3KALA

Structure of homoglutathione synthetase from glycine max in closed conformation with homoglutathione, adp, a sulfate ion, and three magnesium ions bound
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
470
Chain Sequence
APPLFDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLSRTKNADEFTSRLLDIHSKMLQINKKEDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQREGGGNNIYGDELRETLLKLQEDAAYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISSSYEGGVLPGFGVVDTVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords homoglutathione synthetase
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
total genus 160
structure length 470
sequence length 475
chains with identical sequence B
ec nomenclature ec 6.3.2.23: Homoglutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kalA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kalA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kalA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kalA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kalA04
4C5AA 1CS0A 4L1KA 4C5CA 3LWBA 1JDBB 2W6QA 1GSOA 1EZ1A 4O7NA 4IZOA 1IOWA 2J9GA 1KJIA 2VR1A 4ZI7F 1C30A 2W6OA 4O7RA 2R85A 1Z2PX 2R87A 1M6VA 1Z2NX 3AX6A 4FE2A 4FFPA 2NU8B 4MV1A 2Z02A 4NYEA 4M9UA 2C00A 2X0SA 1Z2OX 4MA0A 4O83A 1W96A 2FPIB 3R9RA 5J2UF 4O4JF 3VMMA 2YZNA 4MA5A 4MV7A 2GPSA 1BXRA 1GLVA 3RV3A 1I7LA 3KAJA 1PX2A 2I87A 3TIIA 4HNUA 5JQWA 1BNCA 4YAKB 3VA7A 1DV2A 1IOVA 4O84A 1M0WA 2XCLA 4Y8VB 3OUUA 2R7NA 4MAMA 2VPQA 4DLKA 4ZHQF 1WR2A 2I80A 4FFLA 4FGRA 4FFMA 4HQ6A 3SE7A 3RUPA 5GONF 5CA0F 4O4HF 2YZLA 2GLTA 5JH7F 4QSHA 4XYLB 2QK4A 5JVLA 4MV9A 1JLLB 2V59A 5JVDF 2FB9A 2R82A 3TQTA 3MJFA 1AUXA 2YS7A 4XX0B 4O81A 3Q1KA 3WNZA 2WYOA 3N6RA 3WO0A 3WO1A 1C3OA 4O2BF 2GQSA 2Z04A 4O82A 1EYZA 1AUVA 2W6MA 2VQDA 3TW6A 3GLKA 4MV4A 2V58A 3ORQA 5LA6F 3ETHA 4IHJF 2ZDHA 1SCUB 1M0TA 4O4IF 3U54A 4YAJB 2V5AA 2W6ZA 4TUYF 1KEEA 1VBHA 5H80A 4IIJF 2OLSA 1JKJB 1KJ9A 4EGQA 2CNUA 3KAKA 3JRXA 3U9SA 4ME6A 3TIGA 2PN1A 4TV9F 4I55F 4ZOLF 5LYJF 4FFOA 1KC7A 2CZGA 2DLNA 1VBGA 1I7NA 4FFNA 2YZMA 2YRWA 4XZ3B 5D8DA 2I8CA 5C1PA 3U55A 1E4EB 2NU6B 1KJJA 5LXTF 5EZYF 4I4TF 2ZDQA 1KJQA 2PVPA 2YRXA 1GSAA 3DF7A 3MWDA 5CAEB 5JQGF 4FU0A 2YW2A 1OBGA 4O7WA 4FFRA 4EG0A 3KALA 5C8YF 5DMXA 5HBRB 4O7TA 4E4TA 4YBZB 2YL2A 5HV6A 5KX5F 3U9TA 2FPGB 2NUAB 2YS6A 3VPBA 4O7YA 2R7KA 3K5HA 3RFCA 1KUTA 3N8DA 1DV1A 4O7LA 4WBNF 1KBLA 3JZIA 1PK8A 4MV3A 1ULZA 1CQIB 5CB4F 2W6PA 3OUZA 3VOTA 2FPPB 2P0AA 1DIKA 3R5HA 5J2TF 4I50F 4XYMB 1CE8A 3BG5A 1A9XA 1B6RA 3Q2OA 5BMVF 1EUDB 4DIMA 2DWCA 3HBLA 2DIKA 3HO8A 3RV4A 3AW8A 3K3PA 3GIDA 4EGJA 4HR7A 3HB9A 5LP6F 3JRWA 1KJ8A 2HGSA 1JDEA 2R84A 2CNQA 2PBZA 3R5FA 2QF7A 2NU7B 2W70A 4O4LF 2IP4A 3G8DA 3QFFA 1T36A 1E4EA 1W93A 1GSHA 3G8CA 2DZDA 2FP4B 3NUAA 1A48A 5BPHA 5CA1F 2GPWA 2ZDGA 3TINA 2R86A 3VPCA 5C1OA 3E5NA 5KKNB 3K5IA 3UFXB 1EHIA 1VKZA 1CQJB 2GQRA 4C5BA 5BPFA 2R7MA 4O7SA 2YWVA 5LOVF 2SCUB 1B6SA 2YYAA 2W6NA 2YZGA 3V4SA 3ORRA 2HJWA 2XD4A 3R23A 4O7ZA 1GGOA 3R5XA 3ETJA 3LP8A 4TV8F 2W71A 4YB8B 4MV6A 3V4ZA 4RZQA 3KREA 2NU9B 5IYZF 4O86A 3I12A 4O7VA 4MV8A 4HNTA 4O2AF 3JZFA 4YJ2F 4HNVA 5FNVF 3MWEA 2CNVA 1EUCB 1OBDA 4YJ3F 4ZQIA 2R7LA
chains in the Genus database with same CATH superfamily
1ZSVA 5B2ZA 3T99A 1USIA 3EGDA 2GFQA 3HXLA 4M1SA 4O4IB 1QF7A 5GJBA 5IN4A 1B76A 1KZ4A 1OD6A 3PNOA 5JNTA 1C7FA 3NANA 3VHLB 4GM4A 1G8AA 4CMDA 3JQDA 3S1LA 4TYMA 3EEYA 3C4JA 3A6FA 5D1HA 2PNFA 1FS5A 4Q7EA 4J1QA 1EH5A 3JVVA 5EWMB 2PR2A 4Y2HA 1FL9A 1I33A 4M9UA 3CF6R 4G0NA 5HGXA 4UUNA 2OFXA 3UMCA 3HOYG 5KT4A 1UOEA 1T2NA 1R6DA 2Z1MA 1JPVA 5FNVA 5NLLA 3GVIA 5FJ8G 4KP7A 2JATA 1Z4QA 3PCXA 2OMKA 1YJAA 5BN5B 5DLPA 1KDRA 2A78A 2IY7A 5JE8A 4N5NA 3B5JA 1OF1A 5LIRA 1NZFA 3ZE0B 5IT9W 1XNJA 3IMFA 5JNUA 3S0JA 4JL6A 3IBCA 1KFBB 1OXTA 3P32A 3RUPA 5B4VA 3EPLA 4NULA 3JASB 1NX6A 1VKJA 2LPMA 2AGVA 1P2SA 1E3MA 1EM8B 4EFBA 4CM8B 2FE4A 1KPHA 1NVEA 2Q5EA 2B0CA 1Z7YA 5U1PA 3RSQA 2KHZA 1QWSA 3NKVA 1T9KA 1JT9A 3JY6A 2P5YA 4ZCSA 4O3SA 5AW7A 5C3UA 3Q1LA 5LBIA 3DZBA 2ZJAA 2XVZA 4QLAA 4BXOB 1MX3A 4OM8A 2VCHA 3ORQA 5HKBA 1JG6A 1UAAA 4CKWA 5A3RA 1MZBA 4XKJA 3T7KA 4DL6A 4YP3A 2Q8QA 3HFJA 4R1OA 3IP5A 4TUYF 2DQYA 1R1DA 1AG9A 3BTVA 2W4MA 2RG7A 4WVLA 4R5HA 2ATIA 1U02A 4IXDA 1IRIA 1ZNYA 2BGUA 2I2WA 2RMKA 2ZRAA 1YMUA 3CZ9A 5JH7A 2Q21A 3EXG1 1E0JA 1NVMB 4GUDA 1X80A 1VBKA 1ZM4A 1PYDA 1PDVA 5C35A 3GA0A 5C8VA 4R98A 5BWCA 4F8EA 5CFOA 5KG2A 1F1JA 3S8YA 1AU9A 4ZQFA 1DRVA 2VC2B 3PXCX 5KFAA 1F51E 3NORA 3N8IA 1NL3A 4I4IA 1DXYA 3FHJA 2QRZA 4FMCB 1KC3A 2MYNA 4FYWA 2IE8A 2VJOA 4BY9E 1KJYA 1QXSA 4F1JA 2JLRA 2IIQA 1U99A 4L8VA 5DYWA 1T6YA 3AERB 1N36B 3RYCB 3TAXA 1FFBA 5A71A 1WQ4A 3PCTA 3C6QA 1VCOA 1EFLA 3EOZA 2FK3A 3VISA 2R8GA 2B4KA 5DH9A 4LSZA 3ZZTA 1FYWA 3IPLA 1Q3TA 2VF2A 3A1CA 1IVSA 2WF6A 5SV2A 1ZJYA 2KYRA 1IBMB 1A98A 1N7GA 3TX2A 3L0DA 4IS2A 3QSYA 3LKVA 1XA3A 1XQWA 4OGKA 3N58A 3EX7C 2ID7A 4BPBA 4MGKR 2PBZA 2G9QA 2DBYA 5CLFA 3HZHA 3NP7A 3C39A 1DADA 2WD7B 6ADHA 3NW9A 2I2FA 1VBMA 4EJMA 5F5LA 1KQFA 3V32A 4J4HA 1EM6A 4C6TA 5D51S 1N5LA 1EKPA 1AV7A 1XCMA 3HR8A 5DHRA 5HFNA 3E15A 3P2MA 4GAEA 1SUFA 2YXDA 