2YZGA

Crystal structure of d-ala:d-ala ligase from thermus thermophilus hb8
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-ALA:D-ALA Ligase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 79
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzgA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzgA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzgA01
2W6ZA 1VBGA 4MV3A 4XX0B 4FFPA 1EZ1A 1EUCB 2VHEA 2CQYA 2PN1A 2R82A 3ETJA 4O7VA 2DIKA 4EA8A 2W6MA 4MA0A 3BFPA 4FFMA 1A48A 2YRWA 4FFLA 4M99A 3QFFA 3K5HA 2YL2A 2W71A 4IIJF 3GLKA 3BSWA 3LWBA 5C1PA 2V59A 2NU6B 4IZOA 1I7NA 3BSSA 1GGOA 2PVPA 1JDEA 3R23A 2Z02A 1M0WA 2R87A 3RV4A 5I47A 4MV7A 3UFXB 4M9UA 2W6PA 1DV2A 3ETHA 2R7LA 1JDBB 4TV8F 5LP6F 2CZGA 3RFCA 1BXRA 2FPGB 4ZOLF 1B6RA 4O2AF 4HNTA 1CQJB 5J2UF 4I55F 2R7NA 4MAMA 3HB9A 3I12A 2XCLA 2YS6A 4FFOA 1GLVA 2FPPB 3VA7A 4ME6A 2CNQA 4FU0A 2ZDQA 2YS7A 3U9TA 4FE2A 4QSHA 4TV9F 2GLTA 3GIDA 4J6EA 5CB4F 1KC7A 4HR7A 4M9CA 1BNCA 3JZFA 5IYZF 1KJJA 5LOVF 2YRXA 3U9SA 2W6OA 1UC8A 1KJIA 1C30A 4L1KA 2VR1A 3N8DA 2Z04A 4O7NA 1Z2OX 2GQRA 2NU8B 5EZYF 4MV9A 1GSHA 3TINA 4HQ6A 2YZGA 3R5XA 3BSYA 2J9GA 2GPSA 1Z2NX 3RV3A 2R6FA 1C3OA 3MWDA 2R85A 4O7SA 1CS0A 1DV1A 1E4EA 3AX6A 4Y8VB 3KAKA 4M98A 4C5CA 3Q2OA 4MV4A 1KBLA 4O86A 2HJWA 3E5NA 4FGRA 4EA7A 3ORQA 3U55A 5KKNB 2QK4A 5BPHA 2WYOA 3N6RA 2YW2A 4MV6A 5DMXA 2DLNA 2W70A 5H80A 2NPOA 4O82A 3HBLA 5BMVF 4NYEA 4FFNA 3DF7A 3OUUA 4WBNF 3MWEA 4O7LA 2QF7A 3WO0A 5CA0F 4XZ3B 2ZDHA 4GGMX 1KJ8A 1ULZA 4IHJF 4O7YA 4ZQIA 4O84A 1VKZA 1KEEA 2FP4B 4WD3A 4DIMA 4XYLB 2PBZA 2SCUB 1KJ9A 2C00A 2ZDGA 4YB8B 3G8CA 1Z2PX 1I7LA 3HO8A 2NU9B 3JZIA 4O4JF 4IWXA 1OBDA 1KJQA 4XYMB 5HV6A 5JVLA 2NUAB 1EHIA 3K3PA 3G8DA 4EGJA 3R9RA 2VQDA 3TIGA 3TIIA 4YAJB 1M6VA 1W93A 1M0TA 4O4IF 1IOVA 4O7WA 2HGSA 4DLKA 3LP8A 4I4TF 4C5BA 4O4HF 5LXTF 1SCUB 3SE7A 4MV1A 5J2TF 2YYAA 3K5IA 2W6NA 2V58A 3JRXA 3AW8A 2FB9A 3VOTA 3MJFA 4MA5A 5HBRB 4O4LF 3VMMA 2W6QA 1UC9A 4HNUA 1EUDB 3TW6A 3VPCA 4EG0A 4EGQA 2R7KA 4EAAA 1GSAA 2YZNA 4EA9A 5LYJF 1GSOA 1PX2A 4O81A 2GQSA 1AUXA 5JQGF 3Q1KA 4MV8A 2I80A 5CAEB 3V4SA 5KX5F 1VBHA 4TUYF 4ZHQF 2NU7B 2CNVA 2I87A 3VPDA 4IWYA 2FPIB 2V5AA 2YWVA 1OBGA 1PK8A 2XD4A 3TQTA 1JKJB 3WNZA 3BG5A 4EABA 4YAKB 4RZQA 1W96A 1A9XA 3R5HA 3OUZA 4YJ3F 4E4TA 1B6SA 2R84A 3KREA 2GPWA 5CA1F 2R86A 4O83A 3WO1A 5K2MA 2P0AA 4O7ZA 4FFRA 1T36A 2VPQA 3NUAA 5LA6F 2DWCA 5C8YF 5JVDF 1AUVA 1JLLB 3KALA 1IOWA 3U54A 3R5FA 4O7RA 2YZLA 3V4ZA 3ORRA 4I50F 5D8DA 1WR2A 5BPFA 5JQWA 4ZI7F 2CNUA 1CE8A 3RUPA 1EYZA 2DZDA 2R7MA 3JRWA 2I8CA 5C1OA 4O7TA 5GONF 1KUTA 4YJ2F 2IP4A 5JH7F 1E4EB 5FNVF 2X0SA 1DIKA 2OLSA 3KAJA 4O2BF 2YZMA 1CQIB 4YBZB 4C5AA 4HNVA 3VPBA
chains in the Genus database with same CATH superfamily
4QPDA 5B2EA 1EP9A 5BWWA 1GNVA 1BMFD 1KP2A 1BTOA 3LY9A 4JBYA 1Z37A 1ES9A 3GT3A 2HQRA 1FLAA 1NSTA 1U8YA 1WTAA 4GX0A 5AHRA 2I9KA 5JAPA 1R0KA 2IUTA 4JC0A 3X1ZA 3MFQA 1UDAA 1YV9A 2Q2WA 1VMAA 3L0YA 4BLPA 5AM2A 5CBPA 3MILA 3F0TA 3PFWO 2ILVA 3OZXA 4IMRA 1QGUB 1X38A 4KQ9A 5L1KA 1E9CA 1RJ9A 3EVNA 4LZJA 5DP1A 4NS4A 3UK2A 5A62A 1J1UA 1VA5A 2NSDA 1N1DA 3HCPA 1T5IA 2BGRA 4CLDA 1QWSA 4JITA 3SHVA 1MAWA 1N6PA 1VHWA 2A0FA 2DCUA 2WU8A 4RJJA 1I3NA 2NO6A 3WI7A 3WFZA 4F9GA 3HYCA 5CPBA 1ZXLA 1QMGA 2QPOA 2DT5A 2WB4A 3DJYA 3F47A 1C7FA 2PV7A 3QKWA 3CSWA 1UJ4A 5JS7A 4BUZA 5F76A 4D2IA 3RIHA 1J23A 1TM7E 2Q3EA 4F9TA 2J31A 2QSJA 3UA4A 4F6LA 1Z26A 3RF7A 3RFUA 3S7TA 3GLKA 1OWNA 1UBHS 4PHGA 2Y4OA 2VI5A 3RANA 1FFWA 2BV3A 3EUAA 3TYXA 3NYQA 3NETA 4JLPA 4AY6A 1F9EA 3V1YA 3NXKA 3ANTA 2EG5A 3BBPA 3LOQA 4WUVA 4BX0A 1E6EA 1M0WA 3DZGA 3D9QX 5CJJA 4E07A 1SVKA 5AW1A 3L1KA 1T13A 1E2DA 1YDGA 3OZBA 4LMBA 3A28A 3BK7A 1Y5RA 3LCRA 3RUAA 3UOGA 3DMYA 4LA4A 2FGKA 3WL5A 4M83A 1HPLA 1LI4A 3HWWA 2QJRA 4RD4A 4YH1A 1DV2A 3IV6A 2GCPA 4TPKA 1ABBA 1OIVA 2EP8A 3TNDA 4K8RB 3W4IA 3KNZA 2GZAA 3PL1A 4LYDA 5CAEA 3VNNA 1P7VA 2P5UA 4PV7A 3GZ4A 3PF8A 4BVLA 4IRUB 5LP6F 1OBFO 4GDMA 4NFSA 1SPBS 1UXKA 2G80A 2FSHA 3S1AA 3STWA 4DMRA 4JUAA 4MCJA 2AG6A 4G0ZA 4GG1A 4F1JA 3ZK7A 2TMDA 2QMHA 1YNOA 3CEBA 4P3OA 4OVKA 4R9NA 2A5FA 2YFHA 1RKBA 1I5EA 3ESYA 1JEQA 3ISJA 3L7JA 3S2EA 6ADHA 3KQVA 2R7NA 3S8MA 1WW2A 1L1QA 5TT1A 3HB9A 3C14C 1M1YA 3LUFA 2WWTA 4KN6A 2GBLA 4L4UA 4K9SA 2Q4BA 4V0MA 5A5DA 5LWHA 2H92A 1IZZA 4JBIA 3WNQA 4Q4AB 4V0NA 1GLVA 2E4UA 2ZEJA 4D4KA 4ZVUA 4CL2A 1OBOA 1CKEA 5JNLA 2NX2A 4LSWA 1CF2O 1T2EA 2VOEA 3IUNA 5IP7G 1U1GA 4WSOA 1E92A 1RVV1 2BT4A 5CLQA 1F12A 2J41A 3U9TA 1U6JA 1DG9A 3T1QA 5JY6A 4OF4A 3I58A 1BHO1 2ASVA 3A8TA 2L2QA 4LYYA 4NYMR 1LKZA 2VZLA 4NXMB 4UHFA 1G38A 2W2PA 5AW0A 3A1TA 4DLZA 3PI6A 1RJPA 1PT5A 2IYWA 4J0FA 2P2YA 2R8OA 1FFGA 3NP9A 1V3TA 2P0EA 4M7OA 4MWCA 3GJSA 2PWZA 5TT0A 2FLKA 3RFTA 5K8JB 2YHAA 2XECA 1CLEA 3RYIA 4QG3A 2VEOA 2JCVA 1P75A 2HDOA 3DA8A 3QBDA 3IO5A 4DZRA 1H0RA 4DR5B 2J0QA 3R6LA 4BIIA 1HDGO 5J23A 2PZEA 1KKUA 3QELA 2I4NA 3M0EA 4YCAA 1P39A 1VCMA 2FG6C 4NFYA 4NBNA 4AICA 3GQBA 5AKLA 1FQJA 3WLJA 2IYSA 5FTLA 1AZWA 3SLGA 4XA8A 2GPYA 3LTEA 2WHRA 2PL3A 3D5TA 5F9MA 3ET5A 2NYRA 2ZJBA 4MP6A 5AOBA 2OXCA 4KK3A 