2GLTA

Structure of escherichia coli glutathione synthetase at ph 6.0.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
316
structure length
296
Chain Sequence
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE BIOSYNTHETIC LIGASE
publication title Crystal structure of glutathione synthetase at optimal pH: domain architecture and structural similarity with other proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthesis, ligase
total genus 100
structure length 296
sequence length 316
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2gltA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2gltA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gltA01
4FFMA 4FFRA 2OLSA 1M0WA 1EYZA 4MA5A 5BPHA 3G8DA 4ME6A 2FPGB 2YL2A 3ORQA 3OUZA 4O82A 1Z2NX 4O84A 2FB9A 2NU7B 5BPFA 4YAJB 5JVDF 4FFPA 5IYZF 3JZIA 2DIKA 2XD4A 4TV9F 2W6NA 2IP4A 2R85A 1A9XA 4O7NA 4O7ZA 1ULZA 1GLVA 4HQ6A 2HGSA 5CA0F 2R87A 5JQGF 3BG5A 4MA0A 5C8YF 1GSOA 3JRWA 2V59A 4O7SA 4MV1A 1KJQA 1KUTA 4M99A 3I12A 2W70A 2I80A 1B6SA 2VPQA 2NU9B 5K2MA 3VOTA 5KKNB 4O81A 2SCUB 5EZYF 3WNZA 1C3OA 2FP4B 2GPWA 4IZOA 2W6ZA 3KALA 4MV6A 4XYMB 1JLLB 4DLKA 5LP6F 1VBHA 2V58A 2ZDQA 5C1OA 3BSYA 3UFXB 3Q1KA 3G8CA 5GONF 1DIKA 1I7LA 2YS6A 5JQWA 4O4JF 2X0SA 5JH7F 2PVPA 5LYJF 4IWXA 4FE2A 4O7TA 2PN1A 1OBDA 4EG0A 4RZQA 3GLKA 3HB9A 2ZDHA 1W96A 4MV8A 3V4ZA 5LA6F 2V5AA 4YJ2F 3R5XA 4ZOLF 2GQSA 2C00A 3JZFA 3HBLA 3K5HA 2YWVA 4Y8VB 3JRXA 3KREA 4FGRA 5KX5F 2CNVA 3RFCA 2R6FA 3KAKA 2VHEA 2NU6B 1KJIA 4O4HF 4O7VA 4MAMA 5I47A 1WR2A 1C30A 4HNUA 1CQJB 2VR1A 3BSWA 4XX0B 3TIIA 4MV3A 3R9RA 3U54A 4YAKB 1EUCB 2R82A 1VBGA 5LOVF 3TINA 1GSHA 4EGJA 3TW6A 4O7YA 3QFFA 5BMVF 1E4EA 3E5NA 4YJ3F 4XYLB 4L1KA 3VPBA 1EUDB 3R23A 1KBLA 3WO0A 5HBRB 1JDEA 3ETJA 1E4EB 3MWEA 4EGQA 4HNTA 2YS7A 4C5AA 4FFNA 4ZI7F 4WD3A 1DV2A 5HV6A 1GSAA 2NPOA 2GQRA 2NU8B 4DIMA 2I8CA 4O2AF 4YB8B 1BXRA 4O7WA 5CAEB 5J2TF 5JVLA 4C5CA 2Z02A 4IHJF 3BSSA 3VMMA 2VQDA 5FNVF 2W6OA 4GGMX 2R86A 2DZDA 3GIDA 4MV7A 1BNCA 4ZHQF 4WBNF 4O7LA 5C1PA 5J2UF 1CS0A 3RV3A 3TIGA 1KJJA 2YW2A 4O4LF 4TV8F 1JKJB 2YRWA 1UC8A 3WO1A 2FPIB 1AUXA 4HR7A 2R7KA 4IIJF 2R7LA 4J6EA 5CB4F 4HNVA 3U9TA 3TQTA 1CE8A 1AUVA 2YZNA 3RV4A 1A48A 3K3PA 4O7RA 4C5BA 1JDBB 4XZ3B 2PBZA 2XCLA 4M9CA 4E4TA 2I87A 2YZLA 2YYAA 3N8DA 3V4SA 4EA8A 4O83A 3VA7A 2HJWA 3U55A 2P0AA 3K5IA 3ORRA 4NYEA 2W71A 1CQIB 1UC9A 2DLNA 4FFOA 5DMXA 4ZQIA 3MJFA 1W93A 2GLTA 2R7MA 1M0TA 3VPDA 3MWDA 1IOVA 1IOWA 2CNQA 2QF7A 1M6VA 1EZ1A 2YZMA 1EHIA 4FFLA 3R5FA 2W6MA 1DV1A 2CNUA 3VPCA 1Z2PX 2NUAB 2GPSA 2CZGA 1OBGA 3AX6A 3AW8A 1KEEA 4I4TF 4I50F 1KJ9A 1VKZA 1B6RA 2YRXA 3LP8A 3ETHA 5H80A 2DWCA 4O4IF 1GGOA 3R5HA 2CQYA 3Q2OA 2QK4A 1Z2OX 2Z04A 4EAAA 3NUAA 2J9GA 2W6PA 3DF7A 4IWYA 3KAJA 3SE7A 3HO8A 4EA7A 3BFPA 4EABA 3RUPA 5CA1F 1PK8A 4MV9A 1I7NA 4FU0A 2FPPB 2ZDGA 2R84A 4I55F 4O86A 1KJ8A 3OUUA 4YBZB 2WYOA 3U9SA 3LWBA 5D8DA 2R7NA 4TUYF 2YZGA 1SCUB 1KC7A 4MV4A 5LXTF 4M9UA 1T36A 4O2BF 4EA9A 4M98A 2W6QA 3N6RA 4QSHA 1PX2A
chains in the Genus database with same CATH superfamily
3HSKA 3RAFC 5JUWA 1XP5A 4WKPA 4JB8A 2OZVA 3FJOA 5AESA 3CUUA 3T1YH 3SZLA 1LJLA 3N1UA 3IPLA 1PJQA 3BFXA 3GGPA 1JKXA 4XD7D 2HK8A 5HFJA 3TMKA 4QYXA 3E7WA 2G1AA 4NZ9A 1FFEA 3RC8A 1WETA 3KR2A 3P7MA 2IYOA 3H3JA 4ND5A 5ULLA 4JIGA 4RWEA 4JOBA 1AVTA 2FZCA 2PUEA 4I19A 3N76A 2VSFA 3P5SA 4K9DA 4V2UA 4ZI2A 4B6FA 3PJRA 5JSZB 2LE0A 3QUTA 2DKNA 2VTEA 2YZ7A 2QTVA 5A4IS 3I04M 3ILYA 3OLWA 4JP5A 2G06A 2VEDA 4HDMB 3H0GA 4Z7QB 2REQB 1I1QB 4PGAA 1P2FA 2VDUE 2W9BB 1HG1A 1W73A 3IB3A 1H2YA 3DMNA 2FEKA 2EDCA 3G9TA 4PTYA 1DBQA 2SBTA 3T1HH 3FRJA 2IHZA 4QXPA 4RNNA 5ALKA 2X7JA 2QQEA 4G9BA 3V1LA 3L0BA 1WEKA 4IMJB 2DT5A 4Z53A 1WSDA 3ZQ4A 2YY5A 2OD9A 4DIDA 1WMDA 1X38A 3C8DA 5K6RA 4CMHA 1GYFA 3ZN2A 2MR6A 1EUCB 4QATA 3OPVA 1GZ6A 1ORVA 5K8JB 3A06A 4LUCA 2B3TA 2KX7A 2QORA 4OF4A 1KF0A 4J29A 5CYPA 1EVKA 5BMVF 3WNQA 1F38A 2Q5QA 3Q8WA 3CVUA 1ADBA 3L7NA 2IYRA 2I0FA 3TNYA 4G5FA 2HC9A 3R3JA 4LTDA 1KAMA 1RMQA 2UXDB 1AMNA 3IIJA 5YASA 1XTVA 1U9IA 3PDWA 2R8YA 5IK2D 5K45A 4ZICA 4RENA 4X8LA 1NQXA 4IKPA 4YY3H 1M9NA 4G1BA 1MA3A 2ZBGA 4R31A 1RLTA 4AQ7A 1RKQA 4D3DA 3O38A 4L72A 1U7DA 2C29D 1XMQB 4UAUA 1YQTA 1L6RA 4ER3A 3E9NA 5AQ1A 2R7LA 1L8LA 4GPZA 4UBJA 2GEBA 4HTFA 1WA5A 1AQYA 4IJVA 3I92A 4A0FA 3PVCA 3JAMA 1OYVA 3AVVA 1TAGA 2DAPA 2R00C 4NHOA 4DV1H 4AICA 1RZVA 3TSAA 4CV3A 2OWEA 5FLMG 1R4AA 2RIRA 4MVWA 3ENWA 1RM5A 1V47A 1BZYA 2BVNA 2QN3A 7MDHA 4EDFA 1UMBA 5DSXA 5D87A 4OJYA 1BMQA 1USGA 5EMHA 4FHFA 3BTOA 4CLEA 1EVZA 2QTLA 4NJEB 4L8LA 3SC4A 2IHTA 4OMFG 3V6KA 1CKEA 1RM0A 3BH6A 2G5PA 1RHJA 1OBGA 3G2IA 1I3QA 1FTYA 1L7DA 1YNOA 3ZE0B 1KXJA 2FNAA 2D1RA 1WE2A 1SKYE 3MNFA 1AUPA 3JVIA 4AYWA 5HDQA 1YBVA 3MXTA 1XMJA 1AKNA 4CKEA 4G65A 2OK8A 3OOWA 3LHDA 2CJFA 1KT8A 5ALUA 2WAYA 2WU3A 2YOFA 5EYPA 3VNBA 3CMCO 4G5RA 2DXIA 4L51A 3G2QA 4D9CA 1U8CB 2YMMA 2Q5IA 1NV9A 1VP9A 2HEGA 1LPBB 1LK5A 1QQTA 5FOQA 4J76A 5BVHB 4JYAB 3KZVA 5T4FA 4QOSA 5DYGA 1ZKMA 2IU6A 2VHQA 3J81k 1E1DA 2DFKB 5LMUB 1MN6A 4JEUA 4MW9A 2OFOA 1AXRA 4B4WA 2F4VH 1U4NA 1DE0A 4OYLA 4DJDC 2QTMA 3L93A 5HCNA 