3KALA

Structure of homoglutathione synthetase from glycine max in closed conformation with homoglutathione, adp, a sulfate ion, and three magnesium ions bound
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
470
Chain Sequence
APPLFDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLSRTKNADEFTSRLLDIHSKMLQINKKEDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQREGGGNNIYGDELRETLLKLQEDAAYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISSSYEGGVLPGFGVVDTVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
molecule tags Ligase
molecule keywords homoglutathione synthetase
total genus 160
structure length 470
sequence length 475
chains with identical sequence B
ec nomenclature ec 6.3.2.23: Homoglutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kalA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kalA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kalA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kalA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kalA04
5CAEB 4IIJF 4C5CA 2V5AA 2V59A 4C5BA 4O83A 4FFMA 2ZDQA 4O2AF 5HBRB 4ZQIA 3WNZA 1KEEA 1KUTA 2FB9A 1DV2A 2R7NA 4I4TF 2YS7A 1CS0A 4XYLB 2P0AA 4HNTA 3U9SA 1Z2OX 2YL2A 2IP4A 3KAKA 3ORRA 4MV6A 2Z04A 2R87A 3I12A 4MAMA 2ZDGA 4TUYF 4XX0B 3KALA 2DWCA 5J2UF 3OUUA 2YWVA 3U54A 3VPBA 1CE8A 3UFXB 4MV7A 4E4TA 1EHIA 1CQJB 2YW2A 1OBDA 3JZFA 3TW6A 1C30A 3E5NA 4HNUA 4EGJA 5LP6F 3ETJA 2R7LA 4QSHA 1E4EA 3MJFA 3RFCA 4MV4A 4O7VA 3Q2OA 1E4EB 4MV3A 2W6QA 1KJ8A 4HQ6A 4O7NA 2QK4A 4O7LA 4XZ3B 1PK8A 4DLKA 2CNVA 1VKZA 3BG5A 1GLVA 3RV4A 3U55A 3R5HA 4O4IF 1JDBB 4NYEA 2R86A 2V58A 5D8DA 1T36A 1W93A 5EZYF 1CQIB 4MV1A 1M0WA 5H80A 5CA1F 2X0SA 3G8DA 3JZIA 4MA5A 1W96A 1Z2NX 2J9GA 4O7WA 5C8YF 4FFPA 1KBLA 2OLSA 2SCUB 4FFOA 2YYAA 1EUDB 4YAJB 4HNVA 1WR2A 3LWBA 1OBGA 3V4SA 1A9XA 2R7KA 4MV8A 2DIKA 3QFFA 4FFLA 2YZMA 2C00A 2YZLA 1KJIA 4FFNA 2VR1A 3Q1KA 1AUVA 2VQDA 2GLTA 3AX6A 5LOVF 4O4HF 5C1OA 4XYMB 3OUZA 2CNQA 4I55F 4M9UA 1Z2PX 4YJ3F 3GLKA 5JH7F 3VA7A 4O84A 1EYZA 2YZGA 1DV1A 1GSHA 1PX2A 1I7NA 2FPGB 2HJWA 2QF7A 3NUAA 3V4ZA 3WO0A 2I80A 1KJ9A 1C3OA 4I50F 1VBGA 4YBZB 4EGQA 1DIKA 1JKJB 2W6NA 4EG0A 3SE7A 4ZI7F 5CA0F 1JLLB 2VPQA 3VPCA 2W6MA 4O2BF 4O4JF 2CNUA 5JQGF 3HBLA 5HV6A 4RZQA 3VMMA 4O7SA 4FU0A 1M0TA 4DIMA 3TQTA 1B6RA 1EZ1A 3DF7A 5JVLA 2NU7B 3TINA 2R85A 2W70A 1KJJA 2PVPA 3N8DA 4FE2A 4ZHQF 2I8CA 4L1KA 5KKNB 1M6VA 2ZDHA 1ULZA 2GQSA 2XD4A 4O7TA 2XCLA 1JDEA 3AW8A 4FGRA 4IZOA 1B6SA 2DZDA 5JVDF 2GPWA 3K5HA 3RUPA 4WBNF 1GSAA 3K5IA 3U9TA 2R84A 1KJQA 1SCUB 4O7RA 2FP4B 3MWDA 2W6ZA 2NUAB 3HB9A 4ZOLF 3JRWA 2FPIB 2HGSA 2R82A 3JRXA 3WO1A 2FPPB 3R5XA 5IYZF 2W71A 2NU8B 5BMVF 2PBZA 1GGOA 4O86A 4TV9F 1BNCA 2YRXA 3K3PA 3LP8A 2YRWA 2NU6B 2YS6A 5LA6F 5BPHA 5GONF 4Y8VB 5FNVF 4O81A 3HO8A 1BXRA 5BPFA 2YZNA 2R7MA 4ME6A 4C5AA 3R5FA 4O82A 4TV8F 4O7ZA 2Z02A 5KX5F 5C1PA 4YJ2F 1EUCB 2I87A 1IOWA 4YB8B 5J2TF 1A48A 2NU9B 3TIIA 4MA0A 3VOTA 5JQWA 5LXTF 1I7LA 3GIDA 5CB4F 1AUXA 4FFRA 4MV9A 2WYOA 3R9RA 1IOVA 3KAJA 1GSOA 5DMXA 2GPSA 3G8CA 4HR7A 3MWEA 4YAKB 3ETHA 1VBHA 5LYJF 2CZGA 2W6OA 2W6PA 2DLNA 3KREA 3N6RA 4O4LF 4O7YA 4IHJF 3ORQA 3RV3A 3R23A 1KC7A 2PN1A 3TIGA 2GQRA
chains in the Genus database with same CATH superfamily
1ZD4A 3HB5X 2QG4A 3QTLA 4NYMQ 1OWNA 1P0CA 2P5UA 3LT1A 2GI4A 4TN1A 5AI9A 5CFOA 2DFTA 4L3WA 4HWGA 4M6WA 4BASA 1EFLA 2W43A 3GJ0A 5ILOA 4N3NA 4CRWB 3RRJA 2AR9A 3LUPA 2CV1A 1CCWA 4UUGA 4S1WA 4UAUA 4UFNA 3IAM1 1HZZA 4TUYF 3U9LA 4Q8EA 3KFLA 1RWPA 4WADA 4KFTA 3O0DA 4F4CA 3TOCA 5KG6A 2VQFH 4ZFNA 4F3TA 4RNOA 1P2VA 4LTMA 2FJUA 3E0XA 3N8KA 2I2WA 3N8IA 2R8OA 1OC2A 3RIMA 3Q2IA 1Q12A 4CODB 3UHAA 4RZIA 2WF5A 1IVNA 1RPAA 2ONZA 4DG8A 2JGNA 3GJ4A 1L8AA 3KO8A 2H5JA 1P77A 2FSVC 1MOZA 5IDXA 3QUCA 2WUDA 4YDSA 4LKOA 1J24A 2CE7A 2MSLA 1KZ4A 1QOZA 2EW2A 3EDCA 1CQIB 3H9BA 4RSHA 4E03A 1P1CA 4C0XA 5KYYB 3THWB 3NYWA 1IC6A 4JLMA 3NATA 2VYNA 5EZYA 3JATA 1HFEL 5SZIA 3GEMA 2XZPA 3IOEA 3K1ZA 4H6VA 5A71A 4YYZA 2ZT7A 2V9WA 1MAAA 2BEWB 2ADMA 4JI1B 4B35A 4FR5A 2BKLA 1H4TA 4KO3S 1W87A 2WT4A 4AULA 4HAIA 5JAIA 4W82A 1PCXA 4MV5A 3BREA 5GONA 3QWUA 2EJ0A 1A8IA 3S7TA 5LSAA 1AKTA 4BE7B 2JRCA 2AJ8A 1Z0FA 2ZTSA 1EFVA 1W47A 1THZA 1WDTA 1PW5A 2B34A 3BGOS 4QBFA 4BB5A 4R8MA 4F9GA 5C32A 2KQUA 2LGJA 3DDSA 5AKIA 3DT6A 4YP7A 1O6CA 1HYGA 3NHUA 1K3UB 3CRRA 4J2HA 4E94A 2XNDA 1S8FA 1JVSA 4OYYA 2IXTA 1ZM9A 3D6MA 3NH6A 2AB0A 1OIXA 2F8LA 3K96A 4EEKA 4TMKA 4TRRA 2XNCA 4EB6B 4YY3H 1K8ZB 5AK0A 3N75A 2BDUA 3FFTA 4ZRMA 4O4HA 2W8ZA 3SSNA 4BECA 3TUIC 3ZE8A 4RCZA 3ZOZA 1OE0A 8ABPA 3UMBA 2QORA 5C3EG 3MFQA 1JEQA 3BA1A 5AVXA 1N6KA 1U2QA 3RB3A 3Q3GE 2DR0A 4JEIA 1BE1A 4Q4JA 3ABQB 4RELA 3ROTA 2BQUA 5FTMA 4ZJZA 5HF6A 1XDZA 2YQ5A 1G21E 2VA9A 2YV2A 3EXAA 1BQEA 1NW8A 1ZSNA 4JJIA 3RC7A 4J0MA 5DWVA 3X1XA 2ONKA 5CUQA 3TLYA 4BRSA 2JLVA 5B3AA 4AUKA 4IVRA 2Q3LA 2XUPA 2ERYA 4JV1A 4ZT2A 3V4RA 1CY4A 5LU9A 3CCBA 5FUQA 3N2ZB 2V7TA 3AMVA 1JAXA 1HE2A 1QYDA 4RWEA 2BEWA 3P9KA 4INPA 3L49A 3B3JA 1VBFA 4ZOBA 1Q74A 1FDOA 5AVJA 2RGUA 4B84A 1YH3A 4FKMA 2K6GA 4DCVA 1S8AA 1SXPA 3UMRA 4A3SA 3PQFA 3FETA 4NCBA 5C8YB 3SOPA 1AUXA 4JENA 2G4CA 3DPUA 3BL5A 3F1KA 