4CT4B 2Y27A 3I5XA 2PGLA 4BMPB 3LPLA 3WZLA 2C2XA 3MMXA 3H13A 5KG5A 1SULA 2OXIA 1PGJA 3QOWA 1HEUA 4F3NA 4O2AF 2PJDA 5IKEA 4QYIA 2OD9A 1KEPA 2DP4E 3FPBA 2IK8A 5GJCA 4PGGA 2WQZA 3QYPA 2PV0A 4NHEA 2W0MA 5CA1A 3HKDB 3QBEA 4C5CA 1J5PA 5KFSA 5B2EA 3W4JA 1T4CB 5LQDA 3LDGA 2EJ3A 1N6HA 3C6BA 4M8IA 3SBEA 4B31A 1WMEA 2JCGA 4R2JA 4TX1A 4QPPA 2PUGA 3VYWA 5LMUH 5ILGA 4E94A 1ECGA 2ZS9A 3O8QB 4RE5A 5I4BA 4YJGA 4HNSA 4XQGA 4N5DA 2R87A 3I8OA 3JPWA 3AVUA 2FUNB 2NVUB 4DV0B 2G1PA 3WWHA 1EKFA 4TTQA 4ZMBA 4DCTA 5FA6A 2ENUA 4CEJB 1SCDA 4BBPA 4ES6A 4ZJYA 3SPXA 3H3XA 1S9DA 1TCVA 1JFRA 5DLFA 2R65A 2YHIB 4ZAVA 2A5JA 1EGHA 5T57A 1WY5A 4UTRA 2W90A 4D0LB 1GKYA 4R16A 1T2UA 1V2HE 1C3JA 4RAZA 4RACA 1IONA 2Q4EA 1ZICA 2P35A 1JE0A 3KP1A 3EDOA 1RQRA 2RGUA 2WT9A 3H0EA 3JQAD 2QOEA 3KJXA 3QKRA 4LFCB 1X1BA 2QM8A 1YRYE 2OO3A 5IJZA 2V4MA 1YIAA 5FPTA 3KQMA 3COPA 1QH9A 3MBIA 1CVRA 3DEYX 3CQZA 1P5HA 5CXUA 1AK1A 4EGSA 5IS2A 5IJAA 5K09A 4LXGA 5J4VA 5AKJA 5BW6B 5KC8A 4W82A 4ARSA 3MIIA 3AF0A 4CKEA 5JWHA 2CLLB 2PH3A 1VKHA 1AKUA 4QXAA 2PL9A 1YRQA 3U7QB 3CUVA 2AK3A 1UADA 4GWLA 4JI4H 4QUAA 3KS9A 1EGMB 1GN9A 5KFCA 2ZB4A 4AL4A 4Z9AA 2HIXA 4PN3A 1T8WA 5JECA 5LLSA 4F4WA 3QXHA 5BUQA 1DBRA 2G5PA 4B8WA 2HQ1A 1Z8HA 1TXGA 5DYGA 4DSOA 4UOZA 1XCPA 3MWLA 3G6KA 3GG2A 3DC2A 5ALKA 3SGLA 1U0OC 3I4CA 1MJGA 3IYLW 1SBZA 2GJ9A 2NU6B 2YVLA 5I6DA 3N07A 4TKMA 4K6FA 1PN3A 3FOWA 1A27A 4A93G 5ALWA 2WG0A 3K2IA 3RVKA 4BGVA 4JI7B 5ALQA 1XZEA 4CG0A 4QPDA 1ACLA 4M7RA 5A0VA 2XHEA 1IN6A 1SJ9A 4ALKA 4EJSA 4PPNA 2XWPA 1QRRA 5EKSA 2VAXA 1U2SA 4AJLA 3WBFA 1K9VF 1U0TA 2FFAA 4EB6B 5B55A 2WSSD 5JV5A 2GZDA 4F4CA 1K98A 3LHFA 1RI1A 1KO5A 1E0AA 5LWHA 1J8QA 1MABB 5KQSA 3LT4A 1W75A 2PX4A 5EERA 3NDJA 3H19A 1M83A 5BOSA 3W6ZA 2NO0A 3KOXA 2X1VA 5AXBA 4O4JB 5KYVA 1DJLA 1UJCA 2AFVA 3BXXA 4DIEA 1PJZA 1RHUA 2R48A 1P77A 3C7KA 1D04A 1TEZA 1C3OB 2FZCA 1JSCA 5MN4A 1ADYA 1QF9A 3P5SA 1V48A 3K5IA 4ZXFA 1JH8A 4P7JA 2JFPA 1QPBA 4MQLA 1NPTO 4C5BA 2L69A 1Q16A 2C5EA 4QC2A 4BV8A 4JQOA 3TKYA 1H1DA 1ZJZA 1EWVA 4RD4A 2ZRIA 4R41A 3VM6A 2WWTA 2GPBA 4MINA 1FXSA 3PGJA 2OXRA 4YY3B 1WPGA 4RF3A 3HHPA 5JD5A 1T2DA 1JQJC 5BSGA 3SHVA 1O94A 4MS4A 4DREA 4B3SB 3EYAA 1QO7A 3L8DA 1UKBA 5H83A 5KFBA 5EMNA 4QJBA 3OE4A 1CB7A 1XTJA 3T6KA 1TEVA 5JLJA 1TYZA 4FFBB 4ZOBA 4DY6A 3NH9A 2JASA 4JA2A 1KJIA 4RDIA 1JIIA 4GLLA 2G6BA 2H0QA 3I9V6 1KVRA 2PWAA 5IHXA 5EWLA 4GZ3A 3BA8A 4KLRA 5HBGA 2C5HA 1PJTA 3MMZA 1FNMA 1J8FA 3TR0A 3VNBA 4NK5A 4C78A 4PGHA 3DOUA 1BN6A 1MXHA 4CCWA 4IIUA 4WMLA 4RHCA 3FVQA 3FBGA 4JLPA 1K0UA 3ASZA 2JCSA 1FVXA 3R40A 1ZHHA 2AZTA 4BWVA 1JPNA 2J1LA 4TWZA 4H7DA 5BUSA 1K89A 1AHNA 1ZW6A 3BEDA 1P1FA 1E0DA 1AV6A 3SJZA 4ADSG 1NW8A 3KHRA 4G5FA 4NFSA 3IPAA 4DNQA 1N8KA 4PZ9A 4O2RA 2ZT7A 1QP0A 2IZ5A 2XIJA 2XNSA 1ZUIA 2D2VA 1E79A 1IQPA 1MN6A 4Q18A 1QC5A 2HWYA 4LC0A 4CZ2A 4XYLB 1RZUA 1RT9A 3OOHA 5JATA 2DKNA 5EZ6B 2LKCA 5D6NA 3LQYA 4JT2A 1XK7A 2DSNA 3AJ8A 2AMYA 4DDTA 2RBGA 1F3OA 4ZU6X 1RCTE 2Q5CA 1W1UA 5EXTA 5CCBA 1JILA 2FN4A 2ZIGA 2RDIA 2OVBA 1EXNA 1NBOA 4K6GA 3DOHA 1TMOA 1KU0A 2OV4A 2V5AA 2PD6A 2JJQA 3CLUC 2VTBB 1NSTA 1DL5A 3LBYA 3RYHA 4KPUA 2MSLA 3JQ8A 3I8SA 4M0UA 3SM9A 5JZ9A 1D2GA 3WHPA 2CVHA 5EIOA 4IAJA 3CX8A 3KVYA 3Q0IA 2B4AA 1Q1BA 4IH4A 5AKXA 2WU1A 1NW7A 1YJ8A 5BYKA 3QYFA 2G17A 2Z6UA 4EKNB 1OGYA 4FQ7A 5IHPA 3DDCA 1EBBA 3CN7A 1QE0A 4OFZA 1KJQA 2JK0A 4IGFA 1XLUA 2ESRA 3T9FA 5KNDH 4I5DA 5DXAA 3S2FA 1G21E 4B8YA 3QLEA 1D09A 4URWR 4PNEA 2YHBA 7ABPA 3D3EA 1ACJA 5SZIA 3EN0A 1WDLA 3ZE7A 3CLVA 3DNFA 1RKQA 1ZP6A 2ASVA 2V9CA 3VJLA 2OHXA 4UOQA 1HORA 2P0AA 2BR3A 5GWXA 1A9XA 1A0IA 1GG2A 4CW7A 5IJ9A 2I62A 1UZMA 1DQRA 5DEIA 2P6OA 3PP8A 4ZVPA 3NAZA 2I7XA 5JANA 2D0OB 3BFPA 1U4SA 2REBA 3AR2A 1WD7A 3C43A 1FDWA 2ZI3A 2BLNA 2Y1CA 1RKUA 4ZQGA 1WRBA 1U4OA 3S1AB 3RF2A 3NUAA 3DE5X 1AN9A 5FOWA 1WAMA 5FD8A 3FW1A 3IV9A 4F91B 4XGQA 5ISMA 5BPFA 2VAMA 2QPTA 1C8KA 2B3DA 3UWDA 1RK5A 3W5UA 1DE0A 1A50B 1QU2A 1RJGA 1V9SA 1HEYA 1D1TA 3QVUA 3IOMA 3RSGA 1LBTA 1SZJG 4M1YA 1HYHA 2L19A 1N3LA 4M7WA 4A36A 3IFSA 2ZJYA 4GECA 1N6NA 3DTNA 2JIRA 3HZOA 1S02A 3H40A 4LXHA 4PC7A 3A9SA 5HWSA 1IEQA 2G9UA 3M6XA 1OHHA 3R3VA 3FZQA 3GRYA 3A4MA 4DYVA 2HR1A 1XDGA 5TEVA 5EUMA 3T12A 5KTRA 2GTPA 3O73A 3I5AA 3RAEC 3GBPA 2C97A 1DDGA 4R3NA 1XTBA 1PJAA 1ISSA 1CUZA 1XU9A 4N18A 4QLBA 3HL0A 1I6LA 5AUPB 1TAUA 3I53A 3V4FA 2D54A 3TXYA 1NZJA 2H57A 5K2OA 3DB2A 3FTEA 3SR3A 2A5YB 1T1SA 5BWBA 2GDZA 4HNHA 2W2LA 4J0IA 3JWJA 1KEZA 2R8RA 3L01A 1MJ5A 3PXAA 5K99A 3WLOA 3S2EA 3MINB 1XHEA 3CT4A 2M6KA 5HRCA 1BDJA 2WQ7A 1FPQA 1SG0A 4HJXA 4WV3A 3PC2A 4JGBA 3MB5A 1G8GA 1BHQ1 3NT5A 5D2CA 2JLZA 1OI3A 1C9DB 3S7ZA 5EE5B 1K4MA 1ZI9A 2WG2A 5I7FA 3REGA 5K3BA 5EKUA 2R8YA 1ZIPA 1H66A 5G1NA 4WCDA 1WP9A 1Z0DA 3ZDQA 3V34A 3ANLA 1E3SA 2NSDA 2QD3A 3UJHA 2ZIFA 2QTHA 5CVUA 3GLIA 3BWBA 1LDMA 3D6MA 1BH6A 4KH0A 3SDBA 3UPTA 1W9HA 3AKEA 4GHWA 3IEMA 4TYWA 5FBWB 3SVZA 5IH7A 5CB6A 1B16A 4WKBA 1O87A 3ODGA 4E03A 3HCNA 4LVNA 3VZSA 2CV0A 3SIPA 4GX1A 4ETWA 4H7PA 5HIIA 2JFZA 4Q7KA 3VKWA 4UJ5A 1BVYF 4V0OA 3FF1A 1ISHA 3UBTA 4YB8A 4J1TA 3RVBA 3T94A 3AY0A 2B9EA 2P67A 3OZIA 3EXFA 1W49A 4PZDA 1B0UA 4OVKA 3DAFA 4F56A 3U55A 3WSVA 4XVHA 4REQA 