4MA0A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with partially hydrolysed atp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
366
structure length
366
Chain Sequence
b'MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with partially hydrolysed ATP
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 120
structure length 366
sequence length 366
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma0A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma0A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma0A01
5C1OA 5J2TF 4O2BF 2GPWA 4I55F 4EA9A 1KBLA 3TIGA 2VQDA 4MA0A 3R5FA 2R7LA 3NUAA 3OUUA 4FFOA 5JVDF 1EUCB 3TIIA 2GQSA 2SCUB 2ZDHA 3JZFA 4O4JF 2YWVA 3BSWA 1CE8A 2I80A 5KX5F 2OLSA 2FPIB 3KAKA 3TQTA 3ORQA 2V59A 5JQGF 4DIMA 2CQYA 1B6SA 2PVPA 4MV9A 1ULZA 2CNVA 1M6VA 4L1KA 2VR1A 2DLNA 3BSSA 2VHEA 2CNQA 1T36A 2YZNA 1EZ1A 4RZQA 4M9CA 3OUZA 4FU0A 4XYLB 3JRWA 3U54A 5CB4F 4O7NA 3R5XA 3R9RA 2DIKA 5GONF 4EGJA 5BMVF 5JVLA 3R23A 4IHJF 5LA6F 1GLVA 2FPPB 4EA8A 3E5NA 4WD3A 1A48A 5HBRB 4ZOLF 1Z2PX 4MV8A 3BSYA 1C30A 5CA0F 2YRXA 3U9TA 4MAMA 3KALA 5FNVF 4MV7A 4O7YA 4O7ZA 3GIDA 2XCLA 4J6EA 2R86A 4FGRA 4ZQIA 3BFPA 2NU7B 1WR2A 1CQJB 3Q2OA 2J9GA 4O7WA 2W70A 1A9XA 3RUPA 4MV4A 2W71A 4YB8B 1SCUB 3WNZA 3U9SA 1KJQA 4O4LF 3UFXB 4YJ2F 5HV6A 4MV1A 4EAAA 3WO1A 4WBNF 2PBZA 1VBGA 3TW6A 5BPHA 2R82A 3Q1KA 5J2UF 1GSOA 4FFNA 4FE2A 3ORRA 4O4IF 3HB9A 1GSAA 1EYZA 3BG5A 4NYEA 2W6ZA 4O83A 4IWYA 1KC7A 4O84A 2W6PA 2W6MA 1UC8A 1PX2A 3ETJA 3MJFA 4MV3A 4DLKA 1UC9A 1KJJA 4EGQA 1JDEA 2GLTA 5EZYF 4O7SA 4TV8F 4QSHA 1GSHA 4ZI7F 1KEEA 4XZ3B 3RFCA 3HBLA 4MA5A 1BXRA 5LOVF 4TV9F 2XD4A 1DIKA 2YRWA 4HNVA 2HGSA 3LWBA 1VBHA 4FFMA 1M0WA 3HO8A 2YZGA 1DV2A 3WO0A 2FP4B 5DMXA 5C8YF 1IOVA 5IYZF 3DF7A 5H80A 3JZIA 2W6NA 4O4HF 4O82A 1PK8A 5K2MA 3MWDA 4EA7A 2YL2A 2YZLA 2NU9B 3V4ZA 4HNUA 5LXTF 4O7RA 4C5AA 2QF7A 1I7NA 3KAJA 3R5HA 3VPDA 4E4TA 3VA7A 1CQIB 2I8CA 2VPQA 3G8DA 3V4SA 2NUAB 2W6QA 4O7TA 4ZHQF 1E4EA 2CNUA 1GGOA 4HNTA 4YAJB 3SE7A 2X0SA 1EHIA 5JH7F 4O7VA 3JRXA 1I7LA 3GLKA 2R7KA 2R7NA 4I4TF 2ZDQA 4HQ6A 3AW8A 1C3OA 2YYAA 1IOWA 3K5HA 1AUVA 2DZDA 2Z04A 5I47A 4O81A 1Z2OX 3VOTA 1KJIA 4O7LA 4M9UA 3K3PA 3RV4A 2IP4A 4YBZB 1JKJB 1CS0A 4FFRA 5CAEB 4C5BA 2W6OA 1Z2NX 2Z02A 2YS6A 1W93A 1KUTA 1KJ9A 2R7MA 2C00A 5D8DA 3TINA 2HJWA 3AX6A 3QFFA 2DWCA 4IZOA 4FFLA 4MV6A 1M0TA 2FPGB 2FB9A 1E4EB 2GPSA 1OBGA 1OBDA 1KJ8A 4HR7A 4O86A 2P0AA 3VMMA 5JQWA 4EABA 4O2AF 1BNCA 2ZDGA 1B6RA 3N8DA 1JLLB 4TUYF 1W96A 4C5CA 5KKNB 2R87A 1VKZA 2YW2A 4XX0B 5BPFA 2V5AA 3I12A 3MWEA 4GGMX 4I50F 3LP8A 2R6FA 5LP6F 2NPOA 3VPCA 2CZGA 2I87A 2WYOA 2QK4A 3RV3A 2YZMA 5LYJF 3K5IA 3ETHA 1JDBB 2R85A 2GQRA 4M98A 2NU6B 4XYMB 1DV1A 4ME6A 4FFPA 1EUDB 2NU8B 4IWXA 4Y8VB 3N6RA 3G8CA 1AUXA 4EG0A 5CA1F 2YS7A 3KREA 4IIJF 2R84A 3U55A 3VPBA 2PN1A 4YAKB 4M99A 2V58A 5C1PA 4YJ3F
chains in the Genus database with same CATH superfamily
3FRJA 2C2MA 1E1KA 1XDUA 2DBZA 1UDBA 3TZCA 5B6JA 1QGUA 2QX4A 1JGTA 1GKYA 3UJ8A 3O74A 4IH1A 1CE8A 2VUMA 3LH5A 4QIWE 3NBFA 3ZVNA 4H4EA 2ZPUA 3SS7X 2IIVA 4ILKA 4AMYA 3EIEA 2MMGA 3E4DA 5L4NA 2GJ8A 4JYAB 4QDJA 1XEXA 1Z47A 3WYGA 1XPRA 1D0IA 1GPUA 2WTEA 5CX1A 4TN5A 3AKCA 3IIKA 1TM4E 4AQ7A 3OMWA 4IX1A 4KXFB 3AU9A 3S2GA 3BBLA 3UWDA 5JJIA 4O7YA 4F06A 2XCLA 1SIUA 1DXYA 3LYUA 4QXPA 2MYUA 4C7KA 2F7SA 4K88A 1N0WA 1O2DA 3KKEA 1QE3A 2QLMA 3FB1A 4EJSC 3WWPA 5CNIA 3FKJA 4DYDA 3R3XA 3UMFA 5C9ZA 1GHTA 4ZKDA 2UYGA 3SC4A 3TBFA 2ZBGA 2LW7A 4GOJA 3G2OA 2HAEA 1O96B 4GP6A 4A8JA 4QGGA 3JVEA 4UU1A 4KB5A 2ALJA 2R8KA 4HEJA 1C1DB 5ALKA 5EIEA 2FQYA 5I7OA 4IDGA 3KTAA 1E9EA 3S2EA 1YQQA 4NH0A 1Z38A 3CY6A 4P0QB 1S2NA 3NDRA 1HM5A 3QVKA 4C4PA 4QQFA 2RFLA 2QP3A 2K7ZA 4F6RA 1HYBA 4B4WA 2YV4A 3IE0A 4CV1A 1U31A 1ONNA 2J67A 2PMZA 4FYYA 2ZJYA 3NDJA 3HKBA 2CMHA 2BMWA 3PITA 1KTIA 4O82A 3HLTA 3GYGA 1SHLA 3WRVA 3VPGA 3EOZA 4O4IB 1E63A 1EFRD 1H8HD 3ZWAA 4MS4B 3FF1A 1QB7A 2H85A 1QRSA 3L2OB 1ZSNA 5HBGA 2VNAA 4U2EA 3CIOA 4LRUA 2W6ID 2IXFA 1P2DA 1EPUA 4KWEA 4HH3C 1QO7A 4KAJA 4FNAA 1RI5A 2VIIA 5EMJA 1F4VA 4DV1B 4YRPA 5CX4A 3JWEA 2FUEA 1UNNC 2HHFA 3L9WA 2E9SA 3U37A 4QW8A 2BBTA 3PIDA 2QLBA 1NVAA 3U4IA 5P8WA 4KJXA 3BTOA 4G5OA 5AW8A 5JJ5A 4BGVA 1XYYA 3BF8A 1K06A 3ZQKA 3GH3A 4BMZA 2QAGA 4JI3H 2ZYDA 4ER7A 3DWGA 3LUGA 1KJ9A 4LF5B 3E9DA 1IY0A 2BFBB 2I1LA 3TMAA 2X1LA 1VFPA 2UZAA 1HBJA 1NBIA 1NYRA 1SXJD 3CH6A 4YEDA 3HE3A 4O29A 3DDZX 3H84A 5FBQB 4MUAA 2RGEA 1E0JA 4C2MA 5FHQA 3TLKA 1KYWA 1LNSA 4I4TB 3SYTA 3TD6A 1GADO 3CHYA 1EESA 3HCDA 4UCUA 3NBMA 2ZU0C 4RD1A 2W83A 3U31A 1A97A 3LTEA 3H5LA 1L5GB 1YZ3A 1RAGA 1WZNA 3DT8A 1XTKA 2I6UA 1V6AA 4L2IB 2J9ZB 4HPWA 2WYOA 3KHRA 4N12A 2CDBA 4L4RA 2M32A 4GX1A 3WRXC 3AOEC 3IVRA 2AD5A 3Q3IA 3PNOA 3DBLA 4N0DA 1XDBA 3T7JA 4LFCB 5CDUA 5IPFA 3M6VA 3JQFC 4BFLA 4XGIA 2EZUA 5DIFA 4ARAA 3HADA 5HMMA 1SKMA 1LVGA 3EWSA 2VNIA 5EHGA 2GAIA 4Z6KA 1SB9A 4I4CA 1MXFA 1M2EA 2BFEA 2CXOA 2ACWA 4EA9A 1HYGA 1HNZH 1NZFA 2GYUA 1XF9A 1ORWA 4XCVA 3TVTA 2OQ2A 3C3BA 1NY5A 5C5EA 2YQ5A 2QT1A 3QNMA 1DIOB 1QRDA 3LNCA 2OK8A 1BKSB 2PRYA 3CW8X 3UMSA 2H2AA 3SXUB 4JJFA 1JEQA 3BH6A 