2GLTA

Structure of escherichia coli glutathione synthetase at ph 6.0.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
316
structure length
296
Chain Sequence
b'MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE BIOSYNTHETIC LIGASE
publication title Crystal structure of glutathione synthetase at optimal pH: domain architecture and structural similarity with other proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthesis, ligase
total genus 100
structure length 296
sequence length 316
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2gltA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2gltA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gltA01
4O7RA 3MWEA 4IHJF 4FFMA 2R7KA 4O7TA 3JZIA 3BSWA 5JQGF 1GLVA 1KJIA 3Q2OA 2GLTA 3TW6A 3VOTA 5I47A 1KJ8A 1EZ1A 3HBLA 1KJQA 1IOVA 4EABA 3MJFA 2W6QA 3R23A 2ZDGA 2NU6B 1T36A 4FFPA 4O2BF 5JQWA 4O81A 3R5XA 1BNCA 4FFOA 4C5CA 1EUCB 2YS7A 2WYOA 2YZMA 3OUUA 5C1PA 5LOVF 2GQRA 5CA1F 2W6MA 2YZNA 3KAJA 1DV2A 4O82A 2NUAB 1KUTA 5JVDF 2R85A 3V4SA 2VQDA 1I7LA 3VA7A 3QFFA 3K3PA 1CS0A 2YL2A 3N8DA 4ZI7F 1CQIB 1JKJB 5C8YF 4O7ZA 3U9TA 1M0TA 1VBHA 4EG0A 3KREA 3LWBA 2J9GA 1KBLA 4O86A 1KEEA 3E5NA 4RZQA 2VR1A 4IIJF 3UFXB 5BPFA 2W6ZA 4EAAA 2YRXA 3HO8A 2R82A 5BMVF 2C00A 3K5HA 4XYMB 1KC7A 5H80A 2CNQA 3K5IA 4O4IF 2Z02A 2FP4B 2I87A 4Y8VB 2W6NA 3I12A 2PVPA 3TINA 4FFRA 4O7YA 2X0SA 2FPPB 1JLLB 3G8DA 4FGRA 4MV3A 4O7NA 2DIKA 4FE2A 3KAKA 4MA0A 4DIMA 3LP8A 3RFCA 4C5BA 2OLSA 5J2TF 2YRWA 1C3OA 4MV8A 2W70A 4FU0A 4YJ3F 4M9UA 3MWDA 1UC8A 3ETJA 5HV6A 2R6FA 4YJ2F 1CQJB 4IWYA 5HBRB 1A48A 3JZFA 1C30A 5J2UF 4EA9A 4HQ6A 1PK8A 1Z2NX 2GQSA 2DWCA 2QF7A 2ZDQA 1EUDB 2FPGB 2YZLA 3R5FA 4O4HF 3ORRA 5LYJF 2QK4A 2W6PA 5EZYF 3R5HA 3G8CA 1B6SA 1W96A 4M98A 2VPQA 1DIKA 4FFNA 1M0WA 5LP6F 4O7WA 2I80A 4MAMA 4FFLA 4NYEA 3U54A 2W6OA 1JDBB 1KJ9A 4E4TA 5IYZF 2R7MA 2P0AA 1M6VA 2NU9B 4WBNF 1GGOA 1JDEA 4IWXA 1PX2A 2SCUB 2XCLA 4TUYF 4QSHA 2DZDA 3GLKA 3VMMA 3Q1KA 4I4TF 4EA8A 3R9RA 4MV9A 1B6RA 5D8DA 5LXTF 1UC9A 1A9XA 3AX6A 2YWVA 1WR2A 2YYAA 4HNVA 4O4LF 5DMXA 3RV4A 4MV7A 2VHEA 3SE7A 4EA7A 4YB8B 2Z04A 2W71A 2PN1A 2GPWA 2V59A 1I7NA 2YW2A 2CZGA 1DV1A 4YBZB 2FPIB 1E4EA 3TQTA 3V4ZA 5BPHA 2ZDHA 2CNUA 3BFPA 3RUPA 2CNVA 5CA0F 3N6RA 3AW8A 4HNTA 1OBGA 2R84A 4ZHQF 3U55A 4O4JF 4TV8F 3JRXA 4XYLB 4O7LA 4EGQA 5KX5F 1GSOA 1KJJA 4MV1A 1VKZA 2FB9A 3KALA 1BXRA 3ORQA 3WO0A 3HB9A 1OBDA 2NU7B 4I50F 4TV9F 1SCUB 1CE8A 4IZOA 2I8CA 4C5AA 2HJWA 3GIDA 2CQYA 5CAEB 2NPOA 4O7VA 4MV6A 3TIGA 4WD3A 4ZQIA 3VPCA 1GSHA 2V5AA 3BSYA 4HNUA 5K2MA 1AUXA 4MV4A 3U9SA 5JVLA 4O2AF 2HGSA 3BSSA 1EYZA 4HR7A 2R87A 3BG5A 4I55F 4GGMX 1VBGA 2IP4A 3NUAA 5JH7F 4YAJB 5LA6F 2PBZA 3VPDA 4O84A 2NU8B 2GPSA 2DLNA 1Z2PX 3JRWA 2R7LA 4M9CA 4O7SA 4ZOLF 1E4EB 1GSAA 3VPBA 1IOWA 4YAKB 1AUVA 3TIIA 4XX0B 1W93A 3OUZA 4L1KA 2XD4A 3ETHA 2R86A 5CB4F 4MA5A 4EGJA 3DF7A 5C1OA 2R7NA 4O83A 5FNVF 4J6EA 2V58A 1EHIA 1Z2OX 2YS6A 5GONF 3WO1A 4ME6A 3RV3A 1ULZA 4M99A 5KKNB 4XZ3B 3WNZA 2YZGA 4DLKA
chains in the Genus database with same CATH superfamily
2O48X 1YQ9A 1ONBA 2ZJ4A 4REMA 5BMOA 2CUZA 5FOWA 2WE8A 1P1IA 3LK6A 1ZJYA 4WESB 3QVLA 4G5QA 4OQLA 2GYWA 1NLUA 3VR3A 5CVEA 1Z36A 4HD8A 3P4XA 4HAIA 1KJ8A 4UDOA 3IGFA 1KT8A 4PYNA 1SXJE 1K66A 3WLNA 2VNSA 3EA4A 5KWSA 1N9KA 1E20A 4MYUA 3B3GA 1T0JB 3RHFA 3VISA 4AZ0A 1A0OA 4RTJA 2ZVJA 4ZTBA 3ZCVA 2G0TA 3G49A 2YJ3A 1RE0A 4H7PA 2HZBA 1QYWA 4RVOA 5AW1A 5IDXA 4NYMR 3NATA 1N56A 3PNYA 3HMQA 2RGVA 4FPXA 1W1WA 3WGGA 1FBNA 1Q21A 3I1YA 3BA6A 1GXSA 5M7EA 4XIYA 4PC3A 1S7CA 4O86A 2HWXA 4WINA 2XZDA 4RZQA 1QO7A 3G2NA 4ISCA 1T4GA 1HMPA 4NXNB 3JZDA 2IYZA 4FC7A 3PC4A 4TTVA 3NBAA 2EOAA 3B85A 3LPCA 1W581 5FBLB 1FYFA 2Y1WA 3BFJA 2BCGY 3TLJA 1FSPA 3AVVA 4EEQA 5EN4A 1QZUA 1QP7A 1U0FA 3K9FC 1OWOA 5AK4A 1OZHA 4DY6A 2APJA 4BWYA 2H59A 2JBAA 2JFBA 3RVQA 2EX4A 3KDPA 3RB4A 3WR5A 5IG2A 3Q8SB 3H7IA 1SXQA 3RSZA 1OIVA 3AEUB 1MPTA 1KVQA 4H0FA 3PVZA 1FW8A 1FP4A 2VPSA 4JP3A 2O3UA 4G5FA 4UTPA 4YMWA 1E89A 4YIHA 2CE7A 5C1IA 3PF9A 1M0SA 4CF7A 1E2PA 4MUGA 1CKNA 2OQVA 1ESCA 1EGHA 4ZV9A 3Q2IA 4HDSB 3HYNA 2OUIA 4DCCA 3O84A 3G8CA 1W5EA 1Z2EA 5DBEX 1T8WA 1OB2A 1JPVA 5DLPA 4LHSA 4OG2A 2W6OA 3NH9A 1WXQA 3ZY4A 2O8DB 1RDFA 1DRVA 3A25A 3DT6A 2Y71A 1OI4A 2XAAA 3G2QA 3LDHA 3A1TA 1SD1A 4FR0A 3IN5A 1PGPA 3EZXA 3NJ4A 5IARA 1YSCA 1V3TA 1SB9A 4EF4A 1GSIA 4M53A 4RJJA 3GLQA 3LOQA 1UMBA 4TL6A 4FS1A 4ESHA 4JKOA 4L4RA 2JK0A 3SLKA 2FSVC 3E81A 1TKAA 5AVYA 5KDLA 4C4PA 4YRRA 1Z4KA 2EQBA 3GJ3A 3ZWAA 2B3TA 4PNEA 2W7TA 1EZZA 4WCFC 4AF6A 5HZMA 1Y6GA 4BKRA 1TIKA 4MMYB 5IBPA 4GXNA 2JJ1D 2F3UA 3G2IA 2IX3A 1VJ1A 1K97A 4F6LA 1JIKA 4KN5A 3AI2A 1SG0A 5L53A 3I23A 1IEWA 2F1JA 3ZWKA 4HB0A 6PFKA 3N58A 3L6UA 5JUMA 4OOFA 2VJDA 5KFDA 3AJDA 3GQVA 4P82A 2N46A 3FMAA 5I5GA 3MLEA 1ULSA 4I81A 3EFEA 4JLJA 3KM0A 1O94A 4DSTA 1TZCA 3OHAA 3ADKA 1DAHA 1V45E 4XLLA 3TOSA 1BFDA 3IUBA 3G5TA 3DL7A 2EZ8A 3KPYA 3JYNA 1GSAA 5EUCA 2DXIA 3KHKA 4L4XA 4B5KA 5BN4B 1S9HA 1W88A 1Z37A 4HOYA 3WKAA 5ADHA 2REBA 4Q9HA 3L8HA 2BOVA 1SFOA 2A5YB 3M4ZA 1JXLA 2CFIA 3HWRA 5L3ZA 3KETA 5GONF 2HCFA 5AP9A 1F5NA 5DULA 4O7TA 