2GLTA

Structure of escherichia coli glutathione synthetase at ph 6.0.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
316
structure length
296
Chain Sequence
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE BIOSYNTHETIC LIGASE
publication title Crystal structure of glutathione synthetase at optimal pH: domain architecture and structural similarity with other proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthesis, ligase
total genus 100
structure length 296
sequence length 316
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2gltA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2gltA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gltA01
1GSOA 4TV8F 3KAJA 2W6NA 1KJJA 2Z02A 4MV9A 4EA9A 4GGMX 3K3PA 5J2TF 2R7NA 4ZQIA 3K5HA 4MV4A 3JZIA 3VPDA 2ZDQA 2FPIB 1UC8A 5CB4F 5FNVF 1CQIB 3G8DA 1KC7A 4C5AA 3V4ZA 3UFXB 4IWXA 2NPOA 2R7MA 2GPWA 2CQYA 3U54A 1DIKA 1IOVA 3HBLA 1CE8A 2YW2A 5EZYF 3TINA 5BPHA 1AUXA 3R23A 3TW6A 3KAKA 4MV7A 3QFFA 1SCUB 2W6ZA 4O84A 4M99A 4HNTA 5LYJF 5I47A 5LP6F 1A48A 1DV2A 1W96A 1KJ8A 5JQGF 2NU8B 1BNCA 2XD4A 4YJ2F 1GSAA 1JKJB 1OBGA 4O2BF 2DWCA 3OUZA 5JVDF 4IZOA 1KJIA 1KEEA 2ZDGA 3E5NA 2VQDA 4M9UA 3BSWA 4I4TF 1C3OA 4MA5A 4IHJF 4FFNA 2HJWA 4FU0A 5IYZF 2PBZA 3BG5A 3GIDA 1B6SA 2YRWA 4MV3A 2CZGA 2R85A 4FFMA 4TV9F 2J9GA 1M0WA 3HO8A 4ZI7F 3SE7A 1ULZA 1IOWA 1EYZA 4WD3A 4O86A 4O7ZA 1GSHA 4C5CA 1EZ1A 1Z2PX 1Z2NX 3LP8A 4XZ3B 2I87A 4EGJA 3ORRA 5LXTF 2V59A 1B6RA 1KJ9A 4FFLA 4XYMB 5H80A 2ZDHA 2IP4A 3MWEA 3G8CA 3RV3A 3TIGA 2FPGB 4FFPA 1I7LA 4HNUA 3N8DA 2R7KA 2DZDA 2YS7A 5GONF 3VOTA 2R7LA 2CNUA 3R9RA 1VKZA 4J6EA 4I50F 3MWDA 2YWVA 3MJFA 2SCUB 2W6OA 1KBLA 1EHIA 1W93A 3ETJA 5HV6A 2I80A 4MAMA 5C1PA 4EA8A 2C00A 4YB8B 2CNQA 4O81A 4EA7A 4O7SA 2FB9A 4O4IF 4HQ6A 3R5HA 3K5IA 4MA0A 2YL2A 2NU6B 3VMMA 1CQJB 3JRWA 2PVPA 2NUAB 2FPPB 1UC9A 2CNVA 2GQRA 2NU9B 2YZNA 2WYOA 2R84A 3U55A 3VPBA 3WNZA 3KREA 4QSHA 3WO1A 2FP4B 2I8CA 4FGRA 1PK8A 4O7TA 4RZQA 3TQTA 4YJ3F 2YS6A 4L1KA 2XCLA 2GLTA 5LA6F 3OUUA 4YAJB 4O82A 3AW8A 2V5AA 3ORQA 4ME6A 3TIIA 3GLKA 5BMVF 2GPSA 2X0SA 5DMXA 3BFPA 2W6PA 2W71A 4FE2A 1OBDA 1M0TA 4O7WA 3DF7A 1DV1A 4I55F 3Q2OA 4C5BA 3Q1KA 1I7NA 1VBHA 1M6VA 4HR7A 4YAKB 4O7VA 2W70A 4EAAA 2VPQA 4MV6A 4XYLB 2DLNA 4WBNF 2QF7A 5D8DA 2Z04A 1WR2A 4O83A 5C1OA 5JH7F 5LOVF 1A9XA 4O4LF 4Y8VB 3RV4A 3BSSA 4M98A 2P0AA 4EG0A 3JZFA 2YZLA 4O7LA 1JDEA 4YBZB 3RFCA 4HNVA 5JVLA 4O7YA 4E4TA 4O4JF 4EABA 4FFRA 1KJQA 1AUVA 4MV1A 1GLVA 4ZHQF 1EUCB 1VBGA 2VR1A 1Z2OX 2HGSA 4EGQA 1JDBB 5BPFA 2YYAA 1JLLB 4M9CA 2DIKA 4O7RA 4TUYF 2R87A 5KX5F 4IWYA 5KKNB 2R82A 2YZMA 3LWBA 2YRXA 1EUDB 3I12A 1BXRA 3R5FA 3U9SA 3V4SA 3AX6A 3N6RA 5J2UF 2OLSA 3KALA 5K2MA 2V58A 1KUTA 5C8YF 3NUAA 2W6QA 1E4EB 2PN1A 3R5XA 4O2AF 2VHEA 5CA0F 3VA7A 2NU7B 3RUPA 1C30A 4XX0B 2R6FA 2GQSA 2QK4A 2W6MA 4DIMA 4NYEA 1GGOA 3ETHA 4O7NA 5CAEB 4FFOA 3HB9A 1CS0A 2YZGA 2R86A 4MV8A 1E4EA 1PX2A 4IIJF 3JRXA 3WO0A 4DLKA 5HBRB 4ZOLF 3VPCA 3U9TA 5JQWA 3BSYA 1T36A 4O4HF 5CA1F
chains in the Genus database with same CATH superfamily
1P4SA 4B3RB 5B3KA 3TPFA 4RLFA 1JG7A 2O7RA 1N4AA 1VFNA 4IV8A 1MB0A 5BN1A 2P9QA 1U7TA 3K0AA 3P5SA 3VSCA 1JH8A 1NRIA 3QYJA 1PR2A 1GIAA 1YAHA 4YEDA 2FCAA 4KXNA 2I1WA 1RCTE 4RA9B 1M8JA 1IEQA 5JVDB 1ETUA 1GCUA 1T6ZA 2VZ9A 1OLXB 1FJXA 1Z12A 4BY7G 5HA5A 1KJYA 1NVAA 4WN9B 1EJ2A 1RAFA 3VPGA 2AX4A 4GUAA 2IODA 1CBUA 1VA5A 3KKPA 4C6HA 1A72A 2XD4A 4OQ4A 4X8OA 1U1GA 4EVSA 2Z83A 5DLPA 2WUDA 1OAOC 4NARA 5G0TA 4Y6GB 1SCUA 3KO8A 2VDQB 5AXAA 1L5NA 4BWVA 4Q45A 4HGRA 3W1GA 3V8QA 3TW8B 1WPQA 3H86A 1YXMA 5KBYA 4YJGB 1RAAA 3I2KA 2F1KA 3EZLA 3MAAC 3DMNA 5AJWA 3PFHA 1I94H 4HQLA 2TMYA 5E6RA 4EUSA 3HZRA 4WD3A 4ARVA 4IDFA 2UUCB 1X13A 4G5XA 1NW6A 4R9VA 4D9EA 1T3SA 4TSFA 3ZY2A 1TJPB 3N8DA 3MJSA 5J43A 4WCFC 2H5IA 1ZEJA 3KSBC 2VQ6A 4WLVA 3PE4A 3ZU6A 1UINA 4ABTA 4G1FA 5KCMA 1FU7A 4MVJE 4M7OA 3OPVA 4Z3KA 2HCTA 5E1BA 3PPIA 4OP1A 1GYQA 3KQHA 1SA0B 4RNNA 2GD2A 1QIFA 2FK7A 2ZBVA 3GRVA 4RABA 1O97C 5ALKA 4E7OA 4D45A 4CDMA 4DA7A 3MMNA 3ODGA 4H1HA 4QU8A 1NAHA 5KT2A 3QP9A 1E0DA 3ZW9A 2CGEA 5AJUA 4UULA 4O0LA 4HDNB 4ED1A 4PQFA 5EWJA 4LFAH 5FWNA 4JWKA 5AOVA 2HA0A 8ATCA 2Z1MA 1VSBA 3CRQA 3B5JA 3WGZA 3OP1A 5FXMA 1Y1TA 5KSPA 4J9PA 1BGWA 2DSNA 2OY0A 1DJMA 2NAFA 1MZVA 3D1LA 3GQCA 2J32A 4TTQA 4P36A 5KFDA 4B0PA 3OQJA 3HUUA 2QF7A 3FOZA 1W44A 2P2SA 3QEMA 1FW6A 2O0MA 3DE0X 3T3OA 2HRRA 5JZBA 1KDRA 4O7LA 2NUBA 3E9CA 1XDGA 4LHWA 2B8EA 1WCIA 4QO8A 4KIGA 2IZ0A 1TJ5A 2I5PO 1I3MA 2X3FA 1X9NA 2PRIA 1AHHA 3DJYA 3KR2A 5DTJA 2R8HA 3STXA 1VIDA 2ID7A 3NCTA 1Z2EA 3E4CA 1HE1C 2YV3A 3PWZA 2FRXA 2IY7A 2ZJ7A 5K09A 4K8RB 5LLSA 1QH8A 1Q0QA 4HZIA 3U0BA 2ZUWA 3ZQJA 4DUGD 5KNBD 4LZAA 3DZIA 4Q1BA 4DEVA 3ZZ1A 3A6JA 5FFMA 4BJ1A 5C8YF 5JCJA 1WHTA 1NHGA 2B5WA 1JEAA 1U28A 2QN2A 1T13A 3U6KA 2Z56A 2I4TA 4Z49A 3PHHA 3QXHA 4QIWA 3F49S 1W4LA 5KYXA 3A06A 1XRPA 1QHYA 3QPDA 3ZE8A 1Y1WG 2ZZNA 4N1AA 4UE6A 2AOUA 1SXQA 1SKBA 3LBNA 1Y5MA 3G5AA 1Z28A 2D0DA 1PGNA 4GPIB 5EXDA 1UR5A 2G82A 2HU2A 2FRDC 3BABA 2XQIA 3GQBA 4NATA 1KGSA 5B3AA 2F8SA 3UJ7A 2FSVC 9ATCA 1PIWA 3K5HA 3TTYA 5JSUA 4DV0H 