3MWEA

Truncated human atp-citrate lyase with tartrate bound
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
424
structure length
424
Chain Sequence
SAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-citrate synthase
publication title Identification of the citrate-binding site of human ATP-citrate lyase using X-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 132
structure length 424
sequence length 424
ec nomenclature ec 2.3.3.8: ATP citrate synthase.
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16114 Citrate_bind ATP citrate lyase citrate-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mweA01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mweA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 3mweA03
3K3PA 3K5HA 2R7LA 2V58A 3JZFA 4C5BA 1CQIA 4C5CA 3JZIA 4TV8F 1M0WA 2VR1A 4TUYF 1KC7A 4EG0A 4YBZB 2R6FA 2V5AA 2QK4A 2CQYA 1JDEA 1B6SA 4ZOLF 4O4IF 1E4EB 3U9SA 3WO0A 4YAJB 1VBHA 5CAEA 2OLSA 2YV1A 3N6RA 4MV8A 1EUDB 4Y8VB 2I8CA 1JLLB 1M0TA 2R85A 3U55A 2NU9B 1PX2A 1GLVA 4O4HF 2PBZA 2YS7A 2SCUB 1B6RA 4YB8A 3GIDA 4DLKA 2DIKA 2WYOA 2XD4A 1CE8A 4I50F 4O2AF 1CQIB 3JRXA 4O7WA 2YRWA 2R7NA 4MV1A 4XX0A 4ZHQF 5GONF 2W6ZA 1KJJA 2YZNA 2R7KA 4I4TF 2NU6B 3MWEB 3TIIA 1KJ9A 2DZDA 2CNVA 5CAEB 3WO1A 1EHIA 2GPSA 3VPBA 3RUPA 1SCUB 3KALA 2GPWA 2CZGA 4IHJF 4IWXA 4ZI7F 5CA0F 3ORQA 2YV2A 1CQJB 1BXRA 5BMVF 2YRXA 2PVPA 4YB8B 5JQGF 2CNUA 3OUZA 2FPPA 4E4TA 4FFMA 5HBRB 3R23A 3R9RA 5C1OA 3MWDA 1EZ1A 2R7MA 3UFXA 4O83A 4FFNA 5LP6F 3HO8A 3NUAA 4XX0B 1OI7A 4FFLA 3LP8A 2FPGB 2NU7A 1KEEA 5C1PA 3E5NA 4FU0A 2ZDHA 5I47A 1EUCA 4O7TA 4WD3A 2PN1A 3KAKA 2W71A 4QSHA 2R84A 3JRWA 3G8CA 4O7RA 3N8DA 4YJ2F 1KUTA 1CS0A 2NUAB 3TIGA 5JVLA 2FP4A 4O82A 5BPFA 1DV1A 2W6QA 4NYEA 4HNVA 2FPPB 3TINA 2HJWA 5D8DA 1C3OA 3DF7A 4XYLA 3QFFA 3K5IA 4O2BF 3AX6A 3Q1KA 1M6VA 1KJQA 3RFCA 2YWVA 4C5AA 1W93A 1GSHA 4EGQA 2NU7B 5JQWA 1OBGA 4ME6A 4I55F 4FE2A 2W6NA 3AW8A 1EUCB 1GSAA 2NU8A 4YAKA 5LOVF 2YZLA 5C8YF 2I80A 3WNZA 4FFRA 2FB9A 3TQTA 4RZQA 4MV6A 1A48A 1W96A 4MA0A 4O4LF 1WR2A 2ZDQA 3VPDA 3GLKA 2FP4B 2R86A 2P0AA 2W70A 4XZ3A 2V59A 4O7YA 3SE7A 1VBGA 4HQ6A 1JKJA 4XYLB 1T36A 2YW2A 2DLNA 2YS6A 2VQDA 3G8DA 2J9GA 1OBDA 4O7NA 1KJ8A 1AUVA 5JH7F 2I87A 2W6OA 3R5HA 3OUUA 1GGOA 1DV2A 2CNQA 2YZMA 5FNVF 4HNUA 2X0SA 3RV4A 1VKZA 5J2UF 4O86A 3U54A 1Z2OX 1Z2NX 4O81A 4MV7A 1JDBB 3BG5A 2YYAA 4L1KA 4O84A 1JLLA 2GQSA 2NU9A 4XZ3B 2YL2A 2SCUA 5J2TF 4MV3A 2W6PA 4TV9F 1PK8A 1JKJB 2YZGA 5H80A 2C00A 3R5XA 3VMMA 5HV6A 3ORRA 3LWBA 3RV3A 5BPHA 1I7NA 1EYZA 2Z04A 3HB9A 2IP4A 5EZYF 4O7LA 3KAJA 4WBNF 5LA6F 3MWDB 5LYJF 2NU6A 3UFXB 2CSUA 3R5FA 4FFOA 3MWEA 5JVDF 4FGRA 2Z02A 4M9UA 1ULZA 4O4JF 5KKNB 1SCUA 4HNTA 1CQJA 5KX5F 1IOWA 4O7ZA 3ETJA 1KBLA 5HBRA 2GQRA 2GLTA 2FPIA 4MA5A 4O7SA 4XYMA 1Z2PX 3DMYA 2FPGA 1UC9A 3V4ZA 3VA7A 5CA1F 5LXTF 1GSOA 5CB4F 1IOVA 4IZOA 3HBLA 3V4SA 1C30A 1BNCA 4YBZA 2DWCA 3I12A 2QF7A 4YAKB 2NU8B 2VPQA 1UC8A 3TW6A 2R82A 4O7VA 4IWYA 2NUAA 1E4EA 3MJFA 5K2MA 4FFPA 4YAJA 2HGSA 1KJIA 4IIJF 4EGJA 4MV4A 4HR7A 1DIKA 1AUXA 3KREA 1A9XA 2W6MA 2FPIB 3PFFA 2R87A 4MV9A 4DIMA 5IYZF 1I7LA 1EUDA 4Y8VA 4YJ3F 3U9TA 3VOTA 4XYMB 3Q2OA 5DMXA 2XCLA 3VPCA 3ETHA 2ZDGA 4ZQIA 4MAMA
chains in the Genus database with same CATH superfamily
1Y7LA 3TB6A 4PX3A 2AWNA 2RKOA 3VX4A 1E3WA 1UH5A 4AECA 3PD1A 1ZC3A 4EUHA 4X92A 1L7BA 2HPAA 4JJAA 3V4OA 2GBFA 3FDJA 1RXEA 2BSXA 5E2IA 2XMQA 3N8NA 4WDQA 4X66H 5C32A 4QA9A 3KZKA 4B6FA 1QS0B 1PQ4A 3LX5A 1XXHA 5A71A 4DKJA 5EE5B 4YB8A 5U9CA 1THZA 2WZCA 4YVFA 2WV7A 3IUEA 5KVAA 16PKA 5KKAA 4RETA 4L9SA 1Y7IA 4IIDA 2AFHB 1FS6A 4ZAZA 2WLSA 1R8SA 1KORA 3JWJA 4MUGA 1QZZA 2QGFA 2R96A 1R4MB 1UIMA 2O2YA 3CO0S 3KJEA 1BX3A 4ML3A 3CVOA 2WDTA 1YJBA 1NBME 1X1RA 4GNRA 2GSDA 3R3XA 1Z62A 4Y6GB 4G5SA 3VYWA 1OZGA 4FP9A 1YR7A 4V0SA 2OTCA 2FSUA 3IP1A 1XRJA 3ANNA 1VIAA 5KBYA 1YJCA 2ZJ0A 2YIVX 1J8VA 3NETA 3MELA 1RE1A 3JRNA 3K72B 1JI0A 4D25A 4QYMA 4UQLA 4OKIA 3OPNA 4LOJA 5H02A 4EYOA 1H5NA 3LBFA 1A5SB 1K66A 4OMCA 5F9LA 2IUUA 4ENPA 2CMHA 2I0FA 4H9GA 1PHRA 3KQQA 1GTG1 1SZJG 1H85A 2XYHA 3HP1A 4MMYB 4LCEA 5B1SA 3TLZA 3SQNA 3DC2A 4LMBA 3EHDA 4EVRA 1EQAA 3E9MA 2FW8A 4QQFA 1R8YA 2I2FA 5ERYA 2X9GA 5EC8A 5EJFA 1DBPA 3PW7A 5SICE 3OHAA 4BWYA 3GN1A 3OPYI 2JZCA 4PPQA 5CW2A 1XWIA 3PXBA 1QKKA 4W8OA 4RTQA 3REQA 2HXSA 1Y4AE 2OHFA 3BEOA 3FJYA 4ZZ0A 3HJAA 4A3BG 1Y48E 1EWQA 4ZHQA 4KXVA 3EPJA 2EFGA 5DSTA 4H31A 3DMDA 4R1SA 1E5VA 2IWHA 1NSFA 3DC7A 2IIQA 5DN6A 3N58A 3K9CA 3IHWA 3NTRA 3MT8A 3BWXA 2J9FA 4W5WA 3EVNA 2GVZC 1G59A 2QGZA 3DKPA 1NXOA 5FPRA 4KBGA 3KOUA 3BBLA 1JFFB 4FI3C 5ADUS 3WBBA 4F7DA 5MHTA 4DR7H 2XDYA 1KQGA 2VQFH 5GWXA 3CZRA 1SU8A 5JWHA 1Q0SA 2OK8A 4Z6KA 3OAAD 2GEKA 1GZVA 3HGTA 1E9EA 4BPBA 1RJRA 4DABA 3VJRA 1XWFA 4W63A 5L95A 2DPLA 2PQ0A 4TTRA 4Z51A 3JTMA 4GZMA 4FBUA 4CMBA 3GO4A 1DJLA 3S2FA 3CLSC 4HZGA 1KRWA 3WYAA 4QXPA 3DMPA 1BDHA 2BFBB 4EITA 2XITA 3HRHA 3PQ7A 2CE7A 2AFIB 5JO9A 5KQMA 5IXJA 3ETNA 5IYZB 1DJMA 2C84A 