3KALA

Structure of homoglutathione synthetase from glycine max in closed conformation with homoglutathione, adp, a sulfate ion, and three magnesium ions bound
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
470
Chain Sequence
APPLFDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLSRTKNADEFTSRLLDIHSKMLQINKKEDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQREGGGNNIYGDELRETLLKLQEDAAYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISSSYEGGVLPGFGVVDTVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homoglutathione synthetase
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
molecule tags Ligase
total genus 160
structure length 470
sequence length 475
chains with identical sequence B
ec nomenclature ec 6.3.2.23: Homoglutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kalA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kalA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kalA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kalA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kalA04
2VQDA 3ETJA 4EGQA 4RZQA 4MA0A 4O7WA 4MV6A 2XD4A 3U9TA 4O2AF 3KREA 4Y8VB 1DIKA 1IOVA 3GIDA 2DZDA 3QFFA 2R86A 3N8DA 4HNTA 4C5CA 1JDBB 1VBHA 3E5NA 4QSHA 4O4JF 1GSOA 3JZIA 4YBZB 4ME6A 4ZI7F 2FPIB 2DWCA 2GLTA 2NUAB 1KJ8A 1E4EB 4FFRA 1AUVA 5C1OA 4O7VA 1KJQA 4O7TA 5H80A 2PN1A 3TIGA 1EHIA 3TW6A 2J9GA 3JZFA 1I7LA 4O4HF 4FFPA 5JVDF 2IP4A 5BMVF 2GQSA 1OBDA 3I12A 2R7LA 2CZGA 2FPPB 3OUZA 2R7KA 4EG0A 2YS6A 3U55A 2CNVA 3LWBA 1GSAA 2W6NA 4FFOA 4O7YA 3N6RA 4O7LA 3V4ZA 1CS0A 1BXRA 2ZDGA 4EGJA 4O4IF 2Z04A 1KJ9A 2W70A 3V4SA 1WR2A 3OUUA 4XYMB 5LP6F 1KC7A 1GSHA 5CA1F 3KAKA 3WO0A 3TIIA 4YAJB 4MV4A 4C5AA 2PVPA 5JVLA 4XX0B 1W93A 3WNZA 1Z2PX 5EZYF 5KKNB 5KX5F 3JRWA 1JDEA 4DLKA 5FNVF 1CE8A 4WBNF 3VOTA 5D8DA 4MV3A 5CB4F 5HBRB 1T36A 2YW2A 3AX6A 1EUCB 5J2UF 3Q2OA 4TUYF 3TINA 3VPCA 4E4TA 2ZDHA 2W6OA 4O7ZA 1DV1A 3AW8A 4O81A 4FE2A 2YS7A 2VR1A 1AUXA 2P0AA 2W6QA 2YZLA 4TV8F 1C30A 3G8CA 5CAEB 2NU8B 2PBZA 4O7RA 1E4EA 2XCLA 1GLVA 4O2BF 2W6ZA 2R82A 3HO8A 1VBGA 1OBGA 1PK8A 3R5HA 5LOVF 4O83A 4YJ2F 4ZOLF 3R9RA 2HGSA 2W6MA 2YZGA 3HBLA 4FFLA 2I80A 1KBLA 3MWEA 3R23A 1JLLB 2V58A 3GLKA 1EYZA 1EUDB 2YRWA 2SCUB 2QF7A 4O82A 3NUAA 2FP4B 1SCUB 2GPSA 4FGRA 1KEEA 1Z2NX 3KALA 1GGOA 4I4TF 4O7NA 5J2TF 4MV9A 1M0WA 2YRXA 4MV1A 3RFCA 4XZ3B 5JQWA 1VKZA 2NU6B 3ETHA 3RV3A 4IIJF 1A9XA 2DIKA 3VPBA 5BPHA 3G8DA 3RUPA 4ZQIA 1Z2OX 5DMXA 4MAMA 4YB8B 5C8YF 1C3OA 1IOWA 5LXTF 4L1KA 3BG5A 3LP8A 3WO1A 4O86A 3SE7A 4HNUA 2YYAA 2DLNA 4MA5A 2C00A 1EZ1A 4DIMA 1B6SA 2GQRA 2NU7B 2VPQA 3R5FA 4XYLB 3ORQA 4FFMA 3UFXB 2QK4A 3Q1KA 1KUTA 1DV2A 1CQJB 1JKJB 4MV8A 2HJWA 4HQ6A 4NYEA 4FFNA 5CA0F 2R7MA 4ZHQF 4I50F 1M6VA 4O7SA 2FPGB 2V59A 2CNQA 3VMMA 4HNVA 4IZOA 4YAKB 5LA6F 2CNUA 3K5IA 2WYOA 1BNCA 4TV9F 4MV7A 2YZNA 2W6PA 2OLSA 3DF7A 2R87A 3VA7A 2R7NA 2V5AA 2R84A 3K3PA 1B6RA 3MJFA 2I87A 2W71A 5IYZF 4I55F 3U54A 4O84A 3K5HA 2I8CA 1KJIA 3HB9A 2FB9A 2YZMA 1ULZA 1M0TA 5GONF 4FU0A 3MWDA 2GPWA 4M9UA 5BPFA 1W96A 2X0SA 2YWVA 2YL2A 4YJ3F 2ZDQA 1A48A 3U9SA 4HR7A 5JQGF 3ORRA 5C1PA 1PX2A 1I7NA 1CQIB 3KAJA 1KJJA 3JRXA 4O4LF 2R85A 2NU9B 4C5BA 3R5XA 5JH7F 3TQTA 3RV4A 5HV6A 2Z02A 4IHJF 5LYJF
chains in the Genus database with same CATH superfamily
1YJ5A 3MQFA 4ALKA 1LLUA 1SN7A 3GXBA 1PL8A 4CM9A 2IPMA 4JLWA 4G3XA 4P0TA 3NGLA 4MYCA 2D1TA 1VTKA 3FJOA 4N5HX 5KT4A 1XMOH 1EWTA 5AUQA 4X3OA 2BZSA 4ZGWA 3KQSA 5BQFA 4D57A 4P8RA 2GCOA 1P9RA 2ZSFA 1UM9B 2WT4A 4NNJA 2CEKA 5LN1A 2OC9A 4W1PA 2VAVA 4LJKA 4BB9A 4QQKA 1FYWA 2HGWA 4CNQA 2CFMA 4JT4A 1M2VA 2LGJA 3NDRA 4EEQA 4Q44A 1E1CA 1JL3A 1IRXA 1U1IA 4BO4A 1EG7A 1IK6A 1PZNA 4CE6A 4I50B 3R7NA 3QW2A 3IO3A 1S8FA 4D46A 2Q2OA 2BELA 4ALJA 5F33A 3LUHA 4UOQA 4B76A 1H66A 1YDGA 4HTFB 2GD6A 2XI4A 4PCUA 2GPBA 4F5DA 4XPZA 3VX4A 4YRJA 4TSRA 3JCZA 4JOQA 1PJ2A 3AJ9A 1UPUA 4B3SB 4QOSA 3KETA 3GB9A 2BEVA 1JTFA 5FTKA 3VZPA 4P0QB 3IAAA 1X0VA 1QOZA 2FF5A 2X14A 1ZN2A 3D6AA 4O3MA 4BJ1A 1PR2A 2A7XA 1P3JA 1IOLA 1J21A 2QW1A 2Z56A 2D1SA 4CMIB 1HR0H 2FXVA 4N01A 3BF7A 3JWIA 5BYAA 4NJEB 4AY2A 3S81A 1US8B 4I0WB 4AUEA 1XCGB 1EVQA 4HDKB 4A3EG 1TK9A 2NXWA 4E2XA 3SIWA 3DL2A 1T43A 4WBNB 3O84A 2VQ3A 3B9PA 2ECQA 4XYEA 1NF8A 5AESA 2CLOB 3KJIA 2R8ZA 4MR7B 4Y9UA 1P0QA 2J9FB 2CE2X 2P9FA 3RYCA 2O8BB 1C7RA 1U3TA 2YZLA 4EY6A 1TKRA 2GJAA 4RA9A 2WG1A 1E79D 2Y1DA 2R93G 1E6EA 5IJWA 1EQ2A 4YRBA 1DEXA 1VMKA 3WMFA 4MITA 4G8CA 4BNXA 3M4JA 1DIBA 3W5UA 2ZW9A 2WJYA 4KRFA 1A5ZA 3QVVA 3R5HA 4CEHB 3PSAA 4ESOA 2F9MA 3O8NA 2LNDA 1TCUA 1GO2A 1DC6A 2WMOB 3TKLA 1D8TA 1GGKA 1VP9A 1EFCA 3KYDB 1RLIA 3RRJA 1L5WA 1G3MA 4UHFA 1YZFA 4G0ZA 2ZUTA 1C9YA 3JXEA 4ECUA 5UKDA 4RVGA 5EJ8A 4ARBA 4PQRA 3T7TA 1VCHA 2JI9A 2I34A 9LDBA 2KHZA 4ZWNA 4XSVA 5BPHA 4L22A 2FLVA 1YAHA 1VJ0A 3Q8LA 3A6HA 3WYAA 5ED4A 2A0WA 2R4TA 1T2VA 1ZSYA 5DIZA 4RAOA 3ZCPA 4R8UA 2JAPA 5HTOA 1ZM4A 4AJLA 4EFDA 4QVGA 3H42B 1TF2A 4M9SA 4KE8A 5F9MA 5FOXA 2QYSA 3E2PA 3LT0A 2ENUA 1NW9B 2FFRA 3DLAA 4QW9A 1SBTA 1JX6A 1RXUA 1R50A 3NTQA 4HI0E 5HUHA 3FWYA 2YFHA 1Q44A 3WRYA 4FJ0A 4O1IA 1G17A 2HMTA 3NDPA 3U81A 3MIIA 2IOHA 2XR1A 2A35A 2OP1A 3L0SA 5TGTA 3TAXA 