4MA0A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with partially hydrolysed atp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
366
structure length
366
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with partially hydrolysed ATP
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 120
structure length 366
sequence length 366
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma0A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma0A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma0A01
4MV4A 1AUVA 1W96A 4RZQA 2ZDHA 4C5AA 5CAEB 1I7NA 2ZDGA 3RUPA 5FNVF 4O7WA 5C1PA 3VOTA 5LYJF 2PVPA 1EZ1A 3OUZA 3Q1KA 1OBDA 3HO8A 3HBLA 3BFPA 4C5CA 4EA8A 5DMXA 2CNUA 2PBZA 4ZI7F 3V4ZA 2OLSA 4O7ZA 1EUCB 4EGJA 3MWDA 1C30A 3I12A 2YZNA 2NU8B 2W6PA 2FP4B 1KEEA 3K5IA 3RV4A 4YJ2F 1EUDB 5LOVF 1ULZA 4FU0A 3R5FA 2I80A 4L1KA 2W71A 4O4JF 3KAKA 3UFXB 2Z04A 4HR7A 4MAMA 1Z2NX 1E4EB 3BSWA 2WYOA 2VQDA 3JRWA 4MA5A 4I4TF 3AW8A 3VMMA 1KJIA 3BSYA 4YB8B 1WR2A 2CQYA 3VPCA 3E5NA 2IP4A 3BG5A 4XYLB 3TW6A 4FFLA 4EA7A 1GGOA 1M0TA 2HJWA 5LXTF 3SE7A 1DV2A 3JZFA 2R6FA 2YS7A 3U54A 2YW2A 1DIKA 3GLKA 3G8DA 4O7SA 4O7LA 2XCLA 2PN1A 5EZYF 4O7VA 3GIDA 5J2TF 4FGRA 2GPSA 2V5AA 4EG0A 3WNZA 3G8CA 1VBHA 4O81A 2FB9A 4YAJB 3WO0A 1EYZA 4FFNA 2W6QA 1KJQA 2VPQA 1CQJB 3NUAA 1DV1A 1UC8A 1W93A 5GONF 4WBNF 2DZDA 4I55F 3V4SA 5I47A 1B6SA 4YJ3F 5H80A 4TUYF 1OBGA 4TV9F 3R5XA 5K2MA 3JZIA 5J2UF 2R85A 2ZDQA 3R5HA 1IOWA 3MWEA 4O4LF 5JQWA 4MV1A 4O83A 4NYEA 4IHJF 4IWXA 5KX5F 3QFFA 1Z2PX 2QF7A 5IYZF 3VPBA 4E4TA 5BPHA 3VPDA 4XZ3B 4O7NA 2R87A 2GLTA 1VKZA 2R7KA 5JQGF 5KKNB 2DLNA 5HBRB 4O7YA 5HV6A 2YL2A 4QSHA 4M99A 4O84A 3TIGA 2CNVA 4M9UA 2V58A 4MA0A 2YRWA 1JLLB 5CB4F 4C5BA 2DWCA 4MV6A 1PX2A 3VA7A 2HGSA 3TINA 4XX0B 5C1OA 1KBLA 5JVLA 1VBGA 3OUUA 4FFOA 4IIJF 4ZHQF 4YAKB 1BXRA 4ME6A 1KJ9A 1I7LA 2V59A 3JRXA 1AUXA 2YWVA 4O4IF 1C3OA 2YS6A 1GSAA 3AX6A 3Q2OA 3R23A 1T36A 3N6RA 4HNVA 2P0AA 3KALA 2VR1A 1Z2OX 3DF7A 2W6MA 1GLVA 2Z02A 3LWBA 2R7LA 2I8CA 5JH7F 2NUAB 3LP8A 4IZOA 4DLKA 1A48A 5D8DA 1KJ8A 4GGMX 2J9GA 2R7NA 1JKJB 4EGQA 4O2BF 4ZOLF 2R84A 3U55A 2FPGB 4TV8F 2YYAA 4O7RA 3U9TA 4MV7A 2GQRA 4FFPA 4M98A 5BMVF 4EA9A 4YBZB 2YZLA 2NPOA 2FPPB 1GSOA 2YZGA 5LA6F 5BPFA 5JVDF 4ZQIA 5CA0F 2NU6B 2X0SA 2XD4A 2NU9B 2W6ZA 1SCUB 2NU7B 2W70A 3ORRA 3K3PA 2C00A 3KAJA 4FFRA 2YZMA 4O82A 3MJFA 4EAAA 4MV9A 1JDEA 1UC9A 4O2AF 2GPWA 1M0WA 1PK8A 5C8YF 1CS0A 5LP6F 3RFCA 4HQ6A 4FFMA 4HNUA 2R82A 1B6RA 3WO1A 2R86A 1E4EA 3RV3A 3ETHA 4O7TA 4I50F 2DIKA 2I87A 2R7MA 1M6VA 3U9SA 2VHEA 2CNQA 1EHIA 3R9RA 1CE8A 3K5HA 2CZGA 4O4HF 2QK4A 3N8DA 4MV3A 4HNTA 4M9CA 1GSHA 4Y8VB 2SCUB 2YRXA 2FPIB 4IWYA 1JDBB 4FE2A 4DIMA 3HB9A 1BNCA 2W6OA 3ORQA 4O86A 1KC7A 3BSSA 4XYMB 1IOVA 1CQIB 4MV8A 1KJJA 3TQTA 3TIIA 1A9XA 3ETJA 2W6NA 4WD3A 5CA1F 2GQSA 3KREA 4EABA 1KUTA 4J6EA
chains in the Genus database with same CATH superfamily
1BJTA 2OSVA 6LDHA 4WN3A 4QWCA 2PD3A 2AYYA 4XR4A 1R9GA 2E3JA 3UAWA 1Y8RA 3PGVA 4GP9A 4QFMA 4RF4A 3B53X 4H7HA 3ABZA 2OENG 3IT3A 1GY8A 2ON6A 2CLCX 4LFCH 1X42A 2W6PA 3ZWWA 4CJXA 1JE1A 3A4NA 2ZM5A 1XYYA 4ER6A 4L07A 1MQ9A 4UUOA 3BIXA 2FWAA 3C2QA 1KSGA 3Q3EA 4N7MA 4EHFA 4XPIA 1UMKA 4U7HA 2XQVA 1UWVA 4HGNA 1Q74A 4EGSA 3GEEA 2JI7A 3OAAA 4H27A 1KSHA 1RWXA 3IR5A 4EEKA 3DBOB 1YA8A 2JIDA 4DKJA 4CNQA 2GPNA 2WNHA 4LBVA 3VX3A 3PRKE 3C7CB 3MAAC 3KHSA 1P0QA 3QX3A 2G70A 5EIFA 1CTQA 1YZUA 4D02A 4MWEA 4KRXA 5A0FA 5JH7A 4ZMSA 1U2DC 4RGBA 2HDHA 1JAHA 3MTAA 1EFAA 5TLSA 1AHNA 4GFDA 1NI3A 1E6KA 4EJSB 3G2PA 4FMDB 1IBSA 2W6QA 1R50A 2QNBA 3UWDA 3AI3A 4EJFA 2PXCA 1N6RA 5H80A 4TUYF 5COBA 1TVCA 3H19A 4OSOA 1JHAA 4C2TA 2CJFA 1OYWA 2JA5A 4AZ3B 3WQBA 1SK9A 3RSCA 1I3NA 1A1VA 5A1JA 3U7EB 4Q8FA 2X76A 1RYMA 1KARA 4Y9TA 3I34X 2WWTA 2XR1A 2BW0A 3B1ZA 5C18A 2DBQA 3UK0A 2A9PA 5EXEA 1ISPA 5BWMA 3GH3A 1Y3DE 1NQTA 1JG7A 1X0VA 1PNVA 4HXEB 3QPWA 3L0ZA 4A3CG 1BX3A 3TQRA 2D59A 3GJ4A 3OQMA 4D9NA 3CUVA 2WICA 1B4DA 2ZANA 3DT9A 3QV2A 3ZCRA 1CDDA 4RKFA 4R3NA 4JC8A 4DGQA 3FX2A 1YDWA 4C01A 2J6IA 5DOZA 4WNAB 3AHCA 5FA5A 3R0IA 5BURA 4KFSA 1OE0A 2ASVA 1Y9DA 3L0PA 1UWLA 6NULA 1W0KA 1G21E 3KQYA 4XM2A 3ZLVA 2H51A 1WXDA 2I0FA 1TF5A 2V4UA 1RR6A 5CITA 5JSQA 3DAAA 5IK2D 2WSYB 2J9GA 3DLTA 4IQ8A 5AW8A 4D56A 5AMXA 1YZKA 2ZAOA 5AUOB 3T5JA 2GQRA 1KOJA 1V8ZA 1EE1A 2GEBA 5DM70 4MUFA 4CEJA 2OB2A 4LHVA 2AK3A 1E2HA 5EWMA 3JWIA 1VHJA 2UZ0A 2O2EA 3O31A 1IIBA 3NKLA 2BHTA 2FNAA 1P6UA 3C16C 2I71A 4J9RA 1T4MA 1A9SA 5AHRA 1BHQ1 3ENVA 3KKQA 3ZY4A 1KYQA 1Z4IA 2E6UX 2Q2OA 3X1WA 1HLPA 3G82C 3FUVA 2HZBA 3UK2A 1S5PA 4DMCA 3PQ4A 4PZEA 4JK3A 4ECRA 2FCRA 1KP2A 1DC8A 3IMEA 1V5WA 5DLPA 5AOVA 1JWLA 4FD2A 2BZ0A 4DARA 4MV3A 4M4SA 3B52X 3BMQA 3OCZA 2PXHA 5FPPA 4M0MA 3OURA 1G66A 2D8AA 2YWCA 3IVMA 3VU0A 5I7WA 4AM8A 4URVR 1TTQB 1HM5A 1C1YA 2WNSA 4NAVA 3VR5D 4WOPA 5A6VA 1KF0A 2ZSEA 2VUIB 4UNRA 3KREA 1XDBA 1W49A 4MAFA 4XUCA 4OHBA 1W96A 4ZTUB 4RZQA 5AUNB 3T34A 2X6TA 4Y1RB 3ZWOA 1NR1A 1HT2E 4OM7A 1FJHA 1E3WB 4IRKA 3ZDFA 3QYFA 3QWIA 3U09A 2G0NA 5K5EA 3ACCA 1N6OA 4DR2H 4DKXA 1T3NA 2H0RA 3F73A 2C84A 3H7IA 2JBWA 5TS3A 4HFMA 1B3RA 