3GRVA 3TRJA 1F0NA 4LWZA 3OQMA 2NO5A 2XWSA 2XYHA 4Y0NA 5KTOA 2W6PA 1TA4A 3VX3A 1WP4A 4RLHA 2C5LA 1YRWA 2V5AA 3HGQA 2RKWA 4KIGA 4AY4A 5GVSA 2GZRA 2VDWB 5E7QA 1KEKA 2I6XA 4A3CG 2MINA 4CCSA 1X1TA 2COKA 2H18A 4MIEA 5K7SA 1RJQA 3IAFA 2QRJA 2ACVA 4GYWA 3LT5A 1LLDA 3B6EA 2PH5A 4RB2C 3HLYA 1K7YA 1LFDB 4LDQA 2WJWA 4MTLA 5EP2A 1E77A 1CZNA 1E2HA 1R9JA 4XZ3B 2JI8A 1A0GA 1T8SA 2UZ1B 2ZU6A 3ABOB 3M9LA 3PDJA 3T9FA 3C6KA 3QLJA 1L5HB 1P7CA 2C7BA 4IYJA 4XR9A 1M34E 3IAEA 3GGCA 3P9RA 3Q1LA 4XW2A 4ZT6A 5K0BA 5H7XA 1B23P 2YVQA 3BIJA 2WVGA 4RD1A 2IF2A 1G3QA 2Q1SA 2J5RA 3CWCA 1BQ4A 4WASA 3T5JA 3P2KA 2GM4A 1M5UA 3M4XA 1D1TA 1XLTC 3GW8A 1P2SA 1XNGA 3PUYA 3KYJB 3B1FA 2Y68A 4MW6A 1N1GA 2J3LA 5IASA 1T9DA 4GX1A 1T8WA 2PL5A 5CCBA 4C14A 4LH7A 1F6WA 3GP3A 4M0PA 4IH9A 1Y48E 3H0GG 5B30A 1EVJA 3W5SA 3AHEA 5EJ2A 3HJAA 2UU9B 4EI7A 2X9QA 1J7JA 4KCGA 3I1JA 4BO7A 2E87A 3IEPA 1WQ4A 1PKEA 5ULLA 5BVGA 5T7BA 5I48A 4H6WA 3USES 4BJ6A 4ENVA 1QRSA 2AZXA 3L4JA 1E1LA 2OV1A 2J6SA 3FNGA 4MVJM 3GVCA 5DXFA 4G1MB 1F2DA 1XMSA 3LWNA 4HX2A 5DLPA 1G21B 2VK4A 4BKUA 1F2UB 2I4TA 3IPRA 3IPLA 3L8FA 4Z4QA 4L8FA 5JYCA 3N40P 4JC5A 1XVAA 2WTFA 3CF2A 2YWCA 1NNSA 1SZDA 2IYOA 3INNA 4PZYA 5ALHA 1TEZA 2P9HA 3HJBA 3NHPA 4JQSA 1CE8B 5FDFA 1U2DA 3A6EA 3AUXA 2FEAA 2H5LA 1T8PA 4ZGBA 5F2KA 3DOEA 4XH9B 5JEEA 3B9QA 2WFZA 2XR1A 5DGTA 1D0VA 2I34A 3HA7A 3BRCA 4MRPA 4YAOA 1BS1A 2V6JA 2FCRA 2W4MA 2UXCH 1QYWA 3CE6A 3EXG2 2PLFA 1V2HE 2W2VA 2RD2A 5LD2B 4U2GA 1QQ7A 2EIHA 1QVWA 1T36B 1ZNQO 2PLRA 1U8TA 3K9WA 2R1VA 4NS1A 1F3LA 1N2CA 3KBOA 4MEBA 1CZLA 1A2BA 3LX5A 3O3NB 2IXGA 3Q12A 4IPTA 3LP8A 3RM3A 4CE5A 5DQGA 1S0OA 5FNVF 4OU5A 3WGMA 3P9XA 1EIZA 1P8AA 2W2NA 1QB7A 4IRUB 1P19A 3DHVA 2LIVA 4WBNA 4G1CA 4NDNE 2RGDA 2XZDA 3L82B 4I0WB 1JAIA 1WMFA 1SD1A 2J32A 3QKUA 1BFUA 1EGVB 3E7FA 2XHZA 2JEGA 4FX2A 1QHYA 2VHWA 1UUFA 2ZBFA 3BORA 3BWVA 4QG3A 3NGMA 3T54A 3CH5A 5HJEA 1BXKA 1E9RA 1Q57A 5AKGA 4YQEA 1WETA 4DV5B 1BVRA 5A5FA 1SXJC 5IEJA 4G9GA 1U80A 3HE3A 5JCJD 1XEXA 4MVJI 4OQNA 4AKTA 2ZRMA 4X6YA 5KFSA 4D9IA 3KJXA 1Z3IX 3DL2A 1DJQA 3PICA 3IBSA 4F4FA 2C2BA 1QCCA 2ZZKA 3I8XA 3UXEA 3AUJB 4JI4B 2IYAA 2XWJI 1IBKB 3AFMA 3AK4A 3KTFA 4C0BA 4ZZ1A 5FQOA 5LQNA 3KSBC 4I4IA 1ADBA 5DGHA 3FF4A 1JKFA 1NURA 4AO7A 3L7YA 1HT3A 3EWSA 4D9HA 1I1HA 4DMKA 1YBMA 2B99A 3LWDA 4HSGA 3ECAA 2DE0X 1FL9A 2OFOA 3LRXA 2ZR0A 3R8FA 2PKQP 2XI4A 1P4RA 4YO8A 3UT5B 3VAZA 1OF1A 4EMBA 1KJZA 3TSAA 3OCUA 3NCHA 3UJ8A 5CBPB 3COVA 2EFDB 1R16A 1WB4A 4Y67A 2O0KA 5BN3B 2OL4A 3I09A 4UM9B 5K6AC 4RDXA 2VDWA 5JAOA 4UC0A 4MAAA 1C3EA 2WINI 4N65A 2QE6A 4EGAA 1YFJA 2J41A 3ZDRA 3DOUA 5GINE 1IQUA 1YUNA 4HQRA 4LMYA 4BO8A 3QFFA 1XKTA 4WXEA 2CCJA 4Y2TA 3SXJA 1F8UA 3F47A 5J63A 4GLOA 2Q45A 5ELXA 1JHDA 3ITKA 2RHLA 2B7BA 1KTVA 3PUVA 4M9UA 4NBUA 4N48A 2V98A 3CXUA 3K0KA 1XF9A 4YGXB 1W9MA 2AYXA 3KLOA 4HAVA 2W57A 2PS1A 3ZH2A 2HSDA 4RL4A 1YXMA 5KEIA 2X8AA 3H5RA 1JZQA 3TYXA 1FC0A 3H2SA 1OY1A 2E18A 3LRPA 4W6QA 1GYQA 4M9SA 4QOJA 5AXCA 4GKVA 3HJGA 1VA4A 1XR3A 4HFRA 4NVRA 3IN5A 4UZFA 3GF4A 4YJGA 3DF7A 1QQ5A 1FLVA 1KIFA 4G41A 2JFUA 2JA8G 3QFRA 4U2DA 4BMZA 1JEQB 3LY9A 1MOSA 1A96A 4K5QA 2ZT5A 2XD4A 1E4OA 1OILA 3E15A 1SG9A 4ZOCA 2XX3A 5E7JA 3J7TA 3ML1A 1HO3A 3B5EA 3WLTA 2AJTA 1E6MA 1ONOA 1TRKA 2P6NA 1X7WA 2X86A 4C2TA 2WKSA 2HGSA 4KXLA 1GPKA 3C6MA 1XELA 2ENUA 2YINC 4X44A 3NHSA 4Y2YA 3DO6A 2GDJA 2VF7A 1MF7A 1K6MA 2ZUTA 3NH9A 2WPDA 3VR1A 3PX3A 3Q4GA 3AWDA 3UMYA 1FIUA 3TY8A 2BL4A 1H65A 3A11A 4F6CA 4FIZA 1M2OA 1OXMA 3RTEA 4IJ5A 4BN5A 5KT4A 2JA5A 2WFAA 1A48A 3H2HA 3ABZA 5FI0B 2IF0A 3GHYA 1Z0IA 3ZI0A 1D4AA 2V03A 4JU8A 2JFPA 3VDNB 1E3DA 4YRLA 5KFLA 2F6RA 3GMIA 1KFEB 4MK4A 4X7MA 3GTGA 4CKBB 4CVNA 5BOSA 1AS0A 1RXUA 4JGBA 3ZWMA 2IYNA 4B0OA 4YMTA 1VPLA 1FBNA 1NAIA 4BFVA 1Z5PA 5DWDA 3IP9A 2EGGA 3IH5A 1TAUA 1KO8A 4ZP1A 3OF3A 2WKPA 2EJ2A 1E2QA 2OZLA 2PJZA 4XYLA 5KYXA 3ZJTA 3S1AB 5L1LA 4PZDA 2IE8A 5AKLA 1OX5A 4HYEA 4J91A 3HR4A 2Z04A 3HY6A 4D3XA 5A4AA 3P7MA 1TF7A 4XR4A 2PLNA 3D3KA 1ZIYA 5BT9A 4DC0A 1Y7HA 2ZRHA 3PVZA 5IDVA 4FILA 1Q1BA 2FMFA 3H2KA 3IUYA 1P4JA 2ASJA 1S9DA 5H5JA 1BWSA 4LF6B 3A3OA 1G8HA 2PU7A 1EB9A 3MJFA 4FUTA 4WXMA 3TQHA 4IXTA 3RBZA 3OQIA 2Y3IA 4XD7D 4TN5A 5LMUH 1K8YB 1OXTA 4E1VA 4B3BA 4F93B 4NABA 2F9FA 1DB3A 4DIEA 2FUCA 1VCHA 1H9BA 2H07A 4G0QA 3AUSA 2X0RA 3IMGA 5IBQA 1N34H 2X58A 421PA 1XZJA 4FBTA 5BWRA 2H0QA 3ZJVA 2G0TA 3UJNA 1MMFB 3VR4A 1K2WA 4C3OB 5HIIA 2P40A 3DHWC 1WR2A 1M8JA 4DR6H 3UCFA 1T4CB 2MJLA 3MR3A 1Q1ZA 3EPPA 3FLAA 4DPKA 1LVGA 1NX6A 4E6NA 2YJ6A 4Z53A 2HTEA 4MW9A 1VL1A 4TTAA 3REQB 4NBLA 4PLYA 1E20A 5K0SA 1JDTA 2WWFA 2H3EA 2ZBEA 3LSTA 4FMCB 4ND3A 5IAOA 1RLIA 3R4CA 4QYMA 3WNDA 3M1YA 4X6UA 3DZIA 3G5MA 1K5HA 3I53A 4J4TA 3WO0A 4RVNA 1BC5A 1JBEA 4C1BA 3RBDA 2A0XA 1HE5A 1OPXA 4ND6A 2A9VA 4BRWA 4CR6A 2WPDD 4DG5A 3EF1A 3TI7A 1AZLA 1UZNA 4OJNA 1JLLB 2WJ4A 4XM1A 2FLWA 1H93A 5DZSA 4S24A 5HM8A 3WLIA 2PUWA 2AX4A 5AJHA 3E2PA 3ENVA 1Z35A 3IQWA 4K05A 2R85A 3R0ZA 5EJ7A 1YL7A 2OBFA 1LZKA 4RESA 4N7RA 4MYTA 5A4KA 4TTIA 2FJZA 3HBFA 4NHOA 4YJ2A 2IXEA 2Q3BA 4JI0B 3DE3X 4MA4A 5DYGA 1XD2A 1ICIA 2AN5A 3A05A 1SQSA 1XD2B 4AY6A 2G0NA 2WYUA 2OUKA 1M1ZA 5I45A 3CZPA 2CXUA 3KD2A 2R1VB 