4WERA 3HXKA 2YWEA 3QA9A 5LBIA 1E7RA 4JOBA 4NQRA 2E87A 4C5AA 3M9MB 1Z16A 1HURA 3AZQA 2Z98A 2WAQA 3HOUG 2QRVA 5G4KB 1AC5A 1G63A 3IEXA 3TVYA 3MRTA 1C3EA 3FYUC 1BEZA 2YC2C 2W2TA 1QQ6A 2D62A 1X92A 4V1CB 4QGAA 3WI7A 2VJCA 4ODIA 4I1YA 5T57A 9LDBA 6AT1A 1XZ8A 1S5PA 1RI5A 1KI4A 1SBCA 2Q7XA 5EWLB 4MQ6A 1ULAA 3C5VA 2YN4A 1NY6A 4EGAA 1IBKH 2R4TA 2AMJA 3I9JA 3QPVA 4G0QA 5K45A 3BTOA 2A58A 4E14A 1TK2A 1UMDB 4O3FA 5DAAA 3TE6A 2AN9A 1L6RA 4X93A 4HOYA 5AT1A 3OO0A 4DMCA 1ULHA 1M0WA 3NBKA 5I01A 2PRJA 3CFYA 2E55A 4GGPA 3SJUA 1KZGB 2O3UA 1A9QA 4F06A 2OGTA 1T4MA 4D82A 4LJ6A 4FKMA 4FFLA 2XZTA 1E1CB 3AF2A 2F1JA 2D1SA 2FZ4A 2NSDA 1E3SA 3CG0A 3PJRA 3SK0A 4J3NA 3ETEA 1MJGM 4BX2A 4F7WA 1JU9A 3GGGA 4NE9A 4DC9A 1JAZA 1EE9A 4X85A 2R7AA 3QFTA 2J4CA 2VA2A 4G84A 1NUHA 3W7VA 2AEFA 4F21A 2A0YA 1UT6A 3WLLA 1DBQA 2HV8A 2OVFA 2NO4A 4AJ2A 3DLHA 4YJKA 3KPYA 4BNZA 3JSNA 5KTOA 4IIVA 5KOJB 4P4NA 1FTGA 2PQMA 4Y98A 5A7FA 3W5OA 3ADKA 4BO7A 5GINE 2P2CA 4FR5A 4GP6A 4L9WA 4IILA 4D4HA 1U4SA 1VMKA 4ALMA 2D2VA 1Z22A 1NPYA 4JDPA 5D5QA 4A0HA 2P62A 3TOVA 5DKFA 3FD8A 3U3KA 4MTCA 4EYKA 4NPAA 3CU5A 4M0LA 4OYYA 3AI2A 4Q15A 2C04A 1EDOA 3F8TA 3V4LA 3DYBA 4H6XA 1TKRA 1H66A 1YA4A 2FN4A 1H6DA 4QYWA 4TN5A 3A3YA 1PV2A 2WV7A 2C8LA 4V24A 2FSSA 3L4JA 3SE0A 1L7RA 1Z68A 1HFEL 1KVQA 2QLFA 4FQ5A 1NVEA 2QE7D 2VC2B 3KXDA 3P26A 4ITRC 1XZDA 3DMPA 2BI8A 1GLVA 2NTVA 3JZ6A 4E5UA 4O8CA 1Z3IX 1T0HB 3H2KA 4UAUA 2O7QA 2RJ3A 2VL7A 4AUMA 4LBVA 1V5EA 3IE1A 4RKRA 4EHBA 1OLUB 2QY6A 4HAXA 2FLWA 4RTNA 3WX0A 1WS6A 2BYTA 1CIJA 1U8FO 3QTTA 3NHUA 3L4EA 5AKGA 5DG7A 2DOKA 2ECFA 5C8YA 1I3NA 5EXSA 1T6BY 4AQYH 5DF1A 1VGQA 3KIPA 3U7FB 3T0IA 1NJ2A 1HWYA 3M4ZA 1I6UA 4B6EA 2XOKA 5E3JA 3GCXA 3LE8A 5C4XG 2C0QA 4IG4A 2HPAA 3IP7A 3TMAA 4IP0A 2O3JA 1H22A 1KJNA 2B2CA 3BAAA 4X90A 4HQRA 1T94A 1GR1A 2WT9A 4JEHA 5KYYA 4RY0A 4AN1A 2HLNA 3ZS8A 2EFHB 1M2VB 3T9FA 4OQDA 3IAXA 2VDVE 4OATA 5CBKA 3EVBA 5LOVA 2D4HA 2E18A 4OQMA 4JB2A 3EF0A 4FD3A 2H0RA 3U0VA 1PTJC 1GTZA 1C7RA 1CYEA 3V32A 2OC4A 2XXAB 2IA5A 3UQZA 3GDFA 4UHEA 5HOQA 2PJRA 1JLHA 1E2IA 3H4BA 5AOAA 1ZU4A 5FPPA 5HBRA 5JQGB 3HOZG 1XPUA 4WEOA 2QRQA 3LOPA 3GEEA 4O2BB 3VNQA 3AF5A 5B36A 4F9GA 3MJVA 1IVSA 3K94A 3G6XA 5D1PA 1HV8A 3NZEA 2YBDA 2YHIB 3TVTA 3VSAA 3RFXA 2PHZA 4OQFA 5DWQA 1WU7A 5KG7A 4JI7H 3PWSA 2PLNA 3B1WA 5ESDA 1I5OA 2G28A 1Y6RA 4DV5H 2JFBA 3TG8A 1M1NA 3IVXA 1Z4OA 3W0LB 2ZUFA 5IJ9A 1GD1O 4EA6A 1KEEA 5JDIA 3GZJA 4LE0A 5A4JA 2CHUA 4QNNA 3DFUA 1P0MA 2HQOA 2DBYA 1CERA 2DEUA 3VDQA 5CFRA 4JXJA 3CHYA 2GZ1A 4KPGA 2HQ1A 3O95A 5DTIA 1KI2A 1U7OA 2HJ9A 2E89A 5F9FA 5JWOA 2ZM6B 4HLUA 4CCYB 2I7CA 1SNYA 1K8RA 5IT4A 2ZIEA 4FMDB 4U4AA 3IMKA 1N6OA 4J6FA 2HMSA 2NAPA 2EYUA 2GEJA 4MMYB 1T6NA 4KDCA 2B61A 3NBZB 3GH3A 2E5LH 3D0RA 3IVAA 2VF2A 1K6EA 3AFIA 2FGJA 1FRFS 3ZJVA 3OJWA 2P3OA 1KYIA 4GI3A 5JAPA 3GBPA 4MAMA 1KMHA 5JIBA 3TRHA 1RHQA 1WMFA 2Z8YA 5L45A 3ZX5A 2PR2A 3OQVA 3K9HA 3L4SO 4MA0A 2GS9A 3WGTA 1SHUX 1EM8B 4FYPA 1HEYA 1F1BA 1PJBA 4OHMA 2PBFA 4J16C 1SBTA 1ZK2A 4OQNA 2FPPB 4DLXA 1J24A 4RTOA 1QTQA 1E6MA 4TWZA 2EL9A 3H1AA 4X64H 1J6UA 1YCGA 4WJKB 2FP4B 4XXHA 3OY2A 1E62A 5JAQA 4DILA 1NC1A 1U3FA 4U2CA 4P2BA 3CGGA 5SV2A 4BQOA 2AZ4A 4OQQA 1EXMA 1FF9A 4JWTA 4FJ0A 3P2YA 3L7JA 3ZJYA 4ND1A 3WHPA 5BV1A 1RXYA 4JLAA 3MFQA 1ZX1A 3PNKA 5DXJA 4UNSA 2VHVA 4UM8B 3CNNA 4TKLA 2FLVA 3GUZA 5HFJA 1N9KA 4FNMA 1F1JA 3VR2A 4MRVA 3KZ1E 4XRGA 1LQTA 5LQSA 5KQSA 1OA0A 3AGPA 4PRKA 1UBJS 1ZUWA 4H77A 1XQ6A 4J1SA 1L5QA 4MGIR 3GFVA 4KE7A 4NCKA 3PEVA 1RP7A 1VE5A 2JJ1D 4F12A 3PN1A 4ZO4A 5DW0A 3RBZA 2HR1A 4OMCA 1USGA 4MQFB 2VKQA 4B3SH 5CVEA 1GO3E 1GRQA 1ZUHA 3A32A 3UIEA 1KORA 1HX7A 5FI1B 1GGKA 2YJ6A 4BS9A 4JBWA 4DDVA 1ADJA 1QGZA 3M6WA 3H4DA 2FSFA 4RENA 5L4NA 3MAJA 4LJ9A 5F5LA 4L8YA 4DANA 8GPBA 4NZYA 3RFUA 3ECCA 4JUZA 2J0UB 3FJ1A 3WLOA 4G8BA 4L5IA 1PI3A 4JZKA 4YCSA 2X3UA 4UARA 1NT2A 4E6NA 1C29B 5BQ3A 5FH9A 3ZJTA 3ZDBA 3B89A 5L4LA 2B3DA 2DR2A 3HXMA 1Q0HA 2J08A 5CBPB 4B31A 4UBMA 2UVWA 3K4HA 2CLEB 5CT5A 4A36A 2PT6A 3PQDA 5KTPA 3GYGA 3IHKA 2CDRA 1G20B 3DE6X 4O5AA 5COQA 4DZZA 5AHOA 3FX2A 4XFKA 2WPDD 4TL7A 3M70A 2POQX 3QVMA 4JLSA 2ANCA 2XE8A 1DRWA 4PX9A 3HP4A 1A9OA 2LZ0A 3ZNOA 5DN9A 5LD2B 1V0JA 3QFFA 5EFZA 4AUNA 1Y1VG 1EFAA 3SHWA 1EFVA 3UK6A 1GLGA 3ELDA 5A0FA 1WZUA 4F50A 1NTRA 3PB3A 2IGBA 4OY3A 1OH5A 4MYUA 4ZAXA 5IVIA 2Y68A 4IZ6A 2AVNA 3FW1A 4B7ZA 2AJTA 2ZE8A 5FL7A 1V3TA 2BAGA 3UFBA 4JLJA 3R6TA 4LQCA 3WAKA 2V7BA 4JI4B 3HYSA 3AF4A 6CHYA 2PZ8A 1F7VA 3AEKB 4P7FA 3LPLA 2YVUA 1DFHA 4IX1A 5KFAA 2NTYC 5EIWA 4E5KA 4DDTA 1YDGA 2LV8A 3NRCA 1LBHA 3R7NA 4JUIA 2RONA 1TYDE 3N07A 1S97A 2HX1A 2ATIA 5HDBB 3AFHA 2CBXA 5CG1A 3FZNA 2VA8A 2ZSHA 1NXPA 3ZTWA 1K7EB 5A2QW 4EZBA 2V4QA 3U09A 1V9LA 4G0VA 4FDAA 4EPYA 3G13A 4LRXA 1MLDA 1U9IA 3WL3A 4NE2A 1X0XA 2BR3A 4AY5A 4B17A 3NR2A 4AD8A 3DBVO 3WGYA 1T91A 2G7MC 2ZIWB 3AOEA 4Z4FA 1R9MA 1U0NA 3OH8A 1JQLB 4U1RA 1QRDA 4P92A 2CKMA 4UNPA 4BZXA 3UWPA 4AG3A 3HYLA 4UDNA 4D25A 2P5UA 3BFKA 3D4NA 4E94A 1CUSA 4LWQA 1OXXK 3ZEAA 1I1KA 2P6RA 4C4YA 1QG6A 4KW7A 2IH5A 4GOXA 5IFLA 5B7NA 4PGAA 4X8LA 2ALJA 5MN4A 3QVWA 4JP8A 3C24A 3KJEA 5K1ZA 3OOJA 1W36B 3V1NA 2VEDA 