1F60A 4UD2A 3WL8A 1G4UR 4MI1A 1V7CA 1UDCA 3UWDA 2DECA 1TZCA 3DULA 1DPFA 1KKMA 4J9PA 2ZS9A 4JLKA 1UBNA 2DX7A 4PZUA 2BKUA 4QYXA 3U39A 4E03A 3U16A 1XT6A 3C41J 4QYWA 5E2BA 3WKAA 4A6XA 2WZCA 2QVBA 3PFNA 1CFZA 1M33A 2CCKA 4BY1G 1IN4A 2GO7A 3C6KA 4OIFA 1X7XA 3NIFB 2IUSA 1KZ7B 2WP8J 4GP9A 1DRVA 1XRNA 4IDDA 2WKWA 4FDAA 3FFBA 4HQ6A 4KACA 4C6RA 4F04A 1YKGA 4CM9A 1ILWA 3OQBA 1JDVA 1WMBA 3PEUA 3RUFA 3ZWMA 4MS4B 5KNCH 4QEZA 4LFCH 1FJGH 2A9VA 4PWQA 3QXHA 4FZ5A 2ZFUA 3SC3A 4EPRA 2AYZA 2WY2D 2X5XA 1P2SA 1NXXA 2XYPA 1I4LD 3LRPA 2FLNA 4QFDA 3R7LA 4ARSA 1MIOB 4O7SA 4BX8A 2DQ4A 3OZAA 1ORWA 5TARA 1NMEA 4ZQEA 1LDNA 4QTUB 1Z7BA 3EDYA 1F8UA 2WDPA 2YWRA 1B73A 3MINB 1I5OA 1ZK2A 3QHQA 2H4XA 4X20B 2IHNA 4PQRA 4BATA 1KBLA 3DWFA 5GZ1A 1ET0A 1JLRA 2HRRA 3AT1A 5D7NA 5IKXA 1S7GA 2IH2A 3DAGA 4S1NA 3VU1A 3QX8A 1U98A 1LBHA 1WY7A 3GZNB 2G1AA 4R1OA 1TVKA 4WNIA 2JC3A 5CVVA 4AZSA 1E63A 3JX9A 5ED0A 1I32A 2C78A 2O3TA 5ICMA 2XAUA 3HEAA 3GNQA 3MD9A 3ZHTA 3BA9A 4BV9A 2ZUBA 2Q6LA 3PFBA 2JJ1D 1L5OA 2JKZA 3L4BC 1E2IA 1Q5PA 2AN4A 2I3BA 2ZROA 3S2UA 1WW3A 1H65A 2W5UA 4Y6OA 2OBXA 3TW7A 1NVUQ 1J24A 3UIEA 4HN2A 2BIFA 3HOZG 2GM9A 3NXSA 4EKNB 2PMWB 5EQFA 3DEFA 4ZXFA 1S2IA 3N58A 1KDPA 2F3QA 2Z8XA 3OCCA 5FKJA 1T8UA 1OYWA 3PFGA 5CHEA 3KKEA 2IBTA 2HAEA 3WSTA 4ZEVA 3F5FA 2PGLA 1LLQA 2JFVA 2PKQP 4DV0H 1QPGA 1TX4B 4GKKH 1T9ZA 1ZXXA 3DL2A 2GEUA 3AR3A 4ND3A 4XM2A 2BOVA 2VAWA 3FLMA 4AKTA 5CFLA 4DR1H 1FP6A 3LUJA 4DMUB 4AWXA 1A5ZA 1E3JA 2VUIB 2BHLA 1BSVA 3D2CA 3I04M 3TR0A 1DEXA 3VPFA 1YIAA 3FOAA 2NUBA 2XW6A 3NAMA 5IEJA 1E6CA 2VUHB 1ZHOA 1KIAA 1Z5PA 1RYFA 4PNZA 3RBAA 2OZKA 5HIMA 1SVUA 2IQ5A 1RRGA 2P75A 1J0DA 1Z8NA 3C4JA 1XZEA 3Q6MA 3JQRA 5TMBA 4XR9A 1X9GA 1GA4A 3QU4A 4IFTA 3VC7A 1DIOB 2I6UA 4Q02A 3QZUA 3FSEA 3QH4A 3RC7A 3WLFA 4DR4B 3DE1X 5U4XA 3ZU5A 1SVLA 2PGAA 5JSQA 3LK6A 1X7WA 4RCZA 1QE0A 1KAHA 2W6CX 1G291 5B6JA 3A6PC 3ETLA 1O95C 3NONA 5KQLA 1C29B 1W1WA 4BVHA 3BPSA 3BDAA 4Y9SA 1NN3A 4KO3S 1XKXA 4O4JF 1XKLA 2CJWB 3AINA 3CRVA 3LC0A 1SHLA 4MUBA 4EKEA 4PG7A 4LK2A 5THQA 3ZHOA 3RW9A 3DFUA 5HV6A 2POQX 1WIWA 3KEQA 3KTAB 4XRRA 2RHHA 3PIDA 2TMGA 1J21A 1XRMA 3CZMA 2AZXA 3RU9A 3FPLA 1DU4A 3U60B 3AI1A 3O31A 2JATA 2PRKA 3WWZA 4YK7A 4BNWA 2AE1A 3SDZA 2R79A 4D3FA 1D2EA 4H4DA 2V9WA 3W04A 4MQ6A 2ZR9A 3GR6A 1PWYE 3UB3A 4CLEA 4ECAA 1NVDA 5LL6P 1BU8A 3DVAA 1M2WA 1E4VA 4JWTA 4DVGA 1C7RA 1EJBA 1JJVA 2O2XA 1L2TA 4OHUA 3EXHC 3RLIA 4X1KB 1GXSB 2F62A 4OMUA 2D7JA 1UOEA 2EBHX 4ED0A 3TY9A 1R8SA 2BTQB 1RWQA 2VYNA 4MUMA 3ORSA 4UCQA 4ARZA 3OT1A 1YB6A 3E1KA 4I4TB 1U1FA 5LB2A 4DPLA 1XU4A 1PW7A 2QMZA 4PX5A 4ESOA 1V1RA 2F1OA 3D6FA 4A23A 1UBGA 1V37A 4GVPA 2CFOA 4ZOBA 3O74A 2V9ZA 1VLQA 2HLNA 3V9PA 1I1HA 1T1IA 2C5LA 2DR3A 4COOA 4Z9AA 3H1TA 4ND2A 2Y0PA 1ZH6A 3IV9A 2K87A 4TYQA 1ORHA 3M5CA 1QYIA 2W2VA 1VLJA 4CNBA 4YMUA 3MJCA 1QQBA 3EHDA 2J67A 4W5JA 3KS9A 3S44A 1JWBB 5KFZA 5TGZA 3JYLA 2D8AA 1QVZA 1H2AS 1WZNA 2NT3A 2VDVE 3DBLA 1T8TA 4AG5A 1AKRA 1V9LA 3SGLA 3TFWA 3FJOA 4LQCA 1P33A 3I4CA 4JC4A 1E3SA 3GEEA 4V24A 4XWAA 1H1LA 1HQDA 2ZBFA 4F5WA 4L9WA 4ARZB 4O2LA 1IM2A 3PNOA 3K70C 3SNOA 5JXIA 1DKQA 2HLDD 2CV1A 2PYZA 3MGBA 1BQ3A 4FYYA 3AU8A 3A05A 2FB9A 1AZSC 1PR3A 1HE8B 4MUJA 1GWNA 3PQCA 3WK6A 2PUCA 4YRRA 3ZZ1A 1E0DA 2QDXA 3H5WA 2C2BA 1R74A 5DN9A 1P16A 1D2AA 1JQJC 2AFHE 4ZO6A 4DQVA 2A5LA 2I6GA 1ZOOA 4U6QA 2O03A 3LP5A 1JH9A 1M2HA 1XELA 4U7HA 4JFRA 2XSZA 4DOMA 1UC9A 2OFPA 4NNPA 4EHIA 3TQSA 4ZU1X 3OJ0A 4RVGA 1D1TA 2FPWA 3IAEA 1OTXA 2K2WA 3O21A 3IAUA 1EB8A 3RKRA 5KT2A 2E6UX 3FH0A 1Q91A 3LGAA 1K7XB 4O33A 2EGUA 1Z8HA 2ZJOA 4WZ6A 5J4VA 1Q12A 3OY2A 3S1AB 1QG4A 1T5OA 1KI7A 4ZTBA 3QPDA 5K1ZA 1II9A 4BKUA 3V4SA 3U7FB 4Z4IA 4O2AA 1YVUA 3HNPA 3DVLA 2BF7A 3GJ3A 2BN4A 4QQRA 1U3WA 3FPEA 4CGYA 1YOVA 4CCYB 3H8SA 1MH9A 3B2NA 4TVSA 2ZK7A 1WVMA 2Z09A 1XMOB 1P7PA 2FSUA 5KNDA 3BBLA 1KKLA 2ERYA 1XHLA 2QLJA 1K4YA 2Y05A 3DGFC 4JP2A 1LX7A 2GHIA 3TVDA 4FT2A 4KEAA 4MUGA 5A7HA 2XRMA 2PAFA 1IN1A 1PK8A 5TQ2A 3F9CA 5LDGA 2QHXA 1UPXA 5L4LA 4K6MA 4NDZA 3TI7A 2R8PA 2FV8A 1BH6A 3LUDA 2DT8A 1QHGA 3D3KA 3T5TA 5H4HA 1P31A 3STHA 3U7JA 3VC2A 4AP9A 2O8CB 1GFSA 2HF9A 3VYSB 2C61A 1YHNA 2IIPA 5KWJA 1W96A 3IOYA 5ALTA 1GZDA 3TXAA 3LCJA 3GGPA 4BBZA 4KX3A 1U28A 1NR5A 2IPLA 4RV9A 5LP1A 1C7JA 1R9NA 4MDYA 4OFWA 5A1JA 1PR5A 1ZIOA 2HC9A 2LP4Y 5FA8A 3DXZA 1EJ6A 1C1DA 1A9OA 2PPLA 4G5SA 1WL8A 4H2DA 4GMXA 3G88A 4G5OA 4WUTA 1W47A 4HLQB 1XK7A 2P9GA 2Q0QA 2GN1A 3ELDA 4GKAA 2JH9A 3ES9A 3I0NA 2G36A 1T36A 3ZHCA 1KMIY 4YJFB 2WI8A 4BP3A 1H5UA 4W7IA 3OWOA 4W1SA 1AUVA 1GQYA 4AJLA 4C06A 5IKPA 4G1MB 2VQFB 4WJKB 3AVXA 1JG3A 1PVOA 3I73A 2E5FA 1ZCAA 1GA1A 3NDRA 5BWLA 4XR4A 5F9FA 1V43A 1ZRNA 4N0QA 4B6FA 4Z3OA 3H2JA 3VDQA 2I22A 3D7NA 3GJTA 5AUNB 1FC0A 1SHZA 1U0HC 3MGKA 3QWFA 4RORA 1JFTA 5EJFA 1Z4NA 1V8FA 1M8FA 4QM6A 4DNFA 3AVTA 1JHMA 4GIBA 5FCDA 3VPSA 3EZNA 4I1YA 5DG9A 2NM0A 5FWNA 5EXPA 2DKNA 2WAOA 1OX6A 2D2VA 1CE8A 1W5EA 4C6TA 2PIAA 1CP2A 4JEHA 2R2AA 4A8JA 1XDZA 1VLVA 1XN1A 2ADMA 4MO9A 2ZAGA 4IJMA 3PD7A 3C98A 2HU7A 3SSOA 4G86A 3RJ9A 3L06A 2E48A 1A1VA 3IXQA 4IGEA 1OFUA 2NNWB 4KZPA 2BKVA 3UGTA 3HB4X 