3DV9A 1ZJ6A 1M6EX 1COZA 3TLGA 4XR4A 2I6TA 1PRYA 5EP2A 4YDRA 4XWKA 2IP1A 4DZRA 1D3AA 5EMMA 4NABA 3MLEA 4ISCA 3RU2A 3G02A 4GOKA 3EDCA 2EC5A 4QDOA 4GEKA 4U7HA 2ZBPA 1X8XA 4RY9A 4QELA 2H8GA 5I5YA 3TD9A 4FHCA 4CC5A 3ZD6A 4X8HA 1UXHA 5TDHA 3QBEA 3ROKA 3W6PA 1N4DA 4LFAH 2PS0A 5A0VA 5EHQA 5FL7D 1M6HA 2PUJA 3V1KA 2ZITA 1QYWA 4MWZA 4GP6A 3F5SA 4O4IF 4EABA 1WDMA 4G4IA 5B1IA 2ODBA 2EJ2A 2YV1A 3N6RA 5C0OE 3X3HA 2V9CA 2R85A 1SR8A 2XYRA 4QLOA 1GN8A 4KC0A 5IJ9A 3IILA 3OJLA 3SOZA 2ZAGA 1W0CA 5EZYA 1EZZA 4FLFA 5ICEA 2D4AA 2Y99A 5TQVA 2C3YA 3J81k 1CLUA 4ZV7A 2IS6A 1PUXA 2O2IA 3TLBA 2VH5R 1QDEA 5CFLA 4FC6A 1WY7A 3FM9A 3MFHA 1B26A 1JH9A 5T64A 2B7BA 3PDIA 5D1NA 3ICQB 4DPLA 2YFQA 1W5SA 3NTUA 4FFVA 2Q9UA 5C1OA 2XUOA 4PPYA 3EVZA 4R8UB 1PEKE 2ADOA 1RWOA 5LZ7A 2QN6A 1TWCA 1MKYA 1OT5A 2BJVA 5K0SA 4X45A 1XDNA 2VDLB 4YMTA 4LOAA 2VG8A 4FNGA 4NH4A 4AJ1A 1G4HA 1VSTA 4F4ZA 2W2XA 3G6WA 1ZCZA 1IWPB 4EI7A 1F06A 2EVWX 5A03A 4I99A 2ZI7A 1BOOA 5DYWA 4ZALA 3TSWA 2PNFA 4MHTA 5CJ2A 4QYSA 5JTUA 2BI8A 1N77A 3AX6A 3Q1KA 4IRXA 3RVNA 4GOMD 3L4BC 3IRVA 2WT4A 4NENB 1CVRA 1HM5A 1N2JA 1XX6A 1EFCA 1QQ5A 2HIMA 3QTLA 1D6JA 4N41A 4F6CA 3ED1A 3COYA 3SQDA 3G6KA 3UAZA 4WLFA 5HM8A 1L7VC 2QTLA 2FWBA 4A8HA 3W6OA 3U44A 1WMEA 4ATNA 3FLMA 1TMKA 4ZQBA 4CC6A 4E12A 4WT7A 3E4CA 1T36A 3EXHC 1XF1A 1QGUB 121PA 3WWJA 4GPAA 1P1BA 2XOEA 1UMBA 4M98A 1RK5A 4B6PA 3A1NA 2X0SA 1P16A 1WTAA 3OLCX 1N33H 2DFNA 4RKYA 4HRAA 4M0MA 3KVRA 3KB6A 3WLHA 4M0FA 4C3VA 2BP7A 2HQ1A 1E3SA 2XVYA 2CUNA 5JJLA 3KX2A 2PJDA 1FFXB 1GFWA 7YASA 2FWRA 1YQEA 1X19A 2BMFA 1XDBA 1KOLA 1SUPA 3SYMA 3D6MA 4LMYA 4L0DA 4CV0A 4FGRA 5EI5A 3HLYA 2ZZKA 2JFNA 3L7MA 2O52A 2CW5A 2QY9A 3PJEA 4M1ZA 4WKNA 2VT2A 1RWXA 1FE8A 4IDPA 5BSEA 9LDBA 4TT3D 1HX7A 4LXHA 2FPIA 4BO6A 2E37A 1N92A 4I1PA 1IHYA 4AI6A 4XYMA 1Z2PX 3LUHA 2N0SA 2NMVA 3QHQA 1U0TA 4LYYA 3EGDA 1U7UA 5KC8A 2Q5IA 4AY6A 1U31A 2BBWA 2R65A 2F64A 1JQKA 3STVA 1X3LA 2VPQA 4GBGA 4YJ2B 5AKKA 4WFIA 1MW9X 4J75A 1H4SA 3A9RA 1UKEA 4RZSA 4CV3A 3GELA 2EZ4A 2IS2A 5JTTA 3RRZA 1C9NA 2XNDA 3RFFA 5JMTA 1NYLA 3KZVA 1GFIA 2FN4A 1PD0A 3LKZA 1UQUA 3UAWA 1HR0B 3S8YA 2CLEB 4ZV9A 8ADHA 4J3FA 3TD2A 4QWBA 3I39X 4AN1A 1GPYA 3FOWA 5F12A 4PTYA 3CEJA 2V96A 3I9NA 1R8JA 2X2PA 1ORHA 1NG1A 4Z1MD 5KIAA 3AIMA 1ATZA 4NI5A 4LNUB 3USCS 1PQYA 2HSEA 2IPMA 3FPJA 4LI0A 3N0VA 5JS8A 2SICE 4DV5H 1SD1A 5AKEA 1ZN8A 4R83A 2VJMA 2PO7A 5EMLA 4R68A 1OBCA 4OK6A 1UMDB 2FK3A 3RHFA 4L16A 3LKBA 1AT1A 3DBRA 4FKBA 1LU9A 4LDRA 5AI4A 4JP1A 3TDMA 4XCVA 1KY4A 3LECA 4E5UA 4C30A 5KQRA 5IW8A 2FUNB 1YTLA 4CLHA 2AK2A 4FBGA 3F2VA 1AGXA 3PGMA 3H4BA 3MRTA 4J4HA 4A82A 2NQ2C 1E61A 5L9AA 1MV5A 4ER3A 5HTOA 2E21A 2HW8A 1VSQA 4PZDA 1C50A 4X65H 3V7UA 1GKKA 2YXBA 1UPAA 3SSOA 5F9HA 4EZBA 2O8BA 3OZ7A 1JJBA 4C06A 4BMZA 5C9ZA 4Q1CA 5L3SA 5CDUA 4QNRA 3OSZA 2QX9A 3JQAB 1N5OX 3VSAA 3G49A 1T5IA 2OECA 3PLAE 4XKJA 1NW3A 1CUSA 4IIVA 2F1KA 4B84A 1RM4A 1NI4B 5CJPA 3WGMA 2IYPA 1GPH1 2FP3A 2JGFA 4ZGWA 4CTNA 3HR7A 4PN7A 1IJFA 4KR9A 1QVVA 1EJBA 5CFPA 5KWIA 3F4LA 1EJ2A 1GQFA 2IUTA 2FQYA 2FK8A 3D2LA 1DC3A 2JAXA 4KG7A 4JP8A 2VJPA 3LVRE 5B57C 4J2OA 3EXAA 2COJA 3I8SA 1WR2A 3KD2A 3RUIA 4DSTA 6AT1A 1ISHA 2XIQA 1VB5A 1CEEA 4R51A 4IH4A 2B6HA 3ZKAA 3TPCA 4Z4FA 4BFTA 4HMQA 2BTQB 5DNEA 3FGPA 1M2VA 4GRDA 2M98A 2AJCA 4DEVA 2VYND 4D99A 1YQWA 3BSSA 4N7BA 1E4VA 4EYSA 4WASA 2MHCA 3QV1A 4HP8A 1V26A 1ZIPA 4RB2C 3CZ4A 4G8JA 4Y30A 1X13A 2W7TA 1X9HA 1JDBB 5J43A 1QYIA 1WIWA 4KMSA 4ZCMA 4FYJA 4RPJA 4NV0A 4X1IA 4DW8A 3EG9B 2W6ID 3AVYA 5BOVA 2P9EA 4EWLA 3ACDA 1RI2A 2H2AA 1RADA 1HYBA 3PTZA 1U5CA 1KH1A 3TW8A 4EJMA 4PQGA 5BORA 1UMCB 1MNAA 2VZ0A 3T3NA 2ZFUA 3RVJA 2GB4A 5I9TA 3NV9A 3IQWA 5DWVA 1JQJC 2AEEA 2XRYA 3P45A 1QIHA 1DRUA 3EMVA 1JZQA 5EE0A 4YQEA 2IXGA 1V3VA 4CWAA 3UM9A 1YA4A 1G60A 2B4QA 1YK0A 2AH5A 1Z5OA 2WTXA 3DMYA 2GARA 3NONA 3ROFA 4TQRA 4C14A 3NJRA 5EEHA 3EXIA 1NVUQ 1WSDA 3IPRA 5HK8A 1ZOIA 3ILXA 1GPKA 1QLWA 1JHQA 1M67A 3OZDA 1UUFA 2FSGA 1J1UA 2C54A 4MEBA 4ENSA 1JU4A 5A4IS 3CMCO 1I2LA 1V43A 2Q4TA 5FX2A 4CN8A 4JCCA 4LZNA 2B2XA 2BCJQ 3A0RB 1AUQA 4S2EA 3EYWA 5HJ5A 5B3JC 3UZOA 3OIGA 1PEDA 2FSVC 2JHPA 3QEKA 1I0LA 2WVGA 8ABPA 4C5BA 2C5GA 2UVDA 5KOHB 2RCNA 2MSEB 5JJKA 1LPOA 1E3MA 4N54A 3GRUA 5JAQA 4U6SA 4UVEA 2QDXA 1V3QE 2JI7A 3RLFA 3A3YA 4RZUA 3RNOA 4JVMA 4L27A 3PZRA 2ZYSA 4ZWNA 4I0WB 3H75A 1QX4A 1Y7TA 2LVBA 3GIKA 1QUFA 1T5HX 1Z63A 1Q7GA 4FFWA 4PXAA 1T9DA 5KTTA 4Y8VB 3TBFA 1X8KA 3WL7A 1O87A 1FFCA 2B8WA 1VLJA 5DEIA 2XQKA 3KP1A 5EG5A 1DG9A 2J5KA 1IU9A 3BACA 1VPLA 1JG7A 3ZDCA 5DTQA 3BCSA 3ZXIA 3W1GA 4LWZA 4XQ9A 4HX9A 1ZIYA 2WU4A 2XGQA 4R05A 2O7NA 4UU7A 2CNVA 3KVNA 3A25A 2I34A 3C1OA 3O8RA 4LHEA 3MW8A 2XZPA 3GNQA 3DV0B 1CG6A 4FEYA 2PBRA 2XMZA 2C7BA 2OAEA 1TJ3A 3N87A 1G8MA 1OASA 3THRA 2EERA 4HPWA 3SIWA 3QU7A 2QMQA 2GCOA 4MVCA 4GC9A 1RYRA 3CN7A 2JAUA 4GLFA 1U2TA 4Q9HA 4O7TA 2Z9DA 3GEHA 1AV6A 2G1PA 1YHNA 4S0XA 1SVUA 4KNVA 3I83A 4KQHA 4RQUA 4YAFA 4Z49A 1Z8DA 1Y3IA 1VSBA 3ZXYA 4CMFA 3HCFA 3IUMA 4JBNA 3QWUA 4TMYA 