2GLTA

Structure of escherichia coli glutathione synthetase at ph 6.0.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
316
structure length
296
Chain Sequence
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthesis, ligase
molecule keywords GLUTATHIONE BIOSYNTHETIC LIGASE
publication title Crystal structure of glutathione synthetase at optimal pH: domain architecture and structural similarity with other proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 100
structure length 296
sequence length 316
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2gltA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2gltA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gltA01
5BMVF 1GSOA 1I7NA 4ZQIA 2YRXA 3GLKA 1M6VA 4YBZB 4EG0A 3G8CA 4O7RA 2R7KA 3HBLA 4O2BF 4YJ3F 2W6ZA 4O81A 2W6QA 3TQTA 4XZ3B 2V58A 4FFPA 4XYLB 3OUZA 4MA5A 3BG5A 5LP6F 3N8DA 1EUDB 3Q2OA 4I55F 5HBRB 1GGOA 4WD3A 2GLTA 5CB4F 3GIDA 4IHJF 4O86A 4EGQA 4XX0B 4EA9A 2DLNA 4RZQA 3TIGA 2VR1A 4IIJF 1B6SA 4O7LA 2QF7A 5KKNB 1Z2OX 1PK8A 4NYEA 1EUCB 2NUAB 3HO8A 3AX6A 5C1OA 5LXTF 2C00A 3RUPA 2R86A 3OUUA 2Z02A 1GLVA 4EGJA 2SCUB 2W6MA 2R6FA 3ETJA 5EZYF 3NUAA 4C5CA 2YL2A 3K5HA 1AUXA 2GQSA 4MV1A 3V4SA 4FFLA 2GQRA 3JZFA 2W70A 1JKJB 2ZDQA 1WR2A 1BNCA 4IWXA 3BFPA 3MWEA 3TINA 2PBZA 5LYJF 5BPFA 4C5BA 2FP4B 4FFMA 4M9CA 4EABA 2J9GA 2XCLA 5JQWA 2FPPB 5LOVF 2YYAA 5CA0F 4O7VA 2R7MA 4TV8F 5J2TF 1KJQA 1JLLB 3VPBA 3HB9A 4FU0A 4O4LF 3KALA 3N6RA 4M98A 5HV6A 3VPDA 4XYMB 4YAJB 3KREA 4L1KA 4FFNA 2I87A 4Y8VB 4DIMA 1AUVA 2YZMA 5LA6F 4O4JF 1IOWA 2WYOA 4HQ6A 1JDBB 4MV9A 1OBGA 5JQGF 4DLKA 2YRWA 4O7TA 4O7WA 5I47A 2Z04A 3VOTA 2I8CA 4YB8B 2VHEA 3K5IA 3U9TA 2R7NA 1DV2A 2NU8B 5BPHA 1KEEA 3U55A 2OLSA 2NPOA 4O83A 4ZI7F 4O7ZA 1UC9A 1B6RA 2V59A 2R82A 3JZIA 4O84A 4HNTA 1I7LA 5JH7F 3VA7A 3MWDA 3U9SA 1ULZA 3LP8A 3BSYA 1Z2PX 4ZOLF 4C5AA 3R23A 3WNZA 4ZHQF 2R7LA 4MV6A 4EA8A 3SE7A 2R87A 4GGMX 5JVDF 3VPCA 3KAKA 1W96A 5C1PA 1GSAA 1W93A 1SCUB 1M0WA 2VQDA 3RFCA 2CZGA 1IOVA 1CQIB 3ETHA 4FFRA 2GPSA 2NU9B 4FE2A 2ZDHA 1C3OA 2R85A 3JRWA 1VBGA 2NU7B 2YZGA 1UC8A 1C30A 2YS6A 1A9XA 2HGSA 1KBLA 4M9UA 4O2AF 2CNUA 5C8YF 3TIIA 3G8DA 3DF7A 4MV4A 2FPGB 3VMMA 2YW2A 3QFFA 3ORRA 1DIKA 1DV1A 3BSWA 5KX5F 1VBHA 2YZNA 1KJJA 2YWVA 3ORQA 3MJFA 4FFOA 2IP4A 5H80A 3WO0A 4MA0A 4I4TF 2NU6B 2W71A 4FGRA 4J6EA 4O82A 4O4IF 1CQJB 3AW8A 5D8DA 2ZDGA 3Q1KA 4HNUA 2W6PA 2P0AA 1CE8A 2I80A 1E4EB 2DZDA 4O7YA 2HJWA 3R5XA 1T36A 4EA7A 1Z2NX 3TW6A 1GSHA 2QK4A 3R5HA 4HR7A 4WBNF 1M0TA 5K2MA 3JRXA 1KJ8A 4TUYF 1EHIA 2VPQA 4MV7A 4IZOA 2XD4A 4I50F 3I12A 5CAEB 1EZ1A 3UFXB 5GONF 3WO1A 1KC7A 5JVLA 4O7SA 2CQYA 3RV3A 1CS0A 5J2UF 4E4TA 1BXRA 2PN1A 1KJIA 3KAJA 2DIKA 4YJ2F 4TV9F 1EYZA 2R84A 5CA1F 1VKZA 2CNQA 2FB9A 4MAMA 2FPIB 3RV4A 1JDEA 4M99A 4O7NA 3BSSA 3LWBA 3K3PA 2GPWA 4IWYA 4MV8A 1A48A 5FNVF 1OBDA 3R9RA 2DWCA 1KJ9A 4MV3A 4HNVA 2W6NA 3V4ZA 4YAKB 3R5FA 4O4HF 4ME6A 2W6OA 4QSHA 3U54A 2YZLA 3E5NA 5DMXA 4EAAA 2CNVA 1PX2A 5IYZF 1KUTA 1E4EA 2X0SA 2PVPA 2YS7A 2V5AA
chains in the Genus database with same CATH superfamily
4GP9A 4B7CA 1XVIA 5H4HA 2XUQA 4CM4B 3O94A 1JFSA 5A0VA 3PDIB 3K0AA 1OX5A 2PJUA 3GP8A 1P0IA 1JX6A 3VNBA 1VE1A 2FFAA 4G0ZA 3RE1A 3SBOA 3FGZA 4EGSA 4Q82A 1AY0A 3J7AK 1I4LD 1F4VA 2G08A 1ZVKA 4OK6A 2KHZA 3U62A 4BTLA 2X7HA 2W8ZA 2WNSA 4WZAA 2FOXA 2VTKA 4OX9H 3IAFA 3FG9A 2PL1A 3OEEA 3RIXA 1EKXA 4LOAA 3DEIA 3MGBA 1DXHA 2PL3A 2V9ZA 3GMIA 1EKPA 2JCSA 4HNAB 3T3HA 2OENG 2B69A 4GYYA 3Q2IA 2G1UA 1KVTA 2PMZE 3GTMA 2QVXX 3G2KA 4ODIA 1NSTA 3PFCA 2GEBA 3BERA 4KYTA 4G5QA 2O8EA 2A33A 1QGUA 1RM0A 3O4JA 3ZLTA 2XXAB 1I1MA 1TAHA 1MNQA 3U26A 4QKQA 1ECJA 3ROZA 1XJWA 2C8JA 1XN1A 3PNOA 1RI1A 1SB9A 3TOVA 1A0OA 3H97A 4WCVA 4KOAA 3GLTA 1DBQA 1YK1A 1ZJWA 1Q17A 1GU7A 1UPUA 4X7MA 2WKPA 9GPBA 1F9AA 2GKSA 3PFNA 1OXBB 3B3FA 1H2HA 1NVKA 3QUSA 1I1HA 5KNLA 5BR4A 1VB5A 3SAJA 5I4IA 3L6RA 4LE0A 1RFLA 1S3GA 2OSBA 4M21A 2XWJI 2F7SA 3WWCA 2JI9A 2QRMA 5KT3A 4OBBA 4LH6A 2NPOA 2Q0SA 2XQJA 4BASA 1P0FA 1LLDA 4O3SA 4HNTA 1ESZA 1OGIA 1G2QA 2F8LA 1H0HA 2WG1A 3DKPA 1SKYE 1AKQA 2CCJA 3KL4A 4ACBA 4NXMB 4B3SH 5JD5A 2A1IA 4P4TA 2WJWA 3ANSA 4KO4S 1B7GO 4LX8A 2B63G 1GZ5A 1M0WA 1HE8B 1HE2A 4QARA 4QJ3A 1NWHA 5AI5A 3CO0S 4D9KA 1YO6A 3E7DA 5HA5A 4MDFA 4ESVA 3U80A 2R4UA 1UP6A 3QXHA 5C3MA 2C28A 2FW0A 2CMDA 4WBSA 2VJMA 5JBQA 1M2OB 1D0SA 1VXRA 4UM5A 3T5MA 2W43A 3A26A 3R09A 1LEHA 2H5LA 4BQOA 4JXJA 2NU8A 5LIRA 1LNSA 4JT2A 1AX9A 1FFHA 3MB5A 2V3VA 3WDKA 3DTFA 3HWWA 1IYZA 4IPTA 2CUTA 4BO3A 2WQZA 1WW2A 4Y2SA 2YUTA 2O54A 3F71A 3ZDFA 5DN6A 5BVHB 4XVRA 3W4JA 4ZVLA 4IUBS 3MFHA 1E1KA 4BO6A 4WBNF 1ISJA 5DBHX 1NM5A 2HREA 2OQ2A 4JJIA 3ZVRA 1WBDA 3JVIA 2IXBA 5FWDA 3UK1A 1EUQA 4TTVA 5KJ6A 4R2KA 1G2PA 3A7EA 1U0FA 4EJ0A 3P19A 1Q16A 3H86A 4TWRA 3SYKA 1Z6GA 4P08A 4PN7A 2XBMA 3L07A 4NBSA 4C6HA 4RUKA 1N5KA 1K27A 1ISGA 4PF1A 4J0CA 4WNIA 3EZ2A 5JAHA 4H3VA 2GPWA 1YJBA 1GGMA 1SC6A 4ZI7A 4RK0A 4ZDKA 1H22A 4MV3A 4JJGA 4C14A 2QSUA 1ZHOA 3B13B 1VZ3A 1LPMA 1SCIA 1IBKH 5J40A 3W5SA 1WMAA 3TIFA 1DCMA 1PZNA 3MUOA 2Y1EA 4AN0A 1RYDA 3D6JA 2ZI9A 1VCIA 4DQLA 4JNKA 2WB1A 5JD4A 4URHA 