2YZGA

Crystal structure of d-ala:d-ala ligase from thermus thermophilus hb8
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-ALA:D-ALA Ligase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 79
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzgA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzgA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzgA01
4O7ZA 5KX5F 4FFPA 3JZFA 2NPOA 4MV9A 2CNVA 1VBHA 1Z2OX 4EAAA 3AX6A 4WBNF 4O84A 4O7YA 1C30A 3N6RA 4O7VA 2R85A 1EUDB 2V5AA 1JDBB 2PN1A 2YYAA 3MJFA 3KREA 3OUUA 4O7WA 3VPCA 3UFXB 1GLVA 1AUVA 3U9TA 4EA8A 1W96A 4E4TA 2FPPB 5C1OA 1CQJB 4O4JF 2GPWA 4IHJF 4IWYA 4ZOLF 1VKZA 2W6MA 2ZDHA 3QFFA 4C5BA 4I55F 2I80A 4FFRA 4DLKA 4XZ3B 3U54A 3Q1KA 1IOVA 4TV8F 3TIGA 3RFCA 1AUXA 1VBGA 2V58A 4ZQIA 1B6RA 3LWBA 4QSHA 4TUYF 2FP4B 3ETJA 4YJ2F 2GQSA 5D8DA 2V59A 2DZDA 2W6PA 3V4ZA 3GLKA 4HNTA 4GGMX 1IOWA 2NUAB 2QK4A 3E5NA 3N8DA 3VMMA 2Z04A 4MV3A 2W70A 1CS0A 2W6OA 2NU6B 2CNQA 4O7SA 2X0SA 4J6EA 4O4IF 2YS7A 4IWXA 2I87A 1KEEA 4YBZB 2W71A 4MV8A 4O4LF 3JZIA 5JH7F 4FFNA 5LXTF 2VHEA 4O4HF 3R5XA 4XX0B 4NYEA 3JRWA 4HQ6A 3ETHA 3TIIA 4YAJB 2YS6A 2GLTA 5JQGF 2DWCA 1A48A 4YB8B 2PVPA 3HB9A 2R82A 4FFMA 2C00A 3WNZA 3TINA 2CQYA 4O86A 5I47A 2ZDGA 4IZOA 5J2UF 1M0WA 4O7LA 1B6SA 2Z02A 3RUPA 5DMXA 3I12A 1C3OA 2GPSA 2R7KA 4HR7A 4M9UA 1W93A 2PBZA 2YZMA 4O7TA 4O81A 1EZ1A 5GONF 3VPDA 3G8DA 4I4TF 4O83A 1SCUB 3GIDA 1KBLA 4O2AF 3KALA 2HGSA 4FFLA 3BFPA 4HNVA 5LA6F 4O7NA 1JDEA 4XYLB 4I50F 5JVLA 3R9RA 4FU0A 3BSYA 3Q2OA 2YZLA 2R87A 3VA7A 4MV4A 2R86A 1M0TA 1EUCB 1EYZA 4M9CA 1GGOA 1GSAA 5LOVF 4EGJA 3R23A 5C8YF 4MV7A 2IP4A 3MWEA 3K5HA 1BXRA 2R7LA 1PK8A 2YW2A 5IYZF 4EA7A 1M6VA 2HJWA 3OUZA 1UC8A 4MA5A 2YWVA 1E4EB 2J9GA 3JRXA 5K2MA 3KAKA 1OBDA 3WO0A 1KJIA 3LP8A 2R84A 1JLLB 5CA1F 3WO1A 1I7NA 2DLNA 2YRWA 3TW6A 1GSOA 4YJ3F 1UC9A 3HBLA 2DIKA 1E4EA 2OLSA 4EABA 1DV1A 1CE8A 1KJQA 5JQWA 1KJ8A 2R7NA 5HV6A 5KKNB 4C5AA 2FB9A 4FE2A 5JVDF 1T36A 1I7LA 2NU7B 1JKJB 3U9SA 2SCUB 4YAKB 4DIMA 1OBGA 1KUTA 2VQDA 3V4SA 2R6FA 3BSSA 4FFOA 4O2BF 1WR2A 2FPIB 3VPBA 4FGRA 4MV1A 3K3PA 2ZDQA 1A9XA 1PX2A 1KJ9A 5H80A 5CAEB 3ORRA 3R5HA 3KAJA 4C5CA 3TQTA 1KC7A 1DIKA 4RZQA 1ULZA 3MWDA 2NU8B 4MV6A 1KJJA 2QF7A 4MA0A 4HNUA 2YZGA 5BMVF 5CA0F 4M98A 5LYJF 3BG5A 4MAMA 2W6QA 2NU9B 2CZGA 5CB4F 3HO8A 5J2TF 1Z2NX 1GSHA 2CNUA 1DV2A 4L1KA 2XCLA 4WD3A 3U55A 5EZYF 2XD4A 3VOTA 3RV4A 5FNVF 3R5FA 4EA9A 3BSWA 1BNCA 4O7RA 2YRXA 3K5IA 2VPQA 3AW8A 2FPGB 4EGQA 2YZNA 5HBRB 3SE7A 1EHIA 4EG0A 2WYOA 4M99A 5LP6F 5BPFA 2VR1A 5BPHA 2YL2A 4Y8VB 2W6ZA 4ZHQF 4ME6A 3DF7A 3G8CA 5C1PA 4ZI7F 4O82A 2GQRA 1CQIB 1Z2PX 4IIJF 4XYMB 3ORQA 3RV3A 2I8CA 2P0AA 2W6NA 3NUAA 2R7MA 4TV9F
chains in the Genus database with same CATH superfamily
1D6MA 5FD8A 3A04A 3I01M 3TTUA 5CH8A 4B35A 1XVTA 2WJVA 4EPWA 3X2FA 4TQUS 1PJCA 4YECA 4IIJB 4OG2A 3WK8A 5TS2A 2EWVA 3MWDB 4J9KA 4L8YA 5HIIA 4WY8A 1P1KA 3N8KA 4H7PA 1RHKA 4CKEB 1MORA 4NYIQ 1OV6A 5DGHA 2PA0A 1JECA 4IDCA 3OMXA 3ZU2A 4ESHA 1LKZA 2UU9H 5EUQB 1OWTA 2YMPA 3C70A 3JYOA 4WJLA 1DTSA 3PFKA 5IUNC 1FY2A 5LMUH 3U5TA 4RADA 3Q8QB 3AFMA 4Q7EA 2IXBA 1PFYA 4O3PA 3JWIA 3L7NA 4CKWA 2KI5A 3H75A 3CY6A 1YJXA 4BN5A 1RZRD 5BR8B 1P17A 2EFEB 1K97A 5AJVB 2CMDA 1VYVA 4NR0A 1FFXB 2PZFA 4OHFA 4R1UA 4ZK2A 5GM1A 3WLKX 3JQRA 3G85A 4NECA 1CR1A 3WFJA 4GDFA 1I51A 3HDHA 3DB1A 3WMGA 3EJ6A 4AS3A 1P1RA 3VISA 4TYPA 5REQA 4CDMA 1RXVA 1FFSA 4YV7A 4UTRA 3ASYA 4CIBA 2XC9A 2VK1A 4Q3NA 2ZUEA 1OXKB 4NFYA 1TJ5A 2H7YA 2JAPA 1ESZA 1XCOA 1D9XA 3E8SA 3I53A 4HX5A 1R6XA 2YN2A 3NLLA 2HRZA 1NUSA 1FJGH 4GKAA 1K7CA 3EDYA 3B1FA 4KHZA 2AOUB 1NXSA 1L5FA 2VXYA 4ECVA 1M1XB 3FBTA 2BKXA 3BOSA 3W5HA 4AO7A 2VYCA 4JP8A 1Y63A 1EK0A 2A57A 1UMCA 5F1YA 2YZMA 2OO5C 4O63O 3E4CA 3V33A 2H5IA 1CYEA 2KBEA 1YR6A 4K1XA 4JJ6A 4RSHA 3ZDZB 1IWOA 4RPKA 2YOFA 16PKA 4ECXA 4JI3H 2PBFA 3TFOA 5T7BA 1T9GR 5J2UA 3TTXA 3LQFA 1SGWA 2QIPA 4GL4A 1D09A 4RO0A 3UH0A 3N3BC 4FYVA 1OT5A 4EGJA 3KVVA 1G8AA 1L5KA 2PU7A 3FDZB 2QBYB 2X0NA 3EQ9A 2P5YA 4EG8A 3LZDA 3K9FC 3IAHA 1UC8A 1XNRH 1LW6E 4TS1A 3K2IA 3ZV3A 1I2DA 3FNHA 1UBHS 4Q9KA 5FBQB 2RAFA 3ZH2A 2L69A 1JLRA 2NGRA 1OZAA 5IZCC 2I2CA 1MQ9A 2A2ZA 5TR9A 5HV6A 1YVPA 1G7CA 3CRNA 2BBSA 4B84A 2G77B 1PJ8A 1KFBB 4IIYA 1NG1A 1X1AA 1TW2A 4GOKA 2EFYA 2P4HX 4E5UA 5CFMA 1KTIA 2IYVA 2GEJA 3HGMA 2AH5A 5EEHA 4W9RA 1ESCA 3GO4A 3UTDA 3BD9A 3GRFA 4EZBA 3S0JA 1II8B 1ULUA 4YLGA 3E9DA 1EBUA 1MU0A 2XT6A 2OOSA 4BUJA 2C7VA 2LBPA 1CR0A 4DC1A 4LY9A 4CV1A 1SVKA 5CDUA 3GLIE 3WYNA 5H1YA 2IHZA 1KEVA 2EF0A 4LYJA 1ZWKA 3AJAA 2I4OA 4B17A 1S9HA 2PKQP 1IK4A 4XD2A 4XUGB 1MG5A 3K73O 4GC9A 1YVUA 2QMQA 2RDMA 3NOXA 2HT1A 4UCVA 1X8LA 2P1DA 5IDXA 2PR2A 4F04A 2DHDA 5FORA 1FVIA 2ZZKA 1FSFA 3LY8A 2MCTA 3OETA 4BNYA 1WHTA 2YCHA 4R1LA 1CKEA 3AK4A 3ZJTA 1ZSVA 1Y33E 3DKIA 3LT0A 2EZ8A 1PWZA 1RYHA 3JQ8B 2JK0A 4LRWA 4BFWA 5KEIA 2O8NA 3SBOA 3N2GA 5KX5F 1ZZGA 3PC4A 1BTOA 2CL0X 1ZY2A 3SZGA 2COIA 2B69A 2QT9A 3MD9A 2ZRDA 3CS3A 1YIAA 2WNSA 4LZNA 5JFOA 4GKKH 4J0QA 5BN5B 3NDPA 4YJKA 2HN9A 5BSMA 4HV4A 3CLTC 2Y0BA 2PFSA 1TJPB 4P35A 2QQFA 1Z0IA 2YUTA 