4MA0A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with partially hydrolysed atp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
366
structure length
366
Chain Sequence
b'MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with partially hydrolysed ATP
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 120
structure length 366
sequence length 366
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma0A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma0A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma0A01
1GLVA 3RUPA 4MV3A 4Y8VB 1EUDB 3TQTA 4GGMX 3U55A 2W71A 1SCUB 2DZDA 4ZQIA 4YJ2F 2PVPA 1Z2OX 5JVLA 1BXRA 1C30A 1EUCB 1M6VA 4HNTA 4J6EA 4ZI7F 5I47A 1JDEA 2P0AA 4XZ3B 3JZIA 3K3PA 3VMMA 2YW2A 3AX6A 4IZOA 3GIDA 3G8DA 4FFOA 2I8CA 4O83A 4YAKB 5LOVF 4HNVA 2OLSA 3ORRA 2FB9A 4DIMA 4XYMB 1UC8A 2NU6B 1WR2A 2XD4A 1VKZA 4O7WA 1CQIB 3I12A 4FFLA 2CNQA 2R7KA 4TUYF 4XX0B 2R7MA 2GQRA 1KBLA 4EGQA 4O4LF 4MAMA 2ZDQA 4M9CA 4FE2A 1KJIA 2YRWA 3Q1KA 3N8DA 4MV9A 3WO1A 1UC9A 4MV4A 4YBZB 2VQDA 4O7SA 4YJ3F 2WYOA 2YZGA 5HBRB 3R9RA 5CA0F 3R5HA 5LA6F 4I55F 1VBGA 2GPWA 4MA0A 1DV1A 1B6RA 4MV7A 2VR1A 2V59A 2CNVA 4TV9F 5JQWA 1JLLB 2W6QA 3N6RA 4IWXA 5H80A 2SCUB 2VHEA 2IP4A 3VA7A 3SE7A 2W6NA 2I80A 5LYJF 2ZDGA 1JKJB 4QSHA 5IYZF 1B6SA 3NUAA 3WNZA 1W93A 1GSAA 3KAJA 4MA5A 4DLKA 3K5IA 4EA7A 2GQSA 1EZ1A 4EABA 4MV6A 3TW6A 3VPCA 1PX2A 2R87A 2CZGA 4I50F 3MWDA 4ZOLF 2YZNA 4FGRA 3TIIA 3LWBA 4HNUA 2R86A 2Z04A 4ZHQF 2PN1A 3LP8A 5HV6A 2DIKA 2W70A 3RFCA 5KX5F 4O7NA 5BPFA 1IOWA 4MV8A 1T36A 3ORQA 2R6FA 1KEEA 2NUAB 4WD3A 1GGOA 4I4TF 1KC7A 4RZQA 4O4HF 2YZMA 4M9UA 2QF7A 3JZFA 3AW8A 2R82A 4O4JF 3UFXB 2PBZA 1ULZA 1DV2A 4O84A 1A48A 3KALA 4WBNF 1Z2PX 2Z02A 5KKNB 3BFPA 2CNUA 4IWYA 5JH7F 1CQJB 1Z2NX 1OBDA 4O4IF 5LP6F 1A9XA 5LXTF 2R7LA 5D8DA 5CAEB 3ETHA 4EA9A 3K5HA 4M99A 2NU8B 3HBLA 3G8CA 3KAKA 3BSWA 4O7RA 1AUXA 4YB8B 1PK8A 3HB9A 4EGJA 2R84A 4C5CA 1JDBB 3R5FA 4ME6A 1E4EA 4O81A 1KJQA 4E4TA 1AUVA 3BSSA 1EHIA 3HO8A 2VPQA 2YRXA 1GSHA 3R5XA 1KJ9A 3QFFA 2XCLA 2CQYA 2FPGB 4FU0A 1GSOA 3U9SA 3TINA 1KJJA 1EYZA 4O7YA 3VPBA 5J2UF 4O7TA 1CE8A 5FNVF 1CS0A 1VBHA 2I87A 2YZLA 4IHJF 1M0WA 1DIKA 3E5NA 1IOVA 3ETJA 4O7ZA 3DF7A 2R85A 5BPHA 3RV4A 2HJWA 2C00A 3BG5A 5DMXA 5C1PA 3V4ZA 5CB4F 2HGSA 5JQGF 2YS6A 2X0SA 5C8YF 3JRWA 2ZDHA 2YS7A 2DWCA 4MV1A 4HR7A 3V4SA 3KREA 5EZYF 4L1KA 2FPIB 4TV8F 2YL2A 1BNCA 2J9GA 5GONF 3GLKA 3MJFA 1KJ8A 4YAJB 2FP4B 4IIJF 1W96A 4FFPA 1M0TA 2DLNA 5JVDF 3TIGA 4M98A 1C3OA 3U9TA 4O7VA 4HQ6A 2NPOA 3Q2OA 4O2AF 5C1OA 2GPSA 3BSYA 4C5BA 2GLTA 4EG0A 1OBGA 3MWEA 1I7LA 2YYAA 3JRXA 3R23A 2NU9B 4C5AA 2YWVA 4O2BF 3VOTA 5BMVF 2QK4A 4FFRA 4O82A 2V58A 4FFNA 2W6OA 5J2TF 3WO0A 3OUUA 1I7NA 2V5AA 4O7LA 2W6ZA 2FPPB 1KUTA 5K2MA 4O86A 2W6MA 4EA8A 1E4EB 3OUZA 5CA1F 4EAAA 2W6PA 4XYLB 3RV3A 2R7NA 4NYEA 2NU7B 3VPDA 3U54A 4FFMA
chains in the Genus database with same CATH superfamily
1GLVA 3CLUD 3P27A 3IE1A 1E7RA 2P1RA 1OUMA 2AX4A 4JXUA 3AVOA 5EMNA 3U2QA 4FP9A 4YAUA 4HLCA 2ZTMA 5KAMA 2R48A 1QOZA 3NV7A 5CM2Z 1SIOA 2XUQA 4J6EA 3LE8A 3S8YA 1UK8A 5KQSA 3FFXA 3OEEA 4WACA 1K4YA 3UJ7A 3D5EA 2ZTSA 3L7IA 4G2NA 1N34B 4YY3B 1ISMA 4H0FA 2PM8A 3D4IA 4UTZA 1CQIB 1NVBA 2XBMA 2C2RA 1NVXQ 1X0VA 5D2CA 5KREA 1NRIA 3FBWA 3UWSA 4AT1A 3SQMA 3M2PA 4UNSA 1UDRA 2PE5A 1QS0A 4Z4HA 3F3KA 3VGPA 1NQUA 1YDWA 2VQDA 3PXUA 4YJ3F 1CR4A 1HQKA 5FOQA 1Q17A 1U1CA 4LY0A 4X1KA 1K89A 3DOUA 3IEPA 4GOJA 4F4WA 3T4EA 4GOXA 4Y2XA 1C7FA 4RKFA 1N5RA 3H13A 4MI9A 5AVQA 1YASA 1DEXA 2AGQA 4E88A 1XMVA 2B4TO 5E3IA 3NP9A 2CE7A 1O6FA 3QWBA 5K3FB 3PYLA 2I4NA 3EBLA 4YS6A 4G0UA 2CWWA 4QX6A 3GJ0A 2PZJA 3QPDA 2ZIXB 2Q6LA 3N58A 2ETVA 2JASA 4QGAA 4KV7A 4B3TB 5K3WA 3O8OA 3PVXA 1JIVA 5TX7A 2J3LA 1OFGA 5E4TA 4BE9A 3JVVA 2VZ8A 1ZD4A 2GZDA 2VTBB 1JU4A 1QCCA 4YP9A 2J3HA 3DO6A 3FHLA 4YTEA 1DBRA 2WUVA 4QULA 3A1TA 4K0KH 4YCDA 4M9UA 5IK2D 4D9FA 2AG5A 2SICE 2WIAA 4AQYB 4YX9A 3VISA 3QKTA 2N1MA 4MHOA 2JFFA 1NAHA 1GNVA 3PHHA 1VJ0A 3THXA 3ZTTA 3ZD7A 3PDHA 2WHYA 1TCVA 3CO5A 4BWSC 4D4GA 3T5JA 3C3DA 2RBKA 4P8RA 2HDNB 4HAUA 5BWVA 5BSUA 2Q5QA 1VP3A 2DE0X 2BFCB 5HCUA 2A9OA 2D0PB 2ALJA 3LRXA 1C7RA 2ADOA 1N36B 4FZ5A 2O5RA 2WFZA 2B4QA 3ZCVA 2PLRA 5AVZA 4D8TA 2GUWA 1R3DA 1PEKE 3RTEA 1SXJC 2C03A 3C3CA 4RF4A 1CKMA 4YMUA 4AJLA 4DR1H 2DPLA 4II7A 4QGBA 2V7GA 3HJBA 1E8NA 4DV6H 3H11A 1RZUA 1C1DA 3DV0B 1IJFA 2IYPA 2MYPA 3PC4A 2OV2A 5AOVA 2LBPA 2QUIA 4Y2VA 3PFWO 3C1OA 1G8GA 4X9XA 1FDIA 3IQWA 3KTMA 5CHEA 4N18A 2FSSA 4CMKA 5D6OA 1COWA 2JLUA 2GYWA 4HXYA 1VE7A 4HPJB 2F17A 3DTVD 1X8XA 1UXHA 5ANRB 2TMDA 1TO6A 3TIVA 1MBZA 1OX5A 3VKUA 3DXFA 4GE0A 4BXXG 1I7DA 3SZRA 4UNNA 3KQNA 5KYXA 2V45A 3QXGA 5C1OA 3WL5A 3PU6A 1K5PA 2WF6A 4RWZA 2PLAA 5BNWA 3GEIA 4IEEA 4L78A 1E63A 1IEWA 1V8FA 4GP6A 3T7IA 2W6JA 3OQPA 4MRRA 3AFMA 4ZEOA 5BMVA 5AIAA 3VC2A 5AI8A 1DCFA 4HNHA 2PJRA 3TG8A 1H5QA 4BY1G 3FCUB 4TV9B 2IL1A 5G1OA 1U4NA 1ZSYA 4JYBA 4W9NA 1DRWA 1PDVA 5LQDA 4DMGA 3U55A 2ABJA 1NFFA 2SKCA 4XI9A 3GP3A 2FFBA 3IMFA 4K9MA 1SXJE 4EL0A 1AO3A 3LWDA 4RGQA 4L5CA 2HJRA 2ZR9A 2ECOA 1JT9A 4P81A 5FULA 3VZPA 1GNLA 1KFCB 5FA8A 