2WG1A 4KR9A 4AB1A 1P17A 3OOHA 5GIOE 1ESMA 1PZEA 1XJCA 1T2AA 2HHJA 5D3MB 3NKFA 4Q93A 1P81A 5JAQA 3WRXA 5CDYA 1SZPA 2F3RA 4R31A 1VB5A 2JVKA 2P2YA 4CKXA 2ANCA 4H18A 4HDQB 1B1AA 4C7MA 1PJSA 2ZYGA 3SI7A 4WGGA 2MYUA 3LPMA 3AYXB 1DX6A 1X1CA 2JGKA 3TCXB 3NEPX 5INTA 2COIA 2A9PA 5I8ZA 5JE8A 3LULA 1QCYA 1P8JA 1W8IA 3B12A 3QLUA 2ZSAA 1EGHA 3CX7A 2HQ1A 4IXMA 4KXYA 3X2EA 2O8EB 2FG5A 2ZRJA 3UK7A 4JGGA 4NDAA 1ZITA 1LRLA 3R9RA 4DUGD 4UOEA 1X1AA 5ES4B 3I05A 4A0GA 2WTXA 2NTEA 3N7TA 4MRNA 1T0BA 4MQEA 4V02A 3W8EA 5JXHA 1VI5A 2DFPA 2JK0A 4OLHA 1EQUA 4YRDA 2XDYA 2Q1TA 1JFFA 1JSXA 2V74B 2XMPA 3GMTA 2VHXA 2R8HA 3DTFA 3LUCA 4NH0A 4RVGA 3ENWA 4QBHA 3RGXA 2KYRA 3H6GA 1Z28A 3I01A 4LNAA 3VU9A 3DDOA 3AKZA 1E3MA 2PX3A 4E2XA 4KQMA 4KXXA 2BM8A 1JDJA 3OEYA 4JOQA 1AC5A 4OFXA 2IFTA 1SAYA 2Q3DA 1TO6A 2YU9A 4P54A 1D2NA 4ECAA 3KAKA 4JNKA 3MTIA 3AKDA 1FYEA 2X6RA 3AFIA 5EWLB 3UK1A 3W4IA 2UYOA 1WXXA 1YZVA 2QMUA 3BPSA 1F4LA 1OI4A 3IDQA 4G5YA 4F7WA 2GK3A 2R6JA 4RMJA 4W5RA 4I9UA 3S68A 4YJ2B 1UAAA 4TKZA 4O2BA 4DR1B 1MA0A 3ICOA 4PW0A 1HYQA 1Q7BA 2FX2A 2PWAA 4OIFA 1XZQA 3WKEA 4URXR 3RJZA 4MUBA 4JI8B 4R2XA 5CX1B 4R9SA 4EZBA 5CXXA 5YASA 2VJAA 2E7ZA 3FMGA 4FYMA 3AZPA 1ZOIA 5DHPA 2IPNA 3CY6A 2HA5A 4TYQA 1D9ZA 1V4NA 3KAPA 3CJQA 1B2LA 4J0KA 1NVWQ 3S1AA 1RAGA 2BEKA 3J80A 2RGNA 3H4IA 3IVMA 3KJIA 3BHJA 3LD9A 3SX0A 3T7IA 3TPZA 4BFLA 5JAUA 1Z36A 1QIIA 4B1FA 3Q2KA 4Z8XA 3M83A 5KX5A 4PBTA 3KR0A 1TXGA 4ND2A 4JX8A 2VEOA 4YR9A 5ALJA 3TEFA 5BW5A 2GRAA 1DC5A 1W8DA 3AX6A 3DKPA 4LXQA 5K6AA 2F4NA 2XV1A 5C34B 3GJQA 4OQ4A 1U8XX 3ZY5A 4GWGA 3ZE7A 5TLSA 4Z9XA 1BEZA 3THXB 4Z9FA 4XE5A 2PZJA 4BWVA 4A3FG 5J4KA 2HV8A 1GSHA 4UTOA 4WLUA 3R7WB 2WU8A 4UAGA 4NJOA 1Z0JA 1K88A 4Y2RA 4U2FA 4BKRA 2LP4Y 1F2VA 3K0EA 3ROXA 4ZC1A 1PWZA 3JY6A 1A97A 3VTAA 2HOQA 3LGAA 4GOLD 5DB4A 1CBUA 1RRGA 1VXOA 2XA2A 3GBSA 4U2BA 5DO9A 4MDEA 1B6RA 2X9VA 3PA8A 5HE8A 3ZD6A 2JLWA 4XIGS 3AEUB 5LKRA 3DZHA 4W1QA 2YHIB 2E49A 1SBTA 4HDKB 1CUXA 3QX9A 4IUCS 1KQGA 2ZDHA 4M9XA 4O7TA 2JGEA 3JVDA 1GPNA 2JGFA 3GGGA 5GQSA 1BXGA 1SCAA 2Q1XA 3QVMA 2DSNA 1U02A 1V3VA 2YCHA 2VDPB 2ZYTX 3LVRE 2CHQA 1J70A 3OAAA 2FZEA 3OQIB 3OOJA 2VF8A 4S35A 3IT3A 2HT1A 4DSOA 3UO8B 4D97A 2UUAB 4G23A 1Y1WA 2FKAA 5JCZA 5IYZF 2CEKA 2FPXA 1I14A 4Y1RA 3A70A 1K1SA 1JJIA 2YXEA 4S1VA 4RZ2A 3HP7A 1WB6A 1WLYA 2J9FA 3PPVA 4GQBA 4LJ4A 5TV2A 1JHXA 1DC4A 5C37A 5C4GB 4GPIB 1EXWA 3RIGA 3RC3A 1CSEE 4D42A 1KK1A 1SC4A 3LPAA 5JFGA 3H9CA 4UCVA 2C29D 2EJBA 2IEYA 4HH3C 3FB1A 3F2IA 4JAVC 3JQFC 4JB3A 4DL9A 2QRNA 2XITA 3EYWA 3G23A 5LA6A 3TLEA 1VYHA 5JLJA 1TT5A 1F60A 2WJZB 4ZVPA 7REQB 3OSPA 1ZLXA 1QO0A 2VOBA 1RK5A 2Q46A 2XNDD 1I1OA 3NHFA 2ZWOA 4UTPA 3ASYA 3I1IA 4JFRA 3ZK7A 4CT0A 3TLXA 3QY9A 4D57A 1UMKA 2J33A 1K06A 4PM4A 4R3UC 4ED3A 1FDTA 4XDGA 5AICA 3WKDA 2QVGA 4CMHA 5EOYA 4G0WA 5HCUA 1BJRE 1U7DA 5E6SA 3S1LA 1FJXA 1E69A 3TJZA 4M22A 2QZSA 4IMIB 4WERA 2QOEA 3NYQA 1DEXA 4WOKA 3C85A 5BYJA 3RJMA 4UNRA 2H1IA 4B83A 2G88A 4C08A 2ATCA 1CIJA 1ZGGA 3R6LA 4E0BA 1GKYA 3PNPA 3RYTC 4CCYA 5AM0A 4Z4HA 3QEBZ 2IGTA 3SVZA 3HWRA 5KFJA 5TMPA 1SQFA 1T3ZA 2NUTB 3G7UA 3ME5A 3PCRB 5LOVB 2JFFA 2QRUA 1E4EB 3G9QA 3L1UA 3HB4X 1K5DA 1G8AA 1QQBA 4LRYA 2H9IA 3QU5A 3SZOA 5CEEA 1L8XA 3TXAA 3O21A 3NG1A 4MDYA 1PT6A 3L6OO 1CF2O 3KL2A 4YJFA 4L6AA 4BJ1A 1C2YA 1IY0A 2Y1DA 1TTHA 4KFSA 4K1XA 4HC4A 3RRXA 5LQCA 5JANA 3CX6A 4UUQA 4EEZA 5JS7A 4FFOA 2ZBVA 4LOAA 2HT6A 1E3SA 3RBXA 4EUEA 4Y1GA 1V1RA 2HMAA 5KC9A 1WLSA 3QHPA 1YZFA 1ZZEA 1U7HA 3BFVA 2VNKA 3N6XA 4X1OA 2XNHA 1BKDR 4ZCSA 1JIUA 2BFBA 4OQLA 3L8YA 1ZI8A 5DSTA 2RGGA 5IVDA 2NNLD 1P1JA 2VFAA 4NCIA 1OI3A 5A7HA 2HIMA 2Z5LA 3ETLA 4DXAA 1LZLA 1NOKA 1DPFA 2A0UA 4KX5A 1G291 4MJXA 5IDQA 1HDRA 3ONWA 2V0CA 3EIOA 3CNEA 3KU4A 4J0CA 3HNOA 5FPHA 4LOHA 3H5NA 4CN8A 4PZ6A 3QE2A 1KZ6A 4HDNA 3IXQA 1O8CA 3OMWA 4EB8A 1IXYA 4CN9A 1QX4A 3QEOA 3AR3A 3IOBA 4JLNA 1NBME 1U6JA 2GZDA 4OGFA 4QX6A 1OLXB 4LF5B 1S02A 2WA2A 3SKVA 4Z86A 4IMRA 4UQPA 5DSXA 3QBVA 2GQSA 5DIFA 1GG5A 3OEEA 2I8AA 5JVDF 3O47A 4WNAB 2J5BA 1EBFA 3W1BA 1J5EH 3Q0EA 3H3VH 3RYHA 4BPBA 1XF1A 2AHRA 3EK2A 3FKIA 1NWHA 2QZPA 4EZIA 5AVYA 1P9LA 3OU2A 1JB1A 3QVVA 5IZ4A 1OOEA 3M1IA 4W1PA 1AGPA 5HIMA 4KJZA 5AJZA 3TRHA 5B2ZA 4BX3A 1NVMB 5JS2A 4JUAA 3H20A 1C3OB 4JUBA 3QVSA 1XIVA 4ECWA 3O9MA 4U3JA 1AU9A 1OH6A 3NC0B 4GD3Q 5HK8A 1VLMA 4OSEA 3VU1A 3DLBA 2FRXA 1DAOA 5CP8A 1HEUA 3HO8A 1NE7A 4C2MA 2VRCD 2O5CA 1A7AA 3BRWA 4HTFB 4JJ7A 4NIMA 3NHAA 1ENOA 5A9RA 4YJ2F 1R6UA 4Q3DA 4G0UA 1XTJA 4KK3A 1TLLA 2G63A 3KQSA 2CNOA 1LPPA 5BYBA 2A1UB 2DTXA 3MGAA 5CB4F 2Q3HA 4GZLA 2XADA 4GOMD 3HYCA 4J9LA 1EKFA 4GX0A 2PH1A 3DLHA 1I30A 1KYVA 5I5WA 2O1WA 1DU4A 2OXCA 1WQ1R 4IGIA 5HQ3A 1UP4A 4PC2A 1XA3A 3GRPA 1DELA 3IEKA 1PQYA 4CM4A 2QTGA 4I6EA 3DDNA 3LCUA 1WKBA 4KKXB 5FUXA 1JJAA 4BQFA 2ZJ4A 3TLJA 3BKXA 1OFUA 4F5YA 1TZJA 3HVIA 2IYRA 1OXUA 2IIVA 1P75A 2B8WA 2RBGA 3WLEA 3PX2A 3DXZA 3N28A 4AX8A 2Y1CA 4HN4B 3S5UA 4CFYA 5JYDA 4IXNA 4JBWA 1OZGA 2LXNA 2OO5C 3GJSA 3MTAA 3FRJA 5K3BA 4DLTA 1OBDA 4OHUA 3DR3A 4L78A 1JKXA 4DMCA 3AH8A 3RUFA 4OXRA 4CLHA 3TW7A 1NATA 1ND6A 4K8OA 2QJOA 1DOHA 1YCFA 2BWJA 2CVZA 5LLSA 2H2HA 1T5BA 3F3KA 3A2LA 3UWKA 2WUWE 1GLVA 3H2IA 