4LOJA 1NUUA 1PHPA 3RV4A 2QYOA 3BTUA 5ILGA 2GHTA 1G8FA 2WMOB 4JV5B 5HIIA 2PHZA 3CPEA 3VKVA 2MCFA 4NZYA 4I50B 2R8BA 1E7QA 1HGXA 1E3SA 1OZGA 1WEHA 4WLEA 1LH0A 3JX9A 5BV2P 5D1OB 4RVSA 4OV6B 4XVRA 2PZLA 3EEBA 3BD9A 4Y1EA 1PQUA 3KYCA 2HQOA 4PN3A 1G7TA 1L4UA 2AFHE 3RTCA 2FEMA 3D54D 4DR3H 2B8TA 2KWIA 3WRYC 4RY9A 2UUOA 4U3JA 3PEFA 5JALA 1TKCA 3C5VA 1JFFA 2CFOA 4ZK6A 4DQKA 2AGVA 5DLEA 4BV8A 1PTKA 1L5VA 1R0RE 4MLDA 1BIFA 1UAYA 1YCFA 3QUQA 1UBTS 3KUCA 1RM0A 3T9DA 3KTAA 4WKNA 2ZBGA 5EMKA 1AQ6A 3GLGA 2SKEA 4NF2A 3KJFA 4GICA 4B46A 3CUWA 5K3SA 5DGIA 3HR8A 3VR6A 3EG5A 3HM2A 4FWBA 1JIHA 3DONA 4C14A 3NX4A 3WYFA 3OF5A 1F9AA 3MRXA 5DNDA 2QW1A 3E5HA 4EOGA 1XWFA 4Q4CA 4R8MA 1Q11A 4GMHA 3JTEA 2AN4A 1NU8A 3Q3CA 5CB4A 3QF4A 1RKUA 4ZVVA 1PV2A 1KEKA 2Q2UA 4ZTZB 2O6LA 1F17A 2QVXX 4FW8A 1N8KA 2X86A 2CJYA 1TYDE 1Z2CA 4REQB 5IVKA 4UU0A 3A06A 5IS2A 2WWXA 1XD9A 5BVGB 1SVNA 2Z2YA 3IDFA 1AKEA 4D3XA 2R7LA 4QOIA 4IYJA 4DGSA 2Q29A 1XCMA 4NXNB 4F4WA 2A6PA 4HJXA 5CNMA 4B0PA 1EJBA 3A4YA 3L7BA 2AK2A 1WMDA 2BTOA 3RUDA 1D4OA 4YQFA 1VOTA 4QQ8A 2BUAA 4GP6A 1AK2A 4UREA 3KM0A 1FC0A 2IS4A 5HEKA 3SJBA 1F4VA 4UQPA 2QIPA 2VZ0A 4FDTA 1JXLA 4I99A 1AB6A 3COZA 2VDJA 2VP0A 4C2BA 5J1TB 3EPRA 1YHZA 1OI7A 4M60A 1DKNA 4K88A 1QP8A 2XW6A 4EAAA 3TKAA 5K3AA 2WE8A 3LDAA 3BSFA 4O2LA 4G36A 1JA1A 5EKXA 1NU6A 5CK5A 4HQ6A 5I8WA 4ESOA 5DBEX 1I50A 4RDIA 4ZEMA 1XPUA 1B6RA 3H6GA 3CPHA 4Y7DA 3BEDA 1ADBA 2IYUA 5DIZA 1F60A 4I50F 1FFAA 4KLCA 1CRWG 5EMNA 2BFOA 2J41A 3DMDA 2AEFA 2AG1A 2FWMX 4YCCA 3ZDCA 3O2SB 4TM8A 1W73A 3TI9A 2VUSA 3DDNA 1GZHB 3ESBA 4YV1A 4EYKA 5K8IA 1GSHA 1ZA1A 2AFIA 2JVIA 3DVAA 3BWXA 3TM5A 1O94A 2DERA 1FUIA 4X41A 1WVIA 5JFGA 3K92A 2BTQA 5MGBA 3RFXA 1T9CA 4JC5A 4EB3A 3AR5A 3GJRA 3TIIA 2FKLA 4WJLA 3HBJA 2BGWA 3MYRA 4L2IA 3MCAA 1U9CA 4RU1A 4A4DA 1PS0A 4JJFA 3VNQA 3RANA 2XNCA 1Y42X 4KYIB 2PWBA 3DFKA 2YWHA 2HM7A 1MB2A 8ABPA 4DCMA 2FY8A 3UK6A 1Z5WA 3G6XA 2V5UA 2YZKA 2G88A 4C43A 2ODTX 2TYSB 1CUZA 3KYDA 4LMYA 5EWJA 2P6RA 3QHQA 4YJ2A 4HB4A 2BHSA 3DAHA 4MQ5A 1AKRA 1L7QA 2ACVA 2VCEA 1Q19A 2A78A 3FKQA 3I28A 3CURA 4BRSA 2GBCA 1T43A 4YDSA 3FMAA 5E4YA 2PQ2A 4IIUA 4N5MA 1DO8A 2BUCA 3L7DA 1ATIA 4G0QA 1IB0A 2HL6A 5F5NA 4L76A 1W85A 4OL9A 2N0SA 3AXTA 4Q5IA 3REFA 4PYIA 5K1ZA 3ZXIA 4GU5A 1Y6FA 1E0KA 3CS3A 3ZE7A 3ERCA 3NUQA 2PEYA 2Y0PA 3M1IA 1IK4A 2YBEA 3CEMA 4LC0A 1K8ZB 4ZVLA 2HHCA 2CHUA 4PS0A 4J2TA 4HKTA 3VYTB 5KFFA 5E0KB 3T3DA 1IBKH 3AVYA 1B6SA 3ADDA 1E5VA 2GDJA 1MIOB 1XMQH 1QNFA 4GLJA 3AYXB 3OKAA 4NYEA 2BRUC 3UMFA 3TNLA 4P3KA 3FTDA 1Z8NA 3ZWMA 1LDNA 1I6MA 1C7FA 5ES4B 5FFFA 1A50B 2DPYA 3BGOS 2FQYA 1YCHA 3VZRA 1XTZA 4BB0A 1UH5A 4IDAA 4HAWA 2GKSA 2FF5A 2JGMA 4EATA 4H0FA 4RK0A 1OXKB 1WB5A 4JQYA 4WKCA 1DKRA 2C57A 4YAKA 2H1OA 4NONA 2ZM6H 3IP8A 3TLEA 1N7HA 5A2QW 5BW6B 4E0BA 5DDIP 1G5PA 5FAKA 5D6OA 3Q88A 4BMPB 4G09A 3SQLA 3ZG6A 1N5OX 2FW0A 5AVTA 2INGX 2XVZA 3OFJA 3DTVA 3VHQA 1I4WA 4RZRA 1Y1WA 4JSRA 2IS6A 3RIZA 1E2GA 4PLGA 3HCRA 5E2BA 4HY3A 1VPWA 1EEXB 4LWZA 3L9XA 4HSEA 1OILA 3L18A 2VHWA 2Z83A 2JDIA 3PIIA 5L9AA 4JITA 1ZZEA 1FVIA 2J30A 4H1TA 1QGOA 5KHOC 2FPWA 3C8DA 5LLDA 1VMAA 4QYTA 4BPRA 2Q5QA 4LG1A 2E4UA 2W2XA 1U7PA 4L50A 2WB1E 4ZQFA 3PPXA 2BWJA 3FPFA 2FETA 3CRVA 4J29A 3MT0A 4EUHA 1CF9A 4NBUA 4TMXA 4GBMA 5CPFA 4QREA 1FTNA 3KCNA 5KPDA 4BNLA 1E5TA 2ECPA 2AW5A 3HDVA 1XZ8A 4LEIA 1D1PA 3UWSA 1QFZA 3Q40A 4OGFA 4EK9A 1M76A 3E35A 4ETIA 3CTMA 1BWRA 3AI7A 3NFRA 4YJGA 5IXJA 4DCTA 3ZD9A 3DVLA 1O89A 3OQVA 4F9TA 4FMBB 5E38A 3ZJTA 2SNIE 2P9YA 3OHMA 2QT0A 3GTQA 2MSNA 5ABPA 2XMPA 3FIUA 3P2JA 5EPOA 3QLEA 3LX6A 4BMSA 3PXBA 2OO5C 4UULA 3R9KA 4LZOA 3AEQB 2BEUB 1KZ1A 3WWZA 1FNMA 2ONKA 4RZSA 4J9QA 1I1HA 4L9RA 2Q6KA 5KVVA 1KWGA 3AETA 2YASA 3AERB 3DPSA 4JGBA 4F2DA 4QLBA 4R3WA 2ATVA 1JHPA 3CB4A 2FG5A 1GPH1 3USCS 1IUKA 1XKTA 1JN0A 5FUMA 2QPTA 2WP8J 4C89A 3E2MA 3AUFA 2EJWA 4WOJA 4KIFA 3PEWA 3CVYA 3NFYA 4Z7NB 2QX8A 4LF6H 2VK2A 4G0OA 3QNWA 4ECVA 3AUYA 5AM5A 1E2QA 1SVKA 5KOJA 1NN5A 3FCCA 1LVGA 3IVGA 4TRNA 4J1TC 2NXEA 4DPLA 2DR3A 1MVLA 4TRJA 2R6GA 4PHGA 3SJ7A 3ILYA 3RUAA 5LP1A 5IT5A 2YR0A 3GRCA 4DV1B 1FFYA 3L9WA 3D6UA 2HOQA 3T5DA 4ACBA 5LC1A 1PS9A 3I4CA 1QS0B 3I9FA 4ED1A 4MW1A 3J7AK 3KQUA 3IAUA 4IINA 4M49A 1P5HA 1ORHA 2XAAA 4B76A 2XYVA 1IHDA 3Q3HA 2Q5FA 1CQZA 4AYBA 2X1MA 2ETXA 3IJPA 3NKVA 5CEEA 3AHFA 1T3GA 1P73A 3TVYA 2VDOB 3SJCA 1KJIA 3SFTA 4DDHA 4DM4A 5KT4A 1KK2A 5EINA 1YR9A 3S68A 1OFUA 4RA9A 3DKKA 3RYCA 3LSYA 3VTKA 1NUQA 1XF1A 7ADHA 4YXWD 2NX2A 1FMTA 3HJBA 1ONNA 3FVTA 4DQNA 2QN3A 5C8XA 4OHZA 3U44A 3TKYA 1N5MA 3MQFA 2ATCA 4AIRA 1KI6B 1XMXA 2OECA 3GP5A 4MI1A 1IXRC 1DJOA 5CRIA 3ZBPA 5CFQA 2NVYA 4EJSC 5G1PA 4QBHA 3K16A 1GSIA 4ALIA 4UVGA 2VNHA 2EBWA 4TYMA 2VZ8A 3AIMA 1CRZA 4WCFA 2XBLA 4RTOA 3VPDA 1TDJA 3B6MA 2NT3A 2JLVA 5KKNB 4IVRA 2ZRLA 3N7AA 3NQ41 3BRWA 4CMJA 4UHKA 5CFPA 5B1IA 3DWIA 1TVKA 1UPBA 5BN4B 4MA0A 3B7WA 1XAJA 2HWXA 1CQXA 3OUUA 2DUUA 1CR0A 4ES6A 1QHHA 2CHVA 4BO6A 2CUTA 3K70D 1FSPA 4KGDA 3GJ7A 5DTJA 4NMWA 1CY8A 1WTAA 1Z47A 5ILOA 2WVHA 3ND7A 2YH2A 2A9VA 1FS6A 3DCNA 4LECA 4LH6A 3U4AA 4X65H 5HF9A 3IIKA 1JZTA 2IPLA 4IXTA 1G8HA 4HLNA 4YT5A 