4MA0A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with partially hydrolysed atp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
366
structure length
366
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with partially hydrolysed ATP
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
total genus 120
structure length 366
sequence length 366
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma0A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma0A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma0A01
3VPDA 3BSWA 5BMVF 1PK8A 3HO8A 3KREA 2V5AA 1Z2NX 4XYMB 1KC7A 3RFCA 4TV9F 3RV3A 4QSHA 1VBHA 4O86A 2VR1A 4MV1A 5D8DA 2R87A 2YZLA 3RUPA 3VPCA 4C5BA 2ZDGA 3WO1A 1SCUB 3R5HA 2YS6A 2DIKA 4EGJA 4J6EA 3TIIA 2SCUB 1UC9A 1W96A 1EZ1A 2NUAB 3QFFA 3NUAA 3MWDA 3BSSA 1EYZA 2IP4A 1GGOA 4ZQIA 3LWBA 2R7NA 3V4ZA 2YL2A 4FGRA 1T36A 1DV1A 4O7RA 1OBGA 4HNVA 2YW2A 2ZDQA 4O82A 4C5CA 3WO0A 2NU9B 2X0SA 4HNUA 4O81A 3U9TA 4ZHQF 2V58A 3UFXB 4O4LF 4YAJB 1JLLB 2W6OA 4O7SA 5JQWA 4XX0B 4EABA 4IWYA 3OUUA 4MA0A 3MJFA 1M6VA 2FB9A 4MV4A 3TINA 5BPFA 3ORQA 1EUCB 3VPBA 5KX5F 4FFOA 2NU6B 1WR2A 5GONF 4EAAA 2YS7A 4EG0A 1JDEA 3TQTA 1DIKA 2GLTA 4RZQA 2VPQA 1EUDB 4O7TA 4O2BF 1KJ9A 1OBDA 4MV7A 2ZDHA 2R7MA 4L1KA 4GGMX 4MV6A 2OLSA 2CZGA 5J2TF 5LP6F 1GSHA 2P0AA 2I87A 5JH7F 4MV9A 1KUTA 1GSAA 2DLNA 4FFMA 5FNVF 4O7WA 2W71A 4YB8B 2YZMA 1I7LA 4M9UA 2PVPA 1E4EA 3ORRA 4ZOLF 4O4HF 4O7ZA 2NU8B 2R82A 2CNUA 4M99A 2NPOA 3Q1KA 3N8DA 4M98A 4O4JF 2YZNA 2CNVA 3JZFA 1KJ8A 2R85A 3KAJA 5HBRB 3KAKA 2W6ZA 4ME6A 4YJ3F 4O83A 1W93A 1CE8A 2GPSA 2PBZA 4MA5A 3VMMA 4IHJF 5JQGF 3AX6A 5I47A 5EZYF 4WBNF 1CS0A 3U55A 1C30A 5JVDF 3R5FA 5C1PA 5C1OA 4HQ6A 2PN1A 5LYJF 1KJIA 4M9CA 3HB9A 4FFNA 4O4IF 1A9XA 3AW8A 3V4SA 2R6FA 4TV8F 3K5IA 1GSOA 1JDBB 2R7LA 4YBZB 1Z2PX 2HGSA 3GIDA 2QK4A 3U54A 4FFPA 5LXTF 3WNZA 2YYAA 4TUYF 3N6RA 4O2AF 4O7VA 4EA9A 1AUVA 1KJJA 5CAEB 4FFLA 2I8CA 3JRWA 2HJWA 5J2UF 5CA0F 5CA1F 3DF7A 3JRXA 3VA7A 5K2MA 1UC8A 1IOVA 2W6QA 5BPHA 1C3OA 4MV3A 3OUZA 3LP8A 4YJ2F 4MAMA 1JKJB 5DMXA 4HNTA 2YWVA 2W6NA 2VQDA 2C00A 4WD3A 2YRXA 4NYEA 1Z2OX 1PX2A 2FPGB 2FPIB 3U9SA 1CQIB 3HBLA 2GQSA 3I12A 4EA8A 2Z02A 2R7KA 3RV4A 3TW6A 4Y8VB 3BFPA 4I50F 4YAKB 3GLKA 3SE7A 2XCLA 3JZIA 1I7NA 2FP4B 4I4TF 2CQYA 4FFRA 2XD4A 1M0TA 5LOVF 3G8CA 1DV2A 5IYZF 1KJQA 1BXRA 4FE2A 2WYOA 1IOWA 2R86A 1B6RA 1B6SA 2FPPB 4O84A 5KKNB 4C5AA 2W6PA 3K5HA 3R23A 1BNCA 3Q2OA 2V59A 5C8YF 3MWEA 3TIGA 3KALA 3G8DA 4HR7A 3VOTA 4O7YA 1E4EB 4DLKA 4O7NA 2CNQA 2NU7B 3E5NA 1AUXA 4DIMA 2QF7A 4IZOA 1ULZA 2J9GA 4EA7A 1GLVA 5JVLA 4IIJF 1EHIA 5HV6A 2R84A 2I80A 1VBGA 2Z04A 2DZDA 3BG5A 4EGQA 4FU0A 3R5XA 2W70A 2VHEA 2W6MA 2YRWA 1CQJB 5H80A 4XZ3B 1KEEA 1VKZA 4XYLB 3ETJA 3K3PA 3BSYA 5LA6F 4E4TA 4ZI7F 1A48A 4MV8A 2DWCA 1M0WA 4IWXA 3R9RA 2YZGA 4I55F 2GQRA 5CB4F 3ETHA 1KBLA 4O7LA 2GPWA
chains in the Genus database with same CATH superfamily
5FTKA 3EQ8A 5EJ5A 2P1RA 4RLQA 1QF6A 2XR1A 3TCXB 3RUDA 3MG9A 4NPCA 1ICIA 4IIFA 3KJGA 5DBEX 2AMYA 3OZGA 2XZLA 1IXRC 2F1OA 3DOJA 3EPRA 3F71A 3FYUB 1E32A 1QCCA 2KPOA 3K92A 4IJ5A 3JD3A 1A0IA 2DSNA 1XZKA 2QM7A 5FF9A 3SX4A 5JSZA 5JXWA 5KMGB 4CEIB 1GZ6A 4LYAA 1B6TA 4PC1A 4UMDA 1ZRNA 1UJ6A 2PSDA 3FHLA 3RG8A 5HSGA 3E2PA 4F8EA 3CXUA 4EBFA 2Q3FA 1QVAA 1X7ZB 5DJ5A 2YNMA 3MWLA 3OTHA 1HDEA 3JPWA 3ECSA 4YVFA 4DQXA 1E64A 3ZXUB 1QGED 2V7XA 1WRBA 1PJZA 4ECRA 3HA5A 4DWWA 1GDDA 1UBTS 3I2YX 4OFBA 5DBGA 2OAQ1 2E5LB 3H6GA 5CT8A 1NN3A 5SY4A 2W6IA 4WZBA 4L08A 1EKVA 5AVQA 5LD2B 5LWHA 2ZIAA 2HVRA 3GMTA 3VPFA 1L4UA 1NRJB 1RRPA 2WTMA 2HZBA 3OI7A 1Z5OA 4Z6KA 3K6SB 2OM2A 1BHJA 1HLPA 3C8HA 5BSWA 5KYGA 2CXTA 2J4DA 3UEOA 1TU3A 2HK9A 2ZAGA 1DELA 5AMXA 3VVMA 3QKIA 4W5WA 1J06A 4H9GA 5A4IS 3UG6A 1UUFA 4P6VF 3ZDQA 3FOEC 2V6BA 1H5QA 2VCEA 4D57A 5CJJA 2HQRA 4LISA 4NECA 2L0XA 1ZOLA 1OFHA 2CZQA 2QSZA 2ZIXB 1ACMA 2FXVA 3AONB 4YJDA 4ZPJA 2WFMA 4MMYB 5B6PA 1UMCB 2IYAA 2Q07A 2QLTA 3IJRA 2QG4A 1WSCA 1A7AA 1W8IA 2I9PA 4LZJA 5EZQA 2RBEA 2QPOA 2VDNB 1Z9BA 2FVYA 2J4CA 3IR6A 3O4JA 2FV8A 3OJLA 4M0EA 4LHZA 1DV1A 2Q46A 2JBAA 4HJRA 4QD3A 1JMKC 1GRNA 4N9QA 4BVHA 2RGBA 1Z88A 2DPLA 4JR2A 5LQNA 1RQGA 4HP8A 1CD5A 2E55A 5BYJA 2A0UA 4ITRC 4D9JA 1XVUA 2J3QA 3CYFA 4PRZA 4U6SA 3FMVA 4GC5A 4F5EA 3E8XA 2C22A 3KWJA 2YFQA 1A8IA 2VPIA 3OF5A 3A28A 1K88A 4JI0H 2QU8A 3ENWA 1GGFA 2W00A 3IALA 3W77A 2AX4A 1XNRB 3NC0C 5E3HA 1T0JB 4KXVA 4G9BA 5CT6A 3ILXA 4RANA 2GFIA 5G0SA 4G9EA 5FDFA 3E9NA 1Q7TA 1SC3A 3FPGA 4PHTA 4S3MA 1H1LB 1OU4A 3A3KA 4TVSA 1FMFA 2G0NA 3LA8A 4ID9A 4ER5A 3QLUA 2W6OA 2OV8A 3NHPA 4NBLA 1G41A 1B3BA 1T5LA 2O2EA 4Y2SA 2OBMA 5ICGA 2J30A 1N2CA 3E7PA 3C14C 3UGJA 1OXMA 4ZAGA 4D99A 3QVKA 5L3ZA 3VOBA 3RD5A 3K4HA 4D9KA 4C4OA 1TJ4A 3VKVA 2HRZA 1WZEA 4IHJA 3CLTC 3QVWA 2D1SA 3K9QO 4R2HA 3VNBA 1FPQA 3QZ7A 1BH2A 2PH7A 2XEXA 4G23A 1JV2B 2GM5A 3HRIA 4ZTUB 4MV4A 3LMLA 1H1TA 2QQFA 3A4MA 3KYBA 5EXXA 3IIEA 4C2TA 2BL4A 4X71A 3W5AA 1ZXLA 4L8FA 1U8XX 2NO7A 2ZYTX 4RBNA 2J9YB 1KBZA 2QT1A 3KHSA 3UOAB 5G4KA 4CKXA 3WLMA 4C7JA 1VSBA 3MSXA 1V3UA 3T1HB 5EPOA 5DLDA 2NU6B 2RGYA 5F1OA 4YMWA 4HQFA 5T5QA 2JH3A 