1PS8A 3MWKA 4PNHA 2ILVA 1KH1A 4L78A 2E37A 3EWNA 1XIVA 3L0DA 5BWUA 3A2LA 1JZSA 3GN1A 3ICVA 3U54A 4YQFA 3GYBA 5L6LB 4BQNA 4NBTA 2XUIA 3UMBA 1WSDA 5FTJA 1ESNA 3UT0A 3FLMA 1NN5A 1RRFA 2H0RA 2IS4A 1Z6YA 1MRSA 4K6HA 2VK8A 2DULA 1I2MA 1HDCA 3ER8A 2H65A 3JRNA 3F96A 5PNTA 4RX1A 2Y77A 1TU3A 4NEQA 1LWOA 1APBA 2RSLA 2GF9A 1A5BB 3UKJA 2YS7A 4JI6H 4C05A 5D3ZA 1G5QA 1KQPA 1V9LA 3R3SA 3RFVA 1XJWA 3K16A 4G4GA 4D7AA 2RGGA 1G16A 3W4JA 4AI6A 1KNXA 4CCYA 2Y92A 4RYLA 3WBBA 3H0KA 4LE2A 2NSHA 4DT1B 3WLQA 2GJKA 2ZJFA 2Y1WA 5FL7D 5TEVA 1D2AA 3LS2A 4DGQA 1XLUA 1W73A 1WHSB 2YWCA 4D81A 5IG2A 1XKXA 1AKQA 4EFMA 2GPSA 5F9HA 2HCTA 4ALLA 4H7JA 2OORA 1O1YA 1UOOA 1ZJJA 1WCMA 3VR6D 4BQPA 1RWKA 3PFGA 4MP8A 3DE7X 5IT9W 5JAHA 5CAEA 1EGQA 5C9ZA 2HMYB 5L1JA 4AKHA 1M6EX 2R87A 3JD4A 2EL7A 5LQAA 1E2DA 1VP9A 4X8LA 1TA9A 3A26A 4XJXA 3KOWA 3E9ZA 1TT7A 4OREX 5IM4A 4C4RA 4LOJA 1CB0A 4X92A 2Y9PB 1ZIDA 2Y93A 3D6VA 1Z6QA 2DUUA 4HWGA 5AP9A 1VE7A 3AKYA 1ZA2A 1YZTA 3GFRA 1W35A 1HTWA 3K6JA 4X0EA 2OLSA 5IASA 3IMEA 3OHBA 4OQXA 3U44A 2J9RA 3UMGA 1OI2A 4CDNA 1WB4A 4G25A 3L7AA 5G41A 1B8VA 4LZWA 2QM7A 1T13A 4XI9A 2XRYA 2VQDA 4QNMA 1KHHA 5A1TA 1JJVA 4V1CB 2Z4TA 1JHPA 3DAHA 1Z37A 1E77A 2F90A 1CQXA 4GGOA 3AM4A 4V0OA 1XFDA 1GL9B 4MTLA 3AVXA 4BZXA 3GIQA 4UOQA 2JKVA 1MA0A 3I04A 4B87A 5E3IA 3TLMA 4AF8A 3T5DA 3DMNA 3VNSA 3A9CA 1U6IA 3IKMB 4OAQA 4N3GA 1Q21A 3IEPA 2XYVA 1Z2NX 4JXKA 3K1YA 4OFWA 3AIOA 5H9WA 5KREA 3ZEAA 4D43A 1EWRA 4TRMA 2JS7A 4C7BA 1RAEA 4G5HA 4BIIA 5KFVA 2FPLA 1P9OA 3BRCA 1DWOA 1FZQA 2J46A 4NRDA 1ZCAA 5DV9A 1P0CA 4Z0PA 1TAGA 3L7CA 4JP5A 4N48A 5JR3A 1B3BA 3TIXB 2C54A 1JUDA 2PJUA 4QXMA 5DBHX 1U99A 1PLJA 2BCGY 2XD9A 4BDTA 4QOJA 4RE5A 1ENPA 1QKKA 3PKJA 2AHRA 4L5YA 4GPZA 4EATA 4RGYA 3BJEA 1UBTS 2FHPA 3G2HA 4NCBA 2C84A 3GNLA 1NUHA 1JALA 2FWBA 2EW1A 1KAQA 3HDQA 3F2IA 4MO2A 3HWWA 5TXGA 1NI5A 4EA6A 5KC8A 1PT7A 1DKPA 1UPXA 4AFNA 1WVMA 2RGVA 1URPA 5IUKC 2W6JD 4MUFA 5JNUA 3KHLA 5A2QW 3UAXA 1ZMXA 3JQ6A 3QLJA 5JCOC 2FWIA 4KLNA 1QYDA 4DHWA 1S8NA 3D43A 4KV7A 3VR0A 2OBYA 2R8HA 1S89A 2GPWA 4MP3A 4WNAB 4MVCA 5KSZA 1UPAA 4ERNA 1XA3A 2HF8A 1CUGA 2FQYA 2QUBA 3AJ9A 2J1LA 5A4JA 4WOKA 4BVBA 3OQ1A 2EGGA 2J87A 3PDWA 2PJDA 5F76A 4PDBA 3QX9A 2FEPA 3C8HA 3M4IA 1CUEA 5K7SA 4C76A 4I2NA 3JSAA 4PPQA 1K1SA 2UVVA 2ZJTA 2H2DA 3SIWA 1XMOH 1O6FA 1NMXA 3R41A 1Q7RA 4G07A 4GP7A 4QXQA 5ALTA 1OIXA 3OICA 1KRXA 4YP5A 4CF5A 2I76A 4JKOA 2BF4A 1V51A 3KR0A 2PH7A 3GIWA 2OHHA 2Z30A 3MGBA 5AFSA 4CIWA 5JCZA 1FSSA 1X70A 2EKLA 2VYVA 3PLAE 4I8DA 3LVBA 1F2VA 3MWYW 4WK6A 3R09A 1K7SN 3UV7A 4Z4GA 4LECA 1UINA 4ED8A 5AR1A 2FMXA 3WGVA 2X2FA 2P3LA 4JUIA 1GRRA 4DIDA 4ZJYA 4F21A 3AZQA 2NVWA 3MWJA 2AEJA 3VZDA 4ZCQA 1E3MA 1T4GA 2X1HA 3G7UA 4X64B 1JMKC 4R1OA 3I5MA 2D1SA 2C96A 2WHYA 5F73A 4AKGA 2VSOA 3ZBPA 2MSCB 3UMJA 3CWCA 3LQYA 1XXHA 3RAJA 3LC2O 4LH7A 1F7UA 1C1HA 5DYIA 2AN5A 2V9PA 1ISHA 4C07A 3CURA 1CP3A 1G5FA 3TG2A 4JIGA 4EQ6B 2GEUA 2HDWA 5CHEA 2X8AA 1XVAA 5BUZA 4R31A 1ZGZA 2RAUA 3LTEA 4ZCLA 3RKRA 5DM60 5HIMA 5A9RA 4R01A 1BS9A 4WFKA 4JA2A 4EX7A 4B6SA 4Q82A 5FUXA 4DRYA 3OUZA 3KOUA 3NHWA 5KFJA 2Y05A 2FI1A 4Z49A 1WSBA 2PCJA 2OILA 1Z4PX 3HCFA 1NUPA 1IU9A 3EWIA 1FYFA 4XYEA 4DSUA 3LP8A 4I8XA 2YTZA 4BLQA 2IL1A 4GMFA 4BB9A 1DV1A 2J3HA 4U6PA 4Y18A 3T1VA 4R69A 1IVYA 2GHQA 4UVIA 1RWWA 3WJ1A 1XI2A 1ZHOA 3NBYC 2IPLA 1XRMA 3T95A 4AYXA 2MR5A 5JYCA 3RYFB 4XQ9A 2YJTD 5GV7A 1T34A 3QUAA 2OCXA 4IDDA 1R15A 3B1XA 1P31A 4BVHA 2IYLD 2I6GA 2LUOA 5CVTA 4BVFA 4V24A 1X7WA 4KFTA 4LCJA 4N6OA 4UBNA 1Z07A 1T4CA 3LLSA 4IYJA 3OOWA 4RCVA 3KQWA 3FPSA 1YKFA 2HGXA 4P4NA 3KUKA 2NYVA 3PF8A 3AU8A 2FUNB 4IXNA 1U2TA 1YU9A 3O4HA 3PCXA 1GG2A 1O54A 1TTPB 4N41A 4QYXA 1ZM4A 4DHEA 3FKSD 2JA6A 1B7GO 4LFCH 4KFUA 2G07A 1HFJA 1ZAUA 3QWIA 3DV0A 3NZEA 1JB1A 5A0TA 1U98A 4MRMB 3ZIUA 1PO7A 3Q41A 4ESVA 4IRDA 1JHAA 3T99A 3NUGA 3ZE6A 4MPTA 3JZFA 2A1TS 1UJ6A 1GPAA 4KQWA 4RTSA 1DJQA 3ENZA 3KKZA 4R71A 2E5LH 4PLFA 4URYR 4TYMA 1UBOS 1X19A 5E8JA 4GICA 1OWOA 3GMDA 2GAJA 4L2IB 1EFAA 1Z6AA 3MR3A 2CFOA 1IBMH 1VHQA 1I3KA 1G18A 4UCRA 4CMJA 4ZCPA 4XH9B 1RHRA 3QFHA 1E2KA 2YNMD 2ZSBA 5CCBA 1O77A 9ABPA 4OU4A 4TVBA 2FK2A 4B48A 2HZ7A 4LSMA 2Y1LA 5SYNA 2CKZB 1ECBA 4MKIA 3RVQA 1ZGBA 3LLUA 3UF0A 1GTL1 2PMFA 1SIOA 1KY2A 4R3NA 3R3WA 1JLHA 1JZQA 4RSGA 1NMZA 3JQ9A 1T3SA 5LQRA 1QHHA 4ZO9A 1Z6ZA 3PGVA 3BA6A 4GGMX 3OO1A 4FT2A 2VOBA 2CF5A 3WFZA 2E4VA 4IXWA 1EGMB 4EO9A 1N36B 3O38A 2JCXA 3IO3A 2H7VA 2ZROA 4MH0R 4LCBA 4KQMA 1K5PA 2V7PA 3WAKA 4UEQA 1Q0HA 1R4ZA 2PAFA 3ED5A 2X2PA 3UKDA 1QZ3A 3T5KA 5ADWA 2REQA 3TGPA 1A0IA 2ZT7A 3RB0A 3GFBA 4UXJA 5EESA 1Z3CA 3DBLB 3VO2A 2C00A 4UULA 2XW6A 3H86A 3K0FA 5LKRA 3P7MA 3YASA 4RPGA 2Q5OA 2XNCA 3DONA 3EPRA 3DO6A 5AK0A 5SZIA 1T15A 4M9UA 3JR7A 4L7VA 3NP7A 1HQCA 4YDRA 4AZSA 5EXXA 1ZRSA 3GRYA 4RGVA 3GRPA 1UBFA 4HX2A 4X66H 3PPWA 3U9LA 2PYDA 4FNGA 1W9MA 2QTFA 4AUEA 1GYQA 3Q7TA 3L8CA 5LZ4A 2BEWA 2X4IA 2FP3A 1PSZA 3ER6A 4QEDA 1HLPA 2JAQA 5LR6A 2VEOA 5JDCC 3NHZA 2I6FA 1BXRA 3HSSA 4C29A 4F2PA 2LCQA 4HYEA 1Q14A 3NOVA 2C58A 3L46A 2JGMA 4RESA 1IATA 3FKIG 5F9FA 2WWIA 4NXNB 1ZR2A 1HE8B 3C1OA 4BKRA 