2YZGA

Crystal structure of d-ala:d-ala ligase from thermus thermophilus hb8
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
319
structure length
319
Chain Sequence
b'MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-ALA:D-ALA Ligase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 79
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzgA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzgA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzgA01
4HNVA 1SCUB 4O2BF 1B6SA 2R7NA 3LP8A 5CAEB 5LXTF 4MA0A 2YZGA 5KKNB 1BXRA 5BMVF 1AUVA 2P0AA 4YAKB 2GQRA 1E4EA 5C1OA 3K5IA 2CNQA 5FNVF 3KAKA 4C5BA 3JZIA 2SCUB 4ZI7F 1EUCB 1PK8A 5LP6F 1IOVA 2I8CA 4ME6A 4EA8A 1GSOA 3RFCA 4MA5A 3WO1A 2W71A 2R84A 1Z2NX 5K2MA 3N8DA 2X0SA 1ULZA 3G8CA 2FP4B 4WBNF 2YZNA 1BNCA 2VPQA 1I7LA 4M98A 4M99A 2FB9A 1VBHA 2FPPB 3NUAA 5JQGF 4O7TA 3SE7A 4Y8VB 4ZOLF 4M9UA 3KREA 4MV9A 5LOVF 2W6QA 4HNUA 2W6MA 4EA9A 1CE8A 2NU6B 1Z2PX 3QFFA 3WNZA 2R86A 3BG5A 3HBLA 5JVDF 2V58A 4L1KA 3TINA 4RZQA 4FFNA 4FFOA 1GLVA 4E4TA 4O4HF 4O7NA 5CA0F 4IZOA 3DF7A 4YAJB 5LA6F 3VPBA 3GLKA 4O84A 2OLSA 3OUZA 5DMXA 4O7VA 4TV9F 3Q2OA 1EHIA 4HNTA 5H80A 3R9RA 3JRXA 2DLNA 1GSHA 3GIDA 5EZYF 1KC7A 5I47A 3LWBA 2VQDA 4IIJF 1T36A 5KX5F 1GSAA 2W6NA 1M0TA 2VHEA 3BFPA 2W6PA 2NUAB 3VA7A 4C5CA 2J9GA 2GPSA 4O86A 5JH7F 4MV6A 2ZDGA 2ZDHA 1OBDA 1W93A 3G8DA 4I4TF 3ORRA 1IOWA 4FFMA 1KJJA 2HGSA 1UC9A 2I87A 1DV2A 2PN1A 2V59A 2R82A 4EABA 3HO8A 2DIKA 1A9XA 2WYOA 4IHJF 4NYEA 2NU8B 3VMMA 3BSYA 2PVPA 2YS7A 4O83A 4TV8F 4O2AF 3I12A 5HV6A 3R5FA 2GQSA 4MV3A 4O7YA 2QK4A 4QSHA 4TUYF 2W6ZA 2YRWA 4O4JF 3BSWA 2YS6A 3R5HA 1JKJB 5C1PA 2HJWA 3VPCA 4EG0A 3RV4A 5BPFA 3R5XA 3K3PA 1Z2OX 2YL2A 2FPIB 5JVLA 5CA1F 4FFPA 1KJIA 3VOTA 2Z02A 4O7ZA 4YB8B 5BPHA 4EGQA 2NU7B 3TW6A 1OBGA 5C8YF 1B6RA 4MV1A 1AUXA 1A48A 4O4IF 1DIKA 5HBRB 3AX6A 4YJ3F 3V4ZA 4MV4A 3KALA 1CQIB 4DLKA 4XX0B 4O4LF 4O7LA 5J2UF 3MWDA 1KJ9A 3U9TA 1W96A 4ZQIA 1KEEA 4IWXA 3BSSA 1WR2A 1JDBB 2ZDQA 2YZMA 3UFXB 4MV7A 2R7MA 4O7WA 2R6FA 2XCLA 1KJQA 4XYMB 1C30A 5JQWA 4MAMA 1I7NA 1KJ8A 4FFRA 4EAAA 2DWCA 2PBZA 3RUPA 1VKZA 3TQTA 4HQ6A 2GLTA 3V4SA 1CQJB 2CZGA 4IWYA 4J6EA 1PX2A 2YWVA 2GPWA 3ETJA 3ETHA 3JZFA 4I50F 1KBLA 4ZHQF 4FU0A 4O7SA 2YZLA 2CNVA 5D8DA 4EGJA 4HR7A 1C3OA 2IP4A 1EYZA 1GGOA 2YRXA 3E5NA 2NU9B 3HB9A 4M9CA 3Q1KA 4XZ3B 2YYAA 3AW8A 5IYZF 1JLLB 4EA7A 2R87A 1E4EB 2QF7A 3RV3A 2CQYA 3ORQA 3JRWA 2I80A 4O81A 1CS0A 1KUTA 4YJ2F 4GGMX 2R85A 4DIMA 1EUDB 2Z04A 1DV1A 4O82A 4O7RA 4YBZB 3TIGA 1EZ1A 3TIIA 4MV8A 2C00A 4FE2A 5GONF 3OUUA 1UC8A 1JDEA 2VR1A 3MJFA 2DZDA 5J2TF 3K5HA 4WD3A 2R7LA 2V5AA 3R23A 2W70A 1VBGA 3N6RA 1M0WA 2NPOA 1M6VA 2YW2A 4I55F 3KAJA 4FFLA 3MWEA 4C5AA 3VPDA 3U9SA 5LYJF 2XD4A 2R7KA 2FPGB 2CNUA 3U54A 3U55A 4XYLB 4FGRA 3WO0A 2W6OA 5CB4F
chains in the Genus database with same CATH superfamily
4GXNA 5IAGA 1NF9A 3LP8A 3L82B 3CEAA 4CJXA 2D2IA 3JQ7A 3DMNA 4RM3A 3DVAA 5ALOA 2OWEA 5EY5B 2PYDA 3VR4D 3GOQA 3RU3A 1ORVA 1U7TA 3NC1C 3H4MA 3D7KA 2XKBA 1OAOA 1AKUA 5C7OO 5DFAA 4P4SB 2XMGA 3KYDA 1LK7A 5JBQA 4DJEC 3F49S 4E5SA 2Q1UA 4DIOA 4IDOA 3NIDB 1I4EB 2HY7A 1RHUA 3CA8A 4NV1A 1VIAA 4KFUA 4P5PA 3CRW1 3FM9A 2I1VB 3EFBA 3NHRA 3KTFA 1LJUA 2F4VB 3L0OA 1QOPB 2BGWA 1O7JA 5JDIC 4FB5A 3A7DA 4MJ7A 1ZSVA 4KBGA 4X1KB 3DFFA 1DKPA 1PQPA 1GL6A 4IMJB 4FFWA 3ML1A 3IP5A 1IBLH 3RS2A 3H2SA 4OUDB 3OESA 5AJUA 3GNTA 3HKDB 3PRJA 7REQA 3SJUA 1U31A 4MKIA 5I5WA 4UEOA 1PGJA 2BF7A 4MVJF 3AY3A 5FJJA 3KOYA 1THTA 2C3MA 4B4KA 3ZVNA 3G2QA 4J49A 3U3ZA 2WF5A 4MV6A 2IH2A 3Q8QB 4WCFC 1KJJA 3NZEA 3ITKA 3MD9A 5FBKA 2R11A 2UUBB 1SVKA 2ZUVA 3GUVA 4E33A 2NO1A 1AM4D 4DR2H 2YFKA 2FLPA 3CT6A 4PQRA 2A1HA 3VBCA 2W58A 2PGLA 1Z6YA 2JCVA 4M7WA 3K0HA 2FK1A 2R751 3EQ8A 4DV7H 1BG6A 1TJPB 3FKJA 3LOUA 4PQGA 2YJ6A 2EJ2A 3P0RA 1Y80A 1LSJA 3ZY6A 1FSFA 2B20A 3LHKA 3AM4A 4ITUA 3R9XA 3GDFA 3TVDA 3OJLA 2HSDA 2GASA 4ZCMA 5HF6A 4G5HA 1G63A 3K6SA 3CVWA 1ZJYA 3ZHXA 3SXJA 1QP4A 2I3DA 3P0FA 3WB9A 4ECRA 1Y4AE 3DWEX 1VAJA 1K1SA 3L4JA 3TI9A 3K1JA 5KCZA 3TOZA 1YR6A 3GH3A 1N7JA 4MHOA 1YL6A 2WHRA 2PT7A 1ZD9A 1VE6A 2ZBVA 4OQMA 4ZRMA 5K5EA 1Z6AA 3EAGA 2EGUA 4J4BA 2I1LA 4RANA 2PXHA 3N8IA 1RRGA 3HZOA 1ECBA 4MS3B 3SQLA 3AI1A 3H4BA 2NT4A 3GQVA 1PLJA 2HM7A 1LRJA 1E61A 1OBVA 1US8A 4DSUA 4TLBA 2ESRA 2I4OA 1DTEA 1XNHA 1HDCA 3ZCSA 3ZTWA 5KFXA 3FMPB 4R9VA 4JFRA 2QN1A 3K4HA 4RETA 1AD2A 2N1MA 2JBAB 1BXKA 1P4RA 3LOQA 3REQA 4U3JB 1JYEA 2KMLA 4MK4A 4CW7A 2R87A 1RKBA 5F2OA 2BGJA 4J03A 4AN1A 3O1IC 3A6FA 2AN9A 3SYLA 3OJCA 5GADl 4OHUA 3NBUA 3B3FA 4FZ3A 2YXPX 3KB6A 5FBLB 5KFZA 4L5IA 1VJRA 2C78A 1C2TA 1SHTX 4XDGA 4BQQA 2ZAYA 2IVFA 4WY5A 4P83A 4XDZA 4D4IA 5KO2A 4AP6A 5G3YA 4DOMA 1KJNA 3IMEA 2HSGA 1QR6A 4P3XA 3DTGA 2H2HA 3VX4A 3C41J 3QUAA 1WMAA 1O94C 2IJGX 4JI7H 4ED6A 5EJ7A 4GD3Q 4LQLA 3RT7A 4B45A 1TO2E 4R81A 1N7GA 3FOZA 2NO7A 1PZMA 2A92A 3KUDA 3NT4A 5F33A 1U3WA 4A3EG 4LDZA 3QVMA 3KSMA 1ONSA 1RE0A 4RJKA 4WJLA 4M54A 5CLGA 4RKRA 5B53A 2FP4B 4CIAA 2JLZA 1YJXA 3N8KA 5FUBA 4R1OA 3BTUA 1XMPA 1K7SN 1W88B 2XXJA 4NOLA 3GR6A 4FFBB 4ILEA 4C3OB 2D5AA 3KZXA 5EWJA 2NO5A 2Q45A 