4BGIA 1CS4C 2JG3A 3KUXA 1YS2X 2WOJA 5C44G 4D1YA 2OCKA 3BD7A 2H2GA 2VUUA 4ME6A 4EUKA 3M9XA 4B8WA 3HRKA 1WKVA 4JJIA 4QRDA 3F0TA 4FR0A 4C88A 1EJ2A 5CVEA 2VQ3A 821PA 1B33N 4ED0A 1C9JA 2GRAA 3RAGA 1XAIA 4O7NA 1SKUA 3PUYA 5JCOC 4DCTA 1P7YA 1U9CA 2BMEA 1TEVA 5LZ9A 2ECPA 2I7CA 2JLCA 3QG1A 4MA0A 4JQOA 3DOUA 5FTJA 2G9UA 2QX7A 1KFBB 3RIMA 1AJEA 3ZWPA 1D2GA 3IDAA 3RSFA 3BOSA 3A4YA 4DEVA 2KQUA 2VH5R 1ND5A 3W5UA 2D5CA 4D6XA 4LZJA 4AJ1A 2YNMD 2Q8PA 2LKCA 2JH9A 1R16A 3FOAA 1O8BA 1MIOB 2BM8A 3USCS 2E82A 1XRQA 3VI4B 4CCYA 5BP7A 4RJLA 1G38A 3EQ7A 3C14C 2BI8A 4P3OA 1GWNA 3A7DA 3Q0IA 2DP4E 4CMIA 4DRYA 3PE3A 3IAUA 3RVQA 3C4VA 3R4VA 3W8NA 2PTHA 4KJZA 3U4QA 3ISTA 5CFQA 1JA0A 1E4OA 3K9NA 3RUFA 3ZEAA 2Q6KA 1R8QA 1LI7A 1SXPA 4ZYLA 3RRFA 5JISA 4DV4B 1Z83A 4KX3A 2ZR9A 1XZMA 1ISPA 1JZQA 5JS2A 2FF7A 3VC2A 1CCWA 4QARA 3AZOA 5DHFA 2C82A 1M1UA 1N0IA 4MWTA 2FSUA 3BH7A 3O26A 1YUMA 1TUGA 4WAUA 4EENA 1B1AA 2NIPA 4EBFA 2H85A 3VU0A 5D1OB 3C7TA 5EXSA 3BMXA 4ANFA 3HCNA 1PJ3A 1TMYA 1SVNA 3U7EB 5JADA 3PPIA 1VRCA 1NRIA 1TWAA 3AF5A 3L92A 4URFA 1RXSA 1XNGA 2MTBA 3ESBA 4O4LB 1ZN2A 2CD9A 4BPRA 1S97A 3A6ZA 3N9IA 1XDWA 1P2DA 2IH2A 5KSOA 4F72A 2HRQA 2ZP1A 1PWHA 3QZ8A 1MJGA 3KELA 4LOAA 1JQDA 4NU0A 2QV7A 2A7QA 4A1OA 3BN3A 4JL6A 1BD3A 2GVZC 2PUBA 4A27A 1NF2A 2PH3A 1EFKA 3NWPA 1W75A 3D3NA 4G0WA 4MJXA 2VSYA 3FTEA 4ECWA 1CU1A 1LZKA 3N8DA 2GN9A 2IY8A 1O97D 4BDTA 2II6A 5D86A 1UQUA 3T9BA 5BRAA 4CU2A 4NH4A 3CN9A 2DERA 1JQ5A 1KP3A 2AC4A 3WGIA 1BX0A 2CV2A 1ZGHA 2YZMA 2HA5A 2P9TA 3LQRA 1O9GA 4LFCH 1M2OA 2WIAA 3GRPA 5IH7A 4RLQA 1Z0UA 4CMBA 3EVDA 5JPIA 3ECSA 1MR3F 5KFPA 5EUMA 4RPHA 1BJKA 1ZRNA 4A2CA 2GO7A 3R5HA 4MUFA 3IPAA 4X54A 1TYEB 3RB0A 1RBQA 1HQCA 4DPKA 1XRNA 3H0KA 2P4EA 3V32A 3I6IA 1A9PA 4S2EA 2XQVA 4IUDS 1CY8A 1J0EA 2FVXA 3QI2A 2DLDA 3TRHA 4MRMA 3CINA 1LFDB 5KT3A 4L0DA 2FWRA 1VKHA 4I46A 1XK7A 2X0RA 5AT1A 1SUAA 3J7TA 5ETJA 4HCJA 3G0HA 4GZLA 4CWAA 1AO0A 2AJ8A 1E6MA 4UNNA 4DV0B 1K83A 3ZKAA 2XC9A 4M9ZA 4N6GA 2ZJOA 5IF9A 3NPMA 3L8YA 1DFIA 3BA6A 1CX9B 2OHFA 1YQ9A 4GIBA 2JLSA 3PICA 4GBMA 3OUZA 3GAZA 4FE7A 1SC4A 1U2TA 4KSYA 3DF9A 2B7LA 1YVUA 4MP3A 4PZ9A 1AX9A 4CF3A 3I9FA 1T1JA 3KJFA 5KTKA 2NYVA 3H05A 5KYWB 2DEUA 3R0XA 4KKXB 3PP8A 4QXRA 1IOZA 5KNLA 3L49A 2F3PA 4KTTE 3MCAA 1SIWA 4S05A 5JQGB 1W94A 3AV3A 4CR6A 5HM6A 5JFGA 3M1LA 2FZWA 2EBFX 2FPMA 1R4ZA 8OHMA 4R01A 5KQSA 4M9XA 4ZVVA 1W581 2VPQA 3THRA 1KY5A 1K92A 3I73A 2C5GA 1V11A 1OWTA 4DR4H 1XEWX 3QJGA 4G63A 4X61A 2NUTA 1XZLA 3FBTA 5DTIA 2FMXA 2X0EA 1UBKS 3HKCB 2A9RA 5FF9A 4B43A 2BKXA 5JH7B 4J3FA 1Y7TA 1YRHA 3N58A 2POQX 1U04A 4B8YA 1UDXA 4FDVA 2P6MA 3R5SA 3PNPA 2RGRA 2JJ2A 5KFLA 2FMHA 3IERA 1CIJA 3EWSA 1SC1A 2VTBB 3VOAA 2YWEA 3FZQA 4OHRA 4PNHA 4LOJA 3FDJA 1A9OA 1AKQA 2ZPAA 4LRSB 1U3VA 4PC7A 5IULC 3E7XA 3TRJA 2XE7A 4OBWA 4Z0NA 4JUDX 4C2BA 3A1WA 4DARA 1ADGA 1S6YA 1CDDA 4XGKA 4QDXA 3L0ZA 5BSFA 5ISMA 4ALNA 4FI3C 3LWZA 5EIAA 2ZVJA 1ECPA 2XVZA 2OO3A 4O2AA 3WNBA 4KWTA 1GYQA 5GJCA 4MCHA 1R18A 5TIIA 1J2YA 1DB3A 1I5OA 2JBAA 1TCCA 2YW9A 2VXYA 4LBWA 1MZVA 5EIEA 1PQ4A 4MQEB 1RQ7A 1GOTA 2ALZA 2O6HA 3IOBA 1WUTA 2E4VA 1KFKB 3HCFA 3JD1A 5KYUB 3BZBA 1KWGA 4MYTA 2K2QB 4DMLA 4BV9A 1W19A 2FWAA 5FCDA 1PIWA 2VTKA 4Q4HB 1HR0B 3OU7A 3BEOA 4IIJF 1QK4A 1O96B 2ENWA 4PGGA 3S70A 1NC3A 4MS4A 4BZZA 2G4CA 4PQYA 2R7ZG 2JIDA 1H6CA 3GP5A 2CXNA 3RAJA 2W7TA 3STWA 1I1OA 1NATA 3SC6A 4YONB 2AMJA 1SHJA 2CXTA 2B9EA 4MQFA 4WCFC 3L40A 4N8EA 4MQLA 1ODFA 1WCIA 1Q15A 1PYGA 3ANMA 1ZBQA 4DIFA 5IVDA 4NIMA 5K3AA 1L7VC 1IBMH 3LT2A 3ZGXA 3QSGA 2ZYSA 3WC4A 1HRKA 2AHOA 2OSVA 1D6MA 4GL2A 1E2MA 2VZ8A 1AQNA 1SM4A 3QITA 2QMHA 1FVOA 2A9KA 5FA8A 5KFKA 4YRAA 1X8KA 4EB6B 4Y2VA 1S4MA 5FR1A 4YRQA 3CUSA 3M5DA 1G3IA 1FNCA 1HNXH 3LKBA 2UVQA 4AROA 5FOWA 5BWOA 2VCEA 1MO3A 1C9YA 4ZQEA 5TSDA 5DHTA 2VJAA 5CA1F 1X0XA 1XG5A 4REOA 1K7YA 4B3RB 3T8YA 4O86A 2Z2IA 2RHDA 1IULA 3KNZA 4LVOA 3KFLA 3WMFA 1BVYF 1NJ8A 3QVVA 4OJTA 1COWA 1K5GA 5CT5A 1KC7A 4U9IS 1DADA 1D04A 4TMKA 3ADBA 1C8BA 1LF0A 2CN1A 3R3ZA 3N53A 3D2AA 3U31A 4PLZA 4P7KA 3ONNA 4Y2TA 5BOSA 4L16A 1RKVA 2ZB4A 4GX0A 4Q44A 2OXCA 4TXNA 5IT4A 3O3MB 4FPXA 2ILTA 3BIXA 4NMWA 4Q4AB 4EBDA 1ZIDA 4JI7B 1JWAB 4WE3A 2JNWA 2GYUA 2X2FA 4RNCA 1A77A 4MO9A 1NVEA 3PJEA 1KSFX 2VUMG 1WCMG 2PSHA 2XB2A 4JBYA 4Q4DA 2QN7A 2GETA 3JQ8A 3GPDG 1MJNA 3OJLA 1LS6A 3NATA 2Q0SA 3QOXA 3MFQA 4AMGA 4RQTA 4XLTA 5TX7A 3RABA 5DK4A 3TLGA 1T8TA 2YJ3A 4O4LA 4TQUS 4EP1A 2IY7A 3GRKA 1QO0A 2P6NA 2IX9A 3FWZA 1RQGA 1S9FA 1T2CA 3A9VA 1UFKA 4YN3A 1NJGA 2EJBA 2R6JA 3EPJA 5I9BA 4H1TA 1XMXA 4AY3A 1QFYA 4YFYA 2ETVA 4J1SA 1DJQA 2E0IA 4ECTA 3GLKA 2CLKB 1A7UA 1NXTA 4TWZA 3ANSA 3WYEA 5F5LA 3TLYA 1E9BA 3F7OA 2QAJA 4LWOA 3ZYCA 4GOJA 1TU0A 3RI3A 1JG6A 1SG9A 4DSZA 3K8QA 1D2AA 5CJPA 1E32A 5KJ1A 2QW1A 3ONFA 3GJ3A 3EY9A 2E89A 2GK7A 3PXCX 3BSWA 2QZ9A 3M5CA 3UAVA 5KT7A 4WDQA 4CF7A 3MCZA 5KFVA 3DYIA 5E38A 4UDXX 3RHFA 2OLEA 1E7QA 4H1WA 5J43A 1G2QA 4ZI7B 1NW8A 4IXDA 4WOPA 1I01A 1NI5A 1RTKA 5JY1A 4LI3X 1Z68A 1DBRA 3D6HA 2ZROA 4V0NA 3WQHA 2WYVA 3HJGA 5JBNA 4C2AA 5JU6A 4X1YA 4CM5A 1XI2A 4MW2A 1P1RA 4TKLA 1WXXA 2AJDA 2UYYA 4DWVA 5ALNA 4ZHQF 1JG3A 4AYBE 1XK6A 