1UH5A 3RO7A 2QG9A 2PUHA 3DE0X 4HF7A 4NU0A 5D7BA 2R48A 3WS7A 3IVGA 4UDXX 3LC2O 4BVGA 3BMNB 3I0MA 4KC0A 5FTKA 4LTNA 2ZAMA 2Z30A 4FK8A 4OM7A 5PGMA 2IXGA 2NYAA 1JQEA 2FCRA 5CNJA 5AKKA 2QP4A 3H1PA 1KA9H 1KSGA 4O2BF 1MA0A 1OMOA 2RG7A 1QZXA 2Z5FA 4I6EA 1HFJA 4PR0A 4Q47A 1LV8A 3PS9A 1A69A 4E33A 3REGA 2FWJA 4KRXA 3RASA 2ID9A 5L3QB 3IQHX 1IL0A 2PX5A 3PR2B 4C0BA 2JFXA 2G9RA 1N5OX 4RSGA 2ZRPA 1RJEA 3SFTA 5CUQA 3PEYA 4QDZA 3PR3A 4V0KA 3WXMA 3ADCA 4MARA 5MFPA 3R3WA 4YJHB 4F1KA 1C4WA 2F8MA 1Z0FA 5CP8A 4JI6B 1ABEA 3CHYA 5DHPA 1U6KA 1YT5A 5DM1A 4A8JC 1YDWA 3PHBE 1G3IA 1YQXA 2X22A 1L2ZA 1PYOA 2UAGA 4RLQA 3SLKA 1EQAA 5CB0A 3FHTA 3G59A 3M82A 2EF0A 3MJSA 5EFOA 3OO0A 4I3HA 1R9JA 1VQ1A 4B6OA 4YRPA 2CYAA 2OZEA 3NI2A 3F78A 5F12A 1N6LA 1QVRA 3U4MA 4RLFA 2DFTA 1HZJA 5E1BA 1JMKC 3UT5B 2BGMA 3NYIA 2X15A 4NPAA 2SHKA 2NZXA 5C4MA 4LZNA 4IH9A 5B3KA 2ZPAA 3O7MA 3PPIA 3H04A 4ZO4A 4C03A 1DJQA 5FBQB 1YZYA 4J49A 3HABA 2ZU0C 2W71A 1UBCA 3X43A 1I7SB 2P4SA 3WXBA 3KB6A 1ECLA 4BIMA 4DDHA 1U0SY 4PHCA 1GKIA 3ZKAA 1V25A 2GRUA 3I53A 4JIGA 4EGSA 4Z4EA 3NJRA 2NU6B 2XH8A 3EQ7A 5FTNA 1J8FA 3BSSA 4LYGA 2R7ZA 2ZVJA 5CMLA 1GGOA 4GFDA 3GRKA 3ACDA 3V42A 4N65A 2FQYA 2JLBA 1A8SA 4DQUA 1FLVA 5JARA 4MQBA 3X0DA 5JXGA 5HKKA 1JHRA 5A05A 4EP1A 3BH7A 4R8UA 3EVGA 4G9GA 3BJZA 3PITA 3F3KA 3GTMA 4GPZA 1T94A 1QAMA 5C5IA 2VJNA 2ZSHA 3DDUA 1EUQA 2YN4A 3PC8C 3VV3A 4ETMA 1YQQA 5KJEA 5BR8B 1E5QA 4FEYA 3AR6A 3QFTA 3HMKA 4JJFA 4C7VA 4FTWA 4MPDA 4ARIA 5D1PA 3LMKA 1KI6B 2WYIA 4NP6A 3HE3A 1G1MA 3SIPA 1ZWLA 3WBKA 3ERCA 2RK6A 4QIWA 2PCJA 4JR1A 5CT9A 5H9WA 2A9RA 3W8RA 5CIYA 3RFCA 1ODKA 1QH1B 3OLZA 2W8BA 3MT8A 4MKZA 4BP1A 3EC7A 3JZMA 5SY9A 2DPYA 3P9KA 3EQZA 3DT8A 1P2TA 1JYFA 1UDBA 2HK9A 4QJBA 1JW9B 4RY8A 1VYUA 4BYGA 3FGPA 2VDWB 4I55F 1X70A 1DIAA 5INTA 2C5GA 1I36A 3I9OA 5BSKA 4R8UB 2PSSA 2BE9A 1JXLA 2QP9X 1JDNA 2QPLA 5AW4A 3M34A 3CH7A 5TC4A 1OFTA 5DW3A 1RI5A 1IFXA 3IBFA 1IK6A 5IDYA 1Q0HA 2VJQA 4OYHA 2XCTB 2QY6A 2ISCA 4C7BA 2XUOA 1G21A 2C5FA 1EFKA 1GTG1 2C5AA 3OT4A 2O5VA 4ZRNA 2WWGA 5BN3B 2ZDQA 3EGXB 4HQOA 4NONA 3LHIA 4QJ4A 1OV4A 1VBMA 1ZD2P 4YUZA 3N2NA 2E4AA 3QLUC 1ZUHA 4P7JA 1QP4A 1S1CA 3CC8A 1ZVVA 2NO4A 4IMPA 1TCCA 2ZIXB 2ZYHA 3AL3A 4GI3A 4H0NA 4WBXC 2X4GA 3ZWBA 4ZCSA 4FOPA 4B4KA 4DCJA 1UEXC 2ZSBA 4EBFA 2CMGA 2J6UA 2CGEA 1F2VA 3NBUA 2H2WA 4E7OA 5DHRA 1NRXA 1Q1GA 1Y6RA 3IBCA 3UH0A 4DIKA 3A36A 2NVUA 3OOEA 3Q2KA 2JAQA 3EFEA 2ZWVA 4D0NA 2Q3JA 1G20B 1F14A 3DB2A 2QMUA 3QVTA 3V00A 1FPQA 1RQ7A 3VZQA 9ATCA 1EBUA 4H1VA 2UYQA 1RTTA 2XE6A 4P31A 3D8SA 2BTOA 4E3ZA 4W5WA 1XTZA 1Y34E 1T4CB 2ATVA 2G5TA 4BLOA 2ZJ8A 3BHIA 3ZZUA 3SYKA 1KI3A 3K70D 3A0RB 4ZOAA 2ZRMA 4N8EA 4RVNA 1RC1A 2CNBA 1QTNA 9MHTA 4FFBB 5DHQA 1H23A 5F7OA 1P45A 5LN1A 3FCYA 4MV9A 5CIQA 1JEYB 4MCHA 1QVVA 2GSWA 4EVSA 1E5LA 2XTNA 4LUCA 4R1LA 4W5NA 2HIXA 4Q4CA 4XD7D 4Y2RA 2P35A 3UK6A 3I83A 1MNAA 4HNAB 4OI1A 5HUJA 2ECPA 2QLBA 3MJHA 3FWPA 3N05A 2XNJA 4LJAA 4MPPA 3WJ7A 2IU3A 1TF5A 3N0VA 4TZKA 4F06A 1T1JA 2ODWA 3RWOA 1NUSA 2YC4C 3PFIA 4J3JA 2C2RA 4CW7A 1EFTA 3AEKA 4MW5A 3UO8B 3AFOA 3U6KA 2CZCA 1ANKA 2AFHB 3Q8XB 4G5QA 1K7SN 2ZT5A 2C03A 3MTGA 2H9AA 4HB4A 3D02A 4LRSB 4MIEA 4PQGA 4ED1A 2PD6A 3LE8A 3P4UA 2IYZA 3F9IA 1WHTA 1GRCA 1BWQA 1I4TD 3K4QA 5IANA 4U4AA 3OTOB 2YY6A 3DBHB 2FPXA 2LGJA 1X1BA 1R0ZA 1QM5A 2BFMA 3LF2A 5IULC 3LYLA 1CVRA 3I64A 4CMFA 3JQAB 1J5PA 4BRZA 3MWMA 1M2VA 5C8VA 1KDTA 2CFTA 2UUOA 4JROA 3D31A 4L95C 5FYQA 2HIHA 3ZI0A 2UVQA 3C3AA 2A1IA 4LDAA 2VAVA 5CLGA 4C5CA 1L4NA 2ZVQX 3CPJB 2XTAA 3H2KA 3MCWA 4YN3A 3E5NA 4LF7B 2GEJA 4BNNA 3ORQA 5KT4A 2GEDA 4LKOA 3WGGA 4GX2A 1RBZA 4X65B 1Q3HA 1FSFA 6CHYA 3KQUA 3QTBA 1P72A 2PTGA 1T2VA 3L79A 2I7CA 5AKXA 3OTHA 3JARA 3THYA 4DHEA 2E4YA 4C0HA 2XUIA 1XWFA 1DUVG 5DGHA 1M7BA 5BR4A 4UVGA 4GVXA 2FXIA 4ZREA 5L1IA 4RAYA 1FFSA 1KNQA 1G8KA 1TZBA 3L0PA 3P2EA 1QDUA 2RHTA 3TCNA 3TD9A 2IHTA 1NUPA 2OWEA 4FSXA 4LMRA 4X8OA 3OE4A 1ZRMA 2IS2A 3NKVA 4CGZA 2JK0A 1CQWA 3A1EA 3EMBA 2E2WA 3SR0A 4ALLA 4F46A 1JFSA 4N03A 2JLQA 2Q3LA 4F7WA 4KMSA 2VSOA 3NHKA 3VYUB 3PPYA 4QQNA 1MT3A 2PJUA 2Z95A 4HGPA 4G9EA 3GRPA 2DPIA 4XJTA 5CR9A 2QF7A 3QWHA 4WLVA 2PUFA 2XODA 1K27A 2KW5A 1J4AA 1VCOA 5EWGA 3EQ2A 3CISA 3M1IA 1KVRA 2G1KA 3DHEA 2VQFH 5KDOA 1DCKA 4GL2A 1T1SA 3GRRA 2YQ4A 1ISJA 1R1DA 4EB8A 3FNQA 5AH0A 3RU2A 3JYPA 2B20A 5C44G 1SD2A 4G1UC 5FEUA 4DNXA 1RLTA 5D86A 2Y66A 5BVGA 2FMTA 3E3NA 3H9UA 4X97A 1EI9A 1TLFA 1YR6A 1KDVA 4ZZIA 3K09A 1TAGA 3K71B 4HLDA 4LHSA 4RW0A 1EFPB 5C9ZA 3IHWA 4JP8A 3FRIA 5EXSA 4KI7A 1PNOA 2W4IA 3UKDA 4V1CB 1UMCB 4WXEA 2BI7A 5EYPA 4YUAA 4FFBA 1F2UB 2WTNA 3G8YA 1LI5A 5IMBA 3TLJA 1E1KA 2XIGA 4YP3A 1QLWA 3HQ4O 3GHHA 4AROA 5TSDA 4BNLA 4UQOA 2DHEA 1Y9AA 3COYA 2A86A 2YVUA 1U1IA 2YWGA 5E38A 1OPRA 2QL5A 1YD7A 2O0KA 4Z7QB 3NM4A 3EDOA 5BUZA 3SSAA 1E9FA 1XTIA 2HSEA 4GXTA 4GNRA 4K8OA 4I2VA 5D3ZA 5IK2D 1N2JA 4NCXA 2KMLA 5KINB 3WB9A 1XXHB 2JLSA 3BXHA 5L45A 2AUTA 3L0DA 3X2SA 1KP3A 1XVVA 3RYCA 3F6RA 1L7NA 4F5ZA 5JDCC 1PNTA 5LDHA 3TZCA 1HR0H 1PR9A 2HU5A 3QPWA 4GMDA 4J3FA 1YCFA 4YO7A 3R7NA 4FZJA 1KH2A 4JBLA 4TTVA 4RUKA 4B4UA 4JB0A 4PZAA 