4OQZA 1WS6A 3VYSB 3QITA 2GX6A 3BE4A 2DKFA 4OGKA 2YY7A 3V1UA 6GPBA 1SVNA 4PYMA 1RMTA 3WYFA 2QTHA 1EUYA 2Q28A 2WD8A 5J5CA 4CI0B 4RAOA 3ZD6A 4F5ZA 3VPBA 5ECGC 4RHYA 5ITSA 3IERA 1SC9A 3ZNOA 2H9IA 4B6FA 2YXLA 1V1RB 1MVNA 3IC5A 3KFXA 1LSJA 1FS5A 4ZZ2A 3OZCA 2GCOA 1QGED 4IG9A 3CZPA 4IIVA 1EQUA 1M73E 1J33A 4FCTA 1MOQA 1SOUA 4EJ0A 2W6QA 4Y6RA 3OCUA 1U3TA 3S99A 4NZYA 3TMKA 5J2TF 3DHVA 3II6X 2C2KA 2JIQA 2RB5A 3CZ9A 2IC5A 1VECA 2J6SA 3TE6A 1TIPA 3NIWA 4GWLA 3DWEX 4FNOA 1UMBB 5KSWB 3DFKA 2PKXA 4PSUA 5JWHA 2GH1A 5LZ5A 5FQNA 4IHJA 2HMAA 4I1OA 2GPAA 1BJTA 3LQSA 1ADBA 2NP7A 3C5WP 1QP4A 1DDOA 3H19A 3O5AA 2GNOA 5LMNB 4ISCA 2PLWA 4ZEXA 2ZJOA 2CUZA 2I8CA 3EIFA 3S24A 3ZJVA 4HH3C 3WQRA 4G9EA 1SG9A 1EZ4A 5EJ8A 1IMOA 1J4AA 1J1ZA 3ETGA 2R8BA 5EMJA 1SWWA 3I2IA 2V55B 4HSGA 3RVSA 2APJA 2YY6A 3IVRA 3KT8A 3EEOA 3ONDA 2ZWPA 1XNGA 1LGYA 3PJGA 1Q84A 3AY7A 5ALGA 4K7JA 1M8JA 1MC4A 1HR0H 3VPSA 1VHJA 5LMZA 2VZ8A 3WWIA 4DA8A 1XPRA 2ZAOA 3K70B 1DAGA 3UK0A 3W6ZA 3SNOA 4F6CA 1ACLA 3H5WA 1AKTA 3KPWA 2JJMA 4JOCA 1UAAA 4I5EA 1L1EA 1KJNA 4RNMA 5G1PA 5AI4A 2Z1DA 2P2SA 2EP5A 4FM9A 2VWHA 4ONEA 5LQMA 3OO0A 2A5FA 3IYLW 4V03A 3LT2A 2G83A 3OE5A 3R0ZA 1H42A 4CU2A 1E6MA 2B63G 5KTTA 4CC6A 2JRCA 1YR1A 3KKOA 1M34B 4EEKA 3D59A 3QE2A 5HSGA 2OHJA 2P9YA 4KXWA 1Q7TA 2EBFX 2HCRA 3SSNA 4CE5A 3DTFA 1E3LA 3UXHA 1HSOA 3OX1A 3W1EA 4FHDA 5IVHA 4N8EA 3FPLA 3GQVA 2H4WA 4BVAA 1F17A 4J8PA 3CV3A 1BGVA 2O3UA 5CR9A 4D79A 4TS9A 2J6TA 1K27A 4N49A 4Y9TA 3UKOA 3IODA 2P6NA 3BQ0A 2P68A 1T1GA 2IYYA 2C7OA 2FN3A 4Q9NA 4M6WA 3WLAA 1FVFA 4M88A 1EK1A 3S1AB 1UJ5A 2AFIB 1Y1VA 3BD6A 3I9NA 1VLLA 1VKRA 3UHFA 3UPDA 4FFLA 2PJZA 4Z4IA 4OP3A 1HTTA 2IYOA 1XROA 2FY8A 5KNDD 5IYDG 4XASA 1E69A 4ODIA 3PXUA 2DCUA 1F12A 4XGKA 2EKPA 2BHNA 2JEIA 5EL0A 2IPXA 1H9CA 1MZVA 2IXDA 4D96A 3L77A 4P81A 3LPDA 1E94E 1EFPA 3BMCB 1T1SA 1GRNA 4JEMA 3ZCTA 1RR6A 4UTZA 4P8RA 4KXYA 1BVYF 3E8MA 4P54A 4F4DA 1GKKA 1OE0A 3B6EA 4MUJA 3HCRA 2ZRHA 1GSIA 3KJFA 4QFBA 3D7RA 1IRIA 4GKBA 3MCUA 3U26A 4OI2A 3JTMA 4FDMA 2GGSA 1XAIA 3RABA 1SQGA 1BG6A 2RGWA 3D6JA 5KWSA 4UAJA 4OXXA 2I71A 1FNSA 4GR9A 3BQNB 1WZNA 3A1VA 3ENWA 3IT3A 5KOJA 5B6PA 1EKPA 4EI8A 1QYRA 4FGKA 4EBDA 4JROA 4O1IA 1M8PA 4O2BB 2QQGA 2W0SA 4ZDWA 3BG5A 1BXGB 1WRVA 4F96A 3CKLA 1KDOA 3TI7A 1XEFA 4PSDA 2FMFA 1R0WA 1S03G 4Z1OA 2PX3A 3OHAA 3HOZG 2XVMA 1L1RA 3ZS9A 2AUTA 4PX5A 4WXMA 3OZEA 4N39A 3H87A 4D8TA 1D3AA 4LHSA 3GTOA 2AQIA 2DH5A 4M0LA 4R9NA 1DDGA 2Z8YM 3O8QB 4JEUA 3RSZA 3TR6A 2WWVD 3F8TA 3W5OA 3KU1A 4MRNA 2XODA 3QWBA 2OXTA 3FZGA 2VUSA 3DW1X 1NFFA 4X65B 4DM4A 4FX2A 1Y8RB 1MAWA 4ZAGA 5U4QA 3TYXA 3NI2A 4KX3A 2VTDA 1NVFA 1H0SA 1JAIA 1MX1A 2NZJA 1RWBA 2Y27A 3OFSA 3MCVA 3IV7A 1X80A 3DAPA 3GDOA 3PDUA 5KWVA 4NV1A 3KTFA 4LOIA 4A3CG 5GIOE 2ZI3A 5DE3A 221PA 4TYWA 2Y6VA 2YXBA 3EIEA 5EJEA 2O5VA 4ECAA 2H2IA 4QATA 1ML3A 3AB8A 3SQNA 4KGZA 3SX0A 4ZVOA 1RWVA 4YB8A 3I9MA 3ZOKA 5ERYA 1W0KA 1PQ4A 2R6HA 2O2YA 1SCBA 5AQEA 2GWHA 4NNPA 4QVGA 1H2BA 2OY0A 4CMEC 1RK5A 4UMDA 3HB4X 3ND7A 3KHRA 1N2SA 3CO5A 2B34A 3LXXA 4ZD6A 4IDOA 3WIVA 3THXB 1O0SA 1KPHA 3LF1A 1L7NA 1WLYA 3LVQE 2VXBA 1XVUA 5DXFA 4YRBA 3B2QA 5BOSB 2Q3JA 2FZGA 3JQFA 1AUQA 3EBLA 3PX7A 3GDEA 1NC1A 1KKUA 1OMOA 2DG2A 2CV0A 1CWUA 1NJ2A 5FPHA 5E6UA 3GEIA 4TOIA 4HXYA 4OHCA 1U5AA 1QLWA 2DBRA 4QOIA 1HDGO 4RV4A 3N0VA 1V3VA 3T7EA 1N3IA 3KCQA 3X43A 3GZNA 3VSDA 1SHTX 1U7ZA 5JQGF 1VGQA 3QJYA 3LGAA 5CX1B 5KNCD 4ZA2A 4M0UA 1QTRA 4C2TA 5CB0A 2Z9BA 1YIDA 5IWCA 3U7RA 4TTPA 3LL4A 2RG7A 2I7CA 5J9FA 1OLSA 2A84A 3LW7A 2R79A 4HRXA 2X2EA 4AXBA 4EEQA 4JSTA 3EXFB 4ZYXA 3J80W 1E92A 3Q8PB 3BFPA 3L0SA 2FLPA 3TVTA 5SICE 2PNJA 4KG7A 1EG2A 1I80A 2F1HA 4IO1A 2HU7A 4REMA 3AG6A 4ZAFA 4GWKA 3G1UA 5F7OA 2RAVA 3DTVB 3H84A 1U0NA 2HXSA 3DDCA 1O8BA 3WA7A 1VL2A 1FYDA 4KR3A 1IUKA 1F38A 3KO8A 2D1QA 3TH5A 2Q99A 4J9PA 4XW2A 3PU6A 2LDXA 1U0RA 3OE1A 3GEPA 4FEYA 1FPQA 4M46A 4L50A 1W5AA 1X0XA 3I8SA 4JV5B 1N2ZA 1NMSA 4DLBA 4MVJI 3CFYA 3SWWA 4ZYTA 3HUFA 1CE8A 2ILTA 3K70D 3A6GA 4P9NA 4FE3A 3D8RA 1OHHD 3JQAA 1JKJB 2GJSA 2H4JA 4U8GA 5ADHA 1QTIA 3PTLA 4Q4DA 2R2AA 5I5XA 1BHQ1 4QULA 2FPIB 3HB5X 1EVJA 5K3SA 2JAUA 3IDAA 2FDCA 1KJ9A 2B5WA 2YN0A 4K9NA 1KSGA 4EFBA 2WHPA 4TROA 4DCMA 3D7NA 2QF7A 3OJLA 5HDQA 1DXYA 4JBNA 1GKUB 3VSBA 1WUIS 2BTEA 2AZDA 4KOEC 3MAJA 1JIUA 1NNSA 4HWOA 5IVDA 5JHGB 1SMKA 1BRTA 4PSVA 1N6HA 2C5HA 1QRRA 1X1CA 3RRNA 1GGFA 2UUCB 3ZD7A 3J7TA 1B0PA 4RYDA 5K8TA 2YWDA 3L0ZA 4HAOA 1DB3A 2WVAA 1R5NA 2PT7A 3H42B 3ZGNA 4UFZA 2R8RA 5TX7A 1J90A 5BNZA 3S8YA 4LV6A 3ZHUA 3IG0A 2OB1A 1JPVA 2JIPA 2IF2A 1J1UA 3FXAA 4F7DA 3I9V1 3WDLA 4KWCA 1G5TA 1IFXA 3HXTA 4WBNF 2ABWA 5M04A 4MKZA 1XL1A 5B7GA 1BMTA 3V7FA 4JA0A 4C20A 1LDYA 1HZZA 3HKEB 3PWSA 4R8MA 1YVRA 1Z33A 5CT5A 1QXSA 2ZQZA 1RM5A 3OEED 1QIIA 4JT4A 3L40A 2FVXA 3HVIA 5B3AA 4GVLA 2NTEA 2VUHB 3C5VA 2VBGA 1ISSA 4OTZA 1EUZA 4JX9A 2I7DA 4LNUB 4D3FA 3V55A 2ASVA 3O8OB 1M0SA 1I94B 3Q8MA 3MFIA 4PPFA 2OOKA 5JMPA 2CHQA 1KEEB 3AHFA 4FFVA 1L4NA 1U8UA 5TJHA 3ZBQA 1I7DA 1QH8B 1V7ZA 2YMMA 4LISA 4QGHA 1G5HA 4FMCB 3TRFA 1P45A 2I6XA 3NX4A 5NLLA 1PBTA 3P2EA 4QO7A 4DQLA 5JTTA 