5JQGA 1KXZA 4KFSA 7GPBA 3PX3A 2R8JA 4WWHA 1DEHA 3EGVA 1ZXXA 2YWHA 3FSGA 4K6KA 3COVA 4R1LA 4FFLA 1GQRA 2I91A 3FRHA 1UWLA 2BQUA 2CLLB 10MHA 2A86A 5JCXA 4QGSA 1HYGA 2ZROA 3L0DA 4Q4JB 4DLUA 1NVMB 1KP3A 4L8FA 3OFJA 2H2FA 4JVLA 2NLOA 4YRIA 5IUJC 2IP1A 1ZRNA 1IG0A 1O5IA 3K9FC 2HV9A 3KVVA 1PGQA 4KIWA 1OH5A 2J85A 2HBZA 4WEQA 1GD1O 5G40A 2KQUA 3RGWS 2Z5LA 4DWJA 2ZEJA 4X84A 4CG3A 1ULHA 2H08A 1J23A 4N49A 4F5YA 2QZPA 2VJCA 3WL4A 5CM8B 4K6OA 1AKUA 4LZNA 4DV0B 1JNXX 2BEUA 3ZXIA 2RB4A 3QPUA 2PQ2A 3GDWA 3QH4A 4CV2A 1S4MA 1JA1A 3HCRA 3WHKA 3R6GA 4LJ6A 2J33A 2Q0HA 4ECQA 1K6JA 1JHAA 3HB5X 1LNZA 4ZA2A 4I3HA 1FVHA 2AJCA 1KI3A 4U7PB 1NXPA 1XU7A 2H17A 3D6FA 4ND8A 4BLTA 1TD9A 1K7EB 4DR4B 2PSSA 4WXMA 3Q8SB 5C8VA 4XLZA 1E7MA 4OLHA 2O2ZA 2P6OA 5IG2A 3O5AA 2HNBA 4URHA 721PA 1YDGA 5IC6A 3BGSA 3OJCA 1A48A 5JWRA 4KFRA 4DGSA 4O2RA 1YJAA 2I8LA 1TAQA 2DR0A 3BWXA 5FBWB 1C9KA 3C3BA 3KJGA 4O4IF 1U7PA 1Z8DA 2AX3A 4MGIR 1G17A 1E1RD 4Z3KA 3IUNA 5J4VA 3O73A 2FSPA 1P1FA 3GQCA 3ISVA 5CXQA 4DT1B 4CV0A 2CHUA 5CURA 4JQSA 4XSHA 1K06A 4R84A 3U4GA 5BWTA 4Q7QA 1XJ5A 3IHTA 1P2VA 2WIJA 4ZMRA 3PUXA 2C92A 2IGTA 1QPGA 2DMRA 5LZ2A 8MHTA 1ZK4A 4RF5A 4M9XA 2COJA 1AH2A 3SX4A 1YB7A 1EFAA 1LQUA 1G60A 1EDEA 1VFNA 2XCOA 2HUPA 2YC2C 4TKUA 3ZV4A 4DV4H 1ECGA 1JX6A 4Q4CA 5DGTA 5CFMA 2C00A 3FJ1A 1X1CA 4PTYA 1DOAA 1HE1C 3LY9A 2QTTA 1KBOA 2VJYA 4EKEA 4DNPA 5HMMA 2ZUTA 1Z35A 3G23A 1KMCA 4ZPXA 1IY2A 3I9OA 1PBNA 4Z51A 1RRVA 2AMVA 3WDLA 2B2CA 3IUYA 2FAXA 3W5CA 4JR1A 3I2YX 3G5UA 2ZWVA 2HF7A 5CVTA 1K68A 2GPSA 4H4DA 1YE3A 2O2HA 1AHPA 1M1UA 2QL5A 3SNHA 1ZC4A 3I2KA 5FUXA 3UZBA 3ZCXA 2E5WA 4I9HA 2O8CB 4JUBA 1T8PA 1GL3A 2HG8A 3SHVA 2VPWA 2EYUA 5FYQA 5TS2A 1BE8A 3ISTA 1WABA 3IBFA 3LZ6A 3T9DA 4A3FG 3U19A 4ZJUA 2JEGA 2WWXA 5EFZA 4AKHA 5TT0A 1NAIA 2EFYA 1SCUB 3A1EA 3HNOA 4B7UA 1ZFNA 4URWR 1Z6YA 3MMZA 1R0YA 4H60A 4DZZA 1CX9B 3LC7O 5P21A 3UV3A 4YJHB 1QQ6A 4QPJC 2Q3BA 3VV3A 3ZS8A 2VQ6A 3O4GA 3CWZA 4WUTA 4LY6A 2BKLA 5EKTA 4FC6A 1W88B 4DIMA 4ZYLA 1X9IA 4UCSA 2VJPA 3S2GA 1JMKC 4ZOCA 2FUG1 3MWGA 5GONA 4EHFA 1DBIA 2QM8A 3UW1A 1IBSA 2GI4A 4JJ8A 1AO0A 3GI1A 4PG8A 1QZ3A 1JXLA 3P71T 2F3RA 2O5EA 4C7KA 1QRDA 5F5NA 4YIHA 4U6SA 1AKVA 3ZDXB 2R1VA 2GJSA 1VHTA 4E1VA 2PDAA 2ASEA 4DDMA 1LSJA 1B0ZA 3WO1A 2WUFA 3OU2A 3CEMA 3RRYA 1F6DA 2AZMA 2WHPA 4HX5A 1CUEA 2VBCA 1G6HA 2DPIA 5JD6A 3O4JA 4ECTA 3KXKA 4BKPA 3GCGA 3GRCA 1YUBA 1ZL2A 3RCBA 1A0IA 3E9MA 2VUHB 4WX2B 3UPDA 5KVVA 2JARA 2IPAB 3ND9A 5JI3E 4N0DA 3H04A 4CL3A 1KMMA 4Q7LA 4TQGA 1DELA 4IGEA 4EHLA 5FWYA 1RXCA 2WINI 1MEOA 1H2RS 3E7FA 1NUUA 4BLWA 1CUUA 2P4HX 3I76A 3QPCA 2O59A 1SRRA 1JEEA 3A6KA 4WY8A 1KEUA 5T4HA 5J1TB 3OIDA 3RTCA 3NH6A 4QREA 1PIWA 1I2CA 4E31A 3KUDA 4ETWA 2I6XA 4OYHA 4TT3A 1VGQA 4QDKA 4YREA 5BUSA 2QTLA 3RKUA 1IVYA 5JO0A 1OZHA 3DLCA 3KZVA 3FUCA 1TZCA 3KQUA 1NW6A 3GJ7A 4XSGA 4O2AB 3ZXXA 3AIMA 5ECGC 3EF0A 3KO8A 2KMLA 3TXAA 3G82C 1EPUA 5L7WA 4WBSA 1X7XA 1ZJWA 1TQ8A 3SZLA 4Q4AA 1H1LA 2R93G 4IKEA 1OWPA 2NYAA 1E4EA 4UNQA 1H3EA 3GLHA 3GLIB 4IFIA 1OPXA 3T7CA 1QV6A 1Q84A 4BRSA 1Z73A 1UK7A 5J58A 2XXBA 2QLMA 4U7FA 4LBWA 3AEKB 4LK3A 1XXLA 5KB3A 5IAAA 4IPTA 4RHYA 3U9LA 5JNVA 3AXSA 5EWFA 2VT6A 3EVCA 3W5HA 3EQ8A 5IC4A 1MJGA 3DLIA 1NNLA 1YU6A 2ZAGA 2DWCA 3U3KA 1I6MA 3B78A 3SJZA 2HM7A 1GPMA 3FHOA 4DMCA 3W5SA 1SFRA 1QSGA 1RVDA 4P5PA 1BMFD 2X2EA 1XPRA 3WMRA 1TE2A 4IDPA 3LVBA 5BWWA 4ZANA 3N2LA 1C4XA 2AKAB 4J9OA 4L4YA 4LXXA 2Q0QA 3NHWA 3JYPA 3ROQA 4YJ3B 3U61B 2QRPA 2YHIA 1E2UA 2GCOA 3W34A 1AUOA 3WJ1A 1ZW1A 3VR4D 3NTOA 4R6XA 3DZJA 2HHJA 1DQSA 2AE2A 1WCMA 4GWKA 2COKA 1RI4A 1JIHA 1OPRA 2QL7A 1WCXA 4UNIA 3BS4A 1V6SA 4F46A 3GFBA 3WTCA 3KU4A 1VL1A 2BE7A 4B3XA 3MM4A 4LOJA 5BURA 1LF5A 3PW5A 1JTEA 3U4QB 3D3WB 4Y1RA 1D6MA 3OA0A 1UBKS 4WDRA 3OPYA 4JYMA 1I0IA 1Q7BA 1DEAA 4ZTUB 2XE4A 1VPEA 5K05A 3I9FA 4DSZA 3UFXA 2D2FA 4JVMA 2P77A 4PQRA 3FG9A 2JGIA 1CZOA 4U00A 1DQNA 5JSUA 3J81A 1KTVA 3OSZA 2Y8EA 1WMAA 3B82A 1QQ5A 4RDCA 1C3JA 4NYMQ 2VYVD 1GCGA 4UU7A 3MJSA 3KQTA 4AM8A 4A8JB 3FXAA 2ZIVB 3U4MA 2CVZA 2HMVA 3HM2A 1TB4A 1U2SA 1XA0A 3CUVA 3B12A 3QMPA 2M6LA 3CG4A 3HCOA 3CLRC 3OMWA 3RSFA 4O25A 4ZYWA 1YQDA 2MR6A 4GKBA 3P9QA 5I5WA 3FTEA 1HLFA 1X7WA 5B64A 3P4UA 1QYDA 2IV7A 2EP5A 3JAMW 2I3DA 3QPVA 2D1SA 4XEUA 3VH3A 2IYXA 3ROPA 5U4XA 1FTYA 4DB4A 5ITWA 3Q15C 1RMTA 3E9YA 3GIKA 1R8QA 1T2CA 4IQFA 3FDIA 4H7HA 2YCBA 2Y1FA 4YRCA 2P5SA 3JQ9C 2Z8YA 4M8SA 4A6EA 4G1EB 2XX3A 1BS1A 3ZY4A 2NUAB 1QCYA 1U8EA 4LEIA 4JI4H 1MP0A 4K8RB 2YN4A 3AW8A 3KLNA 1VPDA 1Z26A 1M73E 3ESCA 1PFGA 4HI0E 2YFYA 1XZEA 1ZMRA 4E5PA 1OX6A 4JI0H 1JKFA 1OX4A 3BM5A 4JR0A 1NWCA 3DS8A 1RM3A 4JASB 3S6JA 4AW9A 5IJ0A 4J9RA 4KE9A 3I6QA 4CKYA 1EA7A 4D9KA 3I3OA 4I55A 2ZSBA 3PR1A 5CLQA 3W7AA 5KWVA 1OGYA 4A36A 1B1CA 3AFGA 1WCYA 5E0OA 3U3MA 3WK6A 3NTLA 4G0WA 4MSUA 2NSJA 4FBMA 5C3EG 3RQIA 4JUFA 4AZ3A 1TU0A 1FDUA 5P8WA 3DDCA 1NBAA 3P2IA 1DAOA 1ECCA 4R1SA 1A50B 1H65A 3P9ZA 3GVIA 4BMYA 3GLGB 3VR6A 3M6WA 5A4JA 5A9TA 1TI7A 3OMLA 3WRYC 1EZ4A 1NXOA 3AF0A 2PV0A 2E21A 1Z4KA 2CT8A 4LFCB 5JAOA 2L18A 4XWKA 4MI6A 1L5KA 2WYWA 3H9BA 1IBMB 1VKNA 2O8DA 5HVNA 3TI7A 5DHQA 1ZJJA 2P0EA 