3B38A 4YHBA 4I46A 4NESA 3VZSA 2D5BA 1L5ZA 4TSKA 4EVRA 3O2SB 2XYQA 1PSZA 2JL1A 5JUMA 3V5NA 2I4RA 4I0WB 3EODA 3TSZA 5CK5A 4ARZA 1JHQA 1IXRC 2DIKA 4H0NA 1IQRA 1WKVA 3GY0A 4MZXA 3ASUA 1EJ0A 1E4FT 5HBRB 3PHGA 5SZHB 2FLKA 1V1JA 3M6IA 2A3RA 4G0PA 3FWPA 5ITSA 3BGSA 3IMCA 2WP8J 1ZL2A 4D4LA 4LHVA 1Q12A 5AM2A 4WY8A 3VKFA 2N0SA 2W2TA 1WU8A 4RY2A 4B2YA 1WEKA 4Z4FA 1CFZA 1SCUB 5AJVB 1QKIA 1Q11A 3R0QA 4C9BA 3VZPA 4RF5A 4URZR 3N0WA 4U0JA 3WHLA 3WL7A 3VV3A 3IQGX 1GARA 1PVOA 2V4MA 5C7OO 3PJEA 5IDWA 3N2LA 1JJIA 5BMOA 1UZAA 5I5YA 5HCIA 4Z1MD 4CMHA 3K15A 2QRZA 4FMDB 5DK4A 2Q5LA 1ZDMA 4WAUA 3TECE 2PNJA 4MV3A 4JHLA 3V7WA 5FF9A 5KFXA 1ZVJA 3AEQA 2HF7A 4OMCA 3SC2A 1BFDA 1UBFA 3ZWCA 5E9WA 3O7WA 4MYRA 2R6JA 3NHYA 4JC5A 1XT6A 3IXMA 3GR6A 4RJIA 3DL7A 1U1DA 3KBOA 3QEKA 5ICCA 1R0YA 3PNBA 5E3IA 5JNTA 3VO1A 3A6KA 4B3HA 3MWFA 5C8YF 3IL2A 2WA2A 4BO2A 4TZKA 2DY1A 3EIWA 4J0EA 3LUFA 2AI1A 1AKVA 3QMVA 2A9PA 1YJCA 4OGFA 2XNCA 5TMPA 5IT0A 3P9ZA 4BKUA 4K05A 3KZOA 2QPOA 1V4BA 1F8XA 4JKYA 3ZN2A 1Y6GA 1A9SA 3ZTTA 4LF5H 4U7CA 1YO6A 4C0SA 3VOTA 1NM5C 1X2BA 3C3KA 2CVZA 3JQPA 3FNFA 4IO0A 2KM1A 1I6LA 1OX4A 2AYZA 5I60A 1TMGE 3SSAA 4CC6A 5BYKA 2YASA 2VJKA 2XQGA 3W6PA 4WOPA 3EC2A 2WMNB 4YCSA 1NZDA 1XA0A 1CIPA 2PAFA 4GI2A 5BSMA 4EWLA 3DDOA 3I42A 5MFPA 5JAOA 4AQDA 2UUCH 3FTQA 5ALMA 1ZUWA 4DC0A 1Z4NA 3N40P 3UJHA 1XEWY 2C3MA 4QPZA 4ILEA 1HURA 4K6GA 1ZG3A 2V3CC 1E94E 1OMOA 1WPQA 1D04A 4DNPA 3JZAA 1UDWA 3WYEA 2X8BA 4DL4A 4BRWA 3VPAA 1P60A 1WDLA 1H0RA 2XOKD 2VDVE 4PHCA 2NPOA 4YRQA 1TK9A 5EWEA 5DM70 2XUGA 2BONA 1B15A 3GJZA 3AWIA 3RUDA 1RJWA 1N3BA 2XAAA 4GR9A 1JR3E 4QBIA 1UJCA 2ONYA 1BDBA 2I34A 2Q9BA 1RI1A 2VP5A 3HCEA 1T1GA 3AWDA 4UU7A 4OQLA 4EUSA 4F7DA 2ZUVA 3S40A 1PFWA 1R9JA 4JUFA 3N8GA 4EKDA 4AYBA 3OF3A 1Z0FA 2I2BA 4AQYB 1XK5A 1RK5A 2WABA 3K4HA 2AUNA 4MUKA 4LIPD 2H4JA 3M5WA 3FPJA 4PR3A 3KTOA 2XB4A 4MJ7A 4RSRA 1YC2A 1NXWA 2GHQA 3ZLBA 4TLAA 3QMMA 4UTOA 4TOIA 4WE3A 1JMYA 3WGTA 5BOSA 3M0EA 2FQXA 3JQDA 2CKMA 3ECSA 2ONKA 4JBXA 1T36A 2PGOA 3Q41A 3HBMA 3S29A 4MUFA 3SCZA 5C8YA 1OLUA 2ZB4A 1Z73A 4U7WA 3GPIA 5J4VA 1TM5E 3OQ6A 1PJZA 3QLTA 4NC9A 4EI8A 4YRSA 5E9AA 3L93A 1ZM2A 5FQOA 4DKJA 4HDMA 3QUSA 4WZBE 2IZ0A 3PQ7A 3V9PA 2IEYA 1NKSA 3HOWG 3BYZA 4ZQIA 1SKBA 4CTKA 4WLFA 4IOMA 2PSDA 1HQYE 3T3OA 3SZGA 2AD1A 2PANA 2V7VA 5FCDA 2IYZA 3MTQA 5CCXA 2W71A 3SJUA 1E66A 2XMQA 3T1TA 4KLNA 4N3NA 4K5QA 4X97A 1GAWA 1AZLA 1UL1X 3U6BA 4MRSA 4WBNF 1W85B 1MVLA 1I4DD 1TC1A 4LXXA 5IUJC 4PDBA 1G3RA 2MCFA 5FB3A 4H1WA 4M6WA 5DW3A 1C8LA 3JTEA 5JXJA 4BFSA 4U9HS 3OLVA 3TLMA 2EHDA 3EVFA 3RRMA 1O6ZA 2NO7A 1BXRA 1DJOA 3NFYA 4H3KB 4B3SB 4BX2A 4M0DA 4LNUA 1W52X 1NIPA 3CINA 2JGMA 2E7ZA 3D59A 4JKOA 2WYVA 4NABA 3RB3A 3CW9A 1YSCA 4PN3A 4X60A 1TCCA 1QX4A 4W99A 2PGNA 1A72A 4QBFA 5TF4A 1ZD1A 2RAPA 2ZZNA 1Z6YA 3SYKA 1XQ1A 4EGAA 2EWWA 4CC5A 1U0SY 3BXOA 4FDUA 2BFMA 2VBCA 4MKXA 4MMYB 2V8BA 1YL7A 1IXSB 3RYIA 4UNRA 3AESA 4TL8A 1RLOA 1KC1A 1WXFA 4P4SA 5TQVA 1NOKA 1W88B 1F0KA 2N1MA 3JD1A 3JQGA 5A3SA 4AZ0A 5KC8A 2FDCA 3L0SA 3INTA 2CLCX 2ZJTA 1SA0B 1VB5A 4P0TA 2P6PA 1PFGA 2MMCA 4IXNA 1RIIA 3NIFB 4QHSA 4FILA 1B14A 4OJNA 3RGWS 2BMFA 4FBUA 1OXKB 4K6KA 2ZZMA 1A9OA 1SULA 2F4NA 1IZ8A 2IU6A 4YMIA 3CLSC 3KQVA 2GD0A 3AG5A 4ERNA 4PYJA 5JNLA 1KRHA 4U6NA 1EUZA 3P9QA 1Q14A 4ZRNA 1JN0A 4NCNA 1XVIA 1EM6A 3MBKA 1GGMA 4GECA 4MI9A 5KFJA 3ETCA 3GXOA 4XDGA 2AQHA 1NMQA 3U4GA 2WAXA 4AJ2A 4D97A 4Z54A 1Q0LA 2B7LA 5G40A 4DDVA 2OFPA 1UBOS 1BG6A 5KO2A 1I4LD 2SECE 4QUDA 1G16A 3QWIA 5SY6A 3BL5A 4WKCA 5IAKA 2UVUA 1J0XO 4X3CA 3R76A 5GZ3A 3H11B 3N3AC 4WT7A 1CK4A 4LHWA 1U9ZA 3F3KA 4MVJI 3NIGB 1ODSA 3IP1A 3UA4A 1JBEA 3FPCA 5TT1A 1QK5A 4DJAA 3IQXA 4WBNA 5EXDA 3E48A 3CPHA 2BSXA 4CCYA 3AEYA 3B1XA 4AWBA 4WESB 4QD3A 5LCXA 4TUYB 3AVWA 4J1QA 1E6MA 3L6RA 4PX3A 3KD3A 2YWVA 1P44A 5F1PA 1G59A 1N3IA 5JRZA 1ZH0A 1NRXA 4FHFA 3IAS6 1KEZA 1USUA 2OZLB 3DHWC 4YVFA 1SFOA 4KK4A 2VUGA 3FPAA 2CHVA 3CSUA 4E5NA 2PUGA 4EBEA 2OHGA 2WIJA 2QUZA 1YL6A 3W2TA 4KRFA 4JB0A 4YMHA 3NLLA 3CN7A 1Y1VA 4O7NA 1TD1A 4J75A 3L41A 2H4HA 5IK2D 4UHDA 1KSJA 1ZEJA 4KWTA 1DL5A 1UPTA 1B76A 3RWMB 5TV2A 3I2YX 3H1FA 2O3TA 1ABEA 5CVUA 1O87A 1YFJA 4I1PA 1OIVA 2PUEA 2I6SA 1U3WA 1IAQA 2BJVA 4EBFA 2Z6UA 2DSTA 3ZDBA 3MCVA 2O0JA 1SFRA 4CQJA 5A5DA 2NPIA 2ZOSA 4WUVA 3F6EX 1XZKA 4B6SA 1J5XA 3I73A 1JQ5A 1TK3A 4M46A 3CFYA 1R6VA 3RAEC 2XB9A 2P9FA 3KOOA 2DPGA 3C6XA 3R7WA 3U09A 2PUDA 4XQ9A 4YQFA 2W6JD 2H1VA 3EOAI 2NIPA 3C41J 3H2BA 5FR1A 3WK5A 4ZV4A 1RP1A 1EUDA 4UVGA 5KYGA 2HQSA 3P9YA 4UHFA 1P9WA 1ZR2A 3C1OA 3NGLA 1OI4A 3EGCA 5BR8B 3VR1A 5HHTA 3LYAA 1DTWB 4R9VA 3RM3A 4REMA 1NX9A 3NAZA 4NSNA 1BEEA 3HRHA 4FZ3A 1J9GA 2JLWA 2J3HA 1WULS 2PH5A 4E6PA 4OH7A 4S1PA 1A7AA 3KR1A 3GTLA 4UBJA 5FNZA 1E9SA 2ZBEA 1M2OA 3A6FA 1D1PA 1Z29A 2PTGA 1XQXA 1GPBA 4MVXA 5B55A 5CB8A 2CL5A 2NP7A 1VLLA 1BXKA 3GP3A 3WLNA 5FOTA 2C5FA 3RJTA 2XGPA 3I9MA 4E09A 3HDJA 3PGKA 1B41A 3N0TA 4JROA 4UNIA 5ITWA 1X39A 1RLMA 5K0NA 4AKTA 3LPDA 3PPYA 1ORHA 2AF4C 4NZPA 2YYAA 3H3JA 4TZTA 2CXHA 1AUVA 4EHJA 4DV3B 4KW7A 4U8HA 3S2FA 3HOXG 1TYDE 4TTAA 5ILOA 4NMLA 3ZQUA 4Q7JB 4M1QA 5G1OA 2E37A 