2YZGA

Crystal structure of d-ala:d-ala ligase from thermus thermophilus hb8
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-ALA:D-ALA Ligase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 79
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzgA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzgA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzgA01
5J2TF 2XD4A 3N8DA 2GLTA 4O84A 4O81A 4O7LA 1GLVA 3MWDA 3RV3A 5J2UF 1KJQA 4HR7A 5BPHA 1A48A 1C30A 5D8DA 5CA0F 4FFLA 1UC9A 2NU8B 4O7WA 3U55A 1EHIA 1CQIB 1GSAA 3AX6A 3Q2OA 4NYEA 3BFPA 1EUDB 4HNTA 3UFXB 1W93A 1OBDA 4O4JF 3BSSA 3U9SA 4O7SA 2W6MA 4I4TF 2PVPA 4EAAA 5JQGF 2J9GA 2W71A 4EA7A 3VPCA 2FB9A 1KUTA 3VMMA 2YZGA 1CE8A 1I7NA 5DMXA 3Q1KA 1EZ1A 4FFOA 5FNVF 4O7TA 4MV9A 1IOWA 2R7NA 3V4SA 4FE2A 2VR1A 1W96A 4FFRA 1EYZA 1A9XA 4C5BA 2CNQA 3DF7A 4ZHQF 1DIKA 4XZ3B 2GPWA 3KAJA 4IWYA 4O7ZA 1AUVA 4ZOLF 5BPFA 2FPGB 2R7KA 2W6NA 2ZDHA 1GGOA 4GGMX 1Z2PX 1KJJA 2NUAB 2FP4B 1KBLA 3K5HA 4M99A 2YWVA 2QK4A 3KREA 1E4EA 2VHEA 4MV4A 4TUYF 2R82A 2W6QA 5IYZF 3R9RA 1BNCA 4YJ2F 2DLNA 2XCLA 1VBGA 4O7YA 3HBLA 2OLSA 1ULZA 2CNVA 3TIIA 3KALA 3TINA 2Z04A 1KJIA 3VOTA 2X0SA 4YAJB 3V4ZA 3OUZA 3MJFA 1I7LA 2V58A 4O4HF 3HO8A 2NU7B 2V5AA 3TW6A 3QFFA 2NU9B 5JH7F 2QF7A 3VPDA 2CZGA 3TIGA 2IP4A 1E4EB 2FPPB 5JVDF 1BXRA 3RUPA 3GIDA 4O7VA 2HJWA 1AUXA 5KKNB 5HBRB 2NPOA 3BG5A 2HGSA 5I47A 2R84A 4O83A 4YJ3F 4MV7A 4FGRA 4O7RA 3ORQA 4O2AF 4FFPA 4DLKA 1EUCB 3JRXA 3MWEA 3NUAA 1T36A 3RFCA 3JZIA 1SCUB 4EGJA 2DIKA 4FFNA 1IOVA 4O4LF 2GQRA 3RV4A 4EABA 4XX0B 2FPIB 1CQJB 4Y8VB 4M9UA 4EGQA 1GSOA 4I50F 1VKZA 2DWCA 2C00A 2PBZA 1DV1A 1DV2A 1KJ9A 2NU6B 4E4TA 3ORRA 2I8CA 2YS7A 2R7LA 2W6ZA 4I55F 5GONF 1CS0A 2GPSA 1PK8A 2CNUA 4YAKB 4MA5A 1KEEA 1Z2NX 4MA0A 3K5IA 5K2MA 3GLKA 3SE7A 4EA8A 1JLLB 2WYOA 4EA9A 4ZI7F 3WO0A 1JDEA 1JDBB 2P0AA 3OUUA 2ZDGA 2I80A 2YRWA 4HNVA 1B6SA 4XYLB 3BSWA 4FU0A 5JVLA 2PN1A 5LA6F 4O2BF 4J6EA 3JRWA 2YW2A 1JKJB 3VA7A 2R87A 1GSHA 1VBHA 2YZNA 3N6RA 3AW8A 2W6OA 2YS6A 3G8DA 3VPBA 3WO1A 5LOVF 5C1PA 4IWXA 4C5CA 2YZMA 1PX2A 4XYMB 1WR2A 3K3PA 4MV6A 2YRXA 2YZLA 3KAKA 3G8CA 3BSYA 3I12A 4FFMA 3HB9A 4O82A 1OBGA 1C3OA 4WD3A 4RZQA 4O86A 1KJ8A 4MV1A 4IIJF 4DIMA 2YL2A 2I87A 1M0WA 4EG0A 2W6PA 3R5HA 1M6VA 4YB8B 4HNUA 3JZFA 1UC8A 5LP6F 5LYJF 4IZOA 3LP8A 5CAEB 1Z2OX 3R5FA 5HV6A 4O7NA 4WBNF 2VQDA 1KC7A 3WNZA 4L1KA 2Z02A 3E5NA 2SCUB 5EZYF 2R6FA 4HQ6A 5H80A 5C8YF 4M9CA 4QSHA 2R86A 2YYAA 4TV8F 2GQSA 5CB4F 4TV9F 4IHJF 2V59A 3ETJA 2CQYA 5KX5F 5BMVF 4O4IF 3LWBA 3R5XA 2R85A 2W70A 1B6RA 1M0TA 4M98A 3ETHA 3R23A 3U54A 4ZQIA 3TQTA 5JQWA 2ZDQA 4MAMA 5C1OA 2VPQA 4MV8A 5LXTF 4MV3A 4C5AA 2R7MA 5CA1F 2DZDA 4ME6A 3U9TA 4YBZB
chains in the Genus database with same CATH superfamily
5K9ZA 2EP7A 1HDYA 2PCLA 3ESQA 3QVVA 4FFLA 4QXRA 4Y1FA 4UUGA 2DHDA 2Z6QA 3RG8A 3TG8A 1ZM2A 2G1KA 1NR7A 2HWWA 3UFBA 1RTTA 2LCFA 4GBMA 4EJFA 2OH2A 1ZUWA 5H02A 5ICCA 4QFMA 3TY8A 2W0MA 5F52A 5T6MA 3K1ZA 1EVJA 1WPRA 1RRKA 3AO0B 4LSXA 3U3KA 2F8SA 4B87A 5AW5A 4LYGA 3F6YA 2CKDA 3KOYA 5FTJA 2OBNA 3RABA 4HXGA 5EWMA 4X84A 2QV7A 2LW7A 1NUUA 2CDAA 2R5NA 3A3NA 4JLPA 1XWWA 3K6RA 3ENVA 3HGQA 4KXLA 4O08A 1JS1X 1KYTA 2AG0A 4WADA 1RXYA 4NQZA 3R7WA 5A6SA 3AL0C 1L0BA 4YRGA 1RXVA 4QEKA 3GNQA 1HE5A 1BMFA 3B3QA 5CA1B 4J4TA 3ZG6A 4M2LA 2CDBA 4MWCA 5ALKA 2IP4A 1L1RA 5CJJA 3RAGA 4LKRA 4Q44A 1FP7A 4M83A 3GLFB 4INJA 2Q3MA 2IMWP 4N47A 2C3OA 1E5DA 4MQEB 1YHZA 5KMGB 3L7KA 2YHIA 3FUUA 3I9V1 4X20B 3RF2A 1TZBA 4YGYA 1DIBA 2VA3A 4KYTA 3PWTA 3AR7A 2ZUUA 3BXHA 1A7JA 2ZE6A 3RS9A 3RU3A 4FKBA 2ZPTX 3KHLA 2DHQA 4XX0B 4Q1DA 4BY7G 3TNFA 3E9MA 2X3YA 1CF2O 2CL6X 5EKTA 4E14A 1DV1A 1XCMA 1OV6A 3PRHA 4NARA 4BLSA 5DBGA 4CLOA 6LDHA 2AGQA 3VDRA 5ALYA 1ESMA 1I4OA 2QVBA 2DPGA 1HT0A 4UCVA 1R9GA 1ZGZA 5FUQA 5IK2A 4GH5A 3BZUA 3EAQA 2EXXA 1P16A 1G16A 4A6XA 5FWNA 5H3LA 3C7DB 3O9VA 3NJ8A 3D4IA 1CUSA 3B1WA 1Z5VA 1YUNA 1E6UA 1SC6A 1DKUA 5DIZA 2JJMA 2P3LA 4ZQFA 1FCJA 3ES9A 2VDOB 4UU0A 4IGIA 4DDUA 3T7KA 4N0MA 1ZRSA 3LZDA 3UAGA 2FGJA 4HGNA 3IC5A 4I8IA 1S5PA 3SKYA 3IEKA 5DYTA 3N41B 3FSGA 1XFDA 2NNWB 2V0CA 2ZBUA 4GM4A 4JX8A 4ZJUA 3EZNA 4X1YB 4DWWA 2GVDC 4UAJA 3U19A 3F6BX 1C9JA 3O2NA 1I0IA 5JI3E 4XGQA 3DJYA 1GL9B 2XTNA 4IDFA 5KQRA 1KJ8A 4G5QA 2VWGA 4QXAA 2PMZA 5LZ4A 4GPD1 1QRUA 3GHYA 4MRNA 1Z2OX 2FUNB 5IWCA 1MVOA 4L1KA 2ODNA 2DPMA 5IKXA 3TOSA 2CQYA 3CYFA 4S1TA 5HKOA 3IR6A 4DCTA 3NS7A 4QNMA 5B3AA 2VHYA 3WAKA 1XEFA 4ZANA 1ZSVA 4D9BA 5AW0A 1XCBA 1EFDN 1JQDA 5B7NA 5LOVA 5C5EA 3A9TA 2BRUA 3DKVA 2Q8NA 1JQLB 5C5JA 4IJ6A 1S8OA 1E1DA 3JCZA 2KWIA 4C7JA 1QXSA 2AW5A 3B1KA 5IH7A 3TZQA 1J5EH 1YQUA 4LJ9A 4X94A 2Y1WA 1DZIA 3WE7A 4U39A 1RYEA 1ZESA 3QEBZ 3VVMA 1EFPB 4GL2A 4I4TF 3OM9A 3LD9A 3KM0A 2ZB3A 1DEXA 5ECYA 2NWQA 2FB9A 1E20A 4ZCPA 3IPRA 1W35A 2CLEB 1W4LA 1U8YA 2J46A 2QRUA 9MHTA 3FIJA 4G9BA 5E4TA 1IUOA 2VT2A 4TWAA 1FFAA 3GTGA 5KWIA 2ZB2A 2ZATA 1O95C 3W3AD 2VHUA 4YDSA 5LCXA 4DQLA 2VNHA 5HM8A 3NAQA 1HURA 1XEWY 3MS7A 1PT8A 3ILVA 5B7QA 2DFNA 4RK0A 5G0TA 2HA6A 3IAS1 3WAJA 1PL6A 3FOCA 3LL4A 5KS8A 3DVRX 1NSFA 1XG5A 4FYXA 3CB2A 4ZI2A 