4TLEA 4A5SA 4FI3F 4G23A 1OH6A 1T4MA 1WEHA 4OLAA 1RHMA 2ODAA 1P77A 3JPYA 1SU4A 2B8EA 2ZSFA 5KYVA 5D6NA 1E5XA 2GESA 1L5GB 3B78A 4NHOA 4XPIB 4AMGA 4OJQA 1XBTA 1CVRA 1TYZA 3MRTA 4W6QA 5IC5A 5A3QA 4KXVA 2DT5A 1SKAA 1SCUB 1R8YA 1QBGA 1K4KA 4LDRA 5DZSA 5KYTA 5BQXA 4F4JA 4YO7A 2G6TA 3HDJA 4I19A 1M10A 2JJ2D 1KWGA 1T9AA 4IDHA 5TVGA 1GGOA 4TRJA 3RYTC 3TVYA 3KKEA 3JTEA 4G84A 1ZD5A 2WTNA 1GEGA 4BCBA 2RGUA 1ZMOA 1RZ3A 3I28A 4TYNA 2NV0A 1EBFA 3FLBA 1VKOA 2R97A 3OZRA 3NKVA 1K1QA 4PTYA 4HXFB 1VB3A 4LF7B 2WU1A 3WRXC 2CC2A 2IWRA 3UJBA 4I36A 2Q27A 1DPGA 1Z45A 5FOSA 4QPNA 4BJ1A 4Q43A 5TMDA 1V7CA 2QJFA 1O94A 2AFIE 1U1EA 2BTQA 5T3UA 1KFKB 1UMCB 1C29B 5DGAA 1NBEA 3U4GA 1ZK4A 1FTQA 5T3YA 5KFZA 4HEA1 1ZJ5A 1GTSA 4J9OA 2V0GA 1J9EA 3UC9A 2BBOA 1SIWA 4GOMD 1T6YA 3T7AA 1TJYA 5J2UB 1T9CA 2VT3A 2G9ZA 2ERXA 3GARA 3IEMA 3EVEA 5CA0F 1QNFA 2Y76A 1J70A 1JSRA 1BFKA 3RIHA 4AJPA 2FSHA 2MSDB 1V2GA 5CB4F 2BM8A 3EQ8A 3AUKA 4CQJA 4PXYA 5JNTA 2JFOA 4B2LA 1KPGA 1W30A 5ITWA 3OIYA 2H9AA 4XFDA 3ESXA 4RTMA 3DLHA 5ELMA 3RG2A 5ESWA 4WLNA 3HM9A 4KPUA 4HLUC 1KA9H 3RU9A 1TAQA 1QQAA 1TJ4A 2YYSA 1EFDN 1V45E 2YJ3A 4KXNA 3VHLB 1EESA 4NF2A 2PLAA 4A0GA 2AU0A 4PN3A 1Z2PX 1RM3A 2W4QA 1M2EA 2EJUA 5FO1A 3PXCX 1BVUA 1E3QA 4GBED 2PGOA 3COZA 1OROA 3KJXA 1F2TA 3OC6A 1C30A 3OTOH 2CJXA 2YW9A 3RRXA 5JJLA 2V5AA 3L6DA 3O7MA 1JDBB 2ICAA 2F8SA 1PVVA 4M0PA 2VJKA 1GGHA 4L02A 5DNDA 4M8LA 1P1FA 1IY0A 5KJ6A 4ZO4A 3QEJA 3A2NA 1XPUA 4DXHA 3Q98A 2FSSA 1UPCA 5BN4A 7GPBA 5T64A 3H9EO 3REOA 3G0BA 1ZJWA 3A6DA 4WMLA 4S05A 3E53A 4RL6A 1KBQA 4YI5A 2A59A 1U28A 4YCBA 4ND6A 3KE8A 1UKZA 4QAQA 3B1ZA 5JCXA 4DL6A 5HS6A 5EZ5A 4OYYA 5CLGA 2J6CA 3SFZA 1X94A 3RQIA 4GI7A 4KBGA 1IBRA 1SVWA 5DNEA 5EUCA 3PNQA 4BLPA 1OV4A 2X41A 5D5QA 2O8FA 1DXQA 1LI4A 4CHTA 4DG8A 1JS1X 2IS2A 3N2GB 4TKVA 4JYZA 1EVIA 5EE5B 4V3CA 1RFLA 1ISMA 1XTTA 4FOOA 2BGGA 4LXQA 3CBGA 4E94A 4LC1A 2IWHA 4UJ3A 2EV9A 2DYKA 4BY1G 4D9NA 2NN3C 3GTPA 3EEIA 2X4GA 4YAIA 4DIKA 4B6GA 4Q3CA 4UMEA 4BP8A 2IXTA 4AIRA 3SICE 2F1RA 4FCCA 1NPTO 4ZV4A 4U1RA 2PZLA 3I34X 4PQYA 1JHYA 2BH2A 1NP7A 3I5AA 4YNBA 3MFHA 1C3OA 1JFFB 1GN9A 1SVMA 4TT8A 1CUFA 4ND1A 3COPA 4Y9DA 4Q4LA 3WLLA 1R5BA 3LY5A 3IN5A 2ZIEA 1Y3DE 1JXLA 2XTAA 3LCCA 3I6QA 4F5DA 4ENUA 1O7JA 1II0A 4HNVA 2EERA 3DYBA 4U2EA 4O7NA 1L4FA 1V6SA 1EHYA 4FGLA 3G2LA 4U2DA 4C7KA 4D9HA 5JD4A 2HMUA 1EYZA 1F14A 4M0FA 5LYYA 1MPTA 2Q5EA 3IPAA 1SPXA 2HVRA 4DV0H 4RB1A 2X14A 1NRJB 4TKLA 4YC7A 3TJZA 4DMUB 5KJ1A 4EB3A 5BNTA 5IC4A 3PIDA 3K0SA 1PEYA 1YBFA 4QIWA 4HQNA 4Y1RA 1UBMS 1R10A 1R9JA 3TNFA 4CM8A 5DTIA 4DR7B 3HJAA 2FN8A 2FPWA 3L7KA 4IHAA 4AULA 4X7PA 4TM7A 4J0HA 3CQ9A 4MEBA 3Q1LA 2FLVA 1J0EA 2VJDA 2ENUA 3UOWA 1E4OA 4NXMH 3FSGA 2D59A 1UBEA 5GY7A 2WFLA 1MH1A 3G5AA 5TQVA 3Q7RA 1ZOIA 1L4HA 1PX2A 1RPTA 1KC1A 5CAEB 4J7CA 3FPFA 1JKMA 3TNYA 2EIHA 2PGAA 4QG3A 3RAXA 2XXBA 4HUQA 1NI3A 3WBFA 2FK1A 2VDWA 5TJ9A 1IJFA 5ALIA 3FOZA 3PWZA 4NE7A 5LYJF 3KHHA 1QO9A 4UOZA 5DTQA 2Z4SA 1ZRHA 3REQB 1DE0A 4LWOA 2WM8A 1DRJA 4PG5A 1HT3A 1E64A 4EFDA 3A9TA 3F8SA 4CQLA 4V0KA 1NQVA 5D7BA 2R8XA 2LW7A 1HE3A 1JAHA 2ETVA 3N75A 2VCHA 3U44B 4EYIB 1CRWG 4FGWA 2VP5A 3C4VA 4DNOA 2H51A 3P52A 1YQXA 1E18A 4ECYA 2GWRA 3QMVA 7YASA 1D7AA 4Y2XA 3HJRA 5IT9A 1FDWA 4DR6B 3H16A 2NPOA 2A5LA 1VIDA 1ADFA 1HDZA 1N34B 5A4KA 4R5HA 2Z1NA 2W9AA 3MUEA 2XMBA 4Z3KA 5TNXA 4E30A 2NO1A 2WJYA 1X14A 1OFGA 1T43A 1CF2O 4U5QA 2OAEA 3LECA 1GUFA 5FKJA 2Q49A 3Q8LA 4ND7A 1VC2A 2VQFB 3BILA 3EPHA 4I9UA 3RB8A 4U0KA 3WKAA 1KWKA 5KFBA 1KOFA 2W6MA 4C5BA 1ODIA 2BD0A 3HN2A 1B1AA 1R5OA 1NKVA 3ZTWA 2I0FA 3E05A 4CIDA 3UAGA 4PVDA 4LDZA 1ZZEA 1KDYA 1L3IA 3HI4A 3ET5A 3RT9A 4YI3A 5BWOA 2X8JB 1RS0A 1DKRA 2ZT8A 3RU2A 2QR3A 3N8DA 4PZ0A 4NOKA 2Z04A 1VIMA 5CDTA 1H9AA 4MGIR 2ZOSA 4UNPA 4KQ9A 1NVBA 4OYHA 3JQPA 1Y1KE 2GM3A 3P4XA 3UQ8A 1M1YA 5I7HA 4MUIA 4ZO6A 1IYEA 3HVKA 4IH1A 4Q4JB 2Q5IA 3N7UA 3OCYA 4NYEA 4CMIA 1C3VA 4WXHA 3WDMA 1O95D 4PG4A 1BA3A 3HXKA 1JEQB 3UXEA 2F67A 3K71B 3ZIAA 5CURA 4C0QC 3VH1A 4RVDA 4FS3A 4AS2A 1U0OC 1ZCFA 3DGFC 3OCXA 4PICA 1RXWA 1U8TA 3CZQA 1M0WA 5KG0A 2FRXA 4PO1A 5KYXA 5DXJA 3B3JA 2OYCA 5FTNA 1ZGHA 1EIWA 4MHOA 2ODBA 3H5IA 5TF0A 3DYVA 2QJOA 4DL2A 1EAMA 3G2OA 5AW1A 3V1MA 3C6YA 6LDHA 1E7SA 1QK4A 4D46A 4DE5A 3AR3A 2DEUA 2B1JA 4EBBA 3WDSA 4E2ZA 4KDCA 2AYXA 4W9NC 2B4QA 2CVQA 3O0DA 2R86A 1M83A 4G37A 3AEYA 4EJ2A 5A2QA 5BSUA 2ONJA 3QA3E 4RA9B 4D41A 1H94A 4OBXA 4KU4A 4I1RA 2DP4E 4DQKA 2IGBA 1QG0A 4GRIA 1EP9A 3V3TA 4A3LG 2GZAA 2M1ZA 4GOXA 1A2BA 1Q7GA 2YC2C 5GAJA 1OBGA 3E0XA 3QPAA 1NVKA 1UJ4A 4GUDA 4KX5A 2N46A 5ARBA 1Z6TA 4DJEC 1U6JA 5HFJA 4KVAA 3DQPA 3VUEA 4RK5A 2PUFA 4G0NA 5JW6A 5DP1A 1VG0B 2GRAA 1WPGA 4XARA 1ATZA 2WABA 4ML3A 3AI3A 5CP8A 1AXGA 3GTGA 5KFUA 1L8OA 1VIAA 4CTNA 4EI2A 2JW5A 4EEYA 4B45A 1OYOA 2YZGA 3MM4A 1XN4A 4TX1A 3D7LA 3AEQA 4TZ0A 4L7QA 4DLNA 1E9RA 2W6CX 1GDTA 2PXAA 3TJRA 1ZDMA 4Z99A 2VDPB 1F06A 5UKDA 2J3QA 3JZDA 4YLYA 2O2DA 2GAAA 3LUKA 1G63A 1L8QA 1PE0A 3DP9A 1R6DA 3OBBA 2C59A 3GLQA 1N8NA 3HJHA 2YL2A 4ZHQF 3TLCA 3QE9Y 3BEDA 1TO1E 1E96A 3AB3A 2P90A 1NR1A 1YXMA 1LRJA 4DYHA 4ZT3A 2ZUVA 4HNAA 