2G09A 3CX6A 1EGHA 1O97C 3QX9A 3K96A 3W2GA 2IPLA 4RLQA 4DR7H 1R16A 3O8NA 1VIDA 5JG7A 1L8QA 2XGMA 5BNIA 1Y8QA 3PK0A 3CU5A 3AKDA 3ECCA 3PHLA 1CFZA 4DF3A 4C5AA 2UVVA 4Z1MA 1JI0A 3K05A 1P1CA 1QVVA 1Z75A 3LRTA 2Q3LA 2PX8A 1APBA 1IBKH 5G1PA 2VAWA 5CB8A 4R9NA 3Q85A 4NAUA 4PE5B 1EFPA 1PZFA 2GH1A 5EXDA 2A1TS 2AIRA 3ID6C 5CIQA 3EIHA 1W48A 2VYFA 4G5FA 3EXIA 2WD7B 3RW9A 4BMVA 4DMMA 4V0RA 4A8PA 4HFMA 3NX4A 1NASA 2R00C 1DJMA 2AFHA 4ALLA 2I8CA 3AU8A 3SIRA 4RPGA 3DZKA 3LMKA 1DUSA 2IPMA 5C8YA 2ZUCA 2ZXUA 3ELDA 4PC6A 4WADA 2I66A 3RJMA 5ALZA 4BFVA 1XCLA 3GO4A 4IRMA 1W34A 1X7GA 5FLXW 3PT5A 3TW8B 2DCMA 2YFKA 2OV4A 1SC3A 3RH0A 4DQDA 3L1VA 3QX8A 4WINA 4RJKA 3NAGA 1WW2A 1Y4AE 1FNCA 1PVDA 4EW6A 3QKSB 4O4IB 3RSOA 2QUBA 4G5OA 2AFRA 2VWGA 3B1JA 4U9IS 1B93A 2QMZA 2Y1CA 5KYUB 4MR7A 4ZU1X 4WKPA 4HZUA 4R71A 5ADUS 4RNCA 4CIYA 1XEAA 3TDNA 3VX3A 4U0JA 2IYRA 1SM4A 1CQXA 1M76A 1NZDA 4FFVA 1W47A 4IWXA 1W5FA 3LGSA 4UVDA 1SY7A 3OJLA 4EMTA 2OA0A 1J5XA 2W6NA 4HLQB 2JPDA 3RAQA 3MUEA 1G21A 5E1BA 1KEWA 1YONA 5CHYA 2DPGA 4DG9A 5K8JB 5CGQB 1DB3A 4M1QA 2YVKA 3AI1A 3PJRA 4J0QA 4TTSA 3H2GA 2WU0A 1T3GA 4PIPA 2ZIAA 1UWCA 2P30A 5J4YA 4WXEA 2FPUA 3WP1B 3VKGA 3NATA 4Y1FA 3T1YH 2IDMA 1OJLA 3M4NA 4DEYA 4BKUA 3TUIC 4PS1A 2DWOA 1XEFA 2BT4A 4FMDF 3OE1A 4GZ6A 4A3DG 3BL6A 2QLLA 4MV5A 3QEMB 4NBWA 4XH9B 1SKUA 3M3PA 1U2QA 2NVUB 4YYZA 2P8JA 1M6NA 4EUHA 5JMTA 4QBKA 3UHPA 1Q14A 3GPBA 3IE0A 1LUAA 2BFEA 2A4MA 2UXCH 3QUTA 4NXNH 1COWD 1NVWQ 2YWJA 4BN0A 1PQPA 3U5ZB 2FPPA 2ASDA 4LBVA 3EF1A 3S1LA 4C1BA 4RZRA 2OSBA 4A91A 3D7NA 3FGNA 2XMZA 2IF2A 4M86A 4AYXA 4YROA 5KG4A 2QGZA 5CX1B 3TB4A 3JRNA 2OD7A 2FK7A 4EFLA 2WWWA 2D13A 2B2NA 1V4BA 4FUTA 2XH8A 3OJEA 4NC9A 2H2WA 1ODFA 1UBLS 4MPJA 1OH8A 5I5TA 5IMSA 4KV9A 3TD9A 4WNAA 5KFWA 1E98A 1SCKA 4XYMA 4BY7G 4WY5A 1MGPA 3C39A 3TE7A 5AW9A 1DO8A 3WBBA 4RVOA 1G20A 5FB3A 1SVOA 5LNK6 2XXAA 2BM1A 3PWKA 1G6OA 1JA0A 3EDCA 2QIPA 3KREA 4YDSA 4CKEB 3STYA 3N28A 3G68A 2X41A 1NOJA 3C7AA 2O1WA 5JZBA 2EWMA 1JV2B 4PQFA 4RE6A 4OJTA 5JVDA 2HWUA 2PD4A 1SNYA 3QI2A 5IU6A 3SDBA 1JHZA 1NP6A 5L1JA 1KO8A 2ANCA 2OZLA 3S2UA 5EJ4A 4YUXA 1VIYA 2FZ5A 1QFXA 2AUTA 3O1JC 2AXEA 1S0MA 3BABA 2AGOA 1YS2X 1UJ6A 3HEAA 4O82A 4YPFA 3QYAA 3CNNA 3EPKA 3IFSA 3Q3CA 4A2BA 1ZN8A 1MC5A 5FL3A 3OX1A 1E7YA 1Q7GA 2X6QA 3T5HA 3K6SB 4O0MA 3C6YA 3VPFA 3CEAA 4P2GA 1D0VA 4FEGA 1CERA 4G1VA 2EG5A 1HYBA 3AHEA 3R9XA 1QOPB 3C6MA 3THRA 2J3MA 4HEA1 2G1UA 3JD1A 2C2KA 2DFKB 1YRHA 4FUQA 3ZQ4A 2ZRPA 4BFXA 4YWHA 4IJMA 1RBQA 2BISA 2G9VA 2G9RA 2EJTA 1SUEA 4YXWD 1A9SA 4TLEA 5A7HA 1LFDB 3KIPA 3A3NA 2DF8A 4GLOA 3GGDA 3O7WA 1IN1A 3KAQA 2YJZA 2E49A 3QOFA 1N75A 1UJBA 4DOMA 1Z13A 4RB1A 5JFGA 2NZWA 2BBTA 1PG5A 4B3SB 4HB4A 1NMEA 2AN3A 4F2HA 4IYJA 2GTHA 3DUFB 1EINA 4JLPA 1Y3CE 4J7UA 9ABPA 3GK3A 1RABA 3W2IA 4BO3A 4P7FA 4Q1VA 1KDTA 1R66A 4XWGA 3RVMA 5DG9A 2JAXA 5CA0A 3C5VA 3T52A 2CV1A 1MX1A 4OAPA 4D45A 4BMNA 4XM0A 5KG1A 4CKXA 1MH9A 4AROA 5CK5A 1Y5MA 3BH0A 5IJWA 1D1QA 4IVQA 3RO7A 3CNHA 5B3AA 3LL7A 2C2DA 5HG0A 1FS6A 3MGBA 3NJ4A 1H94A 3OZVA 4MV6A 1E79A 5CX4A 2PUVA 5HMLA 2H3EA 4KSBA 4FDVA 2QP9X 3B8HA 4C30A 1QE5A 3ZWOA 4RS4A 2WA2A 3DR3A 4YRTA 4URVR 2FSIA 5B4UA 4E5YA 1CC1S 3OIGA 1RHMA 1ZQ9A 2OFOA 3AGPA 4BFCA 1SEIA 1JZTA 2COGA 4PYMA 3PVCA 3W5BA 4O3PA 4EW1A 2JEZA 2PH3A 3N2ZB 1F48A 4IDCA 5AW4A 4NNJA 1ACLA 1DRUA 1CY1A 3TQIA 2NUTA 3S70A 3QXCA 4G0MA 4UUQA 2HGWA 1VJCA 3FVWA 4IV5A 2YV3A 1U81A 2C1EA 4UC0A 1NJFA 5CCDA 2OL4A 3S2SA 3SFVA 3WXMA 5COBA 1XE3A 3CJRA 2EBUA 4BBAA 3WYAA 4X1OA 2Y9MB 4P0PB 4N12A 3USZA 2GBGA 2W0SA 2EJCA 3ED1A 4WCFB 4FCWA 1GFIA 5TMBA 2ZKIA 3SF8A 2B5OA 4HG2A 3LTNC 2H4HA 2XGJA 2QZSA 4CTKA 3ZH9B 4H6PA 1RWMA 5AI6A 1V5IA 3PW4A 2CY0A 5AI5A 2QYSA 3TFWA 5KX5A 3DBRA 2OHJA 4OIFA 1MHTA 4IL5A 3UMCA 4FDUA 4YPOA 3L7OA 4YWJA 3ROTA 4C7VA 5EZYF 1N9GB 1FP6A 3DNPA 5CDFE 3ZWPA 2QTFA 3GBPA 2BGWA 4GVPA 1SR8A 1O9GA 1Z39A 3RAPR 1XRSB 3KK0A 4IZIA 4KQ6A 5AJYA 2HHFB 3B9RA 1TQHA 4NYMR 3H9EO 1LB1B 2NSLA 2F3TA 3E9DA 2OT3B 4J4BA 5FORA 4DVGA 4CMFA 1J8DA 3VXKA 3KYDB 3NC4A 4Y2QA 1XZDA 3LZDA 3VI4B 2X6RA 3STVA 1ZNQO 5C1BA 2G83A 4NMHA 4WOCA 4F2GA 4DR2H 4KK4A 2CYAA 3K2IA 3SKYA 3OZFA 3H84A 4O3SA 4B3MH 4RA6A 1RYEA 4ZQCB 4MYSA 4PLFA 1KVUA 2VAVA 2V4RA 2FGJA 1YNSA 2CLCX 1V2GA 4Y8VB 2ZR7A 1M7GA 1JIXA 3I9NA 4GGMX 2FMFA 5AH0A 4M9QA 3DAFA 4ED3A 4JQZA 2IEAA 3PNYA 3KSUA 4OU4A 3CMCO 1S10A 1B16A 1XL0A 3CKKA 1XD9A 3KWJA 5J2UB 4IMIB 1CS0B 2SNIE 4ZDKA 1WKCA 3EXG1 4JQOA 4L3OA 1KHHA 4N03A 4IFEA 4EWLA 1IB0A 1YQUA 1V9CA 2ZIFA 3FFWA 4HDNB 4J16C 3PSAA 1BXGA 3KQYA 3QY0A 1GGKA 1ZCBA 1HA3A 1Q0ZA 2OCKA 5LC1A 3DDWA 3TM4A 5I4KA 4BMPB 1YQ9A 1EDOA 4OQYA 2Y99A 2HR1A 4MQLA 1Z4MA 4MO2A 4JYAB 4MYRA 2NTYC 2FVYA 1LX7A 4A92A 3IP9A 4TT3D 2WV7A 3OD1A 4NLGA 2VI5A 2ZWPA 3DD5A 4IH1A 2FSUA 2V6BA 3B70A 4FLFA 5KFDA 1N6OA 2HQ1A 2C3OA 7ABPA 4PINA 3ONWA 4XTRA 2D1FA 1SUDA 3ETCA 2PZ8A 4NJOA 4HC4A 3EWIA 4F85A 1FDRA 1VG1A 4MI3A 1UADA 1X74A 3W3AA 1LBSA 3K5IA 1K98A 1WUHS 4LDAA 4LDQA 3JTEA 3JVDA 3P2YA 1H2HA 4L0MA 4C78A 2QXYA 4WKBA 4PPQA 2FVXA 5FUWA 2QG4A 3HDGA 1GRCA 3H4MA 2QOEA 2PEZA 3ANTA 3K4HA 1XHEA 5I6DA 2H4FA 1IOWA 4Y6QA 3DNMA 