5ESRA 4RX1A 3EEIA 1RZUA 4HGOA 3PYXA 3HXMA 1HDCA 2C2OA 3KYIB 2OLEA 3EGEA 3WL7A 3O92A 4C0AC 2QIOA 3L49A 4HX2A 4XUCA 2BGUA 3Q7QA 5G40A 4LMYA 4GC5A 1USGA 1Q0RA 1GPUA 4F3TA 1T34A 1VMDA 5U1PA 4DA6A 5C32A 1E66A 2DU8A 2Y9MB 4P22A 3UAWA 4BTEA 4YAJB 4E94A 5FV4A 2JCBA 2ZWAA 4C7XA 1P3DA 2PKRA 4P4SA 5KAPA 1WSCA 1EZ4A 1UBUS 2FF7A 2WT9A 3COVA 3ZDZB 1DUIA 2ICAA 5HRAA 2W90A 2PX6A 3G0BA 3WYAA 3D6NB 1R5NA 5IYDG 2NVWA 3ZLTA 1ZVMA 1QG0A 4C04A 3T06B 4NPHA 4BWGA 2R65A 5B30A 1RYNA 3T5CA 2C7GA 1JNYA 2E4ZA 3WGKA 3U5TA 2B8TA 3PHCA 2Y0EA 4X20A 2IS4A 2F3RA 2KPOA 1EVEA 2R66A 3GT4A 3V4FA 2CLMB 4G65A 3IX7A 1HMYA 3MWFA 5B1IA 1DL5A 4UUNA 2FLVA 1T4GA 3GW8A 2QX6A 4Q44A 1A7KA 4HWOA 4L3VA 4A15A 2V58A 2AMVA 3D4LA 4G5RA 4HJXA 4YAJA 3F8NA 4C0KA 3DGEC 2XMQA 3P2MA 2LCFA 5PNTA 4C3ZA 2I67A 2UZIR 3WGNA 2X14A 3CUEF 1AQUA 1U4OA 1ZNXA 5JWOA 1A8UA 3T9FA 3ZKWA 5DTEA 5CH5A 4GS5A 4E32A 3FZQA 1W19A 5LKAA 4IVRA 1FRQA 1DE0A 1FA9A 1L8OA 3URMA 3VOSA 1P91A 1X74A 2K2QB 4EB0A 2R8YA 4UCRA 1NN1A 1IXKA 1WM1A 1C1HA 5ILQA 3FPBA 2FDCA 1I80A 3O75A 4DYDA 1UANA 3QXXA 1RYEA 4DXAA 2R8RA 2FUCA 3DYBA 2XB9A 4KPEC 3JQBA 3HL4A 1HDOA 1YXMA 2XCOA 2B1JA 2BEKA 2IYYA 1MF7A 2FHPA 4UDNA 3W6OA 2EU8A 3CFYA 4ZOLB 1JU4A 4R7GA 3TX6A 3CVUA 1GCOA 4PIMA 1FYEA 3PC2A 4YRGA 4ZA2A 2COJA 1KR2A 2AB0A 1NMQA 2FKNA 2X40A 1BHQ1 4NMXB 4PFKA 4DPKA 1R0SA 3JAMA 1X7WB 3V6MA 1IEVA 2O5CA 2HBZA 2ZWIA 2PH5A 2W2KB 3IUMA 3OCUA 3A2KA 1QKIA 3ZE7A 2R1TB 3UQYS 2W8LA 3ZWWA 3SG0A 4HGQA 3OZCA 1KT8A 1P60A 1RLIA 3QXCA 1NUAA 3OIWA 4C89A 5KNCD 1BA3A 4YCCA 4RENA 2C1XA 4IZIA 1UJ5A 2OCAA 1XDDA 3FY4A 3J7TA 2ATXA 4ZN6A 1JHAA 2GZRA 4BRWA 1ACLA 1I94H 4REQB 5HJEA 1CJSA 1JAXA 1HUQA 1QCYA 3FUXA 2W57A 1RBQA 4QJFA 4O3QA 4RZRA 2COKA 4FYJA 2V54A 3GH1A 2ZUCA 3E2MA 4EJMA 2RCNA 1RRFA 1UAYA 4GE0A 5EPUA 2C04A 2FRVA 4PCAA 3ZBUA 5KWVA 2HMUA 5HS6A 4RCVA 3RKUA 3KB2A 1QMPA 3RRXA 3UGKA 3OOSA 2GZ2A 3SVZA 5LU9A 1ODCA 2GCOA 3TS1A 2VPPA 1WCV1 5H0IA 1T5HX 5K3OA 4LW8A 1LSUA 3T1YB 1ICEA 2FHSA 5I5EA 1U0JA 3II6X 1CUWA 4UBNA 3UAVA 1LBTA 3IJEB 4HDMA 1T2CA 2NSJA 3AESA 4HB3A 4MXDA 4GR5A 2HVQA 3F7MA 1GCUA 3RRFA 1V26A 4MQEB 5KNBH 3Q3IA 1YFKA 1ESDA 4H1UA 3R9XA 1NUUA 2C42A 4XLTA 4M87A 2I1QA 2Q62A 3Q7PA 2O1XA 4C3OB 1SXQA 3ZW8A 3ZD8A 4YJFA 1ZZEA 1GTJ1 3ILVA 1RM3A 1JDUA 4JI8B 2N1MA 1MPXA 2HT1A 2RONA 2JGMA 4MS3A 3H2SA 5H59A 5IH7A 4ZU6X 3QU2A 3KYCA 4OUKX 1B4DA 4TMYA 2GFHA 2RH8A 3KSRA 3P19A 4CIDA 4F8JA 4YRDA 1V95A 3AWIA 1HQKA 1NIPA 1ZNWA 1O2DA 4UM5A 5LLDA 3HCEA 2CVHA 3ASUA 4N3NA 2O59A 3R5FA 3U49A 5DISC 4LDQA 3RU7A 1BE6A 4NRDA 1VTKA 2OHHA 3QHAA 1A97A 1YKSA 2ZYIA 1W0KD 4IGAA 2H63A 1XMXA 3T8YA 1R0XA 1KNXA 3OAAA 1L1FA 1NOKA 3ZI4A 1JNXX 1NBIA 4K28A 3D4IA 3ZS9A 2B3TA 1L7AA 1RQRA 2C4TA 2RGUA 3K0BA 5ALZA 3TZLA 4ND8B 2QUZA 1G3RA 2LDBA 3JQ6A 2RF4A 4RPGA 1UFQA 3FYCA 4KG7A 4TL6A 1Q1BA 3AZPA 1ZEJA 3DOCA 3DTVD 1E4OA 2V7TA 3PEFA 4WHMA 1S7CA 5D3MB 3TD6A 5K45A 5CD1A 4QU9A 1AS3A 1Y1LA 4UFPA 3PUJA 1A72A 1EK5A 1Q2XA 3OTWA 2L42A 2VHVA 3DF9A 4G5HA 1VFNA 5BWRA 1GFZA 4NOJA 2W43A 3O2NA 4I5GA 2MCFA 4KTVE 4HZIA 1M2VB 3AI3A 1GL9B 1QJCA 3KD2A 4N40A 4N5LA 4I0WB 1UMDB 2WEKA 4A8TA 2OLSA 1KHHA 2X8WA 2ZGIA 1NDUA 1P2FA 5FJIA 3SIRA 3VGPA 3MBKA 2X6RA 4HUQB 3FTEA 4LF5H 1G0NA 4RJTA 5M2QA 1PYGA 1WSAA 4LF7H 5ALYA 3KKKA 2JLYA 3D7MA 1ZSNA 4MRRA 3DCYA 3MSXA 4AWBA 4B5LA 1H2HA 1FU8A 2WJZB 3GVXA 4BJ6A 4MDFA 1QZ3A 1DFGA 4TMZA 3S2IA 3VKFA 3L1VA 1IZYA 2C58A 4JAVC 4NR0A 4JASB 4OHRA 3BXXA 4Q1VA 1NU6A 2VSXA 2AOTB 5GPBA 3T5BA 1OX5A 2BRUA 1B74A 3MVEA 5CX1B 2FI1A 1F3LA 4R16A 1NA5A 2FOIA 1IY0A 3M6UA 3BCSA 3Q7IA 4H17A 4RKEA 4QYIA 4EW6A 4YRNA 4DXHA 4FMCF 4YXFA 3ONVA 4JSYA 3TH5A 2ENWA 2O48X 4U8GA 1BVUA 1H3FA 3KCNA 4IEIA 5J1SB 3FVTA 4EHNA 1RDFA 3MHTA 4MQFA 4R2MA 1JG6A 2DLCX 1Z83A 3K5HA 3C39A 3I1FA 3VNBA 1CX9B 3OM0A 3ZY3A 4G84A 5LC1A 2R4TA 4CDGA 4Q45A 4N5DA 2CCJA 3FZYA 4MKHA 4FB4A 1IBLB 2V6GA 3CPHA 4DIOA 4BBJA 2OCDA 1COZA 1W5FA 4QICA 3PGVA 4BLUA 1Y9ZA 3M5PA 1ZR4A 1YVPA 2HDWA 4ZCPA 4HGRA 4WA8A 5BYJA 3EAFA 4EKYA 5KT6A 2QRVA 3GPIA 4XYLA 3B48A 5DRTA 4MSUA 2J9FB 3GVHA 1MMFB 5ENVA 2C3MA 3G6XA 3U7RA 4DSZA 3HXLA 4Y0AA 1C4OA 3N76A 4JYZA 1KBZA 4XZ3A 3VR4A 3RV4A 1VJ5A 2JFNA 2EBWA 3P9ZA 3UFXB 4WGFA 4K2HA 4QGAA 2PD3A 3AI7A 3RREA 4EH1A 1X9NA 1QGUA 1GRRA 1BJTA 4AG3A 3C6QA 3R3YA 1YCGA 1N77A 5ER6A 5GONB 3ELYA 2Q2OA 3LTNC 3GIIA 1YONA 2I54A 4UBMA 1RPTA 5K4HA 2PUDA 1X6VA 2M6KA 3AF6A 4URFA 3RS0A 2PZAA 1H6AA 3IVCA 3T1TA 1XQXA 2J85A 3QIAA 4XIIA 5EVJA 1QNFA 1G55A 2E1RA 3GFGA 2VHTA 3X2EA 2FKLA 4B3SB 1XRPA 1WZEA 2Z2KA 2WTXA 2JGEA 5G0UA 3BEDA 1OBCA 2R25B 2AXPA 1IUPA 2ARKA 2W0SA 3HVUA 3I5AA 4FQ5A 1AK9A 4IIJB 2PDAA 3HLKA 1R0YA 1U7WA 2VDWA 2APJA 4IOMA 3V1LA 1Z4PX 4EFMA 5FL3A 2FWBA 1E5TA 5E9WA 3ZDQA 1CLUA 2YXDA 3NDBB 3OBBA 1VKOA 3MG9A 4Q0MA 4CMEA 4DDWA 3CN9A 2CLLB 3D6HA 4X84A 2P2SA 1VE7A 3H2BA 3WGUA 4DG5A 3M6XA 2JARA 3B1FA 5I9MA 2IIBA 4J16C 4M1EA 4YUXA 3SDSA 2ASDA 4CKZA 3SM3A 2W00A 9LDBA 4UVDA 2AX3A 2ZE5A 4TKUB 2IZ0A 4UZFA 4ZMBA 1QR2A 3ZQUA 2WYWA 1J49A 1IN7A 3IMKA 1OYOA 1S01A 3C4QA 4PLYA 2LRHA 2H1SA 3FNHA 4FNOA 1XRJA 4LSZA 4JBWA 1L7VC 3SI8A 1AU9A 1H5NA 2IDMA 