4MV4A 7YASA 1C7FA 3NIGB 3FAKA 5KFWA 1V8PA 3BL6A 4PGMA 4C03A 1Y33E 3WWOA 4MS1B 3OJ0A 5CR9A 1IN5A 3AZOA 4JXKA 5CB8A 4DV0H 4WKNA 1KS2A 1Y4DE 1KFEB 1EQAA 3IUQA 1DIOB 1V35A 2ZS8A 3L0ZA 1GT6A 4Q47A 1MO5A 1L4NA 3Q1LA 3UKOA 3CZ4A 5TNXA 2G7ZA 4LYAA 3OVMA 4C78A 2GJ9A 2VYVD 3ZE0B 4CDNA 4IR1A 2NPOA 3R8CA 3PHLA 2RGWA 1W8DA 3V32A 2FEWB 5JQGB 3ZS8A 4LE2A 3HV2A 2O48X 5FWYB 2WD7A 3MRVA 5A03A 3HUUA 2I34A 3DZBA 3QE9Y 4TTTS 4XASA 3QSGA 4BPRA 4P4SB 2PRYA 3NTVA 3W90A 3OQJA 2FWMX 2HRCA 2FX3A 4FBUA 3UO8B 4CR6A 5KQPA 2XXAA 3CWQA 5HUQA 1EWTA 1QYIA 1ZM7A 3ADDA 5EE0A 1C3EA 2FR8C 2CNUA 3U7GA 2D0DA 2OM2A 5ALWA 5AKEA 1I2ZA 3C14C 5JSHA 2LUOA 1E58A 4LVUA 2FZCA 5HMMA 1JLHA 2IYLD 4ER6A 5KVAA 1N0HA 2PKRA 3OY7A 1V95A 2H1RA 1UKYA 1LDMA 3PB3A 2I4MA 1RWVA 4XYMA 1J5EB 2GZSA 5E4JA 4MKIA 1NWHA 3ENWA 1URPA 4FU0A 2IL1A 4CN9A 3NTRA 2VFAA 3MC1A 4JLAA 3TL2A 3PDCA 3PPYA 3FI9A 3EE6A 1W4AA 2XVZA 1A8UA 2GCIA 2P1DA 3PW2A 2W37A 1MU0A 2B3DA 2YN2A 3JPYA 5L9XA 1TJ5A 3H6HA 2C2HA 1DC8A 5DBHX 4HDNA 4JU9A 2OP0A 2RI6A 3VC1A 4R9UC 4HEHA 4DMLA 5JI2E 2B63G 3OPYA 4UEQA 1V16A 1PT5A 2ZS7A 1M83A 4KLCA 1CUAA 2W2KB 2P8JA 1WU8A 3HU1A 4D6YA 4I1PA 1G3IA 3CBGA 1S9HA 4LJ7A 3S1SA 3SPXA 2PUAA 4TV9F 4Y2HA 4PXYA 2UXDH 4MAAA 4WI1A 4TTQA 5AVTA 3WG9A 1XZAA 4KTTE 1AHPA 2GCGA 2JGNA 3UHFA 4MK4A 2WYIA 3UJNA 5DTQA 4CFSA 1YA6A 5I4CA 3L8MA 4IJ5A 4FHDA 5LLSA 4RHYA 1ZM9A 2VVTA 4LF4B 3IDOA 2OV3A 3FYUB 2R2GA 5A5VA 5HX7A 1ZWKA 2C99A 4BYMA 3MT9A 3OTQA 3TOCA 2XCIA 4W5RA 1TJ4A 5AH0A 1CU1A 4C6TB 1C0EA 2WE6A 2FQYA 4OLJA 2DT5A 4DPLA 1CVIA 3K0KA 4YJGB 3BTSA 4KG7A 2RHHA 1TKAA 2QYZA 3RAQA 1P9LA 3MWDB 1M2WA 3GJ6A 4Y2UA 4IHQA 3K1TA 4NBUA 3CZCA 2AGOA 1VMDA 3U1VA 2NP7A 1EYZA 4AMYA 4WCFA 3PFCA 3BJRA 2P78A 1E1YA 4GO1A 1VHLA 2VWQA 1DIKA 2AN3A 2JFNA 1N4DA 3TL6A 2Q0HA 1LLUA 4FBLA 3SYRA 1M8FA 2PX0A 2ZE7A 4B2LA 4POOA 2G1UA 3FDFA 2FK7A 4C08A 4RAQA 3FZQA 3E9YA 3N75A 2N75A 4JBWA 4BNUA 4JYCA 3FTPA 2QW8A 3UIEA 4GE0A 2FU5C 3ACBA 3LHDA 3T3HA 4XQCA 3U6KA 1H5UA 3O94A 4PBRA 1AQUA 4BP9A 3KQUA 3HOVG 3QFSA 3ZI7A 2PKCA 4B3IA 5B5SA 1E3JA 1FTNA 3TMKA 3ESAA 2KQUA 2BJVA 3QU4A 1L3CA 3DYBA 3FPCA 4MRSA 1IY1A 5BUQA 4ACBA 3MQ2A 1HDCA 4J0FA 5FTMA 2H1LA 4R1UA 2C2DA 1IFXA 4J8PA 3UANA 1MNQA 1T35A 3PGXA 1A9OA 4YX9A 3VPHA 3GRKA 3FETA 6Q21A 1CK4A 3PDHA 1E2KA 4N49A 1YDMA 3PTZA 3T52A 2YWJA 2Z5VA 3W4IA 2VZ0A 5C4XG 1WVGA 2GLUA 2WSBA 1PJ2A 4MVCA 1CD5A 4I81A 3DOFA 1V0JA 1HDGO 2JB9A 4BE4A 3LDUA 3LDAA 5L6MB 1J9ZA 3HB5X 4NLGA 1O77A 3TTSA 3G5LA 4X97A 3N5KA 2FLKA 4YRDA 3ASZA 1EFRA 1SHKA 1D5CA 1WM1A 4X8LA 1HGXA 3QOWA 2E37A 5FOWA 3T7TA 1IBSA 4ECXA 1LF5A 1DAIA 4DIBA 2D7CA 3D7LA 3RYHA 1UBKS 4G24A 1AS2A 5GMOA 2JHPA 2YOGA 4QODA 3SLGA 3RAEC 2H8GA 4D4KA 2I22A 3JWIA 1P1FA 1SUPA 4OH7A 4DVGA 1NNUA 4ZYVA 3AUUA 4RPJA 1Q0SA 1PX2A 5KSWB 3X1MA 1JE1A 5LOVB 1X80B 1SQGA 4ZWNA 3CZQA 1FFXB 3B36A 3O4RA 4GZ3A 5EYPB 1ZCZA 3NWJA 4O1MA 4RX1A 1NJ6A 4WGGA 3S2UA 2CMHA 5EERA 1IULA 4X1IB 2WY2D 3LP8A 1EA5A 4CTOA 2F48A 5TGDA 2IOQA 5FX2A 5DLPA 4GE3A 3WLFA 4PINA 1T2DA 4KFRA 4GBGA 3BS4A 5IWAH 3AR9A 2C1EA 4NH0A 1XTZA 3UWOA 3SGIA 1B14A 3M5DA 4NDZA 1QR2A 1GQRA 5ALUA 2FHSA 1YS7A 4M8NE 1RHRA 4LJ4A 3GUVA 2ALZA 1FDSA 3EDYA 3RB6A 1SCQA 3GFOA 4G4IA 1H22A 3N8DA 5BNIA 3HXMA 3D1LA 3VDMA 4TZTA 2BT4A 3SWWA 2CLFB 4C06A 2W6JA 1VZ3A 1AB6A 4QUKA 3TAUA 4NU8X 3MCUA 5T14A 3WGNA 5ES3A 4GKVA 1PBTA 4RU1A 4MRMA 4CLDA 1ZJWA 3LGSA 3VPFA 2Q7DA 1MOQA 2X8JA 3SIXA 4ZFNA 1WB9A 2TMDA 1L5SA 3IAXA 3A04A 5ALSA 1OH8A 3VHXA 2OQRA 4CV3A 2I66A 4ACAA 4JGIA 5DP2A 4LSMA 4EZIA 5GGXA 1OFUA 4YFYA 1EHCA 2ZWPA 4ZQGA 3FX2A 1DAEA 3MQFA 4C5BA 2QAJA 1ZW1A 1NBMD 2WC1A 5A1TA 1P61B 2OV1A 3G17A 1Q74A 4IIHA 1WS6A 1SUFA 3RRZA 1JQJC 2HCBA 1V1MA 5KFHA 2VDUE 4GP7A 4BB5A 4U7TB 3HXPA 4KPGA 3RBEA 1M72A 2J07A 1YGYA 3UUWA 2QTTA 4DLUA 1UJMA 2FPLA 1DO0A 1AUQA 1VHDA 3NO4A 1D04A 1E7RA 3A37A 3G59A 3OZAA 2VAVA 1GPKA 2PG3A 1X8XA 3A36A 2ASLA 2VA8A 4NV3A 1EM6A 4QJIA 2DEUA 1M1YA 1TQ6A 3RREA 2VQSA 4EBCA 1GUYA 3SZRA 3ROXA 2CJPA 2ZRAA 4YJHA 2IZ5A 3GTQA 4E3ZA 1AQIA 3U16A 5JAPA 4J91A 2PH7A 2RHMA 1MG5A 4KFCA 3KLOA 1PS0A 3FLMA 3UM9A 4ZHSA 3K4PA 2MYTA 3CF2A 2XDAA 3OICA 2APJA 2GA9A 1UJ6A 3IDAA 4ZHQA 1PZFA 1NW3A 1B93A 3V1UA 2ASDA 2ZI3A 4Q3LA 2Q4TA 4EYIB 1QWOA 5SZIA 2O2JA 5JWOA 2VQEH 4JV5B 4GX0A 3L1KA 1BE1A 1JR3E 1IN1A 1N3IA 4MYHA 1NJSA 1KVUA 3PNBA 3CRQA 4JVMA 3K3VA 4JOSA 4G8CA 5K7SA 1YVPA 4M54A 4DUGD 2ZSEA 2ZITA 2OK8A 2DBVO 4WSOA 3IHLA 2YFYA 4FYJA 2ZAOA 5HF8A 1DEKA 1DAHA 5C51B 2E4YA 3HXKA 1KJZA 1EIZA 5I3ZA 2DJ5A 2YUTA 4UASA 3BWYA 5J1SB 5E6SB 4W8HA 4QW9A 4GOJA 3OPYB 2P9FA 1PK9A 2R7ZA 2IHJA 3AB3A 4D3XA 4A3GG 1YJBA 4RVNA 4FCCA 3HFRA 4DABA 4JJEA 3G85A 4TKZA 2F1RA 2CYBA 2FVXA 4KQGA 3LHKA 4JLUA 4Z5XA 2HBZA 5FO1A 2ZB8A 3UAYA 4J3NA 2QN1A 4IP0A 1CF9A 5E2IA 3FN4A 5B7PA 4OO3A 1LK5A 4JH0A 3B89A 5K20A 4QG7A 2R3SA 5ESDA 4GS5A 4TQGA 2XKBA 1X7YB 5LBTA 5F51A 4LOAA 3EMDA 4IWXA 4J9KA 3FGOA 3BTUA 3I9LA 1RHKA 4MWEA 5DW0A 4Y67A 3X3HA 2VJLA 2R60A 3G2IA 2RIPA 3TDNA 1E3MA 2NZVG 1T1IA 5L8VA 3QVMA 2JAQA 2AEFA 3MJRA 1ECBA 2BLNA 2FRDA 2D5IA 4KFUA 1WKVA 4KAXA 4RD6A 1LZKA 3T5MA 3KJIA 4FR0A 1H6CA 2Z3WA 2QTBA 