4Y2UA 2OGTA 4B3XA 3IB6A 1N75A 1Y7HA 4OB8A 3GEPA 4LDAA 4M6WA 2VXOA 2XNHA 1ELOA 1GSHA 3FVTA 1K8ZB 4W6ZA 1YZHA 3AXTA 4IMJB 3RVMA 3LPLA 3RAGA 4YC7A 3MSCA 5CLLA 4DRFA 2J0UA 4KGZA 3SFZA 3PGVA 5B55A 3JASB 1EP1B 4W7SA 1R6VA 4YCCA 2RONA 4PYMA 3L1HA 2V59A 3RIEA 5CB8A 1C4WA 1WSBA 1IM5A 4HAYA 4CM6A 2XXAA 1ZM3A 2Q6TA 4WK0B 3OO0A 3G79A 1MG5A 1C7ZA 2WIFA 1VHWA 3CONA 4KQEA 2PLFA 4UNRA 4R3NA 4XQEA 1RRKA 1RYYA 1Z8NA 3GROA 4YRJA 3EQ8A 1ZU5A 2QPTA 5KOYA 3RVLA 1QZ3A 2O6LA 3OETA 4F3NA 2O03A 1VCNA 5AVWA 1NQUA 4P2GA 3SBXA 4OVKA 1ACMA 3RRXA 1RCFA 4DWJA 3NM4A 2CNWA 2QJWA 2B63G 7AT1A 3ESZA 2NM0A 1PJ3A 2JFPA 1FCJA 3ZGXA 5ALEA 3IO3A 1JTVA 5CA1B 3T3DA 3NBXX 1PE0A 4MB2A 3QZ7A 2YXEA 5I8PA 1M34B 4KTTE 1BHJA 2KLBA 1V11A 3PI7A 3IR6A 1MC4A 1U99A 3UJ7A 1JIQA 2W7OA 5ISMA 1I1KA 4LNAA 1E1KA 3OCYA 5HZHA 2I4MA 1SQ5A 2UVUA 4L3VA 1G9XA 4GKBA 1SUCA 1VDMA 3UK6A 4EQ6B 4LJKA 1TX4B 4V0OA 4NBWA 1RQRA 1NQXA 3LT0A 3FDSA 3PL5A 2Q3JA 3SR3A 2IWRA 2ZE7A 5ALZA 4CF3A 4MVJF 4AF7A 4WCDA 1PEAA 1U9IA 2GWRA 1A77A 3JWGA 1XTVA 4BBPA 2BFEA 2KHZA 3SX4A 1ADFA 4JUFA 1LD3A 2AQHA 4CIYA 5ILOA 4GU5A 1EVZA 5IP9G 1ZI8A 4BX2A 4H35A 6REQA 3FLAA 4RSMA 3MA0A 4QFDA 3IA2A 4IDNA 3WDSA 1XQ9A 1VIVA 4QREA 1R6TA 4L6AA 1WMBA 4FHZA 2EW8A 3T1YB 3UWOA 4EB6B 4I4TB 3W2EA 3LSYA 1O6ZA 3F7TA 2DMRA 3IH5A 1TWFA 1SZCA 1YB2A 3ENVA 1JLHA 4GWKA 2YRFA 4BVFA 1YULA 3CMMA 3UYYA 1HTWA 2O8FA 4EDHA 4IKEA 2Q46A 1FB5A 1W52X 4KO2S 2ZB3A 3D2AA 1RPAA 2G8LA 4PHFA 2ILVA 4KN9S 3PD0A 3IIJA 2VK2A 4N47A 4FE4A 3N0TA 3N2ZB 4G3IA 3RWBA 3FZNA 3MJDA 2CXOA 1JEQB 1BD3A 2O7QA 2FPPA 5ALDA 1QPZA 4GXRA 1LQTA 3D3EA 3IALA 4PBRA 5CM8B 2WT9A 4MUBA 2GO7A 2H1OA 4N12A 3GJ4A 5KFHA 5CNJA 5EKXA 3HO8A 3B7GA 4OI1A 3WK5A 3VR3A 3ILYA 5LQMA 2XI4A 3OKFA 6ABPA 5LD2B 3QWBA 3VNRA 1FX0B 3R3WA 3H65A 3VKFA 2D2VA 4RS4A 1L0BA 4RGVA 3GUYA 4JV0A 3WP0A 3EGCA 3G0HA 2K2WA 2WYWA 5AKHA 2VRCD 3OTOB 4Q3EA 4RSGA 3S5UA 1N48A 5H8WA 3OPMA 2YINC 2WAQA 3DS8A 3EG5A 4GICA 4QM7A 4L0QA 4L2IA 3OEWA 3FPHA 3E2PA 2UV8A 2PUCA 1L8OA 4XWYA 3BMQB 1H8HD 3M6XA 5CYPA 1H6AA 4EGQA 3L0DA 3L1VA 2WJIA 3NH6A 3JAWB 3C8HA 1QYDA 1FK8A 1IB6A 1R4NB 4BLTA 3VC7A 2NG1A 3H8SA 1QK5A 1ECBA 4B3GA 3P97A 4MW4A 3GLKA 3G68A 2ZQZA 1DLIA 4ZCIA 1KDYA 4TYYA 1U81A 4O4HA 3EIEA 2PRYA 1B0AA 2QTCA 1U6IA 2NZXA 3DKKA 3T5AA 4LF4B 3Q3JB 4FYHA 5K2OA 1FTGA 4QOGA 3ZU6A 3EXG1 3DOOA 2ENUA 2FUKA 1QF6A 1PL6A 1J49A 3OUUA 3OX4A 3NXSA 2WC1A 5DYIA 1D6MA 4REQB 4AYXA 3G6XA 4W7IA 3DR3A 4XGKA 3U7GA 4TKVA 1F6WA 2VHUA 3OCJA 3DP9A 5JYDA 1TC2A 3UXYA 2JI9A 4KJZA 4J4BA 5KX5B 4KU4A 5FQOA 3Q7EA 5L7WA 3MQ4A 5G0VA 5T7BA 5JI3E 3PVCA 3HBMA 3W0LB 1NDHA 1N0VC 2Y1KA 1P7WA 2PO5A 4O7LA 3S1LA 1LA2A 1L8LA 5LYJF 2NU6A 4F3RA 1RXWA 4HG2A 4EI2A 2VH1A 3KB1A 4EI8A 1T15A 3JCZA 4HGQA 3WGOA 1ZETA 3TL2A 1CU1A 2JA2A 4MGYR 4RPLA 4LDJA 1PP4A 1W5FA 3KJGA 3KNZA 2F43A 4UTRA 4DV0B 1RYMA 4E3ZA 2V65A 3U81A 3IPXA 2WR8A 2WSLA 1Z0FA 5EIWA 1JH8A 4DIDA 3PNPA 4K26A 2HMVA 2XQJA 3I4FA 2UVVA 2D54A 4X6XA 3V33A 1NM5C 2I99A 3NMUF 3DVAA 2FW6A 1QHFA 5CB4F 1IOVA 1YB1A 3ZU2A 1MJGA 1MPTA 1FQOA 4GI1A 5F3RA 4DMHA 4X97A 1XCOA 2QL7A 3T5TA 1CY1A 4CIXA 4CBVA 1P3Y1 1Z2EA 1JB1A 3KHLA 3DM5A 1M6YA 3L7BA 3GJ6A 1I3LA 1SD5A 1GDHA 3WFJA 1L5RA 4MUIA 2HIXA 4ED0A 2YIMA 3CEMA 2XVZA 5C52B 1P8JA 1KS9A 2P0YA 1LF0A 2J07A 2HY7A 4TL7A 1G7SA 5J3JA 2QUZA 3EIQA 3ENWA 3PR4A 4RNCA 5K8CA 4PNHA 3FUVA 2Y1XA 3CPHA 1I94H 3N2YA 3H8WA 1KQNA 4ZJUA 4JR2A 2WFZA 1UXKA 2E4WA 4LZZA 3EAFA 5KG5A 1L5SA 4YPFA 2H65A 4XSVA 5JZBA 4GOOD 1H2AS 1UOOA 4ICIA 3UZUA 4HYEA 2O50A 2YDXA 4BNVA 1J97A 3FUTA 4DL6A 4FEAA 2Z2IA 2C7QA 1GPAA 1GGMA 2ZJ7A 3N40P 4P4SA 4ECTA 2DR0A 2C78A 1PJ4A 5ICFA 5CP8A 3CCCA 3WWOA 3NU1A 2GMWA 3DOUA 2WG0A 4DT1B 3V8QA 1YI8A 1TO1E 2DFTA 3W3ZB 5JG7A 4TXHA 4HOYA 3OUZA 5AIAA 4FFMA 1X7HA 2ZJ8A 5B4VA 2FSHA 4FDVA 1YOVB 3BHMA 4QYWA 3U4IA 2FXIA 2HGZA 4KN5A 4XVQA 1CP2A 3U16A 1ZSNA 5FAKA 4WGFA 1CC1S 1V9LA 1OW3B 4R2MA 5JCOA 3WJ1A 4GMGA 2YJ4A 4BE7B 1P2FA 3ND6A 1EGAA 1BOFA 3DE7X 4KLZA 3Q1LA 4PYNA 3EEBA 5KG6A 4ED2A 4ENTA 2IELA 2JLBA 1BFDA 2YIJA 4L28A 3GRCA 1Q0ZA 4R8MA 4D8TA 3IIMA 4UCRA 3O93A 3C3JA 2F3QA 4LGMA 1TCVA 2JAQA 1IZYA 3F6YA 2YUTA 3ZE8A 4CKXA 3GIPA 1TUIA 1OIXA 5FA8A 4NPAA 3SE0A 3PQCA 2TS1A 1WXEA 5C8VA 4IIUA 4FJ1A 5FFMA 1YMUA 4ZDKA 1UJCA 2H4ZA 3VV3A 4KQIA 3GLIE 4AMUA 1Y5RA 3K16A 3RASA 2F9MA 4TZKA 5D3ZA 4BQEA 1P4JA 4KXMA 2IE0A 3IBCA 2BFDA 3RRNA 1V7ZA 1ZMXA 1RFLA 1SN7A 4MROA 4MO9A 4Q7QA 1PS9A 4MV7A 3J7TA 2FR0A 3HSYA 3Q3HA 3I9FA 2ZTSA 5B64A 4YHBA 4PZUA 5L1JA 3A6ZA 4RKQA 1Z33A 2IUYA 4CCSA 3HJFA 1CDDA 1W25A 3KB8A 5HV6A 4BXOA 4BP9A 3X1MA 5BQ5A 1YACA 3LXUX 3KJHA 4U7JA 3GIJA 4MGKR 4F3CA 1J7JA 3FTCA 1BKSB 5H83A 1MDBA 2YVAA 2HF8A 1VPDA 1OWNA 4HGRA 1JS1X 3GLGB 1QK4A 3T7JA 8MHTA 4DMLA 5BN4A 1C3VA 3UQZA 3GGOA 1IXSB 1KXZA 1IZ0A 2F1JA 1NLMA 1K97A 1DBVO 1ZD8A 1OLUB 3QPAA 1MO3A 1RAGA 5EXTA 5KNDA 3ITEA 2WU0A 2PT6A 2Z3VA 2XCQA 5JXIA 5ECYA 4XUCA 1SUFA 3CVJA 2YWFA 2Y0PA 1UXJA 4KR2A 1YU6A 3WB1A 2REQA 4EENA 3JVUA 4FFPA 3BZBA 2AQKA 3N44B 2SECE 3M83A 3PFFA 2JATA 