3H4DA 3UT0A 4DHEA 5LP6F 4UCXA 5G3YA 5ALSA 4OAOA 4KL8S 2WUVA 3D43A 2EFEB 2VCHA 3E81A 2MINB 4ML3A 1QPBA 3Q87B 1CK4A 4OXQA 1EDOA 1HLDA 1PEYA 2GFQA 4PCUA 4MYTA 3KPUA 1SCAA 5IVHA 1DQSA 1HYGA 3TH5A 1ZMXA 1BYIA 5G53C 1DAEA 3KT0A 3RJZA 2R92A 3V48A 1E3MA 1A7KA 1X94A 3BDIA 4Q3CA 3QLEA 4FE3A 4FILA 4M7RA 3OPQA 4TTTS 4MR8B 3AQ4A 5DP1A 1SVSA 3WWOA 2DSTA 1T8TA 3BX1A 1H2ZA 3GFOA 4ITRC 4UARA 3QU5A 2QVYX 2QTRA 3R1IA 5FOWA 4EF4A 1TB4A 2ZYSA 3HVIA 2PXAA 1I50A 4XFKA 4IQGA 4K7JA 4KPEC 4R01A 4HDMA 3CQ9A 2NTEA 1DO0A 4O7VA 3FMIA 5LBIA 2O8EB 3WDMA 2P8SA 4UCQA 1DQPA 1QGUB 4XEHA 5KTKA 1C8VB 3RVNA 3ZU4A 5K5EA 1JQJC 4A0RA 4JP8A 1S3FA 3PDJA 1VKJA 1AS3A 3N2KB 3GLHA 5I9SA 4BB0A 1S0UA 1UP4A 1PD1A 2BR4A 4I7EA 4BWSC 4FCWA 3AI3A 4JOCA 3PR2B 4YJ2B 2R6HA 4OHXA 1BHSA 3EVCA 4JOBA 4UPEA 2OLSA 4KE9A 4WKNA 3DH0A 5KYUB 3P4YA 1B0PA 4CG0A 1MF7A 1ZEMA 4PYOA 2UZ1A 4HZUA 1Q7CA 5E4JA 3L1IA 1ULTA 4K81B 2DAPA 5BMOA 4CTMA 1U2TA 1IMJA 3R20A 1E79A 4U3JB 1WMBA 2OYSA 1JSZA 2WKQA 3U4IA 5BVGB 1AU9A 4ZCMA 1WMSA 3CFYA 2R62A 5CEEA 2JKVA 3K2BA 2XA2A 2ZT7A 3MJHA 3OWXA 4JH0A 1W36D 4DWOA 4W7SA 2CMHA 5FOXA 2PBRA 1CP2A 2VK1A 3PE6A 4MAAA 3F1KA 3EAGA 4H59A 1QYRA 2BGUA 2PYIA 4AF6A 2DHCA 4CC6A 2VJMB 4PYLA 1MJFA 3WYAA 3B1VA 4D6YA 4R05A 1JDBC 3EWIA 4C4AA 4BBAA 3COZA 2PRZA 2VDUE 2Q0XA 5DOZA 2WB2A 5JW6A 1ADGA 3ICQB 1EA5A 2R68A 2ZJYA 3WGYA 5EZYB 2OK8A 5ECDA 3O4VA 4D9EA 2G9QA 3ETDA 2OM6A 2XXBA 4WZBA 2PKCA 4W5JA 4I50F 4FYXA 2AG8A 3WNVA 5LB2A 1RRPA 1NI5A 2XUPA 3VSBA 2JA5G 4PZAA 4IRDA 2JLSA 2UXBH 4GVXA 4E4TA 5JCOA 2OWEA 5DZSA 3P0HA 1C9JA 3TBKA 1ZQ7A 3T7IA 3B1FA 3DDOA 2CNQA 1H8HA 3THXA 3RV4A 3T1HB 1N25A 4FKMA 3U7HB 4Z4IA 2J0SA 1CLUA 1WWKA 2XMQA 2CK3A 2C7RA 2WKSA 2ODPA 2XITA 3HTXA 4O4HF 4OFZA 3DJYA 5IF3A 3DLAA 1UCFA 5ALRA 4AFNA 1NMXA 3VTKA 2Y0BA 2X77A 5I7VA 4AN4A 3NDBB 2FEPA 4URUR 1I24A 3EIFA 2NXWA 1JQDA 2DUUA 4MW9A 4R8UA 3I01A 1KQFA 2W83A 4PZ0A 3SJZA 2GEUA 2ZYVX 3TNJA 3AVXA 4HRXA 1HH4A 3M1LA 3CW9A 2WSSA 3RSSA 2GHIA 1NX9A 1L1QA 4LHXA 1KC1A 2PS1A 4ZCSA 4PEVA 4RFVA 2AS0A 1GL3A 1ULSA 2JA8G 3LWDA 2JEIA 1KSHA 1P0CA 1VCOA 2WSMA 2Q3LA 1NYLA 1P1HA 2XUJA 3HB1A 3QA9A 1GJRA 4FYWA 3R7AA 1QAMA 4DCNA 2G25A 4OMUA 3IVMA 4HSGA 3A6HA 5IXYA 1L5MA 1CG6A 4J9KA 1N9GB 1RKXA 4XYBA 1ZC3A 2DUWA 3I01M 1PR0A 5JWRA 3NWOA 4FZ5A 4XGNA 4BBZA 1FF9A 2FLLA 2RHRA 2ZATA 4CI9A 1IIRA 2C0QA 1G8PA 1WCMA 4IWXA 2LBPA 1H6AA 1GQSA 5ANRB 4LFBH 2Q5FA 4XIGS 2WJ6A 3HWRA 1VM6A 1IHXA 4PO3X 4G5HA 4KRXA 3A9RA 3JD4A 2RK3A 3G02A 4W9RA 3FCXA 1JMVA 1Z35A 4OUKX 3NORA 2FG6C 2QI9C 4H2DA 2AR7A 3BAFA 3FFWA 3G85A 4G3IA 4EY7A 3DS8A 3JQEA 3SX0A 1HDOA 5IAEA 4ES6A 3OZUA 1O97D 2VBIA 1Y6ZA 1D9XA 4E31A 2G6BA 2EC5A 4HRVA 3NU1A 3GLHB 3ZDCA 3WLFA 2PGOA 1GN9A 4LF8B 4PPGA 4C0LA 3F7TA 4FBUA 2BEWB 3D02A 1D6MA 2GAIA 3OWHA 2FKNA 1N2CE 1W0KD 2NNWB 3PXEA 3L0IB 3OSZA 3ZWPA 5IP5A 2CVFA 4PG4A 5EP4A 3J7TA 4JB2A 2WICA 4R81A 1V8OA 3NH6A 1U1GA 3VU3A 4HZUB 5IDXA 4WOKA 1G20E 4LGVA 1FFXA 5DBGA 2VQFB 1R0CA 3KQOA 2W9CA 1JLMA 2J3DA 1KJYA 4DR3H 2W11A 4TM8A 1JLHA 1V45E 3ZG6A 3LOQA 2FKLA 5JO9A 4Q9KA 2JVKA 2ZUBA 1Q0RA 4MKXA 2B37A 1ZDMA 3K9QO 1B1CA 4G23A 3G0BA 4OK5A 4WHMA 4BKQA 1OLXB 2M1ZA 4UD6A 3UHJA 2XSZD 4O3MA 3TQSA 5JEEA 2BH9A 5DX8A 1ST3A 4QVGA 2QTHA 4ISCA 2XEDA 3KU4A 1Z2NX 4FC7A 1W2HA 2LKCA 1M0TA 2JFYA 4KXNA 3QVLA 4OXXA 1QGZA 2UAGA 1N7GA 1AS0A 3OE7D 2OQVA 1RJ9A 2QNIA 5AJZA 2GF2A 4UCOA 3BIJA 5HZKA 3UH1A 3R7FA 4PHCA 3QLUC 5HKKA 2V4UA 1YZYA 3CH7A 2NP6A 2R9VA 1EX6A 3R74A 1CRWG 2GPAA 2M05A 1L8XA 3GFRA 1NP3A 4X9XA 3ANXA 5EMMA 1O4VA 4NMXB 1ODSA 4ETWA 4MVCA 3VNNA 1B73A 1NW8A 4ED7A 4AKEA 3WLKX 4YFVA 5JSKA 3SIPA 5L1KA 4NAUA 3CVJA 1KDTA 4K1XA 1NULA 4W9NC 2UUAB 2PVPA 5AUOB 2OO5C 2C97A 3BTVA 3DBRB 2WG0A 2QUHA 3V3KA 1RBQA 5AYVA 3ROPA 1E3EA 2VPPA 1IAVA 2ZI3A 3HCRA 4DCUA 3AJ9A 4K9OA 3RSGA 2HG8A 5HBRB 4YMSA 4F6RB 1DP4A 3EDOA 1B6TA 2C7PA 2C2WA 4LYYA 1N36H 1DQRA 5KT6A 3V9AA 2DQYA 4DFDA 1IM5A 1G3MA 4FD2A 4JX9A 2Q6IA 1DAPA 1VOTA 1OT3A 2IH5A 5DM0A 2CLSA 4LF5B 3L84A 4TS9A 1KXZA 3P7MA 1QB7A 3NDIA 3HO8A 3C3DA 3IUBA 2Z1NA 4NLLA 5KQRA 4CV0A 3QSGA 2KB0A 2GM4A 3EPPA 2ERXA 3IKMB 3TCKA 4BYGA 4J0MA 4LFCB 4L07A 4HAUA 5KFBA 2FWMX 4FINA 1FUYB 2WAAA 4OXRA 3IDZA 4EZEA 3ZTWA 2YYZA 2YZ2A 3T34A 1FDSA 1U4SA 1MVLA 1CY0A 3CA8A 3BJYA 1O0SA 2FJUA 3RFUA 3S99A 2D2XA 5FXMA 2WTNA 5E7QA 2ZI7A 2V65A 1Y7TA 2IELA 3IEVA 1A69A 2GRAA 1BMDA 3GZJA 2D2IA 3ND8A 3ISJA 1WS6A 3T3DA 1WPQA 1PLLA 4GEKA 2WWYA 4F97A 4GX0A 4QASA 1TT7A 3GAAA 4RKQA 5BQPA 4P80A 1LW7A 4OKIA 4RPGA 1UIRA 3ILXA 4BNDB 3ZHXA 1ITZA 4O7TA 4MHSA 1J99A 4F93B 2E48A 1E5DA 4MVWA 3ZHQA 2PYZA 4B87A 4IAOA 3DEKA 2ZJ6A 2R92G 3ZEAA 2JJQA 4F60A 4DLVA 2JGAA 4MS3A 2QW0X 1RWNA 1L5HB 3CR3C 2R7LA 4DDKA 3G0CA 1EHYA 3OF2A 4C01A 5EZ6B 3AERB 1XPRA 1FFCA 4AUMA 5CK5A 4AG3A 2IL1A 3QELA 3R7LA 2K87A 2OGWA 3F6EX 5D3MA 5KG5A 5FBKA 4EQZA 5EHXA 3F5DA 1JXAA 4WBNA 2QTZA 1Z83A 3CQZA 1YDFA 1LC0A 1NC3A 2HKIA 3P9ZA 3W90A 3ZCQA 2VDQB 2QUKA 3KETA 1MGPA 3OKFA 1VIAA 4X44A 1K0UA 2P6OA 3MOIA 1R4ZA 3EQ7A 4BCDA 3O8RA 1CUBA 4GC6A 4YMIA 1FFXB 1KTAA 1F1BA 2WWGA 3MXOA 5TGTA 1EVIA 1WF3A 4HXYA 3OOHA 4ED9A 2KE5A 5I7UA 2BGTA 1JHRA 2HMWA 2GMWA 1XKQA 5ELLA 3JALA 