3EWAA 2AFHA 4L4ZA 5J2UB 4PONA 1P9RA 5JZOA 3N58A 1O89A 4C89A 2H16A 3FNQA 3DDWA 4L6IA 1JLLA 3QPCA 4RTOA 5K0EA 4PXAA 2CF6A 4APMA 3NXSA 5CYPA 1F2TA 1R4NA 1GVHA 1OAOC 1P5RA 1SK8A 2A78A 3BCRA 3C70A 3O4HA 4JCCA 4OXQA 5EP1A 3ZJ4A 4JI7B 1ZXLA 2G1UA 3QX8A 3L6BA 1YVUA 1E1MA 3AG6A 3OOYA 3AVWA 2UYYA 4IR1A 1MG5A 3CLRD 3KZCA 3O1JC 3FNRA 1T3TA 4NMWA 1XZCA 2WNHA 4FHEA 2JH3A 3KKQA 4PTLA 3BQ0A 2YVAA 3RG8A 3DE1X 2G4VA 4OYHA 2OAGA 1T9CA 2WNSA 2WEKA 1XZGA 2ZK7A 5KWIA 1TYZA 4K26A 5JNSA 3X0DA 2DFNA 3D59A 2XJ4A 1J8FA 3M7IA 2JGRA 3Q0IA 4ZPJA 5ALNA 5F12A 3GLUA 3SFVA 3ZI7A 4RL6A 4AJIA 3FI9A 1VPDA 3EZXA 3ZGNA 5KJFA 4TKVB 3HI6A 3HDVA 2DJ5A 1VE7A 3U40A 3MHTA 1AD2A 5HOQA 2YC4C 1RWQA 3MWJA 2Y0SE 1K75A 3NIBA 4IDOA 2C3YA 1S2NA 3FFAA 3LP5A 3QXSA 4HTFA 3RTDA 4PXYA 5BV8A 4UE6A 4M0DA 4OQDA 3EPLA 4K9RA 5K03A 2C4UA 2I8CA 1V7CA 3LC1O 2XXAA 3A27A 2RHCA 4GF5A 5IKOA 3E6AA 3A2MA 4TMYA 2JS7A 3EZ2A 3NALA 3V7YA 1G20B 3BD7A 4CM1A 3H40A 3FSRA 2TECE 3DFUA 1E1NA 1E2LA 4JC8A 5I9LA 2YWEA 2F4VH 4IH1A 2QLJA 1ZS9A 3GCGA 2VF2A 2OZKA 2R82A 1YS1X 1XDNA 2OQRA 2CUTA 1WB9A 3Q6IA 5LL6b 2CMGA 2AW5A 4I1RA 1Z8NA 3MMNA 1BRMA 4FSHA 4UHKA 3PW7A 2OYSA 5H68A 2IITA 2XMSA 4IGKA 1M9NA 5D3QA 5FHRA 4A03A 4BFUA 3CVOA 4U5XA 4X8HA 2FGJA 2VA8A 1RJPA 4M7EA 1VOTA 1Z4OA 2BCEA 3UT6A 5B58C 5JQGB 1JHPA 3HA3A 4IUDS 4B45A 4H17A 1GQYA 4URZR 4JT8A 5KWJA 3MXTA 3R0QA 1EFKA 1OWTA 2EWWA 3IQEA 1YA4A 4I5FA 3HB0A 3QNMA 2WLTA 3D54D 4MV0A 4J0JA 3IEIA 4DLPA 3DAHA 4D3DA 2QDXA 2O3TA 3I32A 4KPUA 4E4RA 3R5SA 5EOVA 4B48A 1O57A 3GNLA 3H86A 4RVSA 1TVCA 2EFGA 5KT3A 1ZJ6A 1QCDA 1S3FA 4ON9A 3WZMA 4C5CA 1UPBA 3C98A 1XCBA 3U3DA 4O2AF 4JI5B 4DGSA 1M6WA 1VECA 4GMDA 5KFEA 1N78A 3IHTA 4CM6A 3MAAC 2AKAB 1WXHA 4H3HB 1I94B 1NG1A 1LNQA 3FMIA 3UICA 1OREA 3DL0A 2DF8A 3KR1A 3MUFA 4XX0B 4CMKA 4EGSA 1II8A 1SR8A 1GFSA 2B0CA 2RSLA 5L4SA 2WWHA 2X3FA 4TYYA 5TARA 3OQ1A 1MQAA 3SAJA 5LP6F 2HF2A 4L0CA 2OP1A 1PL6A 1XNQH 2DRIA 1U0RA 3B53X 3I2JA 1Q14A 3CUTA 3FOAA 5D01A 4K0RA 1IBLB 3M33A 2OT3B 3RVSA 1KGDA 5E2IA 3RNLA 2GEUA 5HBGA 2A9FA 3ANLA 1CY7A 4DZZA 3T1YB 3HABA 2P75A 3IXLA 3QXGA 1JH8A 3KSZO 4UFZA 4D99A 4EH1A 2WMOB 2A8YA 3IQIX 3K20A 2FKLA 4CMIB 4BX8A 4DZTA 4ZV4A 1Z8DA 4EBEA 3GUUA 3JQAD 4ZEXA 2Z2JA 4M98A 4U4AA 4XIFA 1ODCA 5A5GA 3DBIA 1T6YA 4Q37A 2IZOA 4GL2A 4Y2PA 1SCBA 3A1UA 3QKSB 4PCLA 2AZDA 2VQDA 3ZXYA 1EFRD 1DEAA 4KK4A 2CWWA 4PHGA 3TVYA 1BG6A 1KJNA 3QLVC 1WMAA 2NADA 2XQVA 1TAHA 5CFZA 3EF0A 1UJ5A 4IMPA 3RB0A 2O0MA 4HS9A 3H75A 1KEPA 2HMSA 2OCXA 2ATLA 2FXIA 4KXMA 1P1FA 3H8VA 1O6BA 4Q82A 4U9HS 5EZYB 1V11A 4O2BF 1W34A 4MWGA 5LD2C 4GPBA 2NIPA 4YROA 2HDNB 4PZPA 2O7NA 1L1RA 2Q8QA 1NUHA 2OC4A 1NSTA 3PHLA 2A6PA 1X87A 3VNSA 3QPDA 4BS9A 1MC4A 4XWTA 1A1VA 1R4MA 1LPBB 1M72A 4NJMB 1JXMA 3D7SA 5JROA 1C0IA 1EP2B 1QDLB 4BQEA 1O96B 4MR8B 2VDMB 2H1OA 3RSFA 1VJTA 5G1OA 5AJWA 3BMOB 3OQJA 5IMBA 4WBNF 1DTEA 1FRNA 3OA2A 4LY6A 1DIOB 4ZC8A 5KJEA 4AN4A 2FSUA 3QPUA 4BEBA 3QZUA 4ZJPA 3MHPA 2N1MA 4EATA 1HR0B 1TJPB 1C2TA 2YASA 3ND6A 1L6IA 3A32A 3PQ7A 5CPFA 1UF9A 4D4JA 5AVUA 5KHAA 5JPCA 3EGXA 4M1TA 4NG5A 3W3AA 1O97D 2CHGA 3FMFA 3NW9A 3C7DB 1UH5A 3KPUA 4JU9A 4ZCIA 3KK0A 2W2OA 4RPKA 3ROKA 1YFLA 2R8PA 3WS7A 4A10A 1KS9A 2QD5A 1E94E 4FMPA 3H5VA 3SE0A 2OZPA 5C8VA 4W99A 2Q2TA 3ERCA 3ST7A 5HFNA 2UUBB 2X5OA 1DX9A 3JQBA 5BYAA 2A4MA 2FGKA 2JAUA 1A5BB 2HCTA 4HDRA 1TWCA 1SHUX 4MCJA 3VU8A 3CUKA 4BX0A 4Z4IA 1OFTA 1GITA 3HKCA 3EPKA 1CLUA 4N4AA 4AMZA 2Y1LA 4NONA 4RD6A 4ER6A 2P5YA 4JODA 4MMZB 2ZIZA 4QTUB 4P7BA 1OFGA 1J39A 1JKJA 3DKRA 2Q8PA 1Q44A 4AZTA 4US1R 3JASB 2EBHX 5BN5A 4MVJD 5BRNA 1RYSA 2D2IA 1WXEA 5KYVA 3QVLA 3TB6A 2HA6A 2DB3A 3U2QA 3F5QA 4XUGB 3PEVA 2Y93A 3KOZA 4Y2XA 3A06A 1N2ZA 2A5YB 2ZE6A 2ZRNA 4YMIA 5FWAA 4EGFA 5AUOB 3JZFA 4FXOA 4WCDA 5DMHA 4AS1A 1MJ5A 3ZWQA 3QELB 1UQUA 4DYVA 3ZV7A 1WSDA 3PC4A 3AHJA 2XRFA 2HF7A 3KT0A 2WB2A 1LBIA 1QS0B 1H1LA 1U2RA 4BAZA 4R1TA 3E61A 4Q18A 1KFKB 1PZHA 1QV9A 4LJRA 1R6BX 2G5TA 5BRJA 1Q0QA 2ZBRA 4MUIA 2B98A 1FRVA 1D1SA 1YNOA 3IAUA 3EY4A 4ZVLA 3ZV4A 3RS2A 1EFUA 5ENZA 2ZG6A 4GMFA 5F1KA 3RASA 4AW9A 3LY8A 4EI9A 1V8OA 3D5EA 4KX3A 3DQPA 1CVLA 3R6DA 3SPXA 1ULHA 3C39A 2A1HA 3PB3A 1J0CA 4EFDA 1ESZA 2PX2A 5SZJA 1TIPA 4R83A 3FCOA 2QV7A 5IAGA 1FU8A 1ENZA 3O26A 3LCVB 4GP7A 5BSMA 3B6IA 4OKIA 3D2BA 5KFQA 4QBGB 3VV3A 3MBOA 4I5IA 3DBVO 5MGNA 5TE9A 4K6OA 3PHIA 3KJZA 1KYWA 4RCNA 1NWCA 1H6DA 2W9AA 4L3VA 1NZJA 1XP8A 1PI3A 2RC6A 2VPSA 1PR6A 4OATA 2EHDA 1QUEA 2IEZA 2ZIXA 3CIOA 5AT1A 1AHNA 4HN2A 1YZYA 2AWNA 2BISA 3CLTD 4A9AA 1C3OA 3DE2X 1JKJB 1CUWA 2PGXA 3SHQA 3S3TA 3V00A 1A9ZA 1Y33E 1FCJA 2GJ9A 1ONSA 4DSUA 3U4IA 2BFDB 3LBNA 4Q00A 1R8QA 4C4AA 5HKOA 3AJEA 2LWIA 2A57A 2J6HA 3K30A 4EECA 4D4IA 4AJ9A 4OHXA 1KETA 1S5PA 4I3HA 3QBJA 4D82A 2R5NA 3A2KA 3VVMA 3AFGA 2UYHA 1VBMA 3MOIA 5IVIA 2E4YA 3KUXA 3AW8A 1V5WA 3D2LA 4WOBA 2EZ4A 2DZDA 1T6BY 5IC4A 1ABBA 3HU3A 5FOSA 2HBQA 1GPH1 4YCAA 4DAOA 1EWQA 4JMLA 4RXMA 1NG9A 1T26A 3G49A 3OF2A 2WICA 1T9KA 4ZI7A 4WW0A 4TT3A 1X8JA 1FF9A 5CBPA 3M5WA 1PSDA 3P0IA 2DU8A 4J1TA 3JQFA 3HVKA 3KHRA 4AY2A 2PGNA 1QB8A 2PD6A 3U09A 2DXIA 1CEEA 4QXPA 1N3IA 2EGUA 3HDGA 3PVCA 1JFSA 3IIMA 5LIRA 3MUOA 1CKNB 3AJAA 4KEAA 2PG3A 1BYUA 