3KALA

Structure of homoglutathione synthetase from glycine max in closed conformation with homoglutathione, adp, a sulfate ion, and three magnesium ions bound
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
475
structure length
470
Chain Sequence
APPLFDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLSRTKNADEFTSRLLDIHSKMLQINKKEDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQREGGGNNIYGDELRETLLKLQEDAAYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISSSYEGGVLPGFGVVDTVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homoglutathione synthetase
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
molecule tags Ligase
total genus 160
structure length 470
sequence length 475
chains with identical sequence B
ec nomenclature ec 6.3.2.23: Homoglutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kalA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kalA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kalA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kalA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kalA04
2I87A 2ZDQA 3R23A 1EYZA 4YJ2F 4YAKB 1VBGA 1KBLA 3JRWA 2NU9B 2P0AA 4FFRA 3R9RA 4HNVA 3HO8A 1VBHA 4O7RA 5C1OA 2YZNA 5CB4F 1GGOA 2QK4A 5BPFA 5LA6F 4O7SA 2NU8B 3OUUA 1A48A 1GSHA 4MV6A 4MV8A 2GPWA 1A9XA 4EG0A 3UFXB 4Y8VB 2J9GA 3BG5A 4YAJB 4TUYF 2WYOA 4XYMB 2W6MA 4ME6A 4O2AF 1JKJB 2I80A 1W96A 2V59A 2CZGA 5GONF 5JH7F 4O82A 2FPIB 5JVLA 4HQ6A 2GQRA 3K5HA 4DLKA 1SCUB 4EGQA 1KJIA 3KAKA 2R7LA 4C5AA 3TW6A 5HV6A 2XD4A 1BNCA 5DMXA 2YRXA 4I50F 2NU7B 3SE7A 3VMMA 4IHJF 3WO1A 1CQJB 4O86A 3VA7A 3AX6A 1JDEA 2V5AA 2R82A 2W6QA 2I8CA 2VQDA 3VOTA 4MV4A 3OUZA 1KJ9A 1EUDB 2IP4A 4I55F 1AUXA 3KREA 3LP8A 2OLSA 4MV9A 1KJ8A 4YB8B 2FPGB 3R5XA 3TQTA 3R5HA 3K5IA 4MV3A 3ORRA 2C00A 2W70A 4QSHA 1Z2OX 4O7ZA 4WBNF 2YS7A 1C30A 5J2TF 3U55A 3VPCA 1IOVA 4FFNA 3QFFA 5C8YF 1KUTA 2R7MA 1E4EB 5J2UF 4IIJF 2GPSA 2Z04A 5FNVF 2YYAA 1I7NA 2R7NA 2YS6A 4YJ3F 3U9SA 1GSAA 2DZDA 3U9TA 1JDBB 5LOVF 4C5CA 5BPHA 3ETHA 4C5BA 4FE2A 1ULZA 1Z2PX 2VPQA 5C1PA 3U54A 3LWBA 1M6VA 2YZLA 4EGJA 1C3OA 5IYZF 2GLTA 2ZDGA 4IZOA 3ETJA 4ZHQF 2R85A 1DIKA 2CNVA 2W71A 3Q1KA 2PBZA 3AW8A 3HBLA 3HB9A 4MAMA 4O4JF 2W6OA 1CS0A 2FPPB 3G8DA 5JQWA 1I7LA 4DIMA 2YWVA 4ZI7F 5LYJF 1EZ1A 4FFPA 3RV4A 3RV3A 1E4EA 1PX2A 5EZYF 4M9UA 2W6NA 3MJFA 3MWDA 3V4ZA 1JLLB 2YW2A 2V58A 4ZOLF 2VR1A 3R5FA 3MWEA 1PK8A 3Q2OA 1AUVA 4O7TA 4O2BF 5KKNB 3GIDA 4TV8F 4ZQIA 1B6SA 1DV2A 2DIKA 2YL2A 2YZGA 5BMVF 5LXTF 1T36A 4E4TA 2HGSA 3I12A 1CQIB 3KAJA 2YRWA 3NUAA 3TIIA 5HBRB 4MA0A 3JZFA 2R7KA 4O7YA 4XX0B 2NUAB 1VKZA 2W6PA 4FFMA 1GSOA 3G8CA 4HNUA 3GLKA 1M0TA 2DLNA 5KX5F 1BXRA 4FFLA 4MV1A 3RFCA 2DWCA 2R84A 3TINA 5CAEB 5D8DA 1EUCB 2SCUB 3DF7A 4HNTA 4O4LF 4HR7A 2CNQA 2HJWA 1OBDA 3KALA 2NU6B 1M0WA 3N6RA 2FB9A 3V4SA 4FFOA 3E5NA 1KJQA 5JQGF 2FP4B 2W6ZA 1KEEA 2R86A 1KJJA 1WR2A 4FU0A 4FGRA 4RZQA 5LP6F 4TV9F 3N8DA 1DV1A 1Z2NX 3WO0A 4XYLB 4O7NA 1OBGA 3RUPA 3VPBA 2GQSA 2YZMA 4XZ3B 5JVDF 4O84A 5CA1F 4I4TF 2ZDHA 2CNUA 4L1KA 1IOWA 1EHIA 4O4IF 5H80A 1W93A 3JZIA 3WNZA 4O4HF 4NYEA 2Z02A 4O7VA 2PN1A 3TIGA 3K3PA 2PVPA 4MV7A 3JRXA 4YBZB 1CE8A 2R87A 2X0SA 2XCLA 3ORQA 4O81A 5CA0F 4MA5A 2QF7A 1B6RA 4O7WA 4O7LA 1KC7A 4O83A 1GLVA
chains in the Genus database with same CATH superfamily
3KSUA 1XCJA 5KPDA 2J46A 1XMOB 4XE5A 4DPMA 3KBBA 1R12A 5K2MA 4JX9A 3HJUA 1A7AA 3PYLA 3H9BA 2ZB7A 3ZXSA 3DUWA 2ODQA 4J9LA 2ILTA 2IEAA 3OUUA 4D8YA 2AQKA 2BCJQ 2SHKA 4IFIA 3QHAA 5GQSA 2ZAIA 1G20E 1HE4A 1WQ3A 3VR3D 3JQAD 1XD9A 1M6HA 4TMVA 4DA0A 3PEUA 4UXHA 3C45A 4EHHA 1A98A 1N1EA 1YJ5A 1XF1A 2HJ9A 1DKRA 4OQEA 2O14A 4HC4A 8ADHA 5DHTA 2WG1A 2FWBA 2IEZA 3GEGA 2PZJA 1FRNA 3P7MA 4N54A 1MMFB 2LVBA 3ZS8A 1M54A 1P0QA 3CVZA 1HLPA 2NXWA 2GKOA 5LD2C 5DWQA 4D97A 4KXVA 5KAMA 1JX6A 5E2IA 1P74A 2E5WA 3ZWWA 2RH8A 3TQ1A 4KDCA 4XASA 4XM2A 4Z7OB 2J45A 3B60A 5K3FA 2P3QA 1ZH4A 2FN9A 1G64A 1Y5IA 4HLUC 1IG3A 4TLMB 2CVZA 1MOQA 2X1LA 4YDSA 3T5PA 1XQ9A 2F1RA 4JJZA 1U0OC 2YDXA 4X3OA 1KYWA 1FLAA 2IPOA 4I1RA 4GLJA 3IVAA 4GZ3A 3JAWB 1M1NA 1R5OA 5JNVA 5GGYA 1KKUA 3HB4X 1ENOA 1MIHA 1JTEA 3U9SA 3S7ZA 3RHTA 3COSA 4LMRA 4V0QA 4UVIA 1QFJA 4GMGA 5GM2A 3L0OA 1CU1A 1QG0A 2I4LA 3E18A 5T64A 1FPMA 3BRWD 4ESEA 2IA5A 3KT3A 3M9MB 3KU4A 1UODA 5B12A 9ABPA 3NOOA 1OOEA 4B3HA 2BM1A 3TECE 3OT1A 1IN5A 2ZDGA 3DE2X 1D0VA 3EF0A 4TXNA 4ALKA 3R3XA 4C9BA 3T5JA 4AG3A 3ESBA 1N33B 2NU9A 2ONKA 2QP3A 1LH0A 1J39A 1PSWA 4LTDA 2J6HA 4MUEA 4G0OA 4YP1A 2GRUA 2QPTA 1SHTX 3X2EA 4ETMA 3ZZ0A 3NBFA 4Q7EA 5GZ1A 5EZYF 4HLDA 2QG4A 2NUPA 3DXYA 4INZA 4DLUA 2O5CA 4FYHA 1QZZA 3ANNA 2OORA 3RWBA 4EW3A 3PQ4A 4LSAA 3KXPA 5H81A 4DDVA 3GEBA 4EY7A 4IXTA 2X4LA 3H7IA 4DRYA 3OJEA 4X63A 2E21A 2VA9A 1VPVA 3KXKA 1DRUA 5AJUA 4M36A 3PL1A 1RYMA 3I5UA 1OU0A 4ZT4A 4OGFA 2DLNA 1TMGE 3SFVA 4C7OB 3HRIA 2Q7XA 2IYAA 5EUQB 1EFPA 2JFYA 5JCZA 2ZIXB 4JKOA 5ICEA 1Y5RA 3DLIA 1ZN8A 1U28A 4OHVA 1CZLA 4ENUA 4XDHA 4QDXA 4FCCA 3TW0A 1O89A 3G2KA 2VJMB 1U7ZA 3UQ8A 4MTEA 1W0JA 3D7MA 3EQ7A 1UWKA 1A4IA 3UJPA 3HJRA 1TADA 1M83A 2CLMB 3PSHA 5B58C 3GFVA 4UKDA 1N77A 4A3FG 4O4HB 4JV5B 2HIHA 1KNXA 1Q0RA 2PCJA 2HUPA 4IRKA 2XECA 1C1XB 