3AB3A 3BHMA 3E3AA 3LBIA 3TQTA 1RJDA 4AJNA 2OMEA 5ITZA 3G79A 4QPCA 1E6UA 4D1YA 1KOGA 3ZHQA 3QP9A 1XQ1A 1N2ZA 1KAOA 2UYOA 5FBRB 2OA0A 3ZWPA 5CX1A 2PD3A 3F6BX 3DJFA 2BGIA 2QNBA 4FDMA 4R7TA 2J0UB 2RH9B 3A58B 5F1KA 3KQKA 4IO0A 2XCSB 3EZXA 1P9NA 3EWIA 2JASA 1ZCZA 5K3FB 4CF4A 4RWEA 5BN1A 5JOQA 3SXJA 2Q0HA 1CRQA 4CGZA 2VLIA 4MYCA 3WYBA 4J94A 4NCBA 2VOBA 2PZAA 2OC9A 1RRKA 5DIFA 2ZAMA 3SP1A 4NH4A 1KJ9A 3RAPR 1PSZA 3QELB 4G4GA 4LHEA 2F17A 4GMGA 5TMEA 4CR6A 3PTLA 2RIRA 3M49A 4RZUA 3LOUA 4BEVA 4D4MA 4LH6A 3VR5H 2O0LA 5KFMA 1FXUA 1VHQA 1OWTA 5J2TF 2FPUA 4I5FA 1BHO1 4Q9KA 2CVOA 2BV3A 1VBMA 2QG9A 2JH8A 1V4BA 4FT2A 5DYIA 5HK8A 4DSAA 2FMFA 3GGDA 4O4IA 4B7ZA 3D6VA 4BKPA 3A32A 3RAFC 1U0LA 4MQEB 4PRYA 3R6TA 4KX5A 4FE3A 3RUFA 2GAAA 3CONA 4W5JA 3K5PA 1T1RA 4KO3S 2EATA 2G36A 3KR1A 5FNVF 4PQFA 1SOWA 3NHLA 4NV1A 3FYDA 4JJAA 2NO9A 5KSOA 2PVPA 2YVQA 1E3WA 1TL7C 5F7JA 2NVWA 4FMDB 2MYPA 4DCMA 2JIMA 3WLNA 5JECA 4FCVA 3CF2A 2RH8A 1FJ2A 3IOMA 1MD9A 3KL2A 1CKNB 1IQRA 1HKUA 2ZRBA 3MM4A 4K9SA 4W7SA 3W78A 4X5OA 1GTG1 1WNTA 1V45E 2OO5A 3PXBA 3GFFA 4LY9A 4I14A 3TFWA 4K87A 5CCDA 1F5NA 3HSSA 3R7AA 2EAUA 4ZOAA 3QUSA 1LRJA 2BF4A 1YUMA 2H16A 3ABIA 4HEQA 3RJMA 5U9CA 2EFEB 4F1JA 1T25A 1E4VA 1VP3A 1SG6A 2NOAA 1F6BA 2ZCUA 3H1FA 4RMHA 2YZNA 4BBJA 1YF3A 5CX4A 2OD2A 1SU7A 4LC1A 1R4ZA 1ZQ7A 1N3BA 2IU6A 3RWBA 4AYTA 4TKVB 4DNPA 1CF4A 5IKOA 1FSGA 2QN9A 2QRLA 1ZK1A 5HA5A 4HEJA 5KFXA 4RPGA 1E7RA 1ONNA 2VQ6A 3NIFB 4BVKA 1LB1B 4BZZA 1KO7A 1BYUA 1NM5A 2JKVA 2VHUA 2ZRFA 1YBVA 3FPAA 3PS9A 3IP7A 3S1AA 5BV1A 5KDOA 5JQGF 2OLJA 3PEFA 2NZYA 3DMGA 1QO7A 3K1YA 3AV3A 4H7KA 4RIHA 4CHTA 2UZ3A 3GIIA 3DCNA 3VR4H 1O0CA 1OFUX 2P0YA 4PG8A 2Y77A 4G1CA 2ZAOA 4C3UA 1R5JA 2ANCA 4PZ9A 5AM0A 2MCTA 4BKQA 5KCZA 3V6KA 4UPVA 2J5QA 3H9BA 1C1HA 2BFAA 4H1VA 4MITA 3ZEIA 5BNIA 1Z0FA 1KZ7B 4OL9A 2I4LA 2BEUA 4RL4A 3S4YA 2KSWA 1JU3A 3T5BA 2OXTA 3EUAA 4UCOA 3OQ6A 4PRLA 2RB4A 1PS0A 2AWNA 4REQA 4HUTA 2RAUA 1N2OA 2P3OA 5BVHA 1NUSA 4WNCA 1QQAA 1EE2A 2VN8A 2QUAA 3COVA 1UNNC 4P36A 4OMFG 1HYBA 2ZRJA 3TUIC 1E0AA 2Q5JA 4TOIA 1ML3A 4A3FG 1Q2UA 5FUQA 5AVTA 2XCOA 1MOQA 5GIOE 1GVNB 2YC4C 3KE9A 4AM8A 3M9NB 4EZIA 4TQRA 4IS3A 2NSYA 4DUYH 1Z2PX 4M36A 1OIWA 1I50A 2VZLA 4DMGA 5B4TA 2OHGA 3QKSA 1QP4A 4B1FA 1Z2DA 4YJHA 5KFWA 4C43A 4IP0A 2CEKA 5KTTA 1OF1A 1M8FA 3D6TB 5T6MA 2P65A 3H2BA 3Q0TA 2BC9A 1XLVA 2C61A 4JJ4A 3WGGA 4BLQA 2IS6A 3LUCA 2FR8A 4DSZA 1NW4A 1NC3A 1PFUA 1FRNA 1V7CA 3ZDRA 3PHLA 2W2TA 4RPCA 4OKSA 1KGSA 1YZFA 3L77A 2OO7A 2V3WA 2WUGA 2Q1XA 3BAZA 3F3KA 4S1VA 2FK1A 4B47A 1PZNA 1ST3A 1YHYA 5HJ2A 1RPTA 3R8FA 1QOZA 4HEA6 1T43A 2O6LA 1T9AA 1XO1A 3BQ1A 1P77A 1P7ZA 4OPMA 1GFZA 2IYUA 3BBPA 3I9MA 1Z35A 4ECSA 1HE5A 1ONOA 1P91A 1QHSA 1RIFA 2WYVA 3H1AA 1X6VA 4GIBA 4J75A 5ALFA 5ADUS 4C4ZA 3W5OA 3PICA 1GG2A 2WMDA 5KC8A 4EZBA 2YFYA 3VR0A 4F3RA 1T3SA 2A9KA 4M0CA 1TO6A 3BDAA 1KOJA 3DUWA 2HK8A 2YXNA 3C7AA 4Q4DA 1EBFA 2FFHA 2FFAA 2FSIA 5J2UF 2CVHA 2QUIA 2Z98A 3NCHA 1MX9A 5LOVA 1AO0A 2Y6VA 4GZ6A 4K2AA 1ORWA 1XDGA 2FFRA 3KYIB 3ZBPA 4RNOA 4B0OA 2DE0X 3P9IA 2GJ8A 2IYFA 2VJQA 1CB0A 3DDUA 2C5AA 4FYJA 4BTEA 2Y1LA 3LX6A 1TB4A 4XGQA 4IVQA 2ZATA 1M8KA 4JU8A 2P90A 2HHFB 1SU8A 4Y67A 3W5CA 3BIWA 3JQFC 1E1DA 4EECA 4TX1A 3T7DA 3TL3A 4OU5A 1X87A 4CIAA 2FPPA 3RT1A 1G20E 1RYFA 3DZIA 4DHEA 5K3EA 5D1OA 2GX6A 2ZRDA 1TKCA 3C6MA 1L5GB 2LPMA 1AQNA 2O54A 4QJ4A 1F4PA 4ZO4A 3X1XA 1A04A 1F2TB 2IEDA 2WIBA 2XWBF 5TV2A 4CMJA 1YVUA 4C04A 1XF1A 3SX2A 4LYDA 1T94A 2TMGA 4GICA 4DLLA 2FW7A 1T1EA 5G3YA 5ALGA 5KWJA 2O0HA 2RB5A 1Q0PA 3HBLA 1KZGB 1U2PA 1LK7A 2GQSA 1T3TA 1A8UA 1E1LA 1YRLA 2AOTA 3LG2A 2YCBA 4TMVA 3V1NA 1ZXXA 5E2IA 5G1OA 4B76A 3RV4A 4AQDA 1JX4A 3IEMA 2WAXA 2A8YA 5CFQA 1FKAH 3AHCA 1XFAA 5FPOA 1SZJG 3LPAA 1LWOA 2VYVD 5JD3A 1E4YA 2DPHA 1RKXA 2J3KA 1L5KA 4B3CA 1YJ8A 5D84A 5DXFA 2V0GA 3EPHA 3Q41A 1I7NA 5I5VA 4A2BA 2AMJA 2C9YA 4REOA 3SSOA 3WJ2A 4Q1DA 4DG5A 3MPOA 2JEFA 5FR1A 2C99A 3GLUA 3PUXA 1MUUA 3OICA 3OZUA 2QAGA 1XCBA 1WPXA 1LBQA 4HPXB 4N49A 4P7FA 1ZIXA 1NF2A 4DG8A 5FFMA 4AS2A 2PX5A 4HLUC 1GT91 4RJKA 4TQGA 1ZGHA 3HGTA 4M1MA 4E31A 3D6AA 3C5WP 1SQ5A 3T41A 2ZWPA 3P27A 3SDZA 2XQKA 4D26A 1G3RA 1M2WA 1NZFA 1V5GA 1COZA 2H54A 2QTAA 2NZXA 5AKJA 5IN5A 4XQ0A 1MNQA 4ECTA 2X9NA 1MC8A 4N3BA 2WYOA 3UT0A 3RK1A 4U8HA 1WUJS 2Z8XA 5FPQA 4G97A 1AMOA 3EVGA 4JUFA 1H2AS 3P0FA 2PGDA 1PLLA 3RSZA 4HF7A 2C7PA 1FCJA 3W4IA 1QDUA 4OHMA 5HIMA 2ABJA 2EOAA 4WT7A 1YDGA 2H3EA 1T9KA 3MN1A 5JARA 3CF4A 3KSMA 2DY1A 1L5FA 3AB7A 3C1TA 4OLHA 3D1VA 2QRJA 2VK8A 4MW6A 1YZLA 1TZKA 1Z6GA 4Q3NA 1BKSB 2PXXA 3R3JA 3SS9X 3VTZA 1LSUA 1KYIA 4B5LA 4O3NA 2GHTA 2IZ0A 3TRDA 1PVDA 5JNTA 2LTAA 3ONWA 2IWRA 4S04A 2QP9X 4UJ5A 4R51A 2A86A 4Q48A 1Y9JA 4G5YA 4YIKA 4WI1A 3FTEA 4FYVA 2DKOA 2WNHA 1UKCA 2HDOA 1NASA 4GR4A 4P2BA 4NU6A 1GFIA 3I53A 4UEOA 4AN1A 2MMGA 2HXGA 4IOJA 3VNUA 1C8BA 2FN9A 3B3QA 1VI2A 4LRSB 5DTEA 3V7WA 1UBOS 4KFSA 5AK4A 4LJAA 5K0JA 3IBTA 4TROA 1GLVA 4X66H 5JVLA 3M1IA 3SFZA 2PLWA 1CUSA 1QRDA 1WDMA 2ZT7A 2FF5A 5D2CA 4W1SA 2W7OA 3E22A 4KRYA 4W4TA 4BKMA 5ALTA 1FUKA 2FE4A 5CEJA 2W9BB 4QPZA 1I6WA 3WIDA 4CKBB 4ZU3A 4JAVC 3C3WA 3TOVA 