1K86A 3UQ8A 1E4EB 1CUZA 3MCTA 1OREA 1VP9A 1NMEA 2HBZA 2XA9A 5KFZA 5K3DA 4AKTA 3FYSA 3W77A 1M6VB 4EA7A 1CUEA 4P1ZA 1ZKDA 2VQEB 2H65A 3T7RA 4CMHA 1GPDG 1S8OA 1ZR4A 4QWEA 5CAEB 1DC4A 1HMYA 4O1IA 4WINA 2YHSA 4QE3A 4CEHA 5LP6A 2AMFA 3LHIA 2DC1A 5ALYA 2YCBA 2FPGA 3EVAA 2NAPA 3HEMA 3CEMA 3EEBA 4HQFA 1KPHA 1K8ZB 4UUMA 1RXVA 3R7SA 1T9GS 2B8TA 4ZO8A 2WSBA 2JLZA 4Z4EA 4WNAA 4RJKA 1B8OA 1OSNA 3GZNA 3PTAA 3IEKA 4ZGBA 5L3RA 4OHFA 4KLCA 1V5FA 3RSLA 3TXAA 1DKLA 5CLGA 2VCEA 4Q03A 1DG9A 2DTXA 1N6NA 1T3LA 2PX4A 1ZUNA 4WVLA 2EDAA 1C7IA 4EATA 2CNWD 1IB6A 2CFRA 1VMDA 4M0KA 3AWIA 2IYNA 3TPCA 5B7QA 2D3WA 2ORYA 3ZHOA 4FSHA 4TMFA 1B3RA 4R68A 1LTHR 2LIPA 3WAGA 1CULC 3CF4G 4U0JA 2PGXA 4MWZA 2B61A 3MWKA 4J9UE 4FMCB 1DIAA 4WK6A 3CW2A 3ZU5A 1CERA 1RRCA 1ZLYA 3TG8A 3W3AD 4JI8H 4BQIA 5LXTF 5IHXA 5FNVB 4LXXA 2ZPUA 3WLLA 3J80W 2UUBH 1MC5A 2L42A 4UZEA 3ZDDA 2Z9BA 3UM9A 5EKUA 1YRQA 2GCIA 2BDTA 3G2PA 4HNSA 4JKOA 3VJKA 1GAXA 3E9CA 4H3SA 2EFCB 1OOEA 1IPEA 3IILA 3KQNA 2H59A 1UJ2A 4KYVA 3BL5A 3JSXA 4D4JA 4WLEA 5BPFA 1MGOA 3T3EA 3LCRA 1QR6A 2C54A 2I76A 2NLOA 4FW8A 3M81A 1R6VA 3OQPA 4JQYA 2FPPB 3KQYA 1NVVR 1DJPA 5BQOA 1X1RA 3GK3A 2G3YA 1QANA 2WFLA 3BFKA 3O8CA 2PKRA 4TV9A 2WM2A 2LVBA 1LC3A 3PD1A 2X86A 1L5NA 1UZNA 3HKZE 2UVQA 2I87A 1MEOA 3GUVA 3L18A 1ZCZA 2YDXA 1JIUA 3DE3X 2W8KA 2C3PA 2ZAOA 3KEGA 3C85A 2YRWA 4OGWA 1ZCBA 2RH8A 1DIBA 1HI9A 4RKFA 4PRYA 4NS1A 4E09A 3VA7A 3PHJA 3BGDA 4F5WA 3HKEB 1G8HA 4OTZA 5FBRB 1YQEA 3DFIA 1F5SA 3JARB 5T4EA 1LDGA 4IZHA 3U4MA 1Z8DA 1V8FA 3W2TA 1YB1A 5CW2A 1SXHA 4G1BA 2NYVA 1T8WA 4X1IB 1H2FA 1XC7A 4FFRA 1VE9A 3EQ8A 4RA9A 1UBUS 4ZK6A 3RANA 4YXFA 5LQUA 3U5ZB 3V1MA 3GP5A 1UKCA 4CU2A 8ABPA 3MTDA 1WP9A 4FJ0A 1GZ3A 3DAGA 2B9VA 1KSJA 4QWBA 4B9AA 4E14A 3AVUA 1XTJA 5ESXA 1BH2A 3SN6A 4JELA 4V0QA 1C1XA 5FOVA 4EKDA 3LTEA 1GCIA 3IODA 6YASA 1X7GA 5E95A 1PZHA 2CCGA 2R7ZA 4B84A 5LQDA 4B81A 1YASA 4Z1MD 1U28A 3GWGA 3EWSA 2RH4A 1SCBA 1TT5A 5A7HA 3PYXA 2GTPA 4ENPA 3V1NA 4JDPA 5DHSA 3LUAA 3RYFA 3PQ4A 4LS3A 4MYDA 3H2HA 3JQ9C 3GFBA 1EG7A 3LXMA 4KIWA 2P6PA 3A25A 2BOVA 1T8YA 1II0A 1MXHA 1O6FA 3CISA 5GWXA 3UTDA 2R2AA 1P4AA 5DT2A 1LUAA 4PWQA 4BDSA 2ZP1A 5IVDA 3IQZA 4XSVA 5FD6A 4KITB 4PG5A 4E5VA 4OBXA 4U8HA 5BQ5A 3M6WA 1GKUB 5THXA 5CNIA 3A37A 4B7ZA 3OLCX 3R76A 1S9HA 4D46A 3ECCA 3HPQA 4LQCA 1HSOA 2B63A 4Y6PA 3LWBA 1GDDA 1GO2A 5I7EA 1OBDA 4B7AA 2DHRA 3HUDA 1VE6A 2W9AA 2FMHA 3IJEB 5I5GA 4DR1B 1X9GA 5IT4A 1B23P 2CW5A 1IHOA 5FCDA 5EDWA 2FW6A 4EEKA 2N47A 4Y0NA 3TR6A 1PP4A 4O81A 3FDXA 3L7IA 2JBHA 4C7OA 1J2TA 1N8SA 1PHRA 5E2BA 1EUDB 2HZBA 2X8JB 4E46A 4MRSA 2QYOA 4I9GA 4PC2A 3BE6A 2F1JA 5FO1A 4MB6A 2FXVA 2AFIB 1ESCA 1THGA 4LK3A 3U49A 1N77A 4PANA 1ZM7A 3LLVA 1WUJS 2QVCA 3A8TA 4ZICA 3PDWA 5J5AA 3R44A 4EUSA 2I7VA 3KELA 4OB6A 3OU6A 4NU6A 2Q1WA 2FLPA 5LD2C 4HAWA 1A2BA 1XKLA 4AJKA 2RB4A 3SZRA 5REQB 2XUOA 1AIPA 2PR7A 4QTYA 1XQ1A 1RWWA 2CFOA 2RGWA 1O1YA 1KYIA 2PS0A 4LNAA 3VM6A 3HR7A 2XXJA 3KVRA 2G9NA 3RNOA 5GZ3A 5TMBA 4REQB 5C7OO 1G21A 2FY8A 4XYLA 3ECAA 3BXHA 2DSNA 3JPWA 4MWGA 2FEOA 1JR3D 4X0EA 3VNAA 3ODGA 4JLOA 3FMGA 3GFVA 3CX4A 3C39A 4F4DA 4QX6A 1H5QA 3UZUA 2D06A 1L4FA 5EZSA 1K83A 3GGGA 5C7LO 5JT1A 3IP1A 3BXXA 1VRWA 1X1SA 3NTUA 1Y8AA 2MDTA 1JEYA 3OIFA 1XWFA 1N2BA 5IVPA 2QHXA 1NT2A 1A5AB 1FUEA 4BQSA 4UQLA 2Z4SA 4ZODA 3N05A 1USVA 1W2WB 2ZTMA 3FZNA 3K0KA 3VGJA 4EB3A 2XCSB 3H2GA 4MX8A 3RK0A 4TVIA 5F7XA 1HNXB 5JUMA 4PGHA 1PQPA 2JVIA 2HY7A 2VRCD 4HDCA 1WB5A 2AA3A 1OI7A 1T3TA 3E9QA 1O94D 5ED4A 4JSYA 1MDBA 2P77A 4P4NA 2O9JA 2C9BA 2YTZA 2X3UA 3W5OA 4YPVA 4X8HA 4URZR 3MINA 3JD3A 1KC3A 1G5PA 1FTQA 2IKQA 1X7DA 4OI2A 1GFIA 4IICA 2Q29A 4X3CA 5A7GA 1UC8A 3H3FA 2X6QA 3BFXA 3N2YA 4RA9B 4KXYA 1L7QA 2PUFA 3PA8A 1JIVA 2AU0A 3JAWB 3TUZC 4WGGA 1WOMA 4ZEWA 4QHSA 2VZ8A 4LDJA 1I0ZA 3M4JA 2DUNA 1CDDA 3GRFA 2JAHA 2FQQA 1KL7A 3RHFA 4UNPA 4JI6H 1LZLA 3NPAA 2ASVA 2Y76A 3Q6IA 4XGRA 5H1YA 2O50A 4B4KA 3FOAA 1L4HA 2GDJA 2P5UA 3NRJA 5BV8A 3AEUA 3EX7C 1RC1A 2JIMA 3NTOA 3UKDA 1YRWA 4G07A 4MK4A 5D5HA 2IEAA 4GI5A 2PZJA 1NYTA 5BXYA 3GTLA 1W88A 4O4LA 5JAOA 5HIAA 1ET0A 1SG0A 2H57A 1AA9A 1S3IA 3W4KA 5KOJB 1XMQH 5J58A 2J6CA 2C7QA 2SHKA 4BJ5A 2QAGA 1Y3DE 4CR8A 1I94H 2A0WA 2ATIA 2P35A 3RODA 4JYZA 3M4YA 4OM8A 4O3RA 2Y2UA 1Z4MA 5HE9A 2NXJA 4KN6A 3KWJA 3IVRA 2NZXA 3Q10A 1YA4A 1GGKA 4ND7A 1GZ6A 1MOQA 1VJ5A 4CDMA 2PBLA 1K7EB 3KFVA 4J0KA 5MDHA 4MRAA 5K2OA 2FUCA 4KLAA 5CRIA 2K7FA 5HQJA 4YWHA 4GOXA 2QMQA 2R8BA 5KYKA 5ALIA 2C2MA 4AROA 4LMRA 3C3YA 3CH4B 5EE5B 4E5MA 4LRQA 4YRBA 2DLNA 3C41J 2QVBA 1BJKA 1KBOA 2R44A 4BY9E 2OCLA 2X5NA 4N5MA 1BDIA 4Q3KA 3S4YA 4CL8A 4C43A 3GN2A 4RUAA 4N5HX 3W5HA 3QXXA 4TZ6A 3EDQA 5B36A 3PGVA 3IX7A 2JANA 1XZLA 1JBKA 5FPTA 1V9PA 1NFQA 2R8PA 3JQGB 1OIWA 3LUGA 3HP1A 4TWAA 5A5DA 2JA5A 2I4MA 3S5JA 4LYFA 4QUAA 1AHIA 1F48A 1WD5A 1QWOA 3I5YA 5HJEA 1NRIA 3F7NA 1WR2A 3C7KA 5HQTA 1H0RA 4ZTBA 4Q4JA 1CF2O 4LMBA 3I83A 4PZUA 4F04A 4DREA 3H4TA 5KFTA 1SXPA 1VIMA 2AOVA 1U9IA 2R7MA 5BV1A 2VJNA 4F2DA 3QVGA 4KB5A 2Q4RA 4MKIA 4YV0A 3H11B 5LZ7A 3U13A 3QE3A 3IPAA 2C2EA 5G2OA 4HZGA 5TNXA 1RSZA 2FX2A 2BPOA 2NQ8A 2QMZA 5L3QA 1PVDA 2VDVE 3TAUA 4XGQA 3HYCA 