3E22B 3N2LA 3LM8A 3PJEA 4CM9D 1O94D 3JW8A 1ODIA 4ARCA 4O7WA 2X9QA 5J63A 4TS9A 5DAAA 4OYYA 4JVMA 1E9DA 1GFSA 4KIGA 3MFYA 1EM8B 3TAUA 3CUWA 5FCDA 1U7OA 1M8GA 2D0IA 4JYAH 2XY4A 2RH5A 2OC4A 3JZDA 4AECA 1E63A 3H13A 2ZAGA 3WL7A 3C5VA 5F4ZA 4LRWA 1GNLA 2D1SA 3P4XA 3EG9A 1QTNA 3L8GA 3E84A 1IYEA 2GZ3A 3OO1A 3WHIA 4MEJA 1JMKC 3I8OA 1D9XA 3BJMA 4EGCB 1N2CE 1I5EA 4ZOLA 2PD3A 2A5YB 4O3PA 1GEEA 2IYFA 3H5IA 4MVJE 4QWWA 4FKMA 3HJGA 4H1WA 3FNFA 4OQXA 3CCFA 4CMEC 1XLWA 1JT2A 4MYSA 1YE3A 3B70A 4BHTA 3IXMA 3S5UA 4J9PA 1ZHFA 4JSYA 3VMMA 1N75A 2YUIA 4NZYA 2ERXA 4IY1A 2ZJTA 3E53A 1Y0BA 4GLWA 1JKFA 4QT4A 3H0GG 3DFIA 5A6SA 2LKCA 1YCHA 4QHTA 3WSTA 2OLSA 4GOOD 2PV7A 1MOPA 3H4DA 3U40A 4JP8A 1V3VA 2GARA 3WTBA 1H0HA 5C4IA 4LOAA 4QTUB 4YMSA 4UC0A 2I8AA 4DJJA 5EJIA 3L6DA 4J43A 5F76A 1WSCA 1IRXA 1VYHA 3GUYA 4ONEA 3FPKA 1RR6A 4GLBA 2X15A 5J2UF 3UMBA 3CRZA 3HUUA 4IKPA 3ERCA 2QHXA 4CDRA 1F7UA 4Q12A 3WWCA 4LJ8A 3U4MA 1JPUA 3QVGA 3EAFA 3U4CA 4Z3OA 1KTVA 5FUXA 4BUCA 4DNOA 4CT4B 3OF3A 2W7TA 3BH0A 3CXUA 3NWPA 4AZ3A 4U7PB 3OE7D 2HA4A 3HGMA 1YTUA 2INGX 5KCMA 1O54A 3MS4A 4W1QA 4RMNA 4J9NA 4G5HA 2XUGA 4JUCA 4DJDC 1X1EA 3MJ4A 4O08A 3PFIA 4A0FA 2CL5A 3F9IA 5EPEA 3GFOA 1L7DA 2FPXA 5DTIA 5KFLA 1UANA 1T4DA 3L9XA 1UC9A 4DF3A 721PA 3ZYCA 1YZYA 2E82A 3SF8A 3DMFA 5GM1A 1UXJA 4V0SA 1RJWA 4FE4A 1OY1A 1H4VB 4OAOA 3ZXUB 2X13A 5C3UA 3LUGA 5EZYB 3J80A 1LNSA 4RHXA 2NADA 4BIMA 3IN5A 4OEHA 2J5BA 4YAWA 5EWLB 1JHUA 1SK8A 4QWCA 4C20A 4JLAA 5GONA 3H11B 3V7UA 2ZRGA 3SYNA 3O92A 2HAEA 2WFZA 5AOAA 2WA1A 3NHAA 4LJ7A 1GCGA 3FDFA 1JDBC 2VNJA 3EXFB 1MQSA 1MGPA 4K9LA 5DHAA 2V4RA 2OENG 3VR2D 2ZSJA 2FFJA 3IP9A 1QB8A 2IUEA 4RMIA 1KQOA 1N5KA 1Q21A 5BR7A 1OX5A 1MTZA 2YV1A 1X7GA 3BXZA 2UXCH 2AHOA 4G1BA 5AKZA 2CB9A 1O9HA 4DYVA 4JAVC 3DZ8A 2DH5A 5C7YA 3QNWA 1M1UA 3BMCA 4HZIA 2OK7A 3VHQA 2AZ4A 3LBNA 4RORA 3AILA 3ZD6A 4ZJPA 1U8ZA 3UHJA 3ZHTA 1FJGH 2BR5A 4GZ6A 2OWEA 2XF8A 1T1RA 3EPLA 1RVV1 4CHIA 3ANXA 1RQNA 4TLDA 4PAWA 1WCMA 1UINA 4B0OA 5L4NA 3DTGA 1O87A 3DBRB 4W5OA 2O8BA 3JQ9C 1JJAA 2GZDA 3NYIA 4WCDA 1MO3A 5EIFA 2FZWA 5EIEA 3T61A 2HIMA 4DCMA 3GJSA 2GPAA 2NACA 4HY3A 3PRYA 3KDSE 4QDUA 3DAGA 2C0CA 3A6ZA 3D6NB 3W9YA 3WYFA 4LNUB 3W90A 1ZGBA 3P8ZA 2HUNA 1G16A 3SEZA 2CHFA 4XM0A 4XQEA 3JTMA 1V3TA 1OHHA 4LF9H 5FTNA 5EJ8A 1PYOA 3CEMA 5LA6F 4DR5B 4JWTA 1OI7A 5E95A 3JYPA 3VR6H 1ZSVA 4YCBA 1ZD8A 5BV7A 4Z7JA 2YKGA 2AA3A 1J5EH 4RAQA 1WUJS 5IKMA 2ZXEA 3ZW9A 4ISCA 3DMDA 1NVVQ 2A7QA 2XXBA 3BKXA 4P4SA 1XXLA 2JDID 3ONFA 5HUJA 1JH8A 1XVUA 4ILEA 3Q9SA 5JW6A 4DMFA 1RJPA 1SEVA 1JIJA 1H93A 2MJLA 3KJGA 3PO3G 1XZPA 3A6FA 4Z3KA 2LTAA 4W5WA 1LDYA 2H1SA 3UBTA 3N70A 4BVKA 1P7CA 3HLYA 3AP1A 4TN1A 3EWAA 3FR8A 1VDMA 1PDWA 3Q6IA 3WRWA 1CRLA 2IYPA 4IICA 1XB2A 1Z0KA 2QQEA 1FXWF 1TIPA 5C51B 1R0CA 4OATA 3ZJ5A 2R8RA 1VIAA 2ZYWX 2CDRA 3ETDA 4W8OA 4YJHB 1RFGE 2JIZA 1CF9A 2UZ3A 1E7YA 3PWSA 3BF8A 1GR1A 2BFEA 3QJGA 3HN7A 4P3PA 4BECA 3FKQA 1TW2A 2I3GA 4EYGA 4E5MA 1JFLA 4YP0A 1YUNA 1RNLA 2XTAA 5FLEX 1ZGJA 2IKSA 1BS2A 3W4IA 3ZCRA 3LRTA 4BC1A 3Q6MA 1R4ZA 1ZYUA 3NRBA 5AXBA 3FTFA 4BZWA 4M8LA 5JEEA 2P41A 1OFIA 4EYOA 2D62A 3K9LA 3SQMA 3TQIA 5JALA 1F51E 5K2OA 1H0RA 2N42A 2VDRB 1M33A 3OBIA 3NH6A 2XWBF 1G2IA 5A1TA 4ZQFA 3VU3A 3AB3A 2XZLA 2JLRA 1FYFA 4F4CA 2JEOA 4IOJA 3JAWA 2D0OB 4QGGA 3NM5A 4EZIA 2VT7A 4GX2A 4C08A 5ADVA 1TAHA 1RPAA 2IBTA 3I61A 3SGLA 2E4UA 1DKOA 4Y9SA 4Y9UA 1Q91A 2X9GA 3MCTA 3FB4A 1T0IA 3CUUA 2JFZA 1MPXA 5IZCA 5CVTA 4M7EA 3NALA 4HV4A 3FYUB 4LC0A 3WAKA 1JDUA 1JMYA 1YI8A 4LSZA 1PG0A 1WHTB 3I1JA 4LJLA 3QXSA 3L4KA 1A5AB 2QMQA 4G4GA 4DEVA 2ZFUA 3BXFA 2CSUA 1O08A 2I7DA 1SIBE 1B16A 3IV7A 1L4FA 1M8PA 1L4HA 1LSOA 1E3MA 1RKQA 1JAYA 2BM0A 3C6MA 3RT9A 5KT4A 2FB9A 2HSJA 3ORSA 1DJOA 3PITA 3AFNA 3DOEA 4MVJI 4QICA 1C8BA 5EIXA 3C5HA 1OFVA 3WO0A 1HDOA 4OXXA 2ZWIA 5JBQA 3VJRA 3PC7A 2RD2A 1VCIA 3KCQA 4LJYA 3SJ7A 2RBKA 5IPFA 2MR5A 2NSJA 4PNPA 5DCWA 1ZL2A 2Y1DA 3V4OA 1ZFNA 3V1YA 2QJRA 5HKKD 1ZM3A 4BQSA 3KT6A 1ZRSA 3GRCA 1SOWA 4EI9A 2VH2A 3F4KA 3GU3A 4GLXA 3QWBA 3EISA 2DY0A 3KO8A 4G23A 1CBUA 1ZIYA 2GNAA 4C7OA 3P2KA 5F7XA 4KLNA 4HMQA 3C0KA 3ZDZB 1GNPA 1GPLA 2ZIXA 3ESYA 5TF0A 4Z4CA 4GSYA 5TS2A 2JJMA 3ED5A 4Q7KA 1IN7A 3G7UA 2VZEA 1TNDA 2F1HA 5FAXA 2WKRA 3AO0B 2VNAA 1N3LA 4WGGA 2C5FA 1TWFA 1XUOA 4U9IS 4L8LA 1ZBDA 5MFPA 4LYDA 5FPHA 3BG5A 4TUYF 3WAJA 4ZXFA 4H4EA 2IF2A 4N5IX 2IYYA 4QPZA 2G5GX 5FADA 2H0QA 4I9GA 2EJCA 4P1ZA 3VZSA 2V59A 5EIOA 5REQB 3AFIA 3GHHA 1RBYA 3IQWA 1C1XA 2RHMA 5CIYA 1V26A 2FLWA 3KYDB 1DC6A 1Y7IA 4OYHA 3FWHA 1UKZA 4J3NA 5AVTA 1E0SA 1GCIA 4C4OA 3N7AA 4FFBB 1N32H 3DD1A 3D4PA 3K96A 4B7XA 2CL0X 5ARDA 3K30A 3B12A 3FHCB 1V35A 4BY1G 3PDIB 1H2XA 5ALJA 2ZIAA 3E9NA 2N1BA 1H0KA 4ZODA 2YIDA 2NN3C 2Z2XA 5IK2A 3AR9A 5EG5A 1GFIA 1TMKA 3R7SA 1OH8A 1NFQA 4B87A 5FPQA 2VPIA 3EAQA 4FT4A 5HYVA 2ID4A 3JYLA 3QNUA 3K6JA 1L7MA 3GUUA 1KGDA 3RBEA 5HIKA 4F6RB 1NSYA 2J48A 3SSMA 1IVNA 1IULA 1CR1A 2EW1A 2PRYA 5ALMA 3TBKA 1SWVA 5KTPA 2BGWA 3SG0A 4F8YA 2XUIA 4G24A 2UVUA 1H9BA 3GRVA 1PS9A 2DPHA 3DE1X 1U31A 1MA0A 3UT0A 3ZDBA 1JR3A 4OGWA 4UOZA 1G9TA 5KYTA 5L7TA 3O26A 3A1EA 3BQ9A 3NTVA 1IE3A 2CFCA 1TWCA 5HUHA 1RI4A 4CC5A 2VF2A 4FMDB 1EFDN 4RZIA 