1MX3A 1SUWA 1QPBA 1VIMA 2WC1A 3AP2A 4GI2A 2WR8A 1QV9A 4HWRA 2YOGA 3CTMA 2ZRGA 3UAYA 3Q7RA 1MPTA 2MSDB 4B48A 2FKLA 3K96A 1VI5A 3N42B 1Q7BA 5AO9A 2FW1A 4UCXA 5HTOA 5EAIA 5ICCA 4JUIA 2W6MA 2GJ9A 3KTOA 5FO1A 3HU5A 5IZCA 1E63A 4WQMA 2XITA 5ES4B 1DWOA 1QBKC 4MRAA 4QQ8A 4Z1OA 3AUKA 2HA2A 1G60A 3C39A 1L5HB 2CB9A 3I4FA 2VSFA 3D6HA 3ZCRA 4AW9A 1R6BX 2B0CA 2OGZA 4FONA 1T5IA 2H1VA 3D6MA 2ZBEA 4XPIA 4CMIB 2O7NA 4QYXA 3GELA 1N8TA 5TJHA 1K1EA 1T8SA 2CLLB 1KJYA 2YWRA 3LF2A 1S7CA 2FCAA 3FGOA 2BFPA 4GG1A 4X84A 5H4HA 1DAMA 1FVHA 3I5XA 4IMRA 1FQJA 4RSGA 2VZ9A 1XU7A 4RE5A 4B3JA 2Q3JA 1WQ1R 5LA6F 2XODA 4Q7EA 5EZ6B 2JHPA 2OK7A 1E5XA 2KHZA 3GRYA 2UYYA 2RGVA 4MV8A 5DMHA 3JQAA 5JVDB 4B45A 4RLSA 3W04A 3H13A 3U4MA 2IPXA 3IDQA 3P2YA 4N7RA 4QQRA 4FKBA 4U2EA 2RSLA 1KEKA 4M8IA 5TS2A 1T2CA 1T0PA 2FU5C 2PL5A 3ED5A 3QPCA 3TRIA 3U7HB 4C06A 4S1TA 4PZ8A 2VRBA 1KS2A 2A9OA 3TQQA 4BNLA 3PW4A 2ZJ3A 4YHBA 1GTSA 3OMLA 2VNHA 5FOVA 2X4DA 3AQ4A 4ZOLA 5LIPA 2V74B 4G5HA 1EIZA 3SLGA 4UUOA 4Y2JA 4B4UA 2GJ4A 2R1TB 2WIFA 4NBTA 4WWHA 4UQLA 5K9ZA 2OVFA 1Z0IA 4GXNA 5FOWA 4JBNA 5LCXA 3W7VA 2NZ2A 2EEPA 3PWKA 4LCBA 1CUIA 2WG1A 5FUXA 3GLQA 2BZ0A 1FSFA 4WESB 5B55A 3GLHE 2C7OA 3WMXA 3MD0A 4JC5A 4PN3A 1B0PA 4PC3A 5DBHX 3OLCX 4ZJUA 5MN6A 5J1SB 3A1SA 4KN9S 1WS6A 2WINI 2IHTA 1GZDA 3FFTA 3MSCA 2X3FA 4KQ6A 1KIFA 3BHNA 1JNYA 2NO4A 3GB8B 5DXJA 1Z5VA 1GQRA 5D8DA 2BGTA 2NAPA 2EFHB 1G3QA 4HGZA 3RUHA 2HLHA 2FSVC 4GYKA 2G6BA 3U7EB 1M1UA 4RACA 2PWYA 2DOKA 2JDIA 1J56A 4KQGA 2Z4RA 1MV5A 5JMPA 1ZOIA 4BV9A 3K1AA 5KFBA 3DFFA 5KFJA 4BWYA 5TLSA 1XMVA 2AKEA 1G6Q1 2F59A 4C2BA 3TDNA 3CM0A 1R0RE 2G1JA 3L1UA 3LL7A 3ROZA 4A6XA 4XYLA 5I01A 1AGNA 1VSVA 2YZ2A 4Y3UA 4Q7JB 2B8NA 2P11A 2PT5A 1AS2A 1SPBS 2Z57A 3CH5A 3KZ1E 1T0IA 5FIUA 2IE0A 1HMPA 3AI1A 3QVLA 4JKIA 1GGOA 3DQPA 3NYQA 3L2PA 2RBGA 4ZQIA 4MB6A 1Y4UA 3BCUA 1PQUA 1AY0A 1LVUA 3U60B 3LWBA 1YGPA 2ORWA 1L5SA 5EZYA 4KB5A 1YB7A 5ALPA 4DA8A 2REOA 1NXWA 2BMWA 1EVQA 1QS0A 3D43A 1TK3A 3GRUA 3IEIA 3CSWA 2YASA 3NEPX 2FWAA 4GM1A 4TXNA 2M6KA 3Q8QB 1XTUA 1J21A 1J2YA 4NU8X 3TR5A 3DYIA 1GTJ1 4M4SA 4H4EA 4V0KA 1R00A 5G2OA 1WXIA 1XMOB 1WBBA 1MABB 2HIXA 2XIJA 5EIHA 1G7TA 1MAUA 5DQGA 1PT5A 2A1TS 3DSRA 3KE8A 1BD3A 3R3WA 1QVRA 1I3QA 4DM4A 3EZ2A 4QU5A 2UXCB 1RXEA 2FR0A 1FDVA 4DV2B 2ATLA 4JV5H 4BX0A 4YMHA 4JYPA 2IPOA 5BSFA 3HSYA 3TLJA 1HT2E 2OYRA 2RHTA 2EX0A 1ADFA 1ACJA 4O08A 4E03A 3QJGA 4Q15A 1U4OA 1RWPA 2AKYA 3OJCA 4G0QA 5I5GA 1L3BA 1BVYF 4NYIQ 2W9BA 3CLKA 2C1EA 4CC6A 4G56A 1IY1A 4IUYA 4A8JA 1GTVA 5AI5A 2R8ZA 3LZ6A 3WQHA 4F4YA 4D0GA 5IEJA 1RVV1 5ER9A 2AXQA 2VT3A 2R92G 4OIFA 2QL5A 5EVCA 1QHEA 2ZG6A 3LYAA 3KZKA 5D3MB 2RJNA 4EFLA 2ZBFA 3OE7D 4IXMA 4TV8B 2RHRA 2FUNB 3AR4A 5A9SA 4KLRA 4UMEA 4PHFA 1Y1LA 3H0GG 1BDMA 2NU7A 3WA7A 3ZH9B 4XX0B 4PZCA 2WOJA 3S2GA 4BN0A 4XM1A 3MT8A 3JQ8A 2PHZA 1KA9H 4CNBA 4DKXA 5JWRA 4BBPA 4R2LA 4C7VA 1I7SB 5DEIA 3GJ7A 1J39A 4RTSA 3RC8A 1A27A 4H35A 2H85A 4Q02A 3U44B 4EBDA 3SC3A 421PA 2X0IA 1W87A 2WJHA 3FFBA 5ENZA 5HS6A 2BSQA 3G8BA 1CY6A 3S27A 1SHJA 4MUMA 1N32B 3MUNA 4QTZA 3UQZA 5F9NA 2PL3A 1JSZA 2X76A 4NR0A 2WY2D 4MVJD 4D96A 4G37A 1GILA 1A95A 4TTAA 3LLUA 1B0UA 3EYYA 1LC0A 2YHIA 2AIRA 4J3JA 4C20A 4FB5A 1CK4A 1IM2A 1UAYA 2C2YA 3UWPA 1D8TA 4CM7A 3FKQA 4NHOA 3IOYA 4FDTA 3F8TA 2C2BA 3G59A 5FLEX 3SNKA 3I61A 4B74A 3AVTA 2ATXA 5JNUA 3LPCA 5DHRA 3I4MG 1SIWA 2C31A 2VJCA 3E0QA 3HH8A 3NGMA 3X1YA 2DH5A 3EOZA 2QVLA 1XJWA 1U1DA 4YCJA 4MS1B 3RS8A 5IYDG 2QYOA 1GXSB 2MSNA 5IH3A 3OCJA 1MAWA 1NQOA 1GQ2A 1H6CA 1T0UA 3FDSA 2ZDHA 1WOYA 1Z29A 3PNQA 4MTCA 2PS0A 4H77A 3H1PA 4QYIA 2VDOB 1X19A 4LF4B 3HBNA 1I24A 2IELA 4CF6A 3DJYA 3FCSB 2BELA 4E21A 3NBZB 2ACVA 3ZWMA 5B3JA 4ZGGA 1OBOA 3O2NA 1GSHA 3KXPA 3WAKA 2I87A 3MTEA 2ZBPA 1A4XA 2NVUB 1A69A 4PONA 1E2MA 4V0MA 5ALZA 2C4NA 1A3GA 2H11A 3C6ZA 3N87A 1XK5A 4OA8A 4RKQA 3S8MA 2NVOA 3GU3A 1RYRA 4JZKA 3VBCA 1PG0A 1YBAA 4QNNA 3ZYZA 5DN6D 1UFVA 4K40A 2YDXA 1PZEA 3HBJA 3FJYA 5LB4A 1IUNA 3ORRA 2VHCA 3ANXA 5I5UA 1E2QA 1RWNA 2VEDA 1YRWA 2VNJA 1NOIA 4OLJA 1Q3TA 1BMQA 2CNUA 1E2PA 3SF8B 4GKVA 4CM9A 2R1ZA 3B9PA 3A9WA 4W7HA 2AHOA 4BGUA 5A7FA 2FLKA 2N1MA 1VA4A 2OESA 2AN3A 4B87A 3JYHA 4BNHA 4R8LA 2NO0A 1T9BA 2W7TA 4YY3B 2HA5A 3MERA 3R3XA 4IV5A 4OOFA 3CEPB 4PGFA 1PQ4A 2V6GA 5PNTA 2CYCA 3TZ6A 1V8OA 4J9UE 2CHVA 3WNCA 4R1QA 2KS6A 6REQB 1WB5A 3EIFA 1KJ8A 5J4VA 3TPFA 1KP9A 1ECGA 4YJ3F 2C5SA 4EMBA 2NADA 4X45A 1ADBA 2AK2A 2FX2A 3AEUA 3UW1A 1JS1X 2ECPA 1RR6A 2OPHA 4INPA 1JTEA 2PT7A 3ILYA 1OHHA 6CHYA 1W46A 1JE0A 2IHBA 4L3WA 1SD5A 1DDGA 1W44A 4LXUA 1GNPA 4O2AB 4MWZA 2ZRLA 4BNZA 4EW2A 2DWQA 2Y0BA 3KDSE 1I0ZA 1EVZA 4MWEA 3GGCA 3NOQA 4TTVA 1RQNA 3MINB 4DRXB 3OFKA 1B73A 2F4NA 4FGWA 3MRVA 3O1LA 1JDNA 1MJFA 3NTOA 4J0FA 3TCKA 1F38A 1PR5A 4TLDA 4H4CA 3ZHXA 4OQLA 3B6MA 5JBNA 4IGEA 4WXEA 4E5UA 3FNFA 4MVJI 1OKKA 3PC6A 1EFUA 4HWPA 4L5YA 3AI2A 4DQUA 5KYKA 1PWZA 1QH8B 3B7PA 1MB2A 1EJ2A 2EJBA 3O0DA 1YS7A 3SXPA 1C3XA 4QSMA 3TIXB 5F7OA 4OU4A 4DDWA 3VR2D 3O38A 3FNQA 2ZWMA 3IPLA 4G5QA 4E32A 4JB0A 1G5QA 2DFLA 4RHCA 1CNMA 5G0VA 2QZJA 1A88A 3C2QA 3TIVA 5KFDA 1JHXA 4II2A 1PJAA 3PUIA 4YBZA 5DG9A 