2AUNA 2J45A 2FQWA 3DGEC 1UR5A 1JHAA 1K5GA 3G0CA 2G5PA 3FPBA 2EG9A 4KV7A 4Q7KA 2AOTA 4AYBA 2RHWA 3A9UA 2V8OA 5AKLA 4PBRA 2VXCA 3DL2A 1Z4NA 1SD5A 3KC2A 4E6NA 3SSMA 2KJQA 2Z8ZA 3NNSA 3R0XA 1DINA 2OM6A 4QUAA 3RO7A 1CZUA 1TUBB 2WE7A 4XX1A 4XD7D 5JNWA 3SC3A 1FNCA 2VJYA 1VRVA 1V3VA 4NV0A 2Q5LA 2PUEA 3AOGA 2HU8A 1RMYA 1HQYE 5DBFA 2ZCUA 2OP0A 3QKSB 2V1UA 1NVTA 1K6XA 2P9GA 5L6MB 5KHAA 3QJ5A 2KSWA 1ZIOA 2JLCA 3HO8A 4JJ7A 3T1QA 2Q2VA 3CWCA 2ZAOA 2QLTA 3LQ2A 1Q7GA 5HV6A 5JZVA 5LD2B 1NUQA 1ZRMA 3JD4A 3UH1A 3TGWA 2AF4C 4ONEA 2ZUEA 5IXSA 4LF8H 1JU9A 4KJXA 3QPDA 3K2QA 3U3XA 1UZNA 5AKZA 2Z02A 1U0BB 2E5WA 4XR4A 2AMFA 4LYGA 3PNOA 3GLFE 3FJOA 1W6RA 1F06A 1SC4A 1MOZA 2X8JA 3TRKA 5JS6A 5J2UF 1II9A 2J32A 4WZAE 4ZVLA 2ACEA 4B71A 3U9TA 1WEHA 2ICAA 2O7NA 1DGSA 3H13A 4YRCA 1Y9EA 2PZLA 2YCHA 1AZWA 3HXKA 3MQ4A 3TKYA 1DX6A 3MT9A 4FINA 4R98A 3RT9A 1OXMA 4YRGA 5IPFA 1XXHB 1OAOC 1Z4MA 4LHSA 3QVSA 5GTDA 1Z8HA 2FPOA 5LN1A 3M0EA 5KNDA 5KFAA 5F77A 4E30A 5T8KA 3RSGA 1OFIA 2ACKA 3BMOB 4JJ4A 4CZ2A 4KW7A 1EGAA 4GPTA 2FZ5A 2H1CA 3BXGA 2ZP1A 1P7PA 2X9QA 4DQNA 4JELA 5JH7B 5JY6A 1ULAA 2IP4A 5C3MA 4IR9A 4DAEA 1FFAA 1YRYE 2G9RA 1KI6B 3QU7A 3K0CA 1EKPA 4X1YB 2PL3A 5KAMA 4X71A 3AR3A 3QLEA 4PLVA 2WJ3A 3I73A 3AJ9A 4ZO4A 3GLHB 2OFXA 2RBEA 4BE9A 5M3BA 2BJHA 2FWNA 1U8EA 3VR5H 4KLAA 4P81A 4Z0TA 4XGNA 3OURA 4GZLA 3A37A 3EW9A 4JP1A 4WMLA 3JD3A 1OQAA 4DVJA 3OBBA 1KNXA 1MQ9A 4H17A 1GUBA 1K6EA 4LMBA 4LF6B 3I37X 3SYMA 2UYOA 3G7NA 3E81A 1JGTA 1X8JA 4DA7A 4DCJA 3MLEA 5A2QW 2BKAA 1M1XB 1LK0A 2A7QA 3PLRA 2I1WA 3KPVA 1WCXA 5G1NA 3UJDA 3ME5A 4PZDA 5CH3A 4DJ5X 3ITNA 4LGVA 2J48A 3KJZA 3FOFC 4TKLA 3TVYA 1LSOA 1XLVA 3KZMA 4POOA 3FSRA 4ZHQB 5KTNA 1QYRA 3MT0A 3PR1A 3OCWA 1QCCA 2BFNA 3HPQA 1KTAA 3WGYA 5HMMA 3EVFA 1GG9A 1CUGA 1A98A 3KYBA 4HYKA 5DIZA 1VLZA 3ABRB 4D3SA 1L7EA 4M83A 2ZRLA 6CHYA 4RVSA 4HVCA 5CDGA 4YV2A 1OHHD 2NVUB 3BXOA 4K26A 3LCRA 3CSDA 3ZCPA 3ZK9A 5EIOA 2PH1A 3ZY2A 1R00A 3KTAA 1ACLA 1SXPA 5FOTA 3NM5A 1HE5A 4KX5A 1XNRB 3K8QA 2E37A 4RK1A 4X1IB 2L42A 1KZ1A 2Y27A 1E99A 5IM4A 1SUFA 5P21A 5B1DA 2M6LA 2ZZNA 1CRZA 3RUEA 4RAQA 2QN8A 2OAP1 5FLMG 2FRDA 3STWA 2BAGA 3QKUA 4TT8A 1UDAA 4OHMA 2W6PA 2ZIEA 1OE0A 1R0XA 4F3KA 5EJIA 2ATVA 4GP7A 3SOPA 3PTAA 1W93A 3UAWA 1CZHA 1RMQA 1XMOB 4O2AA 3H2JA 4FEEA 4TVIA 1GTSA 1Y37A 3W5DA 3STTA 3V4LA 3RIZA 3GV7B 1Q1QA 3SJZA 4MYHA 4ZHSA 4KUHA 4TLDA 3C3WA 4JHLA 2P6UA 5JO9A 5IVDA 1YO6A 4L8VA 4KX3A 3L7YA 4YRJA 1HFJA 3PHGA 3QXGA 1VIYA 3PQCA 4CHIA 2AUTA 2FMAA 2BQUA 1YQQA 2I54A 4IDEA 1U2ZA 5KQRA 4ZPJA 2FR1A 2OCIA 3UJHA 4H9GA 2WJVA 4FDAA 3FNRA 4Y2SA 1P81A 3NHWA 3H40A 2W7TA 1T2DA 5DULA 1HQCA 3GLIE 2XUDA 4URUR 5IABA 4UVEA 2P2LA 1ZK0A 3QF4A 5TQ2B 3E1GA 1NRXA 3JPWA 1CLEA 1D9XA 5AH0A 4CTOA 3L7NA 4JLKA 3CX6A 5K0ZA 3D3JA 3H6HA 1XUOA 4D6PA 2Q4BA 2NNLD 3B38A 3IAM1 4HKTA 1E4FT 2JFQA 3CUYA 4J6EA 1R27A 4D0NA 1GFIA 3GVIA 1K0UA 4J76A 4ZEOA 1RE1A 2W98A 5C4MA 1C7RA 3DKVA 1ZXBA 3F3SA 1QZUA 2GHRA 2JGEA 1KP3A 2XCQA 3CUKA 2X0JA 1TAEA 2CNNA 1I7QB 4PSAA 4UTPA 3KVOA 1DDIA 1CVLA 4YMIA 1FDRA 5HJEA 4JWTA 3Q6NA 4AO7A 1V3UA 4NL4H 1PGNA 2QZZA 1BYUA 5K05A 1HDRA 3H4DA 3QITA 1XEAA 4TV8B 5DG8A 1QBGA 1YZVA 2O8CB 4G65A 5AT1A 4JIGA 2NXEA 4EGSA 1R12A 1YC2A 2P3QA 4BMCA 1V6CA 3DBLA 2VPTA 2XOKA 4V2UA 5JROA 4YPFA 2Z1NA 3K1YA 3GFFA 5BV8A 3FHCB 2PCJA 3BWYA 3TIIA 1CQJA 2JFGA 3KKMA 5FUMA 3VAZA 3CEBA 1XZLA 4MROA 1B0ZA 4ZV7A 3GJQA 4HQ0A 1M6EX 3PIRA 4ND1A 3BXEA 1ODCA 3QE4A 1J0CA 1N6NA 3FNEA 3I5XA 3PB3A 4TV9B 5LL6b 4FJ1A 1PFVA 1YHNA 1MV8A 2TYSB 5DYGA 5IDYA 4X45A 3OLQA 4JP5A 4O25A 1LGYA 3UWMA 1ZESA 3OLZA 2P1RA 2OC4A 1O6ZA 5C1OA 1P7VA 4DCPA 1CY1A 3CUWA 3KAKA 2HGZA 3H2HA 2JFVA 4KOAA 2AK3A 1TMYA 4FYMA 1X9NA 3AF5A 3CZ9A 1N2HA 4B6SA 2IYZA 1N0WA 4HNAB 5IJ0A 3AVPA 3L5OA 2X4DA 4QGBA 3UC9A 4DNQA 4Q3LA 2PX2A 4X00A 5JBIA 2RHOA 3J81A 1YGYA 3L84A 4RZ3A 1Z2PX 4BQPA 2AJBA 1AJEA 3AU8A 1L8AA 5T8KC 1A71A 1G8KA 4OSEA 4ZVTA 1EBUA 2JK1A 1MOPA 1L5QA 4HDRB 2HDNB 3R3ZA 4FGKA 2JNWA 3WWEA 2WQ7A 2BTEA 4G0YA 5AUQA 4BWGA 1NYQA 4ZXFA 1VPDA 5J4YA 1J1ZA 3NVKI 2JHCA 4PCVA 1T0IA 2W2PA 3CB2A 3MF4A 4N9QA 1MTOA 1VG0B 3F78A 4HBGA 1ENZA 5M7EA 3ZX5A 2VRCA 3RVDA 1DO8A 5FBWB 3K0CC 5F9MA 2CZQA 2JFOA 4E5KA 4B33A 4DJTA 3WBJA 3GIMA 1NUAA 3FKIA 4R0NA 1LB1B 5HK9A 2ZJ6A 2Y1XA 3B85A 4QXQA 4PONA 2KSQA 2R8HA 3R3YA 2DPGA 4AKTA 3CNBA 2JB9A 5IG2A 1D4AA 4QUHA 1QFSA 2BJWA 1ZJ6A 2TMYA 3GBVA 1NU8A 1B3BA 2F2TA 1RCFA 5DRYA 3SGIA 3VRHA 5ITZA 4JVOA 2KBEA 3IT0A 3AL0C 3PYMA 1XAHA 1YOVB 3VH2A 1MDFA 5CFLA 1PSWA 1E3DA 4ACAA 1Z2OX 1OU0A 2AZMA 3RTEA 3BICA 2CW5A 3KEOA 5HFJA 2Y1WA 3B8EA 1UPTA 3WLSA 2HI0A 3VKGA 5JNLA 3ROQA 1U9ZA 2Q6VA 3K92A 2YR0A 3U39A 1Z5ZA 1D2AA 1NMYA 4MGYR 1GNTA 3RAQA 3K9BA 2GNAA 2JAPA 3S55A 1XNQH 1GEGA 5AK3A 4YUZA 4CEHB 2LP4Y 3N44B 4PNHA 3ROPA 5JYDA 4CIBA 2QRLA 4ZJUA 3BJEA 1CLUA 3ROFA 5LMZA 1J9EA 1YULA 3WK7A 3RGXA 1JU4A 1AHNA 1E9CA 1P1KA 2AEJA 2FTKE 1JKJA 4WESB 4PAQA 3WXBA 2C8VA 4P31A 2QW8A 5HUQA 3PQ8A 5JRDS 4GC6A 1D8TA 4CUJA 4WBNA 4KK4A 3FLBA 1UPXA 1ZXXA 4R1NA 1MC5A 4GI7A 1KI9A 4HP8A 1YHYA 4RZSA 4BNLA 4RD0A 2D3TA 1ZWKA 4C9BA 4EMSA 1M2OB 4MOWA 4TXMA 4A1FA 1CKOA 4HAZA 