5EZSA 4UUNA 3TWOA 2ARKA 1OUMA 4OFWA 2QU8A 4PYRA 5JATA 4DSNA 4YUVA 4FGJA 2R79A 2FYTA 3NKLA 4JP3A 4FYHA 3PDHA 2HIMA 3KLMX 3EVZA 5B3AA 4CV3A 2NN3C 5DLYA 1NG1A 1RWKA 3RUIA 1CR2A 1LVHA 4C7OB 3ZGZA 2C1ZA 4G6ZA 2POQX 4DBZA 1M34E 3CLTC 3PQ7A 3ND5A 2PDAA 3GRYA 2VF8A 3U62A 1UBCA 1ODCA 3O8OA 3H8SA 1EVJA 2VBCA 3BJRA 4H2DA 4URUR 4Y2JA 1O97D 2Z2JA 4LZJA 5LLTA 3JD4A 1DAAA 2EZUA 3KIPA 2IHVA 2QMOA 5E38A 3L0IB 4C0JA 1TQHA 1HNXH 1QDUA 5A62A 4KL8S 3QGMA 2HSGA 1TU0A 2HYIC 4DNFA 1T6ZA 2AEFA 3O95A 1K9SA 3N8NA 5AVJA 3OE5A 3GJXB 3RFXA 5KOHA 4EKIA 3O1IC 4M53A 3UV6A 4X84A 1U8AA 1E63A 1F14A 3H83A 4I8IA 3R7DA 1K89A 3RHSA 5A4MS 2AG8A 4LISA 1EJ2A 5E0KB 2UUPA 4II7A 4Q7QA 3AVVA 3NEYA 1OVGA 3OJEA 3QOWA 3DLCA 3GJ5A 1NV9A 4AJJA 1J5PA 3USES 3WNBA 1EQAA 4U7GA 5PNTA 2CFIA 3E3MA 1XRLA 2WWHA 4Z86A 2H0QA 3NANA 3KR1A 5JMTA 4BRSA 3F67A 2Q27A 3DWGA 3GX1A 1QHHB 4X6UA 2ISQA 3W2FA 3LOQA 1G1MA 4XYBA 1CJVC 3RK4A 4F12A 4PLFA 4DLLA 1B1AA 1SUWA 3DNFA 4BEWA 2VNJA 2FFHA 1JHZA 1WMDA 1FDRA 1QYIA 4H1WA 4OI0A 5HNEA 1PCXA 1KO5A 3C3JA 1R6VA 4XTCS 5DE3A 2R62A 4RTNA 4MQLA 5L1LA 1ZCFA 3DP7A 2BFAA 3C5CA 2Q0HA 4JEUA 4DQUA 2PMZA 3TOCA 4EKGA 3A3KA 4E3ZA 4JBYA 3Q5DA 2ZRQA 1A1SA 4GU5A 3FHLA 2W2QA 2DR3A 3GEHA 3RCBA 1WXQA 3AR5A 3T34A 1EJ0A 1K4KA 3FNIA 4XQ0A 1L5QA 1UK7A 3L0CA 1IXRC 4YT5A 2EAUA 3LKDA 5KYKA 4UNSA 4Q48A 1WWKA 1S8OA 5TDHA 3KKNA 2ZS8A 4FGRA 3MWFA 2PX2A 4XDGA 3SYLA 2PAAA 3H0GG 3BIOA 3CWZA 1RPTA 1GUYA 3MD0A 4HCJA 1TD9A 3ZX5A 4FS1A 3KOWA 3URKA 3VR4H 5BW6B 3EFOB 4JLNA 4Y2GA 2P5UA 2UYYA 5BNIA 1CKOA 2ZKIA 2XUKA 4OXQA 4YXFA 1S0OA 3GUHA 3CRW1 1PW5A 4BNJA 5KYVA 1FIUA 2HU7A 3J81k 2YYAA 1XZMA 4AQ7A 2A92A 1XLWA 3HGTA 3FDZA 3DCNA 4KYUA 4OSOA 3FZYA 4HZIA 4R9NA 4RQAA 1GNLA 4ABYA 5DRTA 5A05A 4PPQA 2V7EA 1IN8A 4O1HA 2QAJA 3QELA 3RJMA 1T3NA 5K2OA 1GKLA 2VAWA 5J47A 5C5EA 3MGGA 4G5OA 5GOTA 4M7EA 2AG5A 3PNKA 5I6DA 3EEFA 3RADC 4WNCA 2JH8A 3IIKA 3KT3A 1I51A 1OREA 1YZUA 1RXVA 1P7YA 1A9RA 3QWIA 5JSQA 1HDRA 1HNNA 1MB9A 2UZ3A 5L3SB 2QPOA 3A6JA 2ZEJA 3L46A 2CLFB 3MUNA 2YWVA 2PAFA 4XEHA 3BXOA 4MUMA 1JHVA 2BBTA 4D8VA 1T0BA 2AUNA 4KR3A 2I6QA 5A4KA 1Q84A 4Z0HO 1G8JA 5JIBA 5KFRA 1N8NA 1JYEA 4GO1A 1TM2A 1L7XA 2G7MC 2PWAA 1LU9A 1BMDA 4Y8VB 4E08A 5SY6A 1N2ZA 1T25A 2AF3C 2V5UA 3BB4A 2JAXA 4NNPA 3IPRA 3LWZA 3S4YA 4DIUA 3UUGA 3OOYA 1GPKA 4TKUB 4YH1A 5U4QA 1XMPA 4B6EA 4ZCIA 3HYTA 4OQEA 4XSHA 3QWBA 4OHZA 1JKMA 3GFRA 4J2OA 5GV8A 2CNLA 1CUXA 2A33A 5A3QA 3UEOA 1M66A 4NH0A 1KFBB 3D8RA 2AFHA 3RVSA 2REQA 1L4GA 4ENTA 3FB1A 1Z08A 1C8BA 1AA9A 1TVKB 2DX7A 3D5QA 3GO4A 3FNRA 3OTGA 2RONA 3ADBA 1DHTA 1CD5A 1L7RA 1JIUA 2BDTA 2NO6A 4KQGA 3D7KA 1V8FA 1YHYA 1R64A 1VRWA 3DBVO 3GT7A 2OCIA 2ASEA 3QXGA 1SM4A 1U02A 4PSKA 1DQPA 2X9LA 3AEYA 4MMZB 1XGKA 2ZI4A 1TWGA 3SGLA 4MI9A 4PS1A 2CLLB 1RVDA 5FTMA 3IDOA 1PNQA 4WZBB 4Q16A 2XRFA 2JLUA 4A8HA 4LDQA 1D1PA 1PFYA 3EXHC 1IHXA 1Y1SA 4YT8A 2A14A 3FPEA 5A7FA 5K45A 3AXTA 2JBAA 2P3QA 2WAYA 4F3CA 5BV8A 3G88A 1WVMA 1Z5ZA 5CEFA 2YINC 2XYHA 1MTZA 2HJRA 1QZTA 1PR0A 2FK7A 2EWVA 5CFZA 1N3BA 4IHKA 2PLAA 4PYMA 3R20A 3ZE1B 4M1WA 1MV5A 2NAPA 1UINA 1P33A 3MG9A 4RD1A 4LG1A 1P80A 5DPMA 2B3DA 3HSSA 5HM8A 3J7AK 2IOFA 4DARA 4HQFA 4C6TB 3PFNA 1Z4MA 1VLZA 1HK7A 3ELUA 4GIBA 3EC7A 4EB0A 1NAIA 5KO2A 4KPFC 3WR5A 1MOQA 5HJ7A 2RMKA 3HO8A 1OBGA 1FP7A 4K28A 4OBWA 4CIVA 3F3MA 1FK8A 3WMXA 3JYNA 3QVMA 1CSEE 1JQJC 2X4IA 2FPWA 3JZMA 3C8UA 1NBMA 2DUUA 3CX3A 5EIBC 5FJIA 2BGUA 4Q02A 4EPYA 2Z98A 1P1BA 1QKIA 4ZOLB 1LLCA 1FTGA 1AQIA 3FFWA 4YWJA 3W77A 2ZJ6A 3UT0A 3UJDA 4NCNA 1C4OA 1EXVA 1QYRA 1HL3A 2IV7A 4UFZA 5HUJA 1SQGA 3PIIA 3E03A 4EYHB 1H3NA 3EQ2A 2IA6A 4R2KA 1D07A 1XEWX 4B79A 2R68A 1BX1A 1Z7YA 4R1OA 1QR2A 3V8NA 2G9ZA 2LBPA 1VJ1A 3WNVA 5I7SA 1OOEA 1GZ6A 3PW5A 1G9TA 2IK8A 4ZODA 1B93A 2B63G 5KFNA 1OD6A 3VMMA 1GXSA 4RNNA 1T2AA 4GYJA 3HFGA 1VMIA 4V0MA 3WB2A 1E5XA 3L7JA 5GJBA 3MELA 1UMDA 1D2RA 3BMCA 3C8ZA 3JQPA 3E3NA 1VLVA 1OWPA 1ZD9A 4LSXA 4NENB 3QMPA 4MRSA 2QL5A 1V8ZA 3QVGB 1GEGA 1JJVA 1FFAA 3SZUA 3CBGA 3NKVA 1RCFA 1XTZA 4YJ3F 3AV0B 2DTXA 3PGKA 3M70A 4CCYB 1JLLA 3P71T 5DOVA 3K20A 3F8NA 1G8HA 4OLBA 5LDGA 4GC9A 1I7NA 5EE0A 5ICMA 4RF2A 3JRXA 5DISC 4RHTA 1Q19A 2AFIB 4AX4A 1JEQB 3QNMA 1L8XA 4MWCA 5B6PA 2GHIA 1OZAA 1S1CA 1NMYA 3L0OA 1C14A 4YP1A 5DTMA 4DA9A 4WKNA 3CVYA 4G5XA 3KD3A 4KR9A 4QUEA 3MCWA 4M0MA 5ALQA 4EY4A 1I3LA 4PU0A 5DM1A 2PGNA 4QGBA 4G0XA 4AQYB 1ZPDA 5GPBA 2I9PA 3KB6A 4MUAA 2ZPAA 2Y76A 3CZPA 3IP6A 4B4KA 5B12A 1ZAUA 2REXB 4MUXA 2Y99A 3TF5A 3E58A 1VSQA 1I33A 1K1EA 2YCHA 3EOBI 1WMEA 4UDXX 2LD4A 3ZZUA 4B4UA 4ND4A 2WNSA 4X91A 3JVDA 2PA0A 2FR1A 4ZZIA 4HQKA 3AF4A 1F5NA 4QOEA 3DB1A 1IIBA 2IYXA 3HY3A 3NAGA 4Q93A 4WH0A 2PUJA 4K0KB 4TV8A 3RRMA 4JYAH 5I3CA 2XF2A 4TL8A 1I5RA 2AEMA 5DM2A 4F4FA 2WICA 2ZJZA 4M9CA 1RQLA 2VAXA 1IWOA 4HNAB 3KAKA 5EIAA 4M7RA 2XQVA 3UHOA 1DBSA 1HC7A 3NVMB 3MB5A 5LD2B 3RT1A 1YRYE 3VBCA 2PR7A 4L5BA 4QRHA 2AH5A 2WWIA 3STXA 4O4LB 2WD7A 3BRSA 1S0UA 1BA2A 1NV8A 1UFQA 2FNAA 2GBLA 2HAEA 1HG1A 2ZJ5A 2XA2A 4MPPA 4DIDA 1CUEA 3CPJB 3RYFA 2O2ZA 5JCXA 4UTXA 2QRJA 4CHGA 4DWJA 4FMDF 2YC2C 3DE1X 2XYRA 2GYUA 1VKRA 2QN2A 2GLUA 2XUFA 4UUQA 2EFYA 5HOEA 4NXNB 1XD8A 2GZ1A 4Z9YA 2NVXA 3ZK9A 4RHUA 