3TVYA 1AKYA 4W1SA 1EUDA 3EBPA 1L1QA 3V97A 1Z68A 1FDIA 2YN4A 1TM7E 4GGOA 4M86A 1JMYA 3GW8A 5FOQA 3IP7A 5MGNA 3PUKA 3KT8A 3RUDA 4JC0A 3PNOA 5K5EA 2ZR0A 1TM1E 4LK3A 1JHUA 1L4NA 3ZQJA 2BGRA 3E7PA 4KGVA 2PSFA 5BUQA 3TOCA 4ZU6X 2ZWAA 2V4QA 1BCSA 2KMLA 1C1XA 4TT8A 3SBDA 1CUJA 3JQ9C 1W49A 2VNHA 1OJ7A 3G2IA 2GN4A 4NYJR 2HI0A 4LV6A 4AKTA 1T3GA 3AIOA 1BKYA 3N7TA 4EL5A 1RRMA 1D0VA 2GZ3A 1RDFA 3OZSA 1WY5A 4A8JB 3FN4A 2EJWA 2VSQA 1J20A 5FTJA 2E4UA 3SNOA 2Y68A 3SFTA 2WIBA 1P62B 3DT8A 1XD2A 3P2EA 3HKZE 3NTLA 4O0LA 3HC7A 4R3WA 1D09A 5JAIA 3KEGA 4B43A 1R4AA 2P90A 2R6ZA 3LPNA 1D7OA 3HYTA 5KG7A 2IHKA 3D8SA 3D2CA 4X6YA 5IAKA 2ZSKA 4PAQA 5GZ6A 3ZV7A 4R31A 2HK7A 4DA4A 5FWAA 3UK2A 3Q7TA 5HNKA 4LQDA 3AUXA 1Z5NA 3I9JA 1UBRS 4CCYA 2D8MA 3CEHA 5IVHA 2I2CA 4NEHB 5GADl 5D2CA 5DYNA 3KL4A 2I2WA 5I5WA 3L04A 4HDAA 3BM5A 4UBNA 1Q1ZA 1GOTA 1I13A 1Z2DA 1WLSA 2GTHA 4NDAA 1ZCFA 4P4UA 3OTWA 1Y6JA 3RS5A 1QH1A 2VDUE 4JU8A 4CCAA 3H9JA 2NT3A 2IGTA 2HWWA 1AA6A 4E46A 3AVOA 4CETA 2CSXA 2NXJA 5NLLA 5E6SB 2AVNA 5KG4A 5DMHA 3T7DA 4G09A 3VVLA 1IC6A 3EDYA 1CB0A 4QC2A 3H2ZA 1T9BA 1YQXA 4P9NA 3MN1A 4TMVA 1G7CA 2AOWA 2Y27A 3RVQA 3O8OB 3P9KA 2NTYC 3EISA 1M5RA 1GA4A 1U4OA 3ESXA 1CEXA 4WXHA 1YQGA 5JW6A 5JBQA 3Q7PA 1DE0A 2GEUA 3GLHA 3L05A 3PFBA 4D9FA 1DWOA 4NULA 1P1RA 1RACA 3OICA 1RXVA 1JG3A 3T5CA 4EECA 2XVAA 2WP0A 4TL9A 1J2UA 1H3FA 4HYTA 4YP5A 2XAAA 4MPPA 3ZWYA 5EQDA 3GHYA 4MQ5A 1Q7RA 4CQMA 3KQNA 3RQIA 1UBUS 4ZT2A 4R54A 3W5DA 4JI3B 1T8PA 4FJ2A 4KE7A 3EAGA 4DTCA 1OZFA 4BFLA 3H0GA 3QIVA 2WFLB 2DFDA 2GSWA 4C3OB 2W9XA 4OF4A 1XJ0A 3ONNA 4MWSA 3ZQ4A 1H8EA 3F8NA 1YHZA 1GUDA 3FFBA 5MFZA 2DT5A 4U7PB 3U80A 2KPOA 2AFVA 3W6ZA 3BMNB 2D1RA 4ACBA 3V1LA 2JLUA 2AYXA 2FFHA 2I1WA 5L3RA 1MU0A 1KYQA 1XL1A 4G2NA 4YJ3B 5BVHA 4Q5IA 1J8QA 4G25A 4N03A 1PSDA 2V6IA 1J99A 4NV1A 4K6KA 3GJQA 5ARCA 1HI9A 2HK9A 4MMXB 1IG3A 3L4JA 4Y1FA 4XSGA 1F17A 4IICA 2C9MA 3P5BA 1C30A 4R3UC 3V1UA 4I3FA 2HKIA 1Z73A 2XCIA 1E63A 1P4SA 2IBTA 1JG6A 3ZHBA 3PQ2A 1M66A 3T1YH 4QICA 5DZSA 5KVVA 3VRHA 4MIKA 2R48A 5ICSA 2RB5A 1AMOA 1UK8A 1FLNA 2LTAA 3U3KA 3JQQA 4MQEA 3O21A 2CB9A 1C80A 2BE9A 5HQTA 2MYUA 1MIOB 2H7XA 1S9DA 1CS4C 2W2LA 5F23A 1ZGJA 4BRUA 2C2RA 2OZLA 1MB9A 1T5LA 2EGGA 2IU0A 5F1KA 1PWEA 4DRYA 3I9V6 2XYVA 4MCAA 5EJ4A 4TWAA 4BE9A 3GVXA 4G23A 2ZIVB 4E5MA 4OBBA 5JD5A 2E6KA 4HX5A 1RHJA 4HK4A 4OA8A 1XLWA 4D8XA 3HN2A 3N7AA 4OYLA 5JCXA 2ZUFA 1DTWB 2VXBA 5DGDA 1CX9B 2B5WA 2EBHX 3P27A 1DXHA 4IHJB 1UDWA 4RJJA 2PX6A 2VS1A 2W9AA 2GK6A 3WLFA 1KY2A 4UHKA 4XWTA 5FI1B 1NR1A 3KKNA 2XUIA 1SXJB 3S5JA 3LGXA 1E79D 4FT4A 1SKYB 3PFGA 5C5EA 3OM9A 2JFVA 4Y6PA 2XYQA 3HVRA 1DC7A 2HCRA 2YWDA 4CHIA 5F35A 3ICOA 5D3MA 3NOQA 1POXA 3X1DA 1SKUA 1E0AA 3RAQA 1PHPA 4RNNA 1K68A 5LWQA 4J9PA 1Q6ZA 1E8NA 3ZD8A 4UCQA 1RQ2A 5DBIA 2CL0X 2IODA 1KFJB 3VU0A 1G4UR 2OE2A 4L75A 1RRVA 2H0RA 2XOKD 2WHQA 4F2WA 3M34A 2OXIA 1NXTA 2ACWA 1GQOA 3F71A 4BC0A 3T4EA 3BXPA 3E5NA 1PGJA 1VTKA 4URYR 4R4JA 3IQEA 5C81A 1RCUA 1ZWLA 1THMA 1GGNA 1TCAA 3ISTA 3LXXA 4KPGA 1Z56C 1YVPA 3F8WA 4JR1A 4JBIA 2WWTA 3A6JA 3GOHA 3ZTYA 4LMAA 4DL5A 2ZRMA 3QG5A 4F5EA 3CF2A 3JWEA 2KBFA 4A10A 3GUHA 4B85A 4FMCB 3NBZC 3ENQA 2NU7B 4LF4H 4PX9A 3MFQA 4JT9A 4YRGA 4OAPA 5BRNA 3QVGB 1CS0B 5IDYA 1S8NA 5DM2A 2IDJA 3TR6A 3O8CA 2WINI 5BSVA 1R66A 4LISA 4GD3Q 5B6JA 1CV2A 4MQ6A 4AD8A 1NUHA 4AXXA 3KPVA 1KSHA 3N5CA 2BMVA 4AX8A 1PZEA 3GYGA 2BBTA 4D1YA 3RADC 1U0LA 4ENVA 2JBAB 3LQQA 1V16A 2WM8A 4J0CA 4XE5A 1GZ5A 1SK8A 3LULA 3PC3A 1Y1TA 1OBVA 3ECSA 3HBNA 5A05A 4M8SA 4LECA 4HUTA 4HAIA 3HJTA 4Z9XA 1PKEA 5T6MA 4QGGA 3UF0A 4U7WA 5KTNA 5IHXA 4Q34A 3CQ9A 3CZ5A 3E7XA 1GTRA 4D4LA 4DV1B 2QDKA 4OLBA 1IY8A 3HH8A 1RKVA 3K9BA 1PLLA 5FWNA 4MWBA 1XDGA 4M54A 4NDZA 3BE5A 3S1AB 5C4GB 1ODLA 1NVVR 4DV0H 3HKBA 2WWIA 1T13A 4J1TC 1YKFA 1ODIA 4QBGB 1WXXA 1NU8A 5KYKA 3JQFA 3CKLA 1DAPA 3BXGA 4OXKA 4RORA 3EQ7A 3HL0A 3ZHSA 3DAHA 2P5YA 4IILA 3AT1A 4GF5A 2Z4SA 4X95A 1S3SA 1WCIB 5BNFA 1JDUA 4HEA6 3EUWA 4RMGA 5DM0A 4HLCA 3W78A 2XCSB 4B47A 4JLKA 1N2ZA 5AJUA 3KSMA 4N0PA 3GEMA 3FOZA 4AUNA 3ZV5A 3VSCA 1SIOA 4G85A 2O0LA 2QUKA 4IQ8A 3A9TA 1GQRA 3QIAA 5IM4A 1W36B 4MULA 1SWVA 1RBZA 4KYIB 3T9BA 4X91A 1CFZA 5HF6A 4RGBA 4EKYA 4G0NA 2RHLA 1IH8A 1IN8A 1U2SA 3WLIA 1S8AA 1P4RA 2C59A 5DT2A 1E5DA 3DF9A 4XI9A 1P45A 1A9XA 2QLFA 3UHJA 4ZYLA 1V9PA 4A2BA 1TJ4A 4PXYA 3ZVLA 1ZISA 2PUVA 5TGTA 5DQHA 4C4PA 2CMFA 5EXSA 4P1ZA 1XVUA 3PENA 1AGRA 4U8HA 4DNPA 2ZXUA 1QZUA 4CEHB 1X80B 2JGNA 1COWD 2J5BA 2DQ4A 2C77A 1KZ1A 1ZVJA 3HZZA 2SHKA 1VPTA 4B45A 4YMHA 4FMDB 5CAEA 2P75A 5JCJA 5LU8A 5JDCA 3NTXA 1Y82A 1B33N 2PT5A 2XZDA 1RZRA 5I51A 1T26A 3UB2A 2P4QA 3H3FA 5KCMA 2QQ0A 4WFJA 3JRXA 3KWJA 2B0JA 4HJRA 4TQ9A 3VX3A 3S2ZA 5HCNA 1D1TA 2VTKA 3DDUA 1DAKA 2N46A 3DBIA 4JI0B 1SYXB 4KB5A 3TOSA 4FYKA 4AB1A 3WO1A 3CH4B 4G9GA 3V4VB 1DWQA 3BCHA 4TMTA 1ESDA 3V1YA 4IJUA 5CBPA 2IYNA 3F3SA 3F4BA 3DTVB 1EX9A 2NP6A 4I5DA 1NDQA 4OJTA 3ZGNA 3G85A 3QPCA 2CFOA 2DOKA 1KBZA 1T8UA 2RHMA 5TQ2B 3GC6A 1MA3A 4CM7A 3FPAA 3K9WA 