4QJ3A 4OJQA 3FTNA 3WLHA 3O2SB 4R1LA 6ADHA 4D5EA 1I4OA 2FQYA 4O1HA 4LGCA 5JAMA 5CFLA 1ZA1A 1UDWA 5AVXA 2XJ9A 5A5FA 5KMGA 3RFCA 1FC0A 1ZL2A 4HXYA 1JFLA 3GFGA 3AI7A 3H17A 3CNHA 4P3XA 2WNHA 5J1SB 2ONZA 5ALNA 4IMRA 4ZMBA 3AKYA 4OTZA 4QWMA 3X44A 1G18A 4PDBA 1NM5C 5H7XA 3H1TA 4I55B 1Z38A 4JI3H 4FMCB 1XUOA 1PGOA 1YRHA 4NDZA 2IXTA 2B4AA 4J0EA 2PZGA 1C0LA 1KNQA 3GR6A 4DUYB 5T3UA 3MW8A 1DDIA 4IO0A 4GF5A 2D74A 4C3OB 3CRW1 4JNCA 3CSUA 2K7ZA 1I3KA 4B80A 3H2BA 3AVXA 5KZMB 3HYRA 3LQRA 1D4AA 2LBPA 3SWWA 3VU3A 2ASLA 2O8DB 2VJKA 1Y1SA 3S70A 1N34H 2PBLA 4PO3X 3GJQA 4O4LA 3GB8B 3BJZA 3ADCA 1QSGA 4IJWA 3LZDA 4KMOA 1D2MA 2IEIA 1HZJA 3R3SA 2OYRA 3DLPX 1XVIA 2VJLA 3BGVA 2XUFA 1WBDA 4XJXA 3G88A 1NIPA 3I05A 4QECA 2GPWA 4EG4A 3OF5A 2JA8G 4GNRA 1TD1A 4DOMA 1GYPA 1IRIA 3ZGNA 3ROMA 3NRJA 1P7PA 4QYTA 2BM1A 3A6FA 3PGVA 2O8EA 1T8WA 1G7RA 1M8PA 1RTTA 3ZBUA 2ZXEA 3FNFA 4YVFA 1H23A 4TQAA 2WIDA 4F38A 4CG2A 4PYOA 2BTQB 2WVAA 3PIIA 1XR3A 3LK6A 1UWLA 3AKZA 4YRKA 1FRNA 1K9SA 2YWHA 3HU1A 3LYHA 5EWMA 2WTAA 3KTMA 2QZ4A 4NEHB 1DAHA 4HN4B 3B82A 1V1RB 3OZWA 4EKGA 1QB7A 1OWTA 2RB5A 4Z7QB 2VTKA 1Q7BA 2HT6A 3MGBA 4UW9A 4MS3A 3RGWS 1D09A 4D98A 2BFBB 4JBLA 3TAXA 3TR0A 2BFDA 4I3FA 1X1AA 1VL5A 2M98A 4MKHA 3B8EA 2GJSA 5IVPA 3UHJA 4LE2A 2NV0A 821PA 1Q11A 1AGRA 2R93A 3GF4A 2DR0A 1YRWA 3GO4A 4WLNA 1FUIA 5TY0A 2GEFA 4ZYYA 1GV0A 4QICA 2JZCA 4HP8A 1ZH2A 1W85A 3E61A 4ARUA 2QXUA 2X19A 2V0GA 2VK4A 1O1YA 2NXJA 3VNVA 4V0QA 3OIUA 2M05A 4JI8B 1CTQA 4D9IA 3MMPA 2DULA 3EPIA 5A4FS 5AW4A 5DG9A 5JMOA 3M1YA 4INZA 2XSZA 1Y9DA 1WRBA 1E3IA 1TPZA 5CW1A 2J9FB 2A3RA 3C6XA 5TMEA 1X3SA 3EAGA 2VHTA 4ON9A 3BKXA 1ONOA 1G6KA 4ZT4A 2WMNB 4ZQEA 5EVJA 3BFPA 2VTEA 4GYJA 3UW3A 4O2RA 3NIGB 4ARZB 4HR7A 5E9QA 5LU8A 3IDZA 4F3YA 1MO3A 5H70A 1H5NA 1MP0A 4RVFA 4CG3A 4P22A 3FVWA 4KHZA 1B23P 4YECA 4Z0NA 4M1MA 3HCEA 5DYNA 4OKIA 3BBPA 4YH1A 1JF8A 3IMEA 4EUHA 2ZSFA 3B78A 3T3DA 1ZD4A 5BUCA 2ZU0C 5IYDG 2PRSA 3G59A 2DAAA 5F77A 3KYCB 3DTTA 1YR1A 3BICA 3BXFA 1X70A 2VQEH 4YDQA 1WSAA 5KKNB 1P39A 4JBYA 3SNHA 4YIHA 1TC2A 2B34A 3R7DA 2NU6A 5ALEA 2DWPA 4WECA 3ZWNA 5FQNA 1JYSA 5J3JA 4K0RA 4ZJZA 1QCZA 2HBZA 5LQUA 3RVMA 1CSEE 1CUZA 2CLDX 3E8SA 4DZTA 4AM8A 4CVNA 1CC1S 1SIUA 2OV8A 2Y99A 4K46A 2H54A 1TXGA 1TKBA 1QTNA 2I6TA 5K0GA 2FK3A 1DRJA 2EKDA 3HKBA 1M3SA 4FOSA 4GW3A 6LDHA 1YONA 3PK0A 4PAWA 5JO0A 4RB2C 4GKJB 1NPDA 2PMWB 2F17A 4RD1A 2JD1A 1AXGA 4EEKA 4Q3AA 3HKZA 2IBSA 3VZBA 3E82A 5E0OA 3KS9A 4EI7A 5KFIA 3H3VH 2O2YA 3MTEA 3NUGA 2PKEA 4XPIB 3B13B 5CM0A 1N77A 4DQNA 1XTSA 2V7UA 2YZ7A 1NW7A 2FLPA 4Y6PA 1EK2A 3STTA 5IDXA 4KWTA 3BKWA 3QVLA 4OXKA 3ZOKA 3HXQA 1PK9A 3USCS 5AKKA 5EIBC 1W96A 1F20A 5ALGA 5WRFA 2J30A 3C14C 3AL3A 4ER3A 1HOTA 5EZ6B 5FEUA 4X3CA 5EJ6A 1ZHOA 4NMMA 3R77A 2J3LA 1BN7A 4BQPA 1U1CA 2PBZA 3O92A 1KO7A 1SK9A 3CT4A 4A2CA 4IXTA 1VZ2A 4G0YA 2NVBA 3ZLTA 1TU3A 1QMGA 1QOQB 3HBMA 4XZ3B 2ZR8A 4LOIA 2HFKA 4LJLA 1MDFA 4QPJC 4QO7A 5TRTA 3HDYA 2ZT6A 1K1QA 2GEVA 5FPSA 3STVA 3A1FA 4D5GA 3R0JA 2AG6A 2RKOA 1GNTA 4AIRA 1R6VA 1XMXA 1Q21A 2PX8A 4GSLA 3JRNA 2XAAA 4HUJA 4PHFA 3RT9A 3IP8A 4Y0AA 3O21A 3DMDA 2VSYA 5TPZD 4ZAFA 3ZR4B 3N28A 5KAMA 3GGJA 5DM0A 4QXQA 1U4OA 4GBED 4YDHB 3ESDA 3TZEA 4G8CA 3HB7A 3WHLA 1UDAA 4KDRA 2OHOA 3I64A 5I3ZA 2ODAA 3Q1LA 1THTA 4NAUA 2BGMA 1W9MA 1D7AA 2ZRDA 5B7QA 4KACA 5GY7A 2ZREA 1X1EA 1A0GA 2R6ZA 5TF0A 1SVOA 1V8FA 5F4BA 2BZGA 3B20A 5EIFA 5BORA 4QVKA 3WB1A 4D3FA 1MA0A 4P3PA 3Q15C 4EEZA 2UVRA 1NI5A 3E7DA 3TCKA 2AN5A 4C03A 3U56A 2QRHA 3CQ9A 3VPAA 1SEPA 4MTLA 3RUFA 4H0FA 2R62A 4IF6A 4NJMB 4PRZA 5DH9A 4DR4H 1OZ0A 5KINB 2ZATA 1PT8A 3EEIA 1RAEA 1QYIA 2ZPAA 3BORA 4TTIA 5BWNA 1UKAA 1E7QA 5D00A 1ND5A 2GHTA 1KYYA 1PGJA 4A16A 4FYHA 2J85A 2UUAH 3UATA 4RKEA 2I03A 4WXEA 1P8LA 4X44A 3PGMA 4WA8A 3ZY3A 4DARA 2VHUA 2VUUA 1QK4A 4XGQA 2QI9F 2G1UA 4GRIA 4EL5A 4OQEA 1BOFA 5LR6A 2C77A 3HZHA 3EDQA 4RTMA 3PPWA 3VNUA 3AR7A 5EIAA 3EWIA 4TS1A 5HDQA 3LTEA 1U0JA 4L3OA 5L3RA 3BQ2A 1S8FA 3R9KA 3LPAA 5IW8A 3LP6A 4IXNA 3GK3A 5CPBA 3GJYA 1QAQA 4GYKA 1HNNA 2FPSA 4YPOA 4O25A 1XA3A 3R44A 4FZ3A 3OOWA 2HIVA 2D1FA 4MEAA 3UK7A 3BWYA 1EVZA 2C8VA 4OPMA 4LXQA 4MQ4A 1KJWA 4C0LA 4UUBA 3UAVA 3B6MA 3QPAA 4LFBB 1ES9A 4MRPA 4QRHA 2IU3A 5DBFA 4FEYA 4GLJA 3TUZC 4IRKA 1HE2A 4M2LA 1P62B 3G85A 2ZI5A 4CHGA 3LI2A 2I7XA 5KT5A 5BURA 5EZYB 5AI0A 3EXHB 4A5OA 3QU7A 4BB0A 5F7ZA 5J2TF 4URZR 3DZ8A 4PO9A 1SVWA 2GNAA 3UYYA 3H7IA 3LOQA 2PUGA 5LYJB 1UJ4A 1TCVA 2EBUA 2NT4A 3PC6A 2JCGA 3K53A 3FYTA 4BP9A 1OX4B 1K1SA 3R0XA 2CJWB 4C29A 2UUPA 1EP2B 4X61A 5B53A 1EBFA 4JUFA 3ZE0B 2Q21A 4BRUA 3DAFA 4EH1A 3O8BA 3QLUC 4X6YA 4OKSA 3I30X 4ZEMA 2R6AA 1I4EB 3OEWA 4J9LA 1SUEA 1E69A 3A6HA 2I78A 3GLIB 1XTJA 3LKBA 3VKFA 4X41A 2CMHA 1F5SA 3RYIB 4AKIA 1U8EA 3HV2A 2WSMA 2XMSA 3EWAA 4FR0A 2OAGA 4AJJA 5IMSA 1OKKD 1Q1AA 3LECA 2W7TA 5F7OA 2Q28A 1H6AA 3KXPA 3JARA 3JVVA 2WK1A 1DIBA 2FVYA 4KG7A 3JQRA 3UJ9A 2HHJA 2QN7A 4JI0B 1N32H 3KYIB 4RCYA 3CNBA 1KFCB 4IRDA 1K8ZB 4U6QA 4TXJA 1AA9A 3FLMA 5H68A 5DIZA 4G9BA 1UPUA 3GROA 3M5CA 4BKPA 4PC2A 1KZ9A 3LKVA 1HDIA 4Y6OA 3HJCA 4U0KA 4M7PA 3DZBA 1DG3A 4DHEA 3PFNA 4QLOA 2VSNA 3Q7EA 4KTVE 3EMKA 4QM6A 4RUKA 