2EW8A 2O20A 1A8UA 2IIVA 5CIYA 1WCWA 3AX6A 2DPMA 3BQ2A 5FH9A 4FBGA 3K2BA 1XLVA 1MX3A 1I1HA 3OMWA 5LLSA 1MJFA 4Y1FA 5HJ5A 2W48A 2RI1A 3KAPA 5AKGA 1X7WB 3LCMA 3DBOB 3GP5A 4B5LA 3R0JA 3U13A 3PW0A 1NDQA 1T4CB 1SCQA 1TF5A 1AA9A 3GNTA 4CETA 3KLBA 5LN1A 2R7ZG 1C4WA 1JILA 1XEXA 1DAKA 4KXLA 4HEJA 1W25A 2H3EA 1EFCA 1RJ9A 3UHPA 3P94A 2RHWA 4CTOA 4JGBA 4P7JA 5F35A 2Y0EA 3S7ZA 4BGIA 4HY3A 2GXAA 1E0AA 1JPJA 4BO4A 2I3ZA 1NOKA 2VJMA 1LC3A 5K0EA 2XCTB 4QGAA 3DV0B 4S1VA 1USIA 3PIIA 1MMFB 1VJ0A 2B7BA 2GVNA 3HJCA 1Q50A 1LBHA 3ZD9A 2CVOA 3NHRA 1BFDA 4AJKA 1ZQ7A 1D04A 3ZDBA 3DLPX 1V7PC 2ODWA 3BB4A 5DW3A 1HFWA 4X6YA 2M6SA 5JROA 3JAWA 1PGQA 3TIIA 2IYXA 3ND8A 3DFMA 3KUUA 1A48A 3ZK8A 4UUQA 3PR4A 3PLNA 3F5MA 1CJTC 1KFEB 4H08A 3S5JA 1HQDA 3UQYS 1MAUA 3U3ZA 6NULA 4WCFC 1QFMA 2PGJA 4IOJA 1Z4MA 3OZBA 4IXTA 1KY5A 2YIDA 4NS1A 4PNZA 3BE6A 4B3MH 3ITEA 3EXG1 4B85A 1TMOA 1TA8A 4KMOA 1I0ZA 4ZEOA 2FX5A 3NV7A 2HU8A 2BMDA 5DEIA 1DTWA 4I3GA 4PX3A 1QHHB 3IURA 5LA6F 5TQ2B 3LV8A 4G8DA 3CR7A 3BB1A 3ICWA 3TZCA 1I6LA 4A8JA 1GYRA 2JEOA 4Z2YA 3RUAA 3GELA 3DHYA 1TZCA 2YWXA 2D62A 1QQ5A 1AKRA 2PXHA 4EEZA 5IVIA 4X1OA 1E2NA 3K09A 2HWWA 2VDRB 5H02A 4CLRA 4KXXA 3JYNA 3ZY3A 1RJPA 3QQ5A 4K28A 1NOIA 3GVXA 5IJ0A 4PX2A 1EVEA 3ETNA 2REQB 4YPFA 4ZI5A 5C4GB 2QG6A 3WGKA 4U7GA 2CXTA 1HUQA 4FBTA 4AY5A 3PJEA 1QDUA 3T5PA 4XVQA 5IABA 1F4VA 3RHZA 3C48A 4B3DA 1U9YA 1KJQA 3K0FB 4CMKA 3EFHA 1KO8A 4KN5A 5CFNA 1LVHA 1KBZA 1LDMA 2PX6A 2B21A 5E4TA 4QGSA 1GUYA 4MVJH 4OUDA 4OFBA 2CDBA 2VDLB 1QV6A 2FZEA 5IHPA 3ASUA 2QPOA 1DJNA 4BE4A 1PAUA 4LSWA 1Y42X 2VP6A 3KAJA 4RD0A 1B2LA 4YDHB 3TZEA 1QM5A 3V7YA 2WJ3A 4HNUA 2W2MA 3DKKA 1ZUNA 4C7JA 1LDEA 1H93A 2VSXA 1I4LD 1EEXB 3COSA 1BXRB 1Q91A 3KNZA 2ASEA 2YX1A 1EWVA 5EKUA 4EGCB 5J4YA 5FPTA 1FC0A 1E7QA 2WT9A 3ZE9A 1S8OA 4JI5B 3B85A 4EA9A 1SIBE 4ETSA 4H6XA 4P7BA 1GL3A 4XAQA 1YDGA 3EW9A 3DCNA 2VR1A 4Q18A 4IM7A 4DIBA 1GR1A 1NI4B 1ZM9A 2TECE 3UM9A 4DLAA 1P9RA 2VJBA 3UB2A 3RR5A 2AB0A 5KWEA 5B1YA 4FC7A 1GKYA 1XZNA 4TV9F 3W1WA 3HBJA 2B30A 4BX2A 1A3GA 5LP6C 1HLDA 5KTRA 2BOVA 3WWZA 4L73A 2ZW9A 1WU7A 3EGDA 4A03A 4F50A 2R85A 3JVIA 1J8QA 3P0HA 2WQZA 4Y9SA 1DX9A 2KS6A 3FPBA 2FE1A 1TKRA 2GCOB 4OXQA 4JLSA 4R0MA 3W5DA 1TUBA 2I03A 1Y5LA 3M4ZA 2E7ZA 3LWZA 1MW8X 3EZNA 5KG7A 2KE5A 3JWHA 1UBCA 3BBPA 1EH5A 4XB6B 3WTBA 1YA8A 3CF4G 4A0QA 1RJFA 1RDFA 4TXNA 4BCCA 2SHKA 1V41E 3AY0A 1MBZA 4O08A 4YR9A 4Z0TA 2WOJA 3DOHA 3X1WA 1L1FA 3ICQB 3NPAA 4TUYF 1WKCA 1HETA 1LFDB 4IHJB 2VBCA 5I8WA 1OJ7A 4Y2HA 1TJ3A 3HXPA 1YVEI 3D0OA 3BN3A 1R2QA 5FWYB 3TAHA 4AZ3A 4HNHA 3E5NA 3SOZA 4G89A 4JI1H 2JLRA 2WT8A 5M2QA 4CCWA 1P0IA 5A05A 3VKFA 4QTZA 3ESQA 1G0NA 2W8ZA 3C8ZA 5KFLA 3D1LA 4OHZA 3AL2A 2IYNA 1CUUA 1R37A 1E1LA 3UAOA 4QC2A 5D1PA 5F51A 1L6RA 3MVEA 4WOCA 1N2OA 4P82A 4AY6A 2GNPA 1ZW1A 4AECA 1FW6A 1TQ4A 4CM6A 1NLZA 5HOQA 4ZYYA 3W3ZB 1JLLA 2A58A 3LJKA 5BWXA 3JARA 2MINA 1TGYA 4YAJA 4XD7D 2FEWB 5F23A 4I5IA 3ACDA 4KXFB 2A6PA 1TF2A 3BCRA 2Y0SA 1RJQA 3OM0A 3JSNA 3ZY5A 1GAJA 1VMDA 4A3GG 4BNUA 2WICA 4CMGA 4JBLA 3PDCA 2I3GA 4KCGA 4EWLA 1TRHA 3WWDA 4LMYA 3VH4A 1R0SA 1PL8A 1S96A 5KQMA 4EG7A 5KTMA 1TUGA 3D64A 2B4KA 4JFAA 1RVDA 3PF9A 4JWTA 3QX3A 1Z4NA 2VTKA 1AVTA 1N2IA 4MDEA 4I4NA 4GL2A 2VC2B 2JC3A 2UUBB 1PSDA 1NR5A 4O2AB 2XA9A 4XYLA 3AUJB 4OQYA 2VDUE 1GTRA 3CKMA 1PK8A 4TMVA 1U8ZA 5IYBG 2GUGA 2WE7A 4RY8A 2W2LD 3L4JA 2QPTA 5F78A 1JE0A 2EKQA 4RL4A 2PKRA 3WO0A 1H1LA 1VLVA 3VR3D 4AY2A 4B09A 3D3NA 1W88A 3NFYA 4NYMQ 2PX8A 3OJXA 2HSJA 1LLCA 3O4VA 3T94A 1NAHA 1XALA 3IKVA 4INAA 1MTOA 2HQOA 3CEAA 2WAMA 4ACBA 1O5IA 1CKNB 5C35A 2J3IA 4Q37A 4UD2A 5JE8A 2UVQA 3X1MA 1H2ZA 4M6WB 4FKBA 3CHYA 2Q29A 1YS7A 2C0QA 3H3VH 3EGEA 1VYUA 2O4UX 4CWAA 1Y6QA 2J5BA 3DL2A 4GRAA 1GILA 4LRTB 1YACA 2CSUA 1CF9A 3H17A 4AJ9A 1VDZA 2PMCA 3K1ZA 4FR0A 2WSSA 1OR8A 1F20A 1WY5A 4EY6A 2WJJA 3BK1A 1GU7A 1RKQA 5I60A 1U9IA 1DQYA 3M5PA 3HXLA 2QLJA 1HLGA 4LFBH 4BKMA 3G0GA 5AVWA 4M98A 4RKWA 2MCFA 3D4PA 1EFPB 3I5UA 1EINA 4W1PA 1SUIA 2CXSA 3LPNA 1B8NA 4IKOA 1IUNA 3GV8B 1XRSB 1PWHA 2UUAB 5KAPA 1KZ4A 4TXHA 4BP9A 2VPZA 1VE1A 2DLDA 3KL4A 1FSGA 3I4CA 2V7GA 5KFMA 4M99A 1RYZA 4X6LA 3R44A 4RKYA 2WIAA 4K6FA 4P2BA 4UBLA 2JH9A 1VIYA 3BUSA 4J43A 2CNKA 3WK6A 4QWDA 2P9TA 3ADCA 3VX3A 2F3TA 3G1WA 1DT5A 3ESYA 2VF7A 3M34A 3H9UA 2NU6A 3KZKA 4YASA 3VU3A 2VO1A 1RIIA 4F46A 3NHJA 3PW7A 2FUG6 3ADPA 4LZJA 3MQ4A 1PV1A 4WKGA 2DY1A 1MHPA 1G20A 2ZIFA 3E9MA 4HZUA 3CLVA 3EVTA 3A1DA 4DAEA 2PM8A 5G0WA 4ESOA 5CB6A 1ZC3A 3K6SA 5CFLA 3U9TA 4TMZA 1DC3A 2VQ3A 4PGMA 3KQHA 2Q3FA 4DR5H 1O6CA 2W2KB 4NX2A 3A58B 3ANYB 2JLQA 1M7BA 4NNJA 3QFFA 4GZ5A 3N43B 4NG4A 1D8TA 3H8JA 2QRMA 3ZCPA 2QZJA 1BDIA 3A9VA 3G1TA 1GPMA 4JUFA 3MSXA 5G4KA 2H48A 5B5SA 4X6XA 3SKXA 3IE1A 1VG8A 3GFQA 3MJRA 4APMA 4A91A 4EHJA 3KK0A 2XNHA 4JUAA 2WWWA 1OA0A 1NV9A 5DQIA 1J49A 5JSHA 3UZBA 3OZGA 3QQPA 4JBYA 4ZOLA 1JZTA 5BT9A 3TX6A 2CNQA 3FPEA 3T7IA 2ZXEA 3UJ3X 3P0EA 1VBFA 4MWSA 4PGHA 1UH5A 2VDVE 3TKAA 2PRYA 4IKEA 4BJ5A 3FCXA 2Q2VA 3IP3A 1S9FA 4EGAA 3BQ9A 721PA 4C08A 1IEWA 3WXMA 3G02A 3DC2A 1QVWA 2WIJA 3IILA 1JFSA 3RHFA 4DL4A 3H2KA 4EMUA 1KMNA 