1E2FA 1IK4A 1SB8A 1G60A 1T5IA 4MJ3A 3OO1A 1Q19A 1YL7A 4U2BA 1FZQA 1L7PA 4RUKA 3CLTC 3RUEA 2OHHA 2OOSA 1HTWA 1KYTA 1T3ZA 1WBDA 5F3RA 2FN3A 3CV3A 2GEVA 1H22A 4IEFB 3I39X 1JEOA 2HNAA 4HG2A 4QTUB 1C1XB 1USGA 4ZRDA 1CRPA 1RM5A 2ZT7A 2ABJA 2MYNA 5DV9A 4QU0A 3HFJA 2Z5FA 2ZJ5A 3OZVA 3VNBA 5IJXA 3D1LA 4W7IA 5C8DA 3SN6A 4F4YA 2NT3A 2ZUBA 5H4HA 1BJTA 1L7BA 2YL2A 1MC4A 3OEED 2WZQA 5E6UA 5EXEA 4YT5A 3KTAB 5ALTA 3UQ8A 1DUSA 5DBIA 5G0WA 3M49A 1AKUA 2NYRA 4ZREA 1CUSA 3N0RA 3A4IA 3P9ZA 1E4GT 2WUVA 4ZZ0A 3OQBA 4LOAA 4NEQA 4GPIB 4UNPA 5HE8A 4MPTA 1YT5A 4D57A 4HWKA 3T9FA 4K05A 1LKZA 4B8WA 3B53X 5KFKA 2W6JD 3HWWA 3PYLA 4B3MB 1WNFA 2XGJA 4R2JA 5B36A 4EFNA 1XFDA 1ZONA 1U3FA 1I2DA 4ANFA 3ABSB 1C7QA 2IZ7A 1F4VA 2VTBA 4RSHA 4KTVE 5A04A 4GKBA 3WJAA 3ICVA 1FUYB 3T9BA 4O3PA 2BPOA 3NC0B 5EZ5A 4K7JA 3MERA 3GFOA 4DLWA 4MOWA 3CCBA 4IMRA 4C0KA 1Z8HA 3KSBC 4JXXA 1N48A 3OOYA 3LUKA 3PXUA 4ECEA 2HSWA 4HGNA 1P5ZB 3A11A 5HKAA 2R5NA 1PZMA 1DQPA 5SYMA 5AW2A 3G6WA 3VDQA 2B5VA 1SEVA 1RQGA 3KVOA 1VMDA 3UM9A 4RQBA 4ER7A 2B8EA 4GYWA 4ZK6A 2A8YA 2FKNA 2Z8YA 1NLYA 4WXMA 4UEOA 1JDEA 1JNYA 3UUWA 5BO5A 2BYTA 5A62A 1OC2A 4RB3C 1E7SA 1Z0FA 4GE0A 2UZ0A 2EL9A 4L4SA 1W94A 3H17A 2RAFA 1Z4MA 4P0QB 4XTRA 4YMIA 5FAXA 3RIEA 2GWHA 4WOKA 4O3NA 4M89A 3KQNA 2E87A 4ZYZA 3C16C 5A9TA 3CF4G 4I0WB 4YBZB 4U63A 1V2HE 5KOIA 3OWXA 2AXPA 3E58A 1G8AA 2HD4A 4ZHQF 3A2NA 1O77A 1OX4B 3ER8A 1Z39A 4QYSA 2RHDA 2PX6A 3DQPA 3EPRA 1K7YA 4ZZ3A 1EHYA 3BWXA 3TRDA 2W9BA 5EXPA 1MG0A 2C59A 3T15A 4ERNA 1LF5A 3MBOA 3RVMA 4PGFA 3ZN2A 4IDDA 3RYIB 1Z8DA 5F7JA 2J45A 3ZVNA 3EHEA 2OG2A 1IN7A 2FRVA 3OQPA 5A3SA 4YJ3B 4JJIA 1Y1SA 1K6EA 5G4KA 3C6ZA 3W6NA 4UM9B 1PZNA 5EIBD 4MEAA 3U4CA 4AMZA 1JFSA 4HBZA 1AZSC 4GWKA 5CR5A 3HR7A 1VLZA 1HL7A 4Q4JB 2QWXA 2PTHA 4FKZA 5KINB 2F9LA 4XARA 4V2UA 4O7SA 3WHIA 1IC6A 4ED2A 5FI1B 3L1JA 2H52A 1HDCA 3T1OA 2JI9A 2HU2A 4EHAA 1XO1A 4UUAA 3RVJA 5TT1A 4OM8A 2AXEA 2CFRA 1Z0DA 4RORA 2IZZA 4LGCA 5CEJA 3CISA 4C07A 4G0XA 2XGQA 1NMQA 1Y81A 2H31A 1I2AA 1QE0A 1SUCA 4LA4A 4WBXC 4R8MA 2OBBA 3L6CA 4UBLA 5EJ5A 2AXNA 3DO5A 5BV7A 1SK9A 1HYHA 3X2EA 4DR2B 3GJZA 1KJIA 3VZBA 2IH4A 2EJVA 4DRFA 3TD2A 1EDDA 1NDUA 2WFMA 1QIGA 4QATA 3TO5A 2PCJA 1ZD1A 1BQ3A 3MJHA 3G0BA 3BILA 3IA2A 3FNQA 2WK1A 1LZKA 1P6QA 3NJRA 1LDEA 2KLHA 1XU4A 2X0RA 3P2JA 3WLAA 2R8GA 4D0LB 1DV2A 1U7XA 5CA0B 1XCMA 4JIMA 2ZI5A 1YNOA 3ASUA 3B8HA 4AJKA 2FKLA 4MDEA 2JLAA 3UYKA 1UJ6A 3WLIA 3KREA 2DFKB 4J0HA 3ZDYB 2VAPA 3VR1A 4PSUA 4MQBA 3K6SA 4BDSA 2JIZA 3TNDA 1WKBA 4JYAB 3H3XA 2VWGA 1Z38A 3PTZA 5C37A 4C3UA 4PQFA 4ZO9A 3R76A 1YDMA 4J0KA 4R2KA 1N9GB 2WJIA 3TINA 1H0KA 1JA1A 4JZKA 5C3MA 1T1JA 3A3NA 2CDRA 2VRBA 5HDBB 4EFBA 4BRZA 6LDHA 2B9EA 1C30B 4A0RA 5KYUB 1WZIA 3W78A 1HC7A 1W73A 5TEVA 1QYXA 3RC9A 2NVWA 1X7DA 2WTEA 4UCWA 3S24A 3B2QA 2MINA 4H3VA 2WSMA 5HV6A 1WBBA 2IGTA 2CFTA 4B8YA 4D43A 1V8ZA 1NE2A 1TYCA 3WWZA 2B4QA 4Q03A 2ZE7A 2OD7A 1A9SA 3MINA 2HWWA 4BO5A 4X44A 2O2DA 5HCNA 4JYZA 3QW4B 4I4LA 5K0EA 3AUFA 3ONVA 4I6GA 4YLYA 1TCAA 3O8NA 1XL1A 1GM5A 4YRIA 1TCCA 2IMWP 4IH4A 1J97A 4KOEC 2V4QA 3KXKA 2G9QA 1BXGA 4H15A 5KYGA 2VJAA 4PYQA 1H1LB 4C0JA 2VDQB 1SU4A 4DV0B 2PJZA 1QFMA 1T5LA 1KYYA 4PR3A 2ZU6A 1P9LA 3LZCA 5LMZA 5TPWB 2GZ2A 1MIHA 1X39A 4DL7A 1G8FA 3LVRE 3DMRA 4IKOA 1IPEA 1PWYE 4FBMA 1RJEA 4EY7A 1KJWA 3I28A 1UZMA 2HSGA 4B4WA 4HB2A 3TLMA 1N8KA 1N2XA 4KR7A 3N39C 1OMOA 5EOVA 2NG1A 4IJWA 1DV1A 1EFTA 1XLVA 3NC0C 4MKIA 2R0QC 2W2XA 1W34A 5CDFA 2V6FA 4KNVA 2CW8A 2R84A 2GEJA 4F5YA 5A5GA 3O8OB 5DN9A 3EE6A 4Q9DA 4H7DA 1HORA 4PLYA 5KYYB 5I5SA 3HUUA 3EXIA 2KWIA 2RDMA 3Q3HA 1ACLA 3THYB 4KFTA 5KVSA 4JBIA 4YAOA 3KOXA 4IRCA 4KK4A 4F6RB 5A71A 4F92B 4H7JA 1FFWA 3F9RA 3R3UA 5ERYA 2VDNB 3NFYA 3TOVA 1DO8A 5J4KA 2WTBA 3THSA 1FNSA 1RVDA 1Z8NA 1VHJA 3IVRA 4M6WB 2M2IA 2C2MA 5JLAA 4MUEA 1E4EB 3RUHA 3TIIA 3KYCB 4O5OA 3L7JA 1EE1A 4IO0A 1S0OA 4YV0A 3D7SA 5KNDH 3QPUA 4QYTA 3EG9A 4RGQA 1JQ3A 4C0WA 3ZHVA 2ID7A 3JAMA 2M9MA 2NO1A 4HSGA 4RD2A 5CB8A 1TTQB 2Q5HA 1RIIA 3PEUA 2G9NA 1TT7A 4FZ3A 4GF5A 1JMKC 3TJMA 2HW8A 3W1BA 4DR7H 4PZ7A 5IJ9A 1LDYA 3KQKA 1VIAA 3Q88A 4KQCA 1O5TA 1QDUA 2O7RA 1ZHSA 1NI4A 2GM4A 5CFQA 2PBRA 2H1SA 4KYVA 3PHHA 1G5QA 4RUCA 2ZSJA 4OK6A 2QMUA 4ACBA 4I9FA 3M3HA 4DEVA 2I7TA 5HIAA 2MSKA 7YASA 1W5BA 2P9FA 5LZ2A 4DV3B 1VKRA 1JZQA 2FXIA 1PO7A 2DYKA 3G5MA 4K1XA 4E2FA 1G291 4RMJA 1OFIA 2VQSA 5T5QA 3PGKA 5K3DA 5I5UA 2FF5A 2QXYA 5FJJA 4EVQA 4IYRA 1SA0B 5F52A 2UZ1B 4J03A 3FWKA 4ZT4A 4PS0A 5G3ZA 2IUYA 3JZAA 2AW3A 2EX1A 3R3JA 2P0YA 3K9LA 2IUUA 4FYKA 3BJRA 3I8SA 1RYYA 5I7WA 3RU3A 1U3WA 3ABZA 4WERA 1ZD8A 1JDUA 4RLHA 5L1IA 2ZSAA 1JQAA 2WUFA 4JGIA 1T25A 1JGTA 3GZ4A 3SR3A 1FVIA 4RTOA 4J7CA 2VK1A 3ME5A 4PZDA 3HCPA 4M83A 8ABPA 3OFND 4DANA 1ZBDA 2JFFA 2AF4C 3TDMA 4L6CA 3Q6MA 5L3VA 4A1FA 3Q8RB 4OBXA 2V7WA 1YDGA 1RYSA 2PQ0A 2A35A 2RK6A 2AVDA 1GZ3A 3SQWA 1NBOA 4IWYA 3I4LA 1B74A 1P2UA 4PZAA 1SQFA 4LXQA 1L7OA 3ELWA 1P44A 3DMTC 4GBED 1O4WA 3KTFA 4U2EA 3ULKA 3WK4A 1I6KA 2C99A 2FZGA 3M70A 2Q5QA 1Y6ZA 5GVSA 3MJ4A 3MMSA 2XNSA 4RHYA 3AEUA 3E8SA 1ZKDA 3D3EA 4RTKA 3IV6A 2H54A 3IE0A 1S2IA 4M98A 4IVQA 3I09A 3THWA 1WUIS 4X66H 4C7OB 4KREA 