2HHLA 2H7XA 1BW9B 2VH2A 1G3RA 2VNSA 3REFA 1ECBA 1I4LD 3CZPA 3PUIA 1JXAA 2LW7A 4M55A 1KOGA 2WZDA 4Z7NB 1WW2A 5EIHA 1Y89A 2D8MA 4C7BA 4KH1A 2GFIA 2JD2A 4DL9A 3GRRA 4UVGA 1TEVA 4PR3A 1W8IA 3P9YA 4UVHA 4MH0R 4X20A 2JC3A 2ZP1A 4NJOA 3KZKA 3M7IA 2XCLA 4W8OA 2K2QB 2JIDA 3R6GA 5GVRA 1C41A 1JIHA 1F2DA 3OT1B 3DG9A 4CMAA 3KSDO 1WKVA 2IWRA 3G7UA 1JMKC 2MMCA 5I45A 4RS3A 4Q48A 3FCEA 4TZTA 1F38A 2P3QA 5JHGB 4ZHQB 1TZCA 1FXWF 3WIVA 4Q7MB 1E96A 3JD3A 4EUKA 1NG1A 4QD3A 1R1DA 2ZJ8A 1FDOA 2CB0A 2GFQA 1UPXA 3L49A 4PBTA 2R6R1 4GVPA 3FFAA 1QZZA 3KR9A 1HF3A 1ENYA 3NONA 2J33A 4A3EG 3JQAD 1MEEA 4FWBA 2PM8A 3TGPA 1K86A 3EXEB 3NFRA 4TMXA 2J7KA 3KPUA 1MQ8B 1NDHA 1MXFA 3FZYA 1ZXBA 4II2A 1U7XA 3BL5A 2WU1A 1VJDA 2ZTSA 1V6SA 2X2PA 1PYOA 1RKBA 2WD9A 1CVRA 3NMUF 4E5MA 3ZVKA 1CQXA 3E9DA 4CIDA 2VPSA 1O95C 1PUXA 2D2FA 2AQ8A 1AKVA 3VOSA 2YU9A 4RGVA 1HL3A 1U3TA 5K20A 3K8YA 3T52A 1I9GA 1A7UA 1FMLA 1FE8A 4OV6B 1EDDA 3O94A 2BOVA 4ZVVA 2ETVA 1Z7YA 2ZQYA 1IZZA 5BYBA 1QRRA 1U7DA 4LDPA 4CIBA 1T35A 3ABSB 2OCAA 3LYAA 3TIFA 3N75A 3EWNA 5TQ0B 2J3DA 1GPBA 2VXBA 1ZCJA 3MPOA 3WO0A 2H1VA 3FDZA 4PG6A 1ULUA 2ZTLA 2IYPA 4D8WA 3VPCA 2H0QA 5K8LA 5J2TA 3FCAA 3A36A 3ZNNA 1KJJA 2X77A 5D84A 4DMHA 3P20A 2BP7A 1OFVA 1GADO 3NHZA 4P7KA 5KNLA 4Y1EA 3HL0A 4F6RA 3TQ1A 4HO1X 5K3BA 4MHSA 5HPYB 2EP5A 4QU9A 1JIJA 4JLUA 3M2PA 2GN4A 1T1EA 1ONNA 4UCOA 4JLPA 1TM1E 4MPJA 1B16A 4H0CA 3TSAA 1TVKB 1TYAE 1GQFA 1S1MA 3K6SA 2CVFA 2NV2B 4HDMB 3WGHA 4Q02A 5I3CA 1P72A 3A0RB 3MINB 3CE9A 2XHZA 2VPPA 2QVYX 3CUKA 2AOTB 2V7XA 1IXZA 2FYTA 2Y0SE 5KVCA 4ILEA 3BWMA 3NEJA 1PR4A 1G8PA 5LYYA 4TZ0A 3O26A 4XKJA 1ILEA 1XNQB 4JSYA 1NUTA 3ZW7A 3N05A 1UP4A 3GMSA 3ED1A 1TFUA 4HZGA 3WV5A 3R8XA 1DZ3A 5HX7A 1QHFA 5FHQA 3CV3A 2IIQA 5A06A 4Q9DA 5BW4A 1SOUA 5IXJA 1M2OA 3AR3A 5CFQA 2WWIA 4KQFA 3ZGYA 1WZEA 1VE1A 4YAGA 5DNVA 3J81k 3WLEA 2IQ5A 5E95A 4DNOA 3OU6A 3WBFA 2K7FA 1GNVA 2OP1A 4FGZA 4O3NA 3X1ZA 3H2SA 3LLCA 1M5TA 2BGRA 1CY4A 1TUIA 1AURA 3W5HA 1TA4A 4RUAA 4RHEA 1E4OA 5C4MA 2G63A 3ILVA 1Z7GA 3LAWA 2O8CA 2DUUA 2IYVA 4FB5A 3SS8A 4WRRA 5T8KC 4PYIA 2RCYA 1S68A 4HQ6A 3LY7A 4DXHA 4CF4A 4EW2A 5JJLA 1NW4A 2ODPA 1WM1A 4ETSA 3VC2A 3T3GA 3UAOA 3AERA 3U3OA 3DHVA 3TB6A 1FPQA 2O14A 5IJAA 1G8FA 4QDXA 4EHAA 3TSWA 1JG1A 3CXRA 1P1HA 5I8WA 3REQA 4PS0A 2QTVA 5F7XA 2XKJE 2HADA 4UU0A 2C8JA 3CR3C 2WHPA 2C4MA 2UVPB 3G17A 1GGJA 1Y82A 1A0OA 3QRWA 3EMVA 1R27A 4N7MA 3W79A 1PNQA 2CKDA 4BZZA 1LLUA 2Q9UA 4WLOA 2QD1A 3OLYA 4DYHA 1FXWA 3U44A 2QV7A 5BQPA 3GLTA 3KT3A 4GZ5A 1ENPA 4V3BA 5TMBA 2WSSD 4FCTA 3WAGA 4EG8A 1TKAA 1JYFA 2O2CA 1FFGA 3PC4A 3VR4H 5LOVF 3HDGA 4DKJA 1NVXQ 3PQ3A 4K9MA 2OXFA 2FQXA 2R96A 1DXOA 4YT2A 5IG2A 1RLJA 1AZTA 1JQDA 2GLXA 4N18A 1KEWA 3G1TA 5AQEA 4CFZA 3MTGA 5LSAA 1OV4A 1REQA 2XQFA 3PX2A 5K3EA 4GPD1 3W8EA 1ZU5A 3UGKA 1XWFA 3NBMA 5EYPA 3KRTA 3K30A 4OSPA 3GWGA 4E30A 5CA0B 4ZU1X 4LDJA 1P5HA 4AG6A 1QKJA 1KP2A 1BQ4A 2W8LA 5K6AA 2YHBA 2V9WA 1BXRA 4PTZA 3CLSD 4RY8A 3MGKA 2IYFA 5ALQA 1SZJG 1KQOA 4TT8A 3FOCA 3T5GA 1Y9AA 1KUTA 2VRCD 4N0MA 1YZ3A 2CHFA 5FO0A 2FW9A 3K5PA 5E8JA 3LRXA 2FEMA 4DPLA 1VKNA 1G5PA 3IBFA 3IVMA 4BMNA 4EJ6A 1PSZA 5JAOA 4MQBA 3S4YA 3IEVA 4KQKA 4DQUA 3AIOA 1YZKA 1T5HX 3OCWA 4LY9A 1EINA 1J06A 3BMQA 2QTFA 3DTFA 1G5FA 4DT1B 3EE6A 4GLXA 1QFJA 3QNUA 3KKQA 3ASYA 1SCQA 4HLDA 4YP5A 3ZWWA 3ZUPA 4R7RA 1RJQA 5DLDA 3ZJ5A 4AS1A 4F7DA 2RGBA 4D26A 3PO3G 1BCRA 5B58T 3WK7A 5JJ5A 2OORA 3SYKA 4HRVA 5EY5B 5AHWA 4W7HA 1RYZA 1JEYB 4G4SP 2IDZA 2ZRKA 4DJJA 1QRUA 2X9GA 2Y1FA 2OHHA 4M9QA 1GKIA 4QASA 4DCNA 1MNQA 4LK2A 4PONA 3CN9A 4RV9A 2R1TB 1Z34A 2PX6A 4FWIB 4F3NA 3GLHA 1RE0A 1TF5A 4TQGA 4HYKA 2GCOB 4Y7CA 4FBMA 2TMDA 3HVHA 3A11A 4LMBA 2D7CA 3B1YA 3DZFA 1W94A 4M8NE 5ENZA 3EQZA 3RNOA 3NNNA 1CJSA 1JIIA 4FPXA 3LPDA 4FWTA 1HFWA 1W76A 4EGCB 1NBHA 4WA7A 3M82A 5AYVA 4DQDA 1H2WA 2ADFA 2JFNA 2O5CA 2AEEA 1XKQA 1RIIA 3LLSA 3ZUGA 1KK3A 4EHKA 2A94A 4AZTA 4REQB 3N7AA 4HB0A 3D2CA 1MTZA 3UWOA 1XB2A 3T5CA 5FTJA 2ISQA 3A1WA 4XYMB 1WBBA 3TM5A 4DUGA 2WIBA 1QOPB 5KNBA 3NEYA 4BECA 1UP6A 5E2BA 1SU7A 3DMFA 5KFUA 1WSWA 4MKFA 4TLCA 3ZNQA 3RTGA 5JZVA 3WVNA 3W5SA 4WFKA 3R7LA 1E1DA 2O3QA 3WWDA 3Q88A 2P2NA 5KYKA 3H2JA 1E3MA 5ALUA 1J4AA 3KUKA 3M6XA 2DPIA 1U0BB 4LWZA 3WJ1A 1K2VN 3QENA 4INOA 1PUIA 3M5WA 3LQKA 1O94C 2G5TA 3DS8A 5ESRA 2GBIA 3OMLA 3HGQA 3SS9X 4R05A 4FGRA 1TAGA 4K88A 2P6NA 2SECE 2VK8A 2GGSA 3VU8A 3FLEA 1AX9A 3GGOA 3W7AA 2D4AA 3ZDDA 5L8VA 4GO1A 2QP9X 5A2GA 2SKCA 2R8RA 3WIEA 2XVZA 3NHAA 2UU9H 2QLMA 2F3RA 4EHDA 1YDEA 2FEKA 2ZSUA 4LYGA 3W90A 1E2KA 4OHZA 3OZRA 3Q1KA 3HKCA 1E9DA 4LDQA 2EVWX 4V3CA 1E0JA 1SYXB 1ZNZA 3ZJUA 3JATA 2UVVA 4EF5A 1E1MA 4KWHA 1IBLH 2BW0A 4RA6B 1BCSA 3HY6A 4X91A 1HDYA 3CGWA 4OBXA 1IPEA 3GCWA 2CVPA 4H7KA 4BJ5A 3FOEC 2NXCA 4HBZA 1T4GA 1SO8A 3AM1A 1V11A 5H3HA 1T1IA 4Q7LA 1E9FA 1GL7A 5ARCA 2IPNA 2BM0A 1RYRA 3QXSA 4RSHA 3DP9A 3W77A 2C2HA 4GM4A 1I4WA 3N5KA 1EI9A 1Q7GA 1YKGA 5AVSA 2HYDA 3WWJA 2BY4A 5JC1A 2JJ2A 2YMMA 1XZIA 4PG7A 4DPMA 4B6RA 3LCJA 5B64A 4J8PA 3WMGA 3RVLA 3U80A 1ZVKA 3BPSA 1U1DA 5IX8A 5GPBA 4OUKX 3GJTA 4LSGA 4U02A 1C9KA 2DJIA 1XZEA 1L7DA 3X1MA 1WUYA 2INGX 1NKSA 3FHLA 1ONBA 