4MA0A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with partially hydrolysed atp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
366
structure length
366
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with partially hydrolysed ATP
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 120
structure length 366
sequence length 366
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma0A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma0A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma0A01
1B6SA 3R9RA 5K2MA 3U54A 1KC7A 2PBZA 5EZYF 2XD4A 1GSAA 4MAMA 2NU8B 3Q2OA 2ZDHA 1DV1A 4MV3A 4EABA 3N8DA 2YYAA 3R5FA 1CE8A 4O2BF 3BG5A 5C1OA 4M99A 2FB9A 2R85A 1I7NA 4MV1A 4MA5A 4EA7A 4O7RA 2W6OA 3JZFA 2W6QA 4HNTA 5CA0F 2R7LA 4O7WA 1W96A 3SE7A 2R84A 4FGRA 2SCUB 3VOTA 1M6VA 5JVDF 2CNUA 3GIDA 3Q1KA 2YS6A 1UC8A 4TV8F 4QSHA 2Z04A 4O83A 3R5HA 3N6RA 4IZOA 5KX5F 1EUDB 1GSOA 5IYZF 4WD3A 1EYZA 4YB8B 5LA6F 4C5CA 5C8YF 3VPDA 2GPWA 1C3OA 4FFRA 4WBNF 2YS7A 2X0SA 3MJFA 3BSYA 4FFPA 4XX0B 2R7NA 3KALA 1E4EA 4YBZB 3R23A 3OUZA 3R5XA 4O4HF 4ZI7F 3MWEA 2FP4B 3UFXB 1ULZA 1A9XA 4IWYA 1AUXA 2P0AA 4L1KA 3OUUA 1JDEA 2V58A 3RUPA 3WO1A 4EA9A 2YL2A 3BSSA 3V4ZA 1DV2A 2I87A 4DLKA 2QK4A 5BMVF 2YZLA 4O2AF 1VBHA 3K3PA 2NU6B 2DIKA 4O7VA 4YJ2F 4I55F 3K5HA 4YAJB 5LYJF 1KEEA 2J9GA 4FFOA 1AUVA 2HJWA 3AX6A 2YW2A 2IP4A 5CAEB 2I80A 2FPGB 1KJJA 2PVPA 1JKJB 4J6EA 5JH7F 2PN1A 4MV7A 2W70A 1T36A 4HNVA 2FPIB 1W93A 4FFLA 5DMXA 3TIGA 4O84A 2YWVA 2DWCA 3U55A 5KKNB 1UC9A 3HB9A 2R82A 1GGOA 1Z2NX 4HR7A 2R87A 1CS0A 1KUTA 3AW8A 3G8CA 5JQWA 2NPOA 4YJ3F 2NUAB 3BSWA 3KAKA 2W6NA 4MV4A 3JZIA 3ORRA 1A48A 2VPQA 5C1PA 3K5IA 1EZ1A 5JVLA 1Z2PX 4M9UA 2V5AA 5J2TF 3MWDA 4C5BA 4FU0A 2W6ZA 1JLLB 3QFFA 4XZ3B 1M0TA 4MV9A 1IOWA 4RZQA 1PX2A 4O4JF 4GGMX 4YAKB 2VHEA 2YRXA 2WYOA 3U9TA 4ME6A 1BNCA 3TQTA 3TIIA 3V4SA 2ZDGA 2YZGA 2VQDA 1OBDA 1WR2A 1KJ9A 4EG0A 1DIKA 2R7KA 4O4LF 3I12A 3ETHA 4TV9F 4ZHQF 3KREA 5J2UF 2C00A 4XYLB 1SCUB 4IHJF 1GSHA 2R6FA 1BXRA 3LWBA 4O86A 1B6RA 2XCLA 4EA8A 4O7ZA 1KJQA 4DIMA 3GLKA 2HGSA 5CB4F 2FPPB 4FFMA 2OLSA 1Z2OX 1E4EB 5I47A 3G8DA 2CNVA 4O7TA 3VA7A 1VBGA 4M9CA 3LP8A 4EGQA 4MV6A 2DZDA 5LXTF 2YRWA 2CZGA 3HO8A 4M98A 5D8DA 3U9SA 4MV8A 2ZDQA 3ETJA 1IOVA 3HBLA 4O7SA 4E4TA 2VR1A 1C30A 1EHIA 3JRWA 3TW6A 3RFCA 3TINA 5GONF 1PK8A 4HNUA 2CNQA 1CQJB 1EUCB 4TUYF 1GLVA 3VPBA 1JDBB 2NU7B 4O4IF 3RV3A 2W6PA 4IIJF 1VKZA 2NU9B 2W71A 1OBGA 5HBRB 3VMMA 4I4TF 4O7YA 1KJIA 3ORQA 2R86A 1M0WA 4ZQIA 5LOVF 3KAJA 3BFPA 2YZMA 3VPCA 2GQSA 4EAAA 4FE2A 2I8CA 4EGJA 1KJ8A 5FNVF 3NUAA 2Z02A 1KBLA 4FFNA 4I50F 5JQGF 3RV4A 3WNZA 2CQYA 4Y8VB 4ZOLF 4HQ6A 4O7NA 4C5AA 2GQRA 5CA1F 2GPSA 3DF7A 3WO0A 3E5NA 5H80A 5BPHA 4O82A 4NYEA 5HV6A 4IWXA 5LP6F 4O7LA 2DLNA 2V59A 4XYMB 1CQIB 2W6MA 2GLTA 5BPFA 4O81A 2YZNA 3JRXA 4MA0A 2QF7A 1I7LA 2R7MA
chains in the Genus database with same CATH superfamily
5TS2A 3CMMA 1R9MA 2OLKA 4OH1A 2RD2A 2HHAA 2OV1A 2ZUUA 4DL7A 4HVLA 5KNBH 2ZDHA 1X0VA 1IPHA 1OGJA 1N0WA 3ZU6A 4K2HA 2CFOA 4HD8A 3RJ0A 3UBTA 5C32A 3IAM1 1XU4A 3AEKB 1XEXA 1Z6PA 2XKJE 3X1KA 5JAIA 3MT8A 1M2OA 4I1SA 4M0JA 2JA2A 4JKOA 5AK5A 3GMDA 4DXHA 1RYEA 4N8EA 4ZALA 1TVKB 2W93A 5KCZA 1AHNA 3NANA 1XAJA 2AG5A 4LF9B 3I2FA 3ZDEA 1DKUA 2X0DA 4HN4B 4HNHA 4FW8A 1X70A 1P5ZB 2WD7A 3WIBA 4K1XA 4LF6H 4JLVA 1TJ5A 3LW8A 4LJSA 5T6MA 4ECSA 4JI0H 4YBRA 1BE1A 1GUZA 3OG9A 2Y0SE 1D7AA 3D4PA 4W5NA 2CL6X 1BVRA 5DSXA 2WNHA 4LMAA 1BDIA 1I1OA 1YWGO 2LIPA 3LIPA 1B43A 3NHMA 4EHLA 1UFKA 1JW9B 5CFOA 3PW4A 4TVBA 1FW6A 1JE0A 2L82A 3DFZA 4TMZA 2EAUA 4RTOA 3IOBA 3TKYA 3GRZA 4F3NA 1VSTA 2PMBA 1TJPB 1W2WB 3GCWA 1XQXA 5GJVC 4KIUA 2PJRA 4PG5A 1Y1WG 1YD7A 4QDKA 5A0TA 3IS3A 1GQQA 1TMKA 3GIIA 3ISJA 1Z2CA 4TRJA 5A9TA 2P0EA 2NQTA 1UJBA 2R92G 4KHPB 1OJ7A 1ZH6A 2UXCB 4BL5A 3IE0A 3REGA 1R4MB 3BMNB 3K6KA 2HSGA 3O3OB 2C8KA 3RIMA 2HRCA 4EYEA 3O8OA 4Q21A 3HN2A 3NFYA 2HRBA 4Q3AA 3Q12A 3KVVA 4UVGA 3CNEA 1DELA 2BEWA 4BMNA 2DFVA 2X6RA 1V7PC 4FXOA 1WVGA 2VPQA 2E87A 4HWRA 4FBGA 3I5XA 1A71A 4EG8A 3ITKA 2VQ3A 2PMDA 2CSXA 5CX1A 2BHTA 3Q2KA 3RSZA 3PJDA 1E3MA 3HSKA 2WKWA 1IB0A 3KYDA 5BYKA 5LP6A 4NZMA 4M8KA 3OQOA 1N9ZA 2I7VA 5IBCA 1GADO 2PKRA 1DEOA 5KNDD 3R7BA 3EPLA 5AVSA 1T6YA 1GL6A 1W581 5BV2P 3OCJA 3DGFC 1GTVA 1OWOA 3ZD6A 4OHYA 3A6GA 3KYJB 1YRQA 1IN4A 2F9MA 4C2TA 3AHFA 1KXJA 4NS4A 1XK5A 4KBYA 3QOFA 2PR2A 2PH7A 4ZC1A 1PNTA 2FPXA 3S55A 1GTZA 3CRMA 5DTJA 4KN9S 2VNIA 3LQ2A 4GG1A 3CVXA 3FMGA 4ECXA 2XOEA 3PF9A 4KOEC 3ETJA 5BR8H 5DW3A 4D97A 4GKKB 5EWEA 2ANBA 3VHLB 1IRXA 1HE5A 3TD6A 1U5BB 3TL3A 3QUQA 2OV3A 4WZBA 3H1TA 3KSMA 4UARA 4HH4A 3FHOA 5CX4A 1FQWA 2YV1A 4FFSA 2Q9CA 4FJ0A 4NOLA 4M49A 2B2NA 2PS1A 4LQDA 1VJ0A 1PN3A 1TFUA 4MUIA 5CLQA 2NYAA 3DFKA 1I2KA 2VBIA 2PEZA 4D9EA 1LLQA 3ROKA 2H3EA 3E15A 5G4LA 2QM7A 3GQBA 4I9NA 5K0BA 1BMFD 2Q3DA 1ORTA 4DDHA 2AVNA 1SUFA 2PZ8A 2D3WA 5LA6B 2XQFA 3C3BA 5CBPA 4BFLA 4HDSA 3FOZA 2JA1A 1RCTE 1Y8RB 1PWHA 4KXQA 2ODAA 4BLQA 1HM5A 4UEJA 2HRZA 5BWVA 2JHCA 5I9BA 4CNBA 2JFXA 4L5CA 4CMAA 3R9RA 1E0SA 1LRLA 1NI4B 3G2KA 3KOZA 3JYPA 3C41J 2AFHA 3A0UA 2RCNA 4RK1A 1JYEA 