2DLDA 5KOJA 3SQOA 1LDNA 1N3IA 4QNMA 2VTDA 4G8JA 5IJ0B 1FFWA 5LWQA 2BONA 2GMWA 3HDGA 2GO7A 1HRDA 1Y5NA 1N9GB 1NQUA 3SKVA 1OXMA 2B1GA 3I72A 1ILEA 1VL1A 1RJDA 2C5BA 4ECQA 2BBOA 3ZBUA 4W4TA 4BKQA 2WG2A 4HPXB 4X65B 2SICE 5BMVA 5IC4A 2NZ8A 2ZQZA 3P32A 3LGAA 4BMYA 1XN1A 3AB8A 3F5QA 2IZ1A 4D26A 4BNVA 1L4NA 3OM1A 4AN4A 3DW3X 4FDTA 3KHGA 4ZQFA 3HEMA 1Y9EA 2J3LA 1CULC 5I60A 2NTJA 1P4GA 5K3SA 3WO1A 3IQXA 4Q1AA 3WMRA 4MP3A 4JYZA 1FFYA 3NCTA 1LI5A 5B3JA 1X1DA 2E82A 3FKJA 1RRVA 2PJUA 3A9TA 3TGWA 3ZWOA 5CLFA 3CF2A 2QL6A 3GLIB 3RFFA 1DV2A 3ETEA 3ZCTA 1RFLA 2HF2A 1JBQA 1T5DX 1XA3A 4EMUA 4NHOA 2AKEA 2FP3A 4TQAA 4DDMA 4R41A 1A9OA 3IKTA 1U3VA 3CIFA 1IN1A 2BFFA 3PWTA 4A2WA 5IAAA 2NYAA 4AY4A 4WEQA 1ULBA 3L4BC 4YUWA 3THOA 5DLDA 4I55F 4YHBA 3MYRA 1SC3A 2A1UB 1KYIA 4M0LA 2ZUBA 3W0LB 1CT9A 4W5JA 4B3MH 1WVIA 1PU2A 4R7ZA 3DT8A 4HXFB 3W34A 4A5SA 1OTYA 2YR0A 1YMVA 3CF6R 3O4GA 2PT6A 4C78A 1R6DA 1U2EA 1A9PA 1NAHA 1ZU4A 4G97A 5FBVB 4Q9LA 3I0NA 3IQIX 3EODA 3VNBA 5KJEA 5KNBH 5EIEA 1WCMG 1FUUA 2GN0A 1UPCA 3PJEA 2O1EA 1FDIA 3M5CA 4EHNA 1K3FA 5IS2A 2PBRA 4PLZA 4P4UA 2OXTA 1RABA 3DTGA 2QLNA 1W36D 2X1LA 3QE2A 1ISJA 3B7PA 2E85A 3F1KA 2OV3A 1U31A 1H9CA 5C8YA 3WC4A 3TW6A 3GV5B 1ZK3A 3IHTA 2ZRMA 2Y1KA 4BIIA 4LDPA 2ZJYA 5IBRA 4N8DA 3TZEA 3FKIG 5ENZA 1X3SA 4DL6A 4UQOA 2AC7A 3WYCA 3K8OE 4CM4A 5JHHB 4F04A 3FR7A 4RKQA 1DZIA 4M0PA 5LKRA 1OC4A 4XWAA 3QKRB 5B1IA 2B6HA 2QRKA 2QRZA 2B30A 2WVHA 2VJQA 2QGZA 1KDTA 1XDBA 1SHLA 2XECA 1T6BY 2P4QA 2D1RA 2C84A 4EBBA 1JEYB 1YB2A 4MV4A 2IZ6A 1TJ5A 3WGIA 3VI3B 2JHCA 4LHZA 2PX3A 2PZKA 3D8NA 3WLHA 4AYTA 3LS2A 1V11B 1AGXA 3EVEA 3TI9A 3BA8A 3JSXA 4OHMA 1P3Y1 1X13A 1N36B 2H8KA 1PG5A 4F4ZA 1ECGA 3KQQA 3STTA 4NYIR 1EUCB 3F6BX 2BFNA 2VDWA 2J41A 3ZCRA 5WRFA 4J9KA 2O5VA 4XFKA 4NC9A 1D2MA 4O0MA 2RK3A 3KUCA 3OHMA 2PD6A 4TYYA 2BSXA 5DGIA 3GYBA 4OL9A 1F48A 3BFKA 2ZVJA 2AOVA 4YO7A 1WZEA 4OGKA 2FVXA 2RAVA 4Y18A 4MDHA 5C1BA 2GN6A 3E2MA 4R1UA 3ZVNA 4H77A 2E1PA 1VBGA 1XZHA 3SQNA 3OZBA 1CJKC 2Z5FA 5SZJA 2JBHA 1XOIA 1ZCAA 3T7DA 5KS8A 1N3LA 3UK0A 4RH3A 1RAAA 4ZP1A 1K7SN 3FPAA 2O8EB 1N33H 3G0CA 3PNLA 4R9SA 3Q5GA 1ZRSA 2ZVDA 1HA3A 3G82C 2C9YA 3KALA 3DDCA 4ZARA 3F6PA 5IUJC 5JSYA 3OKCA 4L4UA 1SCUA 3Q8XB 4ZQIA 2XWBF 4DHEA 4LMBA 1RHJA 3OCZA 4G5RA 1SD2A 3C8DA 3ZTTA 5DU2A 3QBDA 2ZR8A 5DM4A 1KC3A 3CT6A 3UAVA 2H48A 2IUFA 4MYUA 2GM4A 4EA7A 1Y4DE 3G2HA 4FFBB 5HTKA 3KT0A 1KPIA 1LPOA 3DAOA 4TMFA 4AG5A 2ZI3A 2K7ZA 1NBHA 2C7QA 3Q72A 1NJFA 2XYQA 1KZHA 2OM2A 5JBNA 2R7NA 5HFJA 1LEHA 2ATLA 3SYNA 3ZGLA 7ADHA 2W71A 1RYBA 3DMTC 2POCA 3IS3A 3KEOA 2UVDA 3TCNA 3PVCA 1HYGA 2R25B 3CW9A 3ZU6A 4RWEA 1XF9A 3BK1A 1TPYA 2VZ8A 4PGFA 1ZQ9A 1ZHQA 1DSSG 1P60A 3O4JA 4DUYH 5HZGA 3PPXA 4NWIA 5J40A 4JLAA 4C4PA 4MVJI 1KJYA 1JYFA 2VC2B 3PVSA 4DCPA 2EX4A 9GPBA 1J33A 3CURA 1UT8A 3AEUB 3DMGA 5BV1A 3DWFA 4D42A 1JDVA 5TT0A 5KOYA 5FWYA 3L0PA 2WF7A 3E1SA 1DIOB 3D7LA 2UVRA 1POWA 2EYUA 2QJFA 2BGRA 3WX0A 2YWRA 3PL5A 1EK6A 3REQA 1E4FT 3ZGVA 1W76A 3H9UA 5KFVA 2AV6A 4XCXA 4HUTA 4FYPA 2W57A 4LVCA 5HE8A 4BMNA 3S2FA 1CEYA 5A9TA 3PRJA 2FPGA 3DB2A 1WPXA 1J56A 4KSYA 3FOZA 3AM1A 4TN5A 1GCIA 2DUWA 6AT1A 1Y81A 2IYVA 4OKNA 4ZTBA 1MAVA 1H6CA 1Y4ZA 4YHHH 1TIKA 1Y1VA 3CLUD 4NFHA 4YR3A 1OZHA 3N0TA 4TV9A 1EP9A 1GL7A 3C74A 4UARA 2B8TA 5LQAA 3A9UA 4GMDA 1KQFA 1Q20A 2Q9AA 2DOKA 2ORWA 2VNSA 1W4AA 1D7AA 2P91A 4C21A 3ROGA 1ET0A 5IKMA 4ZYTA 3ZQ6A 3KAQA 4ASUD 3JAWB 5KKCA 3RROA 1DC3A 1YZVA 3S24A 3QK7A 1OPXA 2YW2A 1RPNA 4R7GA 1K7XB 1Y80A 1TZJA 5CJJA 5J4KA 1TW3A 5KFDA 3VO9A 4V0LA 4HK4A 4KW7A 4OD0A 4AKEA 1J6UA 2Q2TA 4NR0A 3CFYA 3WL6A 3A6ZA 3NBYB 1P77A 1TUBB 1VL5A 1Z12A 2FPIA 2ZZKA 3REFA 2JZOA 1TMYA 4Z7JA 2NUAA 2W8BB 5L1KA 4FZJA 1A9SA 3JTEA 4DWOA 3BCHA 1E5VA 4QWMA 4HADA 1MO5A 5JECA 3OWOA 3LQRA 5E7IA 4ND1A 1ZMOA 3O4HA 4RZ2A 4F9TA 2IHJA 1QANA 2R1TB 2A5GA 3QLEA 3SICE 5BWRA 3QEOA 3TBHA 2E3JA 1UXOA 4ZJYA 2DHDA 4RK0A 2H4HA 4OQYA 4R1NA 1FDOA 4M3NA 2FFQA 3JQAB 2VTVA 3DZFA 1F60A 4Q45A 5IT4A 4CN8A 3WGVA 5JQWA 5JMOA 3QWAA 4OXYA 4KIUA 3K5WA 3QPUA 1PAUA 1HDYA 1MQAA 5AXBA 5A3JA 1YBAA 2P7IA 5FUWA 2VHEA 4LE2A 4WNYA 1R10A 1GRVA 1Y3FE 4PYIA 2I6XA 4R68A 3TEJA 1N2GA 1RAEA 4QUKA 2ZJ1A 4C76A 5C9ZA 2PVCA 4B4WA 5CEJA 1E60A 2Z09A 4M8LA 4P7JA 3WLFA 5INTA 1KUTA 5LWHA 2FEWB 3CWQA 3L7NA 4RDIA 4NBKA 3W6OA 1VGVA 4ECSA 3RIHA 2QS9A 2COJA 5F3RA 4FQ7A 1I2CA 2CNUA 1MJGA 1FJGH 4K8RB 3M6MD 4B45A 3QUCA 3NFYA 3AJRA 1FOEB 1SY7A 5FA8A 5BWTA 4B3RH 2X1HA 1K7YA 2UZ0A 3HJTA 5B36A 3LY7A 1JHMA 4HB2A 4DV7B 1IPEA 2RIPA 2AEEA 3CVVA 1IHYA 1Q0QA 5HCIA 4J0CA 4AJNA 3I2FA 1H69A 3HB5X 5K0NA 5EIOA 3CMCO 3LF1A 4ZT7A 1Y6RA 3IAUA 5J4LA 1XN4A 4L3WA 3NJ8A 5DWDA 4J3NA 4Q4HA 4RTJA 4YROA 2XB2A 2C99A 4U7WA 3F49S 3ZH9B 2RB4A 2GK3A 4ADSG 3ZLTA 4TYPA 5ALTA 2VAMA 5HMLA 3TM5A 1KYXA 4EI7A 2IDMA 5BSTA 2YVKA 4JQOA 1IZ0A 4PSVA 3FIJA 3J7AC 5JXHA 4WLUA 5CDTA 1JDZA 5T3UA 3PXUA 1ZJ6A 3Q5EA 1K7FB 3IN5A 1UXJA 3ZK7A 1NMEA 5IYCG 2IBSA 3AR9A 1XZFA 4BCCA 4GSKA 2BZ0A 5C1OA 1OI4A 5FPQA 5EY5B 1CZRA 2PCLA 3DZHA 4JBIA 3HKCB 1ZRHA 5FJJA 5AI8A 1JSRA 4YAKA 5T64A 2XA9A 1K8XB 4AS3A 2JLBA 1DFIA 2QAIA 3AU9A 4WLFA 4O7YA 1GUDA 2RD2A 1MENA 4ZHQA 4NU0A 5CK4A 1GP2A 4RUKA 1L4MA 3C1UA 4EBCA 3ZGXA 