1I2KA 4PIVA 4F1WA 3DTGA 4JWKA 2XCQA 1DRUA 2WNIA 2VZ8A 3KDSE 2A94A 3FTFA 1BCSB 1XRRA 1KAOA 1U2EA 2WWXA 4HFRA 3BA6A 1KDYA 3ADOA 5K6AC 4HNHA 3WHLA 3ZQ6A 1EHYA 5JSZB 1B2LA 3IE2A 3YASA 1V7PC 4F71A 4EM6A 2O8BB 3ENKA 3D4OA 3LXRA 3CLTD 4J0GA 3R0XA 5LOVF 2ONZA 1HDXA 2J7KA 1CUAA 1KJYA 1N0HA 3BA1A 3ZPXA 4EUFA 1WV0A 1S4MA 1K5PA 3KZXA 4P32A 2ZWOA 5EL0A 5HM8A 2J33A 5LMUB 3BIXA 1WUTA 4RU9A 4L1KA 1OA1A 3N8DA 1YB7A 4RWEA 3HUTA 4IINA 1GQRA 3HOXG 4UTXA 1E79A 4HAWA 4JODA 5KDLA 3A1CA 3CVJA 1GQSA 3V4VB 1IJFA 4KV7A 4FFDA 2G17A 1P0PA 3VU3A 3W0LB 2QLTA 4XQ0A 1NW3A 3EZFA 2B63G 1UBFA 4UAJA 1IUKA 4QIWE 3KHSA 3EZ2A 3OH8A 3QXSA 2WWHA 1C0PA 3WMGA 3FBWA 1Q14A 4INOA 1DAEA 4QO7A 5T7BA 1W25A 1KO1A 2IYUA 3THOA 4TYYA 4DIUA 1KH3A 3GJ0A 2I4IA 2H17A 3IT2A 1PEKE 3QPAA 2JAPA 3QF4B 5FPKA 1U63A 5JCPA 5F9LA 2R2GA 3R5XA 3OKAA 2WFLA 4AAYA 4R69A 2B2CA 3CR7A 3KSAC 2QN6A 3FR8A 1DIGA 3G5MA 1D7OA 3LO8A 1EWRA 1XNRB 1B0ZA 1Y81A 2WYHA 4YJDA 1HE3A 1JR3A 2ZUWA 1WV1A 3JYQA 4N6GA 4R7ZA 5JVDB 4DA7A 4DMCA 4HT3B 1A2QA 1E2KA 4P92A 2QT0A 3O6VA 1E7RA 4IUDS 4B80A 4JI3H 1L4YA 1SKAA 5FPSA 3MMSA 1YB5A 2EZTA 4RZ2A 3G0OA 3MLAA 2TRSB 4EYKA 2FFAA 3EA5A 4D3ZA 5KPDA 1NMYA 4UCSA 1XQ9A 2B21A 2XTZA 2ECFA 3C2QA 3DVSX 3OPVA 1ZUNB 2EHDA 2Q27A 3GMIA 1DRWA 5E4FA 4BJ1A 4EY4A 3FUWA 4CDMA 4O02B 1ISRA 2FFQA 3ZV5A 1XJQA 3VNSA 4IIFA 1DC4A 3WLQA 4ED9A 3IOEA 1CDOA 5DCLA 5DNWA 5G53C 4L6IA 4M38A 5M3BA 3SICE 3EW9A 1IRIA 1OXSC 1UM9A 2A3RA 4PYQA 1WUIS 3KQQA 3UV3A 3JAMW 1VI5A 4BWSC 1GLGA 1Y8AA 2TMYA 4L51A 1V11A 1XYYA 4DY6A 1A5BB 3LLMA 3WRVA 2D1SA 3N41B 3RFFA 3PRJA 4K88A 4XGRA 3BJEA 5JEDA 1SULA 3BJIC 3C8UA 3EAQA 1PFKA 2P9HA 2PZJA 3DL7A 3A14A 2BMJA 4MV6A 2OQ2A 3F96A 1S5PA 5FL7D 4A6DA 3M2TA 1SXGA 2X8LA 3IP9A 3F73A 3TEKA 5DU2A 2UVPA 3DPUA 2AZTA 2VNHA 4E12A 4I19A 1ZW1A 3SBEA 5CM0A 1GPLA 4BKOA 1E3WA 2VQEH 3VKWA 5KB3A 3SJZA 4G07A 1H2BA 3H2IA 3P32A 3RGGA 4TRJA 2IBSA 4NOLA 5ALPA 2FJZA 3F7OA 4MQ4A 2ORYA 4L2IA 1RXIA 1ZMOA 1B42A 4LCEA 1II8A 3CUWA 4H7PA 1N75A 2IHYA 5CA1A 4IVPA 1QGED 2CHQA 2A1HA 3LQKA 5EIHA 3RVRA 1MRZA 2PMZA 2JI9A 2GXSA 1JEJA 3BMNA 4INAA 4KV9A 3OZWA 4N0PA 4EFKA 1XZKA 1ZSVA 2ZJ5A 1A9YA 1WEKA 1EVQA 3ZY4A 2VCYA 1DINA 4EUEA 5CDFE 4O84A 2WAQE 3GWGA 4B6GA 4Q7MB 3SIWA 2O8FA 4XX0A 3DDZX 3PPVA 2F64A 4ZQCB 5C35A 4B45A 5E8RA 4A3JG 4GKVA 1Y4UA 4BNDB 2VJYA 3G0CA 1WW8A 3BHJA 4IOKA 4JP5A 4JL5A 3SBXA 2OBFA 3VRHA 4U9UA 1U3DA 4A8JB 4DARA 1GR0A 3IP1A 1OI3A 1XE3A 2L19A 4UBJA 2QQEA 4YRBA 2GTHA 5EQTA 3AKZA 3GFOA 3HN2A 3IMCA 4OOFA 1YRYE 4IXDA 3I8OA 2PQ6A 5K0LA 3VZRA 4BO6A 5EJ9A 4P80A 1QUFA 4WLEA 5HS4A 2XXAB 5ES3A 2D62A 4PR3A 5K8UA 1TZKA 4Q01A 5KIAA 4UNPA 4B3JA 1WLSA 4LCBA 4BYMA 3KLMX 1SUSA 5KYWA 4IVNA 1YKFA 2Y92A 4ENVA 1UKAA 4WRRA 4HI0E 2JF0A 2J5BA 3E61A 3E7PA 1SU4A 4U6SA 5TPWA 5B2FA 3L8YA 3JZ6A 5A7GA 4O4JB 3D6AA 1ZNYA 2JFOA 5JQGA 2B8WA 3NNSA 1D4ZA 3MJDA 1M74A 2JZNA 3GXOA 4QRHA 5ALFA 5FLXA 2V1XA 5BWUA 1T3SA 1PBNA 4DLUA 4GQAA 4S12A 1N4DA 1NJ6A 5FULA 3MD0A 2BSXA 1P17A 4ANFA 1PWHA 5A2QW 5A9TA 4CYMA 2VQDA 4RUAA 3V4LA 4RNMA 3RI3A 1YB1A 5E95A 3S29A 5JASA 1G8HA 3LX4A 4E15A 1RCUA 5CFOA 4KBFA 3KC2A 5AXBA 2PRSA 3WRYA 4BRUA 2QD1A 1M6VA 1FTSA 2HGZA 4GXQA 3RC8A 3RG8A 3A4LA 1NQXA 3VFDA 3MZ0A 4AO7A 1E4YA 5DQIA 3S6JA 2HD4A 2C7QA 1N8KA 2F3TA 1IVSA 1RBYA 4ZK6A 3QWIA 1Q74A 1X8KA 5CGQB 3M9OB 3VR2A 4I4TF 1PSZA 5KTSA 4R81A 5MN4A 5KREA 4EBEA 5KVAA 2XRFA 1R0CA 1Y3CE 2Z83A 2B2XA 3LPMA 5A3RA 5HTOA 3VISA 1WOYA 1I10A 3DBVO 2NVBA 2W2TA 3UWKA 1SCUB 1SVNA 3GLSA 3TN7A 1Y1KE 4C1NA 4RAZA 1BX1A 1YS6A 4EYGA 3C85A 2YMPA 3Q3HA 3ABQB 1WY5A 2R92A 3FOWA 1CR0A 3CLHA 4HDNB 2IYEA 3UJ3X 1IIRA 4CUZA 1N2GA 3R5TA 1G6HA 4PTZA 1J0AA 4R4JA 4Z9YA 3T99A 1BYIA 1FDIA 2O7SA 3HGMA 5E9AA 3V6LA 4BN5A 2J0SA 1KY4A 4QTTB 4AKSA 1RK6A 3BH6A 4LAFA 2XBUA 1T9GR 3OG9A 4JLDA 3V6HA 2DMRA 3W9SA 4CV2A 5L9AA 2V4QA 1H9CA 3UWMA 4KK4A 2EWVA 3DVAB 5KTRA 5JLAA 4G6ZA 2ECQA 1VYHA 2E87A 5KNBD 3VMMA 2W6QA 1CZKA 1ML4A 2F43A 3DFKA 3JZAA 4FX5A 4EBBA 3J80W 1ZM9A 4EG0A 1U3VA 2ATEA 1UMKA 5COAA 3BAFA 1XFDA 1X19A 4FGLA 5EE3A 4UAGA 3JQFA 4Y2QA 1B04A 4NZZA 4DGSA 5KFRA 4IJWA 1JSCA 2CDRA 1THTA 2VYND 6AT1A 1LNSA 3A6GA 1MW9X 2FEKA 2Y99A 2PRYA 4LRXA 4RQTA 4EF4A 2G9NA 2AEMA 4RLHA 5J2TA 1NXWA 2VKTA 2BYTA 5KFJA 1G1AA 1K3UB 1ODLA 4R41A 2P2LA 3LULA 1VBHA 2ZSAA 1GNPA 2AMJA 4F4YA 4NFLA 2LPMA 5EJEA 5EIXA 3MELA 3W78A 3MR2A 3WL3A 1IQPA 1B0UA 2MINA 3JQGA 4C14A 3ADBA 1UXHA 2A1TS 4HCJA 2VK1A 3MT9A 2JLZA 1KVTA 4BXOA 3EGXA 2AH5A 5IBRA 5BRNA 4W5RA 3PE6A 4GW3A 2MDTA 1P5ZB 4OBWA 1KJZA 3AHCA 1ZJJA 1ST3A 2OHOA 5K3SA 3WMWA 4WXYB 2ZZMA 2H11A 3HBFA 4R8LA 4LQLA 3D2AA 2O8FB 4BNHA 3NANA 3INRA 2IWRA 1NW8A 1PT6A 2VQSA 4R2LA 4EF5A 1W30A 3CINA 1I8TA 1GPJA 3DM5A 1XEWX 3ZGNA 3DUFA 1P4SA 1IXSB 1ZCFA 4DGQA 4O4IB 3RVSA 4L5CA 4ED7A 2ALZA 1J0EA 1CZUA 3O1LA 3KVRA 2DSTA 4IAOA 4UJ5A 3RIMA 2GWHA 3VSCA 4L27A 4LI3X 4ILKA 4TWRA 4CFSA 3IIMA 5FA6A 3EIFA 3ND8A 3GV8B 4K46A 4QUHA 2VZ0A 2IHKA 1AKVA 3D5EA 5MF6A 3OD1A 1HKHA 2CXRA 3IR6A 4BMNA 2PAAA 1CNMA 5LA6B 5CDYA 3NYWA 5H4GA 5LL6b 2AJBA 5CA1F 3GT7A 3E9QA 1RHKA 4RQAA 1IDOA 1GARA 1RRCA 1B15A 3D5QA 3DE2X 4NXNH 4U02A 