5E4FA 5EAIA 4YB8B 2PVPA 2ADOA 1PG0A 2DUNA 2PKQO 3UZUA 1QLHA 5HW0A 2P27A 1RYRA 4GLBA 2RGNC 2CLOB 1WCXA 4AJIA 1LQUA 1AV6A 3PGJA 5B58T 3DJFA 3OQOA 3WGUA 1ZN2A 4V38A 4KUGA 1WDLA 1R8XA 4I4CA 1UJBA 3Q40A 1EX6A 3GNQA 5K8IA 5A9SA 4U7WA 2BHLA 2Y1KA 5GINE 1EDEA 3ETEA 2YU9A 2IJGX 3BJZA 2WT4A 2QA5A 3TQOA 1JVSA 2JJ1A 2E85A 2HK6A 4LBZA 2R4UA 4TWIA 4YCNA 4LMAA 2AMVA 2Q0XA 2ZP1A 3A3PA 3PVCA 6REQA 1RI4A 3UMYA 1U2GC 4RQBA 2DQ4A 5IF9A 3ZK9A 4UAVA 2HQRA 2X7XA 1DKUA 4G5XA 3K5HA 2HA2A 3WHLA 4NU8X 2E1PA 5I7RA 3KSBC 2UU9B 5MN6A 1ZXXA 2BEUA 3GZNB 2ZYIA 5LMUB 4I50A 5FI1B 1VBMA 3PQCA 1G8SA 2VTBB 4CHIA 3OLVA 4YWHA 5KYWB 1AMOA 5B4VA 2SKDA 1OU0A 5KFXA 2PGNA 3A6PC 4L07A 4QUBA 3S2YA 1UCFA 1OLSB 1UWLA 3AZOA 3T4XA 1BYUA 3KJQA 4NCKA 1DBQA 4P33A 3MXTA 2ZDQA 1AK9A 2XE6A 5AVRA 5HIAA 4MITA 2GEBA 4WZZA 4E88A 2OV4A 2VPTA 3ZXYA 5ESDA 5K3CA 1LD3A 1OGYA 4K3UA 4AJLA 4DXAA 2WYWA 4MYTA 1IQUA 1E9FA 4ASUD 2WM3A 5KMGA 3MLBA 1FJGB 3AHGA 3RUCA 3ZQ6A 1ISIA 5FFMA 3CVWA 1ZUWA 5L7WA 1T8RA 4HNGA 3PPIA 3S3TA 2LR0A 5E2BA 5U9CA 1E2HA 2QE7D 1A7JA 1BD3A 1N5RA 2H4HA 5C81A 1DG1G 2RONA 2XOXA 3UAWA 3CUSA 1CE8B 1QV9A 4CEIA 2N0SA 3JQAB 3BACA 4JI3B 3DF9A 2R7MA 3J80A 1YAHA 3L41A 3TO5A 5ALYA 4MCAA 3TFWA 2GK7A 2AEFA 2AQHA 4XIGS 2OL4A 1TEZA 1PTKA 5TC4A 3SJ7A 2ZUUA 3OPQA 2DPLA 4QNRA 2P1RA 2GFIA 2WD7A 4LTNA 2WHPB 5BNWA 1XNRB 1CUZA 1FOEB 4O7WA 4W4TA 2GHTA 1BA2A 3VR2D 1W96A 4K9SA 4GC6A 2IHNA 3NUQA 1COWD 2O52A 3O2NA 2VT2A 1TEXA 4XGRA 3ROEA 1SHKA 4D3ZA 2MHCA 1LSSA 4ZQIA 2C2OA 1B2RA 2OT3B 4IYRA 3ENVA 1NC3A 1WA5A 5JXWA 5I9MA 1LC0A 1BFUA 3ZV6A 2A9JA 2BGKA 3W1VA 1N32H 1YDHA 3W9UA 2VKTA 1PU2A 4MRSA 4OX9H 3OOJA 2XUQA 4O4JA 3G68A 1G8JA 1J2RA 1M74A 1GN8A 3AJEA 2Y99A 3BDAA 3G8BA 4G01B 2F6RA 2X0SA 3KT3A 1L4GA 2EGUA 4OVKA 1G8HA 2QAGC 1CY1A 2C9OA 4DLZA 5DIZA 3T7JA 4MTDA 4D6XA 3JZIA 1W36B 3NC0C 1C8BA 2IKSA 1GZUA 4NE2A 2GXQA 4ZQEA 1FNDA 1HYEA 2PFKA 2HO4A 4TVOA 4GBMA 3RIXA 2ZAMA 1E20A 3DOOA 5A4MS 1A9PA 1PUJA 5IH7A 1GZ4A 2ZBEA 2KX7A 3T5GA 4L16A 5L40A 2NZ8A 3IAUA 3KJHA 2AMLA 3LKZA 3ZU6A 3TPFA 3H5AA 2IEAA 3BB3A 2PBZA 2JIBA 2FE3A 1X7XA 4FHCA 3BA1A 4UFNA 4E1AA 1UK6A 4JLMA 1KI4A 3NTUA 3FFBA 2E48A 3N2YA 3T4UA 4KDEA 3TOCA 3GV0A 1I1QB 2BAGA 1ZEMA 1A0OA 5GIPE 2VDOB 4YCAA 4GKKB 1U94A 1I0IA 2HUPA 3H6HA 1GFSA 3L05A 2AKYA 1I4DD 1EFTA 3VYRB 2BONA 1AGYA 3SHWA 5LBIA 3NAQA 1Q74A 3I58A 4C6HA 2O6HA 3GFFA 5E2AA 2VYQA 1CZRA 2MYPA 4PZDA 3RSSA 3S28A 4F2WA 4AF6A 1QK3A 1X1QA 1AK1A 5JS8A 4DBLC 2V6FA 3QVVA 3LFUA 4PZ8A 1QRTA 2DIKA 4IL5A 1YFKA 2I65A 2YKGA 1MJGM 2AXPA 1TZKA 3HY3A 3HVJA 4BC0A 3QIAA 2EJVA 3F6RA 4LJAA 4OQDA 3CJTA 4LX8A 3QU2A 3BMQA 4N5IX 4L3VA 4EL5A 1AB5A 3MTDA 1GADO 4JI6B 4Y2VA 3U31A 1QFYA 2A78A 4QUEA 1C81A 1GT91 2XGGA 2CDRA 3NWEA 3R5HA 3TKLA 3ELBA 3Q11A 2L0XA 2PYZA 3D0KA 3G17A 2ZJ1A 4AMVA 3KJZA 1LBQA 3OKPA 2P41A 1G3RA 1SVLA 1MT3A 4XCQA 2Y1EA 4KDFA 4R7ZA 4LYFA 4E2WA 3CH4B 3THOA 2F55A 3REGA 1CJMA 4EY7A 1QZTA 5FUQA 3B36A 3CLUC 3UHAA 1XTIA 3TOXA 3ROQA 4HUJA 3AW9A 1QQBA 1U63A 1KK0A 3O3NB 1F9AA 3WQBA 1RYMA 1BN7A 1ULHA 4ZCSA 5I3CA 4REQA 2NQ2C 5JLJA 3VDMA 3BMNA 4PPNA 2BTQB 2RH5A 3D2LA 3LOPA 3I39X 3WK4A 4MUNA 4R8UA 4O7ZA 4N82A 3RO7A 2LP4Y 1LBEA 3WLRA 5IDWA 1T0BA 1Z2OX 4UEKA 2IPAB 5L4LA 4RMNA 4UZFA 4U2FA 2O6LA 2G9UA 2C4MA 3H2BA 2HC9A 3SYRA 2CJPA 2GN4A 2C3MA 2OWDA 2BM0A 2EF1A 1XDWA 5ALJA 1C50A 3H3XA 3GDFA 4HBGA 2J5XA 5JH7A 3EF0A 5ADUS 1XF9A 2IPNA 3KD3A 3BA9A 3W8FA 3AESA 4CKWB 1NDUA 1NUQA 3B6ZA 1N1MA 5I7SA 1GGJA 3C7TA 3E7XA 3MS4A 1E9SA 4BMCA 2IUSA 3RCBA 1WQ1R 3PV0A 4DGSA 1C9KA 2FMKA 4KRFA 2HU2A 1Q0TA 3MYYA 1JL3A 3VZPA 4EO7A 1Y1PA 4BFZA 5CGZA 1M34E 1XDDA 4WZ6A 3CZAA 1SELA 4JZKA 4LZPA 2H11A 5REQB 2HRBA 4MW0A 3HOXG 3DLIA 2IU0A 3EVDA 3IAS6 1VL0A 4FN5A 1C30B 3IAXA 1ZNYA 2VQEH 3VNQA 1R6BX 4O4HF 2DTEA 3TM5A 4QUDA 1HDXA 2GTIA 4OSPA 4EG3A 1JT2A 2VHQA 2CVPA 1T3ZA 1OJLA 4RMJA 4HLQB 1MAVA 3C3JA 1H6DA 5BN4B 4LHEA 3R0VA 3NJRA 3JD2A 1MV5A 1VQ1A 3U60B 1JHMA 3OZSA 3N53A 3OOSA 4NIMA 3BAZA 2OG1A 3IELA 4LF9H 3TTSA 1NAIA 5ES4B 4NJOA 1QFZA 5CNJA 4WVFA 2GR9A 2HRRA 2F4VH 4ED6A 4R1TA 2A94A 3EDCA 2HHCA 5FBHA 2HTEA 4R0NA 4GZMA 5EIEA 3Q88A 4J4HA 1EVQA 5IVPA 5GJBA 3KQKA 1CZNA 3GUUA 2GN1A 2YASA 3D8UA 5AT1A 2FZCA 5EGSA 2QN3A 1I0LA 2DUWA 5EJAA 4TKVB 4UHFA 1N5KA 4OD0A 1DQSA 1X39A 4KQ6A 3JWEA 4BCDA 3IUYA 2FN7A 2CEAA 2W43A 1AMNA 4IGEA 3CLSD 4RCYA 4FE4A 1Q2XA 2VH2A 2R5FA 2I2DA 3KXYT 4X5OA 1N2BA 2IBSA 3W8RA 4ENVA 3OQMA 1XDNA 2EBHX 3KJNA 3WA6A 4DQ0A 2HIHA 4B3RH 1Y4SA 3GDGA 3FVVA 3U9SA 1PWEA 2VLBA 4ZT5A 3LF2A 6AT1A 4GVPA 3GFGA 2AQ8A 1XD2A 1HOTA 1XMOB 5JU6A 1FMFA 1N77A 4A6XA 1Z88A 5B3KA 2NT3A 2M9MA 4YR3A 3F2VA 1LPNA 4URZR 3DTVD 4MW7A 4ZEVA 4BNHA 3LYLA 4UCXA 4PXSA 4A8TA 5DGCA 4BLTA 2OQ2A 3LK6A 3F46A 1S1CA 4CMAA 3R8CA 2A33A 4MMXB 3FGPA 3T1NA 1I32A 5CB8A 5CR5A 3CNOA 5L1IA 1A04A 1T9KA 3QFCA 3PQEA 4KR2A 4MCJA 5TPWA 5F98A 3AWIA 2Q62A 4R40A 4B82A 2C31A 5DAAA 4R2MA 1WHTB 2HCJB 3EGIA 4FFSA 4JYAH 1B3RA 4Y1RB 2EX0A 1ESDA 1V3UA 1KAHA 3HABA 5HE9A 3EAQA 4B2PA 5H3HA 2FFAA 5B1SA 1IE3A 1BO6A 4MI1A 1T9GS 3R5TA 3EDQA 2GOYA 3BTOA 5IX8A 4IIBA 3NV9A 4WBSA 1F0NA 2JZNA 2QLLA 3C2QA 