5SICE 2O52A 1Q1ZA 3UK6A 1LDYA 2B36A 2GF9A 4C0QC 2FWIA 4BX9A 5DNYB 4GWLA 4RDIA 4TYNA 2C03A 1MDFA 3HEBA 4EOGA 3RROA 1RAGA 3WOHA 2VOEA 2ZSIA 5FIUA 3E22A 2QTCA 4GR9A 3I6IA 2FRDA 4YRKA 3V8EA 4D9JA 4ZJPA 3VZQA 3RVJA 3WMFA 4X93A 3QEMB 3LDGA 2HH9A 4ETIA 4RV4A 1JFVA 3F1LA 4ECUA 3RF2A 5TQ0A 3WADA 4YP9A 3SWWA 2E85A 4XYMA 1DRJA 3EWAA 4XTRA 2VF8A 4HUQA 1PJ8A 4IMRA 1Z2CA 2G8LA 1M72A 3KOWA 1UINA 2O4CA 4FUQA 4NECA 1RM5A 3NRCA 1Z4KA 2O6HA 3V8NA 1M5TA 1CZNA 3EGIA 3HWSA 4B3XA 2EG5A 4E94A 1V2GA 2GHQA 1U5BA 1G1MA 2CLIB 1APBA 2QE7D 1TA4A 1HNZB 4O3PA 3UB2A 3IKJA 3U3RA 4BNXA 1SBHA 2CV2A 1ZJJA 4HGZA 2VUIB 4K9NA 1VBKA 1Y9ZA 1IBSA 1JG7A 4QO7A 3RKRA 3JRXA 1FLDA 1RRKA 4IZOA 5EJ2A 2OZVA 1FP4A 2M6RA 3JAKB 1KEZA 4RV5A 2HIHA 4JROA 4PGAA 4PZCA 3BACA 3G7UA 1JN0A 1TKRA 1TYDE 2POCA 2VJDA 5J2UF 4GM0A 1XCLA 1WXFA 1QRAA 3L4JA 4RZ3A 2VPIA 4AS2A 1UBOS 2JLQA 3D6FA 4LCEA 4IR1A 4OOEA 2E5FA 2QV7A 4PBRA 2VT7A 3T1NA 3BREA 3FHLA 1X74A 1XP5A 4D96A 1VE7A 4B8WA 2A14A 3BC1A 3B6ZA 2IYTA 4LRXA 3ABIA 1D2RA 3U54A 2YZLA 3F8TA 1YQTA 3EIOA 4ZRNA 3CUWA 2V5AA 4NTZA 2R7ZG 2IZ1A 2CMKA 2CY0A 1Z9BA 4XZ3B 4YCMA 4MQEA 3WB0A 2PLWA 2PZMA 2C2OA 4BN0A 3PQ6A 1PT7A 3S70A 2M98A 2VXCA 3B38A 2QLNA 1LDBA 4ASUD 4F4HA 3K8ZA 5H3LA 3NHLA 2GHTA 2D2VA 3C16C 1DHTA 1G60A 1T24A 1EFCA 3BL6A 4LA4A 3GELA 4NCBA 1ETUA 1PK8A 2WWTA 1CVIA 1Q20A 4J9VA 4JYMA 3OTIA 4ZFNA 3TZQA 4MWOA 1S89A 2I2AA 3AVQA 4FWBA 2NUAB 4A3BG 4DY6A 4X3PA 4CM8A 4YY3H 1XYVA 1U0NA 1DADA 2YC2C 3R0VA 4UFZA 4EGJA 3N0VA 4I9NA 3QKSA 3W6UA 3TSYA 3RI3A 3FCSB 3U39A 1CKOA 1VMIA 1SK9A 3V8VA 4RTPA 3WYGA 3ZY6A 2JBAA 3GF4A 1GPWB 3L9XA 4JC8A 1WCIB 2BP7A 4GYWA 4W63A 1YH3A 4PM4A 3ED1A 4DT1A 1YE8A 4LAFA 3WP0A 1J1UA 2GZRA 5FNZA 4FT2A 3IFSA 2VRBA 4RLSA 4BNGA 2Q8QA 4LXQA 5ECWA 3ANNA 5EIBC 4A8HA 2IBSA 3USZA 3TVTA 2M6KA 3IA7A 1L5LA 4IEFB 4MGHA 3GIJA 2YHIA 4DNFA 4MP3A 4EPXA 4RF5A 4GC9A 2X41A 1XQWA 1ULUA 2C99A 5E7MA 3EPGA 4B85A 3ESXA 3QU2A 1KK3A 1UAYA 1XTTA 4LKRA 2X1HA 4KDEA 3IMFA 4MSUA 2WIKA 3WGGA 4EYKA 2I8CA 4EO7A 1T10A 3L9WA 3BMXA 2RONA 4ZKEA 5ENDA 3PEWA 1CQIA 4A7PA 1FVXA 2YMPA 2J6HA 3R0JA 1VSVA 2NOAA 3HSSA 3ASUA 5L3QB 2VZ9A 3W5JA 1LX6A 4Q9IA 1KMQA 2WM3A 3ESQA 5L7TA 3AUSA 4E5YA 1QPZA 3DTVD 4OB7A 4ZCTA 4JJAA 3KHLA 2IUYA 1QGAA 1JYEA 3C6MA 3W5DA 1GPYA 2H1IA 4EHLA 1QGDA 3A7DA 2PRIA 2CSUA 4LXHA 2HNBA 2MU1A 2IYZA 3RTGA 2AG6A 1TF2A 3Q15C 4ETNA 1U1DA 3KX2A 1X2BA 3MLEA 5KREA 3SG0A 5GVSA 4WCFC 1U8ZA 4FOLA 3KB1A 1Q92A 5JMPA 4EUNA 4PTYA 3GOQA 4AZ0B 1CJTC 2PRSA 3PW2A 4HUQB 4FYIA 4KYIB 4EUEA 2HHJA 2XV1A 4QBFA 3M5CA 2C5HA 4BVLA 1ZS9A 3UANA 3INYA 4MV0A 5ALVA 5FBZA 1DTWA 4ROTA 4F4CA 4JKYA 1MRZA 3CKLA 5FLKA 5ILQA 2VYVD 1U1EA 1CIJA 3K0AB 1ZL0A 1A4UA 1NQVA 3LI2A 1AMOA 2AEFA 2O3TA 4Y1EA 3CLVA 2JJ2D 5JNUA 5K99A 5G0TA 1A0GA 1EVZA 3P0JA 4DN6A 4HN2A 5ALTA 4QYSA 4Y18A 3O6VA 3E3NA 3TZ6A 4WOPA 4KFRA 1UXIA 3IIJA 4L8YA 3IAUA 4WZAB 2R84A 5JDCA 1RKQA 3ZUPA 4LDPA 3JQFC 2MYNA 1Y5LA 1UBCA 4PAOA 2DUMA 2HV9A 2E4XA 5JXIA 1V48A 4ICIA 3K9GA 1RQNA 1J24A 3N40P 3A9TA 4WCDA 3WLPA 4FDAA 4NZ9A 4OFBA 1WY7A 3G5TA 2BJVA 3K0FA 4KFCA 1OXXK 2Q99A 3BXPA 1DINA 2O2IA 4ZVOA 4S24A 2A58A 5FPKA 3ZDRA 2HZ7A 2RMKA 4Y6OA 3Q2OA 4TQ9A 1X42A 2RCYA 1ZJ5A 1AQNA 2VAPA 4AB1A 2EZ4A 3AOGA 3QKUA 4I8DA 1MB9A 4MCHA 4N3AA 2G0NA 1ISRA 1N1EA 3G5UA 1DBWA 1M0SA 3RRJA 1OX4A 2Q49A 3HJGA 3BE8A 1ZN7A 2P9QA 1IXRC 2CE2X 2RHMA 3BWVA 4IINA 4TTQA 2WJ3A 3HQ4O 1J5PA 2Q1YA 3DOFA 1U0GA 4UTPA 1TE2A 1QZUA 3GGOA 2XRYA 4LXUA 1UEJA 4H3HB 4OIMA 3EPIA 3E4DA 3TXXA 4Z9AA 4CCSA 2CHQA 3CY6A 4OJYA 4B47A 5B1HA 1H2YA 2RGYA 3RIHA 4IYJA 3RJ5A 1IEWA 5T3YA 3PI6A 5CB8A 5A9RA 1L4LA 1XRRA 3A4IA 4A6DA 2ZIEA 1J0BA 4PYKA 2QRKA 3GL9A 1XNQB 2BP7B 2IOHA 1IZ8A 1SXJC 3VU8A 3E84A 3S7ZA 1FRNA 3HO6A 4LPKA 1JDZA 4C7BA 4RXUA 5AW8A 3CM0A 5BV7A 2J09A 4D92A 1GGVA 4WLVA 2Q4DA 3GGDA 3M9WA 3JQPA 2VUGA 1O4WA 2ORWA 5L40A 1B41A 2OGSA 2H08A 5JJKA 5D00A 1ENOA 4RMGA 3IEXA 2NU8B 4P0TA 1R0BA 3F98A 2H4YA 5BW5A 4PR3A 3FMPB 4PV7A 1TXGA 3K20A 3F67A 1KYTA 4PSUA 1KO4A 1PWXA 1SB8A 4ERNA 2IOQA 3R9WA 4PIVA 3IRUA 1KDVA 1ICIA 3UW1A 1BXKA 4BNMA 2C5BA 5I5EA 1YQGA 3CF4A 5C8VA 2PX0A 2W42A 4G5OA 2DXIA 4H0CA 1CQIB 1PG0A 3FTDA 3ACCA 5F1YA 5EIFA 2CXNA 1M8KA 1XNHA 3AF4A 3PXGA 4PSAA 4YAJA 1L1EA 1GTVA 2DOKA 5H81A 3HXLA 3H1GA 2AHOA 4QIWA 3BBLA 3VGPA 1OTHA 5LWHA 4YP5A 2R1UA 2H2GA 1HFKA 4IW3B 3KNZA 2GM3A 4R40A 4QWCA 1UBMS 3RFTA 1AN0A 4DMFA 3X2SA 5CEJA 4ZI7B 2NV0A 1P9OA 1FA9A 3IHLA 1P4HA 3F5FA 3SC3A 2DPYA 2RF4A 4JGGA 1NXPA 3WLQA 1WSDA 4S3MA 5G1OA 1IXYA 3AEQA 3RQIA 5DNCA 2XDAA 4C2TA 2Z6AA 4IGIA 3NOQA 3ON5A 1WXIA 4FZJA 1DTWB 5LMUB 3E0XA 2CLOB 1N7HA 5JZBA 3WRXA 4WNCA 1GARA 2R5FA 2CXUA 3L2OB 3RS7A 1OWTA 4QWWA 3WY9A 4W4TA 4PX2A 3HP4A 4Q7EA 4EEYA 3PW5A 4GX5A 3CE6A 1A7JA 4PICA 1VJGA 2FFJA 2H52A 2A57A 2ZKIA 2WPDA 2FN8A 4YFYA 1A9TA 1KU6A 4ZZ3A 5TRTA 5KTYA 1KUTA 4AX8A 4MUBA 3G5MA 5JC1A 2ZULA 5GPBA 4JHXA 4F9GA 3G7NA 4Q6BA 3IBGA 3NEPX 3GLIA 4NCNA 5BYAA 1MAVA 1R0XA 4Q1DA 2OAP1 3LP6A 1FS5A 4HDMB 4F46A 2H4JA 4IHJF 3N1UA 2G7MC 3H5NA 1L5ZA 4DCOA 2QR5A 2ZJ5A 2FQWA 3E7FA 4EY5A 4R7ZA 4PZYA 1SURA 5EFZA 2J5KA 1KI2A 1U6JA 2IUTA 3EFBA 3KHSA 1ZGJA 1R88A 4M9XA 4NZMA 3KXIA 