2AG8A 1E1QD 1OIXA 4UUGA 1QCZA 3RNOA 3N7TA 4KTTE 4J1QA 3UANA 4TZTA 3E2PA 1G5PA 1SK8A 1TIBA 2CDNA 3TECE 1ADFA 4RJTA 3S8EA 4ZQFA 5ER9A 3QGMA 4RIEA 2P79A 3H11A 3K8ZA 1DX4A 3A9VA 2GRAA 3PFIA 4PPNA 1ZI8A 3GIMA 5FUXA 1W85A 5A7GA 3DVSX 4B2LA 2WA1A 1E63A 1LPAB 2AS0A 3QYPA 4IO1A 3ASZA 1FLVA 2ESRA 3AEUA 3MT0A 2JNWA 5F9FA 4IWYA 5AVRA 4B82A 3UXEA 5DQIA 4X3OA 4YACA 2PZMA 5J2TB 4TYYA 3TS1A 1D3AA 4PC7A 4TMVA 2RC5A 1JFSA 2OHFA 2IKQA 4FCVA 3IBCA 1LI5A 5ESWA 4CKEB 1OASA 5F7JA 2VIIA 4RKRA 4WQMA 3M6VA 2VXCA 3D0RA 2BN4A 2P41A 4CFYA 4NHOA 5DKFA 5GTDA 5JADA 1Q15A 4GMGA 3EASA 4WK4B 1YKFA 2QZZA 4UUNA 3E5MA 3K8OE 1Z4KA 2I2CA 2OCIA 1RJEA 2PGJA 3ICVA 2DTXA 2ALJA 4F5YA 2VDWA 3WLNA 1J0BA 5FQNA 3RF2A 3RAQA 1EK1A 1NPDA 1NGSA 2PKQP 5KFIA 4X93A 3MWJA 2GA9A 3B2NA 1ORWA 4ENPA 1EGQA 1B04A 4LHEA 1X7YB 1K6EA 3UW3A 2CMDA 3MLAA 4LH7A 1ZVQA 3PGVA 2M6LA 2ZUTA 2O5RA 1G2IA 2Y2VA 3UJ8A 3WE7A 4HLCA 4PLVA 3DZ8A 1MZPA 2RKWA 3DLIA 5ALOA 2FKLA 2GLXA 4PNHA 1QTQA 5B5SA 3PSHA 5E4JA 4X62H 2GJAA 4Q3NA 2R7KA 2Q3BA 1LA2A 1OKKA 3EFHA 3CZRA 1N77A 1CHNA 3MGAA 4D0RA 4YMGA 2H4FA 2XBLA 1CR2A 2QRUA 3EDOA 3IQDB 2W2PA 1HDXA 5CA1B 3QVGB 3B1KA 4F12A 3ZZMA 7MHTA 2J6SA 2CFTA 3GUYA 1PHRA 1EVKA 3OHAA 1N6HA 1L7XA 2XE6A 3BWBA 3B13B 5BW8A 1FQJA 4RTRA 2XX3A 3T15A 2YWFA 2GJ4A 3LT2A 3IN5A 1D8TA 1PR4A 4D56A 2J9XB 3TLKA 4TT3A 1JDBC 1NLYA 4YROA 5BWUA 1G16A 4EEYA 1ACLA 4ENRA 2P3QA 1O7JA 4TVSA 2NU9B 3CNHA 4RTSA 1N5JA 3ID6C 7YASA 2HM7A 4DCSA 2Z2ZA 1X1CA 2Z8YA 4KWHA 3QOWA 4RHTA 1GU0A 1GIAA 4BRUA 1FFCA 2GPYA 3E6AA 4RANA 4NH0A 1TL7C 2ATEA 3PUJA 3P27A 4TKMA 4FMCF 1YKSA 4BP8A 1I0IA 4M0LA 2JA7G 5ERGB 1SU6A 5F33A 1SA0A 1QGED 2V7UA 1Z0AA 1E6KA 2C2ZA 1WV0A 3AERA 2BFPA 3ZK7A 1A96A 4I5FA 1R1DA 4L9WA 2H18A 4CV3A 4X66B 4G65A 3ZE7A 3WAGA 2VPIA 1G6Q1 3EARA 4N65A 4NONA 4MAMA 4DR4H 3B9BA 2QM3A 1G20E 2YNMC 1QP0A 1DBSA 4JOQA 2IYOA 5BMVB 1ZHQA 2XUFA 1L5NA 2ISSD 1G98A 1RAHA 1WVIA 3W90A 3OEHA 4BOYA 2BJHA 4DSUA 4FKZA 2QN8A 3TR6A 4IIJA 3NQ41 2V3VA 4RH3A 1PVVA 2VWPA 1AF7A 1NVVR 4GP9A 2JBAB 3D8SA 2J45A 5ECWA 5EE3A 3OEEA 4JI5B 1AQUA 2OO5A 3EVAA 1QGZA 1WP4A 1XDUA 2ONYA 4LDPA 3MQFA 5KFPA 2DSTA 3LUFA 3E22A 4D98A 4P6VF 4YWJA 4JNCA 1JALA 4BFZA 2YASA 3DEHA 2G0NA 3UMGA 5TC4A 1R4NA 3L8ZA 3D43A 3Q8LA 4R84A 4US0R 4MVJP 4JYBA 3GIWA 1ZD4A 4PHGA 4DA9A 5LMNH 5HEKA 2O14A 4RD6A 2DR0A 3K70B 2QLJA 1R8XA 5F7OA 4XWYA 5C5EA 4EJFA 3KHHA 3QBVA 1CQWA 1BQEA 4GX5A 3ASYA 3DWIA 1T2VA 1SVWA 4X84A 3HXOA 5CFRA 4QXOA 3OZAA 2BF4A 3JSAA 4BQRA 2DH5A 4MTEA 4E1BA 4PW0A 3VU9B 4R16A 4UNQA 3OCYA 4O33A 3HUDA 3UB2A 1IJFA 2NP6A 2FVYA 1MRZA 2A57A 2C96A 3EIUA 1BDBA 1N6LA 2WB4A 2RJ3A 2XQKA 1QWSA 1E9CA 4DCTA 4H1VA 3T9FA 2V5UA 4KO4S 5EJEA 1G4HA 3LQRA 4JGGA 3RPEA 2QXUA 1PV4A 2A94A 2PMWB 1P9OA 1N34B 5B2ZA 4MO2A 4ZGWA 3O83A 3K1AA 4GE0A 3GFGA 4UDXX 1HT2E 4FGKA 4NXNB 2E1RA 3BIXA 1YAHA 1H2RS 1U7OA 3BD8A 5B1SA 3KE8A 3B5IA 4IMPA 5C1DA 3I9NA 1V4YA 3GELA 1WPQA 2HW8A 3RBAA 4M8SA 3QE3A 1IBMH 2VHQA 3LGAA 3LW7A 3R6DA 1LX7A 3T3OA 3A58B 5K3OA 5DZSA 3N8IA 4XFKA 4IILA 2XCPA 1JFVA 1ZY2A 3NWOA 2PR7A 3FWKA 3IKVA 5TQ0B 4B7ZA 3KT0A 1KOGA 3NT2A 3K0CC 3WGIA 4IDEA 1HNWB 5A4FS 4LDRA 2Z6VA 3RTBA 1MO6A 1GL7A 5K0TA 2QSJA 4QIWA 1DJOA 2XT6A 4ZKDA 3HP1A 4HJRA 4PYIA 4M6WA 4LSZA 3B8HA 5A03A 1TRKA 2QIPA 3KJNA 1JQDA 3OLQA 4DLSA 1M33A 4JSRA 4BMZA 4DV2H 3MJRA 2DBZA 1LNQA 4B2PA 1XZPA 2JD0A 4YHHB 1JAHA 3ESQA 1A5TA 3ICQB 1MW8X 4PZ7A 1GL3A 4G25A 5EIAA 3B1YA 4MW6A 3N40P 3D4IA 3N2LA 3EF1A 2PUVA 5FQOA 4PQFA 1QVZA 3WG9A 1NULA 3FNBA 1E2GA 3CX7A 2HA7A 3RR2A 1J0XO 4QWEA 2VHUA 3CEPB 2FLPA 3B5EA 4UUAA 3AF2A 3JAKA 1SD2A 2Q6OA 4QPNA 4GOOD 4Q02A 2BISA 2A67A 3LUKA 3QXSA 4RTMA 3K4HA 5E38A 6AT1A 1QHHA 5JAPA 1YRLA 2VSNA 1EWQA 3OPYA 1D4ZA 3UAVA 3Q3EA 1MXFA 2YHUA 3QV2A 2VRNA 3LMLA 2VK4A 3IFSA 3PFCA 3IKLA 5KFCA 1LBSA 3L8EA 2G1KA 3F8SA 2Y0EA 6GPBA 5AHOA 1JB9A 1IQUA 2YJZA 2WUDA 1SCAA 3FZQA 4EB6A 3SE7A 4MZDA 5KYUA 1NUUA 3RRZA 5LMUH 3GEGA 4R8UA 2JLUA 4WHXA 3IR6A 4FVTA 1Y8AA 2BGUA 4OXNA 1O94A 5EWGA 2AK3A 1USIA 4NXMB 5GQSA 4DZZA 2IOFK 4WBNF 2C1ZA 4TRNA 1BE8A 4XJTA 3UTDA 3ZWMA 1L3BA 1IZ0A 2IVZA 4EKIA 2P9CA 4FDTA 2FTKE 3AM4A 4LYHA 4BFYA 5KYTA 2CUKA 3T7SA 2E18A 1G1MA 1KFKB 4UTOA 5K3WA 1PBNA 3BSSA 5DHFA 5JYCA 1JPVA 1GV1A 2QK4A 3CYFA 3RAEC 4YP7A 1FUIA 4J91A 2WHPB 3CEBA 5G4KB 3OCZA 3B6IA 4UHJA 2XIGA 2BMVA 3JVDA 5EG5A 5FUQA 3QVXA 5DW0A 3P94A 3FBTA 4LRYA 1MUUA 4BX9A 1E61A 1T1IA 3DPUA 3O47A 2CJYA 4V3CA 2KPOA 4BWFB 3NHSA 4OQFA 4ZK6A 3ZCSA 1RRFA 4EO9A 2QTGA 1RWPA 5H02A 5IZCC 4KUGA 2A4MA 3VDMA 3AYZB 1JQEA 4H7IA 2X14A 5C8DA 4I1IA 1XCPA 4X1IA 4OREX 5CB4B 2YBDA 1UXOA 5B7PA 2Z5FA 4DR2H 1CUBA 3TN7A 1HZZC 3BULA 2J3LA 1XJQA 4N54A 2CYAA 4IV0A 5BSRA 1SUPA 2B7LA 2HQBA 5F98A 5CH8A 4HAIA 2ZJ8A 4N7RA 3ZD8A 3OLYA 5HHTA 3FRIA 2EQAA 4L8FA 1OWNA 1MF7A 2GZRA 3UK7A 3CVWA 3U4IA 1GILA 1RS0A 3EJ6A 3O3NB 2KLHA 1C0PA 1JXOA 3AJRA 2Z2JA 4CIXA 4UATA 1UMDB 5DQGA 2B63A 1RHQA 3WMGA 1BWRA 5EZ6B 5JEEA 1V48A 2C4UA 2Q2WA 1UPFA 4G5HA 3DOJA 1YQ9A 5EESA 3X0DA 3OZ7A 3BBPA 2RAUA 1ISMA 4LOKA 2FZCA 3TAHA 4PLGA 1TLFA 2V5VA 5E6RB 3K9CA 3ADCA 4X3PA 3ICWA 4MV6A 2DY0A 2WKQA 4PYQA 3HMQA 3QHQA 4NE9A 1WDLA 