5KFMA 4FMCF 3C15C 2VPPA 1IHPA 2EJUA 2XDQB 4KQWA 1KDVA 4TQAA 2H85A 1VMKA 3GCXA 4BHTA 3L7DA 1NYQA 1VPWA 1DEOA 3LU1A 3IOYA 3OPVA 4M0CA 3H19A 3TMKA 2JANA 3E18A 1M1UA 1A9OA 4IXNA 2FSGA 2J6BA 2ZI6A 1UCFA 4RGYA 4OFWA 3I9KA 2REQB 1ZN7A 5DNAA 3SJCA 2H29A 2VJKA 4MQFA 4DG9A 1OY1A 1RVV1 3RYFA 1O0BA 2CZGA 5ALEA 1I7PA 2V5VA 1SQSA 4BFSA 5IXSA 2WU1A 3SC2A 4LYAA 2A9PA 2IY7A 4XR9A 5P21A 3WG9A 1OFUX 3H8WA 2CUNA 2FLPA 4HAWA 4D3DA 2N1BA 1U8FO 3SM9A 3F5MA 5GM1A 1WQ1R 3KALA 2TMDA 1OBDA 4JKIA 1TA8A 3UOAB 2WDPA 1F7UA 4ZV7A 1WZNA 4QJIA 3EWNA 3WL8A 1T6YA 2DLDA 2XBLA 5IBCA 5E6RA 2HK7A 2CLKB 3Q5GA 1NXTA 4M55A 5KFEA 4XUEA 4Z0HO 3GWZA 4CLOB 2ZB4A 3E9CA 5EHGA 1WCV1 2P0EA 1W4BA 2PH1A 1EX6A 3G2OA 2IYRA 3F7MA 1G6HA 4QSMA 1HR0B 1VL8A 1WCXA 1VJ0A 1PFQA 4EUNA 2AHRA 3QWBA 3PJRA 5F7XA 4B40A 2JEJA 4BZPA 1S2NA 3VAZA 4UMDA 4RFVA 1ULUA 5DX1A 1OF1A 2HJVA 5CFLA 1X1SA 2EWVA 3JD3A 1QVZA 2P9YA 2ZQZA 4X8MA 4Z4CA 2OUKA 3EXHC 5IJZA 3T3PB 2FWJA 3CNHA 2JCVA 4PZEA 3L43A 3NTVA 1RI5A 5CH3A 3UMRA 4D0RA 4FWBA 1V16A 3MAGA 1SOUA 2PMFA 4GEKA 3A10A 4FBGA 3ASZA 4O2AA 1QPBA 4KR0A 4UPVA 3X2SA 3P8ZA 1ZITA 3T5GA 4A8PA 3QJ5A 4HN4B 1X1AA 2X7HA 4J4TA 2C2EA 4DA4A 2ISSD 2Q3LA 2ZPUA 4BMPB 3JYLA 3GDFA 1A1VA 3ESDA 4CW7A 1E1DA 1PGQA 4LOKA 1N36B 4FKMA 4F4FA 3GRFA 2OHGA 3ENZA 3GLHE 5H9WA 3HCFA 1C8BA 3KT8A 1THTA 1U5AA 1ODCA 4K6FA 1C1XA 4P53A 1BWSA 1JG3A 3MIIA 3H87A 4TLDA 2C4KA 2YWJA 4ZT3A 4A8JA 3UFXB 1VCNA 3QWFA 1ULHA 1OFGA 3QZUA 4ZTUB 2CLFB 3JQGB 1KFJB 2QAGA 4YJFB 2FEKA 2PGAA 1R5OA 1OZAA 2VJBA 4IDQA 2R1ZA 2OPHA 4Y8VB 4JP5A 1PP4A 2O2SA 3KTAA 4TTQA 4D6YA 2X0SA 2FPPB 2BGWA 3GIIA 2OXFA 5E0OA 3DM9B 1PJTA 3OE1A 4OLBA 2Q1UA 2UUBB 2WVHA 1YR2A 3CONA 2OLSA 3Q72A 3FY4A 5KNDA 3AQ4A 3MR3A 2W9CB 4LF9B 4RNNA 4AS2A 2P6MA 5JRDS 2C03A 3U0GA 4CMIB 2C2XA 4RKQA 4YRBA 1PT8A 4R9NA 1JR2A 3CR3C 4IDHA 1QIIA 3N74A 1VPLA 1A9PA 4EGSA 3ZKWB 3SXPA 4OXIA 1B14A 3MJSA 4JI8B 2YQZA 4K9LA 1WQ3A 1E64A 4IQFA 4XYLA 4LGMA 5AKJA 4MIYA 5KBYA 4CLDA 5MGNA 4RNCA 5K0BA 5K0ZA 5BXQC 1SEIA 2GN1A 3HCCA 2VYQA 3UC5A 4B47A 4MAMA 4QU8A 2QUZA 4IP0A 2W57A 4ER6A 4BV2A 1GTZA 5CA1B 3I1IA 4OHMA 4Q1CA 3WTBA 1KA9H 2VPWA 4FJ0A 3AHCA 4GS5A 4XE5A 4UAJA 1K9SA 3NTUA 3IAXA 3HO1A 2O1WA 1SUEA 2I99A 2EG5A 3OQMA 2E5WA 5HQ3A 3SU8A 3VC7A 1DKQA 1CY1A 4C3OB 2PZBA 1OBHA 1L1FA 3KTOA 1Q7TA 2EC5A 3LIIA 2VQ6A 2MYTA 3TR6A 1AM4D 3CEBA 1TAEA 3H97A 3ZYZA 4ES6A 2JRLA 1TYEB 5I7RA 2ZIWB 2OP0A 3RKUA 1E96A 4Q3CA 5AH0A 4CM8A 2Z5VA 1PR6A 4EHHA 5JJLA 2HBQA 1UBOS 3P2KA 4CZ2A 2DUMA 1VL5A 4HX5A 2JGEA 3V7YA 3DWGA 3LG2A 1ZJ6A 1WMDA 1ADYA 1UMDB 4S24A 1V8DA 3I9OA 1YRBA 3D6JA 4QBHA 1V95A 1NR5A 4YHHB 1NJ1A 4WACA 5BSEA 4CIBA 2XTMA 3V4OA 4PBRA 2QGZA 3IHLA 3PR5B 2L42A 3DOIA 4JYPA 2FE1A 2A94A 2XUIA 1XBTA 3SM3A 3P2MA 4EFEA 3YASA 2ZS7A 3SBXA 3DXXA 2CLMB 2I78A 2HMYB 3CHYA 5TSDA 4AY5A 1CU1A 2ZRKA 1L9XA 2W43A 1LCIA 4OYRA 1PJZA 3P5SA 7GPBA 1CYEA 1Q2UA 5AIBA 5B1EA 3PQCA 2H5IA 2VEDA 2ZS8A 5AM5A 2HVQA 1MQAA 3HCWA 5IYDG 2AG5A 2OBMA 3WSVA 4QDOA 1R0CA 4LRTB 1SVMA 4C0QC 3SHWA 2AQKA 1R3DA 4DJDC 4EZBA 3KWLA 1QO0A 4BLRA 2YCHA 3C8UA 4LW8A 5JCOA 3QNWA 5J1TB 4AUNA 4IIDA 1TMGE 4Y9DA 2Z4RA 1T2AA 2VOBA 2GCNA 3LC2O 3GXOA 2HCTA 3I5AA 1NQXA 4FDTA 4UM8B 3L1KA 1L4MA 3OJWA 3NHAA 1CQIB 2NTNA 3UXHA 2VNHA 3CLHA 4IIVA 1JDVA 1P1RA 3JCZA 5GVRA 1U81A 1R00A 1YE8A 2C7BA 3A9CA 1DOHA 2PRSA 4LDRA 3NBZC 4U9HS 3MJVA 2FZCA 3P52A 1JHOA 5JLJA 3L92A 2XWBF 4GLFA 4AS1A 5IDWA 3RG2A 1XU9A 3JPWA 4DKJA 3W3AH 3C85A 1WDWB 2XCPA 4O63O 4MLDA 2OBYA 1C7JA 3TGLA 4GUAA 3BFVA 3TVYA 1NZDA 3VSBA 4BL5A 3ZEIA 4KIJA 5CM9C 1C9MA 2BTOA 3UAZA 2A67A 2B82A 4DR6B 4M1TA 3BPSA 4CV3A 2RHHA 1C30A 2OQIA 5KYUA 4GMDA 3EIQA 4BGVA 1HV8A 4P83A 1MC8A 1PR0A 5TMBA 1YZGA 3BRWD 4FYYA 2QF7A 1HDZA 2V96A 3GEMA 1Y1VG 1HY3A 1QS0B 5C4GB 4U3JB 4U7TB 1JMVA 2XA1A 4IF4A 4KRFA 1KARA 1CUXA 4QJ5A 2D59A 2EX0A 1X7GA 3EVEA 1PZEA 2QRMA 1YD7A 4EGCB 1SUIA 4CG0A 3KR9A 4HDNB 4JCOA 3TAHA 4B4UA 4XEHA 3L6BA 4FZJA 4CEJB 2AN1A 3FKJA 2YWHA 4MPPA 1B6RA 1CTQA 1H1LA 3C6XA 3A1FA 1JAXA 3JD1A 3DULA 3EMDA 1SBIA 5E9QA 1AS2A 4TTJA 3OA2A 3PQDA 4TZ6A 1SHTX 3T4XA 1VA4A 5TPWA 4IJQA 1NVGA 2QN7A 3ZGZA 4MYTA 4X54A 4LN1A 2M1XA 3WXMA 2VPIA 2X1HA 4HYQA 2JJ8A 2ON6A 1F3LA 2VBCA 2GPJA 4BLPA 1MFPA 4Q15A 4IQ4A 3MR6A 1YZVA 5LMNH 3GLFE 5DLDA 5DCLA 3HA3A 4TQRA 3WNQA 5A6VA 1J7KA 1UDAA 3TAXA 3KFVA 1JB1A 3PGXA 4GPD1 2PA0A 2UVWA 4K9KA 1OKKA 1RHJA 3TIGA 2Q9UA 4GNRA 4U7JA 2XZTA 1N8SA 1F48A 1DNPA 4Z4QA 4JEHA 4E5NA 1H2AS 2IELA 1K5DA 1C50A 3PEFA 5I45A 5HKKA 5KYYA 2AK2A 1ZZEA 2KJQA 4TMTA 4E12A 3EEIA 3LPNA 2FCRA 5KYWB 3OLZA 3ESAA 5KEIA 1CZLA 2ZWVA 4OXYA 5JRJA 1AKVA 4FSHA 4Q39A 4KQKA 4TXLA 5DHTA 2CFSA 5CW2A 3X1YA 4E7PA 6CHYA 3T9DA 1BROA 4KIUA 1SUPA 4PCVA 2GZSA 4V1CA 2BEJA 5JI3E 1XTTA 1TAGA 2B2NA 4PLHA 1Z26A 4ME6A 1KOGA 5KKNB 4EHNA 4UCFA 2OORA 5GGXA 5LM3A 3HPQA 3KYCA 1Y4AE 3ENWA 1UM8A 1UKEA 1J07A 4H16A 1H4SA 4RLSA 2Y8EA 3GN1A 2PT9A 2WBLC 3PENA 1GG8A 4M54A 4NXMH 4J3NA 1YOVA 4GU5A 3KZMA 2X58A 1ATIA 3WMRA 2O03A 1IOLA 3IVMA 1Z33A 2C95A 3OD1A 1HA3A 3O1IC 3MILA 2WE6A 5AT1A 4TWJA 2WIFA 2W37A 5A9SB 4JYCA 2C8KA 4O4JB 1IFXA 2HXYA 3B70A 3WFJA 1VRWA 3D8SA 3A26A 1A72A 5EYPB 1TM3E 