1EUCA 3ZCQA 3SQOA 1DEAA 2HTFA 2FMTA 1QE5A 3ND7A 4JT4A 5SYNA 3PXCX 5LKAA 5G4KB 2V3CC 1ORVA 4DUYB 1YUNA 4PPFA 5TNXA 1C1DB 4YRKA 1MFPA 2JFQA 3E4DA 5BPFA 1JJVA 4QRHA 1SXQA 4Q44A 3QF4A 3AONB 1EI9A 1Q83A 2QLNA 1JJFA 2BHLA 2QP9X 1RMTA 1LQ2A 2AE2A 3IKVA 2VCYA 1AQYA 1M2EA 2YWVA 4QHSA 3LY8A 2WM9B 3G8YA 3Q5EA 3AXSA 1I5OA 4QGHA 4ER5A 3TEMA 1VIMA 3WL4A 4UASA 3PFCA 5C4XG 1CUHA 3FKQA 5LZ8A 4ZU3A 5F21A 2HA6A 5TJ9A 3WMGA 1KO5A 1FUEA 4TGLA 4XM2A 3WDMA 4V0LA 4B6QA 3QKSB 3RBAA 1OOEA 3ER8A 4MW2A 3LHSA 4OBWA 2Q49A 3VDNB 3CYFA 4TL8A 2L17A 4D96A 1TZKA 2ETVA 4MWGA 2EP5A 2QN7A 2VHWA 2H52A 1NIPA 2J9XB 4H1TA 2XE6A 4BN0A 1DQPA 3TQOA 5BWVA 1I5EA 4F5DA 2H92A 3DMRA 5F5XA 3H42B 4AWXA 1FZTA 3E8MA 1YJ5A 1VMAA 4BQQA 2A84A 4GOND 3HJNA 2HCTA 3NEPX 3B5JA 4QUEA 3EEIA 3QA3E 2V7QD 3RV3A 2W93A 5BPHA 2Y3IA 2RH5A 2JBWA 3UHFA 4JOBA 4AN0A 2B4KA 2N1MA 4ZREA 4XD7A 2O8VA 3T7TA 1Q91A 1O8CA 3MWEA 4MYCA 5JNTA 1VIDA 3TY5A 4K6GA 2GK3A 2X9VA 3FFTA 1Q6YA 1BHO1 2P6RA 3OZUA 3RANA 1ONSA 3Q87B 3KUKA 3E58A 2IIBA 5KYXB 4MS3B 3Q7SA 4DCCA 1H1DA 2OCDA 3N74A 3QLUA 1EGMB 4LY3A 2E2WA 4Q3DA 3QEJA 3K1ZA 1ZC4A 4MRMB 4UC0A 3L1UA 2OAP1 4LY0A 2YOFA 2K7ZA 2YHIB 1SMKA 3ZHCA 3MAGA 1LPNA 2E87A 1KARA 3U2QA 5GGXA 5AK3A 3UV6A 2JLCA 1G3MA 3ANTA 2P67A 1I9GA 3I9MA 4NFYA 5KTYA 3D31A 1TM5E 4JUIA 4K86A 2VTDA 2LNDA 2IUEA 4OXNA 5U4QA 4BOYA 1KY5A 3CH6A 1LBTA 2GD2A 3H3XA 2IE8A 2JH3A 4LYDA 1FRZA 2QK4A 3C6QA 2YV4A 4MW0A 2C03A 3FI0A 4NS1A 1EWVA 4WEOA 4OD0A 5FUQA 2XD9A 3U26A 1ZZEA 5IM4F 1U94A 1NAIA 1H2YA 3QFCA 4R1MA 4TRNA 1NVEA 3KYDA 3VNUA 1NRWA 3PE3A 3E9ZA 3VSEA 3U49A 1I6KA 3ZHUA 3U0BA 4LBZA 1AXEA 5D01A 1KZHA 3PGA1 5LBTA 4K9DA 1V9CA 3MXOA 1S2OA 1Z37A 1BWQA 3OWOA 5BWNA 2C42A 1SB8A 1T1IA 3PRHA 3OZFA 3FDFA 3GLFA 5BW4A 2H31A 3IA7A 3ACCA 5EJ5A 2UZIR 3NNNA 2RI0A 3MEQA 1JUDA 4MVJA 4BO3A 4D79A 1VL8A 2H16A 3PR3A 3M1IA 4H4EA 5DHTA 2JEOA 3GJSA 5I47A 3V4LA 3K6SB 2JK1A 1LRKA 3ILHA 4UHDA 4CN9A 2V7PA 4KN8A 2CWWA 2R7ZG 1J0XO 3PEUA 3NWPA 4QOIA 1XB2A 1ORTA 4PZEA 3EQ6A 2QAIA 4W4TA 4GMHA 2HIAA 1SZPA 4O3MA 4IVPA 1Q12A 3M9XA 3BIXA 1USIA 3F74A 2FDCA 2FZWA 4O2BF 2O1XA 3LFTA 5JATA 1RT9A 4FQ7A 5F73A 3ESBA 3RRMA 4PHTA 5E9JA 3QE3A 4ME6A 3IUJA 1HURA 3Q5GA 2X6RA 2VO1A 2CJWA 4MCJA 4TQUS 3CPJB 2Y0BA 5A4DA 5JUWA 4OKSA 1Q21A 3KQUA 4DL2A 1K7YA 2XZTA 5PNTA 2VDWA 1N2EA 5AHWA 5I4KA 3N86A 4RK5A 4DY6A 3RU3A 1KAMA 3D8UA 2Z5FA 3NHWA 3IULA 2O07A 1QOZA 2CK3A 2TMYA 3WG9A 4JI3H 4FX2A 4A3EG 3VR6A 1VGVA 4P08A 1PR3A 4D4JA 4RVDA 1YCGA 3CLKA 2OESA 1MO4A 4ND4A 5GVSA 5EYPB 1M54A 5KEIA 4AQDA 4MUAA 4J0IA 5AVXA 1DIHA 4WXEA 2WA1A 5BV7A 3CJQA 3V2IA 4LYFA 4U9UA 4Y18A 4PBSA 4QVGA 4DLWA 3BGVA 2JVIA 2ODTX 5LQNA 4IFTA 4B74A 2JGKA 4P5DA 4Q00A 1Y89A 3C97A 2D2IA 3D1LA 1XXHE 3OHSX 4YRNA 3NYIA 3RTGA 1JNYA 5IT4A 2A67A 1UFQA 4P34A 5FJIA 4F3KA 3U7IA 3FG9A 2CC2A 1BCRB 4EHLA 1DGSA 2HWUA 1DVRA 1DIOB 1YDGA 3TZBA 3D2BA 1BMDA 3BRWA 2VYVD 4YR0A 3VR5H 4Z4IA 4YJGB 4YMVA 3DTGA 3VOSA 2HOQA 3ISJA 5GJBA 1C14A 3VR5D 1F51E 1X92A 4JLDA 3OCCA 4UHBA 3GH1A 1GV0A 4MA5A 5LP6B 5EHNA 1M2FA 1H65A 1A8QA 1YR9A 4B4OA 5E6UA 2C2HA 1UOQA 5ALRA 3FPKA 3GFQA 1G8FA 4D6YA 1TKCA 1JQ5A 3ZYZA 2HDOA 4JS0A 3ONDA 3IQIX 1D5WA 1FRQA 2G4VA 1W94A 1UC8A 3CLVA 4N5MA 1SA0A 1Q7EA 3LMKA 3T9FA 3LQ4A 1QE0A 3AESB 2LBPA 4OHPA 4HH1A 5KSPA 5IT0A 1K86A 1CYDA 1L4MA 1G9TA 4YHHB 3W05A 1PVOA 2AZMA 3U7RA 5DX0A 3SYTA 3TK1A 2J6TA 2OM6A 2ISCA 4OX9Y 3EA0A 4IH1A 4F06A 1ZIXA 1WZCA 1P0CA 3D7LA 5HHTA 1EXVA 1ZR2A 1X7WA 3FWNA 3D8NA 1ZM9A 2JHAA 4UUAA 1G8PA 3VVCA 2Y1DA 2XTAA 2YJ6A 3B6MA 3ROXA 2VBCA 1XQXA 3R7NA 4HDSA 5KNCA 2BQUA 1OBOA 2PGXA 3ADPA 4JLSA 2VQSA 3TNLA 4MGIR 4G8BA 5LYJA 5BUCA 1RPTA 1IVNA 2IDMA 4HLUC 3UGJA 4UFPA 4RTPA 2QRGA 1T5TA 2HU8A 4HYQA 1T0HB 2FPSA 1IWBB 4RESA 4U2CA 2P41A 3M1LA 3QUSA 3MRSA 4QYIA 5BYJA 5LMZA 1DEXA 3I01M 1ZW6A 5EUMA 3U4HA 3Q3GE 1P29A 3WXMA 2B34A 3T7KA 4MPDA 2R00A 3NAZA 5K8LA 5K20A 1SCJA 5JSYA 4IJ5A 2JI4A 2PWYA 4F4DA 4UNPA 5DLDA 1DFIA 1JI3A 4OREX 5L4LA 4RU9A 4BP8A 2A92A 5CB4A 3GAFA 2GN0A 5KYUA 4HDOB 3T3HA 4UXJA 2A4KA 2J6SA 4Y6SA 4JJGA 3OHBA 2WZQA 3DZFA 2CVFA 4LJSA 2WT8A 1OKKA 4ODIA 1IN4A 1DCFA 3EARA 4RD4A 1M0SA 2ZB7A 1NFFA 5AHXA 3IJEB 5FADA 3PEWA 1JX6A 3DKVA 2ZIXA 2H6EA 2CDRA 3OZVA 5JISA 1DB3A 3RYIA 1N9GB 4IG4A 3GZNB 2LKCA 1QQBA 4CLRB 5FUVA 4FE3A 1U0OC 5CFZA 4XIGS 3K0SA 3SC2A 3CWCA 3F97A 1OBGA 4I19A 1F2UA 1SG0A 4TKUA 3N59A 1GGFA 3IDQA 3URKA 1XLTC 4NZZA 5AJWA 4MUNA 4EPWA 4X20B 5KJEA 2X8AA 4QODA 3WYGA 5A5GA 3HCCA 4OGFA 2GOYA 1YDEA 4TQSA 2KQUA 5E0KB 8OHMA 3D64A 1V25A 3DOEA 1PUIA 2UU9B 5COBA 4LH6A 3PGKA 3OT1B 1JKJA 2P9BA 5K6RA 1GDDA 4P3NA 5KT5A 1XNJA 2Y2VA 5DHFA 4DV1H 1YZKA 4UCOA 3L6BA 1QMPA 5EMHA 4CRWB 3PSAA 4B35A 3HM9A 4Y0VA 3JQPA 4EFDA 1U1DA 2DFKB 3R5TA 4LX8A 3NKLA 2F1IA 5FD5A 5L3QB 4X63A 4GQAA 3A06A 3DDWA 5GIOE 2YY6A 4YS6A 4KI0A 4LYAA 2BE7A 1T0BA 2HXGA 1ONPA 3EB9A 3N2LA 4EATA 2GQSA 3HTXA 3EIHA 1N25A 3PNSA 1MRNA 1TVMA 3PE4A 2WSBA 1UKZA 4G0OA 1LEHA 5ADWA 4F84A 2FPMA 2HPHA 4KX5A 1ZMTA 1S8FA 4A6XA 5A3JA 2P3LA 3U0GA 4IDGA 