3G6VA 3O95A 5AJXA 2VDNB 3L40A 1Q0RA 2CMHA 3SEZA 3RK1A 2IZOA 2I66A 1HT2E 2C2DA 2F6RA 1E9BA 5DMXA 5K4AA 3ABOB 2XGQA 3O0DA 3U4MA 2C4HA 3A6JA 2WB2A 3RVNA 4YK7A 1VTKA 1PGQA 3GB8B 3OX4A 4NK4A 3MTAA 4CV1A 3WYCA 1DC3A 4BX0A 1ZLYA 3MLEA 4KAFA 4BTEA 5K8UA 4UBOA 4J76A 1NM5A 2VSQA 4S0XA 2O1SA 3GCGA 1IHDA 1B43A 2EJWA 3EOBI 1VGQA 1HDEA 3QLUC 3L5OA 2O8BA 3LLVA 3SCZA 1U98A 4Q9HA 5FADA 1MT0A 3JRWA 5DSZA 3HKCB 4OQLA 1QYDA 5BWWA 1FB5A 2WF9A 2FLVA 1JJBA 2V7VA 2CDBA 1NBMA 4GEKA 3OQJA 2Q5FA 4L6IA 1WTCA 4ZI2A 2QVYX 5AFSA 4KXYA 1AKVA 5HZKA 2L17A 1A9SA 2ACEA 1M34B 1N75A 4BN5A 5AMXA 3V48A 2OGTA 2BFAA 2YCBA 2WJAA 1COZA 1VYHA 3GV7B 2IP2A 2C94A 2IY9A 1X94A 2QZSA 3B2NA 2D1SA 2YZKA 3MHTA 4LMAA 3A1NA 5FYQA 2P8JA 5HILA 1ZK0A 3R6LA 4GC5A 4AO7A 4XLZA 2Q5HA 4Z49A 5JVDB 3SQOA 2QQFA 1HT1E 3JZFA 4EVSA 3DKVA 4ZXPA 3WL3A 4YRJA 1MW9X 4YX9A 3GTGA 2CNVA 4IFIA 3K53A 1UOOA 2H2AA 3KQNA 1ZJJA 3M3PA 3OA0A 2A5LA 2BFCB 2OV3A 1Y1PA 2I6GA 2SKCA 3FZNA 3IAM1 3NUZA 5HA5A 4X54A 1H85A 1VPWA 4XSVA 1LTHR 3U7GA 1MB4A 2OQRA 4BEVA 2WU0A 1ZGJA 3E61A 3BE6A 1ESDA 2J87A 1E3JA 1IUNA 1V9CA 5EJ6A 1OUMA 1GQQA 4M1QA 4AROA 3U7HB 1EK0A 4NTZA 2DPIA 2H1HA 3SNOA 1SNYA 2XDAA 1TC1A 3CA8A 2DFKB 4DHWA 3IQEA 2VPPA 4B4UA 1SC6A 3VA7A 4OMFG 3L07A 4M9QA 3LYAA 4RPLA 2CE2X 4W9RA 4PIPA 2PFKA 2P79A 1JLSA 2JA1A 4MV0A 4NJEB 2WBLC 3AV0B 2C8VA 2GT1A 3D4OA 1CQXA 5D5PA 1E2MA 1ZL2A 3DXXA 5ALYA 1FYXA 4XWGA 5F23A 2CYAA 4CM7A 2B63A 2YZ2A 4FC7A 3R3XA 1JLLB 4CHTA 4BFCA 5BSUA 3AR6A 3THYB 5CG2A 5I7EA 4RMJA 4QNMA 2ZJ5A 3GCWA 4BO4A 2WDPA 3W1WA 3I6BA 1CG6A 2Z5LA 3OM1A 1PJCA 5FL3A 4BLTA 2I6XA 3A1SA 2ZSUA 2G9ZA 2IYPA 1MOZA 2I0FA 3SMQA 1F8YA 1PR5A 1S0UA 3TSYA 4ZCRA 1LBSA 1PS0A 1TJNA 3MZ0A 1MOPA 4D0SA 3E4DA 1MIOB 3RSHA 4QQNA 5BV7A 4LFAB 2P1DA 3VVBA 2V7QA 3E7XA 2CK3A 1CZNA 3SS9X 3IEVA 4FGKA 2QUAA 4BVAA 4MVJG 4H59A 3CVWA 4FFNA 1B6TA 2I2BA 1UKZA 2VAWA 4HQRA 2AZ4A 4H1WA 3GRFA 3I9OA 5KNDD 5FPHA 3DEFA 2EKZA 4BMSA 1IZZA 1J70A 2JGKA 1FMLA 1GSAA 4LDQA 5JQGF 1UP4A 4BUZA 4PZ8A 2GJ4A 3WZMA 4FFRA 3SOPA 1P17A 4XX0A 3RNOA 5FD5A 5JR3A 3ONNA 1SU6A 2BGLA 2F3PA 2F4NA 2IYVA 5I9NA 5BV2P 4XWAA 2DFLA 4UE6A 1OA1A 4RNNA 1G6OA 3K5HA 1UOPA 3UJNA 3MJSA 1YQWA 2FPPB 3L04A 1I7QB 4U8GA 3N6XA 1NSYA 3DO6A 4UVGA 1HA3A 1N8SA 1VSQA 4OK3A 2D06A 1Y4AE 3B60A 4BL5A 4Z99A 4OYRA 2XUZA 1N9KA 3TE6A 4FBLA 3L93A 3EVZA 5BQXA 5IDQA 3ZJUA 3PW2A 2O0MA 5FKJA 2NP7A 2QTVA 3RS8A 2PIAA 3DLTA 3CWZA 4NJMA 3S29A 1T5HX 2VRNA 1U28C 2V5UA 4XWWA 2FWNA 3NBKA 2PRYA 3BH6A 5KFIA 4XGKA 5BRJA 3A6HA 2CCJA 2I3DA 2HEIA 4OUDB 3MJHA 2ODTX 3RRYA 4RF2A 2XGSA 5FYDA 2OHFA 3OOYA 3DOJA 1YB6A 4U7DA 1H2FA 4L5BA 1Q1EA 3BSYA 2P9FA 2FE3A 3FWYA 1TJPB 5KEIA 2NU9B 4W5TA 1AUQA 4DLPA 5LUAA 1PL8A 1W8IA 4N41A 3T1HB 2FMUA 2R6FA 4WJKB 2OCXA 3JD3A 3V3KA 3TNJA 1XNRH 4YFYA 2XHZA 5JG7A 1TLTA 1BIFA 4Q66C 3KKQA 1A8PA 5LUBA 1H8ED 4F6LA 3IMEA 2B4QA 4FOLA 2BBWA 1H0RA 1JAYA 5ITSA 4GMFA 4R9NA 3W7BA 221PA 5CR5A 1X3SA 3FY4A 1J33A 3RTAA 5GIOE 3GGDA 4RVCA 1A96A 4K1LA 2Y1EA 2RHDA 2GHRA 4TKLA 3TL6A 3OZGA 3L2OB 4C4RA 2JH8A 4BWSC 3LJKA 1KMMA 1M6VA 4RTPA 4BKPA 3I61A 3HQ4O 3LY8A 5G0VA 1AXEA 1ZNWA 3DKKA 3LHIA 2G40A 3U3KA 1M1ZA 5KJ6A 1RNLA 1KKMA 4HAVA 7YASA 2XUHA 2N75A 1EGAA 2BI4A 4QOIA 3T3EA 3I32A 3HEMA 2AC7A 1PT9A 4FYIA 5AOAA 4D9MA 5CFLA 4UDOA 3RSSA 3PWKA 3CINA 4MRMA 1NVVR 3Q15C 3NOXA 3MUOA 4GKKH 1MJFA 5KT2A 3K35A 2LKDA 2EFJA 3SEFA 2PA3A 4OJTA 2QV0A 4NENA 3OLCX 3DP7A 1HR0B 2UXDB 1Y9DA 5C8ZA 5KFVA 1D4OA 4A0SA 4J8PA 3IQGX 4MUKA 3DF9A 3WRVA 1H8HA 2Y0CA 2LD4A 3FLBA 3LC7O 2P30A 5DBOA 3UW1A 4NBUA 2B5OA 3UQYS 4PSCA 3QITA 2Z3ZA 3X1KA 5KFRA 4U3JB 3GMTA 4EPVA 3B8HA 1FRZA 3L4JA 3O8DA 1SK8A 2OBNA 1BKSB 3IE2A 2X5OA 4QDOA 4MPPA 2WABA 3SQMA 3BMQA 4RPIA 4GRIA 4YMUA 2DKOA 2I1LA 4Y30A 2FLLA 4GC7A 2EZ4A 4A0GA 3GMSA 3NNSA 5DG9A 4F6RA 4U5XA 2VK4A 3KE8A 4E5KA 3X1JA 3H8SA 4JZKA 4U2EA 5F78A 1PR4A 1GT91 4PG8A 1QHXA 2A7QA 2ZVPX 2XY4A 1Z4IA 2I6FA 3DSRA 1JFFB 4UDYX 3KT3A 2QE7A 4ENWA 2IODA 1SVMA 2WT8A 5T6BA 2HIAA 3H5NA 3QHPA 5IM5A 3O92A 1GPMA 3QE2A 4DM7A 1ORRA 1DIGA 4FI3F 5GZ3A 3JQ9A 5C5EA 3WL8A 5K0EA 5JCZA 2P1RA 3LVQE 2R11A 3D0OA 3T9CA 4DR6H 1X7YA 2XQIA 1DKLA 2PS1A 3T15A 3IB3A 3HDHA 3ET4A 3I2JA 4JC5A 1U3FA 2XQJA 2EG5A 2ZIXA 3KD3A 3TQFA 3KYHC 3HUEA 3B2EA 4MLZA 1JDEA 3N2ZB 4RFVA 3BJRA 2ZJBA 4HDNB 2W8KA 3V1NA 1B8OA 2IP4A 4QX6A 3UHJA 1XZHA 4IIXA 3KKOA 1A48A 3HR7A 4X65B 2GKGA 2WR8A 5A6SA 4OMCA 4M1TA 3U48A 4IG4A 4Q37A 3L6BA 2CNWA 1HMYA 5KVVA 3O2SB 2O5RA 1DDIA 2HJ9A 1CUDA 1I3MA 3TCXB 5E1BA 3IERA 3VFDA 1LPOA 3DE1X 5SY9A 3C3PA 1RWWA 1EU1A 3CEJA 4ZHQB 4KWHA 3DLHA 5IVDA 3MSCA 3OJLA 2CY0A 3I2KA 4WXHA 4CKYA 1T4GA 3ITEA 3OQHA 4YT4A 2WJ3A 2B2XA 4WUVA 4JBWA 3SEAA 4QJ3A 2H07A 1Z7EA 3U7EB 2XZOA 1GTSA 2ZRQA 1A8SA 5TJ9A 1YDGA 3R7WB 1SCKA 3R3JA 2J4CA 3U3MA 5DI3B 1J56A 3ZHZA 3RSOA 3A4TA 4Z4GA 1R4MB 4J7CA 1CS0A 4RB1A 3SI8A 2ZKIA 2YNMA 2XNCA 5D5QA 3OIWA 3H2BA 3HBNA 4UHBA 2FMIA 2XAUA 1K7SN 2Q3MA 3EQ7A 5FA5A 2C82A 3VAYA 1NMSA 4H6XA 4L9AA 2VAPA 5AQ1A 2IDKA 4Z9YA 4Y6QA 5J4KA 2CHVA 2R60A 1Y8QB 4XJSA 4EA9A 2Y71A 4NEQA 1AURA 1UIMA 3G2MA 4EF6A 4HQFA 4O02B 1E7SA 4D9BA 3J7AK 2IVFA 1R2QA 2E1PA 2HQSA 4JWKA 3T7JA 4QOEA 3A6DA 4MPJA 4EIWA 1YCHA 4DWJA 1T4BA 2DUNA 