2OHJA 3CJQA 1J8QA 1TWAA 1U2ZA 4GZ3A 4ZI5A 3B8EA 4BBAA 4E3ZA 3H0EA 4G1EB 4CMIB 4AK9A 3TSOA 2BE9A 4JD5A 4M9RA 4PRKA 1IBMH 2G7MC 1TPZA 4JEHA 4IJUA 4MP8A 3VKUA 2B98A 3ANMA 2RGRA 2R48A 2IPOA 3FCYA 5BYKA 3WQHA 2NIPA 3F49S 2ZI4A 3QMPA 3IPXA 2BUBA 4RIIA 5LP6F 4P3YA 4D4HA 3TMKA 4YI3A 3ESAA 4HB0A 3DPUA 3NP9A 3ETHA 2BISA 1Z08A 1U80A 3QWFA 5J3JA 1SO8A 4WVFA 5C5DA 3HYTA 1VIMA 3HU3A 4BV9A 5DAAA 3BB4A 2OY0A 1ZH8A 3LA6A 2LCFA 4BV3A 4EB8A 1SC6A 1XUOA 4NMLA 4A8TA 3FTPA 2ZKLA 2YWBA 4MJLA 4NDZA 4PSKA 2BLNA 3B82A 3R7LA 3K8ZA 4RPHA 3CN9A 2NNWB 3LLSA 5FBLB 4KI0A 4EBBA 3BE4A 5ALIA 2C94A 2Q3BA 4ZU1X 3RSOA 3EPLA 4KV9A 1CULC 1UC5B 1E6UA 3GHYA 1T2FA 4KQKA 1E4FT 5EC8A 4LZJA 3BJEA 1P2GA 4MDYA 2AQKA 5F21A 2PWZA 3T7AA 4NYMR 1N5RA 4HPWA 4HX9A 4XWGA 3LHKA 2AC4A 4X1YA 3F3SA 4EUNA 3MR6A 2GHQA 4MGEA 3PNPA 3IQZA 4P84A 3W7AA 3C0FB 3MEQA 3PVZA 4L7QA 3P96A 5KNCD 3ZBQA 5K3FB 5KSZA 1NGSA 2VTVA 4E2XA 1P44A 5DG9A 1JPNA 3VV2A 3UTDA 4YRFA 5A7HA 1J90A 4P7KA 5CT9A 1COZA 1Z6XA 1KXJA 4LXTA 2W6IA 1MAVA 2YQ5A 3KHHA 3HWSA 1Z5NA 3NOVA 1RXUA 1IVYA 3A9VA 3X1DA 2CHQA 5A5FA 3B2EA 2W00A 1DB3A 4BFUA 5FX2A 3GZTB 1CE8B 2BMWA 3OPYA 1GPBA 3G0CA 4OSEA 4TRRA 3JATB 2GJKA 4W9MC 4EA7A 2OQ2A 4LDAA 3W2EA 3OJFA 2O48X 1EFPA 2X0IA 3TG8A 2QAGB 2C9CA 3GFPA 3H4MA 2CDCA 4M6WB 1TRHA 1TM1E 5HW0A 4X71A 4KI7A 2FK3A 3U3XA 2ZAYA 4BRUA 2NVWA 1YR1A 3ZU3A 4K40A 1DTWB 1VBHA 2PA0A 3B5EA 5BMOA 4QXOA 1CDEA 4Z3OA 1D2AA 3NCHA 3TTYA 2R6CA 4NPAA 1KERA 4AY3A 4MDEA 4WL0A 2GNOA 4NICA 4W1RA 4YRBA 5JVDA 1Q0LA 1AC5A 3MWEA 3A3NA 4JUIA 3JVUA 1WKCA 4O25A 3NGXA 3NUZA 1X1EA 4OBEA 2OWDA 4P0TA 4J6FA 3KQKA 5JCOC 1WWKA 4N6NA 4KXMA 2GLTA 3QVGA 4CC5A 5H70A 3V34A 1MIHA 5BQFA 2NLOA 5JCXA 2NWQA 1MAHA 3GIKA 4JGIA 3OP1A 4C0SA 1O96A 4EFKA 5C31A 2DQKA 4RFSB 1EWYA 3KELA 2J33A 3QFSA 4R40A 1N5KA 3DKVA 1Z5ZA 2JZNA 5A05A 4NIMA 5FB3A 1LKZA 4DL4A 1KEUA 1X1TA 1U6KA 4CLRB 1WTCA 3TNDA 4FEAA 5T4BA 2VBCA 1RXYA 1L5HA 3X1ZA 3K9CA 2R4TA 1SELA 3VUFA 4LYFA 4G41A 4LY9A 2FZWA 1UDWA 1TYZA 3KQPA 3CLVA 3SYRA 4EQ6A 3K32A 3KE9A 3L8ZA 1S4MA 3G8YA 4HVAA 1GZ5A 3IDAA 2IWRA 2IYZA 2FLKA 1JFVA 3T9FA 2VNJA 5M34A 1NPDA 4YRDA 4IEIA 2JK0A 3OHBA 1ZLYA 1JBEA 1HDGO 3O84A 4PG7A 4Q47A 1R74A 2EJ3A 5LA6A 2IHVA 3HFJA 2QSJA 3B2QA 2IV3A 4JI0B 4Q7EA 3ZJ5A 3H9BA 3FWNA 5I8PA 2F6RA 4N4AA 3OD5A 3DVSX 2FP4A 4YBRA 1V16B 4J8PA 5E2IA 3SZMA 3H13A 5COQA 5ERYA 2JD2A 2HJSA 1JR3E 1W4ZA 3NAQA 3K0AA 4N6OA 5IT9A 4ENWA 4U9HS 5CURA 5C53B 1A7UA 2WQZA 5DYYA 1DAPA 1E4YA 3LOUA 2BFDB 4RH0A 4QODA 4KPFC 1U8XX 1CUCA 3I72A 4KAXA 2V1UA 2YXLA 3OMWA 3C4QA 4K81B 3VU9A 1W52X 2OO7A 1VXOA 3JR3A 4HFNA 4BVLA 2H00A 4R0MA 4LYYA 4ONEA 4JB3A 3UMBA 5A4FS 2A67A 1B2LA 1V5FA 2G1AA 4WV3A 2R25B 1PLKA 2JIZD 5EJ8A 1XPOA 3GDHA 3PQ5A 3Q7EA 2P11A 3TS1A 4HSGA 1A1SA 4JJ7A 1KTAA 4U7GA 2A3RA 5TMBA 4KKXB 3HGQA 1P9LA 1DOAA 2YHBA 1U3CA 2L69A 2Q49A 5DRYA 4E2ZA 1G8GA 2JFUA 3M49A 1IH8A 4C0AC 2DVMA 1TW2A 4H3HB 4D4MA 2JA7A 3JZ6A 3L6UA 3EZ9A 1W4RA 3EBLA 3CFYA 4NQRA 3MUFA 1QCZA 2YRFA 3T7CA 1XK6A 5LYJA 1KY3A 5LKRA 1JHYA 1KEVA 4OQEA 4MTLA 4JI5B 3OECA 4IF4A 3S2SA 2FKNA 4G4SO 1HLGA 2XCIA 3G6KA 3FOCA 3ZD6A 5ECDA 4BEVA 3PP8A 3SOPA 2I9KA 2XSZD 2CL0X 1T6YA 3O4FA 2I67A 4XCVA 1MX5A 1G0NA 4FGZA 1WETA 4LY3A 1G6KA 5E6UB 4HZIA 4MQEA 4WX2B 1IZYA 3D59A 1MA0A 3FVQA 5DB4A 4C9BA 2B8NA 5TARA 5CGQB 4Y6PA 5EUCA 1QJCA 2KE5A 2IYYA 4MCIA 1PLLA 3KZ1E 5HQTA 4CLOB 1R8YA 1QAMA 2HQRA 4D0GA 4ECQA 3PWSA 3ZWNA 2Q4EA 2QL6A 3ILHA 2IH2A 2ZT8A 4IDGA 1ZMRA 1SRRA 3EC1A 2ZS9A 4ENVA 1X7YB 2O1EA 3N8IA 3K6KA 3OE5A 1G41A 3GUUA 2PV7A 4JS0A 2W2NA 1G98A 1YS7A 3LBYA 1IYZA 3T1HH 3ANNA 4ZT6A 1PR3A 3ZU2A 1TCUA 4F3TA 5KTPA 1RM5A 4RTKA 1F2VA 2YMQA 1I80A 2H29A 2GPAA 2O7RA 4BGDA 1ZBQA 1GPLA 3K8OE 1NA5A 3WTCA 4GM0A 2YC2C 3NRBA 4HRVA 4NBLA 3BMNB 1U99A 3DMNA 3ORFA 4L4ZA 3IAFA 3HG7A 3JALA 5DSXA 5FPKA 3OM0A 1JJIA 3PNMA 5AKYA 1H1LA 4O84A 4Q7QA 3TR0A 9LDTA 3RS0A 1G2IA 1M6YA 1Z26A 5AVKA 1U94A 3OVMA 1PX2A 2RMKA 1R66A 4ENTA 1CUAA 5BWXA 4FYYA 3V4PB 1AQUA 4QDTA 4HDKB 1RBYA 3ZV6A 4ZXFA 3R3VA 1GPMA 1RM3A 5HGXA 1P4GA 3WLRA 3SIXA 5GV7A 4WOBA 3HFGA 4RFVA 2QDKA 3OOEA 5CBPB 1PWEA 4V2IA 3LXRA 4TTQA 2X3FA 2VZLA 1BVYF 1T36A 5JE8A 2OBYA 3U7GA 4MUJA 3T5LA 1KNXA 3K71B 3PR1A 5FI3A 3IEPA 4JP5A 2X2PA 2Q3MA 2ZYDA 1PU2A 2H3EA 2OPHA 4EEYA 2OM6A 3E9NA 5M3BA 3R75A 1WCWA 2G3YA 1XI2A 3KBOA 2VOBA 4CTOA 1X7ZA 1U5BB 1ECCA 5K6RA 4DMKA 1SCNE 3M4XA 4V0LA 2A1TR 4QUBA 4ARBA 5TJHA 1AVTA 1Z25A 2XBUA 1AM4D 3QKTA 3PENA 1LJLA 3OT1B 3L84A 2V7QD 3K72B 2O19A 4NCJA 2OV4A 1G5IA 1Z5PA 2IEGA 1Z4PX 1KRXA 1VTKA 1Q3HA 5KYUB 3KVNA 3M9XA 2C2GA 5KQPA 4G89A 1QDLB 3CZCA 5THXA 2ZFUA 4F4HA 5CJPA 4D0RA 4ZYXA 1BMQA 1N5IA 5CNKA 3DHYA 4IH9A 1SD5A 4AZWA 2WB2A 2IY8A 2XUHA 1GNVA 5ED0A 2JA5G 1OX4B 3HPRA 2JHFA 3PJGA 5KFCA 2QDXA 4ZZ1A 1WXGA 4ICIA 1J8YF 1Q22A 5KFQA 3NTUA 4BNTA 4C4OA 4AI6A 4HDSA 1MABA 3QUSA 1HNXB 4WFQA 4MK4A 4DEVA 2VHCA 3CV3A 2QTVB 1AH2A 5KFOA 3TDNA 2K4MA 4GVPA 4XYGA 5LDGA 3BCUA 3KXLA 5TB5A 1F2UA 1JHQA 2W83A 3FNQA 2QN1A 2QUKA 3T0FA 1U4SA 5IZ4A 1TYBE 1TQDA 1Z56C 4Q3BA 2JH8A 5ITZA 1HV8A 3TSZA 4XLTA 1ZHSA 1P7WA 3WFIA 5KEIA 2WZCA 3N7TA 1QF7A 3DJFA 4PAWA 4UHFA 