3DDOA 3WWJA 1XI2A 3DW1X 4LRSB 1B4DA 2EF0A 3PIRA 2W98A 1YS2X 1A50B 4MUYA 1QGOA 4QDJA 4X1OA 4RADA 3IAS1 2E4AA 3TM4A 4AJ9A 4DIUA 2FJZA 1Q1EA 3LDGA 5KC8A 5IRCD 1ZFNA 2FSSA 3ZZUA 3N75A 3EXG2 4EF5A 2WB1A 1CW2B 1SVIA 4IIHA 3I42A 5I7VA 4FGJA 3EX7C 4FGRA 4UEQA 4G07A 3C3JA 3AUSA 5ALVA 2H48A 1LBHA 4LBWA 1WB6A 1ZCAA 1DCTA 1AXEA 3EUWA 1U6KA 1V35A 1FXWF 1G21A 4JV5B 5IWAH 3L84A 4MB6A 3G82C 2BISA 4N01A 2Y9PB 1D1PA 2OLKA 4QYIB 3D59A 1FE8A 4BNJA 4D92A 1S3SA 4J0GA 1QV9A 1L7EA 3NPMA 1U3GA 2P35A 4UNIA 3P9IA 1DGSA 3A1SA 1RQ2A 2LKDA 4QQKA 1N2JA 5C80A 2ACEA 1JU4A 3BQNB 5F73A 2GDJA 4CL2A 5E3IA 1KE1A 3EVAA 3LI2A 3O4JA 4BVAA 3MYRA 1ADGA 3RD5A 3GL9A 1VLQA 2RI0A 2BFDB 4Z4FA 2QTVB 5EJ6A 4BMOB 4DRYA 4I1VA 2GZDA 3CX4A 4ILKA 2XOEA 3B1VA 3VNAA 2F3RA 3L7KA 3DEJA 1QE3A 2NZUG 2GMWA 3KR1A 1KE2A 3DTVD 2X6QA 3M9WA 4C0LA 3C87A 3ONEA 1SBTA 1OI7A 3RBVA 1IY8A 4OHZA 4D9CA 4R3NA 3GJTA 3ZHRA 2RGNC 4E5SA 4FW9A 3JYOA 1S5PA 2XITA 4A9AA 2YV2A 4KP7A 2DFDA 1CT9A 3ZY6A 1QQ5A 3K71B 5B3LA 1P2BA 3ZIAA 3IMGA 4PANA 3W3AA 4L0DA 1MMFB 3HKDB 1QUFA 3C97A 3CVZA 4F1JA 3N0WA 2B1GA 2CNDA 5DGXA 4UMFA 1KH3A 3H6GA 4MCAA 4LJRA 1TWHA 3ZZ1A 4QVIA 1XQWA 3AEXA 4QWWA 4IIXA 1KKUA 4MW7A 4NARA 4Q93A 3R5TA 1I6WA 5EIBC 5CU7A 2FUKA 2ZJTA 1UF9A 2I7XA 2OV1A 5EINA 4LBYA 1NTOA 3TW8B 4DZTA 5AJUA 4LI0A 2C61A 1HH4A 1V11B 4KFSA 2RHTA 1DUVG 2ZJ7A 1EWTA 3I9JA 1XJCA 2I3AA 2C4NA 3QUSA 1CHDA 3LOUA 2EW2A 4RJKA 3B3QA 2GFIA 1R3UA 1HRDA 1V96A 3I3SR 3GK3A 5IS2A 4QXAA 2XUHA 4ENRA 4RB2C 2FSPA 3AYHB 1Z15A 2W4IA 3GMIA 4Q05A 5BUCA 3NV7A 4KQEA 1YJBA 3E23A 4IR7A 1KAEA 3BJYA 4QHTA 2Z95A 4RLQA 1KF0A 3BK7A 1ZQ1A 3WMGA 821PA 1C7IA 1X1DA 2GK6A 3DVSX 2H4WA 2PS3A 2W6QA 1XKQA 1MOSA 1BDBA 1YVRA 3BGVA 3Q7RA 1C5KA 4LXTA 4MVJI 5G0VA 3LBFA 1I2LA 1B26A 3W34A 3CW2A 3WLRA 2PH5A 3ZDQA 1T2NA 5CVTA 4EEXA 4HN2A 1UC5B 5ALOA 4ENPA 4WPGA 1NP6A 2AFIB 4Z7JA 2R85A 4TV8B 3B20A 4MARA 3KFXA 5BYKA 3NP9A 4OI2A 3RTAA 1GQSA 4AKSA 3P45A 2EEZA 3AOEA 2EL7A 1RAIA 4J29A 3OLWA 1Y6JA 2QNIA 5DF1A 4UHKA 5FAKA 1OWTA 1KEEA 1HE4A 3WK9A 2J5RA 3FZYA 1SBNE 2NQTA 3PX2A 5HNEA 5KFRA 3Q8QB 3ES9A 3WWCA 1ZD3A 4O2BA 4MYRA 3DAPA 3DDZX 4KAFA 1HMYA 1ZIDA 1N6KA 3WGUA 4B6PA 5L7WA 5U4QA 1XN4A 4FFDA 4Z0NA 1RQXA 5IC4A 2UVDA 4RULA 4OB6A 3H5LA 5CURA 2OH2A 1S03G 1U0OC 3MWKA 1U02A 4GLXA 3BAZA 3R6WA 3WIUA 1NBAA 2JCXA 3O4RA 3D3KA 1T3SA 3FTPA 2OQ2A 2ZBDA 3R7BA 5AUPB 4C0BA 2EGHA 4G4IA 3QKRA 1C9EA 4PV7A 3PXBA 4M49A 4M4SA 3EZ6A 4RTMA 2VI5A 1Q95A 3LWNA 1WCMA 4B3XA 5FL7D 1NNSA 4JJ6A 1GA1A 2NACA 1NRWA 3ZE1B 2JK1A 2ZJ2A 4L5AA 4R1SA 3B5EA 3HB4X 2W6PA 1XROA 4HWPA 4GMKA 5LL6b 5GJWC 5LJLA 4NABA 1PKXA 2JJ1A 5ER9A 1PEKE 1UQTA 4QPCA 2IHKA 5A5VA 2YN0A 5AOAA 1DC6A 3PUYA 2E37A 1MNQA 5TGTA 1J9EA 1P0PA 3HOUG 2W6ID 5BWNA 4EBCA 3AW9A 1Z0ZA 3D6TB 2IL1A 3PI6A 4XVRA 2Y1KA 4V0ME 2E6UX 1C9YA 4CQLB 3M5PA 5D3MB 4FCWA 5CA1A 3VYRB 3RV4A 4HEJA 3NKVA 1DTEA 1YF3A 2WU3A 2LVBA 1G8JA 4FGUA 1QGDA 3N6RA 4GPEA 1NXSA 4NLGA 1Q20A 4MWSA 2I62A 1Z9BA 2IYVA 3WISA 3U7QA 2H11A 2DJ5A 3G17A 3L7MA 5ED0A 5F78A 5CYGA 3NH6A 4HADA 1QYIA 3INNA 3HJAA 4ZU3A 2G0NA 3ISJA 1R9JA 2IXTA 1IOZA 5JVLA 3QEMA 3CR7A 3E4CA 4ITRC 1H0RA 1WX1A 3T3HA 3QKSA 2GSWA 2H5JA 4AO8A 2IPLA 1ZWKA 1X94A 1QCYA 3KU1A 2GPSA 2CJWB 3PR3A 3RRXA 2NZXA 3ETNA 1ZVJA 1X77A 5E3JA 3H3VH 1VQ1A 5IJWA 3CYFA 1JHUA 5KOYA 4LY0A 4KBFA 4CM7A 3JVVA 2HX1A 2R7NA 4HTFB 4I9HA 1MAWA 3RV3A 4M99A 3UANA 4PBTA 2BN4A 4UBOA 3HNOA 1XA3A 1JFFB 3JZMA 4YXWA 2DJIA 3OEEA 2A3NA 2BGIA 2XE8A 3SEFA 1B1CA 1COWA 3E84A 3ZWDA 4M0EA 5C81A 1FTWA 2QRPA 3BQ1A 1J2TA 3PRKE 1A7AA 3HABA 3UGTA 2NU6B 4HO1X 2J5QA 3X1KA 4K5QA 5JO0A 1ZIPA 1OD6A 4UE6A 3H1AA 1AC5A 1TRKA 4GL4A 3IEPA 2W6MA 1PJRA 2AEMA 4J4HA 4QELA 4Q4DA 2FMHA 4YP1A 1VLVA 1H65A 2JIBA 3I6IA 4GBJA 4HRVA 2B6NA 1K7XB 1ZRSA 1FLVA 1IM5A 3BA1A 4Z6KA 2Y77A 4IW3B 4OH7A 4S1WA 1YZFA 4LJKA 2HF7A 1K8YB 3TR0A 4G85A 2WFZA 2G72A 1XTRA 4F2DA 3PC3A 2G76A 2VR1A 2Z2IA 1MT3A 3R6GA 3ZWVA 1MORA 5IH7A 3GTPA 1TPYA 4MR7B 4GPBA 5KS2A 1CZKA 1JQEA 3OQHA 4D97A 1SUBA 3KYDA 5DISC 1TVKB 1CFZA 4HPJB 3TB6A 1P9WA 4XOUA 4IX1A 5HJ5A 4OREX 3RVDA 1RYBA 3TFWA 4CKEB 2IJGX 3G0HA 3EY4A 2DIKA 2R79A 1GKIA 2AE2A 3AEZA 1PFGA 4IIJB 2RGBA 5CLGA 4OK5A 4MS4A 2FE4A 5REQA 1QFJA 4KKVA 3I34X 1RPTA 2R7ZG 1FX0A 4BGEA 3HFRA 3HXPA 5FUBA 1E4FT 3SOPA 1JH8A 5KC9A 2IXFA 4PYKA 2QE7A 1ENPA 3AETA 3I37X 4PLZA 4MI1A 4KPFC 1QH0A 2OYSA 2D5IA 2ZAIA 1O96B 2D0DA 5GJCA 3CW8X 1V5WA 1KBZA 4Z9BA 5HDQA 1J6UA 4V0OA 3O2SB 4HXYA 2OAP1 4RH0A 3KQHA 4LBVA 3IURA 2Z3ZA 4DDTA 4U2DA 2WJHA 2ZI9A 4JLNA 3D81A 2EG9A 3NRJA 1LDBA 2CLDX 2FAXA 5B6JA 3ADPA 2JEGA 1ZMTA 2HIHA 1ELOA 1NSFA 4RTLA 2JLBA 4HEQA 1E9VA 2ST1A 2XT9A 1L4GA 2EFHB 3GP3A 2ARKA 4RJTA 4MYCA 4NXNH 1L5SA 2VDUE 4JVNA 1Z82A 5K8JB 3D6HA 1C7RA 1ZUNA 2R5FA 4GRAA 5DNVA 1PDVA 3UHOA 2QTRA 5DMXA 4M7WA 5A4JA 5ENDA 4JLVA 2GJ9A 3GH3A 4KAAA 2P9HA 2F00A 2YFKA 4Q4HA 3UJPA 2P1DA 5ESRA 2VJNA 1VGVA 1KZ4A 4Z1OA 3OX1A 1YVEI 3G7NA 4CEJA 1RJ9B 3CB2A 1A71A 3B9RA 4RABA 5A2GA 3TW4A 4J7XA 1SKYB 1S4MA 3CX6A 2ZYIA 5KG7A 1SVKA 3L82B 1HI9A 4Q8EA 1ZR2A 1IZ8A 1Z08A 1Z5OA 2W2PA 3G02A 1R9TA 3CNNA 1EJBA 2JLYA 3OE5A 4LJ8A 5HKLA 1P5FA 5ALYA 1RKBA 1J56A 1GTMA 2O8EA 