1NHWA 3OFNA 2XQJA 1QO0D 5ALKA 2AGQA 1Y1QA 3ITDA 4ZTBA 1ILEA 1YRBA 2NU9B 4LRQA 3AJRA 1O96A 4MR8A 1K1EA 3P94A 5M7EA 2QT1A 3E5HA 4DMMA 2TMKA 5AXBA 3PXBA 1W581 4D9JA 3E1GA 3OX4A 4N0QA 1XA4A 5JNRA 2HHCA 3N3AC 4YRIA 5A1JA 2RHOA 5ADHA 1K7EB 1PWXA 3FSJX 3RADC 4MXDA 4BQNA 3DDCA 2BFFB 1DC8A 3LJKA 4MW1A 3GLQA 3H1TA 1XLVA 4CMFA 1QAMA 2QSZA 3GAFA 2BMWA 4NYIR 3WNZA 4R84A 1GJRA 1XDGA 4XM0A 3R9IA 3QU4A 1HA3A 4PLVA 4YPOA 5L3SA 3RS0A 3ZGXA 3D8SA 2DFKB 4B3HA 4CKWA 4GEKA 4X7PA 3MT0A 2IYVA 1DRUA 3EVZA 3O3MB 4KLCA 1NU8A 3AKYA 4CG0A 2V0GA 1TCVA 4DV6B 2WE6A 2GFQA 2L2QA 3H05A 3OPQA 5U1PA 5JNVA 2C5GA 2NXEA 2SHKA 4JFAA 1Y7IA 2Y66A 2Q4TA 3RFCA 1OBCA 2FPMA 4RXTA 3WXMA 2X0FA 4AK9A 4EG7A 2PA0A 5IF9A 1SRQA 2Q62A 2Y8EA 5BQPA 1NUUA 2OVFA 4WESB 1QDEA 2GEDA 4XASA 3ED1A 4HI0E 1A9RA 3AUTA 1P7VA 3QLTA 3LKBA 2C8JA 1I6WA 3SIRA 3WIVA 2GCOA 1T36A 2Q3FA 4HMOA 2NP7A 3GILA 4GSKA 5FTLA 2EU8A 3JZIA 2CJXA 2FZLA 3I3OA 1ZGCA 3MSCA 3HO1A 5LZ5A 4GRIA 5KPJA 4YP3A 1F5NA 3VTKA 2VDNB 3O8CA 1RWWA 3W5BA 2CXSA 4UUBA 4GQAA 5HFJA 1TJNA 1HTWA 4PGAA 4KV9A 5JSQA 2NGRA 2NM0A 4D4MA 4IZHA 3MAJA 4DC1A 1G9SA 3CZCA 1ZA1A 1RZVA 4JQYA 2X23A 4F4DA 4EJMA 5KT2A 2H7CA 2XGGA 2ZJ3A 2ZYRA 4UCWA 4AWAA 3G1WA 1XTUA 4JV0A 4W9RA 3QWIA 3RRNA 1V6AA 2J1LA 3RRZA 3WK4A 1GCIA 4TTSA 1ISPA 2X0KA 4I50F 5DGBA 2XYVA 1VCOA 3IIIA 2R1TB 4B0PA 1G7CA 1NBIA 1YJAA 2Z0MA 4Q16A 1ZBQA 3D6HA 3K1TA 4MQFB 3FCSB 4CF6A 4F11A 4MWTA 2V7BA 4QFCA 4BNUA 1QH9A 1S0NA 3H9UA 1M2HA 4S1OA 4CIVA 3P0FA 4DUPA 1YR3A 4HB3A 1ZCFA 1YS2X 1EJ2A 5HM6A 2HLNA 3N8GA 3E3MA 4J8PA 1ZU4A 2X0NA 1MEOA 3ZCQA 4E7PA 1A4UA 2VPIA 2W93A 4FNGA 1A0IA 2IUYA 4O2RA 5C1BA 3UC9A 2PHZA 3SJAA 2RIRA 4R2WA 5ALWA 3CB4A 3RYFA 3VV2A 1YVPA 4R9NA 1JIHA 3G6YA 2MSCB 2R4UA 2VBCA 2VWGA 4R1MA 4F6RB 5C7YA 4EBCA 1RSZA 2C8KA 1WDMA 4HEJA 1QE5A 5A4IS 3FMVA 3LUJA 4TLCA 2XVMA 4M8IA 1ZR4A 3GY0A 2VQ6A 4CIBA 2OWDA 3GB9A 3ZDYB 3KLMX 5L53A 1CWUA 1KRHA 1JL3A 5A2QW 1SIOA 3TOZA 4CKWB 1CP2A 4XCVA 3SCZA 2IV7A 1GUBA 2Q5QA 1ZN9A 3KHKA 1I24A 1R0YA 3E03A 4RYDA 5G53C 4KQ2A 2Q8NA 3QKIA 2W2KB 5E1MA 3COZA 5DRYA 1EZ4A 4HAYA 2ZYAA 3GROA 3P5BA 4Y6PA 5P21A 3KYIB 4K8RB 2WSSD 4IJ6A 3M9OB 2GJ8A 2QY6A 2OXIA 4V2UA 4HR7A 1N25A 3M9MB 1SCQA 2B20A 2P9BA 2VH5R 4G5OA 4G9EA 4DE5A 3NBAA 4B3TH 3U0BA 3VZRA 1XXHA 1NYRA 5L1JA 3Q5GA 3TTTA 4LRSB 3C3JA 4ECUA 2HDWA 4HN9A 2G6BA 4NE9A 4PC3A 1RWKA 2NTJA 3CR7A 1KO4A 3I9MA 5AJYA 1E92A 2Q9CA 3SJBA 2AJCA 3DGEC 5GVRA 1N34B 2FCAA 2I6TA 4ZCPA 1VPEA 4CLOA 3KUUA 1OW3B 5F9LA 5BUCA 1B33N 1E61A 2HU8A 2GUGA 8GPBA 2X8BA 1G3RA 1TK2A 2GXUA 3VO2A 1ABFA 4RLFA 2CDBA 3QBEA 1E1RA 3BSFA 4JLAA 5LZ2A 3V4PB 4DDHA 4JUDX 5CT8A 3PHJA 4DIUA 5TXGA 4GC7A 2OO3A 5DG7A 4YYEA 5BR1A 5DBFA 1UZLA 4O7VA 1S0MA 1E89A 4YJ3A 2UVVA 1ZX1A 5ESDA 3GAAA 1QGYA 3GUVA 4L57A 4UBMA 1U4NA 1SUDA 4A6XA 4F8JA 3I9NA 2WTUA 4TRJA 1O0BA 1JWAB 3JYQA 1JZSA 1NY6A 2PX6A 3TD6A 5JEDA 2W7TA 3ZVNA 3C4JA 1DQPA 5BURA 2BUAA 1WF3A 1Y4SA 1RQ7A 3HLTA 3ZDBA 3T6KA 2JG3A 2O2IA 4OQMA 4GZ5A 3BXGA 2A14A 4KPYA 2OKGA 3THYA 5EYPB 4WH0A 1V3UA 1NT4A 3JTMA 4LBZA 2UYCA 1EQAA 1IMJA 4ZWNA 5D51S 4N5MA 2IDMA 3KKLA 3WLFA 4F5WA 2H7XA 3BIXA 5JFOA 3AUKA 2Q5LA 3X1KA 1XKLA 4Q9DA 3IBFA 1MB9A 2VP4A 5M04A 1YJ5A 5JTUA 4LVOA 2LVBA 4IH4A 1FSSA 4KO2S 1E6UA 2DFDA 3JXEA 4KO8A 4U0JA 1GCOA 3ROMA 1DQZA 1QNLA 2AOWA 4AFNA 4EPVA 1KJ9A 1RBMA 3F4LA 1NM5C 4ZYXA 2VTVA 4GLJA 3UMMA 4I50A 2R11A 3NT2A 1Z6TA 4ALLA 3T3HA 2AVNA 4RZQA 2KX7A 4QELA 4R5HA 4JA0A 4YJGB 5IF3A 2FE4A 3QWFA 4RKQA 3DUFB 4MPDA 1T1GA 4DADA 4DKXA 1RC1A 2AA3A 1YMVA 2WSSA 2GZ2A 3HKDB 1BMFA 1NRIA 4REOA 5CDSA 1U3TA 2XCLA 3W5HA 3PNMA 4KZPA 4ABYA 3D0QA 1G17A 5AMXA 1TZ2A 3U44A 2P62A 3JD3A 2WAQA 5TQ2A 3C0FB 3ZC3A 2Q5JA 1J2YA 4DY4A 4YPVA 1DEOA 1GA6A 4YR2A 1U2GC 1VL6A 1WY5A 4KQWA 4C4XA 4ZVUA 5AM4A 4DTCA 1VLVA 3V97A 5KNCH 3R5XA 4BATA 3R5TA 1O4WA 1SVLA 4AC9A 2VH1A 1P7WA 1V48A 1Z0UA 2ZIFA 4PZUA 5EUBA 3ZIDA 1CKNA 5JNLA 6REQB 4MROA 2NNWB 3A7DA 1N32B 4L02A 3B2NA 3U0VA 4F1KA 3FTEA 3O8NA 4P86A 4QECA 1FYFA 3UXHA 3UHJA 1XRNA 1UFOA 1TVKA 4YMGA 2Q3EA 2QI9C 4OGWA 4DIOA 5AJTA 4H77A 1QP8A 2WJGA 5AR1A 1GDTA 3FOBA 1T8UA 2VOEA 1FUUA 2PO5A 1UAYA 4N7BA 2EFCB 4HEA6 4QEZA 4Q9IA 5LWQA 2C77A 3WJ1A 5ALQA 1CJKC 2C9YA 4DM7A 3KT3A 3R40A 2WB4A 3SM9A 2GKOA 3AF0A 2WTAA 2XUIA 3ANXA 2HWKA 2C92A 5LP6B 5KYYA 4BLQA 3UW1A 1K97A 3R3UA 1UBFA 1YJCA 3PC8A 2R7NA 4S1PA 5BV7A 3S81A 3N8HA 4MIKA 5L9AA 4F8YA 4X8OA 4QWCA 2OP0A 1T15A 2QQGA 4KI7A 1XZFA 2FA9A 1TQ4A 1RWVA 2PWYA 3N2EA 2C9ZA 1Z73A 1G60A 2EQBA 2A0YA 4E4TA 2ZJYA 1C30B 2VP9A 2PS0A 1U0BB 1GU1A 2Q6OA 4FD3A 3SIPA 2O03A 2OQ2A 3HV0A 1KJ8A 4YCCA 1T5HX 2EOAA 3NI2A 4UNSA 3EXHB 5GOZA 1Y6GA 5CT6A 3GQCA 3OIGA 4DDMA 4UJ5A 3G7SA 3QM1A 1PJ4A 2HRQA 2QPAA 1U2SA 3WBBA 3ZVRA 1I7QB 4NULA 3MOGA 3RAJA 2X0SA 5EE9A 4YRPA 3U7QB 4A0QA 4JT9A 4C7VA 3OICA 4DBLC 3I4NG 3IULA 4GHWA 1J0BA 1QQAA 3WA6A 1YOVB 1E8MA 2ECOA 4MQ6A 1MZBA 2OOSA 5DPMA 3VYTB 1E2IA 1ISHA 1FMLA 4LF9H 3R9XB 3C3WA 1WW2A 3ET5A 2I9KA 3C1AA 4QWMA 4BO4A 3G2NA 2IEBA 1MVLA 1VHLA 3FZYA 2NXNA 3IODA 4A82A 2OLJA 3E22A 1GKLA 1JDPA 1MOQA 1OFUX 1VHDA 2IPLA 4X41A 3RHTA 4R0VA 3ZDZB 3T38A 3FTFA 4QDZA 1G0OA 5AVVA 3E4CA 4N8DA 1QPBA 4NI5A 1TCUA 4OP2A 4DV1B 1KKLA 1SXHA 