4UCUA 3EXAA 1Y14B 3UQZA 1H0SA 3S8YA 3ODGA 4GGOA 3S2ZA 4DE5A 4N5HX 3GJTA 3AUSA 4U8HA 5KNDA 3I09A 4HLUC 1D4FA 2QTCA 3G9XA 4H7PA 1UMCA 4L02A 2PSDA 4S3MA 3L18A 2R1TA 4PLFA 2HSDA 5TIIA 3HVRA 2W0MA 4J16A 1SYXB 2QXYA 1I1MA 1A9PA 1P8LA 4GICA 4FI3C 3ZWPA 1JPNA 2X5NA 4LYEA 3WL6A 2KBEA 1T4DA 2ZSEA 2P1RA 1Y8QB 5HQTA 3O4RA 3FDSA 2VVTA 5CM0A 2QJTA 1X86B 1IG3A 2R66A 2O0JA 3NGDA 4BJ1A 4MYSA 3RYIB 1XJWA 3X1WA 1N8TA 1VLZA 1M5TA 5HW0A 1CR1A 3PKIA 4A8JC 4X61A 1UADA 4DUGD 3D3EA 3HCWA 4HZUB 4QRIA 1XZIA 4JY7A 2FNAA 4AYBE 4MV3A 1C9JA 4DDUA 1ZU5A 1KWGA 2WJZB 1TLTA 5C1OA 3OHBA 4M8LA 5JD3A 1Z8NA 1E0KA 2BUAA 421PA 3W3AD 4RPJA 3AJ8A 5E1OA 4RC9A 2PL9A 4FT4A 1DRWA 1XOIA 2DBVO 1E59A 3RBZA 5JH7B 4JLJA 1BMFA 3ZWQA 4D3YA 4C22A 2E55A 4YY3H 1URPA 1I13A 4P8RA 3D6NB 4ZAFA 3SHFA 3MFHA 4MEAA 2O1WA 4P3YA 2OPBA 1U4NA 1C0IA 1ESEA 4D44A 3NPAA 1NP3A 1WXXA 1XZDA 4G2TA 4YRTA 3JARB 1ID1A 2PUJA 1MIOA 3FOEC 3WRVA 5T41A 2R96A 4MQEA 4TMXA 1R27A 5KFMA 2D5IA 3MWEA 1KQOA 2XCIA 4MB6A 2XAAA 3OTHA 4JWKA 3RK4A 4BVJA 4UU7A 1E1QA 3ICEA 3D59A 2EDAA 2XRYA 1P0CA 4NKRA 1KEZA 3AETA 3RSCA 3IMKA 1DT5A 4FEGA 3UPTA 5D1OB 2UVPB 4ETNA 1TMGE 1NX9A 3IHLA 3MJ4A 5GV7A 2I76A 3ZBPA 5EZ5A 3TZEA 3R9IA 3ZV7A 1QFJA 4YDHB 4L74A 3TDMA 2I7XA 2R48A 3K0AA 1TLLA 1YAJA 2RHLA 4REOA 4IHKA 4CLDA 1OX4B 2IEGA 2Q0SA 4JVSB 2YIVX 1OA1A 4YJ3F 3IEVA 3WSWA 1WZ2A 1XP8A 1YASA 3KJXA 3MGKA 5F5LA 2OCGA 4U1RA 5EJGA 3TRIA 4II3A 5FL7D 4LSXA 3FBWA 4P34A 3WLMA 3GPIA 2ZWMA 2B1JA 2IOYA 2WYVA 2JJ2D 2DSNA 2EVWX 3LCVB 4N76A 1JLLB 2IT1A 4LF9H 3TH5A 4YALA 2ID8A 3VXKA 4OQXA 1A9TA 3EXFB 4RVCA 4GD3Q 4YFVA 5AI5A 1HZJA 3FIUA 1L9KA 4P31A 4O4IB 1A77A 2G9QA 5C8VA 1FX1A 4ZRNA 4PEVA 3M5CA 4P4NA 1O0CA 2AL7A 4QBFA 1GAWA 4L6AA 1ZD3A 2O3RA 5AVZA 4TS3A 5EJ2A 2Q6TA 5HILA 4Q12A 1R0SA 4UZSA 3ZTWA 2Y9PB 3EMDA 1M74A 4KACA 1O5IA 1NF9A 2BMWA 3R5KA 5ALZA 4U6QA 1OLXA 3LK6A 2XUAA 4H2DA 4BGVA 1XF1A 1D5WA 1P2VA 2ZBPA 5JXJA 5LXTF 2D5LA 3TEKA 2BJWA 2O4UX 3D6UA 3ZCPA 2Q6KA 2RGXA 1VFPA 5LWHA 3WNVA 4X65B 3DBOB 3AVTA 5L45A 4KHPH 3BKXA 4ZVRA 4YX9A 1KYXA 4DAOA 3BM5A 4QOSA 1O9HA 2UXCH 3ON5A 4HFRA 1DXHA 4GVLA 4G4IA 1SBYA 3WK4A 1QAMA 5C3MA 3UJ9A 2EERA 2F8TA 3DAHA 1CUVA 4RXTA 1UBOS 3BIFA 1CYDA 2O07A 2Y66A 2B8EA 4Z9BA 4BFSA 4GRAA 4A26A 2BTOA 4G9EA 4AG5A 1YOBA 1RLIA 5HGXA 2XDQA 4M87A 3UK1A 4CG1A 1Z47A 4OQPA 3BH6A 2H8GA 2JH3A 1ZG3A 5JMPA 4QGHA 1JR6A 3BDIA 3CT6A 3GGJA 2OILA 2H5EA 4LMPA 4JYCA 4F2WA 1W4CA 3EWIA 4Z2YA 1ULSA 2ATCA 2BT4A 1NNI1 3UK2A 5HV6A 1G5HA 1SB9A 2CNNA 4BNTA 5EVJA 2IE8A 2OO7A 5DGCA 4DMHA 1YS1X 4JCCA 2CW7A 1CJTC 4RUAA 1I7LA 2BGGA 4AUMA 3I9OA 4OHRA 2HHHB 1O6ZA 5F52A 3M6AA 3GVCA 4S2UA 1Z2EA 1BWPA 3FA2A 5G0WA 3L1JA 2J1LA 2RGNA 5I9TA 1NYLA 5KNCH 4OU5A 3JAWA 1U31A 4YNBA 3GZ4A 3HWSA 3HACA 1LV7A 3JWPA 3RYHA 1OKKD 1W96A 5HA5A 4EL5A 1OTHA 3QX3A 4RZHA 4EG6A 1QF6A 1PFUA 1G2QA 4GKKH 4UJ5A 3G9TA 4CF5A 1FB5A 4TRMA 5BWRA 3DHNA 3HO6A 2NO4A 3ZTTA 3O4GA 5CVDA 1U0RA 2R00C 3RSFA 1PK7A 2FI1A 1XFAA 2IYUA 3F67A 5JYDA 3RRMA 3RUHA 3RGGA 2BOVA 3MB8A 3EJWA 4C04A 4LTNA 3OWOA 2P0AA 2DCUA 5D00A 3FCYA 5JC8A 3QZ8A 5FTJA 2CB9A 1UWKA 5I9IA 1O9GA 4QQFA 3C45A 2YXPX 3E0XA 2GJSA 4OJQA 3COPA 4H4DA 1XXHE 2AFIE 3CB4A 3O8DA 4IQFA 2G0TA 3HJUA 1H5UA 1GGKA 4DJDC 1AK1A 2H57A 5J4YA 1XMQH 2XIQA 3JYNA 1DRUA 4IIVA 1B15A 3QYJA 4AQDA 4F72A 1HV8A 4IF4A 1RVV1 3T38A 4BEBA 2XA9A 2D0DA 3H9UA 1W93A 3AB7A 1YI8A 3KL4A 3ACDA 1VBKA 4YK7A 5TE9A 2WP8J 1NRIA 4OQEA 2DWPA 4L07A 4OFZA 5E4TA 3DL0A 4BMOB 1Z74A 3GJXC 1HYBA 3A10A 2JGMA 3UMCA 2OGWA 1P17A 6CHYA 1CRLA 4HOYA 1AKTA 1W44A 1T43A 4RK0A 2NOAA 2H9YA 4CM8B 3CN7A 3UYKA 1P1IA 2QIOA 2ZZMA 2Z2IA 2GFIA 2NUTA 3F3MA 1PX2A 2ADMA 4HC4A 1XK7A 4NYIR 3RVDA 5A06A 2IHVA 3ISTA 5DE3A 4B3IA 5CM9C 2MOKA 1KH2A 3SIPA 1NZFA 3T7EA 3JX9A 2IHZA 3C8DA 4I55A 1ZDMA 2J6IA 5BWLA 1NP6A 1HE8B 1OYWA 3PR5B 1UBJS 3RKRA 3NHAA 3OZRA 4FMDF 4ECWA 1YFKA 4F1KA 4P0QB 4ZOLB 4LYFA 3S0JA 2B2CA 1SKBA 3QPUA 5AESA 2IWHA 4QW8A 5A4JA 3IEPA 5C46F 3LP8A 4QDOA 3LBAA 4KFSA 1SEPA 3QWBA 3KHKA 2MCTA 5D3ZA 1XZAA 2OM2A 4CDGA 2HBRA 3TPCA 2FSVA 1E9SA 5CHEA 1BCSB 4FN5A 2X0KA 1J06A 5KQGA 4DSNA 4HNUA 3TBKA 1TCVA 3A9RA 2IY9A 3A1TA 3LGSA 1GPKA 4AS3A 5T4FA 3VPSA 3WYFA 4WK0B 3KXYT 3IVMA 2SKDA 4EOGA 1E7MA 1PGQA 4IIBA 4JP2A 5DSTA 2OZKA 2NTJA 1V11A 5I7FA 4AVYA 1OQAA 3KAJA 3N74A 4C0XA 4HYQA 3TLXA 1RPAA 1L7BA 3CLRC 4V38A 4MVJG 2XH8A 3HOYG 4GI5A 1FP4A 3Q9UA 4N47A 1RXIA 721PA 2XCQA 5G0SA 2SKCA 2H59A 4RTLA 4B3JA 2HMYB 1H3NA 1T5DX 2EX0A 5SY6A 3FCUB 4W5WA 2WU0A 1DC3A 1EX6A 1QE5A 4NFHA 2R4TA 3RI3A 1MJFA 1PR1A 4C4YA 1CUSA 2ZIXB 2NAPA 4BE9A 1F9AA 3TXXA 4PZYA 5CEEA 1A7UA 3L8HA 2ASDA 3GV7B 1TKBA 3IE1A 1U2RA 2DQYA 2XYRA 4U7JA 3FHTA 3QEKA 4MUBA 4ZI2A 5HIIA 4YMHA 1J1UA 1L4YA 1IATA 1YL7A 1KFBB 3FXAA 1CW2B 1NDUA 5IYBG 4Z9YA 1ZEJA 4YXWD 4YMIA 3ZJYA 4I50A 3TCXB 3STHA 4TLLB 1S0UA 5K8IA 1ORRA 2WIAA 3NC4A 4QJBA 1P72A 3JQQA 4CMKA 4G8DA 1YVUA 1QANA 1P2SA 3AGPA 4JB3A 4K6OA 3H8WA 3IDAA 5JR3A 3B1XA 3LUGA 3DOIA 1P1RA 1U1CA 5BURA 4KQWA 3U7IA 2FUCA 1I7PA 4GMDA 4FNGA 2ERXA 1JHAA 3HM9A 1WU7A 1AUVA 1RKXA 2Y1DA 4DBLE 4J9NA 1K4YA 2ODQA 5CGZA 4IJKA 1LLUA 3COVA 4HNVA 5AKLA 1QYCA 