3ILYA 3U56A 2WPDD 2XKKA 1M2NA 1M2OB 3ZWXA 4YBZA 5EMLA 4EKIA 3HK2A 1C3OB 2CVZA 3CUWA 4KB5A 4QLOA 3N43B 1FUYB 3LYHA 1GFSA 4WKCA 4KO8A 1H8ED 1F9AA 3I5UA 5BV7A 5E6UA 1II8B 2J5QA 2FX5A 5KG5A 4QUAA 1Z5OA 2ZB4A 3ISVA 4F4ZA 3VC3A 3NPMA 4BV3A 4U7WA 4MV3A 1O87A 4ILEA 4ON9A 1UWLA 3NETA 1YHYA 1VECA 2JH9A 2EGGA 1PI3A 1VP3A 3IL2A 1SR8A 4C0BA 5IDQA 1IQUA 4BP3A 3C3PA 4OAPA 2H07A 3GJ4A 4EL0A 1EVLA 4AWBA 5ER6A 6ADHA 4U2BA 4X92A 1K7FB 4ZYYA 4RL6A 3G2OA 5GIOE 3I45A 3IPLA 3T1HH 3NFRA 3U4GA 1KJWA 2JCYA 4IF4A 4WBNA 4F71A 2OR3A 3ZWVA 1T8TA 5H9WA 3O93A 4WZAE 3ZHQA 1Z2CA 3FVWA 1Y9ZA 3GVXA 1JB9A 3S8EA 3ODGA 3WVNA 5LYJB 1HPLA 3HL0A 4N3NA 2C8VA 4BGEA 2KJQA 4KAAA 3NH9A 2R7KA 1IDN1 3QF4A 1XRLA 1KOFA 1T2UA 5A4AA 4BVAA 2W8KA 5ETJA 3EFOA 1C1XB 1XF9A 3WMRA 4ZAFA 2XYHA 2XWPA 3NBQA 1PEYA 1UBNA 2WIGA 3V4LA 2BFEA 1WZIA 2V7WA 2Z1DA 2YYSA 4F1WA 2J7PA 4EP1A 4AD8A 5H81A 3S27A 1JEOA 2WU1A 3TQFA 2YQ4A 4MVJM 1E7QA 3IH5A 1KO8A 4PPFA 1GCGA 2BVNA 1E2FA 3Q0IA 2EKLA 1ZUNA 4DV2H 1KRHA 3RNOA 3Q5EA 2R2AA 4BZXA 2VJAA 3GT7A 2HX1A 4D4MA 4NCAA 4HP8A 1MZPA 1Z4JA 5F7JA 1RLOA 2QTHA 4D9JA 4P7GA 3RYHB 4REQB 3ZHOA 4YRFA 4OHYA 2XCSB 4L5IA 3SNHA 3GMDA 3TW0A 3AY6A 4JQCA 4EHDA 2OQVA 1DAKA 3WFZA 3DCNA 1G18A 1FZTA 3C5WP 4MW1A 1SNYA 3N28A 1YKGA 2VBGA 2YN0A 2ILVA 1OXBB 3KB6A 4QC2A 1QUEA 2ERXA 3V1KA 3V6HA 2FQXA 3OEEA 1B0UA 2YXDA 2AFVA 1SUCA 2LIPA 5FPOA 1XZGA 2YY5A 2VNKA 3U61B 4F9FA 4IINA 4BNTA 1OY1A 1AY0A 2H2HA 4CIYA 4CI0B 5BT8A 1TUBB 4TYWA 5KT7A 1OHHA 2ATIA 1M10A 3CNEA 4DV5B 5LUAA 2DY1A 1X3LA 4XUEA 2IEAA 3T95A 3T1HB 3CW9A 2YWGA 1M1NA 1W52X 2NZYA 3ZWAA 4EHKA 1KIFA 2QLNA 1B3RA 1D2RA 1WETA 5KTSA 4RLQA 3P9RA 5B2FA 3P7MA 1NMEA 4GZLA 2AX3A 2PRSA 4PLGA 3T7SA 2WWFA 3KPYA 4GLBA 3FDJA 1N0WA 1N9KA 3C8HA 3OFND 5IPFA 3PUXA 4JJAA 1JEQA 5EWEA 1IE3A 4NJMA 1FDTA 4DUYH 3ONFA 3H40A 1KK0A 2HI0A 1Q6YA 3UJPA 3JZFA 3RVKA 3AJAA 5C81A 3CVVA 2AEJA 4MP8A 3FKQA 2XCTB 3WZ2A 5BQFA 4DSZA 2G40A 2BTEA 3HCWA 2QPOA 3TZ6A 3SG0A 3WYNA 1DHTA 4WCFC 1DP4A 4J0DA 2XOKD 3F7NA 3I1YA 3DZHA 1ZXBA 1W36C 3MJSA 4FEAA 1QHHB 4QU0A 5HJ7A 4Z0TA 2HHAA 4E0BA 4GMHA 1KMHB 1WB5A 3ZE9A 3ANNA 4ZVLA 3KZOA 5F21A 3O4IA 3R9WA 4EEQA 2MSEB 3MJ4A 1T94A 4DV2B 4O81A 2QUZA 3KXPA 1GLVA 4UPVA 1X87A 5E1OA 4JLDA 2PU7A 4HI0E 2FN7A 3I2YX 2R44A 4F5DA 2TRSB 3QFHA 1TA8A 4Q1BA 1EWYA 2Y6UA 1EAMA 1N2ZA 3DP9A 3U13A 1US8A 1CDOA 4U5QA 3H3JA 4RLHA 4MV9A 3ZD8A 1C7RA 4H7DA 4IIEA 2XSZD 2XZDA 3AR3A 2YJ5A 1T6ZA 5F35A 3O21A 3LGAA 2EVWX 3EG5A 2V8OA 1W1WA 1VL1A 4RZ2A 4NHOA 3DZKA 2O59A 3UZUA 4NBLA 5KFOA 2P41A 2IU0A 1RYMA 3V3TA 1JHYA 4PSDA 3SVZA 4P3KA 1PW5A 5CCDA 2OXCA 4P86A 1JHDA 3TUIC 1GPWB 2C8LA 5CA1A 1N5KA 3L05A 2C88A 3X1WA 3WGHA 4EHHA 2RGXA 4KR0A 2BI8A 2QGNA 3BWVA 5DNUA 3OWOA 1U0TA 2QN3A 1D3AA 4EFNA 1QGAA 3R3ZA 3GLFA 3O4FA 4HHEA 4RUKA 4XLZA 3A6KA 3ZIAD 3DKIA 3GCWA 4QARA 4MQEA 1WXQA 3AUKA 3CZAA 3E0XA 3MELA 4DR2H 5KG7A 1HFJA 3H97A 2P68A 4X20A 4EHFA 1IWPB 2OE2A 3QFFA 3WA7A 3PFWO 2AC4A 1TADA 2FZVA 3BQMB 2JRLA 3TDMA 4XX0A 4KK3A 1X42A 4N3BA 5I47A 2GZ3A 121PA 1KA9H 1DKRA 5KOYA 4WDQA 2EIYA 3M4NA 3AEXA 3D3WB 4GSLA 2DB3A 2PTGA 3TQQA 5DHPA 2J6SA 3NGMA 4XCXA 1CDDA 1RKBA 5G4KB 3VSCA 3SP1A 3KKPA 1T0PA 4F4IA 2ZM6H 1KPGA 2QPAA 5HNKA 5D3QA 3CLVA 1QH8B 5FOTA 2C7PA 4RV5A 4HNQA 1P6UA 4HC4A 1PN3A 5IVPA 5FTNA 2NU6B 4TLAA 2QLMA 3B6IA 4Z0HO 3LHSA 5BSHA 4JJKA 1I6UA 1E6LA 3GJ8A 1HRKA 3G5UA 3CCBA 2FMIA 4G0QA 3PYXA 4BJ6A 4W9NA 3ZWPA 4BUCA 1JU4A 2IIBA 5JHHB 2IUUA 3RWOA 2LGJA 4R41A 4ZZIA 4QQRA 2QTCA 2ZWIA 1SUSA 2JIOA 1GQQA 3EXIB 1RHQA 2A7QA 3H20A 5F33A 1HDRA 2RBEA 5DH9A 4X1YA 1MB9A 3IT1A 2VYND 3G0HA 4R16A 4TMXA 2DPYA 2NOAA 4BNVA 3AILA 2DJIA 3C7CB 1HO3A 3PNVA 1RXEA 3WYDA 2V74B 3W5VA 4ETSA 3STVA 5DVZA 1T9ZA 3I23A 4D56A 3S70A 4MA4A 4BRZA 4KQXA 4I1YA 4BO6A 4JL6A 3AKYA 1DRWA 1RAGA 4OTZA 3DE4X 1Q1ZA 4ZDKA 1MRSA 3QTLA 4XSVA 2BR5A 3JTEA 4TLBA 3IOYA 3NNDA 1M0WA 2QG9A 3DLCA 2B8NA 2PX3A 3SR4A 1WXFA 1SBHA 2MINB 3L0BA 4NQRA 3SSMA 2GPAA 2JF0A 5L1LA 4EO9A 2F67A 4QDKA 3HRHA 4URWR 1JEDA 4A3IG 1V71A 2Q4OA 3SHWA 1MP0A 4ZTUB 3BC1A 4DR2B 5BMVF 2CSXA 3UV7A 3TI9A 4DNQA 4CEIB 1IZ8A 4COOA 3IV7A 2C4WA 1FUEA 2BGGA 4MQFB 3T41A 1RKXA 4OHPA 2ZIWB 3M70A 3OAAA 1F9EA 2AG8A 4GI1A 1UDXA 2H59A 1JWAB 3BZBA 2BKAA 2F1JA 1NFFA 3ZHVA 3R7NA 4A0HA 3EQ9A 2EFYA 2IXGA 1PZNA 2J6IA 1PR1A 3NBYC 4BL5A 2GEFA 1FFCA 1XI2A 5JTTA 1SJ9A 3OQNA 2X4DA 2A1TS 2F3TA 4U6NA 3N2EA 2A59A 3L7AA 1X9GA 3JQCA 4XUGB 1AQJA 1MTZA 5ALIA 4Q24A 3PQCA 4G0UA 2ZM6B 3PX7A 3LE8A 3C8ZA 5AESA 1DX9A 4UCRA 4Z51A 1RE0A 3S5UA 5GQSA 4H16A 2R7NA 4BTEA 3UB4A 1IN7A 5L3VA 1RJWA 3C0FB 3B6MA 2WV9A 3G2KA 2HCJB 1UPAA 4Q9LA 4MS1A 3IKLA 3BDIA 4IWYA 3H9UA 1YFJA 1GTSA 2H08A 5FLEX 2AFIB 4A16A 2EHJA 3UQ8A 5K6AC 2JFPA 1NHGA 2D2VA 1MB3A 1PT6A 1KBLA 1YFLA 5GGYA 3I9FA 3C3EA 4M1MA 3U3JA 4HVLA 3AWDA 4LE0A 5CBPB 1UMCB 4IDBA 1Z68A 2P4QA 2MSNA 2JH8A 5KAMA 1I32A 3S81A 4E21A 3HABA 4AF7A 5JEDA 2JGAA 3RU7A 3ZU3A 2OUIA 1J39A 1IZYA 3KXLA 3SOPA 5AQ1A 5JQGA 3RPEA 1CIJA 4IJQA 3GFRA 2MDTA 2QT0A 1AKVA 1IIBA 4G1EB 5FWYA 2D1TA 2NU9B 3B48A 2SECE 1XSEA 4BKMA 4AUNA 2ZSKA 2JA7A 2I29A 3GELA 1RYZA 3UJ6A 1EXMA 2DKOA 