2PR7A 4CIXA 5GV7A 2YN2A 2GCNA 1UEXC 4XPIA 4KQMA 5HGJA 4V38A 4XLZA 4Y8VA 3A1FA 3DZIA 3VDNB 3SOZA 2GK6A 1H1TA 1XXHB 1JIXA 3UM9A 3PEWA 1PD1A 4TMWA 1GFSA 4I1RA 3EGWA 3ELUA 2A4KA 1DEAA 1S97A 4BV3A 4GVXA 1MH9A 2Z2JA 2FSPA 4LRYA 1R15A 4R98A 3PFIA 1XNGA 1Q7CA 4DR5H 4O3MA 4EQZA 1XVLA 4ZVTA 2L82A 3D0RA 4BHTA 3FPHA 3AYHB 4K6FA 4QTTB 1JKFA 2JIQA 4Q44A 3ZS9A 1YVPA 3G0BA 2ISSD 1WV1A 1V5FA 3CKMA 5TQ0A 2XZPA 2AG8A 3ROGA 3RTEA 3FM9A 1WY5A 2I7DA 2XLCA 5TPZA 1S3IA 5JSZB 1NVBA 1ZI9A 4GPTA 2CXQA 3QXCA 4OGGA 4P86A 1TA9A 3JS5A 5AXAA 2PN1A 4KAAA 1T3HA 4LC0A 3OTGA 1ECJA 1O6CA 7MHTA 2P2SA 1G0NA 1VHQA 1ZJYA 1SYXB 3SVLA 4X7PA 2CC2A 4D74A 2XUFA 1GQ2A 3TFWA 9ATCA 3UQ8A 4RORA 3LVQE 4A3DG 1QGAA 4XM0A 1DBWA 2W8ZA 4PBTA 4YAJA 3JD4A 4ZI3A 3ZS8A 1KO8A 1I24A 4PYOA 4TMYA 1OTHA 2M6LA 1C41A 4X1OA 1CJKC 4QBGB 4S3MA 4TYNA 4ETIA 2FZKA 1B74A 2PDAA 3AT1A 3WHPA 4CWAA 3A1EA 4WEOA 4RETA 4H7KA 5B6PA 3NAQA 3NHMA 1M34E 1U8AA 3DFFA 1CD5A 4BNZA 4QTYA 2AR7A 4J9KA 2E3JA 2PWBA 4CZ2A 1DU4A 1JXQA 3D0OA 4GRAA 1DPFA 4DV0H 1W4BA 2HXGA 1HE5A 2NUPA 1T8RA 3B3FA 1A9XA 4IUYA 1DO2A 1A4UA 2D5IA 1W48A 3Q6NA 3T7DA 2F1RA 1K8QA 1SB8A 3BHNA 2FTKE 2BFDB 3TIFA 3BG5A 3WV5A 1FJ2A 4IRCA 2QTHA 4O84A 3ZCPA 4YRCA 4J9MA 2UXCB 3PUXA 3GQVA 5B1HA 4L76A 4XKJA 3M49A 4Y2HA 4PQYA 3ICQB 1QANA 1YK0A 2O8EB 1N6NA 1UPCA 4TPKA 1PZMA 1HH4A 4JI0B 4HYTA 1IVNA 3MPUA 4P4LA 2W4IA 3K0CA 5AHKA 1CFJA 4I1YA 1Q91A 1W5FA 1Y3BE 1Z68A 3STVA 4CKEA 4Z86A 5EEHA 4W9NC 1FLVA 4H6PA 3C97A 1QBGA 5K3OA 4KSYA 3QLEA 1JILA 5JCZA 1DAAA 4KN5A 3AHJA 1N6PA 4US0R 5EJ8A 2AN1A 1LDBA 4E4TA 2I8CA 1I36A 4GKBA 3CN9A 5TR9A 4GLJA 3DKPA 4DV3H 1QORA 2OO5A 5EMHA 3AF3A 2YNMA 2YV1A 4ZI7B 1PFKA 1S0OA 1TVMA 1C5KA 2JBWA 1XQ6A 4JQYA 3JAKB 1VE3A 1ORRA 4MR7B 1FXWF 3S1SA 5TVKA 3RCBA 4D4IA 2QS9A 4WWHA 5CBPB 1RJ9A 4AFNA 1XA4A 3JYOA 3I6MA 4J16A 4YXFA 1SG9A 2K6GA 4JB8A 1W94A 2MINA 3ONVA 3CVWA 2OHHA 2G08A 2NO1A 2ABJA 1FFYA 1QQTA 5KT3A 1N2JA 3H0CA 4DLXA 4P3OA 3MT0A 4JLVA 3M34A 2IA6A 3O6VA 3S28A 4E5SA 3I04A 2B94A 3H16A 5LZ9A 4DMGA 4BKRA 2JJMA 3EQ9A 4P2GA 2X58A 3RFTA 3GGPA 2PMBA 1TTQB 4C6SA 4CDNA 2Y99A 3H1PA 2ZSAA 2R6CA 2XMRA 2XCIA 3P9PA 2A58A 3KT6A 4KCGA 1EHYA 4M1KA 4W4TA 1IFXA 4IKPA 2VC2B 1U2DC 4HZUB 3L77A 4AP5A 1T4MA 2H1IA 2Q4EA 5EGSA 2WU0A 1YIDA 1SXIA 2OCXA 2Q4DA 3ZZNA 1X7GA 2I7VA 4DSZA 1T4CA 3JARB 2B5OA 2NT3A 2QK4A 3ZE1B 5CITA 4A3CG 1AMOA 3N6VA 3C8UA 3KQOA 3DV9A 3O9VA 3G0IA 3WNVA 3D1JA 1TWCA 1HT2E 5C5DA 3OEED 3ASYA 5FLMG 2ZTLA 3C0KA 3QBEA 1ZMRA 5TGDA 1MX5A 1NC1A 3KPJA 2FP4A 4IIJF 1V8OA 4BX9A 2XNDD 1YCHA 1K8XB 1WUHS 3V8EA 1IPFA 1K6XA 2GPWA 4FNOA 2H65A 2PLFA 1N5IA 3EUFA 4Q45A 3SS9X 1R64A 2FI1A 4RAQA 4HNAB 3KJFA 3V4OA 2OLSA 4Q3BA 3DAGA 3E23A 2VJOA 2PA3A 3G2HA 2IY7A 4BEBA 1W0JA 2UUOA 4LZPA 2CYBA 3PFWO 2WIFA 2HJRA 3THSA 2KMLA 5EHQA 2PKEA 4KI0A 4P2BA 3OPYA 3GJ4A 5EWLA 4XRGA 4J0IA 4L75A 3LV8A 3A0UA 4I55B 2ZJAA 3IUBA 4DXAA 2CBXA 3KSBC 3BFKA 4H6XA 4GL2A 3E5NA 2JGDA 1D0SA 1JZSA 4IZHA 3H99A 4MGZR 4TQGA 5MHTA 3PI7A 3A25A 5FPOA 4PPYA 3D7MA 1UJMA 4J6EA 3BFPA 2B4RO 3IALA 1XRPA 1VG1A 4N7JA 2XE8A 5DYGA 2VYND 3IO3A 1PR2A 2M6KA 2UXCH 1FXWA 3NWJA 1H6BA 4XB1A 1K9SA 2R79A 5DLEA 1XEWX 4M8IA 1J2TA 1R7RA 3VV2A 2NADA 1RZRA 4YUXA 3MRTA 4GPBA 1DRKA 1GEEA 3DTVD 1PX2A 4Y1FA 3FCSB 1NVEA 3FYUB 5AHRA 2AYYA 4XB2A 3C3XA 1BH6A 1DGSA 4LF7B 5B58C 3FFXA 3H2GA 3EXHC 3O93A 2VPPA 3RJ9A 2YZKA 3E9YA 3PNLA 1B6GA 4H7FA 1QVWA 3HCOA 2PT6A 3B53X 1LF0A 1N9KA 1AC5A 1U8TA 5DCWA 2WSYB 4G5SA 1SQSA 4NICA 2YXBA 3RVNA 1VBFA 1PWXA 3HZHA 4AYXA 4ATNA 3QU7A 4CM3A 3C87A 1SZJG 1ZVKA 4ZJUA 1K7SN 2BEWB 3GRZA 3OU7A 2QN6A 4I3GA 4ESVA 5B30A 4KQJA 2P30A 3LT5A 3RT7A 2BBWA 3WYCA 1QP7A 4PTLA 3OIVA 5A9SA 1I1OA 4L4XA 3X44A 2PS3A 2IYNA 3GAMA 4EJ2A 5CPFA 1XTTA 2PRKA 4IIJA 1APBA 1NBWB 3CRMA 4ZO4A 5KOJA 1XZFA 1YZHA 1QMPA 1QGYA 5JXWA 2QBYB 2WU3A 2YOFA 3KSRA 4L0MA 3BZBA 5DOZA 3B2NA 1CS0A 2ZWPA 1X3SA 2YS6A 1GPKA 4QVGA 1ES9A 2QQEA 3B6MA 4C2TA 1VC2A 2BVNA 4TVKA 1JZQA 5IXJA 2YX1A 4XUGB 3WHIA 4QT4A 4IDHA 3HOVG 3SR3A 3M4IA 1WSDA 2JFOA 1XTZA 4BQNA 2JJ2D 4Q1DA 3FUXA 1KYZA 1H9CA 2IKSA 5H8WA 1FNSA 3JQ6A 5L95A 1XZGA 4R9UC 1PVDA 3RRZA 5KSYA 1FMLA 5JYEA 1NQAO 3ZX5A 2CHGA 4TKVB 4BDSA 1DT5A 1JIIA 4F85A 1NRIA 3FNBA 2FMIA 1GM5A 3DDWA 4B35A 3WK9A 2VBIA 1BFKA 3Q8QB 2Y71A 4BKMA 2R6FA 4PFKA 3E81A 4DNQA 2I87A 2WE7A 5K8VA 2XR1A 5DQGA 1ECPA 1ZGZA 3KZ1E 4J1TC 4ZZ2A 2A88A 4J0FA 4CT4B 1RXUA 5DCUA 4J03A 1A9QA 3OFNA 4N6GA 1XLVA 2PGIA 5JEDA 3AJ8A 2WDZA 1YJXA 2BJWA 2BEVB 2EZTA 5IT4A 3EJ6A 5DNEA 4LCJA 4O2BF 3PPXA 4L78A 1D6JA 4PIMA 4YGYA 3W2GA 3A32A 2VTVA 1G20B 4DA4A 4O63O 4PX5A 3LE8A 2R5FA 2GYWA 5B36A 4URXR 4UHKA 4DSNA 5HK9A 4PS1A 3BEDA 5JD6A 1QUFA 2I3BA 3GIPA 2DJIA 4KZPA 1Z5GA 2G28A 1CETA 1NMZA 5JC1A 1GNQA 4ZJPA 5H81A 1N92A 3QFCA 2AYXA 4FE3A 1X1RA 2BCGY 3U0GA 2C95A 3NH9A 4MI1A 4DIBA 3F71A 5IH7A 4EVSA 2FMUA 4ZJYA 1KH2A 1VMIA 2COGA 3FPBA 4F3RA 1YBAA 3T1YB 2UZ1B 5GJBA 3TOZA 1OLXB 1Z2PX 3ROEA 3KB1A 3RI3A 2G25A 3EUEA 3W3ZB 2C9ZA 4RE6A 4ENSA 1F8YA 1JTFA 2Z5VA 2WWRA 1GR1A 1WR2A 2GZRA 4W1PA 1U6KA 2HUPA 2IHZA 5E6RB 3TOSA 3B1FA 3BRWA 1EWQA 5HV6A 4B84A 1UANA 5M2QA 5CFQA 1THTA 4V0RA 1OVGA 