4KWEA 4FFLA 4K40A 3VMFA 1E9VA 4QWDA 1OXMA 5EOYA 5I5WA 1E4VA 4JDPA 1U81A 3ORYA 2OVFA 2OUIA 1TAUA 2Z9CA 4MWBA 5K6AC 4FFBB 2PPVA 1EBUA 3PQ4A 5E8JA 2G9NA 4JLWA 4CKCA 4E32A 4CRWB 2C5EA 1SGWA 4YRPA 1XAGA 2AQ4A 3ANLA 1YA6A 4JUZA 1HNNA 3MQ2A 4TRRA 1T8YA 1ZL2A 3NTXA 2GPAA 4BAUA 3SG0A 1OFUA 4G01B 3AL3A 1V3VA 3FJOA 3R6GA 2PWAA 2P2LA 5GONB 4BECA 3PGMA 2QDXA 3ZKWB 2FSIA 2P67A 1VP9A 4TVOA 3VOBA 3JALA 5D5PA 4JI5H 3BSFA 3NM5A 1GGHA 3L6EA 4BNXA 4P36A 3CBQA 4NCIA 4QGBA 1OBDA 1JVBA 2QRGA 2XF2A 4Q7KA 3SYMA 1M6VB 4YGYA 1CY2A 2OV8A 1MOSA 2DFPA 2W9CA 1H9CA 1QMPA 1QFMA 3BXXA 5TVKA 3GYGA 4IX1A 3WLPA 5BW4A 3GP8A 1NXQA 3PQ7A 4HWOA 1CFZA 3SHTA 5LBUA 1EKPA 4OUDA 4RCYA 8LDHA 2Y1GA 3CKLA 3WBJA 3VA7A 4Y2UA 3VYWA 3OA2A 1N0UA 1L5ZA 3F5SA 2VZ8A 1V35A 1HDEA 4LV6A 1ZJZA 1YZVA 4ETSA 1ZSVA 1PCXA 1IOVA 3RC3A 1T0PA 5LIPA 3R3SA 1G9TA 2H6EA 4NI5A 5ICCA 1FYDA 3QKIA 2C2EA 4MS4A 3AUAA 5MF6A 1RAIA 1F0PA 4Y9DA 1J4AA 4EFNA 5BO5A 3ZHZA 2W2KB 1FFSA 3EA4A 5FORA 1G6OA 3IMCA 4DIBA 2XUPA 2IHJA 1B33N 1MH9A 2GEJA 1LPSA 1UK8A 3PXAA 4C88A 1Y6QA 4O4LA 1IM2A 2DCMA 1B26A 2ZSJA 5BQFA 5IAJA 1P62B 1N34H 3PFNA 2VA9A 4B6PA 4DR5H 4LGVA 4Q7EA 1MABA 4LHWA 3KE9A 3MPOA 2P78A 1CIVA 3TZLA 4NXNH 4MPTA 2EFYA 4KMSA 3ZWVA 3QVJA 2YVLA 4BO8A 4W9NC 1GHTA 3FDFA 1I4DD 4JP5A 4BJ3A 2A0FA 1M67A 4DY6A 2Z2YA 1KEKA 1YZQA 1OWPA 1MB3A 1Y7IA 4QTZA 1K7FB 2P9EA 1O4WA 4KAXA 4G0MA 5JJCA 3IDSA 3IQGX 1CE8A 1K6XA 2FMTA 4FOTA 4LHVA 2Z8XA 4Y9RA 2BMJA 1TFRA 5LYJB 1TADA 3TZCA 1M2WA 3GXOA 2QHXA 4P0PB 1QQAA 1HNWH 4W5TA 2IOQA 3U1BA 3L7CA 1L6IA 3VVBA 3ESDA 3ZWXA 4G1FA 4L4SA 4PO8A 2WM8A 5LJLA 3ZZ0A 3W34A 4INJA 1M1UA 1W35A 2PMEA 1Z7EA 1HE3A 1N3BA 3L0SA 3YASA 2COJA 3IEUA 1L8XA 3I4MG 1RM0A 3UK0A 4BKMA 3AH8A 1RSZA 2H11A 5J59A 4BZQA 4EZIA 4LFAB 3BJRA 4KO1S 2A1HA 4DUGA 4NCXA 3BBLA 1SXHA 2A1IA 3RH0A 2Z6AA 2PJZA 2QVZX 4XGIA 3OX1A 4JJ6A 4LRTB 1JAIA 3W3AA 1Y1SA 2YZLA 1G41A 4KUHA 3KEMA 3GARA 2YV2A 3U0GA 4UMDA 1F60A 3K5HA 2RGAA 2BGWA 1H93A 5BWXA 5B30A 3KDPA 3IAAA 4KQ1A 5I7VA 16PKA 5IABA 4JT8A 5FNZA 1WOMA 2CJPA 2YMMA 3L40A 1HQKA 2HRQA 2HA3A 1K89A 2CVHA 4HN2A 1GEGA 3I04A 1X0XA 4Z8YA 2YCLA 1P0FA 1RXYA 2CFCA 1PU2A 4TX1A 2IYWA 2NUAB 1M10A 2Z3ZA 4ZDWA 2XKKA 1YDHA 2XSZD 3VR6H 3NI2A 2Z9DA 3R0ZA 2JI7A 2UVVA 1FU8A 2CNLA 5DCYA 1VL6A 3U7GA 2D4HA 3OJFA 3H8JA 4WZ6A 3Q2IA 2A5GA 3ICCA 1A9ZA 4P86A 3HZRA 3E2IA 1L8OA 4KXUA 1IMJA 4RELA 3ZDZB 1A7JA 3U1TA 2YV3A 2WJHA 4NXMH 3GA0A 3R0IA 3HSSA 1FS4A 1IE3A 1O54A 4ESOA 4R7TA 3AKYA 4G5QA 1JMVA 3MOGA 2HHLA 2Q5HA 1VJ5A 5KG7A 4DMGA 4FZ5A 5FL7A 1P29A 1DARA 4YCJA 3FYHA 4LH6A 2ZEJA 2ZRMA 2JJ2A 4YJKA 2OENG 3B2EA 2QQ5A 4M0CA 3X44A 4RDHA 4UEWA 5EJ7A 2NO1A 2F1RA 4IH1A 1A9RA 1RYDA 1QONA 1T3TA 3WMWA 1XCBA 3RAFC 5JUMA 3I5MA 5IBRA 2AXNA 1X7WA 3KDAA 4KQEA 3FCXA 3TIXB 1CQJB 3F4BA 5JNTA 4ETWA 4ZU6X 4RA9A 3E9MA 1T5OA 2ECOA 5SZJA 2EX4A 4I4TF 2JLAA 3EPIA 3PUHA 1ZJYA 3GQVA 1Z26A 3E8MA 3GV0A 1VJ1A 1LS6A 2FE1A 4AJ1A 1HUQA 3O82A 2YZ7A 2UZ1B 4DG5A 3CPHA 5CYOA 3H20A 4KRYA 2MYTA 5KOHA 1FMFA 4P83A 4O7NA 5I4CA 4IHJA 3BE6A 4PZ0A 1WO8A 1C1DB 2BTQB 3F9IA 5AYVA 5BOSB 1F3LA 3P4YA 2UDPA 1A5SB 2JEFA 1A2KC 1XU7A 2QYTA 5AHKA 4UFZA 3ZNQA 1A4RA 2C5BA 4PAMA 1RXUA 1DIRA 2FYTA 3O8CA 3KBOA 2BLLA 3E3AA 5MN6A 5EIEA 1LRJA 1IZYA 2IYTA 1VRCA 4PZLA 2ZUBA 2BGKA 4XJSA 4AJ2A 2NU8B 2P2SA 3KWFA 3AL0C 4CEHB 4ED6A 4JWTA 4UCQA 1I7NA 2FLLA 1WTAA 1TB4A 3UJHA 3JQAB 2O6LA 4N41A 1S3GA 4CM3A 4ZTBA 2CNUA 1XD8A 3GIDA 3S2YA 5KFLA 1CNFA 4AJ4A 3NMUF 3VZPA 4L72A 4P3NA 2VRBA 1NN3A 3L4JA 5F9HA 1NVTA 2H17A 5COQA 4W9MC 1D2AA 4Y6OA 1T6ZA 2JLQA 2E1PA 4EUHA 3QMPA 1E5LA 1IG0A 1NURA 1U3GA 4HRVA 1KAMA 2E21A 4AKTA 3O9VA 1T3HA 5TV2A 1N92A 1A9OA 4B85A 2G9RA 4JI6B 2ZYTX 3WDLA 3ZVRA 3JZAA 2O8CB 1KZ6A 2VTVA 1FNBA 1OZFA 4Q6WA 4E08A 4DNPA 2YYYA 4GXNA 4YJHB 5ELMA 3K96A 4L4XA 4I6JA 2J9GA 4F4IA 1SQ6A 4L75A 2YCHA 1Z75A 1SVKA 2FCRA 2FEKA 3LRXA 4MYTA 5I5TA 4LF4B 2YQZA 1E3DA 3KZOA 5DB4A 1UBUS 5TQ2A 2PH1A 2XMCA 2BGMA 3HDQA 3SZUA 2L2QA 2HMVA 3WZLA 3H1GA 4CM7A 3UH0A 4HAOA 4W1QA 1GPUA 1RKQA 1OPXA 5L7TA 2ZR9A 4P7JA 2Y77A 1RQPA 3CR7A 2KLBA 3QVOA 4WLVA 4QPJC 1C0KA 2NQ8A 2VYCA 3S40A 3P45A 4IFBA 4MINA 1DUSA 1ZMBA 1S4QA 1YONA 4C0AC 3O2QB 4XRRA 3AI3A 3G0HA 2WUEA 4IW3B 3VPFA 1EFVB 2E0IA 4INOA 4RKFA 3F1LA 2UYCA 1NZJA 4UPDA 1YZGA 2E4AA 4DR7H 4V0ME 3MR6A 4O2AA 2ZIGA 4LHSA 3GLGB 1EKFA 3U80A 1YJCA 2GS9A 1WJGA 3LYLA 4YO7A 2IP1A 4HNAA 4ZO7A 3O0TA 1RFLA 1XNRH 5JQGB 2R6CA 3QFRA 1NQOA 4O7ZA 3X1DA 2X5JO 1IUPA 5L9AA 1OLSB 1ODJA 3AF6A 4KMRA 1AS3A 5DAAA 2PD3A 4F4FA 4Z2AA 2RGDA 3KJQA 1F20A 2PYDA 9MHTA 4PPGA 2YIJA 1S02A 1VLMA 1R2QA 2ZJ4A 3TLGA 3H5IA 1V7CA 4QPZA 2C9CA 2FZWA 2EIXA 2PX6A 1OD6A 4YPOA 2B35A 1J2EA 3ZU3A 2W8BB 4K7JA 2QUIA 4DCJA 5ERYA 1Q16A 3WGUA 1RXSA 1WCMA 3Q8MA 3T5HA 4GAEA 4XLTA 1VKNA 4J07A 4N9QA 4NQRA 4TZKA 4XW2A 4YP3A 4CLRB 5JT1A 2ATXA 3CUEF 3THRA 3JS5A 4OLBA 3I5UA 4IQ0A 3P52A 4B40A 4EGCB 4Q0YA 3QXHA 1FQOA 1Y1QA 4U7TB 1QPBA 1RWBA 1YF3A 1P8JA 1NP7A 5A4AA 4RETA 3QQPA 3AVVA 4CF3A 1X1TA 2C7OA 3ENKA 3AM3A 2Z30A 2C20A 4F46A 2DR2A 3WFJA 3H2GA 4ZPJA 4N5MA 4JH0A 4Q9DA 1JHZA 2WJ6A 4KE6A 3NKVA 2VP5A 2PGIA 3GGSA 3E7WA 4BKQA 4YAGA 3E4CA 