2W6IA 1KGSA 3AKEA 4P4GA 4R1MA 2ASEA 4FDUA 3T15A 3DE0X 3PFIA 4XTCS 1Q95A 1SULA 3MWLA 2O1WA 1TFRA 1JHYA 1JAXA 4Z54A 4MOWA 4UCVA 5F3RA 4EA6A 2OESA 3KKKA 4EI8A 3E58A 1CUHA 1E7YA 3DZBA 3I1FA 3WLSA 4J9QA 1P74A 5DTQA 2V97A 5ALWA 5FKJA 2PUTA 3CLRC 3V7FA 4IIFA 4L9WA 4ZAFA 2UZ1B 4YIKA 5K05A 4X97A 5E9QA 5AHWA 1DUIA 4EI2A 3HOUG 1WA5A 1FP6A 3WKEA 2P27A 3V4FA 1JT2A 4EDHA 1WKCA 4AU1A 2ATCA 1KJQA 4C88A 5A5EA 4K9KA 2J7KA 1GNQA 1N6HA 5I5WA 2EGGA 1H2XA 4EHDA 1QX3A 4ANFA 1INLA 3OIWA 1JKIA 1RZRD 2O3UA 3TLEA 4GKJH 4KVFA 3M6MD 4CQLA 5DLDA 1UK6A 4XARA 1A88A 1ORWA 1X7YA 4R8LA 4TN1A 2ZCJA 1FPMA 5BN4A 1TEHA 2N42A 5C51B 3ND9A 3CRMA 5AW4A 4F38A 1M1ZA 2HVSA 3KKZA 4DMCA 3PX2A 5ECGC 3LYAA 2IEZA 4IHQA 4MIOA 4DCMA 5AKKA 1BWSA 3S81A 3EZYA 3IOCA 2CLFB 2CNNA 3RKSA 4ZEMA 3SE7A 1WXHA 2H48A 1P4RA 2CXRA 3TLZA 3DO5A 3RRYA 1TM7E 4RENA 2YOGA 3IBYA 4J7AA 4W5QA 4CTOA 4PSVA 1T0BA 2HDHA 1SVIA 2YIJA 4WZBB 5FF9A 3EVFA 3COVA 3IUSA 2JLWA 1BD4A 1F6WA 1RQLA 1ZGCA 2PRJA 3WIEA 2DPGA 2CB0A 1R7RA 2VHQA 5DISB 2M32A 1BE1A 2I4NA 3MMSA 3TWOA 2HPZA 3AL2A 1G4UR 1OGJA 2C8KA 1IM8A 2ZBUA 4W1RA 5KFAA 3B9BA 3U4GA 2GN6A 3THXB 5B1IA 1KARA 4B6JA 1QFXA 2GPBA 3WL7A 2NO7A 5AM0A 1PV1A 1KI6A 1NMYA 5DGCA 2WWWA 3Q41A 4WXEA 2DQZA 3ABSB 1EAMA 5IF9A 1UMDA 2OTCA 2V6IA 4R8UB 4F5EA 2VDLB 4ZQCB 4X8OA 3GJ4A 1DAFA 4QD3A 2CJFA 3LUPA 3E7XA 3E03A 3CU5A 2P79A 3NHFA 4CT4B 3T95A 4KGDA 4D45A 3LS2A 2JF0A 3OZTA 4X45A 4O29A 1PD0A 2C4KA 4JP3A 1GAEO 1MVNA 5C5IA 3RHTA 4UCTA 4S35A 5KS8A 3AINA 4GAEA 3OQNA 5DBEX 1U02A 4H1HA 4EG5A 4CMAA 1GGHA 1B43A 3WWZA 2FK2A 1N3LA 1AKUA 1HDGO 4B7XA 3CVXA 4O5OA 3TNYA 3AI1A 3LMKA 3MHPA 2VP4A 4LBVA 2OXEA 2I5PO 4C6TA 4Q4HA 4AP5A 1YFLA 3O8OA 1MKYA 5IUJC 2G6TA 1PK9A 4DE5A 3IAEA 1YTLA 4F6CA 3SJUA 4B5LA 2WAOA 4K9DA 3CZ5A 1UDWA 2X2PA 3NUGA 1V6SA 1EX7A 1WEKA 3KSAC 3QUTA 4NJOA 1OKKD 3RAFC 3NBAA 3GTOA 4JHLA 1ZK2A 5KFHA 4RD0A 1SOAA 4O1HA 3SZOA 2ZAMA 5CB4F 3JD0A 1YI8A 2O59A 4FP9A 3GJXB 3I73A 4ZJUA 2INGX 2WD8A 1GTZA 1Y6RA 3TSAA 1W7AA 1QV7A 5GOTA 2JL1A 4QPJC 3PFBA 2G72A 5ES4B 4Y6GB 2IS4A 5DJ5A 4D56A 3ASYA 1U90A 2GJSA 4LZJA 3BCRA 5EERA 4G84A 2HK7A 4F4JA 3VI3B 4MCJA 1UKAA 2R6R1 3GTKA 1XX6A 3PZPA 1RJGA 1L6IA 2ZI4A 3ONVA 3S1AA 3PKJA 1YDGA 3EEIA 4B3MH 5HZHA 1IVSA 1X77A 4EYGA 5JNWA 1CEXA 1Z8FA 1ZH4A 1NBME 3LX6A 1KPGA 4DLTA 1IHPA 5LQJA 1ESMA 3QUCA 3EG5A 4B09A 4JP1A 3VPSA 5EUBA 4KRGA 3H5IA 1Q83A 2R6CA 3RG8A 3C6XA 4GPEA 3ZGOA 1PCXA 2NTJA 1RXSA 2ZUFA 3LRPA 4FKBA 4ZTUB 4ED8A 2CBGA 1L5GB 5ALOA 2D1TA 3SICE 4I8IA 3RYHA 3GJZA 3E2PA 4TTAA 1GPNA 2W6CX 2BRUC 2PWPA 1FFWA 2O5VA 1S7CA 3ID6C 2JD0A 1QVRA 1SUIA 2ZIZA 3LHKA 4C6SA 2JEGA 1IK6A 1O87A 4OQPA 2W9CB 3LIPA 4F3YA 4BNTA 4L16A 4ZQBA 3RRBA 4Z2AA 4I5GA 4XASA 3UAWA 4CEIA 8LDHA 4HFNA 4PAMA 2OHFA 1HO3A 1XZNA 4MYUA 1JHVA 5EWMA 1G6HA 2ZXUA 3Q98A 4DV4B 4D74A 4F0JA 2JNWA 2Z2ZA 2WLTA 3TZLA 1EQUA 3FGOA 4V1CI 3BJRA 1Q1EA 5JJLA 5FR9A 2IEGA 3FPCA 5KQPA 4CQLB 5L3VA 4EL0A 1ZUIA 2XLBA 2OAQ1 4BMXA 4NBUA 1NY6A 3I9OA 3PEFA 3D7MA 4PONA 3GN1A 1Y1VA 2BMWA 1KTVA 1F8UA 1ZD2P 1UP7A 2BI8A 2NXEA 1YCGA 4M54A 3B52X 1N1MA 3DHVA 3UJAA 4P3XA 4CM5A 4MVJP 2TSYB 3P9RA 1RJ9B 2PWBA 4BV9A 3DOIA 3EVGA 3O1IC 3RT9A 2IH4A 1T5BA 1EGQA 3QBDA 2YJTD 1R8YA 2F64A 1DX9A 3EFOA 5JANA 5C5DA 3QFFA 2X0RA 4D9NA 1XCBA 4ALLA 5KVCA 4AZWA 3LU1A 1PL7A 1KVSA 3D7KA 1T2CA 1RQRA 1JR4A 2WMYA 3JSNA 1U4NA 4DADA 2I4OA 4D6XA 2ZB4A 1BHQ1 4HAXA 3WRVA 2J8ZA 1U31A 5F1PA 5FUXA 4EECA 2VJAA 1RXUA 1DC5A 3EVTA 1PJTA 2WI8A 4DIFA 2HADA 4ZT2A 3PR3A 1SU8A 3G82C 3RC8A 3HDGA 2WUGA 3P9SA 3MFIA 3OVMA 3K1AA 4FBTA 3SYTA 1NBHA 4UEKA 2N1BA 2IY9A 2X5KO 3T9BA 2ZJTA 2R11A 5EC8A 2AL7A 3C0FB 3ZE6A 4P92A 3FBTA 3INTA 4HDAA 2VHWA 2CFMA 3GZ4A 3TX6A 1TLLA 2F9MA 1TK3A 3G6YA 3GU3A 2I6UA 1RQXA 2IW3A 2FSSA 2VF2A 3MMXA 1FMTA 3AEZA 4LDAA 4G5FA 3WGKA 5AM1A 4XW2A 3CZCA 5KCMA 2X8AA 3W8FA 4CT5A 1HBJA 3C3AA 4E03A 2C1EA 1A50B 2VLBA 1D2MA 2NO1A 1UBSB 2WWHA 1VLVA 2BZ0A 2WMOB 5K01A 1G0OA 2GVNA 4G0OA 5DH9A 1E9DA 1WEHA 4KQCA 3UCXA 3WV5A 3RLIA 4BTEA 2ZR0A 5IULC 2ZETA 4GQIA 5C2JB 4NMLA 4JV0A 3ER6A 4Q4HB 1BFUA 3TQTA 1QE5A 1I51A 3U9LA 1KP3A 2WU0A 2E55A 4D0RA 3OZXA 1U1CA 4JVOA 1B74A 1JDJA 1ZK4A 1TUGA 2ACWA 4NE7A 1IL0A 4PAQA 3OAAA 3K4HA 3M70A 3VOBA 2WHPA 1N5IA 3UAZA 3DVAA 4CLHA 4Z53A 3FDJA 1AQLA 2WVHA 1RXWA 4M0UA 3TJZA 4B2PA 4LF4H 4MVXA 2E2IA 2P62A 2RH9B 3B1KA 4A3KG 2J3LA 3WX0A 3R3SA 2NG1A 4BMOB 3G2QA 2XWPA 1FFGA 1WOYA 2QTGA 4EITA 1X6VA 2P2NA 1AN9A 3EPRA 1DT5A 2QYHA 2AXQA 4MV1A 2E82A 1G63A 5IXSA 4MS3B 4FFLA 2JLRA 3GIPA 2ADMA 2G1JA 4JAVC 2X4DA 1FW8A 1X19A 2EX1A 1Q91A 3UVEA 4G81A 3RC2A 4OX9B 5L7YA 5AWFC 2JJMA 3RFVA 4WN3A 3TLKA 4I50A 1W4CA 4NABA 1JP7A 1HQDA 3QELB 4ISBA 3AR5A 1H2EA 1G42A 1SIOA 4R1NA 5D3MB 2IEDA 1AMUA 1E62A 4A3GG 4WBNB 5FBHA 4OP2A 2CDNA 3LV8A 4X65H 3UIEA 2OV2A 3RK4A 4JXXA 4PFSA 1HE4A 4FYVA 3TQHA 4KFSA 4U7WA 5EXTA 4OIFA 1Z4LA 4NFYA 5ALMA 3UHAA 2B21A 2GUWA 1CJSA 4O4HA 1YZNA 3FWHA 4IF4A 4YRTA 1Z12A 2CEKA 3AM1A 3GGPA 1FYVA 4KUGA 2WVAA 2EBWA 5K6TA 2XKKA 1O5IA 1P0MA 4LH7A 1NQAO 1XNGA 5C35A 4ZOLF 4LYGA 1A8QA 2QJRA 3A1NA 3KEOA 3JALB 1Z39A 4MYSA 5EWMB 2OILA 3QEJA 3A6LA 2R65A 2I6XA 5KTSA 1LFAA 2OP0A 3X1YA 4HUTA 