1ML3A 3LX5A 5DX1A 3UF0A 5JRJA 1I4EB 1US8A 3A3OA 3PCTA 1FU7A 2Q3DA 5KOIA 4XRGA 4U7DA 4DXDA 1Q57A 2F9FA 3E9ZA 5GV8A 1VXOA 1GOTA 4E2FA 5FWXA 5IM4A 1GTL1 1NM5A 3LCUA 4MEAA 4RPJA 2HIGA 2I3GA 3NHUA 1T9HA 1V0JA 3GLTA 4MMXB 5TR9A 2KM1A 1NP6A 2Y1LA 2GS9A 2AEEA 4CKBB 3OLCX 1J8VA 1QIGA 1T10A 3HFSA 3A4NA 3GJQA 5C3MA 4W9NA 3IL2A 3L5OA 4DL3A 3W05A 2H54A 4ZI2A 3DE7X 1LTHR 1GIAA 1YRBA 2AQIA 2FWRA 4HDSB 4AF7A 3DNMA 5JD5A 4YPVA 5JQWA 3T7KA 1T4MA 4NH0A 5IJZA 2WKQA 1PFQA 4HDSA 1IWBB 2UUAH 2N0SA 2GKOA 2XE7A 3Q3GE 3RUPA 5JBQA 2ISQA 3L0OA 1E8NA 3IP5A 4JMPA 5IRCD 5DNCA 3R9WA 2BBTA 2VRCA 5TQ0A 4CCWA 4YAGA 1DXQA 2JFQA 2RI6A 4O8CA 2YMLA 3MWGA 3HOUG 3CPSA 4RPIA 3W8EA 3USCS 1ND5A 3NBXX 2DPHA 4S35A 2ZBPA 2NU9A 1DQRA 1QYRA 2V03A 3BE5A 4Q43A 2GETA 2WTMA 3LU1A 3NZEA 1NM5C 1Y3IA 1YHZA 3IVXA 4S3MA 5DCWA 1IHXA 5FPHA 1YQWA 4EG7A 3TVYA 2O5RA 4E70A 3SQXA 3R5KA 1EEHA 1BMQA 1JSRA 3D0OA 5I7FA 3STYA 4HTFA 5F7XA 2J0UA 3PC6A 1DKRA 4OXYA 4LHVA 3G2QA 5E9QA 3AHFA 3IOCA 5K8TA 2I3ZA 3IB6A 5JMTA 2XOKD 4LXTA 1F4PA 1N2ZA 2V7VA 1EFUA 3LXMA 3NHFA 3SS7X 3W6ZA 1DKUA 4RAOA 1LBSA 5AIBA 3ZOKA 1HKUA 3B6JA 5HOQA 1V9CA 1E99A 1I4DD 1GPYA 2EGGA 3EQ9A 3E9DA 4JLNA 4CM9D 1SC4A 1EUCA 3MERA 1THZA 1SVWA 4H7HA 5JSFA 2WZBA 1XVIA 4PVDA 1ZHFA 3UMRA 4R5HA 3CW9A 4AJOA 3EPHA 5SY6A 3VOAA 5AD1A 2Q5FA 1OT3A 1OWTA 1Y3AA 2QZJA 3RYIB 3WGYA 2ZYWX 3DO8A 5BUCA 3ZBTA 1E8MA 2PGJA 2REQA 3R7DA 1ZD9A 3LECA 2EDAA 5I4KA 4BZPA 1GDTA 1TZJA 4LPSA 2WWRA 5KOYA 1U9IC 4HAUA 1NYLA 3UGQA 3CLRC 1P2GA 4BXOB 3M9NB 4WFQA 1RLUA 2FWMX 4RK7A 5DTQA 3F97A 4ZICA 3EFHA 5AFSA 4TQAA 4M22A 4Q93A 1PD1A 1T1RA 4W7HA 3IBYA 1Y1WG 1I24A 4KE6A 5IABA 4X1OA 2FQWA 1N9KA 1ZFNA 1W5AA 4Z0PA 4R40A 5SZHB 1AN9A 4B1FA 4N41A 4G0UA 2PTHA 3I4NG 2JIPA 4J9LA 2OPBA 4WACA 1OREA 1W2HA 3N28A 1ADCA 2XWBF 1ZH8A 2QSYA 4BFSA 3ABSB 1JFVA 1QRAA 4PLZA 2PJRA 5FBKA 1HTWA 2XDYA 4J0DA 4D9NA 3CVYA 1QJ4A 4UMVA 1CKNA 1NT2A 4IILA 4ND5A 4WCFC 2QM0A 4XD2A 5JWHA 3VNAA 1GKUB 1W581 1U9CA 1Q0LA 2PWAA 1PNQA 2P9QA 1Z5UA 3U4DA 5BQPA 2PMKA 2P41A 5K3EA 2R47A 2VATA 3GQCA 1P6UA 3I2JA 1Z4QA 3TRHA 3ISTA 5JEEA 2RGVA 1A88A 3TLGB 3ER8A 1Z6PA 2X5NA 2O8EB 3LQ2A 5T3YA 3HJBA 3PSHA 2XRYA 1SU7A 2CZGA 4EO4A 4HAVA 1IHUA 2Q2TA 4DV2H 4HYYA 4CMDA 3E27A 5EHQA 4AU1A 1WQ3A 1RMTA 1ZRSA 2PGDA 2WDZA 3KQTA 4M9QA 5DK6A 5DTRA 3SDBA 2Z58A 1LWOA 3GDOA 1Z6ZA 4G8BA 1XA3A 3RGXA 2M6RA 2JRLA 2POCA 2QD4A 1UQUA 3FPGA 4LHXA 4OJYA 1M2OB 1TCVA 1ZIYA 2AC4A 4EHDA 5BYBA 1K4MA 2AG1A 2AE2A 2CJFA 2NPIA 2XAAA 3A10A 3NHBA 2PLWA 3W9UA 4N76A 1EE9A 2H7XA 1S4QA 4TV9A 3SHFA 4P4LA 4HLUA 4DRZA 4D8XA 1C0EA 3ZUPA 4J9QA 1XD9A 3C3EA 4LQ4A 1GM5A 1QX4A 5HSGA 5TXGA 4A0QA 5FTWA 4KR7A 2O57A 1UPTA 2FR0A 2JLWA 4A6EA 1N0IA 2A9PA 1KZ9A 3BZBA 3DAOA 3HPQA 1RXSA 1QQAA 4EJFA 2VYVA 3VKUA 4XDYA 1IAQA 3LRTA 3EPJA 1UDRA 2JGDA 1N5JA 3SKXA 1E3IA 2Q1YA 4WFKA 4E6PA 5KTOA 1QH0A 1XV5A 3KHKA 4BOYA 1D2CA 4A5OA 4F12A 4X41A 2YFYA 4PZ0A 5EP2A 2FVYA 2A9OA 2EQ5A 1YZQA 2HJVA 1L4UA 1B41A 1EP2B 2FU5C 2WQZA 4W5HA 2R1VB 4NY1A 5DO9A 5BO5A 3SI7A 1FNNA 1WHTB 1D2GA 4W1PA 4QXRA 4L5YA 3T3HA 1BQEA 1TI7A 4MW7A 1Z06A 4B3FX 3OLWA 1NX9A 4DSUA 1XDWA 4MH0R 1T0IA 3A37A 2PQ2A 4ZC8A 4Z3KA 1HT3A 1I3QA 5CK4A 4EI7A 3FMFA 3U9SA 2NTVA 1VLMA 2BHRA 2R5FA 2MYUA 3CUSA 1ULSA 3HCFA 3OETA 1S89A 2NSYA 4US1R 4CTMA 1SC6A 1P1BA 1RPJA 5HF6A 2AUMA 2HK8A 3HRIA 5DX8A 3UM9A 3QVSA 2XITA 1LY1A 3AUKA 2JIDA 5SICE 1NL3A 3UK0A 1MAUA 4YMIA 1UC4B 1HSOA 4KN5A 1Z2OX 1EDZA 4QWBA 2V4MA 2B1QA 3BK1A 3LS2A 4N82A 1V51A 4M7EA 5DDIP 3RFXA 4J03A 2GQRA 1DOZA 5DG7A 1ZK1A 3LY7A 4XOUA 4HZGA 4RMJA 4AJEA 2VS1A 1T2UA 1VMKA 2VT2A 2AKAB 3GLQA 2B37A 1V35A 2BUBA 3LQQA 1X7YA 1CQZA 1OJ7A 4FGKA 4PYIA 5AI8A 4ZO8A 4R8KA 1JEAA 2ZRBA 3H8JA 4BE9A 1XF1A 4P2BA 1TL7C 2HU2A 4PC1A 4P33A 4CU2A 3B8HA 3R3VA 5AVOA 2WA2A 3D0RA 2YZGA 3THWA 1X3LA 4K0KH 1HURA 1V1JA 4HSGA 3H1FA 4JLUA 3M81A 5ESWA 1EK6A 1WETA 3FDSA 3NIWA 4Z4QA 4ADSG 3O3MB 4FYXA 1B43A 2XMGA 4OK6A 4RE6A 4X24A 3VVLA 4FYPA 1N32B 3I5MA 4QIHA 4HDMB 2J30A 4I8XA 3L8MA 3FTNA 1N2BA 1J5EB 2QWXA 3MWDA 2A84A 2R85A 5AUQA 3EEOA 2Z1MA 3GGGA 4P93A 1Q7RA 3DR3A 4KXNA 1GKKA 1N6OA 2HHAA 2BM8A 1G3UA 3PGKA 4NNJA 2W9XA 4XQGA 2WD7B 5D5QA 3PLRA 3K9CA 3KEOA 4Y6GB 5L7YA 3T5HA 3U0VA 2Q3HA 1OASA 4RVFA 2QPAA 2YMQA 4ZO9A 2V8OA 3CEHA 3K4HA 3R6TA 4OH7A 1XAJA 4ROTA 4FEEA 1LLDA 1WZCA 2JASA 3BTUA 4D41A 4DR6B 4O86A 1V16A 2P4QA 3L3BA 5AOAA 4FGRA 3CX6A 3U55A 1A7UA 2BMFA 4TXJA 4CE6A 3C4VA 4M1KA 4RHXA 1VKJA 4K9DA 4ZIRB 13PKA 1OFIA 4CN8A 4Q9HA 3I2HA 1NBAA 2O3UA 1U1CA 2EX0A 4LI0A 1QLHA 3IVMA 2EOAA 3R8XA 4YAIA 3BREA 1GU0A 1WB4A 1Q84A 3KWJA 4KWEA 1DG3A 2ZYAA 4FEGA 1E89A 1Z4IA 3NKFA 4P4SB 1PAUA 3K9HA 2ZSEA 3OT1B 4HEQA 4ZPJA 1V6CA 3J80A 3MCUA 4G0QA 6REQA 2WG2A 1QRSA 1XZDA 3ITDA 3VU8A 2X2PA 4MTLA 5BNIA 2JJQA 3GPBA 4IHJA 4OGFA 5HIAA 1QO0A 1RXUA 4K5QA 3BKXA 1AZLA 3F7NA 3O95A 2NPOA 3QK7A 1V96A 3M1LA 4I08A 3V2HA 3DV0A 3HBLA 4YEDA 2YXLA 1K0UA 3T7AA 1JIIA 5KFTA 3O94A 4EL0A 4WFJA 1GRNA 2NXWA 4P3YA 1CWUA 4LCJA 1GDHA 1E5XA 2EKZA 3SQMA 1WULS 3WLNA 3GF4A 4Q66C 6YASA 5IZCC 4N47A 3UJ9A 2D06A 4C43A 2IZ1A 4N48A 1QIEA 1ID1A 4B87A 3OWHA 4NK5A 