3HRIA 3HGQA 2X5NA 3L07A 3NW9A 4OQQA 3RG2A 4QAQA 5DCWA 3OUUA 4W5QA 1PYOA 1S03G 3TH5A 1QHIA 3NR2A 2QSYA 3IQZA 5A5DA 5SYAA 1Q3KA 3NC4A 5BNWA 5IYZA 5IT5A 2R5FA 2QPLA 1BRMA 5K8JB 4M1YA 4WBNF 2A59A 5CPFA 4IVNA 2GZ3A 2V7BA 4XCVA 4Q3BA 4MEAA 4DR1B 1XJ5A 3KTDA 2YICA 1U28C 5FPRA 2WF5A 2XB9A 2FU5C 3ZU4A 3KL4A 5C37A 2DR2A 4DUPA 2LV8A 3K70C 2JH9A 4UQPA 5FWDA 1V4NA 4KBFA 3TZBA 2D5AA 3CWCA 2Z8YM 3FZQA 3MOIA 4MVJG 4YMHA 1FRQA 3QQMA 1QAMA 2NQ2C 2XOKD 5AVKA 1M7JA 1NI4B 2YX1A 2Y1FA 4F5WA 2N75A 1X2BA 5JTTA 5D1OB 4JBLA 1PR6A 4R1PA 4JJ7A 5JCOA 4EB6B 2FETA 1A5SB 5DXFA 3TRDA 1E7MA 5HE9A 2D2EA 4QUJA 3NTXA 3KYCB 3BUSA 4Q0MA 4FWBA 2CXXA 3WWJA 2QAGC 3AUUA 3LT4A 2QXUA 4MCAA 1KHTA 2Q6KA 5CVJA 5EOVA 1V4YA 4NDNE 4K40A 3NIFB 3TKAA 4D7AA 2Y1EA 1F2TA 1VDMA 2MSKA 3SP1A 3DPIA 2QQ0A 3F3KA 2BKVA 3SYKA 2UUCB 3LECA 5ALOA 1LPAB 4RA6A 2ICAA 5JI3E 2KBFA 4U8HA 4RW0A 4XWTA 3ESCA 2P0EA 4DIEA 1AMOA 2HIGA 1HNZH 2GBGA 3WQBA 1FW8A 5K3AA 4WY5A 3DMHA 1NRIA 1R27A 3ROPA 4MW1A 2EFCB 4AP6A 3IUPA 3H11B 1J0CA 2HMYB 3NRBA 3OLWA 4LI0A 4QDZA 3SIRA 3UMFA 2FW1A 3ZWNA 1OQAA 4D4GA 4G37A 1IYDA 1RWQA 1A8UA 4J3FA 4KPEC 3QVXA 2VUGA 2O2GA 4YGXB 4RIEA 5BN1A 4HO1X 1U8YA 1N5DA 1GCAA 5DG7A 5IARA 1YOVB 2V6FA 3GQBA 1NI5A 3FTEA 4YMGA 1MO6A 2YZMA 3ZHBA 4G1BA 4MW5A 3I1JA 5C2JB 4GE0A 1PGPA 2V6JA 2BHTA 3MWDA 4V0SA 1V45E 5JY6A 5AW8A 4FXPA 3KVRA 2MSEB 2XLCA 1MKYA 4X20A 1Z0IA 4L4ZA 3VC7A 2OCYC 1V5FA 4TL9A 1ZOIA 1HLFA 5GONB 3A14A 4B7AA 3QLUC 1QGUB 4MRMA 3BMNB 4MSUA 4DR3B 5TF4A 1ISMA 5AW0A 3FFTA 1NLYA 1ZN8A 1YBFA 2JFOA 4OPMA 3TPZA 3PLNA 1QHSA 2BFBA 3V1KA 1UNNC 3V46A 4KDCA 3HNOA 2V55B 3LOPA 4N18A 4UCUA 3MGKA 2BP7A 3SLRA 3ITKA 5DFAA 4YJFB 2FMHA 3QH4A 4ZEWA 2QJWA 1ST3A 1Y4UA 1HKUA 2ZYDA 4G4SO 1V8DA 1BXGB 1QB7A 1PUIA 1B2LA 3ICPA 4ZRNA 3GCZA 1T3HA 3EZ7A 1R4ZA 4B6OA 2EJ3A 2FOIA 4K9PA 3O4VA 4LMRA 1LRJA 1U7ZA 5EC8A 6LDHA 4L2IA 4YCMA 3IUQA 3N2LA 4WJZA 3OVMA 4O3RA 2VA2A 1G19A 4RCNA 5JYDA 3ABRB 1HG0A 2PM8A 4JR1A 3ROXA 1V26A 4NESA 1CETA 4YRNA 4IJKA 1DWQA 1CFZA 4C30A 3E35A 4S3MA 3QI7A 4QEKA 1I94H 6PFKA 3BDAA 4HYYA 5K8TA 5FWXB 1YRWA 1VYTA 3UN1A 2WPDA 1WR2A 3FWZA 1WUTA 2P3LA 4TPKA 2H4WA 4DPLA 2HSDA 5FBRB 3BWCA 2AN3A 3GZTB 3CZCA 2LDXA 4NBTA 3CVOA 1QTRA 1EJ6A 4UTPA 1QX3A 2GT1A 3IB3A 2EJ0A 4YEDA 3WGJA 3MPOA 1SBNE 3FB4A 5ENDA 1IY2A 1PR3A 4CMJA 3FYDA 1NSYA 1Q7EA 1JR2A 2YJ4A 4JV2A 4M98A 1BC5A 2GDJA 1KOJA 2AJTA 4C08A 2AK3A 3LAWA 4E5NA 4MK4A 2ETXA 1E9CA 3AW8A 2P3SA 4QU5A 1FYDA 3TOVA 4MW4A 1KA9H 2P2CA 2VYFA 1E9SA 3Q12A 1EG2A 2NG1A 5T57A 3SM9A 3THYA 4Q9JA 4EGSA 1QPGA 4DGSA 3RVMA 1ZNYA 2FZKA 1P7PA 2V0GA 1VGQA 2LTAA 3BKWA 3KOZA 1LDMA 1W6UA 3UGKA 1RXWA 4WI1A 1XBTA 4QYWA 2JHAA 2PUDA 2V4ZA 4NBUA 3PGXA 2GEBA 2EW8A 5JEDA 4N39A 1D6NA 4B3HA 3NUZA 2IEBA 3TO5A 2ECFA 1OROA 1T0PA 1VIMA 3QHQA 1V8BA 2IPLA 4I55A 3JV7A 5AKEA 3OY2A 1N4DA 5K20A 4CGZA 1NM5A 4FS8A 4XD2A 5CJ2A 4L57A 5B1HA 3BTSA 3LFTA 4ZYWA 2JGDA 5KQLA 1TI7A 1JYSA 2B69A 4U7PB 4EFKA 1TEXA 1BFDA 2ZREA 3AKYA 2IXDA 4GDMA 4H60A 1SUEA 2IYFA 5E3JA 4CQMB 4KWIA 2DPIA 4ZKEA 2ZSHA 3PWSA 4WJKB 4Z9AA 3BGWA 1OC2A 3A05A 1R6TA 2JFQA 2QYTA 2ZYAA 2GYWA 2ZOSA 5JZOA 2VYCA 4GOMD 4ATNA 2JA6A 1W29A 3ZS9A 5F2EA 1WP4A 2X9NA 3NTRA 2AI3A 4IOKA 4J7CA 4J0FA 4KPYA 1Y7LA 3MERA 4WZAE 2BM0A 3PFKA 2PO5A 2VSFA 4HLNA 3ONDA 1MHTA 4P7FA 1SC1A 4ID9A 5ALNA 4UTVA 3R5TA 5ALZA 1TMOA 5AJVB 3KOYA 2NU9B 5JHGB 3TG2A 1R7RA 3SVZA 1YL7A 3B7WA 4MA0A 3GBPA 1WZUA 4BNMA 4L16A 2DU8A 3GJ3A 4YJGB 3M9OB 4TXMA 4AS2A 4OREX 2PY6A 4IIVA 1P6XA 3CISA 3JARB 4YAFA 3K32A 2OFWA 2Q4RA 2G09A 4DY4A 1Q0ZA 1OYOA 2G3YA 1PFWA 4YP3A 3ONWA 5T5QA 1YCFA 2IYOA 4G1EB 3ZHUA 2EP8A 3P2YA 2ZXFA 1RJRA 1G2QA 2APJA 1QWSA 2NU7A 3H4TA 3CEPB 3KQHA 1SCJA 3R3HA 2UU9H 1ACLA 3VTZA 1NQ5A 4D56A 1NR1A 1ONPA 1N8TA 2ZJFA 1I4LD 3F3SA 4PANA 4M55A 5I5XA 3PHCA 2ZQYA 3UJNA 3IQFA 4RY2A 2R8JA 3IUMA 1E3JA 4OHXA 1TM1E 4M8NE 4RZRA 4ON9A 1U9JA 1OYYA 2GXAA 2P5TB 3AI2A 1NF9A 2PWBA 2XUHA 3OF5A 1LS6A 1DKLA 3ZHCA 4CM5A 5I51A 2O3UA 3P52A 4JY7A 1XQ1A 1R88A 1MO3A 2XWSA 1KY3A 3RU9A 4YT4A 1OH8A 4B7XA 4CUKA 4J9LA 4LECA 4BQEA 2BF4A 1OYWA 3B52X 4ZK2A 3N70A 4ANFA 2YWDA 4MVCA 4NZPA 3V42A 2HHHB 2QMEA 2D2FA 4D96A 4CT5A 3K9BA 2PIAA 3OIYA 1Q15A 1VKOA 5FL7D 3COYA 3AF0A 1NN0A 3PNBA 1Y1PA 4DJTA 3FZEA 4PO3X 2AOXA 3MR2A 1PNRA 2CUZA 2ZG6A 4U9HS 1NVFA 2IZ0A 4F7DA 3RAGA 5BN4A 3M6AA 1XXHA 1E5TA 3OCWA 3WDKA 1XAIA 2PGAA 3OCCA 4LFAB 1Q5PA 4O2AA 2R1VB 1SHTX 4ZI7B 3VAYA 4GD3Q 1JB1A 1W94A 2GO1A 2PBZA 4O7RA 4F46A 1Q50A 3JQBC 3AVQA 3LVQE 1BYIA 1VB3A 3ZWBA 4JA2A 3M4NA 4O2BF 3O73A 2ZB4A 1OBFO 5L45A 3WL7A 5JUWA 1LQTA 1E20A 4XQEA 4NXMB 1PZFA 3NIGB 2WR8A 4ZOLF 1NYQA 3NXKA 5GVRA 5FUQA 3DE0X 2HLHA 4X9XA 1NBIA 3S2GA 3HKEB 3R23A 3OZEA 3ZDDA 5KQMA 1QIJA 4DKJA 1FBTA 1H4VB 4LJ6A 1IY8A 4U3JB 5AW3A 1L1RA 3DLPX 4EEYA 2ODPA 1FP4B 1KRXA 1E2NA 4UEQA 3BE8A 4KVZA 4FMCB 1Z4KA 4OXNA 4PICA 2EJCA 1UPBA 2R6HA 4HFJA 5LP6B 4TSFD 2WQZA 3FUTA 5KFAA 4B82A 1M1NA 2ZTLA 3DVLA 3FCYA 4H7IA 4RVOA 1YR1A 1IJKA 1IHDA 2E87A 3PFHA 3TLGB 4B8WA 3N87A 4HAXA 1WE2A 3MF4A 1MOSA 3LF2A 3FYUC 3WKCA 4JI5B 5ESRA 3L0YA 1R0RE 3A7EA 1CIPA 3I28A 2ZYHA 4DUGD 2DE0X 3SBOA 5BT9A 2X4DA 3HCEA 1QHEA 3K4PA 1ZHHA 2A1TR 4QGHA 1DO8A 5CFRA 2I1QA 4QUBA 