4IJWA 3O6VA 1F20A 1S3GA 2R4UA 2ZI5A 4QJFA 2AQ4A 2FRDC 2OV1A 1IMJA 1WZNA 2R6GA 2DWPA 7AT1A 2YHUA 2W2MA 3ICQB 1UXGA 1AHIA 4U7JA 2LKDA 1E3QA 3SS8A 1I0IA 2CKMA 3CZQA 4HNSA 1WQ4A 2OB2A 3CW2A 4ER7A 3UHFA 2C28A 5K4HA 2GEKA 4TSFA 2NWQA 3KD2A 4UMEA 3M6MD 1UJBA 3IHKA 3GJ3A 2R96A 4Y9DA 5JZ9A 2GETA 5JXWA 4Q44A 2QVGA 5AW2A 2PE5A 5TGTA 5KQMA 4BX8A 3O90A 4CKCA 3AYZB 4R8RA 3EXAA 4WDRA 5E4FA 4UVIA 5IK2A 3TCNA 2VP4A 3DONA 4KPUB 1XDSA 2VDVE 4HXEB 2YZGA 5JEEA 2TRSB 1WMSA 1RM0A 2VSQA 1IJFA 1U7PA 1PL0A 2B25A 1GQFA 4EHHA 3ROKA 1FF9A 1FVXA 4B6EA 4I5IA 3TTVA 4R2WA 4JASB 3A04A 2HVSA 4G0OA 5TMDA 2XE7A 2X8BA 2HHHH 5TE9A 1BNCA 3DDNA 4CMFA 2YXDA 4BNYA 1FUUA 2ZUTA 4KITB 2DWQA 3TFWA 3H4TA 5KG2A 3E61A 4UZEA 1WDLA 1Z15A 3W3AD 3NBZC 3UKDA 1RJEA 5CVDA 3RBZA 3P0HA 1MENA 4Q4LA 1WCMA 5CA0F 2Z08A 1IEQA 4RGBA 1MH9A 1D2CA 4FCWA 4OB7A 3OHPA 2GX6A 1TM4E 4UCUA 5JTUA 2C0QA 1RMTA 3E7FA 4RE5A 1OFVA 4KG7A 2E85A 1QB7A 1E58A 1WEKA 5FUVA 2OWOA 4BYMA 1SK9A 1KYXA 3LRPA 5LUAA 3I04A 1H2RS 3KVNA 4LBVA 5E7MA 4Z7QB 1G59A 3JS5A 3NHFA 1ZOSA 3VZRA 4EEYA 3UCEA 2EJTA 1Y3HA 1TDJA 1EAMA 4EB3A 3BJZA 1D0SA 3WLRA 2GCOA 1N56A 3WFZA 3EWAA 1THMA 1TZJA 6Q21A 4LNHA 2YS7A 3EBOA 3TVTA 5HOQA 1YK0A 5AW4A 2QK4A 4IEEA 3EGIA 4GWLA 1MAAA 4MUNA 2VJAA 1L8LA 2QN7A 3TM4A 3VZSA 4Y1FA 4ENWA 5CD1A 1JH8A 1OR8A 1THGA 5CA1F 3MELA 2YIMA 3DEHA 2RBGA 4ECSA 2IX9A 2BQRA 3PICA 4EF6A 3MMZA 4BJ1A 1KK2A 4EKDA 3FYUB 4BMDA 3NEYA 2ZJFA 4BV2A 3PNVA 3FUTA 4YP0A 1X7WB 5JVDB 3RIMA 4FQ5A 1OTXA 4EHFA 4Q4CA 4KIFA 4CI9A 5BSFA 2VNHA 4PFQA 2Y8EA 3T1YB 4BO5A 3QPBA 3KL2A 4XASA 4HDMB 4UCRA 5CB4A 1EJ2A 2JA2A 3RAJA 1S4MA 1W4CA 2W00A 1GCOA 4RCYA 2ZBGA 3V1NA 5J9FA 3VNQA 1W59A 1QS0B 4G3XA 3HA7A 4NIMA 1PBNA 2DQKA 4Q5IA 3WX0A 4PBSA 1BFDA 1J97A 3JQGB 3Q5DA 3HCFA 3AEKA 3K73O 1RWQA 4II3A 4F4CA 2H51A 3R7AA 3QHPA 5H9VA 3KSRA 1Z4OA 3KX2A 4BIMA 1NVXQ 4JKIA 3M5WA 5AW0A 4GICA 3CURA 1QKJA 2WTMA 4O3QA 5JI3E 1B8PA 2H1VA 3EGDB 3BA9A 2P6OA 4HZGA 6GPBA 1IXYA 3P4XA 4MR7B 3QNUA 3SX0A 1O5IA 3O31A 1UAAA 3BJYA 4ALKA 4UNQA 3DXYA 4NXNB 2VT2A 1CD5A 1TA4A 4YHBA 2ZJ8A 2ZI9A 2RD2A 4AUNA 3E48A 1KE1A 1V47A 1EXWA 1OT5A 3NCTA 4EZEA 3ELYA 4H7PA 4XPIB 4IIJA 4I55F 2NGRA 1HDXA 3OQJA 1JFSA 4DLUA 3KB1A 5I48A 3BMQB 3WGZA 2NIPA 3ORSA 1FB5A 4XA8A 1OKKD 2BKLA 4BJ3A 4LC9A 1E9VA 2E87A 4FGRA 4M1YA 3NGXA 1BWSA 2BZGA 4GZ5A 1VHLA 2IXTA 4L27A 3TQIA 2J9FB 3IUMA 1DOHA 5A6SA 2V9CA 1XQ9A 2CFRA 4LBYA 4OJMX 3Q2KA 5LP6F 1E62A 3CIFA 4DSZA 1YFKA 2G9VA 4G9BA 1QE3A 1RDFA 4R3UC 4I4IA 4JJIA 5HQTA 2Z8YA 3C3MA 3A32A 4KXLA 4G1UC 3DEZA 2AE1A 2YJZA 5IF3A 1LLCA 2POCA 3ZV3A 5AVSA 1UBTS 3CLKA 4Q9DA 1WF6A 1NBMA 4OLFA 5CVTA 3GPIA 1M5TA 1A9SA 4IX1A 5CTJA 5HX7A 2C7OA 5E6SB 1H4VB 5LMNH 2XA1A 2RK4A 3OOHA 4M9XA 4JI1B 2XA2A 2FMHA 3BZUA 4ZYYA 2WSIA 1E96A 3T12A 2ZG6A 2RGWA 2H5EA 3O0TA 1EFKA 4IDGA 1ARZA 1P16A 5DE3A 4DZTA 1FFHA 1OI3A 2SICE 1OFTA 2BBOA 1UC5B 2EF0A 1K1QA 2JVIA 2WJIA 3G5LA 4A8HA 3QUCA 4OJKA 4FI3F 1RKXA 1UPBA 1QP8A 2JCBA 3FFXA 4QVGA 4ARVA 3FROA 1SA0B 2ZQ5A 2R4TA 4B3FX 4F8JA 5CYFA 4D1YA 4EPWA 4C7BA 4OXQA 2CF6A 4IJMA 3NVDA 1HFKA 5KPDA 4R4JA 1MEOA 4EFEA 3C1TA 3LWZA 3C8HA 1CUSA 1PG0A 2H8GA 1PWEA 1U1GA 1CF2O 2XMCA 5COQA 4EJMA 1NKSA 3KYJB 2CLDX 2GJAA 3L6BA 5BPFA 4RK5A 5FPTA 1KR2A 1TQ6A 5L1JA 4UHEA 2G1UA 4G89A 3CPHA 3IOCA 2IYAA 4OCZA 3KEGA 2ASDA 3GRRA 3RWBA 5C8YF 4ZZ2A 1B6RA 3OWOA 4ZAWA 5KQPA 3W1EA 4YJ3F 2PMDA 1EFPB 1U2SA 4RXMA 1ZK3A 1QSGA 1Y89A 3BK7A 3IE0A 4O4LF 1RYNA 1HI9A 2W2LD 3QUQA 3RB8A 3HM2A 2O8DA 3FY4A 5IEJA 2E6KA 3MTQA 2AHRA 3IAFA 5ESWA 4PZ9A 1L4NA 2WY2D 3LUFA 4EL5A 1PQWA 2C1EA 4LWOA 2D1TA 2FF5A 3PR3A 4GKAA 3PD0A 4MQ4A 5LXTA 4D43A 1MB3A 3MXTA 2P67A 1L4LA 1XV5A 4U7HA 2QG6A 3IN5A 4D3DA 5I7WA 5KREA 3G9ZA 1CVIA 3G9XA 5K0BA 1G5RA 2FWJA 5FOXA 3D64A 4AXXA 2GN2A 1RW4A 1I0ZA 3N2ZB 5ICGA 1NI4A 1KY4A 3RU2A 1QHFA 3I2FA 4BAZA 1F12A 2NYAA 4LY3A 5HEKA 3TQ1A 1I5EA 3NVMB 3OZIA 1G6Q1 3ICEA 1JH9A 1J8FA 2YMLA 1Q2UA 2P41A 4M9CA 3EEIA 4F11A 2IXAA 5DTJA 4B4WA 4DL3A 1PJ8A 2YYAA 3I53A 1E5VA 1P0IA 3V8VA 1V48A 3LXXA 2BR0A 4PIPA 4RY8A 3PGMA 3PXCX 1OVMA 4RTRA 3SKVA 5KFBA 3WDSA 1WHTB 2VDJA 3IS3A 2IYYA 2PUAA 4ECWA 4P58A 3IEUA 2HXYA 3VH4A 3CY6A 3ZHBA 3H5NA 1DV1A 3OM0A 3A1WA 4G41A 4U2BA 4AZ3A 2C9OA 1KDZA 1GOTA 1ZU5A 3RJ0A 4PZPA 2VPZA 2GLXA 3OZBA 3WQSB 1GXSB 4PM4A 5REQB 3GVXA 2VHYA 2VKTA 1XD8A 3ITEA 3PNKA 2UVPA 3D8RA 1GQYA 1OGIA 1VOTA 2Z2XA 5ALGA 5KYTA 2FK7A 5IARA 3S1AA 2R7NA 3TY8A 3UV3A 3CM0A 3H2BA 3NCHA 4WXRA 2I6TA 5DDIP 3I6QA 4UATA 1MO5A 1E4EA 4DJJA 5IKPA 4LZNA 4D92A 1TFUA 2PUWA 3H84A 1FTWA 5I7FA 1E6UA 5EJ4A 4ACBA 4OU4A 3I42A 1XCLA 2IZOA 3N2GA 5HQJA 3L8DA 4CKYA 2VBFA 1YT5A 4JOQA 4CHTA 4QHTA 1E5TA 4Q9AA 5BWUA 1G9TA 4O59O 3NHZA 2I2XB 2UZ1A 1FDWA 3D4LA 2ZT5A 3K5PA 4H3KB 4B8ZA 1TWCA 3GLQA 3FCXA 3M6FA 4LMPA 4EFDA 3KJHA 4J0CA 4QUJA 3OSUA 5AUNB 3RVQA 1N3IA 2HPVA 3AH8A 4U5QA 3GFBA 5HF9A 2ATIA 3T5BA 2D1QA 1NNUA 5IAEA 3EUWA 3ZWQA 3WMWA 3BS4A 5FBZA 3FPKA 5DLYA 3V7UA 2EX4A 4L9AA 4C7OA 1MAUA 1GUAA 1YRQA 4FBMA 3ER6A 3P8ZA 2B4TO 4KEAA 4OH1A 1TTQB 4ZI3A 4IIYA 2OO7A 1K27A 1C4XA 1R18A 2GEFA 3TRIA 1XL0A 2F1IA 3T5AA 4RAOA 1TZMA 3UMVA 1JG6A 4KDCA 