2JFQA 3C3XA 5EJMA 1IOVA 3P19A 1P7WA 4FGUA 2OA0A 1WJGA 1EUCA 2ERXA 3SKVA 4XYGA 4JXZA 3AB7A 4EYGA 4R5MA 3UO8B 4JOSA 3ELUA 5AD1A 2HLDA 3RJZA 3T7AA 4UM9B 5FA8A 4Y7DA 1G8YA 1G0NA 4K9LA 1LWNA 3ILVA 1E2NA 4Y6LA 2O0KA 3ZTYA 1A0GA 1XLVA 1SVSA 3U4HA 5HF8A 3CSSA 2BR5A 3MWYW 4WY5A 4EG1A 4DDWA 2D2EA 1Q7TA 4RDCA 3AF3A 3OTOB 4MEJA 3W2HA 4ERNA 1EI9A 2BELA 1CKOA 4EHHA 1CUIA 3N8KA 5E3IA 4IJKA 1AMNA 2AYXA 3LW8A 3JAKB 5EJEA 1J5XA 4ZJZA 1FFGA 1P6UA 1U81A 2FWIA 1ZMBA 1EVYA 2I6SA 5AW3A 4M6WB 5F76A 2SECE 5EWGA 3HE3A 1TYBE 3ZKWA 2J3KA 4JT9A 4U2CA 1RP7A 1ZKMA 3AOEC 2C35B 4Z9BA 5TT1A 3QPBA 4TQ9A 3F71A 4YO8A 4PVDA 5FUWA 3TIGA 1QZZA 3WWZA 1MC8A 2ZUCA 3R6DA 3K1TA 4C3OB 4B32A 2VS1A 4AZ0B 5LNK6 1T35A 2VYND 3VU8A 3GLHB 1KEWA 3DMYA 3BCHA 2O6LA 4JUZA 2IYTA 3D1LA 1NASA 4JAVC 5E2BA 1CCWA 4FSDA 1G291 4YCMA 4E1AA 5LA6A 3GTOA 4EEKA 4JXKA 4OAPA 4K9OA 1YT5A 1RWQA 2WNIA 2IYNA 2JGRA 4TWRA 4OI1A 3BIJA 3N8DA 4MCJA 1M9NA 3T3NA 5K1ZA 3JQQA 1CR4A 4XR4A 1QCZA 1TDJA 2VUHB 4G5SA 4LV6A 1OVGA 5CYOA 3I2GA 1P3JA 2ETXA 3L7OA 2VDMB 4OBXA 3HBLA 3X2FA 5IK2D 1WCIB 4AJKA 3WLIA 1AQYA 1BMFA 2Z6VA 3JYNA 3OMWA 2JJ1A 4AZ3B 4GBJA 5CCDA 1RAIA 4C76A 2E2HA 4DB4A 1JALA 2CXHA 1FTSA 3GEEA 4EHKA 3H2IA 4A1FA 4PZEA 1I4DD 1EXDA 1UJ6A 2NGRA 1UC5B 5JSZB 4TLEA 5ELXA 1I6KA 3F4BA 1IG3A 3TZ6A 2JI9A 4Q16A 3NHBA 3UFBA 2QN1A 4IDOA 4GMHA 4KQIA 3RHTA 5CNJA 3HN6A 1J22A 1DTWA 1AKTA 1OFUX 2P3OA 5CD9A 3KJHA 3T0FA 2AMVA 3ZBPA 4P7KA 4PGFA 2H51A 5IX8A 1LBEA 4G0ZA 5BO5A 4DB2A 5GQSA 2CL7X 3E0QA 4J0EA 5CVJA 1I7SB 4OKSA 5HKLA 2A9OA 5HE8A 3RCBA 3DYIA 1PQ4A 3P20A 1M34E 1YAHA 2IL1A 3WR5A 1B0AA 4Q15A 1I2KA 4AMUA 3ZY5A 3REQB 3ILSA 5K8VA 4KR7A 3CMMA 4KDCA 2ORWA 3BGIA 4QBHA 2JLWA 4G24A 2CLEB 2O50A 4JBGA 1YQQA 5DW0A 4OHUA 2ZAIA 3HYSA 5IAGA 3GLGB 3JTMA 5ICMA 4IMJB 4V0LA 3RSFA 1JEDA 4MPDA 5KNLA 2A14A 4LTNA 4WK0B 3SIWA 5KPJA 1U7TA 2ASEA 4YASA 1Z2PX 4TV9B 2JIQA 3KSBC 4D41A 3TOSA 4YRSA 3FVRA 3HWX1 1WNFA 2VTKA 3BWYA 2D2IA 4OQFA 3PNPA 2QYSA 3WGVA 4YUXA 3UB3A 1MMFB 4MP8A 1FVOA 1JFLA 2XJ4A 1YUBA 3QI7A 2PH7A 3S81A 4YCBA 4OFWA 3AV3A 3FPFA 1XEFA 2OYSA 3UZUA 4JBHA 2Q6IA 3PJDA 4Y98A 2JI7A 721PA 2XC9A 5TJHA 4F84A 2WYWA 1SIOA 4HAXA 3RQIA 3B7WA 1G6HA 2Y2UA 3KE9A 3FMAA 1QG0A 2AOUB 4MO2A 1EDDA 4WBNB 2FLPA 3ZZ0A 3MR3A 4MQFB 4IOLA 4Y2QA 2FKLA 1E99A 4EH1A 4EP1A 2QNBA 4R8VA 2PMFA 5B1YA 4NPCA 3OKFA 4W1PA 4A03A 4WNYA 1QRAA 5LL6b 2QRQA 3E3AA 1L8AA 2AOTB 3HDVA 1JIUA 2X6RA 2HDWA 4PZUA 1PQUA 2AI3A 4R3UC 4X24A 1TZKA 1B41A 2IY8A 4LN1A 4PZZA 3JRXA 3DZ8A 4IHAA 2PLFA 4R01A 1HSOA 2JRLA 4OOFA 2YWGA 3ISTA 5ECGC 3PPVA 4QBTA 1NOJA 1NVGA 1JU3A 3SHFA 5K20A 3KBOA 4EI9A 3R8XA 2CHEA 2HC9A 1UXIA 4D7AA 2Q1XA 3RIXA 3V2HA 3EVBA 2O8FB 2GN8A 4YJ2B 3SF8A 5HX7A 4HDRA 2JEJA 2ODWA 4XI9A 1ZMOA 4TS4A 4HRYA 2GPYA 4IDDA 2HIVA 1L7QA 2NLOA 3DC7A 3PIRA 4FIDA 3STVA 1L4GA 1VMIA 4ND1A 4FKMA 3C6ZA 4IQFA 1CNEA 3UJCA 1ZBQA 2AMFA 1Z7BA 1R0ZA 3B9RA 4IIBA 3PD0A 5H3HA 1M1UA 1X3LA 4LBZA 3JD4A 3OEEA 3HBFA 5DTIA 4XD7D 4WA7A 1F0NA 2VF4X 5K3DA 4PXYA 1TX4B 4DV4H 4F60A 2X7JA 1KJ8A 4KO8A 5KI6A 6REQB 3OTGA 4RY2A 3R7NA 1AB5A 1M2FA 3TX6A 2DCUA 2Q4BA 2HH9A 3V80A 2CHFA 3K0AA 3H6GA 3FDZA 1NNLA 2BUAA 1OLXB 1G42A 4XDHA 3VPCA 4D56A 3UB4A 2VHXA 4YMSA 2O8EA 1BE6A 3MEQA 4ENPA 1Y48E 3GUHA 2XCPA 2ZJ0A 1QAQA 3MTGA 3X1MA 1EP3B 4JITA 1FSGA 1B6SA 2ZE7A 2IRWA 4I1VA 2W6NA 3V7FA 1NMYA 1RAFA 2HJWA 1X1SA 4LGMA 1C0PA 3LF1A 4JI8H 2X23A 4J2OA 2W71A 2OCDA 3WXMA 2CJWB 5EMKA 3T5HA 2PKEA 5GY7A 3EZ2A 2GM3A 1FZTA 3ZJTA 4R2LA 3CONA 2P90A 1LW7A 5LC1A 3THXA 4ICIA 3ZCRA 5HFAA 3G13A 3ZLJA 1ZQ7A 1SHTX 3EXIA 1Z6TA 4HZGA 3UPUA 3RUAA 3ZWVA 3CGGA 5EY5B 5AVJA 1J8DA 1KPIA 3RB3A 3ZIUA 5DBFA 1GZ6A 2MOKA 3TE7A 4BFTA 5EXDA 1XAIA 1XRMA 3ZQKA 5CNKA 1GTL1 3Q7TA 5CEFA 3A6LA 4TV8A 4FFDA 2J5XA 5LYJB 2IXTA 1QYXA 1MENA 5KUTA 2XUDA 4HTFB 2NU8B 3UK0A 3F6PA 4QWAA 1OBCA 2H85A 3H05A 3EEBA 2QY6A 4NNPA 3UV7A 3KQOA 3A0RB 4GMXA 3WZ2A 5KNBA 3GB9A 4E46A 5KS2A 1SUEA 3T34A 4J2TA 2H06A 4Q48A 1WSCA 2WB1E 2V7GA 1TYEB 1DX6A 1PW5A 3KT0A 1G3QA 4D9IA 2XF2A 1NKTA 4O3MA 2BMWA 3TDKA 5M5BA 2J6HA 1K2WA 1DOZA 3PC8C 4D2IA 3T7IA 4N3GA 3SNHA 1KHTA 4CXMA 2CV2A 2KPOA 4HYKA 2BUCA 1RRGA 4I50B 3P9ZA 1PUIA 2GGSA 4E22A 3WK8A 4Q3CA 2Q46A 3CZ5A 2H1OA 3S24A 5A06A 3F5SA 5A2GA 2QTCA 3CEAA 4QXRA 3CJRA 4ED8A 1NN1A 5LQKA 1TUBA 1LJLA 1ECPA 3EVTA 2COGA 4BNDA 1E9RA 4QYSA 2Q1YA 1CUGA 4PONA 3BA6A 1SN7A 3REFA 2BM8A 4D96A 3KSUA 5IANA 4YPOA 5BSRA 2I7TA 5IP5A 1Z7GA 1DIRA 3AJRA 1NV8A 2OCPA 1KEEA 5DYIA 3TQOA 4M1OA 3C45A 4JP2A 1J49A 1ULUA 1VS0A 4QXOA 3TQIA 5AJZA 2A33A 3OE7A 1OFGA 4AI6A 3F74A 3MRTA 2VATA 5TS3A 2Q41A 4CF5A 3H86A 2C22A 2QIPA 1PEDA 3FYCA 3HJGA 1VYTA 3DL2A 4WZAA 4R2WA 2QZJA 2ASDA 4AYBA 1OH8A 3EGIA 3ZXIA 3NYRA 3RADC 1G2QA 1HXHA 3B9BA 1B33N 1COWD 1Y6RA 1SBYA 1EGQA 4LQDA 3RREA 3CO5A 5AJHA 3IRUA 4OAQA 3O1HB 2C0CA 1TVCA 1UQTA 4PYQA 1DAEA 1GT6A 3OCZA 2KLHA 4TTJA 1CR1A 2PIDA 2PU7A 4AZSA 5AM2A 1SUIA 4C2MA 3L7DA 2Q1UA 2VDWA 4OQXA 3U3RA 2CB0A 4OG2A 4B8ZA 4RW0A 4L22A 4BJ6A 1RRCA 3AK4A 2FPIA 3ZGXA 4FSHA 1DEHA 3N0XA 2XDQB 1T9GS 2C7PA 1AS3A 3DR5A 3QX7A 3P0IA 4ZRDA 4YMIA 2PX2A 5FPRA 1ENYA 7MDHA 2R1VA 3BL8A 4M60A 1XMOH 2YC2C 2QQEA 4YAKA 4PBSA 4Y2UA 2G9RA 3VH3A 5H3CA 