3QWBA 4ZAXA 4P4SA 4JUDX 2P4EA 1OW3B 4DMRA 4LISA 1JDUA 4BCBA 1DS6A 1JYEA 3K20A 3OMLA 4AUEA 3NIWA 4A8JB 1MRZA 4Q02A 7MDHA 7GPBA 2QD3A 3K9NA 3ND5A 1VG8A 1NBEA 5I8WA 4PNEA 1N0VC 1KGSA 4A3CG 2FPWA 1GLGA 4J7AA 4ZMRA 5LMZA 3ASVA 2GZ1A 4IIBA 3W6UA 2X1HA 3EZLA 3CN7A 4DQ0A 1GLNA 4A0QA 1TIPA 3IVAA 5DX0A 1TJPB 3NHJA 4EI8A 3OWXA 5I9MA 2DQKA 3PKIA 3HYSA 4URYR 3DC2A 3AR6A 1V45E 3KZNA 2WICA 3ZLTA 1NJ1A 2YBDA 2C4TA 4ED0A 2B1RA 2D1SA 4LX8A 4O29A 1MGPA 1QQAA 5G1OA 1ORIA 2FUCA 2RGNA 3GTKA 5AW7A 3E53A 1W6RA 3W8EA 2OV4A 4KKXB 5FF9A 2UVQA 5AYVA 3AHIA 1ULUA 4IRMA 3UK7A 4ASUA 1IATA 3W8DA 2GEUA 3G2NA 2HXYA 2PSSA 3GUHA 1A8PA 1GYQA 4NWIA 4AQDA 3TUZC 1EB8A 1XDSA 3IQWA 3O7WA 1GZUA 1YQWA 4C04A 4ECWA 4E15A 3PEWA 2W2KA 4W5QA 2OC4A 3ZGNA 2K87A 4YA6A 4Z1MD 2RHBA 4MWDA 3N0WA 5HJ2A 5JYEA 2VYQA 1YB6A 2YXPX 4I46A 3RSHA 1M34E 2Y99A 2AU0A 1F7VA 4U7JA 5TE9A 4H1HA 1QOPB 1Z63A 1GAQA 2AVNA 3LWDA 1ORWA 3E1SA 2VDVE 2QA5A 4JYPA 2SCUB 2X5NA 4X62H 3EUFA 2QRNA 1O0SA 3RBDA 1QP8A 3WQBA 4GI3A 2BUCA 3ZWYA 1NW8A 2G5PA 4ESHA 1CUUA 1US8B 3OZGA 2ZCJA 1C7ZA 2H29A 3FYUA 3G2HA 3AY7A 5AVYA 2P91A 1E66A 3TKAA 2GJ8A 4Z1OA 2A94A 3ETHA 3DMYA 4C6TA 3W2EA 5CLJA 3STYA 4HN9A 3H0KA 2FZLA 4KUEA 4YJGA 2GFIA 2Z6AA 3DMHA 4F4XA 5HFAA 1CC1S 1SKQA 4OHFA 3EXEB 3MWDA 1KI8A 5JR3A 1SPXA 2G5TA 2HIMA 4IIJA 1UQRA 1WSCA 4LZZA 1P9RA 1X2EA 2I2AA 3MG9A 5D87A 1W0KD 3DB1A 1M8JA 4KMRA 4TMFA 1Z18A 4OQNA 3DBHB 5AOAA 4YUVA 3ZCSA 3RJ5A 1PR5A 3UOGA 3DHVA 5T3YA 1SU8A 1RWOA 4KACA 1DT5A 1EGAA 4PRKA 4TZ6A 1SIUA 3L04A 3E1KA 3GA5A 1UMBB 3BMQB 4KQEA 2E87A 3HN2A 1TGVA 1BXKA 1DKOA 4D44A 4M0CA 3RVLA 1MABB 1GGFA 1RQNA 1T1EA 3ZBQA 3M3PA 4MMZB 2NO9A 2POQX 3LCCA 2OAP1 3OHBA 3EF0A 3N7TA 2NP6A 2E9SA 3Q3VA 4IHJB 3D8UA 3IUNA 2VBCA 1KI6B 3HUFA 2XIQA 3EF3A 2IHVA 5I7VA 1I1HA 4J3JA 4JLOA 3RVPA 1FVHA 2PMKA 2Y68A 4UAVA 5L1KA 5IXSA 4HYTA 2IEYA 5F2NA 4F8JA 2UVDA 1AHNA 1B0ZA 3HSKA 5FYQA 3WWYA 4RW0A 1UT5A 1MRNA 2FUG1 2Y4OA 3T3GA 4B0PA 3L8HA 3QKTA 2QENA 2NT3A 3V4VB 1WCMA 3AQIA 5FTKA 3CR8A 4LOKA 4BLWA 3VOAA 3ZEIA 5BV1A 3I04M 2A0YA 3VX3A 5HKKD 3AFOA 1Z17A 2J4FA 3AGPA 1TLFA 4L8WB 3GJQA 4YQYA 1KFBB 4RXTA 1T4GA 3TAXA 3RROA 5JV5A 4R4JA 1KY4A 2VDJA 3L82B 5EESA 4X62B 3V00A 3RGZA 3L92A 2VP5A 3HKEB 5CX4A 3ZY5A 1R2QA 4LJLA 1HWYA 3PGJA 5EC8A 1G8PA 3OURA 4KR6A 4C01A 1W1IA 3H05A 3DOOA 5BSRA 1QF9A 1WXGA 3WLNA 1X7HA 2C20A 4X64H 1QSGA 2ZCVA 2HHJA 3IXQA 3U37A 1PG2A 4GKAA 3CUVA 1K7XB 4HH4A 3O4HA 4N7RA 2R65A 2O3JA 1I1OA 4AP9A 1GR0A 5FCDA 3K5IA 4MUEA 3H2YA 2M32A 2DECA 4GKKH 3IULA 4GEKA 3Q7QA 2W57A 3IKMB 2QSZA 3RAXA 2BH2A 4IDHA 8LDHA 3IHKA 1X80A 4WTOA 3WQSB 4C20A 1FFXA 2DRIA 4C0JA 1SUWA 5EYPA 5B4UA 2PLWA 2WJHA 1VBHA 4NX2A 4E2WA 4X1IA 1V8DA 2O7VA 4YQWA 1QYCA 3AF0A 1DAOA 2GBFA 4AJ1A 4FMBB 4BDTA 1RE1A 4PBSA 3EJ6A 4IFTA 5EIEA 1J5XA 1WG8A 1ZGCA 3E3NA 1QMGA 3P94A 2Z5GA 1YI8A 5CM2Z 3RVNA 1M6YA 3SY8A 5GWXA 1UC8A 2Q1SA 4BGVA 5JS8A 3L06A 4RB0A 2B4RO 1WZEA 2H16A 3UBTA 3FPJA 4UTZA 4M22A 2O7RA 3M6VA 2HA2A 1I80A 1V4NA 4Z2YA 1QHXA 4YN3A 1P4SA 1SN7A 2QY9A 4XQ0A 4FDAA 2G5CA 1OYOA 1QVWA 4R9NA 3REQB 2R8ZA 3R6GA 3KJNA 4XSGA 3SYLA 3KOUA 2A78A 4BKRA 3J80A 1D2AA 3UMJA 3WJ2A 1VCOA 1RAAA 3V3KA 3V7WA 1AO0A 1TVCA 1YU9A 1J9GA 3U9LA 4R54A 1NF3A 2LKCA 3CXUA 1Y37A 1E1CB 5HQJA 1KI3A 2PAFA 1N6IA 3WYEA 3OJCA 3X1XA 2OZEA 2YV1A 3HDVA 3LUGA 1R6VA 2IFTA 1SUDA 4UE3S 4I1VA 4LHZA 1V9SA 3OSPA 3LQ1A 2Q3FA 3VPCA 3QTTA 5EKUA 1FQWA 3RU9A 4ECSA 3C85A 4YQZA 1CUWA 3K6KA 4OJKA 2Q2UA 5G2OA 4AG6A 5T4BA 2D2XA 4QOEA 1J0CA 4X64B 4A82A 3Q5DA 5JZVA 2GHRA 5AKLA 2C03A 5I7UA 3MPUA 2RHRA 5AMXA 1Y98A 2NVBA 4UFNA 2W8ZA 2YY7A 2EYUA 4GKKB 2FF7A 1Y89A 1UFKA 3VGPA 1KZ6A 2FEPA 5CE8A 5DK4A 4MKHA 1NDUA 3MTQA 1SO8A 3PBKA 1KFCB 2FKNA 2WG2A 4XRRA 3BQNB 1YQQA 5ITWA 2W93A 1XZBA 1B8NA 2IK8A 5L4LA 3D5TA 3WTCA 4MVJD 3TY9A 4W9NC 2BR0A 3BWXA 3GV8B 2J3LA 4EFEA 2NGRA 3KP1A 5JZBA 5I45A 2EC5A 3QHQA 2X8LA 1KSHA 3ZDBA 4M0UA 5CDUA 5EGNA 2HJWA 5AKHA 1M8GA 4J9MA 4YDQA 3L0DA 5KCMA 5ABPA 5I7OA 2WU8A 4FOPA 1K4MA 3UN1A 4O3NA 3KB1A 3T54A 2HB6A 2Y1GA 3K31A 4N41A 3MTEA 3C8DA 1UH5A 3UMGA 2CBXA 3SEQA 5CVVA 3TE6A 1JGTA 3A1UA 3TB4A 4WLOA 2A3NA 5ILGA 3P0JA 1JRLA 5E6SA 3JSXA 7ABPA 4I1RA 3MNFA 4K2HA 1ISMA 3MRTA 4BC1A 3OZWA 1EAYA 1YA4A 2QD4A 5JATA 3QI2A 4F3TA 1S8FA 3AVQA 3L7DA 3GAZA 3UC9A 3LQSA 3MWEB 5EJFA 3L79A 4QU8A 4IICA 4KGDA 1PK8A 3UA4A 2VTDA 4F3NA 4X66H 3CLUD 4DPMA 1TMOA 2VAWA 4GPTA 1OKKA 1X7YA 2SBTA 3AFHA 3L0SA 4DV0B 1WCV1 4EYGA 2J3MA 4Z9YA 1GT91 2FPRA 4L73A 4IVNA 3A6ZA 3ORSA 1E2PA 4RVGA 1EKVA 2HHLA 2QVGA 2PUCA 2ODWA 1FC0A 3RIZA 1T24A 5JH7B 2Z2IA 2XB2A 3ZV7A 4Q3DA 1U7WA 3WLPA 3IRUA 3H4VA 2C7RA 4XTRA 4LXYA 2HKIA 3F5MA 1OFIA 1CUXA 3VPBA 1L7OA 2BGWA 4W5TA 1XRMA 1GZ6A 2RAPA 4BB6A 1AM4D 2PT7A 4CDMA 4DJ5X 1Y63A 7REQA 3G8CA 1M2OA 1UP7A 1YI0A 1FU4A 4A3LG 4R7RA 1C3OA 4O86A 1D4ZA 3C41J 2V7QD 1RYNA 4TXJA 2GUGA 3WMXA 5DBIA 2RJNA 3AETB 4IIJB 3MMXA 1A1SA 1II8A 4IXMA 5KDLA 1HZZA 3NDPA 3ITNA 2ZJZA 4KSBA 3R74A 3T7DA 2R62A 5IVDA 4OJMX 4YI3A 3MRSA 3W5DA 4XFKA 2H5JA 3EIXA 2EWMA 3LQRA 1F2TA 3SBOA 2C9YA 1GJRA 2IA5A 4GYWA 4DIDA 2G4VA 3N40P 2X9GA 1U2DA 4AYXA 3M5WA 