1PR5A 5AJZA 1REQA 3EIWA 4S1TA 2G82A 3IAFA 1FJHA 1P0MA 4RSMA 3NH9A 4RPIA 4DLYA 2PG3A 2H2HA 4HUQB 4UQOA 3QZ7A 5IARA 4EQ5A 3H2ZA 4A6EA 3SVZA 4PIMA 2R62A 1B6TA 1JU4A 2XCAA 2B36A 1XZCA 3CTPA 1TJNA 4I7EA 4JHLA 1K4MA 2E6KA 2WR8A 2PKWA 1QZUA 4EW3A 4ZRMA 1PNQA 4EJ6A 3O4IA 1VKZA 1O6GA 3GXOA 2D6FA 3LHDA 2J0EA 4CQLB 2X1LA 3PI7A 3GRAA 3R3JA 5K4HA 4II3A 1E9AA 5JS6A 2Z3ZA 1F8FA 3PKIA 4G0XA 2Q6OA 4HDMA 3S70A 3AV3A 1JHRA 2XUFA 3IB3A 2W22A 5ALWA 2VUTA 4RFVA 4EUEA 2EGHA 5KHOC 3DAAA 4HWKA 2W6OA 3X1YA 4W8OA 2RFLA 2B6HA 1TO2E 4BNGA 2GAFA 1DQRA 4IDBA 4PQGA 3I9LA 5IHXA 2PZEA 2E1RA 4OGFA 1V43A 4WFJA 2O8BA 5A71A 4CCYB 2VHEA 1JVNA 1XZMA 4Z9BA 2O3RA 1J2JA 1Y8QA 4OBWA 1HI9A 5H81A 5CXUA 1UP7A 2C5SA 3I3SR 4DVGA 1GG5A 1GCAA 2GSWA 3EUFA 3WMEA 4JOQA 1D4OA 1I5RA 4Q7QA 3NGLA 1P0FA 4LFCB 2WFMA 1MOPA 4YRMA 4Q3LA 2WAYA 4UDYX 4JC4A 4CF4A 3PD0A 4XJVA 2ADFA 4MX8A 4IICA 4UC0A 2FW6A 4Z6KA 4KYVA 3PE4A 1YL5A 3P9PA 3ZHTA 1QCYA 5KTPA 5A06A 5L3VA 3ZTTA 1M6WA 2E5LB 3CRVA 4JCOA 4D9MA 4V0SA 3DLCA 1IBMB 1N25A 2WYHA 3NMUF 3CNEA 4HN2A 2VTVA 4G4IA 1M1YB 2ZRJA 2EWMA 2QGNA 1QE5A 3ABRB 3HHPA 3SI7A 2IMWP 2QENA 2RGDA 4OHUA 3SF8A 3HR7A 1XLWA 3FH0A 3A05A 2E2IA 3EDOA 5F2KA 4CMIB 3HU5A 3AZPA 3W79A 4QM7A 5CLFA 2CE7A 3G49A 1XZEA 5E7IA 2YWVA 4LQLA 2IU6A 2PRKA 1FP2A 4KUEA 2I29A 3RYHA 4BVEA 3AFGA 2DFTA 4GSKA 3LHSA 3N8HA 3U7QA 1W2WB 1I6WA 5DT9A 3ZG6A 3K0HA 3O6VA 5EJ6A 1U2RA 3AEXA 1PV2A 2FAXA 4H1UA 2O48X 3AF5A 2GZRA 2FZLA 4CV3A 4PG8A 1EM6A 4AP6A 3FYUC 4KRXA 1A2KC 3X1DA 2NU7A 4I1SA 5HJEA 3R77A 3SBDA 1DO2A 1OZHA 3NVDA 4OHPA 3ENKA 4Y9UA 1QR6A 3E5MA 4B2IA 4LQDA 2V4QA 2FPSA 4BO2A 3A6HA 4IINA 1QLJA 1KZHA 3V2GA 4FMDB 4BNXA 3EJWA 1E1YA 1JA0A 3HMQA 4UM8B 4I3HA 1EX9A 4BKQA 5KO2A 4HLDA 1JFTA 1VA4A 2JL1A 2PMBA 2ZBVA 1VMIA 5AXAA 3ESDA 3VHQA 1CUIA 1VBNA 2WHQA 5F3RA 1MABA 4FE7A 4OY3A 1GZ5A 4MVJA 3FIUA 3UMVA 1JQDA 3ZBUA 5I5WA 4X66B 2FR8A 1X9GA 2ZGVA 3KWLA 6YASA 4TWBA 4IJUA 3AQ4A 4RVHA 1KHTA 4XVUA 3IESA 3CLKA 4EAAA 2CV1A 2XF8A 2ZM5A 2QN6A 3WNQA 2P9QA 3W5CA 2E4UA 3CZCA 1DAAA 4XX0A 5D51S 4DXDA 5D00A 1S2LA 3D1VA 3CEMA 5HFNA 4L8FA 3BWDD 4WRRA 5LU8A 2YXPX 1CEYA 4L8WB 4DWOA 1V0JA 1JEEA 3L7OA 1NLYA 2QMOA 4FYHA 1ABEA 3S44A 4YCSA 1G38A 3ZV5A 2OC4A 3KQOA 1ZQ1A 5LD2C 3TLZA 1PGOA 3I8OA 4JVMA 2PWPA 2DCMA 1PJ2A 1SUAA 3FMPB 4M1TA 2PAAA 1R00A 3QVGA 4GPD1 1EVKA 4BVKA 1Y3BE 2LXNA 5EN4A 2Z8XA 3H0GG 3SS8A 1Z4OA 3EH1A 4OXYA 3ROPA 3NGMA 1KERA 4U7TB 4FKZA 2F2TA 1CUXA 1OTXA 1FP1D 5HJ7A 4OHBA 2Q8PA 5EERA 3FYSA 4A3MG 4HNAB 3EY9A 1M5UA 3ESCA 1UBLS 4Q16A 4PHFA 1XK6A 3EZYA 2GETA 3A10A 4Q5IA 3A4VA 4WDRA 3G8AA 1AXEA 2I87A 1ODFA 2HWXA 2PSSA 4JV1A 1XT6A 2ZS7A 2PLRA 3A1SA 1JIXA 2EDCA 4Q4AA 1N6KA 3EGCA 1D5WA 3R3XA 4YBZA 1XCJA 1U8AA 4KKVA 1LBIA 3W4IA 3FWPA 5C37A 2E4XA 2JGNA 1E2LA 1V6AA 3OKAA 4ACAA 1YHYA 5BW8A 1YF3A 1KO4A 4N40A 3PRJA 3KQMA 4B83A 1XEXB 1ZQ9A 3RC7A 2W58A 1RJ9B 5DLDA 2QR2A 1XXHB 2HL6A 3P32A 5AW4A 5JAMA 4JYCA 3CPSA 5FA6A 3L93A 1FQWA 3AQIA 2VJMB 1XRLA 4B80A 3HWRA 1LA2A 4QXOA 2Z58A 2QUJA 4E07A 1NN0A 3C41J 3JVEA 1AV7A 3F6PA 3Q0TA 4I6GA 1A95A 4O2LA 5A0FA 2H0QA 5EJ9A 2AVDA 2GPNA 5ICEA 2JDIA 5FUBA 1NNI1 1HR0B 1LB1B 1MP0A 2I7XA 4D2IA 3B5JA 3JAWB 2ZTUA 4CLXA 3DZGA 3LAWA 3QPDA 3GLSA 4A2AA 3QU7A 1HL3A 3E5RA 2ES4A 4OK3A 3IA2A 3NHLA 3WLTA 4RPJA 3ISJA 2RH4A 4RFLA 2RIRA 5A3SA 1H5NA 3B1WA 4PSAA 2QAJA 3STTA 3FR7A 2EEPA 4IOKA 5IYZA 1V9CA 3D4LA 3HKZA 1OFHA 3CH5A 2R44A 5K0NA 1SRRA 3G6KA 1MH9A 4DL7A 4ZAXA 5LLDA 3MJSA 3WGTA 2Q9UA 2OZKA 1DTWB 2I4NA 1JA9A 4R8KA 4QDZA 4Y9RA 5EMKA 4IX1A 2N3ZA 4FR5A 5BORA 5CW2A 5KG1A 1B8PA 1M75A 4B44A 4YDQA 4HGZA 3HU2A 5DG7A 4MUKA 5IJ0B 2PQ0A 4HLCA 5C46F 2PPLA 4IFEA 4I14A 1EVLA 3OU7A 1KYIA 5CVDA 1BKYA 1G6Q1 1US8A 2CLCX 1EHIA 3HZZA 4BGDA 4BY7G 2B7CA 5C52B 1NT4A 3LRTA 3F5QA 1LBSA 2O1XA 4F1WA 2ZZMA 2OV6A 2ZJYA 2FKNA 5C3EG 4KQEA 4OUDB 4FGSA 3SC4A 1P60A 2XOEA 1N78A 3BFVA 4N54A 2XCPA 2CUNA 2JCVA 4F45A 1I9CA 4NMLA 1DMRA 2FFRA 4R2KA 5KWIA 1ID8A 2YYAA 3DFZA 2B82A 4Q9DA 1TQHA 1XVLA 4BEJA 3RS5A 3MPOA 1XU9A 2Q2NA 3MWLA 1ZUNB 5CK5A 2BGWA 4C0XA 3CE6A 3PT5A 4KGXA 3FNEA 5ADVA 5LB2A 5BSWA 2FXIA 4YAUA 3G6XA 2VDQB 3KX2A 3QSGA 2ZPTX 2AI3A 4I55F 1PFGA 1KQNA 3OVMA 4DLKA 4ZALA 4HD8A 2R47A 4LYAA 3TQHA 3FDXA 3ECSA 3DVQX 1M66A 2Q8QA 1WEKA 3Q3VA 1CLEA 3ELYA 2ATCA 1YB7A 3KZXA 2XZOA 1T2AA 5ICSA 4AIIA 2I67A 1C8KA 2ZRFA 4DMFA 1PQYA 1U2DC 1A9YA 3RIMA 3A4IA 1P7ZA 2G72A 1G42A 2VN8A 1EE1A 1E2GA 1U65A 4EJSA 5T4FA 3HK2A 3U4MA 4P98A 3UK6A 3EGDB 4KAFA 3HVUA 3LGSA 1P5HA 1HYBA 1UOEA 2PUJA 3C3AA 4NZPA 1TUBB 3HTXA 2JBHA 1P5ZB 3G7NA 4RVNA 1A0GA 3ODPA 5FBWB 4B3HA 1KE2A 2AEEA 1YDFA 2PT5A 3EXEA 5EUBA 2XLBA 5DI3A 4HZIA 1FIUA 5P21A 4BWVA 1LWNA 4HTAA 4LWQA 4U6QA 1DO0A 2HEIA 3R9IA 4EH1A 3G5TA 2P2ZA 4JJFA 1M2OA 1XRRA 5FLYA 2HADA 3EVZA 1QORA 3GB9A 3DUWA 2BEWB 2HGSA 1F8YA 5IBQA 4QM6A 5TT1A 1A4UA 3SNHA 1B42A 5EIBD 4P5EA 3R0QA 1X8XA 3TK1A 3O2QB 2C2WA 1IXKA 5FOQA 4X95A 1BGXT 1Z0DA 4D82A 3QNWA 1RD4A 4ZYWA 4JEHA 1ZL2A 1KZ9A 1P8JA 4KFRA 1WXWA 3B7PA 2C35B 4XGNA 1ZEJA 2NMVA 4YX9A 2V7VA 2YWBA 4EARA 3AB7A 4KW7A 4MUXA 2G88A 1PIWA 1JLLB 2HIVA 2QMZA 5BV2P 1KARA 3JARB 