4B17A 2PXXA 1NMZA 1HYHA 3CG0A 4HAOA 1N2XA 1V51A 4IWXA 2OQRA 4DMFA 4E6EA 3K5HA 2QROA 1VMDA 1G21A 2FK1A 1RS0A 4HN4B 1SXGA 4QHSA 4UUAA 3K8QA 4GAEA 4YCJA 2PMBA 3BA9A 1WDKA 2GTPA 4W7HA 5DBFA 1H22A 1O8BA 4TWIA 3UUFA 3Q8KA 1Z73A 1GTL1 5KAMA 3NRJA 4WASA 3PC2A 3MXOA 1YZGA 4TRNA 4CM8A 5K0LA 3TNDA 2SCUA 2QG9A 5JS2A 4WXHA 4LXHA 1KOFA 5CK5A 1WX1A 4D9MA 3ETJA 2OB1A 3K72B 4IRXA 2WDZA 4OGWA 3KREA 2B25A 4JX9A 1Y9JA 1JPVA 4IM7A 4UTNA 1CY1A 3R7LA 1RJQA 2C54A 4JP2A 3V2GA 2ZVPX 1CY0A 4AMUA 1FQOA 1GTJ1 2VEOA 4RJIA 1R0LA 1D2EA 2JEJA 4J1QA 3R6TA 5HS4A 4WERA 4NZMA 2CXNA 4QDUA 4ALMA 1ECBA 3LXMA 5EYPA 3MTJA 5CLQA 1MFZA 2Z5VA 3H86A 2O6LA 5KWJA 4ZPXA 1Z3IX 5BN5B 1GUFA 3RIYA 4B85A 2D0DA 3KJQA 1WD5A 3L7BA 2BEKA 5FV4A 2BD0A 4ZCSA 2QD4A 4MI1A 3T15A 3DDSA 5DKFA 4JUDX 4AXBA 2XWJI 2YYSA 1YXMA 1UEXC 3N6RA 1KJZA 3EZNA 4OQZA 1M75A 4I1RA 4OLHA 1EIWA 5T7BA 1PZGA 4LY0A 3L7CA 3ZG6A 1D4OA 1KGSA 1MJFA 5G0VA 3LO8A 5A6SA 2C98A 1QBGA 2ILTA 5DN6D 5HIAA 4LXUA 3DSRA 5JXIA 4AUNA 4F84A 2RGNA 1O77A 3D4PA 1UM8A 1W581 4CQLB 4JQCA 3DUWA 5CA1B 2CY0A 3EXFA 1RWBA 5KTSA 3FCOA 3LBAA 2XKAA 1DC4A 2JATA 5ALKA 2NTYC 4Q5IA 1R0CA 2E4UA 3SDBA 4DWVA 5FNVB 4EG4A 4TWRA 1YU9A 3ADCA 2IKQA 4ALLA 2ZCJA 1E99A 1CVLA 4Y9SA 1KERA 2JRCA 3H6KA 3BJIC 3MLAA 5K99A 2HIAA 5IVDA 2P0AA 1XQ9A 3DD1A 1MCZA 3WLSA 4E21A 1E79A 4JIGA 3MN1A 2XMBA 4OK3A 5FLXW 2C7VA 4KPUB 4NQRA 2EZTA 3HMKA 5BVGB 2ONJA 3DMNA 2WQ6A 5DRYA 4EW3A 4YRMA 4YAWA 1K66A 2FSFA 5JVDB 3IHKA 1VYUA 4FTWA 4J0JA 2EQ5A 1L5SA 2Y93A 1PT7A 4PQYA 4ZOCA 3BMOA 2QY9A 2ILVA 2WYVA 1A5AB 5FOVA 1U0OC 4RSRA 3V00A 2LCIA 2AZXA 4LX8A 3TTXA 1YCGA 4M9RA 2X2EA 5CLJA 3IIJA 1IG0A 3O3NB 4QBKA 1S2OA 1AGYA 4XYMA 2F3UA 1TJ4A 3QA9A 2JLYA 1AIPA 5ARDA 3EGDA 2H92A 4AK9A 4DQNA 1F8XA 3ID6C 3JAMA 3H2BA 4US0R 3BHJA 2UXCB 1SXJB 3UYYA 4CMKA 2W2LD 4QU9A 3SD7A 4MO2A 3U16A 3NBFA 4WDRA 3ZBQA 1TGVA 3SN6A 3WFJA 1TRHA 4UEOA 1VFPA 3KQVA 5BURA 6Q21A 2WSSD 2NZWA 3MJVA 3WGZA 2ODTX 2PD3A 1G7CA 4QYIB 4NYEA 4RUCA 3IUEA 4JX8A 1KDOA 1OVMA 1VJCA 1N48A 1CFJA 5L4SA 2D1QA 1JKJA 3B3AA 4JSRA 3M9NB 4RELA 1E18A 4JYBA 1PN3A 1H9AA 3PRKE 1SCBA 4OHUA 2EBUA 3TMAA 2HM7A 1OFUX 2Q1YA 2HFJA 1RMQA 2G6TA 4XWYA 1XTPA 2GVNA 4TLLB 3MR6A 2CLIB 3IA7A 2ATEA 1EKXA 5HX7A 1K83A 1QH1A 3LDHA 4XGKA 3TRHA 4ZCPA 4B2PA 2IYYA 4AMGA 4DM4A 2PL9A 1F4LA 8MHTA 1WF3A 4Y6QA 3Q87B 3SF8B 1PBNA 5KYTA 3SGIA 2XZDA 4Y7CA 1YC2A 3HYLA 3G9TA 2VAPA 1EWRA 3G17A 1E6LA 2E1RA 2Q3BA 4LGMA 2H9AA 2JA5G 5DX0A 3N43B 5HIKA 2G83A 1RM0A 4R9UC 2JAQA 3KUUA 3WL5A 4TMXA 4JK3A 4LHYA 1NXXA 1ODKA 1FLVA 4PLGA 2AB0A 4DQLA 1GU0A 2PANA 3PO2G 1P75A 4ECWA 3W4JA 4F6RA 2O54A 1FE8A 3KVNA 4OP1A 1QYCA 2ZRPA 1H85A 4FONA 5DI3B 3KFXA 4KMOA 1Z18A 3DA8A 1B41A 4DDVA 4GC7A 3PTAA 1IN6A 1OLXA 2NO9A 3MWEB 2BFDB 4H6PA 3QE0A 5JR3A 1GSAA 1FTNA 3I5AA 2C5AA 3OZXA 1P2DA 1ITZA 4O33A 1ESZA 3TD2A 2II6A 5A2QW 2IZ7A 3RS9A 2DFVA 2HBRA 2XMCA 4DABA 3U3XA 5L7TA 1GSHA 5H3CA 1CWUA 4RAQA 5NULA 3N8IA 4DCUA 4BV8A 3WMWA 4YACA 2RGRA 4W5WA 3OLXA 1QU3A 1HLPA 4OLFA 2CXOA 1RYFA 5KFQA 4FWTA 2TMGA 3RAPR 4QJIA 3PJGA 1AKNA 2PLRA 2AN4A 3WV4A 1GKYA 4RK6A 1JQAA 3HC7A 3NP9A 4Z3DA 2ZB7A 4OX9B 4NMXB 4LSMA 3DLTA 3OU6A 3QTLA 4X93A 4UUMA 1I5OA 1J49A 3PTLA 3UATA 4FILA 3GJ0A 2ZR9A 3W5AA 2YV3A 2M1ZA 3TTSA 4WNAB 1AF4A 3P9IA 1KOLA 3D8BA 4DR4H 1DO2A 2WA1A 4CQJA 4D9JA 1PVOA 3SBXA 4A0HA 1NATA 5LOVF 2QOEA 1TE2A 3I4MG 1UQRA 4GI3A 3AR6A 4JJ6A 3EF3A 2P6OA 5LQUA 3GLKA 4LQDA 4LVOA 4V1CA 2MR6A 4F5ZA 4QM6A 2BR0A 1G38A 3N40P 1BVUA 3EC1A 4CF3A 3ZHVA 2HHLA 3T41A 1H65A 1O95C 2C57A 1Z2NX 3KPVA 4BP9A 1PX0A 4CDNA 4Y7DA 1PEYA 1IRIA 3EDMA 4Q4JA 5E2AA 3UOAB 3RODA 4YAUA 2ADFA 1K6MA 1XCOA 2WTNA 3T3GA 3I6QA 3GOQA 3OA2A 1YS9A 1CZNA 5TX7A 1JZTA 3OE7D 1C29B 1NX9A 3GJZA 4NCAA 4FI3F 4UDOA 4IAJA 4RPLA 6ABPA 3AESB 1J24A 1Z0SA 1A50B 4URHA 5FXMA 2XTAA 4W8HA 4GC5A 3KEFA 4P82A 3C98A 4QDOA 2QTMA 2Q49A 1KARA 1F6DA 3N75A 2QP4A 4WEOA 3V34A 3UMBA 5HKBA 4QFBA 3TRFA 4UVEA 2QP9X 3ABOB 2XBUA 1L6RA 1U9IC 1LNSA 1SEIA 2D1FA 1L8OA 2C4WA 4LRQA 5ALIA 2GX6A 4NCBA 2C03A 3IT2A 1X87A 4DR2B 1JIJA 4FBGA 4RVCA 1WU8A 3TI7A 5GGYA 3L9WA 5D3MB 3CW8X 4KP7A 3FMIA 1K6IA 3W1BA 1UBFA 1GLGA 1B3BA 4KXUA 5TQ2B 3D5EA 4RIFA 2HYDA 4OEHA 3B5IA 1TA8A 1MEJA 4LMYA 1XZQA 1G5FA 1MC4A 2YMQA 4B47A 4J3JA 3KOUA 1ULAA 1PNOA 4BVGA 1HMPA 1AN0A 1JLHA 3UTDA 5JSHA 1ZHOA 5JFOA 1ZKDA 1RXCA 5MN6A 1UJCA 1TT7A 5EIHA 5CTJA 3HI6A 2WM8A 4QFMA 1ESDA 1JAIA 1J0XO 1CY4A 2R92A 1QVWA 3IIMA 5CNMA 1FFXB 4OQXA 3TNJA 4XJXA 4ZAVA 1QFSA 1U0TA 5B2EA 2HJHA 4O4JB 1XNRH 5DLFA 1AQYA 1HDEA 5CXUA 2Z6UA 5AKZA 3QBVA 5FUBA 2IYRA 3JQQA 4IW3B 1LQ2A 4UUPA 3TTYA 3PI7A 1GGMA 4F2WA 2A5JA 2OXCA 2F9LA 3MC1A 2V1XA 4I9GA 1E2DA 3X2EA 3CNHA 1Q21A 4F4CA 3GLQA 1GCOA 1HZZA 4QUIA 4TXLA 3CLSC 3OF2A 4UHHA 1Y1LA 2FZCA 4CMEC 1AHHA 3RKRA 3KSBC 5DGCA 4EVQA 1DRKA 4C2UA 3NHFA 4YRFA 1TWAA 3ZS8A 5I7HA 1QIMA 5HF8A 2IEZA 2XNHA 4D6YA 4ZVNA 3OU2A 4DDHA 4G0NA 4E2FA 2BRUA 4HAYA 3TZQA 1BQ4A 1YZNA 2V7XA 1SELA 4WESB 2PRJA 1O6BA 4L5IA 3TJMA 1ORHA 1KO4A 4LRWA 3D1VA 3A4NA 3COJA 4W63A 1CE8A 4BKOA 2XMPA 1WY7A 4WXYB 1O96A 1UBHS 1GNSA 4IHJB 1F9EA 4WOPA 3SS7X 1SCIA 4N9QA 4CDRA 3M3HA 4X44A 5EMHA 2WRZA 3RVQA 1U1EA 1NOJA 4ZKDA 3CF0A 3L92A 3OOWA 4DPKA 