4HYEA 1JSLA 4JLAA 2J59A 3UXYA 3CSUA 4UUPA 4BCDA 4J76A 1X13A 4HX2A 1AUXA 5JMTA 3CUEF 2FRDA 5FFFA 5THQA 4HPXB 3RB0A 2HJGA 2VTVA 3KBBA 3PWZA 1Q1QA 4EPTA 4BQOA 3U4IA 3P20A 2C5LA 1KQFA 1K7CA 4MRAA 1ZS9A 1YA8A 4OLHA 4PZCA 3JRWA 3LW8A 3ZIUA 4B8ZA 3X3HA 4R41A 4B2IA 3QLJA 3FVRA 4XX0B 3EVNA 3CZCA 4G4GA 2VNAA 4FYVA 4J3JA 2EGGA 4G2TA 4NFSA 5EZYB 3EVDA 3FYCA 1OC4A 4ZHSA 3CW9A 2Q0XA 3IA7A 3V9PA 3GEDA 4BNHA 1XJ5A 2FN7A 1I4OA 4YRAA 3KTMA 2GARA 3OZRA 4KUEA 5KO2A 3LRTA 1GITA 2WQ7A 2J09A 5DLQC 4I4TB 3BXOA 5BT9A 1SOAA 3VOTA 4F4HA 1ETUA 3PFCA 4XYMA 4B3DA 1PR1A 2XJ9A 2ZGIA 1IXYA 2QXUA 3EOAI 3ND8A 4TSRA 1VTKA 1KMNA 1JFTA 3R5XA 4U8HA 1JLLA 1AIPA 3NDJA 5F98A 1EP1B 1Z68A 2AJ8A 2QMYA 5HOQA 2UXDB 2OB1A 1QCDA 1DIBA 2CCGA 4CG3A 1HX7A 3AJRA 3AU8A 1PWZA 2RAVA 4F8JA 5KTYA 3QFFA 2GO1A 3NWPA 4NKRA 5B2ZA 2IIVA 4IYJA 1AZTA 3VJLA 5KG3A 1FS5A 3R8XA 1L5MA 2FSVA 4BO3A 5J58A 3QUTA 5JZVA 5HOEA 2IS1A 1WJGA 4MULA 3KHLA 2RHJA 4WCFA 5DW3A 3N7TA 3Q3GE 5EYPA 4O8ZA 1P6UA 2M98A 2AR7A 2BGLA 1N33B 5DHSA 2KPOA 1IN4A 5AVJA 1IATA 4WH0A 5BSRA 3OESA 3W5CA 4S1OA 3U7GA 3ZUGA 4J16A 4D4JA 4A2PA 1E9CA 2ZAOA 3LXMA 3QNMA 2X3FA 3ZV5A 3FB4A 3SP1A 1P3JA 5IULC 1X7ZB 3KQOA 4DIKA 3EPIA 2E2IA 3OCWA 3DCIA 5DW0A 4G1EB 3BGWA 4E08A 4TTRA 1RKUA 1FUIA 4HQKA 1RJQA 2ZSDA 3EXHB 1M7HA 1II9A 3TN7A 4GC9A 4D5EA 4OI4A 1EJ0A 1UQRA 1D2AA 3UGQA 4F85A 3GJ4A 2NYVA 4BBSG 1NNEA 4I3FA 3TI7A 2BDUA 4KXLA 3P2OA 3Q3JB 3ZCPA 3CRRA 5DEOA 5JJCA 1QWOA 1HPLA 1DJOA 1PFKA 1WR8A 2ZYRA 4QYIA 1Y1VA 3R3HA 4I4NA 3QPCA 1JQDA 1ZMRA 5FWYA 1Z13A 3U5TA 1YIDA 2XUGA 5FR9A 2O4CA 1BCRA 2QROA 4RB0A 3RLIA 4LPSA 1MIOA 4YMTA 3SICE 3W5DA 4DQLA 3BCSA 4OSEA 4W5TA 4TOIA 5D8DA 2ECKA 4BATA 3H3FA 2NXCA 1A8HA 1G1AA 3N7AA 3ADBA 1MB2A 3S1AB 4WHXA 3C7KA 4X63A 3COSA 4X7BA 2QX8A 3S2EA 1Z75A 5H8WA 1WLYA 1UPTA 2Q5EA 3QPVA 3TRJA 4DG5A 2Z1MA 4B3MH 2GPBA 2ZAGA 3AM3A 2HSJA 4CM3A 4JI0B 3V7NA 4W9MC 4BFTA 2PT7A 3Q3CA 1T3HA 3NHZA 5JS7A 4LYHA 3LQ2A 3C98A 4XZ3A 2Z8XA 1AOXA 3E7XA 1SCUB 1TU4A 3OY2A 3KZCA 4XAQA 4PINA 1LLCA 5E1MA 4WESA 2Z6VA 3R9IA 1Y1WG 5HCIA 4CLXA 3UPTA 3R7WB 2AQHA 1EQUA 2CEAA 1Q7RA 3O8LA 4D41A 2BZ0A 4WMLA 4S0XA 2YY7A 1VRVA 3NIDB 4XYEA 2VF2A 5JXJA 1YS9A 5TMPA 4FGLA 1OAOA 2XDWA 5JSYA 4LJYA 1I2BA 5K4HA 4L2IB 3TW8A 1UOOA 1YCFA 4OXRA 3PYXA 5L8VA 2GCOB 4FNMA 1R4AA 4RX1A 2GA8A 4UHFA 2V3CC 1EHIA 3FLEA 3OEHD 3V7UA 1FFAA 1YCGA 4OATA 1X14A 4L3VA 2HKIA 1FLNA 4RVDA 4S12A 1PJ8A 4JITA 1FXSA 1MOZA 1EFVB 3GCDA 2ANBA 5C7IO 3LGSA 3WWIA 5E38A 1S2GA 3LT2A 3T7EA 3ISTA 1J8MF 2YVAA 2D7CA 3VKFA 3TUIC 2BUBA 3DGEC 3A3OA 1Z4PX 4ML3A 3U61B 2TRSB 2ONJA 1BCSB 1S0UA 4PAMA 4QYMA 1PEAA 3RU9A 2C97A 3IAS6 4EARA 3RR2A 1ZA1A 1BHO1 1I24A 4ZO6A 1JAIA 3PUVA 5C46F 3SZ3A 2YUIA 2HDOA 3MG9A 4OVKA 1POWA 1IDN1 3I52A 5J5CA 3KWJA 2RBEA 1QAOA 4TMFA 3HBMA 3BN3A 1MABB 3EF0A 1NLZA 1UEXC 3GEEA 2MMGA 4OXXA 2V6BA 3WMXA 1RLTA 2CKDA 2NT4A 1ZDMA 4G1VA 1ESMA 2IXEA 2FPRA 2G7ZA 3O3MB 4HDSA 2JCGA 3QEKA 2WF8A 5G1PA 2QTMA 2IHBA 2RGYA 2G1AA 2H08A 2FUEA 2L17A 1E3IA 2O8DA 5IC5A 5FA6A 1EVKA 2SICE 1BHSA 3DTVB 3TRFA 3N42B 3B1YA 1MH1A 2XNDA 3HR4A 1SCNE 4DR2H 3RYHB 2O2YA 1EFCA 2FX5A 3NFRA 4NU6A 2WFAA 4FDVA 3VKWA 4KNYA 3ZZTA 4RDXA 2IU4A 1Q0LA 1FP7A 1A5ZA 1UXOA 4XH9B 4WVFA 1A96A 4OX9Y 1X80B 2XGPA 2AEJA 4BEWA 4UHEA 4WK4B 3HYCA 3KHRA 5AM1A 2QX6A 1CF9A 1AKEA 3IXMA 1JIUA 3SF0A 3ILXA 2RSLA 4EFLA 1Q5PA 1G8KA 4CIYA 3QM1A 1I4EB 1RCUA 1UXKA 3V80A 1KO1A 5EWEA 5CDGA 4IGIA 3WB2A 4F8EA 4FFLA 4XWKA 3W9UA 2G1KA 4DYVA 1WE2A 2E82A 1D6MA 3UF0A 5KQMA 2JBWA 3BA8A 4H2DA 3M9NB 4JYAH 3LQQA 1MF7A 1LTQA 2IYLD 4E94A 5FO1A 3URKA 1RZRD 3EDCA 1X7XB 1GRRA 2JHPA 5C51B 3PXAA 5EIFA 3FLBA 3TXXA 2QTCA 1TWAA 2R1UA 5LBUA 2XCQA 2GNAA 3JQQA 1YR3A 5D86A 4OBEA 2ADFA 5BN4A 5BQOA 4ETMA 2ZG6A 4ILEA 3OKAA 2BGGA 3NBZB 3P0RA 1NNLA 3DOUA 3JR7A 3DTGA 3FTEA 4EENA 1M7GA 1XZMA 2ORVA 2COJA 1G0OA 2RG7A 3OJLA 4E5UA 1HDOA 2IXBA 1Q3KA 4XGQA 2NV6A 2X8AA 1P2TA 1T9GS 2RAUA 3HS3A 1YBHA 2XBUA 3ZIDA 3PE6A 1J22A 5DCYA 4MVJD 4OQFA 1WY5A 5HKOA 2AMLA 3FW1A 3ORFA 4LFBB 3KSUA 3ZE8A 2R4UA 2LWIA 3PD7A 3PWKA 5LCXA 1BW9B 3MWMA 4B5LA 1RC1A 4DV0H 1I1NA 3OX2A 3VHRA 4I5DA 2WAQE 4O4HB 4QUEA 5DWQA 4PG7A 3H2IA 5LN1A 1KJZA 3OQ6A 4MZDA 4PLWA 4LCBA 3H0KA 4RF5A 4NDAA 1WCIB 3I32A 3AVOA 2CJWA 3GDGA 4IHAA 3A14A 1E2MA 2HHLA 4UUGA 1XZBA 4KRYA 2XYPA 4B7XA 2Y92A 1CV2A 4CKBB 1ZD2P 3AUXA 4N5LA 2WJGA 3GMDA 5F2OA 4ZO7A 4MTDA 1DIAA 3ANSA 1JX6A 1IXKA 4YCJA 4HTFA 2R92G 3D3WB 4I2NA 4QW8A 4E33A 4IGFA 1SOVA 1NPDA 5CYOA 4BPBA 2Q41A 2AF3C 4J1NA 5H02A 3JYHA 2XE6A 5EL0A 2WB2A 1ONSA 1NSTA 5T3YA 2BMJA 4EYGA 4KLRA 1T4BA 5JR3A 1NF9A 3COWA 3PUIA 2PRZA 2FLKA 3IP5A 3WQRA 4IXDA 4WZAB 4YR3A 4YO8A 5SY4A 5TX7A 4E46A 2UYHA 1ZGBA 1TAHA 3S40A 1GZSA 3GHHA 4Z2AA 2OGWA 3HUEA 4BYMA 3FR8A 1V1RB 2HMVA 1N2SA 3VU8A 2FGKA 1KTIA 2PKCA 4NMMA 3SJ7A 4N0QA 3C3XA 4AJNA 4NCAA 2V7BA 2IF2A 2Z4SA 3CLSD 2QVZX 3R0QA 1R0BA 1PJAA 2C9OA 3M6MD 4JVLA 1K5HA 4DBLC 2IS4A 3PDWA 2JA7G 4LIPD 4RV5A 4ZPXA 2LPMA 2JLWA 1DAGA 3FDJA 2Q2OA 1Y42X 3BERA 1P19A 4TVBA 4CKEA 3RM3A 3JD4A 4KR6A 4JDUA 4X93A 4I4CA 4CCWA 4XDHA 1ZJZA 4IIJA 4YBZA 3SEQA 1ORTA 3MJCA 2Y93A 4MTCA 3IQZA 2W8LA 4DV3H 1VOTA 4WFJA 4QX6A 