1DTWA 3I1FA 2AQHA 2BDTA 4GLBA 4BP3A 2I3BA 5KFLA 1DFGA 3JWHA 5ALDA 4G0XA 5E3JA 3W3AH 1A7UA 3OZTA 2HADA 4X54A 5AOVA 4YUYA 5C8DA 4WH0A 4XJVA 2HGSA 1HH4A 4CEJB 4GP9A 3GLHB 2Z1NA 3AEQB 3VJKA 5LXTF 2PGIA 3WNZA 4Z2AA 4B0PA 4KIJA 4WX2B 1F0NA 4YRRA 4FX5A 1WZUA 1CIPA 2Z8YA 2OGSA 1Q1EA 3E9MA 1SZCA 5HJ5A 1XYGA 5L6LB 2XADA 1WCMG 4XR4A 1A8SA 3GJ4A 3Q2IA 4CQLB 4JZYA 1AUVA 2Q6OA 2HYIC 3E2MA 4A7PA 4M9SA 2SKDA 2EWWA 2A5LA 4J0GA 3UCFA 3OZ7A 4MLZA 5F9LA 1P2BA 1KPIA 1R0LA 2ACEA 3DHEA 4Q45A 1U4SA 4EGAA 2LIVA 4F4CA 3R9XB 3CX7A 1SVMA 5D87A 4DL7A 2CLFB 3RBZA 3VI3B 4DLWA 3LUHA 1U0GA 1LW7A 3FWNA 1H4TA 1UWCA 3N8HA 1E3DA 4GQAA 2C4MA 2AG8A 4MMXB 4OA5A 3JQ7A 2J6TA 5I51A 4KR9A 5IYZB 3V8QA 1P5RA 3DF7A 3CBQA 4EIWA 5J43A 3WQSB 3DQZA 5SY9A 2VHYA 4CKEB 5EDWA 5C80A 2VP2A 4E11A 3DC7A 3T7AA 4QOHA 4INAA 3IQFA 3TLKA 3MHPA 3OUZA 3ADOA 4FS3A 3P2KA 3R7SA 1IOLA 1F3OA 2GN6A 4MVJA 1TJNA 4JI6B 1HRKA 3OJEA 4NENA 2X0DA 2ZM5A 4MAMA 3UT6A 4BXXG 4DCNA 5FULA 3GA0A 3E03A 4LK3A 4ZU6X 4HNTA 1J24A 2BFWA 2YVKA 3DP9A 3UV3A 2PUAA 3ITDA 4UARA 5G02A 1IEQA 4DSTA 2PL9A 2MR5A 4KGDA 3M33A 1KYZA 1V9LA 2YNMC 4GYYA 3VZCA 1JVSA 2GAOA 5JI2E 4XIIA 1Y9EA 4R2JA 4B17A 1V39A 3MT7A 1I2AA 4FP9A 2OSVA 2C0CA 4HLNA 4L5CA 1F2UA 1JLLA 1DAEA 2O7SA 4DL9A 4LGYA 1ZX1A 1ICEA 1Z36A 3EXEA 5EMLA 3W8EA 3WWCA 4CT0A 4WGGA 4Q4AB 5B37A 3Q10A 2R7KA 4KGXA 3GRZA 4BEJA 3WNVA 1OH7A 1G5FA 3VKGA 2RONA 3Q72A 1TEVA 3HR4A 4FGJA 2NQ2C 3PTAA 2UUBH 4FOOA 5DQHA 3GNLA 2EF0A 5DGBA 1NQAO 4PBRA 5GJCA 1TJ3A 3TKLA 1GD1O 4H6VA 4KO2S 3K35A 4DWOA 3BCRA 1WETA 2XA9A 1P6XA 1VYHA 1WX1A 4YCCA 4I1UA 5BSMA 2BEWB 4L6IA 5FJIA 2ADMA 1ESMA 2VUSA 4WPGA 4UCWA 4C1BA 4EY8A 3FRHA 1NMXA 5JTTA 1M2NA 1P4HA 4Q05A 4DLSA 2H1CA 1JG4A 2PCJA 5IYBG 1XVTA 2CB0A 3DUFA 4KFUA 1JP7A 4IXDA 4MRSA 3VH2A 3FGZA 2ISSD 3DBHA 5KSZA 4RLFA 1ZCAA 4PCAA 3CB2A 3HDJA 4QRHA 3R74A 1IRXA 1IAQA 1E9AA 4EHAA 1DVRA 4R1SA 3HFJA 4F4HA 1NBAA 3MXTA 4FE2A 4FNMA 1RYEA 2DUUA 3RSHA 1ISRA 3GRPA 1SU6A 3VPHA 3N8NA 1OE0A 1QTQA 3I32A 4YLYA 1SB9A 1VS0A 1UMKA 2Z1MA 4U2FA 4PZDA 5TQ2B 3WGLA 4DEXA 5IM4A 1N9GA 3OPVA 1QH8A 1I0LA 2RJ3A 3PXAA 3PWTA 4E13A 4EQ6B 2HU7A 2XXBA 2ID7A 3FFXA 1QLWA 4MGYR 4AN0A 4EJ2A 4GLLA 2PR7A 5CM2Z 3ENKA 1Q7EA 4R16A 3WGJA 4ALIA 5JYEA 3HZRA 4M0MA 3H0CA 1TM3E 1T3HA 3ROPA 3KZNA 4DCVA 3H75A 5J4LA 2IJGX 1UQTA 1PTJC 1LDMA 1GQFA 3E7WA 4EPYA 4M9XA 2V5UA 5CXXA 3C4QA 4MS1A 4TKZA 3VH4A 4KQHA 4CTOA 2Z58A 3DHYA 3RROA 5I48A 3ZX4A 2WF5A 5CFMA 1I2KA 2F1HA 2XCQA 1E4EB 3KZCA 1X80A 1KKLA 3OEHA 4O7NA 2ODAA 4G0NA 1KAQA 4OHCA 5F3RA 2GLUA 3MTJA 3QMPA 5DX0A 3N7TA 1MJHA 1OHHD 1OBHA 4HGRA 3EQZA 4LH7A 1RNLA 1VMIA 4ENQA 4M7RA 1L5RA 1RC0A 1S97A 1FE8A 1OT3A 1TD1A 2VP0A 4M21A 4BLRA 3OX2A 1FFBA 1S02A 4I6EA 5KUTA 1HDGO 1BEUB 4YJGA 3LRTA 4YR3A 1ZLYA 3DOUA 2V9WA 3P0HA 3W9BA 1JHAA 3A3YA 3ZD9A 5JJ5A 4XWKA 2VDVE 1DSSG 1JFFB 1H22A 3PPWA 1RBMA 4V0LA 1IPFA 3M5CA 4KR0A 4K03A 1OPRA 3CLHA 3OWOA 3ZIAA 1RWBA 5DNCA 2I80A 3MTAA 5KT5A 3RC9A 4B85A 1JW9B 2BI7A 2ZANA 1PR0A 4PVCA 3ND9A 5KPDA 4UU0A 4P3NA 3WHKA 2PGAA 2Q9AA 4TMTA 2Q45A 4TT8A 2WHYA 1S3SA 2WWYA 1N7GA 5TE9A 4DA6A 3UTDA 2XUOA 3PNMA 4ZJZA 3L8ZA 1TUBB 3D64A 3DZJA 4OYLA 5CHEA 2AA3A 1D1QA 5FYDA 2Q2TA 3WWYA 4BVJA 4C01A 1FOEB 4DJAA 1D2MA 1Z74A 4MUGA 1UMCA 2P9GA 3FKSD 2RGUA 4WLOA 4X6XA 3WLIA 2TMDA 1QFYA 2R6CA 2VUTA 3F7OA 3ADCA 1OB5A 1C3JA 4I81A 4DDTA 2H4JA 2O3UA 4WBNB 3CNHA 4ED6A 2DWOA 3DWFA 3GFRA 4B3SB 1P6QA 4YREA 3A9CA 3FDJA 2D5CA 2QLBA 3LT2A 2Q9BA 3MOIA 3ZI4A 3ADPA 4HPWA 2BGNA 5LBIA 4P80A 5JPDA 2C3OA 3R40A 1U7XA 5KFYA 5IVPA 1XZAA 4KWEA 4NC9A 1CULC 1OLUA 3PUVA 4RZ2A 5TQVA 5LSAA 4L73A 3H1BA 5SY6A 3W9SA 4JI7B 4LZPA 3VU0A 3LO5A 4JYCA 2L69A 2M1XA 2C84A 3VU8A 4GC6A 2R3SA 1D7AA 1E2GA 1L9KA 2Q1SA 2WYUA 3QMMA 2I22A 2R93A 4RVOA 5M04A 2QJOA 2RK4A 2GM9A 2OO5C 5EQJB 2VUMA 4R0NA 3OU6A 1HZZC 4UHEA 4P54A 1L8XA 2YZ7A 1TRKA 3N6XA 3N53A 3QEMA 4WY2A 4AJ4A 1IUKA 3AVQA 5B2EA 1N3IA 2JD1A 4C7OB 3D3NA 5HRUA 4E5KA 4HMOA 4GZLA 1L4FA 1N48A 3WB2A 2VXOA 2YDYA 2HA0A 1M1YB 4WZAA 4P8RA 2X9LA 1KY4A 4V1CB 2A1UA 1GKIA 2CLSA 4DEVA 3B1XA 1I4DD 2QQEA 1Y80A 3PHJA 1K1SA 3L5KA 1F0KA 1S0MA 2W2MA 1TCAA 4YT4A 3VC1A 3IOBA 4OREX 4Q3AA 4AU1A 1JFTA 1VHLA 2B98A 4LE2A 1BWSA 3V1KA 5BUSA 1FFXA 1XRSB 4I5DA 1U99A 2RC6A 1EPUA 3AUFA 5CLHA 5HPYB 2VR1A 3K20A 1YDEA 1YACA 1EINA 4WCDA 4L4RA 3TD9A 1E5VA 4NABA 4QUKA 3CZMA 2J9ZB 2A1HA 2HV8A 1CJSA 4MWCA 3QA9A 1RK5A 3O8DA 1UXGA 1ZWKA 5FLXW 3F97A 2D74A 2GEDA 2C2XA 4ENSA 3IE1A 5D01A 1O5IA 3PYLA 3WB1A 4PLVA 1JLSA 4JS0A 4ZDWA 1MEEA 5MF6A 1HA3A 4CQLA 4J6EA 5EA2A 4JV0A 3FY4A 1JAZA 1V2HE 1N2IA 1KZ1A 5I7HA 2WUWE 4Q43A 1KZ6A 1ZKDA 3H83A 1ZGGA 3Q9SA 5JW6A 1VBKA 3P7MA 3B1JA 2O05A 2O3SA 2BJHA 1M83A 5TMDA 4RU9A 1EGVB 1OI4A 3P97A 3SAJA 4AZSA 3OZWA 2BGUA 3ZDZB 3MJEA 3V2GA 3Q7EA 1N2CE 2XB6A 4YJHB 2ODWA 4CDRA 1IWOA 1F17A 3AF1A 3OZCA 2HK6A 1CJCA 1P2GA 1P1KA 3SZRA 2YXDA 3GJSA 1S96A 4F8YA 4DSOA 1DEOA 3EIEA 1N6KA 2XT6A 4X9XA 1VFNA 3AJ9A 5LD2C 3FOBA 3GG9A 3BMQA 1ECFA 4PSAA 1JE1A 5JWOA 1V8BA 4RXTA 4V2IA 3ZU6A 2FN8A 3K0FB 2GRJA 1YTUA 2G63A 2ZDQA 4L9RA 1X38A 5C9ZA 2W9AA 4M37A 1SEPA 3T7TA 2PNJA 4L4YA 3N59A 3JCZA 4HAWA 2XBMA 