1XAHA 4R81A 3D8UA 2XW6A 1IB6A 5CVEA 1CZKA 4LSMA 3LC7O 1O6FA 2JBAA 2HGWA 1PJRA 2AFHB 3UBTA 2JBAB 5JJIA 4W7HA 3E9CA 1DIKA 4UREA 4E5KA 1YUMA 5CT5A 3CCFA 3TNFA 3CWZA 5A0VA 4YQZA 1H8HD 3BCUA 1RZ3A 2H2AA 1ZGZA 3KNZA 2CL0X 1GDDA 3T61A 1XL0A 4WFJA 4CMCA 1RXYA 4YWJA 7MHTA 4DWJA 2VTDA 4N3AA 4HWTA 3DOJA 1UK7A 2D3WA 2WMNB 2R97A 1GRNA 2CEAA 1JSZA 1LXCA 2MMGA 1QH0A 4QODA 4NSNA 3L04A 3KV3O 1O9GA 1XVIA 1U31A 4Q9HA 3SLRA 5B5SA 4W1SA 2CJWB 1QU2A 1DGQA 3ACCA 4EQ5A 3OHSX 2BYTA 3CXRA 3PE4A 3SKYA 5JV5A 2Q6KA 1L7NA 4L7VA 4WKCA 5BWUA 4XLLA 3WLMA 1OBVA 2FPIB 2CFCA 2WTEA 5FA5A 3RU3A 3GLFB 1YK1A 2X8LA 4TL7A 3VO1A 2QZ4A 3VR3D 1Y1LA 4OHYA 2IS6A 2QYTA 3U49A 1FDWA 2CXRA 2NUPB 4YT8A 1QTNA 2QXYA 2ZCVA 2E2WA 3FUUA 3JQ7B 2P35A 1Z68A 2G9QA 5IJ0A 3SN6A 3LLVA 3K53A 2IS1A 3IBYA 2J6CA 1X80B 4P0PB 1Y7LA 2XQKA 1PZNA 3HCRA 4OL9A 1G5QA 4NFHA 1Y3IA 3ESZA 1I5OA 4HDKA 2AE2A 4MHOA 1R50A 4MUXA 5KFOA 3HKBB 4XD2A 4JC4A 4O0MA 4P38A 3AY3A 8ATCA 1FZTA 4XFKA 1SFRA 2R6DA 4WK6A 4XLTA 4B46A 1JU3A 3HADA 1NT2A 4H7EA 1JP7A 3T1NA 1DS6A 1U94A 5JADA 2VQSA 3IR5A 1OGJA 3FYSA 3JW8A 4RY8A 3KE8A 3UAXA 3WGKA 3EN0A 1BVUA 2ISSD 3BXZA 3Q3VA 2FQQA 2VO1A 3T15A 2ASEA 2RK4A 1GT6A 4RU9A 2WF8A 1XTBA 4RQTA 4WBXC 1SMKA 5EFOA 4BJHB 3A1WA 3EODA 1YA6A 2PT7A 1PVOA 2YJTD 4ZOLB 5C53B 2SKEA 3F3MA 4MMXB 4QJ3A 3T3NA 3I34X 2ZOSA 3LXRA 3ZLUA 1OLXA 4BO5A 3VPBA 3RAGA 1MRSA 1X2BA 2I1VB 3EDMA 3RSZA 2DUUA 2YMLA 4XQEA 3E3AA 2BFNA 1CETA 4D74A 4QSHA 2NVUB 3MLEA 1XTIA 1VE5A 2OA0A 1MFPA 2FLVA 2A30A 5C2JB 5I8PA 2HMTA 1X6VA 1X2EA 5ERYA 4A8HA 1B4DA 2WWXA 4PR3A 3K2QA 3WTCA 4DCTA 2VQEB 2BE9A 1RXEA 4DCSA 3DDHA 4NU5A 1AO0A 4TLLB 4UCUA 1PV1A 2JATA 4YRRA 4ACAA 2NSLA 1PEAA 5K8CA 3QEMB 4OFWA 4XGNA 3V1NA 4DPMA 4RWZA 2QGZA 4CTMA 3KPWA 5IT9A 1YQEA 3E3NA 2HCBA 4G65A 4TV9A 3NTOA 1DHTA 2YZLA 1UMBA 3A8TA 4HUQA 4GO1A 4QYXA 1I36A 3ZV6A 4N3GA 1OSNA 1IWBB 1G5HA 2PX5A 4I6JA 2NYRA 3HEMA 3N2YA 1DTWA 4OGLA 3J80W 2EYQA 2A58A 4GM1A 4YDHB 3TBKA 4NCAA 1AKVA 3EVBA 5FR1A 3UOAB 3TQIA 2YZGA 2PV7A 4WACA 3L0YA 2AFVA 3O84A 5DI3A 4DZRA 4ENRA 5BYKA 1I1MA 1KF0A 2ORVA 4YJHA 4ZT3A 4AAYA 6ABPA 3ZNQA 3QLVA 2RGRA 3EXFB 1SC1A 2ZBDA 3UMSA 1R2QA 2Y99A 4LSGA 4CJXA 1FDRA 2OMEA 2XVAA 3CONA 3H1GA 2ASVA 4ZO7A 3VZSA 3QGMA 4CMIA 4DCGA 2OFXA 2HRRA 1EWTA 1JNXX 3RVJA 1XTKA 4V3CA 2VNJA 5EWFA 4LTNA 1YAHA 3I9FA 2A5DA 2ODPA 3WOHA 5I7EA 4RZXA 4WFIA 3OZDA 1EFCA 1SKYB 4IINA 4IVQA 1RWXA 4Q4AB 4TSKA 3R5JA 4Y6RA 5TQJA 3Q8KA 1SCUB 4JX9A 4ARUA 3ZZNA 2QENA 3OFND 1JMVA 2ATXA 4G0OA 3RUCA 4HMPA 3PHCA 5H70A 1GHTA 4WX2B 5MN5A 4N76A 3MRXA 1EH5A 4OBWA 1H4SA 3AOEC 3AM3A 3M4NA 5EMLA 3TAHA 4GICA 2RGAA 4DV4H 4D6XA 2E5LH 2R3SA 1VMKA 1YVEI 2KBEA 3LNCA 1JLMA 5LYJB 1GU0A 2GD0A 2P7IA 4LX8A 1QKJA 2PRSA 4XKJA 5GJVC 3VOSA 3LXUX 4W9NC 2PXAA 4Q4CA 2QRZA 3NVMB 1ZI9A 4QXQA 3FIJA 4I7HA 3D0KA 4YMVA 1FTYA 3MELA 1CUAA 3IMFA 4L5CA 4B43A 3DOHA 5CB4A 4ZGGA 3R44A 4V2IA 1ACJA 4URUR 4IGEA 2YHUA 4DA7A 5JPDA 3T7JA 3USZA 2CJPA 1X3SA 3FVVA 2J0EA 2G5GX 5ALDA 3GR6A 1JSRA 1MH9A 3E7XA 4B7ZA 3WR5A 4D80A 4K6HA 3PPWA 6CHYA 3CBQA 2ZDQA 2NUPA 2ZRAA 1IOZA 1C9MA 2AQ4A 4TL8A 4Z8YA 1XDUA 1MRZA 1MNQA 2BGNA 2ZWPA 3Q0TA 4FUQA 1SBHA 4MP8A 5IN5A 2YR0A 4NG4A 3OOWA 3F6PA 4U8HA 2GGSA 1CEYA 3ZHSA 4LJ7A 4DIKA 1BDHA 5T3YA 3OKAA 5D86A 3I5AA 3W2GA 1DT5A 1Y82A 4ZO9A 2WB1A 1QTIA 3K0FA 4MO2A 4RVHA 5TT1A 4CCAA 1JPVA 2WHEA 1P5ZB 4V39A 2ZIWB 4HRAA 4RENA 3GZJA 3R77A 1PZMA 3JSXA 2RAUA 3QBDA 4Z7NB 3QUSA 4HF7A 1KTAA 5KTRA 3GPCA 1EIWA 1R5NA 2AR0A 2QUAA 3K9GA 1DC3A 4L4XA 3BDVA 4MV1A 1UIRA 1YS6A 2B4TO 5T4HA 4A2QA 4MS3A 1U28A 2ZVPX 3VYRB 2JA6A 2R6HA 2VK1A 3ZZ1A 1BROA 4YJHB 3UXYA 2F7SA 3CRVA 2SCUB 3FGZA 3BK7A 3ONDA 4O2AB 3CQZA 3SR0A 1IHPA 2FVYA 1E64A 3F7OA 3KCNA 3P9ZA 3H42B 4LZAA 1PZFA 1QM5A 1Z7EA 3TVDA 1QANA 4Q66C 1DTSA 1VZ2A 1D7OA 3IHLA 3DNFA 1ADCA 5IC5A 5BUQA 4I7EA 2AFIA 4ZZIA 2IZ1A 1U1DA 1YQTA 4I1VA 4QUBA 4LXUA 1O54A 5GP1A 4XIYA 5G0VA 4NZPA 1SVWA 2E5WA 3MYYA 4HWSA 1KQFA 4DV6H 3HEBA 4KO4S 4M9CA 1BX0A 3TO5A 3R6GA 1EG2A 1PJQA 4WNYA 1TMYA 2D0OB 3QA9A 4MEAA 2WD8A 1U65A 2IQIA 1HMYA 4OB6A 5EL0A 3TEMA 1SUFA 2N0SA 1XCGB 4UM7A 2DQZA 1BHO1 4I4LA 1TQ8A 2RDMA 3FPLA 3JYHA 3V8BA 5LNK1 3CU5A 1KE2A 3OJLA 3RVDA 2R7ZA 5E95A 4ED7A 1H4QA 4W5OA 4LGMA 5FBZA 4YT2A 2XC9A 3L7AA 1I3NA 3MLAA 1EHYA 2Y1GA 1B6TA 2VYVA 3R9KA 3SYKA 4TVSA 3RBAA 3ZIAD 1JG6A 3CEAA 4UHFA 3MIIA 1BW9B 1GZ6A 4CIWA 5DT9A 2JH9A 3MSXA 4XVUA 5CGZA 1XQ1A 3GJYA 4IKOA 4OSOA 2J7KA 3DDUA 4NPAA 2ZXFA 1N7JA 1WOMA 2G67A 2VWQA 3EC7A 3GRRA 4OJTA 3W1WA 4PHHA 2HHFA 3GTJA 3EGDB 4Y2QA 3EGEA 1J0AA 1R9MA 2OLEA 4J7CA 4NYIQ 4CDNA 4CV1A 4OJKA 3UQYS 3UG7A 4S05A 4R3WA 3IUMA 1ZN8A 1L5KA 1J8VA 2DUJA 3IBCA 3KJNA 3OCJA 4QWWA 4YPFA 4D96A 1YR8A 1YGPA 3R7NA 4Q47A 1F3OA 3HBAA 1J5EB 5HCNA 4UMFA 2PJRA 1XXLA 3K35A 4YB8B 3NBMA 5IKMA 3WGIA 1RKVA 4BMNA 1VL5A 4FHGA 4HATA 2P2NA 1WSAA 4LE2A 1TC1A 3DOCA 1E32A 3PNLA 5FTWA 4OU4A 3ICQB 1W2GA 2HI0A 5CNMA 3DLIA 4BXOB 3ZNNA 5SY9A 2DR2A 1NLMA 1U1GA 1JI3A 1JR4A 2I4NA 3DZCA 4GC9A 3U31A 3LXXA 2ERCA 4US2R 2D5AA 5CHYA 2X0EA 1FVFA 3X44A 4DV3B 1G4HA 4C5BA 1G6Q1 4UZSA 1K4MA 1ZMTA 2A7XA 2CLDX 3DQQA 3O3CA 1BH6A 4UDOA 3ZZ0A 4N8EA 1R64A 1T4DA 1U9IA 2DP4E 4N7MA 4HVLA 2VPTA 2WU0A 