3U1TA 4LF7H 3KWJA 3UQZA 2AC4A 1NVWQ 2FX5A 2C5HA 3E05A 4HXYA 2YVAA 5HJEA 5I8WA 2C9MA 4K9DA 4DUYH 2NVUA 2DPHA 2JGAA 1DC7A 3B9BA 1P77A 4FUTA 5THQA 2RIPA 4ACAA 4CMBA 4A5OA 2IV3A 3EAFA 3DDSA 4RHYA 2Y68A 3KQYA 3JWGA 3EVGA 3BD8A 4G01B 1Z6ZA 4UTPA 1P7CA 1PN3A 5DEIA 4FYWA 4P4UA 1PL8A 3DDCA 1P6XA 4U7DA 1I3QA 4Z2AA 2GAJA 5LZ7A 4NF2A 3LWBA 2YJZA 5JNSA 4I9HA 5EJ5A 4HP8A 3ZKWA 1EX9A 3ASZA 4JI3B 2I4TA 4FS2A 4P80A 1PR9A 2CWWA 5JYCA 2PBLA 2XUPA 5KQGA 1ENZA 5LZ8A 3HKCB 3UYKA 2V7PA 4Q4AA 1UMDB 3FYHA 1JAXA 2GD6A 3ZXSA 3IA2A 2J3JA 2IX3A 1OW3B 1PZEA 1E0SA 4IVNA 1FX0A 5A03A 2M1XA 3DM9B 4JXXA 5DYYA 2D0OB 1NN1A 4MYTA 2FRVA 3COJA 5DM60 1IIBA 2ZDQA 3PN1A 4GOMD 1MQ8B 5CFMA 1R4NA 4MGHA 4O2BA 1WCV1 4NCKA 1CB0A 3V1UA 3K35A 2B8NA 4O7LA 5COBA 1E9AA 4B3CA 3NEYA 1DLIA 3FTPA 3V97A 1OIXA 2FZEA 2W98A 3GCXA 2XUJA 1KMNA 1EFPA 4OP2A 3RS4A 4GZMA 2B36A 3P2KA 3FFAA 5C7YA 1HNZB 3QV1A 4W7IA 2H6EA 4C6TB 1AS0A 2QRUA 5KFZA 2UUPA 2B3DA 4ZTBA 1WF3A 5H82A 3EXFA 3IX7A 1P1KA 4EFBA 2XWQA 2QX6A 2J5RA 3GC6A 4IQ4A 2XMZA 1NAHA 3AUYA 5C4IA 1QVRA 5FXMA 1CVRA 2HHLA 5I9MA 1KIMA 3E9CA 3FPLA 3O0TA 4EK9A 1ODFA 4Q3NA 4CKBB 1NT4A 1XPJA 4ZQHA 1JFFA 4MP3A 3H4IA 3D0KA 1G8MA 5BWUA 1OWOA 3A3YA 3QWAA 1YGYA 3AZOA 3RTGA 1ZRMA 2EKQA 3FZNA 1NUUA 3K6JA 2WF7A 5FEMA 1F5SA 1YOBA 4EJSA 1UOQA 5JD4A 2J9RA 2D54A 1Z7BA 3GLIB 1TF2A 4UREA 2WHYA 2FPMA 5CM2Z 5A3VA 3WGLA 3MLEA 4RCVA 3BM5A 2V7BA 4NJMA 4LXYA 5DN9A 2QMOA 3I8OA 3C3PA 1K8ZB 3VVCA 1ZHSA 4EUKA 3D8RA 3TQHA 3VR4D 1KWGA 4WX2B 1H8HA 3TLBA 2GAAA 3MTEA 3DEZA 1U8EA 1VPLA 2COIA 1HZJA 5J4HA 3T1YH 2IIBA 4JKIA 1L5HA 4AICA 4E31A 3CBQA 3H5RA 4G84A 2Y4RA 4BFYA 4HGYA 2VJPA 4G24A 4F11A 5KWVA 5JAZA 1W9HA 3LYLA 4GD3Q 4IWNA 1UT5A 1RAEA 4QNNA 3HH8A 2PWZA 1SKAA 1FXUA 3C45A 2I91A 1HQCA 2C7BA 1DCKA 3H4TA 2Q07A 1G9XA 2XTZA 4M9SA 1D07A 4UDNA 4R71A 4W5NA 2OV1A 3P52A 3NV7A 2DC1A 4NG5A 2HI0A 2J3QA 5LZ5A 3R40A 4DIUA 3N7AA 3R09A 4DKXA 2C28A 4U6PA 4K81B 2HTFA 1XO1A 4WJKB 3F5QA 1KZ6A 2JF0A 1E61A 1ZIPA 5TARA 2Q62A 1RJGA 1MQSA 3OETA 2Q3HA 3V4LA 3KNZA 1SXJA 3DMFA 2FLWA 5ES4B 2H31A 2R82A 2C31A 4ZAYA 3CZ4A 3LA8A 4C4AA 2FUG1 2R8ZA 3ORRA 2YRFA 4RTPA 3WDMA 4AYWA 4XB6B 3QPVA 2IYAA 3GJQA 4KWHA 2PJRA 5I01A 1X8KA 3JQCA 1ZRSA 1LUAA 1GSHA 3MCAA 4ZC1A 3BPSA 4YCBA 1PR3A 2MYPA 3I0ZA 2H18A 4L8YA 2KYRA 4FZJA 3TAUA 3M1AA 4FLEA 1V9PA 5D01A 3EMKA 1OXBB 5IYBG 4XARA 3I45A 3S3TA 3DZ8A 1XHFA 3CR7A 5F12A 3DOFA 5EJFA 3EAQA 3NBQA 4TL7A 4N7RA 4ZCPA 1C4WA 1VS0A 3WRYC 3CSDA 2A9KA 3A27A 2UUCB 1DZIA 1HDGO 1NIJA 1KOLA 4E4RA 5KPDA 5LQMA 4R1NA 1PS8A 1Q1EA 3SDBA 4JI4B 1C7EA 4GDMA 3K32A 2B0CA 4P3PA 3ZQ6A 2D1TA 4FGUA 2BEUB 1VRWA 3TY5A 1GYPA 1CQWA 4X1YB 1QQAA 1SBHA 1GAEO 3C43A 3OWHA 4N47A 4JL8A 2BKAA 1FZQA 5CDFA 5HFAA 3VC7A 2Y3IA 4GSKA 2HV9A 5A4JA 1H23A 2PKQP 1T2AA 5BW8A 1ZQ7A 1G3UA 1W73A 3NAMA 2Q1SA 3F7OA 4MWOA 5A3JA 5A5FA 1Y7LA 1ZIOA 5F9MA 3OX1A 4OQNA 3DZBA 1ZRHA 1L5VA 1WMFA 4Q4CA 1MB4A 3EFOA 3NB0A 1ZOPA 3OURA 3PRJA 1C8VB 2PZLA 4C0AC 3L4JA 1F7VA 4JP1A 3X1WA 2H7CA 4BTVA 3ISVA 3QKSA 5LSAA 2YYSA 1DJNA 2XCQA 4F1WA 1EQAA 1XZIA 4R69A 1PL7A 4MRPA 4RA9B 3N07A 1TEZA 4C78A 3OPYI 2IUFA 1L8OA 3P0IA 1YB7A 5FV7A 1DAHA 3A6PC 3IPCA 4TT3A 2IS6A 2JLQA 2O6LA 5TB5A 3LLVA 1J9EA 1DMSA 4D4HA 2VHWA 2O1XA 2RDIA 2HA6A 1HDZA 1J2UA 2BM1A 2YDXA 5JSHA 3VPCA 5TRTA 3SHWA 4WXRA 1FVHA 1OZFA 3PHHA 4TXLA 4Z1MA 3K5IA 1LS1A 2JLAA 4BJ6A 1CT9A 3QH4A 4UCFA 4HDRB 2DU8A 5HIKA 4M55A 2XQKA 4A26A 3CE6A 1VMDA 3UT0A 4K6NA 3DOCA 5TXGA 1LD3A 5EINA 3AONB 4ZT3A 2QTMA 3A3OA 4BLQA 3URMA 1HDRA 1KBLA 3DZKA 4WOCA 5EJ7A 3RT9A 2Q5QA 1F06A 1V11B 3LC2O 4H3HB 1JB9A 3F2VA 3B12A 1SVWA 4C30A 1JDBC 3VHXB 3WLHA 2EERA 3HM2A 2GTPA 2EFEB 1P8LA 1J6UA 5LP6B 2ZG6A 4RNDB 3JQ9C 4ZO6A 5E7JA 2JJ8A 3QZ8A 3C6YA 4R1SA 2BMDA 3I83A 3W9YA 3FYDA 1VJ0A 3V6HA 1VYVA 3GBSA 4JLKA 4OIMA 1XCJA 3BIXA 1SBCA 5HQJA 3IVXA 4Z0HO 3FGNA 5ENDA 3E7FA 5KFGA 3NGXA 4IIGA 3D54D 4IHJF 1Q1NA 1CUIA 3RDPA 4EI2A 4XRRA 2ASVA 1GXSB 3UY4A 1TQDA 1Z7YA 1UOEA 5SV2A 2RK6A 1K68A 4DCGA 3R7SA 2HCRA 4HHEA 3ZCTA 5CCEA 3RYFB 1RWQA 4FUQA 5FWNA 2F3TA 2Q3EA 3CRNA 1CRQA 2ZYVX 1G5IA 5ITZB 1BS2A 3AK4A 1IU9A 1V7QA 2IXEA 3K1YA 5J63A 1BCSA 1EYZA 3V3TA 3VR5D 5BMVB 3F7TA 3PEFA 2PXCA 4DQKA 4C29A 4EY5A 5AW5A 3EDMA 4R2JA 1X19A 1NDQA 5FX2A 2JFNA 3RRNA 5CUQA 5LOVF 3JPWA 3GELA 2WJVA 4U7PB 3V46A 3EMVA 4WLNA 3PGMA 1W6RA 4MUXA 1W2HA 2OQVA 4JI4H 4LWPA 3VU9A 4DMFA 4FZVA 3T34A 2J8ZA 3NHRA 2OMEA 4BO5A 1E1RD 3R3SA 4O7RA 1S89A 2DQZA 2Q41A 2WDPA 1ODTC 1N7JA 2VH1A 1RE0A 2AJTA 3AB7A 5DT9A 5I7AA 1X7DA 1JWAB 4JLSA 4JJAA 4G0MA 4LJAA 3K9HA 1WA5A 3NEAA 1PP4A 3ITNA 4JV0A 4U00A 1ZMTA 5KCZA 2ZSDA 5L45A 4L22A 1Q2UA 3SSOA 1E1QD 2NQTA 1D09A 4QPDA 4MULA 3EBLA 4KIUA 5CLJA 3DEAA 4LOHA 4Q48A 4UHCA 4M4SA 2GLUA 4BXOA 1J8YF 5FL3A 1HDIA 1CDEA 1VQ1A 1IEVA 2OV2A 2M2IA 1CZLA 5HNEA 2YWCA 1BCRA 2FW8A 1ZD2P 1FRVA 2AIRA 4XSGA 3MJEA 4R40A 2O50A 3M4JA 1QO9A 3ZYZA 3N8IA 2VDWA 4LEIA 4XJVA 3Q5EA 1Y4DE 4L51A 1U5BB 3I9LA 5A9RA 1YS4A 4Z4HA 3TLXA 5JDIC 4ED3A 4D6XA 4QGFA 2PKXA 1V47A 2PLRA 3UB3A 5LR6A 1DOHA 3D2LA 1KVTA 4G4JA 1B1CA 2HYDA 3PC3A 2Q5JA 2C2KA 1KXJA 1EP2B 4IHJA 4CG0A 3B6EA 2XTNA 4I5GA 3AERA 2IDJA 