3HVIA 5IEJA 5DMHA 1OB5A 5EIAA 2H1VA 4XQEA 1N5IA 1GAEO 4MB6A 3GOHA 3IPCA 4OGKA 2XGJA 3W79A 1Y8ZA 4D26A 4V2UA 3N2GB 4TRRA 4JROA 1XAHA 4D0RA 2NYVA 3SZ3A 4P3NA 2PKWA 3DNPA 1MC1A 5L51A 4JU8A 2ABJA 1KQPA 2ZRJA 4JLWA 1P5RA 1JSLA 3K0FA 3CT4A 5KTNA 3ICPA 4QWBA 1R3DA 1P60A 1OBDA 3EPRA 4PS1A 1LBHA 1S4MA 3FVTA 4HNSA 5LYJA 3CNBA 4HNRA 4AYBE 1BWSA 4ECAA 5K3DA 3VX4A 4FMCB 4BAZA 1KO7A 5EVJA 1FRQA 5TVGA 1C1XA 4FBTA 3JAMW 2NQ2C 2LZ0A 1R6UA 1YD7A 1SUAA 3B20A 3DE5X 1SEPA 4F60A 1X77A 4OKIA 4JIGA 1YASA 2F1OA 2Y1OA 1L7XA 2UXDB 3SQNA 2NO6A 3MINB 4TL9A 3FTEA 5ICGA 4LZLA 5DI3B 4Y2SA 3GVCA 3GGPA 4TLEA 1HNZH 3EBPA 4LS3A 1JIKA 1M0SA 2PMCA 3PGLA 1UFQA 4MCHA 2DLNA 4MR7A 2PE5A 3T7CA 4B7XA 2XRYA 3QOFA 2JA6A 5GADl 5BORA 2FW1A 4A36A 2O2GA 1UMDB 3PG5A 3C1UA 5K0NA 2KX7A 4REQA 1LBIA 4CHTA 2PS1A 4XGRA 4LVNA 1IN8A 1ENZA 2RGNC 1KEPA 3W9YA 4BWGA 4FKMA 2B21A 1ZQ9A 2HGSA 3LQKA 1MAAA 4TXMA 3SICE 4CM6A 4IHKA 3IVCA 4K3VA 1VI6A 3AOEA 4ZVMA 4MEJA 3RVQA 5IC4A 2CJWB 3IMGA 3E3MA 1DQRA 4L9AA 4YR0A 4N5MA 2R6HA 1IEVA 2Z8YA 3KQOA 1F2UB 1LDNA 4WHMA 2QN9A 1DG1G 1R15A 2BUAA 2ODBA 3JW8A 3GQVA 2EW2A 1N9GB 4B4DA 4KVAA 1RIIA 5AI8A 1RZ3A 1TUBA 2QMYA 3L6CA 4YXFA 4CCAA 3ACCA 5J4KA 3TR0A 2E1PA 5LYYA 3M4IA 1CYEA 3P2EA 1AGRA 4WECA 1LA2A 3V4FA 1J06A 2GETA 3QIVA 3A9VA 4MQ5A 3FDIA 2HSZA 4DJDC 1JIXA 3N70A 2G5GX 2UAGA 4IDQA 5TQ0B 4EJ0A 5JS6A 2HL6A 4YPOA 4GOXA 3PW0A 2JGJA 3FYUC 2VZ9A 2ZBFA 2XMRA 1O58A 4NV0A 3FPGA 1FDVA 3PHJA 5ALXA 3S0JA 2Q3CA 3EYAA 4BQRA 1YOBA 4PX9A 1Q22A 3RIHA 1KJNA 1W0JD 3WX0A 1XMPA 1IOLA 3GG2A 5LDGA 3C45A 3VR0A 1NKTA 4M9RA 1YV9A 1A1VA 3WICA 1B04A 3KAQA 3IIJA 4A9AA 4BXXG 1OBGA 3UMCA 1HQCA 4DIFA 5HE8A 5T41A 1E99A 4GC7A 4RXMA 3TS1A 1Q83A 4D9KA 2C5LA 1NDQA 5HIJA 1QHHA 4ZRNA 3D6VA 1FDRA 3IBCA 1KMHA 1CQXA 2EP8A 4G3XA 4WBSA 5AOBA 1HNZB 5HGXA 4PY2A 1E4VA 2ANBA 3H19A 3RS4A 5ALRA 1QGOA 2O20A 4DE5A 5KT2A 1BX3A 4HX5A 3DMFA 2XNHA 1EDZA 4TZ0A 2XYGA 4KP7A 2ZBQA 3MAGA 1P4JA 3VPGA 4QFDA 1MJNA 2VPQA 5CFQA 1SKAA 2BBOA 5JJLA 3RYTC 3VZBA 5K8CA 4N9WA 3W06A 4BGDA 5AUOB 1U9JA 2AE2A 4QU5A 3P2IA 3C5CA 5LA6B 4J0MA 1TO2E 3V7UA 2TMYA 3KZMA 3GJ3A 5IYDG 3K0CA 2WTNA 5EUCA 2QRVB 3TOZA 1N92A 1E3LA 1E3QA 3E23A 1SHUX 2YHAA 2UUAH 4E1AA 5DIFA 3S2ZA 4EY3A 2AFHA 3IQGX 2QRHA 5DE3A 4M1KA 4WRRA 5IAJA 4ZZ0A 4GMGA 3RFTA 3AK4A 3PC3A 1FIUA 3V7YA 4X63A 1V3QE 3OPYI 4BS9A 1BQEA 3KAJA 1NOIA 1RM0A 3E27A 5EXEA 5IWAB 4TXHA 1I50A 2IRWA 2BHLA 1NBHA 2BN4A 4EJSB 1YKFA 2C4NA 5DB4A 2XAAA 5CITA 1YULA 2I65A 4PCAA 4QUBA 4PNZA 2C92A 1OSNA 3QVOA 5JNRA 4BQPA 5DHQA 4CJXA 1M54A 3D3WA 2IYSA 3B9QA 4UCUA 3TW6A 4Q3CA 4NMWA 3DZ8A 5JADA 5G4KA 4BZQA 2R1TA 5GJCA 2ODQA 4LWOA 3GROA 3H83A 1GNPA 5FRDA 1PTJA 1QH8A 4WLEA 4ECEA 3ZE6A 4WNCA 3IIMA 2ECQA 2JDID 3T5GA 1Z83A 1NVVQ 4FGRA 2NU6A 2BRUC 1SBIA 4RQAA 1QQ7A 5KZMB 2VDNB 4D96A 5SY9A 4D3ZA 9ABPA 4F3KA 4JVLA 1TYBE 2EJWA 1GL6A 1JVSA 4PV7A 4CMEA 1WXXA 1TMYA 1JG2A 5DXFA 2D7DA 1QGUA 3VO2A 2B34A 3EXIA 4XI9A 1K3UB 3GGOA 5EIWA 4B8YA 3ORRA 1LSSA 1HZJA 3FCSB 3OSZA 4AXBA 4EX6A 3CB4A 4BLRA 4DJJA 4U6SA 1OH7A 4JB3A 7REQB 2WVAA 4N6OA 3E8XA 3LQYA 5EHXA 1SIWA 4WLUA 3VVBA 2H3HA 3DD1A 3GNSA 2GHQA 4B2PA 3TJZA 5H3CA 1P5JA 1EE1A 3DBIA 4G89A 3E3OA 3R8FA 4OM8A 3AOGA 4Q15A 4Z7QB 4DLZA 3MOSA 1F51E 4EPXA 3TLMA 1P81A 1GCAA 1MF7A 3UWDA 1XWFA 3UYKA 2B98A 1F2TB 3JD3A 1O6BA 3R7FA 1W5SA 4BAGA 4NVRA 1JJFA 2UUAB 2NYRA 2MINA 5K3CA 3B2NA 4MDYA 2NO4A 1ZOSA 2VQEB 1EFUA 4NL4H 3SSNA 2Y1DA 4ECZA 2QP4A 5LSAA 1BMTA 3H99A 1WSDA 4MP6A 3NTOA 4LCBA 1LWNA 1H4VB 2V6BA 5BN5B 4V0ME 2DBRA 3LVFO 1I14A 2JD1A 3WGQA 1NI4B 5EJ8A 1TZJA 2GESA 1V7PC 4LE1A 4K88A 1KE1A 1UAGA 4CEIA 2OTCA 1ZJ6A 1JPVA 3DL2A 1MO6A 1ZZEA 3K0FB 4MQFA 1G6OA 1Q16A 1DOAA 4YMGA 2QLLA 3GVPA 5JPDA 2H8KA 4OSEA 1EKFA 1MDBA 2ESRA 2BW0A 2IOYA 5DM0A 4MV5A 4ZYLA 3DDOA 4EHBA 3MSXA 1ZZGA 1F4PA 3ADOA 2G07A 2I4TA 3GTOA 5ANRB 2XITA 1LBSA 4O4IB 4GQBA 3QIAA 4OUDB 4UVIA 1NQTA 4PWYA 3N76A 4RL4A 3MERA 2X8WA 2V4ZA 3W1VA 3PK0A 2C78A 2IHZA 2Y76A 3JZMA 3A7EA 1IEQA 4WY5A 4XVHA 5DRTA 3TW8B 1BRMA 3CPEA 3MWLA 2CD9A 1OLOA 3B1XA 5G1PA 1ZONA 2CV1A 2Q28A 3T7RA 1UZUA 3V8MA 2HDNB 4M76B 4Q3OA 3VOSA 4KE7A 3WLKX 1M7JA 4N9QA 5D86A 4RZXA 5AR1A 2ZUDA 4MR7B 3GN2A 1K86A 3ZDRA 1BYIA 2D13A 2HA3A 2AFIA 3KR2A 4AK9A 1GQSA 1NPYA 4XWGA 4Y2XA 2D5CA 2PGDA 1F6DA 4ZVOA 1KC1A 2QU7A 4J1SA 3QI7A 1NE2A 5CBPA 1UMCA 5C2JB 3QLUA 4DSNA 3M8KA 2YV3A 4W63A 4MLCA 2FMUA 1TYCA 2HRDA 4J9OA 1FFGA 1Z6PA 5KBYA 2SICE 4I3FA 3FLBA 5J4YA 2AL7A 4Y30A 2O5VA 4OOFA 1J20A 5AVKA 4HKTA 3M33A 2NU9A 2A9JA 4RQTA 4B4WA 3UAXA 4K9LA 4JI6H 1F0NA 4ZAVA 1ONSA 1SD5A 2YX1A 3E03A 3BX1A 1K5GA 1GDHA 1OYWA 4BJ1A 2ZSIA 5AHKA 2O52A 4RK1A 5EVCA 2QLJA 4A8JA 2XWJI 4QTYA 4J6FA 2X9QA 4X71A 1GG9A 4UDYX 3KSUA 3K5WA 4A8TA 2WM8A 1JHQA 2YWRA 1ZJYA 6REQA 4LXUA 1EE2A 3WLAA 5A7GA 2XZLA 4GI5A 4P7JA 2W22A 1VPLA 3AVYA 3AG6A 3FNBA 1SUEA 4JP8A 1TKBA 2DKNA 1HXHA 3OM1A 3DO6A 3KBOA 2HK7A 2M9MA 3LKZA 2X7XA 1USKA 3MJVA 1QONA 3T3NA 5AVRA 1AN7A 4LRSB 4IOJA 2CW8A 5K8JB 2ADFA 2YWEA 4WASA 3MS2A 2OK7A 3F4KA 3VJRA 5JD3A 3O91A 4HG2A 2X2FA 2Y8EA 3IIKA 1V39A 3SGLA 3FY4A 4BQFA 1KAOA 3INGA 1VQ1A 1MJGA 1XMXA 