3ME5A 1RE1A 2AQKA 2OD7A 3TSCA 1IUKA 2V9WA 1DBVO 3RJMA 1EHIA 1A3CA 3DTVA 3SZGA 1QFJA 1XDSA 3SC3A 4BOYA 5T8KA 2V3CC 3ND9A 1SXGA 5F3DA 2FSVA 5B1DA 2HADA 3KOOA 4Z0NA 1IL0A 3S8MA 2F8SA 5BWUA 1CR6A 3OOJA 1E3EA 3WRXA 1T2CA 1THGA 3DZKA 1AGRA 3WIOA 3EB9A 4M9ZA 2VJDA 5FBLB 5ICEA 2NSHA 3IAAA 1JPUA 3PRKE 1HE5A 4O59O 3ZWCA 3RC9A 1Z6GA 1Q21A 1U80A 4RXUA 3AUFA 3L0IB 4MTLA 2D13A 3PI7A 4FEAA 1YQXA 4C29A 1GUYA 1P2VA 3COSA 5KVAA 4EYSA 1KVUA 4NYMQ 1MO5A 3PF9A 5CH5A 4H6WA 3TQQA 1VGVA 3I5MA 1ZM7A 5CR9A 1LNQA 2OORC 1W88A 2W2MA 3O90A 1YZLA 4HQNA 1GOTA 2NAPA 1HFEL 4MVJA 3RE1A 5AVVA 2HMVA 1FFSA 3TOCA 2X4LA 5FX2A 4EO9A 5TPZA 2OD2A 1EFRD 2PANA 2C00A 3ZS8A 2X9GA 2X0SA 3EBOA 4PHGA 2A0XA 2J67A 3UUGA 4TLCA 4NCNA 4JOBA 1I51A 3CHYA 5I9BA 4N0MA 3VAZA 3SAJA 3KAJA 2REQB 4JJZA 3X2SA 3U3XA 5AWFC 2C7BA 3Q2KA 1GQRA 2JFOA 1UMCA 1KY3A 5FBKA 1O89A 3MS2A 1LPAB 5G40A 1KEVA 4PRZA 2AOVA 2QU7A 3GDHA 3GUYA 4EO7A 1KTAA 1N2ZA 1H65A 3IAHA 2HZ7A 3TL3A 2HWKA 4CVNA 1D4FA 3K0KA 5SYMA 3DR3A 3IUJA 1RPAA 3P9NA 3TD2A 4DG8A 3KTDA 5J2TB 3AHDA 3LQ4A 5CHEA 3L9XA 3IALA 1FXWA 4KR3A 3RAXA 3KQKA 1YKFA 3S5JA 5EA2A 2AVNA 4MHOA 2C4KA 4CHIA 5BWRA 3FWKA 1GPKA 1DIBA 4GP7A 1PSWA 4KXLA 4M3NA 2V4RA 2FKAA 2BF4A 2EX4A 2BUBA 1E6KA 2GZRA 4IMIB 4DDUA 5FWYA 5KAPA 1U6JA 3T3HA 5B7NA 2BE9A 5C31A 1KH1A 4PR0A 3PE3A 4HDQB 3EWIA 3KSMA 2IELA 4BKQA 1KMNA 1H2YA 4AN4A 2YV1A 1U1GA 3O1LA 4K2AA 1IEWA 4MS3B 1I6MA 1KZ6A 5K6AC 4FR0A 1XZLA 1CY0A 3BGDA 4U7TB 2B61A 1UKAA 1W0KD 1S0OA 3TLAA 2AK2A 1QE5A 2ACVA 5B6IA 1Y37A 2ONKA 3KSDO 5F1OA 1JHZA 4B17A 4B7AA 5CVTA 3ZE2B 3OEHD 3AVQA 4RGVA 4PX2A 2FPRA 2Q3BA 4FDUA 3AKZA 1JJFA 3WSTA 5IWAB 3U62A 4HTAA 3GLHE 1GEEA 2YTZA 3R9XB 4YR3A 2BFPA 1LI4A 3JRNA 1MB0A 2HU2A 3A6EA 1V45E 3DDHA 3LKZA 2BN4A 4D57A 3LCJA 2VF8A 3QW2A 2V1UA 1OB5A 5L45A 1MO2A 3N7TA 4C88A 2ZE6A 1DFGA 4EGJA 1X8KA 2PTGA 3FDFA 4YRIA 1XZ8A 4UAGA 3TN7A 1QQ5A 5JMPA 2EXXA 1W4RA 2RHLA 4CQMB 1GUDA 4UBIA 4NI5A 3C15C 1W8DA 1E3QA 2Q1SA 2Z4SA 5IVKA 1XOIA 3O3MB 2QS9A 5KYUB 1ZHSA 5AW8A 2AZMA 5EPOA 2UUAH 1TYDE 3KZMA 1IXYA 3LHSA 5F9NA 4K86A 1A77A 1PTJC 3ZHYA 4BZZA 3T5TA 3U56A 4EEXA 2V5VA 3K9QO 4BLOA 3C5VA 3A8TA 3BC1A 5DMHA 4KPFC 3CUUA 3LPNA 2OESA 3AF6A 3EXEB 2V74B 4ZU3A 4AQ7A 1EB9A 3PUJA 1BE8A 2GARA 2H8KA 4V0MA 1SBNE 2VT2A 2ZSHA 3SX4A 5CFMA 4JV0A 5HJ2A 2D1RA 4WADA 4CN8A 2UU9H 1P2DA 5KMGA 3D2CA 2FLWA 3PG5A 1N9GA 3BICA 3M3HA 3CXRA 2BM1A 4F46A 3LBFA 1VZ2A 4IY1A 2IYFA 4D6PA 3A05A 4BYMA 2C3OA 1EFCA 2WTXA 4TSFA 5F3WB 3E81A 3O2NA 4JJGA 3TI9A 1ZH8A 3C8ZA 2WHPB 4FUTA 3TOZA 5JI2E 4ZOLB 3FI0A 4BFVA 4LOLA 4X45A 4K9SA 3G68A 4G5XA 4KNWA 4MV1A 1RRKA 2CNDA 4QODA 2QRVB 4C7OA 2YZNA 3WGHA 3RVPA 3GLGE 2OZPA 1H1LB 2GN2A 1QH1A 2QX4A 4BO9A 3T41A 5IBCA 4PBCA 2C88A 5E25A 1ZM2A 3CW8X 4M0FA 2B21A 4BDSA 4Z4IA 1Y3DE 1WVGA 3L7JA 2J8ZA 3K30A 2QRKA 4E1VA 3EE6A 4IOMA 1WKBA 1T34A 1Z2EA 1X8JA 4NS4A 1C1YA 2WIDA 1L7PA 1I9CA 2FB9A 2B2NA 2RHMA 5CNIA 5ENVA 5KPDA 2WIFA 4BGUA 4P4SB 5FOXA 1M3SA 4NCXA 3AQIA 4ENUA 2IZZA 2R9VA 5BN3B 2ZJZA 4BV3A 3NV9A 4Q02A 1B8PA 2OE2A 2ZU0C 1PGPA 1XPJA 1PQWA 1NONA 2IPXA 1HLPA 1QIMA 1OAOC 5GOZA 1C1DB 3NHWA 4Q3NA 1VBHA 3AH8A 3H0KA 4K8RB 1Y4ZA 2VZ8A 5JD6A 4P3YA 3V00A 4Z3KA 3F7OA 3ENKA 1GLGA 1R66A 3H17A 4LJAA 3TXAA 1KC7A 4IILA 1QCYA 2ZATA 2GJAA 3SQNA 2MWMA 4K6MA 3GJ8A 2GXAA 5HKKA 4ZICA 4J16C 4DA7A 1X2BA 2FR0A 1VCIA 5I5SA 2ZPUA 2GBCA 1YZ3A 2O8DB 3QVSA 3S8EA 3KDAA 4FBGA 2NPIA 3EFBA 1IB6A 1QGYA 1ZGGA 3PW0A 1JLHA 1G6KA 1EA5A 3CZQA 1FYDA 3QVLA 2YOFA 1DDOA 3G9UA 3UAWA 4BMOB 4Y6SA 3O4RA 3FRIA 2Q9BA 2O8NA 4HO1X 1Z08A 4MHTA 4LOAA 9GPBA 4WECA 4EKYA 4A6XA 3IAEA 4KNVA 5L7WA 4UU8A 3DPUA 4HMPA 2ZR7A 4JMLA 2IEIA 4LJ7A 2AG1A 5ELMA 1GUZA 3GQBA 4CDRA 3G2KA 3ROMA 4UC0A 3FPEA 1D03A 3G9XA 3M2TA 5BMOA 1GPAA 1KDTA 4P35A 3UJ9A 1Y6ZA 1E8MA 1P9RA 2FR8C 2VEOA 3HADA 4CCYB 1I2AA 1Z8FA 1GV0A 2VYCA 3M9MB 1R0LA 1G5FA 2CNQA 5A6VA 5E6UA 2ERYA 3HKEB 3MUFA 4CT0A 1ZVMA 3RT1A 3KUCA 1JEYA 2RGAA 5BVGA 4DUPA 5K6TA 1AQNA 3AI7A 3IJRA 5DYYA 5DPMA 1UEXC 1Y42X 3GAMA 3RG2A 1IWPB 1PDOA 5FUBA 3VZDA 5AIAA 1CUAA 1Y5NA 3ND7A 1HY3A 3N1UA 1Y81A 3CNHA 3CGWA 1F2TA 3MNFA 4YRKA 4EKIA 1S1CA 4KH1A 3G0OA 2GNOA 1OAKA 3MWJA 5B53A 4E6PA 3M33A 3NHAA 1E98A 5BYBA 3WGNA 3D4LA 1E61A 3CSWA 3B12A 3EMKA 4BQRA 4RZQA 4Y9DA 4DJFC 3GO4A 4E2FA 3D8TA 5FI1B 1JKFA 1M6HA 4V0RA 1ZN8A 4MR8A 4AD8A 2RGXA 4DL2A 5LU9A 1XJ0A 5T3YA 4YJ3F 4L3VA 3O3CA 2BBTA 2WTFA 4C7XA 4R1MA 1FNDA 2PX0A 5JPDA 3S2ZA 2QRLA 3UK2A 3K70C 2LBPA 2XYQA 3P27A 3SP1A 1Z9BA 1P7VA 3QELA 4WOJA 4TROA 4ZEVA 1SVNA 4H7EA 5CTJA 2KSQA 5ELLA 4YV2A 5EKDA 3MCVA 1LSSA 4R2MA 3BIFA 1P8LA 4I55B 4WLEA 4MW9A 3KKZA 1F60A 2XGPA 4QLOA 3NYQA 5IBQA 1WZCA 1BJTA 1DCMA 3CG4A 4KE9A 1UJBA 2I7CA 1E5XA 2CLKB 3PA6A 3Q4GA 5L1JA 1N92A 2ZRPA 1FNCA 3LAWA 1GGJA 1Q7GA 2RDJA 2GM4A 1GZDA 1HZJA 2YWCA 4A73A 3A9CA 1Z0IA 2P2NA 3A6ZA 4X93A 3IEUA 4RSRA 1F14A 3WLQA 1VG1A 5C5CA 5FLKA 1W7AA 1J2EA 4WZBA 4A91A 3KZOA 1RLOA 1A4XA 1LRJA 3AEQA 3VO8A 1HKUA 5EZ5A 4L3OA 3C1UA 5C52B 2FG5A 2WJJA 2XIQA 4QQKA 4EW2A 1S3SA 2OORA 1KETA 1H2AS 3SYNA 1P44A 3RC3A 1KY2A 2N1BA 2ZETA 3ZC3A 1JDBC 4UD2A 4ZO4A 3GFTA 5DGAA 2CLHB 2GQSA 4GE0A 5ENZA 2VNHA 1HE2A 3OIDA 1SZCA 1ZGCA 3A1EA 4EEQA 2JA2A 2PYZA 