4I50F 4CUZA 3FDZB 1Q7BA 4BC1A 1B0PA 4DN6A 3BD7A 1EBUA 5IUKC 3DZCA 4BWFB 3LFUA 3CV3A 4GC7A 5C32A 3RBVA 1WG8A 4B7ZA 4BNUA 4HFJA 1WZCA 2B7BA 1WMDA 1SBIA 3PO2G 3CUSA 2ZJBA 1I7SB 1BU8A 5LJIA 4LOJA 4OUDB 1SQ6A 4ZCIA 3U55A 2P9GA 4RH0A 3VPHA 3RKRA 1TYZA 3FWHA 4HUQB 3R5JA 4YJ3F 5HZMA 3K0FA 1U5AA 4FCTA 3FOCA 3CQZA 4Y2QA 3EA5A 1WX1A 3IXQA 1UK6A 1XCLA 3W8EA 4E14A 3QI2A 3NO4A 5TMEA 1E6WA 1CYEA 5AK5A 1KQFA 1YD7A 4BQSA 3PXGA 3ZI7A 2DETA 1TZJA 4AJJA 1GZ3A 1P2TA 1ZGBA 4BE7B 4LMYA 5LOVA 3U4QB 3KQQA 4N01A 1HE4A 4EEZA 2VHEA 2C88A 1NW4A 3CQ9A 4PRLA 4KQIA 3EPIA 3B5JA 3RRJA 4EM6A 5DU2A 1Z3IX 4FZRA 2A0UA 3HBNA 5LNK6 2XZTA 2QD3A 2F1JA 1FFBA 3KVVA 1RTTA 4UFPA 1DFGA 2OHFA 5IJ0A 2RAFA 3LGXA 1U0RA 2VT3A 1J0CA 3PXBA 4FT4A 3REGA 2D00A 3CLKA 5KOHA 4L8FA 3R7DA 1ZGHA 2EC5A 4F86A 1PW5A 2PU5A 3KZMA 1NBEA 4AJIA 1E7WA 2ROQA 4R8RA 2GJ9A 5EIAA 4CKCB 1W87A 2VHZA 2HU2A 4EY3A 2P2NA 5JD3A 3UKOA 1LPMA 1N2OA 3OU2A 3ZHCA 1KORA 1P0CA 2WAYA 5JYBA 2IK8A 1HE3A 2BMAA 4ZVVA 2FSSA 2QUJA 4CKWB 3ZUGA 4ABTA 1HEUA 3MNFA 4NP6A 1E1NA 2YJ5A 2C1EA 4RWEA 3ENVA 4JBNA 1P7YA 3ULKA 3N53A 4N49A 2YZ7A 1RTKA 4D0NA 2I6TA 4F92B 2FEPA 4IV0A 4AJLA 1QFZA 3C16C 1RXSA 3VC2A 1BTOA 3V7UA 1EA5A 1FF9A 2H7XA 4MJ3A 3CLSD 3AUUA 4I50A 1Y42X 5BUCA 1JFSA 3UTCA 3V55A 3IUSA 1KE1A 3HVJA 1BS1A 4A2WA 1SHZA 3KETA 3QE9Y 4NV3A 1GAQA 1CHDA 4DR5B 1QK4A 1IL0A 3BDVA 3A9RA 5JUWA 5HKOA 3PGLA 4C7XA 5IS2A 1O95A 4LHXA 2HK7A 4OB6A 1U7ZA 3PUVA 2ZTUA 3NHBA 4N03A 4YJ3A 2VF4X 3RBEA 4HNQA 4FJ2A 5EMMA 3F74A 2W9CB 1RHJA 3K09C 1JIKA 2XYHA 1VLMA 1FEZA 1DFHA 4HLNA 3I6IA 3KK0A 3LWNA 4BBSG 2OLJA 5IK2A 4FDMA 2UXBH 4DLYA 4IGFA 1A27A 4OXKA 3PC7A 3CVUA 4FEAA 2YJ3A 3TINA 2RGUA 4YR0A 1XTVA 2GESA 4EPYA 4GG1A 3NDIA 3KFLA 3L02A 1US8A 3QEOA 4L5JA 2WQ6A 4MLDA 1EX7A 2Y4NA 6CHYA 4M8KA 2AZMA 2H5IA 4IDPA 4MMZB 4C1NA 1NPDA 1GSIA 2WJGA 4MRMB 2OPBA 2B25A 2AFIA 1ZQ1A 5L1IA 1A82A 4XVQA 3NBYB 4OXQA 4YUAA 3BIWA 2O4UX 4EX7A 3COPA 1ZW1A 1LLUA 4UHJA 3ZZ0A 1TA8A 1XAIA 4B09A 3FCYA 1S02A 3ZXXA 3FNHA 1W76A 1I2CA 1PG5A 5DULA 1NN0A 2W6JA 4JEMA 3STWA 3PV0A 5CFRA 2IW1A 2WZCA 4HQLA 3WLIA 2HHCA 4QU0A 4NONA 4KFUA 2E1PA 1BGWA 1T5LA 1U80A 2FG5A 4D9EA 5JATA 1CP2A 5BN4B 3W2HA 4RHXA 3GJ7A 4IXTA 3GUHA 1XZLA 2A1HA 3GFSA 1Z5VA 5FFNA 9LDTA 2CNKA 1KPIA 4HATA 4DV0B 2Y4OA 3AGQA 3H18A 1UPBA 1ZQ9A 3SOPA 521PA 4C4XA 3RNLA 2DCUA 4X64H 2BGTA 3F1LA 4APMA 4MHTA 4BWSC 5ENZA 3ED1A 3V2GA 3AF2A 1GPDG 3G89A 1AMNA 1TZMA 1WVMA 2R0QC 5KT6A 3AXTA 3KPUA 2D6FA 1KI3A 1AZTA 3HZZA 4AG3A 1QFJA 2GBIA 4AZ3A 4G63A 3PA6A 3R9IA 4QDOA 2IE8A 3D3JA 2QRLA 3H1AA 5A5EA 4AJ1A 2ZRHA 4BBRG 1QKJA 1G2IA 4MYHA 4HGOA 1CUUA 3P4XA 1EHCA 4RLQA 4LVCA 3UAYA 4JJEA 4OMDA 3BJZA 2VATA 3OIYA 3AF0A 3B48A 3ONDA 2GNOA 3E9EA 5ED0A 1W1WA 1RXCA 2IU4A 2PA0A 4Z9BA 4J9PA 2PNFA 4JEIA 4URUR 2XGGA 5AW9A 2GA8A 2N42A 2ZBVA 3VH4A 3GUCA 3DMTC 1YUMA 2P7HA 5EEGA 1LBEA 1AK9A 3QW2A 3RIZA 2B99A 1LGYA 4B79A 3TQSA 2I6FA 3SU8A 3MQFA 4M0JA 5SZJA 5C8XA 3OEYA 1VTKA 2QD4A 3WYAA 2DUWA 1VB3A 3P19A 1CB7A 1UC9A 1MORA 3KPVA 2CLLB 1NYQA 4Y1GA 4UAGA 5A0VA 3Q8RB 2OGUA 4PAOA 3OCXA 4A3SA 3T9DA 2JH8A 4QBTA 2KLBA 1ISGA 2YCBA 4TS4A 1CC1S 1Y4ZA 3NOQA 3GCWA 3SJ7A 1AKWA 1Z75A 4IRMA 3BCHA 5HG0A 2VAWA 2G9RA 4LQ4A 5FFMA 1GPNA 3CPEA 3HOZG 3QY9A 4XOIA 1UZLA 2MOKA 1MDFA 2QZZA 4ZOBA 1RIFA 4RACA 1XMJA 3UXEA 3JRNA 1I0LA 1RR6A 1NQUA 1DXOA 1E3LA 3KR0A 2HEGA 2OL4A 1FBNA 4UD2A 3WAJA 3EISA 1LQ2A 1PJBA 2IUUA 5E0KB 3UK2A 2W90A 2Q8PA 5KOIA 3CR8A 1XRSB 4WNIA 1L7OA 3KXDA 3EDCA 3KSUA 3A31A 3MMPA 3E18A 4RAOA 1ZFNA 1TF7A 4HTFB 3AKYA 4IR9A 3NNSA 5C4MA 2R65A 4BAUA 2ZANA 3HXQA 2ZVJA 2GGSA 2NWQA 1LVHA 5HRCA 2Z04A 2PUVA 1U2RA 1JDPA 3UGKA 4M9UA 3FUWA 3RRBA 3DEHA 1LU9A 2AN4A 4QECA 3KVRA 4EEXA 3CEPB 1UFKA 4YP6A 4U7FA 3OECA 2RI0A 2PU7A 4FJ0A 2JVIA 1P9LA 3L6EA 4P34A 1YJ8A 5ECWA 5CLIA 4RL4A 3QBDA 5ED4A 2G9VA 8ATCA 2R7AA 1V2GA 4V03A 2G8NA 2WPDD 3LI2A 5AKZA 2E2WA 2AJ8A 4WVFA 4RUCA 1W96A 4ECVA 4D45A 5L9AA 3R20A 1PG0A 3F3SA 2PD6A 2V5AA 1E5QA 1U2TA 4IIHA 4HADA 4ZT2A 2ZJ2A 3WKBA 3HHPA 3LCRA 5CD9A 1B43A 3DE5X 1I1MA 3HDQA 4ETWA 1O8CA 2CJXA 1IK6A 1XPUA 1WXHA 3QVWA 4GICA 5E8RA 1WPXA 3RJ0A 2DKOA 1UQTA 2AFHA 3L0DA 1AHHA 1IATA 3TYXA 1KAQA 3DL0A 1Z0DA 3ICPA 1VGVA 4CETA 1U3CA 4XOUA 2GBGA 4G0WA 2QYHA 2RB4A 1G63A 5EJMA 3QTLA 5AKKA 4C3UA 1REQB 3HC7A 1GCUA 5TSDA 4Q4JA 1SC6A 1X13A 1D6NA 1G6OA 5IDXA 1PR5A 1GGKA 1DWUA 3EMBA 3UV3A 2ZKLA 5DK6A 2IYFA 2JI6A 3VYSB 4D42A 5DYWA 5FTJA 2HMWA 3LPCA 3F7MA 1PAUA 3FF4A 1R8SA 1QTQA 4GP7A 4OOEA 1KQGA 2H1SA 3OQMA 1QOZA 5FI5A 3N9IA 3C85A 3AH8A 1QMGA 1C9KA 1GKKA 3QELB 3R3YA 1UK9A 5ALOA 1I10A 2XH8A 4Q9LA 4FFDA 5LA6F 4R8UB 4DPLA 1E9FA 1M5TA 3U48A 4JN6B 1JQDA 4J2OA 4RQBA 1IZZA 1U1CA 5AHOA 1H4VB 2JFFA 4S05A 3FOFC 4L4UA 4MPTA 4GYWA 2W9BB 3QNWA 1UXOA 5DNVA 5H3CA 3T4PA 1ZAUA 3L0BA 5K05A 1HZZC 1KEWA 3UANA 1MEJA 2WNSA 2GN8A 1FUIA 1JHMA 3KE8A 5TC4A 3CUWA 4UDXX 4RFLA 2BMJA 1DKOA 4L72A 4WN9A 4A2CA 4BCBA 1MOSA 2IXTA 5EJEA 1BW9A 3NETA 1VKOA 1UC5B 2WHEA 2IXBA 3D7SA 4IX9A 4QBHA 3T8YA 2XSZD 1MJGA 2DT8A 3VKGA 5B2FA 4Q47A 3WGIA 3WGNA 4X84A 2G70A 5JG7A 3VR6D 3BB4A 4F56A 3BMQA 4UUAA 2XMPA 1N75A 3A05A 1FXSA 2O05A 1FTWA 