5KG4A 2ZAYA 4X7RA 4N0PA 3FIUA 1NP6A 2YJZA 3DHNA 2GFQA 2ATLA 5D1NA 9ATCA 4RDCA 3VJMA 4DN6A 3LTEA 3GV7B 4HYKA 1T9DA 1E32A 3UJBA 4BVBA 1IZ0A 3RIMA 1HZZC 3RS2A 2M1ZA 4HFRA 4YMLA 1S2OA 3UK2A 1V8FA 4XARA 1D0VA 2WIKA 3K2EA 1B43A 4ECQA 1EJ6A 2ZBGA 2B78A 3WSVA 5JIBA 4LC0A 1U2DC 2W00A 3FMFA 2XUQA 3MFYA 3AL3A 2PN1A 5P21A 5KVVA 4CF4A 2Y1LA 4PLYA 4RJTA 5J5VA 4QIWA 4AIRA 4PYIA 4AKTA 4WE3A 3NBMA 3MIZA 1G7SA 3LKDA 4ARZB 5K3AA 3GR6A 3EULA 3I37X 1MEOA 5IFLA 2ZXUA 5DN6D 2SCUA 2R8PA 5JCOA 4N6NA 5JEEA 5C0OE 4Z6KA 4FFMA 5ALPA 1WHSA 1HF3A 3H2IA 4QBHA 1WUKS 3OPVA 1QDEA 4EFBA 1LY1A 4Y9TA 2BKUA 4YMWA 4QUDA 4J75A 5DYYA 1SGWA 2FFRA 5AW9A 3WBKA 1SCAA 1VLVA 1ZS9A 4YY3H 2FPSA 4O6VA 5JC1A 5DGXA 2DGDA 4ZT6A 3LLCA 1G66A 4EGSA 1ZKMA 2YJ6A 3EXEA 5MF6A 3V2IA 4B5LA 1CRLA 2AFHB 5FA6A 2IDMA 3VPXA 5A6VA 1RAIA 3P20A 5E7QA 4NBNA 3IBSA 1N4AA 2QR3A 3DZCA 2EKBA 3FUWA 2FP3A 3WJ1A 3DBHA 3UMFA 1YS9A 3PI6A 4X3PA 4RAZA 2Q4RA 1X1SA 4KRXA 3V1TC 1D2HA 5BYBA 3OTIA 1DBVO 3ZXXA 2R8RA 1Q7CA 3Q2OA 3RUAA 1UMBA 3HI4A 3BMQA 2ZJOA 1KK1A 3FOFC 2OORA 4ZRMA 1XWIA 3HOXG 1W5BA 4DUYB 1MABA 3F7MA 1PFYA 5EUQB 4Q12A 2WK1A 3ECSA 1ULAA 3PA6A 2VS1A 4Y1GA 4WHXA 1BROA 2X0JA 2BDEA 3FHOA 2BF4A 3EIWA 4CG2A 3WK7A 3PFKA 1O75A 2QD1A 4IHJA 2KM1A 4FCTA 1KI6A 2R1TB 1ECGA 5EMHA 5HCIA 4BECA 3LKVA 2OMKA 1TT5B 2AJLI 1L5FA 3K70B 1XJWA 2FEMA 4RAYA 2ZRPA 2QTFA 2FOXA 2OWEA 5KC9A 3E61A 4B6FA 4O8CA 4C05A 3PUZA 4FGKA 4L5AA 4P5PA 2P9YA 1GUFA 1T10A 1LW7A 3E84A 4F2WA 4KC0A 4ZCLA 1XRSB 3ZWOA 1JFLA 2IHKA 4JENA 3A1EA 1IUNA 3U1BA 2BGNA 1C29B 1A9PA 4JYZA 5GM2A 3OY2A 1JIQA 2WDZA 2MT9A 5EQDA 1QGUB 4P3OA 3HHEA 1JKMA 2HM7A 4OQEA 4PLWA 3M89A 3KTFA 1V6CA 4EZEA 4JGGA 3SDSA 3JQBA 2Y0DA 1AK2A 3QXXA 4OQQA 3BICA 4DC9A 2E0IA 4CKEB 2WNSA 3JPWA 3RUPA 1PNVA 1NPTO 3KLPX 1B8UA 3HKEA 3LUHA 3HC7A 3HGTA 1ZQ1A 4RIIA 2O8DB 3E81A 3JAKA 3PP8A 3PW4A 1WLSA 4YR7A 5K8UA 3HR4A 4BBJA 5JYCA 4JS0A 4QBFA 1OWTA 4YY3B 2PFGA 1UR5A 2QW0X 4KW7A 4OXNA 4QYXA 3GBPA 4IH1A 4EGCB 2YS7A 1E2HA 2OXRA 4FJ0A 2EIXA 2OFWA 4V0KA 3EMBA 1WXIA 2WUWE 4V3CA 4UKDA 4KN8A 4YRZA 1Z08A 1X7ZA 4ZDWA 1QYRA 1WP9A 2B9EA 3DM5A 3EUWA 3DUFB 3DTVB 3R40A 2ODTX 4V3BA 2DBZA 3ESDA 3CC8A 4QTTB 3CJTA 1TA0A 3I6QA 2D7JA 2FWBA 5DSXA 2VOJA 4DBLC 2VJNA 4RK5A 2C22A 2YV5A 2JRCA 1VIYA 1ZBQA 3E0QA 3IILA 3MTGA 4YFVA 3RJ0A 1FVFA 4YUXA 1Q7RA 4QPNA 2LP4Y 5K3WA 3OX2A 2GDZA 2QMHA 5CEJA 2WSSD 1B8OA 4BMVA 3V48A 4Y9SA 4DLTA 1MVNA 3H0GG 3VTFA 3A28A 4O2AB 3R3XA 2HUNA 2HF7A 3W5HA 1G6Q1 4D25A 3C6ZA 1JIUA 2YL2A 1WCIB 3DVQX 2HU7A 3REQA 4Z4FA 5FORA 1U5CA 1VE9A 1H2FA 1OBOA 1RVDA 3IEUA 1UXOA 1H4QA 4P7BA 4XWTA 1Z6GA 2VQDA 3PVCA 1L8QA 3ICWA 3LSTA 1WUHS 5JNTA 1GAJA 4CFYA 2AGPA 3VR3A 1E1CA 2KYRA 2C2OA 2WAMA 3PXAA 4DDTA 3WGJA 1HT1E 2G83A 2JAHA 4O59O 1DFHA 1TECE 4YAGA 2H7CA 4FX2A 4MGEA 3ORHA 1ZN2A 1IBRA 3QW2A 3BIFA 3SKXA 3AIIA 1F14A 4XIJA 1Z8FA 2PZMA 4A0FA 5K8VA 3I9KA 3TAHA 3N2NA 3IKVA 4DA0A 3AJRA 3VNAA 4DLXA 3ORYA 1NXVA 3D54D 1J0AA 4KIWA 4JNKA 2HSGA 2GZMA 4D02A 1XJQA 1U9IA 2VYFA 4E09A 1AMOA 5D7BA 1XUOA 3LT1A 2B8JA 4MRPA 3JASB 1DC4A 4DTCA 3NU1A 4L8YA 3CWZA 1Y6GA 1GUZA 2V9WA 4OX9Y 4MVJG 2NMVA 4OA5A 3RJZA 1PP4A 4ND5A 2QTMA 5CB4A 6REQB 1PTJC 4C4YA 4DCUA 2VOBA 5TPZD 1TYAE 5JARA 3I8XA 4MGIR 4YR3A 2PR2A 4MB2A 3HCAA 2WZQA 2RJ3A 2NSHA 4CMGA 4G97A 2ON6A 1FNSA 4M0DA 3MUNA 1OXSC 2C0CA 3BB3A 1TW3A 4RDHA 1N6PA 4JV0A 3LOQA 3NPAA 1HFKA 1QPZA 4XM0A 4D0NA 1A8HA 2E4VA 1E9RA 4OGWA 1WQ3A 4ESOA 2FRDC 5LFAA 1GZVA 3W9BA 4TUYF 2QV0A 2ZJ0A 4QLAA 2EZUA 2QXTA 2PKQP 1G20E 5BSVA 1SG9A 4DVJA 2OPHA 1CQZA 1CRWG 1KJIA 2UUCH 2QRMA 2J6TA 2JANA 1PV1A 3V4ZA 1Q7TA 2GCNA 5B30A 2HQOA 1EJ2A 3EHEA 2B1JA 4H3SA 4DJEC 3ZWQA 1OXVA 3A10A 3GXOA 4R9VA 4BNWA 3HDYA 3C8UA 2C7VA 4BQEA 1JQ3A 2FFHA 3COWA 2DUUA 4IR7A 1EUCB 3EGIA 4R1NA 3DE0X 4Y6SA 2CNLA 3SJZA 2NM0A 5D00A 4MVXA 3MWEA 1P5HA 1BOFA 4EX7A 3RKSA 1WD5A 2C0PA 4O63O 1RVV1 5KVSA 3WAGA 1Q1GA 1NUHA 5ENZA 3AVUA 4IX1A 2CVQA 2AUNA 1N5LA 2XNDD 1A9TA 2VP3A 4GECA 3ZX5A 5JXIA 3K8OE 1ZHFA 4I55F 4Y6PA 5AUQA 4BASA 1SWVA 4CM5A 3EPIA 5FI5A 1VBNA 5JH7A 1XMIA 1WHSB 3G6WA 1PV4A 4WZAB 4FS3A 5FL7A 4C4TA 4ONEA 4K3UA 1UBEA 4PRYA 3ZUGA 5M3BA 5AKYA 1GTRA 3R6WA 3HWRA 1G98A 2X77A 4D9MA 3EY4A 4MVJF 4FQ5A 4PF1A 4DRZA 5EFOA 3N05A 1ZK1A 5MFZA 4H18A 3W77A 4WXEA 3H1GA 2HJ9A 3MAJA 4OPMA 1T8RA 2Y0PA 5DM1A 1QCDA 5K01A 2Z4SA 4RTJA 1Q7EA 2GD1O 1EPUA 3AETA 4KXQA 4UVGA 2XGOA 4B44A 5KFRA 3ADKA 3KE8A 5M29A 1ZR4A 5KFMA 3PNPA 4IAJA 3H4IA 3T34A 4GG1A 5E9WA 2AN9A 1FTQA 3BD9A 4E2FA 4E30A 1P6XA 3KE9A 3BEOA 3BMNB 1H8HA 4TWRA 1I24A 1FMTA 2EBFX 3ZR4B 1XTPA 2VLIA 1CY6A 3CH6A 4AMUA 4A8HA 3KFVA 1HUQA 3CSWA 4UM8B 4J0KA 1DUIA 3I4NG 4ZI7A 4EMSA 4ALMA 1EZ4A 3N2GA 3TBHA 2A9QA 2OOSA 1A8QA 2PL3A 1P7CA 3IVGA 2FN4A 3I5AA 3ERCA 3NT5A 2JL1A 3INTA 3QLUC 2UUCB 1JT9A 3IOBA 1RRPA 2UYCA 4K7JA 3H5NA 1R5OA 2I8AA 3S24A 4F9EA 4R68A 1O96B 1TD1A 3EUEA 1WV0A 3TFWA 3TOVA 1JPNA 1K3FA 3SC6A 1P62B 2R8XA 5AJHA 4A5SA 4TS4A 5TMBA 3DDSA 1UC5B 3Q3IA 2W4IA 1JFRA 4FZJA 1YBVA 4MDEA 2WBLC 4KQIA 1IWBB 4JI4H 3IODA 3IO3A 1DZ3A 3RFVA 3N87A 4EPWA 3ZJYA 2AXQA 4MTCA 1IYDA 4A8JC 1LX7A 3QKUA 4TM8A 4QASA 