4JROA 1KI8A 2EJ0A 3R0VA 2QF7A 3FPJA 1HLGA 2NO9A 2Q4EA 3ZJ4A 3GLSA 1LI7A 3GK3A 4U0KA 3GZJA 4M88A 3QQ5A 4ZZIA 3N2IA 5HKKA 1QP4A 2JCBA 3FDZB 4GP7A 4QD3A 1CZRA 2DHRA 2ILVA 3PXBA 4HGOA 1PF7E 2VF5X 3OA0A 4WFKA 3S70A 2J6TA 4PR0A 1T8PA 5HS4A 3PX2A 4DA8A 4IXTA 2WLTA 1NSTA 2WOJA 2F1HA 1L5SA 2JJ1D 1H1DA 4MQ4A 1TK2A 1EXVA 3IBGA 2BRUC 2AN3A 4YAEA 3Q40A 3ESRA 2F4NA 4GMKA 1JIJA 5B3JC 3WJ7A 5IVPA 3SC2A 5A5DA 1WMEA 2QYHA 5DF1A 2MTBA 1L2TA 3R5XA 4H7JA 4MRNA 4M9QA 4D79A 1L5LA 5AI9A 1W4LA 3OLZA 4RZIA 3UFXB 3K0CA 2XTAA 4FGZA 4FKBA 3SYKA 2BUBA 1QTRA 4BQNA 3FKIG 4M7RA 4MS3A 3IELA 1IUKA 4KFRA 2IKSA 4IJQA 2CD7A 3OX3A 2HBZA 4LVNA 3ZDYB 1W5TA 2X8JA 2P9HA 1FP1D 2BMEA 3LYHA 3QEAZ 1GGEA 3OT1A 1WWKA 3AQ4A 4JUBA 3H2JA 3U5TA 2YDXA 1DAHA 2C7PA 2IPAB 1EX1A 1QE0A 2ORYA 2WWWA 1RLMA 4XE5A 4HEA6 3ZWOA 4YXWA 1N2CB 3W2IA 5EGNA 2E4XA 2CXPA 1UUFA 2ZQZA 1DTEA 3ITEA 3VC3A 2FX2A 1CUYA 3THYA 2O7NA 1HKHA 3IUMA 2WUFA 2BEVA 4KNYA 3DO6A 2GPBA 2NIPA 3WLQA 1J39A 1IK6A 1UDWA 3ZR4B 5TLSA 3BS4A 4F71A 4XKJA 3W6ZA 2EF0A 2X3UA 3DBLB 3KKZA 1U7ZA 3G2OA 3IOEA 2LCQA 3HJHA 1Q7EA 2V8OA 4FU0A 4HYTA 4IDAA 1U3TA 4F84A 1VDZA 3FLAA 4RZQA 1EEHA 4KWTA 5AM2A 4D5EA 2AD1A 2YKGA 2GKSA 2P5SA 4WXHA 4KZPA 4WCFC 1LDGA 2X0RA 4UOZA 4D9KA 2IXBA 5LR6A 5IC4A 1XELA 2WG0A 3BK1A 2RHDA 4QBKA 3SI8A 3PRHA 3SCZA 4J3FA 2L69A 1N0VC 2BQUA 4TKVA 2ZUWA 1S2LA 4KREA 4EFBA 1CF4A 5CVEA 1DAAA 4YGXB 3ZS9A 1RM4A 1GOTA 1IBSA 3I6IA 3SU8A 5JROA 5FI0B 3IOCA 3FTCA 3TFOA 2XMZA 1G8KA 3MR2A 1V7QA 1AMUA 3HCDA 3VNSA 1V4VA 3P32A 1ZR2A 5HJ7A 2K5UA 1JRLA 2QBYB 2DULA 4A23A 5KSPA 1M34B 2RGVA 1I4EB 4B3MB 5GADl 2F8MA 5ANRB 4EZEA 4YUVA 1V41E 2OMKA 5EZYB 4I5IA 2IMWP 3VZCA 2W98A 1N2XA 8OHMA 3H5WA 4BY9E 4JR2A 2AV6A 3HDVA 4IRDA 3AEQB 4DV0B 1Y1PA 3DE5X 3GDFA 1Y3HA 4B0PA 4TTVA 1SU7A 4KLAA 2IU4A 4JI3H 3I0ZA 3R9WA 3AVYA 5KFNA 4H1TA 4TV8B 1Z4IA 4IFEA 5IZCA 1MCZA 4CMGA 3J80W 1GQSA 4EHFA 3HKZA 4ABTA 1YB2A 4C0KA 2GDJA 5BYJA 3VDXA 1OFIA 3NBXX 2PTHA 3LSYA 1IH8A 5IAOA 1Z22A 2Y0CA 3PHHA 3VC1A 2VKTA 2NT3A 3LQYA 1PLJA 5DBIA 4RHEA 5JRJA 5D5HA 1KS9A 2YVAA 3PBKA 2VG8A 4H3VA 4QU9A 4CQLB 4RM2A 1EFPB 2GTIA 3U6BA 1SD1A 2XAUA 1Q92A 3PHJA 2YV5A 2NZ2A 2XB9A 3DV0A 3NBYC 2A4KA 4LRSB 2XWJI 4GM1A 4MDHA 4OM7A 2YN4A 3PDWA 1NVFA 1N2HA 4HXFB 1VI6A 1IOLA 3TTXA 2AQIA 2G17A 2QN2A 1QH1A 3Q1KA 4CETA 1ZISA 1RNLA 4QSHA 2FDCA 3WL8A 2TRSB 2Q4RA 3DWGA 3FCOA 1W0CA 2FZKA 1TYZA 4L8GA 1G5TA 1HT3A 1HA3A 4P3KA 5TT1A 4II7A 1HYEA 4KHZA 2QUHA 1SWVA 4BKRA 3FRJA 3JRNA 4YBZB 3RRFA 2YXLA 3TSAA 2QQGA 3TG2A 5DIFA 1ML3A 3I1FA 4P93A 2F3TA 2QRQA 3R3XA 1A9XA 4Q8EA 3WMFA 4M7OA 3WWDA 1VS0A 4ZN6A 3MRSA 3W05A 2CDCA 3VO8A 2B8NA 4FSDA 2V7BA 5EKDA 1UDAA 3SIXA 2I55A 2J3IA 4ZPXA 2IUSA 1RRCA 5E2AA 5JCPA 4J0MA 4IVNA 3M9XA 3MJVA 1O0BA 1NVMB 2PSFA 4IDHA 2WQ7A 1CWUA 4IGIA 2FPGB 4C1BA 3UOGA 3QENA 4OJNA 3LCMA 2ORIA 2HTEA 4FYPA 5K8LA 2JLWA 4CU2A 4W99A 1NATA 2QKYA 2EJUA 4PFKA 1EVLA 4HH1A 3PUYA 1QSGA 4KWIA 1K1QA 3AHJA 1DQNA 2BKEA 4HXEB 1ZGCA 2J41A 2GUWA 4OP3A 2PDAA 2P6NA 2QRKA 3E9NA 4F4HA 3HEBA 4YT8A 4DQUA 3N3BC 2QT1A 4X6XA 4KAAA 4YUYA 4Z9XA 1MB9A 5T67A 3FMVA 4GIBA 4JA0A 4YLEA 2PXXA 4IS3A 4V1CI 1RPZA 3Q3IA 4Y2TA 4DA7A 5HIKA 3SI7A 3H5TA 4MLPA 4H08A 3TG8A 5GZ3A 1Q17A 3RVSA 1FUKA 1UMKA 1CCWA 4Y1GA 2IEZA 1E7YA 4YRJA 1XHLA 5KQLA 1FUEA 5B58C 3PICA 2YMPA 3T5KA 4TV9F 1W1UA 2V4MA 4CM1A 5AJUA 1E1KA 5CNKA 3TW8B 3RAJA 1HT0A 4MR8B 1JU3A 2R6FA 1XDNA 2ZTVA 4MR9B 1Y6FA 4XDZA 1R0WA 2XSZA 4IGKA 2FPPB 1KRHA 2E48A 3CVVA 4EBDA 1JFTA 5HJ5A 3HFJA 3QLVA 4PSVA 2P5YA 5K0ZA 4ZEOA 4ED2A 4IJ5A 2J30A 3H40A 1NMEA 1R50A 1A8UA 1YVDA 4PTYA 1N5DA 4O6VA 4AWAA 1KVRA 5KJEA 2Q28A 3DLAA 3HJFA 1TYAE 1ODCA 2VCHA 1TYBE 2FN3A 1NE7A 3KAQA 4ZQCB 4IFIA 2BHSA 4QJ4A 3HT5A 3SQNA 2W71A 1KY3A 1CJUC 1T36B 3I53A 5BNZA 4EJMA 4DCNA 3ZKAA 3BX1A 5NULA 3HPRA 4DB4A 4FZVA 1J1ZA 1WUYA 4CLOB 3UHAA 1S89A 3UHFA 3R41A 1M6YA 1DP4A 5JW6A 4ERNA 2G06A 4NICA 4QPCA 621PA 1VCNA 5EFZA 1O96B 2IH4A 4PONA 4P7BA 4GKJB 1I24A 2ZUEA 2OHIA 3GLHB 1IXRC 4JQOA 4KXNA 4DUYB 2HC9A 4ZVMA 1VE5A 4QU0A 1UBGA 4B83A 4OP1A 1FS5A 4QAJA 1B8OA 4MHSA 3UKOA 1WXEA 2FMFA 2YYAA 4YAKA 3CU5A 4CM4B 2YYZA 3QKUA 2ZAOA 3C6QA 1XRRA 5E6SA 1PSDA 4H0NA 4M7EA 4HL6A 3WB1A 2NVBA 3V8VA 3AOGA 4QO7A 3Q88A 1N57A 2W9BA 3T95A 5M29A 1H2FA 1WSBA 4K6NA 2WM9B 4MW4A 2X0NA 1Y6RA 2ODTX 3PO2G 5BYAA 4LZJA 3I9JA 3RVNA 1P3Y1 2IYNA 5HOQA 4QYMA 4ZV9A 3PQ6A 1Q3KA 4ZIRA 2QR5A 1NVXQ 1VPLA 2AFRA 4O2RA 2C2KA 3BRWD 3LY7A 4NOJA 3OJOA 3MA0A 4KCGA 4QBGB 1BD4A 3RVOA 3BDAA 1FY2A 5I48A 4G4SP 1JR4A 2PQ2A 1ZIDA 3WO1A 4RVDA 4BLTA 3V4ZA 2HCRA 4Q05A 1QYIA 1U7XA 2VDMB 3KKPA 5MFPA 1PVDA 2NVXA 2GCIA 1F3OA 4LW8A 5PGMA 5A1TA 5L8VA 3K1TA 3ZE0B 3NUZA 1S10A 3L93A 4BXOB 4LN1A 3QKSA 3T3NA 3O90A 2H1SA 2QAJA 1II8A 1RJRA 3RS4A 4HS9A 2FPIB 3AR2A 3HOZG 5UKDA 4CF4A 3FIJA 1J22A 3T9CA 2BFNA 1OE0A 2X7HA 4E09A 4YRGA 3W6NA 3O73A 4YN3A 5HS6A 3HC7A 1DTWA 2ZCUA 1CS0A 2A5DA 3AF1A 4YECA 3DBHA 3VDQA 3MN1A 4B87A 3DTFA 3CINA 4PX2A 3VZQA 1QZ3A 2R8OA 2XVZA 4HVAA 5FWXA 1B2LA 2Z5VA 4LK3A 1X7XA 2GYYA 3E48A 2ZP1A 1TM1E 5A6SB 1I7DA 2YHIB 4ARUA 5DK6A 3NYWA 2FWNA 5FADA 1RK5A 1JQLB 1OSNA 2A1TS 1Z4LA 3GLUA 