4X1OA 2QPAA 3CG4A 1U1FA 3WBKA 2WTNA 1S0UA 4YCDA 3MRTA 3B1VA 4J9LA 4KBYA 1XDDA 1QQ6A 1P2SA 1ZO8A 4BFSA 3QVMA 2AUMA 4Q6WA 1ZRNA 1MG5A 4DDKA 2YV5A 4L1KA 4YJFB 1X13A 1FP4A 1M34B 3A58B 3STVA 1IY2A 3MGGA 5SICE 2Y1EA 3GAAA 1GPNA 2DT8A 1R6VA 4QX6A 1Y4DE 3N70A 2CVPA 1GAQA 1GYFA 1RWNA 2X6RA 3CEJA 2XCPA 4X9XA 2VXYA 3E5NA 2GB4A 4WKOA 3B3FA 2V96A 3EQ9A 1EE2A 4EY7A 2PUCA 3G9ZA 3ZU6A 1Z6GA 2ZIXB 5BXYA 3PJEA 4ILEA 4GMDA 5JAZA 4GGPA 1II0A 3A9TA 3G68A 2A7QA 2ZSJA 3CKMA 3ND8A 2PLNA 1U90A 5KYWA 2HEIA 3G5TA 4LZWA 5KOHA 4CKEB 1PNOA 2BH2A 2QG6A 3DM9B 2GPSA 1O95D 4HZUB 1KZ9A 3P2YA 6YASA 3ITKA 5HGJA 1YR6A 2NNLD 3RB8A 1PSDA 3D7SA 1QAOA 3IDSA 3DMYA 1WDWB 1WZCA 3ZW8A 4KO3S 2D1RA 3PFWO 5KKAA 5BUQA 3SBEA 4A8JA 2G82A 3VPGA 5BW4A 2QX9A 1IUNA 1ADCA 2CYCA 4U6NA 4QU5A 5IYZA 2XBMA 5D85A 3MW8A 1JEYB 2C77A 4QWDA 4M53A 2IOFA 5FUBA 2JGRA 5GJWC 1T8PA 4YP0A 3FDZA 1SUDA 1OAAA 3LYAA 3NEPX 3OQHA 1IPFA 3BMOB 1ZNXA 4K9RA 2AG0A 3TJMA 4BATA 3IAM1 3H87A 5FHQA 3AM4A 5CHYA 8GPBA 2I2FA 3D9QX 4QPDA 1ZU5A 4N01A 1T5TA 4LMPA 5JLJA 4PXSA 3C8HA 2IY9A 3E9MA 3AEKA 4J2HA 4LRXA 3CLRC 2C83A 3U37A 5BUZA 4KYUA 1XTJA 2G83A 5FUWA 3SJAA 1TEVA 2C0PA 3U49A 4ABTA 3RT9A 4YR0A 2GAAA 3FWHA 1ZD9A 3H8VA 4B3TB 2UUCB 1YKFA 2B69A 3UHOA 3JWEA 1UEIA 3I73A 1XZBA 5M5BA 3CX3A 4BZQA 4G23A 2H4XA 3PX3A 1YRWA 1PCXA 3GXBA 4QBFA 1RQRA 4RL6A 4PWZA 1LI4A 3R40A 3H9UA 1GPAA 5ER6A 2PLWA 1CDOA 2DX7A 6Q21A 3I05A 3RSHA 2QVBA 3R6TA 3DQQA 2I55A 1USGA 3WGYA 1NFFA 2L18A 1Z3IX 1F8YA 1KNQA 1FFWA 2AIRA 4EFMA 4I9UA 1GKIA 2D06A 5FORA 5IJ9B 3UFXA 1XCOA 1NAIA 1XO1A 1MB9A 4MGZR 4TYWA 5HKOA 3HP1A 1OLOA 4UPDA 4YYEA 2YHAA 2NT4A 3HRHA 3MZ0A 3PUXA 1JHUA 5A5DA 5EIEA 5AWFC 4UDOA 4DR4B 4LVNA 1G63A 3W6ZA 3AYZB 3SPXA 2JFXA 3H9GA 1RYHA 3ZHRA 4CKBA 2VP3A 3OOHA 4KIGA 2W4IA 4MGIR 3GJYA 2P5TB 3LVQE 3OZCA 3UJHA 1QKJA 1RK5A 3RU3A 4QUGA 4FGSA 3A9WA 3CZ9A 3DA8A 2B3DA 2C4KA 3AHJA 4R9UC 3D6VA 5IBRA 2R8IA 4V0MA 1V4NA 4ZDWA 4DEYA 2HK8A 2YV1A 1V8DA 1CPYA 1X9GA 4UFPA 3PTLA 1CQJA 3KPYA 4HPJB 5CAEB 3GFFA 2HSGA 3TZ6A 3WQSB 5JYBA 1DEKA 3L01A 2XQKA 1YZQA 2GYVA 1D4AA 3MPUA 4D99A 5JRJA 2HMAA 2FXVA 1BE0A 2QU8A 1EVLA 2DPXA 5KBYA 2FMFA 3FB4A 1ISIA 9ATCA 1YONA 1DBWA 4IOKA 3RC2A 4JV1A 1CEEA 3J81W 1RHRA 1VLMA 2ZE7A 4N3BA 5JNRA 3HLKA 3VZSA 2ZQYA 3BWEA 4QGSA 2RE8A 2Y1WA 1FTQA 1X8LA 2J08A 5G3YA 3SXUA 1J7JA 4YAEA 2OCLA 3EUEA 4DA0A 2I6UA 1BX0A 4GE0A 4CFYA 4ZREA 2W9BA 4XSVA 1OVMA 2DPHA 2WJPA 3AFNA 3RS9A 1J9EA 3DCJA 4O4HB 3NXKA 3OY2A 4YY3H 2FDCA 4CKXA 2GBPA 3ZC3A 4DCSA 1SVIA 3DHEA 3T3NA 5JS8A 1VSBA 5DYWA 4A23A 2P69A 3HRKA 4BHTA 2H59A 2IV2X 1XNQH 3WWPA 1RYSA 1GRNA 2Q0HA 4ECEA 5CLJA 4Y6SA 3PS9A 3HKEB 2GD1O 2AZTA 2CNNA 1C3VA 3MIZA 3T7DA 3D2CA 4QEZA 3ZKWA 1AKWA 1HI9A 4INAA 2ISSD 4N3AA 4XWKA 1HG1A 1UOQA 5EIOA 5CVEA 3TQ1A 1VB5A 4YAOA 1IWPB 1QHXA 3TK1A 4HYYA 4HUTA 1JDNA 1T1JA 4OGLA 3DFMA 4TMZA 4DUYH 1DWUA 3JQRA 1P3DA 4G0UA 2Q6VA 1O4VA 4G0NA 4KVGA 4G8CA 3DAYA 5GQSA 4TYQA 4JV0A 2I4RA 2AL7A 5DCWA 1IZ9A 3LXMA 4FD3A 4DL6A 2XQIA 4RY2A 3FZYA 2V58A 3ZE8A 1M34E 3O8BA 3HJUA 4PVCA 4A0FA 3A6HA 2PV0A 4POAA 5F77A 2Z4TA 2O7SA 3F7TA 4OAQA 4QUKA 3K0BA 5K45A 1WSWA 1AK1A 3PGA1 4OUKX 2OQIA 2BLLA 3IQEA 1DEOA 3NUGA 4EI7A 1IM2A 3KALA 1YRLA 4AZ0A 4O2RA 2A5GA 1HK7A 1U0TA 1DIRA 4P7JA 1XNHA 4NBSA 4PZ0A 3ZIAA 5IARA 2Y77A 4MUAA 3KOMA 2R84A 1JQLB 2UVRA 1NVDA 1OXBB 1UR5A 5CX1A 2EP8A 4DRXB 4J1SA 1R0WA 2CNWD 4D6YA 4P4SB 2UVUA 1BYIA 5H3LA 1RWQA 5FLXA 3PX2A 1XMIA 4MMXB 4BNKA 4KSBA 2BR4A 5DO9A 1QAQA 1TLLA 1YE8A 4HMQA 5KYNA 1XQYA 3F2VA 4QLAA 4X20A 3M1AA 3M89A 2AEJA 1WV1A 4BN5A 2Y66A 3FDJA 4RPJA 3HGTA 4P82A 5AVQA 2CYAA 3TW0A 3MCUA 1Y81A 4CF4A 4LI0A 1A7JA 2IEIA 3WGMA 2E4ZA 1SVOA 1LW7A 4K0KH 4C76A 3P32A 3P4UA 3LT2A 1ODSA 2BEWA 4E09A 1YQQA 5KYGA 4FONA 1QH8A 4O4HF 2G1KA 1YIAA 2C35B 3LMKA 2FG7C 2ERXA 3WLSA 1R9NA 2VZ9A 3N2ZB 5BV8A 1EKPA 1UL1X 4E03A 5DHPA 1J1IA 3ZWVA 3OIVA 4ECAA 3T9BA 3MT7A 1QRUA 2DFLA 3LIIA 1CQIB 3EIUA 4MV8A 1KAGA 4JI6B 1GGKA 3TLJA 4NCNA 1RAAA 3PC3A 3L07A 4KIJA 4PZ7A 1Z17A 2ATEA 2A0FA 5AYVA 4PQEA 2N42A 2G9QA 3UHFA 1MC1A 2PLFA 2ZBDA 1NPTO 3C1TA 3AU8A 1Y1WG 2IYNA 1NSTA 5JAUA 2ZUFA 3SZRA 1TZCA 1ZJYA 1TZBA 2E55A 3INNA 3AG5A 5E4TA 5F9FA 3EXIA 2ZOSA 3KU4A 2CJWA 4BO7A 4K26A 2FUCA 1S7GA 2FR8A 4YMGA 5H81A 3TRDA 5B2EA 3FVRA 4F8JA 1XZFA 3M6WA 1PRYA 3PJDA 4NE2A 2WHYA 3QOWA 3HUDA 3BWCA 1V1JA 1W1UA 2PU7A 2MMCA 1O5OA 1B8UA 4YCSA 2E4AA 2C04A 4MIYA 4AN4A 3BS4A 3RKRA 4QQRA 2IUSA 4W4TA 1UFRA 1N3BA 3TY9A 3TD9A 1FFEA 4DSTA 4L4SA 5I48A 4OH7A 4ALJA 1GPYA 4D4GA 2GTPA 4S1WA 5FQOA 1KO4A 4L75A 4OQYA 4RSHA 1CJBA 2IBTA 2O8DA 2D0PB 3V1UA 5ICMA 1TWFA 2YW2A 1XAHA 2ZUTA 3ZWAA 3F9IA 1G18A 4C87A 1QR6A 4MWSA 1LBSA 2Z5VA 2C7QA 4GF5A 4GI3A 3B60A 3L7NA 4DPMA 1YU6A 5B1DA 3GW8A 4YV0A 4O3QA 4F46A 3NBQA 1M2KA 3RU7A 3K1AB 1C8VB 4C0HA 2LIPA 4YJ3F 4WOKA 5CDFA 3QLUA 1KZYC 5FLEX 2CFTA 3PW5A 3O4GA 4QO7A 3O8QA 1G17A 3E7WA 1UAGA 3U16A 2M05A 3ZCUA 4N3NA 1U5CA 2FXIA 3DBRB 1C2YA 2P2ZA 1ENOA 4PX2A 3ZK9A 3HO6A 3TQFA 2BC9A 3M6LA 5AVOA 2H2DA 3TIVA 2M6RA 2V98A 1HE2A 1Y9JA 2VJMA 2CLKB 1R4MB 3K20A 4UBNA 2XHEA 2W9XA 1OWOA 3EGCA 2LW7A 5FTLA 2E1RA 2PX3A 2KS6A 1KK1A 3R7AA 