1FP4A 1DAHA 4JKOA 4IHKA 1Y63A 2B1IA 2WJPA 3NTXA 2ZTSA 4N3BA 4D74A 4U3JB 2A0XA 2CEAA 1Q92A 4DWVA 4EGFA 1XTJA 1DUSA 1S2MA 5KX5B 2AA3A 3Q8PB 2CNOA 1MQAA 4UHBA 4X45A 4FDTA 3EK2A 4WD3A 4MO2A 1KSHA 2P6MA 3SK0A 1U0FA 4DB2A 1BCSA 2ROQA 3OU7A 4I4CA 4OMCA 2GSDA 2J1LA 2ZT8A 3D8HA 1XZ8A 1U28C 4ZT7A 2VA3A 1IJEA 4DLRA 2WKPA 3VTAA 1ZGHA 4GMGA 3AHDA 3OX3A 1L5WA 1MV5A 5F3WB 2X4LA 1DRJA 4IH4A 4CMJA 3DNPA 4RHEA 3FZNA 4MDEA 1Z34A 5AJHA 3PEWA 3RRBA 3G2IA 3L07A 3OWXA 1CHNA 3DOJA 2OL4A 4WKGA 1A9SA 3EFOB 3V8PA 3DMNA 3KB1A 4AS2A 4GR4A 1XHEA 4B3MB 4A9AA 3AW9A 2PG3A 3HR4A 2WHPA 2XGSA 3HU5A 2XQJA 2FX5A 5G1OA 1Y5IA 2JFPA 6ABPA 4RKYA 5A5EA 3CTMA 3CG4A 4P08A 2VTBA 2NUAB 4DSOA 3JD2A 3MK31 1RWWA 1T6ZA 4H60A 1WUKS 2NG1A 1SUFA 2JA5A 3V6KA 3BD9A 3IVRA 3WTCA 5KQGA 2ZIWB 2B7BA 3QOYA 1VPVA 4ZVVA 3PO2G 1N3YA 4KYUA 4DL9A 3REQB 5F35A 3OZDA 3I2IA 1NJSA 3IMFA 4LE1A 3N8GA 3SJUA 3TEJA 2REOA 4X61A 3VZDA 1PZHA 1U9YA 4DRXB 3CV3A 2QI9C 2NXJA 4XFKA 4MR9B 5BV2P 1YR2A 2DBYA 5KAMA 2CW5A 2UVUA 2F7SA 5CW1A 2C4MA 1LRJA 4RU1A 1ZOPA 1K68A 3KG2A 1DCMA 2AQHA 4ZVPA 1P4JA 3DMRA 3KOZA 2VXBA 4BCDA 4KPYA 4JR0A 1HF3A 4AJIA 4LF6H 4MZXA 1IOVA 3ZIAA 5BN1A 3H8WA 1KP9A 2CE7A 1ZW6A 3IUJA 3O8OA 3UA3A 4BNIA 1H42A 4D92A 2XD9A 4PINA 3VR1A 1WMEA 5JMOA 3OPQA 4YA6A 1W4RA 2BFAA 4CV1A 3UFXA 2OAGA 1HT1E 3I4LA 3KV3O 4IJQA 3LBIA 2H06A 1OIXA 3AR9A 4YBRA 5DSTA 1AKWA 4QWEA 1SIWA 4LDJA 1GU7A 4V38A 3TZ6A 2AG0A 2XVAA 3CX3A 3AHHA 3KX2A 4ERNA 3VMFA 1XVTA 2HSZA 4QGHA 3K9NA 4MB2A 2ZJ6A 4AG6A 3M49A 4I1RA 3EB9A 4GPTA 4Q34A 4K81B 4PNPA 3C74A 4M6WA 3R9KA 2ZSDA 3L01A 3O9ZA 1ZD8A 4TN1A 1SVSA 2HF7A 3ICVA 2BH9A 3WSVA 3Q8QB 1CFJA 2A59A 5IYBG 5IJWA 1YMVA 3ITKA 5A5GA 3U9LA 1P77A 2PZBA 3A9UA 3IAS6 1XEXA 4TTRA 4X71A 2CZQA 2PFGA 4CTOA 3TLEA 4EJSA 3DEZA 4FWIB 1RCTE 3FG9A 3NHWA 1TQ6A 2HREA 3AKDA 4I1VA 2MIIA 1M1XB 4FZ3A 3HHEA 1ZA1A 1Z0IA 1MJFA 3BH0A 1X7DA 1YL6A 3ICEA 3TW6A 1XAHA 3VPCA 2QTVB 3U40A 5DXAA 1FBNA 4AJ2A 2I6TA 1YL5A 3ZWYA 3HT5A 2Z6VA 1SCDA 4BY9E 1L8XA 4MQEA 1HNZH 1DBWA 1TVKB 2P78A 1U9JA 2XB8A 3BJRA 3FCAA 4ZI5A 1Y6FA 2EJTA 1DP4A 2PBRA 3ZIDA 1NQTA 5IBQA 1WD5A 5CB8A 1WSWA 1V3VA 4I9NA 5GOZA 1YR7A 4J07A 2HBYA 1DQNA 1V9SA 2WC1A 2B25A 2ZAOA 3BL6A 5CAEB 4K9KA 4L4ZA 4C4PA 1NNLA 2JJ2D 4N8SA 3SGIA 3WLTA 4TRNA 5MN6A 3NALA 2JFGA 2HHFA 2NU7B 2JI8A 2QT1A 2GD0A 3UZUA 2AGVA 1PZGA 4C4OA 5JJLA 5K0TA 3QNWA 5AK0A 3VPDA 4IJ6A 1XLTA 4MWSA 1XDNA 2N47A 1HL3A 1D2NA 1SZDA 2ZUUA 4TS9A 4UARA 4RJ2A 3N59A 1UBLS 1GUAA 4PX3A 4Y2TA 2JGLA 3NLLA 4EJSC 1C9EA 1TTHA 1P7WA 3P0FA 5JDCA 4NCAA 5G0WA 1Z7WA 3CEMA 3KQYA 2PKXA 2ZI7A 3BG5A 2ODNA 1VIAA 3I0ZA 4NENB 2BGWA 4ERXA 1PZFA 2GJ8A 4WDRA 4I66A 2OECA 5B12A 2Q1SA 3T7DA 4HJRA 2RMKA 3MF4A 3U48A 3AM1A 1AA9A 2FPLA 3PHGA 3PRYA 4ZCRA 4J91A 2HSJA 3B6ZA 7MDHA 4QUAA 5EZ5A 4E4TA 3GN1A 5K3DA 2O2GA 1O6CA 4OQNA 2X2EA 1CERA 2NLOA 4PSAA 3TL2A 2AWOA 2P6PA 4PS0A 3DCIA 3H7AA 3R20A 4CKEB 2H7CA 4X3CA 5EHGA 5D00A 1RD4A 3I4MG 2I91A 1YRLA 4LTMA 1IEWA 4KDFA 4GEGA 2CT8A 4HEHA 4LJ4A 2FN9A 3L4SO 3QNMA 1SXHA 4J0HA 4LBWA 4WWHA 1BGVA 3MCTA 5T6MA 4FFRA 4HTAA 2IMWP 3WZLA 4INPA 3EOAI 3W5AA 5K7SA 2HHHH 3COPA 4U7GA 1IBKB 1TD1A 3U4HA 2X7XA 3ZW7A 5B4UA 1WS6A 3PDIA 1T43A 1YCDA 2QTLA 1E1QD 4PYNA 1OFHA 2GEFA 2YH2A 3Q7TA 4X62H 4O1HA 2Q41A 3P45A 1KTIA 3WIBA 3UWPA 1B76A 4MI9A 1UM9B 2O2HA 4S0XA 1N0VC 5GMOA 3M6FA 2EVWX 1N7HA 4JJ8A 4LVUA 1GQ2A 2AYYA 2QM7A 2ZSJA 3TXYA 2FXVA 2WPDA 3ZE9A 5CT5A 1UCFA 4G67A 4BO9A 2WAMA 4ZI7F 1A9RA 4FE4A 4BAZA 4JI7H 3TOSA 4FZRA 4BZQA 2AQ4A 1BVHA 1R16A 2BJWA 2O2EA 4MS1A 4DQ0A 4G4SP 4CMBA 3PUKA 2I0FA 3IEKA 1U90A 3Q7SA 3MTQA 5EZYB 3E23A 1N32H 1J1ZA 1G60A 1Z22A 2CBGA 2Y1KA 4XYBA 1KETA 4AUNA 4OV6B 1KXJA 4RKFA 7REQB 1INLA 1NQUA 1VI6A 3F7TA 4YONB 3KFXA 1HK7A 4GZLA 4HN9A 1V1RB 1YBHA 5JHGB 2JANA 3SOZA 1JKFA 3DVQX 4AQDA 2Z3WA 4KOAA 1ISMA 1IMJA 1MHPA 3K73O 1PYDA 4I81A 3CNEA 4G4SO 4L2IB 3OQOA 3PSAA 4LQDA 4DMMA 2ZRGA 3HZRA 1D6MA 2CFSA 2JIMA 3KQPA 1ABFA 1BX0A 2XLBA 1NVWQ 3LFUA 4U39A 5AKIA 1JPNA 3R0IA 4KKXB 4KQXA 1K5GA 3ER9A 3N40P 2ZIVB 3ZWXA 2PZ8A 5IDWA 1YBMA 3OEHA 4RGYA 4TQUS 3GAAA 4ISCA 2I7TA 5CVCA 4DL6A 1IULA 4MCIA 1EZ1A 2QLFA 5K0NA 1EUCB 3V1UA 3NGDA 3BWDD 4ZOEA 1RKUA 1CJBA 2C8KA 3C16C 3KLOA 3LYAA 2VP0A 1DKMA 4XYMA 2VUTA 2WB1A 3KUKA 5AJTA 1DBIA 3HFJA 3QYFA 3H2YA 5HR5A 1AJEA 1KZ4A 4IW3B 1MEEA 1R9MA 5HRUA 5BUQA 2DETA 5I7HA 4JLSA 5I5GA 5BQ3A 3RHTA 4L8YA 2HNBA 3QFFA 4LSAA 4LDNA 2RDIA 5DVZA 5AQ1A 1TB4A 4ZC1A 3EEQA 1U7HA 3E5MA 4AQYH 4GLFA 2VPIA 1C41A 2MSCB 2IIQA 3FIJA 3OHMA 2AFIB 4LJ6A 1QV9A 4DV3B 1XHFA 4BWYA 4EAQA 1W4AA 3SY8A 3MW8A 1CUIA 1XQ6A 2JHCA 1UOPA 2Z8YA 2QNIA 1GQFA 3BRQA 2WOOA 4HH4A 2ONYA 3BD8A 2J9RA 3K53A 4KDEA 1R4MA 5IG2A 3RSHA 1LK5A 2C07A 3G5TA 3GJZA 4YJ3A 1A3CA 2HA2A 4K1LA 1JILA 4N7BA 1IN8A 3JQ7A 1OZFA 4DZTA 4EY8A 2F4VH 1V2GA 4XIYA 3ZEIA 4J3NA 5KWSA 4ZDWA 4YR3A 4GOND 3W5CA 2UXCH 1P8JA 2UUBH 4NH4A 5DM2A 1MX9A 1RP7A 1PN3A 1YZKA 3IG0A 2FW0A 3H75A 3Q9NA 3HDTA 4YY3B 1IU9A 1UQRA 2H2FA 3IMEA 2GCGA 1SUAA 3JSLA 1ZINA 4UXJA 3SKVA 2Z56A 1S0UA 2WNSA 3DEIA 3MCVA 4TL7A 5B7PA 1CY8A 1WABA 1PF7E 4B3MH 2QAGB 1KRHA 1PGOA 2WMYA 3O83A 