1CPYA 4PLCA 3L7BA 3GEHA 5D84A 5KOJA 1VE7A 3QJ5A 2X3FA 5EEGA 3SMQA 5CD9A 3NYQA 4EI2A 3UXYA 1W52X 2OC9A 3DBRA 4LFAH 2FWMX 4XSHA 2XTJA 4GI7A 3DKVA 4I8IA 4XIIA 2YWJA 5TB5A 1SBCA 2C00A 2H52A 3C0FB 1WLSA 4HVTA 3CM0A 2EQ5A 1XVAA 1P73A 2VFAA 5KG3A 4EPTA 2JFWA 1KJQA 1N3IA 4NJEA 4GE3A 2CNOA 1BC5A 3F8NA 3CVUA 2BBTA 5FJ8G 3EXIA 3ONEA 1NW4A 2R00A 1VHJA 2CGEA 3DMDA 4MPJA 1ZSYA 2I4MA 1PSWA 4HWSA 8ABPA 4B48A 2IPNA 3PEEA 4IDOA 2FLNA 1RKBA 1GG2A 1AKVA 4WNYA 3M9WA 4V2UA 4GLXA 1EXWA 2I7CA 4TOIA 3L05A 3L01A 4NE7A 2WHXA 1QLHA 1UKCA 2IU3A 5AVQA 3QU5A 3PYXA 4HQFA 2PZAA 1XMVA 2R8EA 1I7QB 3H8VA 5J5AA 2PS3A 1RWQA 2O8EA 1QU2A 3FBGA 5CTJA 4UEQA 1NHGA 2MSNA 4DIKA 3W5CA 4ZHQA 2XCUA 4CG3A 1E3JA 1KDYA 2PRSA 5CGQB 4QUAA 4D9HA 2QLBA 3EGDB 4UHHA 3BD9A 4IH9A 3C8ZA 3ETNA 5HZGA 4OJMX 1VCOA 4FR5A 5EIOA 5KB3A 1GPAA 1LWOA 5BNTA 4I7EA 1WIWA 5ALEA 4C03A 3CO0S 4S35A 3BGVA 1QG0A 2I66A 3DVAB 1Y3CE 3EZXA 2IS4A 1TT5A 1H2AS 2C07A 5DYIA 3U39A 1AB5A 3FOFC 1KAEA 4FC7A 3NYRA 3K1JA 2PUEA 5BN3B 1FF9A 2YNMD 4IAOA 4M99A 4ZVVA 1WY7A 4YXFA 3O8RA 2QTLA 3BQ9A 5SZHB 3VYSB 1P2GA 1RXWA 5JOQA 2ZT8A 3M3HA 4ZP1A 1VB3A 4QKQA 5JIBA 5KC8A 221PA 3OHPA 3HY3A 1RRPA 4KUEA 2A3RA 4KQFA 1EM8A 3WLIA 4O83A 3H04A 4UNNA 3H1PA 2RBEA 1P2BA 4M36A 1KO1A 1L7OA 4UTNA 2AF4C 2JA6G 1PTKA 4BXXG 2NUPB 1LJUA 5IASA 4AB1A 3TSYA 4CV0A 1LQ2A 5FEMA 2XKBA 2IYVA 2D0OB 2K87A 4K5QA 2ERCA 4JVMA 4R6XA 1W0JD 5K4HA 4EFEA 3P9RA 2B0CA 2GD1O 3SQWA 2NXEA 4IAJA 3GA5A 4IOKA 3VHQA 3BERA 3GRKA 1NIPA 4CEIA 3L8YA 4DBLC 3DD1A 1JDJA 3AR6A 4MR7A 3L6BA 3E3NA 2OOSA 3TM5A 4WZAE 4FFOA 3FR8A 2JJ1A 4F4ZA 1LD3A 4F97A 2EBFX 2HSJA 4EQ5A 2O2ZA 3EXHB 4WESB 2PLWA 2PRJA 1V9SA 5F4ZA 4BUZA 5KSWB 3H97A 4GBED 4Z4GA 2R751 3B1VA 3R44A 3GZNA 2AG1A 1NNSA 4M1WA 4FINA 4DV5B 4NU0A 2QVCA 2IZ5A 1BRTA 3MCVA 2F00A 2FWPA 2MYUA 4DILA 2C22A 5H70A 3DEFA 3GJ0A 3WWYA 4JXKA 3GPCA 3M2PA 1SIWA 3T12A 1ZVMA 4Y6LA 1DFIA 4MW1A 5KDLA 3MRTA 1ZMRA 3NHWA 1WV1A 2ZWAA 1XZEA 3RSHA 5JCZA 5AW3A 4DRXA 3ER9A 4E07A 4JI2B 3UIEA 3PV0A 3G2QA 2FSUA 4EARA 4L50A 4OY3A 3DZFA 5HKKD 2JKVA 3BXHA 3J7AK 4H77A 5EHNA 4F1JA 3ZV6A 4QOHA 5DNUA 4C87A 3CBGA 1JDTA 2QV0A 3K0FA 3QWFA 3FI9A 2XW6A 1DPFA 2PS9A 3F6SA 3AY6A 4JI6H 4CM9D 1H4TA 5F1YA 4O86A 4JGIA 3UJ3X 4J9MA 2C95A 3A6LA 4C78A 1QLWA 2HWXA 5KPJA 1QPGA 2Y0SA 3M4IA 3SSAA 4ZAYA 1TEZA 3IPLA 4RK4A 2CZGA 1FX0A 1USKA 4LF4H 3TW6A 3WKDA 1C5KA 1WSAA 2IZ7A 4JAVC 4PV7A 4ALKA 3PGA1 1M2VA 3HLTA 2NU7B 1P6QA 1IYZA 3CKMA 4YS6A 2XCOA 2BDUA 3HYTA 3LC7O 1EB8A 4HHEA 1OBGA 5TGTA 1Q95A 2II6A 5A1JA 5MN4A 5DJ5A 4HGYA 1W2HA 5EJ6A 5LOVF 1QH8A 4R40A 3KZCA 4K9KA 4DYVA 3VPCA 5IDXA 2VJBA 4M46A 1U7TA 2ABWA 4AU1A 3OSZA 2EX1A 3WHKA 1KQNA 2FW6A 1FXWA 2DUNA 2VBFA 1ESCA 2ZIFA 5KG5A 1L5WA 3DMTC 3I37X 1ISRA 5K6AA 3VISA 3QWIA 4CIBA 5LQNA 4DV4B 1WCIA 1ZEMA 3NCHA 2B1QA 3I83A 1EGVB 3JQFC 4Y3UA 3NHKA 4MLZA 4MTDA 2R7MA 3PFKA 4HI0E 1UDBA 4NS1A 2NT4A 1PNOA 1E3EA 4RQUA 2QL6A 4FYMA 1RI1A 3Q2OA 3HDYA 3I39X 4RLQA 3WJAA 1KQGA 4H6PA 3M6XA 1CK4A 3C7AA 4GUDA 2N47A 2Y05A 1F2UB 1VE3A 4X66H 4WVFA 2Q7XA 5FYDA 1BFUA 1RZRA 1DFHA 3DE7X 5A4MS 1W48A 5KFWA 4QGFA 1E3IA 4E5DA 3DFMA 3IAM6 3GQCA 1ND6A 2AGVA 3I2JA 2AW3A 4TYNA 4CT5A 4JJIA 3U4CA 5AVKA 2XC9A 2B9VA 1ZK2A 1SD5A 2BMDA 3JD1A 1CEEA 5JMTA 5NLLA 1OFHA 5AOBA 3VDRA 2PPLA 5AOCA 3AP1A 2I8LA 1AUOA 1UPCA 3M0EA 1AUXA 3JD4A 4C7BA 3F74A 4UBOA 2VK2A 1SN7A 1RW4A 1E4GT 3SFZA 3N3AC 1R0BA 2W2OA 1H2YA 3LJKA 1G2OA 2JFVA 3RUEA 1JEOA 4RU9A 5BSTA 1WSWA 3T5BA 4DL3A 2F1KA 4DLZA 4ECTA 4H18A 3B38A 5AJTA 4RVHA 4F3KA 2CKDA 3AJ9A 5EDWA 2A59A 2ZJTA 1YS4A 1PUJA 1P75A 1T8SA 4GMFA 2FV8A 4ZOCA 3LLVA 1VQ1A 4CC6A 3WWPA 1P1HA 3KHGA 2FWJA 3BOSA 1DS6A 1RI4A 1KRWA 1HE4A 4GOKA 1GGJA 1KI1A 4HYKA 3HU3A 4HDRA 3QXCA 5F2OA 5IUJC 2B20A 2QMHA 4KBFA 5I9NA 3BH7A 2OGUA 3TDKA 4JJ7A 1KTIA 3WQRA 1YJ5A 4QNRA 3G02A 3H2HA 5SY9A 2ZI5A 1AGRA 1TAHA 1FYVA 2FN4A 2B2XA 3I1YA 4W9NA 1L4MA 3NOOA 1AOXA 4RQAA 4EKYA 3P2KA 2ICAA 2YX1A 1UJNA 4Y2RA 1V1RA 4ME6A 3F3KA 2B8JA 3EGXA 1U04A 4UZEA 5TS3A 2Q29A 1VBFA 2OVBA 1HI9A 5SY4A 1Z5OA 4C29A 2GK7A 4N5DA 3H1EA 2Z4SA 3GRFA 3HKEB 2DKOA 3T7JA 3E7XA 4B33A 3MWLA 2Q8NA 2UV8A 5E95A 3BICA 2G5PA 3DMRA 1XPUA 1X3LA 1UEJA 3MWGA 4EZBA 5KYYB 2Y1WA 4IPTA 3URKA 3ECAA 2KMLA 4XX0A 1CBUA 4MLCA 4HH0A 5ED4A 1LX6A 1QIGA 1ZHHA 4RPCA 1GPJA 1Y4AE 4KLZA 1NN1A 4N1AA 1CR4A 4RULA 4Q4JA 5JSQA 2GT1A 5CYGA 4N8SA 4CFSA 4GXQA 2R6ZA 3Q8QB 3ZU2A 1MNQA 1J0EA 1UWVA 1XA0A 5C4GB 2AYZA 2J3HA 1VKOA 2O3TA 2Q49A 2H2FA 4RAOA 1XMXA 4MWGA 1JAXA 1Q84A 3FOBA 2JJ8A 1NXXA 3WNZA 4G0NA 3REFA 1DQRA 4QDJA 4YHHH 1XDSA 2QI9F 3LOQA 1V2GA 1UOPA 1TO6A 1B8NA 1L3IA 1ZINA 3IBSA 4S0ZA 4PSKA 3DC2A 4JYZA 4L9AA 2J3KA 4UW9A 4XYMB 4JI7B 4X85A 1LJLA 2JFNA 1RQNA 1KC1A 2YZNA 4I1PA 3O31A 4K6GA 3HE3A 5KNLA 3UQYS 1TE2A 3FLMA 4TYMA 2KM1A 3AFGA 1VZ3A 3PQ2A 1SXJB 1RQLA 3QIAA 1A50B 4BEJA 3W2TA 4BFWA 1JE1A 4TQUS 4R0NA 1T6BY 1VIDA 2XGMA 4O7RA 4I2VA 3EEYA 1U1DA 1RM5A 4AZ3A 4D9MA 5JHGB 1T9KA 3NCTA 2OZLB 4YVFA 4B3MH 1I36A 1IXSB 1CIPA 2CJWB 4EF6A 2NGRA 3S24A 1Z15A 2YXBA 4BNDB 3VUEA 2HK7A 5AVJA 3SM3A 5KYWB 3WB9A 3LS2A 2RBKA 1W7AA 3PCRB 1JSLA 4R9SA 4QJ5A 3CISA 1K4KA 4R9NA 3A04A 