4ZQCB 4WERA 4F3KA 2WU4A 1ZLXA 5E1OA 2O1WA 4G4JA 1JA0A 5F76A 2PMEA 2HO5A 4GOJA 1N57A 1A1VA 2VOJA 4ECXA 1BE0A 3NWPA 2Q9CA 4GOND 2F3PA 2IV3A 2MINB 1E6MA 1RZVA 5KNBH 2V6MA 1Y82A 3J7TA 4O25A 4IIJB 1XZDA 1UC4B 2W0SA 2ZSJA 1JH8A 4DRXA 3B3JA 4JQOA 3EXEB 3EH2A 1Z0KA 2UXBH 4LJKA 1LX6A 2I6FA 4QEDA 4U5QA 1ZI6A 2B6NA 3J80W 4HTFA 4JVSB 5TVKA 2B37A 2EF1A 2FWNA 2ZJ0A 1CFJA 2XEDA 3TZKA 3FLMA 4KO1S 2E6KA 1N2CB 1E5DA 2GEVA 5KJEA 3DZFA 2BFDB 3R0XA 1PJ2A 4URFA 5ALMA 4YBRA 4K8RB 4Z1MD 2EDAA 4ZTZB 4UHBA 3FUUA 3B1VA 3CRVA 3ENQA 4HDMA 4LRUA 3DAFA 5I5EA 3QE2A 4GP7A 2XVZA 1KDZA 2Y68A 1G8FA 3BL5A 3UBTA 3AINA 3OHPA 3W4KA 4GKKB 4G24A 4DJDC 1ISPA 2QW0X 4KWHA 3VR4D 2BAGA 2C9ZA 4MLCA 5DOVA 5H70A 3Q98A 4F4IA 5B6JA 3UJ3X 4EAAA 5JMWA 4DR5H 3UENA 3T1QA 4F0JA 3UOWA 4I0WB 4Y30A 1VLMA 3PSHA 3TQRA 2VDKB 2Y92A 1YRQA 4LPSA 1A2OA 3IL2A 5CR5A 5D86A 5DDIP 3L9WA 1Y3IA 3C4JA 4M7WA 5CLQA 4TLCA 5TDHA 2LV8A 4UVHA 3ZLVA 3B78A 1NQWA 3AESB 3PUWA 2G1PA 3V8NA 5I7EA 1NBEA 1EB8A 2BP7B 2IH2A 4KH0A 4JV5B 5FPKA 1OZ0A 2C5GA 2JA1A 4C0KA 1AMNA 1UINA 2J45A 2J31A 1XZCA 3CLSC 3DEFA 4U0KA 3A1CA 4DDKA 4IOLA 9GPBA 5JSKA 3STUA 1CRPA 3D1JA 3CMMA 3EZ9A 2QTZA 2QAGB 1NJ5A 2IZZA 2ZUDA 3FKSA 4X62H 4QPDA 1UFQA 2G4VA 3CRNA 1VKNA 4RZHA 4GGMX 4UNIA 4EVRA 5B1YA 1UDRA 1QE3A 2OLSA 2WMYA 3W0LB 1W5TA 1BS9A 1GZVA 3FPJA 4NATA 3VR4A 1XNGA 4U6QA 4A8TA 5IT9A 5FV4A 1Q91A 1FDOA 4O8ZA 5E4YA 5L51A 4WHXA 3RTXA 1DFIA 2G72A 1UBEA 4G1FA 4C30A 3GF4A 4HKTA 2HN9A 3HJRA 3OETA 4JLWA 2CDNA 1NX9A 2A0YA 2HWUA 5JDCC 4UQOA 5KHLB 1KMNA 3CW9A 1NQUA 5BP7A 4IEFB 1I7LA 2W2NA 4RK1A 4TRMA 1GEEA 2WPDA 4GZMA 4YECA 2I2BA 2P7IA 2CFOA 1U9JA 3HNOA 4GRAA 2RBKA 3G8YA 4FQ7A 5EEGA 2B1IA 5EWJA 4YAGA 5I7SA 4K0KH 3C5EA 1E4EA 1A50B 2YUIA 3S29A 2C7RA 3HT5A 2GBIA 1LPMA 3QX9A 3LUGA 1CXZA 1WUIS 3OC0A 3SY8A 2GK6A 2BE7A 1VI6A 3QLJA 4LDZA 4UCUA 3EXG1 1HETA 3HBMA 3F5SA 2BCGY 3JYPA 2EBUA 4L22A 3MOGA 3FMFA 4BASA 5KG7A 3PW5A 3G2LA 4Y9TA 3A6ZA 4H0NA 2XF2A 3TOSA 5BNWA 5I9LA 4W5OA 2W9CB 2WJ6A 4AKEA 3A6EA 3I5MA 4DUZB 1E4OA 2GILA 3TM4A 3GRVA 1QIMA 4A2AA 3ZJYA 5KWVA 4R1NA 9LDTA 3D8TA 5B3JC 5DOZA 4Q4AA 3KAJA 2CXSA 4NEQA 4ECZA 2FUKA 3RBVA 3RNOA 1T1GA 4FEGA 5JUWA 5JE8A 4NV3A 2IBTA 1RKQA 2GPSA 4NG5A 2OCLA 1WF6A 2OBNA 4YXFA 1XRQA 3F5QA 3PV0A 1A4IA 1J7KA 3DDZX 5FTLA 2HF9A 5HNEA 1R6AA 3VUEA 3MYYA 2WKSA 4TTQA 1JDJA 2GWRA 2XNDD 2HSWA 2Y1EA 3DKPA 3FCUB 3IHKA 4RMGA 3UY4A 3G2JA 5A03A 5CAEA 1ZETA 3HB0A 2HJRA 3FSEA 2D54A 3RBAA 1GPUA 4TTPA 1KIMA 3CKMA 3HFRA 3JZ6A 2AJTA 1LJLA 3M5WA 3N0XA 5JZSA 3K0SA 2I34A 4KTTE 2DULA 1FX0B 2FFBA 4RY0A 4YO8A 1DC4A 2OHVA 1R74A 1XWFA 2V4MA 5JVDF 1XTQA 3GFQA 3EGXA 1RD4A 3G2HA 2A3NA 3G0BA 4FEEA 4IDFA 4Q3BA 3X3HA 3S99A 4ZKDA 5IXJA 2PN1A 3P9KA 4BV8A 5AVZA 4M0UA 1NXVA 1L8OA 2OAGA 1RQPA 3JZMA 3ZOZA 1S2NA 3SCZA 4JI8H 3FAZA 4JJFA 4PEVA 3LHDA 5L1KA 1WH2A 3DL4A 4ARSA 1ISHA 2ZJAA 2A5GA 3ETEA 3QEMB 4HDCA 4B3TB 4Q3EA 3V4SA 2IYTA 1RQXA 5FUBA 1R6UA 1HUQA 2FZ4A 3DBHB 4Y9UA 5FWYB 1YE8A 4ECVA 2EJVA 3EUFA 1EE9A 3UW3A 4MVJE 5J5CA 1GPNA 5FFFA 1USIA 3EXIB 3W2EA 2JGIA 2RHMA 2R6GA 3FTNA 4S0ZA 1BO6A 5ED0A 4BMCA 3T5AA 1OH6A 2WKPA 3A9TA 3R3YA 3DXFA 2Z43A 5KVAA 2XNJA 1J8MF 4DL4A 2Q6TA 3ANLA 3BZWA 4NBNA 5GOTA 4BMDA 1WCXA 5AHWA 4YY3H 2NWQA 1M1XB 2CUTA 1I4OA 2OV2A 1ZL0A 2REQB 1D1TA 2NXJA 3ENVA 1LI5A 1ZUNA 4JBHA 5GONB 3HM2A 1UXOA 4UUNA 2YWDA 4ZZIA 1YHZA 5CEEA 1V71A 1D04A 1RJWA 1WDKA 3L0YA 2XMRA 1OILA 2WIKA 3NAGA 2P6MA 2H59A 4K6KA 3H4BA 3VJLA 4LJSA 5KQSA 1YZQA 4BO0A 1DRWA 1PEDA 2Z2XA 3B3FA 1CUZA 1EK1A 1NUPA 1GL9B 1ZITA 4K6OA 4C4RA 1OWMA 3TECE 2IOYA 2YXEA 2YMPA 1T5TA 5ECYA 3S2SA 3ODPA 2GO1A 2I8CA 1C3LA 2H65A 2ISQA 2BQUA 3OEWA 1AB6A 1IAVA 3U7IA 4ZI2A 1MVOA 2JI4A 3TMYA 4I8DA 1KK1A 4MR8A 3KL4A 4TUYB 1VJRA 1WEHA 2RAPA 4UVEA 4AUMA 5F9HA 5E25A 4RQAA 5J47A 4AAYA 3DP7A 3JWJA 4E6EA 3IOEA 3CNNA 2DCUA 3HP7A 4QG7A 4NONA 1Z68A 2PZJA 5AUQA 1DAKA 1EEXB 2B5WA 3NHSA 5H16A 3RYCB 3UH0A 2H2FA 1V4NA 3ZCSA 2JEGA 5CFLA 4BNJA 2WWFA 1TWGA 4OJNA 5EIFA 2OUKA 3WK8A 4HGQA 4O2BA 2AYXA 5C32A 3QOFA 3LW8A 3TRFA 1NI4A 3T4EA 3QXHA 2FEPA 2PWZA 1GZUA 3SIXA 5JDIA 4AMBA 4D8UA 5ENVA 5IKXA 2B4RO 2V6FA 4HUQB 3BE6A 4QYSA 2X5KO 4PCUA 3ZS9A 4OHXA 2H6EA 2Q0XA 4IGIA 3DE5X 4ASUA 4B6SA 2J41A 9MHTA 2UVPB 1DKUA 4TMWA 3RC2A 1W5SA 3KAPA 1RRGA 1TUBA 3FCAA 4QBFA 1IK4A 1KSFX 4TV9A 2Q21A 2JA2A 4QKQA 4N0QA 2O23A 2ACKA 1J0XO 3TW6A 1AGPA 3JWEA 2R1VB 4DUZH 3L43A 4G0WA 2J6BA 2MT9A 1BMTA 1SCBA 2ZTUA 1DUVG 3BFPA 1TO1E 2CNKA 1XA0A 2EKZA 2CMKA 2FGKA 1PCXA 3QUAA 3AJDA 2P62A 3O6VA 1PL8A 2FZCA 2OGUA 2ZT6A 3IBSA 3KELA 4LJ9A 4BPRA 2G9RA 1NXTA 2V9ZA 3WRYA 4LDJA 4LJ4A 4YDSA 2ZSBA 3RC3A 4FS1A 4ATNA 5CJPA 3WADA 5AM2A 1I10A 3FWKA 4WXMA 4LYEA 2CLDX 2CUNA 4QT0A 4DV4H 2P40A 3PGXA 3BHIA 1MA0A 1DWQA 4A1OA 4ZAFA 4ZHQA 1XVLA 2ZXFA 4IFEA 1FVFA 5LZ4A 4ALLA 3QX7A 1ZR2A 1BXRA 1T1SA 4PG7A 3Q6MA 4K81B 4QYTA 5HUQA 2PH1A 5AP9A 3RJZA 3HCAA 3AWIA 1CDZA 3GZ4A 4UATA 4G5SA 3A6JA 2H52A 5CA0A 4EKDA 3PR3A 2H17A 1UC5B 1YRBA 4CIWA 2VYCA 3D8SA 2QLLA 3SC4A 3ZJUA 4RAZA 3C98A 3COYA 4WXHA 3M89A 4WVLA 1GKKA 2H1WA 3VZSA 1FNDA 4IOKA 1CUEA 3IAM6 5G0WA 3T5DA 4EEQA 2J3LA 1FZQA 1V8ZA 2CBXA 3HPRA 