4ZV4A 4OB7A 4PZPA 1T0HB 2GXAA 2JGDB 3WSWA 1S8NA 3O26A 4FHCA 1JX4A 3OEHA 1O3YA 4FYHA 2V7EA 4I5GA 4B83A 3CSSA 2R8JA 1LNZA 3MINA 4P4LA 1YBFA 3FWKA 2FN3A 5DI3A 4NV1A 3SXUB 3K2IA 3GDHA 4H35A 1I2DA 1W96A 2QZ4A 4MUIA 4MXDA 5AM3A 4FI3F 5I7RA 1BU8A 4A7PA 3VTKA 2DPJA 3RNLA 4XWOA 2YVQA 3R9KA 3HJTA 3NHPA 2WOJA 5A9TA 1EDEA 1WOMA 2FPGB 3JAKB 1JA9A 5KPJA 2RB4A 3SQMA 1UMDA 3L8ZA 3MLAA 2LXNA 5JLAA 1L4GA 1P4AA 3QXJA 3ZZ0A 1RT9A 4EPYA 4NZZA 2VHEA 4B34A 1K6MA 1BD3A 3E6AA 4UE2A 3ZEAA 1RZVA 1D2MA 2ZT6A 4DHEA 4TT8A 4HZIA 3IHTA 3KB8A 4K1XA 5K3FB 4M7RA 3OU2A 1Q2UA 2YVAA 1JLRA 3DCYA 4Y6QA 3IAM6 1E0AA 2CJWA 4G0WA 1X7ZB 2FZWA 1K83A 2EJTA 4YVFA 3E9CA 2ZIZA 2LIVA 4X9XA 4O7VA 3O92A 1AUXA 5DLYA 5IT9W 1E6KA 4EYHB 1BHO1 2AQ4A 1F2UA 1JBQA 1OFHA 4BNMA 1XEXB 4LJAA 3PXUA 1TYEB 3VKGA 1SXHA 4C6RA 3HE3A 1FMJA 2PQ6A 1R7RA 4BCCA 5ERXA 3E8MA 4FMDF 2QZSA 1N9GA 3OMWA 4G8BA 3I5XA 4OXIA 1R0SA 4PXAA 1NC3A 2XMBA 1TIKA 1V47A 3EEBA 3ZLVA 3LY7A 2DPIA 3A4LA 1C1YA 3EQZA 2A0FA 1PJCA 1T43A 1ULBA 3TFQA 1ODLA 1ET0A 2F1HA 2P69A 4G65A 5JCOC 4G0PA 1BS9A 5TQ0A 1HT3A 2PH3A 3HN6A 3W6OA 2EOAA 1DMSA 1GTMA 3DBVO 3O4VA 4AG5A 4OBXA 4NNPA 4FKZA 3N44B 2E4ZA 1Z5GA 1J0EA 3PN1A 1FQKA 5A1JA 3ICQB 4O0LA 1FMLA 4HGOA 4XA8A 3D81A 4RJJA 2A0WA 4GPZA 4LPSA 3VM6A 4G0VA 1WY5A 1HH4A 1OJ7A 1NVEA 4X7BA 2OFPA 4JI4B 3ZI4A 1TM3E 4LY9A 5KQGA 2VHTA 4BOYA 5IJ0B 1JIHA 3PJRA 5EN4A 4DCNA 4KR9A 2Y77A 1YS4A 1PUIA 1N6LA 3L07A 2YV2A 2CVFA 1Y14B 2IZOA 1YR7A 1LW6E 2SNIE 1A0OA 5JC8A 4HRAA 3AW8A 1RMTA 1W44A 2Q9CA 3RHFA 1OGYA 4F11A 2PKEA 1YE5A 2AOVA 4RPHA 1C4OA 4A2WA 5DNYB 4PGFA 3I05A 4RNDB 4Y98A 3U0GA 1Z7EA 4WIAA 2NZ8A 2W2TA 2XMPA 3HS3A 4X91A 2HJRA 1LQ2A 4A3KG 3NKFA 3F6RA 4KLNA 1AG9A 2XF8A 1G5RA 2QRLA 3HUDA 3FWZA 1F8XA 4RD0A 4OBEA 4RENA 2OORC 5FDFA 3N0XA 5F98A 1EK6A 3GD5A 3JD0A 3K4HA 1JN0A 2RGEA 3OTOH 3EVNA 1B7GO 1GTJ1 4M53A 1U2ZA 1ZIDA 4ZYUA 3L2OB 1U2EA 1R18A 4PHTA 2Q3EA 1U0EA 4K9QA 3MW8A 4BUJA 2V1XA 5D01A 3BXPA 4RB1A 1I2CA 4TROA 5CB4B 5LA6A 3CBQA 3EPKA 4HLNA 4F3RA 2D59A 4QXQA 1Z4QA 4PZZA 5JQWA 2QJRA 3KYIB 1MB0A 1FPQA 2QRVA 1M7HA 4LCJA 3HU3A 1G7CA 2R1VB 4YO8A 4PX2A 3RTBA 1SZPA 3W8NA 1NNLA 3GA0A 3RV3A 3BIJA 4N8DA 1RZRA 3A6HA 2CLSA 4AY2A 2O8VA 1CJBA 1CQIB 4UBKA 2MOKA 3P0RA 4S1WA 5F23A 2WAQE 4C3VA 3GP8A 1VZ2A 1Y1WG 2O9JA 3I5MA 2ZQYA 2CE2X 1SMKA 3JQBC 4R1LA 3HZZA 2IGBA 3IQEA 1JJBA 3E35A 5T5QA 1EZ1A 3IFSA 1G8AA 2P9QA 4FK8A 3HYTA 5DZSA 1H0HA 4YXWD 4EJSA 4NE9A 1QIHA 1UFOA 3MWFA 1S7GA 1TWAA 2A1IA 3BK2A 4EBBA 4R3UC 1L4UA 1LTHR 4CF7A 4MR8B 2Q41A 3L9XA 1C3LA 3D6FA 4PHGA 2C1ZA 1U63A 1NIPA 3S2EA 4F92B 2PGOA 2Z2YA 4I6GA 5JTUA 2ORYA 2ZPUA 4N39A 1AS0A 4RUCA 3E2MA 2YCLA 1N2CE 2CW5A 3KL2A 2XYQA 3DAGA 5KFGA 3Q8RB 3D0KA 2I3AA 3PUYA 4H27A 3FKIG 4UEKA 3RS8A 4Q05A 3PS9A 1NU6A 3NBAA 2IXBA 2BGLA 2RKWA 3PXEA 4IOMA 3ZGYA 3C8MA 3HJFA 2G1JA 1T0JB 3CR3C 3OFJA 4I4NA 1WD7A 4C07A 1A2KC 1QS0B 5KNLA 4OH1A 4E3WA 2K2QB 2QXUA 3PE6A 4MHOA 4LGYA 4DUZH 1PV2A 4HYYA 3OTOB 3SQXA 4PZ0A 1E5LA 1GNSA 5GP1A 2J32A 2XT9A 1JBKA 4CTKA 3PO3G 3TD2A 3KT0A 4NG4A 1H1LB 5JJKA 4Q4HB 1E2IA 3TTXA 4H17A 3ITEA 1Y8QB 3ACDA 2JJ8A 3GRVA 3AUXA 1X1QA 2CK3A 1TFRA 4MA0A 4MJLA 1FDUA 3QU7A 3OZEA 2FSSA 1N2JA 1TK3A 5C4MA 4LK3A 2BY4A 2LR0A 1FU7A 1K98A 2YXNA 5BW6B 1UBHS 2N1BA 4ZI7B 4HX9A 2NSYA 3D4OA 4P53A 3PVXA 1DUSA 1GZ4A 4JUFA 5BN5A 2RH8A 3T0IA 1NI4A 4DWOA 4S04A 2XQKA 4H6PA 1E98A 5CUQA 4BEJA 4IXWA 1SXJE 2R87A 3QUAA 2OD9A 4L78A 3I64A 1D2NA 2R93G 4QDTA 2PXHA 1AOXA 1DHRA 4DA8A 5KWEA 5FLYA 1OX4B 3H4MA 1G2PA 4E7OA 5FWDA 3HB9A 3VTZA 3NVDA 1HQKA 1LDYA 2XIGA 1P7ZA 1U9IC 2WF5A 3CLTD 3R6DA 4X5OA 3ZJ5A 4YB8B 3CVUA 2H2IA 4EQZA 4J4HA 1QHEA 4O4IA 3VKHA 5ALJA 4OUDA 3OETA 5J5AA 1FNDA 2H48A 3CVJA 5DM4A 1ZK2A 3TRHA 5FBZA 1YGPA 3DO5A 4MTEA 5CD1A 5IAGA 1FTYA 3W8RA 4DREA 4X66B 4ZQBA 3L7NA 4AM8A 3TW8A 3KQLA 4LCEA 4F91B 2R7AA 3PPWA 3C1AA 4U3JB 2GARA 4V0QA 5DX8A 4CM7A 3WLRA 3DKKA 3MT0A 4G4GA 4BVHA 3WWJA 2X6RA 4CM1A 1J22A 1JNXX 3UXYA 4UU7A 4JC5A 4MW4A 1JAHA 1GGHA 1FSSA 3IE1A 4RTPA 4YHHH 5TQVA 5KU1A 1FEZA 4GWLA 2A5DA 4RGYA 3RJTA 2VP0A 1U1FA 2W8BB 4Q8FA 1E4FT 2WSYB 2WTMA 1B2LA 4M8SA 4DUZB 3DDZX 2FDRA 3Q85A 3O9MA 3SX2A 3PGMA 4MW2A 4JXXA 2YZGA 3VV2A 3EVGA 3FYCA 1CEEA 3V46A 3D1JA 5A4MS 1BIFA 4JXUA 2J9XB 1UKAA 5CTAA 4LZJA 3VR4H 1P8JA 3C7KA 4QVIA 2E2WA 5EE1A 1YL5A 4DL4A 3FSJX 1O94A 2AZXA 4MX8A 5I48A 4AJPA 1BRTA 1ZRHA 1EBBA 4ZOLF 3DL7A 1BFKA 4HF7A 3CX6A 2GK6A 4D0LB 1U8UA 4E5MA 4ENVA 2Q6IA 2ZT8A 1YAHA 1CJVC 3M81A 1JPJA 4LPKA 4H3HB 4RTMA 1DX4A 1RRVA 1XKTA 2ID4A 4EHAA 2PJRA 3P2MA 3E9DA 4F46A 2IV7A 2ATVA 5TSDA 2VJKA 3L0OA 4G5OA 3D6JA 1M34B 1X15A 3ZQJA 2HSJA 1UK7A 3A1NA 1SQ5A 4RY2A 2W2LD 3BJMA 1OC4A 5TARA 1U8AA 4Y0NA 4K2AA 1JH9A 2OHVA 2X23A 4GT1A 5LQUA 3G5MA 4OXKA 4NMXB 4HQNA 2BEUA 4B73A 3WRVA 4BIIA 1NP7A 1VTKA 3P9PA 2ZOSA 3RTAA 2BL4A 3PQ5A 1K6EA 1R4MB 4ABYA 1ILWA 4LJSA 5D84A 4PIVA 3W4JA 3QVWA 3BFJA 3CLRD 4G07A 3WDMA 1JHAA 4JR0A 1VI2A 4QECA 5PGMA 4EQ5A 2C9BA 2ZRDA 3HKBB 3KTMA 5AHOA 4EABA 2H52A 3GILA 1JAZA 3H9CA 4YK7A 1QP0A 3F71A 2A0XA 2ZRHA 2WAOA 2I78A 4OYRA 4G5RA 6GPBA 1E6WA 1YQTA 2CD7A 1MDFA 3R9XB 4D4IA 2UZ3A 