4E07A 1S2GA 1T9GR 3ADBA 2B92A 4PZLA 1A4XA 4PO9A 3ZU5A 4XM0A 3FSRA 5DCYA 3MTIA 3KQSA 1O03A 3JYOA 1S02A 3PFHA 4QGBA 2X0KA 3M8KA 1YFZA 1JNXX 3M7IA 3GMDA 4TKZA 2C7RA 4IMJB 4NYJR 2Q3HA 4UE2A 1MDFA 4ZQCB 1W47A 4ZMRA 1G55A 3UMSA 4YREA 2PAAA 3JQ7A 3FDIA 4H3SA 1J4AA 1LPBB 1C9KA 2ZSHA 2OKGA 1P0FA 4X5OA 2R8YA 2VWHA 1BS9A 3FNEA 4PIMA 3QPDA 3SQOA 2M98A 3DO5A 1N33B 1YI8A 2O0JA 1N2JA 4QYIA 4I1OA 3OF2A 1Y7PA 3TX2A 4U8HA 2Q1TA 4B7XA 1J20A 1K6XA 2QLBA 1A69A 2BMJA 1HF3A 5JTTA 4ND2A 2QE6A 3OIWA 4O2AA 1ZM7A 4N7BA 4PBCA 5FJ8G 4FYVA 2PSJA 2OHOA 4E6NA 2IHJA 3GRUA 1V1RA 4Q21A 2VATA 5FPSA 2X0NA 3AOEA 4K6MA 1SKQA 1TT7A 4DSZA 2PM8A 4GM1A 4QRDA 1OXVA 5ARBA 3JAWA 3IKTA 5JYCA 2H9AA 4KQIA 1R4NA 5DRTA 4HG2A 3L92A 1C4KA 4RZUA 1TF7A 2WT8A 3J80W 2D2EA 4ML3A 2RAVA 3PDIB 4WDRA 2O8EB 4KWIA 4LK2A 1QYDA 3WRXA 1R1DA 3EIHA 4A3GG 1GPWB 2PFKA 1QIEA 1ZW1A 3RUHA 1WP9A 1RPAA 3RQSA 3OSZA 5D3MA 2ASDA 2DGDA 2W9CB 3WJAA 1J39A 4EIWA 3EFHA 4ALLA 3LBHA 4WK0B 1FU8A 5DN6A 1FFBA 5REQB 4EGCB 1MUUA 3NM6B 2CK3A 3PZPA 1WO8A 5B4TA 5IUKC 3QKRB 1CVLA 4EELA 4AJIA 1IULA 4KE6A 1CNEA 1GOTA 1DEXA 1H5UA 2YYYA 3T7IA 2J85A 5JI2E 4B3MB 4BO4A 4UAGA 4WZBB 5BR8H 4DQVA 4I46A 4WECA 4IIDA 3NTOA 5JZ9A 5JMOA 5FOXA 2VF5X 5HKKD 3ABOB 2DJIA 2ZYUX 2XGMA 4W6ZA 5IVHA 2I76A 1L4EA 1JPJA 4RSMA 4ECTA 3SM9A 5HJ5A 2YQ4A 2YUIA 4YK7A 3LOPA 1Y3IA 5CB6A 1U98A 1SOVA 3GJSA 3WGZA 1LLFA 1QU3A 1ZWKA 5AW5A 5JZSA 2VAVA 1RJRA 5BSWA 2A1IA 3SZLA 4MIKA 1NJSA 1JF8A 4GNKA 5TIIA 1YSCA 2OZPA 4DV7B 2VPPA 3P97A 5CVUA 2Q5HA 4KAJA 1W9HA 5TR9A 3PQCA 1NVVQ 2PQ6A 3MJRA 3N0VA 4MKFA 4TTAA 1ZH2A 1LZLA 1T2UA 2BZSA 2NUBA 2UUBH 5AJXA 3MCWA 4O2BA 2ZQ5A 2QA5A 1W93A 4I55A 3WGJA 4BNHA 1U7HA 4LRQA 4OYRA 5LYYA 3H2KA 3TNYA 2CDAA 3O82A 3GLRA 4B8YA 5C8DA 2RHOA 3KZXA 3ITEA 4L95C 5KT6A 1XHLA 3EQ7A 1G42A 5HRAA 1G20A 3P9IA 3WYGA 3U0GA 4B7AA 3B6ZA 3K9QO 1M9NA 2WWHA 2HLHA 2HXSA 4KQ9A 3FYUB 3A04A 4K9PA 1YDGA 4P81A 4R8KA 4EZEA 2CMFA 1OX5A 2DLCX 1VL5A 2I54A 1XCGB 3LF2A 4UQLA 1K7CA 3ZHXA 2CCGA 3USES 2BSAA 1I33A 4UEJA 3MSXA 2KX7A 1K7FB 4HTFB 3V8MA 3TZQA 5AVVA 5ADVA 4OSPA 4MVWA 5E4FA 3H2HA 3GTLA 3LP8A 2XWQA 4AKIA 1ZC4A 2O07A 2KPOA 1M74A 1WXFA 2P75A 3JASA 1CR2A 1I2CA 3ZOZA 5D8DA 1K2VN 3ZVRA 2AE1A 4YJKA 2V3VA 1NN0A 1D7OA 1D1SA 2D5AA 4Z6KA 1U28C 3C98A 3BB1A 3EASA 1CY0A 5B1YA 5CM8B 1NJ2A 3E81A 3WGNA 2Y67A 2B20A 2IQIA 3EXEB 4NENA 3VSAA 4J0EA 2QT1A 3KC2A 1C2TA 1XSEA 2C88A 3LQ1A 1CUUA 4WPGA 5CLLA 5FHRA 2QRHA 1E62A 2BMAA 4LZLA 3KXKA 3FHTA 3AR8A 3QVUA 1QOPB 4NATA 2JA8G 3PITA 5LP6B 2RI6A 5CPBA 2RGVA 2N46A 2VO1A 5CH8A 4MUKA 4P2BA 2PK3A 1DAEA 2FG6C 5HIMA 3DWEX 2I4NA 4R68A 1DXQA 4J9SA 2O3RA 3P2MA 3O8OB 4H4EA 4X8HA 1Y4SA 3IILA 2CB0A 4BO1A 1ACMA 3IPYA 1C3OB 1XWWA 4TKVB 3ZDXB 3UJ3X 4ZK2A 4RQBA 2YFHA 3EISA 5IP9G 1EGVB 1Z06A 4AJJA 3E5RA 3NYQA 5T41A 4WI1A 2QVLA 3CLUC 4PIVA 3HDTA 3LM8A 3S3TA 3V1LA 1XD2B 2C7PA 1T8SA 1Y3AA 2ZB7A 5CLGA 4QJ4A 3RFFA 2ZIFA 3CX7A 3SLGA 2Y3IA 3SSMA 2ID9A 3GCXA 3NYWA 1UKBA 2ANBA 1F6BA 1V5GA 3JQAD 4QWEA 2AB0A 5KFEA 3V7FA 1U31A 1DBQA 2REBA 3HCEA 3VZBA 4JSYA 5DXAA 1MEOA 2G25A 1K5HA 5I4CA 3KT8A 2OR3A 4II3A 1NBMA 3ZR4B 2H31A 4ZOQI 2XYQA 3M4IA 1N7IA 2ZUWA 4S0XA 4IR9A 5HF5A 4FHEA 1V3UA 3O3NB 2CC2A 3AJRA 4D25A 2OQRA 4MLCA 1GARA 1KH1A 2XB9A 1BE8A 4DT1B 1RLOA 1TUBA 5KWIA 1RHJA 3B89A 1VYUA 4H0NA 3TZLA 2VN8A 1N2EA 2GZ2A 4GKVA 1A4RA 1YB2A 1IEWA 1DNPA 1KAEA 2XYHA 2GWRA 2A59A 4GOLD 1N5JA 2IOYA 1LBTA 1LBQA 4P33A 2RCYA 3ZDRA 4M0JA 4CYMA 4M0LA 4ZCTA 2VRWA 4Q18A 3GEIA 2XE8A 2ID4A 5DLYA 4JOQA 5A4JA 1EXWA 1T5IA 4F0JA 5IWAH 4A5SA 5HK9A 4GNRA 4KACA 2ZRMA 1Z0IA 1FE8A 1A5AB 2HLNA 2XTNA 3PQ2A 4Q9LA 4EI9A 3QPCA 2J07A 1FFXB 4UZSA 3IG0A 4PYOA 4B4KA 1UBRS 1I32A 2GXAA 2AOTA 3V1MA 1E7WA 3EEFA 3QU5A 2P2DA 3WZ2A 5TRTA 4QPNA 1QVRA 3TRKA 4MW6A 2JFBA 1A8UA 2NU9A 4M0CA 3KLMX 2NU7A 3NP7A 4Z8XA 3UMCA 3TLZA 3KEQA 1Z18A 4PCLA 4AMZA 3I62A 3D5EA 2JA7G 4BVBA 4F56A 4HNAB 3NI2A 3R7WB 2AJDA 5BQOA 2QR2A 4IMIB 1U2TA 1EWTA 4L0QA 1ZGCA 4WZBE 3P0RA 2Q4TA 8ATCA 2ZWAA 3FNBA 1CZOA 4G9BA 1Q5PA 1KDTA 5DBFA 1A2BA 3LHDA 3TINA 3PGLA 4LFAH 4HLCA 2XGPA 1X70A 4RU9A 5M29A 1KYXA 4M8IA 2HF8A 5E6RA 5B4VA 4RYDA 1ID1A 4CG1A 4NZ9A 2QRQA 4ZV7A 2B82A 3WLKX 1MB4A 2OA0A 4KYTA 1YCDA 3LUFA 4RPCA 3TRFA 4IIYA 4I9HA 4ND7A 1ULTA 4POOA 1EA5A 4UM5A 3BC1A 2JPDA 3GLIA 2VTBB 3T7SA 3KXIA 4TLAA 4UDYX 4ZAFA 3EDCA 2WUVA 3U9TA 1O3YA 1YQXA 3U0VA 4URUR 3UWPA 4YBZB 4H1HA 4XGIA 2FE3A 4OX9B 1XVLA 5F7OA 4C6RA 2DOKA 3GUVA 2YNMD 5HJEA 4GR5A 3GHHA 2G9ZA 5D3ZA 3MJFA 3HCAA 3RC9A 4CT4B 1PR1A 4EW1A 2HTFA 2OCAA 3KKPA 5EXDA 2BFEA 2VUUA 2R8EA 4IFTA 1AIPA 2BM1A 2ZBFA 2EFGA 4UW9A 2UZ1B 3ZZTA 3Q9LA 3IQDB 4IEEA 3A1DA 3AFHA 1OLUB 4LJ9A 1WA5A 4FYMA 3VUEA 2HK7A 4FILA 2QLNA 4RY0A 4UU8A 4EVSA 1VIDA 4J07A 1T25A 1SXJA 3L1IA 5EZSA 1W5TA 1BGXT 1WCMA 3VPAA 3I09A 5C44G 3RB4A 1L5OA 5F98A 1U2GA 5HRUA 1YWGO 1RYDA 2ZJ7A 1XNRB 1GNQA 4OFBA 2BKEA 4LF9H 2A30A 5DGXA 2OK7A 4PC3A 1NXVA 4GUAA 3OZBA 1WW2A 4K05A 2DM6A 4DLVA 4QGAA 1K3FA 4ARUA 2KBFA 1I7NA 2WHPA 1SZPA 4RE5A 3KJIA 2VK1A 4OH1A 3V97A 3ZUPA 3IT2A 1UPUA 3JVEA 3DTYA 1H6DA 4TZKA 3I1JA 1TVMA 2V74B 3A7DA 3BILA 4B7UA 4I9FA 4RA6A 1Q91A 