4DV3B 3BMCB 1TKBA 4HZUB 4MDEA 1SY7A 2ZKIA 4PWZA 4BB5A 3PNLA 2UU9B 1WV0A 3GIJA 4QT4A 2AG5A 1LPAB 4BNXA 4D0SA 3OQIA 4WFJA 5TPZD 3PE3A 3ZYCA 1KEUA 1JHDA 2GCGA 3BMOA 2YQ4A 2JAHA 3AESA 3NDIA 3KR0A 1E7SA 3D8RA 1HSZA 2ADFA 5A6SB 1XEXB 3LSTA 2F9MA 3CZRA 1OXXK 4CM8A 1RYZA 5K0ZA 1HQYE 3JVDA 2BGGA 3DL2A 3GQCA 4I50B 1DNPA 1X1CA 1ABEA 1JHPA 4R8UA 1QIKA 2J5XA 1ZIYA 2WHPB 3AUTA 3DEHA 4NK4A 3WK9A 2PMZA 2YICA 2DBQA 1NTRA 4G3IA 1PR1A 2PMBA 3ZUGA 1P74A 4OQNA 3CXRA 4RHTA 2WJ4A 4KQKA 5AQEA 1AUOA 3FYHA 4L72A 2BZ1A 2H07A 3ABRB 4DNOA 3RRNA 4MXDA 1G21B 2IY8A 2WQ7A 2Q5HA 4PG6A 5EUBA 5CXSA 4IR1A 1A2QA 4ACBA 4YV2A 1JFSA 3MHTA 4HAOA 4A0RA 1QKKA 4EPTA 4ZMBA 2OENG 1DPGA 1U98A 1ZMRA 3JQFA 3Q3GE 4EHDA 4GI5A 4M54A 5C51B 1U9ZA 2HPHA 2PZGA 4J07A 5C44G 2I6XA 4A27A 2POCA 2EP5A 4QREA 5HKKA 4LWOA 2OCKA 2XRMA 3E6AA 3GEDA 1NPYA 2VHEA 1N1GA 3KHKA 1X39A 2DFTA 3L4KA 3CNLA 3LD9A 1XAHA 2GRAA 3PGJA 1GHTA 1L9XA 2MYUA 2P2YA 4HGOA 2HDWA 3EARA 3TW7A 1FBNA 4LXGA 4OQDA 1AHPA 3V80A 1CUCA 3H8SA 1LTKA 1I1QB 1DXHA 1N8NA 5F5XA 4DOMA 3ONFA 5EZ5A 4Q8EA 2TYSB 3ROKA 5IBQA 1J07A 1P6UA 4GUAA 2GZSA 1M2KA 2W90A 3WMFA 1MOZA 4ECEA 1JQAA 4GVXA 1NSFA 4GX1A 4EL5A 4XPIB 4MGHA 3JQAD 1FNCA 4LIPD 4P4UA 4X95A 3A04A 5DV9A 3ZHVA 3QPUA 4CQMB 2DRIA 3L4EA 4WBSA 4ZYYA 1CUJA 1DJQA 1UKYA 3ZWYA 4FNGA 1XMIA 4WZBB 4YAOA 1KR2A 3A4LA 3QE0A 4H7EA 4RNMA 4GLOA 4YFYA 3KHHA 1OYWA 3EB9A 1L4YA 2Z9DA 3RQSA 5ESXA 3USES 3VM6A 4L0CA 5KT3A 4OHKA 3EQ9A 4YV7A 3KB8A 1AU9A 3K0AB 3GX1A 1KOFA 4NYJQ 5BSRA 3RO7A 1QRRA 4B6QA 2I6QA 3OIVA 4GR9A 4Z49A 2ZWVA 3B38A 4YQZA 5FORA 1K6EA 4GVLA 4C9BA 2ZIUB 3ZHYA 2XUJA 4NXMH 3NWOA 4KACA 4UTZA 3ZGXA 4DL6A 4ALKA 5JSUA 2R7ZA 1AN0A 2ZYUX 4S1OA 3AV0B 1QNLA 5K1ZA 1ZI9A 4KSBA 3MCVA 5M2QA 4BBSG 2VA8A 5K5EA 1TZBA 2P2LA 3DXXA 3F90A 3NATA 4RQTA 4URYR 5DBFA 3UMSA 4RY2A 1HRDA 2ZBUA 3IKJA 3A6PC 3GGOA 3UJPA 4RVSA 2C78A 1JEQA 4MUHA 5EHQA 2VOEA 2AT1A 3V42A 4EQZA 3QXSA 4XYMB 1P2TA 2IIBA 2IY9A 4M0KA 3CH4B 3CVVA 3KSUA 3EAQA 3WIVA 4XW2A 5G40A 5LL6P 4C6TA 1D4OA 1OAAA 3B8EA 3Q0IA 4PF1A 1EUQA 3IIKA 3TBHA 2Y66A 1OX6A 4QFMA 2F1JA 1M0EA 1JQ3A 3IVMA 4LAFA 4TZ6A 3IPRA 1PX0A 3O93A 1FL9A 2IYQA 4JT4A 1K8XB 2HMSA 4Q03A 4ZFNA 5FX2A 2TS1A 3RUPA 1Z5NA 3M9OB 1G3MA 3LS2A 1SUPA 1RXCA 3TVDA 5FWYA 4HB3A 2EJ2A 1EA5A 3EY4A 4RGQA 3BZUA 3LECA 1IH8A 1SCUB 4ZCLA 2GEKA 3COZA 2IA6A 2MSEB 2QR3A 3K6KA 1H1LA 2CJXA 5KSYA 1Z8HA 2VT7A 4M22A 1RBZA 3N3AC 4M83A 5FWNA 1JMYA 1W19A 3R5KA 1PL0A 1R8SA 1G98A 2AN9A 1OXKB 3B89A 4XCVA 1STOA 1KHHA 3QG1A 3R7FA 4GS5A 1UZMA 1RQLA 3U5TA 1Z75A 4UBJA 1CSEE 1ID1A 3O73A 1J8QA 2B82A 3AEQA 1IZ0A 1QK5A 3E8MA 1EFCA 2RHLA 4G3XA 1EI9A 3EGIA 5B5SA 1NXOA 1EVIA 2C77A 5BWLA 3FDZB 3AHHA 1SXJB 3TNYA 2IE8A 3G2QA 1UDAA 1YIDA 3KLNA 3VRHA 4E3WA 1XNQH 5JHHB 4MI9A 4K9LA 4D45A 4HNVA 1FFAA 2YW2A 2GNAA 2QYSA 4ZCSA 4O82A 5FTNA 3TL2A 2R8JA 1NJFA 1X7ZA 3T99A 4HN4B 4PLGA 2VT2A 2FPWA 1EVEA 4Q9JA 4DR3H 2F55A 1UM8A 5BRJA 5K8LA 1LZKA 1Q16A 2QGFA 3ILHA 3QLVA 4GNRA 3RU3A 2HFJA 4I1RA 1OYOA 2Q4RA 3AEKB 2XV1A 3JQGB 4IRKA 2UZ1B 4RENA 5JCXA 5IABA 5TC4A 3BICA 1A0OA 4OYYA 4QARA 4RZXA 4U7WA 4XCXA 4KHPH 4EFMA 4MPTA 4BKOA 1JAXA 1DQRA 4WLVA 1X7HA 2ZJOA 3L6RA 4UUMA 2QT9A 3I04M 4U7DA 3DO5A 5HKBA 3QI7A 2NN3C 2ECQA 4MRVA 2EZ4A 2WDTA 2FOXA 4IZHA 2PRJA 3CVZA 1IDN1 2A0WA 2PIDA 5DG7A 2D8AA 3GEGA 1XQ6A 4H0CA 4DCOA 4R54A 4I66A 3VJRA 2G9ZA 3R3UA 5DLQC 3WGIA 2IHNA 1CNEA 1USKA 4IR9A 1X2EA 2D06A 3OTOH 1SUAA 2FDRA 4JLVA 2AFVA 3DPUA 4NV0A 4PSKA 4G8DA 3CZAA 4GW3A 3WQQA 5B7GA 2WT9A 3BT7A 3FPKA 2J7KA 1Z22A 2O5RA 4R7GA 4FKZA 3OKFA 3OHSX 1Z45A 4TV8A 3I76A 4UPEA 4OKNA 1AD2A 4N0PA 5D1NA 3BMNA 5FOUA 2BTOA 4K05A 2JBWA 3LC1O 3QVOA 5HJ7A 1G4AE 3T9BA 1WR2A 2VF7A 3NHYA 5DULA 2WAYA 2XDQA 3MINA 1EUYA 3D2CA 4IGFA 4YJFB 1Y1WA 3JAKB 4ED0A 1YI1A 3WJAA 3GT4A 8ADHA 4UCSA 4E5MA 1PGNA 4JXJA 4KXLA 1IUOA 1CY0A 3IIMA 2F3UA 2H4WA 4WACA 3QFSA 4XIFA 4KPEC 1DHRA 4A3GG 4U9HS 1EUDB 1LDEA 5SYMA 5T4BA 1ODJA 3UHJA 3OJWA 2PBFA 1E8MA 1KEZA 3KVNA 4JI1B 1EWYA 3RSOA 1YO6A 4IWNA 1ISGA 1SK8A 4XQ9A 4ZAYA 1WXGA 4F92B 2WP0A 1IM8A 4DR1H 1I9GA 4BNDA 1LBTA 2VAMA 3DTNA 5DHFA 5I9SA 3I39X 4Q39A 4C0JA 2EGHA 1ZUNB 5KNDA 2CZGA 2O3TA 4JBXA 1JEYB 2HAEA 2YJZA 3FHJA 2ZXUA 1IYZA 4MS4B 5ICEA 4WTOA 1GGHA 2AZMA 1MTZA 1QZZA 2L18A 4EUSA 1Y1PA 3FVQA 3G0DA 5JISA 1L8AA 3CISA 3NTXA 5FL7D 3QITA 3UAZA 1F9EA 4CODB 1FEZA 2UZ4A 3V1TC 3DV2A 4RJJA 2X3YA 4FD2A 1I6UA 4L76A 4PNHA 3R0ZA 5A5GA 1MQ8B 4I4TA 2O7RA 4GOLD 3RAGA 3UJNA 4M7EA 5CVCA 3X2FA 2O8CB 1IHYA 1U2DA 1ESDA 4D3FA 5DLFA 4XJTA 4MKZA 3SJCA 2JH9A 1H6DA 1KI9A 3ESCA 4ZCRA 3KU1A 2AZ4A 2FP4A 3B70A 4P2GA 3HB7A 3H4DA 2CGEA 3IVXA 2X2OA 3OEYA 4QO7A 3BJMA 1J0BA 2G82A 2IYWA 3JVIA 5FAXA 3E70C 5D6NA 4BCCA 5A6VA 5C4MA 1IBMB 2XTNA 2JA6G 5IPFA 1E9BA 4G9GA 5IT4A 4CKWA 3GPLA 4IV8A 3O4HA 5DN6A 4LFBH 1YS9A 1XLTC 2GXUA 2WU1A 2YWCA 4NCXA 3WTBA 1KRHA 3U4DA 1Q50A 4DLVA 4I9HA 3DT6A 2BRUA 3DTTA 1JFLA 2PZMA 4I1PA 3JQ9C 3NIWA 3S5JA 4A8HA 4W9MC 1XA3A 1NXXA 2Z3VA 3ICPA 3WLHA 3ORHA 4QODA 2P9ZA 3FD8A 1JTFA 1Q0TA 3M1YA 1J25A 4EUKA 5LJIA 3GV7B 3GYGA 1CS0A 5H3LA 2XUAA 4LQCA 1PR2A 4HI0E 2OXIA 4PX3A 1HE3A 5KKAA 2DBZA 2YY7A 