4ENUA 2H2GA 5L4LA 1H69A 3OIUA 4YLEA 3B2QA 3OEEA 4IDQA 3O7MA 3JQAA 4TVBA 3UHOA 4ALNA 4BP8A 5CLGA 1PG2A 2RJOA 3C6MA 2XRYA 2PX0A 1QLWA 5DSTA 5CHEA 2QVGA 5K0EA 4I1UA 4XIJA 1E2NA 1ECGA 2ZIXA 1KI1A 5ILGA 3IVGA 4FZ5A 4ZOCA 4Q05A 4B6QA 3IOBA 3STUA 2FH5B 4XXHA 3R7AA 1YQEA 4G67A 3RLIA 1GRNA 4A0GA 3LQ1A 3JRXA 1IBRA 4MJXA 1WHTB 3OSNA 1KMMA 4UU0A 1HYQA 2IBKA 2RBKA 4BEJA 3GD5A 1F8UA 3KAQA 4J9UE 4DSOA 4JELA 1S4MA 3ENWA 4FS1A 1F14A 2O52A 5ICFA 3OOWA 2VZEA 2W6OA 3Q8PB 4E03A 5AXBA 1WBJB 3AJ9A 1I1NA 3QIAA 2R93G 1I2DA 4NZNA 2PZEA 3HWSA 1D6SA 1IC6A 2W5UA 1C29B 1LJUA 1ZCJA 1XCOA 2ZB7A 4CNBA 1ZISA 2P9CA 3EEIA 2AZDA 1N6LA 5KTYA 1CRPA 3EFHA 5AQEA 5GM2A 1Q0QA 4B7XA 4B3RB 3QQMA 1Z6QA 1UAAA 1ZVQA 3O1LA 2ID8A 2FLNA 2B83A 3CJQA 1QIDA 5LA6A 3TX6A 4GLLA 3PHCA 4EHHA 3OCYA 2LD4A 16PKA 2HJHA 1O75A 1AKNA 1V96A 2Y1DA 3VYWA 2HK6A 3KOZA 1DX9A 2I3GA 4X90A 4D8UA 1D2GA 1RRPA 1J8FA 4NR0A 3RS0A 1JDVA 1NHWA 1DX6A 5FPKA 1B04A 3K9CA 5FUQA 5L1LA 3I6ZA 4TWRA 4NBTA 4BN4A 2YMLA 4RX1A 1AKUA 3BWEA 3LBYA 3CEJA 4Z7JA 5CB4B 3ND8A 4RVFA 2PKQO 3ZU5A 1D8TA 1C4KA 4ZYTA 4KE6A 1G5TA 3WGUA 4MIOA 2C5SA 4J4HA 4EUNA 3HL0A 3K6SB 4DLPA 2XI4A 1PGNA 1WVGA 5ALJA 1DC3A 2EFDB 2GAOA 2QLNA 2RK3A 4DUYB 4IO1A 4MTCA 3HA3A 1IBCA 3EEQA 1C7ZA 4MW5A 4ZD6A 4IJ5A 2VP3A 1OAAA 4EAQA 4XGNA 3DZHA 3O91A 2HNAA 4WKGA 1W49A 4D8XA 1AIPA 4DB4A 4L4ZA 5BYBA 2D0IA 3R9RA 4YX9A 3P7MA 3ORHA 3GJYA 5EUBA 1ISFA 1GLVA 4AECA 3HDTA 3A3NA 4I3HA 4EJ0A 3B9RA 1Y82A 3AVOA 3KL2A 1U0NA 2TECE 4D0GA 1XP5A 2DWOA 1UK8A 4YH1A 2DB3A 3D3WB 2OVFA 4UUPA 4J9NA 5KVQA 5DWQA 2GKSA 1A8IA 1DQSA 2B8JA 3THYA 5KINB 3C7AA 4Q5IA 3IERA 2WM2A 2J9FB 3OZGA 4KKVA 4ONEA 2XDQA 2JJ2A 1QU2A 4R2MA 3GLFA 4HO1X 3W78A 3RYCA 4D9MA 5ERXA 4U6SA 1CQIA 2R8PA 1RK6A 3S55A 4G23A 1I2KA 1H6AA 1USWA 4FWTA 4MINA 2R1TA 2NTEA 3TJZA 3B9PA 2OCAA 4RK4A 1VGRA 1KOFA 4EG3A 1GCIA 1LPAB 2FPLA 4X1KB 1HX7A 3FXAA 2FR1A 4LMRA 3AIIA 4E1BA 2O8BA 2J3IA 3IC5A 2UZIR 4L5IA 3CZAA 4QOGA 3R6GA 1ZOOA 4DTCA 4E5KA 2OA0A 2Q2QA 4ETNA 1PNOA 5EJIA 2X1MA 3T7AA 1R9TA 1ENOA 1YT5A 3W06A 3KSMA 3CX3A 2Q2TA 1NFRA 1AHPA 3EVAA 4RAYA 3WGZA 4EB8A 4OX9Y 1BRMA 3URKA 2AMYA 2WWTA 5GMOA 3E1SA 1A2KC 3ILYA 1CRWG 4UFOA 2WKPA 3R0JA 2C2WA 1AGPA 4JP3A 4E6NA 3Q1LA 4UFZA 4Y2RA 3K0EA 1YK1A 1MV8A 2KW5A 3L0ZA 2W8KA 3IOYA 2FN4A 5KFSA 5HA5A 4RF2A 1WVIA 1RI4A 2HWXA 4LZNA 3D1LA 1G8JA 2ORED 4PX9A 4KVAA 1OREA 2FPPA 5AI8A 5BP7A 2YWEA 4YBZB 5BSFA 3SK0A 4YCLA 1Y48E 4EP1A 4JLAA 1M67A 4HY3A 2Y1WA 4B9AA 5FOVA 1NPYA 3EVDA 4B3RH 2EL9A 1IOLA 2XEXA 3E7XA 1E2QA 3OWXA 3TBHA 3ZLUA 4JNCA 2BCEA 4TS3A 3H8VA 2FMTA 1B8PA 2YJGA 5CFPA 3QFFA 2PMWB 1POXA 4RK7A 3A26A 2VS1A 3UB2A 5H9VA 2CB9A 1MB2A 4P98A 5ABPA 3OE4A 1E9BA 1U8XX 4XASA 1V5WA 2FDRA 4EL5A 5K8LA 3W1BA 1BA2A 4L6AA 4RMJA 3C6QA 1PKXA 1CX9B 5IW8A 1BNCA 5HUQA 1URPA 4TQRA 4KQWA 1MA3A 1QFMA 2QJRA 4D9HA 3CTMA 1MD9A 1FC0A 1VKZA 4MV0A 5EP1A 5JS2A 2WQ7A 1PWYE 4O8CA 4YWHA 2O8NA 2O0MA 2CFOA 1O5IA 4BV2A 4PRKA 3NPMA 3NM5A 5DLPA 3H8SA 1JMKC 1BWSA 1J25A 3IMEA 2YZMA 2HPHA 2VN8A 4WFQA 4HAUA 1Z17A 2BISA 3KBBA 3HV2A 3H8WA 2B9VA 1FOEB 1J49A 5HW0A 3ZY6A 4DDKA 4UCVA 5EYPB 1G5RA 2QMYA 5IXSA 3QG5A 5DNWA 3CH7A 3AKZA 1IUOA 3PLAE 1PJLA 2D74A 4HSGA 3GJ8A 3RSZA 2Z6AA 1NYTA 3GJTA 1XPOA 2X6TA 5TGTA 3S6JA 3HRIA 2XODA 2HMYB 4J0DA 3DW3X 5BSTA 5KTOA 2P9ZA 3CF0A 3Q7RA 4ZVMA 2VYVA 2YN0A 3FR8A 2BFCA 1H2RS 2XT6A 3OWOA 2Q6TA 3P5BA 1W2WB 5CFOA 3ZWVA 4KXWA 5IANA 1P19A 4YFVA 3RSOA 5D6OA 2HK9A 1VLQA 3ABSB 3CGGA 2VEDA 3T5GA 3LW7A 1UZUA 3L6UA 1ZHFA 3CLRC 4YV2A 1C3VA 4M9CA 3C6ZA 3PSAA 4FIDA 5K6RA 5FBZA 5KS8A 4XR9A 4JWTA 2ZRLA 1F20A 2Q6OA 1E2FA 4BVKA 3AR7A 3PGVA 1RC0A 4EL0A 1QYWA 4J9SA 1X1SA 4ER6A 4D2IA 5AVYA 1KJZA 3QKRB 3DMHA 4QYXA 2BFAA 2WSLA 3HFRA 4K1XA 3CLRD 4EW2A 1JG1A 4KIFA 2AC7A 1HDOA 2J9GA 2G5PA 3AVTA 4GDFA 5FLXA 2EDCA 2G7MC 1GZUA 2YFKA 3ROKA 4XIGS 3NPAA 3BJYA 3QWFA 1HDYA 3HI4A 1LW6E 1P5RA 2NNWB 1VBGA 1L3BA 3T1HH 1E9CA 3UGQA 4FE2A 4GWKA 3PKJA 1RQXA 2H00A 1Z08A 1ZS9A 1VL8A 2FR0A 1BE0A 4RB0A 4AMBA 3GARA 1KJJA 3OFSA 3UBMA 4QSHA 1U8YA 4GYYA 1EINA 2XX3A 2ZUDA 4R9NA 1HKHA 3UV7A 1WXDA 4U9UA 1RWPA 1W8DA 4YP3A 2FK2A 3GP8A 2QU7A 1YVRA 2HT6A 4ZIRB 1Y7HA 2C07A 2FN8A 5FR2A 4YACA 1IHYA 4W7HA 1CF2O 4WERA 4ND3A 4J9RA 1BGXT 3HQ4O 1QFXA 4ED6A 5EE0A 2YZLA 3UENA 3DGEC 1KI2A 4CTJA 4OKSA 3V4SA 5BWWA 5HTOA 2R68A 1E3EA 1E2EA 4G3XA 4GUDA 2IPLA 1XZ8A 1TEVA 1LLDA 3O8QA 1QLHA 4ZFNA 2D1QA 4BQRA 4CHTA 2BGKA 4G4GA 5EZ5A 4OK6A 1XWIA 3PNQA 1Z5UA 4ZZIA 4JT9A 2J3MA 3DV0B 3PK0A 1TKRA 3UZBA 3JQ8B 4QU9A 3HXTA 3PXEA 4BO7A 4HBZA 4FKZA 3KQKA 3T41A 2VOJA 4OSEA 1G19A 5JY1A 3RS8A 3TTXA 3UKDA 1VL1A 2OBXA 4XI9A 4U3JB 4PPGA 1C30B 4BLSA 1UPFA 4YMLA 1I6MA 5ADHA 1EFRA 4CL2A 2WVHA 4IZOA 3KWMA 4J9OA 2AF3C 4C6RA 1I80A 1L7DA 2ZR9A 2VDQB 5KFAA 5LWHA 2IYQA 2O2GA 3GGGA 1ND6A 2P4UA 1V1RA 1GUDA 3F6SA 3DC7A 2BQ3A 2W6IA 4GI1A 5BV2P 2P2YA 3KQUA 5E38A 1RXYA 3SI8A 3V6JA 1NV8A 4D5GA 2X0IA 1AKQA 3HGQA 4ZYWA 3OO0A 3SY8A 4OHPA 2VXBA 2ERYA 3LL7A 2HZ7A 2FSFA 5A4IS 7AT1A 1L6IA 5HPYB 1ZO8A 4WZBB 4HQRA 4OBWA 2ECFA 3LHKA 4QM6A 4H6VA 3GJXB 4R1LA 1GGNA 5J5VA 1ZY2A 2HQOA 2XWJI 1IZ9A 1EB9A 1U6JA 3P94A 4B43A 1VL2A 5K3EA 