2IU3A 2ZJ0A 2BE9A 4IGFA 4LF7B 2J0SA 4OOEA 1B6GA 4JUBA 3OM1A 3TPCA 1JPJA 4GI5A 2SKEA 1YNOA 3TRKA 4JEIA 1NN3A 1PT5A 3OKAA 3IKTA 1FXUA 1TF7A 2I4MA 3KKPA 2TYSB 3O7WA 4H60A 3LPCA 4OMCA 1C4WA 5ADWA 4G5OA 3LNCA 1CQWA 2F8SA 2N9UA 1R88A 5TMBA 1PDOA 1QS0A 3WJAA 1E2JA 3KSMA 4KKVA 4I6JA 3IP5A 1K66A 5EKUA 4R8MA 4X7BA 1NBMA 2VSQA 5FA5A 4Z4HA 4JC4A 1SVOA 4PLVA 3ICPA 1ZN2A 3HKEB 4HAUA 4N3BA 3H2GA 5C5DA 3BSWA 4DR4B 1C14A 5DCYA 2Y0DA 1O2DA 3HADA 2I4OA 4ZO9A 5EQFA 3NEPX 5EQTA 4Q24A 1JLRA 5EWLA 1PHPA 2ZBGA 4ON9A 3PLNA 1QYDA 1D5WA 4JI5H 4TWZA 3JQ7A 3PCXA 4ED3A 1AHHA 1RLMA 2VUMG 2FR8A 1DVRA 1Y80A 3FMFA 2P9BA 1QYXA 2ABJA 5ICMA 3W3AH 4DSZA 3BIOA 5L3ZA 3Q7RA 2ZSAA 3CG0A 4MRVA 2HJHA 1K5PA 1Z28A 2FMFA 3EXFA 4GI1A 3WIDA 4B76A 5AYVA 3EOBI 5JI3E 1OLOA 3DZJA 2DF8A 3HBAA 1Y8QB 1T9ZA 1KVTA 1SKAA 5HKOA 2GCPA 4L9SA 3L0PA 4KEAA 3NNSA 1TKCA 3V6MA 5SY9A 2E5LB 2OVBA 2W2PA 4LJAA 1TUGA 1NBIA 1FFWA 5JJLA 2V6FA 3VM6A 3ZUPA 5KNLA 2Q2TA 2XV1A 1NMZA 3DEIA 2ZTHA 3F5MA 1MJFA 1XQYA 3EB9A 5JRZA 1HL3A 1ISPA 3HCBA 1CY7A 3F6RA 2YJNA 5AFSA 1ODSA 3QE0A 1THZA 2B7CA 4D0NA 1J24A 1F9EA 2ET6A 2UZ0A 2O5EA 5IDWA 4RS4A 4IRXA 3N59A 2JBWA 1I3KA 5BR8H 3FUTA 4PONA 3DTVB 4QOEA 4PZPA 3AF4A 2QGFA 3LQ1A 1EQ2A 3UC5A 3NC4A 1ULHA 4NPCA 3H3JA 4YT5A 4LNUA 1ZDMA 4UUOA 3B6ZA 3SVZA 2B1JA 3NEYA 2VA3A 3VPSA 2CBZA 3KU1A 1ZNWA 4M1KA 1HYBA 3VZCA 4MUBA 4JXKA 4IVPA 2G1PA 2AI3A 2QVYX 4GPEA 4XRRA 1VG1A 3UQZA 2JH9A 4EW6A 3UJBA 5JISA 2A9JA 3ILYA 4W5TA 3ZZNA 3ICOA 4BWFB 3DHNA 4ENWA 1U6KA 2AJLI 2HRZA 4NOJA 1OYVA 1ZJZA 5F1OA 3HWWA 1I4WA 3MQFA 2O9JA 1P5FA 1GNSA 2XKJE 1QIGA 1Q0SA 2PUAA 2CHGA 1GYPA 1O6ZA 4ECXA 4DR3H 3I53A 3RVRA 4UHBA 3OM8A 1J97A 2C82A 3LCRA 1JQAA 1QHYA 1IY1A 4QELA 1JTFA 1RC0A 4EI7A 4F4YA 3LBAA 1L5MA 5JDCC 1YAHA 4TKVA 1J8MF 1RQ2A 2OY0A 4B3TB 4B4VA 4A6XA 4DIMA 3H3FA 3IUSA 4C0JA 4J1SA 4XJTA 4F3RA 3V6HA 1PZMA 2JFFA 1R2QA 1JFTA 2WK1A 4ZOLF 4IMJB 4RJTA 4R31A 5AJWA 1E2LA 4RYDA 2ZB2A 3WB0A 1WHSA 4RPLA 3DO5A 4S35A 2ZU0C 1AQYA 5F7ZA 4RANA 1J1IA 5KQRA 3G2HA 4BPBA 2QAGA 3UJ7A 4Z4FA 2W6ID 2OM2A 2JLCA 4B9AA 2AG8A 1XTSA 2BSQA 2OV2A 3ZKAA 1P77A 4LF8B 1EFRD 4QPCA 1DEXA 2FZKA 4WAUA 4TLCA 4E7PA 4EL0A 5A2QA 1PFUA 5LJLA 2OXIA 1ILWA 4EJFA 3TG8A 1U7PA 1E3SA 3CGGA 3AUXA 3A7EA 2EX0A 1WP9A 1A3CA 1HMYA 3G2LA 3VX4A 3P9NA 4YA6A 1ODFA 1M1NB 3KHHA 4KXWA 2R5WA 4PX5A 1VMDA 1ELOA 3IUBA 4CF7A 1P1IA 1W93A 3FYUA 4FCVA 4FS1A 1ZK1A 5I01A 1WHTA 1NBOA 3ZIAD 2M2IA 2KI5A 3IDZA 1P2UA 1NFRA 3ETCA 4G1FA 2VK2A 1ATIA 4ZAVA 2XYVA 1QG2A 1R00A 2D1RA 3SVLA 1P4SA 3DQQA 1MB9A 2OB1A 2FZEA 2NU9B 3ZDQA 3MD0A 1Z4OA 3E7WA 1JDNA 3HZZA 2UXDB 5FR1A 3GD7A 1GD1O 1E77A 1GPAA 2DFTA 2XDYA 1PT6A 4EGAA 4B3MH 3I2HA 4Z8XA 1UJNA 1DCMA 4YWHA 4IJKA 1BS9A 2FPPA 2NUPB 4D9MA 3WZLA 2Z5LA 3Q9NA 1QGAA 5LB2A 2W6MA 1GU0A 4D4IA 1AS3A 3KJZA 3RK4A 1L5FA 3ADPA 2HK7A 3ZE7A 3WS7A 1XCMA 1RZUA 4A3IG 5GONF 1H42A 1EBUA 1T91A 3VR5H 4Z0PA 2X6QA 5EIAA 1XNJA 1I5RA 5JVDB 5KU7A 2NVWA 2B4AA 2VXCA 3HUEA 4DCCA 3ROEA 2P8SA 1OXBB 2Q0HA 4KK4A 3K92A 4AXBA 1G4UR 3T9EA 2MOKA 3F0TA 3H4TA 4OXNA 2D74A 5EL0A 5FB3A 3U4IA 3Q7IA 2EC5A 1PGNA 2AN9A 2P9CA 1XU9A 5A4AA 5CNIA 2H5EA 4Y6RA 3VSDA 1Z5VA 3ROGA 3FHOA 1G7RA 1FU8A 1SZJG 3LY5A 3C6KA 4KX5A 1QO9A 1Z0JA 4I08A 3N07A 5REQA 2QMUA 5D00A 3UT5A 1TA9A 1E3JA 5BOSB 1DIBA 3KYDA 4DJTA 1XZMA 3RASA 4OA8A 1OI3A 4N7RA 2C84A 1VSVA 1CSEE 3C48A 1R6VA 1SOUA 3BA9A 1NV9A 5ARCA 2DJ5A 2XSZA 4PFSA 4Y2TA 2ZITA 2KB0A 4IRDA 1QYCA 4JI0B 1RP1A 4KFTA 4O8ZA 3EEBA 2DLDA 1AX9A 1UWCA 3W5SA 2B8TA 2OCPA 3H2BA 2GZHA 5EJMA 3EVNA 5K0NA 4G4JA 2PZEA 4E2FA 2ST1A 2ZAYA 2WAYA 5CFNA 3ANLA 4KIUA 1ZXLA 2KWIA 1J0DA 5KFHA 2VHTA 3ZWMA 2VXOA 4W9MC 3EG9B 5FKJA 4QUHA 4H6XA 3TVDA 4HDSB 1TOAA 5KG5A 2WP8J 5H3HA 2WIKA 3Q5EA 5L3SA 2J85A 3T3PB 1I6UA 1S0UA 4MMYB 3TTVA 4JP1A 4ER7A 4KMSA 5EOYA 1CB7A 3HK2A 2FRXA 2FWAA 4PAMA 4LOIA 4H0FA 1FVHA 3PXUA 3ZU3A 3PT5A 1I3CA 3AVQA 3H9UA 5D51S 6GPBA 4C03A 1NQVA 1VJCA 2D2XA 8AT1A 3A8TA 2Y1KA 2RK6A 4MYDA 4FMPA 3PC8C 2IU6A 4B5LA 1U7HA 1LF5A 3WP0A 1NQAO 3GJ6A 2A92A 2PVSA 2OGZA 1XJCA 1BDHA 3HYCA 3OKPA 2BSXA 4HN4B 1UMBA 4YS6A 1EUCB 1NVTA 4JXJA 1LX6A 3BEDA 4QQ8A 1PL0A 2WPNA 3T3DA 4UHEA 4R98A 5E7QA 4J90A 3LY7A 1E6UA 1XFAA 2BHNA 4P31A 4RTJA 4G5YA 1GU7A 2MHCA 1SIUA 2J08A 3ENZA 1T1EA 4U2FA 2XAAA 2FMHA 1H23A 4AZ3B 1IUOA 3OOJA 3NPMA 4O25A 4RKQA 2OYSA 2CCJA 3LECA 4K86A 4GOKA 1IIRA 1ZGHA 1UPUA 3PJDA 1NJ6A 1OAAA 2JI6A 4QVIA 1NXOA 1IPHA 4TYMA 1VMIA 2O8NA 2Z2ZA 4H4CA 1U11A 5T4BA 5LQMA 2Q6OA 5BN1A 2DUWA 4KP7A 1HRKA 5TARA 2O8DA 4BMZA 3CEAA 2FMUA 1GGOA 1R8SA 3KJQA 4QYTA 4QJIA 5KTYA 4K6CA 1BH6A 1YVUA 1FNNA 3TSZA 2WYOA 4TRJA 4YRGA 3ZJUA 3NJRA 3LFTA 3PDCA 2QMOA 5GONB 5HK8A 3RUIA 4ZJYA 4XWTA 1TU4A 2FCRA 2ZIGA 4CM5A 4CLEA 2DBQA 4K03A 4ZK2A 2J32A 1WE2A 5DW3A 1Y8QA 4O3MA 3TW6A 1UKVY 2ZJ8A 5DYWA 4ZC8A 1MXHA 3BMOA 1VQ1A 1J8YF 1O95C 4CM8A 4AKIA 3U48A 1BFDA 1GWNA 2ATXA 2ZVPX 4JVOA 3L1UA 1BE6A 1KI3A 4FXOA 1M34E 1Z35A 3FWYA 5T3YA 4A3CG 5B36A 4OYRA 4DUPA 5JCPA 3PW7A 1OASA 5ALQA 3TPZA 3CVVA 1X74A 2H7XA 2CXRA 1PFWA 1CUZA 1T8SA 2HT6A 5HS6A 4Q7QA 2VS1A 2BP7B 3IURA 2JARA 3LH5A 2H57A 4CEHA 3CLSD 1Z56C 4Q4HA 3NMUF 3L9WA 4CKEB 3MWLA 3R74A 3DTVA 5ALXA 4D96A 1ZJ4A 1AG9A 3CZ4A 3FG9A 