3H3XA 2UZ1A 5ECGC 3UH1A 4F46A 1RS0A 4ZP1A 4L0MA 3M6UA 1L5LA 5H02A 3KX2A 521PA 1L7OA 1TAUA 2R62A 4UMFA 5F5LA 4CCWA 3OO0A 1MO5A 4K9DA 1FP4B 4HQ6A 3M3PA 4MHTA 1NYTA 2Z2YA 4PBTA 2B6HA 3B2NA 4GEKA 4ZN6A 4NOMA 4FFNA 3QPDA 2GCOA 2VBFA 1IG3A 3CX4A 3ICOA 3MJSA 3IXQA 3WIBA 1E7QA 3WGYA 4F2WA 1DQYA 4Z53A 4L28A 1RADA 1GA6A 3P4XA 1USUA 1ZGBA 1A0GA 1LDBA 1UMDB 1ZK0A 4BTVA 4GPTA 2GN9A 3OVMA 3IB6A 3BH6A 3FPCA 3H5TA 3TBFA 2X6QA 5FD8A 1V5EA 4YBZB 4J0MA 2VSNA 1MQ9A 4MQMA 3LAWA 5K3SA 1I36A 3TRJA 2PUTA 3L0SA 1CEYA 3GIDA 3I92A 1P29A 3V5NA 3VNAA 1N7HA 2NZVG 4DA0A 4IFBA 4G65A 1GKUB 3N74A 1Y4DE 4Q1FA 4BLSA 3M4YA 4UE6A 2EQBA 2HJ9A 1AKWA 2YWXA 4PZZA 4R84A 3ZGVA 1NW3A 5JHGB 1W5FA 2D13A 2ORYA 1WB4A 5IJ0A 4ENTA 4O7VA 2WD7A 1SHLA 3BYZA 5K0EA 4C2MA 2IUTA 2O03A 5JD4A 1MZVA 3L46A 3RVDA 1SFOA 2HWXA 3FJ1A 4R01A 2ZYWX 1KJJA 3K9CA 4RFSA 3ZHBA 1O6BA 4I50A 2AOTB 3NYIA 4H1WA 2PVSA 1T2DA 3LLMA 3WS7A 1EUDA 3ND8A 3OE7A 1NF3A 4FOSA 3RBXA 5IYCG 1TQDA 3EWSA 3HOZG 1V9SA 3NO4A 4K3UA 2AR7A 4BE4A 5CFNA 5IF9A 5JYDA 3KEGA 4TZTA 5GJBA 3W2TA 2HJWA 2CMGA 2ZRAA 3IT0A 3K05A 4LDNA 4QOGA 1B26A 3IV9A 3FWPA 1NAHA 1J9ZA 4LRYA 4PYLA 3W5VA 4TMFA 2QZ9A 3CLUD 1Q1ZA 4LC0A 2QR2A 2JIBA 4E1AA 3CNBA 4L95C 5AVKA 3WA6A 4MOWA 1GV1A 2H57A 2XUDA 4QFCA 4RHUA 3BH7A 4EH1A 4JJEA 1L0BA 3OCWA 4ZYZA 2H5IA 4Q18A 1VJDA 5EE5B 2JCSA 3TRHA 4EOGA 1E0DA 1PLJA 4IDEA 4XE5A 3SBXA 1GPLA 4MGIR 3TSZA 2X3UA 1UBMS 2WKRA 4PYNA 3WTCA 4A36A 4K6CA 1DRUA 3OT5A 3OTOB 4X8HA 4DYVA 3GBVA 3UA3A 4EPRA 2H7VA 4OQMA 3ZQUA 1MIOA 1KDRA 2IHZA 4MYDA 1VLHA 4TXJA 1SXJA 4KNYA 1A9YA 4F5ZA 4DJTA 4CM5A 3C3DA 3RVNA 2FSVA 4X1YB 3ZUPA 4IRDA 1Z33A 1E2HA 1HY3A 3R8XA 4CUJA 4MARA 5KG6A 3ZDAA 1DGSA 3LZCA 2BIFA 2VPYA 2JA8G 4ZI7A 1GA1A 4AY3A 3LHSA 2IZ1A 2I6SA 4D9HA 2I78A 4JP3A 5FPTA 1HF3A 4RD2A 1BMFD 4A26A 4UTPA 2CFSA 3BRQA 1FS4A 3U40A 3V8PA 1DGQA 3AM5A 3FNEA 1Z7BA 4XUCA 2VJMA 5ALLA 1DARA 1O4WA 1LCIA 1L7QA 3KUDA 4K86A 1XOIA 4TLEA 1HE8B 2QTWB 1HNZH 1RLIA 4E6NA 4PXAA 3T35A 3FOZA 1OH5A 3ZJTA 1R4NB 3SIWA 3KOUA 3ICWA 4WK4B 1IHOA 3OQBA 2NPIA 3BEDA 1DV2A 3GCGA 5IBPA 1F4LA 1G2OA 5CP8A 5E7IA 1CNFA 4JI3B 2Z08A 2QLMA 1YIOA 1PBTA 2R6ZA 3HCOA 2I2CA 4XDHA 2JL1A 4GBGA 4PLFA 5B1EA 1RMQA 3GIKA 2JCGA 2QVGA 5D3KA 2P78A 3KRTA 3PF8A 4YWJA 4R05A 1FDTA 2HDNB 3K2EA 3SM3A 1POXA 2BBTA 2VWQA 5T64A 4HDAA 2H2DA 3TXXA 1XDNA 3WNDA 5DE3A 2CXXA 4O3PA 1U02A 2WZCA 4XYGA 3TBKA 1VPVA 1XHFA 1F8UA 2FRDC 2NXCA 3OX4A 3BCSA 3I58A 3QKWA 1Q1AA 2O4UX 3K6RA 1NMQA 3S8EA 2F6RA 3BMNB 5F5NA 3PPIA 1XLUA 1Z0DA 4KXFB 1U6JA 3I9JA 3FHCB 3QU5A 1P9LA 3Q6NA 5IK2A 1LXCA 1NATA 1ILEA 4PE5B 3JSLA 1CJKC 1U04A 4UM5A 4YV0A 5EI5A 1EXVA 5C8YF 4UXHA 1RWXA 4W5NA 3MWEA 2OH2A 5EE0A 2O8BB 3FRJA 4XTCS 4HR7A 2ZULA 3TY8A 3SJZA 3ZHOA 4DVGA 4O7YA 5JXIA 1E8DA 4QYWA 3EQ7A 4RVGA 5TF4A 4RHYA 4I1VA 3L7KA 4HWOA 3TLMA 1ABFA 2ZYVX 3GJ8A 3JQPA 2OBLA 4D3XA 2Z83A 1A71A 2I7XA 1XTIA 3I23A 5EJ6A 5JNRA 3Q8WA 4DHWA 5CXQA 3AZQA 4M1EA 3UKOA 4CG0A 1FFXB 2X40A 4GKKH 3EZFA 2E2IA 1O94A 1Y3BE 4OFZA 2VHQA 4Q44A 1EDDA 1NVUQ 2QF7A 3WY9A 2ALJA 5AKZA 3IERA 3GEIA 1M5UA 2VTEA 3KDPA 3LKBA 5KQLA 4RD4A 1YR1A 4UDXX 4Z9BA 1EHIA 1J0CA 1YAHA 4EVIA 3U7JA 1O03A 2ZPUA 2V03A 5BWVA 3DBIA 2J46A 1CU1A 2CMHA 4TTJA 5AW9A 4A9AA 3S1SA 4A2PA 3QSYA 2GZRA 1I2DA 3GDHA 1P80A 1E18A 5BW4A 2BCEA 3HDQA 4Z0NA 1V3QE 2O2ZA 3RR2A 5IT9W 3H5WA 3BE5A 3I45A 1FC0A 4JI5H 5JNSA 5EIOA 1U3FA 4L27A 2P2CA 3ZY4A 4C4SA 3ROQA 3CVWA 2ZBQA 3OFND 1Z7GA 1L7DA 4HN2A 1JJVA 4C4XA 1BCSA 3OTQA 2B0JA 2OHXA 3OU7A 4YAWA 5C7YA 1Z06A 4OFWA 5CK4A 4KQWA 2PS3A 1H65A 3AQIA 3EXAA 4FMBB 3RU2A 4QOFA 2NMVA 3E4DA 5ELLA 3D4BA 3GAAA 1KDYA 1CR0A 1SR8A 1TGVA 2RGCA 3TSWA 5IF3A 3SGIA 4YMSA 2IPMA 3UPUA 4B80A 4XYLB 1UT5A 2D8MA 1IIRA 1JPUA 3DOOA 4S35A 5EPUA 4Q4HA 2B21A 3CX6A 3OCZA 5M34A 1DIHA 4MVWA 1JR3E 4HBGA 3ETDA 2ORVA 2IKSA 2FRVA 5CPFA 2XDAA 1HSOA 5HILA 4AXBA 2IPNA 4YUWA 2PXHA 2ZUUA 4AY6A 1DIRA 3V48A 4QHSA 2WF6A 3I73A 2C1XA 2W57A 2VHXA 3CW2A 4GFDA 1NOKA 4MUBA 3P26A 3ZVMA 1XA4A 4MWTA 1OFIA 1B6GA 3LA6A 3V4PB 1ZJ6A 4I2NA 4PBCA 1WCIB 3Q12A 3M9WA 1JT9A 3BZBA 1BU8A 1E0SA 4OHPA 2AFHA 2YW9A 3AR6A 3EGVA 3NIDB 5KYNA 2ZM6H 1Z62A 1ZVJA 2LR0A 1VDZA 4ZGBA 5JBQA 4YJ2A 2V5AA 1I8TA 3AGQA 2HXSA 5DNWA 4DLTA 4GPD1 2XYPA 2JFXA 4C14A 3A1FA 1T15A 2F3RA 4RVNA 3A31A 4NFHA 2V7GA 2XQVA 1DPFA 2X4IA 2BGWA 1KC7A 2NSHA 4IL5A 1DBWA 1WMFA 1KZHA 2QMZA 5F33A 1ECPA 5L4NA 4XEUA 1E66A 4RMNA 4XDZA 1XNJA 3GTPA 2DC1A 1UR5A 1XZ8A 2QX6A 4FYXA 2ZJFA 3ZBTA 4MR7A 3RK0A 1OYVA 4PZ6A 2IK8A 4XX0A 1USGA 2AJLI 1MFPA 1P44A 1X8LA 3M7IA 4C5BA 2YJ3A 3IUNA 2ZDGA 1J00A 1MH9A 5K3DA 3T38A 4EHFA 1E9EA 4PG4A 1SIUA 1KAMA 4ZJPA 1X3LA 3PT5A 3P20A 1QRTA 4NU5A 4QOSA 1SVKA 2JPDA 5DO9A 2C4WA 4C7XA 5JG7A 3O4FA 2I3AA 2BFNA 3I5AA 5IN4A 3U1BA 5BXYA 1J6UA 3EDOA 2DKNA 2HO4A 5HFNA 5TMPA 2ZE6A 1Q0LA 1ZIOA 4MB0A 2VTDA 1V25A 3HBAA 2EC5A 3FVWA 5ISMA 2XWPA 3CZQA 4YR2A 2O07A 2FA9A 3DW3X 4GU5A 5BV2P 5L40A 1PGPA 4W99A 3NVKI 1WSBA 4NU0A 2WM8A 4E88A 3T3NA 2PA3A 2WIAA 3HKDA 1IHDA 3PDUA 2LNDA 4FYKA 3ZCXA 2YL2A 3MIIA 3OM9A 2QRPA 2YH2A 3RS2A 1J20A 2JGDA 4JXZA 2QN1A 2V6IA 3R6GA 3OZIA 3SVZA 1L7MA 3A6KA 2QOEA 4LSXA 3E7DA 