1JEQA 1E5LA 5JR3A 3OPYA 1JU3A 3T1TA 4CMBA 3JRXA 2VTVA 3NLLA 4TM8A 3EUAA 3HB5X 2NM0A 5BVGA 3VKWA 2J3KA 2PX4A 3T4EA 4XM0A 1P8JA 5L3VA 5CAEA 1TJNA 5GP1A 4IEIA 1ZW6A 1Y3CE 2J6TA 1PD0A 1L7EA 3WRYC 3QVTA 3SZLA 1U7HA 5TDHA 4GWGA 3I2HA 1NNUA 3L1IA 5SY9A 3TIVA 3B7WA 2W2OA 3DNFA 5ADWA 1DTWB 4NBLA 2QS9A 3NH9A 2X0JA 2YJZA 4A6PA 4L27A 2XMDA 4L8FA 4UMEA 1DBWA 3KAKA 3AUYA 2RGAA 1C3OB 2PUDA 2OGZA 3IPCA 2PD4A 3MR3A 4Q93A 2FEWB 3IAEA 1RQLA 2IPMA 2WEKA 1P61B 3MWFA 3FNIA 1YJBA 2UZ3A 3I5MA 1CW2B 4JHLA 2IL1A 5IVDA 3LCCA 4LSXA 4HGPA 4R2XA 3PDUA 3F2IA 4QNMA 4A92A 1J5EH 2ORYA 1P44A 1RACA 2D2XA 2XPCA 1KHTA 3QLVC 4FFNA 3IP6A 1N3LA 4QAJA 3FY4A 3QW4B 3CUWA 3KJNA 2LWIA 3UCFA 3GJ6A 2JJMA 2Q4OA 1PEYA 4ID9A 4B3HA 5LU9A 4OEHA 3MQ2A 3ZH2A 1BH2A 2RH5A 4M83A 4DNFA 4N9QA 3MRXA 1EB9A 1ZCZA 4YCMA 3ISVA 3U31A 4BO0A 3DHNA 2WF5A 2DPLA 5K0EA 1BX1A 2MYNA 1JE0A 3C3KA 3NT5A 3WK5A 3J80A 4TTAA 5AW2A 2DBRA 2A9OA 4BMYA 3C5HA 2AFHE 1B43A 2X5RA 3UJ8A 2RK6A 3AYZB 5AM2A 3BTVA 3DAOA 1OAAA 3DWEX 1RFLA 5CCEA 1LDEA 4I9HA 4N65A 3K1ZA 2GQRA 3B6IA 3F5MA 1PGPA 1JFVA 1RM0A 2VNIA 1J2TA 1O2DA 4CM7A 1BGXT 1VTKA 3WHIA 4B4VA 4HYEA 2Y2VA 3FCUB 4JKYA 2BHSA 1VCMA 4KTTE 3VVBA 2IE0A 4ZRMA 4Y1RA 2Y93A 4DE5A 4CLRA 4TQUS 2ZYSA 4EB0A 3RVKA 4LZOA 2XTAA 3TY9A 3QVGB 3B1ZA 3MS7A 3RGZA 1RYFA 2XI4A 1RRKA 5FWDA 5CVCA 4QVGA 1DQSA 5HM6A 3EA4A 5BQFA 4DR7H 3AQIA 3E18A 4JX8A 1H0RA 3FPAA 5T41A 2BKEA 4NG5A 1X86B 3VYUB 1G3QA 4NJEB 4ZQHA 5HCIA 1Q7TA 4O4LF 3RV4A 3V8MA 3R8CA 3WB2A 2CEAA 4XYEA 3JZFA 3IN5A 4PCUA 4U2DA 1RPZA 4KE9A 2Y27A 1YE5A 5KX5B 3INGA 2D6FA 2QVXX 1YNOA 4DY6A 1A0IA 2HRCA 3K92A 3JVUA 2BR0A 4RFSA 4GKAA 2O03A 3VJKA 2WAAA 2GF0A 2XMCA 3ZD6A 2AFIB 1V8OA 1Y3HA 4ZYWA 2H2WA 3KPJA 2PEYA 1ZO8A 4UAVA 5DJ5A 3HFSA 4EECA 1HDGO 2O2EA 4HYQA 1WXQA 3GGCA 1XMQB 2ZIFA 3CCCA 1XP5A 2ROQA 1K0FA 1QONA 2FMXA 5B1YA 3MVEA 2JGFA 3F71A 2FKAA 4BXOB 1Y48E 2PIDA 3EGXB 3RKSA 4FR2A 4O6VA 5FR9A 4WFJA 3SJAA 1XBTA 4IH1A 2QIOA 4DWOA 4Q21A 3WSTA 4PZLA 1B0AA 3PIDA 3I92A 4LJ7A 1BWSA 4IXWA 1A8UA 3AJRA 4Y1GA 3ICOA 1WXHA 3I9FA 4PZYA 3IAUA 3Q8RB 4ZYTA 3CUSA 2Q2OA 5AWFC 3WIOA 2DGDA 4RJ2A 1FU4A 3JYLA 3RBXA 1SQ5A 2Q1YA 4GT1A 3PV0A 4WXYB 3DT6A 1K9VF 2J5KA 3KOZA 4YJ2B 1V25A 1V2GA 1ACMA 3ISJA 1XMOB 1LBTA 2CQYA 3P9CA 1MBZA 4AJNA 2ZJYA 2NVOA 3TINA 3IUBA 4AKHA 1NX9A 3KFLA 4I14A 4JB3A 5ITZA 5BW5A 2JH9A 4BV9A 1N2CB 5JAUA 4R54A 2C82A 2QTNA 3BEOA 3H5AA 4C1NA 4XTRA 4BBSG 3UT0A 2VXYA 3X1KA 4B3XA 2IYXA 2GF2A 2C5BA 1MT0A 1U80A 4YRDA 2PX5A 2W2XA 1CZRA 2WP8J 3PQ5A 3H2ZA 4L02A 3JWIA 3BBLA 2X4IA 3D4LA 2FFQA 4E33A 3TSOA 4DJEC 4QGBA 1OBOA 2P11A 5E4FA 5LP6C 3NM4A 3M83A 4ZI7F 1IDN1 2WWHA 2RBEA 3VJMA 1M1ZA 2FV8A 3I01M 5D6NA 3UOAB 1XMPA 3OEHD 1YSCA 2I87A 2JJ1A 5DK4A 5EKXA 3UT5B 4BAGA 5ERYA 3FKIA 4LGMA 3JD4A 2GEUA 3TIGA 3LXUX 5CR9A 4P0PB 1AZSC 5FEMA 1IWBB 3R09A 4P5PA 4MK4A 3CCFA 4PQEA 2PGAA 4BVGA 4DL6A 2UYYA 2Q3LA 2WIJA 4J0JA 1XTKA 2I80A 3N2IA 1OH6A 3CJTA 1S9FA 3F46A 2XUQA 4DV4B 2NTJA 3ZCTA 4Q1VA 3BGWA 5IH7A 1S4QA 3ZX4A 3PFIA 3S7TA 1U0TA 1G41A 1YJQA 3HVJA 2GK4A 2ASVA 3EC1A 5TARA 3R6LA 3LLVA 1YI0A 3OIVA 3MIZA 2WUFA 1SXJC 5FR1A 4DRXB 1Z62A 1CU1A 3T61A 1FLAA 3VHQA 2YS6A 4M3NA 1I7SB 3NOVA 3H4VA 4BPRA 2W4IA 2WT8A 4MMXB 5EJ4A 4QWBA 2QZPA 1OXTA 1PJAA 3ZI4A 1Y3BE 1Q3HA 3H9BA 4ME6A 1H1LA 2VT2A 4EITA 2O2SA 5E25A 1EFUA 4BWYA 3AZPA 5THKA 4B33A 4H59A 1O5TA 2Y1WA 2OD9A 1SG6A 4EFKA 2WPDA 2ZWOA 1FTNA 3L0DA 3O8QB 3I04M 4BNFA 4JJ6A 1SVSA 4EB8A 4C08A 1WZNA 1RHKA 4EFLA 4H4EA 2FHSA 3IO3A 4IDPA 2A5LA 1VOTA 3S8YA 2COJA 4NNPA 1J39A 1KFBB 2WNSA 1T5DX 3LQ2A 1FFHA 4KQCA 2E1PA 3ZEIA 1VJ1A 1PWYE 4P4GA 5JU6A 4L72A 4O0MA 3OCUA 4H3SA 1KFKB 5TS2A 1XVAA 1A8HA 1FFXA 4M46A 4LSAA 3TW7A 2DPMA 2QMHA 4QULA 3TQSA 3MB5A 4O2AB 1JR3E 3T94A 1T3NA 3K0CA 4AZ0A 2CD7A 3N70A 5A04A 3L41A 3RF6A 3E2IA 3W34A 5JDCA 5BNIA 4I9GA 1VIVA 1M2KA 1H3FA 1NUPA 1LD3A 4X1KA 1BS1A 4X6XA 4M9ZA 4JSTA 3CZ4A 3F73A 2FOLA 1B00A 3A9RA 4ZCPA 1NONA 1UM9A 3ZZUA 5TVGA 4XLZA 2HTEA 1W4CA 2YZKA 1PFQA 1DPGA 1C30A 4OD0A 2WJ3A 1RKUA 1YQQA 3U4DA 4A8JC 3T41A 5HKOA 4AURA 3GT4A 3GT3A 4ECUA 3QI2A 5J5AA 2QL7A 1WTCA 3DPSA 2E37A 3PVXA 1G21B 1CUEA 4TVKA 1AQLA 4BLSA 1Z0KA 4IUYA 3M0EA 4BFSA 1IULA 5J40A 3HI6A 2Z9BA 2WDZA 4DB2A 4UBOA 3DTYA 5BP7A 2EX1A 3W1WA 4EHFA 1R5BA 3AY0A 4HZUA 5BSRA 3LF2A 3ZVNA 4GGOA 4S35A 2AL7A 3GA0A 4V1CI 5J63A 2VTBB 2JD0A 3ILHA 5EMJA 2GXSA 4R01A 4BN5A 1AE1A 2Y0PA 3D59A 4DZRA 5FUMA 4Q18A 4KODA 4I3HA 2C2OA 1L8AA 2FPIA 3QWIA 4ED7A 3NDPA 4IHJB 2ZBEA 4FSHA 4F4WA 1KWKA 1KVRA 4OFBA 1G38A 5C7OO 1ZD3A 4BLWA 1U98A 4E0BA 4YAEA 4PV7A 4RPIA 1NQAO 3D0OA 3ZJ4A 2X8JA 1RWBA 2GJ9A 4X6LA 1JDUA 5FUWA 1Y3IA 5M2QA 4PBSA 1K08A 1KK1A 5EHZA 2N42A 1Y4AE 4ZI7A 1OC2A 3MD0A 1WB4A 2OC9A 3L0BA 4PQRA 4LF6H 2O1EA 4J0CA 4XR9A 1NBMD 3WMRA 5AXCA 4BKUA 1Z7WA 1UFKA 3I9V6 2IP1A 2CLLB 3F5QA 2D7DA 1YZYA 2YDYA 1P9WA 3T35A 1XCLA 4OL0A 3E9YA 1JIUA 1FP4B 2XNCA 2OMKA 5CB4A 1TM3E 4IH4A 4I5EA 5AKXA 3WRWA 2X13A 1PEDA 4LF7H 3EZYA 2JI6A 1QU2A 2YJ4A 3IIJA 1KBLA 1KT8A 2V0CA 2AQ4A 3SBXA 2OAQ1 5FUVA 1U7PA 4RPJA 1YE8A 5BRNA 2D3TA 1RHUA 3I83A 5KFYA 4K40A 5IASA 4MWDA 2JHGA 1CUIA 4Y7DA 4KJZA 4QQRA 1W8DA 3G1UA 1HA3A 3AJ8A 