3P2JA 2V58A 2EGUA 3MCUA 1P19A 5L6MB 3NTLA 2POCA 4K9QA 3ETHA 4OSEA 5AW4A 3LQRA 2XCOA 2HOQA 3T5JA 5EXXA 3CVZA 3LI2A 3R77A 2QVCA 4EGQA 2PMCA 2WTAA 3GGGA 3E22B 3Q12A 4ED7A 5C8YA 3LDUA 1XTTA 3HDTA 3QTLA 3UHPA 2VNAA 3ZLBA 2VUMG 2WJGA 4D9HA 5E7JA 1TQDA 2C2HA 1P2UA 1JX4A 2QYHA 4MVJM 3DBRB 3GEHA 3H5RA 3U3ZA 1IMJA 2HRCA 1NNSA 1H3FA 3A1TA 1NZDA 4QNNA 3UH0A 1E2LA 2F48A 1XRSB 4LSGA 1W4ZA 3WWDA 5FP0A 2FPMA 3ZDZB 3N40P 3IT1A 4I08A 4D3ZA 2XMSA 3LS2A 4LF4H 4WN9B 1YBVA 4XWYA 3D8UA 4CL3A 1BWRA 2ANCA 2AFIA 3DYBA 5TQ2B 4HH4A 1TAHA 1W94A 4ND3A 1QPZA 2F1KA 1XVAA 3MJTA 5JCJD 4X1YB 1GCOA 4ZVSA 3MTQA 3Q3JB 4M36A 2F3TA 5L6LB 1KJNA 5B3KA 3CW9A 5A7GA 5LJLA 3S44A 3LL7A 4DG5A 4NBTA 4OHMA 2XCTB 1WLSA 1RCFA 3ZJVA 5BRNA 3EISA 2HK6A 3QRWA 1NP7A 3D3KA 3I1IA 2MSDB 3FLAA 2CKZB 1OLUB 4PAGA 2AF4C 2HO4A 4M76B 1BYIA 3M4ZA 5EZYA 1V8OA 3AKDA 4OP3A 4Q6WA 2G77B 2I34A 2PSJA 3GZNB 3V2GA 2VRCD 4AS1A 1JS1X 1P31A 4YMHA 1CEYA 5FBHA 1ARZA 2C2BA 4A8PA 2UUBB 3OOSA 3A1DA 2ZYHA 3A37A 4A5OA 4LRWA 1U31A 1L2TA 2PM8A 2JIZA 3HY3A 4LX8A 5JT1A 1VLLA 4CM4A 2Y0BA 2G1AA 3HYLA 3GLFB 3AR7A 4XWOA 3JATA 2ZB7A 1LZKA 1XEXB 2WSLA 2V8BA 1QIHA 4ECRA 4GUAA 2RHGB 1PWYE 4JSYA 2F64A 1ZU5A 2R6HA 3S55A 1NV9A 5A4IS 4UMDA 5I4KA 3QV1A 13PKA 1OBOA 3SZLA 1T8TA 2CXOA 1NF9A 4XASA 1T25A 2YOGA 4UVHA 3AF5A 3M6MD 1TZJA 1R64A 5DB4A 4MZXA 3AR8A 5BSKA 5B1HA 2BEVA 5IYBG 1JEAA 1PZGA 1K0FA 3TB6A 5SZKB 1TIBA 1TOAA 4OU4A 5K3FA 2P2YA 2A9FA 4QAJA 3RR2A 8MHTA 3REOA 4K2HA 3H18A 4IUBS 2F4VH 2XVXA 5LSAA 1GL3A 5BR1A 2L0XA 1XCOA 5JIBA 2B4YA 3BHIA 1OZHA 3NHRA 4MWDA 3VC3A 4ZCLA 3VKVA 1QV6A 3A58B 4AN0A 5B58T 4EKEA 3LLUA 5CVDA 3NMUF 1US8A 4GOOD 3A2LA 1VA5A 1AGYA 5EIEA 4OX9H 2R7NA 4IEEA 4QQ8A 5E1OA 4RB0A 3ROPA 2CEKA 4P5EA 3ZWDA 4D6YA 4HDKA 5CE8A 3J7TA 2X2PA 4PZ0A 5DX0A 1HFWA 2VBFA 2PUEA 3CLRD 2QV7A 2X9NA 2PMDA 2PL3A 5KYGA 1E9VA 3FB4A 4Y0VA 2ZWMA 2AN5A 2NT3A 5I5EA 1JDZA 2WZBA 1NLMA 3YASA 4LWOA 2W00A 3W6OA 3C97A 4Q3LA 1KS9A 3EG9B 2CNOA 1M0TA 3AY7A 1VJRA 1PFQA 4FNGA 2HPVA 1GPNA 5DM2A 2JB9A 3UF0A 1NE7A 4O3NA 3WGJA 1EK1A 1KMHA 5AW1A 4KXMA 4DJDC 5DHAA 3PO2G 2Z2IA 3WGTA 2XNDA 1K3UB 3OC0A 4RQUA 1EP2B 3ROQA 4XWTA 2DPHA 1V5WA 5LLTA 2A0UA 4DNFA 3WK9A 5BV1A 2CFCA 3GP5A 3VZQA 1QBGA 2GAAA 4JNCA 3SC6A 4LH7A 4HXFB 4X41A 4TMFA 3O93A 5A62A 4X62H 4J9RA 3PQCA 1A8IA 2HDNB 1F2DA 1PO7A 1JWBB 2P91A 3I2FA 3HY4A 2TS1A 4FCWA 1XF1A 5FCDA 3VH1A 3QLUA 1IU9A 4YQFA 2PZFA 1HF3A 1U7PA 1BS9A 4NXNB 4GU5A 4G4SP 1T9CA 1MNQA 2FEWB 3BMCB 4MQ4A 4ESVA 4LSMA 5HE9A 5LZ7A 5ADVA 3FMFA 4OUKX 2Y4OA 4GS5A 1R8SA 5FI3A 4JB3A 5TLSA 5A5VA 3ZV6A 4HH3C 5DIFA 1BO6A 5LXTA 3ENVA 4UTPA 1CUBA 4BQSA 3L2PA 1XZAA 4HXGA 1YL6A 4ZREA 3OPNA 1JIVA 5DG7A 4XTRA 4RY9A 1NJ6A 2EF1A 4MS1A 5BWTA 1FY2A 2XI4A 4GOND 4EEYA 2ZJ7A 4DR4B 3N2NA 4WCFC 2E7ZA 2BGJA 2IXFA 2RAVA 1O4VA 1WZUA 5A9SA 2IYXA 1UT8A 2A1TR 2AEEA 2IYAA 4LI3X 1GAJA 1ZN2A 5KOYA 5DW3A 4TXLA 2OO5C 3DONA 2WPDA 2P5UA 3TRKA 2C31A 1JTFA 3FWZA 4TZ6A 2YFQA 3F67A 4NE7A 5JCXA 4WNIA 4AJPA 1X42A 4ZJUA 3W5JA 2QX6A 5K3WA 1RYNA 2FXVA 4Q5IA 3WNBA 4KMOA 2FR8A 2Q5IA 5YASA 2CSXA 3TUIC 3JU3A 1BCRA 1C3EA 4RV4A 1GFIA 2NG1A 3F9IA 4DBZA 1DQPA 1QLHA 3OC6A 5K51A 4YV7A 4DG9A 4E5PA 1NWHA 4UMFA 3HEBA 2FRXA 2J6CA 3IGFA 3OZAA 7REQB 1RXIA 3AZPA 2RKWA 5G0WA 1Q3KA 3MGBA 4WJLA 1BN7A 2YJ5A 4G4JA 4PC2A 3AX6A 1U0EA 3Q3VA 4K88A 3WVNA 1Q1NA 4Y2TA 2QZ9A 4I1PA 3S1SA 1X74A 1DQZA 1X70A 2PZBA 3RSCA 1N0UA 3IULA 4AY6A 2VDRB 4JJEA 1KHHA 3QKIA 3RV3A 3UJ8A 4M0DA 3OWXA 2HA5A 1G4UR 3B3AA 2PZJA 2HA6A 4M38A 4B76A 4OIFA 3OUUA 1E2GA 3U3JA 2A1UA 2Q0XA 3OZUA 2I8AA 4J0MA 3G5AA 2PLWA 3ZWOA 3SE7A 2NZWA 3IAS6 1FBNA 4U02A 5AKGA 4BNKA 4OI0A 4B87A 2PDAA 1OFVA 2G4CA 3G2OA 5H5JA 1OZAA 2GM9A 1YD7A 1V4BA 1RKBA 4JQZA 5CDUA 4NDNE 2VQDA 4E15A 1M0SA 5IAJA 4A6EA 3LGAA 1DGQA 1NHWA 4JA0A 1WDWB 2QW0X 2GPJA 3LWZA 1RYEA 4QO7A 3THWA 4K28A 5FPQA 1PR2A 5DLDA 2X1MA 1WETA 2QKYA 1PZNA 1TM1E 3AR4A 5FAXA 1HPLA 1AB6A 4PLPA 2EJ2A 2HX1A 3BCRA 2DLNA 3FD8A 2C78A 2PZLA 4TL8A 5LDHA 3L6RA 5DISB 3R7DA 5TE9A 4HX5A 1BMTA 3AGQA 4ZGWA 1C5KA 4LYJA 1G1AA 4CKXA 5AKKA 2I3GA 2X4IA 4NU6A 3D4IA 3FTPA 5L4SA 1X8LA 2IW1A 4BEWA 1ESCA 3CVOA 3EZFA 4O25A 3R0ZA 1HT3A 2FK8A 1KK0A 4ZDJA 1SCAA 1DBWA 3W3AA 4CDGA 2OHIA 3WBBA 1P16A 1P9OA 4UNIA 1Q19A 3ETCA 2JIMA 4QRIA 3EEIA 4AXBA 1J6UA 4LHYA 1IMOA 4ZI3A 4F3YA 3PEUA 1EUDB 1AJEA 4LBWA 3JVEA 1XTVA 1A1SA 5D00A 4YHHB 1XRJA 2PLAA 3UUFA 1CZOA 4ILEA 3CCCA 4O0MA 4U00A 3QFSA 3RC1A 1C1XA 2Q49A 5KWIA 4JELA 5I3ZA 1U28A 1RFGE 1UKCA 2Z6QA 4O4LF 3LUHA 4UW9A 3TPFA 3VNAA 3HVUA 3K9NA 4HZIA 3IJPA 2ISSD 4CF3A 3S2IA 3NUGA 1XDUA 4QZVA 4QHYA 3I73A 2I03A 3I9KA 3E5NA 5KKNB 1W5FA 3B3GA 2FMAA 1SXHA 4YDQA 1JAXA 1Z6PA 5L51A 1GKIA 5HPYB 4FBUA 3BZBA 2UVQA 3H2HA 4CPDA 2O06A 1RLUA 1IJFA 5FLEX 5G4KA 3PDJA 3KTOA 2BD0A 4JI1B 2GKOA 3GLUA 1SHLA 4TXHA 2XUKA 4KR2A 4LPKA 1MKYA 1VLMA 3KQUA 4TKUB 3V8PA 2FPOA 4EFLA 4FLFA 4ASUA 2PSEA 4QOFA 4OMUA 4WZ6A 3K92A 1R5JA 1ZVVA 4UZFA 1QDUA 3RGWS 4P3KA 1CZRA 1D1SA 2QA5A 3PHGA 1PGOA 5AI8A 5D7NA 4WNAB 3K6SB 2XVMA 2BFDA 1N32H 4BE9A 4CKCB 4J4BA 4HGYA 5AVZA 3HSSA 5E0OA 1M1YB 4LNUB 4DV7B 5IAEA 1ZIDA 1KO7A 4I2VA 4C07A 3GRUA 4TSKA 4D99A 1MQ9A 3N7AA 1CUSA 1Q95A 3E53A 3KOZA 3C5EA 