2WJIA 3U9TA 1EWYA 4O4IB 4V38A 1JQBA 3KC2A 4JVLA 5AHXA 2YIMA