3DL7A 5IEBA 2QQGA 1UBEA 4B17A 4GLBA 2I22A 1GM5A 3VNVA 4C6HA 1GCIA 4ZC8A 2C3MA 1WVMA 2H2DA 2ZBUA 5TPZA 1DEKA 3ZVKA 1ZA2A 1T2AA 4Z54A 1P2SA 2Q8NA 1S2GA 2E48A 1ISRA 6NULA 3GFRA 5HQTA 5JOQA 4NG5A 1H2XA 1FE8A 1T43A 2CL7X 4QUKA 2VJDA 5FLEX 1Q12A 1ZOPA 2EF1A 1M0EA 4R31A 2FLVA 3SQWA 3HCPA 1O95A 2JCGA 1AGYA 3OQVA 1CIJA 3UJ6A 3NAZA 3BMNB 1PK7A 1OI4A 1QQTA 4Q6WA 5DQHA 3W2HA 1X7ZA 4PZ8A 1X9HA 4BNZA 1WF3A 1N33H 3PP8A 1I6UA 2R47A 4JLSA 4A0HA 1Y1VA 1NN5A 2OAEA 4KACA 4B33A 5IYZA 1RK5A 4LWOA 2KSQA 4JDPA 3OJOA 1KJJA 4JWTA 2IU3A 3CISA 3E53A 2V7PA 3SC2A 4FB4A 1UKYA 2DFVA 5KI6A 1Y6QA 1M0WA 4ZVPA 1B23P 1WVGA 2X13A 2J0QA 4Y7CA 3MR6A 3K2EA 2EARA 2WWFA 1VSBA 5D1HA 4XM2A 1KZYC 4BPRA 1BCSB 1MQAA 3CX3A 5JW6A 2HRZA 4OHKA 3MWYW 3ENQA 4TV8A 4YRKA 4UCWA 3D2CA 5JT1A 1HNXB 1BTOA 4HB0A 4MGEA 3UGKA 3DZGA 1FFGA 2I4IA 4Y30A 4RD2A 1PBTA 1P45A 1MU0A 2PRSA 4I5EA 2BHSA 2Y0EA 3JCZA 3NBZB 4MVJG 3ZJTA 5BW5A 1RXVA 2C2OA 2I2WA 3WHLA 3C0FB 4F8EA 3HJFA 3VR4H 1FJXA 1GTSA 1GPAA 1YDMA 2ZRKA 4YK7A 4UZSA 1W5TA 2IOYA 5ALJA 1P3JA 4Z0NA 2DPYA 1P74A 5TEVA 2QVYX 3THSA 2IDZA 3I72A 4DAOA 2QLBA 1E2EA 2BW0A 1V5FA 4E3WA 3BF7A 4UU0A 4D3XA 4YT5A 3L18A 4CI9A 4KRFA 1VMIA 2LUOA 1DDIA 4ZI7F 2VNAA 3NHMA 1QJCA 3GIIA 1B3BA 4GSKA 1SOUA 3TIXB 3E8SA 5DV9A 1YUMA 1XDGA 3M81A 4Z4CA 5CB4B 1WDLA 3H5LA 2GYYA 2W6ID 1ZM2A 2IV3A 4QOSA 4QFMA 5ESWA 3G1TA 3BOSA 5M2QA 1O54A 1G9XA 3PGLA 4W6QA 3OQIA 1XGKA 2CLDX 2LCFA 5I7RA 4E6EA 4Q3OA 1SHKA 3T0IA 4IVRA 3L6UA 3TH5A 4Q44A 2NZ8A 2PWPA 3ZBQA 3HU2A 3A1SA 4IH9A 4B4KA 4Y18A 2ZBPA 1NI4B 3RBDA 2PGIA 3DVQX 1XLUA 3RASA 1A8HA 1ZRHA 4DDHA 5LQUA 1F0KA 2PS9A 1UT5A 3ZE0B 1G5RA 3VDNB 3RIZA 5DLYA 2V65A 2IPXA 1YFJA 3FMGA 5AHRA 2KLBA 1HFJA 4ISCA 1XNJA 2Z3VA 4F11A 4G85A 2BH9A 1FP4B 1VMEA 1VG9B 4CF5A 3JQEA 2XT9A 3E9QA 1C9EA 3T4UA 4N7MA 4DUZH 5K3BA 2NO0A 2IZZA 3MXTA 4ZAWA 2QN3A 5DGAA 2XE6A 3C7KA 3L1KA 5A04A 3BIJA 3MRVA 2KI5A 5I7EA 1L4NA 4NHEA 1L4LA 2FG7C 3I5XA 1Q1ZA 5T6BA 4RHUA 4KQ2A 4I1SA 5JYBA 1E2NA 3R8FA 4C7OA 2XUDA 4ZGBA 1RIFA 1EFVB 4RJTA 1E2QA 4NSNA 3G9QA 4L9WA 3DCNA 2I03A 1GYFA 2AK2A 4GUAA 2FEXA 4HDQB 1JQJC 2PH5A 1SXJA 3S55A 2EKBA 5BP7A 1HKHA 4EA6A 2QRLA 2X3UA 1JWBB 2D62A 2QMHA 3E23A 3Q8XB 1EX7A 5JO9A 1O57A 1P75A 4KO3S 4EPYA 3HOUG 4ZMSA 4LFBB 1DLIA 3GRAA 2O5CA 3BRWA 4B3RB 3DAHA 3G5TA 8GPBA 3WLSA 1GQFA 4P93A 2IC5A 2WG1A 2ZE7A 4YAFA 3FPBA 1B15A 1SG6A 4YRQA 3NWPA 4QTUB 2CV2A 3ML1A 1WXEA 4REQA 3LXXA 4Q24A 1T6YA 2O7NA 2Z43A 2CYBA 2OGTA 2PEYA 2OLEA 3LBFA 3K8OE 3C5WP 3QMVA 1VMKA 3ZJ4A 2PG3A 4CETA 1P1JA 2IEBA 2PHZA 1H0SA 1FX0A 1LD3A 1QIJA 4M88A 1JHOA 1EQ2A 2OENG 3EXFB 1T3TA 5HNKA 2GN9A 2JATA 3K8YA 1RPTA 3LY5A 3WGOA 5FX2A 2QX6A 1YVPA 2P5YA 4BO5A 3HEMA 4ZXFA 3OEYA 4M98A 3RSHA 2FI1A 3GHYA 1YB6A 1Q50A 2R751 1GPDG 3DZ8A 1KH3A 2FV8A 2V7UA 1AB5A 1XNQB 4TWBA 3R23A 3WS7A 2OV3A 3KOZA 2ZB3A 1KAQA 1Z0KA 3GP5A 4QECA 3RAGA 3P1JA 2BM8A 5IKPA 5I45A 5JNWA 4I2VA 3EGXB 3NT2A 3LUJA 3G85A 2VYCA 1U3VA 2VATA 2JFQA 3G6XA 1JJVA 4LSZA 5HQ3A 2VZ0A 3TQ1A 4PNEA 3RGGA 3COYA 1DRKA 2REQA 1VGVA 2JH9A 4J3NA 2JLXA 2F9FA 1TTQB 4LYGA 3TRJA 1NMSA 3IIEA 4J03A 1ECBA 3G8BA 1UXIA 2C8LA 3L06A 4OLJA 1F4PA 3WGYA 1CWUA 3R9WA 2GK3A 5EVCA 3K9WA 1UM8A 4O83A 2HO5A 4ALMA 4G0OA 2PRYA 4L6IA 4MDEA 3BDIA 4K9LA 1TU3A 3O0TA 2GBPA 1CJBA 4J9VA 2J3EA 1CKNA 1IPFA 1S3FA 4W5QA 3OA2A 4OB7A 4CN9A 2DBQA 1ETHA 3GFSA 4HNRA 2OE2A 2X0JA 1WO8A 5DVZA 3IMCA 1V3VA 5DM4A 5C7OO 3MB5A 5HBRA 3TK1A 2LDBA 1G1AA 4EVRA 2KSWA 3QQPA 4OJQA 3PC3A 5FUYA 1X8LA 4C6TB 4CLEA 1VCMA 3H4BA 2OQVA 2BGRA 2XQFA 3ROFA 1YTLA 4ZT6A 4M1ZA 4KHZA 1I1KA 1QP4A 2Q6IA 2NW6A 1YSCA 4RNOA 1W1WA 4EUNA 2RCYA 3QVUA 4UCOA 2HYIC 3H2ZA 5B12A 3OTIA 4XM1A 3KZ1E 3C14C 5E7IA 4ERNA 4AX4A 2FW6A 2IUFA 5LMCA 4JJZA 4ESEA 2HIAA 2P2CA 5FLKA 1JDBC 2H7CA 3DD1A 3EWNA 2IY7A 3PV0A 2GN4A 3OF3A 3GNTA 1LPBB 3DEFA 4Y2UA 3KT8A 1Q5PA 3ZV6A 4M4SA 1M6VB 5J4LA 4MR8A 1TMGE 3HY6A 3HG7A 3SMQA 2I1LA 1QG2A 1V1MA 4LNUA 1GRVA 4C3UA 1X7YA 2Y1DA 3HT5A 4CMBA 1BHSA 4K40A 5DNDA 4BEBA 4LOKA 3TUZC 4TQRA 1VI6A 4N8DA 2DAPA 3A7EA 3JPYA 5HKLA 1M9NA 2N1BA 5HKAA 5MGBA 3ZWCA 1IBCA 1PNQA 3RS8A 1Z5WA 1SC9A 4YR0A 1EX6A 2ZTHA 2YXLA 2VA9A 1W9HA 3O2SB 3I01A 5CP8A 2QRGA 2D8MA 4UVHA 1Z16A 4OUDA 1PG2A 3HJNA 5BQPA 1VKHA 2ZJ0A 5IWAB 4FDMA 2O8EB 2OKCA 5KYWB 4ENUA 5KS2A 1J2RA 2F3PA 3OM0A 5LA6B 5H5JA 2VKQA 4F7DA 5CBPB 2MR5A 4LE0A 3QOYA 1NMYA 3AL0C 1S6YA 4LF4B 2XCLA 4RW0A 3CRVA 3WKDA 3BJIC 3AVWA 1Z5UA 2I1QA 1GSOA 2WJVA 3OFKA 3DPIA 1NG1A 4YO8A 3AHDA 3OPXA 4ZFNA 4YP6A 1G8AA 2PMCA 3GEEA 5BYBA 2Q6VA 4WFKA 4N5MA 5J5AA 4DQXA 1W5SA 3HU3A 1VFPA 4W5TA 3RV4A 4EELA 2G1AA 4UHJA 4MQUA 1Z7BA 4Y1GA 3II6X 4ECVA 3O90A 5I8ZA 3H3XA 3G7SA 1T5IA 1NBME 4DCJA 1JQKA 4DTCA 2VEOA 1D2EA 5FD8A 2M98A 5DTQA 2ZREA 4IXDA 3N40P 2CXTA 4CTJA 5AVSA 5KZMB 2P4SA 1GA6A 4WBNB 3LT0A 4BATA 2ZIWB 4GI2A 3V7NA 1PCXA 1KP2A 1EWQA 3PZBA 2PQMA 2OCPA 2ZANA 3SIXA 4EHDA 2G72A 3OUUA 1LPOA 4BMZA 4RORA 2ZWIA 2G76A 2EZUA 4GC7A 1QYVA 4RD0A 1ORHA 3CSDA 2W6MA 2XT0A 4CKWB 3BEOA 1E77A 3IDAA 2HHLA 1CRLA 2Y1KA 1S3IA 1G4UR 2QTCA 4MS4B 2WY2D 2RF4A 3Q7IA 3U44B 2PGLA 5CH3A 5ICGA 4G0NA 5EXTA 2ROQA 3HZOA 2QAJA 1WP9A 4DXDA 1E3WA 