1J33A 1QX3A 4PZ8A 4A3KG 4G24A 4C9BA 1I5EA 1JHQA 1SWWA 4NF2A 3G8BA 4YI5A 4BZQA 2PKWA 2F9FA 4B3IA 5LMNH 4KN6A 4TROA 3P0HA 3QWFA 3PJEA 2EWVA 5ITVA 3GLGA 4GX0A 1UMCA 2FMAA 1U3DA 5GMOA 4E4YA 1DWPA 1TM5E 3RAXA 1O6BA 3LUAA 5CX4A 4NWIA 1CG6A 1IUOA 3DHWC 3GGPA 5A9TA 2XUOA 2YICA 4Y2PA 3GNLA 3H6KA 1XLTA 4Q1DA 3NGXA 3QTBA 2PPLA 2ENUA 1JJBA 2H8GA 5CVTA 2DECA 3D6TB 3J81W 3VR6A 1VJ5A 4POOA 3T5AA 4HPJB 5IT5A 5I6DA 4XGRA 3VR5H 2IEAA 2BKXA 3UMRA 3R6WA 3Q7SA 1XKTA 3SNOA 2YWRA 4GZ3A 2YZLA 1A1VA 2WJJA 1FDVA 3QE2A 4RACA 3PRHA 2C22A 2R00C 4J0HA 1C9EA 3NBFA 3SZUA 3LMKA 4G0ZA 1EUCB 2FTKE 1IWOA 2OCPA 1LXCA 2QBYB 3A6LA 4D46A 1IBCA 2PWBA 2HWWA 1EDBA 2ZQ5A 4PRLA 3LUGA 4R8LA 5B3LA 2NTEA 1KMMA 2OVBA 2G5PA 4RC9A 4F8EA 5KVAA 2IU0A 5K7SA 1VGVA 3B9PA 4I9UA 1T2CA 1J8QA 3DZKA 1LLFA 3SXUA 2X1HA 1YZQA 3NXKA 3ZU2A 4WIAA 4EFMA 3TR5A 4A10A 4XSHA 5BR1A 1YA6A 2NMVA 2RG7A 1NXXA 1EWYA 2ID4A 1VLMA 4QYIA 1CS0B 3ZI7A 3C7KA 4LZNA 3GRPA 5AICA 1ZK4A 4HAIA 1N3BA 1ZITA 2VHEA 2KM1A 4QLBA 1L2TA 1I80A 2Y1XA 1CB7A 4EY4A 1V3UA 3B51X 1A9PA 3D1JA 1QHHA 2DPXA 5K4GA 2EAUA 2ZUVA 4B48A 2LR0A 5E0KB 2NO0A 4J9UE 4GQIA 4GVLA 1YR6A 3A1SA 1GQSA 3LLUA 4L0MA 2REQB 3ABRB 4QBFA 3BRWA 1JZSA 3AUJB 2QMEA 1YK0A 4Y2TA 3KZMA 3LS2A 1WXIA 2DKFA 2BFMA 1DDGA 1DKRA 4CTNA 1P0IA 3FWHA 4B8ZA 5BN4B 4YIKA 3OFSA 2WLSA 2I8LA 4QIHA 2D1TA 1MX3A 3RF7A 3KX2A 1VE3A 3H1FA 3NX4A 1JA0A 3JR7A 4IUCS 1KYXA 4ICIA 4GPEA 2EYQA 4BKMA 2HU8A 3VZRA 3KKOA 2PKCA 5FPOA 1DC6A 5BYAA 1ZR4A 1QYVA 2R4QA 4RTRA 4S3MA 3DAPA 1ZC3A 1UJMA 2BZ1A 3FAKA 3UQ8A 2QYOA 1NVDA 4D99A 1FTYA 1C14A 4JI5H 2VK2A 3F8WA 3VZDA 4EELA 5H3CA 1RKQA 3TBKA 4MTEA 2D5IA 2VZEA 5EOYA 4P5DA 4QXAA 2HGZA 2VRWA 3N2GB 1S2LA 1NSTA 2ARKA 4YRGA 3AM3A 1LDYA 1EX7A 3SX0A 1Q1BA 1NFRA 1HBJA 1E6LA 5KQLA 4LJKA 4Q24A 1MKYA 1PJCA 2ZDHA 4Q9IA 3K5WA 4TZKA 5HFAA 2HHCA 2I7DA 5FNVA 2J87A 1UQTA 4WH0A 1KSJA 1TRHA 3C1OA 4BE9A 4E51A 1LPOA 4ZKEA 1HM5A 2R0QC 1A88A 1Z7BA 4NU0A 4WL0A 3K5IA 3GXBA 3LCMA 4JJZA 2BGLA 4FFWA 4C4TA 3RIMA 2O3SA 2C57A 2QUHA 3VX4A 1UZLA 2P69A 3WL4A 4MGKR 1EFRD 1ZZGA 3EVCA 1E4VA 1ZZEA 4WOJA 3GV0A 1VJTA 1PQ4A 4L4SA 4JASB 4C2MA 1LNQA 3U4IA 1UAYA 3AW8A 1SD2A 4PAMA 1E0AA 2DG2A 3CLRC 3ZGVA 3KHHA 1SC4A 3QPWA 4OP2A 3ET5A 3I3OA 4WUVA 2QMZA 4LZWA 2FK1A 3OCCA 5TQ2B 2GNPA 2REBA 1JBEA 4N6GA 4WBNF 1M9NA 3U3XA 4L3WA 2DT8A 2PKRA 2RBKA 4W9MC 1E1QD 3AILA 3RPEA 5I4BA 4E3ZA 2FX5A 4WZBB 1QGAA 1W581 3HHEA 4ZQCB 5JSQA 1LC0A 3EZGA 3AUFA 3K0FA 3RVQA 4KN9S 2XF2A 5KHLB 4YFYA 4MW0A 3LG2A 5A1TA 2VVTA 3PNOA 5KJCA 4XPZA 4UBKA 4YHHH 1XL1A 1NMXA 5IZCC 5EOVA 2O8NA 3WQRA 5LPNA 1P1KA 3EIUA 5HF6A 3HO6A 2BR4A 2BGJA 1DWQA 4GVXA 4PPFA 4E2WA 3B12A 3MJHA 3WDMA 3FB4A 2Q8NA 4AU1A 4LYFA 3G9ZA 3WNCA 2QXYA 1N33B 1TEXA 2J59A 3QZ7A 2XC9A 1F3LA 3ZH9B 3OJFA 5BOSA 3G2IA 3Q8QB 1Q92A 1W35A 1OT3A 5CM9C 3RYHB 2WJWA 4H4CA 2QJFA 4MHTA 3FHJA 3BREA 3EGCA 1O4WA 3ZBTA 1RVV1 2VP5A 1L5SA 4UHHA 5CM8B 2C4TA 3K0AB 2W2VA 2PWPA 3NHKA 4DBLC 3WLMA 4GS5A 4O59O 1OF1A 5F9NA 2BIFA 2VJPA 3ESQA 2CXHA 2VXCA 1EWVA 4WN3A 4QHYA 4XD7D 2IEYA 4KL8S 3OA2A 3OHAA 5HIJA 2YN2A 4G9GA 4X1IA 4HWGA 3ERCA 2JAQA 5EPEA 3LX6A 4NXNH 3N2EA 3UZOA 3PTAA 2R7MA 1PKXA 4BBZA 1KO8A 3H83A 4G5OA 2KPOA 3KQKA 3D4OA 1YQEA 4HATA 4RPHA 2IBTA 4XM2A 1SCUB 4KXQA 3SF0A 1YDHA 3QGMA 1QH1A 4RFVA 3ND8A 5IANA 3GV8B 1T9AA 3G02A 1JDPA 3U26A 5LM3A 5TGDA 3J7AK 3UVEA 5JJCA 5E6RB 4R3UC 2I6SA 3Q12A 5KAPA 1RWNA 3P0FA 1PW5A 1YHYA 4N6NA 4CMHA 2YN0A 4UDOA 2BKVA 1LC3A 3WA6A 1E92A 1C3XA 1ZRNA 2E6UX 1I0ZA 3NS7A 3BVPA 4LIPD 1OU0A 5KWJA 5T4HA 3CBGA 2WAOA 2F9MA 3OM1A 4PPNA 1XD8A 1U1IA 5KSZA 4PHCA 2EZUA 2I65A 4BMPB 4TS3A 3ZWKA 3VMFA 1EX6A 2JAXA 1PR9A 3I09A 1I3QA 3O4VA 4XW2A 4HXFB 2ABWA 1Y6QA 1H3EA 3BWVA 2QUBA 3HMQA 3T7SA 3DVSX 4U7DA 2C4HA 1X7DA 3H0EA 3C5WP 3G2OA 2WT4A 3MJFA 1S2DA 1DEAA 2PL5A 3G2LA 4EEYA 4EO9A 4RGQA 4CV1A 1CETA 2JI4A 3I5YA 2C0PA 1D9XA 2VHWA 3HFJA 2C7VA 3EAQA 3RJ5A 5C3MA 4GMKA 3AEYA 4EARA 4ES6A 4ZARA 4X7PA 4CMIA 1RR6A 5ALLA 4KSYA 1WCXA 3TH5A 2QL9A 1NULA 5EWJB 3ZV4A 5KJFA 3NP9A 1MAVA 4PRYA 3LA6A 3CEAA 1E8MA 1HQDA 5DU2A 1GXSB 3RAQA 3ICEA 4Q7EA 3OSUA 1TZMA 521PA 2EJBA 1MHPA 3OAAD 1ESMA 2G0TA 4D0NA 5F7JA 1SG0A 3AV0B 5C7LO 3IPXA 1ADCA 4FIZA 4ASUD 2GUGA 3QEMB 4WCDA 4MZDA 2P41A 4C2BA 4ER5A 5JECA 5JTTA 1WCIB 1U3CA 2QP3A 4CKWA 4IVPA 4WBNA 4YRMA 5FWXA 1G8HA 2WYVA 3VVLA 2QNRA 4QKQA 4FBLA 4F1KA 4NZ9A 2EJVA 4MP3A 4EG0A 3CRNA 4D9BA 3HCFA 5K4HA 1XELA 5FL3A 2HY7A 2XW6A 3QQ5A 3A70A 3ROGA 2RIPA 4FLFA 4OX9B 5FI5A 4R69A 3MR5A 2ETXA 1RYBA 3EVFA 1OKKA 2XBLA 3T0FA 1SKYE 3O8NA 1KZHA 4B3RH 3FJOA 4ZU6X 4HDOB 3UUWA 1IAQA 1FLDA 4QDZA 5E2AA 3KKNA 4JC0A 4Y9RA 4WEQA 2HMAA 5IP9G 1QPBA 2ZUCA 5BSWA 3KM0A 2BHLA 5KYXB 4DW8A 4LDZA 1X8XA 2HLPA 5EP4A 4KQ2A 3HB0A 3HCPA 3Q8MA 4CHTA 2AOUB 3U4AA 4FDVA 3Q8KA 1H8ED 4RVGA 5E4TA 4OM8A 2QTTA 1MXHA 3IVCA 1RWPA 2HD4A 3M9XA 4C89A 3GQBB 1QF6A 2W6JD 2NSYA 4DCJA 1XA4A 4C7XA 2VYCA 3OCZA 4IIJF 2YXDA 2PGLA 1BWPA 3LUPA 5B3JC 1XDSA 5GJWC 4TWBA 1QC5A 1E3LA 4WKGA 4P9NA 3LNCA 5LB4A 4MVXA 1YOVA 1GPWB 3Q5DA 1JHZA 3LBYA 2QTWB 3KQTA 2UYQA 4ED9A 3FPKA 2QRVB 4XWWA 1AKYA 3GA5A 2P2YA 4QAQA 2CNKA 1WQ3A 1JZQA 4ETNA 2IWHA 4DCOA 4H6WA 3PA6A 