5EDWA 4FCVA 4UPEA 2PRZA 4MZDA 2OGWA 1CHNA 2XADA 4K3UA 2J3LA 3GRVA 5IT4A 2F62A 4IHJF 4NYEA 3PD7A 4GMHA 2WUGA 1NATA 3B1WA 2X0EA 1D0IA 4CM4B 4U7WA 1FXUA 2YJTD 4ZI7B 1KI3A 4Z0PA 3AV0B 1DADA 3HYTA 4F97A 1QG0A 2IIBA 1RP1A 1LPBB 1TTTA 2Q6OA 2D5BA 1ZG3A 3BZWA 2L18A 3IQFA 4G23A 2BP7B 2QE7D 4IG9A 3CPJB 4DLRA 4QUBA 2COEA 2GSWA 2PLRA 2NOAA 4HXGA 4KYUA 3NEAA 4DDMA 5JPCA 3FUUA 2WSYB 3B1KA 1KEEA 4G3IA 2VJCA 4WH0A 3DKIA 4HJRA 4ZAVA 1FRVA 3KKEA 4J7CA 1LNSA 3L40A 4HMQA 1U0RA 3QBEA 2H85A 2R7ZA 1CUIA 3ZHTA 3RRXA 1BH2A 4O2BA 4A2PA 1H85A 1T4DA 3V32A 1Y8QB 3VM6A 3NFYA 2BN4A 2RGDA 5A5DA 2XCIA 2ZT7A 4N54A 5TGDA 1Z25A 1Y1WG 2IBKA 3WB2A 1KQGA 4A9AA 3U7QA 3ZI7A 1WXFA 4M0UA 3A2LA 2QJWA 4V1CA 3PKIA 4GOKA 3EZ7A 5LYYA 3L2OB 4FYPA 5DXAA 4G85A 3GCWA 1ZCBA 4E3WA 1NW6A 3KXPA 5CDFE 3QU5A 4EX6A 3QIVA 3SHOA 3TY9A 1QF9A 3H1AA 1Q57A 3ETGA 2NACA 1PTJA 5IAKA 5AW9A 3RR5A 3JQAB 3VR6D 2VNKA 3FFTA 3K0SA 3LO8A 3EVEA 4JYMA 5A4IS 3O8DA 1LSUA 1G3RA 1QO9A 3O2JA 4DL5A 8ADHA 3GMIA 4LC1A 1L5NA 3AG6A 5E25A 1XJWA 3U62A 2ECFA 5LA6A 2D0PB 4QG3A 4KMMA 1WO8A 1EFDN 5GOTA 3DVRX 4RHEA 4E5VA 3K4PA 1YQTA 3DMPA 5LQMA 3OCUA 5TR9A 1Y7PA 4F5DA 2HPZA 3O26A 4LDNA 2R1VB 3F6BX 3EXHA 2PRYA 3PE4A 4RVOA 4LZJA 1A7UA 4PINA 4OFZA 4GLBA 3I30X 1XZIA 1AZSC 4DF3A 4D45A 3VSDA 5CCBA 3UXMA 1SKAA 1L3CA 2J09A 1F3LA 5U9CA 4LF9B 1WF3A 1B6SA 2QI9F 2HK6A 1UKAA 4A3LG 1QF7A 1DE0A 1NUSA 3QXXA 1V71A 2GZAA 5AKEA 1BHSA 4CEJA 5K3EA 1NXPA 4KUEA 4RF2A 5K8CA 1KZ4A 4X24A 4JBLA 4L3VA 1X14A 4LMRA 5LU8A 3RFCA 1Q0PA 3JALA 3E7WA 1ADFA 2XI4A 3QENA 4ECVA 3VNRA 1KAGA 3AFOA 3U3KA 2DABA 1DTWB 4XJVA 4DLZA 4YCCA 3NUAA 3L7AA 1AHPA 1A50B 5AESA 4GR4A 4OGLA 3PNQA 4CF3A 4ENUA 5KFCA 1P2UA 4RK4A 4G1MB 3T3GA 3ND6A 1I6KA 2FSGA 3F7OA 2GBGA 3QPAA 1ZCZA 1G0OA 4IMPA 4F6RB 1Q1EA 5EJ5A 1V4BA 2J3JA 3MRVA 5I4BA 4EW1A 2IKSA 1J1UA 3T15A 1B15A 4I66A 3IA7A 5I51A 3Q2OA 3ZGXA 3VPAA 4KQEA 1RAFA 4HNTA 4IVQA 3TQCA 4JI5H 3PXDA 1CRPA 2P65A 2GN9A 5TB5A 5CU7A 4HSEA 4RUCA 4DDKA 1E3WB 4JUDX 5D3KA 4UCOA 1Y1LA 4EG5A 2R8KA 4NABA 2QQ0A 5BWLA 4U7CA 2B37A 2CVQA 3RNLA 2BR4A 5GV7A 3D2LA 4ZDJA 1JSCA 4TQSA 3PQ7A 1QFXA 2R93G 3HZHA 1BZYA 3GNLA 2F8MA 3RTGA 1B8NA 4P3NA 3FHOA 4ZO9A 3T5MA 3FLMA 5JARA 3BIFA 2C29D 3B52X 2QIPA 5H68A 5KG6A 3VHLB 1Z6GA 4RNCA 3B82A 1PFWA 3HXQA 4JQSA 1UK8A 2B8WA 3H5OA 4QZVA 4B3RB 5FIUA 3LYLA 2ZITA 5K0EA 4XH9B 5G53C 3O8OB 5I5VA 3TZBA 3BIXA 5K01A 3NOQA 4MV4A 2BPOA 4EB0A 3EDRA 3VPGA 5E6UB 5G40A 1NMXA 3MWDA 3QYPA 5KYYA 1I14A 1YONA 4QOSA 3K70B 621PA 1KI7A 1T1JA 2AMVA 4N3GA 1EGQA 5DEIA 1RZVA 2OV8A 4N5HX 1GHTA 2MJLA 1RIIA 4OOFA 3UJCA 3G59A 4BNTA 3IOYA 3V6KA 5HM6A 1Y6GA 1S2IA 2R8EA 1F2TA 2EERA 2VSYA 2VDLB 3TNYA 1NJ1A 4FMCB 1VCOA 4RK6A 3AVVA 3AFGA 4B83A 5AIAA 4BVHA 3RUAA 1JX6A 5JJKA 3RKUA 3UOGA 1D1PA 2VTDA 2Y71A 1U1IA 1KSHA 4AZSA 1OWLA 4KCGA 5CCDA 3JD0A 1CRQA 4YV0A 3AL2A 1KBQA 4WLEA 3WS7A 1QMGA 3T3DA 4XYMA 3A3KA 4YS6A 2PA3A 2JEZA 4DYDA 4IKPA 3F5MA 2PX8A 4ECQA 4XKJA 4CM9D 1EJ0A 4WZBA 4J9MA 4P54A 1RSZA 2WU3A 2R00A 3GYBA 2GBCA 1XZKA 3HVUA 2IELA 4BAUA 4Q6WA 1BHJA 4H0CA 2CDNA 1VPVA 3QI2A 2Q50A 2HIHA 1KDTA 2WM9B 4U00A 5KWVA 3I8SA 3ZEIA 3ZJUA 2BFMA 4ABTA 3G2JA 2NUPB 1B0AA 4AY3A 4L0MA 4ASUA 1JJAA 3P0IA 1KXJA 3SLRA 4HMPA 4L85A 4ZZIA 2Y0SA 1BCSA 3ZYCA 5ERXA 1P4GA 2KBFA 5LQKA 4ER5A 1RBYA 2FW8A 1GZ7A 2YC2C 2H4JA 2E4XA 1CDEA 4G9GA 3DZKA 3Q3JB 4YVFA 3VX3A 4P80A 3SEQA 3RRNA 4TWIA 2XVZA 4QUDA 1K88A 1KU0A 3AHEA 2G04A 4GI2A 3SE7A 1QYWA 3IHLA 4S2UA 3RAXA 3FGPA 4EA9A 1CB7A 3P2YA 5JE8A 2FMXA 1UOQA 2IXEA 1JECA 5A05A 3JATB 3NANA 5BNFA 4HWTA 3V5NA 2HV8A 3CX3A 4YAJB 4IOMA 4HQKA 4JJ8A 1M5UA 1L7AA 4KNYA 4QTYA 2CEKA 1YBVA 1DARA 5LQUA 3P71T 1Y63A 1JZQA 2B63A 1M7JA 1JT9A 1TEHA 3OIFA 3MTJA 1YDMA 4KVZA 2PWYA 2IHUA 3SXUA 5DLEA 1PTJC 5DM4A 4XCXA 1N8KA 3CZAA 4AW9A 5DN6A 4FNAA 2L19A 2A0UA 3N59A 1DBWA 3JWPA 1O57A 1Q0SA 2FFRA 4NI5A 1EP9A 1EINA 1C50A 1AE1A 3LK7A 4MW0A 5EOYA 2MU1A 4HEQA 5EWEA 3TRJA 3GOHA 3LT1A 3D6AA 3KIPA 1V16B 2OZVA 1KZ6A 3O3CA 4HAIA 5JYBA 4N6GA 4J9NA 4C30A 2PWBA 3IBFA 4YGXB 3S70A 2PM8A 3TK1A 1O95D 1E3SA 4EYGA 3IMKA 4UAVA 2ORED 2WWHA 5FWAA 1M1YE 3EXHC 3HMKA 1ZR4A 1LBIA 4B6GA 3EYYA 3MCVA 1Y8AA 1JXOA 3SM3A 1C1DB 3Q3CA 1RI3A 4JLPA 5LLSA 5C2JB 3TZ6A 3WK5A 3LP5A 5HGJA 2IA6A 1NX9A 3BCUA 2JLRA 3F97A 3IAS1 2JPDA 4EW3A 1HOXA 1E5LA 2BEWB 4C87A 4RPGA 1P7YA 2JIPA 4B44A 4F86A 3OBIA 1T4MA 3TYXA 5BV2P 2X2EA 4MWOA 4Q7LA 1K7YA 4M2LA 3E8XA 2QTGA 3TQOA 3AVTA 1BJTA 4ZTBA 3HGQA 2YDYA 1NV8A 1K4YA 4UNIA 3KXYT 1PJZA 3AR8A 1U3TA 1TEZA 1AKRA 3RBVA 3K2BA 2JEOA 3MWJA 2ZQZA 5IJXA 3BMNA 5IAOA 1KJ8A 5GQSA 4AJLA 2I7XA 3AVOA 1GL7A 3F90A 5AM2A 1VKZA 4P7JA 4QFMA 4LGCA 2O2EA 1RFGE 1GFWA 2LIVA 2P30A 2E55A 3HCBA 2QN3A 4WN9B 1XYYA 4KJZA 4RKYA 3I9NA 4G56A 1D5CA 4FU0A 2AL7A 4RLFA 1NONA 4BNMA 1F6BA 4OSPA 4YJHA 4NAHA 3ZXXA 3KR1A 5AW6A 2VDWB 4PSVA 1IOZA 2MMCA 3I28A 5JQGA 4X93A 4PYRA 1TECE 3UT6A 4PHFA 3WLHA 1UPCA 1Q12A 4P86A 3ZE1B 4FKMA 4XE5A 3FNIA 3K32A 3SF8A 5B4TA 3Q10A 2D5LA 2QLFA 3VDNB 4XWTA 1Q7EA 4UKDA 1J9GA 3DXXA 4XM2A 2J41A 4ARIA 3RF6A 4GC7A 4Y7DA 3JVEA 3QELB 3T52A 4GOOD 1JHMA 4NICA 1GPBA 3WWJA 2QMYA 3P2OA 1Z83A 