4R9RA 3OOEA 4D99A 4BFYA 3LHFA 4QT4A 3SF0A 1OILA 1BQEA 5AUOB 1UPUA 1NXXA 2I9KA 3GR6A 2MSEB 1F0YA 4AZWA 1WVIA 3I12A 2DETA 4AY3A 2Q4OA 2XCSB 4ML3A 1NJ5A 5KQLA 3AY3A 3U7HB 3M9OB 4CQMD 1BX1A 2Q2NA 1ONSA 5ALGA 1L7QA 2PNFA 2CJFA 4G8JA 1GA1A 5E9JA 3TQHA 4RGBA 4OA5A 2YNMA 2WAOA 2VRCD 4FNAA 3B20A 4EM6A 4W4TA 1L4KA 2VHTA 5ALEA 4LVCA 2VTEA 2O4UX 1NRJB 3CNLA 4DCMA 1BU5A 1JDNA 4AJHA 3R3YA 2P1DA 3ZE6A 2O8BA 2GN1A 5D6NA 3IC5A 2X7HA 5KFHA 2OLKA 1Z17A 2YY5A 4Y2SA 4YRJA 1M7JA 4ARBA 4BP3A 5HZGA 1HMYA 1RVV1 2PFKA 4IG4A 3MWLA 3NQ41 3AUTA 3PJGA 1IPEA 2HJHA 1GU1A 3O7MA 4WLFA 3L8YA 1UT8A 2BR5A 1DLJA 3QFCA 1A2QA 1ZXBA 4GT1A 3RYIB 3QITA 3RFUA 5HV6A 1Z22A 4PDBA 4KG7A 5EI5A 3T1QA 4AUNA 4D6XA 4EYEA 1ULSA 4W7IA 2ZUVA 2OMKA 3G0OA 4X3OA 1SEPA 5JAQA 4FGUA 1VLZA 4N3NA 1GG9A 2JZCA 3SEFA 4N39A 2QN9A 4F4JA 2XTMA 1NMXA 4JI3H 2Y9PB 1TA0A 1N2CB 1QO9A 4E22A 2R7LA 3KRTA 1PYGA 2NVBA 3RIMA 4EA9A 3DZBA 3ASZA 4BX3A 4I5DA 3AL3A 2A33A 4HRVA 2YCLA 5CK4A 3QVLA 3HCFA 1U0HC 3CLSC 4QJBA 2CVOA 4BVHA 2YV4A 1KJQA 5ALMA 3PDIA 4EO9A 3TJRA 1XL1A 3ZTYA 1B43A 2AI1A 2YWDA 3THYA 3R0ZA 2ZQYA 4L73A 3ODGA 2NIPA 5GY7A 3AHHA 3HGQA 5TXGA 4A5OA 2XQGA 3NOOA 2I6FA 4IIEA 4LYYA 5T6MA 2I5PO 3RRBA 4QVIA 1X87A 5A4KA 1G2IA 3E48A 2O0HA 4F4IA 2J09A 1TM4E 3A2KA 4ZI7B 3FOEC 1J8FA 4N5NA 2HLDA 2IPOA 4EG7A 2AQIA 4L85A 1P1IA 4QXPA 1JHRA 1OI3A 2AC2A 3GN1A 4RENA 2C2MA 3DBVO 3CRMA 2VHXA 3KXIA 3NIDB 1FS4A 4UM7A 1RC0A 1HM5A 4PIVA 4FFSA 2N46A 1M0TA 2C9MA 3KKMA 4EB8A 1PLLA 4B9EA 2OM2A 2PKCA 4BTVA 3ZBTA 2GXQA 5LXTA 4Q93A 3SXPA 3UK7A 4E70A 1TKCA 4YFVA 4HD8A 3A2LA 4YRBA 1H0KA 4I2NA 5DCUA 5HE8A 4UOZA 1SAYA 2W48A 5HA5A 3C16C 3ONNA 2BLNA 1TCBA 3HLYA 2JLZA 1X80A 1P18A 1OVMA 1DIAA 2AJ8A 3IKJA 1OFUX 3GMTA 5K99A 3KVRA 2ZGIA 2X23A 1HNZB 1CJTC 1IZ8A 1TGVA 3VO2A 4TSKA 1RZRA 1CZKA 3PHBE 4HLUC 3OCZA 7MHTA 4E32A 2B82A 3PQ3A 2GOYA 2Y68A 3ZCQA 1AKTA 2N3ZA 4HZGA 4HO1X 3NJ8A 2E1RA 5KKCA 3O4RA 3LT5A 4ZGWA 3AUAA 3G2OA 4AC9A 1FTNA 1C30A 4CCAA 3K9CA 3O3CA 2C31A 1V5EA 1RBZA 3UB2A 3KPJA 4BJ5A 4LF6B 1V39A 1M8JA 5ALWA 3PKJA 1N1EA 1B04A 1IHUA 4C04A 1X14A 4KEAA 4L27A 5A0VA 1GTVA 2GS9A 3L4EA 4RUCA 1TT5B 4QASA 5FYDA 2GD6A 2CD7A 1QP8A 3ZY5A 4AJ4A 3EZ7A 1KQPA 5KMGA 2E4UA 1VLVA 4MV4A 3D8SA 3RFTA 3WYDA 4UNRA 1LVHA 5IN4A 4Z7QB 3KTDA 4FT2A 2CSUA 1U3UA 2ONYA 5M7EA 3V1KA 4PTLA 2YN0A 3KE8A 2OORC 2XMPA 4OV6B 1FYFA 3KR2A 1Q0TA 2OK7A 2JGMA 5IT5A 3H0KA 3PYXA 3ZKWA 2PSFA 4QO7A 1U8UA 2XYRA 4B2LA 5CTJA 2GYVA 2YCHA 1G3UA 2P62A 4I4LA 3M89A 3EN0A 1U7TA 1DKPA 1T9AA 1QO7A 2BDUA 1G98A 3BSFA 1OVGA 4RK7A 3DWGA 4B1FA 4LA4A 5H7XA 2ACKA 4OFZA 5D87A 4J0FA 4JOSA 5EWLB 2ACWA 5DLDA 1T9GS 1ZJZA 5DBGA 2H5EA 1JEAA 3GPCA 3TR0A 2WMYA 3HJTA 4ZOLF 4ARVA 3I30X 3JR3A 5FEUA 2XQJA 3KUUA 1KYXA 1BXRB 1J0XO 1M5RA 2IIQA 1T1JA 5JCOC 2A7QA 1BYIA 2B5VA 3TLMA 3GIMA 4JBNA 2OK8A 1RKBA 5AW8A 3GJZA 4GOKA 1DT3A 2DHRA 3K0FB 1RQRA 5T67A 3OTOH 3S68A 4DZRA 4L7VA 5F76A 2AOUA 5HTOA 3A70A 3ZZ1A 4FSHA 2IYQA 3PVZA 2VUSA 2PSHA 3SBOA 3OEED 2NSHA 3A4YA 1Z7EA 3KWLA 3OKFA 3RYHB 3TAXA 3U7GA 3E3AA 1QOQB 3H0GA 1SG9A 3CR7A 1B8NA 4AY6A 3Q6NA 5FBQB 3B1YA 1FFWA 1T4BA 4ED0A 5D3MA 4HDMA 3SHOA 4PO8A 4JHLA 1T8WA 5LP6C 2EZ9A 2G25A 3V1UA 2R1TA 3WRYA 4PLTA 3G5MA 2ID8A 1SUIA 2GAIA 1OASA 3I45A 2DSTA 4O7YA 1WW3A 1RKXA 4UTRA 3N3AC 5EUCA 3N2KB 1VJDA 1T2NA 2AG6A 1H4VB 1VPTA 1Z62A 3KTOA 4CCYA 4HAYA 4RFLA 3LUCA 4L72A 1GA4A 3A6JA 2G1PA 4UDXX 4UXIA 4X95A 3RIGA 2WDTA 3QU7A 1RI5A 5I4CA 4A23A 1NP3A 1KEEB 4MUMA 4L8WB 5CIWA 2QJTA 4LF7B 3EWSA 1KOJA 2E4ZA 1LV7A 4TLLB 3KEGA 3QKWA 1GZDA 1F38A 2C54A 5EEGA 3F3MA 3JQFC 4JS0A 2PMBA 2QJRA 4WN3A 1K8QA 2WU3A 4K3UA 2A3RA 1OFVA 1RWNA 4AMGA 4ETMA 5BVHB 3G1WA 2CLHB 2IUUA 5BSHA 1KYWA 1MFPA 2JA7G 1I24A 4UFNA 3DOHA 2QMEA 2V5AA 4NICA 2CVHA 3KUCA 3RSLA 2VPSA 3WB9A 4KLCA 4BWVA 3VR0A 3EH2A 2R00A 4A3IG 3EQ6A 4JN6B 2V54A 4NIMA 4I6EA 1IM2A 4QNRA 3UWDA 4XUEA 5AVUA 3ZJVA 2QM3A 1Z4LA 3AY6A 1Z15A 3V1LA 2I6UA 1NV9A 1TYZA 3N5CA 3AF1A 4PN7A 1R88A 5CCXA 2X3YA 1S8AA 4AMUA 4CQLA 3LRPA 2K2WA 3TS1A 5LP1A 2KLHA 1QRTA 1C9YA 2VSOA 2QAIA 4U3JA 3BB4A 5K1ZA 2VJLA 1ZUNB 3IPLA 1YCFA 2OFXA 4E6PA 2IELA 3CN9A 3JQ7B 2RGNC 3GQBA 3QTTA 1T5DX 3ANMA 4KUGA 4RIGA 1ORDA 1JP7A 4XR4A 5C7LO 4IS2A 1QF9A 1GYRA 5BVGA 2QNBA 1XLTC 4F3KA 5K45A 4ABTA 1DCKA 1JSXA 1Z88A 4DC1A 4IGIA 2V6JA 3KHGA 4XJTA 1U9JA 1IN8A 2ZCJA 4JB3A 3O9ZA 4MV9A 1Y1WG 1V1RA 5JY6A 5L1IA 4NLLA 1KY5A 3A0RB 4XARA 3TCKA 3E1SA 3E15A 3MGCA 4YDHB 1RJGA 3Q7TA 1NHWA 4MJXA 4JLWA 3U81A 2BL4A 4GIBA 2ZJOA 2PKXA 2GNOA 4J7AA 1SXJD 3WQBA 3FPLA 2W6JD 2XCAA 2GCNA 3C3AA 3IXLA 3X1JA 1FSFA 4IZHA 4QAJA 4PXYA 4HGRA 3IAEA 4C2UA 2NYRA 3DBHB 3U4CA 3GMDA 1T36A 4XB1A 1W75A 4NTZA 1THZA 1IB6A 3T3GA 2XZOA 1IN4A 4MV0A 3SYKA 5C52B 2AEFA 2VSXA 4LYFA 1EXWA 5GV7A 1D07A 4MVWA 2CDRA 2BSXA 4O4JA 2I7TA 1ULZA 4C88A 1SCNE 2FEKA 3ZBUA 1QQAA 1NN3A 1J90A 5BR8H 1KI2A 1TVKB 4MRMA 1ZUD1 1QG6A 1R9TA 2OH2A 3ASVA 1QE3A 4CIWA 3VZDA 4C2BA 3I9LA 4X63A 3HBLA 2OWDA 4EMSA 4G37A 4U2EA 1A9ZA 3EAQA 3FSGD 3LPMA 1GU0A 1JUDA 3FN4A 3RT9A 1HQYE 2ZB8A 1NC1A 2GK6A 2FZGA 4C6SA 1T3ZA 3KS9A 1YXMA 2IZ7A 1AD2A 3QK7A 2I54A 4N6OA 3OT1A 1GSHA 1I13A 1KJWA 3R3UA 