2X9NA 4MJXA 1QXSA 3VBCA 2XDWA 2Q6LA 2CDBA 1PLKA 3JQEA 2QAGC 3RSGA 4J9VA 3CISA 5HJ2A 2HF2A 4OGLA 4PC3A 4UEKA 4KRYA 1DPGA 3SS7X 4YASA 3HY3A 1ADBA 3Q88A 2C5FA 4LMRA 4MH0R 3LPCA 1TU0A 1T6NA 2DHQA 4XDZA 3MT0A 1DC4A 3H2GA 4H3SA 3EIOA 2BMWA 1E9VA 3VA7A 1RMQA 1NN0A 4PZ7A 4O1HA 1U2DA 2GPAA 3OP1A 5JPCA 2DTEA 1X9NA 3L7AA 1WOMA 4NARA 4N0DA 5L8VA 2ZBDA 3COZA 4KV7A 4IIJF 4DADA 4MS1B 2AJBA 1MOPA 2X86A 5DB4A 1TDJA 2WQ6A 4P5EA 4MX8A 3ONVA 4ND5A 4TX1A 3CA8A 1TOAA 1JAHA 2H1FA 5KYYB 2ZRDA 5CB0A 1CQIA 4WTOA 3ZJYA 3PLNA 4AROA 3W8NA 3HA3A 2JLYA 5A04A 1PI3A 3TXAA 3UWKA 3MAAC 1GPUA 5AXBA 1QNLA 1FU8A 4JI0H 3NRJA 3DE3X 2GILA 3H18A 1QGOA 3K31A 1BQ4A 4IUYA 2ZWOA 1Z0ZA 3W04A 3PF8A 5DWDA 4XLLA 1DOZA 4ILEA 1A50B 2R44A 5C46F 3SP1A 3E9NA 4NECA 3FPCA 1KMMA 3KT3A 3W5HA 4BQSA 4DV6B 2GHQA 1H2FA 1OLSB 2P4SA 4U2GA 4B48A 1ZXBA 2DZDA 1NRIA 4DAAA 2PKCA 3ECCA 4ZU1X 1GAWA 5JEDA 2A0WA 2IOYA 4ZCRA 1IIRA 4AKHA 4AWAA 2HPZA 3WX0A 3Q5DA 2I1QA 1LFDB 5EQJB 4JUDX 4PZ0A 4DUYH 2XGMA 1SOMA 1Y9JA 3JR7A 5HUQA 4AICA 2PWBA 4YUXA 4RAOA 2I66A 4YV0A 3K2EA 2Q2OA 4P36A 3S44A 3COSA 3N43B 2O0MA 1YQDA 5J40A 1SEIA 4ECUA 3V32A 1S0NA 1ZMOA 4WCFB 2IITA 3HCEA 3KYHC 2NUAB 3SS8A 2QQGA 1GPBA 5JVLA 3FXAA 1ML4A 5A1TA 4Q7KA 2VJBA 1VZ3A 2FQ1A 3CWZA 4P86A 4NOJA 5E1DA 1MZVA 3HU5A 1XJWA 4UBOA 3J80A 3UBMA 3QMVA 1TAUA 3WADA 1UPCA 4LJ7A 3O91A 2ZRLA 2Y05A 3AU8A 1K7SN 5DLYA 2X1LA 3BXEA 1H5UA 5ED0A 2V55B 1WETA 2PX4A 5ITZB 4PZ8A 4LGCA 1ZHOA 5IKPA 4DUZB 1TUGA 3TH5A 2W58A 3DBOB 2HDNB 5KWEA 5KJ1A 3NTVA 2NO6A 4AP5A 1NU6A 1WNFA 5L6MB 1ND5A 1GPJA 1HR0H 2AR7A 4D80A 4IMIB 3KTOA 2EX4A 5FNVF 1M1YB 2GHRA 2W2MA 5JSUA 3WAGA 4JT8A 3G2MA 3UMSA 1F1JA 4L5JA 2H4JA 4KFCA 4Q4HB 3LS2A 1V5WA 3T3GA 3QXHA 4OXIA 2A1HA 2GD1O 4C7OB 2AOUB 3WNQA 3LW7A 1Q3KA 1KEVA 2J1LA 3CRW1 2ARKA 4K6CA 4RVOA 2QMOA 2DPGA 2DXIA 4L5AA 4KUGA 2VOEA 2BGLA 4C4OA 2C04A 4S1VA 1YRWA 4X90A 3AMVA 1J33A 4FFOA 2OYRA 5AI5A 1PBNA 5AJYA 4EK9A 1FSFA 1XZEA 2G7MC 3PXEA 3ASVA 3SJ7A 1G55A 1CZHA 2ZTHA 3G0BA 3I73A 1KVTA 2ZJFA 5JHHB 4IINA 1R9GA 3RVKA 1E2JA 4BQFA 3PSHA 3BJRA 3NGLA 4M1SA 4RJIA 4YALA 4YCAA 3SKVA 3ZBUA 3K73O 5DGAA 1PKXA 1U3UA 3H99A 5IUKC 1VE7A 1TVCA 3RU9A 1TM2A 3RAXA 3HS3A 1QYRA 2JFZA 3L7DA 4DVGA 1YR3A 1ID1A 2GRJA 2JA1A 2W8KA 2E1RA 3VH4A 3L8YA 4BNDA 5DAAA 3JSXA 1OIVA 4ENWA 4MQBA 1JQ3A 3X1ZA 1HYQA 3RT9A 3H11B 4HQ0A 1JEEA 4Y2SA 5ALIA 4HSEA 2I7TA 4RB1A 1PR1A 1E3DA 2HA3A 4LDQA 5AUPB 4PF1A 3IQGX 3OJXA 3JQAD 5BSWA 4JITA 5IAEA 5K6AA 3H5NA 5JPDA 1OFVA 2JH9A 1RP1A 4XOUA 5LLDA 5IJAA 2BSQA 4DYDA 4TT3A 1RJWA 2VDRB 1R0XA 4DQVA 1S9FA 1ZM4A 2B99A 3OEYA 2YWXA 4V1CB 5L1KA 1Y37A 1ZJJA 2EJUA 4JB3A 3I37X 4GOJA 1XP8A 3RC1A 3W34A 3QTTA 3O92A 1JDTA 3GEBA 3QOFA 1P44A 3CZMA 4RS3A 1MZPA 4DSOA 2X8LA 3RS8A 5HUHA 4BUZA 1FJHA 2OGWA 4RX1A 2WE7A 3N0XA 1RRCA 1KOJA 4ZYWA 2B98A 4I5IA 2JB9A 3WRYC 4PQRA 2J45A 2QTTA 2VA2A 2G7ZA 4CMIA 3TLKA 4UHCA 2Q5JA 5JQGF 1AM4D 1IATA 3ZV4A 2H0AA 2QTMA 1YS9A 4Q1AA 3FUWA 4IGAA 2FRXA 3M7IA 2QP4A 4QTZA 4Z1MA 1JQAA 3L7OA 1UINA 3PC8A 2I67A 3HFGA 1JL3A 4J8PA 2ORVA 5AVKA 4J9LA 3ZE1B 5F1YA 1R6BX 2ET6A 4LJ9A 1XZDA 3DP7A 5AW3A 4JGIA 1SAYA 1C9KA 2ZZNA 1H1TA 4P22A 2C7OA 3UWMA 1GUAA 4PZ9A 3D6HA 3PFNA 2XNSA 1GTJ1 3GLVA 5IK2D 1EK6A 2NSJA 4IOLA 4UCTA 5I5XA 2F62A 1JLMA 2W8BA 4ZC8A 1D2AA 4FD2A 2ATXA 1FFDA 4J0EA 4CF7A 1QTIA 4GR4A 1BO6A 4L8WB 2B4AA 2DKFA 3OF5A 3QE4A 4MV6A 1QHSA 5BN3A 5L7TA 3BCUA 3GNSA 4EARA 3RPEA 2ON6A 5P21A 3QEMB 3FNRA 3EN0A 2CUZA 1J5EB 2EJ3A 2YZ2A 3KYIB 3L0IB 1OA0A 2PGIA 2I7DA 5TGZA 2ZI9A 1RWMA 3EVTA 4WBSA 1Q7BA 3L8FA 4M0JA 3BQ2A 5KPDA 3T3OA 4KQKA 4U9HS 2Z83A 1OPRA 1Q20A 3O7MA 1WBDA 1N2GA 1HDIA 4CJXA 3R24A 3GYBA 1M1XB 4EELA 4EG4A 5AOAA 2OHHA 1TA8A 3I5MA 4XZ3B 2LCQA 1BH6A 4YI5A 5GM2A 3CLRC 4S24A 4R41A 1JALA 1QAQA 5GAJA 4LTDA 3FYCA 1A7JA 4ZT4A 5AK0A 2QLLA 3BMOA 3EXG2 4OHMA 2WUWE 3QVVA 3FHCB 3IQHX 3DQPA 4OHBA 5DX1A 1VPWA 1NNI1 1OX5A 4E5DA 4MWCA 3KJZA 5CDFA 2XV1A 2VF4X 5BMVB 3HM2A 3E5HA 1G4AE 4TMZA 4ZTUB 2TRSB 3PWTA 4PNPA 1DBIA 4HNGA 3K5WA 1WUKS 4YJKA 2WB1A 2NYRA 2WG1A 2O6HA 4A2WA 3V6MA 3GFFA 4RZHA 1I50A 3B85A 4CKBB 3RC9A 2ERCA 4YHHH 1E5TA 4TM8A 1XAIA 2PLAA 2XQIA 4I6EA 3TBHA 3GRRA 1FNMA 2XMRA 4J90A 4RJ2A 1HDCA 3GRZA 2J32A 1Y8QB 4AM8A 4WUVA 3AB3A 1U04A 3F0TA 3V1MA 1UWVA 4J7AA 2IHTA 2QNIA 4QEZA 3EZ6A 3PFIA 3BULA 4Y2XA 3ZW8A 1Z26A 4NQZA 1Z45A 3MXTA 3NPAA 3ZD7A 4FFBB 1OFHA 2HRRA 1IN5A 5IJXA 4HWPA 5G3ZA 5IJWA 5HZMA 1E4EB 3GJXB 3K0HA 5JD4A 1YI1A 3OECA 2E89A 2EBWA 1G5HA 3VVBA 3JVVA 1FMFA 1Y4DE 4LY6A 1J2YA 2YZ7A 2JGDB 5EPEA 2W4QA 1OFIA 1FNCA 4IDDA 2X0DA 5DM1A 3O94A 1Z4KA 2VK8A 4A6EA 2ZXEA 2C61A 2FZCA 1AB5A 1F14A 1T94A 1ZG3A 5FLMG 5EP3A 2HHLA 1P5HA 4GYKA 3SX0A 2VPPA 5CVVA 1NWCA 1DAMA 4QZVA 5HX7A 4P3KA 2RGXA 4X64B 3FD8A 3LT4A 3PU6A 1MAAA 3A9UA 3SDZA 4Y6QA 2WU8A 1ZY2A 2WK1A 2CZGA 1YR6A 1A4XA 3RYFB 2UYQA 3J81A 2D4HA 3BFXA 4CT0A 3RVSA 4NY1A 8ATCA 4N40A 5K3CA 2WJWA 2R7MA 5GPBA 3UUFA 4BNJA 3HK2A 1NBOA 3L6EA 4QW9A 4E4YA 4OMUA 2VNSA 3E03A 3ULKA 4DCMA 3D02A 2X5KO 3WGTA 1CQZA 3VQTA 