2XMSA 1ABEA 3G5UA 4JEMA 3BDIA 5CAEB 1W85A 1CIVA 2FEXA 3KVYA 1JJBA 4DJDC 1OBOA 1I0LA 2MTBA 1ZR2A 1L5KA 2YC4C 4CEJB 4G24A 3P8ZA 2Q4DA 1WZIA 2Y0SE 4BNWA 3ECCA 2HGSA 1IULA 2W2MA 1IBLH 4GBED 4HGOA 3RAQA 3DFKA 2IBMA 1T3LA 2GHRA 4LZZA 2GRJA 5TARA 1XFDA 4JI4B 4IIGA 3AEKB 2GPSA 3SC3A 3BRCA 3NOOA 4RTLA 4CCWA 2HTFA 4NE9A 4IX1A 2ZETA 5K0EA 4CG2A 1OXKB 2H5IA 4FKBA 5AR1A 1DELA 2HDNB 3VZQA 4E70A 1O75A 1NE2A 4EITA 3ZCVA 4KQ6A 2QTHA 1XPRA 4XX0A 4NK4A 2FGKA 2FW9A 4LE1A 1I6KA 1KQNA 3FHOA 2HK9A 4YWHA 4NX2A 1TZKA 4PC6A 1UPXA 4EG1A 3FTPA 2DXIA 3WJAA 2X22A 4HB3A 4OHCA 4MA5A 4RPKA 1SCKA 2FQXA 2QD5A 4Q6WA 2VQFH 1G9SA 1I2MA 1Z7GA 2X0KA 1L4LA 3Q88A 5K3DA 1D2AA 3KB2A 3NHSA 4HQ6A 3RBDA 1S9FA 1GSIA 2QL9A 3TN7A 4K0RA 3L7AA 1IYZA 2KI5A 4MGZR 4M9XA 2ROQA 8ATCA 1KDRA 1QJ4A 4QYMA 4B3CA 2CXPA 2R96A 3PEYA 1F2UA 5HMMA 5FFMA 2F3PA 1PUJA 3RREA 3ANTA 1CV2A 2VDPB 1P7CA 2P90A 4HEA1 1CP3A 4BVAA 3O1LA 3L6DA 4MKXA 4QD3A 3H3JA 3RFUA 1JQ3A 2D4HA 1DX4A 3LH5A 2QRQA 3EWAA 4RB3C 4JI7H 4DADA 1CTQA 3E81A 5L95A 3IJPA 4NONA 3F2VA 3VKGA 3CINA 3PG5A 1XNQH 1ISFA 1ZD3A 2XNCA 4AS1A 1KPGA 1N5LA 2JAHA 1GGNA 1EWVA 2PG3A 4PQEA 2QN6A 1MOPA 1PT5A 4BMCA 2I3BA 4FYWA 3IVAA 1MG5A 2BGJA 4ER0A 4Z0PA 1VJTA 4HJRA 3T9FA 3U9LA 5A4JA 1X7YB 4NDZA 2XYPA 2Z57A 4HFMA 2GJSA 2Q1XA 3N7TA 4FW8A 3ZXSA 1M1YB 3OHPA 3CVUA 5JJLA 5FQNA 4F85A 1YI8A 1QRRA 3LCVB 1QFYA 4FHZA 3HU3A 5ELMA 1H1DA 3PKJA 3PZRA 1BO6A 1OLSB 4TMZA 4RHYA 4UOEA 2W00A 4RE6A 4OSEA 4AJ9A 5JDCC 2QL7A 1N3YA 1VXOA 4X64B 1QPBA 4WBXC 3AL3A 3OD1A 1P5FA 5KEIA 3TBKA 1IFXA 5E0OA 4DZZA 5E4YA 4L5AA 3CGGA 4HT3B 2MYNA 1GPNA 1E0KA 4PBTA 3LNTA 5ADVA 2VDJA 5JY1A 1Q83A 4O2BA 4ZVKA 2ZANA 2B9EA 4QLOA 3WISA 4DCJA 1H93A 4R5MA 1ML3A 2YHIB 2DULA 3AY6A 2IT1A 2WSMA 1Y5IA 5MDHA 4CEIB 4LY6A 4LE0A 4Q6BA 1HSOA 1PSDA 3MVEA 1V9PA 2JJMA 2RHHA 4MA4A 1GPDG 3JSAA 4ENVA 1T36A 2OBBA 3BWBA 9ATCA 5IDYA 2VSYA 2CB9A 2HWXA 1PT9A 4BZQA 3RYIA 3OQ1A 3UJCA 4ACBA 4KN9S 1IMOA 4ZYXA 3TLKA 3ENVA 4LDNA 3V7YA 4B3TH 5JCZA 2ZYIA 1F4PA 4WKPA 4BBAA 2VPXA 1NVVQ 2AHRA 2CMGA 4GPBA 5K4GA 4ILEA 3MWYW 1ISGA 5B6IA 3DEFA 3WGNA 2H7YA 3LDAA 4J75A 2OGZA 2P6NA 3C6XA 1W30A 2B5WA 3P20A 2D0IA 1HE8B 1TXGA 3AJAA 1Z74A 4U2CA 3NM5A 2ZRJA 3LSYA 1HQKA 4OL0A 4A2CA 2G9VA 3FPKA 4RMJA 4FCVA 1NJGA 3ZV5A 2Q3HA 1XLTC 3M6XA 1Z5WA 1YDMA 4LN1A 4JI0B 5DHQA 5CX1B 4JI1B 1TQ6A 3G8BA 4QECA 4MI3A 3O2NA 2XITA 4BY7G 5IKOA 1C3JA 3MNFA 5FD5A 3V6JA 3ESQA 4ZVTA 5MFPA 4MB0A 3LXXA 3EPKA 3JALB 3TSCA 4YB8B 3MK31 3PQ8A 4EKNB 1JPUA 3F9IA 1P1KA 1Q77A 2VIIA 4OX9Y 3AK4A 4JA0A 3RM3A 3HDVA 3ESXA 1RM4A 3L6CA 1X1EA 3QU9A 2GB4A 3T7AA 4E12A 2ID7A 4ZCTA 4LXXA 5HS6A 4A8TA 3F5FA 2JAWA 3T8YA 2QX8A 4I50F 3FG9A 1NW5A 1R6XA 1JF8A 1AUPA 2M2IA 2W9BB 2PJZA 3R3VA 4KFTA 4FM9A 4PF1A 2BSAA 2FMXA 5K7SA 4Z9XA 5JO0A 3H5LA 3VVMA 5CIWA 4DNQA 1IPFA 3KPYA 3MBIA 3IKMB 1XZNA 5LLDA 1XG5A 2X40A 3AUFA 3NHZA 3EFEA 1T91A 3V8VA 3U3JA 5EWMA 4EA6A 3IVGA 2UUBB 1TCAA 3A1UA 1XR3A 4ERXA 3BD7A 2YNMC 1UEJA 4Q8FA 2LKDA 5GONF 4ZAXA 2OHOA 4MPDA 3OFKA 1COZA 5ALJA 4Q9HA 4YV1A 2OPBA 5TB5A 1XALA 5L53A 1UT6A 4E5SA 2VPSA 5LM3A 2QE6A 1F9AA 4QVIA 3ZKAA 3N2KB 2FCRA 3IP5A 5LMUB 1NPTO 2QZSA 4FC6A 4LMAA 3JQAD 4P35A 2NWQA 2WIGA 3K9QO 3FMFA 1WXWA 4MB2A 4G56A 4LV8B 3E7PA 1G1AA 4KQFA 2G5CA 5IABA 4O02B 4UTZA 3C5EA 4N7RA 2DCMA 1WSBA 1F8FA 3CH4B 3SQMA 4WOKA 3RAEC 3K96A 3LBIA 3WL8A 2NPIA 3P97A 4MGHA 4FEGA 4C4XA 2IVZA 2YMLA 4K6KA 3TDNA 1GWNA 3AETB 2OWOA 3I3SR 4NI5A 2UVUA 1PFGA 2EIYA 5CXXA 3ETGA 4MQMA 2R6JA 5EAIA 1KYQA 4BQOA 3IAFA 2DETA 2J3QA 2G72A 1UBSB 4Q82A 3PC6A 3GA7A 3Q2IA 3UK1A 3KZKA 5A7HA 3CNEA 4Z7NB 3D0OA 3AVPA 4WFIA 2WHQA 5KFKA 1FMTA 5ALEA 4JMLA 1ULHA 2EV9A 3T5KA 2XUOA 4JSTA 5JSFA 5F7OA 3MMPA 5LL6b 721PA 5LBIA 4CCSA 1I0IA 2AKYA 4M99A 1HL7A 1T13A 3RJ9A 2OFFA 3F1LA 1J0DA 1L1QA 3HCNA 4NJMB 1P0FA 4FGSA 3B5EA 1JBKA 5JD6A 1ZIYA 3F3YA 1DAEA 5ISMA 4YJ3A 4H3VA 4QVKA 4PZEA 2ZIVB 3ZDFA 1CKMA 2PMWB 3Q2OA 3GIIA 821PA 4M36A 5KIAA 1QNFA 4J2TA 4NG4A 5E6SA 2ZDHA 2WWWA 5FLMG 3B51X 4JV1A 2IIPA 4RHCA 4UPVA 2YY5A 1WBBA 3PP8A 3PNVA 1M74A 5J3JA 4BLPA 4PPFA 3FX2A 3UJHA 5J2UB 1YKFA 2FHSA 2OE2A 2X8JB 4WAUA 2O8CA 3LVFO 3Q0EA 4MW2A 2A1IA 1Y8QB 5G0TA 1ZFNA 1XKLA 3SXPA 2ID4A 1Z82A 1A72A 2YFKA 2CD9A 1Z15A 1XQVA 1D1TA 7MDHA 1MO4A 5L3QB 2XEDA 1KQPA 3DZKA 4B6SA 3T6KA 1V6AA 3MT9A 3FKSD 2FH5B 3G8YA 4E1VA 5CDHA 3H5NA 3DOFA 4M1ZA 1E4OA 5D7NA 2YRXA 4DMGA 3HYSA 3UMVA 3WFIA 4K81B 4PPNA 1I4OA 4EFEA 1XV5A 4KXWA 2UVPB 4YY3B 2OCDA 2VNKA 1S02A 1NVUQ 3OH8A 3N44B 2OYSA 4UU0A 1LPMA 2WUGA 4BOYA 1V1RB 4ZTUB 1GVNB 3A9VA 1J1UA 4HNSA 4RXTA 3DLIA 4YO8A 4RMGA 1ZP6A 3LA8A 5GIOE 5IMSA 2FN3A 3OQMA 3TUJC 3ZWWA 2XRYA 4D9HA 2IYLD 3ZC3A 4L0QA 4EHFA 5IP7G 1QGOA 2OLSA 4ECRA 1J7KA 1H1LA 1FEZA 4OV6B 3SEAA 4C2MA 2QLBA 4KFCA 5IWCA 2X2PA 5D3QA 1VL2A 5CMLA 1M10A 3ZNPA 4DV2H 2Y2UA 2SKDA 3ASVA 2C2OA 2WSBA 3IQEA 4FU0A 1BE8A 1AO0A 4Q43A 3ZV7A 5K4HA 3IXLA 3UAGA 4BQSA 1KF0A 5F78A 4PBRA 2O0MA 1G3IA 2F4VH 5IU6A 3FSJX 2D8AA 1KJJA 4BDSA 4G1FA 4GSLA 4RD2A 2CXUA 4EPTA 5E8JA 3D4LA 4X1KA 1VC2A 2J6UA 5KQRA 3AG5A 5C0OE 3ZWYA 1B76A 2GRAA 2FR8C 3BGSA 1HDIA 3GIDA 1RKBA 3M6LA 1I6MA 4IH4A 4KXYA 1QGED 4C6HA 5CBPB 1IZZA 3CXUA 4EEZA 1EM6A 1FPQA 5CCDA 