4H6WA 5HPYB 3R40A 3KM0A 4BO0A 5LDGA 1O5OA 3M4XA 4H1VA 4MHTA 4C5BA 1QIEA 3V1MA 2GXQA 1KO7A 5AUPB 2G5TA 4WVFA 1YB2A 2ZSUA 4UM9D 2AMVA 3U54A 3D8HA 4IS3A 1Z68A 3BWCA 4JK3A 4Q05A 5KYUA 3C5WP 1TWAA 1M6WA 2A9FA 4HFNA 4XIYA 1FLDA 2VPYA 1CEYA 1PCXA 3RT7A 2ZS9A 2W6JA 4NFSA 1EM6A 5CE8A 4GPAA 1XDNA 4X8OA 1P6QA 5JJKA 2WJJA 4R01A 1LXCA 2HC9A 3COVA 2C8JA 2CK3D 3AF1A 1KZ1A 4C4SA 1ZVJA 4O7TA 4PE5B 1KIFA 2UXBH 2RMKA 2RI6A 3BVPA 1CY0A 1LC3A 2P35A 2QW1A 3B5IA 3DM5A 1KDVA 1K92A 1TEVA 4DDHA 4UARA 2AW5A 2OP1A 1OTYA 3QEOA 1T5HX 2WMNB 3D9QX 4WNAA 3MNFA 1X70A 2OK8A 4JT8A 2W2OA 1NVKA 1XWFA 1DC5A 2CNWD 3GCDA 5KT5A 3MWGA 1KF0A 4RTOA 2CNQA 1N2SA 3KYBA 3LVQE 3VTFA 3N6RA 1PJSA 4L4XA 2PSFA 1SR8A 4DSOA 1HZJA 2QYSA 4C3UA 3L18A 1CJVC 5C5JA 1OKKD 2V65A 3QK7A 4E5KA 4JDUA 3DB1A 4REOA 2ZQZA 1M0EA 3I2FA 1CERA 1YC5A 4J76A 3OLWA 2PE5A 3VC2A 2ODPA 3IXLA 2BFEB 2HQ1A 2A5FA 3ZHRA 3A7DA 3O94A 2QXYA 5T6BA 2EHDA 4COKA 4M1ZA 3FOBA 1OILA 1CY1A 4HYEA 3HP4A 3H3VH 2BDEA 3STWA 4DLLA 3ZE1B 3LL7A 5L1IA 5ADHA 4ARSA 3UC9A 4AI6A 1SNYA 1Y6JA 3ABQB 4W5JA 1TAGA 2PT9A 2E6UX 1R6DA 1JEJA 3EDCA 4I8XA 2XCIA 6ADHA 3O4IA 2ZJYA 3CJTA 4GX0A 1ZKMA 4R2XA 1QIHA 2AN4A 3W78A 4GM1A 3ZQKA 5JADA 2ZUSA 1RU3A 4YP9A 2CFMA 3LUHA 1RYEA 3HO8A 2VSYA 4C7BA 2Q1UA 2ANCA 1K5DA 3D2BA 1NQXA 4Q0MA 3R4CA 4NU8X 4RTSA 2C9OA 4LRQA 3WYEA 2HWUA 4LV5B 4F2PA 3BHMA 1Q1AA 2V3CC 3IDFA 1DG3A 2BYTA 2RGXA 3QPWA 2NGRA 3L6OO 1WD5A 2RF4A 4O2LA 4MR9B 5LQNA 4ZRMA 2WD7A 1C9EA 1U2DA 1JX4A 2VJYA 1WW2A 3Q8MA 3SEAA 4MS1A 3MILA 4KPYA 4UTRA 1RRFA 1XEWY 5F9FA 3CPJB 2ATLA 4WJZA 5C8DA 1IHDA 3Q8XB 1IJBA 1JQLB 4QTTB 3FVWA 5JROA 1JZQA 1F0YA 4LF4B 1L0BA 4R40A 1O1YA 4CTOA 5FF9A 3RTGA 4ZAFA 2ZRHA 3HXQA 1MB2A 3G2NA 1HLGA 3L7LA 2HL6A 5FV4A 4P0TA 5KHAA 2IS6A 4YHHB 3AYHB 2AF3C 1K1EA 1SPXA 3B20A 2WTFA 1X8LA 3HDQA 3FF1A 4MX8A 4QSHA 3GJQA 1ZIOA 2BKVA 5LZ2A 2FDXA 5KOIA 3NV7A 3O6VA 4UM5A 3GX1A 1RQXA 3AXTA 3HZHA 3VU8A 3D1LA 5AWFC 2J9XB 3HL0A 1YRAA 3GTGA 4E4RA 1YCDA 5JVDA 2JKYA 2WB1A 1I6KA 3TX2A 3RLFA 4UXIA 1GZDA 4XVUA 4WFJA 3VH3A 2NZVG 1EVKA 1N0WA 3U3DA 4LFCB 3IPLA 2GPTA 4NG4A 3I64A 3DE6X 1HSZA 2HX1A 4L8WB 2JJ2D 3FNQA 3I05A 2CXQA 5GVSA 1A50B 1T0PA 3KYIB 4QXQA 4XWOA 1CHNA 3PUHA 4Q3DA 3FW1A 4HWRA 3SSNA 5BRAA 3K09C 3PXGA 1FP6A 4BQQA 4AKGA 2C2XA 2ECOA 2QSYA 3IT1A 4GL4A 1BX3A 3RAGA 4R1SA 4CTKA 3THRA 2G36A 2ZK7A 2CF5A 3JVIA 3MCAA 3M1YA 3WIEA 1PR0A 5BOSA 3Q8PB 1A9ZA 3RJ5A 2G04A 1E0DA 3R76A 1XZDA 4L5JA 3OURA 4A2AA 4GICA 4PIVA 3M6MD 2YW2A 3TTYA 5EXEA 2P69A 2YHIB 5BURA 3UUEA 4TL6A 5EE0A 3SDSA 4I5FA 2O0JA 1C50A 2ZULA 5E1BA 2BGGA 3ZCVA 1ZVMA 5CM8B 3WL8A 3ZNNA 2KLHA 1YOVA 1G5PA 4HDQB 4E4TA 4MCAA 4RGBA 2V1XA 1LRKA 2C9DA 3C16C 4F3NA 4DA8A 2R7KA 1SBCA 2FZ5A 3SNOA 2CNNA 1A1SA 2Z8XA 3GDHA 4R0NA 4ZEVA 2BEUB 4D6XA 4FS3A 2HQRA 2BI8A 2BE7A 4BRUA 1P17A 3C1OA 3WGOA 1O94C 4IUDS 3COPA 1PK9A 1XAJA 4EYSA 5I4IA 5JD4A 1F8GA 3RIZA 1OX6A 1NJSA 4IDNA 4HDSA 4CIXA 4LFBH 1YBFA 4ZEXA 1G21E 5IP7G 1H2YA 3EMVA 2J5RA 4W9NA 4B0PA 4IOLA 2BOVA 5LUAA 4LMYA 2FE1A 1Q92A 3UPUA 5KVSA 5K51A 3TD9A 4RK1A 1DV1A 3TJZA 5TEWA 1E6KA 1YA8A 1WKCA 4U3JB 2VQEB 1UIMA 2JANA 3SBDA 4QU8A 4RY0A 3KLNA 2C4VA 4QXMA 2PGJA 1XDZA 1G20A 4YP3A 1E92A 3CF2A 3KOOA 4PF1A 3MUOA 3FNGA 1COWD 4V02A 4G36A 1L7AA 4JYBA 3PDJA 1RXVA 1EUCA 4XLLA 1BJKA 4IEFB 2UUCH 4NBVA 4XDZA 4QBTA 3RVNA 1JDPA 2GKSA 1YVDA 4G5FA 4X64H 4CG3A 2DSTA 2JIBA 4GU5A 4CXMA 4JA0A 2XW6A 2AI1A 1NBHA 1L4GA 4XQ9A 2FAXA 3JWGA 2VDUE 3EF3A 4P53A 2PLWA 4JMPA 1ULUA 4OI2A 3DDNA 1QANA 2X5XA 5DTQA 2NO0A 1AV7A 1ZOPA 1FC0A 1PGQA 1QHHB 4ZI2A 1VI6A 2ADOA 1IWOA 4HYQA 3H6KA 4JV2A 5BWTA 1QS0B 1Y34E 4PWZA 4LK3A 3E9RA 3P2IA 4JDPA 4Z1MA 4RPCA 4IEIA 4HDNB 4EZEA 4ZU1X 3B2QA 3FOZA 4L8YA 4WINA 4XXHA 3GVPA 3CH4B 3LOQA 5DFAA 4PHFA 1PFQA 3GILA 5BSMA 1ZWKA 4JA2A 2IDMA 2B98A 5ER6A 1RK5A 1M2OB 3AV3A 2PX5A 1BC5A 4MVJM 1KFEB 4EUEA 3UPTA 5FHQA 1WMBA 1ZVVA 2O3TA 2MSKA 5K3CA 4JI3B 2DVMA 1ZSYA 3AY0A 3C8DA 3N76A 5G1OA 2IFTA 1O5IA 4FBLA 4LC1A 3JQ7B 1PSZA 3RRBA 3QE4A 4FJ1A 5TLSA 1N6PA 3WY9A 3GHYA 4V2IA 5IAJA 3AWIA 3CRW1 3E5MA 4BLOA 2M6LA 4I3GA 4BLPA 4P4GA 5ETJA 2HBYA 2BGLA 2W43A 1WUIS 1N3BA 4UD2A 1VJTA 3R2JA 3FWPA 1BCSA 1KMIY 2QM3A 3IDOA 2MYNA 1W88B 1CJBA 2OILA 3V1UA 1NA5A 4ZQCB 4LJ5A 1W85B 4YIKA 1TCCA 1JE0A 2VP2A 3A3OA 3F3SA 4JLPA 4TXMA 3ZY4A 2RKWA 2GFQA 5L9XA 3VAAA 1M7HA 2DJIA 4CT0A 1PX0A 2Y93A 2RIPA 1QIMA 3R5JA 1UFRA 4UEWA 3LFHA 3I62A 4DV3B 4W9RA 4MQ4A 1CETA 2OKCA 2OP0A 3GUVA 3VKVA 2AK2A 4A27A 2V7VA 2C54A 3L3BA 4DY6A 2BP7A 5I8ZA 4XJSA 5G0SA 1I3MA 2AOVA 2QN2A 3AERB 1DUSA 1DBQA 3X3HA 3UMJA 3EAGA 4BZPA 1GDHA 4P3OA 5J4YA 2ZWMA 4CKEA 3MGCA 2VOJA 5KTOA 2BBWA 1ZO8A 1E62A 1VLLA 3L82B 5C1DA 1JWAB 3RAJA 3P2JA 3LZCA 2DQKA 3PUJA 5CLLA 2X0RA 2BKLA 3OPVA 4N12A 4DWWA 2D0PB 5HM8A 3OJWA 1LFAA 3NP7A 4KVGA 4GVPA 2FPRA 3OE4A 4DLRA 5DGTA 1OW3B 3MJCA 2GLUA 4B44A 4D92A 7MHTA 2PUBA 4ATNA 2V9WA 1E2UA 3KPWA 4GPZA 1K0UA 5IFKA 5EJ4A 1WCXA 4TVSA 3LDUA 1NQOA 3BA1A 1EXMA 3LBIA 2X0NA 2A14A 4FFOA 3UANA 2Z4SA 3WA7A 1OFHA 1DWQA 5TPWB 2AUNA 2IH2A 4S2UA 3ZWPA 3W5OA 3UV6A 2WPDD 2QMYA 4CG0A 1IWBB 3G8YA 3M6IA 2GK6A 3MR3A 3INRA 1DQYA 1E5XA 4O3OA 3RREA 1P5ZB 3PFFA 3JPYA 5TXGA 3K2IA 3T4PA 2WOJA 4H3SA 5EN4A 