5IULC 1L7QA 4DV0H 3R23A 3GHYA 3CZAA 3U2QA 4O4HF 3LPMA 3JYQA 1PD0A 4HGQA 5EIFA 4M21A 4AY2A 3KPYA 2PANA 1IDN1 1JHRA 3HB0A 3NC1C 4OVKA 4WKPA 4CG2A 2TMKA 4GBMA 4ZCTA 1ZJ4A 3LUCA 4V0NA 1WOYA 3CF4A 3QY0A 4MUMA 4RDCA 4L51A 2MWMA 4PBCA 1N9GB 3OQ6A 1ZH0A 3NFRA 4U5XA 2IP4A 2ZI3A 3I62A 3CLKA 1E3TA 3CTPA 2PZEA 4NCKA 5AKXA 5T4EA 1U5CA 3L3BA 4RHUA 1LXCA 2AT1A 2X4DA 4D3XA 3Q11A 2IBMA 1TYDE 4LZPA 3DDHA 4Q48A 4NYJQ 3FVRA 4DHEA 3BRWA 4XGRA 2HIXA 4V0RA 4M1KA 3PFGA 3MK31 1VECA 2DOKA 4URWR 1MO2A 4XVRA 2J7KA 5AXAA 3KTMA 4EPXA 1DOAA 1GPH1 4EEXA 4Z9AA 1AO3A 3O4VA 4GZ6A 4DQNA 1QIDA 4FFDA 3WK9A 5HKBA 2IZZA 1OH5A 1BDMA 4LE0A 4OYYA 5FWAA 3OJCA 1KU6A 4BZPA 3TTUA 4NZPA 4MGKR 1VPVA 1ZWKA 3PA8A 1JQ5A 1G20A 1KF0A 2NXCA 4BB9A 4ENTA 4MEJA 1T9CA 1WHSB 2HK9A 5CU7A 3O4JA 1EI9A 4QOIA 3RUFA 1Z37A 1J42A 2OCBA 2EFEB 3STUA 1K68A 1XVLA 4EKNB 3ADPA 3MMNA 4RJJA 5AW7A 2FE4A 5EYPA 4ARIA 1F51E 4XIYA 3W04A 4MKZA 1SQSA 2JI4A 3BGOS 2HMWA 4D0NA 3R3HA 3VSAA 3A4IA 1IM5A 3S44A 3E9YA 1LTKA 2FW8A 3REQA 3MGCA 2ZREA 2I6GA 4LCBA 2XR1A 4X00A 4O7TA 3QLUC 3QHAA 2RKOA 4CR8A 3ONNA 4KLCA 4HATA 3CRVA 1OAAA 2CBZA 1WKVA 4FMPA 3I9V1 3R6LA 3EZ2A 1C30A 2V9WA 4GU5A 3N28A 4J0HA 1P5RA 2QW8A 1E89A 4C2UA 3H75A 4DJJA 3U5ZB 5H81A 2PT9A 1LBHA 2YOGA 1FFXA 1Q7GA 2ROQA 1BHSA 3BE8A 4J6FA 4OKIA 5KWVA 1UJ4A 1PL8A 4QFCA 3WLAA 2VTBA 5FBHA 3GTOA 3RC7A 5DLEA 3KEOA 4PHFA 4A3EG 3WYEA 1PYOA 1XLTC 2JAXA 5JVDB 3IIIA 1CUZA 2C9ZA 5JC1A 2RK3A 1CETA 1UBLS 1S97A 1M1NB 1Y63A 1U99A 3OFVA 3EODA 1WXHA 4KGXA 4D9BA 2KQUA 1HC7A 3SYNA 3NW9A 4HQKA 5KX5B 1G8GA 5LMCA 2RIPA 4OBBA 2ZRPA 4U2KA 4FTWA 3DF7A 2W2QA 3FWHA 1JG2A 2X76A 2OKGA 3NHFA 3IUSA 1MH1A 2OAP1 2CBGA 3IPCA 1FZTA 1Y7PA 1KI6B 5C4XG 4B3CA 5THXA 3RYCB 4HYYA 4TQAA 3G8AA 4R8SA 1Y6JA 2HT6A 4C20A 5DXFA 1V3TA 5LQJA 5E7MA 3ZUPA 2I71A 3FJYA 4DLBA 2XYHA 3EIQA 3MEQA 2W7PA 4M38A 1L5HA 1ZM7A 4LF5B 5COBA 4EI9A 2HYIC 3K9NA 1QNFA 3PPWA 3B6MA 2HF7A 3O9ZA 1O2DA 2I67A 1WDTA 4MTLA 3L49A 1RQRA 4OSPA 4WXEA 4FUQA 1UC8A 1Z0DA 3OEYA 2H4XA 5LD2C 1GUYA 2F9LA 5IDYA 1SCUA 4CKWB 5IEJA 3MUNA 2RF4A 2OTCA 3ENZA 1WKBA 3EQ9A 4V2IA 3TI7A 3AT1A 3EA0A 2G8LA 1F1BA 1OX5A 2O05A 5JMWA 2GM3A 5KSZA 1RWKA 4WV3A 4B44A 5EXSA 3AESB 5A2QW 2YNMA 4G84A 4WDQA 2H00A 4CKYA 1H2EA 821PA 3I5AA 4ENSA 4HT3B 4CFZA 3JWEA 4K3VA 4QGSA 3DE3X 5LFAA 4R81A 4HB2A 1FDTA 4EL0A 5A62A 3DHWC 5IN4A 1HTWA 3FZGA 3SICE 3TGLA 4RPGA 2BMAA 3GUHA 5A3QA 3F5MA 1NN0A 2PGLA 3D1JA 4TLAA 3HHPA 3JQ8A 3EGVA 5ICSA 2I7DA 1YVEI 3NOVA 1PR9A 4L5JA 4GKJH 2JIDA 2WSBA 4P92A 2LNDA 1OB5A 4IYRA 4UOQA 2QPTA 3VBCA 3GJ5A 1G64A 2YXDA 5L3QA 1L1RA 2PUBA 1W0JA 1ICEA 1L4BA 5K03A 3OIGA 1R5JA 4X8LA 1M1YE 4Q18A 3IERA 3CJRA 4X95A 3Q9LA 3KPJA 4TSKA 1YU9A 1I4OA 3CW8X 1YMVA 4GOMD 4JD5A 3SQDA 1D4AA 3ZK9A 1O0SA 4BYGA 3ANNA 4R1NA 2QGNA 3HABA 4XRGA 1ZD1A 2OP1A 3JZ6A 1PNVA 1RU3A 3HJGA 5K0NA 3OWHA 4OTZA 1QCYA 5FCDA 4CM6A 1HEYA 3NWJA 4AO7A 1Y80A 4ZEWA 1SIUA 2AC2A 3D5QA 2VAWA 4RLSA 1EGHA 3AFMA 3G8YA 1G21B 2JFFA 5THKA 4JR0A 4BY7G 4ODIA 3R74A 3TNJA 2QJOA 5H7XA 2BRUA 2XXAA 4WLUA 4YRLA 3ADBA 2VAMA 2IV7A 1GPDG 1KMQA 4ZVQA 4JV2A 2C59A 4HV4A 2C3PA 4L3WA 4I9GA 2BFBA 1O3YA 3HRIA 2TMDA 4J90A 3ELBA 3OKCA 5H82A 2Y27A 3DFUA 3ANTA 1VLLA 1LV8A 5BMOA 2NVYA 2Y1FA 5KIAA 4PX9A 5DN6D 4AJJA 4FS1A 1XQ9A 4KI7A 4XXHA 2VUIB 3CX4A 4X65H 2GETA 2YWCA 1L1EA 4B71A 1EVYA 3FUCA 4N8DA 4CM9A 1QFZA 1E62A 1QDEA 1UKVY 4ZZ0A 3BHMA 2OQIA 1VL8A 2E5LB 1TCCA 4I5EA 1Q3HA 5CE8A 1Z4PX 3HR8A 1B8UA 2P30A 3T1QA 3OZBA 2W6IA 3CMCO 3EH1A 2GDZA 4LZNA 5EHIA 1T8RA 1JKMA 3CLRD 3SBDA 5B3KA 2UYOA 4LVUA 4X6LA 1PEKE 3RQIA 4OQQA 4QNNA 4B6SA 1PX0A 1O1YA 3B3JA 4US1R 1PL6A 4IWXA 4NYMR 4C2AA 1LF5A 5E9QA 2DAPA 3K72B 3ZYCA 4AX4A 3P7MA 3HV0A 1L5YA 2CV0A 4DWWA 2BE9A 3KV1A 4C01A 5FLXA 2CKZB 3VSBA 4ECYA 1OXVA 2HBYA 5IJWA 4EG1A 4DV6B 3AF0A 3G2LA 3AF5A 1ORDA 3LQ4A 3P2EA 1DFGA 3S28A 2ZBQA 3OSNA 1J5EB 3C97A 4QYTA 2HHHH 2IY8A 4CUJA 5I6DA 2H2GA 1U9JA 1LTHR 2D8AA 1W0KD 3MTAA 3ZI0A 2GZAA 5JXWA 2NXWA 5TARA 4N3GA 3DOFA 5HRAA 3UUWA 3VSCA 3W4IA 3W5JA 3R7WA 3I8OA 1J70A 4PSDA 3BD6A 2RHRA 3OT5A 2ZSAA 5KFBA 1S8NA 2J0SA 3ZHSA 2XHEA 1G3QA 2PAAA 1VA5A 4NCBA 1BN7A 2AXEA 2XZTA 3DZKA 4Z1MD 3OF3A 2JBWA 3HLYA 5KJ6A 4F5DA 3QE2A 1E94E 1GY8A 4R6WA 5HE9A 5CFPA 2W4MA 3LYAA 4X20B 1T24A 4BU0A 1PJ4A 3LY9A 4DDMA 4B4UA 4W7IA 4PG7A 4XX1A 1TJNA 3RS5A 3DAFA 2OHGA 5JZBA 1EUCA 3K0EA 2P6RA 5JCXA 4DXDA 2GYUA 3AEXA 1G8MA 4EHHA 3RKSA 3UWOA 3EQ7A 3AJEA 1E5QA 5EKSA 4IIHA 2PL1A 3CSDA 2I6QA 4US2R 3IBFA 1DC5A 1BXGA 3GLFB 5FB3A 1QO7A 3KZVA 2FMAA 4O08A 2D00A 1GM5A 4FOPA 1LBEA 2GXUA 3AXTA 5GWXA 1FDOA 1NDHA 3RSOA 2HPHA 2FX3A 4WACA 4Y8VA 4A1OA 4FHEA 1FMCA 3KSBC 3TOSA 4P7KA 2O8DB 3ONWA 4IL5A 3Q3VA 5IEBA 2QTNA 1XPRA 3IXMA 4CLHA 2AKEA 4UCRA 1WCV1 4ZQBA 5LB4A 5CXXA 1G42A 2ZRIA 2XD9A 4IVPA 2NP7A 4AYBA 3RF7A 4DJFC 4KXLA 1GYFA 1D1TA 1U3WA 1XBTA 1RZRD 2YZGA 3LHDA 4RS3A 3ESBA 3VNVA 4B3SB 1SKYB 3I3OA 3BE4A 2FETA 5DT2A 5J2UF 2DUJA 5EIWA 1UZAA 2I91A 3R9XA 1GRVA 4QVKA 3FYCA 1EKVA 1U0LA 3GJ6A 3ZBUA 1HZZA 4J9VA 1EX7A 4U7FA 3OM0A 3IJ5A 5DI3A 5TPWA 4CUKA 3GRRA 4OL0A 3CSWA 1B73A 5BWNA 4F7WA 4HUQB 4UAJA 1ZK0A 4OYRA 1AA9A 1BKYA 