4YBZB 1GGJA 4LJSA 4YFYA 1IY8A 4A3JG 5EPUA 4YACA 5ALEA 2FPKA 3UK6A 5ALMA 3GO4A 1K92A 3KJNA 2Y1DA 1YBMA 3R3JA 4OGFA 3DVQX 1GPUA 1OD6A 2OBBA 5CT6A 2R6AA 2HCJB 2DYKA 1Z6QA 3AR7A 4ENPA 1GGNA 1OLSB 4JAVC 2R9VA 2MSDB 5JMTA 3A4TA 1P2GA 2G17A 1HKHA 5E4YA 1PDOA 3LDAA 3F6CA 4GSKA 3K15A 4XZ3A 4URWR 4JT8A 4JYZA 3UMBA 3CLHA 2G40A 4OH7A 3SR3A 1WOMA 1YRHA 1DAMA 3KE9A 3PDJA 3AEUA 3RU7A 2C58A 4Q45A 3F2VA 5TF0A 3NWBA 4TWBA 2PANA 1JEAA 2GCIA 1S8OA 4Y9SA 4X7RA 2OE2A 1C8VB 1DBRA 3WWIA 4QM6A 2CJXA 4IHAA 1FLAA 2CGEA 1T2CA 2ATEA 1CE8A 2UXBH 4NYJR 2IU3A 1S2GA 3OECA 2RH9B 4F6CA 2AV6A 3K9LA 4HUJA 1R5BA 8MHTA 2XWPA 4F2GA 3FZYA 4FQ8A 4LRYA 4C0AC 1NSFA 4FCTA 1JA1A 3A31A 4O84A 1SIUA 2NSJA 4LH6A 2WE6A 1G7CA 4XFDA 3OTOH 3WRXA 3KTDA 2FCAA 1PT7A 3B78A 3CUUA 3C14C 4EPVA 5M2QA 2XNKA 3B51X 5EZYF 5FUWA 5I7EA 4GNKA 3RYIB 2LIPA 1FFWA 1Z34A 1T5IA 2XBUA 4L02A 2ZBQA 1PL6A 4DUZH 4CMHA 2FAXA 3A4YA 2YW9A 5BR4A 5G0TA 2PGNA 3WP0A 2QE6A 5B7QA 1IBKB 2DHCA 4DAAA 1O6FA 2EJ0A 3TW7A 1HRDA 1JZTA 2DHDA 3HADA 2OXFA 1K5PA 3OPYA 1XP8A 3B1ZA 1J8YF 1IRXA 2NU6A 4CNBA 4RS3A 1ESNA 5HKBA 4B3MH 2P40A 4MUIA 4KSYA 4QWMA 2R00C 5CJPA 3N53A 1GZDA 4C4XA 4P7FA 1H5UA 4ISCA 3UHPA 2VZLA 3MR6A 1H2EA 5DU2A 1U7ZA 2PH7A 3LDHA 2VZ8A 4DR1B 2ZSUA 3CE9A 3EISA 1HSOA 3QWUA 5FQOA 3P9YA 1P80A 4CKWB 1YS7A 3VKFA 3N74A 3EXIB 1FFXA 1UOEA 3ZJYA 3MOGA 1EWRA 3BK1A 5L1IA 4YAOA 4KAJA 1A7KA 2YQZA 2GGSA 1DC7A 4HOYA 1OREA 3RODA 1N3BA 1IN5A 1I4TD 1QHIA 1FQWA 2C84A 1CY4A 3QTLA 4ESEA 4RB0A 1BOOA 2OYRA 1IBMB 2LTAA 5E7QA 3KZOA 2QBYA 2HL6A 2WFAA 4RY2A 1NDUA 1HE4A 5FT9A 4KBYA 2IBTA 1GZSA 3H0GG 1YZUA 1ECLA 1R8XA 3NHYA 1M6WA 3RUPA 3WNBA 3K96A 4OY3A 2PX6A 2WIBA 3COVA 4QBIA 4YRZA 1CKEA 4ND5A 5BRNA 4P2GA 3PEFA 3IKLA 2CVZA 1S10A 5CG2A 3IDQA 3GQCA 2TMDA 4JU8A 4FHEA 4NH0A 2C7PA 4GOJA 3VZDA 1EFVB 2RAPA 1F4LA 1GGOA 5HBRA 3CMMA 4R7RA 3UUFA 1F48A 1XKQA 1M6YA 5JHGB 3ERCA 2P9EA 2Z4TA 3HKBA 1A9PA 3KKPA 1W85B 1LV8A 1PDWA 2E2HA 1DOAA 2BI7A 4NFYA 2HHJA 2BYTA 1X7ZA 1OXBB 1COWA 4DIMA 1V8BA 3PIDA 1KWGA 4R05A 2P9FA 1E5DA 1PX0A 4RTPA 3QW4B 2YXLA 2B8EA 3CH7A 3RQSA 3ZX4A 2VPYA 4GX1A 1T1RA 1EM8B 4IJ6A 4AKHA 4QLAA 1GRNA 4TMFA 3EAFA 2QTCA 1I94H 1VSVA 1Y3FE 4A6EA 1MZPA 221PA 5K3OA 1TLLA 1CUHA 1V0JA 4R84A 1XZNA 4B9AA 2UUAB 4M8IA 3UGQA 2I6FA 3L4BA 4OMUA 3VR4H 1UMDB 1UDRA 3X1ZA 4B7AA 4FYHA 1GWNA 4MQBA 3IVGA 3RC9A 1XCGB 4MIYA 1TVMA 3SQNA 3VR6H 4EY8A 5LMUH 1NQWA 3RT1A 3CVJA 1XRRA 4UBKA 3KHRA 1G5FA 3AJDA 4JLDA 3AILA 3ZYZA 1YMVA 2DTEA 4JT9A 5TMEA 1EEHA 2PFKA 3T5DA 3MQFA 3OEHA 4MW1A 3P0EA 4J16A 4OM7A 1U04A 1MD9A 1RCUA 4J3NA 1ET0A 4C07A 3OETA 4YPVA 4GPEA 5KB3A 3HUEA 2P9TA 3VSBA 2FPGA 1UK7A 2HA7A 5C81A 1VPLA 1E1RA 4YRTA 3C3DA 2ASLA 4RFSB 4ER6A 1C9DB 3V7NA 3HOZG 1S03G 1G42A 2CSUA 3T94A 3WWZA 2VH1A 4YP7A 1B0PA 1ZIPA 3FSGA 2VEDA 2ILVA 1DX9A 2Q0QA 4GQAA 5JYEA 4ZV9A 2WMYA 5DF1A 3UT5A 5C5CA 1RD4A 2D3WA 2OV2A 3KLMX 1TWFA 2M2IA 2DBQA 3EQ2A 2EX1A 4EJSA 3CV3A 1NT4A 3HOUG 4DW8A 1JQEA 3PP8A 2I3GA 3SBDA 2JATA 2FQXA 5M5BA 1JXMA 3KLPX 2BGLA 3FUVA 4NDZA 4NH4A 2JHGA 3D0QA 4XSGA 4BP1A 1ODFA 4K46A 3A1EA 3JARB 4AT1A 3V6HA 2NQ8A 1I7PA 4M9QA 3N0XA 1REQB 4HDSA 1I6WA 2VJQA 3UW1A 4LOHA 2FPIB 3AKEA 4JI6B 1XAJA 3ZI4A 2I1QA 1GA1A 1O9GA 4J9UE 3IP6A 2F1KA 3TW6A 3H5WA 3QFCA 2QYOA 4EBDA 4EP1A 4MWBA 3VR5A 2AFIB 2HQRA 4W4TA 1ZUD1 4NFSA 2CL0X 5L40A 1V4YA 2FWBA 4U4AA 4B84A 2WIJA 2NZ2A 3P97A 5JBNA 1BE6A 5ERGB 2NO9A 1M8JA 2I22A 3GJXC 2J85A 4GQIA 2DQYA 2F3UA 5EZQA 1HE3A 3OU2A 3R8XA 4JI3B 4HZIA 2DULA 4GRIA 1J7KA 2XXAA 2V1XA 1H5QA 2POQX 1IWOA 1K8QA 1LZKA 2P5UA 2E4AA 4TSKA 4TX1A 2IUTA 3GV0A 3QLJA 4RABA 2Z5GA 4UUOA 3ZDCA 2EGHA 3DKPA 4JXJA 1M34B 4RZHA 2C2ZA 4FOTA 4ZKDA 4R8VA 1E7QA 3UK7A 2ODWA 1G16A 3FCSB 4JL5A 2XYGA 3QX7A 5IJ9A 5HUJA 2EEZA 2X9NA 3WRXC 2C9DA 2Q3BA 3COSA 1IBSA 5HRAA 4CKZA 4ED0A 2AEEA 4DMKA 1E2IA 4RNMA 3NJ8A 4YJ2A 2B2NA 4HDKB 5FPHA 4CVNA 2WD7B 2WA2A 5CR9A 1CNMA 4C05A 4Q21A 4DANA 3BULA 4NJMB 1IDN1 4GLOA 1GKLA 3IDFA 5F3DA 5T7BA 2BDTA 2Z04A 2A78A 3B3GA 3BA8A 1SZPA 2WD8A 4X64B 2FFHA 2HHAA 5JAUA 4G67A 3I6ZA 3LQRA 1OIVA 3BMCA 4IDPA 4O0LA 3W5OA 4CFZA 3N6XA 4BVFA 3L05A 2A4MA 4UOQA 2XGGA 3C3BA 1XF9A 4I9HA 3CE6A 3O8CA 3WKDA 4HH4A 2WJGA 5DBHX 2PQ6A 1NNLA 3DC7A 5TLSA 5KTYA 2OXTA 2VQ6A 4MVYA 3AF3A 3Q15C 1EE9A 1NP6A 2XTJA 3P2EA 1P77A 1R0ZA 2W9BA 2G1KA 3D9QX 4GQBA 1CJTC 1CS4C 4WLVA 1I1QB 2Q1TA 4U2GA 4X7MA 5EE5B 5DKFA 4O4IA 4AQYH 5T5QA 5G0VA 4C22A 4M22A 3MBIA 2ZXEA 1TWAA 5DV9A 3TGPA 5KT5A 2FX5A 2BEKA 1RPZA 3A6JA 1FYVA 2X58A 3QX8A 1WXIA 3IO5A 1NX6A 1D09A 3TJZA 5DZSA 1PJAA 3B36A 5DX8A 2RH8A 1IPHA 3D4OA 2PKXA 1XRMA 5CGQB 4HPJB 3PE3A 4PZLA 2YOFA 3D4BA 5BN3B 1LS1A 2RGBA 3W90A 4Y7CA 1DG9A 4B3CA 4I8IA 4IXMA 2IF0A 3HJRA 2H4HA 3UMYA 1C0LA 4C5CA 2H7CA 5HF8A 3JVIA 1BHO1 4YLGA 3IJEB 5DMHA 4JT4A 4JC8A 4F7DA 1ZHQA 4IV8A 1J2RA 2H1LA 1U0JA 1X0XA 3C8DA 4BRSA 3NVAA 5ITVA 4PR3A 3TSOA 1KETA 3F74A 4PNPA 1GGVA 2C77A 1LDNA 3GRUA 4R51A 2JANA 2IV2X 1EXVA 1SVIA 3VPCA 3DAYA 4OXKA 2XC9A 4R41A 4PFKA 2ZBDA 4FYXA 3S2ZA 2O6HA 2DHEA 2EL9A 1AC5A 4J4HA 3A9WA 1C1YA 1E8MA 1TKRA 1V5WA 2VCEA 1ZNXA 4DJAA 4A92A 3T5JA 1DXYA 2IY9A 3NHJA 3MJTA 4E14A 