3UAZA 4O3FA 2OD2A 3SQWA 2WIFA 1AUOA 4MYRA 3BMCA 5MFPA 2ZDGA 2NSJA 3QHAA 4P83A 5FR9A 3GHHA 4NJMA 4WNIA 2YIVX 2B37A 3OPYB 4MRAA 3HJRA 5K8JB 1ZNYA 5HF8A 3SOZA 3O9ZA 1AXRA 3HKEA 2BM1A 5ECDA 4U7DA 1Y9JA 4NZNA 2ZUWA 3K32A 3K05A 4RCVA 1ZW1A 4EHNA 3PJGA 1EDBA 1TMGE 1ZI6A 4N1AA 1ZJJA 2Y1EA 3FUCA 1VSTA 2XECA 3HO6A 1XEAA 3L9XA 1AGNA 2D1SA 5DGDA 3RUEA 4PG4A 4CM9D 2PZAA 3BVPA 4HTAA 4KQ6A 3UCEA 1I3OA 4LV5B 3PW5A 4IJUA 1UT6A 2GASA 4OXYA 2HHAA 2M05A 1GGJA 2POQX 1FQKA 3KELA 4X1IA 5E3HA 3QEJA 5A4MS 1VMDA 5HF9A 4BZXA 2I4OA 1JFRA 2PYZA 3DZDA 2H2DA 1E63A 1ODSA 2FN4A 2O3RA 2IPOA 3LUBA 3VC1A 1SC3A 2BZ1A 3WISA 4UBIA 1ORRA 5LP6C 3MZ0A 1TMKA 1HE8B 1XCOA 1R6TA 3IR7A 3KC2A 1NNEA 3Q1KA 2H4WA 2FWPA 4C6SA 2EZUA 3ZGLA 1FK8A 3EGWA 3N39C 1RACA 1REQB 5JWRA 4WHMA 1SQ0A 1DG9A 1LLUA 3GQBB 4P3KA 3WDKA 2P9YA 3WQQA 4DV1H 1ZRSA 2G8NA 3NAMA 3DXYA 1N6NA 2P1RA 3EF3A 3I4FA 1DXYA 1OA1A 1XDWA 1C7RA 4MGEA 3JQ7A 2ZM6H 1XQVA 3SJ7A 3H2BA 2RHRA 3VPDA 3IP3A 4NQZA 3PNVA 4CMJA 1LDYA 4LGYA 3JQDA 1EZ1A 1U3CA 3IIEA 5FA6A 5DM60 2R7ZG 1GZDA 1MAUA 3PVXA 2Q27A 3S8MA 1LEHA 2O8CB 1NR5A 3O4RA 3E18A 1CY1A 2UUBH 1QF9A 3C8HA 3KPVA 5DTIA 4L27A 4QBTA 1VCIA 3EFEA 3GJ3A 3QK7A 4ARVA 5CYFA 1TW3A 5JZMA 1HSOA 1U7PA 3NDRA 2IXDA 4K87A 3LQQA 2HW8A 2X6QA 4EA7A 2Z5GA 5REQB 4YRCA 4XYBA 4GFDA 4HPWA 3THWA 1RI4A 1X7ZA 2AGPA 1JWBB 2H8KA 3DHNA 1R9TA 1NGSA 1EE9A 2HEIA 3EAQA 3N07A 5F7ZA 2Q7OE 5BNTA 2NZ8A 5LDDC 4IGAA 3LGXA 3GIWA 1BXRA 2O8BB 3DS8A 4NU8X 2JI6A 3RW9A 4FSXA 3X2FA 5B3LA 1RJEA 2XE4A 3Q9NA 4MJ3A 3TNDA 4MPTA 3KCQA 3TJRA 2Y4OA 3SBEA 3DNMA 3FLBA 3MB8A 3Q8MA 2BV3A 4A3DG 1RKUA 2ZRLA 3G6KA 1YZKA 2HVQA 3HYNA 1ZM2A 1UKBA 4G01B 3TLAA 1HL7A 1DGSA 2ZRCA 3F7TA 3TQCA 2PM8A 4TLAA 1JPUA 5C7IO 2BMJA 4G4GA 1R27A 1XMPA 1PWEA 4QOEA 4D9CA 4QRHA 1SB8A 3ZDFA 4NBKA 3H7AA 3V5NA 1GFZA 4W9NA 1CTQA 3D0OA 4MINA 3K4QA 5DX1A 4DL5A 5KYTA 4EX6A 4K0KB 1MJGA 3T52A 5F23A 1FJ2A 4FC6A 2C4HA 2JLRA 2XOXA 5ECGC 1TQHA 3C16C 4V0MA 3A9WA 2QD4A 4ARBA 1BWPA 3I4LA 4ECSA 1KDPA 1G5FA 2JJQA 3KXDA 4HUQB 1K3FA 1E2PA 3F97A 2CBGA 2EF0A 1CUHA 2B69A 4IFEA 4PEVA 4Q7MB 3KSRA 2GBLA 1E1CA 4MWZA 4M99A 4YUXA 1V35A 5EE0A 1K0FA 1X7XA 1IZ0A 3C8DA 1N0VC 3SZGA 521PA 1X7XB 2X4IA 1OLOA 2IUTA 1NDQA 1JR2A 2V5VA 4OCZA 4P5PA 4DVGA 1JHYA 5C4XG 4JXUA 3VU3A 5HGXA 1ZJYA 3KOYA 3PCTA 4YIKA 3AWIA 5AI4A 4X1YA 4CMEC 3CW9A 1NP7A 1GP2A 4MS3B 1NVKA 1T1SA 3IOMA 4TQ9A 2IODA 3GJ8A 5DJ5A 3OM0A 2BJHA 4JQCA 3F5FA 3EMDA 3VSCA 1I3KA 1GFIA 1YNSA 2BKVA 1KYQA 2PEZA 3UB2A 4ARZA 2B61A 1JA0A 3I04M 4PSDA 1L4BA 2NAFA 4B3TB 3I0MA 4EW2A 2VJCA 1RHMA 3FDXA 1A9SA 2I9PA 5B2EA 4RMHA 3OMXA 2IEGA 4PCUA 2CDNA 1PLJA 3K2BA 3QITA 3JQCA 1TW2A 3ZHUA 5I60A 1CRZA 4GVPA 1VE6A 4ZCLA 3RDPA 2FDCA 2Q1YA 1IN4A 3FG9A 3R3WA 2P9EA 2YHSA 3OVMA 4NZMA 2PZLA 4FWBA 1AV6A 2R6FA 1S1CA 4JL5A 5DGCA 5DX8A 5HUJA 1T8RA 1P7PA 1Q1AA 1GZ4A 1GPBA 2DTDA 2EBUA 2EZTA 1LH0A 1WXWA 2FN3A 2I4RA 3OJ0A 4IAOA 4IO0A 4PYKA 5EE1A 3FDZB 3L01A 2FUKA 3DC2A 3A26A 3LQ2A 4HQLA 5JCPA 1ZEMA 2XRMA 5A4DA 1S6YA 3ND8A 1XEFA 1UADA 2C5HA 3DFMA 3GX1A 2XIGA 2P9JA 1CUJA 2F90A 3OT1A 1N7HA 4M60A 1G1MA 1IHOA 4MPRA 2C42A 4HEHA 3ADCA 2AI1A 3M49A 2H4YA 5E6UB 4BZPA 4KXUA 5AKYA 1IZYA 1NXTA 2H59A 2F55A 3D6JA 5GJBA 5BQXA 5F5NA 4IHKA 4FZ5A 1OKKD 3EHDA 1HDXA 1ZK0A 2E6KA 5CJJA 3OIWA 4NBTA 1GXSA 2HO4A 2A86A 3OX3A 3NMUF 2NPFA 2VL7A 1E5DA 1RKXA 4L4YA 3RRYA 4YUAA 1Q83A 2UYGA 2WIAA 4KXVA 4RPLA 1FMFA 4DSTA 3DM9B 5TMEA 2W2LA 3U4QB 4B71A 4EGCB 1BXZA 2ZYSA 2WOOA 3IBGA 3P2EA 2ZM5A 2OK8A 2ZWVA 3ABRB 3U4QA 3MILA 1S68A 1JPJA 2UXCB 3DMNA 3AC0A 4R7RA 1ADYA 3RBVA 2ZKLA 3GYBA 1VXRA 1Q0LA 1VKRA 1YQGA 1F4PA 1PFYA 3M1AA 2C8VA 4BCCA 1KT8A 5LOVA 3AKEA 3MJEA 2WYOA 1YKSA 1KYZA 2JHFA 3RVNA 3UPUA 1T5TA 1EE1A 3U7IA 2VRBA 2X13A 1KC7A 1LK5A 2A0FA 2JFOA 3PQ8A 2YQZA 4G0XA 3K1JA 5JXJA 3ZQUA 4JVSB 2ZTMA 5IJWA 1N33H 3PUJA 2UZAA 3MQFA 3BDAA 3VH1A 3VSEA 3U3MA 3ZHVA 3PGMA 2WHPB 3PIIA 1H8HA 4YXFA 2BFEA 4KOAA 1E60A 1HC7A 2NACA 2NT3A 4YMLA 1K89A 4YMWA 1ZH6A 1XZPA 3X1MA 1N5LA 3O4JA 3SHVA 2GSDA 3TFOA 1E7WA 4LNUB 4EJSA 5KTNA 4ARSA 4REQB 3UTDA 5KVAA 2F1KA 2BFPA 3TS1A 1ZRHA 3F0TA 1HV8A 1C0EA 3DVQX 1J0DA 1Z8HA 1Z6QA 2Y0BA 4Q7KA 1ZKDA 3T12A 4ZHSA 3STYA 4F71A 3SP1A 1C29B 3CISA 4DREA 3KU1A 2Z2XA 3RV4A 4AP5A 2D1RA 3HCBA 3UT5A 5MF6A 1F51E 2V58A 2I55A 1L9KA 1UBOS 2AXEA 2YIMA 5CLLA 4F3YA 4DA4A 4QUHA 4XQCA 4BNXA 1XJ5A 1UPUA 2IBSA 5LZ7A 4RA6B 5FLEX 2PL9A 4HB0A 4UZEA 2OGSA 1YDEA 2G77B 2FZCA 1N32H 2XKBA 3QEKA 4JWKA 4AL4A 2YYZA 2B78A 2WHRA 1OU0A 3CFYA 2FLPA 1NP3A 1ZWLA 1UINA 2FF5A 3P9SA 5F3DA 4RTRA 2NVBA 3NNSA 2VUGA 1ZD1A 4WY2A 1AA9A 2F1RA 2GTIA 1B0UA 2NSYA 2H5IA 3PPXA 1XB2A 2XE7A 1FYVA 4GUDA 5LQRA 1MW8X 3RH0A 4WQMA 3WB1A 1NE2A 1FFEA 2IWHA 5CITA 3LPLA 3KHLA 2G25A 3WGHA 1GNLA 1ZWKA 1XVVA 1ZOOA 2B1GA 4MPJA 1QHNA 1L7RA 5CURA 5CCDA 2FOIA 1PX2A 4KN8A 1DCFA 1NI5A 1X74A 1MG0A 3SDSA 3HXPA 2W6NA 2P1ZA 5B7PA 3SE7A 2H5EA 2IA5A 4TQSA 5E1DA 3W1GA 3EFOB 3ZX5A 2WJIA 3O93A 4YJDA 3MT8A 2O5VA 4LJ5A 2YZ7A 4NENA 2GAFA 4JYCA 3G9XA 4C03A 4O4HB 4DUZH 1OCEA 1RWOA 1QKIA 2B25A 4B4KA 3PO2G 2ILVA 2KWIA 1O0CA 3KSAC 4TOIA 2JLQA 4L5JA 3F96A 1S10A 3HACA 2D06A 3OQOA 4KH1A 4S1TA 2RDJA 1J6UA 1W88B 5TPWA 3SBOA 1V4YA 1UPCA 