1ECJA 4C1NA 3CX3A 3PK0A 3UOGA 3OMLA 5FLKA 1TUEA 1N5JA 2WPDA 4OSEA 1OASA 1UC8A 1I3MA 4BO2A 2J3QA 4JL5A 1RYDA 3FPKA 4BZPA 3ZBPA 5F1PA 1NBHA 1DIOB 3BIFA 3GLGB 1VKJA 3JYPA 3M49A 4K5QA 2NTEA 1OC2A 4M9CA 4IDGA 4DCNA 3L4JA 5E8RA 1MG5A 2BM1A 3ULKA 3LDGA 1YU9A 3IVGA 3SM9A 2JJ2D 5EQDA 5ECDA 5JMOA 4XM2A 1J8DA 1E0KA 1RLOA 1XJCA 1XCLA 1PGPA 2Q3EA 2VTVA 1IOVA 4O08A 5ADWA 3L1HA 4JT4A 1WXDA 1XPJA 3QTBA 4YLYA 1WDMA 2ZZNA 2QF7A 1GUDA 3A14A 2CXPA 2IHVA 2NYUA 2ZSIA 3ACBA 5ADVA 1M8FA 1NWHA 3QHPA 3ZQ6A 3NU1A 2V7UA 4BQSA 4M0FA 5KOHB 1IDN1 4WZBE 3N8NA 2BCJQ 3C3XA 1GAXA 4IO0A 1H66A 4TYPA 1G6HA 1VKZA 3C7KA 2Z0MA 3AXTA 5LWQA 4XOUA 2K4MA 4CU5A 4RVNA 1RKXA 2FW8A 1JMVA 1U2DC 1Q95A 2VPWA 3WAKA 4CLOA 3K9BA 2WE7A 4I99A 1TF5A 4BKMA 2QMZA 2VUIB 4IDQA 1NJ2A 1EVLA 4FXOA 3T15A 2VKTA 5AK5A 3LVRE 5HILA 3OLCX 2VVTA 3GQVA 4NV3A 3SEFA 3G89A 2BKVA 3LDHA 3DE6X 4G4IA 1XEXA 5KFNA 2HKIA 3WLRA 4YDSA 1DTEA 2WTXA 2X0IA 4UOQA 4YJFA 4DGSA 4ZYZA 1V48A 1FXWA 4A8JA 1QAOA 4BRUA 2KYRA 4V0RA 5H1YA 1ZM7A 1NG1A 3VNUA 1X7WA 3FKIA 3DXYA 1GNVA 3WDLA 3E15A 1V4NA 1XELA 2P6PA 4HYEA 4K6HA 3GGOA 1CUWA 4A16A 2EX0A 4GQBA 5F35A 2NU9A 1DDOA 4MYCA 2C9MA 3DHNA 4DR6B 3ENNA 3PE4A 4HBGA 2OP0A 2DRIA 2ORYA 4MQEA 4EGFA 2GPAA 4YUVA 3CLUD 3LPNA 3GHYA 5HTKA 4CIYA 4GKVA 3ZDZB 1WVGA 1VHQA 2NYAA 3K71B 3ONEA 1PAUA 1U0TA 2GCEA 4W7HA 3OQNA 5BUQA 1O96A 1T2VA 2FVYA 4FE4A 3C87A 1EK1A 4E07A 1AKMA 1ZEJA 4KQJA 4EG6A 3E8SA 5A9RA 2EJTA 4Y6PA 1L3IA 3JW8A 2P4HX 2H1HA 5CBPA 3VH1A 3B6EA 2AA3A 1ZHFA 4LGMA 3RUCA 4PAOA 1COWD 2Q6VA 1ZW6A 4LMRA 4ALLA 3GWZA 4LVUA 1F3LA 2YV3A 1QUEA 2O59A 3RBAA 3N8KA 3GUUA 1I9GA 3O0TA 3DEYX 3S1SA 1NVKA 3LI2A 3FTCA 4G5HA 4YR2A 4B7CA 2IHYA 1UDCA 4JP1A 4IFEA 1Q0HA 1ZUD1 3RS9A 1Q0RA 3DWFA 1VI5A 3GRCA 1T2FA 5B6IA 1A8QA 4KQHA 4OI1A 3U80A 1NOJA 5CDGA 2OLKA 3QXHA 3WSTA 1RYBA 3EH1A 4FC7A 4JKIA 1NXQA 3VV2A 1MABA 5FA6A 4Q8EA 4R7ZA 2OQIA 4EFLA 4J90A 3UWPA 4G24A 3WZLA 5J2UF 3L6RA 2J6SA 2YU9A 1HE1C 4S24A 2XQGA 2VF5X 1JEDA 1QO0D 5KHAA 4ES6A 1YRWA 5HIIA 3BGDA 4R6WA 2WKQA 1R12A 1ULHA 2BZ0A 1PBNA 5ITSA 1YB4A 4DV2H 1OGJA 4FMCB 5F4BA 3KD3A 3GFFA 1A48A 3Q5DA 3WRXC 1RWQA 2IF2A 4JKYA 2C2GA 4P2BA 2B34A 3MRXA 2A0WA 4HZIA 2TECE 5ALFA 4F3TA 4DDMA 2C0PA 4FBUA 2X5NA 4N5IX 2IIVA 4PG4A 5B6PA 1K27A 4X65B 4QRIA 2BDTA 4FR2A 2WB1A 1REQB 3UFBA 4IAOA 2WKWA 4LOIA 3T3GA 4EOGA 3TBHA 1TXGA 3EFOB 1CETA 1O0SA 5I4IA 3D4IA 4TMZA 4M9RA 4TQAA 1FJGB 2FPUA 5EIBD 3IFSA 1M73E 2CLDX 2IYLD 2DJ5A 3V7NA 4UNQA 2JBHA 4KE6A 4ZJZA 4U9HS 4GM1A 3O9ZA 4NNPA 1M2VA 2Z6UA 1BO6A 4H7EA 3KJGA 2WAQA 2AF4C 2AK3A 1G7RA 1WXQA 4XUGB 1LXCA 2OBBA 1W49A 3LC1O 1RJGA 5DN9A 3G2KA 2ZIUB 3W7VA 3UF0A 3MLBA 2ZDGA 4KODA 5AKEA 4HUTA 2W57A 3HABA 1IYDA 4LF7B 4CKWA 2G4LA 1KKMA 3PGLA 4JOSA 3I2JA 2WPDD 2SKEA 2VT3A 4CM7A 2NAPA 3ZJYA 2HNBA 4C0QC 1FSGA 3TEMA 2PGAA 2JI9A 3O2QB 1DAOA 3ROXA 1FY2A 5DNWA 4QFDA 3O9MA 2PGXA 4UJ5A 1HRDA 4D02A 1GUAA 3VH4A 2PZKA 1H9BA 1E79A 4FNOA 4AJIA 4DADA 4IXTA 5FUQA 3WHPA 3SEQA 3NDPA 3QUSA 2X2EA 3K0SA 2FSSA 1I7QB 3NHKA 3BPSA 3G8BA 3NUZA 4LHXA 2XXBA 4HP8A 3AY3A 4DMKA 1ZCZA 3KXYT 4NQZA 3FMAA 2NZXA 3LQ4A 3VSDA 1EWYA 2PSDA 1P61B 3X1XA 2I33A 1GZ7A 3KEFA 5EINA 5GM1A 1BWQA 2CJPA 1WMBA 4BV2A 5DXAA 4Q7KA 4IZOA 4XRGA 1GUZA 3DCIA 2VZ0A 2G04A 4JLUA 5SYAA 4ECAA 1JNYA 1Y1PA 2UDPA 1JDVA 2R7AA 2C5FA 3F6EX 4M87A 1DIKA 2V5VA 3UIEA 2QTVB 2H7YA 3K7EA 4B2YA 2BGUA 2FMAA 2QZPA 2WHEA 4G86A 3H4MA 1QKJA 1EQ2A 4WLEA 1N2CE 4EUHA 1G3MA 4XGIA 4B3MB 2YYSA 3B13B 5DHUA 2H4JA 3OO0A 3U4GA 2ID7A 4QAJA 1MJFA 4L4YA 4S1TA 5KAMA 4ZOEA 1G8GA 3R3SA 1ST3A 3MHPA 3BWVA 3NWJA 3SQOA 5FD8A 4JI5H 3O4JA 5EESA 3H8SA 4QDKA 2YV1A 4YJ3F 4LV6A 5EC8A 4HSGA 3IE0A 2M1XA 1AQJA 1O87A 5KTMA 1P9RA 2GAAA 2VJKA 1VCNA 4TZ0A 3VHQA 2RH9B 3SBEA 1XZDA 4QBHA 4CF4A 3FGPA 1WW3A 4ZVTA 4KLNA 2BJWA 1KZHA 4ASUD 1E3TA 1SGWA 1KVRA 3ISVA 3LP5A 4WRRA 5CK5A 4NV0A 2JCXA 2CYAA 3S3TA 4ENWA 1AZLA 4DLAA 1VRWA 5KFBA 4JP2A 4EG4A 1H0RA 1Y1TA 2WHYA 4CDNA 1HT1E 1AUVA 3RV4A 4ED1A 4TN5A 3E9EA 4HTFB 4DQLA 3S2IA 1THTA 1ZUNA 4NATA 5ICMA 3OCYA 4BGUA 3A0UA 3N43B 1E9AA 1N5MA 1C8LA 3WLOA 3NJ8A 1KI9A 4L4XA 4GXQA 1V3QE 2VSQA 3AWDA 5BWVA 3GEIA 2HY7A 1USUA 3CVOA 4KGDA 5BSTA 1EZ1A 4IIGA 1UMBB 2B9VA 3U9LA 5M04A 2HOQA 3FWNA 4IDPA 1QKIA 4Q1EA 5DDIP 5EFOA 2JI8A 2Y1CA 1D3AA 3LKZA 2PM8A 1WULS 3N28A 2OV2A 2G72A 4DV6B 3OWHA 3RVOA 4W4TA 2JCSA 3ODGA 3ID6C 3UQ8A 3ANNA 2JC3A 3VR0A 3ZHBA 4CKEB 3TY9A 3CCFA 4X6LA 2UV8A 3ECAA 5EYPB 2H08A 5L3VA 2HIAA 2VPTA 3VNSA 2Q2OA 5AUOB 1FBTA 2Z9DA 1R6TA 2E4XA 2A0UA 4JS0A 2W9AA 1C3XA 1YBFA 2EWMA 5KDLA 1U8XX 3KR0A 4ECQA 2BFAA 1ZRSA 4JWKA 3SLRA 3K0EA 2DLCX 3N87A 2Y1EA 2W6QA 3VVMA 4RY8A 5SY4A 3L18A 3CBGA 2GJ9A 2GKSA 2CVFA 2G76A 1B4DA 1VE6A 4F4CA 3PUZA 1PHPA 3VJKA 1O75A 2GR9A 4GE0A 4E5SA 3LU1A 2EV9A 2V9PA 3TRDA 4QUKA 4TV9F 3NGMA 1TKCA 3VR4H 3WHKA 2QE6A 4BO4A 4UHCA 1TYAE 2BQUA 5CEFA 3F4BA 2VS1A 4C4YA 2BRUA 1DIBA 2WVJA 2Z57A 4AUEA 1ZVQA 5BQXA 1CVIA 1PNOA 1Q14A 1YB1A 4LGVA 3IUEA 1SR8A 1ZM3A 3U3ZA 5B58T 1E4FT 5BWRA 2R4QA 1RACA 3UFXA 4JMLA 2GK6A 1WQ1R 4JLKA 4RMIA 4MUYA 1OWNA 1SQ5A 2Z1MA 5GOZA 4QJBA 1HURA 2A3NA 1JJ7A 4YK7A 4RZSA 3OI7A 3VOBA 3M9MB 3NUQA 1B2LA 1TAHA 1U63A 