1IZ0A 4XX0B 4UU0A 3OZDA 4J0MA 2NO0A 4O7LA 1Z18A 4JY7A 3LFUA 4IW3B 3S4YA 2AG6A 1I50A 3FPGA 1XALA 2QDKA 5LYJA 3IR6A 3UN1A 3PTZA 4DDTA 1ZI6A 2XY4A 1JQLB 1R66A 1GZHB 3O1HB 2OXIA 1YZQA 3KWFA 1KAMA 1H1LB 2NV6A 2XZLA 2QUAA 3R6DA 4ESOA 2FUG6 2EQBA 4PLZA 4J16C 5CHYA 2VKQA 3NNNA 2IPOA 1MA3A 4XUGB 1FTSA 2IZ1A 3L8ZA 3QF7A 5FNVA 4Y6RA 1YI0A 3LF1A 2YWGA 2VF8A 4RH3A 2GFQA 1MA0A 3NPMA 1XBTA 4KYTA 1B8VA 3GCXA 5HKAA 2M6RA 3DWGA 2JJ1A 2GBIA 1PP4A 3M83A 4Y1RA 1I4OA 4NULA 1Q7BA 1HUQA 3R0VA 5BYBA 1KYYA 3U1TA 3ZIUA 1DS6A 2WYHA 3FYSA 2P4QA 2CLKB 3I5UA 2RGEA 3P2KA 1YB4A 4REQB 2QSJA 2VG8A 2D4HA 4BLSA 3QWAA 1XZEA 4A15A 1EA7A 4G2TA 2HREA 4BU1A 2W90A 2XVXA 4H7JA 3X2SA 1R3DA 1DWUA 3HSSA 4WOBA 4OP2A 3DTNA 1JIIA 3MINA 1OXUA 1P4HA 3SLKA 1O9BA 4IJQA 3REGA 4EJSC 2ZVQX 4ND7A 2OLJA 2VHQA 4ZEVA 5BW8A 4AJ1A 1N32H 2CJWA 1XJ0A 4Z8XA 2VUSA 4IH9A 3R23A 3PR4A 1PS8A 3AI7A 1YE8A 2O4CA 4Y2QA 2B94A 3URMA 3GWZA 4LV8B 1PQ4A 3BB1A 1JYFA 3N39C 3K8OE 1C1XA 1LPSA 1O54A 4AY6A 3EIFA 2KQUA 5G0WA 2CMGA 3VR4A 3NWOA 5FBVB 1D1TA 4TT3A 2NP6A 3C3PA 4M4SA 4OFXA 2R92A 1WXHA 4JXZA 2YDXA 3L92A 5JWOA 1GAWA 1U65A 3M4XA 1XDNA 3QOYA 2RH4A 1U0SY 3MWEB 3KQHA 3OFJA 2ZR7A 3MUNA 2VS1A 1G17A 1YD7A 3MSCA 3GEDA 3S5UA 1T8PA 2WW8A 4O4JA 1ZK1A 1T1EA 4BV9A 1ZFNA 3RYHB 2IX3A 5EGNA 2AR7A 1T8UA 3HUDA 4JEIA 4FUQA 1I13A 1E7WA 1ZETA 2GFHA 2CC2A 4GIBA 1P7WA 5EJGA 1NXTA 2XYHA 2ZTUA 3ETLA 1FL9A 4J7UA 4LXIA 1JDJA 1M2VA 2G09A 4TPKA 4F1KA 1RBMA 1K5DA 4DR3B 3WIBA 4AG5A 1NR1A 1Z7GA 3VHXB 4HGYA 521PA 1SU7A 4LYDA 4QRIA 1FVHA 3CC8A 3L77A 4EKIA 2QN6A 3OSZA 3L7BA 1DJOA 2J67A 1X9HA 4PS1A 3SZRA 1GKIA 1OZGA 2OYSA 5HK8A 4DJFC 1BX3A 2IDKA 4MVJM 1CFJA 1XPJA 4FYYA 3I3OA 1M0TA 3P9CA 1ENPA 1OX4A 1P4JA 1PGPA 1VCNA 2H2IA 5G2OA 3V97A 2F9FA 3D8NA 2J6CA 4DR4H 4X7PA 1L4HA 3A3NA 3HR8A 4Z9FA 2R7AA 2PPLA 4XARA 3LIIA 1OYWA 1FQKA 4RKQA 1DQNA 2CNWD 1UMCB 2QY6A 2WIGA 1G7TA 1AQ6A 2O2XA 5THQA 3KHSA 3T1VA 3CNLA 4GKJH 1E2FA 1O97D 1Q0RA 2BMAA 1OXXK 5ESRA 2QRNA 3DP7A 2AG5A 2UVUA 3OH8A 3I6IA 2ERXA 2Q3EA 3SS7X 4IO1A 3UCXA 4LZWA 1WH2A 2GI4A 1N5OX 5KS2A 1IY9A 2I6UA 4MRMA 1Y9JA 4YV7A 1P5HA 2QT9A 3ZXSA 3CZ4A 3HN7A 5CLIA 3U17A 1BWPA 1NN1A 3LA6A 3EGCA 3W04A 5EIEA 1FJGB 1XEWY 4L6IA 1JHVA 3P32A 3X1WA 2QX4A 1PR1A 4DV1B 3BH0A 2VPWA 3OZCA 4ZYUA 1GYQA 1GZUA 1LPOA 1ZI8A 1JQDA 2AG8A 3WLNA 3IAHA 1EHYA 1WHSA 4G5OA 2F59A 5GIOE 5CXUA 3MOIA 3C3EA 3CEMA 4NR0A 3WQHA 3LQQA 3WG9A 1X70A 4BMNA 3OZUA 1ZA2A 1IZYA 2O7SA 3O1JC 1W0JD 3NOOA 3CWQA 3LGAA 2VJOA 1JE1A 5LU9A 3HBFA 3R3SA 4XLTA 2DUJA 3HE3A 1KK0A 5IUKC 2X1HA 3U4QB 3MT7A 4LF5H 4MQUA 2PUBA 3WLFA 2RHLA 4B1FA 2J6HA 1WCIA 2Q2TA 5LOVA 1J39A 5K09A 2OHOA 3I1JA 4G2NA 4OQ4A 4PHTA 3T9FA 3D1VA 2XLBA 4R5HA 3GUZA 4C2MA 3IVRA 1PFYA 3Q0TA 1QE0A 4ZQCB 5B1IA 4B48A 2GDZA 1FYEA 4NOMA 2YXEA 3GEEA 3TG2A 2DM6A 3T5LA 4PO1A 1PK9A 3D8SA 3HFJA 2PL5A 3BQNB 1UIMA 2EZ8A 3JSNA 4AIIA 3IT1A 1TPYA 2ZATA 2ZTMA 4C0XA 4HX5A 3GDWA 4UBMA 2A7XA 1SHJA 4TM8A 2EFYA 3HCWA 2WU1A 4HDNB 2WIAA 1GLNA 1MBZA 5DT2A 3U19A 4GI3A 2IEDA 4NCNA 1GAEO 2DAPA 4PCUA 3R6LA 2IYXA 1T26A 2AR0A 1FW8A 1HZZA 3GFPA 1EK2A 5FYQA 1X1SA 3FTNA 4GOMD 3OSNA 4EO4A 2X8AA 3EX7C 3ORYA 1NR7A 3ZGYA 3CR7A 4BRUA 3I1YA 4DV6B 2VOBA 4WKPA 2QTTA 4L4ZA 4K1LA 2FZVA 1DB3A 2X15A 3SJ7A 5K3AA 4HX2A 3WAKA 5LZ7A 2W8BA 1D4OA 1YQDA 3ZC3A 1NQUA 2AW3A 5K45A 1SM4A 2XB8A 1ULHA 3EIXA 3LL7A 1GGEA 2FWRA 4M53A 1MG5A 4Y8VB 3LAWA 1MABA 1F0NA 1U2DA 2OVBA 4N40A 3UAOA 2QD1A 1XJQA 2V7BA 5K6TA 1QJCA 5JWHA 1A4UA 4XD7A 3T4UA 3AERB 3C1AA 2I71A 3OWHA 4YJFB 2VYVD 3JAWB 3A1NA 3EJWA 1KDOA 5EYPA 3AW9A 2V7TA 5ALHA 3KU1A 5ALKA 1GAQA 1C0KA 3DCJA 4O7VA 4TS9A 4JH0A 5DGDA 2EJCA 3AEXA 4MR8A 1I2CA 1RQNA 1P18A 1TA9A 1WR8A 4BEBA 1H4TA 2Q1XA 4M86A 3THXA 1T8WA 4MHSA 5JD6A 4PLHA 1UEJA 3MS2A 1G20B 4AMZA 1U6JA 3ZHRA 3EG9B 3S81A 1BFUA 4RD3A 1OBCA 1YXMA 5E9AA 3R7NA 5CLLA 3URKA 3ZOKA 3L49A 2V9ZA 2VATA 4ZAGA 5L3SB 1RLOA 1Z0JA 3I9FA 1XCMA 5AXDA 1GGKA 5K0SA 1KYTA 2QM3A 1OFHA 4HRYA 3H4IA 2WAXA 2OCYC 1UJ6A 4G37A 3VNNA 3DBIA 4JQCA 1XZJA 4QOFA 4JR0A 2GJ4A 4LSWA 1RM3A 2IH5A 4OK6A 5FO0A 3NGMA 1O6BA 3CWZA 4UTXA 3KVRA 3GMSA 3MBKA 2G1AA 2HTFA 3IEXA 4UDXX 3FFWA 4XIGS 4LHZA 2VJKA 1A48A 4HGZA 1MFPA 4UCXA 3EDCA 2A3NA 1MO2A 2YWDA 2COUA 3R5SA 3QG1A 1OMOA 4DQXA 4K6NA 2CHQA 5BORA 3KD3A 3IQDB 2IK8A 1GQQA 1S0NA 4MVJI 3PVSA 4CT4B 4WUTA 1PL8A 4O1MA 1ZVVA 2B21A 4CM5A 5H3CA 3DW3X 4QT4A 1IVYA 3PUYA 2PMKA 2JASA 5ETJA 1QWOA 2XE4A 4W63A 1HFWA 3FTFA 3R7LA 3QV2A 4CTNA 2YWVA 2GK6A 4LEIA 3USES 5HRCA 1OY1A 4YCLA 3DXZA 4QXAA 5DASA 3I05A 4NCXA 4L8FA 3EXFB 2PLFA 3PT5A 4ZT6A 3ONEA 3P94A 3LVRE 3H8VA 3I9MA 2VRWA 2R97A 2P4EA 4I7HA 1JAHA 2J5QA 4EYKA 4L3WA 2FN4A 5AJVB 2IU6A 3PEYA 3RJZA 2QMOA 1RYRA 3Q98A 1II0A 2EFEB 5DRTA 4O81A 2WVHA 2V7QD 4X3PA 2XTAA 1HK7A 5E2IA 1OUMA 2R85A 2VA9A 1Y7TA 1OAAA 4FGLA 1MXFA 2WV7A 3EQZA 3NIWA 3LT5A 5C80A 2JLSA 5I9BA 4XQ9A 3AIMA 4BP8A 4HMOA 1WDMA 1KFKB 1AQNA 3ZDQA 2PT9A 2PQ2A 3ESYA 4Q1EA 2PX3A 3LCJA 1OX5A 1G5HA 4O2RA 4HDAA 3U5TA 3U44A 4DS3A 3CW8X 1Z8NA 2AH5A 3FDSA 2J3MA 3IKMB 3S2UA 1C3LA 4NS1A 3P9ZA 4L28A 4OGWA 4R2MA 2A67A 2A9QA 3BXZA 4QWDA 4MDEA 3VU1A 3OQ1A 3BL8A 