1K89A 2FFQA 2NU9A 3KLNA 3IUYA 2A94A 1X1BA 2AVDA 3PYMA 4UTXA 3BAAA 3DVRX 3O3NB 3TR5A 2R96A 5DKFA 3GI1A 4TL9A 3FGOA 1Y7TA 2Y0EA 3VSBA 4NQZA 1OH8A 1CY4A 4DANA 5HVNA 1OZAA 4GKVA 1WW8A 2H92A 4Y6GB 4OJTA 2CQYA 4TM7A 1YS7A 3H9JA 1VXRA 1B6SA 3E1KA 4Y1EA 4B4DA 2KBEA 1EDOA 2WG1A 3H7IA 4MQBA 4QOEA 2H63A 3K05A 2FPSA 4IJ6A 2CDCA 2HVRA 5AHXA 1VLVA 2R00C 3G1TA 5EE5B 5DO9A 1AGYA 4F21A 1P81A 3NKVA 4QODA 1J1IA 2ZFUA 3UMJA 1X6VA 4N1AA 1IXKA 1OB5A 2WWXA 3KX2A 1PJ4A 5KFDA 1HL3A 4DCTA 3X2FA 3BSYA 1XWWA 3KYBA 3KALA 4A27A 3OIFA 4IINA 2YWJA 4H77A 2GRJA 3GIKA 3AUKA 1C9NA 3WRXA 3AOEA 4RF4A 3IDFA 1UDXA 3OJWA 4HVAA 1CSEE 4HAWA 1XCGB 5H02A 1X9IA 2A5DA 3DAOA 3JQFA 2RGDA 2XDYA 5IYDG 4RNCA 1V4NA 3K6RA 4FCWA 5BQPA 5B2EA 1IJEA 2P4EA 1L1QA 3X2EA 3GTQA 2FW1A 3KELA 2V9PA 2O8DB 1FTNA 3IAM1 1SPXA 3ANTA 3D6UA 2W6ZA 1N2IA 1YRQA 4BOYA 3QVSA 4HEA6 5HMLA 4TMTA 5J5AA 3F47A 4NEQA 2GKGA 3K4QA 1QPZA 1KO5A 1WO8A 4PLCA 3MJSA 1AHIA 3WBJA 2XUOA 4KNYA 1WW2A 4RLFA 4CIDA 5SY4A 4RZRA 5BV8A 3WWIA 6YASA 3L7KA 2XXAB 3QMPA 4PC1A 3UMBA 4JIGA 1JHUA 2IXAA 1YZLA 5HCNA 3PF9A 4HNUA 2HBYA 3DMYA 3MSXA 4B5LA 4LQLA 3M6FA 4MEBA 4ODIA 1T0BA 1CPYA 1GFWA 1IIRA 4BNMA 2JNWA 1ZIYA 3ZGYA 4GF5A 2CNUA 1YB2A 2VVTA 1R5NA 3ZWDA 4RH3A 3NM6B 2JEFA 3WGKA 4M1MA 2Q5HA 4JXZA 3ZTYA 1PTKA 3IP7A 2BEJA 2H2HA 3B8EA 3R0XA 2QGFA 2B4TO 2Y0PA 4L4SA 3M4ZA 3CX7A 4MYCA 4O2AB 2CCGA 3FOAA 1JFVA 2BGRA 1OSNA 3IR7A 4OV6B 1RCFA 4KO2S 4BRSA 3WLMA 1VOTA 4GM1A 2AQKA 3SBOA 4RLHA 3SVZA 4TQUS 5KTRA 2CEKA 1LRLA 3UJ3X 4N0EA 4CMCA 2RGXA 3OX2A 1GQFA 2YKGA 1Y8RA 2X5NA 3DOJA 3NHUA 2B1IA 3TRDA 1VIDA 4ENWA 1AA6A 2VDPB 4F60A 3GTKA 4RA6B 4GVPA 4DZZA 2VYCA 1P4JA 2ZBRA 1MHTA 4OA8A 2BFNA 1AS2A 4AXXA 2DR3A 2Z4TA 4BPRA 3SYLA 1V5GA 2IHYA 3VR5A 5D1OB 1YHNA 5IJAA 1Y1KE 3KB6A 3PE6A 4TKUA 2ZIZA 4C7BA 2X5RA 5E3HA 3H20A 2HEIA 4W8HA 4KRGA 4UNSA 1W5TA 4U2CA 2Q3MA 1R0BA 3ENQA 2V4UA 4J94A 4YRJA 1KE2A 1U0OC 1XXLA 5C1OA 1J0AA 5K7SA 4BIIA 2EJUA 3ICWA 1NM5A 1XQWA 1UP4A 4RO0A 3GAAA 3AHCA 3C3DA 3KZXA 4NBWA 1U0GA 3OOJA 1NVXQ 4DF3A 4HMOA 4WXEA 4ZYZA 4ALLA 5EE3A 3EPJA 4OJMX 3GXBA 5JALA 1FFSA 1JU4A 4IFBA 1XCBA 4KVZA 5JHHB 2EKZA 2OBYA 1V9SA 3K1AB 3LCMA 4WNYA 4S24A 2XOKA 4F38A 3VM6A 4KBGA 3SEZA 1A8QA 2RJNA 1AXGA 1P31A 4MAFA 3ABRB 3W5JA 4F4ZA 3BERA 3JASB 4CODB 4M22A 4KPFC 1WAMA 1Y14B 4UZFA 1XDDA 2FKNA 3L6BA 1ENPA 3DOOA 2RHWA 3W4KA 2XITA 1E1QA 4EFMA 2XRZA 2QTWB 3GVIA 2A1UB 3S24A 4UC0A 4QWWA 4WZAE 3R77A 3FPFA 3JQ7B 2PJZA 4P31A 1LTKA 1ATZA 2X4GA 3BQ2A 4PYRA 5ARCA 1ZX1A 5ULLA 3B13B 1W2GA 3AUJB 2YVKA 1IHPA 3RU2A 3E4CA 4W8OA 3JWJA 3V2HA 1VYTA 5ER6A 2VPWA 1G3IA 2EHJA 1T1RA 4KQ1A 2PBZA 2JGFA 3PXDA 3PDUA 1DMRA 4UEQA 1JL3A 1N1MA 2R6DA 5CDHA 3JYPA 3FYTA 2X9LA 3RHTA 4KVGA 2ZJ0A 1WDWB 3CEBA 1VI5A 4C08A 2BSAA 3LBAA 2JFYA 5C5JA 3L1JA 4GKJH 3RPEA 1ETUA 4Q9KA 1SEIA 3DD5A 1PL0A 3DQPA 3GA0A 2NSLA 1ZP6A 4JYBA 4UEKA 1M1NA 2AK3A 2XVMA 4CKZA 4TLEA 1NI4B 4KO4S 3G5MA 2D7DA 4A15A 2BZGA 5F4ZA 3PX2A 4PSUA 2RG7A 3OLCX 2VYQA 5JH7B 4RLSA 3AI3A 2UXBB 2FN7A 3D31A 4GX5A 3AO0B 3KYHC 5K3CA 3T9EA 4DV6B 3NIWA 1E3WA 2FK7A 4QHYA 3WGVA 3IT0A 2YC4C 5HSGA 5JD5A 3OQHA 1CEEA 3U17A 1EX6A 3BX1A 3UJPA 4IYRA 4RVNA 4ZHQF 1SQFA 5FYDA 4W5WA 1YQUA 1JA9A 2PO5A 3B5EA 3LHFA 4G5FA 2E5WA 2H0QA 1JALA 4NK5A 3DVSX 1P80A 3M1LA 4B4UA 4M3NA 4MQ4A 1QUEA 3QPBA 2QM3A 1Z2OX 2C96A 1W4CA 1NVFA 1UBSB 2PYIA 4Z5XA 5DGDA 2Q6LA 5DRYA 3K0HA 3CH4B 4I4IA 2EZ9A 4CV2A 3SJAA 1UMCB 5FDFA 3EEBA 2A4MA 4OQMA 2HSWA 1HKUA 5DGIA 1C0KA 3D8UA 2OBLA 2Q0XA 3R3UA 1IHOA 1EM8A 1JEYA 4Y6SA 1IRIA 1P3JA 2GXUA 2FB9A 4G4SO 1D5WA 2J3LA 1SURA 1QH9A 4X64B 5JQWA 2QM7A 4GZ3A 4ZGGA 3A1WA 5I7SA 1ORIA 4AN4A 3DUWA 5JMOA 1D2CA 1ILEA 2JW5A 2BIFA 5DBIA 4F5YA 1X7XA 4EECA 4FGSA 1OXMA 4UMFA 4ZCQA 4EYIB 1LK5A 1M34B 3F46A 3AJAA 4DW8A 5I9TA 2ASDA 3G2NA 2GVDC 4B9EA 2FQQA 4CN9A 2AOTA 3GVPA 5KU7A 5HJ2A 3II6X 3O92A 5IDQA 1P1CA 1A5BB 4MVJM 1GEGA 5F1YA 1CLUA 1CUCA 3N3BC 1XYGA 1RMYA 2X0RA 4LY0A 2Y1FA 1TJ4A 1P4GA 2QRQA 4KKXB 4OXIA 4GKKH 4M0MA 2R25B 3ETEA 3KYCB 4C6HA 1SCKA 3D8SA 3OJLA 1T2NA 4RELA 2OAEA 5H3LA 1BVRA 2Q5EA 3EWNA 4E08A 3U7GA 4XIFA 2C8JA 1XJQA 4CMIA 2VDJA 5LMUB 4GZ6A 4KACA 4ZC8A 5EKSA 5BOVA 5A6SB 4IVRA 2D0PB 1L4KA 1WXWA 2P1ZA 2IY9A 3HCNA 3K1ZA 2JA5G 3E61A 1TRKA 3P2IA 4FINA 3EXIA 4S1WA 3DPIA 2TMKA 4EITA 2GK7A 5JR3A 3SZ3A 2O3RA 2ZREA 1E1LA 2O5RA 1CHNA 4IAJA 5L3QA 1FE8A 1NKTA 4ZXFA 5B4TA 4YT4A 2F4VH 2ORIA 3GFFA 3FHLA 4AP9A 3OZWA 4HGNA 4N65A 2ST1A 3WP1B 2AMLA 4GOND 4ZHQA 3KTDA 3C3CA 1G17A 1I7QB 1G64A 3JALA 3U44B 4O4LF 1FP1D 4N5MA 2BGGA 3O8CA 1JSRA 5DRTA 4WW0A 5LIPA 4FC7A 2CMGA 1FS6A 3DM5A 1YIOA 2VDRB 4HXFB 4IWYA 2HDOA 3IKMB 2V9WA 1S7GA 2GCPA 3M9MB 2AGPA 2C8LA 4NBLA 1UFOA 1V7CA 2LE0A 4K1LA 5HKAA 4QWMA 3E84A 1J42A 4XYGA 1LC0A 1BKDR 4UAVA 2JK1A 2P9JA 5JCXA 1L8LA 3BMOB 2YJ4A 5L4SA 1L4LA 4DV6H 1Y8CA 3G2MA 3ZV7A 1JWBB 1F1BA 3LHSA 2IOHA 5LN1A 4PAWA 3FB4A 3RRXA 1Q22A 3L4KA 4EPXA 1HRDA 3A7DA 1ZN7A 1AN7A 3FNEA 1PGJA 4PEVA 1Y1SA 4DR6H 2B78A 3BIFA 5EI5A 3IJ5A 1EFVB 4YJKA 2P2GA 3UK7A 1V71A 4Y2UA 1GDHA 1HT0A 1UBRS 4EUHA 1ZMXA 5CFZA 4J49A 3UK1A 1IAVA 5FJ8G 1EHIA 2X7JA 2Z8YA 1WBBA 5KSPA 1FSPA 1B2RA 2PG3A 