3O2JA 4EGFA 4CIYA 4DL2A 3GNTA 5CVTA 1NLMA 3CZQA 4PY2A 3NBYB 2B1RA 1IY8A 3LW8A 1YQWA 4Q05A 1NW4A 1CBUA 5HZKA 3TH5A 4I4TA 4B3SH 1I2BA 1YBFA 1NQVA 1JXAA 5FWYB 1EG7A 1SM4A 1XMPA 3MF4A 1Q92A 1CVIA 3RHFA 4ETSA 3NXSA 2Z1MA 2H7VA 3F5QA 5LXTF 4OU5A 4PRLA 1WF6A 1EQUA 2GAJA 4KPGA 2JNWA 5JZBA 4MW2A 2UU9B 5J58A 2G67A 1VLHA 5K9ZA 3SGIA 4NCBA 1NDHA 4JI3H 2QN2A 3O8NA 2JLQA 4Q24A 1QH1B 1QPZA 3ZLJA 3EVZA 5KYYA 3GIDA 1I6WA 2H5EA 3RAJA 2ZXFA 1YIOA 3AF2A 1Y89A 3P2EA 3RF2A 2D2FA 3C4VA 2I4OA 3OEEA 1DARA 5AJVB 4OJTA 2CXNA 1UC8A 2Z5FA 4TMTA 1U0LA 1WY7A 3C43A 4WLFA 2MYUA 4WACA 4LNAA 1Y8AA 4G5SA 3IIMA 4EKGA 1J2TA 4H60A 3MR3A 2HK9A 2QGNA 3DE1X 4PWQA 4D4IA 5IBPA 1KSFX 2HGZA 2J5XA 3S8EA 3RVKA 1V41E 1AOXA 4E4TA 1KVQA 2C22A 1ONBA 4XB6B 4DBVO 1WPQA 2X9LA 2R7KA 4G1FA 1IOLA 3HVHA 2P90A 1R8JA 1J8FA 5BV1A 4FBGA 3L0SA 4BUCA 1DGQA 1VHTA 3JYPA 1TLFA 4FOPA 2C28A 5GWXA 1HETA 5CVJA 3HXTA 1Q12A 2V59A 2HVSA 2XDQA 4KWHA 3CF6R 2H65A 3PRYA 3I2HA 1UQTA 4CIVA 2VHTA 4XWWA 5HTOA 1CUWA 5AW6A 3GC6A 2B6NA 2Y1OA 3AF5A 5BR1A 3GLQA 4UC0A 4HXYA 4IZOA 1YI0A 4MA4A 4CM9D 3D31A 4BGEA 4GPBA 3GZJA 5DXJA 3D4IA 3N58A 5BNIA 2GK6A 1QP4A 1FFCA 3ROQA 3G2HA 4KUHA 2B7CA 2G6TA 2OHHA 2PGDA 2ICAA 4PCUA 2Y0BA 1X7WA 5ALRA 1DWOA 4Q4JB 1QDUA 4ZZ0A 5ESWA 1A3CA 1QVVA 2IWHA 5I51A 1M0WA 5IEJA 4PQRA 4O3PA 3BGSA 5CEFA 5IM4A 4FYJA 4ZAWA 3EVEA 2QV0A 1V5EA 1HNNA 4UZEA 2GBIA 3H83A 1W0JD 1KJWA 5FPOA 1Q0UA 4DIEA 5E3IA 4F3NA 1CKOA 5KVAA 2FMKA 1X92A 1NC1A 3A9CA 2JZOA 1PZNA 5EIWA 2JCBA 4YP6A 1DRWA 2XCUA 2X8LA 3QYJA 2DRIA 4PYMA 4OHUA 3EB9A 4UTXA 1H1TA 3H5NA 1GNTA 2GKOA 2CW7A 3VX4A 5DYTA 1GCUA 3QSYA 2VFAA 4D1YA 2ORIA 1EEHA 2K7ZA 4LF8B 3IP5A 1T8WA 4EKNB 2FFHA 2PRKA 1SK8A 3EN0A 2G5CA 4ESHA 4JVNA 1G8AA 2V0GA 4YJHB 3TE7A 3PXUA 4DC9A 4BBRG 2ABJA 2CVFA 2COJA 4C3UA 3HKCA 1MX9A 2WD7B 2AMJA 3RUPA 2LTAA 1R3DA 3DOEA 1UODA 1ZH6A 1Z74A 1DAFA 1LTKA 1FMFA 3PC7A 2OYCA 3BYZA 1JAIA 2C96A 2JL1A 3EGXA 3X1YA 1K27A 1UXOA 4EG5A 4A15A 2NO5A 1D9XA 4LKRA 3L1VA 2HA7A 2HIMA 1ZD3A 2OFOA 3S2GA 1BKDR 4HR7A 5KFHA 2XGQA 1WSDA 2BP7B 5ALQA 3GTKA 4ZO4A 1CHDA 3YASA 1PL7A 1ECFA 1ZI8A 1JDPA 2MSWA 4MRVA 2HHJA 3DHNA 1UPCA 3UJDA 4Q9DA 1ECGA 5F78A 2FAXA 4M89A 7REQB 1K68A 2FSSA 4E46A 3KLNA 5WRFA 4IQ4A 2FA9A 3W06A 5AW9A 3WNQA 2YHIB 3MRVA 3KHKA 4XUEA 3E4CA 3GK3A 3WZMA 4JVOA 4RV9A 1QVZA 4CF6A 4RULA 2TMKA 5K6TA 3PTAA 1P1KA 3HMKA 2VL7A 1R0LA 4B8ZA 5E9QA 2ZRCA 1FCJA 4K9MA 3UM9A 3DYVA 5LMNB 2M9MA 3CJRA 3TOVA 1JIUA 2VQEH 2IFTA 3RTGA 1Y5NA 2NZ2A 1JDJA 3HDJA 4MWDA 4BX9A 4RZ3A 3AGPA 5AH0A 4FYIA 5GOTA 3I76A 2HBZA 5HF8A 3H4VA 3GY0A 2BE7A 4P58A 4DUGA 1EVKA 1USUA 3A9UA 1E32A 1CYEA 3N2IA 1H5NA 2OGWA 3MGAA 3HVIA 2B7BA 1DHTA 4Y6RA 5EP4A 1RAGA 4ZPXA 3GDOA 5ESRA 5IYCG 3HLYA 1XTQA 1SUAA 2ZJFA 4CKWB 1ZGJA 4RB1A 3FYUC 4E5SA 5L1LA 8MHTA 1C9DB 1B93A 5I7AA 1PX0A 4IIJA 4N03A 2P4EA 3BXFA 4UMFA 2AYXA 1JH9A 4M8KA 4U9UA 3AKDA 1YA4A 1R64A 2X5OA 1UJNA 3F5DA 4D9GA 1ZNZA 2W7OA 1Q3TA 4N18A 5HIKA 1G8PA 2QBYA 3HBAA 2RHLA 1J22A 1MHTA 4UBOA 2D1QA 5AW7A 1YS6A 2GM4A 2XQGA 1DPGA 3O4IA 2IYAA 4J3FA 1AE1A 1V71A 4OPMA 1VBFA 2J9FA 3IL2A 5I7FA 1T5HX 1N57A 3HVRA 4GYYA 4MWOA 2CLMB 1P16A 4PSUA 4RUCA 4YCMA 5BWVA 2F48A 4EY4A 2R60A 2I91A 2A1UB 4MLZA 1N2GA 1HQKA 1PGOA 4JLJA 3TL3A 1HTWA 5C7OO 1IM8A 1JT2A 4GEGA 3DCIA 4RPKA 3HJCA 1UINA 3ZGOA 3UWMA 5HOQA 1ODLA 5JANA 4O4JA 4DMHA 5AHOA 1WY5A 4TM7A 4Z9FA 4R2HA 1I2KA 3UJ6A 1E6EA 2AJTA 2OCGA 4Z7JA 4XUDA 3OO0A 5LP6C 4PNPA 1Z5OA 1HYQA 4PZDA 1DKOA 3K96A 3O7WA 1XDNA 1N2ZA 5FTJA 2O3TA 1PSZA 2JBAA 3IOBA 1RWPA 1FP7A 2GA9A 4KQ1A 4BXXG 3SZUA 1JFRA 4GH5A 1I9GA 2W43A 4IUBS 5E2AA 5KSPA 5EERA 2J9XB 5JWOA 4JLPA 4HVCA 2QM7A 3CWZA 4NC9A 5C2JB 4Q3NA 3UBTA 1IJBA 1ODTC 1A9QA 2C99A 1FTYA 4FXOA 4DOMA 5TPZA 4A0GA 1RJ9A 3BIJA 2QU7A 2GYUA 5CD9A 9MHTA 2WAAA 3BMCA 3NEYA 2XXBA 4ERXA 1HZZC 1NW7A 3Q7TA 4WUVA 3QMMA 4EGAA 1FRVA 1WB4A 4XGQA 4NU6A 2Q6LA 3N8GA 1TCCA 1Z7GA 2V6GA 4DLXA 1CUEA 1Z9BA 2OCYC 1P1BA 4IQGA 3QG5A 1KXZA 1LDBA 4L8YA 2C59A 4JODA 1OY1A 3E27A 4RD6A 1OV6A 2HN9A 1U8YA 3VR6H 5KNBA 3TR5A 4X6UA 1J2RA 3UPTA 4GO1A 1H6BA 3VGJA 1QZUA 1RWVA 2I2BA 5FADA 4F93B 2CXOA 5F23A 1VL0A 2UV8A 2J6TA 1M2HA 2A9JA 1LQUA 1QVAA 4QYSA 5FBWB 3UK1A 4ED8A 2N75A 1V37A 4BNNA 1U2DA 2OBXA 2OYRA 4P2GA 3GFRA 2J8ZA 3ZK7A 1AS0A 1C4OA 4DLWA 4PW0A 4X8LA 5EKSA 4YP3A 1SOAA 3RYHB 4D8TA 2E7ZA 2QXUA 5JEEA 3W8EA 4BKMA 1PD1A 1N4AA 3NV7A 2V5AA 1KE2A 1W0CA 2BMFA 4DLPA 4KHZA 3T95A 2I2CA 1P5JA 3D7KA 5B7NA 4S24A 4I3FA 3QXXA 4LF5H 1KJQA 1SAYA 5AW2A 2C2BA 2WF7A 4X3CA 1H2ZA 2PFSA 1FS5A 4NFLA 1TD9A 2XD9A 4LE2A 4EPTA 3WOHA 3OC6A 1CFZA 5FP0A 5DYNA 4PGFA 4CBVA 2E37A 2FWPA 1WPXA 2GGSA 1DBVO 2DPLA 3LQKA 4RNMA 4IJMA 4RV5A 1WHTA 3QBEA 1S96A 1J00A 4F1KA 4JUCA 3WL8A 3FPSA 2OD9A 1MOSA 1O1YA 1RADA 5LZ4A 2PL3A 1KETA 4HDRA 2SECE 1TF2A 4LH7A 7GPBA 2I8LA 3W1BA 2R7ZA 2FU5C 3F4BA 1NVTA 4LJAA 1PVDA 2AYZA 4P6VF 1G7CA 4JC4A 3A9SA 1ZVVA 1G8YA 5FCDA 4IDEA 3C5EA 5CDSA 4TS3A 4LHEA 4EB6B 3AX6A 5IJZA 1NE7A 3MAGA 1TGVA 2JI9A 2R6HA 5ILQA 1FYWA 4JJIA 5LQKA 4CQLA 3DV9A 3HYLA 3Q12A 3Q11A 4M8SA 5AXAA 4KXWA 1IN4A 2V6BA 4ILKA 4J0JA 5J2TB 2FPUA 5THKA 4I1UA 3W7BA 5HPYB 3PUHA 4IV5A 