2CVHA 1PRYA 3TUJC 2QTZA 3LZ6A 2I7DA 2ZM6H 2Y0PA 2D7JA 1SOWA 1NTOA 1OHHA 1ICIA 3QVVA 5GZ3A 4E09A 1MAVA 4P3PA 3GWGA 4XWOA 5HPYB 3G68A 2VYFA 1P1FA 1QYDA 4RQAA 1G8AA 4JJGA 5F64A 4M9RA 3W3AH 1E2EA 1I7LA 1N2IA 2I9PA 1MAHA 1VIMA 4F9EA 2BL4A 2FPPB 1Y9DA 2Y76A 4WLUA 3LHIA 2BGRA 1Q91A 4N0PA 4B46A 4MV9A 4UD2A 2W6MA 2IU4A 1RJQA 4Q9NA 1XTPA 2PMCA 2WC1A 3KQVA 2HDOA 1OX6A 3ZOZA 3BXXA 3FMGA 4FFOA 5JV5A 3A28A 5EP3A 3W8FA 2E6UX 1XE3A 3I0NA 5CFNA 4UXIA 4F5YA 4Q43A 3TBHA 3T5TA 4ZI5A 4NHOA 2KB0A 4KWIA 2HRQA 1N7HA 1Y3AA 1CUJA 2RKWA 1PUJA 4DQUA 2W6NA 4CKEA 1UAGA 4UPVA 4Y2PA 5B64A 3B2EA 1Z82A 1Y1RA 1AKWA 1OBHA 5K4AA 4LJRA 1A27A 4IGFA 1YB5A 3B20A 2P2ZA 1V8PA 2P0EA 2XGJA 2VXBA 1N34H 2QVBA 3P1JA 2OGTA 1IWPB 1W46A 3M9LA 4B35A 4IZ6A 5KTRA 4H6WA 3FPAA 1SB8A 2DBYA 1U0TA 1XWWA 1X8XA 1Z0UA 4ED7A 3JD1A 4WUVA 2JHPA 4OQNA 5SZIA 4Q0MA 4LF7H 3OZFA 3I9LA 3BAAA 3A2NA 1DSSG 4I36A 2G7MC 1QU2A 1TK2A 4DRXA 3ZU5A 2O59A 3NV9A 1ZAYA 2GQ0A 3WZMA 1ZXLA 1VDMA 2WZDA 3L6RA 4TMZA 3T1HB 1M2JA 1BTOA 1HZZC 1W36B 1OLXA 4GS5A 3PLAE 3EVNA 4ZKEA 4LC0A 5G0SA 4YUWA 1UIRA 1F5SA 1FDOA 3ZGOA 1HF3A 1OI2A 2QQ5A 2EVWX 4Z9XA 1TMGE 3WGUA 3KUUA 5TT0A 4TS4A 5D86A 3KSDO 1QO0D 2IGTA 2YICA 3G7UA 5E0OA 2OD2A 5IM4F 2J07A 1QGDA 4PPFA 2QSZA 3TBFA 1PL7A 1JVSA 1WSCA 2QN2A 4BO4A 3QA9A 1L4GA 2CYCA 3DAHA 3INTA 4DNPA 1TAQA 1I2AA 4UM7A 2WA1A 1U2DC 2VVTA 2HA3A 1FRQA 1BW9A 4EDHA 1JQ3A 3IERA 1Q3TA 1I6MA 5F5NA 1EMDA 3AHDA 4CQLB 4REOA 3K1AA 2P6RA 4JB3A 5MN4A 1MORA 5IT9W 1T29A 3VO9A 4B82A 4RYDA 3U0VA 2CKZB 1NXSA 5HHTA 5DW3A 3S68A 2CNLA 3RVMA 2F1RA 4QHYA 1A2OA 1DKNA 2I9KA 3DOCA 3DE2X 4YDSA 3BZBA 3ZQJA 3F3MA 4MYCA 1VGQA 1X7HA 1ORWA 2VHUA 3ZBQA 2GK3A 2Y0CA 5K0JA 2WKSA 4Y9TA 4KLRA 5J47A 2I8LA 2XWQA 1IM8A 1WD5A 4AMBA 1P8AA 3ORFA 5L4SA 3KHHA 2X4LA 5DXJA 2V7UA 2VIIA 2WB1E 1KI8A 2ZVJA 2BV3A 2IIVA 1U80A 3UM9A 1PUIA 3GUCA 2Z5FA 2DZDA 4WD3A 3DDCA 4BWSC 4DG8A 2XA9A 4PEVA 2X4GA 4US2R 1S68A 2J3EA 2XB6A 4UBOA 2W9CA 1ISHA 1A82A 1JFTA 2H57A 3QE9Y 5JZBA 1QH9A 4EO7A 1DAHA 1EAYA 3A8TA 2GD1O 2C97A 5JXHA 4EIWA 3JASA 2IODA 2O2ZA 1ZY2A 4MV0A 3EF3A 3Q85A 1O6CA 5C4GB 1V7ZA 3I5AA 2C22A 5NULA 3MA0A 3UJBA 4HN9A 1KWKA 4C5BA 3UYKA 3C3YA 4NXMB 3M3HA 1E4YA 1MIHA 4C89A 1BE1A 4ZXPA 2IYTA 2P62A 2Z3VA 3C7AA 1TJYA 1I3LA 3UG7A 3TD2A 2AYXA 3O9VA 4IRUB 5ILQA 3SZLA 5IVIA 1MGPA 2MSKA 1I2ZA 1VIDA 3UMJA 2B7BA 1NMEA 1XXHE 3VUFA 3NJ4A 1FDVA 4WW0A 1WTAA 4K6KA 1XLUA 1ZGGA 5IYZB 3KLOA 2RI0A 3EB9A 3BAFA 3GLFA 3H1EA 4YA6A 8GPBA 5IWCA 2X1MA 2H1SA 3UAYA 2C4HA 4YLEA 3EH2A 1F1JA 3OQPA 4WZAA 1EK6A 2G5GX 3IQHX 2X9GA 2PT5A 4A0HA 2B82A 4Q66C 1X9IA 3DDHA 8LDHA 4JP3A 3GFVA 5JS2A 4KXVA 4QVIA 1W4RA 4DIKA 3I9V1 2V7PA 1EQAA 2PH3A 4V24A 4P3KA 4F3RA 3VA7A 1YS2X 1NBWB 4OX9B 4O1IA 3WIEA 1RRFA 4BWVA 1WW3A 4CV0A 2HJVA 1AF7A 4DUYB 2Z83A 2A5YB 3ORRA 3CZ5A 4RVGA 3MFHA 2P6NA 3AG5A 3OPNA 3GLHE 3H16A 2QVCA 3M9WA 1Z29A 5JXJA 5C9ZA 2QX6A 5BVGB 1TTPB 1KZ7B 4KDFA 3OIVA 1VGVA 2B8NA 4AF6A 1YUBA 1JMVA 1UC4B 2R62A 3R5HA 4OJQA 4TRNA 1JZSA 3GCZA 4Y98A 4Q3DA 4UDOA 4CODB 3KQTA 4WNIA 3ZCXA 1M0EA 2IHVA 4O7ZA 2A88A 5J5VA 2D4AA 4OF4A 1CHDA 3SBXA 1I1MA 1A9RA 3INYA 2ORIA 3NBYC 3G2LA 2PGOA 5ALDA 2QAIA 1FZTA 4QUIA 1JDBB 2GN4A 4M9ZA 2JRLA 2UUPA 3U2QA 1ESZA 3ELUA 1ZM2A 5EJ6A 3DMTA 1Y1SA 1PWYE 1KJQA 4E22A 3UJ8A 1V5EA 2FKLA 3K94A 2OLEA 3NBQA 1UAYA 4I50A 1NLYA 4BFVA 3GC6A 4EX7A 4LYHA 3BL6A 4B7CA 1K97A 4MKHA 5C7LO 5EE1A 1BXGA 4PXAA 2F6RA 4HXYA 5SYMA 1UMBB 1L4KA 1U99A 2VQFH 4PWYA 4WN3A 1IB6A 1WXGA 1ZI9A 4KRYA 1SCAA 1C3OA 4LFBH 1QQBA 1IG0A 4DR6H 2OQIA 4X94A 4LYFA 1Y6ZA 4Y30A 4YAEA 4E2YA 2B4KA 3HBMA 3W0LB 2YFQA 3WL7A 4YTEA 3R2JA 2WABA 3ZHVA 5AXCA 4WZ6A 4XB6B 2PSEA 3OKPA 3IILA 4MQEA 3NNDA 6ABPA 3U48A 5IANA 3PFFA 3K8YA 1KVSA 5D5HA 3TJRA 3SNHA 4YT8A 1GG5A 4Q3BA 3KEQA 2A1IA 4CWAA 2FW9A 1K75A 4G0XA 4C6RA 4YPOA 3ONNA 3V8RA 1WTCA 4KQ2A 4B17A 4B4VA 3PWKA 3G0IA 1P6UA 4I5FA 3P4UA 1RLMA 1E0AA 1EBBA 3HU3A 3CYFA 4DNXA 3DGFC 5JFOA 4OL9A 4GC9A 5CIWA 1U8FO 1LI4A 3R6TA 3UWOA 3MYYA 3TLJA 3KWMA 3V1YA 2R7KA 1CUFA 1JFVA 2B7CA 1S7GA 3O5AA 2AYYA 4L95C 3MAJA 4RWZA 4JENA 5KFUA 5DM60 3OE7D 3U6BA 3GTQA 2WJWA 5FTWA 2IUYA 2OCBA 4ZAXA 4ZO8A 1LY1A 4MYTA 1VLQA 2B5OA 3EODA 4DYHA 1AQUA 3ZZMA 3RIHA 3ZE9A 5GWXA 2PH5A 3JAMW 3IIIA 5JLAA 1GVNB 3GTMA 1CDDA 1CVRA 2J7KA 5HQ3B 1A8PA 4BTVA 1WXQA 5H70A 4PICA 4TXHA 4KXFB 4KO4S 2OCLA 3FSEA 4POAA 4TS3A 2CL7X 1GPNA 4WBNF 3RFXA 2BE9A 3ADKA 2YMMA 3T54A 4DZRA 4EG8A 4FMPA 4XB1A 4JJFA 3OZXA 1I30A 4BX0A 4BB6A 4UE3S 3JZDA 5CFOA 5A3VA 2J46A 1KIMA 4PZZA 1R74A 3DF7A 2RGVA 3VTFA 4XYLA 3V1MA 4IV0A 4MHTA 1XKTA 4BN5A 4MR9B 1G8MA 4XEHA 1YDWA 1VE7A 1GGMA 3GLIA 4F96A 1X80B 3GXOA 4CPDA 3KVYA 5C31A 2ZBUA 2DLNA 3HJBA 3GIDA 2X5RA 3HEBA 1Z2EA 3D3WA 1NJ6A 2IY7A 5FTNA 5J59A 5HP4A 3VJKA 1DEKA 5DNCA 1N78A 3VAYA 3KOMA 2EHDA 1NVUQ 4Z4GA 3WLLA 2VCYA 1LVHA 1QHHB 2JGDB 2P2YA 3VU0A 3IP9A 2NNWB 2F00A 1A9YA 4II7A 5AJTA 1NDQA 2WIFA 1N2CB 4YMGA 1JR4A 4IIFA 1O03A 4BNXA 3ZIAA 1XPRA 4U02A 5EHIA 3BN3A 5J4HA 1N6RA 3IUPA 5I7UA 5KTPA 3WR5A 1XK6A 4N5DA 2P1DA 4ZDKA 2C4VA 5AVUA 4M1KA 1E7MA 1SU6A 1W5SA 4MI1A 3Q11A 3AF2A 5IYCG 4F4WA 1X3LA 4MTCA 2Q3LA 