4MUYA 4RFSB 4OK3A 5BORA 3HA2A 5HSGA 1ATIA 3X1YA 2JAWA 3AIOA 3R7BA 3TZHA 4LJRA 2AZTA 4QICA 1E9CA 1D4ZA 3AVQA 3QUCA 4XWTA 3G0CA 4K81B 4JBHA 1JN0A 2BUCA 5KDLA 1W49A 3WLJA 1HWYA 3CEBA 3Q7SA 4V0KA 2ORED 1BGXT 4F5WA 3M70A 4PSKA 3HCBA 3O1IC 3F4KA 4INJA 1AG9A 3IB3A 2O2SA 3NHZA 5ILQA 1J0AA 3O21A 3G2JA 1YBFA 5IANA 2FPIB 2G9QA 4ESHA 1WNTA 1KJ8A 4F9TA 3QBDA 2XGPA 1Q0QA 4GRAA 4X5OA 4TS4A 1TLLA 1W96A 4V03A 5IKXA 5GZ6A 2EYQA 4X6UA 2NO4A 3VRHA 2WYIA 1T26A 4H08A 3JAMA 4RLFA 2ODPA 2R5NA 1A8UA 4U5XA 5KOHB 1XA4A 1GUAA 5FO1A 3T5MA 3RM3A 1UEXC 2PPVA 1GZHB 3EVBA 3EIFA 1IL0A 2BTEA 5DWQA 4J07A 4CEJB 4LJYA 5GZ3A 2E2IA 5FOSA 3KUXA 1ZG3A 3PWZA 4KVZA 3IURA 1QRSA 3FJYA 3WK4A 3BWMA 4JXXA 2FSVC 1D6JA 3WBFA 1LQTA 3DL2A 5KUTA 3UH0A 3SQXA 3MCWA 3JQDA 5AI4A 4RGYA 2I4MA 3BE4A 2Z2XA 1JU9A 4R98A 4A3BG 1HYQA 3OH8A 1L5HB 1A4XA 5BWOA 4UMDA 3ZU5A 4F9FA 4EMBA 3S4YA 1VE9A 1NQTA 4PBSA 2X7XA 2C3YA 5KJ1A 4ED9A 3RIXA 1RMQA 5ENVA 2Q4BA 1K86A 3SJUA 2EJWA 4RK4A 1N0UA 5HS4A 2FZCA 3ORRA 3KFLA 4NJMA 5FQNA 1NKVA 5CVJA 5JLAA 3Q3HA 1M2VB 3KEOA 4DV7H 2R5WA 3UAGA 2XVZA 1WXHA 4Q1AA 1ZC3A 4D7AA 4Z7OB 1YBVA 2YASA 2ERCA 3UMMA 1LTHR 4DIUA 1U9ZA 3B48A 1MABA 2B35A 2HH9A 4HBGA 3ICEA 4S1TA 5AM1A 5JUMA 1XZGA 2X4IA 3A9SA 3LT2A 5BQ3A 5AMXA 4RZHA 1QM5A 3JALB 3KTAA 1FZTA 3OWXA 3MWKA 4BO8A 4ZJYA 4ZZ3A 2AC7A 2QRVB 4PGAA 5CH5A 4UKDA 4FB5A 3TUJC 1RXIA 2ZR8A 4EJ2A 3BYZA 3O4FA 2PS3A 4S1VA 4B6EA 1Z4QA 3I09A 4OMFG 2OBMA 2JLRA 3HLKA 1H9AA 1NUPA 2WICA 5CDFA 1PZMA 2FZKA 3QBVA 4XUCA 2ZE6A 2H1SA 2RBGA 2C7VA 2F62A 3QQ5A 5DM1A 3HNRA 1K1SA 1YL5A 1RXEA 2O5VA 2ZSKA 3W6ZA 3I6ZA 3ET4A 4TWAA 5D5PA 4TYNA 5D3QA 1YCHA 2VJKA 3QEJA 1KO5A 1HG1A 4XEHA 4ZT2A 4M38A 3AVXA 4Q4LA 2GEVA 1E9AA 3Q2IA 5JDIC 2W70A 2CZCA 3OCYA 3GD7A 3VOSA 3NT4A 4PBTA 2RI1A 1BJTA 4KR0A 4TVBA 2PGNA 4FX2A 1MB9A 1GV1A 4GXNA 2FOIA 4QYSA 3INRA 1FDOA 4FHGA 4M60A 1OZAA 4JI8B 1ZU5A 3HBMA 5HYVA 1Z2PX 4IDQA 3SQOA 3UOGA 4MOWA 3OIWA 4E2ZA 3DA8A 3TLEA 1SQ5A 5JTTA 3QF4B 2BBOA 1N6HA 3ER8A 1M34B 2CD9A 3PNSA 3ZNNA 3MWFA 3GLFB 1XXHE 1ZISA 1QXSA 4TS1A 1E58A 3OOJA 4GMHA 3VOBA 3C4QA 3OLCX 2QBYB 3Q8PB 3ZVRA 1P4GA 4QC2A 4FIZA 2HTFA 4B35A 2P75A 1R5OA 2NU7A 3P0EA 1H23A 4N9QA 3PE6A 2ZTLA 1P7ZA 1F14A 2CQYA 1H6BA 3WGTA 1HTWA 3GTLA 4OQPA 4QOEA 1C29B 5FLXA 4DHEA 1DC7A 2ODAA 3GLUA 1Z3IX 2MYNA 1K3UB 4BEJA 4HUJA 5CU7A 1PKEA 4LOAA 3KZCA 1ZY2A 2BEVB 4HL6A 1L7BA 2QB5A 1EJ2A 4C0SA 5B58T 3AFOA 1XJ0A 2CNBA 3COWA 1QF7A 3FDXA 4QJ3A 3UYKA 1J97A 2H54A 4ID3A 4RSHA 1DJNA 3PFNA 5DISB 4K9PA 1JJIA 4JV0A 4FMPA 4ZO9A 3V2IA 1EE1A 1SKYE 4RTOA 3QA3E 2AA3A 2DP4E 2IEIA 4ZYYA 2XZTA 1H4SA 2DFDA 4BVEA 5HM8A 4KFCA 1U9YA 2ATCA 3TNDA 2DTXA 4J9LA 5A02A 1TTPB 4UUAA 1ZH6A 4GGOA 2YNMD 2X8WA 1QV9A 2OTCA 5F5XA 4IQ0A 3HRIA 3TW0A 2DM6A 4N7BA 1QR6A 3SEAA 4KXVA 4V2UA 2JJMA 4OXKA 3EEQA 5AKEA 3GT4A 5KTMA 1LDBA 1TW2A 3FZEA 2A5FA 4DL2A 4J16A 1E8MA 2DJIA 3WLIA 4GS5A 1J22A 1JDEA 4ZOLB 2C9ZA 3O82A 4UTOA 4OH7A 2VPPA 1ESCA 4JI6H 1UPCA 4EFKA 4OHPA 5DX8A 3EGOA 1UBNA 2IH5A 5K0JA 2Q2VA 3S0JA 2EWVA 5FOTA 3VU9A 2X0EA 4HN9A 1R12A 3M0EA 4TVIA 2GCEA 5C80A 1PR2A 4GZMA 2ZVPX 1TVMA 1Z0JA 3VHXB 4EYIB 3KEQA 1FX1A 3TY5A 4PLYA 4ECEA 1G7RA 4JDUA 1OAKA 3H5RA 3EF3A 4UCRA 4PLZA 2OB1A 3WLHA 3HXLA 3ADPA 2GPAA 4P4UA 2FWIA 2VF8A 3N3BC 1CVLA 4KH0A 4R8MA 4DAEA 3VMFA 2QJOA 5C34B 5AJUA 5B1YA 3L7NA 2VYQA 4FR5A 4P80A 1A82A 1M83A 3PSHA 3NG1A 5LYJF 2AT1A 2DHEA 3KPWA 1VIMA 3ECSA 1SD5A 3H0EA 5TEWA 2QRZA 1QYRA 2CLIB 2Q3EA 4RQTA 3EG9A 4TPKA 2V5VA 1L3BA 1WMDA 2VTDA 1AZTA 2V3WA 4UMEA 4EUKA 1ZVMA 3SAJA 3GJTA 1XJQA 1NYQA 1J2UA 2UYYA 3IO5A 4Q34A 2ZATA 1M2KA 4YMTA 5LB2A 3V33A 1V3UA 3D7LA 2PRIA 1C0LA 3JZFA 5HE9A 1Z6XA 2VQSA 1C0EA 2OYCA 5DLFA 3B7PA 2XB6A 4RH1A 3HRHA 5I9LA 5FFNA 4ECSA 4LI0A 2DFNA 2VVTA 3VVBA 3OIVA 3HSSA 3T06B 3OCCA 1VQ1A 4BV8A 1Z6ZA 1P19A 3G13A 4KWTA 3PEWA 1AS0A 3ZHYA 4JYZA 4G01B 1I8TA 2XMQA 1UIRA 1NJ8A 3IIMA 3S5UA 4HXFB 5F1PA 2GEBA 2G36A 1YIOA 5AR1A 3TOSA 1RJQA 5JJLA 3OEWA 3DF9A 4BV2A 3K6KA 3N39C 5K3DA 1BMQA 3B53X 3DCIA 1M2EA 4GKJB 3K1AA 3R5FA 4IMRA 3GBSA 5CXUA 5A2QW 1JDSA 3P97A 1PT7A 1N0WA 4FZVA 2JLSA 3TX6A 3QKIA 4UEJA 2XZLA 1M6EX 3QE0A 1K2VN 3PFIA 3HRKA 1RAFA 4QPDA 1S3SA 3QFFA 5PGMA 1AS2A 2X22A 4RD1A 3ESQA 1OY1A 3PEEA 4F93B 3UJ8A 2P9GA 3H87A 3U1TA 4MHTA 4C08A 1C4KA 3LQ1A 1V3TA 1Q74A 4KJZA 1EM6A 2H29A 3GB9A 2JA8G 1R4AA 3E5NA 1PFKA 1BRTA 3IELA 3ELYA 3GJRA 3K9NA 1GAJA 4CIXA 3KQQA 3UMRA 3ECAA 4DY4A 3LWZA 4GLFA 1SXGA 5ER9A 3EGIA 3WGNA 1OD6A 1CB0A 3NOQA 4B3IA 1TA4A 2VUMA 2IZ1A 4B0PA 3IUBA 3T5PA 3RLFA 2BFOA 5K5EA 3AOGA 6REQB 1HF3A 4FMDB 5COQA 5SY6A 3KL4A 2VCHA 4I7HA 5LQSA 1UJMA 3ZE1B 3MUNA 3DKRA 3H5NA 4PWQA 3AUUA 3CPEA 4I1PA 1I10A 2JFYA 3EIXA 3L8FA 1ZCAA 4FYWA 4BAGA 3A9WA 4BUZA 1HL7A 3SG0A 4B75A 1DAAA 2XUZA 1Y9EA 4M87A 1XLVA 3NHPA 3VH2A 4AN0A 5JJIA 5IP7G 4EY6A 1E0JA 4AS1A 5CT4A 3EUAA 4GEKA 3MAAC 1JMYA 2QUAA 3RFFA 3TQTA 3A05A 1RMYA 2YQ5A 3NBUA 2PVPA 4IDDA 1GAWA 1B8VA 1ZRSA 5L3SA 2FFQA 4GX0A 4ZT4A 1I14A 1F9AA 4YMHA 1ODKA 1QH1A 4HVAA 3G2MA 2YWBA 3IA7A 3RTBA 4LF8B 3GRPA 3A28A 1NVTA 5H81A 3ORFA 4U7JA 4JB0A 2WVHA 3QENA 3F3SA 5KFJA 4F4XA 5BRJA 3TQCA 1NSYA 3DEYX 3C3JA 