1SURA 3IJPA 1J0AA 3V1TC 3I64A 2HIVA 1BE0A 2RK4A 3O1HB 4CCYB 2IFTA 3GN2A 2VDMB 5D5HA 4L8VA 1FLVA 1KU6A 2H2IA 5KJCA 1LV7A 2DFPA 4FWTA 1X39A 1E0SA 4ZAVA 4CMIB 1Z12A 4GMGA 3SQDA 2NAFA 5K3SA 4G1UC 3U4QB 2G07A 1TA8A 3PDIA 4TX1A 2ASJA 2V98A 4PC3A 4EI7A 2VPZA 3ZU3A 1JB1A 3HJUA 3GPLA 2ABWA 4RPKA 1E4EA 1E79D 1PR9A 4DPLA 1F8XA 5IDXA 5DX1A 4UDYX 3COJA 2AMYA 3EGIA 4OAPA 1RAGA 1OZHA 3AC0A 4C0XA 2W8BA 3CE6A 2AI3A 1ZOOA 3OBBA 2R1ZA 4INPA 1T3NA 1FA9A 2EBHX 4K8OA 2VQDA 3LK7A 3K0HA 4YJKA 2GILA 2H59A 1QP0A 2KWIA 4MRVA 2WWRA 5EP4A 1J06A 4QU9A 3N2NA 1F8UA 3PI7A 2M6KA 4GKAA 2WZBA 3NONA 4U2DA 2SNIE 5LU9A 3PGVA 1G8MA 3E5MA 3GIQA 4NFSA 3IEXA 1Q6ZA 4C2MA 3C39A 1UK7A 4GECA 3O3OB 5A3QA 3GDGA 2WTAA 2XLBA 1QU2A 4O83A 2XGGA 4A0GA 3ZWYA 3OIVA 3AJ8A 1GTVA 1N6KA 4ZT3A 1BN6A 2R7MA 5JMPA 1K1EA 4Y2QA 2WZCA 3SYNA 2AC7A 4JP8A 3IMFA 2PUGA 2BJHA 3ZCVA 3LYLA 3BA9A 2JGFA 1K8ZB 4D9GA 5TF4A 4G4JA 4A3JG 1UQTA 3TPFA 4UZFA 5T64A 5K0LA 3SHVA 4Q3KA 3EC2A 4YREA 1NWCA 3BCSA 5GV7A 1M2OB 3UMJA 5IXJA 2Q9AA 5TS2A 3NH6A 1P9NA 5IT5A 1DC5A 1DIRA 4EQ6B 4Y9RA 4E5KA 2QL6A 2C4NA 1GFIA 3Q9LA 2JLZA 3H97A 4WLUA 1H65A 3K4HA 4N8DA 4FGUA 1TK3A 2JLAA 2FSFA 3DMPA 4OQEA 1PK8A 5DRYA 3ES9A 2OCBA 3AKCA 3PFCA 5THKA 1FQKA 4MRMB 4UD6A 2VYFA 5ILGA 4UAJA 2D62A 2W6IA 1F2TA 2P11A 4LJYA 3H3FA 3E4DA 2Z5GA 1PCXA 2QYTA 3IT0A 5ALSA 5E4FA 4F6RA 5FO0A 4MR7B 4G0UA 3BAFA 2BFEA 4QASA 5KFAA 2C9OA 3QEOA 3RARA 3IUJA 4HQFA 4MHSA 2W8ZA 5IVHA 4FCVA 1GHTA 5KHOC 1I7PA 4GWKA 1OXMA 4NOMA 4Z8YA 3UXEA 1I6UA 1NKTA 5JVDF 2Z1DA 4XWKA 3QVKA 2HCRA 3T38A 3RKSA 4IYJA 1C1YA 1CY2A 5FUVA 4US0R 1IXRC 3HVKA 4NMMA 2Q4BA 4GLBA 4MWZA 3M81A 2VOBA 1L7MA 4QIWA 4Y3UA 4F1WA 4H7DA 1QE0A 4C43A 3ND6A 2HV9A 1H2AS 2D0IA 2FH5B 3OZFA 1II0A 1PWXA 1QCZA 3NP9A 1GU7A 3CF6R 4H77A 3TCNA 5ALWA 3W2IA 2FCRA 1L5WA 1I1NA 5EQTA 4QREA 4RUAA 1KO4A 3IMEA 1V11B 2ATVA 3DOEA 1PR3A 2NUTB 3KTDA 3Q1KA 3DMFA 3INRA 3PLNA 2JK1A 3I4CA 2ADMA 2ZI7A 1NQVA 4MRSA 2PVPA 2GHTA 1OHHA 1X3LA 1M7GA 3WP0A 4ETIA 3IQWA 1UKCA 1E1MA 4EG0A 3U39A 4I9UA 1FDOA 2C2HA 1WTCA 1EB9A 5EI5A 1IPFA 3FYHA 4OP1A 2GCIA 1Z06A 1IM5A 2JEGA 2V55B 2RI1A 2HUNA 3CEPB 5CM9C 4TTAA 3H1BA 3HLKA 1X1RA 3CLUC 3AFNA 4JLNA 2FKNA 1I51A 3K2BA 2IS4A 4JROA 4UNPA 3W3AH 3MFIA 3FIUA 3VZCA 1O08A 1HYEA 3HCWA 1UBJS 3S2YA 3C1TA 1YZKA 3EODA 5HKLA 2EYUA 1WY7A 4GMXA 1U5BA 5LD2B 3I5MA 3NEAA 4LYGA 4O2AB 5TJ9A 2JLQA 1OXVA 4BATA 13PKA 4OHYA 3LUJA 1N0VC 5F12A 3K09A 1P4GA 1L5YA 2JBAB 1CIVA 4KN5A 3PWTA 3PNQA 4HEJA 2AW5A 2H51A 2QU7A 3CX7A 3HOXG 2O0MA 1PS8A 4DCVA 1UINA 4UHDA 5KO2A 2ACKA 3JVUA 3ABQB 4OH7A 3OETA 2WICA 5G53C 1CD5A 3C5EA 3QXJA 2G1KA 4LTMA 5BSUA 3GEGA 3V9PA 4MGZR 2XHZA 2G08A 3IEIA 1SVSA 2VSXA 5AM3A 1E1QA 3WBJA 4FHDA 4KIJA 3QU7A 4FHEA 4HUQA 1QIFA 5TF0A 4FC6A 4EUNA 1LEHA 2NADA 3T12A 4KC0A 4PVDA 1V2HE 1UBFA 1LDGA 3C3WA 4JR0A 4MS4B 3OUTA 4WJKB 1YQXA 3LA8A 1DRUA 3VO1A 1KY3A 2IHBA 4I6EA 4Q7JB 4ZTZB 2VUSA 3TJRA 3WYGA 5JROA 4ZAXA 1ESNA 2X8JA 2YOHA 4P36A 1E6LA 4PG8A 1CIPA 2P3QA 4PINA 4HWOA 4MQFB 1K2WA 1ZI8A 4X44A 2QLNA 1LD3A 1WCIB 1AGXA 3ZDRA 2E2WA 5KJFA 1U0RA 5KHLB 4O59O 3PR3A 4JL8A 3NVAA 5J59A 2JHGA 3SM3A 5AJVB 4TTSA 1TVMA 2UVDA 4BU1A 3DDZX 1R5BA 2JL1A 1Q50A 2QP9X 2DM6A 1ULBA 1JDZA 4WXPA 4ZEOA 2C83A 3O6VA 2EJCA 2XCRB 3RM3A 1DJPA 2OE2A 4L8FA 4FONA 3MTDA 1OJ7A 4KR9A 3USES 3TEFA 3FFXA 3DONA 2DABA 5MN4A 1TADA 5LR6A 4YEDA 9LDTA 2WWFA 4Z4CA 4UM7A 1NF8A 4CVNA 3CF4A 5L45A 1BD4A 2VWPA 1N6RA 1Y3HA 3EXHA 1ZJJA 5BN3A 2DWOA 1XB2A 3DLHA 2XKBA 3EW9A 2HTFA 5C5EA 1AS2A 3ICOA 5EGSA 4JQZA 4ICIA 2SHKA 2NV0A 3A1NA 2C92A 4EMUA 4MVJF 4IICA 1FS6A 1R0SA 4XIIA 5DULA 2GXUA 1ZH8A 1XQVA 3ROPA 1XNRB 3TEJA 3R3WA 3OFVA 5BOSB 1VDZA 4MVYA 4ERNA 2WU0A 3BJZA 1T9DA 3WYBA 4D5EA 4L57A 1R6VA 3M9WA 2YRFA 2BDEA 3KT6A 3ZU2A 3RNOA 3DBLA 4DL6A 3W5HA 2OD7A 1C7ZA 3TTVA 2XWBF 1EAMA 3EWAA 5EZYF 2CXOA 3JQ8B 1KC3A 4I8IA 1Z33A 3TLGB 2Q5LA 2P9FA 3IMCA 3FWYA 4HS4A 3I2GA 3SBDA 2HI0A 3O94A 4C7OB 4IDNA 4MVJE 3U26A 2E5LH 1QGZA 3LA6A 2RBEA 1JVSA 2ETXA 2IODA 1NF3A 2O5EA 5DLDA 2PCLA 1Z62A 3KXDA 1TA4A 2VP6A 1IRXA 3BILA 3IEKA 2W6ID 3LHKA 4FS8A 4L02A 4MZXA 3NIFB 4MWDA 4P54A 2ZIGA 1KZ6A 4DM3A 5JJIA 4FB5A 3E61A 1HETA 3NBAA 1R8XA 1RAIA 4YCLA 2PV0A 3NTUA 4E4YA 1YJXA 1XJ5A 3FE2A 3FCSB 4RS4A 3UZUA 2OQ2A 1U8UA 3UY4A 2AX3A 2NWQA 1LBIA 4EL5A 4QYTA 2EIHA 3CKLA 2FW1A 4M8NE 4IJ5A 4ID9A 3QKTA 2YY6A 4Q93A 4EKNB 4L1KA 3I83A 4OQDA 1WCXA 4IG9A 4UMEA 3ZCTA 2VPPA 3DOIA 4EQ6A 1FTWA 5D00A 3NT4A 4F4IA 4RAYA 1B3RA 4XR9A 421PA 4KUHA 3CNEA 3H4VA 5FEMA 3NHAA 4YP0A 3FLEA 3LHSA 4DDWA 4KV7A 1HZZA 5JR3A 1UWKA 5DBEX 3ZW8A 3TECE 4K6CA 1J0BA 4TMFA 4X1YB 5FWAA 3H5OA 1H4QA 4DG9A 1TYDE 3SP1A 1Z5GA 3GGDA 3V8MA 1K3UB 1TM4E 2HVRA 4WXYB 4F9GA 4DIOA 4MR7A 2VQEB 2DX7A 1Q11A 3ESQA 4GOMD 1OBFO 2WWHA 1ZC3A 2VATA 2W22A 5J4HA 4PXAA 1OHHD 4YRGA 4ARAA 3HU1A 3NEJA 3DKVA 3TSCA 2XZOA 4NCAA 1QIJA 4ZCLA 4BCDA 2JAHA 2F59A 3PDJA 1DO0A 1HC7A 4J49A 4CT4B 4H59A 4B46A 4N0DA 3WWZA 3FRIA 4ENTA 2CXXA 3JCZA 1A9RA 4NYJQ 1FDTA 3HCBA 4B44A 2GF9A 2WSMA 2BOVA 4F93B 3KHSA 1KFEB 1EXNA 2PUTA 2O2JA 1PNVA 4KBFA 5BR1A 3Q0TA 2O2HA 2BN4A 4BASA 1NOIA 1E2KA 3I9V6 3V7UA 2GUWA 1YCHA 4CM4A 3RTXA 