5F7OA 3V1KA 1OX4A 4NV0A 1PGOA 2WJ3A 2WOJA 2HRDA 4WDQA 1LF0A 1SU7A 1JQLB 4LYGA 5IN4A 4LJAA 3UH0A 3U1TA 4ZMSA 2B8WA 3RYIA 3T35A 1OLSB 2VP5A 2N75A 1SXHA 4YJ3A 4IQ0A 2QMQA 2R6GA 3LC0A 3RU2A 2B30A 3MD0A 4ENTA 4G23A 1XF9A 2R25B 1WU7A 3F4KA 3MWDB 4NZNA 3G2LA 4Q4JA 2CDCA 4MCJA 5BNZA 1NULA 1R16A 2QZ4A 3JAMW 4BWFB 2RBGA 3BJMA 1KI3A 3B52X 1NF3A 1YQDA 3ZH9B 1BVHA 2DFNA 3B36A 3H2JA 3F5SA 1A97A 3GLTA 2D2EA 3CH6A 2F9MA 2JGFA 1QXSA 3EUEA 2QAIA 2VRCD 2NGRA 3Q8XB 4QPNA 1E2UA 1JHZA 5EEGA 2WD7B 1KEUA 4MQEB 1S8NA 1RJ9A 2R00C 5CFNA 2RG1A 2VWQA 1U2SA 3SYRA 1M72A 4Z51A 2VQEB 1IB0A 4GICA 4JUCA 4MV4A 1LS1A 5FLEX 4O2AF 4RUAA 4GOLD 2Q6TA 2JHFA 4Q18A 1D6SA 3L79A 1WXHA 1U9CA 2IP4A 3THXB 1UK6A 3Q7SA 3P9NA 5DMHA 4KE8A 3VPDA 4AXXA 4Y1FA 3CRVA 1YR7A 4JI5B 1CG6A 2YJGA 1N0WA 5CA0A 2IK8A 3IIMA 3KHHA 3DHEA 4CHGA 5DK6A 1R0YA 3UW3A 4DWVA 1EB9A 2OLEA 2HI0A 4DTIA 2WWIA 3WBFA 3KSDO 3EGOA 4JI3B 5IKPA 2J9YB 1KSHA 1WABA 3EDYA 2YZ7A 4UFZA 3UW1A 4I2VA 4FR5A 3CRQA 4ARIA 3FFBA 1KORA 5K51A 2HMAA 1U2EA 2R4TA 5SYAA 4D8VA 1TUGA 4K9DA 1E1KA 4TSKA 1V43A 1ZK2A 3PQ8A 4G1MB 4AF7A 1N9GA 4WIAA 4FFPA 2X6TA 4FQ5A 1PWEA 2WU8A 3C43A 2HYDA 3GJ8A 1X1QA 1FDUA 3SNHA 3W5VA 4WXRA 2Z9CA 1ZK0A 1B1AA 3IP1A 1R8XA 5HQTA 2UYGA 4D8UA 1JHRA 2XBMA 1WHTB 3WL6A 2AB0A 3GOQA 2J0SA 3BWEA 5C7LO 1VBHA 3Q11A 2JNWA 3TQQA 4D6PA 2Q2NA 2WPDA 2R2GA 4UM7A 4K9QA 1KBLA 4I9NA 4CNBA 2PR2A 1C1YA 1HR0H 3D3JA 1YRAA 3FVWA 3CXUA 3NCHA 2P8SA 5KT4A 1RHRA 1OXTA 4QAJA 2CV0A 4GRIA 5BSFA 5IK2D 3DDNA 3JSAA 2ZWOA 3EDRA 1I0LA 4Z9FA 5IEBA 2NUPB 2X8JB 5E2BA 3TSZA 2W90A 1M5RA 3ZHBA 4Y2PA 4ZDIA 3AHHA 2K6GA 3OCXA 2ZSHA 3HBJA 3IALA 3V1NA 3RFTA 1AHIA 4A2AA 1AV6A 1ST2A 3HM9A 2EZ4A 3NC1C 3CVVA 3AR6A 2H7XA 4OO3A 3B13B 1XWWA 1GPDG 3CF4A 5FEMA 2JH8A 1NX9A 1TYZA 4M9XA 4H08A 4R2MA 4ALJA 2WD8A 3H5NA 4AL4A 4MVJM 5DP1A 1EUDB 2JA5G 2Q6KA 2EKBA 2D06A 1JDNA 1TMKA 1G55A 1XPOA 1PQUA 2W8ZA 2IODA 2ID4A 3O8OA 1N36H 5KYTA 4J2TA 3COPA 1RRPA 2QR2A 2H4ZA 3EXHA 3SX0A 1OBCA 3OQIB 4TZ0A 4OA5A 2XVYA 3THYA 1R8JA 4CJXA 1ZI6A 3HO6A 3WAJA 4F6RA 1T9ZA 1RLUA 1E59A 3S8EA 2Q8QA 4IJUA 5H9VA 3GLGE 3G2KA 4A2QA 5K6TA 1CUCA 3VU1A 2VDJA 3QA3E 4XFKA 4EHDA 1G5HA 5F9FA 4XJXA 4A27A 4TMYA 5C8YB 5H5JA 3HA2A 2AX4A 2ZTVA 4D4LA 3PVSA 3M6FA 1GADO 1GUBA 3ESBA 4M6WA 3S2YA 2ZIUB 4NS1A 3PA8A 1NC1A 1E4EA 3BBPA 4XOIA 1YS1X 2CNVA 2UUBH 5KG4A 1Z83A 3Q4GA 1E79D 5KWJA 1PZFA 3CEAA 1E6EA 1XDGA 3C4JA 3AJEA 1KJJA 5IAJA 4LF9H 4XPIB 2ONYA 3ZBQA 3UJCA 3UJNA 2X23A 3LT5A 5L3QB 3C6KA 4FMDB 3KO8A 5DM4A 1Q12A 4RE5A 1B0AA 3RBZA 3TJRA 5KFPA 3M4NA 3LMKA 3E1SA 4UD2A 4JI8H 1ZGCA 4PSVA 1KDZA 2PAFA 1NXPA 1YFZA 1KIMA 5IAKA 2D5AA 4EY5A 1UKYA 2OXCA 1PQYA 2G4LA 4JLWA 4DHEA 5AHOA 2YY6A 5DNUA 1T43A 3GGOA 3HCOA 1W49A 1RJRA 2QD4A 2VO1A 4AURA 1AGYA 2G1UA 3U4AA 2GCPA 3HJTA 4BCCA 1GG2A 4JSRA 3G0CA 2WZBA 3TIVA 3EH1A 1U0NA 2VYVA 3FUUA 3OZFA 4E4YA 1SA0A 2UZ1A 1WNTA 2X3YA 4D9KA 1EQ2A 1AXRA 2BLLA 3PFBA 4HH4A 1MX5A 1Y3HA 3PPYA 3H1FA 4LNHA 1E8MA 1LPAB 1NU6A 5T67A 2VPXA 3OETA 4N7RA 1YQQA 1Z07A 3S2ZA 2C4UA 5LLTA 2BGMA 3RPEA 2Z5LA 4W6QA 1XZ8A 4L51A 3T61A 3V7FA 3ZY3A 4X85A 3VZCA 4D9MA 1KDOA 4RS3A 4LRWA 2ODPA 4YV2A 1XXHE 2IYUA 5KFQA 3RO7A 3IEUA 3H84A 3MHPA 1EFVA 2KBEA 3FB1A 4MMXB 2CXHA 3G6KA 1PFUA 3U1VA 2X8BA 2JI6A 1LVHA 4OX9B 5JECA 2QRLA 1W46A 2A9FA 1RP7A 1QG0A 4YHHH 2V98A 1JLMA 2B21A 3PCXA 1BCSA 3FPHA 1PV4A 1EBFA 2B4RO 2HF2A 2X9NA 4PC1A 1O75A 1TM7E 2MSCB 5B57C 1YS7A 1VYHA 2E2WA 3DOFA 4QGFA 3WGTA 3GYGA 1D2HA 1T8YA 1QO9A 5LQNA 4MWCA 2J3HA 3LNCA 1W2GA 1NP3A 2IY9A 4MGYR 4Y1RB 2WWGA 3VBEA 4C7OA 1TU0A 2QTZA 1G4HA 4N0DA 2XDQA 2C42A 2PX4A 3AESB 4G97A 1TLTA 1NM5C 1PGJA 2Y1XA 3V55A 2AFHE 2QZSA 1CR4A 3A6LA 1MFZA 3T3NA 4HAVA 3O8QB 3DAAA 3PSAA 2YBEA 3NHBA 4I5FA 1V3UA 4C14A 8MHTA 2BGNA 3S5JA 4WKNA 1RM3A 1CB7A 3EPLA 1Z4LA 3TQSA 3IDSA 2REQA 5HBRB 5ALRA 2PNJA 3DZJA 4M38A 5HKBA 1N4AA 4PIVA 3DTVA 1X19A 1IONA 2BJVA 5C3UA 3F4LA 4K2AA 3RYHA 4CIWA 5F1PA 4EOGA 1OTXA 3OFJA 3USES 4AMGA 2E4YA 1AUPA 5C53B 2VH2A 3Q5DA 1ILWA 5G4LA 3LC7O 2ZRPA 4XTCS 2E48A 1ZOOA 1XCGB 3KLMX 1J8YF 4DL6A 4A5SA 4XW2A 1JEQB 3V6LA 3IOBA 5IX8A 5C34B 1VCOA 3C39A 3S7ZA 1CEEA 5GAJA 2RMKA 4CV2A 3MRVA 4QUJA 4QSHA 2YMPA 3UWDA 4CLOA 4W1SA 1JHQA 4HGQA 3JYQA 1Z3CA 2XGGA 1KWKA 1XLTA 4MVJG 2XQFA 1XTPA 5CVDA 2VKQA 2HMTA 1R15A 1M8PA 4OLAA 5KT3A 2Y4RA 1D07A 4WV3A 2HIGA 3SWWA 1UPXA 1XSEA 1X74A 5BPHA 3RBEA 3T06B 2ZBPA 3Q9NA 2CHEA 1OJ7A 4MR8B 1X7XA 2I4OA 3UAGA 2QD3A 1QG2A 5KX5F 3BSFA 2FW8A 2Z2XA 3W5AA 2A84A 4NU0A 4UCOA 5EIHA 4BFYA 5DISB 1FU8A 4LGYA 5IUKC 3PEYA 3U31A 2A0UA 2ZYSA 5ELLA 4DR6H 1T1GA 2NUTB 1IG0A 4B0PA 3ZWCA 5C8ZA 1XGKA 4ECWA 2B20A 1NYRA 1PV1A 4HS9A 1GARA 1M54A 1LX7A 1XRRA 1E0JA 3QE0A 3N87A 3ANMA 1DE0A 2BMAA 4KQ1A 2NU8B 2P79A 1Y4UA 4CTOA 1CY2A 2BFBB 2GS9A 1YE5A 1DKPA 2CF5A 3VR4D 2VHXA 3F74A 3UJ7A 4EAQA 2YN4A 4CL0A 1H9AA 3ETHA 2BQ3A 3HTXA 5I9MA 1EUQA 1MG5A 3IEIA 3R6TA 2CJPA 1QZTA 2IPMA 3CZ4A 3ZTWA 3QOFA 1G63A 2WM9B 1EH5A 1BW9A 3HVRA 2V7QD 1T91A 3H8SA 1PX0A 1EAMA 3I4CA 3UFXA 1P0IA 2VYND 3AF5A 4O4HA 1N0UA 1JMYA 2X2OA 4OJYA 1GVNB 4C3ZA 1K9VF 3JQGA 1QHGA 4YJFA 5B30A 4BWSC 3GA5A 4Q7EA 5AHXA 4Y8VA 3OCUA 1E2QA 2II6A 