4F71A 4K9QA 3KO8A 1OZHA 3P9IA 3I2IA 2J0EA 3PGLA 4CMGA 4IS2A 2V7XA 4WEQA 2J9YB 4KPYA 3B8HA 3G5UA 4D3FA 3ADDA 1HT2E 2A6PA 1M2GA 2R1TB 4DMMA 1J2TA 4DV3H 4KR6A 3V8PA 1E9FA 3K9WA 3GEIA 1XNJA 1JA0A 3SBOA 4RULA 1IN8A 3PWZA 4GKKB 4RNOA 4PXSA 2OP1A 3U37A 4NU0A 4LXXA 3T41A 3IAM6 2XDWA 3A3OA 1A9TA 5L3QA 3ECSA 1LTQA 5I3ZA 2XUOA 2HA6A 1N36H 4INAA 3GBSA 4TQRA 1PFKA 1DMRA 1N2BA 3HDVA 1JG7A 1T5SA 2JGIA 1UDCA 4UAJA 2G83A 1LDGA 5BR8H 4OYHA 3AP1A 2CNVA 1EGVB 1S0MA 1Y5LA 4C14A 2ZSBA 2VHJA 3O9ZA 4ZZ1A 1UMKA 1YZLA 2QD2A 2PDAA 1PD1A 1J0EA 5HDBB 3NOXA 4UNNA 1DEAA 3ZGLA 3AOEA 4H27A 2DXIA 1VBMA 5EWGA 2GUGA 4MQFA 4ZIRA 3THYB 4PSDA 1R0BA 2QLLA 5BR1A 3THSA 2HU7A 1KYZA 4YRQA 1RXUA 3QPWA 1ZNZA 3UFXA 5BWRA 2BM1A 2J3DA 3QVGA 4OHKA 4JLNA 4OYYA 4CLHA 1IG3A 2J33A 2C7BA 1H8HD 2ZUCA 5EP4A 1Z4PX 1QANA 1OKKA 3SMQA 3AESA 4DABA 1PZHA 5IC5A 3LU1A 2E82A 2XODA 2WFLA 1WV1A 2IZ0A 2BFFA 1TF5A 4URZR 2IQ5A 2ZT6A 4TKUB 3QSYA 1XWIA 2J30A 1U7HA 3NHUA 4E32A 1MJGA 4JEUA 1MEJA 4ZPXA 2K7ZA 1P39A 3IUYA 3GJSA 3GTOA 5CB4F 1VZ2A 4HC4A 4DQKA 2G07A 2QY9A 4QJ3A 2GJ9A 4ZCPA 2V5UA 4C0BA 4BMVA 1WP4A 1JKXA 3T7KA 1YI8A 3FDZB 5F4ZA 1PLLA 1U5BB 2XWBF 3TTUA 2WTNA 3KS9A 2ZYHA 3DC2A 4COKA 4LZLA 4BNUA 3E3AA 3EH1A 4MW7A 2FDCA 4D6XA 5CIQA 1PFQA 1ULZA 3KT6A 1PZFA 1E2KA 5JSHA 4AP9A 2RC6A 4DV5B 3DMTC 1VBHA 2GHTA 1YQEA 2WUFA 2N75A 2C20A 2HLHA 3LTEA 3I9JA 4Q00A 4AJEA 2JIBA 5A02A 1U7XA 1U5AA 1SH7A 3D8HA 1AN0A 1MT3A 4G81A 1IBCA 2XWSA 3ONVA 1LWNA 2PO5A 2ZJ7A 4CF6A 1I5OA 1BX1A 1CJSA 1KPIA 5T6BA 3EMDA 2JEYA 4MS1A 4EYEA 2H2DA 3Q8KA 4I1IA 3TSAA 1K98A 1SCUA 4ECXA 1HKUA 3AB3A 3OI7A 4B3TB 1NVVQ 2OFWA 4Z6KA 2BY4A 2QUZA 4FTWA 4KRFA 1SRRA 4DSOA 4UARA 2YV1A 2FWAA 1MVOA 5I47A 3EG5A 3RNOA 4A6DA 4IIJF 4D8WA 3CNHA 3T9DA 5KNBD 2DFPA 1C7QA 1UXIA 2IP2A 1DJNA 3PNLA 2O8FA 3MG9A 4A7PA 2JFXA 2RGNA 3PF9A 2V74B 4LK2A 4E2ZA 5DCLA 2CLOB 3MTEA 4ZDWA 4BQNA 1QRUA 1ZUNB 2BM9A 3UATA 3OAAD 1R7RA 2EKBA 4IRKA 2VDOB 3K5WA 1QPZA 2F3TA 2P2DA 4LQ4A 4N7RA 3X43A 2BM8A 1Z0IA 1PJQA 4CFSA 3C3CA 4MAFA 1IM5A 3UQZA 1KFEB 1L4UA 2W2LA 4BO7A 5BN5B 4WRRA 3UVEA 3WGNA 3LMKA 1X74A 2Q3HA 4DR7H 4RLSA 4HYEA 5E6RA 4ESVA 1E7YA 1WQ1R 3DL4A 3IEIA 5FI0B 4DKJA 4K5QA 1KFCB 1O89A 3VU8A 3EVDA 3EQ9A 3L6CA 2DETA 3SN6A 1VSUA 3OHAA 3C98A 4I3FA 4R2KA 1J0BA 2YJGA 2QUKA 3GZ4A 3W7BA 4E15A 1MEEA 1LBEA 3ZWNA 1C7JA 4F5ZA 3RKRA 1M76A 1KAHA 2B92A 5BN4B 1GL9B 4C6TB 3QBVA 4XQ0A 2VTBA 5AI9A 2WWWA 2QPTA 2OZKA 1K66A 3QWHA 1HTTA 5KX5B 3RF2A 3NM6B 2EKQA 4NHEA 3RWMB 4PX9A 4WZZA 4HUTA 1W9MA 3CF4A 2C2MA 4GZMA 3HR4A 1C0PA 1EH5A 3VU9B 2QAGB 1E1QD 1GT91 4E6EA 1PF7E 5HKKA 2XIQA 1QONA 2BOVA 4XUEA 5D1OB 3I32A 5KG0A 1NNSA 3VMFA 4DLWA 3RSCA 3BTSA 4YUVA 1VECA 3C7TA 1JAYA 7ABPA 1RRCA 1CS0A 5KYXB 1TWHA 2E4VA 1JWBB 4KSCA 1ABFA 4G0NA 3BKXA 4Q15A 1LVUA 4DTIA 1XRJA 5CDUA 4AX8A 4PN7A 1YR9A 5I7RA 1X1CA 5IJWA 4RLQA 4Y18A 4KO8A 3DKKA 1M0WA 1XQXA 4JYAH 4J75A 2IEIA 3FIUA 3DXFA 4HQFA 4J7XA 1SBNE 1R4NA 4PGGA 3FMAA 5ALLA 4P0QB 4JXKA 3AXSA 4I1SA 4NS4A 1RQPA 3NDJA 3MW8A 5ER9A 2RJ3A 4XWAA 5LXTF 4HWKA 4LY0A 2C82A 5KKNB 1X7DA 1AUVA 1EP1B 3B6MA 2B1RA 4UHJA 3VNSA 1W34A 1LDYA 4BNKA 1U3VA 2A0FA 2ASVA 4I9GA 5CRIA 3SX4A 3ND5A 3PUKA 4A8JA 3PNBA 1A5TA 3HCAA 1Q1BA 4ITVA 1DQRA 1ISMA 4EBEA 4MGHA 1AK9A 2HA0A 2QXUA 4DV0B 5LUBA 1UKZA 3OU7A 2F9LA 1YFLA 1H2HA 3L0YA 3I01A 2HGWA 4MWEA 1S8AA 1K83A 3R3HA 1KNQA 3Q8SB 2ZIXA 3M4JA 4JLSA 3TINA 3RK1A 2WOJA 3L4BC 5TY0A 3D5EA 5AYVA 3HN6A 4P22A 1IVSA 1FUKA 1X7XA 3FSJX 1O8CA 4HH0A 2YXBA 1U8YA 2WWVD 3WSVA 1NYTA 5FOQA 3NQ41 3EN0A 1CDZA 1ITZA 3JQPA 2IPAB 3BSFA 1TM2A 1EUCA 4CU5A 3AOEC 3PR5B 1NW4A 3N05A 5FWXB 4RF3A 4O86A 4GX2A 4F45A 2JIZD 2VJMB 2A9OA 3PWSA 2PQ0A 3QQ5A 4M0CA 4RHFA 1O96B 4K0RA 5KAPA 4L76A 5LZ8A 3QBTA 1WUJS 1OA0A 2QLBA 2I2AA 1C30B 2Z56A 1D07A 4DV2B 1E1KA 1GNPA 4A8PA 3GNQA 1QCDA 2Q9AA 4DG5A 3L9XA 4JX9A 4NDNE 3KZCA 5FWNA 4O5OA 2R44A 2QE7A 5DTQA 5CB0A 2CXOA 4OBEA 2GF2A 5FD6A 2O0LA 2VI5A 3A06A 3QKRA 3WK9A 1TF7A 1QH1B 3R5XA 2VSXA 3SDSA 3TN7A 3JQ8B 4OX9Y 1O0CA 2YVUA 4PYQA 5I5XA 4UNSA 3ASVA 1S97A 3GRKA 1DAPA 3W5CA 1XCBA 2QRVA 5SY6A 3VNUA 4F4JA 4RC9A 4RA9B 1GCUA 4CM6A 1HWYA 4B32A 2WJJA 5JNUA 4RHYA 2WWXA 2OHFA 3DO8A 2CJPA 1FP4B 3SHTA 1MB9A 3RC2A 4FOLA 2R79A 3LW7A 4BLRA 2CLIB 4D44A 4FHZA 1R8QA 5GY7A 2RE8A 4R8SA 4PN3A 1IN7A 4FD3A 1ZJZA 4JOCA 2WG0A 4FEGA 3ZHSA 4O02B 3VDXA 2EX0A 4QPCA 5DHQA 2FR0A 3TL6A 3DQQA 1TD9A 5K3FA 2JG3A 3FTEA 1DIOB 5KSOA 4BNNA 2FOLA 1QHNA 1F6WA 3VR6A 1M6VB 3ETHA 4R31A 4Z51A 2YC4C 2GOYA 4AN0A 4XCQA 2HN9A 5YASA 3BQMB 3MR5A 2B7LA 4B0OA 2XVYA 4OQEA 4G25A 4OI0A 1S0OA 1P6XA 2Y68A 3C39A 4N1AA 3A9VA 5EWMB 3F1LA 1RWVA 1V25A 2ZIVB 2F4VH 2ZYIA 3WK4A 1RS0A 4XJSA 4V0OA 2I03A 2X6QA 1WA5A 1ZM4A 1FKAH 4YMHA 2A9VA 1WZCA 1LRLA 1VHQA 3R3XA 1E1NA 3DFKA 2I6XA 4N7BA 3BE4A 5AO9A 1B0UA 5DEOA 7MDHA 1J6UA 4E1BA 3R76A 1Z17A 2RGNC 1U9IA 1NBAA 1WSWA 3I2HA 4O82A 2VFAA 1EZ1A 3K31A 3ONFA 1Y48E 3AETA 3I5YA 3KSUA 3S99A 5U1PA 1PTKA 5A04A 3SI8A 3M89A 4G86A 3BQ1A 5EN4A 5AKXA 1WQ3A 1UJCA 3KAJA 2AN4A 3P2JA 4XJTA 4J9VA 4MUHA 1V1RA 4BVEA 4HK4A 2UUBH 2O23A 5AMXA 4WCDA 1X1DA 3QVWA 2W6JD 2N46A 4YRSA 4LWQA 3N3AC 5JW6A