4MJ7A 4DIOA 3HCOA 2NUPA 2GLTA 1SBCA 3EISA 1ZQ1A 2UYQA 3UK7A 2OILA 3IVMA 1MT3A 4BB5A 3AR3A 4L08A 3DKIA 5BYJA 2FCAA 4KGVA 3WL4A 5CUQA 1X7WA 4EHDA 3FHCB 1OXVA 1WXGA 5HFNA 1EFPA 2X3YA 2R7LA 4WCFB 4HH3C 3PHGA 4LF5H 4D4KA 4ZQEA 1W8IA 1R4MA 2DSTA 4MKZA 5JOQA 5DNVA 5BV0A 3ILHA 1DLIA 2HA4A 3E5RA 4YFYA 3QKSB 3UBTA 3FTDA 2INGX 1NRXA 1AN7A 4QM7A 3P45A 1KSHA 4L8WB 4A1FA 1PTJC 4TS4A 4DCMA 4CM3A 3V1YA 1BCSA 3VPFA 2EG5A 4TYQA 1M5TA 3Q3IA 4B4DA 3U3OA 3HXKA 3K6SA 2Z30A 4AF6A 4V24A 2JJQA 2R48A 3EA0A 4ASUA 2HIHA 1L9KA 1QGZA 5C18A 4OQDA 2HDWA 3BQMB 4EABA 1K9VF 5FADA 1C8KA 2OH2A 4MRVA 1AKRA 4NEQA 5A3RA 2OAQ1 4F93B 4N3NA 2IHNA 4KO8A 3RFTA 1HFEL 4C7JA 3K0SA 2QRHA 3M9XA 2FZVA 4D6XA 2NVUA 4F5EA 1E92A 4BMOB 1C30A 4CTNA 4BNDA 3ZW9A 1UAGA 4JI8H 1J8VA 3VR1A 1USUA 2BAGA 1RPZA 4FZRA 2JHPA 5CH3A 2FDCA 4KHPB 4WXEA 1VG8A 4JXXA 4HDAA 4D9BA 4UNNA 3G1WA 2XDQA 4TLMB 2R8KA 4RTQA 4DL3A 1MAWA 4I1UA 2OFPA 3SU8A 5DM60 3R9RA 3KHUA 1UDCA 3AF2A 2GBIA 3PGMA 4PRZA 2F1RA 2W8ZA 2PPVA 3WRXC 3R3SA 4A23A 1QYWA 1BXZA 4QEDA 2VTBB 2COEA 1U8UA 1N5KA 1NI3A 5FO1A 1CG6A 1DKUA 2OO5A 3KO8A 1AZLA 2GKOA 3ICWA 4Z0TA 4GR5A 1V4BA 3UJ6A 3MFQA 1EUZA 5A1TA 4LSZA 5IWAH 4JLPA 3B78A 1C8VB 3HU5A 3PXAA 3BIXA 3TLCA 3RUPA 4CKZA 3U2QA 5C51B 4FOLA 4BP8A 2VH1A 2RHLA 2YOHA 1P0MA 1K6EA 2IEGA 1YR2A 5AHRA 1B74A 5AJHA 1IBMB 4A8PA 2XZPA 2HQSA 2EFJA 4GOOD 1T10A 3AHIA 1DTWA 1YFLA 4JCCA 2XSZD 3VR5D 2FE3A 4OB6A 2J33A 2WHRA 4PC1A 4KO4S 2J30A 4J2HA 4ZCQA 4KLRA 5DGTA 3A1WA 4OGGA 1Y8RA 2X3UA 4NCHA 3GJ7A 4BFUA 1IHOA 2HBYA 1HEIA 4PG6A 4N6NA 3RB4A 5BW4A 2DRIA 3AUYA 4A93G 5JNLA 4XGRA 4QU0A 4RLQA 3TG8A 2PEZA 1E2IA 3DMRA 1VE7A 4FLFA 3ZZMA 2ANCA 5AUOB 3X3HA 3UCFA 3I2YX 2GPJA 2VDLB 3V7NA 4DLZA 3GVPA 3V6HA 3B1FA 3GLFB 2ECPA 4EY7A 1TC1A 1H6BA 3CN7A 3X0DA 1JHQA 1QC5A 1ZCJA 3AFGA 4Q0YA 4RTRA 1J99A 2FP4A 1GFIA 4F97A 4U5XA 2BKAA 3QPVA 4U2FA 4OIFA 2R8YA 4UU8A 4JASB 4MGKR 2OYRA 4GOKA 2PZMA 5FFFA 1G20A 1P44A 2DJIA 5BVHA 4FHCA 1SCDA 3WWIA 4BV3A 5C3MA 1N6KA 2HXSA 4JQSA 1PS8A 1ARZA 3NAZA 4BGEA 1T4CB 3EEOA 1X70A 2NVYA 4NFSA 4MI6A 3G9QA 4CF6A 4GRIA 4HBZA 3EG9B 3PKZA 5JCJD 3UFXA 4CQMD 1YVRA 1PD0A 5I5UA 2I8AA 3CRMA 3HR4A 4IBOA 4EYOA 1P19A 5LNK1 2NZXA 2LPMA 4LFBH 3C3EA 1YTLA 5LZ9A 3LTNC 3H7IA 2NPFA 5TMPA 3VNRA 4AJ2A 1XT6A 1P1CA 3PICA 4KV9A 2YIDA 4IIBA 3GIWA 5ALDA 1B26A 3JAKA 3QIAA 5BQXA 5B6JA 1KMHB 5CHEA 1EK5A 3LKZA 3RS5A 1XD9A 4JEHA 1NLZA 3UAOA 1PR4A 3PPIA 3F73A 6REQB 2E4YA 1T35A 3IRUA 1XP5A 3FHJA 5CA1F 1K75A 2QVZX 3DKPA 3FLMA 2V3WA 2C2YA 1GQFA 3O4RA 3WDMA 3LLSA 3MWKA 2IYQA 1H5UA 2C2RA 1K2WA 2IIQA 5FNVF 4N5MA 3ED5A 4Q9NA 2Z2YA 5E4FA 1K97A 4EPXA 4GQIA 4MCIA 5GJCA 5KX5B 4J7AA 3N2GA 1OWNA 1C0IA 1KTIA 1UXKA 4R8KA 1O58A 2AWOA 3PE3A 4H4CA 3DTYA 4IFEA 2NZJA 4O7ZA 2QV0A 4IP0A 4P3NA 5AHXA 3VO8A 4BY9E 1CF4A 5FD8A 4QGGA 4DPMA 4Q7KA 3R6LA 3CB4A 4A10A 2VUHB 2XOKA 5TIIA 3PA6A 1M0SA 2XCAA 4ZVVA 4EM6A 5ES4B 2B1IA 1GNTA 1SH7A 2EVWX 2IGTA 1QJCA 1BU5A 2IITA 2RJNA 3D7NA 2PSJA 2G9UA 5BOSA 1PJSA 4DR6H 2PWYA 5DWQA 3U1BA 3K16A 5DB4A 1HZJA 1QIFA 1KORA 5D6OA 1VZ2A 1SXIA 3DOCA 4PLVA 3L7LA 2VJPA 3PD1A 3CH5A 2A94A 1F3LA 3LIIA 3PTZA 1SXPA 1TQ2A 3AR7A 1R3DA 4YR9A 3IMGA 3U39A 5K3FB 1VBKA 4XIYA 1MABB 4ECZA 4RKRA 2X13A 4FINA 2QG4A 4UPDA 1VGRA 3KQKA 4KQHA 4FR0A 1PHPA 1M2OA 1NXWA 1DIHA 2WZBA 4UHKA 1N32H 5E7MA 3VR6H 1IBCA 3QLVA 1O87A 5IXSA 4B84A 5KPDA 3KTMA 1DGSA 1MF7A 1DWOA 1KI7A 1DDIA 1O9HA 1JV2B 4BQFA 4C1NA 2OQ2A 5E2BA 1ZU5A 2PRIA 4PBCA 4N7BA 3ESZA 3BFVA 3KQPA 1QMPA 4OJTA 1MRSA 2Q7XA 3Q98A 3LC2O 2V45A 2J5QA 3AHHA 3PO3G 2NT3A 4JHLA 1KP9A 3ZWXA 4CFZA 1BD4A 2JD0A 3A26A 1O94C 4XGIA 5EUMA 2YVQA 3EZFA 5KFSA 3UC9A 2DVMA 4L95C 2QLLA 2YWFA 3UW3A 2V0CA 2PMZE 1L4YA 3P0FA 2W83A 1KY5A 4LXGA 1H05A 5JD3A 3DCIA 2BMAA 4LXTA 1IQRA 2Q46A 5A3SA 1TADA 2CKZB 3U13A 4HATA 4JV5B 4DZRA 3WWDA 3OZCA 3DYVA 4O4LF 2UXDB 3BN3A 2WE7A 3E53A 2I91A 3IURA 4QBGB 1NT4A 1NC1A 4WHXA 1U7WA 2J0EA 4AW9A 1OXBB 1BMTA 3HT5A 1YAJA 2IDZA 3D0QA 1C1XB 3WK7A 2F64A 4XDZA 5D2CA 3CEAA 1K1QA 1U9CA 2X8LA 4II3A 1KTAA 4B0OA 4NRDA 1WPQA 1FYFA 2F2TA 4PRLA 2JJYA 1U0NA 2H4ZA 4G1CA 5TT1A 2LKCA 2H2WA 5A2GA 4NYJR 4Q1CA 2PPLA 1CRWG 3BCRA 1W8DA 3JQ6A 3NOVA 5FCDA 3IB6A 1XJQA 5KFTA 3MCZA 2R5WA 5JPCA 2CHUA 2CDRA 3S7ZA 4BKRA 3QPBA 2CJXA 5GADl 3E9MA 3DBOB 1I9CA 4UMEA 1D0SA 4FT2A 3RSFA 4O7LA 1PS9A 1N2CB 5A71A 3QYJA 4JELA 1XL0A 4A82A 2GEUA 1BU8A 3RIGA 2QZZA 1YE8A 1G2PA 1ZNZA 2OL4A 3NBKA 5FD6A 3V8EA 3EHDA 2Q50A 1MX3A 3RUDA 4HEJA 1KXJA 1O6FA 4AC9A 4EUFA 5E6RB 3RVOA 3GRPA 2IP2A 3RSCA 1YDWA 3TE6A 5HBRB 4QXRA 5JH7B 2WTFA 1LLFA 1VLMA 3LYUA 1ZK1A 4IHQA 3NHKA 4QJ5A 4XVRA 5L1IA 2W7OA 4E09A 1VPLA 1S5PA 2CLKB 1HLGA 1WCIB 2F1JA 1RYSA 3HR8A 1ZI6A 1PQPA 2QXYA 2HK6A 3WADA 3WK4A 2RHCA 3WTBA 2G1JA 3FWPA 1ZGGA 4HLDA 4JFRA 5LZ7A 1SHKA 1UM9A 2Y1CA 1A8SA 2IEDA 3O8QB 4JZKA 4NV0A 2C35B 3WLEA 4IKOA 2ZUCA 3GLHB 3HL0A 1JHYA 1GADO 2G06A 4PHFA 4B40A 2QW0X 3AM4A 4F8YA 5E4JA 5AIAA 3VKWA 3FROA 1WJGA 3A31A 3OSUA 1A4UA 4BNNA 4BYMA 4QICA 5FAXA 3DAFA 2H3EA 1N5IA 2OUKA 2N3ZA 1ORVA 1T5HX 3INRA 5AOBA 3CSUA 3HBLA 2J1LA 3PNMA 2AFHE 2R8PA 4F8EA 2VHZA 2H1RA 1VSTA 4HTFA 3QEMB 4PEVA 1BRTA 4L7VA 2QTLA 2JGKA 2RHDA 1QQAA 4P93A 1FLDA 4KLCA 1UOOA 