2MINB 2B61A 1P1CA 3ZY4A 1FXWA 4X7RA 2IH2A 4K0KH 4A82A 1KDVA 1Z7YA 3PUKA 1FU8A 3L43A 1N7IA 1TGVA 1DJPA 5JD6A 5HKKA 2EBUA 3FOAA 2ZRBA 2ZIAA 1WMBA 5C5JA 4ADSG 2XMQA 3UB3A 4CM9A 2BDUA 3HGTA 5YASA 1MNAA 4I99A 4R84A 1MQSA 1NVTA 2REXB 3MIZA 3I37X 4MW4A 4UCFA 2FZWA 4ZMSA 3L07A 2X0FA 2XB2A 4ED1A 3KT6A 5BXYA 3K0KA 3C7DB 4Q9AA 4O29A 1UJ2A 2VYVD 4CC5A 3ODGA 4PLGA 4L85A 3BWMA 1Y4UA 3CF0A 4DJDC 2QM0A 4EVSA 1DV2A 3LC7O 1W0CA 4C2AA 3EDRA 4WD3A 1QHFA 1SG6A 1MB2A 2GJAA 4UCUA 3DW3X 1W88B 2C3YA 5FBZA 1HX7A 2BDTA 1JWBB 2WYOA 4TVSA 5HCUA 4CL8A 5BPHA 3PC3A 5L51A 2IEIA 1QTNA 2ZYDA 4L5CA 3M1LA 1VE5A 4G56A 4OLJA 1ULSA 4RTQA 1WKBA 5AD1A 4A36A 5DYYA 2LGJA 1OBVA 5LB4A 4YAWA 3BSFA 5JMTA 1E3TA 3B12A 1YTLA 5C8XA 2ZRLA 3ICPA 4TTRA 2GPTA 3HL0A 3ZWXA 3PRKE 1NHGA 4M37A 1VFPA 4GPAA 1I4WA 1OI3A 5CCEA 3HO6A 2FG6C 3ZJ4A 4QPZA 4E0BA 2H2GA 3G8YA 3BXOA 2DGDA 2HB6A 2CHFA 1SBIA 2WILA 2VQ6A 4Z2AA 1AIPA 3MWMA 5AMXA 3IJEB 5EFOA 4PQEA 1QTQA 1KF0A 4ZQFA 5IMBA 2WB1A 5JD5A 3DDSA 1TPZA 4DYVA 1DRVA 1HSZA 4GRDA 4IJMA 4ZAYA 2QW1A 5LJLA 3RIEA 2EJCA 2YXNA 4CPDA 2DZDA 2HI0A 2YWRA 2WUDA 4YH1A 3W1GA 4O3NA 2WEKA 3B82A 1FA9A 4RZIA 2QRKA 2FFHA 1RM0A 1JG1A 2AR9A 2NU6B 4TLAA 4TV8A 1PGPA 1H0RA 1IZ8A 4J07A 1N4DA 1QE0A 5KDDA 5AW5A 2ZPUA 4IS2A 1P44A 3FRJA 1LK0A 3K6SB 5E9AA 1NXVA 4C0KA 3ZWPA 4BZWA 4IJ5A 4WECA 4WLEA 1OC4A 5KTOA 4IZOA 4XRRA 4Y1GA 1UWKA 1UPTA 2X1MA 3AF0A 2GO7A 5D3MA 2MYTA 4CHGA 3LFHA 3KTOA 3DEYX 4KTVE 3KDPA 2O54A 3VDXA 1V25A 4L57A 3PSAA 4DJ5X 3R7BA 1SG0A 4UARA 1SBCA 1N2GA 2QU7A 4HQ0A 4F93B 1ESEA 1N92A 4F7WA 2P2GA 3DMYA 1CDOA 2D1YA 1RAHA 4UUBA 3ITNA 4ZOLB 4JL5A 4YRRA 4JSYA 3U19A 4NKRA 2YZLA 4LXUA 5I4IA 1ECFA 2O2GA 3NHFA 3P2KA 5JLAA 4HGQA 1A1VA 2J9YB 4LUCA 1P16A 3MTEA 1EEHA 3AOGA 3BWYA 1E2BA 3HB7A 2Z57A 1LZLA 1UKAA 1HDIA 5LL6b 1DSSG 1KOLA 3ELWA 1JR2A 4C9BA 2HVQA 4Q3AA 3CPEA 4BP1A 2QTNA 1Q7BA 1AK2A 3HQ4O 4V0LA 4WLVA 1NL3A 1FJ2A 3TG8A 3C8MA 4ZO8A 1XXHE 1L2TA 2JEFA 5AICA 2D7CA 3IIIA 3U4IA 2XWQA 4EF6A 3HE3A 4BRSA 4NFSA 1CD5A 4ZWNA 4S1NA 4G3IA 1JF8A 2AK3A 1E7RA 1P81A 5KOJB 2GCNA 5DHQA 3OEHA 5DW0A 5KFKA 4XOIA 1T0PA 5L1KA 2IYPA 2NSYA 1O9BA 4XIJA 4I4LA 1MO5A 2AUMA 3WSTA 4YREA 1MB4A 4IUCS 3VKWA 1ULZA 1I6MA 1X1BA 5HCIA 2DBQA 2EXXA 5F9NA 6REQB 1A5SB 3L8HA 1RQGA 5BMVF 1KQOA 3H4VA 3A4YA 2R8PA 4MUAA 2RC6A 3PTAA 1G5PA 3UJ9A 4BO6A 2BEUB 4KNYA 5B30A 4KUHA 3KHGA 2ZIVB 1PVDA 4Z51A 3FTCA 4I50B 3FHTA 5JPIA 1EXMA 1UWCA 1TB4A 3LUJA 2GEFA 2HLDA 4D97A 3GQCA 1NYRA 2DQZA 3U5ZB 4HOYA 4H3HB 4KQFA 2WJ6A 1T4BA 4E15A 1CNFA 3UK7A 5A7HA 4Q1VA 4NMMA 3R7LA 3BVPA 2UZ4A 2RE8A 4PC1A 3BRSA 2ZJ4A 4DMKA 2CD9A 4YQZA 4QYMA 1X80B 1DBPA 2H2FA 1CKMA 4M3NA 2JAXA 4LF4H 3N05A 3GVHA 5D1HA 1G41A 4K6KA 5B3JC 1U80A 5K1ZA 4C4OA 2JFPA 3Q5GA 4BATA 1HXHA 3ZXIA 4HSEA 2CMHA 2D5AA 5C4XG 1S68A 2PEZA 3USCS 1Y1SA 1Q6YA 3OUUA 1RPAA 2C9YA 3CF2A 5KMGB 1EWYA 3A0UA 3WP0A 3D4OA 4E21A 3M6VA 2E2WA 2PVSA 1XTRA 5SY4A 2BUAA 2LCFA 4HXEB 3UFXA 2VJAA 5EE1A 5AUQA 3VXKA 3FHOA 2IUTA 4J76A 4EB6A 1P7YA 3IR5A 1X86B 3EF3A 2XYRA 1LVUA 4OIFA 4G67A 2C78A 1K88A 2IZ6A 3WGHA 4ZJZA 3PUVA 2XNKA 2GAIA 5FWXA 1PZXA 2P65A 5FEUA 3GCWA 2JANA 4X91A 3C4QA 4XLTA 5JV5A 3DNPA 5JALA 3RFTA 4CEIB 4KL8S 1M2GA 4Q3DA 2MR6A 5HQ3A 5E6UB 3AY3A 3CX4A 5L7TA 4EF5A 1Y6FA 4RNOA 3MAGA 4GEGA 1M6HA 2C2MA 1E3EA 2HIGA 3Q3CA 3FJYA 1BS2A 3BIOA 4O3RA 3DQQA 2WD7B 2J9FA 4X44A 4DNQA 5CG2A 1WV1A 3QI7A 3FYHA 1TZBA 4PPYA 3DZHA 5KVVA 4Q93A 2A14A 4LHWA 1KFJB 1U9JA 3K9QO 4Q15A 3HDGA 1OXTA 2AJ8A 2W37A 3L6CA 3C6KA 1AS3A 1B6SA 4P7FA 3QLVC 4K87A 5C18A 2FR1A 2EJ2A 2FLKA 1GFIA 4QODA 4D9EA 3ZLBA 4CVNA 4ZOAA 4X97A 3ND9A 1GRQA 4I4TF 1Z12A 2ZAGA 1YB1A 1ZVJA 5K3BA 1BN6A 3QLUA 3OTOB 4NK4A 1YKGA 3M6LA 1HT1E 1CYDA 2BR5A 1FX1A 2H6EA 4IQFA 1L5ZA 3B3AA 4ABTA 2K7FA 2IUUA 4B4UA 3C6BA 1BROA 3VU9A 1NQAO 4B3SH 4P38A 4P3XA 1BE8A 2C07A 5A4IS 3H4MA 3KRTA 4H3KB 2BMEA 4RTPA 1I1KA 1KGSA 4E6PA 3NTXA 2OAGA 3ACBA 4C30A 4Q3KA 1C0IA 5IJ9A 3ZNPA 1S7GA 2SECE 4MR7A 1QV7A 3V1NA 1RQNA 3AFNA 1E4EA 1E1DA 2YZKA 3TRKA 1NIJA 2V6JA 2GZ1A 3IQIX 4HRYA 3CRW1 1X1SA 2J45A 2XT9A 4Z8XA 4JJ4A 3PUHA 4BQRA 2GHRA 3A4NA 3GPCA 4ZGGA 3HV2A 1V37A 2IHJA 2GCIA 2PHZA 4JZYA 1KORA 2YV5A 3D2BA 3RC2A 2FDXA 1XQYA 4GYYA 1OX4A 1A4IA 4RWEA 2WJGA 3OFND 4QQKA 2PMWB 3OQ6A 3QVMA 2NO6A 3A9WA 2V45A 2P9CA 2O2SA 3C1AA 4YQEA 4D9BA 1D07A 2NUPA 2CNOA 2OFOA 4W7SA 4N5HX 4RPHA 5CTAA 5I7EA 4UREA 3RKUA 2BZ1A 3VO1A 3E9EA 1JE1A 1G3QA 1D1QA 1W87A 2QMYA 3UUGA 5FNVF 1ECCA 3IUBA 3PEYA 3ZGVA 5IKMA 5AVYA 4RTJA 5FFNA 2QD1A 3N44B 4J16A 2P6PA 4MQEA 5FIUA 2NXCA 3ZWQA 2P78A 1CUJA 5BR1A 3QMWA 3IHWA 1TLTA 2I9KA 1D0IA 5DMHA 2XA1A 1W4RA 2A0XA 4F8YA 5ERXA 2P0AA 2W6NA 1FMCA 1IB0A 4TT3D 2C5FA 3S40A 1ISGA 4B3JA 5TMPA 4EKGA 3CJRA 4JBXA 1YJQA 3SMVA 4YJ2A 4QUGA 3GGPA 4S35A 4W8GA 2AG6A 4WLOA 4G1MB 2C22A 4DV0B 3GQBA 1KAMA 4CDGA 4YJFA 2Q7OE 2M6RA 1T3HA 3GUVA 4MEJA 1DC7A 4CR7A 3GLTA 3UK2A 1YQGA 4WH0A 1RWOA 2O7RA 5AVXA 3IDFA 1JEYA 4S1PA 2JFBA 4JLBA 1Q0PA 5AKJA 4BGVA 1OLOA 3D9QX 4IDEA 1QP7A 3KZNA 5KTKA 3FFWA 1SCJA 5HF9A 1RRGA 3CUVA 5ECDA 3EWSA 3W6NA 1H4SA 3HEAA 2VA9A 4C4PA 5CTJA 2FSIA 4IILA 1AXRA 3EG5A 3LQ1A