3BTUA 4TVOA 1MO3A 1EX9A 5ALZA 5BSHA 1FJXA 1ZHFA 2YFKA 1KZ4A 5E3HA 3R3ZA 2RI0A 1GQYA 3QLVC 1RRFA 4CEHB 5LP6B 3GLRA 3E1GA 4BE9A 3RU7A 2ORED 1IWBB 2FPGB 1WX1A 4XWAA 3RS0A 1Q1GA 3HB0A 3MB8A 3KJEA 3O4FA 2QUIA 4C7JA 3GH1A 2ZYTX 2OBYA 5KX5F 4B3SB 3M8KA 4OQXA 3IE0A 4BECA 4CXMA 2YZNA 3LQ1A 4RF4A 1AQIA 3KV3O 2HMYB 1B93A 4WNAB 5DB4A 3RC3A 5CH5A 1UQRA 1C9MA 4TYMA 5SY6A 3GZNB 2XQKA 1QQ5A 4FEEA 2C2DA 3EFOB 5MGNA 3HG7A 3PT5A 1DUSA 3CZ9A 2D7JA 1F0YA 4D4HA 1WHSA 4BXOA 1SFRA 4D9BA 3Q7QA 2RJ3A 4RCNA 1G5HA 3BIOA 1LI7A 2B5WA 1DRKA 1ZUNB 2JLAA 4BMVA 4YP1A 1M3SA 3CWCA 3W4IA 4MV7A 1CRQA 3VR4D 4X6UA 2CD9A 4GWGA 3BCSA 4IQ4A 2BR5A 1CZHA 4QEKA 1PF7E 3FTEA 5IX8A 4E6NA 1RMYA 3F6RA 4XWGA 5C80A 1E5XA 1C2TA 4BGVA 1SVOA 5KNCD 2GBIA 1VHWA 4R8RA 3JVDA 3S0JA 3HXOA 3UCEA 1E66A 3AETA 4E3WA 1E1DA 5GV7A 3HJTA 5LUBA 1Q1BA 2I7DA 4XI9A 1R9MA 2XRFA 3VH2A 4XUEA 3WIVA 1N7IA 3FFXA 4DEYA 1G7SA 2YASA 2XF2A 4ZP1A 4J7XA 2C83A 4M7EA 4RTNA 2CKMA 4UHBA 1EUYA 1JVSA 3NG1A 1P1RA 1HLPA 2ECPA 3FJ1A 4EIWA 4BNYA 5FV4A 3CURA 1FUKA 3ZWYA 3W6ZA 2MOKA 3NVAA 3A6GA 2XGMA 3O95A 3P9KA 4KU4A 4MUGA 2HMTA 2BBTA 3LYHA 3OEHD 4UZSA 3C6QA 3DEZA 3FKIA 1VCHA 5BWCA 3DBLA 3IQDB 5B4UA 2H5IA 1XEXA 3OETA 1GXSA 1IYEA 3HLKA 3ZWDA 4AG5A 3NKLA 1MT0A 3G17A 2QVZX 4JUFA 1HTTA 2XKAA 1ZM3A 3JQ7A 2OAEA 3A6EA 2WFLB 3VHLB 5DX1A 1USKA 4QOFA 4TV9B 5CFMA 1Z0SA 3QY0A 2Y1OA 5IDVA 5EHQA 1IBKB 3ER9A 3S40A 4F5ZA 1DDIA 4YP3A 2IWHA 3V8PA 1UFKA 1BGXT 5EE0A 3VTAA 3P4XA 4OL0A 2VH5R 1E4FT 3NWEA 3OSUA 2Z5LA 3PLAE 1O6BA 1CUUA 3C3WA 2FRVA 3VU0A 3BXFA 3K5HA 1SXJE 3DB2A 3IPYA 4CL0A 3LZ6A 4K9QA 4AP9A 5HPYB 2OXCA 2NQ2C 4ARVA 3I92A 5DLQC 1M2WA 3DDHA 4R2LA 4GLXA 3WC4A 1PZMA 3IP8A 1PGJA 3PHCA 4US2R 2C78A 3PO3G 3TY8A 4UBJA 4LHZA 5KYWA 1E6CA 1IEXA 5I01A 4G8JA 4L74A 3HU3A 3D6NB 1N0UA 4CRWB 1H4QA 4LV8B 2CHEA 4DJFC 2JHGA 4NSNA 3NNDA 2HA6A 4V0ME 4KXXA 4U2BA 5L9XA 1PSZA 1H6CA 3TI9A 5C46F 5KFXA 1C1XB 4P35A 1OWPA 5BWWA 1TAQA 2ATLA 1AM4D 1N3YA 1YVRA 4TROA 3OHSX 4OQLA 2Q6LA 4V0KA 4PSDA 4DL6A 1TT5B 4AECA 4TSFD 4HEA6 3K09A 4LKOA 3RYFB 1HPLA 2IYQA 1BWQA 3SOZA 3DULA 1S0NA 4MUEA 2VAMA 3I5UA 3TYXA 1CPYA 1IEQA 3IDAA 3TFWA 1V26A 4LYAA 5HXAA 3T5HA 2J9ZB 3NETA 2ZBPA 3GFFA 3RHZA 1VS0A 4OVKA 5G02A 4YCLA 3ZH2A 4MIEA 3UOGA 3JPYA 3R24A 4KACA 4B82A 2G4LA 5AW2A 1I7PA 3NYWA 4ZMRA 4RSRA 5AESA 1XTRA 1GM5A 4V2IA 4J29A 2J33A 5C0OE 3JVEA 1JAIA 4WVFA 2R8JA 1U7DA 4E2YA 3OZAA 5C31A 5BR8H 3G8DA 1GQ2A 3H2JA 1GAJA 4H27A 3BIWA 3LM8A 2QAIA 1JA1A 3RUEA 2X14A 1VLQA 2Y0CA 1H2BA 2Y9MB 5A9SA 3F4KA 1OFGA 4DLWA 2PX6A 4LF6H 4NBVA 3KB2A 1V9LA 3HGTA 1NW5A 4RO0A 1YR9A 4XWWA 2QM7A 2CUZA 2V45A 1J9EA 1QFZA 1XHLA 4FEGA 5BT8A 2KSQA 3QOFA 2G77B 2B34A 4E6PA 4JLSA 5A9TA 3HUUA 5DHRA 1NPYA 1YNSA 1U8UA 4C7OB 4DPMA 4TUYF 4X95A 1PNQA 4HF7A 1ZOIA 1XZ8A 1TVKA 4NICA 1Y1VG 1ZD5A 1P45A 3GXOA 3NUZA 1RC0A 3HVKA 3OQIA 4D82A 4EJSC 1FDUA 3N2ZB 4TZKA 3AFOA 4EH1A 5JI3E 4ZMSA 5DM60 2ONCA 1V16A 2ODNA 2I3AA 1I10A 4EEQA 4I19A 4ZVRA 3FE2A 4QFCA 2HEGA 3KJHA 4GOND 3ZW7A 5C53B 3DB1A 5TEVA 1G2OA 5FPQA 2XF8A 2KM1A 3DAFA 5A4DA 3TQQA 3INGA 1NN3A 1NQWA 3P2IA 3LLMA 1BMFD 1QYDA 3WWEA 2UXBB 5JG7A 4M9SA 3RASA 4CZ2A 2RGBA 1ZW6A 1SVMA 5ELMA 1G21B 3EISA 4XYLB 1L8QA 2R6AA 1FQWA 2Z6VA 3BG5A 1BIFA 1PTJC 2Q5HA 2JLXA 4JEHA 4R2JA 2ZJBA 3SJCA 4YS6A 3M9LA 4ZAXA 3UMRA 3BN3A 4DIDA 4F3RA 5ICCA 4FQ8A 4QBTA 1CVRA 1YC2A 3W5VA 3W2HA 4UEOA 1NIJA 2B82A 1AGXA 2G5CA 4NG4A 4LDZA 1JEYB 1IMOA 4DW8A 1KH2A 3GMSA 3P0FA 4QUEA 1IZ7A 2JGMA 1G5TA 3OOJA 2BHTA 4UUBA 4FJ1A 4EG4A 1KY5A 1EWVA 5EJGA 2XC9A 3LY7A 1J0DA 3UJDA 4C5CA 5TMEA 1Y8CA 4JUIA 3NYRA 2HCTA 3IYLW 1DTSA 3W9BA 2G4VA 4PO9A 4NYJQ 1QP8A 4XLTA 3ZI4A 4RAZA 5HP4A 2GN4A 2PANA 4B6RA 2JLUA 4EUKA 5JNLA 4YR0A 1SYXB 5IP7G 1AHNA 1C8KA 1FP7A 4PFKA 1XN4A 5DG8A 3IXMA 3LNTA 2BFFA 4R51A 3MINB 3UG6A 1S96A 4NFHA 3GEMA 1TJ3A 5MF6A 4F84A 1UDBA 3M1IA 3TFQA 3DBIA 2Q7XA 1F2VA 1VC2A 3VH3A 2Z09A 6ADHA 4F8EA 2Z5FA 4ZVPA 1U3WA 2WT4A 4CETA 4U6PA 5HQ3A 3OEYA 1XA0A 5TVGA 4RVNA 5KINB 1ZRSA 3LVQE 3AHHA 2YIVX 1T2FA 4LFBB 3PHIA 1X0VA 4WKOA 3L1HA 1UC9A 1DC3A 4F85A 3B7WA 3PV0A 1GNVA 2ZUUA 3K2IA 3CVVA 2W2NA 2XMRA 3WQHA 5KT2A 2FWRA 3QWAA 4Q12A 5C81A 5GIOE 2X0IA 3W1VA 1IK4A 1JIXA 3AEUB 1FRFS 3VU9A 2G1KA 3H1TA 4LDQA 3MJSA 1KY4A 5CFNA 5AUQA 2VEOA 2B8JA 2BGWA 2RGCA 4Q93A 5FDFA 3CUSA 2V7WA 1UDCA 2UYYA 5IN5A 5DI9A 4RZRA 4E1AA 1VGQA 1AK1A 3KYHC 4JV5H 1BWPA 4O4LB 1W88B 3KP1A 2Q6KA 5BRAA 2WF8A 2A7XA 2F3UA 5HMMA 2AN9A 2Y05A 1KI8A 5EIXA 3MR6A 2HWWA 5BW4A 4Y8VA 2QAGB 2C2GA 2VS1A 4H7IA 3RTEA 2V1UA 3TMAA 2OVFA 2HV8A 4P54A 3DWIA 5LXTA 4EHJA 2IPXA 4A2PA 1KETA 2B78A 3H1BA 3EPLA 3D0RA 2PKEA 1NMZA 3RWBA 5TARA 3AEYA 4GUDA 4OMCA 3ZS9A 5GJWC 3VR2A 4X6LA 4E5PA 4NU8X 1VIDA 1IPHA 1DEAA 4DIUA 2XRZA 1KF0A 3A1SA 5DLEA 3CNOA 1V96A 4CKCA 4EHBA 1XD2A 4JC5A 4LWPA 2HN9A 3EMBA 4YV7A 4DR3B 2WF6A 4LUCA 2Z5GA 1Q7BA 2A9FA 2ZSJA 1P2SA 1LI5A 5LQNA 2Z95A 4M1MA 5JVLA 3TR5A 1DJOA 4OV6B 1DVRA 1Y9DA 3IP3A 4ESEA 4HAIA 1QOQB 1D6JA 3FOZA 2DR3A 1KMMA 1SBNE 5T4BA 4YO8A 4B6GA 1U8TA 2PUJA 3PTLA 2VZ0A 1EJ0A 4O7NA 3KL2A 4PVCA 2WTFA 4Y2QA 3REOA 1T13A 4AS3A 2EJ3A 2JGEA 4FR0A 1H65A 1N5JA 4OKSA 4OLHA 2ZGVA 2B94A 5A3RA 