3DTTA 4HV4A 4XB2A 5A3RA 1PR9A 4BMDA 5EPEA 1PJBA 2DGDA 3UMGA 2WWWA 2XMCA 3O7WA 2ZUBA 3BCSA 4QDOA 4Y9TA 1Z2AA 3OUTA 5KYKA 2R6ZA 2MSEB 3LFTA 4TTVA 1NUQA 1T1IA 3WE7A 4C1NA 9LDBA 5HDBB 5ALRA 3TZBA 4N3CA 4ND1A 1XWWA 3STUA 4IIHA 4QZVA 4E31A 4BX2A 2C04A 4MUKA 1VM6A 2BRUA 2IHNA 1G1AA 2GT1A 2QT9A 3FJ1A 5BXYA 4QHTA 4GBMA 3H2YA 4PSUA 2DHEA 4RV4A 4TS4A 2I99A 3KEFA 5EMMA 4WXRA 2PPLA 1UQRA 2FVXA 2C3PA 2ZAMA 3RVQA 2AG6A 1KKUA 1Z5GA 3NQ41 3T3EA 4HWKA 4Q1FA 3RWBA 4P4SA 2PPVA 1BE6A 2L17A 2GPSA 1IRIA 3HVHA 4ER0A 2VDVE 4NK4A 3KVRA 1YS7A 4R68A 2DY1A 1Y7PA 1PDOA 3NTRA 2PMFA 1YB6A 5D2CA 3HWX1 1EAMA 1TPYA 3AHHA 2QM7A 4TS3A 5E8RA 1UFVA 2A1TR 1QQ6A 4IJWA 4JCOA 3SNOA 5L7WA 4FS8A 5EJGA 2FW6A 1Y98A 1BD3A 2H1CA 2VDQB 4RK6A 3P9IA 3EQ7A 4RBNA 4Y6QA 4DLXA 3FPKA 7ABPA 5K09A 1ZUHA 4FQ7A 3WFZA 3WYFA 3PI6A 3IL2A 1EI9A 1QK5A 1W0JD 4MARA 4AZVA 2VYQA 1ZC3A 2BGJA 2GNAA 1WCMG 2ZRGA 4KQIA 2W9CA 4FYWA 3MBKA 3VC7A 4YRNA 4GBJA 5BQFA 3NEYA 3GZTB 2ZAOA 4G0VA 3TN7A 2D2XA 2C4WA 1V25A 4JR0A 1ISJA 3HCPA 4ZI5A 4H7IA 1XMXA 4XZ3A 2W7OA 3R3XA 3ZQKA 4F91B 2LDBA 4NAHA 1BMDA 3V4OA 1ORHA 1EK6A 1PP4A 2NXCA 3OEHA 1M1YA 1VYUA 4MGIR 1Y5LA 4FX5A 4EHLA 2ZYVX 5A1TA 3S4YA 1I6LA 1X86B 4YLYA 4KO1S 1I3QA 1H0SA 4FLMA 1LSSA 5FT9A 3U7QA 4RZ3A 1JQ3A 4QUEA 3K2EA 2RJOA 4KYUA 4RVCA 2V9CA 3TL3A 3UA4A 1IIBA 1LTHR 5ALXA 5MN6A 3K6SA 3I2GA 5IVHA 2Z98A 2PJUA 4IQGA 5G0SA 5DTRA 5CLQA 5JH7B 1QH8A 4E5VA 2D54A 4KW7A 2L19A 2JVJA 3FDFA 5EHXA 1Y89A 3DV9A 4LQDA 3FROA 1DDGA 2GCIA 3LT0A 4DL4A 3DG9A 1UXIA 2G8LA 2PJDA 3CR8A 3T5MA 3O4GA 4C7KA 1DRVA 5IVKA 4R7GA 4FLEA 1Y1VG 1DKMA 2V7UA 2F1OA 3L0SA 5L7YA 3Q8RB 4JYPA 1Z8FA 1I2AA 3NHZA 2NLOA 2OZVA 4F96A 3GV7B 1PK9A 3KWJA 4ATNA 2UDPA 3W3AH 5J43A 1O0SA 3T35A 3DAOA 2ZIEA 1IZ8A 3PXDA 2BGIA 1E0AA 2ORED 5E0KB 3L1VA 2Q2UA 4PLCA 1E4GT 2YJZA 4E46A 3PENA 4JSRA 2BLLA 5DU2A 2AEMA 5JTTA 4O7SA 1UQTA 3WRVA 3KLPX 4I55A 3HN2A 3B7PA 4ED9A 4F7DA 4QUJA 1AXEA 2FSVA 2NAPA 3AHGA 3CX3A 5AHXA 4JKYA 1VGVA 4PN7A 1TM5E 1IHUA 1OGYA 2E6UX 3BS4A 4J29A 4WVLA 5ES3A 1RAEA 5AVKA 4ZDWA 4CL0A 2B30A 1GGEA 4IIDA 5IJXA 5KFRA 3WAGA 1NN1A 3I01M 3W7VA 2KSWA 4KI0A 3ZDDA 2NUAB 1WMDA 3R0XA 4X00A 3GN2A 3UK2A 3NJRA 4CQLB 4AG3A 4BNFA 2V4RA 2QE7D 5BMVF 3E2IA 3NR2A 5FLMG 1R7RA 4I9GA 3K6JA 1J1ZA 5AVQA 4CKCA 1F6DA 2C0QA 3E3LA 2YOGA 1QP4A 2P30A 1QGUB 4FD2A 1U6KA 3DZBA 3TW8B 2C9DA 3BXPA 4B79A 1COWD 3THOA 4HS4A 5K2MA 2BI8A 2AT1A 3GFQA 3PNOA 1IHXA 3SMQA 5KVSA 3BAFA 3ZTWA 2C3UA 2ADOA 4GGMX 3V55A 3KZNA 1X14A 1WTCA 2O8NA 4GPTA 3KEGA 4JJ4A 1WRBA 4RCYA 1N3BA 1CQXA 5IM5A 1RJDA 1VL8A 1XTZA 3T5LA 2PZMA 4I36A 1Y5NA 2WM9B 3RUDA 2ZKIA 1EXVA 1HE1C 2AMFA 2FETA 3HUUA 4AXBA 4WGFA 2FEMA 1DDOA 4WCFA 4OAPA 3KX2A 2VYND 3T3OA 1LBEA 4MGYR 1QMGA 4WDRA 2CMFA 3O91A 3KQKA 3UM9A 4ITRC 4PO3X 2JEJA 5SICE 1RPNA 2XMZA 2O19A 2ZVDA 4PNEA 1LRKA 1IJEA 1Q0SA 3IAXA 2CLHB 1UP7A 5J58A 3CTPA 5CDUA 2R8KA 5KYGA 1EA5A 2J4DA 1E1QA 1D5WA 2ETVA 2HN9A 4BMXA 3VR5A 3GP5A 7REQA 2ZUUA 3D4OA 5BP7A 3NT5A 2Y0DA 1I33A 3AY6A 1DZIA 3KWMA 1J8DA 1N5OX 1ZHFA 3CB2A 3M8KA 4O4IF 5CX1A 1P4SA 1XE3A 3E35A 1MKYA 3PQ4A 4BUJA 1I3CA 5H16A 1MO4A 4AT1A 2XEXA 621PA 4HAZA 3SS8A 4OUDB 3ZY4A 2JFNA 4G89A 3MS7A 1II0A 1F38A 1ZNZA 5BR8H 1UXKA 2F62A 2GERA 2YWBA 3T1HB 1SBNE 2FFHA 4Q3BA 2R66A 5FR2A 1RS0A 4XGKA 2VA3A 3QWHA 2F8SA 5KC8A 4A15A 3IT1A 2XE6A 2CGEA 4B3SH 5FL3A 1QLWA 3LBAA 2PT5A 4X1KA 2B3DA 4DNFA 4OQFA 4DRXA 4ER5A 5A02A 2GYVA 3B20A 1EE2A 2UVQA 1XNJA 1P74A 4BV9A 2MCTA 1NMQA 3QTTA 4D79A 3B3FA 1G63A 1KQOA 5CHEA 4CE6A 5T8KA 1E2BA 2VK2A 5AI8A 3WK8A 5KHLB 1V8BA 1PS9A 4MUYA 2I2CA 5L3RA 2VUIB 5LZ9A 2QP9X 1GPYA 5MGBA 5EIXA 3WWOA 2E4UA 2MYNA 3OZRA 5KQLA 2MWMA 1SFOA 3K0HA 5KJ6A 1Y8CA 4L2IB 3AF2A 1OKKA 1JV2B 1N2CE 3EDQA 4K86A 1FNBA 3PQEA 4L4RA 1NJFA 4X54A 4BPRA 1J1UA 3SQNA 3TOVA 4OXIA 2ZI3A 1PR5A 3JZMA 3MJDA 4QVKA 3DKKA 3IRUA 5E4FA 4ZAXA 3W2EA 3GRCA 3SSMA 3E7WA 3VKHA 4BTVA 2FR1A 4M1SA 5G1PA 2DY0A 3L77A 1I4OA 2N47A 2XA1A 1O03A 4TT3D 1YO6A 1EWVA 4FHCA 2O1XA 5AI5A 5DM1A 1WCYA 3RAXA 1G2WA 2IW1A 2OLKA 3OQ6A 4RY9A 5EJMA 3AM1A 5D6OA 3LOQA 4NY1A 5U4QA 1N5RA 4ZCTA 1XU7A 3JRXA 3G2JA 1LC0A 3NTLA 4E7OA 2JKVA 1VYTA 1QIKA 3FNFA 1WDKA 3HDHA 2GILA 2AKEA 1EKPA 2H08A 3IMCA 1G16A 4AMBA 2NO6A 2OSBA 2C78A 3AF4A 4J1QA 2A9JA 1ZMRA 1TVKB 4E07A 2Y1FA 3C7KA 3GEPA 4BMCA 4WV3A 2ZJ2A 3D43A 1WDLA 4KIFA 5BOSB 1JMYA 5B6PA 5C5EA 3G5TA 2YV3A 4J1TC 3RRMA 1ETUA 3NOQA 3WWYA 4MV9A 4PQGA 1JYFA 5BNZA 5FH9A 1NFQA 3GEHA 4OL0A 4AWBA 2RH5A 3CLSC 1QGAA 4NE2A 4BNWA 1V5IA 4E08A 1EDDA 5AW3A 1V1MA 4ZI7F 3L8CA 3M4ZA 4CL3A 1G0NA 4R1UA 2FK2A 2HHHB 2V59A 1MX9A 1YZGA 4IIGA 1QUFA 4D9EA 1GEEA 1QG2A 3FHCB 1L8LA 2FHSA 4DOMA 1QGUA 4ZKDA 2QUIA 3THYB 3WB2A 1A9XB 4B4OA 2GEVA 2HGXA 3DMTC 3L8MA 1DAFA 4QNRA 4DLZA 5C18A 2HYIC 1TCCA 3LHFA 4DS3A 2QG6A 1S01A 3D9QX 4M0LA 1EFVB 5K20A 4GVLA 3ZZTA 2P8SA 3GUZA 2REOA 2FPKA 8ADHA 4JL8A 2ZQYA 1T94A 4JITA 2UZ3A 2X1LA 4KR3A 2JA6G 2FI1A 4QUGA 4KSYA 1CZRA 2XBLA 2K7ZA 4ECVA 4K9PA 4GXTA 3LXMA 1E6EA 3KSDO 4JUFA 1SHZA 2Q1UA 3T4PA 4HQFA 3S8YA 1OBFO 3RVKA 4P3PA 1JWLA 4QVIA 1JR3E 1Z34A 3BB4A 2OAEA 4JK3A 1Y3BE 1RJGA 1TOAA 3GAMA 1SKUA 2HJRA 1FRZA 3TEKA 2EIXA 2PZGA 2VUHB 2VQ3A 5K3SA 1KWGA 2VR1A 4EL5A