4FUQA 2GTPA 5JQWA 4QWDA 2FPPA 1A77A 2QP3A 5AKLA 2QM3A 2PMBA 4OBBA 1XZPA 3T6KA 2Q4BA 3UJDA 1U7OA 1Y1PA 3EEFA 2ZQ5A 2H4HA 3GVCA 3DLPX 3QJGA 1RM0A 3HBFA 4JYBA 2FU5C 3QQ5A 2W9CA 3ROPA 1JB9A 3FVTA 2NNLD 3WSTA 4OXKA 4CMIA 2J7PD 4D5GA 4HI0E 3FYTA 5JO9A 2L69A 1M1ZA 3QEJA 3IB6A 4BJHB 3MM4A 4TLEA 2CNWD 1CUBA 1P1HA 1R6VA 2PGLA 1I01A 1VB3A 3ZKWA 4J1SA 5TJHA 2W7PA 2QJFA 3N8NA 1H2RS 4ERXA 2A6PA 4AP9A 2AX3A 2WJJA 1KEWA 1NMZA 3HO8A 4KDRA 4GFDA 1XVVA 4OUKX 2ZRJA 2BV3A 4URFA 3SJAA 4G8BA 4FGKA 5CW1A 3W8NA 4PPQA 2J4DA 2YC4C 2CDAA 4QVGA 2ETXA 1VECA 2HSZA 2PMKA 1KXZA 2LCQA 1KRHA 3SGIA 2OC9A 4ZC1A 3WWPA 2FK3A 4LTNA 2D1SA 1WXIA 3RC3A 2IE0A 4S2UA 2OR3A 5KJ6A 1TPZA 3P94A 1KO8A 3TSOA 3IQEA 3Q3VA 4JLUA 1D9ZA 2O3TA 1JDTA 2W6IA 3RDPA 4MKFA 3QXSA 3K5PA 5G41A 2QT1A 4JZYA 5F5LA 5JYCA 3JZFA 3O4GA 3BYZA 4P3NA 1NSYA 2WWFA 1NKVA 4JC0A 2HREA 4OMFG 1Z5ZA 2QTWB 1ULBA 2XZLA 5KT6A 3ED5A 2Q3HA 3MGAA 1IJBA 1X7WB 1DC5A 2FX2A 3H8VA 5I4CA 4RD3A 5P8WA 4QUHA 2JIOA 3H20A 4LZPA 1F6BA 3ZE2B 1UMCB 1OBFO 2XVAA 5KFXA 1N2CE 3INYA 4DMGA 3NYQA 3TTVA 5DO9A 4J6FA 2ABWA 3BCRA 4ETIA 2IYOA 1UMDA 3P96A 4EDHA 3KLBA 1ZL2A 2ZATA 3I64A 3MIZA 4NAUA 5K8IA 5IN5A 2YYAA 3G85A 4X1IB 3TPFA 4RNOA 4WADA 4OJNA 1HE5A 2W11A 4P86A 1T4DA 3VNNA 1HKUA 3B2NA 1N6NA 4INOA 1F38A 4G6ZA 3DLCA 4KACA 1M2JA 5K6RA 2R60A 3HP4A 4R5MA 4QBIA 2HOQA 5KT5A 1NVUQ 1QF9A 5CM8B 3IDZA 2DPMA 4G56A 1AMNA 1Y8CA 4JV5H 3G23A 3N1UA 5KFOA 3OKCA 1KR5A 4AN4A 1XAGA 1GL9B 4TLMB 2ZYWX 3UMGA 2EF1A 2MMCA 5DYNA 3O8BA 4IDEA 2GCGA 5CX4A 2GVZC 3KQMA 4RIFA 3BSYA 3BC1A 4DCTA 2C2DA 3QQPA 4PE5B 3ZUPA 1DOAA 2LIPA 3UJBA 4MQEA 2W6JA 3PPIA 4RFSB 1AKMA 4ZU6X 3K3VA 1FRZA 3SQXA 3UQZA 5BY2A 2XI4A 4G41A 2IV2X 1E8NA 3R7AA 3SEZA 3PB3A 2X2EA 4A3KG 3I2FA 3IAHA 2JJYA 3W06A 2H63A 4IINA 3MCVA 1FQJA 3L0OA 3DFZA 1FEZA 4YQYA 1WWKA 1YB4A 1CQIA 5AK3A 3THXA 2YASA 3AFIA 1Z0IA 1A8SA 4NY1A 5F9MA 5I4BA 1TT5B 4BNVA 3NTLA 4UVHA 1GNSA 1CZNA 4XD7D 2OC4A 2QL7A 2QTBA 1SPXA 4QFCA 3M33A 3HDVA 4R2XA 1TUEA 3K94A 3PGLA 4MS1B 3T5KA 4GX0A 4BFLA 5DKFA 4DMMA 2G5TA 3VR0A 3C8DA 4ARAA 3CR8A 4YRTA 2X4LA 1TE2A 2PD4A 1J7JA 3CZMA 1JNXX 1OFUA 2CHUA 4EABA 4GW3A 3PG5A 3TFOA 1CRWG 2CLEB 4EUFA 4O2BF 2A5DA 3JWIA 1YHYA 3OZ7A 1KNQA 2VTKA 3DE5X 3M4XA 1W4RA 3FN4A 4H1HA 1UBMS 2W48A 4YQFA 3CSWA 3K30A 5J1SB 3MGCA 2PQMA 1UKBA 2VQDA 1SIWA 5BYAA 1HFJA 4ZVRA 2Q5JA 3PHGA 4HYKA 1O0CA 4MXDA 4Y6OA 1HQDA 4L28A 3OOJA 3PW7A 1I80A 3AVPA 3AMVA 4PQEA 2RGNA 3TL6A 4B4OA 2AZDA 3TZQA 4WY5A 1ZMBA 3IP9A 2I7VA 1BWQA 3STUA 1WHTA 2FXVA 1QS0A 3W5JA 4ECAA 4U3JA 3KDAA 3N53A 3NX4A 4IIGA 4AULA 1XRQA 1NVBA 4D96A 2VT3A 1Q1GA 4WXPA 2FHSA 5F9LA 5BYBA 4TLCA 4M37A 1QOZA 1RHMA 3LPDA 4D42A 4HDNA 3ZR4B 3RSOA 4CQMD 3FA2A 3RJ0A 3UNXA 3O94A 2B8JA 3C8MA 1WD5A 5A1JA 2QZJA 1OXUA 3AVXA 2R6FA 1C1HA 4CIVA 4IVRA 1T1SA 1Y0BA 2OENG 4BNZA 3BTVA 2ZM5A 1GKLA 1T24A 3E03A 5DXJA 1RBZA 3QVUA 2GUGA 2JGRA 3K8OE 4L4ZA 5SY9A 4EYHB 4IF6A 4ED8A 1ZOIA 2Z2ZA 4ATNA 3SOZA 5ARCA 4N82A 1R4MB 3STYA 3I2KA 3GRPA 4RZSA 1IZ9A 2E85A 1M2VB 4AUKA 3GHYA 5EIOA 2UYCA 3I01M 2B7CA 4NZYA 3AVUA 4IQ8A 3LGAA 1YWGO 3UJAA 3UJHA 2YQ4A 2HU8A 4DC9A 5KYWA 3BQ9A 1ONNA 4GH5A 4CMEC 1J33A 3IMCA 1HBJA 4JYMA 1OGYA 3SE7A 4M9ZA 2OK8A 4NU8X 1AO3A 1KERA 3I9MA 1XEFA 1J42A 1DP4A 1XRSB 2PS1A 3H2SA 4XVUA 4AZ3B 1WZ2A 1OA1A 4UUQA 4GVLA 5FA5A 3SJBA 4LECA 4BO0A 3QRWA 3RRJA 3V9AA 4KFUA 1VHTA 3A7DA 1E0DA 5FT9A 2C20A 5DOVA 1GKKA 4LCJA 1P5JA 2NU7B 1W75A 3LTNC 5FEUA 4NJOA 4JXJA 1F20A 1KU0A 4RB1A 1AF7A 3MT0A 2JG3A 3L7OA 2BIFA 3FTFA 3E7FA 4JP2A 3Q8MA 1GZVA 1JG7A 3ZHXA 3GFQA 3DHVA 5HJ2A 2WJ4A 5TXGA 1Y9EA 3NDIA 5HFJA 5I7SA 1A9XB 3Q7TA 5L3QA 5DT9A 1N9ZA 2HADA 2PAAA 2IPAB 3A9TA 3L05A 4X8HA 3IL2A 1E9DA 5A9SA 3RODA 4O4JA 3CKLA 5EG5A 1TWGA 4R1QA 3U49A 5E0KB 3HKZA 2VG8A 3WL7A 2ATLA 5EPOA 3Q0TA 2JW5A 4QPDA 3EAFA 1QOQB 1AS0A 4KDCA 3PZBA 2V58A 5CK5A 4Y6QA 4AWBA 1CJSA 4B6QA 3CPHA 4DLKA 1BKDR 3ZX4A 3V1YA 4G84A 4WECA 1GQRA 3LXXA 6GPBA 4DB2A 2C7QA 3HFSA 3ZH2A 3JZIA 4AMYA 4GEGA 5K05A 4GP9A 4EJMA 3PEVA 3VV2A 2OVFA 1Q6ZA 4U9UA 5F1OA 1YKSA 2JAPA 3FHTA 1GZ7A 4K9OA 4QOIA 3DZHA 3VVLA 4XWWA 2R4QA 2BZ1A 5AR1A 4KUGA 1FZTA 2PH7A 2V7GA 4D4MA 1VMEA 2P2SA 3WK7A 1NE7A 1E2JA 4IDNA 1FNNA 3L8DA 4IZ6A 3QE2A 2XKBA 3W7BA 4FXPA 3K3PA 1SKMA 1J0XO 4MGZR 1EVIA 4QFDA 5B2FA 3D6AA 1X86B 3ZV7A 1F0PA 3MR5A 2CWDA 3T1NA 5E2IA 3D0RA 3FG9A 2GILA 1A27A 1KI4A 2BKXA 1CZOA 1EXMA 2G28A 3S4YA 4M0MA 5I5TA 1G19A 3B1WA 3CLSC 1DAFA 3DXZA 1H8HD 2Y0DA 1TZBA 2OXTA 1V8BA 3ADDA 5BSVA 2PL9A 4WOJA 4EEZA 3WOHA 3K70D 2IHTA 1PUXA 2BFDA 3KKMA 2QTVA 4YT4A 4DKXA 4H35A 1ZGHA 3FOZA 2BT4A 1C29B 4F2HA 4WNAB 2WIKA 4R16A 4N9QA 3WDLA 4LF6B 2GESA 3PUWA 4UTOA 4KIGA 2V7EA 4DF3A 1MV5A 4J9RA 5FRDA 4P4SB 1LVUA 2XTZA 3O8QA 1ECGA 1L2ZA 1KK2A 5HFNA 5M04A 2MTBA 4YRZA 2PUJA 3S2UA 5ABPA 2DHRA 5HIKA 3HJRA 4M88A 4F3YA 2WD9A 3HKDA 1TMYA 3OCVA 4HQLA 3L6EA 3I9LA 3RAPR 4XUDA 1NJSA 1CKEA 2UUOA 2RHRA 3R77A 4NBRA 4QG3A 3LIPA 1L6IA 4WOPA 4RQTA 3TTXA 1I3CA 4MV9A 4A6XA 5HTOA 4DUZB 1EP2B 4CQNA 4CHIA 1D6JA 4U6SA 3GC6A 1V11A 2G1PA 3D4BA 1D04A 5LQKA 2Z04A 4DC0A 2ZUCA 2CN1A 2O9JA 5KU7A 3U7FB 1PZHA 3OHBA 2I6XA 2QG9A 4RZ3A 4BO9A 1QV6A 1XF1A 4C05A 