3KOYA 3BX1A 1XP8A 1KY4A 2QGZA 3SICE 3V6LA 1CUDA 5AWFC 3ELBA 1FVHA 1OE0A 3VYVA 1G7TA 4MLZA 1R10A 1Z6ZA 2D1SA 4DFDA 4CLOB 2CJYA 5DNVA 1NQ5A 4OQXA 5H16A 2GH1A 4MUXA 4DN6A 1I7NA 1S1MA 2HNAA 4K6GA 3HFJA 3ZWAA 3L6CA 5I48A 2FA9A 4RKWA 3TFQA 3RVKA 4G67A 2R5WA 2AWOA 1P7PA 1YE5A 2YXPX 3RCBA 2WABA 2B7BA 3WGNA 2FOIA 1R6BX 4Q1AA 1P0QA 2ZB2A 3OCZA 1XEXB 1E1QD 1Z34A 4ND8A 4PNPA 3L4KA 3CJRA 4YMTA 1IQ0A 4YJFB 1P5HA 1QH8A 5CXQA 5ICSA 3T5KA 3T0IA 4NEQA 4A8JB 3HB0A 4L6AA 1NNSA 4WESA 1CUJA 4ZO4A 2XD4A 2P5YA 2HO5A 4XARA 2CFSA 1X7WB 1IY2A 2Z3VA 2RC5A 4DB4A 1SOWA 3PNMA 3VAYA 2REBA 1E3QA 1EA5A 2QQ5A 3KZOA 3OKAA 3DT8A 3JQ9C 3DZBA 1QVZA 1RP7A 4EBBA 2NU9B 4OREX 1QF9A 4GT1A 1RKUA 1SD2A 3GVCA 5B2ZA 3QFRA 4DQVA 2O8DA 3DDOA 5EJ7A 4RZUA 4RZIA 3QF7A 1MFZA 1AO3A 1TWFA 4QNRA 5K0SA 1YI1A 4PRYA 3U62A 3EIWA 4X1OA 5AM0A 5K05A 4DA8A 1IZ9A 3ND7A 4OKIA 2Q9CA 5DO9A 4IAJA 3LD9A 3AZQA 1ITZA 1D8AA 3MJHA 3W5VA 1QP8A 3AJAA 3VJLA 1BYUA 1Z4IA 3FB4A 3ZOZA 4MVJM 1ZNWA 3HWRA 5INTA 1EX1A 2OXFA 4CXMA 2OORC 2PD4A 2CXUA 3A1EA 4DIUA 3NTQA 5CBPB 3KAKA 1YMUA 3OZBA 1I1LA 4XUDA 5BR8B 4NFHA 3MHTA 5IKOA 4TM5A 2BISA 3BGWA 1LWNA 4JI1B 1R6XA 3NV9A 3RGWS 3R1IA 3GTMA 4RHUA 4BQPA 5GM2A 1DT5A 3S2SA 4JEMA 5EPUA 1HE8B 4JJFA 1DL5A 1ZOSA 4B6SA 4E2FA 4BNMA 5HRCA 2J0EA 4YLEA 3ZHZA 4ILEA 4Q5IA 2HT6A 1Y8QA 5J2TF 3JYHA 5FBRB 1LY1A 1K2VN 2XOXA 4D44A 1J00A 4NOJA 1MABB 4UOEA 2Z2XA 2OLJA 1L5QA 4F3NA 4HGOA 1AMOA 4BNJA 4RJIA 4EVIA 1XCGB 2A1IA 2NPIA 2AHRA 3ZK9A 3BHNA 3D8BA 3DZ8A 5AVVA 5E7QA 5CYGA 4FLEA 1V8DA 1GL7A 3FOFC 3ORHA 2XPCA 1GAQA 1YE3A 4X9XA 3JR3A 3V4SA 2R8RA 1OWOA 1FB5A 3VGPA 3P2IA 4NYEA 2MSNA 4ZAZA 1WR8A 4RA6A 3G2MA 3VPDA 5GZ6A 4YPVA 4IRMA 5LL6P 2ZUFA 3MUNA 2P9YA 3VPXA 3RFFA 1L8OA 3OJCA 3UGQA 2HRRA 4N7BA 2IPNA 5KFUA 1RPJA 1ZYUA 2Q4EA 1CYDA 3QWBA 3CRMA 1Y6JA 4ZZ2A 1B6RA 1EQUA 3B3GA 2A5FA 4X92A 2ZCUA 1FVXA 1YNSA 1NVVQ 2QM7A 4URYR 5IBQA 4F4XA 2W2PA 1NP6A 4ZGGA 1K1SA 4HFNA 1FP2A 4JLOA 4OK6A 4DCUA 1M2VB 3TLCA 1IK6A 4XTRA 4C7OA 2NO6A 1B16A 2W7OA 3FLBA 5KYTA 4UTZA 5U4QA 1Y3CE 4H6VA 4BX9A 3O82A 2CFRA 3S2EA 1NX6A 2ZSFA 4E03A 3IURA 4DKXA 2WDZA 5E95A 3RT9A 3VXKA 1SOAA 4XLZA 4Y0VA 4CKWB 3DE4X 3O93A 3L0PA 2QX8A 3IQGX 2J5XA 3ACDA 1JEQB 4PRKA 4YHBA 3LCJA 1PNTA 4UREA 3W5JA 4EW6A 4CE5A 1AH2A 3U5ZB 2CDAA 1LK0A 5DOVA 1NY6A 4ZCTA 1FNNA 1Z2NX 3RBEA 1J5EB 4V0LA 3SZOA 4UTNA 2P6OA 5U1PA 3ZVNA 3E7FA 1IXYA 3PENA 4F1KA 2GAIA 3BRQA 2ID8A 2ZUBA 3E18A 3A6PC 4XI9A 4QFCA 3R3UA 2HGSA 4KMSA 2CE2X 3V6JA 1L7NA 3NT2A 4TLMB 4ETNA 4F5EA 5JJ5A 1IXZA 4JMPA 1KTAA 2FI1A 3CZPA 5CNIA 3NGLA 4YJHA 2C2KA 5CVVA 3LRTA 4PLFA 2H06A 4BB0A 1HDIA 4TLAA 3KALA 1XZHA 1U6IA 1ZU4A 8ADHA 5AI5A 4RLHA 4V3CA 1WZNA 4GLJA 4PS1A 2WYWA 4R9UC 3EYWA 5L1LA 2XUFA 1X6VA 1QRRA 5K0TA 2A5DA 3LZ6A 3ZHYA 5HJEA 4O7TA 2UUBH 4HLDA 4U6PA 1PEDA 5DBFA 5C4MA 1RXUA 2P7HA 3VR1A 3PXGA 1FE8A 4R8MA 2QM8A 2V5AA 4YT4A 4Z2AA 3PEFA 2B94A 2ZRHA 4LQ4A 4YQFA 3ED5A 2W8LA 5CNMA 4YV0A 1QYDA 3NS7A 2DPGA 5KX5F 2QNBA 2NZYA 3QEAZ 5KFQA 4ZT2A 2XYVA 3D7MA 1L8QA 2C4VA 2FHSA 4OMDA 2PUHA 1Y4SA 1QMGA 4LYJA 4C14A 2JD0A 3VYRB 4MUMA 5F73A 3DLCA 4PLPA 2PUDA 1ZWKA 4XWGA 2FOLA 4WOCA 2JA5G 3CR8A 2GPYA 1J7KA 4F4HA 1NDHA 3LVQE 4FBMA 1Z5ZA 3KT0A 1DPFA 4TZ6A 1KYYA 4DLTA 5DNAA 4JGBA 4PZDA 5HV6A 1CY0A 3R5KA 3FAKA 4JYBA 4PWQA 3B3JA 3DFKA 5G1PA 3H1TA 3OJ0A 3WYDA 1TRHA 1WO8A 4FNMA 2NYRA 4G5XA 1PVVA 1P7ZA 4RNDB 2NO9A 2FPIA 2Q5HA 2OY0A 1VE1A 1OFUA 3U3MA 1FNDA 5EERA 2CYCA 2HRDA 1IWPB 1VOTA 1F0KA 4Y9SA 3D64A 1P4RA 4EG7A 2AYYA 1P19A 2YHSA 2FUG1 1Z7EA 3THWA 3DZHA 2ASLA 4J9OA 3F8WA 1KU0A 1QPGA 3JAWA 1YOVA 3E2IA 2AYZA 5DGXA 3PQ4A 3K9WA 4HAYA 3L8CA 2EG5A 2XTNA 3C6QA 2ALJA 3OICA 5JS8A 2FN7A 3C2QA 2W71A 3IILA 2HQ1A 1XJQA 1ZUNB 3L7AA 3W2HA 2OV4A 4XCXA 3B48A 4CR7A 1MGOA 3UW1A 5HCUA 5TQJA 1M2NA 4B3BA 3D43A 1RRFA 3EF1A 2NVYA 3GUCA 1SCIA 4KQ2A 3UAXA 1M34E 2FLPA 4TMYA 1S2IA 3FXAA 2GQ0A 3QHQA 1UAYA 3TDNA 1F12A 3W5CA 4N49A 3TW7A 3AEXA 5IBPA 5H3CA 2VCYA 3PR5B 3UOWA 3F5MA 5KFHA 3LCVB 4U02A 3A6LA 2Z04A 3D3WA 3IKTA 4O5AA 3M70A 4Q9JA 2WTEA 4A23A 2XRMA 1BDBA 1HFJA 4N5DA 2FPKA 3O2SB 3UAYA 5LBTA 1WX1A 2WUVA 4UHBA 3QPDA 4ZJUA 2R60A 3CH5A 3IDQA 3G5MA 4FZ5A 3EGCA 1KVUA 1PKXA 5DG7A 3BBLA 4C4OA 4ZKDA 1SUBA 3FZGA 1KS9A 3IQXA 4IDCA 1ELOA 1DARA 4FDLA 5E0KB 2ERYA 1YZLA 5LSAA 3EAGA 3PSHA 4LOKA 5JC8A 2BZSA 1SUSA 1QLHA 4YHHH 5EIFA 4QM6A 4JQYA 1FP4A 3DVLA 1LB1B 2W93A 4AY6A 3K32A 3VC7A 5CVJA 1V25A 3I5YA 1JEJA 4IRDA 3NNNA 2HX1A 4NCJA 4QGGA 4MS1A 5A5VA 2EKZA 4G97A 1JHUA 3WLAA 3QVLA 4NDNE 2WA2A 3AFIA 4KQMA 1TGVA 3QLEA 5K8CA 4KUGA 2YNMC 3W78A 1N36H 2FJ0A 2R1TA 5LNK6 1X74A 3ZDCA 4L75A 2H0AA 2OSBA 1XVUA 3CKKA 5PNTA 4GF5A 4U7WA 4YP6A 4NG5A 3OWOA 1VFPA 1IYZA 4ZGWA 2GSWA 4DLKA 5LDHA 3TQFA 1LI5A 3CNHA 4DLPA 3LIIA 2N3ZA 4MUHA 2IK8A 4CCSA 1UBLS 5TMBA 3UFXB 2BGGA 1IOLA 1JR4A 4LYEA 2F1OA 3SKXA 3HV2A 4CMEA 4BNFA 4D9BA 1OB5A 3CLVA 4BMVA 2R93A 4FZ3A 4F91B 5JDCA 4H3SA 2VUGA 1ZZGA 1Z75A 3FPHA 3EE6A 2CSUA 3W9YA 2CCKA 2JHPA 3H5AA 2ASDA 3H9JA 4BVKA 1B00A 4WVFA 3HBMA 4NEHB 3WA6A 3WYFA 4GKKB 5F9LA 3EQZA 3TUZC 1UP7A 2W42A 3UGTA 5IAOA 2C5LA 1GGEA 3GLSA 3CNNA 3OMWA 2HLNA 5EY5B 4BCCA 4F3KA 4PSKA 4OQ4A 3NWBA 