1Y3FE 2OQVA 1TU4A 3S1SA 3L18A 2PXCA 4HFRA 2IV7A 5ECGC 3SYTA 4IEFB 1QS0A 4DN6A 2HREA 3CX3A 3NYQA 2P3SA 2BTEA 4IUBS 5A02A 3KVVA 2GPTA 2XGPA 4N3NA 4DNPA 3PUZA 5TV2A 3G5MA 1DQRA 5B2ZA 1EP1B 2OM2A 4ECSA 5B6IA 2WTBA 2DWCA 2VT7A 1KXZA 2W2KA 4JN6B 4MPRA 3LBHA 3ND9A 2A1HA 4AKTA 1W5SA 2PQ2A 3QH4A 2PYZA 1UXHA 1ZESA 4LMPA 1EFDN 2FA9A 1M34A 3JQAA 1OB5A 2C28A 4Y18A 4O08A 1PT9A 4LOKA 2X5XA 2CFOA 2O05A 2GBCA 5AFSA 4AVYA 1S8OA 1PUJA 3VVMA 5CLJA 4IJ6A 5EI5A 4DC1A 2P8JA 2FPRA 2ZSEA 2CFTA 3BCRA 3NVKI 2IKSA 1U6JA 3HP7A 1ZL0A 4UZFA 4EHJA 4RJTA 5A7HA 3L5OA 4LSMA 2VS1A 3T9CA 1JDTA 3UO8B 2HLHA 4ISCA 5IEBA 1Z4JA 2HI0A 2CWWA 2ZSAA 2XWBF 1ZNWA 3KB6A 2H1HA 3H11A 4KYUA 3P2KA 3TD2A 3RAJA 4EBBA 2ATEA 2OV4A 4HFMA 2AK2A 3BXPA 3H4TA 3HV0A 3UANA 4AP6A 2RDJA 3TLYA 1J1IA 2I2AA 4DG8A 1W1WA 4XDGA 1KOJA 1R0BA 4UREA 4YMTA 4KFUA 4RTPA 4Z9BA 3BXZA 3I8OA 2HPVA 5EL0A 2ZSIA 3W6OA 1VE6A 3B9BA 3ASUA 2DH5A 3V8RA 2GXUA 2C8KA 3IEUA 1VE9A 4UKDA 3NHSA 5HF9A 3QE9Y 4MKIA 4MCJA 2C58A 1M0EA 1GY8A 1EJ6A 4I5IA 5MN5A 3FPFA 5EPOA 2H5EA 3V1KA 3AJ9A 3A37A 4EG1A 1JLMA 2C3OA 4AJ4A 4NV3A 2OM6A 2DY0A 2C2WA 1GA6A 5DP1A 1GPKA 1R12A 3COYA 1LPNA 4HRXA 5KTNA 2IMWP 4L2IA 1YV9A 4LHZA 4J4BA 2GM9A 4ZODA 1TWHA 4B1FA 3IOCA 4MUIA 5L3ZA 3DC7A 1ZIOA 4O7YA 2ADOA 4MW1A 2HB6A 2FN9A 1QTRA 3UAGA 4MV1A 3AJAA 1T5TA 2GRAA 3I6YA 1ADFA 2Y71A 3F7TA 3Q87B 3ZE2B 5C8YB 4MB2A 3ZWQA 2O4UX 1J2EA 1OFUA 3C1AA 1W5TA 4Q7QA 3NC1C 2O0JA 5JZMA 3HSYA 1KPIA 4NS4A 5IAOA 2ZRIA 1GITA 2QSJA 2XZLA 2XCIA 3DMHA 3PSHA 1XU7A 3BAFA 2MR6A 4FI3C 1EHYA 1Q74A 3IQIX 1ZXLA 3QU2A 5KYYB 1G7CA 1CFJA 5L3QA 1QHIA 3SKYA 3GILA 4P86A 3AVYA 1O4VA 2GKGA 4OL9A 4HMPA 5LOVB 3KBBA 4NU8X 5SY6A 4C7JA 1PZEA 3HACA 1VDZA 2PMZA 5AK6A 1DXQA 3VNAA 4MUYA 4PFSA 4IZHA 4KOEC 1ZW1A 3HA5A 2IOYA 1FRZA 3HUTA 4IIJA 4RHXA 5DIFA 1GILA 5E4YA 3NGDA 2DSTA 3EPHA 2ZRJA 4U2FA 3W3AD 3K8OE 5HBRB 3UMVA 1CUUA 1YR8A 3WS7A 3VPSA 2W6NA 1XRNA 5AJYA 3C6KA 2JZOA 3V6JA 2COEA 4OI1A 1TCCA 4DREA 4EI8A 3DV9A 4BQNA 2N1BA 3OIWA 5HUJA 1BO6A 3AJDA 5IUKC 5EHGA 3INRA 5F35A 1M1NB 2F2TA 1SU6A 3X2FA 1USUA 5IJ9B 2CNBA 4G2TA 1KEEB 2ESRA 3I2JA 5GZ1A 1L7QA 3TLBA 4EKIA 4ZVRA 4K6OA 4RE6A 1RLIA 2JA7G 1YTUA 5HZMA 5HFNA 2F90A 3VX3A 1GUZA 2WSSA 4R1SA 4LGYA 4CFSA 1CZHA 3GX1A 3W5BA 3KZOA 4X0EA 1NQVA 1U7UA 1T2DA 1BHQ1 1V4VA 4JYAH 2BGUA 3EQ2A 1VRCA 4DSAA 2NU8A 3LWDA 1Q15A 1AA6A 1P4HA 2C9CA 1EWQA 4IG9A 3L5KA 4AKGA 1Q1ZA 2WWFA 4BQIA 1E2EA 2XCTB 3VI4B 3KHLA 2IUEA 4R3WA 1DCFA 1CQZA 4KRGA 2FJZA 4MS1A 4K5QA 1KMHB 3GAAA 4Y9UA 4BRSA 4UFNA 4X95A 2G80A 2QU8A 4GKKB 1T24A 3C87A 5SZHB 2OO3A 2YS7A 2ORED 5DULA 2KBEA 2YY6A 4LOHA 2ACVA 1NZFA 1ZIDA 3L6BA 5DLQC 2VRCA 1C0EA 2GDJA 3IESA 1Z3CA 4W9RA 3I42A 3Q0IA 2M1ZA 1KIAA 3P19A 4DYVA 4DR2B 5HQJA 5KG2A 3H9CA 2Q2UA 3ZYZA 1KAOA 5A4KA 3V1UA 2QZ9A 3SHFA 3W2GA 4UMVA 3IEPA 2I71A 3EBPA 3OTOB 1SURA 5AW7A 2R79A 5A9SA 5AK0A 4CCAA 1B2LA 2HNBA 5JNRA 3EFHA 2DQYA 4L08A 2JEGA 3E2PA 1OASA 1ZUNA 4M37A 5DM70 2H9YA 1ODTC 2YXPX 5AESA 2VOBA 3K70D 4NE7A 2VQSA 1G2OA 5B37A 4WESA 3PI7A 3SXPA 3VC1A 4B35A 4U7HA 5P8WA 4GX5A 1JHRA 1Y6ZA 3EGIA 2ZSDA 4L85A 5EJGA 3IUYA 5DQGA 4F4XA 3IRVA 5EWEA 1FVOA 5PGMA 3PZRA 1YI8A 3RFTA 1DAFA 3VTZA 4K03A 1F6WA 5LD2C 4PCLA 3D2BA 1VP9A 4IDBA 1M2WA 1NW8A 1GUYA 5EQJB 1H2EA 2P0AA 1Y8QA 1QDLB 2O7VA 3WZLA 3G68A 2F4NA 3E53A 1LDGA 4BZPA 5EJAA 1NYLA 5EDWA 1UDXA 3PRYA 3S7ZA 3KHTA 1RZUA 1K6IA 2PYIA 3K20A 4B6FA 4Z2YA 5FBKA 3WWZA 5BV2P 3AFNA 4CM6A 4Z5XA 5KB3A 4B6JA 2CUTA 3TSYA 1K7XB 3N8HA 3FZGA 1FUYB 4IXMA 4R4JA 1QVWA 4XDYA 2HHHB 3X2EA 3A6KA 5CDUA 4RLQA 1X1BA 3DD1A 5FWAA 5CLQA 4HS9A 5KNCH 4MINA 5FJIA 5U4QA 1JX6A 2JL1A 4F4FA 2H11A 1U0EA 1UIRA 4WVFA 4EENA 5DBGA 1QR6A 1VYUA 3I9MA 1F9EA 4CCSA 1D8AA 4RH1A 3HBNA 4AZWA 1C50A 5DW3A 3DDSA 2QE7A 3GC6A 2R8PA 4AO6A 5F98A 1E9RA 3ESXA 2FMKA 1A4IA 3INTA 4UC0A 3FM9A 2P30A 5JS1A 3AFMA 3VYRB 2GVNA 2QPLA 1OHHD 1RSZA 5K3CA 2Q50A 3CEHA 3BXGA 5LBUA 3LQ4A 3WKCA 3JZIA 1JE1A 5FLXW 1BU8A 3SLKA 1M75A 4BJHB 1B0PA 2ZM6H 1QZTA 1Z8HA 1UK7A 1EFVB 3RTXA 3O73A 1M73E 5KIAA 3WLTA 3B6ZA 1PFYA 4G26A 5BN5B 3IOMA 4MW5A 3WL7A 1YU6A 4AWXA 4G3XA 1FSPA 4RKQA 4HWKA 4N5MA 4F2DA 4P4LA 4EBEA 2CNLA 3TCXB 3ER8A 4J43A 3UFXA 4DCPA 3ZN2A 4Q3DA 3SSNA 3QPBA 1W36C 2VDMB 2G8NA 4F5WA 5TF4A 2VP2A 3Q0EA 5DCYA 1OBHA 1BE1A 3C5EA 3UWKA 3FVQA 1R9TA 3L8DA 3IBYA 2XMQA 1DJLA 4FNAA 4IQ4A 4D56A 1W1IA 2CLSA 3QMVA 3IPLA 1EQ2A 4ER6A 3IQZA 2ZRGA 4W1SA 3OZEA 3GLFA 2GQ0A 2HIGA 2V96A 1CUJA 4ZI2A 2XVXA 3W5UA 2QL6A 4XCXA 1EYZA 3E9RA 1JSRA 3OBBA 4QFMA 5KUTA 1SZDA 3DLCA 1HO3A 2VJOA 1QZUA 3H04A 4QBIA 2OV1A 3UV7A 2YJ5A 3GEMA 2EBFX 2QORA 3JWGA 2BBSA 1ONSA 9LDTA 3PX3A 5AVOA 5DT9A 4RULA 3ZBPA 5HKBA 2IVFA 1SB9A 2JS7A 2UXBH 2I4IA 4TL9A 2BFPA 3OVMA 4Q03A 5E38A 1UDCA 2OMEA 1DIRA 4MVJD 1SZPA 5CXQA 2VT6A 3DL4A 4G0XA 1F0YA 1OYWA 3I0NA 5CVVA 5EJ8A 4XWAA 2JEFA 3MAGA 3OIDA 3FPCA 1BH6A 1KR5A 3OJ0A 1EFPA 3C8MA 2EZ4A 1J22A 1TMGE 3DFIA 2OHJA 2NZ8A 4DAEA 4BFYA 1YB2A 3A4VA 2YWDA 3WNDA 4E5DA 4KFSA 1GKUB 2Q4TA 3JQDA 3N58A 4R8MA 1S4MA 2ZKLA 1YFLA 2J9ZB 3JZDA 2IC5A 3C6MA 1EFHA 3R5TA 5G1PA 1W25A 4CF7A 4JLNA 3VRHA 2OXIA 3UAWA 5ETJA 3D8NA 5TR9A 4FXOA 4N9WA 3RUEA 3D8SA 