2AMFA 1TYAE 4FOLA 4C0SA 4U6PA 1XP5A 5DNDA 1NI3A 3X1XA 1O6CA 1ZRNA 3EYYA 4LC9A 8ATCA 1QLHA 4RQUA 1K92A 3LLVA 3CKMA 2V9CA 4PBSA 3CQZA 4AKGA 4YCNA 4MR8A 2D7JA 3ZW9A 2JF0A 3F2IA 3UK7A 3EAQA 2QG6A 2G67A 3S5UA 1Q84A 2GVNA 4RO0A 1XRMA 3ACDA 3OFNA 4IICA 3RAFC 2XRZA 1KJYA 4FKBA 1DBPA 4RXUA 1NV9A 2A5GA 3CVWA 3VH4A 4MAFA 1RLMA 3KJQA 1QUEA 2AFIA 4TV8A 5IAAA 5JS6A 1Y14B 4CV0A 4UM5A 4R1OA 2QP4A 1P8AA 3GDEA 3WK5A 3DDCA 3MMXA 3D5TA 3QFCA 3A4VA 2PHZA 5JD5A 5C1OA 4I3GA 5GWXA 4WKBA 4PQRA 3FKQA 1ONPA 2WA2A 2NU8A 2EV9A 2BFBA 2PUGA 3WNDA 3C48A 3KSAC 5I3CA 1CJKC 4HXGA 2V7UA 3FYHA 3GARA 4ICIA 2BUCA 5IT9A 1W47A 4LXYA 1QH8B 2JFUA 2WU0A 2BDTA 2ACVA 1ZMOA 1Y3BE 4GDFA 3BULA 1Q7EA 1H0SA 3A7EA 3F90A 1ZESA 3PUZA 4AKEA 3V4FA 2H4XA 3R9WA 1BZYA 4GT1A 4N49A 4D9GA 2A92A 5A02A 4RLFA 2HLHA 4OP1A 1JYFA 2XB2A 3HDTA 3QX7A 1Z0SA 1KXJA 1XK5A 4U7GA 1XQ1A 4W1QA 4MTEA 1D5WA 2OFPA 5TVKA 4IS2A 4BVLA 2OV8A 3N43B 4NPCA 3I6BA 3DKIA 3ZOKA 4WKOA 4KX3A 4WLOA 2TS1A 3WGKA 4US2R 2XEDA 3W4IA 5TT0A 5B7GA 2JL1A 2PQ6A 5JY6A 3NBQA 1UP7A 2QUJA 1WKCA 4ZJPA 4PLFA 1SIOA 4G9BA 2DBQA 1SULA 1QQ7A 5FPHA 2PE5A 3DHYA 2XCSB 4R8UB 4BPRA 1ZJJA 2D5LA 2GHTA 2J3QA 1L1RA 4GKKB 3DEIA 1N3YA 2NSHA 5CB0A 2OFXA 1R2QA 1R0XA 1NN5A 4C5BA 1KL7A 5FLYA 2YRWA 2ODAA 2XYQA 4EH1A 5ALQA 1CUDA 3ICCA 1EUYA 2DUWA 1IZ7A 1OIWA 4CQLA 5D3MA 4L9AA 1P5RA 3VR2D 2AJTA 4M86A 3MTGA 1AN9A 1NMEA 3SYKA 4PW0A 4R9RA 2UXDH 5JS8A 5L4SA 2V7PA 2QTLA 1GZUA 3W2HA 2H1RA 4PG8A 4I46A 3ZHCA 5CE8A 5ALLA 2PA3A 3RTBA 1ZMXA 1Y5LA 3MCUA 2WHPB 3SXUB 3PRJA 4E4TA 1UBFA 3E5MA 3E9ZA 1X7WA 4M1OA 1YDFA 1FYEA 5I9NA 3FOEC 2J5XA 3IV7A 1YK1A 1QVRA 3M1AA 4YIKA 1N33H 1YZHA 3DXFA 4D9FA 1UMCA 1M1YE 3WIOA 3EFOB 5KYVA 1QHIA 3SY8A 4P4NA 1LBIA 2YW9A 4OHRA 3G2JA 2DQSA 3KJHA 2EAUA 2ADOA 4IY1A 2AUTA 3RIZA 5H4GA 4QBKA 4ZANA 1GLGA 1AGXA 1D7OA 4DCVA 5LXTB 2Q3DA 3ORQA 4ZDJA 1LUAA 1FJHA 1BFKA 1JFFA 3GCWA 3JQ8B 4R2WA 4PZ8A 2IDMA 4RZRA 4DLAA 3QFHA 4BV8A 2GXUA 3WBKA 3Q9SA 2M05A 3GTJA 2P5UA 5FUWA 1L4UA 3GV7B 3K32A 4DJFC 1C0EA 1H8ED 3PW5A 2VRWA 2IDKA 4PN3A 2AI2A 3E9QA 3LX5A 5ECWA 1P1KA 2WM2A 2NU6A 4PM4A 4KRGA 2LIVA 4BMZA 5DRYA 1BA2A 1NW5A 3PHCA 2GBPA 3ZE6A 1X8LA 3ZXYA 1L8XA 1XEWX 2Y1DA 5FKJA 1JX4A 2CMFA 4QRHA 5JXHA 4JEUA 2C2GA 1TK2A 1YUNA 3M9OB 4F0JA 1NBME 2D00A 3CUKA 10MHA 4UNRA 3KKOA 3KYBA 1EXWA 5HIMA 3KPVA 3GMTA 4U2KA 5KWIA 4H7FA 4RFSA 3MUFA 4DHWA 5BWRA 3GGSA 3P9RA 2H2FA 4UEJA 3B6MA 3DC7A 3PYMA 3I6ZA 1VE7A 1OU4A 1DCFA 2WYWA 3R9KA 3WLMA 3WNZA 4LXIA 1F9EA 1LQ2A 3PIIA 1SKBA 1BVUA 5A6SB 3OPQA 3E8MA 1VS0A 1YA6A 3M7IA 1KI1A 2IXDA 4J4BA 4G5GA 3GUVA 5LUBA 1QZ3A 4MR7A 3G1TA 4TS4A 2MR6A 3P9YA 5K3AA 13PKA 1N7JA 3IQXA 4O08A 4JI0H 1TVKA 2AVNA 1K63A 1POXA 1SUSA 4RCZA 2X0JA 4Z1MD 1X0VA 1T5HX 4YI3A 1Y3CE 3QIAA 2WYOA 2BGKA 5C1PA 3AV3A 3GRUA 2PD3A 1OGIA 2O06A 3JVDA 4OBWA 1RC8A 2H7VA 4K1LA 5FBWB 4Y9UA 5DQGA 5D7NA 3QKIA 4RJLA 4F71A 4ND6A 4M1YA 4RU9A 2VUGA 2WHQA 4LF8B 3KJXA 4PHCA 4YAEA 1GPLA 2UYYA 3AI7A 3PNQA 3EG5A 4EG0A 2C4TA 3K0CC 3H42B 2A30A 2O1SA 3PWTA 1E1RD 2AMVA 4UE3S 2WTXA 2J4FA 5KOJB 3N41B 3FHCB 4RM2A 1K6IA 2FV8A 1K83A 5EIAA 4KMRA 3T7CA 3AG6A 1O96A 4UXIA 1RACA 2HUPA 2FEPA 2WWTA 1E5VA 2VOJA 3QTLA 2C3YA 4P84A 2QPTA 3X44A 2NLOA 1NW9B 3KXPA 2HT1A 4EJFA 3G8BA 1VLMA 1A7KA 3JSLA 3H8JA 2HV8A 1IYZA 2HNBA 2JFQA 1W5FA 1XRPA 5H7XA 2N42A 3T7JA 3J7TA 1I1QB 4NU5A 3MNFA 1Q44A 4L7VA 3A3PA 4M2LA 4OU5A 5BMVB 5LJIA 1RZ3A 3RASA 4L50A 3BABA 1RT9A 4TYQA 5IVPA 5LIPA 4XJVA 5DTMA 5IAGA 3ZJTA 1B8VA 3VKGA 2Z3VA 3WLTA 3UOGA 4DR4B 4IDOA 2G08A 1OE0A 3K0FB 4E6NA 1EX1A 5CVJA 1GQ2A 1EKPA 2IV7A 3H05A 1P75A 4FOSA 5K3EA 1XZNA 4OYYA 4FX2A 4GM1A 1VLHA 3E0QA 2C7VA 3TVTA 3KCQA 1QB7A 3SIRA 3UB4A 2IITA 1V5FA 4Y30A 2WMYA 4WAUA 1P1BA 4MYDA 1ENZA 2R8ZA 1MZBA 5CLJA 1N34B 3OQ1A 4BAZA 3LY9A 4KLAA 2JIDA 4LSZA 4ZAZA 1SQ0A 1RYEA 2ZE6A 1OX6A 5EJEA 3TXAA 1M2VA 4GLBA 4D0GA 3LCJA 4BB9A 5I6DA 3MLBA 5KFHA 1NN1A 1WEHA 4IKEA 2VXYA 1YHZA 1HNWB 1AB5A 3DMTA 3DFKA 3ZJYA 4CUKA 3AKCA 1KYZA 4XX0A 3BGIA 3ZBPA 2WLSA 4EX7A 2E1PA 3MSCA 3WY9A 1GKUB 3FFXA 5EZYA 3Q3EA 5CUQA 3IULA 3NNNA 4B3SB 4LHZA 5IZCC 1W35A 4UTRA 4EFKA 3O8DA 4N3GA 1U5BB 2D1RA 2ZT6A 3DTNA 3TZLA 3N0TA 3DKKA 3QUAA 2WAYA 2YFHA 1RHKA 4CRWB 4AZ3A 4LJ7A 1NY5A 4EY4A 1WXEA 2IYAA 4H17A 4I4TA 2XCOA 1IU9A 4IOLA 4YQZA 5LB2A 1B0UA 2FW6A 4OD0A 1SBZA 2W4MA 2HGSA 3DBRB 1UBUS 4B4DA 4W82A 4GLWA 1G4UR 2IC5A 3FFAA 3U60B 3EEBA 2CXOA 1KEPA 2ZGVA 1DKNA 1ZXLA 3FNBA 4HK4A 3L0YA 3NMUF 3U3DA 4UPEA 2G09A 4GOJA 2DABA 5TVGA 3GTLA 1PNQA 2R8RA 3AFGA 4B84A 5FP0A 1G2PA 3SYLA 3REQB 2OZLB 4Z9XA 3BRWA 2IS2A 1P31A 4CMFA 3ZDFA 5EERA 2VUIB 3A9VA 3BEOA 3MB5A 3LPAA 3HDGA 3EFHA 1XG5A 2WINI 4WLNA 3KUUA 1FTSA 1EX7A 4UJ5A 3VO1A 5IM5A 5DLEA 1II8B 2GPTA 2PLWA 2DY1A 1XMSA 3K9CA 2QG4A 2C4VA 1SMKA 3AUAA 2VHTA 4G63A 4RA6B 3DZGA 2QBYB 4KVZA 1ZNXA 4Q44A 4AD8A 5BW5A 2X4IA 5DOZA 1P3Y1 2DB3A 5EE0A 1CNMA 4CQMB 4DLSA 4FTWA 4F5EA 4RWEA 3AY0A 3AP3A 3IKVA 2R7ZA 4DGQA 4HATA 2DM6A 3KD2A 1OPXA 1X7ZA 5EJ8A 4OAPA 2PNFA 1AB6A 2HPZA 1NAIA 1TMOA 2ZTSA 5BV8A 2DFTA 4AJIA 1GA4A 3G6XA 2FG6C 5C5JA 3TK1A 2ZE8A 4F8YA 1PJBA 2IKQA 4O3RA 4J43A 1PLKA 3KT3A 4LFBH 4IIJF 2QVLA 5COBA 2VP6A 5JXWA