4EA6A 4D3XA 3RH0A 4REQA 4DV4B 1CQPA 4COOA 3AY6A 5T14A 2A9JA 3I2KA 2P3LA 2B35A 1MX3A 4ZYUA 2X9GA 3LK6A 2C3UA 3KJNA 2VOEA 121PA 4WNAB 2E55A 3QWBA 3KJQA 3VU1A 2NZ8A 2NX2A 1M2NA 5CT4A 1IXZA 1I8TA 5KYYB 4FEEA 3TKAA 4B80A 4MQ6A 2GEBA 3BJMA 1E60A 3ZLTA 3VDXA 5AUOB 3ZV3A 4I9FA 5FLEX 3TLGB 3W77A 3FKIG 3WP0A 3KHLA 1T0HB 1JEOA 3OJXA 5C46F 3DHVA 2C54A 1FVOA 2BP7A 2OGWA 4DMCA 1BDIA 9GPBA 3FZEA 5DXJA 5ALSA 2H1RA 4C0JA 4RU9A 3MFYA 1UPXA 1KEEB 2FHSA 2Z08A 3C3WA 1MPTA 2BELA 3AL2A 4UPVA 4B4OA 4O4LA 1Z0IA 3OCCA 3AUTA 5KDLA 4GE0A 4YAKB 2VQSA 3OU6A 1PR1A 3G6KA 4CLRB 3Q3GE 4XEUA 3RYHA 5KQSA 1MTOA 4J07A 5LMUH 3NALA 5IKMA 5IZCC 4MB6A 2SCUB 4C43A 2VF2A 3C70A 2EFJA 2IY8A 4ALIA 1YJAA 1G2PA 1JJFA 4QO7A 1YQDA 4UUQA 3KAKA 4HAXA 1E5VA 2FN3A 3D7RA 3ZU3A 1J2RA 2OYSA 3GLHE 3UCFA 3G0DA 1ZNXA 1YAJA 2QV0A 3C5VA 1SKUA 2HNKA 2C78A 3WK8A 1I0IA 3EVBA 4DSUA 4ZN6A 4DS3A 3PTZA 2XUHA 4PWZA 2B69A 5TQ2A 4K2AA 4M0FA 3K0AA 1HQKA 4I9NA 2AMVA 5M3BA 3RASA 3PXXA 1MABA 1SY7A 2ZB8A 2QE7D 1JHZA 2X9QA 4PGHA 4AO8A 1ZUNA 5M5BA 4RCNA 2QJTA 5IZ4A 3GAZA 5KYXA 4X8OA 1C9EA 3HJHA 3FPGA 3W1VA 2REXB 3PEUA 2F43A 2WB1E 1GV0A 1SEVA 3TB4A 3TF5A 2NU7B 2GT1A 1QYIA 2W2PA 4XVRA 5EGNA 3X1MA 3CG4A 4BB9A 2TMYA 4E32A 3BULA 2P4QA 2VZLA 2OORC 4BBPA 3ZI4A 1Q1QA 1ZONA 4M0KA 4PLTA 4ZO8A 4EUEA 2XCSB 1TADA 2O0HA 1IM2A 1ZL0A 3QX9A 4HTAA 3NTVA 5A7GA 1ZXBA 4R1QA 1Z0ZA 2ZBFA 2DR0A 3MWEB 4HB2A 3KDAA 4ED9A 4FD3A 3RQSA 5KWEA 1JDEA 1SJ9A 4JSTA 4EO4A 3JVIA 1ZU5A 4Z4QA 5DTQA 2X3UA 1RPTA 1RJEA 2GEVA 3OZTA 5JSYA 3QPUA 5IBPA 4IEFB 4FMCB 5LC1A 5M7EA 2XGSA 1P1HA 1PLKA 1V2HE 3E53A 4NBNA 4HI0E 2ALZA 4FFBA 1H3FA 4KI7A 2JAXA 4L07A 4Y9RA 2FOIA 1XTPA 2WK1A 1U8ZA 3ZD6A 1K0UA 5E1OA 1QZUA 1K6MA 5KFVA 5KNLA 5CLLA 3MK31 1QRUA 3MR3A 4UBIA 2I2XB 3F4KA 4PZLA 1P45A 3CBGA 2KHZA 4NRDA 2O0LA 2VNHA 1GTSA 5GY7A 4OXYA 3ROZA 5F2EA 4DV4H 4UQLA 3ISTA 3RO7A 2GEJA 1JYEA 3OLQA 3WYBA 1KK2A 4JI8H 3QXXA 4P0PB 1E9VA 2II6A 3GLKA 3H3FA 1SBQA 3JYNA 9ABPA 1M8PA 1R10A 1MMFB 4XYLA 1QH8B 2B4YA 1EWKA 1CJTC 1JVSA 1XU9A 3ZCRA 2VHYA 4PO8A 4QOHA 5I45A 1IJFA 4FFRA 4OVKA 1D2EA 2ARKA 4Q39A 1QIGA 3LQYA 4CLDA 3IV6A 3DAHA 1Z5NA 1VMAA 2C2OA 5BWRA 2XQIA 3JQBC 5F98A 1OI7A 4JP2A 2HLDD 2UDPA 4Q34A 1INLA 1C9MA 2Y1GA 5F23A 1AQNA 5K3BA 4PYKA 4QTZA 3WZMA 2ZYUX 2WYWA 1GZVA 4JI1H 5I7EA 4IJQA 4F4JA 1HC7A 2W2KB 4JJGA 3GUYA 5AW0A 2H51A 2XHEA 3IJEB 4YAOA 4PFJA 3GZNB 4IRKA 4HH0A 4W9NA 3KJHA 3V7YA 4AS3A 3M4NA 4ZTZB 2NSJA 3EGVA 3ZDXB 3CEHA 1JI0A 2IA5A 4DREA 2O2DA 3BILA 1GKLA 1EZZA 3N75A 5I5XA 2WAQE 3WGMA 1XBTA 3MWYW 2KB0A 5J1TB 5K2OA 3VRHA 3SSMA 1HT3A 1SIBE 1A88A 1Z26A 3WNDA 3GEDA 3EIHA 4XJSA 3UEOA 4YLYA 4XA8A 4TX1A 4ZYYA 4LSAA 3T9CA 2XSZA 2F17A 2JIMA 4LZZA 4AJPA 2VK2A 5IC5A 4RXUA 1TK2A 3VR6A 4O3PA 1Z2DA 2WF5A 3D6FA 4HB0A 2XMSA 2B92A 1EDZA 1GT6A 5AK0A 3IKJA 1PQWA 1RKVA 1T6NA 3U4AA 4LZOA 4MP6A 3NANA 4EMSA 2OWEA 3FSEA 1SUPA 1I9CA 3STHA 5JXIA 3QOWA 3ANYB 3PR4A 1U3GA 1NATA 1WRBA 5BT9A 5BT8A 2FR8C 5KVSA 1T6ZA 3OHBA 4DVGA 2QVYX 3EBPA 2GHIA 4G4SP 1R9NA 3AZPA 4QUIA 2IVZA 2CDNA 1R00A 1OT5A 1XMOH 4QT0A 2V9CA 5CM9C 4KQGA 1JXOA 1CNFA 3TNFA 4HX9A 4PBSA 3ZBPA 1GZDA 2PJUA 3IP9A 7MDHA 2LTAA 1X86B 3G23A 1U2DA 1Z0AA 2PIAA 3GGSA 3Q7IA 5EKTA 2H5LA 4RANA 1H4TA 2Q2UA 2XNDA 4AS2A 1NBOA 3GQCA 4DT1B 3RSSA 3QYFA 4HPXB 5LJLA 4ECWA 2Q1WA 1TAHA 5KT4A 2OXRA 5BR1A 3H0GG 1BHSA 2O2JA 4IOJA 1KY3A 1JAZA 2BGUA 4YUVA 2KWIA 4BS9A 4PHHA 3IVAA 3TTYA 2Z58A 4A8PA 3VU3A 4MIEA 2Z3VA 4DLZA 1LDMA 3LZDA 3ZXYA 3OIWA 4NATA 2BRUC 2Z1DA 1G8AA 2O03A 1OFIA 3AHDA 2FPWA 2F8SA 2JIBA 4HX5A 4IUBS 3FVQA 4OI2A 2CD9A 1DEHA 1TJPB 5JLAA 3GLGA 4N9QA 3MOGA 5AI5A 2WAOA 3IMFA 3ZCXA 3CKKA 3IE2A 5FNVB 4MUBA 4W63A 1DIHA 4QDTA 1EUYA 4KU4A 3GOHA 4ESHA 1XAJA 4ZA2A 3ODPA 3K20A 2X8WA 4OBXA 3WQRA 1U0LA 3AM1A 2WVGA 3WIDA 4KFTA 1PS9A 4DJFC 5BRAA 5DMXA 3HB1A 1LCIA 1UQUA 3FLAA 5KNBH 3E5MA 4ZCTA 1DAKA 2VYNA 4D8VA 3FYUC 5KWJA 3WJAA 5IRCD 3WLPA 4M1TA 3W7BA 1NFQA 2QEQA 4IDAA 3AI7A 4NZZA 1XIVA 1L7NA 3DP9A 4LX8A 3MIIA 4P58A 1GN9A 3AY3A 3OHMA 4LF4B 2Y77A 3P26A 3DTVA 1T2VA 3INRA 4L6IA 3PGXA 3TNYA 3C8ZA 4B47A 3T12A 1NVUQ 3UUGA 5AKGA 2A1TR 4K40A 3ZLVA 1Z7GA 1IOWA 2CLKB 3B7PA 4DCSA 5CURA 5I47A 1E96A 3R9XB 2AV6A 2Z2XA 4D79A 4JL5A 4Y6PA 5DNDA 1CY8A 4JS0A 2GZMA 4BX3A 1NBHA 2PZKA 2EIYA 1ZIDA 5G0UA 5J23A 2YY7A 4HD8A 4J1NA 4BFUA 3SX2A 3CZQA 5CCBA 4AMZA 5U4QA 4QULA 4RJKA 2LXNA 3EXHA 3KHKA 2VJYA 2FSHA 1YDHA 2C22A 1OFUX 2Z1NA 4ER3A 1Y1WG 2E4AA 2C7RA 4JBWA 3ED5A 2W2XA 2C9DA 3P9CA 1BHJA 3VC3A 3PEEA 1VBKA 2FWJA 4RDHA 5DGBA 1N5KA 1XHLA 2IZZA 5K0TA 4FMBB 4Y0VA 4YWJA 2VPIA 3QF4A 4O59O 2ZPTX 1XYVA 2ATVA 4O3NA 5C7LO 4UBMA 1DUSA 8ABPA 4X41A 4WA7A 4H7HA 3HUFA 1O03A 2XB2A 4GZ5A 3AUXA 4HMPA 2H4FA 3RC8A 5CYGA 2Y67A 1GG5A 3AGPA 4AN0A 1U7HA 4NDNE 2GO7A 4IVPA 5C1PA 1MP0A 4ZHSA 1YRLA 2GI4A 4A3MG 1J07A 5JNVA 2I6XA 1UWKA 2CVFA 4MRVA 3BFJA 4KLAA 3ZVRA 2YHBA 1FLDA 1UXKA 1JIHA 3O2JA 4YUYA 2B0JA 3N74A 1A8SA 2Y0DA 1DEKA 1QG0A 1B0AA 1MQAA 3EVZA 3GCGA 2XHZA 4WDRA 3F8SA 3AJDA 3TEMA 4DR2B 3T1HB 5D00A 3QJGA 4YV0A 1J0DA 3OIGA 3HEAA 4K7JA 2O2IA 1DHTA 4FQ8A 3ZWMA 2F90A 5C1DA 1I6UA 5AKLA 2J7PD 4YY3H 3FHOA 4UATA 3H83A