3RS4A 1W4BA 3DNPA 2JLAA 4ZIRB 3EQZA 1KDPA 5FJ8G 1NXSA 2R8BA 4KXNA 2C9DA 3H2GA 4RTKA 4RFLA 3ZJYA 2VDUE 3RAFC 4BWYA 3EPRA 1E2KA 5B3KA 4P7BA 3AF6A 4JBHA 3AHEA 3OTHA 4CMIA 1YBMA 3N53A 1W0KD 4NJEA 4LV5B 1AY0A 1US8A 3GJ4A 2IE0A 3A2LA 4OMUA 5KVSA 3G6KA 3AYXB 4HDKA 1E8DA 2PEYA 1ETHA 1THZA 4NY1A 1KQOA 4KXQA 4WBNA 3GK3A 1AV6A 5C8XA 3BTVA 5BSUA 3LG2A 2J3MA 621PA 4EYKA 1HO3A 1DAPA 4MR7A 1NNEA 3BK7A 5DHTA 2V5AA 2FFAA 2J9FA 4HS9A 4KQIA 4ZYUA 2O8BA 2AYXA 2ASJA 3RUAA 2GBCA 4Z54A 1H2ZA 2COGA 1UWLA 5B7GA 1KMQA 3IO5A 3O83A 4OFZA 4NQZA 1U2PA 2VP0A 3NIDB 3A6KA 1VPWA 5JZMA 4CEHA 3CR3C 4Q15A 3O3MB 1I01A 4R8MA 3H0CA 2QLMA 1BE0A 2I6TA 2R8EA 4IKEA 4PX2A 1G16A 3KYDA 4JNCA 3DEKA 5IC6A 4QZVA 4AWXA 5IZCA 1D6MA 1KVRA 1NBME 4ID3A 4ZI2A 4PRYA 1ENZA 1GRRA 4QYXA 1G2IA 3AEXA 4PZ0A 3HADA 3E22B 2AF4C 1RKUA 3H97A 3I92A 3E9QA 4O4JF 2EYQA 3ACCA 4C2AA 2GJKA 1SXJD 1N5JA 3BM5A 1ADBA 1EWKA 1FPMA 3VGPA 1G3QA 1HTWA 1UP4A 1WUYA 4P4GA 3F96A 2VUMG 3MM4A 3EXHB 1T9HA 3WZMA 3SC2B 3A1CA 1N2IA 1I7LA 2BHLA 2VA9A 3PW0A 1K63A 1TYCA 4XLZA 3W04A 1PJBA 4BTVA 3VNAA 2LRHA 2CT8A 4ML3A 3BREA 1K98A 3OQVA 3PENA 3QW4B 1YS2X 1PSWA 2BE9A 1BJRE 1DLJA 3SJ7A 1ZVVA 4WLNA 1UBRS 3G23A 3HO1A 4QIWA 4QGAA 5K8IA 3EIEA 4V0ME 3H4MA 1LH0A 5GJWC 3RBVA 1ECJA 3M6FA 2YIJA 3LDUA 1DUVG 1U7DA 4RETA 2CK3D 3F4BA 4QPCA 4EOGA 1RE1A 5IJXA 2UZIR 4Z7OB 1Z4NA 2WF9A 3HS3A 3TQCA 3LK7A 4TRJA 3BX1A 4MB6A 2DUNA 4UMVA 3BRWD 2Z4RA 4M0UA 1IJEA 3GYGA 4AL4A 1ZEMA 4C7OA 3K6JA 2DABA 3HBNA 3VTAA 3OM9A 5FL7A 3ROEA 2Q0QA 1Z8NA 1NLMA 1NPDA 4D4IA 5I9TA 4C0HA 3NNNA 1LTKA 2XQIA 4GKKB 3AB3A 2OV8A 3NHPA 1G6KA 1LXCA 2GM3A 2CEAA 1NXTA 2YQ5A 3WBBA 1WV1A 8GPBA 4XRRA 4IOLA 2AMFA 1LBEA 1XK7A 3PJRA 4BKMA 1SWWA 4QW8A 3T9BA 3V3TA 1NJ5A 4TVOA 3II6X 5A4IS 3GIJA 3GV7B 3FF4A 2WVAA 2ZM6H 2OT3B 1ZUD1 2ZJ7A 1O54A 4QNNA 3ZDXB 4FS3A 4JJ4A 1FNMA 3JWEA 1TQDA 4XM1A 4ZDKA 2R6R1 4XB2A 5KDOA 2OUIA 4QYTA 2VT7A 4QXAA 4MQEB 1VKZA 4TSFA 3TE7A 1XRPA 2YBDA 2PXHA 2ZIEA 4UM9B 4OK6A 1ECLA 2NUTB 3B38A 1QHHA 4R2MA 4R8SA 1QLJA 4MIKA 1RYNA 3M1IA 1Q17A 5DISB 1S2MA 4RXMA 1S8AA 4HH1A 2HWYA 4A15A 2I03A 2D2IA 3BIJA 4DUGA 1XDSA 4NG5A 3KXYT 1VE3A 3M33A 4OLJA 5I45A 1NL3A 4JS0A 3VC2A 2L2QA 5KTNA 1WHSB 1ZWLA 3GEMA 1BYUA 1WG8A 3ESYA 1MB3A 3DF7A 1QM5A 1U2SA 3H1GA 4BLTA 3AVXA 3VKFA 1IEVA 3MGAA 1QIGA 2D06A 1DU4A 3W8FA 5AKGA 4EJFA 2ZT8A 1L5MA 3E6AA 2N1MA 4IOJA 3UCEA 2Q3LA 3GDOA 1MUUA 2AW3A 2O8VA 1B8VA 5DAAA 4JOBA 3AERB 5U1PA 1TFRA 1GGFA 5BW5A 1CUDA 3QE9Y 4MUGA 2DB3A 1RP7A 2BV3A 1U2RA 4LDJA 3MR5A 4FFWA 3K0BA 2MYTA 4OJYA 5J5AA 4BEVA 1Y8ZA 1AHPA 4HJXA 5IDXA 1M1XB 4W8GA 3MFHA 3DP9A 1KFJB 3B6JA 3EFOA 3D2BA 3RDPA 3NC1C 4N48A 1RI3A 2ZT6A 2Q5EA 1FRFS 4F0JA 1NWCA 1H2XA 4XQCA 3AGQA 1E9FA 3RBAA 1ORDA 4J9SA 1Q1QA 4WLVA 3FJ1A 1XMOB 5D7BA 1HH4A 3U0BA 3UTCA 4ED2A 4Q3DA 5L7WA 3ILSA 4HXEB 2HF8A 3E7DA 3B6ZA 2ZBEA 4WE3A 5NLLA 1WQ1R 4J1NA 2C2GA 1VPVA 4L4YA 3H2HA 2P1DA 2HGZA 1QCZA 3E23A 5THQA 1KVSA 4IMIB 5REQB 1EE1A 2AL7A 3S1LA 4KUHA 3H16A 5L3SA 3BOSA 2C58A 1GKIA 1N0WA 2QVLA 5DN6A 4BEJA 4GRAA 4K3VA 2VHUA 3KKMA 3GVIA 3EGOA 3CEJA 1J2TA 1I2DA 3C3AA 3EGCA 4V2IA 5H9VA 3NHYA 1KWGA 4NZNA 1QKKA 3ABIA 4Y8VA 3SHQA 1JHOA 5IC5A 5C7YA 5F3DA 4J43A 2O23A 2Q62A 4LDRA 1U9ZA 1HR0B 4IR9A 3PUYA 1SBQA 1EX6A 4EUKA 3OZSA 1P2BA 3KZCA 5I01A 2EEZA 1T5BA 4N8EA 1NKSA 3GEGA 4TKUA 3NU1A 4ZC8A 1NW3A 4ED1A 3H5OA 2CKMA 1DOZA 4BGVA 3BB1A 5T6MA 1GGVA 1WD7A 5FLKA 3TL3A 1KNQA 4QRDA 4K2AA 3KS9A 3IVXA 3JSNA 1T8WA 3GAFA 3GEEA 5EOYA 2P9CA 4EDHA 4YUYA 2Q28A 4N0EA 1Z6AA 4D41A 3KKEA 3U4DA 1TVKA 1CVIA 4MTLA 3V7WA 3CZMA 1CIJA 1E1NA 4V3CA 1Q7GA 2R60A 1MC8A 3AFHA 2G36A 3VXKA 3ROKA 3M89A 4DRXB 1FYVA 4GUAA 5CM2Z 4A36A 4JV0A 4G23A 3ZWPA 5I9IA 4ZPJA 3F6SA 4XZ3B 3ETHA 1K2VN 1U4SA 5DXAA 1ZW6A 2J46A 3HA5A 1J70A 3DT9A 2A78A 4OFXA 3H2SA 3LUDA 3U3DA 2W2LA 4WZBA 2DY1A 3R9XB 4ZVUA 3UXMA 4MARA 1QRUA 5C5DA 3WGLA 1CEEA 1N5RA 2JL1A 2YJGA 3TLZA 3IOBA 2Y71A 5MGBA 3ILYA 3NJRA 2WSSA 2QIOA 2RH8A 2EC5A 3GGDA 5IXYA 4WXRA 4E13A 4KUGA 2H07A 3DLHA 3DUFB 1RYDA 1Z7WA 2VYND 3I5YA 2XE4A 5FUVA 2HZBA 2I1LA 3RPEA 3HXLA 4KXLA 1F1JA 4OO3A 1S2NA 5KU1A 1XZJA 2JK1A 2G1PA 5JJIA 4C6TA 1D1QA 3BZBA 3OEHD 1TQ4A 4DVJA 4CCAA 3SZLA 3PDIA 3BWVA 3PDJA 4DCNA 2A5DA 3VHRA 3CLHA 2O8DB 5ITSA 3RC1A 3WWYA 5C7OO 2VHVA 3C7CB 1DBQA 5K0JA 2X19A 2I4LA 3ZY4A 4XD7D 2GNOA 1UBTS 5JZVA 2XNKA 2XDWA 4FUTA 4ZOLA 3B20A 4MROA 4GX2A 10MHA 2VUIB 1K3UB 4BLVA 3HBAA 4I4TB 1SVWA 2I65A 4JENA 4WTOA 4JOCA 3QFFA 4UCWA 2R86A 1H4TA 5HKKD 3OCJA 3VR3D 1IATA 1E9DA 4GYKA 3A1EA 3ZZTA 3LPLA 3DJYA 4ZD6A 1KH1A 2CF6A 3VKUA 1O0CA 5KFOA 2WUWE 3B13B 2DPGA 3OMWA 2J67A 3OC6A 5J43A 3UH0A 3L1VA 2GARA 1A69A 3JYPA 5F1OA 4P2BA 5DLGA 2ZPUA 1C81A 2XVXA 1EX9A 2Z4TA 2R6DA 1VBFA 3GP5A 2ZPTX 1HNXB 3UT5A 2BMFA 3AHFA 3SOPA 2LP4Y 3CZ9A 1CDZA 2WDPA 1USIA 4DR7B 4Q4AB 4AP9A 1ISPA 1HX7A 3D31A 2D1YA 4NENA 1OLUB 4PHTA 5ICEA 2QTTA 4EO7A 2E49A 3C4JA 2YN4A 4KH0A 3QVGA 3HKBB 1P1IA 2CL5A 4JT9A 3PGJA 1K5GA 2ZYGA 5FX2A 3X1JA 3DV0B 1NQTA 2YY6A 3O2QB 3R7SA 4CCYA 3U7GA 3RWBA 2FRDA 3RKSA 2YZ7A 1FJ2A 3NTLA 1NBWB 3A1TA 5IAOA 2OGSA 1AUOA 3K1AB 4RK1A 2XE7A 2G5GX 2AFIA 2HU8A 4TMVA 5AVUA 3Q3EA 2DAPA 1JEQA 4IDHA 4QHYA 2OGUA 3EMBA 5J2UF 5EUQB