2TMGA 4G5YA 1FTQA 4Y6SA 2WQZA 4X5OA 1P44A 3GRCA 2I3GA 5JY1A 5ECGC 3CW2A 4HAUA 5MHTA 4ZZ3A 4PYLA 5IVDA 4EUFA 3M1AA 2Z6UA 4EBEA 4DV5H 1QG4A 2IU0A 3JZDA 5CG1A 1BWQA 3WQSB 3EVGA 1FRZA 2HU7A 1QHXA 3HL4A 3D6TB 3A0RB 4Q5IA 3C5WP 4TM8A 5MN5A 1Z68A 1MHTA 1XYGA 4I81A 2Z1NA 3ZE1B 4AMBA 3WO0A 3WYAA 1G2WA 1GZ6A 1G6HA 4PNZA 3HFSA 3BTSA 3CKYA 5HIAA 3WSVA 1EAYA 5BPFA 5TR9A 1Z7WA 1DG9A 3LX4A 4RFLA 3U37A 1RBZA 4HLUA 1DNPA 3Q8PB 2HF2A 1UL1X 5IANA 4WCVA 4RNDB 1YS9A 2ASLA 1BA2A 3CY6A 5JZVA 1GZDA 4F3RA 3ZHVA 4CZ2A 1W94A 1KKMA 2ZUFA 4BTEA 1CVIA 4Q4HB 4BN4A 4EA7A 3WL3A 1ESDA 1W5SA 2BCEA 3KLNA 5CA0F 3K9FC 2ORED 2PSSA 2V0GA 2V9PA 4FSXA 2GN9A 3CVOA 4AF7A 5L4NA 3GJ4A 1FFAA 3N07A 4NENB 1FSPA 4JZYA 4IGEA 5C8YF 5C2JB 2GZ3A 3NWPA 4C3UA 3B7GA 1A4UA 4A8JA 4WH0A 4BPBA 1ULZA 2FUEA 1EWRA 4EP1A 2OFOA 2JFUA 3U4DA 3K05A 1GO2A 2CC2A 4Z4HA 1HWYA 3RTAA 4LWZA 2PZJA 2J5BA 3GFSA 3NJ8A 3ZV4A 1XE3A 3W9BA 5BV1A 2W0SA 4UQLA 4F92B 2M32A 5DH9A 3P9KA 4TMFA 1V8ZA 4Q66C 5H4HA 1UOOA 3JQ7B 4OJYA 3I6YA 2XGGA 4O84A 5BUCA 1WF6A 3M6LA 1LQTA 1VPDA 4ZOQI 5K3FA 2EP8A 2QTWB 1FUYB 4UXJA 3ELYA 1DKQA 1DPGA 2Q5OA 4KX3A 1DQYA 4YCAA 3FLEA 1N8NA 3D6AA 2YN0A 1VOTA 4DPMA 4HP8A 3VI3B 2JEZA 2Q2UA 2OYRA 3S2EA 2VHZA 2HEGA 4D5GA 1MENA 4IIUA 4X1YB 3TX6A 4NR0A 3L41A 1K9VF 1YA4A 3CLHA 4TLBA 2VI5A 4J2HA 1TQ4A 1RYRA 2F3RA 3URMA 4B32A 4DQDA 3U9TA 3DZGA 5CK4A 4BC1A 2Q5EA 4WNAA 1HTBA 1SC4A 2OHHA 2BEJA 2Q5CA 1P39A 4X1OA 4IZHA 2WP0A 2D62A 4BKPA 4MULA 3ZX5A 3MERA 5BY2A 4RPIA 1EMDA 4ECQA 2YTZA 1KZ9A 3KYCB 3HWRA 2B4RO 4TLEA 2VDLB 4FOLA 5AVYA 4S0XA 4FDVA 3HU1A 3CONA 1O08A 2CUNA 1V1MA 4EITA 4IJMA 1I3LA 3OMWA 3FZNA 1S01A 3OP1A 2QMZA 5EXEA 3W0LB 5HYVA 1ORIA 4I08A 1QQ6A 4E21A 1JU9A 1E4EB 4YB8A 2Q6LA 1KTVA 2O06A 3PZBA 4M9CA 3PXCX 1Q1ZA 3UCEA 3BVPA 3AP2A 2V54A 2I5PO 1QO9A 2AGOA 3MVEA 4AZ0A 3OTOB 1EHIA 1ZQ1A 1CG6A 3UWMA 2QM0A 3LP5A 4JT9A 3FZEA 2VPWA 2WU4A 3RFTA 2AFIA 4MHOA 4HN9A 1JI0A 1V5GA 1WUTA 5BYBA 1Q0RA 2MSCB 2ZETA 3NHYA 4E0BA 1TYCA 4UMFA 2R47A 3CEJA 2X9NA 4D9CA 3LL4A 3SBOA 1JIKA 3DCIA 1TTPB 5ESXA 1ZR4A 2WK1A 5L4LA 4KR3A 3ANMA 6REQA 4AWXA 2ZG6A 4IRKA 2ZRDA 4YCSA 2Y9MB 5DSZA 3KV3O 1QIEA 1FZQA 2GPTA 3NUGA 5IYZB 4TQSA 1YOVA 2JAOA 2YW9A 4E3ZA 1MO5A 3GCDA 2PU5A 4TL9A 1PEAA 1LU9A 2PLRA 3RS0A 5H9VA 2W6CX 3E03A 4NNOA 5L6MB 4Y1RB 4X7MA 5BWCA 3DOCA 3WWZA 1Z0IA 3L1HA 3D7LA 4MKRA 2GLUA 2HO4A 1KERA 3C3CA 3AIKA 1GYQA 3HN6A 2QL7A 1G7RA 4IXNA 4EVQA 4D81A 4EQ6A 5TPZD 4XWWA 4KQKA 4U0JA 4MW7A 4L4UA 3KB6A 3UPDA 3S1AA 5KFTA 3V6JA 1SWWA 4Z0HO 1VL2A 2DBQA 3MINA 2AZMA 1IEXA 5LA6F 1N0IA 2BFWA 1KQPA 5C7YA 3OIFA 3A37A 1W4BA 4JHXA 1T5HX 3OY2A 3SYRA 5C34B 2OLEA 1SOMA 1QXSA 1DVRA 3P9IA 4OBXA 1F38A 2FX5A 1JXAA 1ZI9A 4JITA 4LNAA 4WY2A 3RAXA 1CYEA 5KWIA 3CXRA 1L4FA 4YT4A 1EBBA 2BE7A 5ITZB 3K9BA 3TOCA 3GVXA 4YRBA 3GJ7A 1E9RA 2Y4RA 4L8VA 3AV3A 1NOJA 2NU6B 2H2HA 2HA0A 4QFBA 3ZVLA 1I4TD 4A3GG 3IP5A 4EI8A 4ZYXA 3PC3A 1GUAA 3NM6B 3AX6A 1JJAA 2IGBA 3MUFA 5BN5A 3LY8A 1KJJA 3QKWA 5TX7A 3AR8A 3UK6A 4JI7H 3M6WA 2JRLA 1Z07A 3WLFA 3PNVA 1EUZA 1R0RE 4MUFA 3GMSA 4DWVA 3IAS1 4LTMA 3NHZA 2KSQA 2FJPA 2XXBA 2BJVA 3KD3A 1LWNA 3JQRA 3EE6A 4MWDA 3EVEA 1CD5A 4NY1A 2HPAA 1XTBA 2IDMA 2GK6A 5J2TF 2ST1A 2CZCA 4C5BA 4PINA 3G0OA 3MBOA 3I4FA 5BXYA 1UPUA 4Y6RA 2BFDB 2G82A 3RREA 1H1LB 1AKRA 2HMSA 5DGXA 3G2NA 5BQ3A 2ZBFA 3GFFA 4RV5A 3TUZC 4KE8A 5FJIA 1M2NA 3A1NA 4Y2XA 1BCRB 4YAOA 4D82A 4HPXB 4IDQA 1FP2A 3IEXA 4IQ4A 3GX1A 3KPUA 4GLJA 4PZZA 1OTYA 3UGKA 1AG9A 4L2IB 4DG9A 4KXYA 3W5IA 4ITUA 3EWNA 3UMJA 5KKCA 4AX8A 1C1XB 3AGQA 4V3BA 2O3SA 5DI9A 1GNQA 3W2EA 1JDSA 3SEZA 3KJFA 1U4SA 4ZYZA 2ZATA 1NF8A 5EJAA 3KP1A 1XAHA 3VR4A 1FMLA 1I2CA 3F47A 2FP4A 4RTPA 2FKNA 1MMFB 3VAYA 3BJMA 3CRW1 3NEYA 3ST7A 2YFKA 3G0IA 3UY4A 4KL8S 4I9FA 4PRZA 3W5VA 1NVVQ 4BYMA 2O8FA 3C3YA 3A6KA 2X4IA 2YHSA 4OB7A 2AZXA 5IAAA 1KJYA 1GZSA 2KE5A 1QWOA 1Y33E 2ZPTX 4ECAA 2YJNA 3GFTA 3O8BA 4TS4A 2EFGA 3MSCA 2J4CA 2BELA 3DTVB 1CZKA 1NJ1A 4G8BA 5LBIA 2IBSA 4O29A 3WKAA 5JSHA 5THQA 5BV0A 1ZSNA 5DMHA 5E2BA 5CA1F 2FUNB 1I01A 4JU9A 2J3QA 2XYPA 1VLJA 1UWCA 4L0CA 2HNBA 1IVSA 2DLNA 4JB8A 3WMXA 3INRA 2XCSB 2P5UA 3BA1A 3ETDA 3P9QA 2H1RA 1SK9A 1YHYA 5DN6A 3SQXA 1OVMA 1P4AA 2WMDA 1Z2DA 3QMMA 5C18A 3DE4X 1BIFA 2XBMA 4CLXA 2OBFA 3BH0A 2CL5A 4R51A 1PG2A 3NBKA 5EL0A 1XEAA 5AVUA 3WYCA 5EXTA 3EYWA 5C4MA 2HB6A 3LOPA 2QRZA 1HLDA 2WHYA 1HTTA 4GVXA 4YQFA 1T3ZA 3I42A 3KHUA 2DG2A 3NZEA 3BA6A 1HRKA 2A92A 4HGZA 2ZLBA 1P9LA 1T5LA 4PRYA 4BPRA 3HYCA 2P7IA 3EBPA 1SHLA 3QOYA 2O2HA 2PA0A 3TQHA 3EOAI 1ZCBA 4P4SB 1MFZA 2BL4A 1YT5A 1KXZA 4M0FA 4CKBB 2BFMA 4J2OA 1JGTA 4X91A 4JJFA 3I2HA 4D9JA 1H2XA 3SIRA 2B63G 3V2UA 2G6TA 3H87A 3IQHX 2QAIA 3NB0A 1JDEA 2XE4A 4X9XA 2IXGA 3EZLA 4NBNA 4GYKA 4HLNA 4NX2A 5BMVF 5TDHA 3L9XA 4O4JB 5DO9A 4G86A 3RUAA 1W0KA 1QQ5A 2WV9A 3HDJA 2A86A 1DBIA 4X71A 4G0XA 4Y9TA 3EVTA 4B7CA 3PR1A 3NP7A 5E7QA 3ILYA 3O8LA 3FNIA 1V16B 2HU8A 5K99A 2CHVA 1UBMS 1TC1A 2XCRB 2YWEA 3KR0A 4P9NA 2W6ID 3RT9A 5KT4A 1RYHA 3FGZA 5EJ9A 4Z1MA 2FZVA 1JP7A 3JQ9C 4E51A 3H9EO 1M0EA 3ABZA 4IFTA 9GPBA 1JEAA 2ZI4A 4K8OA 3PDHA 4FYJA 4DV3B 4LF5H 2ZQ5A 4YAWA 2V97A 4PCLA 1F17A