5JATA 1JEJA 1H0KA 2XXBA 1ESNA 4IRUB 5CK5A 5MFPA 4MWCA 2NV6A 4NYMQ 1DPFA 5A71A 3RAPR 5JVLA 2ASJA 5T14A 1KEZA 4JR2A 1QGDA 4ZQGA 3F5DA 2BKLA 2C5FA 5D7BA 4FSDA 5L6LB 4YROA 1D7OA 5IHXA 3SJZA 2YHUA 4MS4A 2ZIXA 5HE8A 4NNOA 2P6PA 4ZEOA 2PUWA 3AZOA 1Z6PA 1XZLA 4PTLA 4JL6A 2XHEA 1FDUA 4HNQA 3I72A 2FKNA 4F1WA 3BB3A 4DAOA 1QO0D 1PZFA 4FNGA 2XEXA 1U3VA 3RO7A 2P2GA 3A4LA 5C81A 2EQAA 4D79A 2WE8A 2VN8A 1Q7EA 4O33A 1L7MA 3LUCA 4MI6A 1W88A 1W4AA 1NN3A 4GOLD 1UMKA 1ORWA 4F6CA 3DCYA 4X24A 221PA 3PC8C 3QMPA 5I7AA 4REOA 3SEZA 5CXSA 2CCKA 5AJVB 4KGVA 3KOXA 3AUAA 4B40A 3C6ZA 3PHCA 1GZUA 4F2PA 5AHKA 5H81A 2ZE5A 4OA5A 1DEHA 4RXMA 2CV1A 4JI4H 5CB4F 3T7KA 3ZCVA 4FBGA 1EIWA 5TSDA 2O8EB 3QUAA 2NQTA 4B74A 1G2WA 3EC7A 3V8VA 1F6DA 4G8DA 2X9LA 3ECSA 3VQTA 3GG9A 3QA3E 1PWXA 4Z7JA 2F7SA 2A9PA 1Y81A 1PDOA 4IWNA 4N54A 4O2LA 4WHMA 4OHUA 4PZAA 2G77B 1H2XA 3RWBA 2QPOA 2J9RA 3UGJA 4K1LA 3OQ1A 4JX9A 5EWMB 4U2GA 2KI5A 1U5AA 3G0CA 3QBVA 3D9QX 2A33A 3BF8A 2FWAA 1GN8A 4MRMA 4QBKA 2RI1A 3AT1A 2Q8PA 1ISSA 4MS3B 1ZOSA 4Y2GA 2I4RA 2BONA 4ZZ1A 1NBOA 1ZM3A 4MV5A 3N2LA 2NNWB 2QRUA 4L4RA 3URKA 2BFDB 4OQPA 4ZGBA 4BQRA 5A4IS 2COGA 4G0WA 4FJ1A 4HB3A 2Q3CA 1GQOA 3ADPA 3EVTA 1EGHA 4ZO7A 4J4HA 3ZDEA 1ZJWA 5CLGA 2X9NA 1A8SA 3EC2A 3HCRA 2Y92A 4YWJA 4H17A 1EZ1A 1C3LA 5EIXA 1W85B 3LKZA 1LBSA 1KZ6A 5BT8A 3P8ZA 5FUBA 4JV1A 1P1RA 1B6RA 5FFFA 4AY3A 4OX9Y 5CFOA 1Y9EA 1T1GA 3O74A 4YR7A 1PJTA 1G6HA 4LVNA 3F6SA 4BGEA 4PG8A 1U2GA 4KX3A 1N7HA 2W6OA 1WEHA 1ORHA 3OJOA 4LXGA 1WA5A 1P6QA 1MX5A 4QUGA 5EMHA 2QW0X 2FPGA 3UUGA 4JLVA 1D2HA 3HUEA 1FQKA 4I36A 3BHJA 1ZJJA 4RTSA 2ZBUA 4FD2A 3RK1A 4LECA 2ODQA 4QQKA 1KOFA 4CKEA 1NUAA 2G8LA 3FN4A 4F4CA 5ALIA 2G1KA 4LY6A 3EYYA 3MCVA 3C3DA 2YQZA 1EVIA 2ZG6A 1Y8ZA 4NFLA 1JHYA 4O82A 1SGWA 4JD5A 3VU0A 5LZ5A 5GZ3A 5E6SA 4JJ7A 2X0SA 4MQEA 2VPYA 2W37A 3CRZA 1ISHA 2XMZA 1S3FA 1YMUA 2IRWA 1M1YE 4CETA 4V38A 2QDXA 1GUFA 4LYDA 3BB4A 1E0KA 2DJ5A 3EZ9A 2D00A 4NMWA 1L1FA 3DM5A 4C01A 3SKXA 3UC9A 2OFOA 1AUPA 4GMHA 3HWX1 1FFAA 2GEKA 5B5SA 1H05A 1K06A 1XRRA 4KBGA 4IZIA 3H40A 4UXIA 1N78A 3WISA 5AP9A 3WYAA 4Q39A 4XYGA 2V6FA 2CKZB 1NXVA 5KFQA 4WCVA 1RQPA 4IUDS 5EP1A 2VAVA 1U0GA 2X86A 4F9TA 5JRDS 3L6EA 3KJZA 3DOOA 2IDJA 1SBYA 5IF3A 2JLUA 3CTMA 1AZWA 1PWZA 1G8KA 2JDID 4MUEA 4TUYF 3BXOA 3OTIA 1P7VA 3I12A 3V6HA 3N41B 3U9SA 4MHOA 4BY9E 3OEHA 1PKEA 1Z5GA 2ZVJA 1VYHA 4B7CA 1WDMA 4TYYA 3SF8A 3EOZA 2QTCA 3PT9A 3DLAA 2W7OA 5DT2A 3MIIA 4KHPH 4C43A 3JQBC 4BKRA 1GO2A 4RJIA 2C88A 2O07A 2Y4RA 4B3DA 2PWZA 1HKHA 3ANMA 1RXWA 2G6TA 3ETHA 4O7NA 2Z95A 1AKTA 1IXYA 5DM4A 3GG2A 4KQMA 1DQPA 4P54A 1RQRA 3UTDA 4KK3A 3CW9A 4JEIA 4LXIA 2AXPA 1CR6A 1AV7A 1P6UA 2XCSB 1UKVY 3C3AA 1MEOA 3X43A 4Y2UA 1MRNA 2FMIA 1KH1A 2JFYA 4WOCA 4E11A 5LN1A 1G0OA 3HXTA 5FNVF 3IHLA 1ZP6A 3EFOA 2CF6A 1CUAA 4RZXA 3KU1A 2WG0A 4P38A 4M1WA 3JQ6A 3D43A 2JFOA 4R84A 4EHIA 2IW3A 4L6IA 2A6PA 1PJ2A 2QG9A 2CXXA 5KFZA 3GIIA 3CWCA 1XLUA 1HUQA 1L3IA 2OFXA 1I14A 2QX9A 2O5RA 5DOZA 1A48A 3DVAA 3GAMA 4QXPA 5CNMA 1W0JD 3RYFA 4I8IA 2R8EA 3F9IA 1CIPA 3UN1A 3KOYA 3ZD9A 3FOFC 4Y30A 3TD9A 2VNKA 3WKBA 1P1JA 4BLQA 3ENVA 5H4GA 2RD2A 4JI8H 5AKJA 1YS4A 3HN6A 1IJEA 3TAHA 3LW8A 2XCOA 5THXA 2V7QD 1MMFB 1VPLA 2HA4A 2YWJA 4BMZA 3AO0B 1O96A 4KR7A 5SICE 5A3JA 4I4LA 1TTTA 4BLOA 2X4GA 2PMFA 1DWOA 4LUCA 3TG2A 4ZYUA 4ZT5A 3W2HA 5K0CA 4R8UA 3UYKA 3ZK7A 1UJ5A 5CH5A 3ZQ4A 2ZGVA 3Q10A 2WJZB 1R0CA 1J7KA 2AFVA 1CUYA 3EOBI 4KN5A 3PFWO 2VLIA 3HWRA 3SQXA 2W6ID 3O8OA 4MRAA 1TM7E 1CF4A 1XZJA 3A3NA 2G9QA 4PAOA 5CDTA 4DWWA 2H0AA 5BNZA 4KEAA 5KQPA 4IOLA 5FKJA 4H4DA 2R84A 3FWZA 3RU3A 2HGXA 4PAGA 5LKAA 4EJSA 3E3OA 1N5RA 3KL2A 4QA9A 1P77A 3HKEA 1MW8X 1Y8RA 1EVKA 4US2R 5I7RA 4PLPA 2O2XA 1QGYA 2YVKA 4FT4A 4GX2A 1JS1X 2BBWA 5AO9A 2I3ZA 1NOJA 4C4SA 2ZBRA 3DCIA 4YP0A 3LKDA 1Z0SA 3EXHC 1KL7A 3OHPA 5FB3A 3CZMA 3IMFA 1XC7A 4RANA 1N1EA 4CQMD 3V8EA 3PUKA 2FR0A 4EYEA 4G07A 1Z08A 2AH5A 2ZUEA 5G1NA 1V9SA 4CG0A 3G0IA 1UZMA 3SIWA 1NX6A 1HZZA 3QMMA 2Z2KA 3GTPA 3DAHA 4K6CA 1EFTA 3ODPA 3GTJA 1ST2A 4GKJH 1G2PA 3AESA 3RS2A 1X7XA 2YCBA 2O2GA 2WJYA 3V42A 4TUYA 2FR8C 3VSBA 1R3UA 1SXJE 1JTFA 1XZQA 3VPFA 3QNWA 4YBRA 1T2EA 1NBMA 2Z1NA 3R9IA 3IQWA 1W4ZA 1YE3A 1QUFA 4JJKA 4LZZA 4FE7A 3L8MA 3H4MA 3TSZA 1BJTA 3OO1A 4BB6A 4M87A 4HG2A 5JNUA 2ATCA 3VA7A 3NCHA 4B85A 5FJ8G 4IQ8A 1RM5A 5LQMA 4QGSA 4HGNA 4Y2SA 4D41A 2JIZD 3HU3A 1U7ZA 4JXUA 2XGSA 4C87A 1E9VA 1ZISA 2JAUA 2IHZA 1PV1A 4ND5A 1NYQA 2ZANA 5FOQA 3LULA 4JLWA 2J9XB 3I2GA 3WLRA 5JJBA 3COWA 2EGHA 2MYTA 3HJTA 4Z6KA 2RIRA 2VT3A 2HXSA 1Y42X 3RYTC 3AG6A 1THMA 2DUWA 3E5HA 2WAMA 2YRFA 4W5OA 1EZZA 4R68A 1RC0A 3E7WA 4G5FA 3EPGA 4NY1A 1R6AA 1YJCA 1NURA 3KDSE 4ZCQA 3WRXC 1ZJZA 2PNJA 3H9GA 2K6GA 5AUQA 4HNAA 2BUAA 1D2NA 5COAA 1U2QA 1TYZA 1KVSA 1WCMG 3QPUA 1AMNA 4E32A 4NCIA 3W8NA 4UJ5A 4H7PA 4LSWA 4CF5A 2IHJA 1BNCA 3OSZA 1P0QA 2FPXA 4A6XA 3OUZA 4LPKA 1H94A 3JARB 2V6GA 1OFIA 3NT2A 3WJ7A 3EG9A 3DDCA 2NIPA 2F1HA 2UV8A 4AK9A 4RD6A 5LC1A 3I4MG 3IV7A 4JLOA 5DLGA 4YGYA 4J4TA 1K92A 1SCDA 4GRDA 5CFMA 3NBQA 4RDCA 4XX1A 2DU8A 3LK7A 3MT0A 4KE8A 5HMLA 3OZIA 4MW2A 8AT1A 5HG0A 1YC5A 3GDEA 3VJRA 4U6NA 3ZDXB 3VAZA 3B2NA