2YUIA 3L02A 3ZDFA 3BQ0A 5KJCA 2VP9A 4RE5A 2PT7A 3BYZA 2MMGA 5KNLA 4TMKA 4TN5A 1P80A 5AUOB 2J6IA 1JQBA 4NQRA 2DBVO 2VF2A 3GLUA 2KHZA 3L43A 3PDIB 3CIFA 4NK4A 1DDOA 3TNYA 1T3ZA 1CVLA 4HDRB 4OHMA 4XFJA 2HADA 1RSZA 5CNKA 4O1IA 1S02A 2IXDA 4JELA 4BNFA 3ZWCA 4LF9B 4FOLA 4DT1A 1KYWA 3LA8A 1MENA 4AKHA 2W9BA 2JFUA 4E13A 3SD7A 3IDQA 3LPCA 5AW5A 1UZLA 5DLYA 2VPYA 3SZRA 3UATA 1OD6A 2YNMA 5FOUA 1A0OA 4AJHA 3WHPA 5IAOA 2OG1A 4KI0A 4DUPA 2QL6A 4DCCA 3I61A 1PL7A 3GVIA 2B4KA 2VVTA 1P8AA 4OXNA 1U8XX 2O50A 2ATLA 4PCUA 2NO0A 1OBHA 1UDXA 1SMKA 3ZJVA 4N49A 1S0MA 4ZJYA 3K1JA 3NWJA 3MOGA 4NJMB 4Z1MA 3N39C 3H5IA 2WV7A 4G0OA 1ODFA 2O4UX 1FVIA 2JEJA 4QXAA 3H11B 2W7OA 2RKOA 5F2EA 4F4HA 1XPUA 2WLTA 2Q0SA 2C1EA 3AL2A 1OLUB 1JKJA 3PWKA 1E4FT 1E58A 3GNLA 3UAYA 1B26A 2R8XA 4AMGA 3G2OA 2CE2X 3F6EX 1R4NA 3CR8A 3D0QA 5CW2A 2LR0A 4BMYA 2PBLA 1A8PA 3N7UA 1GNTA 4AZ0B 1ZP6A 1KJJA 2CLOB 4PWYA 1GUFA 4Y7DA 5DHAA 1FUIA 1M3SA 1SQ6A 2A4KA 4B3TH 3RODA 3GLFA 1CE8B 1JBKA 3FSRA 5HJ7A 3O2QB 2E2IA 4OQ4A 4QBGB 2VJOA 3EISA 4R98A 3FGZA 4MRSA 2I33A 4JVMA 2Z04A 4QNMA 4MUAA 4QVKA 3VO2A 4WL0A 1AMUA 1UZUA 1UMBA 3WK8A 1YO6A 5IDVA 4CMCA 5AM1A 1CUCA 1SKQA 2GEBA 3GVPA 3ICPA 4LF4H 1WBBA 5JS1A 5K8IA 4Q7EA 1JDPA 2GHTA 1UK7A 1XTBA 1Y3HA 3V46A 2ZRIA 3BHNA 3V1MA 4ZT4A 2GCIA 4U9IS 421PA 2YZ2A 2HDNB 4W5OA 5KQPA 2HJRA 3EJ6A 2GAAA 2P1DA 4XLZA 4DCVA 2WINI 1RYRA 2IKQA 3CF4A 2IEGA 3ABRB 4HQKA 2FSGA 2X0EA 3BSYA 2CMDA 3AOEC 3FN4A 4KQEA 3MS2A 1N3LA 1OJLA 5ALDA 1Z56C 5FNVB 3AR5A 2VJCA 2LCQA 2PX4A 5C31A 3WK9A 1ZM7A 1TC1A 4QUEA 4UATA 1JALA 2BEUA 3GEHA 4FMDF 4W8GA 4LHZA 3FMOB 4WKOA 1R0LA 5D3KA 2X41A 4QPPA 2O8EA 1QZUA 2JBAB 1NATA 1G6Q1 1UINA 2HHLA 2XI4A 5FOXA 1ULUA 3IDZA 1JIUA 4OMFG 4D4IA 2GWRA 1VHJA 2A3NA 1ZQ7A 4UFOA 1JAYA 2ATIA 4ZEMA 4A3EG 3PO3G 3AC0A 3HTXA 4UUAA 1Z9BA 3CN7A 3HLYA 2DJIA 2PMZE 1JH8A 2IY9A 4J43A 4RCNA 3RAXA 1LSOA 4Q39A 3MRTA 1E0JA 4PHFA 5EI5A 3ITNA 4ZI7A 4ZZ1A 4ZTUB 3V7WA 2HJWA 3ZDEA 3OFKA 3FFWA 5FHQA 3C1OA 3C45A 1TWGA 1WCWA 2VHXA 1LW6E 3GELA 3T9EA 1TNDA 4QW9A 2JK1A 3LRXA 4LOHA 4TYNA 5DHSA 1OHHD 1WE2A 3FUVA 1IY2A 4G0YA 5MFZA 1A9QA 4GWLA 4RH0A 1SKBA 3SFZA 5EJ5A 3DZJA 2BJHA 1B8NA 1EVLA 2FFRA 2E0IA 4QGBA 1H0KA 3W4JA 1XTSA 5LZ9A 5TV2A 3UEOA 2DFNA 4WNCA 3I9NA 4Z8YA 4WT7A 3LBFA 4IEEA 4ZVRA 1XZCA 4GYWA 4EW2A 2AS0A 3M4IA 1ZGZA 2PKCA 4UULA 5BV8A 1M2EA 1WPQA 2HDHA 4EEQA 1HNWB 1DGQA 4PNEA 4AY3A 3UT0A 1O9HA 2QRPA 3ZE0B 2ZT7A 2MCTA 1X1QA 2Q2QA 4B8YA 2IL1A 1V39A 3JQCA 5H3HA 5I9BA 3VH4A 4JD5A 5KSPA 1HLDA 4EOGA 4HV4A 3SYMA 1HYQA 3B53X 4TTAA 1JN0A 2VDQB 4X95A 3GN2A 3SAJA 1U0TA 2HPZA 2YJ6A 5K0CA 4NE9A 4RNCA 5L3SB 2RAUA 1KBOA 4Y2YA 1FXSA 2EFEB 2WIGA 2I2CA 3PNKA 3QFSA 3WNDA 1S8FA 4ZQIA 1QHFA 4DY4A 5L4NA 1FJ2A 2FSVA 4YYEA 4IHAA 1JSLA 4R05A 1Y42X 2X8JB 5E1OA 2QQFA 3AEKB 3VR5A 3G9QA 2XCIA 3ZIAD 1GZHB 5JFTA 4OI0A 1XNHA 2P2CA 4CKXA 4I1OA 4MW4A 2ZSFA 4YP5A 5LCXA 4DM4A 3U2QA 1Y7PA 5DT9A 1TOAA 1IHDA 2G04A 1P9WA 1VCIA 4WVFA 2XHZA 3D6VA 3P0EA 1NW7A 2CNWA 2LIPA 4O3OA 5IX8A 5K01A 3CB4A 4L74A 3ZBPA 4QOGA 1T9GS 3BTOA 4KOEC 1UP6A 3CCBA 4V0OA 5AKZA 4M0LA 1XDGA 1MRNA 3KUXA 3WISA 1JIVA 4FGUA 3KB8A 4CTKA 3G5UA 1U65A 2NU9B 4DV7H 5BUSA 4DC0A 2BFDA 1K8ZB 2QL7A 5DHFA 3IXLA 3JZIA 2FE1A 1VJDA 3RD5A 3SOPA 4IWXA 5DKFA 2V7GA 4GYKA 4OQDA 2BI8A 1JDTA 4UPDA 4JHLA 8AT1A 4CI0B 3SEZA 3A1SA 1TCUA 2ZI3A 4C4TA 4ZYXA 5K0GA 1M1YB 2XIJA 1F1BA 4DLAA 3LDAA 3H3XA 4RY2A 3A4MA 4ZGBA 1ZU4A 4IX1A 5JSKA 1MNQA 1DBVO 1UFKA 2JAXA 1GT91 4BB6A 5BNTA 3PA8A 2WMNB 2J4DA 1Z88A 2HIAA 4K6CA 1LI7A 2X76A 4PSKA 3UXEA 4AX4A 4EF6A 1NI4B 1L1EA 3WIUA 1CF9A 3KT8A 1QGDA 3KKOA 4E46A 2O8VA 3V1KA 1JSZA 2WDTA 4DL2A 1EM8B 2P9CA 2R5WA 1G8YA 3DZHA 4G9BA 4X8HA 4ZVKA 1E7SA 3BXPA 4MV0A 4E21A 5LUAA 2P90A 2ZB3A 5DWDA 3MR5A 1ZIXA 1HNNA 4QG7A 3R0JA 3MUFA 1CP3A 1X7GA 5E7MA 1E5VA 4ITVA 3GD7A 5KYXB 2J09A 1VJGA 5EUCA 1MJGM 4ND4A 4QBKA 4WESA 1YE3A 3FMIA 3W06A 4F3RA 3D4BA 1M1UA 1O95A 1ONPA 3PVZA 1E61A 2DWPA 4K9LA 4QOJA 4X66H 1W35A 5BWXA 1F48A 4YNBA 2G0AA 3TSYA 2FMHA 3BXEA 4JGGA 4YMWA 4CT5A 5I7RA 3H2GA 4O29A 3A9VA 3JASB 4GM1A 3Q9SA 4KQMA 1T5BA 4U7FA 3MM4A 4BTVA 1R10A 1W9MA 3BB4A 5CCDA 2EFJA 2HLHA 5IVIA 1BN6A 1A3GA 3DFFA 2DXIA 1KMNA 1PR1A 3KXDA 1TTTA 4DUGD 1X15A 2BDTA 2W6ID 1E2QA 1ZOLA 3OKFA 4GAEA 4NAHA 4OU5A 2WSSD 4PQYA 4YV1A 4NJOA 4DV3H 1PSDA 4W1RA 2AKEA 2MTBA 3FDZB 1RMQA 5IXJA 4CG0A 2ZXFA 4A3IG 5E7QA 4BASA 3CVVA 4C88A 4PLFA 2W9CB 3Q40A 4X6UA 1QE3A 1VG1A 3SJAA 3V2GA 2JA7A 4WASA 2HV8A 1Z25A 2F1RA 3T1NA 1BCRA 5LIRA 2Z8ZA 2FZLA 5BSRA 4MA5A 2D0PB 5DI9A 3DTTA 2MSNA 1R3DA 2R62A 3L1HA 3WMRA 2H0QA 4YVFA 4F2GA 2P4UA 4O4LF 3NDIA 2HTFA 1CKMA 1ZC4A 2XMBA 4R01A 5CT6A 3CZCA 1JKMA 4INJA 3L7YA 4TV9B 3OX1A 5LUBA 4RMHA 2A7QA 4RGVA 3L7DA 1NFQA 4BDTA 3LLUA 4WGGA 2UV8A 1UXIA 2ZRAA 1G2QA 4L15A 1QANA 2Z98A 3F6YA 3H1GA 4YR0A 3JALB 4MW6A 2AUNA 1PJ4A 1OTHA 5K3FA 5CFRA 1O6FA 3AUYA 1V4BA 1XMVA 2C20A 3DW1X 3GLHB 3FCOA 3PQEA 5CDUA 4GLOA 1FFYA 5CD9A 4ZRDA 2FZVA 4K7JA 4NHEA 5IHXA 4BLTA 1BCRB 3DKPA 1S6YA 1TKBA 4K86A 3USZA 4Q12A 1RKVA 1T26A 5HNKA 1AF7A 3LBAA 4G0NA 5FUXA 1YRWA 4FOSA 4PSUA 3RGWS 2P9TA 2OESA 1MOZA