1K5HA 3O4HA 2OMEA 1PJCA 2FLWA 1LCIA 2JEJA 5AKXA 1QTNA 3PF9A 2K87A 3ESAA 4RY8A 3SDBA 4BZWA 4OLJA 4MWOA 3E0XA 3FTNA 5KKCA 3VZRA 4Q9LA 2ZJYA 4ZDWA 2VUIB 4FZJA 2PY6A 1U0NA 4YR7A 4XCQA 4A3GG 3HE3A 4CQNA 5CFRA 1ZGGA 3DVSX 1XRQA 5CIQA 3R3SA 3GJ7A 3STUA 3AEUB 4MB0A 4BNHA 1NV8A 1T3HA 3X1XA 1VKOA 1P3JA 3TBKA 3TTWA 5HKKA 3H8VA 3B1YA 5LNK1 4EA8A 2X7HA 2G9ZA 3KPWA 2WM3A 1B16A 2YW2A 1ZMBA 2KSQA 3KOWA 3GTPA 1CJSA 4DR2B 1M8KA 3OFVA 3DEKA 1Q0QA 3M1AA 3V3KA 1JHDA 2OC9A 1Q16A 2JIQA 3HUDA 1BQ3A 1PJBA 1UPBA 5FR9A 4O86A 1CIVA 1GKYA 3AYHB 3GY0A 5DKFA 4CMDA 2C4UA 1XRNA 5IP5A 4BLWA 2R6HA 1TADA 2VPXA 2QE7A 3HHEA 4CDMA 3UUWA 2NQTA 2O9JA 5JARA 3AKCA 2QI9C 5I8ZA 1PZGA 3AR6A 4M53A 4R6WA 2FMXA 5CH3A 4EW1A 2A1IA 4JLOA 3C87A 2RGDA 3B6IA 1ULHA 5TQ0B 2RIPA 2I4RA 2VQ6A 3GMDA 3KR0A 1PZFA 2A1UA 3O8DA 1M3SA 2FN3A 1IOZA 4G5GA 4DHEA 2OR3A 5I8WA 3GDGA 4KJXA 4AYTA 1DDGA 4NZPA 4INZA 5FP0A 4Z0TA 1IXZA 2XB6A 2XCPA 1MJHA 3KXYT 2BMJA 1DQZA 4KO3S 2EHDA 4OQYA 4D82A 4OLAA 3DZIA 4C78A 3DEHA 4AJIA 4WX2B 5HQ3B 2QNBA 1SVLA 1N3LA 2EZUA 4YT5A 2QRQA 4YAKB 1J25A 3AHHA 4V39A 3T34A 5EWJB 1CZKA 2OCKA 3WR5A 4Z3OA 2X4IA 4ZRMA 4MAFA 3OTOH 4N7MA 2RCYA 1XTQA 5ERXA 1KR2A 4KPUA 2WAQE 2CZCA 4EJSB 3IUBA 4L9AA 1E1QD 3OX2A 3OCVA 1W48A 5HIIA 1LZLA 2DSNA 1P2GA 3RUAA 4ES6A 1A95A 1H9CA 4EG0A 1EFVA 2JIBA 4G5XA 5IKEA 1G2PA 4ZKDA 1P7ZA 2I03A 3KKPA 1E9DA 5IWCA 3BQ0A 3MRXA 2YV5A 4DV6H 4GSYA 3KUDA 4H27A 3A2NA 2HFJA 4WADA 5A9SA 3CR8A 1G98A 3B5IA 4ZO9A 3ND5A 5I3CA 2C2MA 3EOBI 2PDAA 2RGWA 4TKMA 2WYOA 4AJEA 1XNRB 2ZETA 3IEMA 4ROTA 3TL3A 5DTJA 2JCSA 3O2NA 3MJCA 2BW0A 4KQFA 5HDBB 5BURA 4IV5A 1ZGBA 5DV9A 3ZQ6A 2UUAB 4YLGA 2EW1A 2W6JD 4PM4A 3OD1A 4EF6A 1SXHA 1G5RA 2QN2A 4DYHA 2R93G 2ZJ6A 4QIWA 2QRNA 4RO0A 2HR1A 4MYRA 2CKDA 4L78A 5FBRB 4M55A 2CHGA 1LGYA 4RCVA 4DGSA 3F5MA 3U3ZA 4FMBB 1T24A 3FWYA 2QR5A 3SHWA 3CZ9A 1AGYA 1VP9A 4Y2QA 3VPAA 3DLBA 4KXQA 1TJPB 1OLXB 2K6GA 3QE0A 3PNQA 4LHYA 4M1YA 2GPYA 4IIBA 1IFXA 1ND6A 2J3DA 2Y67A 3FR7A 1R0KA 3RU7A 2PL9A 1GPDG 4A6DA 4TKLA 2IXFA 3K9NA 4AZ3A 3EGWA 2P3OA 2LCFA 1GZ4A 1IXYA 4LQLA 2X0EA 4EYHB 3UKJA 1F2TA 1FVIA 2Q1YA 4GL2A 1T0PA 3OBIA 4DUZH 1M6VA 1YT5A 4OAQA 2Y1WA 4QOEA 1E3JA 3C3AA 4QJIA 2OXFA 2H29A 521PA 3CLHA 7ADHA 4KNWA 1C9DB 3MJSA 3CJTA 3M6VA 1JR4A 1VS0A 3ZHTA 5JSQA 1C3JA 1JIUA 2ISSD 1YRAA 1EKXA 4M99A 3DT6A 5IAAA 3H05A 3SE7A 1KVRA 4PU0A 4L73A 1S2LA 5H68A 4GGPA 1VKRA 1DU4A 3BPSA 1NX9A 1UEIA 4U2FA 2NAPA 3SVZA 5EHGA 4XPIB 3R5HA 1FTWA 5JUMA 3RV4A 3A1WA 1XU4A 4RAYA 5ALJA 4Q16A 2VRCA 2FK2A 4CF5A 1HPLA 4JJIA 1N6RA 1JQBA 5BN5B 3GUUA 3GGJA 5GINE 2B3TA 4JLPA 4UJ5A 4NJOA 1H8HA 1XG5A 3MS4A 1OWMA 1R0CA 2RGUA 3FUCA 3LQFA 3AERB 1VG1A 4A2QA 2QSYA 1PS8A 5A3RA 1GPMA 3A3NA 4JL5A 5HG0A 3THYB 3ZHZA 1JTEA 5IKOA 2G17A 3T7CA 3GMTA 1F0PA 1PZHA 3NUZA 4RHYA 3NYQA 3VU9A 1GG9A 3IS3A 2NACA 2RGAA 5K03A 3FNHA 2RJNA 1JWBB 4HUQA 1N3BA 4PV7A 3FB1A 2I62A 3K70B 1EWYA 4IM7A 5G02A 4BCBA 3ZWNA 3U62A 1EE1A 2GBCA 1WUJS 3UJ3X 1RI4A 1DRWA 4G9BA 5FO0A 4HVTA 4O2BA 2R4TA 5JADA 3A10A 1P9WA 3CRVA 1O1YA 1LJ8A 4EYGA 3AR5A 1PIWA 4KE8A 5FPKA 5DOZA 2FX2A 4KO4S 3SHVA 4A8TA 1G0OA 3S28A 3TGPA 4UULA 1C8LA 2G83A 3DL0A 2FEAA 4ECWA 3KVYA 1CW2B 2DFVA 3AYXB 3QK7A 4AJ9A 4DLYA 1TT5B 4ESEA 2X42A 4HNQA 5ARBA 4AJOA 1LNSA 5KI6A 3TZLA 4C0BA 4IFIA 1NQWA 5F4ZA 2E1PA 1M1ZA 1RQNA 2OB2A 3TZEA 3OIVA 1DIBA 5CD9A 1WKBA 3WOVA 3BS4A 1W1IA 3GEIA 3DAOA 4G26A 3A26A 4A0FA 1JKIA 1K1SA 1L7AA 2FVYA 1XMQB 2YH2A 3C98A 3VR0A 1BX0A 4MTLA 4C7VA 3OIWA 4C0LA 2O3SA 5DI3A 3L0BA 4MICA 1R37A 1LKZA 4ARUA 2ZIWB 4PS0A 4REOA 4BBAA 3E22A 5DLFA 1FXSA 2VJYA 3GPIA 1CQJB 5FDFA 3HOYG 3R3VA 2XGPA 1LDGA 1N5IA 3GLSA 4HTAA 4J2TA 1J56A 1FXWF 1TKAA 3B6EA 4RXTA 1U9ZA 2WAOA 2Q1TA 3FSGD 1IEQA 2CNDA 4ND3A 4HDMA 2AGQA 3NI2A 1SVOA 4H17A 3B1KA 2DTXA 2VYFA 3PPXA 4RVSA 2D2XA 2VTBB 3S99A 5ELLA 1AS2A 2AG8A 4ID3A 3H20A 4Q03A 2J87A 1QHHA 3LV8A 4QBHA 4XIYA 4X6UA 3HADA 3UV7A 4JEHA 5DLEA 4Z86A 3FFXA 2AN9A 1Y3DE 4RD2A 5DHSA 3KPYA 1PL8A 2MCTA 2QVCA 4JXUA 2VJLA 4JUBA 3EXEA 4M88A 1QU3A 2OG1A 3VC3A 1UT8A 3NHAA 2HIGA 3R8XA 1NVBA 2CVHA 3GRFA 2ZW9A 5B36A 3C5CA 2GJ9A 2BFFB 5AI9A 4B3JA 2AGOA 1L2ZA 1JZSA 1RHRA 4CT5A 1JR2A 2DBYA 2ZWIA 5EWEA 1N7HA 3FPSA 2CXUA 3FCUB 1FSSA 3BFVA 1AK1A 3RVOA 4XJXA 2FX3A 3P8ZA 2FP4B 5CEJA 3OLVA 2Q4DA 4ZA2A 4ZC1A 2X14A 1H6BA 2CFTA 1W46A 5AW4A 4E3WA 2DQKA 2C8VA 1O5OA 1K98A 1Z0IA 3K2BA 3M5WA 1JDJA 5LXTA 2C92A 4JIMA 3ZWCA 2B4TO 2YASA 1RQGA 1TB4A 1UBLS 4HH0A 3LCVB 5J23A 3IBSA 2YYAA 3VR1A 1FFWA 4BLOA 1RHUA 3WSWA 3OIDA 2X8JA 3DOHA 5H1YA 3QXGA 3JD1A 4O2AB 5TQJA 5CTAA 4E5SA 2PRJA 1TLFA 3AEKB 4EAQA 3MK31 5REQA 5KSWB 3CC8A 4JLMA 3MWDB 5KQSA 1AJEA 2GJ4A 3U37A 5DLGA 2GRUA 2IHJA 5DGBA 1CJCA 1QUEA 4TVOA 1LPPA 3QKRA 3CEPB 1LBEA 2IU3A 3INGA 2HMUA 2NN3C 2VRWA 4YUYA 4C29A 3SK0A 4QBIA 2FN9A 3W9UA 2DT8A 5EHIA 3NO4A 4LZLA 4C08A 3GP3A 3S2SA 1IZ7A 2JA5G 1K6XA 1FP1D 1EJ0A 3N8GA 4CODB 1V41E 4JH0A 1WNTA 2BR0A 3JAMW 4G0UA 1E7WA 1GG5A 4DJDC 5A7GA 2J7PA 4BZZA 3PHLA 3VO9A 3JY6A 1X7YA 4KKXB 2Q7XA 1GN9A 