5BXQC 5KYTA 5C32A 3RAFC 2IXDA 1DKMA 4IJVA 4TSFA 1R5NA 5DF1A 3E9EA 2PMZA 1N9GB 2WB4A 3VC7A 4OB6A 4XAQA 1PFYA 4DLUA 4D9KA 3HB4X 1E6WA 4KXUA 2JFHA 4D45A 5FO0A 5F9NA 2Y9MB 5JBQA 5C37A 4WN9B 4RJJA 2ZTVA 4LNUA 3QXHA 1BROA 3GDWA 3NDBB 2VBIA 1KFEB 1NJ6A 1MGOA 4YP7A 2W2LD 1WD5A 4V38A 2P0YA 4NLLA 5A4DA 2P9JA 2ATLA 2C54A 4AXBA 4L6CA 4DNOA 3M6IA 4GDMA 4E2FA 4UMEA 3CNOA 3LO8A 2XOKA 1ESDA 2RG7A 4KN9S 1E4VA 4F5ZA 2XF2A 1ZJJA 4ZOBA 2I4IA 4CQMD 3ECAA 1CQPA 3ET5A 3KYIB 1W5SA 1EFCA 5K3CA 2AOVA 3B36A 3DF9A 5I9SA 2PSFA 3RLIA 1ULAA 2A4KA 3ONEA 4M1ZA 4AZSA 1EG2A 2ZWVA 4JX8A 3FHLA 3EA5A 3W9YA 1FA9A 4FNGA 4EITA 3UB3A 2WE7A 1BKSB 2JB9A 3EJWA 4OGWA 5ALSA 2QAGC 3LDFA 4BC0A 1M3SA 5C81A 3IEIA 2E82A 4HRYA 3QWHA 4ITVA 1FNNA 1X8JA 5IPFA 2FSIA 3WDLA 1SWVA 3T12A 4BLWA 2DTEA 1I01A 3A2MA 3T38A 1GGHA 2F9FA 3VJMA 3FOWA 1JQAA 3UF0A 2B83A 4G37A 4YCBA 5IP7G 4HVTA 4N5NA 1UCFA 1JI3A 1Q0HA 4ARZB 1CK4A 4KJZA 3VR4A 2XQJA 1QV6A 3P9KA 5K05A 3BSWA 3GDEA 3F1LA 1WL8A 5ENVA 1ZN7A 1LQTA 5BSRA 5DG7A 4R84A 4MYCA 1QV9A 4HNQA 1LCIA 4N12A 1RCFA 3KG2A 4U7PB 1PSWA 4I36A 1AQIA 3PU6A 2XQFA 3WRYA 2I3GA 3JARB 1IJFA 3PCRB 2GF0A 1MRSA 5AM1A 3O3MB 4N65A 1I1NA 4Q9IA 4LF7B 3LA8A 4QPPA 3C3CA 2I4TA 2RIPA 3LT5A 1A96A 3VYWA 5KNDH 1H8HD 5A2QA 4G25A 2VCHA 4JOBA 2G1PA 5A5GA 5J2TF 1W36D 3GFSA 2NP6A 4B6GA 3IDOA 4LJ5A 3E7DA 4EG0A 4LDZA 2F43A 3B48A 3IAS6 5TVKA 5DT2A 4PHHA 2NUPB 2G4VA 4ENSA 2A57A 4MULA 4XWTA 1ZY2A 1KE1A 1XP8A 2EX0A 3RO7A 3LWNA 1RRFA 1CF4A 1NF2A 3M1YA 5K3OA 4YJ3B 4D9CA 1QG2A 2JIQA 1JEEA 4F4IA 1RZRA 1ZL2A 4F7DA 1BFKA 3ESXA 3MWDB 1J6UA 3QKIA 1AQNA 1Y8QA 4UKDA 1L2ZA 4ROSA 4WWHA 2CSXA 1XQXA 2DUJA 1NMQA 3L1JA 4M99A 3H9JA 1R6UA 1YS2X 3SI7A 5BO5A 3II6X 4QECA 4ARVA 3IURA 1RWWA 2J5BA 2JAHA 3MOIA 2FFBA 4P0QB 2FN8A 2QX4A 2TSYB 1WOYA 3PQ3A 2DB3A 1MTOA 4CQNA 2DWOA 4ED0A 3ENQA 4UFNA 3C3YA 5L40A 1GADO 5NLLA 4IQ0A 3KZVA 3DP9A 4D4KA 4PR3A 3AP2A 1ZD2P 2NUAB 2WU4A 1K9SA 1JSLA 3EG9B 4HAZA 4DNPA 1QUFA 4F45A 1ZGGA 3P9CA 4E15A 1U9YA 3RT7A 3R8FA 1E2UA 3WGTA 4ZOLA 2JARA 1KDPA 3AVQA 1JKMA 5PGMA 2ZSUA 3LLVA 2SHKA 4UFOA 4LOLA 1EK0A 1QHSA 1M6EX 4TS9A 4JMPA 5JSFA 1ITZA 1M2FA 3VZCA 4PZ6A 2FW8A 1AF4A 1EUCA 2IXFA 2V4ZA 4F85A 1L5SA 3QVTA 4X0EA 2G07A 2BZ1A 3CLSC 3U7QA 1Z34A 4X64H 3Q4GA 2XRYA 2VSOA 3HJFA 2W8LA 2LD4A 1N0VC 1ZKMA 3RNOA 2OMEA 2FW7A 5I7RA 2R86A 3GI1A 1PE0A 2PKEA 2B5OA 3AUSA 1FY2A 3TAUA 5DXFA 2F1KA 2WMYA 2O8FB 5KI6A 1L3BA 3QA3E 1WOMA 2GRAA 5KAPA 4GMKA 2RHTA 2RHRA 3THXA 4BC1A 3CT6A 5GMOA 1PJTA 4L9AA 4PX3A 2VTDA 4Z1MA 2KJQA 2UZAA 4D43A 2P2LA 3ONVA 4BNJA 4DIMA 1BD4A 5GJBA 4QFCA 1OV4A 4MRPA 1M1ZA 4RADA 1HPLA 4TLEA 1N2SA 1ZINA 2PRSA 3FYDA 2VSYA 3AV3A 3MILA 1JFSA 3CNBA 2WV7A 1NPYA 5EZYA 1HORA 4N5HX 2BKXA 3FFXA 3F98A 4LPSA 3OM9A 1IBRA 4R8RA 1SGWA 1B0AA 2YW9A 3SJUA 2QTLA 3OKPA 4QW9A 3QX7A 3OZUA 1PYGA 4KQMA 1G5RA 2EGGA 3A1VA 2Y1GA 4L27A 3AG6A 3UHAA 2HQBA 5BYAA 1N9KA 4B2PA 5I9LA 5LOVF 1T3TA 4JH0A 4DWWA 4BFCA 2EQ5A 3Q10A 3GQBB 1Q0QA 2WJHA 4MVJA 1PZHA 3H4DA 4LXGA 4CMAA 1YQDA 3HN2A 1NVVR 2Q6IA 1U3GA 3DHWC 1H2BA 5AJYA 2Q4OA 3L6OO 4XGRA 2HREA 5LJIA 4BFYA 4WXPA 3PDJA 3GEGA 1VI5A 1P9OA 3KWLA 2HDOA 3EVNA 1AQLA 1C9MA 3H1AA 3LCJA 4F9GA 1ULHA 2R6FA 1JSZA 4ENUA 1U11A 2O0MA 1BDMA 1LNZA 4JOSA 3DEYX 2WAQE 4YR3A 1UXJA 4AJ2A 1QO0D 2EF0A 1KDVA 3D64A 4LCEA 4YRMA 2B6HA 1TT5B 4FSDA 4EDHA 1ZITA 2X4GA 4DZRA 5JMPA 1PJLA 2OKCA 3PC2A 1EDOA 2VYFA 2Q1WA 1KMHA 1X1RA 5CLFA 4X63A 4OQXA 1Z82A 1XRMA 1G1MA 3C3AA 4EI2A 4CEHA 2NU6A 4DREA 4BFLA 3JZIA 1CEXA 4HN9A 3HH8A 3I83A 3QOXA 4ZPJA 3DZDA 1L7XA 1FSFA 5MFPA 1O77A 2D5LA 2YWDA 4AY2A 4N41A 5SYNA 3LGXA 5HDQA 4BE7B 4KH1A 3HA7A 2O52A 2NYAA 5IHXA 2IZOA 2WIAA 1D3AA 1DCFA 3K15A 2IKQA 3CUYA 1IDOA 1RT9A 4U00A 1TWGA 5JNUA 2HHHH 2WWGA 3OZXA 3EPJA 1YOVA 2BFAA 2J0UB 3TX6A 1PJ2A 2PNJA 2RHJA 2QQEA 3OZVA 5JSZA 1EZ4A 1CF2O 1RABA 3GV8B 2PR7A 1J70A 3ELYA 1MBZA 4DV4B 2HK6A 2AJ8A 1HNWH 4YQWA 3NBMA 2JD1A 3KT0A 4MROA 5F52A 1GA1A 2X8JA 3DMRA 2W0SA 4KPEC 1U0FA 3GA5A 2GVDC 2X8BA 1KOGA 4RF5A 4BX0A 1NQAO 3K94A 3KKZA 3ICPA 5KJ1A 2VRCD 3DBHB 1A27A 2Q1YA 2KQUA 1GPDG 4B3FX 4PLFA 4LYEA 1XJ5A 1X77A 4BVGA 3DL4A 2NV2B 2QMQA 3AF4A 3JAKB 3BK7A 2X4IA 1B7GO 4R1MA 3L02A 3DQPA 2W6ZA 4L4XA 4IEFB 3CVJA 1QRDA 4BFWA 2PX5A 1V95A 1F7VA 4MKXA 3PIRA 1NXTA 4KIUA 2NXWA 2EW2A 2EZ9A 4WXRA 3RFCA 3DV0B 4LXXA 2LRHA 1DWQA 2WZQA 3GB8B 4B83A 3KB8A 3RUCA 1BEZA 4HF7A 4RHYA 4YROA 1GUBA 3AFMA 1Z6ZA 4KYVA 3G0IA 2DUWA 2VYVA 1B33N 2AFHA 2VHEA 1AN9A 5KTKA 2Y76A 4I9GA 5TF4A 4BNXA 5EWFA 2YWEA 1E2IA 3R3ZA 3T3HA 5IDQA 2PH3A 4GKJH 4ERNA 5LQCA 2JFVA 1ISRA 4CGZA 4GM4A 2COIA 3PVXA 2XCQA 4JDUA 4BP1A 1IWOA 3PUWA 4JKIA 3GO4A 3K0KA 4U2BA 4DCJA 4QJFA 4QUHA 2UYYA 1NBOA 3KQVA 1I3OA 1XWIA 4J1TA 2IUTA 3BFVA 3JSAA 3GIJA 5KU1A 5K0SA 3S2IA 2XX3A 5FLKA 3RF7A 4LXQA 4ISCA 3HBMA 3CNLA 5KWSA 4QIHA 3VO9A 5FJIA 4IQFA 3C0KA 2FMXA 3C4JA 1S9FA 5KAMA 4BZPA 4EA8A 4ETMA 4CVNA 1K66A 5JAHA 2WKWA 1L5KA 2HMTA 2RDIA 2GCEA 4EHHA 1H65A 1HYGA 1X3SA 4MR7B 1LA2A 4UXHA 4A3SA 2X4DA 3VVBA 4AY5A 4E5KA 5K4GA 3LRPA 1XZKA 4RGVA 2PGNA 4Y0VA 3BT7A 4AY6A 3VJLA 4JI7B 2GN8A 1RU3A 2CXPA 1JQEA 3DP7A 2ZUSA 4P36A 1IMOA 3GGOA 