4R9UC 1K2WA 3D6NB 3P9QA 2PWAA 4O7RA 2EBFX 3PYMA 4J8PA 4WCFA 3EWAA 1BWRA 4F1KA 4N01A 3WDMA 4ETSA 4K9OA 4AKHA 2JZNA 5KVQA 3W9YA 4AS1A 5P8WA 3EIQA 4AJ9A 2VZEA 2ZGVA 1TT5B 1N6PA 3A1UA 2ZPTX 4NLLA 1BFUA 4HEA1 4OJKA 2NU9B 1P2UA 5DGCA 1XTKA 3R7LA 4XVUA 4CEIA 1YS6A 3RB8A 3SMVA 4URVR 1EG7A 2BN4A 3CA8A 3C1UA 1RWKA 4PAWA 4P1ZA 3DOFA 4AURA 5L3QA 2H5EA 3RHTA 2Y27A 3INTA 1P1RA 4UBNA 2IQIA 2W58A 1ZQ1A 3IE0A 3K1AB 1HLGA 3RRZA 3CPJB 3U4IA 3PUZA 3RIEA 2FDCA 5HUJA 5JAOA 3CF0A 4DARA 4DW8A 2PRKA 1KNXA 4N5DA 3O5AA 2KMLA 2V54A 4ZV7A 5CG1A 3DLBA 4EJ0A 5L53A 3BOSA 2G08A 1RACA 1OVGA 5C5DA 2QD3A 1YR3A 4P38A 2ZYSA 3DEYX 1WB6A 4P7JA 2C2HA 4PLCA 3TJRA 1LV7A 3IMEA 4FR5A 3MJFA 4IDAA 3KIPA 3KR2A 2NZJA 1Y48E 2WHRA 1ZO8A 2EGGA 2H4XA 3OKAA 3N40P 3U0VA 2QX7A 3D4PA 4GE0A 3VPBA 1XC7A 2JIQA 4NXNH 1JDUA 1T0HB 1B93A 1UJ2A 2SICE 5FWAA 4KWTA 2V7TA 3PQDA 3R75A 3T6KA 2DXIA 3MBIA 5C8ZA 1QRAA 3AVOA 5HTKA 4LOHA 4A3CG 5I7OA 1JQEA 5A7HA 5BSKA 2AQ4A 4HQOA 4EG0A 1ODCA 2AI2A 4WA8A 2QRZA 3FWHA 3RVPA 1S2IA 5LVAA 1T8TA 4DDUA 3HR8A 2M1ZA 4NBWA 1J2UA 3EXFB 4PZYA 4NOKA 4KN8A 4YA6A 4ERXA 4GHWA 2G1AA 4FGSA 4EW6A 2QN2A 3H8JA 4IUCS 2B1GA 2K6GA 3IMKA 4TMYA 5BWNA 2ZT8A 4UASA 4JODA 3TM5A 3JWPA 2IFTA 2UVVA 1TMOA 3HXPA 2FN3A 3MWFA 3R7WB 1TIPA 2GZHA 1XPOA 3C3PA 4YJ3A 1L5NA 3DMPA 4I1YA 2FQQA 3ZS8A 4O2BF 1QHHA 1OTYA 3L92A 4MV7A 4Y2XA 2J3DA 2I66A 1ZEJA 2SKEA 4F6RA 1SQ0A 4P7BA 2AG0A 2W6JD 1XIVA 1H2XA 4UEQA 4D4GA 2O4CA 3M6LA 4CLRA 3L93A 1KERA 4CM4B 3NBYB 5J4HA 3K1JA 4IVNA 3GDWA 3NFYA 3ZXXA 4AWBA 5DNAA 5JYCA 1P1JA 3WRVA 4Y1EA 4WLFA 5E9JA 3BQ0A 1DXQA 1KUTA 3T15A 1TJPB 4FFMA 1ISIA 1XDBA 2CBGA 3QZUA 4X1IB 4QBGB 3REOA 3UFBA 1NVFA 3KV3O 3PUHA 5K2OA 1JA9A 2JLUA 2H1IA 2FZGA 3PU6A 3MLAA 4Z99A 3EZ7A 4AQYB 2O2XA 3BWBA 3H1EA 1RWWA 4ZQEA 3K71B 4L8GA 5HDBB 2WJJA 4J1QA 5WRFA 3DLHA 1M33A 4IIHA 5D7NA 4YT2A 3ONEA 3EFHA 3N76A 4PIMA 3G6KA 2UU9H 2K2WA 5IDVA 1GRCA 3HEBA 3RAQA 4H3KB 2GJAA 4UMVA 1WZ2A 1K8YB 2DBRA 4BX8A 1B0AA 2OUIA 2X7HA 4ND3A 4EARA 3I4CA 3ELDA 3LNCA 1S03G 3NM6B 4W8OA 2AD1A 4X97A 3ZXSA 1EFDN 2XGPA 4NDZA 3YASA 1OAOC 5BYAA 3PNYA 3D3QA 3BXEA 1W73A 2DJ5A 1XPJA 2EKBA 3F47A 1RHJA 3GJXC 4TT3A 3FYUA 3H99A 2O8VA 4EHNA 3CV3A 3U37A 3AVPA 1ZINA 3HYCA 2IYZA 2XZPA 4NI5A 4LJ5A 1EFKA 5A3QA 5F98A 4NFLA 4OSOA 1SBYA 2FUEA 2B4AA 1DT3A 3AKEA 3LY7A 4IKEA 4U7JA 1M75A 2A84A 4JMPA 4YN3A 1XB2A 2FQWA 3OP4A 2HSDA 1I2ZA 3UM9A 4E14A 5JAIA 4MUIA 3DZKA 4EB3A 3V3TA 3AOEC 4IHJF 1BX3A 3GN1A 4N48A 2C0QA 3T12A 2QTCA 2FW9A 1KAHA 1JHMA 1KKUA 2IF0A 3LQRA 4MK4A 5KQPA 3OX3A 1NX6A 4EG4A 4YAFA 5FH9A 2LKCA 2PVCA 1X3SA 5KQGA 5HZHA 1TZMA 3Q8PB 1R9TA 4UTNA 1L7AA 4AKTA 3GVPA 2QBYB 2AGOA 5CR9A 3TZHA 5JS6A 3S28A 1I30A 4DR7H 2P6NA 4D8XA 4F4UA 3KKPA 4JROA 1GZSA 3J81A 2GPTA 2FI1A 1U1CA 3M5DA 1AQJA 4PX9A 4OBEA 2QYHA 1Z12A 5C1OA 4MGEA 1NL3A 3UK1A 2CE2X 2ERCA 4J4TA 2XGOA 3QV1A 5EUMA 2FPXA 5M5BA 2F4VB 1KJIA 1IATA 1YDWA 3ZG6A 1PJRA 1TEZA 4ND8B 3ADBA 5BYBA 1V4VA 2C83A 2EKDA 2WU8A 3E48A 3VVCA 1HDYA 3OFSA 1U7HA 4EATA 1MHPA 2XMZA 2IVFA 4TV9B 4Z7JA 2L2QA 4A0HA 2IHVA 1N5IA 1TUGA 2G8LA 2HK7A 1M2EA 3WP1B 1V26A 1ZUHA 3TOZA 3MMXA 3VR6A 3WGZA 5CFRA 1U7OA 2GD6A 3OIGA 3WL6A 2P9QA 3G13A 4LMYA 1RRMA 2YYZA 3EA4A 2CNLA 3INYA 3O4GA 4PHCA 4L2IB 4QJFA 5FFNA 4URZR 4I6JA 5K0NA 1C4XA 4BWFB 2AJ8A 1Y33E 1DXYA 2LD4A 4M3NA 2X0FA 1L6IA 4GM0A 4UHJA 1DLJA 3SOPA 4RH0A 3QOYA 3PC3A 3FWZA 1L1QA 4G0UA 1I13A 1PK7A 3IP8A 5GZ6A 4RVFA 3HVIA 1TVMA 3ANTA 2YJ4A 2ZR7A 3ZVLA 4UUBA 1CZHA 1F06A 4JI0B 3FPLA 1UOEA 3IA7A 1AT1A 3EISA 3G9TA 1H8HD 2P6OA 4PPYA 5FJ8G 1AB5A 3ZWAA 1PNRA 2ILVA 5JATA 4RF4A 3OD1A 4QUEA 1ZCFA 3BWMA 3UA4A 3CJQA 3RG2A 1CP3A 1US8B 2XRFA 3BBLA 1SHUX 1ORDA 3GC6A 4ZTBA 4MO9A 5B3LA 3A9RA 4UNPA 1XRRA 5MFZA 5J5VA 1IONA 3IT3A 3KLBA 3M1AA 4R4JA 3RFFA 3B1YA 3JYLA 3AGPA 1SEIA 2Y67A 4ETWA 3VHXA 2VCHA 1OXVA 4U7PB 1NP7A 1W49A 2ZJ4A 2W6QA 2OQ2A 1AQ6A 3IIIA 3L0CA 4CL2A 4H6WA 2GBCA 2LWIA 3MLEA 5B2ZA 3EBLA 4OXYA 5HCUA 3RYCA 3DR3A 4OP1A 3L1KA 5HIJA 4MH0R 2QZ4A 2WSMA 1MG0A 1NUTA 1ZJWA 5LZ8A 2J3EA 2GF0A 1LLUA 3GLRA 5I4IA 5E3IA 2RF4A 4R1OA 2J7PD 3H9CA 2VQDA 5KQRA 1JYSA 1OA1A 3BJYA 2C00A 3LBHA 1TQ8A 3UT5A 3ZE8A 2WSYB 1TQ6A 3QG5A 4MQLA 1EFRD 3K9LA 2RGXA 1TE2A 2XE8A 2YMQA 5E6UA 2YKGA 1IVSA 4FHGA 1U8UA 4AY2A 1DCFA 1LNQA 1KMIY 3GTKA 4EA8A 2HH9A 2QL9A 4NQZA 1O3YA 3U1VA 4PANA 1RT9A 1EX6A 1Z82A 1ZM2A 1JHZA 2PDAA 3EF3A 1SUCA 4GGPA 1UF9A 3H42B 2COJA 3DBLB 3RPEA 3STXA 3LDHA 3MZ0A 5J2TA 5EXEA 4BNKA 3NBMA 3VU1A 3FKJA 5BURA 2R8RA 1BSVA 2FFJA 1ITZA 2RDMA 1E77A 3C24A 5AH0A 5H9VA 4NCIA 2GA9A 2I3ZA 5FAKA 4NZMA 1MQAA 2PQ0A 2HF8A 1WCIA 2RI1A 1EM6A 4LZOA 2ZVJA 2WIGA 1GDTA 2XQFA 3HY6A 3W05A 4Y0AA 4Q4LA 2H9YA 1O0SA 5GV7A 2XC9A 4DAOA 3DDWA 5C18A 2HVQA 4UVIA 2YVUA 3BXGA 4D8YA 3LLCA 2ZSIA 2KWIA 2YUTA 4NEHB 1SUSA 4BU0A 4G41A 2EU8A 3W5SA 1JJIA 4CBVA 1R0WA 4MUYA 2G9QA 4X66B 3O9VA 4WNAA 3KM0A 5IAKA 2JLBA 3VYVA 4LYHA 3C3YA 4F50A 3T5PA 3F5DA 1G63A 2F8MA 2DR2A 3FCYA 1XDSA 1AKYA 1G55A 1N5OX 2WNIA 1DB3A 2PGJA 3VR3A 1RWOA 3AHEA 1O6ZA 3ACBA 4RJIA 4X8MA 2BQRA 2C3PA 1CUDA 1AC5A 3CH7A 3NG1A 4L15A 2PYZA 5F78A 4CLOB 5B4UA 1SHTX 2BBWA 1Z39A 2BOVA 4UXJA