4V3CA 3D0OA 4O8CA 2WHEA 5AM4A 3IAHA 3TJMA 2C4NA 1SG6A 1GZSA 4Y1GA 1WBJB 5A6VA 4Q4JB 4B33A 3RO7A 3OLZA 2C0CA 4N01A 2II6A 3DVQX 2GETA 3THWA 1Z45A 4CNQA 1YUMA 3SSMA 2D5BA 1Z28A 5FA8A 1R4AA 1KR5A 3BEDA 1CFJA 4AJLA 5CXQA 4S1VA 5IT5A 2P5SA 9LDBA 3HCFA 3RF6A 3QVGB 1O57A 2VTEA 4TYQA 3X2FA 4DY4A 3C7DB 1G3IA 1J97A 1GGFA 2VYND 2C9MA 1R9NA 4IMPA 3DE7X 4WERA 1J07A 3LFUA 3T9CA 4QOJA 5L3SA 5JALA 4D02A 3OMLA 3ANLA 2Z58A 4LWOA 1LQTA 3EJ6A 1EFTA 1NF2A 2DPHA 1L7EA 4M37A 1MPTA 5B3JC 4C89A 1PAUA 5IKMA 5HM6A 2PZAA 4IR9A 3G9UA 2E18A 1T3SA 2J7PA 1NZJA 5FULA 2O3QA 4K86A 4PGMA 2JHAA 4PX9A 2IK8A 4FYKA 5JAUA 1YR7A 1N36B 2Y99A 3QVMA 2YYYA 1U0LA 1EXDA 1G8SA 2I6FA 5D3ZA 3E22B 2Q5JA 5AW5A 2X5XA 3UXYA 3T1TA 3IQWA 5T5QA 4W1SA 4HPJB 3SX4A 1U9ZA 3AH8A 4X7BA 3GCGA 5ENZA 4IVPA 1TCAA 3ROFA 5TQ0B 1K4MA 1ZP6A 3GT4A 2HT1A 2UKDA 2D0DA 1W1WA 3FKIG 4K6GA 4XYMB 4OKNA 3GJYA 4PPNA 3KREA 3JW8A 3DYVA 2HQBA 5E1DA 2G07A 4BV3A 1NVAA 1E98A 3EF1A 4DIEA 2A30A 4HQ6A 2IITA 5D87A 2OQRA 3AR7A 1Q2XA 2BFPA 2N0SA 5IARA 3C4VA 4JYAH 1HLGA 3AUJB 5KX5A 1VHJA 1GUYA 1FW6A 2JAXA 1ORRA 4IZIA 3MD0A 1FFYA 3S55A 1S2OA 4Y2UA 1U5BB 7MHTA 1ZJ6A 3N42B 4JJKA 3W7AA 2R87A 4LE1A 2CDRA 2H92A 3D0KA 3EQ2A 4G2TA 4N0MA 3ETHA 5G40A 1QDUA 2ASJA 3L6EA 4TTIA 1NIPA 3ZIAD 4H7DA 2GK7A 1FP4B 4NCHA 3GJ3A 1AB5A 4P83A 2P8JA 5BT9A 3GFQA 3JRWA 4L0DA 3ABQB 1YI1A 4MEBA 3FHOA 4LW8A 3BZWA 1Z0UA 5EWJA 3D6TB 3TZHA 4XVUA 2BVNA 3I62A 2DP4E 5KFDA 3LUKA 3IEPA 3T99A 4K9SA 3AILA 3FZYA 1WNFA 1N78A 3F90A 5EJEA 3N5KA 4PXYA 2FDXA 3ZXUB 5E9JA 1GG2A 2Q2OA 3RKUA 1I4EB 3LGAA 1K5GA 1KE1A 3W3ZB 1E64A 4AQDA 5F3WB 2QYSA 3OT1A 4CKXA 4BLVA 2FN9A 2ZK7A 4TRJA 1KRWA 4RVSA 5EXXA 1ORDA 5K8CA 3IS3A 3MPOA 1CS4C 5CDHA 3O8NA 1QK3A 1K89A 3G49A 2R1ZA 1A2KC 3RBAA 3ZK9A 2H11A 5KG7A 1U2DA 4GXQA 2Q2WA 3T4EA 4MQEB 4B3JA 4C7XA 1E8NA 3IAS6 2V54A 2AI1A 3UYKA 1FUUA 1U4OA 4URFA 2R1VA 3GJ5A 3OQJA 1W44A 3JSAA 3BMCA 1XEFA 4YACA 5IC4A 1WE2A 3F96A 1ZOLA 4GMFA 1DE0A 2E4YA 1G3UA 1VRCA 4MUIA 4CL3A 4EYEA 1T2AA 1LLFA 5AM5A 2XE4A 3LA6A 3EFHA 4YBZA 1ZITA 4XB2A 4CM8B 3HR8A 3DMNA 2MSKA 3BQ2A 2V7EA 3V1TC 1T4BA 4CQMD 1I3MA 1ZGGA 2Y93A 3HOZG 1O08A 3QKSB 3IOYA 4RS3A 3EULA 4C05A 5F1OA 4P53A 1PN3A 1IFXA 1QRDA 4U7HA 3WIOA 4FMPA 5ESDA 2JBAB 1S8NA 1XEAA 2MYUA 4HQNA 4J3NA 2ZM6H 4DT1B 4JLUA 3NBYB 1VJCA 1ZICA 1A77A 3QVJA 1UR5A 2MT9A 2BJHA 1NAIA 5KFEA 2FETA 2HM7A 4OLFA 1XVLA 3HJCA 5I6DA 1AKNA 2YVKA 2NXCA 4EW2A 3ABRB 2I1WA 1V39A 5IH3A 2YHIB 1QPGA 3UMFA 3AFGA 2HBQA 1H66A 3UWDA 1P33A 2ZRMA 3SD7A 2HWXA 4L2IA 2CMGA 1OXKB 1GTL1 5K7SA 4Q7KA 1S01A 4FYJA 4J16A 3LZDA 1QG6A 3FB4A 4K6CA 2VSYA 2JCBA 4EG6A 3ZE8A 4TS1A 2DUJA 3W34A 3KFLA 5M5BA 5FUVA 1MOSA 2OBNA 3QOYA 3RAPR 1JEOA 1JXQA 4WLNA 2E49A 4KTTE 1EBUA 3V00A 1Z0ZA 5LJIA 4GC7A 3PF9A 2VOJA 2PWZA 2YU9A 3PD7A 4AIIA 2HGXA 1VQ1A 2FFBA 1JTEA 4JI8B 1WU7A 4HQKA 2AE2A 5CNMA 3B5EA 2ZM5A 4GZLA 4YT8A 2CF5A 3CPHA 2NUPA 1PO7A 5FL7D 3MG9A 2ZB8A 2UUBB 3I37X 4AULA 3W8RA 3BRWA 3HB4X 4YJHA 4ZRMA 1Z29A 4CHTA 4OQFA 4XR9A 3I2GA 3GNQA 2REOA 5ALLA 1Q15A 4QWMA 4CKWA 4F1JA 1JJAA 2Z04A 2PSJA 2VF4X 3IT3A 5EKTA 4XOUA 1R0SA 2YNMD 2BM9A 3SFTA 2RDIA 2VPXA 3LP8A 5DVZA 4RPCA 4HWOA 2AWNA 4B35A 1U0SY 2JFPA 2Q2NA 5K3AA 3SY8A 1FK8A 2QROA 4LZOA 4X1KA 3PR1A 3NNNA 1W96A 4MUFA 4Q02A 4JQOA 1XKXA 5TGDA 1IH8A 1VJRA 4BCCA 1UQUA 1FFDA 3DEAA 1E2IA 2F1RA 4YCSA 3ENVA 4JLWA 1E3DA 3TIIA 4GM4A 5JPIA 4B74A 3B9PA 3C24A 8AT1A 1H2AS 2I4LA 4FBGA 4XR4A 4K9PA 1PEKE 5DO9A 3OQ1A 4Y9UA 1V25A 1F2DA 1HRDA 3T0GA 4JLVA 1I1OA 5B3AA 4J90A 3ANYB 4WOJA 2VWPA 1YDMA 2ISSD 3L79A 3INRA 1XQXA 4OI1A 4I4TF 4MI6A 1WZUA 1E5QA 1EP3B 4KE6A 2N75A 5HKOA 3GJSA 1CJCA 4TZ0A 2BQUA 2JAUA 3ESBA 5DYYA 2Q9BA 5E8RA 1G8FA 3PC6A 2PKXA 3K0FB 4XQEA 1XZIA 1NNI1 1VKRA 2G70A 2J3HA 3BFVA 1GSIA 4UBKA 3A0UA 1PL8A 1IHYA 2FEKA 2GZ1A 4O0MA 3U31A 4RPLA 1JF8A 1AURA 3FTPA 2QPAA 3RV3A 2H1LA 1OXMA 4GXRA 3F4BA 4FC6A 1KY2A 1BXRA 3K35A 4PHFA 2FZGA 1O3YA 1OX4B 5CDYA 1JR2A 2FWJA 3WHIA 1BFKA 4L7VA 1KEKA 4YGXB 1BQEA 1EI9A 5JY1A 3QW2A 3OQMA 5LL6b 3O47A 3OPVA 5CBPA 4ND3A 3BMCB 1FP2A 4QUIA 3E61A 4NMMA 1R18A 1FE8A 5GGYA 5LMCA 2HSWA 4YALA 3CVWA 3ZHUA 2CYBA 3VDRA 1E7WA 3K1ZA 2WZBA 2XRMA 4ZCIA 1SBIA 2QTAA 4HFJA 3UAVA 5B2FA 2PRYA 4LQLA 4B83A 3VHQA 3G6WA 4DUGD 3Q5GA 3CLTD 4YBZB 5ENVA 5KZMB 4GL4A 1NZDA 3M9NB 3JAMA 5A7FA 3LT0A 3ZIDA 1ZEJA 3VO8A 2AN4A 5LQKA 2EFGA 4B4UA 1V8ZA 2YYSA 3S6JA 3W78A 4FUTA 5DNAA 4BVGA 1NTRA 4UOEA 3QEOA 3CB4A 3OD5A 3G6XA 4EA9A 4AUEA 4BO4A 2HLPA 5E4FA 4NEQA 1MOPA 1L4UA 5GM1A 4BCBA 5JMWA 2E5LH 4ZPJA 3WYFA 2EL7A 3UNXA 2RGNA 3EXHA 1F2TA 5TS3A 1OA0A 4ND1A 3L8EA 1I6MA 4C2AA 1CWUA 1G59A 1N75A 3N7AA 1KAQA 1LLQA 1CUSA 5KVVA 1NKVA 2D00A 4XUGB 1R6XA 4KQGA 3QPDA 1HMPA 1TI7A 4F3TA 3IIKA 4KWTA 4A8JA 3WWJA 4GX2A 3VUFA 1XSEA 2CUNA 2I2WA 2OO3A 3LSTA 2I29A 1XB2A 3Q85A 4KV7A 2GQ0A 2GCNA 1HKHA 4UPVA 2GQRA 2YWRA 4JOSA 2O1SA 2XQGA 4OUDA 2VFAA 2FH5B 2NP7A 1P8JA 2QRVA 4POOA 3K9WA 4EB0A 1MIHA 1HSZA 3KUDA 5I9BA 4GRIA 3AIKA 4I0WB 4L73A 4J1TC 2LR0A 2GFIA 1RKBA 3TTUA 3DHYA 3WZLA 2BYTA 3B5IA 4GLJA 5J2UA 1A7UA 2FPUA 1NW3A 4Z8XA 4YAJB 4C7MA 4GP6A 2ACEA 4L6AA 1JMYA 2F90A 3VHRA 3H84A 3SSAA 3PUWA 1O0BA 1L5OA 