5T67A 1U3GA 3HKZE 4TVBA 3G0IA 5JNWA 4R7ZA 2JA7G 1RYSA 5CXXA 2BSQA 2BOVA 1BJKA 3MHPA 2IH2A 2VA8A 3HOXG 4EG6A 3TEFA 1YS1X 2OBBA 3RKUA 1PFYA 2LE0A 2BR0A 4YROA 2BFMA 1D8TA 5I5TA 2IV7A 1N1EA 2PZEA 3VVCA 1KOLA 1ZBDA 1YI0A 4NECA 2I76A 3KHHA 1A7KA 3NAQA 4EVRA 2FQYA 3B78A 3KM0A 1W5EA 3A9WA 4KUGA 4MRPA 3VJMA 3CLSD 1Y8RB 5EQTA 2QK4A 5SZHB 1SUWA 3CF2A 2CF6A 4C4YA 3SI7A 2C2RA 2O0LA 3GAAA 2BFFA 1QZXA 1P9WA 4O2BF 2CSUA 4KOEC 1L5GB 2PSDA 5A7HA 3BMOA 4DMUB 2ONCA 8AT1A 3HUTA 4P86A 4HQKA 1A82A 3Q3EA 5E9AA 2KI5A 4ZAWA 4ZCQA 4NU5A 2QVLA 1GZ5A 1G2WA 4F3TA 3OT1B 4C08A 2D3WA 3MPUA 4J0HA 1DI0A 4YRCA 1ZI8A 1NVTA 3RKRA 5LD2C 3Q72A 3U9SA 3E9NA 3L8GA 1BJRE 4XA8A 2EX0A 2BISA 2YV3A 5KTNA 3KQVA 2BKXA 4NOLA 3ORFA 5CTAA 4E11A 6GPBA 3IBGA 4V0SA 3QEMA 2H6EA 3JQ7B 4YECA 3ESYA 1SEPA 4R7GA 1KYZA 4DQKA 5B3LA 1HI9A 1X7DA 1Q7BA 5IC5A 1SUBA 3CUEF 2MT9A 5DT2A 4WW0A 5CB4A 4E6NA 3D2LA 1G60A 2KX7A 5EE1A 5CJPA 4RA6A 1ZSYA 1Z83A 1WHSB 3BRWA 1N6OA 5JTTA 2H1RA 4R3WA 3T7EA 3K6KA 1FSSA 3QX3A 1ELOA 2CFTA 1TUGA 5DQGA 3PYLA 5MF6A 3BWDD 5KX5F 4IIJA 3MLAA 3KKNA 5EJ5A 4OQEA 1RDFA 3U31A 3NETA 1XKTA 1GXSB 3KXYT 3P4UA 1Z25A 1Y8AA 3HPRA 3PRYA 2SNIE 5AUNB 4QOJA 1TVKA 4KODA 3PFCA 4F21A 3EUEA 3GA5A 4HGPA 1IEXA 4N49A 4HGOA 5LLDA 5HQ3A 1RHMA 2ROQA 4BLWA 1TWCA 1ZUNB 1UIRA 1T15A 2FP3A 2ALZA 3GCXA 2BEKA 5KOHA 2ZUSA 4CLOB 4R81A 2ORIA 5DSXA 3DOIA 4EYEA 2UZAA 2ZUDA 3UQZA 1V8PA 3IUPA 3Q5EA 3JSAA 3KEFA 3CX6A 4OHYA 2AU0A 4OGLA 4ARZB 1TI7A 3QM1A 1FNBA 4YJFA 1VPDA 2IS2A 3L8ZA 4J91A 3HKBA 1ZGAA 2HHFA 1R0RE 2I9KA 1QQ6A 1VKOA 2FSGA 3TKLA 2GF0A 3ZOKA 5CLJA 3WJ1A 4AYWA 4AKGA 5H9VA 4FKBA 2IHZA 3IP8A 2VNSA 3ZCUA 1ECFA 2H48A 4PZ6A 2A7XA 3I1JA 3PNBA 3F46A 3JWIA 3VSBA 3UAVA 5K3SA 3DAPA 3EGXA 3UGKA 3ZNQA 3EWSA 4Y1FA 3CPHA 3GRAA 4ZCPA 5I48A 4MIOA 2AJTA 3RK0A 5ITVA 2JW5A 2W2LD 1UDWA 1XMJA 4DF3A 2AG0A 1ZQ9A 3GLFE 2M9MA 4BXXG 5E7IA 4UBKA 3LUAA 1U5CA 1R7RA 3W2FA 1IY1A 2VUIB 2Z09A 3UAGA 1YIOA 2O52A 4RH0A 3U6KA 4DR5B 5B6JA 4MRNA 4BLPA 4LF5H 3HDJA 2ZSIA 1XN4A 2UUCB 3DOEA 1Z6AA 1U5BB 3CEBA 1NC3A 4GZ5A 3ED1A 4QWWA 2JGFA 4TXJA 3MQ4A 1S9FA 2PCJA 4DGQA 4X7BA 3BQMB 2E6UX 2GA9A 1C2TA 5DCWA 4CKBA 1YVPA 3L7LA 1KDPA 1DV2A 5FBQB 3M83A 3WL5A 2VP2A 2XCLA 2V4QA 4U0JA 3L7AA 3NAMA 3K09C 1NXSA 1XA0A 1UPAA 2X5NA 1SXJC 1OI4A 5EIBC 3HBJA 1U2ZA 4FYXA 3W4IA 4M9XA 3DFMA 3AMVA 1U04A 4GOMD 3QMWA 4KUEA 3LFHA 2IBMA 4EABA 2R82A 2EJCA 1XXHE 5K0BA 1JI0A 2HFKA 3G2LA 3PHIA 1TT5A 3NVDA 5CYFA 3AOEA 3GBVA 4U7CA 4TRNA 1KI7A 4R83A 1VPLA 5LB4A 3DEAA 4BO5A 1TZBA 3JZAA 3K0FA 2HHHB 1ZOSA 3M1IA 4IHJF 3EVNA 1MR3F 3OLXA 4ER3A 2W6ZA 2M32A 1VXOA 2BMJA 2C2EA 2DXIA 4RNOA 4Q3DA 3NBAA 1MC1A 4L7VA 3ITKA 4KKXB 4FE3A 3MB8A 2G0TA 4Q82A 3QLTA 4URYR 3VGJA 2RCNA 5L7TA 4FWTA 1FS6A 1NBEA 5IF9A 2QX9A 4Q1BA 1KYYA 1SHKA 2GFHA 4GW3A 5H7XA 2ZP1A 4CNQA 2WU8A 2GXSA 5DM4A 3R4VA 3EPPA 3Q8XB 1E4EB 1LB1B 1Z3CA 4BE7B 1D9ZA 4LZPA 2XUPA 4IWYA 4EG4A 4AYXA 4JEMA 4XGNA 5EWFA 1ZWKA 2JNWA 2RB4A 4IGIA 4BJ1A 1JEQA 4WVFA 3A26A 1GAEO 1GDTA 3F9CA 3O9ZA 4H4CA 1NBMD 1TWHA 1QCCA 3PKIA 1IWOA 3UH1A 5KWSA 3WICA 3D7RA 1TMGE 2OHGA 5L3SA 1JR3E 2BP7A 1IULA 2BFWA 5DLGA 3COYA 4FQ8A 2ZAMA 1QNLA 2WUWE 2W6JA 3K1AA 1W85B 3AUKA 3K1JA 4C2UA 1C1HA 1CDEA 4ZI7B 3KSZO 4ZARA 3HV0A 5ITZB 5BMVF 1NXTA 2WC1A 4EYOA 2O59A 3A0UA 1B42A 2BL4A 2JGEA 3ITDA 4MH0R 1XB2A 4RL4A 1XKQA 1O6GA 4PO1A 3ONDA 5LCXA 3G82C 4N3CA 3KQQA 4IH9A 4J6EA 1E2QA 3KEGA 2XE6A 3I30X 3VYUB 1C7EA 2RGYA 4DMHA 1Z0AA 1V0JA 2Z43A 3F2IA 8GPBA 3CVVA 1CQJB 3KYCB 4MMZB 1INLA 4U6PA 4Y7CA 1AC5A 2VOEA 2Q8PA 1YS7A 5SYNA 3RTBA 2LP4Y 2YWEA 2G1KA 4HATA 4WHMA 1X1DA 5IUKC 1W36B 4F4JA 4HZUA 1FQKA 5ED0A 3I1FA 4BZPA 3W1EA 3HWRA 2GEJA 1HSZA 2XOXA 1SC4A 1F48A 2CXPA 4OY3A 3BJIC 5C34B 5CX1B 5FNVF 5G3ZA 2X0IA 2J0UB 4ZV7A 4GG1A 3X43A 4CQLA 1ULHA 1I4WA 3FNQA 1ORHA 2JAXA 4F4XA 3LK6A 1VLHA 4XB6B 4TM8A 2QN8A 2A5GA 2EL9A 1OLOA 3MAAC 1B04A 1B15A 1C4XA 4ZV4A 2BWJA 3GGOA 2FWRA 1TW3A 1V11B 1XJCA 1DMRA 1GYQA 3QI2A 2DLCX 3JWGA 4JVOA 1ZUHA 4G3XA 4A0FA 2YV2A 3MT8A 1R15A 1HNXB 2VUMA 3BJMA 1WTAA 2F8TA 4DBVO 2WNHA 3R3ZA 4MKHA 4GOXA 3WQRA 2DOKA 3PR5B 2ORED 4X9XA 2BFOA 1WXQA 2FW6A 4L9WA 3F6RA 3GJ7A 4RF5A 1Z06A 4PU0A 2Q62A 2Y66A 4ZEXA 1S0NA 1BU5A 1HFJA 2Z2JA 3IKVA 2OK7A 3NEYA 2ATEA 2ZUEA 1EVZA 4QJFA 4RJJA 1N48A 1VG0B 3RK4A 4GVLA 4B2IA 1UMDB 2R3SA 2O2SA 4A3JG 4YWJA 3M89A 4QPNA 5ECYA 1XVLA 5IVHA 1OYWA 3PSAA 1OIWA 5JH7F 3GNLA 4JI5B 2V7QD 1RI2A 2PX8A 4W8HA 2RC6A 4DFDA 4Y1RB 3VKGA 1Y1KE 4KBFA 3TTWA 3TZKA 5B2FA 2R00C 4UOEA 2QXUA 4N0EA 1J7KA 4G0QA 3JARB 4JYZA 5BR8H 1JI3A 1XDWA 2QQ0A 4YA6A 5CCEA 4ECQA 1EE1A 1L4KA 2IS1A 5K9ZA 3AESB 1KGSA 3VBCA 4AP6A 4Y6PA 1I5OA 3T3IA 3J80A 3OQIB 2PPLA 4XVQA 2X40A 2D5IA 2Q28A 2Y1OA 2QSYA 4FK8A 3H65A 4BMVA 1VL2A 4JC4A 3VR1A 1S9HA 1Z5PA 3LUDA 1Z07A 2XDYA 2XXAB 1LPMA 2PMZE 3ZCXA 4R0NA 2FVXA 4OSOA 3O4IA 4LRQA 1QRDA 3N2KA 3Q10A 4BBJA 1YJ5A 1CIVA 3X0DA 2FZKA 2INGX 1SKYB 4LQCA 2DEUA 4RADA 5ALLA 2AEJA 2M6RA 3ZY4A 3EXHC 4DMMA 3V6JA 1RCUA 4UHEA 4G0YA 3QGMA 1FIUA 4FGLA 2BF7A 1FS4A 4HQOA 5J63A 4Z54A 2OAQ1 1A9YA 3IO3A 4JI3H 1UDXA 2MSEB 2GVNA 4TVSA 4YP6A 3Q85A 3KD2A 5KT3A 3TOXA 3L84A 4DSNA 4YAJA 2YMQA 4IX9A 3R5HA 1D2CA 3FFTA 5ESXA 5LBTA 3PGXA 