2FY8A 2CJPA 4JI6B 5LZ7A 3RS7A 2X9LA 2GYUA 4GVLA 3KSAC 3ZBQA 5HOEA 5ES3A 4JJIA 3UMCA 3L0ZA 2HCBA 4YAFA 3KJFA 1RKVA 4LY6A 4MVJA 4AM8A 3ASZA 3TW8A 2BH9A 4YAKB 3EASA 4ZYUA 3D4BA 1BHJA 4I7EA 4OHOA 3WLSA 3GNSA 1KDZA 4TKVB 4HNAA 4N82A 1YSCA 1BE0A 4X8MA 3TOSA 4ZZ1A 2ENUA 1XT6A 3GK3A 2IEBA 3ZH9B 5JAPA 3LBHA 3KAPA 1NF3A 3RT1A 3C8UA 1Y9AA 2AXQA 2B92A 2ZI4A 2GCEA 3D6MA 3GLHE 3QVVA 2QVCA 1QMPA 1IZZA 4HUTA 3JQ6A 3I5AA 4G5RA 1WHSB 1TLLA 2PX2A 3AM3A 1J56A 5B1DA 1XHEA 2RH4A 3IHLA 2PKXA 2GJAA 1REQA 4G5GA 1RACA 2QAGB 4YMIA 4N01A 3ECCA 5CJPA 3R5TA 1VRVA 4OXKA 4FMDF 2W8LA 4JUDX 1Y4UA 4WKCA 1SYXB 2VHVA 1UBSB 4H16A 3WAGA 1E2BA 2GPNA 1V9LA 3IS3A 2RJOA 1T3LA 1JT9A 3HM2A 5EIHA 3BICA 4B8WA 4DN6A 1OV4A 4ECRA 2HA0A 2JFPA 5G2OA 2H9YA 3M2TA 3BB1A 4WZZA 4GDFA 1W52X 3HYSA 2R5NA 3Q9UA 3AK4A 3B13B 5AKEA 4EB8A 4RTQA 4N0DA 3DL0A 2NG1A 2NSDA 3PKJA 1LTHR 3HOVG 2XUQA 3W7AA 3E7XA 4MR9A 5H0IA 4L74A 4ZDWA 5HW0A 3U4DA 4YRQA 2IUFA 3QPCA 2R3SA 1CS4C 4OJMX 1BCRA 1LC0A 4M1YA 1XK7A 3EGWA 2OQ2A 4I9UA 5EE9A 3RUAA 2QSUA 4NMWA 1QDLB 4NATA 2Z2JA 4KXXA 5HJEA 4E5NA 1Q57A 2BTEA 4V0OA 4FE2A 4TKUB 2F1IA 3BJEA 1RI1A 3OH8A 4BZZA 3HLKA 2GBGA 2PUDA 5F98A 1OYWA 2OTCA 4CN9A 1QP4A 2C0PA 1U3DA 2DPXA 1TZKA 5KO2A 5CXXA 1CHDA 2IYRA 1WXEA 3MR2A 1M2NA 3TDMA 1Z4IA 2ZE5A 5JLAA 2FPPB 2CVOA 5JXWA 2BHLA 2V7XA 2GTPA 3ZU4A 2ZIEA 2QE6A 3O82A 5IBRA 3I42A 3FOFC 2GF9A 5HOQA 2BV3A 3W1GA 3G59A 2IYNA 2FJPA 2R8BA 1LVHA 1YO6A 4PR3A 1RCTE 2R6AA 2EGUA 1NKTA 1L7PA 5BWLA 3U3OA 2FKNA 4Q3AA 2YZGA 3PNPA 2H7CA 5KWVA 4X90A 3FX2A 4PYIA 1ZK4A 4DPKA 4GHWA 3I2GA 4IMIB 3BGDA 2DG2A 1GZSA 4Y0NA 4GI3A 1CP2A 2XEXA 4HBZA 1AKWA 1D07A 3OJ0A 3MBIA 1P6UA 4YV7A 4RKEA 3SGIA 2R00C 1LY1A 3ITKA 3AHFA 1AHPA 4KOAA 1UP6A 5GY7A 4HR7A 1NM5C 4OB8A 3NFRA 5FOXA 3GJXB 2I99A 2JJYA 1EIZA 4UPEA 2IQ5A 3H5VA 1W35A 1MVNA 4R71A 3QMPA 1PGPA 3UT5B 2K4MA 1XTUA 3SIPA 1L7RA 3TQSA 5DASA 2YHIA 2PQ0A 3PUXA 2DUJA 5C5IA 3BQNB 2ADFA 2P9TA 3ST7A 4A73A 4YXWA 3UICA 1AUPA 3KZNA 4F2WA 4D9FA 2W2VA 3VPHA 1WPGA 3T4UA 2RDMA 3EFOB 2O7RA 2G9NA 2PO5A 4LXGA 4UAUA 5I7RA 3RBAA 3QVUA 2OSBA 1CT9A 4GE3A 2Q7DA 4O7VA 3C43A 1YWGO 5A4JA 1KYTA 1EX6A 2BEUA 3ADOA 4BEBA 3VVCA 3UMVA 2R47A 4BMDA 1PG5A 1CRPA 1UEJA 2R8XA 1QF6A 1HMPA 3J7AC 3DDHA 3FSJX 1GRVA 4NFYA 5AJTA 4JB0A 2YXDA 5DGAA 1Z8NA 1S68A 1WQ4A 1P1RA 2HFKA 2CYCA 3GPDG 4YCLA 3OIGA 3KWFA 4YR7A 1X1TA 5L3SB 3GMIA 3TB4A 2XR1A 4OUDA 1T8WA 1I3OA 4OP3A 3A27A 4NX2A 4CEJB 4QUKA 4YVFA 5AW5A 3GP8A 2ZM6H 2GZAA 2V7QA 4U3JA 3F3YA 1TK9A 3PC3A 3OEYA 4R9UC 4BLVA 2ZWPA 2R6ZA 1GN9A 2HR1A 2ZVDA 1Q0ZA 3DBLA 3KZKA 2WU4A 1MV8A 2AQIA 1VJ0A 3GLRA 4YO7A 4EG3A 3T95A 2G17A 1AT1A 1P1CA 4UBMA 4OSPA 1OA1A 2AOWA 3L05A 4IJVA 1LKZA 4M7RA 1P62B 4GXQA 4RNDB 2QRGA 3L0DA 4YPVA 1CQIA 1UMBB 4DAOA 1GAXA 1RKXA 4QYSA 4R7RA 4NL4H 3ZJ4A 2WG2A 4RIFA 1V8ZA 3A1UA 4OKIA 4EHFA 2PWYA 5BNIA 5G0TA 2YXPX 5HMLA 3PNKA 2XGOA 1BHSA 4C7VA 2AIRA 5CP8A 3TLJA 1U8UA 1YR9A 3AF2A 2RGUA 2CKZB 3KOYA 4HAOA 3CVJA 3PTAA 5JS1A 3TTUA 2YC2C 4FP9A 2FW7A 4NS4A 1J9ZA 2CXPA 4G3XA 2PGIA 1QHHA 4NEHB 1U6JA 4CIYA 5IMSA 3VKFA 4C0HA 3W34A 4NF2A 3HJHA 1QLWA 3HB1A 4ECWA 4RPKA 3VNQA 1WIWA 5EYPA 1YVEI 1TMYA 4UVEA 1POXA 4RWEA 4HDNA 1ZMTA 2ACKA 4N49A 4TVIA 5C0OE 2WU0A 4I1UA 2FLPA 3VKGA 2XKAA 5KWEA 3A9CA 5ALYA 5FFNA 2NZWA 4YROA 3N74A 4ZQGA 3X0DA 3LP5A 3LC1O 3G6KA 1PNRA 5ALRA 1AQJA 1M2OA 4IDHA 1OLXB 5EI5A 3BK1A 3TZBA 2G5CA 1RWOA 4CTMA 1ZX1A 2EF0A 4TQ9A 4MI6A 3LSYA 5KPJA 1XL0A 2O8DB 4GMXA 4YAIA 4OHFA 4MRNA 3FN4A 4B2YA 5F4BA 1CUDA 4FC6A 3RBXA 2YJGA 1Q6YA 5F9MA 1D2MA 3PFBA 1FVFA 4BJ3A 1W7AA 2AJTA 5KG7A 2CYBA 2QT9A 5CCEA 4I1SA 2HYIC 5CNJA 1GP2A 1W88A 2DWPA 4A36A 2PKRA 2YQ4A 2X23A 4LDNA 1KFBB 3MWEA 3M81A 1W85A 3N2GB 1EK2A 4UREA 2YW9A 3NNNA 1HX7A 4TT3A 1NXTA 3SYMA 5HHTA 5KG0A 4N6NA 3T7CA 1W76A 1YIAA 3BMOB 5EXPA 4CM8B 1YK0A 2H11A 5B1IA 4WZBE 3OIVA 4XIJA 4O7YA 1QM5A 1MZBA 4UVDA 4UUNA 3LKBA 4RMJA 4OHPA 5COQA 1CTQA 1FSZA 1M1YE 4LF6B 3ZDAA 2VH1A 3EFBA 4WCVA 3ZGLA 3RU7A 3ZWYA 2QRZA 4HEA1 4E3ZA 3AERA 1ZL0A 4BKUA 2GNOA 4CL3A 5JSHA 2O05A 1YJAA 1RK6A 4CEHB 1ZM4A 5IDXA 4Q4HB 2QRMA 4H7EA 4BU0A 3GLIB 1L4EA 3BB4A 3ZZ1A 1UK8A 2VRWA 2XTNA 2IW1A 4CF5A 3F9RA 5JVDF 2YOHA 1Y6FA 2Q1SA 2NVYA 5AVVA 3GJRA 2HCJB 4YK7A 3LI2A 4LSXA 5ALIA 4A0GA 4WW0A 4DNPA 2C7GA 3ZX4A 4BN5A 3PFWO 2A58A 1BWRA 4BB0A 1HFJA 5EHQA 1K2VN 3LAWA 4M1SA 3ZVNA 1L4MA 5HZMA 5AW3A 5KYUB 4AZWA 4QWAA 3H17A 3DL7A 3A6EA 2ZDQA 4PS0A 2GN2A 1BMFD 4IWNA 3BPSA 1CULC 1PUXA 1V7ZA 1KBLA 2HNAA 2PH5A 4K6GA 5FUYA 1DFHA 4WCFB 5JAMA 4JQSA 4RKRA 3V00A 5TPWA 4YMUA 1VBHA 5C1OA 3ABZA 5BSUA 3PPWA 5K0TA 4NZZA 1ECGA 2HREA 2FSVA 1UL1X 1MDBA 3HDTA 2GHIA 3PFHA 4CCAA 2QYHA 4S12A 3JQEA 4PO3X 1TQHA 3ZHBA 1KAGA 2XI4A 1P2GA 3PR3A 3AVOA 3HXTA 2VAVA 4V1CI 2HB6A 1XI2A 1Z6GA 4RFSB 1B74A 1Y4AE 1SKUA 4NVRA 1QRUA 1IIBA 3AOEA 3EDMA 1YJCA 2HW8A 1O0CA 3DSRA 2F8MA 4G67A 4WWHA 4WNAB 3EZ6A 4EBDA 3KC2A 1U8YA 4YAKA 5E4YA 3SWWA 2V7BA 1KZ9A 4C4XA 4KAJA 1I51A 2C8LA 4LRYA 3C6ZA 4GC9A 5KFEA 3DH0A 1PJCA 1KJ9A 1RJEA 4HNSA 4N65A 1EINA 1H05A 1U2GC 5LDHA 4R0VA 1GOTA 2HU8A 3A9SA 2J3MA 2POCA 3RODA 3H97A 2YZ7A 3G88A 4AF7A 3R20A 4LSMA 1Z36A 5J3JA 4Z3DA 5K3DA 2VZLA 5TQVA 1PJZA 4GKVA 5FWAA 2VHEA 4DM3A 