4D3YA 1Z75A 5AJWA 5JUMA 1GITA 4GR9A 3B12A 2ZJBA 2QZZA 3PNYA 2RHJA 2HVRA 1ZIPA 3PDWA 2X0FA 3LT5A 2FZKA 1DAPA 3BN3A 5GV7A 4TS3A 1A72A 2FX2A 1XE3A 1HG0A 5CB6A 3LY5A 4ARZA 4YHHB 5HF6A 1SB9A 2BM0A 2AYXA 5LU8A 1E3EA 3BULA 1BXGB 5K4AA 3GJ0A 1HM5A 1Y1KE 2JAXA 3EFEA 2CWDA 4C0HA 4ZQEA 4LHYA 3TGPA 2X76A 3URKA 1F1JA 3WO1A 1JR6A 4AI6A 5TXGA 4ZVUA 4HJXA 2JEOA 3W5SA 3MZ0A 1WSWA 3PWKA 4EMUA 5B2EA 3TLEA 2WZCA 1XD9A 4WD3A 3OO1A 1VMEA 3GT0A 1ZHSA 4HPWA 1BFDA 1NRWA 3AG5A 3F6PA 5SYNA 4CV1A 3EGEA 3FUXA 4JBGA 2W6CX 4AYTA 3KKMA 4WLFA 3CCCA 4FB5A 3H7IA 1EHYA 2X0EA 4BFZA 4DHWA 4KI7A 1DXYA 4WNIA 4YCAA 2JEZA 2YOHA 3JATB 4U7HA 3DTNA 1UT8A 4CNBA 4Q3NA 4UE6A 1R6XA 2WP8J 1VGQA 1JZSA 2W4MA 4TV8B 3PXGA 4QKQA 1LUAA 2A1TR 3G0DA 1D1PA 1FDWA 1TIBA 3VR6H 3AR4A 4IS2A 4A5OA 2KE5A 4PNHA 3GEHA 4WPGA 1AZLA 5KNDH 3V1NA 2C96A 1KXZA 1JW9B 1KJQA 1P5FA 2I2XB 5IF9A 3K72B 1M75A 2VT7A 5AOVA 1CXZA 3V7FA 2R92A 1TT5A 5DG8A 5E1BA 4N76A 2OBLA 3ANSA 1CUHA 3R7DA 4HAVA 2H2FA 2AR0A 3SQOA 5FAXA 3C97A 2NTYC 4OB8A 1VPWA 3LLMA 2J9GA 3TLZA 3M0EA 3KL4A 4OL9A 5DEIA 4I2NA 3A1CA 1DQPA 4UQOA 1GR1A 3MOIA 4XDHA 1L5OA 2XUGA 3EVDA 1UM8A 2JJQA 2NYUA 1WW3A 3V4SA 3GQCA 2OZPA 1GG5A 1USUA 1W47A 1KDZA 1A7KA 4H7PA 4KWCA 3QEAZ 4LOLA 4D4LA 5TDHA 4EGFA 4J90A 4YCNA 5LWHA 3N8KA 4S35A 1WF3A 2DR0A 2ZG6A 1ZY2A 3DLAA 3WB0A 3DV0B 4IJUA 4L7QA 3HEBA 3Q8QB 1TRKA 2HK8A 3U39A 3FDXA 2Q4EA 2WWYA 4CKEA 5K05A 3QVTA 2A5JA 1ULTA 4II7A 4ROSA 4LQDA 3IMCA 2JLYA 2O8DA 2A35A 4LFAH 3ZWKA 1YE3A 1H2XA 4QBTA 3IPAA 4WXPA 3ET5A 2FZGA 2P77A 1U8ZA 3UXMA 3VC7A 4DM3A 4UBMA 4ND8B 8ABPA 4HB2A 4WN3A 3ZE8A 1XZDA 2OC9A 1DC3A 3NANA 3CNQS 1ZH6A 3PVZA 1X8LA 3M9NB 3TZBA 2A8YA 4O4JB 4YJ3F 1EDDA 2AUTA 1D6NA 4P4NA 4K1LA 1Y3CE 3UT6A 3EISA 4R98A 4XD7A 2EZ4A 2OSBA 4C1NA 4QHSA 2AI2A 2CXXA 4MIOA 1PZXA 4D9GA 4ISCA 1SU4A 4P82A 2HQBA 1U0BB 2QQ0A 1S3FA 2BWJA 5A9RA 4OCZA 3EVAA 3EZGA 3L5KA 1XC7A 1IQPA 2FPIB 3DUFA 4FBGA 4B6EA 3DTVA 3H5LA 4BJHB 2ERCA 4IV0A 4CF3A 2AI1A 1KPHA 1HA3A 4IRKA 1FY2A 2PH1A 3KVNA 2FPMA 1NQAO 1X92A 3KAPA 1XHFA 2IXFA 1U3WA 2ZETA 2GVZC 1WA5A 3L40A 1C2YA 4LY6A 4KRGA 1U0HC 2XRMA 3OCVA 5JWHA 5JRDS 4C2BA 1Q0ZA 4NP6A 1SRQA 1Q0PA 3TZEA 4HYQA 4U63A 1NY5A 2J0EA 4ILKA 3W2GA 2F3PA 3OE4A 4S3MA 4O2AA 2W83A 4JBLA 2XVXA 3RARA 5LQAA 3D3NA 4YRKA 2HRZA 2N9UA 3CLSC 1VHWA 1XROA 3RT9A 4Q6BA 3P2KA 1WCIA 3IJRA 1MPTA 1IPEA 4B47A 2KLHA 1JXOA 2QYOA 5AK4A 2BJHA 1OH5A 1EXNA 1CY8A 1V9PA 4JYAH 2FLVA 1C50A 4HV4A 5ILOA 1F3OA 4Q9IA 2VDPB 1L5YA 1OXTA 4XGIA 1GAWA 3MF4A 2R0QC 2FDCA 1UOOA 4RWZA 3NJ4A 2ZIXB 5T7BA 2UZ1B 1CJCA 3W3ZB 2HLNA 2RHLA 4FS8A 3L0PA 3R5HA 1QTRA 3UJAA 3ZD6A 1JR3A 1BMQA 5IFKA 2H7YA 3NGDA 4JI7H 4IGAA 1F4VA 2X14A 4MB0A 3GJXB 1PK7A 1Q1NA 2FMXA 1F6WA 3D43A 2CXOA 4W9MC 1C9EA 2YYAA 1V41E 1PHPA 1PTKA 1DXOA 4EJSC 3E5HA 1ZFNA 4PZDA 3GYGA 4MS4B 1FQJA 2ENWA 4UATA 4LFAB 4NYJQ 4LXIA 4RGBA 5KX5B 3SI8A 5TMEA 1QFYA 2QEQA 1CY2A 1MQ8B 4LK2A 4B4KA 3B1FA 2HVQA 3JASA 1THZA 1E3TA 4EY7A 3BXZA 1VJDA 1BKYA 3TBKA 1E2BA 4Q66C 5E4YA 2JJ2D 4RMJA 5J2UF 5SZJA 5K8IA 4N7JA 4Q45A 1AX9A 3H5AA 1V4YA 3D6NB 4O2BB 1QB8A 3GPIA 3WDSA 1C3JA 3AX6A 4EHJA 4FXPA 2XYPA 3UB3A 3CGGA 2NW6A 3LFTA 3QBDA 4FDLA 1T9BA 3ZI0A 2H1HA 4F72A 1VPVA 2G8NA 1M0EA 1ONNA 1NZDA 1QIMA 1YU6A 3I6ZA 4EB8A 1FSZA 2QORA 2O1EA 3HNRA 3DXZA 1NZJA 1ZJJA 1YHNA 1FP2A 3F1LA 1TQ8A 5A3VA 5BVHB 1DGQA 4P58A 1JDVA 5IX8A 4KDFA 1EBUA 1XLTA 2BEUB 1YIDA 3AERB 2CUNA 5EMMA 1MN6A 5DLEA 1HBJA 2GJ4A 1IRXA 2WHRA 3FROA 5HUHA 4BJ3A 1A5AB 1AS3A 2J9ZB 1GUAA 2R751 4MINA 3LPAA 1DLJA 2GNOA 3F5QA 2TMKA 3CF6R 1GA6A 5HKLA 4Q9HA 3TL3A 1NSTA 5EHIA 2X1VA 5F4ZA 4RMIA 2GNPA 3DW3X 2P0EA 4YCMA 1C8BA 3DT8A 1QU3A 4E31A 3I72A 2Y93A 3PFIA 4EW2A 2OKCA 3M34A 1TM2A 2FN8A 1XP8A 3U3ZA 4QSMA 2QNBA 1J1ZA 3IYLW 1KZ7B 2HAEA 1O97C 3WB9A 1EUCA 2O2SA 4BVEA 4Q18A 1UXKA 3ZHCA 5A2QA 3GEDA 1A69A 1FXSA 2Q6TA 3UJ3X 2Z0MA 4JYAB 4ARVA 3BE6A 1FDIA 4N82A 1VYHA 5E25A 1G21E 5I8ZA 4AMZA 3AHEA 4J03A 2V54A 2D74A 4LFCH 1QDUA 5KSPA 3OCUA 4MV7A 4DIEA 2LDXA 3PQ7A 4TQRA 3JR7A 3L7IA 1XZJA 2Q2TA 4JI7B 5H0IA 1IOVA 2ID9A 4WZAA 3V7NA 2WSLA 5FFNA 1QZ3A 2RCNA 3TDKA 3R7AA 3CZRA 4CMIB 1DAMA 2VRCA 3GJYA 5CEFA 3QGMA 4OYLA 3E82A 4O3MA 1ODFA 4JI6B 4IUDS 4TVSA 2RGYA 5TF0A 4UBNA 4DEVA 4L4UA 5G0SA 2ZJ2A 3CZMA 3DXXA 1Z2DA 2E85A 4S12A 4QDJA 4D46A 1G1AA 4PG4A 2O0KA 4D81A 1QX4A 4NENB 1ZQ7A 1QOZA 3FTFA 4KV9A 2ZDGA 4IKPA 4GC5A 5JO0A 1FX0B 4I9FA 1Z6ZA 3C4QA 5BQPA 3KVYA 4AJLA 2HO5A 3EIOA 2HWYA 5EHQA 2HH9A 3EAFA 4MCJA 4RMGA 1P80A 3BMNA 2LRHA 2D3WA 1JEAA 2DTDA 3UOWA 3FZGA 1N48A 2G9ZA 3OIGA 1FKAH 4HH1A 4ARIA 3F3YA 2WOOA 3HB7A 3KQSA 2I4LA 1PFWA 2RHCA 2GN0A 4K8OA 4U2DA 4PCUA 3A2KA 5CNKA 3ROEA 4P7KA 1PUXA 3NX4A 1D2GA 4Q9AA 2E18A 1NMSA 4H77A 4RGQA 2B0JA 3JXEA 4NBTA 2CBGA 2Z9CA 1O96A 5FOQA 3ZTYA 4UUQA 1HV8A 3TMAA 3Q9NA 5I4IA 4P6VF 1TCVA 4KVZA 1LV7A 3AOEC 3KZ1E 2IU6A 2CZCA 4H0CA 4NFHA 1WUIS 1Z4LA 2JBAB 4LTNA 1O94C 1IQRA 2HIHA 4IOLA 1CRPA 1MA0A 4CQJA 3SEZA 5HCNA 1L8XA 4B1FA 4X8OA 3LO8A 3D7SA 5JS7A 2JGDA 3FPLA 5J2TF 3BOSA 4EITA 3A4YA 5ARCA 2JA5G 5D8DA 3FGNA 1COWA 2IKSA 3SXUA 3AF4A 5DNVA 3DTFA 1IPFA 3EOBI 1IG3A 4EEZA 2PIDA