4DTIA 1DTWB 5EJ6A 3HXTA 1REQB 3BFXA 2J4DA 3VR6D 5JXHA 3G8AA 1X86B 4JQCA 2VDKB 2HVRA 4MRPA 4CU5A 1X0XA 4IXNA 2GEDA 2WPDA 1YS1X 1GFSA 4RC9A 3DUWA 3PW2A 2OBFA 1TRKA 1J5EB 4JP1A 2Z1MA 3M5WA 3MCAA 3OJWA 4Q05A 4HFNA 3CE9A 2DAAA 3U17A 1Z37A 1XWWA 2R62A 3OY2A 4X20B 1NIJA 1M7HA 3QLTA 1E1MA 1Q11A 1QAOA 3FYUC 1L5ZA 1U28C 1HT0A 3Q40A 3EVEA 4KXYA 3O8QB 4YAWA 1ZH0A 3AIKA 1UBHS 1R8JA 1OWMA 3Q7RA 3MMNA 1Z8FA 4TTRA 3BCHA 4PCUA 4JEUA 4PYOA 1JAIA 1XTBA 1ZPDA 3OLZA 1WSWA 3IKTA 4GLJA 4Z1MD 2OUIA 1V7CA 3PPWA 3I6MA 1Y89A 4F4FA 2VP3A 1TKBA 1DKNA 3KXPA 5G4KA 2X42A 1XG5A 3BH7A 1B14A 5BWCA 1PW5A 2O8VA 5B1HA 3GIJA 5J5VA 1K7XB 5KFAA 4MO9A 4QXQA 2OCDA 3C85A 5H70A 2RHCA 4M0DA 2Z5VA 5LUBA 4J9NA 3QELA 5SY4A 4IV0A 1CQJB 3MJVA 4YLGA 1L9KA 1FDWA 2GFIA 4X3CA 3AVPA 1TCUA 3H16A 1RCTE 2EFDB 3K5HA 4DCCA 2HWXA 1XEXA 3IJPA 2VDPB 1USUA 2V6IA 4DCUA 5AK3A 3MPOA 3CWCA 2Z08A 3OPQA 1K9VF 2MIIA 3FGOA 1Y9ZA 2FETA 2QM7A 2A94A 2RAVA 3SXUB 4YQEA 4LC1A 1TCAA 3K16A 5HZKA 4XLTA 1SIWA 1AA9A 1NYTA 1H8EA 1PJ3A 3BGIA 5EIHA 1YJBA 3HB7A 5KT6A 1NJ1A 3AHJA 2AZ4A 3TTYA 3IESA 5KTTA 3GT7A 4B76A 3CEJA 1IM5A 1PJSA 4L9AA 1EGMB 5HIKA 3DZIA 1AE1A 1PNOA 2IY8A 4OGFA 1MVOA 2NZUG 2HL6A 2I87A 3FR8A 1MB3A 4IHJA 5A0TA 3RS7A 5DGDA 4R2XA 3GVXA 3L0SA 3WV4A 5AHXA 1MDFA 2R85A 3SZGA 4ECZA 1L5WA 2NT3A 4G24A 5JXJA 3L5OA 1KQOA 1LNQA 3L7BA 1E4VA 2B92A 4R0MA 3FCXA 4D0NA 3OPMA 3SVZA 3S8EA 3TO5A 1GO2A 5L3RA 4OQDA 1D9ZA 1JPJA 3DZDA 1SBHA 3BGDA 2QV0A 4YBZA 4OL9A 3RVBA 3F6YA 3WK8A 2ZJZA 3RU2A 1MW8X 3V00A 4E7PA 4OMCA 4OUKX 5JY1A 1Z08A 3HM9A 1LZLA 1YV9A 4QDZA 1NULA 4RSRA 3LJKA 4EG5A 5A6SA 3RHFA 3HWRA 4CUKA 2PL9A 3WAJA 2R8RA 4HT3B 5G0WA 1B4DA 2I2AA 4OJKA 4OH1A 1FP1D 2I34A 4E09A 4OA8A 4L2IB 3RJ5A 1WUJS 5ERXA 3FOAA 1UMDB 3H18A 4WOPA 1G8KA 4EITA 4EX7A 2IIBA 4EG6A 3ISJA 3SHWA 4G86A 4FMCF 1QAQA 2X2PA 4QXRA 4QL3A 1LLFA 3JZIA 3HJUA 4POAA 5EZ5A 3OQJA 4X62H 3FMVA 3R6TA 3K72B 4INAA 5MN5A 3D8UA 4B87A 2EKPA 2UVPA 3L0BA 5GQSA 3UAZA 2FRVA 1TIPA 4YQYA 4HX2A 2HCTA 2WTFA 2GFHA 3MUOA 3LDUA 5CT9A 3VBCA 4CVNA 4F06A 2CBXA 2AI3A 5IT4A 5EZYB 2BFAA 4ANFA 1YIDA 3R7LA 4PSAA 2IHTA 4ZOBA 4FQ8A 2OHXA 4HDKA 5IPFA 4K6CA 3L6RA 2W2MA 2ZRAA 2Q27A 2VJBA 4DRXA 3JTMA 1AK9A 4JSRA 1SELA 4HQ0A 2QSYA 1WSDA 1O75A 2B9VA 4B8WA 2V7TA 3IIIA 1F51E 4C3OB 4UVEA 1V48A 4AF8A 1XTQA 2WT4A 2ECQA 3N2GB 1OLSA 5AKYA 3REQB 2QM0A 1NBMA 4TM7A 3IJEB 2X4GA 3FOZA 1FUEA 4X6LA 1UIMA 2RK3A 2VH5R 3N76A 2INGX 4D9BA 3MJTA 4DN6A 1OXXK 4RDHA 4CT5A 4LX8A 1B0AA 4KGXA 5G0SA 4MAAA 1VLMA 4I50F 5L6LB 3IILA 5AUNB 3V48A 1KVTA 3AG6A 3MZ0A 4ZARA 4TYPA 4XYEA 1AOXA 1Z25A 4E12A 5EJMA 4J75A 4KIJA 2ZXEA 4ZHQA 1J0CA 3ZGOA 3T3EA 1NBWB 3MEQA 2UUBB 4XKJA 4K6NA 4WCDA 4K87A 2QVBA 3OY7A 4O08A 1M2OB 1UJCA 1IQUA 4UUMA 4NCXA 4G5XA 3Q98A 3GNLA 1DQYA 3FNIA 4B44A 3ETDA 1E69A 4ETSA 1ISGA 3LY7A 5FHRA 5BSEA 4Q9KA 1OJ7A 3KALA 1CR2A 5AQ1A 1OLUA 2JFBA 3IN5A 3RADC 1IXRC 5EDWA 1HT1E 1C14A 1ODCA 4RZIA 1W5AA 4WECA 2YBDA 2P2YA 3SU8A 2D4HA 2CLSA 4KR7A 4MB0A 1WJGA 2GSWA 1N4AA 3MD9A 3OX4A 1HETA 4IJ6A 3VTFA 2LV8A 2VDRB 3PRKE 4PCLA 4K2AA 4WW0A 1I2DA 4Y0AA 1U1GA 4OX9B 3ILVA 5I5UA 4QTYA 1TIBA 4OHWA 3ZEIA 1HTTA 4AAYA 2WQ6A 2XYGA 5EGSA 1HDZA 2ODTX 3C8UA 2QA5A 3U7QA 4AMVA 5I7UA 5FJIA 4PRYA 3LXMA 4F6RB 1AUQA 3PJEA 3FNHA 2GM5A 4YHHB 4OB6A 3T5AA 1VIAA 4DY6A 1VBHA 4J9QA 2BEWB 3H86A 3OZ7A 1ZK2A 4OM8A 3F9IA 3NHUA 3JS5A 5K8LA 5JEEA 1QONA 4ZPJA 3VNNA 3ZHQA 1TWCA 4ETIA 1ONBA 1Q15A 4CLRA 1E79D 4K46A 1WTAA 4BNHA 4AD8A 4QLBA 1Y8AA 1MX9A 1G8HA 1D2HA 3UO8B 1RQNA 2A0WA 2HQSA 3DP9A 5K3OA 1X1BA 4X61A 1M54A 1YRQA 1ADBA 1NC3A 3NTQA 3GEMA 1GKLA 4AUKA 4WLOA 2ZLBA 2V1UA 4ZDJA 2Q3MA 3I9V1 1VSQA 1WXFA 4OJNA 1N3IA 1LBTA 5A3RA 3GEHA 1T15A 4M54A 1ENPA 4O86A 4IDHA 2R8KA 2V4ZA 4LH7A 5I7VA 4C4RA 4GYWA 4R40A 5EERA 5JNUA 3DE1X 5JPCA 3O83A 4JV5H 2QZJA 3WQRA 3INYA 1SPBS 4CNQA 4XFJA 1TM5E 4EB6B 1JR2A 3IP6A 2WI8A 1CUWA 4AJKA 2FKLA 5LUAA 4BMDA 2AN1A 2A58A 2IEYA 3CUWA 1CDEA 3B9BA 2JAHA 3D0OA 3EOAI 4MVXA 4PSDA 1OW3B 1HFKA 1CF4A 1D9XA 3T99A 4BIIA 5LMUB 3IS3A 4MLCA 5IH7A 1KZ4A 1P8JA 4KXQA 4B2YA 4DNOA 4X71A 4W1QA 3Q4GA 5JECA 1G8MA 3CTPA 1C1XB 1YRAA 3IPRA 3HZZA 1P17A 1BWSA 4LGCA 4UUBA 3SJCA 3Q72A 2C29D 3I4MG 1OAOC 5CRIA 4D82A 4ZK2A 1AK2A 4J9PA 4RD4A 1N3YA 3T1VA 3FTNA 2H59A 4DWOA 4PZLA 4HLDA 5LFAA 1EKPA 1XT6A 3BXHA 4EHJA 2L69A 5ETJA 1CU1A 2GK7A 2LKDA 3BL5A 4U7CA 1N2XA 4QU8A 4MQ6A 4WESA 3K8ZA 2GM3A 4ZC1A 1Y82A 4I14A 2VJAA 1O87A 3A6ZA 3K09C 1WNFA 4GMKA 4H9GA 2A30A 4FLMA 4EP1A 1YGYA 3WJ2A 2VHEA 1SK9A 4JP3A 3KZMA 2OGUA 4Z3OA 2RBEA 3J7AK 2FZEA 2B94A 4WQMA 2GAAA 2OXIA 4ZT5A 2QRJA 1BGWA 2FLNA 1FSPA 4GBGA 1Y6ZA 3NTVA 2VOEA 3IQDB 1KK1A 4OQNA 2WB1E 1GPJA 3BJYA 3DWEX 4IM7A 3TLXA 4QO8A 3MR5A 3GLTA 4RTMA 5AOAA 3T1HB 1S0OA 4QLAA 1QTRA 2R6FA 2WTXA 1U3GA 2ATLA 5D7NA 2I1VB 3WIUA 2XGGA 1I94B 2ZZMA 2C2GA 2OD2A 4TZTA 1DS6A 1W46A 3USES 3OQHA 2JJ2A 4Q21A 3WQHA 1S8NA 4B3BA 1PFWA 3CVOA 3D8NA 5HJ2A 3DVAB 2DYKA 3N0XA 1GOTA 3KKNA 5EYPB 3PS9A 2PTGA 3MJ4A 1A8SA 1KH1A 4G84A 5J59A 1Q7CA 3MOIA 1SYXB 4FOOA 1KWKA 3HH8A 3OQOA 1AGNA 4I7EA 4YB8B 2H11A 3WK9A 1DAIA 1JQ3A 5LKAA 1E6EA 2BUAA 1S68A 3VSDA 3N2IA 4ZRNA 1VKRA 