5BQ3A 5K0GA 4PGMA 4AWAA 3FKJA 4NESA 4XB1A 1S2GA 5LM3A 5CK4A 1DAIA 3V80A 3ZIDA 1MDFA 3PZBA 1F17A 3IPAA 4KWTA 1YRLA 2F3PA 1HNNA 5PNTA 2C4TA 3NHFA 2QQGA 5FYQA 3OEEA 4PVCA 5JY1A 1RBMA 4C7MA 4NRDA 1AF7A 2AXEA 3WBFA 2WD7B 4B83A 3V4ZA 5EP1A 5ANRB 5K03A 1RE1A 4MS1B 1QO0D 3GIDA 3O4FA 5HX7A 3LCVB 1DV2A 3EPGA 3OJFA 4TKUA 1ZESA 4YYZA 2VSNA 1AZWA 4YRCA 3NKFA 4PXYA 5EE3A 4C6RA 3ELWA 1CQZA 1M8FA 1OD6A 1G5FA 2QI9F 1OA0A 2ZZKA 1H5QA 4RENA 4JX8A 2WKWA 3O4HA 1ISMA 1MIOB 3D1VA 3UXYA 2YC4C 4MW0A 4RY8A 2ETVA 4RVUA 4C6SA 2NU6B 2GT1A 4GI2A 4ZWNA 4BV8A 3C8HA 2R8IA 4FR5A 8GPBA 2OHHA 3NTQA 4FYIA 1ND6A 5FUQA 2BGMA 1KI7A 3L6RA 5FX2A 3RB3A 1P5JA 2B6HA 1OUMA 3L1HA 2IH5A 1W34A 3GZNB 2WKSA 1QZ3A 3GFPA 1E5LA 2CCGA 2JCGA 1JSCA 3NB0A 4X5OA 1QQTA 2WU8A 4R8VA 4MW6A 3OIYA 3ZXYA 3TSAA 4ED0A 4WEQA 1W49A 4DQXA 3DT6A 4N0MA 1S8OA 4PC1A 1VBFA 5C81A 1QGED 1BSVA 2JD2A 5E8RA 4ZEWA 1S0NA 5JS6A 3TIGA 4JOCA 4U0KA 2PVPA 3PNSA 5AHWA 1XZ8A 1V45E 1PTJC 4L7QA 5DHRA 2YR0A 1WRVA 4WA7A 3T52A 1IY9A 4P6VF 4MIKA 2FF7A 3H16A 4EITA 1M1ZA 2EFHB 4DV5H 3OO0A 4ASUD 3G89A 4BMXA 2F17A 2E4XA 3KEQA 3U7EB 4AULA 1XLUA 4D98A 1SKBA 4MH0R 5TX7A 1B4DA 4YQEA 2XQVA 5F21A 1EEHA 1KI9A 5LU9A 2QK4A 1TKRA 4DEXA 1X8XA 4DL3A 1UZUA 3KQKA 4BFWA 2XT9A 3ESAA 3Q6NA 2WUVA 4J7XA 4K6FA 5KFVA 1YR7A 3TJMA 3SEFA 1MRSA 1W5TA 3ZQ6A 1Z8DA 3EFOA 1URPA 2P9YA 2I1VB 3VNAA 4D4MA 1ACJA 1GGVA 2XVMA 4DLBA 3QX8A 1YOVB 2W2TA 1Z47A 1EXNA 3L8EA 1NWHA 3DDCA 1PVOA 2Z2IA 2A6PA 1KZ4A 2LZ0A 3WBJA 5JSYA 1UFOA 2PSDA 4DEYA 1VAJA 3V6JA 5HFAA 4FOSA 1UUFA 3FVTA 3ZY3A 2I22A 4RF2A 2EJWA 4YC7A 1DQNA 1WLYA 4AS3A 1F3LA 5EFZA 4P8RA 2PKEA 4L0QA 4QEDA 3LHIA 3OT4A 5THQA 5BT8A 5J4LA 5TJ9A 2C8KA 1NYRA 1SVMA 4YACA 3OFSA 1WTCA 3QXXA 4CEJA 4P0PB 2JA6A 2J3EA 4M8NE 1N4DA 1V39A 2TMDA 5AHOA 4I3FA 1X9NA 5BV0A 2ID8A 3V8MA 5AHKA 1S9FA 4DV6H 4ZA2A 1WXIA 3DFKA 4FZ5A 1VCHA 2Y92A 3ZLUA 2QW8A 2YOFA 5LMNB 1KUTA 1AJEA 1E3IA 3I9MA 3DLAA 3CQ9A 2DHCA 1G20B 1Y3AA 3OCYA 1GZUA 4BZXA 4AN1A 2VBGA 4TZ0A 4F71A 3ND9A 2I54A 4WXPA 2R7NA 1IWPB 3MHTA 3OQ6A 6PFKA 1QF9A 2HQBA 2X40A 3GP5A 3UJNA 1H3FA 2NXNA 3T06B 4MVJF 1G8KA 2DPLA 5EESA 1XVVA 3OUTA 4PG8A 4EIWA 5DYTA 5F5LA 3C0FB 1OH7A 2WVAA 2IHKA 4BO4A 4D44A 1YQWA 1I50A 3FE2A 3I09A 4HADA 1XDWA 3VZDA 3O84A 1VKOA 3QUTA 2GN4A 4N48A 9GPBA 4JLUA 2JW5A 3PHGA 5E2AA 3KOMA 4MQMA 3AIKA 3UCXA 3DL4A 2RONA 1M66A 5KJ6A 4ZARA 4G1VA 4M0JA 2ACWA 4MI3A 3KR0A 4KXFB 1ZQ1A 1GNVA 4JI8B 4JI2H 1OF1A 3AR4A 3SJUA 5AVOA 4M0LA 3GCXA 4YQFA 2J87A 1H2ZA 5HDQA 4B5KA 2Y4NA 1OLXA 1QV9A 2OUIA 2OV1A 2R4QA 3DMYA 4ZU6X 3WRVA 4MCHA 3S1AB 3TMYA 3EXHC 2IOHA 4QBFA 4BDSA 1YR1A 5EKDA 1X7HA 2D5IA 1E98A 1B0AA 4IUBS 5BNTA 3K8ZA 2PFKA 1RXYA 4G0ZA 1UC5B 4NHEA 1EPUA 4WK0B 4HQNA 3A6DA 3HA7A 1NP6A 2SICE 1ZINA 3N0VA 4K6KA 4QG7A 3QWAA 2IRWA 3L07A 3VTZA 4EPTA 3O95A 1SY7A 1BCSB 2QRQA 4I1PA 3N2GA 3JD2A 1UDBA 2DERA 2DHQA 4R5MA 3RUPA 1S9HA 4H3VA 3NVMB 1G8SA 2IYTA 1H66A 1SBQA 3QKSB 4AJOA 3ZCPA 2LCIA 5AI0A 1F4VA 3F96A 5FJ8G 4JYMA 1F8UA 2Q5LA 2W8KA 3ESDA 2BTOA 4KE7A 3H4IA 2IELA 3NH9A 2GK3A 1P31A 1WULS 3ZHSA 5F9LA 2I6GA 4R5HA 1QKJA 1OAOC 2WT9A 3IILA 2WV9A 4QUJA 4CI0B 4PR0A 3HC7A 4II3A 2RK4A 2DCUA 3JRWA 1AGNA 3OF5A 2D00A 3A4LA 2FDCA 1SU7A 3T3OA 4RACA 5HIIA 2C1XA 4WLNA 3RR5A 3URMA 3E9MA 5ESWA 1K6JA 1F6DA 1DTSA 2POQX 2C3OA 1HDGO 4WV3A 5DLQC 2PGLA 3WBBA 3GLIA 2Q28A 2VDLB 1BRTA 4DZRA 3QLVC 1TD9A 4KJZA 1Z29A 3BX1A 5E4FA 4AKTA 2OWDA 2P1DA 5KSOA 1AQ6A 2BQUA 3VR4A 4G26A 4DYDA 4B6OA 4A3EG 1VL8A 1NUAA 4XYGA 5A06A 3G2IA 4WPGA 4P2GA 1TA4A 4RTRA 1IN6A 1VPDA 5JNLA 2OPBA 3CLSC 3O93A 4H35A 4BFCA 8ABPA 1L3IA 1MUUA 1QVAA 3NZEA 3GELA 3TOCA 3FDSA 1JDJA 2OCXA 1X14A 1KZ6A 3V3TA 2GI4A 3FYCA 7MDHA 5IARA 4WCFA 2QXUA 4UQOA 1QCZA 1OSNA 4U2BA 5DXJA 2VPZA 3DONA 4X62H 4GC6A 1RAAA 3FUWA 2VQ3A 4IIBA 1L1FA 1QWOA 3NHWA 1N3YA 4C4RA 3AB8A 3G2OA 5P21A 4F2DA 4RFSA 2V96A 1N6NA 3K70B 3ORFA 1XKLA 1RQ7A 1HFKA 2GBPA 4WX2B 3HXOA 4FKZA 4R4JA 3KPYA 4TXJA 5FTMA 4AUNA 2A57A 4F46A 1A5TA 2E85A 3MJVA 4FIZA 3SM3A 3AG6A 2PLAA 4ACAA 4Q66C 1ULSA 1DBSA 1FU4A 1VDZA 1QU3A 2ORYA 4X3CA 4RU9A 2HZ7A 3NFYA 1ITZA 2PA3A 1FSFA 2KS6A 4L02A 4N3AA 1U3GA 1LK0A 4EAAA 2VEDA 4QBKA 1N2CB 2JLXA 2WMDA 3W5IA 3TCKA 3X2SA 5LMCA 4QPPA 4YREA 3TW8B 2Y99A 2DPMA 4Y1EA 1Q17A 3TW4A 2UU9H 421PA 4M53A 3FPLA 5DBIA 3VJLA 4MCJA 3F47A 1EGVB 4HNAB 1QRSA 4JOBA 5IXSA 1ZU4A 2QEQA 2EZUA 1EZZA 3I4NG 2VPTA 3SM9A 3LHDA 1D2NA 4XD2A 3MBOA 3A06A 1YE5A 4LRTB 2KPOA 1ZD2P 4A8JC 2W57A 3WJ7A 4EI2A 1VKRA 1QFSA 2A35A 5B1YA 2DKOA 3EY9A 5DTMA 2DCMA 2IIVA 1VG9B 3NOVA 5I4KA 4RVGA 4XQCA 5KNCA 3ILXA 3VVMA 5IJZA 5LPNA 1YULA 2AEEA 4MQ5A 1LI5A 1AF4A 2Q1WA 1REQB 3QFRA 2AEMA 2D2EA 4X65B 2YV5A 3UK7A 4LYHA 3UFBA 4TL7A 1D0IA 5KG1A 3RNLA 1VHTA 3RYTC 1VKNA 1Z33A 1BOFA 1S7GA 5E4JA 5J4VA 5LWQA 1JA0A 3K8YA 3Q8KA 2OVFA 1N2IA 7ABPA 4FR0A 3WR5A 4ZXPA 2G88A 3ZE8A 5DN6A 3MMPA 2HK6A 2X0EA 2TRSB 1SD2A 3NO4A 2M98A 3GIJA 4HPJB 3ENNA 1P5HA 2RB5A 5IKPA 1SQSA 5BSVA 1KJQA 5SYAA 3ND6A 1GNTA 4N18A 2JIPA 3S55A 2IITA 1JKIA 3EOZA 4XPZA 4X8HA 3NASA 1TQ4A 3U26A 1BCRB 2QVBA 2J9ZB 4EO9A 4NE9A 2JLYA 3DMGA 3C3EA 3ZZMA 4XB2A 4ARBA 1ADYA 1IN4A 1E7SA 5EXXA 5DG8A 2WQ7A 1MXFA 3DOOA 2R6FA 4GKJH 2C96A 1C7QA 2Q6KA 