2FFAA 1FFAA 1Z6PA 5T5QA 1UWCA 5REQB 2L82A 3BICA 2IU3A 1FMJA 4BY7G 1V5FA 3MLAA 3PDIB 3WNCA 4X62B 1JFTA 2PUVA 5ECGC 1EJ6A 3OTWA 1MMFB 1J2UA 3ZQUA 4YPFA 3PQ8A 1E4EB 1KEZA 3P9XA 2H07A 4HNTA 4BGDA 4B81A 3QEKA 1TCUA 2R2GA 3UK1A 4MWGA 3U09A 3SJUA 2O8FB 4W8OA 4UQLA 4FQ7A 4BV8A 3NI2A 2W8BB 3ANLA 4WBNF 4WX2B 4MYUA 3NWEA 2ZB3A 3HN2A 1JSRA 2ODTX 4DMMA 4QWEA 1O97C 1TC2A 3RU3A 3BK1A 1CP3A 1JDTA 1I6LA 3L7YA 1EM8B 3QF4A 2AJBA 1JEQA 2QUBA 3JU3A 3E9CA 4KMOA 1KJYA 2LRHA 1B8PA 1SEVA 3EQ6A 3ZY4A 1JBEA 2ZBVA 2IBTA 1DGQA 5B37A 3LX5A 3FWKA 3NLLA 4M1KA 1FRFS 1G291 4GXTA 4LJ5A 1YZVA 4U00A 1WNFA 1A8SA 1NXPA 2PL5A 1U9JA 1CJCA 5AW6A 1U9IC 1PJZA 3II6X 2JCBA 1T3LA 4CEHA 2AGQA 3A6FA 5LQAA 1G18A 1MX5A 1N34H 3Q2OA 5HNEA 3JR7A 3FG9A 2Z58A 3M2PA 2BGTA 1UPCA 2O05A 2ZYIA 4ZTBA 3CIOA 1B15A 2H1LA 4RZRA 3K30A 1NTOA 2P91A 4EA7A 4U63A 3KSAC 2IEAA 5DW0A 4L73A 2Q3JA 1WDLA 1EFVA 2AEFA 1W1UA 2P40A 4FLFA 1U65A 5AVXA 1VJCA 4KCGA 3VVBA 3AR5A 3PO3G 3KBBA 1GCIA 3G2JA 2ZRLA 3CR7A 2AZDA 1F2TB 5CLGA 2FN9A 5IT9W 4H1VA 2Q1UA 3AEQA 3MQFA 1A4UA 4F6RB 3WKDA 1COZA 1IEQA 2BFEB 1EHYA 4RMJA 1MHTA 4YP3A 4Q3LA 3CZ5A 3CHYA 2VJMA 2BBWA 3QFCA 1ONNA 2MMCA 3NHUA 2Y1DA 2WOOA 3KXKA 2WSLA 3GAFA 1IWOA 5I7FA 3EGVA 4U4AA 4DUYH 3GLFE 3HGTA 3R2JA 2Z4TA 4UEJA 2QPTA 1NULA 3TD2A 2KSQA 1HQDA 2ZBDA 3B5JA 2XMCA 1Z0AA 4A6XA 1KKUA 1YV9A 2FEWB 3IAHA 2OAEA 4O2LA 1UK6A 4YIKA 3OHSX 3G6YA 3QVOA 4YO7A 3TNDA 4RABA 3CMMA 4G36A 3U17A 3TTYA 4Q66C 3MFYA 1Q0LA 1SJ9A 1RLJA 1XA3A 4QJFA 2BZ1A 5I4CA 3EMVA 4PBRA 2CXSA 2ATXA 3FI0A 3W5AA 4JK3A 3WTCA 4OP2A 4CDMA 3KQKA 2DVMA 2X9VA 3RJ5A 2PFSA 5LQUA 1J9EA 5CB0A 4UUMA 3UCFA 3OSPA 2IHUA 4AKGA 3IEVA 1ESZA 1ZUWA 4O4HB 2D1QA 2V7PA 2VF7A 2LGJA 3IMKA 2ZJ7A 4D8WA 2O3RA 1VQ1A 3WNVA 1RQLA 1SQ6A 2WQ6A 1A0GA 2EHDA 2X5XA 5J3JA 2NO0A 4IBOA 1L5NA 3IA7A 2ZKLA 2GERA 2O0JA 1UBRS 1NMXA 3DW1X 4X97A 4DNFA 4EHFA 5AM2A 1Z56C 4Q0MA 4PLVA 3DDNA 5K8UA 1DOZA 3QX8A 4FJ0A 1XZGA 3IBFA 3E5NA 4AJ9A 5HCIA 3Q3VA 1GG9A 3TZQA 3RVLA 4C2TA 4CTJA 1KBLA 1X7DA 4RMNA 1JIHA 1WKCA 3IUBA 3H19A 3Q15C 3JQDA 4DDUA 2J4CA 1U5BB 2AOXA 2ZQYA 3H6GA 2ZAGA 5B1HA 4NNOA 4L4RA 1FNBA 1W30A 3UHJA 4Y6GB 2O5CA 2WTBA 3OKFA 1JIIA 1V5GA 5CYOA 2XV1A 1JG4A 2NPFA 1F0NA 4DT1A 5AW1A 3MRVA 2HA6A 5JWHA 1K8XB 1N57A 3HADA 4D5GA 3P27A 1KY2A 1G42A 3JAMW 3QLJA 3U49A 5DIZA 3D0QA 3TJZA 3K4PA 1JYSA 3EZ7A 2J8ZA 1IZZA 1JECA 4P2GA 4HUQB 3B51X 1XU4A 1KZGB 4G5YA 2PGLA 2YYAA 1JILA 4BL5A 4DMUB 3JS5A 1DDGA 1BVRA 3UZOA 1M33A 3AM4A 1B26A 4DR2H 2V0CA 5JYCA 2B63A 1PWZA 4OUDB 1FK8A 2X8JB 3A4MA 1PL0A 4BQFA 4C0BA 4NE2A 1BVHA 2ZTSA 4BX2A 4ZOCA 1UJMA 3MWJA 1M8GA 1SKAA 3KV1A 4J91A 3VC3A 5FFNA 5BYKA 1SQ0A 3HA5A 3T4UA 5BYAA 4DA7A 2MJLA 5K3CA 1LGYA 1ZVKA 2CQYA 4L28A 2VWQA 2JEJA 2PMKA 3AYZB 2GPTA 4D26A 3PX2A 3U7IA 3TLKA 1KIAA 1GY8A 5JTUA 3E0XA 3N74A 2COJA 3VZQA 2FZKA 2DWPA 3BF7A 5F5NA 3JSNA 1UKZA 3FCAA 3TAUA 1ZVVA 3SQNA 3RS4A 2PAFA 2ADOA 3RRBA 4TUYF 4QW8A 3EF3A 5ALTA 5EJIA 3FGOA 2ZGVA 4LS3A 3GD7A 3N6RA 3EXHB 3LAWA 4E6PA 5BN3B 2A9JA 5DPMA 4F96A 3V5NA 4N8SA 2P8JA 5E2AA 7MHTA 4LRTB 4RE5A 2YMLA 1IN5A 1X7GA 5FTNA 3PHJA 3UKJA 3VTKA 5REQA 3UMVA 3CBQA 1VA5A 4FDAA 3GLIE 3TKLA 6NULA 2IZZA 2FWPA 3D9QX 3HP7A 2FMFA 2D0OB 1FFCA 3PITA 1KTVA 1YKFA 5I7HA 5KFIA 1M1YA 1WPXA 2K6GA 2R9VA 4M88A 2O8FA 5I5VA 3AY6A 3DBLB 4XYMA 2KW5A 3PF8A 1XZPA 4C78A 5IYDG 3WOHA 1T9CA 1DJLA 1U2EA 4IILA 3T5GA 1TQDA 3QOWA 2GAOA 3BXPA 3GDFA 4PNZA 4F06A 1XXLA 2UYGA 1H94A 2A7XA 4KTVE 3SXPA 4XOIA 2WFZA 1KZ4A 1WEHA 4PYOA 1EM8A 2GPJA 6PFKA 2QAIA 2F1IA 2HF8A 2FGJA 4EI9A 2FQ1A 2ATIA 2EX1A 3DEHA 3H9GA 2V7XA 5E4JA 1A9ZA 3F49S 4GMKA 1URPA 2O2GA 4JV1A 2ZM6B 4KXUA 3TKAA 3NDBB 16PKA 4WOBA 4EY4A 2P90A 3Q3CA 1H23A 1UF9A 2FV8A 5KT5A 4ZD6A 4IZ6A 3KZXA 2ZIWB 5JASA 4LF8B 4KUEA 1IEXA 1W2WB 3CRW1 3DTYA 2W9CB 5F2OA 1TW3A 3QU4A 2P78A 3DAAA 5LOVF 2IPXA 3M5PA 4QU8A 2C20A 4RD0A 3Q7QA 1KNXA 3CPSA 2PEZA 5ALYA 4PZ7A 4BZWA 2QVYX 4XPZA 4LXXA 3L6DA 3IYLW 1EJ0A 3AIKA 3L7CA 3EZ9A 1D9ZA 4B3JA 4PCUA 3NHRA 4RQBA 3LQQA 1SBHA 4HH4A 1QB7A 1XL1A 3TIGA 3PVSA 5KWIA 4HATA 1MPXA 1AUOA 2VJCA 4RIEA 3P45A 2O7QA 2C84A 1UDBA 2J9YB 4HR7A 5KWVA 1YHNA 4QGFA 2C77A 5GMOA 3DBRA 3TQTA 4GYJA 4BVAA 1DQPA 3IDSA 3QIAA 2JCVA 1ZZEA 4DL9A 1ZC4A 3GEDA 5AUQA 2JZCA 2OO5A 1GNQA 3CUKA 3Q11A 5CE8A 1NUSA 5CHYA 2MSWA 2RGDA 5LN1A 4U5XA 2R44A 3QBDA 1AGRA 4RCZA 5LD2C 3TWOA 1MKYA 4V0MA 4RF2A 1BA3A 1W4LA 2ONJA 1QP7A 2VYNA 1QV6A 2AN9A 1D7AA 2VF4X 3GA7A 4WECA 2R8GA 2WJYA 1MPTA 4UCFA 4UVDA 2ZJ8A 1N1EA 5D1HA 1U6KA 2H2AA 2OVBA 5D6NA 4QVIA 3PO2G 4KREA 1MVLA 5AKGA 4JZYA 4ZT7A 3B7WA 5BV2P 1QYWA 4MWBA 4F92B 3UANA 3SVTA 4FT2A 4LQCA 3MYYA 4B6GA 2ZIFA 2L19A 2FSVA 2O2SA 2WPNA 4UHFA 2RG1A 4FGSA 5ICFA 1AKWA 3WB1A 1YJQA 4Q9NA 2DSNA 1YI0A 3ZV4A 4CM4B 2DBYA 3MMPA 3CURA 4Q02A 3GDHA 1GQYA 2XGMA 1NDUA 3TIVA 4GEKA 4JLBA 621PA 1HL3A 2I7TA 2DUJA 3H7IA 3I1JA 1CYEA 1FF9A 3K0AA 1IN4A 3VR5H 1X8LA 4BLSA 3CZCA 4JBWA 2V3CC 3M4XA 3WLJA 5B3JA 4OI2A 3SYKA 2HCBA 1R0YA 1VLVA 1P73A 4O4HA 4FCWA 5LQRA 1GADO 3V1KA 1YC2A 1ZESA 1V7QA 5ALLA 4MVCA 3WX0A 4TLDA 4R40A 1GRCA 2VSNA 1AG9A 3UNXA 2OV3A 4ND8B 2D06A 3P4YA 3D1VA 2J07A 4QU0A 3MT7A 1CZRA 2JEOA 5DLGA 1M75A 