3IQXA 1CJSA 4Q9AA 1S8FA 3IDZA 5KFQA 3NC4A 4HMOA 5DIZA 4HBGA 3R9KA 1T3NA 3DMNA 2OHHA 3EC1A 4DDHA 4GLBA 2GETA 2ODBA 4NQRA 1PIWA 1TCCA 3GHHA 3KTAA 3Q98A 4RHEA 4HDSB 5JJLA 2P9TA 2AS0A 3K5PA 2GZHA 2IHTA 1GY8A 4L16A 2PD4A 2G5TA 5CA1F 4L75A 2IXEA 1PVDA 3PWSA 2MSWA 1W1IA 2QUJA 4IO0A 4DGSA 4CMCA 4J90A 3QU5A 3EG5A 5TQVA 2GQRA 1G0OA 4EPWA 3IHKA 3PC3A 4F2HA 2X0NA 3GNSA 1DG1G 2PH1A 3Q5GA 3RVOA 1RAGA 4QU9A 4DE5A 1RWNA 4JCOA 4Q4LA 2ZVQX 1YU9A 2WMDA 2J5BA 2O3UA 3EBLA 2VJQA 2Z56A 3ZCPA 3JSLA 1DC6A 4LAFA 4AKTA 1PV2A 4Q19A 4YAFA 2HLHA 4UAUA 4QUEA 8ABPA 1F8GA 4LXQA 1BQEA 3VJKA 3RABA 1QDLB 1D2RA 1IN8A 3K9FC 3E7DA 3CRRA 4Q7QA 1FLNA 5IUJC 3HG7A 1CB0A 4YP7A 4KWIA 2IX9A 3BIXA 4UU1A 1SD5A 5HK9A 1Z33A 1THMA 2QLFA 3GAFA 3ABSB 1FJGB 1GTJ1 2QTFA 1FP4A 4GSKA 3TH5A 1LDGA 2JIDA 3UANA 2NOAA 5K8LA 4TYPA 3PV0A 4L0MA 2F2TA 4L4XA 4W7HA 1W96A 3B8EA 4NDAA 5GONA 3KYDA 1SPBS 1MPXA 3K3VA 3I0ZA 1T5TA 2QZPA 3AUXA 3PC8A 4DNXA 2BEJA 3ZV5A 1M1YE 4N12A 1JYSA 1H8HD 4O84A 1SHZA 1M0WA 1BW9A 2NYUA 4ED3A 3EYWA 5EIHA 3FTDA 1SEIA 3ZVRA 4MWSA 5CVVA 3TZEA 2C7RA 2JBHA 3FPLA 3BAZA 2R6DA 4B2LA 4RYLA 3P9YA 5JSUA 2FF5A 2N47A 3EZ7A 3CX3A 1DBPA 3T0GA 5EOVA 2OB2A 4QSHA 2Q0SA 4AJNA 2QRHA 1VJDA 4X20A 4IFTA 2MSCB 4IDAA 4BKRA 1RR6A 4KRFA 3MR5A 2B36A 2E9SA 3RFTA 4L73A 2QN2A 3ADCA 1NATA 2E4UA 3E9MA 1Z5GA 4MV4A 3L05A 1JF8A 1E9DA 3LQFA 1MPTA 3TW8B 2CYCA 1D2EA 2EG9A 2YR0A 3NPAA 5JALA 4DLTA 5ALDA 5JW6A 2QE7D 2JHAA 5AVQA 1UMBA 4B5LA 2XRFA 4GYKA 2P2ZA 5H80A 5ED4A 4XPZA 3W9SA 2WU3A 3AVWA 2BW0A 1GTVA 5HRUA 1PSZA 4RB2C 3PQ6A 3JCZA 3Q7RA 1NR7A 1VL1A 1OZGA 3ESZA 1YDFA 1FSFA 4ATNA 2R4QA 4Z8YA 3OKAA 5F7ZA 3W79A 3DQQA 1P4RA 3D7MA 3CEHA 4XYBA 1KAMA 4Q4JB 4JN6B 2UUPA 1BG6A 1IFXA 5JRZA 4HGNA 2C29D 1O5OA 3SC4A 2KWIA 2FZ5A 2LNDA 4O3OA 1M1NB 2I4MA 4HYYA 1OXVA 1JDSA 2XMCA 1P7YA 4IJWA 1N8TA 4P2BA 5EN4A 4H0FA 3TZQA 3GUVA 1DWPA 4UQOA 2WJZB 4B2YA 3TW4A 4H6VA 4M7OA 5JS8A 4PWYA 2E2IA 5F9LA 1D5WA 1MOSA 2VK1A 3I9LA 2Q6OA 3AYHB 3RF7A 3H9JA 2H1IA 1SOVA 3OIGA 4DCGA 3OCCA 4X60A 4KVZA 4IW3B 4L8LA 1GGHA 2J33A 3OZEA 1CYEA 4R8RA 2OC9A 3VV2A 1AKEA 3SC2A 4HKTA 4MQ5A 2WWIA 4LF7H 3X3HA 1ADCA 2QPLA 1GFSA 4CETA 2YWHA 1MO4A 1SRQA 1VLVA 1TTTA 3M9OB 3TKAA 2YNMD 1NUSA 1JIJA 1HNZB 2PS0A 1YL5A 3TRHA 4BVEA 1RS0A 2JAHA 1LJ8A 3KDPA 3H2KA 2ZLBA 2W6CX 3CUTA 2HHCA 4DIKA 4PSKA 3H1PA 4BVFA 4RNCA 3V4ZA 3FCEA 4AO6A 4FBMA 3WWYA 5KB3A 3A11A 1FA9A 8ATCA 7MHTA 3GTJA 1WA5A 3DLIA 2GAOA 3F5FA 2BZ1A 2FTKE 1AKWA 1O96A 1CQWA 5KHLB 3EIHA 5TXGA 3VOAA 3PC7A 2RHJA 1XGKA 2VH1A 2FXIA 3FDXA 4MYCA 3NM4A 121PA 4XIJA 4KRGA 1IHYA 1T9BA 3TLCA 5FWXA 1U9IC 3EHEA 3DFUA 3OJOA 1WUHS 5KNBH 2XMGA 2XA2A 1ZHQA 1Z3IX 3H42B 3OICA 5LQNA 4MEAA 4FILA 1AO3A 3FROA 4QTYA 1X7XA 2NZJA 1EFHA 2HLDD 1UC8A 1THTA 4PPYA 2ZR8A 4KZKA 4MOWA 4L85A 1Y5LA 3Q3GE 2JAOA 1QQAA 4KPYA 3BAFA 3IH5A 5HEKA 4QUHA 4G81A 4MA5A 3MWKA 3EK2A 3E70C 4PX9A 2VP0A 3PJRA 1TL7C 2N1MA 3LQ2A 5JYEA 5EJGA 4LYHA 5KSWB 4FZ5A 1YRBA 3NHUA 4C06A 2YC4C 2IU6A 1X7ZA 1IH8A 3SQXA 1NUHA 4LSWA 5KYWA 3DVLA 3DCYA 2ZJ4A 4X1KB 2WFMA 4MQEB 4X1OA 4P4LA 4LMRA 4MVJF 3FWNA 1FFCA 1WX1A 3Q8SB 3WIVA 4I9UA 4XD2A 5BSWA 2FDXA 4JP3A 4EYKA 3HV2A 4BO0A 1VG8A 2AN9A 1FX1A 3V4LA 4JXXA 3LOUA 4GZLA 3DEIA 1QCDA 2FU5C 4Y1GA 3AL2A 4KZPA 4XJTA 1STOA 2GJSA 4JV5H 3KCNA 3UTDA 1OMOA 1RMQA 4S05A 3MOGA 3IQHX 4TMZA 3D43A 2QORA 1HE4A 2GN6A 4BY7G 3CLHA 1M8JA 2DMRA 2JFGA 4A4DA 3OX2A 2AN1A 1YWGO 3OFSA 3WV5A 4PZCA 1E2BA 4KQ1A 1Z5UA 3LCUA 3TQCA 1UKYA 2FAXA 4V0QA 4PAOA 4UCTA 2NTEA 2JFWA 5K6AA 2NPFA 4DR7B 5EXEA 4OP1A 5D1NA 3HO1A 1E18A 3IUQA 4QVGA 4C05A 4DN6A 1Z6XA 3HRHA 2VYQA 4B34A 4AB1A 1KP3A 4RCVA 1GZHB 2UZ0A 1QO0A 3A14A 1VB5A 2I2AA 3OM8A 5FXMA 4EF4A 1AUOA 5KSPA 5JPCA 3ZWQA 2ONYA 1DCKA 4B6JA 3INGA 5IYZB 2O23A 3C3DA 1PZEA 1J9ZA 4JVNA 3NKFA 2B25A 2A4MA 3I2IA 4HLUC 2W2VA 3Q8KA 2UVPB 1ZVKA 4ERXA 2AI2A 5ITWA 1UFKA 1OREA 2I22A 4V0KA 3H4BA 4YBZB 4WOCA 1T3TA 1RAEA 5KTMA 2XGJA 1PD1A 2R8OA 1B1CA 4C0QC 5K4HA 4DRFA 5DX8A 4QEZA 1V8BA 2XCIA 1XTIA 5HJ7A 2H2FA 3SSMA 3GROA 3JVIA 3QJ5A 2RHTA 3KZ1E 1OIXA 3ON5A 4K9DA 1NW4A 3K3PA 5GGXA 4DT1B 2VOJA 2IZ6A 3PVZA 3CCFA 1I8TA 1AKMA 2CFRA 1JZSA 2DG2A 4RHYA 2DY1A 2QM0A 1ISMA 2JA7A 1I2MA 1LBIA 1ODFA 1QVAA 4LYGA 4L07A 1VPEA 4LDPA 2HW8A 4Q9KA 3KLOA 5DDIP 3D3WB 4YI3A 3EXHA 1PTJA 2X0DA 3O9MA 4BASA 1QHEA 3GGJA 1OGIA 1VKZA 2NO4A 2PZAA 5JYCA 4RPGA 1J97A 2QLJA 5F1KA 4YUZA 4WKGA 2UZ1A 1YA6A 1OX6A 5DQHA 4LK2A 1XXHB 4I9FA 1MVLA 1ODIA 2GD6A 4ENTA 2WE7A 5ALRA 2AMLA 5EP4A 2IFTA 2QTWB 4MIEA 5JS6A 2QBYB 4TXNA 5I7SA 3SICE 1VSUA 3Q8LA 1FTQA 1F5NA 1RLJA 3COWA 1M2NA 4LCBA 2FEXA 1K1EA 4MHSA 3HT5A 1AHPA 2JLUA 4S04A 4MVJH 4TQUS 5I7VA 3AI1A 1G3RA 3QF4B 3O7MA 2QVGA 1JIKA 5HIMA 4F8JA 3JYQA 1FC0A 3ER8A 1FZQA 2IPNA 4H3HB 4I5EA 4BO3A 1W48A 1KP2A 1ISJA 4PIVA 1HO3A 5JADA 2IA6A 3G9QA 3M2PA 1TM5E 4P36A 3EASA 5EHXA 2ADFA 3VMFA 1UK7A 1SY7A 2J3LA 2J5RA 3PHJA 5C1DA 3SJCA 5E6SB 1U11A 1WG8A 1XZDA 5TS2A 1TKAA 1Q83A 4KJXA 5A0TA 1L8XA 1JQEA 4DCOA 5IPFA 4DMLA 1ODCA 4DQUA 1QP8A 3JQAB 4WESB 1KK3A 3WHLA 3O3OB 2VVTA 2PUVA 1C9JA 2O3SA 5AHWA 4J4TA 1F3LA 4UBMA 4O3FA 2WFLB 1V41E 2JHPA 4A15A 4RTNA 3HP1A 1QS0A 1PJRA 4LY3A 1D2MA 3TTYA 1H4SA 4RD3A 4X63A 1ZGZA 2NZXA