3SK0A 3GRPA 1BVHA 4EHBA 1FSSA 2E87A 1MIOA 1T5BA 4WN3A 4GG1A 4RNCA 2QR5A 3R24A 1XQWA 3TTTA 4D46A 3QE9Y 3A25A 2NU6A 1UDAA 1U0JA 1HT3A 1GXSB 2Y8EA 4XSHA 2ZYGA 4DQKA 2O3RA 2QQ0A 4W82A 1R4AA 3H7AA 3CSSA 1NF2A 3NXSA 4CUJA 5I51A 4UCXA 4JLKA 3GZNA 4TVOA 4UTOA 3K9QO 4L0DA 1EKXA 4HAZA 1RRMA 1D4ZA 2Z0MA 3AXSA 1RFLA 1ZD5A 4PQGA 4R3NA 1WCMG 4ZVTA 4XX1A 1I0LA 3F3KA 3N8GA 3I0NA 4P2BA 1VGQA 3H6HA 1FX0B 2QS9A 1CUXA 4NNPA 3BD8A 2VL7A 1N92A 4NARA 3N0WA 3P32A 1S2DA 2XGQA 3KHGA 2I66A 3OX2A 4P82A 3E81A 1MD9A 1SVLA 4AICA 1KMQA 3H8WA 1WY7A 2I8CA 3QVXA 4MIYA 4F45A 3V8QA 5HFJA 4BO7A 5AK3A 3NIWA 2GN0A 4MUFA 2RGGA 5IAEA 3MXOA 2P68A 4YECA 2NLOA 4XD7A 4US0R 3OWXA 1JLSA 4JYCA 3E9DA 3BXPA 5DT2A 2V1UA 1WSDA 1X39A 4C6TB 4ZV4A 4IWXA 3HR8A 1UJ4A 3E82A 4QDOA 1D2HA 1E0JA 1YBHA 2LWIA 4WNIA 5CVEA 4YRBA 1WVMA 2W7OA 2MMGA 1TQDA 3DLPX 3UYLA 4DQUA 5LP1A 4LYAA 5D7BA 1YQGA 1B2LA 4DTCA 1SELA 4Q9KA 3WNCA 4PGFA 4TQAA 1J8QA 2XE4A 4DIDA 2WABA 2ZJZA 2DGDA 5DYYA 3UOAB 5E1DA 1RYRA 9LDTA 4KUGA 1YD7A 5J9FA 3G1UA 4BVGA 2O06A 3WC4A 3Q5GA 4FB4A 2HHLA 1JFVA 1P18A 1DIKA 1NLUA 4GPTA 3FPBA 4XCVA 2F1KA 1F60A 2GAIA 4IJQA 4OUDB 4JKYA 2ZIFA 4LTMA 3HFJA 4BO3A 3HS3A 1R0ZA 4J6EA 2PGOA 1JG6A 3RFTA 4L3WA 1R18A 3OKFA 4NE2A 2Y3IA 1JL3A 2ZSEA 3QJ5A 4MGIR 1ORIA 4NSNA 4BWSC 5KQLA 4P4UA 1A96A 4EB6B 1C0EA 2BRUA 2RHLA 3DBLB 3RB8A 3QLTA 4KYVA 4DUZB 1PV2A 5JZBA 2OM6A 2X2EA 3KHTA 1Q74A 3PKZA 1S8NA 4LF5H 4QW9A 1T2AA 1GPBA 3ER9A 3NWEA 2QUAA 1MHPA 2VCHA 3E3OA 1CQIB 1Y9ZA 6AT1A 3IP1A 2IY7A 2ASJA 4FQ5A 4NBKA 4BN4A 1HTTA 1CRWG 4OQPA 2QKYA 4YCJA 4QGFA 1X7WB 3I6MA 1G5TA 1G63A 4DIUA 1E6LA 2BFCA 5HF8A 1JIXA 4F11A 3G49A 1ML4A 1F5NA 2YWJA 3V9AA 1O6FA 4ZVNA 1KRHA 4KO4S 3QV1A 1AO0A 4DREA 2JGEA 1U1DA 3ILSA 4PCUA 3KQNA 1ZMBA 1U6IA 4C21A 4LOLA 5GZ6A 3FZNA 4KSCA 2E4VA 3USES 5EYPB 4TM7A 1RHJA 5B1SA 4BX8A 1V1MB 3KHUA 4PC3A 1UKCA 4C30A 2JZNA 3PGJA 4B3GA 3LW8A 1TX4B 4YMTA 4J49A 4UCRA 5EZ5A 3N3BC 4DCTA 2WWRA 1HTBA 3L8YA 3S1AA 3IR5A 3E3LA 2FK3A 1UF9A 2J3LA 4QRHA 3ORQA 4JBNA 3H9GA 4EHNA 3P2EA 3C4QA 3V34A 2CE7A 2YTZA 2JEGA 4KO3S 3RS8A 4BKPA 1RYYA 4GR5A 1FY2A 1NUTA 3WLJA 4G0YA 3BJRA 4S1WA 3NDPA 1ILEA 3NHKA 1A76A 3UG6A 3QZUA 2QNIA 1NX9A 2FMTA 5JSZB 4EHLA 1DP4A 3NI2A 4ZKEA 4EG0A 3IP7A 1JTVA 2QTBA 5B2FA 1PLLA 3MWEB 5GJWC 3QKSA 4RB0A 1W4RA 3PNBA 3ESZA 5AHRA 4QSMA 1J70A 1N2HA 2AFIE 4I1VA 1U2EA 2J7PD 4CIWA 3ZLVA 1JBKA 2GF2A 1PNOA 4RD0A 2B5WA 2YFHA 5F5NA 4E1AA 4OQ4A 4MPDA 3GTOA 4GM0A 2JIMA 2HY7A 4IGIA 4KITB 2NW6A 5JU6A 2XCOA 3CVYA 1IUPA 3DLTA 3QJYA 2NO6A 2BQ3A 4XLZA 4X92A 2ZS8A 1AKRA 4DLZA 4G8DA 3D6VA 1N1DA 3UZOA 5LFAA 1FDVA 4GXRA 2O4CA 1BTOA 1V95A 4EPXA 5HSGA 3O8NA 2OBLA 3FPHA 4QWMA 3QHQA 4YRTA 4OOFA 1USGA 2X8AA 3OTIA 4QTXA 1GAJA 1N9GB 5FFMA 5F2OA 1DMSA 1BZYA 2A0FA 1DKQA 4J91A 3O1IC 2WNSA 1L7XA 2RI1A 4BASA 1ICIA 1KO1A 1QE0A 3MWYW 2W0MA 1GSAA 1R0KA 4L28A 2B8JA 3LU1A 4DLTA 5KZMB 3OTQA 1YK1A 4PBCA 1XLVA 3W79A 1XQ1A 3ICWA 1CDDA 2GFIA 2E1RA 4G9GA 3E03A 1XTIA 1L5WA 1E2DA 2YN4A 4FSHA 4MUIA 2ZEJA 4D43A 2VDMB 4HK4A 3UUWA 1A7KA 3HNPA 3RIMA 2ZPAA 5AJYA 3IDAA 2A4MA 4OK3A 4QZVA 5FO1A 4GQBA 4QNMA 2OL4A 3TD6A 1DC8A 3MR5A 2XMCA 1WEKA 1DX4A 5DM4A 4TYPA 2UUOA 5K0JA 1DAPA 1QK4A 3T1NA 3ND7A 1W4ZA 1MNQA 1Y3HA 2G0TA 5L9AA 3RK1A 1I2AA 4QFMA 4AAYA 5JNTA 1Z0AA 1N2CA 3K9NA 3WL5A 3O8BA 4G25A 1ESCA 1T8TA 2Q5OA 1DJLA 2I3BA 3HBMA 3PNMA 4OCZA 1EK5A 5K8LA 3DOHA 2W2QA 4QOFA 3WBKA 2WOOA 2BH2A 4D82A 3W2FA 4EJSC 2OQVA 5A7FA 3TY8A 5HILA 4ZYZA 3N28A 4J0QA 4N9QA 4EKYA 4ANFA 3H9JA 3OMXA 1T9BA 5CYFA 3QPUA 1CEXA 2DAPA 4LRUA 4QBHA 2DWUA 3QYJA 5DLFA 3B8HA 3C6BA 2Q0QA 5D5PA 3HDJA 1GYRA 1ZEJA 3LMKA 2CUZA 3V4FA 5TGDA 4NR0A 3G7NA 3W05A 3O5AA 3PD0A 2I0FA 1TPZA 5EZQA 3LGSA 1P8JA 4HB2A 1I1KA 1ZW1A 2BZ1A 4A82A 1NBAA 3I73A 2UVQA 1AN0A 1NI5A 3SPXA 5HNEA 1WMDA 4PG7A 1TA8A 2V74B 5F33A 2OESA 2ZUWA 1CZNA 2PKYX 2PZFA 2QQFA 3BE6A 3GGPA 5IVKA 1FSPA 1HQCA 2HA6A 1B6RA 5M2QA 2YDYA 4PV7A 2D8MA 4YI3A 4LBWA 4ETSA 4GR4A 4TMXA 1GTSA 2Q62A 1NNUA 1FMFA 4WA8A 5K45A 1A77A 4HT3B 2PX8A 3KV1A 4F84A 1ADJA 3WIBA 2DFLA 1SUCA 1HYHA 1A48A 1XMVA 3JZMA 5KFDA 3NVDA 3OJOA 2E5FA 4NCAA 1TAQA 4UUAA 2FWIA 3HXMA 4Y1FA 4BQPA 2CHUA 3RFFA 2QTNA 2VAMA 1WSAA 1XMJA 3CLHA 2E2IA 4UNNA 1EEXB 3CSWA 1T6XA 3HLTA 1BEEA 1TW3A 2JGNA 3NHBA 3L8ZA 3MUFA 4D81A 1U8CB 2BEWB 3V4PB 1E4GT 3K1YA 2CUTA 1ENYA 4I6EA 4J0JA 2JAUA 4L85A 3HOZG 5EEHA 3AFHA 1OXXK 2C9YA 1GXSA 2ZB3A 3CTPA 3NDRA 5M7EA 1NYLA 4RS3A 1BQ3A 3LCMA 1EFTA 5EUCA 3O8QB 2L18A 2CZQA 3RWMB 2QN3A 2UUBB 1MEEA 1IEXA 4EA9A 4EMTA 2QD5A 3MCWA 2CWDA 3TSCA 5CVVA 8OHMA 1VYUA 4A2WA 3OFND 3W2IA 3EA5A 4BS9A 1J7KA 5BW5A 1QVZA 1OLSA 2R79A 3IHKA 3AR6A 2ZBQA 1ZC4A 4NBLA 1Z12A 1ZJ6A 1NNSA 2YN2A 1W73A 4MARA 4KB5A 3LC2O 1FX0A 2X8LA 2W9XA 4TQUS 3TW7A 4DV1H 1G5IA 2QT1A 3M9NB 2PX0A 5HGJA 4ISBA 3K35A 4M98A 2OYCA 3ZLTA 3VDQA 3GPLA 3S8YA 3EVCA 1P7ZA 2OV3A 1E2MA 1YOBA 3VO8A 1DRVA 2YVKA 5DHFA 2JGMA 1IHXA 5KG4A 1L1QA 2QYOA 3AUFA 3VYVA 2ATIA 2O7QA 3D0OA 5HRUA 4C6TA 4HVAA 4H2DA 1ZHOA 1JXAA 1I10A 3HABA 2R8PA 2P0EA 2F4VB 1UM8A 1E3EA 2F59A 4YRPA 2YWVA 4RSGA 2VJLA 5G4KA 4GMFA 3RV4A 2REQA 1K5GA 4B7ZA 3OM9A 3ZH2A 2NO4A 4J2OA 1GPYA 1V3UA 3OKCA 2UVRA 1W5FA 1KEPA 2ZSHA 1FNDA 1ESZA 4LDZA 