5B57C 1EFRA 5LA6F 3KXYT 3I5XA 4YASA 2H16A 3A2KA 2RK4A 1ECBA 1RTKA 3JWJA 2NUPB 1NVFA 3T1OA 2H2IA 3QUAA 4BFVA 5AI6A 5TLSA 4NHEA 5CPBA 1F3OA 1O95D 3KSRA 1V41E 1NUAA 3WIUA 4B4VA 3D8NA 4OU4A 1TKCA 4MQ5A 4RJJA 3TLYA 3IGFA 3PNKA 3H0GG 2F59A 1NOJA 2NADA 3LTNC 3CN7A 2V6FA 5IAOA 1N5LA 1N6PA 1GSAA 5A3QA 3AEQB 2AYXA 5LQSA 2F3PA 2XODA 4A3JG 2WYUA 3REFA 1P9NA 5BW6B 2EJCA 4MPPA 3V34A 5BNIA 4Z9BA 4K3VA 3E9RA 5KFIA 3N2LA 4Z0TA 5CNKA 2WSYB 1KOLA 1ZRHA 2X9LA 2HF7A 5JSQA 1U7TA 1GZUA 4CKBA 3GUZA 2NZ2A 4F2GA 2XB6A 4M8SA 3HEAA 4JMLA 3ZWNA 2AC4A 4H60A 1I2MA 4BFUA 4I3FA 1R15A 1E61A 4G5SA 1R27A 2HJHA 1FLAA 4CFSA 1BA2A 3GTJA 3AIIA 1GGNA 4WAUA 1YJ5A 2H2AA 5CIQA 4H15A 3J81k 1SHKA 4IF6A 4BAZA 5KSPA 2Y0PA 1QS0A 4KOEC 1ZHSA 1KT8A 5I5YA 4ZCRA 5A6SA 5BSWA 4K6NA 4QRIA 5JRDS 5DHFA 4CUKA 4AJHA 1ZZEA 1SC9A 3M3PA 3GLIB 5C8ZA 1W5EA 2J0VA 1GHTA 2MR6A 2XNDD 1VL6A 3B48A 2BMVA 4IJMA 1TZJA 1VPWA 4HAZA 4F7WA 2FK3A 1J21A 4JI6B 1P2UA 3LKDA 1W5TA 1SQ6A 3TOCA 4BP8A 4L0QA 3F3KA 4QDJA 4IJKA 1I5OA 2ZUTA 3N7TA 1VCNA 3L0YA 4BFYA 5EHZA 1TWHA 1TECE 5IS2A 2FZ5A 1LWOA 1PV2A 1M8FA 1HL7A 3AUYA 3O4GA 3VMFA 1HG0A 4UVDA 3E3LA 5HCIA 3UXEA 2NZVG 3UV7A 3GJ0A 1RADA 4DBLC 5L1IA 2ZW9A 5IYZF 3KLMX 5AW6A 1J33A 4KN8A 1XMQB 4EG0A 2NX2A 3HOWG 4N48A 2GO1A 4G1FA 1RYMA 3ZHSA 1BVRA 4BRUA 1I94B 2PFGA 1M6NA 1TJPB 3ZDXB 2O05A 2Q9UA 2HYIC 3T3IA 2BM8A 2D5LA 3UF0A 3JQBA 4D8XA 2QTWB 2VSFA 2HF9A 1RKUA 1YKSA 3TKAA 2YRFA 1ZSYA 3UPUA 1G16A 3ZTYA 3GY0A 3BHJA 3H40A 1WVIA 3IUQA 1H2WA 3HADA 2PKYX 1K7CA 3TRKA 3D9QX 3HI4A 4KWCA 3I6BA 3TZKA 5AVZA 2I2CA 3W8NA 3ZWXA 1X7YB 2RAFA 3R9KA 1GUAA 5BN4B 3QVXA 2O2SA 5ALHA 3S1LA 4PLPA 2AEEA 3DV9A 1PG2A 2ET6A 4JA2A 1F60A 1NATA 1AN7A 4CMKA 4ZT5A 2K5UA 2CLHB 3CIFA 1Q0UA 1JQLB 3E05A 5KWVA 2C94A 2FPMA 1O96A 3VDNB 3ETEA 2PJZA 4G5YA 4L7QA 1ZH0A 3VSEA 5IJ0A 1PZGA 3C3MA 1NBMD 4O08A 4A4DA 3CVZA 3IKVA 1SY7A 1VKHA 4OGLA 4GWKA 2FI1A 1KNQA 4AYBE 3TXYA 4FWTA 1NDHA 3M9XA 3QEBZ 3D8TA 2ZUVA 2WUEA 2VSOA 1L6RA 3BK1A 2O7SA 1R12A 4P9NA 3B1WA 4ON9A 5L53A 3HYRA 3VKVA 3K70D 2FN4A 4RADA 4DIKA 4O1MA 4UNNA 3RS3A 1KI6B 4NU0A 1AKYA 2LE0A 4HTFA 3IC5A 3CLSC 1TD9A 1EFLA 1A9ZA 3DL4A 2WV7A 3ORFA 4L15A 4ITUA 2G83A 2Y4NA 2QLLA 3L4BC 1UMDB 5JARA 1Y6JA 2GWRA 2A2ZA 3Q8RB 1CXZA 3F2VA 4MIKA 4MQLA 5FUMA 2HSZA 1TCUA 1SIUA 2DY1A 4AXBA 3WKAA 4KGZA 4R71A 4BE4A 1CRZA 3JWIA 5K20A 4WJKB 3IKTA 5AW9A 4LMAA 1QUEA 1RMQA 4J4HA 3WIBA 5E1MA 3L7CA 1YZLA 1N6IA 4D7AA 4BZZA 4QYIA 1TYBE 1W4AA 2CNLA 4UUOA 3OEWA 4DV3H 1E63A 2ISCA 3KJNA 2MSCB 3ZYCA 2R5NA 2CLKB 3DBVO 4RTMA 4D4LA 5K0NA 3ZV5A 4C6TB 3O8OB 1A9SA 1E4VA 1EFDN 1OXTA 4CKBB 1ZLXA 3HCPA 2X9VA 4RK7A 3MT9A 3G3EA 5DWVA 3TTSA 1R3UA 4PXAA 2Q4BA 5G4KA 3W8EA 1B0AA 5KNDD 4KLNA 5C4GB 2A59A 4B40A 1R9JA 1JQEA 2ECFA 2LCFA 2QR2A 4C7VA 4RHFA 4PHHA 2M6LA 4NNPA 1QYCA 4FHCA 2BGRA 4K3UA 2CJPA 4Q7JB 3PYMA 3HY4A 5SY4A 4X71A 3G5AA 2XMGA 1YV9A 3F3SA 5E2IA 1XZEA 2CZCA 4AF8A 3Q8QB 4UUGA 1JU3A 3PNBA 3WZ2A 1NW7A 3I5MA 3V5NA 4JYCA 1M54A 1HQCA 4OYYA 5EXEA 3RB3A 1UDAA 4H4CA 2Q4TA 1U5AA 4EM6A 2HJRA 4NEGA 3S1AB 4BY7G 1ZN2A 4HGQA 1WZNA 3O75A 3K73O 1DWUA 4MR7A 5GADl 2YBDA 5H70A 2PSSA 4LV6A 4ED6A 3MS4A 3B1ZA 4E4YA 4ZQIA 2L0XA 3DKVA 3S2SA 2CVOA 2F8TA 1Z16A 2B30A 2JFWA 4I5IA 1MB4A 3MAGA 5JNVA 1NL3A 4C4RA 2BEKA 3EPJA 3IJ5A 2FK1A 5K51A 4YI3A 3RYHB 4MRNA 1KK1A 3CNQS 1Q44A 4O86A 1T5IA 2FZVA 4PBTA 2FRXA 4ECXA 5FBVB 5C1BA 2BFWA 4LY0A 2QF7A 4P2GA 3ERCA 4ZYTA 1NJ1A 1XDUA 1F2UA 2QTFA 1E5VA 4CEIB 2A0KA 4IG4A 3HCEA 1GPAA 1AKWA 3LULA 2K4MA 5CX1A 5LMZA 2D1QA 4GW3A 3A10A 1VGVA 4DL2A 4PGFA 3DO8A 1HEIA 2ZIXA 3F78A 4NG5A 2Q3DA 2ZQ5A 5E1OA 1KI7A 3C3BA 5A1TA 3UQYS 3UZBA 2F9LA 4ZQFA 3OH8A 4WXMA 4JBXA 3II6X 1DWQA 1T6YA 4HS4A 1IBCA 1VMEA 4HH0A 1VSTA 4RPKA 4YY3B 2NTYC 1OI3A 1P61B 4DC0A 3MQ2A 3UBMA 1PFVA 5IJ0B 1T1SA 4YYZA 3STHA 1ECPA 1A76A 2PKWA 4L57A 3ZJUA 5CD9A 2V6GA 1T6ZA 2R00A 2B3DA 5JWHA 4BX0A 3GIKA 1VHQA 10MHA 2PLFA 1LA2A 4AC9A 5JAQA 2Q4OA 4QEDA 4QOHA 3UH0A 1PYOA 1ECLA 1EAYA 3CJTA 3FKQA 1P4SA 4I4TA 3W1BA 3TDKA 4BP1A 2JW5A 3K1AB 4JN6B 3EH1A 3N86A 3G0GA 3BMQA 3IULA 4FVTA 1M2VA 1C4KA 4IHJA 4J9RA 4HTFB 2QN3A 3MWMA 4Z1OA 2HHHH 4OAPA 3HXMA 2WWIA 3TTXA 2Z5VA 5IYBG 3TRFA 3ZHZA 2HLNA 1OFVA 1PGQA 3HY3A 1K06A 5BN3A 3LT1A 4XD7A 1T29A 1XCJA 3QA3E 2R2GA 1GPJA 2QUZA 2FJZA 4JC0A 2CT8A 2IVFA 3LO5A 4KJXA 1TYCA 5CVUA 4GVPA 4UZFA 1EVLA 1YMVA 4ENSA 4D97A 3MJFA 1P6QA 4CTJA 4IUYA 1C7ZA 3STUA 4ETSA 4CIYA 3JR3A 3HXTA 3LXUX 1SBCA 2EVWX 1NJFA 4CODB 4U6SA 4MUNA 1RAIA 1W19A 2VWHA 1COWD 4U8GA 2WHQA 3DM9B 2OPHA 5CEFA 2XOKA 1QWSA 4ZVTA 3DUFA 1ZMBA 2WIAA 1YFJA 1VAJA 5HRCA 4KNVA 4RW0A 3KB8A 2V0GA 1I2DA 1ONSA 5KC9A 1IG0A 1PUXA 5C4MA 3NYIA 4PR0A 3QHPA 1NY5A 4QOGA 3GZTB 1X7XA 5CLHA 3I6QA 3ZEIA 4YHBA 1MN6A 5K3EA 2WHPB 3ZZNA 4EUFA 3SR4A 3DVAB 2OGTA 3EIEA 3HT5A 1ORTA 2A5YB 4JASB 4MWEA 2QDKA 4Y6QA 2QG9A 1VKNA 4IX9A 3IO3A 3ZV3A 4MGEA 4BLTA 2OHXA 1T6XA 4A0HA 3AJRA 4YCCA 2HWKA 5C5EA 2F4VH 1M10A 1TMKA 3KHKA 3LE8A 4RNMA 1G6OA 6AT1A 3PZBA 1TQ6A 4W99A 4UW9A 3WAKA 4IOKA 1XTBA 1LFDB 2YS7A 5IXJA 1P7PA 3A11A 1LV7A 4RNDB 5IABA 4FM9A 4O2BF 2VOBA 3RW9A 4CMJA 2Y0DA 1X9IA 3DPUA 4AN1A 4WY5A 1BFDA 1ODCA 2G9ZA 1JV2B