1QH8B 2GCGA 4FFPA 2GRUA 5JW6A 3DL4A 1WRBA 4CG0A 2G83A 5DEOA 3AL2A 2P5TB 1DPGA 2ONKA 1E4YA 4N6OA 4WESB 5K2OA 4IJWA 3V2IA 3SQLA 4F4ZA 4LDJA 1FFWA 4GM4A 4DABA 4G9EA 3WBKA 4CCAA 1UEXC 3LRPA 1P4AA 2O7VA 3E1SA 2I1QA 3MVEA 2QROA 1HFEL 4GVPA 1B6SA 4MIYA 4MKGA 3PIRA 4YGYA 1A7KA 3C74A 4L9WA 3VX3A 4KLCA 2N9UA 4R3WA 1QIMA 4QE3A 3QPCA 2VIIA 4UXHA 1MV5A 3R7BA 3QPVA 2W2KB 1V5EA 5G02A 4GZ3A 2O8DB 1I9CA 2OCPA 5CDTA 4Y67A 4AF6A 4ZOLA 2IU0A 1B8VA 3FF4A 1T24A 4ECUA 5K0JA 1AMUA 5LYYA 4NG4A 1PRYA 1UBUS 2A1TR 1AKVA 5BQ5A 1GPLA 3N6XA 4A7PA 1XLWA 1A7AA 3MGGA 1N2HA 3ZHVA 3GBPA 3RWBA 1G6OA 4JEIA 1I4EB 4B45A 4YS6A 3W90A 4GP7A 4DRFA 2ZRQA 3DT6A 1MTZA 1LC0A 1O03A 1GNTA 5BQOA 2RGVA 1G16A 2EL9A 4OUDA 3RG8A 2GCNA 3RSOA 3QY0A 4LK2A 1P0PA 2Y1WA 4W1RA 1VBGA 5KVAA 2QVGA 3CSUA 3BVPA 1K6EA 4EYSA 4CIVA 1EI9A 2XBLA 4GGPA 2IBMA 5B6JA 3RGXA 4OX9H 2XTZA 4U0JA 1EFRA 1O5OA 5C7OO 4Q03A 4OQFA 4DCJA 2JA6G 4D57A 4QPNA 5EIWA 2XUAA 3H6HA 2JAQA 2WM9B 4G8DA 2EX4A 3KQVA 2RAUA 3EW7A 4LCBA 4EJFA 3GOQA 3M0EA 3A9CA 1XL0A 3W5OA 2GD2A 2HU8A 2IT1A 1Y8QB 3TQQA 3VO8A 2FOXA 1Z88A 2YW2A 3RC9A 2JATA 4M7PA 3E7DA 1N7GA 2HXSA 1W52X 2IQ5A 3Q7PA 1IVYA 3SBXA 4J6EA 4F0JA 1FFYA 1KIMA 4ZVNA 1BDMA 4QLAA 1N6PA 1YD7A 1E92A 1T9GR 5H59A 4G56A 5T67A 2DFDA 4DA4A 1JPJA 2C5EA 4EUFA 5EIBC 4ZU6X 3NDJA 4LRQA 5EIHA 1UEJA 4ZQIA 5CR5A 1T0UA 3RKUA 4NHEA 3Q8SB 4GR9A 4M0MA 1E3MA 3PUVA 3EBOA 3BJMA 1E7SA 1JRLA 4U6SA 4UU7A 3RANA 5K0CA 5L95A 5COAA 4RA6B 5FWDA 2CL6X 1MV8A 3DYVA 2BP7A 2A78A 2D13A 4EPXA 4ALIA 1ZWLA 3KX2A 4N5NA 5JSQA 2WWIA 5AHOA 1SC6A 2SECE 3NR2A 4EJ6A 1E2QA 3MF4A 1KZ7B 1TCBA 4QO7A 5H80A 5A06A 3IP1A 2QYOA 4D42A 1JW9B 4WXEA 2H18A 3H20A 3KQPA 2O52A 3OY7A 1K4MA 3QU2A 1KXZA 2YWGA 1JLSA 2ZYUX 1NJ1A 2BTOA 1X1EA 3C16C 4V02A 4IJUA 4XDGA 3TSYA 3NVKI 1RWNA 1M5RA 4PZ8A 4PN3A 5K3DA 3I04A 5CT4A 4RZHA 5KT2A 2GVDC 3OLQA 2BSQA 1U90A 3OUUA 1SCUA 4DAAA 1JTFA 4V03A 4QT4A 3UAOA 2XXAA 1IHPA 2XNHA 4AL4A 4R05A 4QJ5A 4PBSA 1WZIA 2FMTA 4R1LA 2IYNA 3ZEIA 4NI5A 3P9RA 4EF6A 3GDWA 5DISB 4MEBA 5KWJA 1AK9A 4R8VA 4EBEA 2E6UX 4AWBA 1IUKA 3ITKA 4LF4H 4YCSA 2AXQA 1C3JA 1NR7A 2F7SA 2W9CA 3HI4A 2IKQA 5F9FA 3G2LA 4XPIA 4OO3A 1Q91A 5ER6A 2PMDA 4K26A 4QDOA 5EWJA 4J03A 3QQPA 2GZ2A 2M05A 3ZZ0A 1UIRA 3WGOA 4UEQA 3CYFA 2IDJA 2VYND 2EEZA 3BM5A 4G8CA 3KP1A 1I3OA 1QSGA 4ZYYA 3D4BA 1AIPA 2Z08A 2GOYA 2X8BA 1OZFA 3NHYA 3KVVA 1G7SA 4N0EA 4NC9A 1JFVA 3P9YA 3D31A 3JALA 5KNBH 3UWDA 4YJHB 1DQRA 4MGKR 3UVEA 3W9SA 5LYJA 3LF1A 2RSLA 2KMLA 1F17A 3FTQA 3IXQA 1Z25A 5FTLA 4HLQB 1FU4A 1J8MF 1PZXA 2BH2A 4KXYA 3CSDA 4Y6RA 1U0EA 2JFWA 3CH6A 4ZC1A 4IMIB 1XRPA 2QE7A 1Z82A 1ADCA 2VH1A 4A8JC 2XQFA 1W96A 5TARA 1X87A 4XSGA 5A05A 5GWXA 2V54A 4X3CA 4PX5A 4TZKA 4CKBA 1NPYA 5PGMA 2Q3LA 4CIAA 2AB0A 4F56A 4N39A 4HH3C 5JAMA 2FWIA 2PR2A 1RM4A 4Y1RA 5C53B 2YXEA 2GTHA 3H2JA 1NQWA 1YR1A 3PQFA 4FOPA 3NTRA 1FJXA 2UKDA 4UNRA 1WSAA 2EWWA 4P5EA 3TIIA 3F4LA 4J9RA 1IBKH 4F97A 4QHSA 4OFBA 1PZNA 4NMLA 1RWWA 4I8DA 3ZY5A 3HFGA 1IZYA 1KAOA 4LFAH 3WGUA 2PE5A 4KWIA 5LQDA 4EIWA 2PRZA 1IAQA 1A8HA 4S1WA 5BT8A 4A2AA 5K3FA 5T4EA 1I94B 2OB1A 1SKBA 4ZMRA 2EZTA 5JPDA 1L7OA 1F2UA 3ELDA 2E2IA 3KEMA 3QXGA 4G6ZA 2YUIA 4BJ5A 5B7NA 1TO2E 4R81A 1B6TA 3GR6A 1BA2A 3UAGA 3LXXA 3LCUA 5L6LB 4TVBA 3WFJA 1MNQA 1XZ8A 3JWIA 2EATA 1QDUA 5JJLA 1NYLA 2QP4A 4CDRA 1OXBB 2P9BA 4LXQA 2FPIB 4POOA 4M8LA 5C7YA 4KFUA 3ZU5A 3BFJA 1DU4A 2IYZA 3C6BA 3VZDA 4KXQA 4Z3KA 2GFIA 1RLUA 2OBFA 3PEWA 4XQEA 2OOSA 3AUTA 4E1BA 5JYBA 3MINA 1BS9A 1G21E 5JEEA 1DC8A 3THWB 3K3PA 3KKZA 5KQPA 2FK1A 2FR0A 1FTNA 5IVKA 1M8JA 3JAWB 1YOVB 3R6DA 4JJAA 2BD0A 4DJAA 2IWHA 1EE1A 1ENYA 5TVKA 1R0ZA 1XJWA 4X00A 1VG0B 3T7AA 5K6TA 1EP1B 1OYYA 1C4WA 3B85A 1B23P 5EMLA 1VCOA 1L4GA 4ECRA 1DHRA 5DLEA 3Q8XB 5FLEX 1FNSA 4R7RA 3H1FA 1B76A 4DIBA 3ZU4A 1T6ZA 3UGKA 5HOQA 3SBOA 3G2NA 1EFRD 2ZTVA 3JZMA 3G9XA 5D1NA 4CMEC 2XX3A 1O3YA 3DAYA 4Y9UA 1IPHA 1L9XA 2W2KA 3HCPA 5CDYA 1OWPA 3T4PA 3D3WB 2IDMA 4IDBA 4FDUA 3UJ8A 4G4SO 1GGKA 4D4HA 2P7IA 1HKUA 3CKMA 5A5EA 2PT9A 1GZVA 3FCUB 4I5FA 4EFBA 1RWPA 1CUVA 4OB6A 1TLLA 4YP9A 1XRMA 4OKNA 1T3GA 2PGNA 2MINA 1K66A 1VPTA 5C52B 3PXXA 5BSHA 4ZQFA 3BULA 4RIIA 4I3GA 3RNLA 3OTOH 1IXKA 4KPYA 3OC6A 2HQSA 5BUSA 1X7HA 1YHYA 1HZJA 1UDRA 2J6TA 1STOA 4QHYA 1FP4B 2VPXA 1QIKA 1WVMA 4RETA 3L07A 2PX0A 4BBSG 1PI3A 4JA2A 3QBEA 4HYKA 3ZDDA 4R8UA 3LH5A 3G9UA 1H4SA 3EN0A 2Y1LA 1J8FA 2CZCA 4MS1B 3VH2A 1N1MA 1UJ6A 2WRZA 2C95A 1W4BA 4LMBA 4D3FA 1SEIA 1GITA 1K7SN 4XE5A 2GWRA 2GEKA 3EVAA 2LUOA 2R1TB 3AI3A 4ZAYA 5KFJA 4UHHA 3NALA 2BMFA 4EJ0A 5M3BA 1U3WA 1Z3CA 3ZCSA 4R3NA 3ODPA 5EIXA 3L2OB 1DIHA 2I66A 5L4LA 4ENPA 2Z30A 2IYAA 2GZ1A 3A7EA 2V4UA 3W1EA 2ATEA 2Y3IA 2C31A 3WLSA 2OG1A 3JQGA 1TWCA 1CB0A 2Y05A 3L43A 1RHRA 3EUEA 3WLEA 1S01A 1U2ZA 1S8NA 1E2DA 3AH8A 4RSRA 2O2YA 5BMVA 1XQWA 2XA9A 3B52X 5JAIA 3HYCA 3ER9A 4WINA 3R8FA 4CMGA 4HX2A 2I3GA 4CEJA 4L0QA 4XD2A 3GT0A 5IAEA 5EKUA 3LZDA 2B78A 2CUNA 3H0EA 4JY7A 3GZTB 3OBIA 3V4LA 2FFJA 1BE8A 1RJDA 3BUSA 3AZPA 1ETUA 3DBIA 1DHTA 4Z7JA 1N4DA 3AKZA 2DR0A 2QU8A 2FKLA 5U4XA 1AUQA 5FBLB 5T41A 1X15A 5CFZA 5A6SA 2W2NA 1QOQB 1T8SA 1TB4A 2GLXA 3IUQA 1TWHA 1N25A 