4LS3A 2I03A 3EJ6A 2DIKA 3OMLA 1UOEA 1IXKA 2GJ4A 4ZVUA 2H2WA 4BNYA 1C2TA 4F7WA 5AXDA 5ICCA 1XCGB 1ZD3A 4AK9A 1H8ED 5FTLA 4DV0H 3PUIA 2O7VA 4C0WA 3A1TA 2AC7A 4LHVA 4BXOB 2LNDA 4HMPA 5C46F 4QA9A 3BTOA 1MOZA 2R6R1 5GOZA 4FYWA 5BUQA 2D2FA 4N7BA 1I5OA 1R64A 3QEKA 3KTAA 1RZVA 5JARA 2ZUFA 4ZT6A 1GA1A 4LRXA 1CIPA 3MPOA 3G0OA 3FBGA 3V4SA 2HHHH 4TMZA 3GIQA 3EEOA 2ACEA 3ETLA 4KE6A 4ZU3A 4AP9A 4U02A 4Y7DA 1NIPA 2FPWA 3PW4A 1VP9A 4R1TA 4EB6A 1X94A 2IPAB 3UNXA 3DQPA 4XARA 1H2BA 1N9KA 1R9JA 3WNVA 3CFYA 3D5EA 3TQHA 3RVOA 1UBCA 3EW7A 3WLPA 2DR3A 5E7JA 5EWFA 5T41A 4OREX 3C74A 4ID9A 1RWXA 3UV3A 2P78A 3I8XA 1W4AA 5K3EA 1AMNA 1K4MA 4LBYA 2I29A 3JRXA 1ZRHA 3B2NA 2HWXA 4E2XA 1X7WA 3DPUA 4RVCA 2QN9A 2HRCA 5I7AA 2W2LD 4BAUA 4R81A 2PWAA 3ET5A 1QP0A 4CLHA 1SUBA 4JD5A 1K3FA 2W0SA 2VF8A 3TI7A 5DV9A 4RJKA 4UDYX 2ZSDA 5BRJA 3ITEA 1IJFA 4HSEA 1NURA 1GNRA 2V7GA 1V1MA 4CLOB 3E9QA 4PO9A 4IZ6A 1AKVA 3OCCA 1EKPA 1RZRD 2FMXA 1JQDA 4U6PA 1G7CA 3A11A 2GH1A 3TAHA 5KJEA 1E3TA 2ODEA 4LQDA 3KXIA 3C8MA 2FPIB 3RRYA 1V48A 4QGHA 3QQPA 3BS4A 4HX2A 3T7EA 4BNZA 2C2EA 3VISA 3D8RA 4K05A 1CVRA 1VC2A 2C2GA 3ZU6A 1BFUA 1DEHA 2Y1GA 4CQNA 3AF5A 2DHEA 3TAXA 4O4IB 3SE7A 5FJJA 1M75A 3VQTA 4DMCA 1BU8A 1K98A 1V2HE 1RJFA 2OAEA 3KKQA 3OMWA 5IN5A 1LLFA 2G7MC 4U6QA 1ENPA 4QQRA 3AHEA 3GDEA 5JSZA 4ECUA 1MB4A 3GPCA 4V1CA 3TR5A 4RSMA 1C41A 1K1SA 3MJTA 1YHZA 3ORRA 4EF6A 1QQ7A 3G8BA 1F38A 5KFIA 1R3UA 4Y6OA 3NEJA 1HZZA 1HR0B 2UVWA 3MFHA 2QV0A 1AU9A 4FD2A 4OFZA 3QY9A 2V8OA 3WLIA 2GM9A 1JU9A 1UPXA 3L40A 4DAAA 4IRCA 4ZI3A 4RF5A 2PWPA 1A82A 1QBGA 1SUWA 2FH5B 1NWCA 4R2JA 2FEAA 3OY2A 4WERA 4J94A 2ZS7A 3EW9A 4KOEC 1VPWA 3S2IA 2Z6VA 4N76A 1CUJA 4LDPA 2X3UA 3KG2A 1XQXA 5LB4A 3V32A 4H7KA 3LOUA 4KGVA 4Z4IA 4WLUA 4BBSG 5AJVB 3HCRA 2DAAA 4HAIA 3DEZA 1C9NA 2AG0A 1N0VC 1K89A 2PUEA 4X97A 3I9JA 2G6TA 1Y7HA 1GDDA 3LQQA 1D09A 4Z6KA 1PQUA 2YWBA 1N9GA 5JNWA 1E4YA 2EEZA 4HH1A 5EERA 1EVQA 2IXEA 3PF8A 2OQRA 1LX7A 3PNQA 2H1RA 1VPLA 2Y2UA 5CIQA 1R74A 3IQIX 3PQDA 1SXJD 1NBEA 4F5YA 3FTCA 3VKWA 1AOXA 4QW8A 1Q3TA 2BFOA 3PA6A 1S2OA 1XZGA 5F12A 3VVLA 2HMTA 1QZTA 1I3NA 1NONA 3SZRA 3BREA 1W5BA 2GAOA 5EP3A 1P8LA 3WB9A 4P38A 3OOSA 2WMOB 4BQIA 4ESHA 3UGJA 3N2ZB 5IZ4A 4W1RA 4A6EA 1A0GA 3GTJA 1GITA 4DB2A 5IWAH 4LHZA 3H9QA 2IZ5A 3GGOA 1VI2A 2J6CA 2ZTUA 4GQAA 4J16A 4GO1A 2O3QA 3TI9A 2I6SA 3ZDEA 3CPSA 2RC6A 1TU0A 4B43A 3CCCA 5HBGA 2ON6A 1XTJA 2OGTA 2JEZA 1MW8X 2VP4A 1FYVA 2HXSA 2ZUVA 4DWJA 2WB4A 3DBIA 3A05A 3FRHA 2W6CX 1Y3CE 4MRPA 4X6UA 3W6PA 5I9TA 1AXEA 4KVZA 5J1SB 5EJ2A 2HV9A 1AN9A 2B0CA 1KO5A 2HGXA 2C5LA 2ZT6A 2G1KA 2R8GA 3L2PA 1IONA 1E96A 3WRYA 2R8YA 3ZWBA 1WO8A 4BLSA 1JH9A 2J6BA 3IEXA 5K6TA 3LHSA 3GI1A 3K9HA 1EYZA 4AQYH 4TOIA 1E2GA 4BEVA 5ENDA 5IYZA 5E0KB 1Q0HA 5FOUA 3ZX5A 3DEAA 1JFSA 1JIUA 2BQRA 3EDRA 2CV1A 1VJGA 2AZTA 2FUG6 2HDKA 3S8EA 2GVNA 3HNRA 1IBKH 3KSZO 4RVHA 3UAVA 1PLKA 5T7BA 3CMCO 3G1WA 2NU8B 3IFSA 2HWKA 4L75A 5KNDA 4EKGA 2ZRFA 3QX9A 2WZDA 4XEHA 3GVCA 3G0GA 4CQMD 2BFMA 5CFLA 2BUBA 4JC5A 3GGGA 3IA7A 2O2CA 2XVZA 3G6VA 2JIQA 2QVXX 3K4HA 3KSRA 1ZM7A 3SD7A 2COJA 1R6UA 2Q6LA 1AXGA 1WVGA 5JI2E 4U8HA 1JEAA 4QATA 1CF2O 821PA 3NDIA 4MICA 3ZWOA 4MS3B 5DGCA 4M46A 2AYXA 3VSBA 1HFWA 2XT0A 1KRXA 3AMVA 5TQJA 3ELDA 2ZTSA 3F5SA 3UZBA 4N3GA 3NWJA 4MHOA 3SYKA 2YIVX 2PT5A 3BOSA 5KWSA 2WKPA 5CB8A 2MWMA 1IM8A 4MV3A 3E9YA 4HDCA 2VLIA 2IMWP 1GQRA 1I0ZA 4OBXA 1L5QA 1E7RA 3BJYA 5DP2A 4BNNA 3A3PA 1F14A 2B83A 3IRUA 4NPAA 4DQ0A 4J9UE 1CRZA 3PV0A 3CX7A 4E70A 4M49A 2IHTA 2BEWA 1S03G 4BVLA 3M5DA 2DABA 4S0XA 3BHIA 4KFRA 2WE8A 1PBTA 4DR6B 3P9ZA 2LCQA 2HCFA 3JQBA 4MUAA 5AI4A 1PQWA 4HDRB 3V2UA 1R9NA 1Z2CA 4WLFA 3HGQA 3LPLA 5ALZA 3FPJA 3LHKA 3O8QA 3OWHA 4DMGA 3LWBA 2HK8A 1U1GA 3Q15C 3QY0A 3D7RA 1QIDA 3RIHA 5KJ1A 5ICGA 3VKHA 3IQFA 1EWVA 4BNDA 3FZQA 2C07A 4W6QA 1KPIA 2JAHA 3C3DA 4WZBA 4TQSA 2B21A 1M34B 3HDYA 4QHYA 4G01B 3G8DA 1CR4A 5K6AA 2YZKA 3UMFA 4MYHA 4RD2A 1M1YA 1JEDA 5I60A 3JQ8A 2F9MA 4OHBA 3H8VA 3KZXA 4NZNA 1VHWA 2IYVA 1Y1RA 1QTIA 3R5FA 1DIHA 3Q2OA 1N5JA 4TRNA 1O4WA 3DOFA 1V8DA 4RM2A 4FZ3A 1O3YA 4C1BA 1S3SA 3P9XA 2QAIA 3JD3A 4M9QA 4EVSA 1IEVA 3RG2A 1VL6A 4IIJB 1H65A 2XRFA 3WFJA 2I5PO 2CBXA 3ZCTA 3NU1A 3FNIA 5EJ5A 1GSOA 4G84A 5BSWA 3JV7A 5KS8A 2PL9A 3ABRB 4IHJA 4NCJA 4JHLA 1B43A 4FYMA 5DISC 3F6EX 4P84A 3WLLA 2NSLA 5KJCA 4GNRA 1QCCA 2ZPUA 3T3EA 4URHA 1APBA 5IAKA 2C83A 2N3ZA 1S8FA 3Q9LA 1PR6A 5DQGA 1EX7A 3JR3A 2DBYA 1RHQA 1QX4A 2YXEA 3B1YA 3RANA 2EX4A 1G8GA 4PG6A 4E6NA 1BN6A 4G8BA 1DGQA 1ATZA 4B74A 4L72A 4ZYXA 2JZCA 3DTNA 4GRIA 1FMLA 1X7XB 1Y1KE 1VBKA 2G1AA 2ZZNA 1BRMA 4XWKA 1OXMA 4C3OB 2FLVA 3ZN2A 4MAAA 4BMSA 4WVLA 4C2UA 2Q1TA 3F2IA 3M3DA 3DKIA 4KHPB 1WUHS 3ZY2A 5IRCD 1OZ0A 4EPRA 4NWIA 4ZQBA 4BXOA 4KXNA 4RXTA 4QUGA 4CM1A 2DFPA 4D9KA 4QODA 4FWBA 5KTRA 5MN5A 4IRUB 1L2ZA 2EP8A 1SC1A 1L5ZA 2GETA 2Q29A 3PN1A 3MRVA 4I81A 3HCWA 3SS7X 1U9YA 3FYDA 3JRNA 5FQOA 3HE3A 1RM3A 1K06A 1SM4A 5KT6A 1ZNXA 4NU5A 1XYGA 1A2OA 3V4RA 2VJQA 2X9NA 3TCNA 4F4DA 3KVNA 4R9VA 3MRSA 4BIIA 3S27A 3HHEA 3GXBA 3LZ6A 5EAIA 2XKBA 3MWKA 4L76A 4QU5A 2H5IA 4HS4A 4DV4H 1QVVA 5IVIA 3UHFA 5DGBA 2G71A 2Z3ZA 1HTWA 3AVXA 3H5LA 4ZC1A 1BMQA 4IH4A 4PZEA 1G2PA