4B75A 1GQSA 3LJKA 1OBOA 2A5DA 1HQCA 2ET6A 2YTZA 3RBZA 4RCNA 4BCCA 3GFVA 3V4OA 1I4OA 1GL9B 3NANA 4G3IA 5IAGA 2ILTA 3CGWA 3ODGA 3ACDA 3C1UA 3NVMB 4CM8A 5GJVC 3KDSE 3ZY3A 3BHMA 3ILXA 1C0LA 1DFGA 4MS4A 4CI0B 1NM5A 4O08A 1XCBA 2RBGA 1TYCA 3ID6C 3UXMA 1K6JA 3OX1A 3HTXA 1WCMG 4S35A 4BPBA 4FFSA 4W8GA 4UBJA 3DR5A 5ALTA 3ES9A 3DLCA 4BKRA 3N2KA 4BDTA 4BIIA 2ZJ2A 4G0MA 1FYXA 2RKBA 1USVA 4QU9A 1XFAA 3K0HA 1JMYA 1KAMA 4ZI7B 1LFAA 3IB3A 3UXEA 4UUPA 4AF8A 1ZOIA 2Z43A 3HXMA 2XOXA 3ZGXA 2NXNA 4WLUA 1QB8A 1VE7A 4GBGA 2JGJA 3TNJA 3OFNA 2OXEA 3IX7A 2XYPA 3OM1A 1XLVA 3A2LA 3CRMA 4B3HA 3GLFA 1JEAA 1XZIA 4N48A 1OHHD 4PEVA 2OV6A 3VA7A 4RELA 3FROA 3FCOA 3WSWA 2J6BA 4LAFA 2DAPA 4PIPA 3X3HA 1PQYA 3V7NA 3C3WA 2MJLA 5G0SA 2CNKA 3LBAA 4XIFA 4P5DA 5KTSA 1XT6A 1QCCA 1W2HA 1JVSA 3K6SB 5LPNA 3KHTA 4LZAA 5CCDA 4I81A 4UHBA 4PN7A 1UBKS 3UQZA 2DH6A 4FGJA 4CEIB 2I7DA 3PR3A 1C29B 3EOZA 4AO7A 5F73A 4FEYA 1Y4AE 1SQFA 4B2LA 4OO3A 1PT5A 2WF6A 2YX1A 4TT3D 1SD1A 4X1KA 1Z8DA 1NNSA 2YCHA 5C5JA 2Z3WA 1JVBA 4KWTA 4JCOA 4MSUA 2XKAA 1KEWA 5GINE 4W8HA 3MWKA 4WBNB 5DP2A 1Z7BA 3PVSA 1BDJA 3K0SA 1LSSA 1PL6A 3G6WA 4CGYA 1MENA 1N48A 4RJIA 1M54A 1NP3A 2R6JA 4UUQA 2QD3A 1F8FA 2IEAA 1ICIA 1RBQA 5JISA 2QTGA 4IDQA 3KTMA 1V39A 3HR4A 4KQEA 1PGJA 1DIOB 1RHMA 4RLQA 2M2IA 3KFXA 5E9AA 1OIXA 3W2HA 2B34A 4NZZA 2IY7A 1XPJA 3GDFA 4MR8B 1AB5A 1QU2A 2M6KA 3IN5A 4BQOA 5F1KA 1OCEA 4OI4A 4YYZA 3WGLA 5JMWA 4DIOA 4EJ2A 2B4YA 1M6VA 2DY1A 3RVOA 1SQGA 3RYIB 2Q50A 1GR1A 2UUAB 5L1JA 2EIHA 1TJ3A 2WKSA 1C7RA 1KZHA 4NJMB 5HFNA 1OXSC 2JCSA 4HAIA 1JV2B 1VKOA 4Y8VB 4LHSA 4PRZA 1CKNB 3ZDQA 3DLHA 5KNLA 1APBA 4EVQA 3B6JA 2Y2VA 4EUFA 1IPHA 3IFSA 4FBUA 4ZRMA 3NVKI 1O95C 4QDJA 1KTVA 1ZETA 3QBJA 2PA3A 1K08A 3KHLA 2PD6A 3TAHA 2D4AA 2I33A 3FHJA 1N77A 3W0LB 4LFBB 2ZZKA 3EY9A 5DWQA 2VQFH 4GSYA 4HQOA 1P5FA 1B00A 3IKLA 1M72A 4I5IA 1R0CA 3BQ9A 4KPUB 3GZNA 1GCAA 5D51S 1GNSA 4X3OA 1EM8A 1Y1TA 4UTZA 1L7VC 1UNNC 3BWDD 1WBJB 4ZI7F 4PAQA 3ED5A 4M1WA 5EXSA 4K9DA 2HJRA 1TWCA 3A1CA 5BNFA 1EUDB 3SXJA 5JCJD 4Y9RA 4FU0A 3KXYT 5BWOA 4JLMA 3A4MA 2C4NA 1JRLA 4BZXA 1E4EB 3SS9X 3OOWA 3WQQA 2Z9DA 2UVPB 5AKJA 3ASVA 3KQWA 1Z5GA 3GIQA 5D1OA 5U1PA 4AVYA 1LC3A 4MP6A 4DR5H 1BHO1 1CIVA 4AP6A 1V4BA 5HKBA 2JLCA 3GRAA 4Z7QB 2Q07A 3ETDA 3GPDG 2R7AA 4HD8A 3NR2A 5LXTB 1ONOA 1IZ0A 3EMVA 1AX9A 1TYAE 1GRCA 4US0R 2EWVA 2XAUA 3IT0A 4J76A 1XZNA 3VH1A 4WNIA 3HEMA 4RFLA 4ZO7A 2GCGA 5CFNA 1HR0H 2Q0QA 2H7XA 1VL6A 2PGXA 3BL5A 4G3XA 5F1OA 1RYRA 4LK3A 2J3JA 3EIWA 2QGFA 2VG8A 4O3MA 1T2AA 2X5JO 5AI4A 3L6RA 4WBNF 4BKPA 2UAGA 2PGJA 1F8XA 1BHJA 3WWHA 1P4HA 5JCOA 4G0ZA 2EZ4A 3P7MA 3PA8A 5CR9A 1TKAA 4IHJA 4MV1A 1TO1E 2VDLB 1F2TA 2JJMA 4PYLA 5IF9A 3AUKA 1Y6ZA 2XRZA 3EDYA 3MJDA 3E70C 2RGBA 1SHKA 1BTOA 1AXEA 3OWOA 3VH3A 1NUHA 4YP1A 2QZ4A 1GTRA 3KT6A 4L3VA 4ITUA 3CUSA 1TX4B 2HU7A 3MTJA 3IA7A 1Z16A 3OQIB 1B23P 1E18A 2VK8A 5ALVA 2J3DA 3RGWS 3KSAC 4JLUA 4B74A 3E9QA 3P8ZA 1E3TA 3OY7A 4E51A 2WM3A 5DCUA 1MAWA 2WR8A 4ZOCA 4DSNA 2ZRPA 1UMCB 4Q0MA 4PBTA 3NHLA 4C6SA 3MTBA 1LPSA 2KLHA 3EGOA 3TI7A 1GU1A 4PHCA 3DHVA 1GDTA 3ABIA 3JQAB 1QHIA 3TSAA 3CKYA 2WSIA 1L4FA 2Y1LA 4US2R 3WTBA 1ZOPA 3BFJA 4O8ZA 4X60A 2WPDD 3N44B 1TZ2A 4G1VA 4OOEA 4M98A 2NQTA 1ZVQA 5EHNA 1T1IA 4Q7KA 2DQSA 1C0KA 2XDWA 1TXGA 4X91A 5IYDG 3LW7A 1JXOA 5EN4A 2Q45A 3OQOA 1YL5A 3RU9A 4E14A 2V45A 3WLNA 5B6PA 4JB2A 5KQGA 2FUG1 3HXOA 1UOEA 3HUEA 2IYVA 1ID8A 5AVXA 3I5YA 4EKDA 3GGJA 1EFRA 1NN1A 2Q7OE 3CRNA 3K70B 2P4UA 4IRUB 1FJXA 2P9CA 5J5VA 1L8QA 2UXBB 4DR7B 2GLXA 4CL3A 2LPMA 2X19A 3JQFC 3F2IA 2VDPB 4W7HA 3R0XA 5B7GA 3CZMA 1U0OC 1B04A 5KOYA 2Z2ZA 3NDIA 2V8BA 1GUYA 2V4QA 1M2NA 3ZGVA 5A5EA 4FC7A 4OLFA 4KR3A 2W6OA 3VNNA 1QRTA 1HFJA 4RMGA 3ZQ4A 4ZYWA 4NV3A 3RODA 1YCGA 5CFMA 3EMBA 4M9XA 4C22A 2C2HA 2D1SA 3HWX1 2ZWIA 3EZNA 5GPBA 3QVXA 3SM3A 1S2NA 3MS4A 2FLVA 4X54A 2VT7A 2X7XA 3C6KA 5I5WA 1HDOA 5CW1A 4JLBA 5P21A 4EMUA 3ESQA 1I1OA 2Q7DA 2NPFA 3VISA 2FRDC 4DMUB 1ZP6A 4RJTA 3O5AA 3PPVA 2BJWA 4XVHA 1IEXA 3AV0B 4BTEA 1PKEA 2IEBA 4QD3A 1ZOOA 1KT8A 3B12A 4MJ7A 4D41A 1H1DA 1A95A 4C4ZA 3B20A 4QZVA 1D0IA 5FDFA 3SKVA 5A2GA 3BRCA 4MW0A 4NEQA 1T8RA 1XTKA 4P35A 1ZC3A 3PQ7A 4DA4A 4JYAB 2ZYTX 4BUZA 1WG8A 4NJOA 3AJDA 3W5CA 5J4LA 5HX7A 3ZNOA 2BFWA 1K89A 2TRSB 3I2KA 2XEXA 1X7XA 4GLFA 4FUTA 3U19A 2VYNA 5D2CA 3ANYB 5TQ0A 3I8SA 5JDIC 4RORA 2UYHA 3GGGA 3B13B 4B47A 1XZAA 2I78A 1GVHA 1N2CB 1L1QA 10MHA 1RCUA 1TA8A 4FNOA 2W6CX 4JUAA 2FGJA 1NNEA 4B6PA 1UKZA 3UG7A 1JR6A 1KGDA 4INJA 3SAJA 3OOYA 3BICA 1VE5A 3ICCA 3RGZA 1RWKA 1KA9H 1OPRA 3T3MB 4DV6H 4CM6A 1UIRA 2PBLA 5TF0A 1WBBA 3G2NA 3E9CA 1F1JA 2MU1A 3H2YA 3SYTA 2H7YA 3W5OA 4HC4A 4PSCA 2FUNB 1XN1A 4QE3A 3UNXA 3UFBA 3ZXXA 2VXBA 1PR9A 2BFBB 3V46A 4EFNA 5LU9A 2C58A 1EBUA 2VYQA 5KS2A 3KTOA 3AY7A 4R0VA 2RI1A 2CLEB 3PL5A 2HHAA 3NNSA 1C9JA 3DZCA 3MVEA 1OZHA 4U7CA 4ZVKA 1XRJA 4IVQA 1ADFA 3SEQA 4JLWA 4B2YA 4KSYA 4TYNA 2GCOA 2VJLA 3SDZA 4L22A 5BP7A 2O2GA 4IIHA 1T3HA 2X5NA 2HIGA 4BDSA 1C9EA 2GS9A 2WFMA 2J0VA 3UTCA 1FNCA 3T3PB 3GRRA 4UUAA 4RVFA 1VZ2A 5LU8A 1VYTA 3KPJA 2CXQA 1EJ0A 4F50A 1JDZA 2OH2A 4ZT3A 3R41A 2XZLA 3G1TA 1T6ZA 1A8PA