5FBHA 3C41J 2N1BA 1Q3KA 1PGQA 4DV3H 2B1GA 1PT9A 1KVTA 3VR6H 4BMSA 1G20E 4AWAA 2IE8A 4EA6A 2FHPA 1VL6A 5AI4A 3IP9A 2FZEA 3PD0A 1X9NA 5AW9A 4MA4A 3DNMA 4AYTA 2V9CA 2X42A 2G8NA 3QPWA 1E8NA 2QSJA 2R8KA 3SJZA 2R6ZA 3L46A 3E70C 1ONPA 1LJUA 4NU6A 3RHZA 2V45A 4DC9A 4MINA 3E3OA 3QF4B 3D2LA 4PZEA 2QE7D 2O2EA 1KKLA 4HRXA 1C2TA 4I3HA 4TWIA 4UU8A 3L8EA 4LE0A 4FFOA 4R2JA 5ICEA 1PD1A 3JSLA 4OGLA 2K7ZA 2B5VA 1CZHA 4RHEA 1T2UA 1DKNA 4MDHA 1VMAA 5HTOA 2P2NA 3GU3A 1T8PA 3PUHA 3QMWA 2RH4A 3ZVLA 1D2CA 1MOSA 3JQFA 1RCTE 3MWLA 3I61A 5LMNB 4NARA 1QFSA 3VOSA 1XVAA 4ARVA 1RT9A 1GU0A 3PNBA 4ODIA 2OWDA 3MZ0A 1L4UA 4CZ2A 4CEHB 3PRHA 1FRQA 4DQNA 1XQXA 3OIGA 4U6QA 3T6KA 1HYBA 3LT1A 3DVAB 4JUFA 4RBNA 3ZDXB 1CEYA 4EKGA 5KS8A 1WDKA 3CIFA 2R0QC 4AN4A 2FSIA 1FPMA 3JWHA 4N3BA 4GWLA 5CHEA 5LIPA 2GHRA 1M74A 2VT6A 1YZQA 4P81A 2P30A 2AG8A 2DBZA 1OIWA 1HNZH 3RVJA 1E5LA 3GLUA 1EFVB 2XDQA 2LNDA 4L9SA 1QH1A 1ZSVA 3LPCA 1JFLA 2IYEA 3K1TA 3MJEA 1W4RA 2PGDA 2Y1KA 1TAQA 3AR4A 2X2PA 2I62A 4KIUA 3ZI4A 3Q3IA 4B74A 3RTAA 1N2XA 5JLJA 1ORHA 3DNPA 3AEQB 2XT6A 1XFDA 3KTFA 5D3QA 4LY0A 4H3VA 5FPHA 2BQRA 2VJMB 2I6SA 4DB2A 1M6VB 2YIJA 4JODA 3NAQA 3BGVA 1DX6A 2P2YA 3UMFA 3B9QA 1O58A 1XDDA 4DR7B 1RJ9A 2CUZA 1ZJWA 4BNLA 4K9RA 2UXBB 1U7HA 3RE1A 3TLBA 3LM8A 1UC4B 4PYRA 3RHTA 4CRWB 1VJRA 2FYTA 2N75A 5A5FA 5JT1A 1O0BA 2ZBRA 4HGRA 2HLHA 2PK3A 4YCDA 1RR6A 1I7LA 4QLOA 1Y4ZA 4EEQA 4KI7A 3H83A 4ECVA 1XKQA 2C4MA 4C7VA 5FPRA 2JS7A 1MAVA 2QA5A 3KKPA 2PN1A 2KM1A 1FTGA 4EMSA 4JT2A 1R9MA 1DCFA 3ZW7A 4ZO9A 3BQNB 2CNDA 4BTVA 2CDRA 3DJYA 3LY9A 4BFZA 1XN1A 5IN5A 3RRJA 5KFZA 2YYZA 3K8ZA 1K89A 4PCVA 4DSOA 2HCJB 2K87A 1DXQA 4XVQA 1G4UR 1MF7A 3FCCA 1P1FA 2BUBA 1QZUA 5IZCA 2DUNA 3NYQA 4DBLE 2ZWAA 4IJQA 4DLUA 1U8FO 2BRUC 2X23A 3IDFA 5TEWA 1OI3A 4C0SA 1EMDA 2P41A 4LF5H 5KNCH 1GSHA 3QVWA 4RACA 2QDXA 5E3IA 4EGCB 3INGA 4Z54A 4OB7A 3IPRA 3V1YA 3F4KA 2FPOA 1Y1QA 4UUPA 1WHSA 5AJUA 5GZ1A 3IPCA 4QODA 5EKSA 2P77A 4KWEA 2VH2A 1NXWA 3GRRA 2Q2NA 1PV4A 1S96A 1BNCA 2GBCA 1F6BA 5HZKA 3AK4A 1XYVA 1PFQA 4K6MA 4LISA 1GUFA 5LKRA 4WXRA 4DT1B 5DBOA 3H5VA 3UJNA 2IXDA 2Q27A 4M1QA 1OA1A 5AM5A 4L78A 1CZLA 5IDVA 4J9UE 3QUCA 1C14A 4XLLA 4LHSA 4ZN6A 2GO1A 2NSLA 3S8YA 1T2NA 3L8HA 1SIUA 4HXEB 3ORRA 3QU5A 4NBWA 3GT7A 4Y6OA 5B3LA 2Y66A 4IGEA 4IWNA 3V48A 1GNLA 1VL8A 2O0KA 3N44B 2RARA 3EISA 2BGKA 1LNSA 4LRUA 2JHFA 2X3UA 3QU9A 4JI6H 1EP3B 2EKBA 5H3LA 3WLQA 3HUFA 1Y1VA 3B70A 4KN6A 2WHPA 3G6VA 3GJ8A 4O4IB 3UT0A 3KKMA 4KVZA 4P4NA 2PYZA 3KQUA 2FXVA 5DHSA 3SYTA 2C8VA 5A7FA 1GGOA 3ND5A 3KYCA 1GRVA 1VYUA 4W5WA 2E4WA 5JZBA 3FN4A 4YRFA 1S2MA 4A73A 1KMNA 1E6KA 3BJYA 2I03A 4P31A 5IN4A 2C1ZA 4BVHA 2W83A 2PL9A 2HHHH 1YK1A 3EVTA 1JEOA 1FDRA 2LDBA 4KR0A 1S4QA 2GFHA 4BVFA 3FUVA 1V9SA 5ALQA 2GA9A 4F5DA 4ZT5A 1PZEA 2O4UX 4MTDA 3R3VA 2R7NA 2B2XA 4U3JA 1EX6A 1V51A 4C6RA 1G1MA 1GA4A 4D8UA 1BHSA 4JBHA 3TFOA 5H9WA 1T36A 4M36A 1KAGA 4QQKA 4YJGA 1R5JA 2JKZA 3IBTA 1RHQA 1Y1KE 2C4UA 3KKKA 5DLQC 4E6EA 2P1DA 4KHZA 4BNTA 4QQ8A 4MQMA 1E20A 5JNRA 5CYFA 4RDCA 5NLLA 1EDEA 1Z18A 1CY1A 2W48A 3FAZA 5CM8B 3HQ4O 5K4GA 3WMXA 1JJAA 5HHTA 3RVPA 3C8ZA 2F6RA 5KAPA 5JJBA 3B38A 2C2RA 3F8NA 2BELA 5LQNA 4LQDA 4QJ4A 1M1YB 4KR6A 2O0LA 4NOLA 4E11A 1UJBA 2O7NA 2C3UA 2RG7A 2NVUA 4C3ZA 5IANA 4G5QA 3IUPA 4Q12A 3Q7SA 4XYMB 2I6FA 3UUWA 4BWYA 1T1RA 4KAXA 3H0GG 3G0IA 4RF3A 3ETDA 1F48A 3PVZA 4I1PA 4IDFA 2JBWA 3RFVA 3OM0A 2I7VA 4AY2A 5CK4A 2OO5C 4NECA 2VJLA 1OWLA 4L27A 3TSZA 4AG3A 3MJ4A 2DUUA 4CHTA 4ZJYA 5G4LA 2AXPA 2YFHA 1MBZA 4OHOA 4TM8A 2EQ5A 4HG2A 3GJXB 1VLQA 4GPIB 1G2PA 4CETA 2CCGA 1J42A 4ENVA 4IH1A 1JQBA 5IUNC 4CL8A 2WM8A 1SVMA 1EP9A 4IEFB 1Y14B 3FTNA 4NOKA 2CNNA 1KOGA 1T1IA 3IIIA 4AP6A 1SBZA 2AMFA 4D6YA 1BRMA 1I10A 5BVGA 2FSVC 5JSYA 1LLCA 2UAGA 4LJRA 1N7HA 4XVRA 4IRUB 2VYQA 9MHTA 2NUPA 2ZT5A 4MWCA 1Y81A 3LK6A 1BH2A 4AK9A 3GLHE 1KZ9A 3Q72A 4EGQA 4BTEA 3SNHA 3S27A 3IH5A 1RWXA 4B6RA 4NL4H 4RTRA 4KJXA 1MU0A 4C3UA 1OV6A 2GQRA 3DFUA 3HO6A 3DVAA 3S44A 1W34A 5ICGA 4R9SA 3ASVA 4WWHA 3TTTA 1WJGA 2EP7A 4ER5A 3U7GA 5F9NA 4MV7A 2GM9A 4J2HA 3IAM6 4HRAA 4CQNA 4H3HB 5DV9A 4TS4A 4HPJB 5I5TA 2ZRAA 4TRNA 4AB1A 3IOEA 2F8MA 5FXMA 2J08A 5GZ3A 1DCMA 2KLBA 1WBBA 4JVOA 1WM1A 1HLFA 4YRCA 3ENKA 1H0KA 3NDIA 4DV7B 3KHRA 1ISJA 1CQIA 3DBRB 3V4OA 5F9MA 2AJLI 1N3BA 2C4WA 2PZLA 3JZAA 1JQAA 1FSPA 2JA8G 4FFBA 2PX6A 4TLCA 3LFHA 3QZUA 5DBIA 5TQVA 4PYJA 3PC4A 3FHTA 3T34A 3IKMB 2HA4A 1M6VA 2ECFA 5ESRA 1SAYA 5KU1A 2V6IA 2V4MA 4A03A 4EX6A 1E6WA 1RM3A 1SXJE 5DHQA 1SVKA 3KU1A 3K09C 2GNAA 1C1XA 3AW8A 3PQ6A 5DFAA 3WLIA 4M83A 4PTLA 1EKFA 3NIDB 1MVOA 3H6KA 2WR8A 4FXPA 4PYIA 4D8XA 4B3SH 2QD5A 4UU1A 1ZSNA 2NNWB 4OYYA 4U8GA 4GNRA 3KS9A 3M82A 3DF7A 4RHTA 3V8QA 4F7DA 3KAJA 3EG5A 3WK7A 1VLLA 2R8IA 3OCCA 4Y2JA 3CZ9A 1T8RA 1Z4QA 2DR2A 3FTPA 3M9OB 2IEDA 2QLBA 3VKUA 1LQTA 2MYUA 3J80A 5B4TA 2HA2A 2CMKA 3ILVA 5J5AA 4YXFA 1YA4A 2Y0CA 3K0AB 2WIBA 3HDHA 2Y68A 2XRFA 5AVQA 2PLFA 2E1RA 3R5TA 3HCAA 3TM5A 4KYIB 3E9QA 4KXMA 2XGQA 2HMSA 5K0ZA 2COGA 3ASZA 3CJTA 4TXMA 4R0VA 3A32A 3Q9UA 4EFDA 4HMQA 3WWHA 4MLDA 2IP1A 3W1WA 1OQAA 4TTVA 2Z98A 5H82A 4R0MA 2X9NA 4ESEA 2CJXA 1KE1A 2RHTA 1LTQA