3LF1A 4G5YA 3E3NA 4LWQA 3DVLA 3QX3A 2IWHA 3EYYA 3MXOA 1F2DA 3O1LA 3FFBA 4CW7A 1SVUA 5D1PA 1XMPA 1XQYA 1Y3IA 1MC4A 3IJ5A 4MTDA 1SCQA 3P5BA 3M6VA 2WTEA 1EUCA 5M5BA 1TIKA 2EC5A 3EW7A 5K03A 4NXMH 1NQOA 2ZUFA 5KWIA 4EJMA 3AVTA 4Q16A 1ZGGA 3GDEA 3ZV5A 1GCAA 1CEEA 1U2GC 4DR5H 1P5HA 1L4UA 3WZ2A 3JSNA 5H3LA 3WYFA 1ZGHA 2WHRA 2QW1A 5I7OA 4Z9FA 2QN1A 3WGHA 4P32A 3W3AD 5CEJA 4CMHA 13PKA 3OHSX 2B63G 3CUSA 1KI7A 3G8YA 2V97A 2YOHA 1YB1A 1LDNA 2IXFA 3BIXA 2XB2A 1R8SA 2XQVA 3DV9A 4CKBB 4LH6A 4M7EA 5CPFA 3BD8A 4UCTA 4BKRA 2P27A 2J4CA 1WBBA 1XUOA 4EO4A 1YQTA 1PWZA 1NQWA 4AYWA 2HPAA 3KSZO 2DUWA 3VDQA 4W82A 1UFQA 3WWZA 1KFJB 5EKDA 4HLUA 4UE6A 5AVRA 1V6CA 4UMVA 4TL6A 4ZRDA 1UBFA 4LVNA 1QIDA 3JX9A 3WO0A 4TSFA 3HHEA 5FR1A 2IX3A 4JYPA 1BHO1 4MVJF 3M8KA 4Q47A 4B0OA 3M7IA 1L7MA 4G1BA 1S2NA 5TPZD 2Z57A 3LY8A 3F74A 2W22A 3RKRA 3TI9A 4XYLB 3KZXA 3LCJA 1SA0A 1ADCA 2I6GA 3JQ9A 3O6VA 2Z3ZA 5KFBA 3NWOA 2OO7A 3K0CC 1GUDA 1O7JA 3IGFA 4AU1A 1O95D 4KH1A 4LF5H 1WBDA 4RM3A 5EINA 4EUFA 2VHUA 2ZI9A 3BXZA 4P4SA 1HORA 4DDWA 4KQGA 2J9RA 2Y0BA 4YAKB 4BUJA 4OP3A 3FLEA 1TVEA 4EHAA 2GDJA 2YBEA 5EFOA 4RIIA 3GVPA 3N0VA 5CFQA 4LNHA 5KFQA 3L0OA 5EUBA 4LHSA 2J7PA 5ALYA 2O54A 1KYIA 2OORA 3NETA 2I6QA 3WOVA 3GLGE 4BUCA 4XCXA 2RJ3A 3ZY6A 4UDYX 2GARA 4EGQA 4J9KA 1BXZA 4NKRA 2IXBA 2V7WA 3KJXA 4YRFA 1DXOA 4NH0A 1BS2A 4EPXA 3MTQA 2H5JA 2AGVA 5J23A 1BDIA 2GZAA 1F8GA 3IVGA 3PR4A 4ZVRA 1D0SA 4NS4A 1YJQA 4YAEA 2UVUA 1F7UA 2VHCA 2QZZA 1E2BA 1O4VA 5GM2A 1BHQ1 3IVMA 2BD0A 5JCOA 3LULA 3QHAA 1CEQA 4C0AC 1P7YA 2ZRBA 4OQ4A 1JGTA 1P1KA 3S5JA 1P9LA 3I8OA 3PQ7A 1E6KA 5AK4A 4HYTA 4QFBA 4PYRA 5DULA 3I5AA 3RJTA 2H06A 2MMCA 4DZTA 1VIVA 4A2WA 4N65A 1W1IA 4B4DA 1CSEE 2VDWB 3WFZA 3KKZA 2A9VA 1FMCA 2X86A 1JHVA 4OQXA 2ZULA 1ZNYA 5KFTA 1W581 1R9JA 1DO0A 1W6UA 3LC0A 2QI9F 2DH5A 5D84A 4KDRA 3K0AA 3LBIA 4O4HF 4CMEC 1ZEJA 3IAS6 3BICA 2JGEA 5EE5B 1JHXA 1XCOA 3NP7A 1BCRB 1J8VA 2CFTA 2VT3A 2OXRA 4O4LA 5H8WA 1YZHA 4EARA 3GW8A 2AF3C 3ZI4A 3ZS9A 3TLYA 4N5LA 1HRKA 2NZYA 5LP6A 3VTZA 2GUGA 1CRPA 4BBJA 2NU9A 4GXTA 4MIYA 2PZBA 4JHXA 1N5KA 1V6AA 3UEOA 4BVJA 1Z0FA 3IR6A 1OT3A 2GDZA 3QUQA 2ECFA 3TQSA 5ITZA 1NVGA 3ZDZB 1T94A 4NENA 4UU1A 5LN1A 2WE6A 1GNRA 3E7DA 2LP4Y 5H68A 2PX4A 3AM4A 2VDLB 1AVTA 3Q7EA 1RJWA 3HKEA 3PFKA 1HR0H 4KQ1A 5FTLA 1CJSA 1PZGA 1U1DA 5EWMB 5DHAA 3UFBA 1P16A 1Q77A 3C74A 2NO1A 4FMCB 4XTCS 2C5EA 4V39A 5JSKA 1UMCA 1QE0A 3CRRA 4I5FA 1KU0A 4D0RA 3JQFA 2FYTA 1P4RA 3O8DA 3GBVA 1MIHA 5CR9A 4R9VA 3T54A 5L3QB 1VDMA 5CMLA 2DFTA 2F59A 5CM9C 4UHEA 3I9JA 3KQVA 3FMFA 4HYQA 3RYCA 3QF7A 3J7TA 3DTGA 4ZVQA 3CS3A 2HWYA 3K70B 2VHWA 1R0KA 2WU8A 1VPLA 2HJ9A 3U3RA 1CUHA 5TQVA 1OWLA 1LRKA 3GYGA 2IS1A 5EAIA 3ITKA 4LE1A 3WGVA 2FFHA 4FZJA 3R7WB 4UDNA 3RGXA 4AQDA 1O0SA 4M8KA 3D5TA 1EVYA 5TQ2A 2XMRA 4RCVA 4Q02A 3ZW9A 2PRKA 4AG5A 1UC5B 1JDTA 1FEZA 3VC1A 4G65A 2UZ3A 3D9QX 5FTNA 3RD5A 4N5HX 5EUMA 3DKIA 4XUGB 1A9RA 1FQOA 1Z2CA 2ZWAA 5A2GA 3TZLA 2J0UB 1ES9A 4QU9A 4TXMA 3FUUA 2C99A 1KKMA 2RGNA 4N3AA 4RA9B 3WMXA 2WSYB 2XEDA 4CMIA 4BEVA 4DA7A 3ABSB 3JVIA 3K0EA 2O05A 3ZK7A 3RUIA 4XPZA 1KC1A 1D6NA 1XQWA 1NDUA 1XLTA 1K9SA 2NUPB 4CF6A 3BRSA 3BRWD 4K2HA 1Z6AA 4RAOA 3BIWA 3KOYA 3KQLA 2JHPA 2WA1A 3I4FA 3ZZNA 2ZE5A 2MU1A 2X5NA 3H3VH 1I6LA 4X7PA 3PDCA 1NJ6A 1JL3A 4X97A 2QYZA 2CNQA 2IODA 1THMA 1U5BB 1C80A 3B2EA 3EXG2 1DKQA 4JD5A 3VR6H 1PD0A 1S0UA 1VTKA 3L8GA 5CAEA 3P26A 4DUPA 2VHQA 1N6RA 4IUCS 3ZR4B 1ZGJA 3OIFA 1VL5A 4TZKA 3AZOA 1LGYA 4GM0A 5A9SA 3ER6A 3G6WA 1SOAA 2AFIE 3I5YA 1K08A 4MRAA 2D5CA 2CNVA 3NHJA 4BKMA 1X1DA 1JLLB 1QKKA 1YJCA 3BMCA 3R9IA 5TGTA 4JBGA 5F7OA 3LPLA 3FETA 3CZAA 4NE9A 1ZZGA 3FDSA 4HNAA 2B9EA 2A84A 2KJQA 2CEKA 2WAQE 1JR3E 5E6SA 3NALA 4EY4A 1N0VC 2H7YA 3IV6A 2PJUA 5DRTA 2GKOA 1YO6A 4K6MA 1ZK3A 4JGGA 3EGDA 2PZGA 3EPPA 1ZQ1A 1JB9A 4DR3H 3K9GA 1SCAA 1R18A 5AM5A 3VYVA 2QEQA 1H8ED 4QUGA 3F9CA 4S2EA 5BPFA 3G6YA 4X65B 4BFSA 4QE3A 3NS7A 2PANA 1MD9A 1S3GA 4F92B 4I4TF 3GNQA 4OBEA 4PCAA 3NVAA 4V0OA 5ALDA 3UJPA 2AJDA 2Z3WA 3CWQA 3SSOA 4ENTA 2H8GA 2Q9BA 2GVNA 4WHMA 2ZB4A 3RJ0A 3FA2A 2FUNB 4A3JG 2MSWA 1A27A 2IOHA 1L5YA 3QY9A 1JDJA 1PT5A 4YRSA 3D6JA 2ZT6A 3VKHA 2RJOA 5F4ZA 1TPZA 3IDOA 1EX1A 4BECA 3V7YA 2AW5A 4XIFA 1P44A 1CP3A 1NLUA 4P58A 4HCJA 3M4XA 1Z63A 4TZ6A 2ZGVA 4E1AA 4IKOA 1XTKA 4CM9A 1KS2A 4D8VA 5L40A 3KXLA 4PQYA 1KZ1A 3E2MA 1MX5A 1Q0RA 3A7DA 5BN3A 3R5XA 4Z1OA 3RAJA 4LQLA 5L45A 4Z86A 4E1BA 4Z9BA 4DG8A 3TY8A 4EY5A 4PLWA 3GRUA 4TLAA 5LBUA 5T64A 3O03A 4F8YA 3DMPA 3DLAA 4B43A 4L16A 1A5SB 1UQRA 5I9IA 1YHYA 2HLHA 3LD9A 1IVSA 4PVDA 3A2MA 2M2IA 3DF7A 1A7KA 4PU0A 3MRXA 2WG0A 1JSCA 1EAYA 4OO3A 4N76A 4X1IB 2GHRA 1DBSA 2FMIA 4DV5B 3NORA 2YS7A 3TMKA 3ZCSA 1BZYA 2YV2A 2WFMA 4GI1A 1YCDA 1BGVA 2HHCA 1L5GB 3O9MA 4A03A 2ZSUA 3M6UA 3VYRB 3A37A 4QDOA 1O6CA 1BO6A 2FSVA 4CKCA 1KF0A 2D74A 2XB9A 1RJRA 2PAAA 1HT3A 1T1IA 1PV1A 5TB5A 1R0ZA 4OMUA 1HC7A 3JRXA 1R6DA 2H0AA 4R54A 3KOXA 1YR8A 1NQAO 1MA3A 1WAMA 3AI2A 4FLEA 2J4FA 2XCIA 2FKAA 2B36A 5KHOC 1N92A 1LDGA 1EJ0A 4DA6A 5DPMA 4OIMA 3H6HA 3HFRA 4LCEA 2HMUA 4YV1A 1E2FA 1JKIA 4C0QC 4CFSA 2XQIA 4WASA 1RK6A 4OXRA 3PC2A 4BV9A