1YDHA 3TQRA 2R8HA 3MC1A 2P4UA 4DR4B 1J2JA 4FOTA 3C7AA 3KREA 3L93A 4G0YA 4CKCA 5C35A 5HW0A 4B2YA 2A4MA 1QFMA 3BK2A 4QAQA 4PWYA 3ETEA 2LP4Y 4YMUA 4C2UA 3PDJA 3MR2A 1U2PA 3ETHA 1MQAA 2OT3B 1KPGA 4TTQA 1J8FA 1ISSA 1XMSA 2C2BA 2IYQA 4R1OA 1NZDA 4Q48A 4AIRA 4HEQA 4C89A 1XIVA 4OKNA 2YX1A 3AY3A 4OUKX 4ECEA 3B9PA 1CRWG 2JD2A 4ZKEA 2CQYA 3S7ZA 3EK2A 4C0HA 4ZOLF 1UKBA 1U3GA 4NCNA 3FYHA 5EA2A 2G08A 5BOSA 2COGA 3S4YA 4X64H 4B7CA 4DA6A 2BELA 3R1IA 1CF4A 4QWCA 3WB0A 5HBGA 1F4VA 1C7FA 5DIFA 3GQBA 1W85A 2W90A 1KEPA 3TCKA 4ZN6A 3GLHE 3W2FA 5TC4A 1CQWA 4BGEA 1YE3A 2ORYA 3OZBA 3G0OA 3WGVA 2CVQA 5JLJA 2Z9CA 3W8EA 2D1QA 2PH1A 3HJUA 4G89A 4OMFG 3L0YA 1TEVA 1LQUA 3QLVA 1HYEA 3M9NB 4YPOA 2V6MA 4Y67A 4AY2A 3ZZTA 4HZIA 2WVJA 1U3CA 2DPJA 2PJRA 5SY4A 2PD3A 3ZD9A 4MYTA 2FGKA 1M2JA 1RWNA 5EJ9A 1Y1VA 3ERCA 4NAUA 4RB0A 4N65A 3GRAA 5LMCA 3PJFA 1G2QA 4D9KA 3GTMA 3KQVA 3TF5A 3PWZA 4HXGA 4UE6A 3MTGA 4NBLA 1RLOA 3TCNA 1MEOA 3KAKA 3IUPA 2Z2YA 1F0YA 3KTAB 3VH2A 1T3NA 4IIJA 3ZEAA 4LV8B 4YJ2F 3ZI0A 1SY7A 2H18A 2IY8A 3LCCA 5JI2E 2VQEB 4O8ZA 4I1VA 1YQUA 2X40A 3IDFA 3B51X 3KS9A 5F78A 1WQ3A 1MFZA 4I2NA 2FZLA 3MJ4A 1N7GA 4XYLA 4FINA 1GNPA 1FUIA 4ZOEA 1D6SA 3BDIA 1KWGA 3IURA 4IXNA 4RIIA 2CCKA 4RSRA 4KRFA 4ZEOA 3T9EA 1FQWA 3E7WA 3OU7A 5H3LA 4DR2H 4QDKA 3RUFA 3UYLA 2WSMA 1RJEA 1VLVA 4KSCA 2CUKA 4UUPA 4WCVA 4BVKA 3A6PC 3LUAA 3CIFA 4PLCA 1RPZA 3RQSA 4CZ2A 2J9GA 1NHWA 3ANSA 1JU3A 5I7OA 3O90A 2HAEA 3ZCSA 4RUKA 1SEPA 4R5MA 2WMNB 4WLUA 3N2KB 4BN5A 3KSRA 4C0QC 5BN1A 5FL3A 4KOEC 3MWYW 5JY1A 4ZCLA 3D6NB 2A9OA 4FQ8A 2Q4OA 1T4MA 3MQ2A 1ZAYA 3ESRA 1P81A 2DERA 5H80A 3B70A 1WWKA 2WIAA 4BFYA 1IM8A 1EX1A 3SVLA 2XZOA 1FOEB 3DT9A 3ODGA 4FIDA 2C1XA 2DFPA 2G9VA 1H2RS 3DBHB 5M29A 3HT5A 1B43A 1NMXA 1GU1A 6LDHA 4H1UA 4FDAA 4WY2A 4B6RA 4RVNA 4F4YA 1JXOA 2BJWA 3LDUA 2G0NA 3TLMA 2DR3A 4GKVA 4ITRC 3NJ4A 3BTOA 1WRVA 1SC6A 5A4KA 3N41B 4DMUB 3TZKA 1NXVA 5SYMA 5LXTF 1NJ5A 3OHMA 4BIMA 2NVOA 5JRZA 4JI7B 1BDJA 1JA0A 4Z2YA 3S7TA 4BCCA 2RKBA 1OWTA 2QUHA 1WXHA 4BNFA 4BP1A 1CUFA 3MJFA 3A05A 4X85A 1SIWA 2AEMA 4KYTA 4KKVA 5FHQA 2XGGA 4CKYA 2KB0A 3HDGA 1O97D 4HL6A 4TM7A 3E9CA 2IF2A 5LDGA 3VJLA 1DHTA 3DZGA 3VU1A 5ALSA 4FEGA 1RQLA 5FNVA 3TZCA 5IM5A 5ES3A 2AYZA 1XCJA 3NAGA 1OAOA 1HBJA 2P5SA 1QH9A 4I9HA 3GTGA 3TNFA 2BEVB 3WBJA 1VZ2A 3L2PA 3IEPA 5AI6A 2V98A 3F1LA 1TYDE 4A03A 3GT4A 3OQNA 4BO5A 2BBOA 2FW0A 3OM0A 4ZT5A 2G4CA 5DF1A 3EAQA 4L4ZA 1YE5A 3MWKA 4IX1A 2J4DA 3G3EA 4QGSA 4JMLA 4QOSA 4A9AA 1W9HA 3E9QA 3ORSA 5BW6B 4TXMA 1QCDA 3H5VA 3C14C 4CR6A 4D0LB 1K6JA 4Q9IA 4K8RB 4B6OA 2WMDA 4KN6A 4D5EA 1FQJA 4AYWA 1WHSB 3AVTA 4M7WA 3B36A 3RUPA 1HEYA 1FC0A 1N0HA 2JHFA 4UUNA 4JYMA 4EYQA 4X84A 4I36A 4BDTA 3BIWA 4RDXA 2QORA 2GNAA 2G63A 1HL3A 3E1GA 3PQ6A 3JAKA 4B87A 3JYHA 1CQXA 5ALOA 2C2WA 3O47A 5E3JA 2AW3A 3MTAA 1CVLA 4A0GA 4OSOA 5HE8A 4Z53A 1SHLA 5AKJA 4P8RA 3RHZA 1EA7A 1JSZA 2FZ5A 4OK5A 3TLEA 1OI4A 1F3LA 4R8VA 4RD0A 1KI7A 3OOSA 4G2TA 3L6UA 4MR7B 1Q17A 3KR2A 5A6SB 3T9AA 1JE0A 3NNDA 4OB6A 4HNAB 5T8KC 1OA1A 5E4FA 3CUTA 3HB4X 1APBA 1UJNA 5HJEA 1E79A 3LY9A 1R5BA 1ANKA 1C3OA 2EKPA 4D9IA 4P0TA 4K3VA 1P1JA 1GG8A 3K9FC 5KDLA 2VXYA 1Q84A 2R1TB 1KYWA 1QH8A 2ZU6A 7GPBA 5BQ3A 2YJNA 1X1BA 2EQBA 1JSCA 1OAKA 3IOBA 1QP7A 1YFKA 2R8GA 3CIOA 3V8MA 1W96A 2H1VA 1UBJS 3TX6A 4J9RA 1HDXA 4TVIA 2XOKA 2TMKA 3DL2A 2VAPA 4NYIR 5LP1A 2I29A 3W9YA 3G9ZA 4ASUD 1CIPA 3T5PA 3MR5A 4E2YA 3V4RA 1L5LA 3PL1A 1EM8A 2PTHA 2GA8A 2D1SA 1EFRD 2P4EA 2FKAA 4F2DA 5B7GA 4OM7A 3ANYB 2CFIA 3VZDA 2V0CA 3JQRA 3OAAA 3FYUA 2A0FA 5JNVA 1T29A 1X0VA 2R62A 2Q2VA 4P4NA 4JGBA 5JQGA 3E23A 3HVUA 4PX5A 3O8LA 4DR6B 5JS7A 1NKTA 1XKTA 4L7VA 4OTZA 4DAOA 2Z2JA 3DCJA 5HKOA 1OIWA 1NQOA 1WW3A 1Q1GA 1FYDA 1C2YA 4OOEA 3D8HA 5K8VA 1YFJA 3RS4A 4DXDA 4M1OA 4GXTA 1KE2A 1B0PA 5AI0A 3F2IA 4N5HX 1I3CA 3A2LA 2ZIEA 4TWZA 1A1SA 4FZ3A 4I14A 6NULA 3N7UA 2FG5A 1KVSA 1A04A 4MRNA 1GQ2A 1AD2A 5ALGA 3QUBA 3RK4A 2PBFA 2W8ZA 1Q1QA 3OQMA 1RZUA 1U2EA 2PNJA 4FTWA 3HP7A 2VUTA 4H1VA 3U9LA 3H1AA 4PG8A 1T2AA 2CBXA 4S3MA 1Z7BA 1ZXXA 3RM3A 4YBZA 4NCKA 3QX8A 2Z1DA 3I32A 5HF8A 3PEVA 5LMNB 5DNUA 4KWEA 1WUHS 4ED7A 5FL7A 3W4JA 2ZUSA 3LKVA 4F2PA 3QXSA 3Q9UA 2NVBA 4KXWA 1H6DA 1PFVA 3JTEA 1KMQA 4U63A 3L40A 5EINA 3CN9A 4V38A 2CLDX 5GZ3A 5CT8A 3BABA 3KSAC 4KV9A 2D1FA 1FTNA 3MINB 5M34A 4QDUA 3P4UA 3W90A 2Y1FA 2A9QA 1HLFA 3U7EB 1XDUA 5J5CA 2F48A 4Y9DA 4M36A 3VTFA 4XCXA 1SCNE 3RSHA 2YY7A 4DRXB 4B4WA 2UUCB 4WHMA 1ZVVA 3RFXA 1YAHA 3UCXA 4UBIA 4OYHA 4F4WA 1SFRA 1TEZA 3LRPA 2X0KA 1RXIA 3Q85A 2CW8A 4HPXB 2C96A 4LZWA 1QO0D 4B8ZA 4CEIB 4F9EA 1ZXLA 4APMA 4IUBS 4MVJI 5EWLB 1PJTA 1XI2A 2UXDB 2V4UA 4OL9A 1MX5A 1DAIA 4H7KA 4JBLA 4DNOA 4QECA 1ZK0A 3FTDA 1ABFA 4DLZA 3TI7A 4G65A 2DF8A 1OROA 2EFHB 2PMKA 3D7KA 3Q3EA 1Z88A 1SU4A 1JAZA 4KOAA 5LU9A 3BA9A 1IHDA 3UCFA 3CQZA 3N53A 4S05A 3H2JA 1S3FA 3DUWA 3OU6A 4RDCA 1WO8A 4NZNA 1COWA 2QJOA 4MI6A 3NIGB 3NHZA 3RRYA 5KU1A 3C1TA 3HXOA 3T0GA 1FZQA 3VYVA 2YN2A 1Q57A 2B5VA 3OA2A 1X77A 4E7PA 2FA9A 4N7JA 3OF3A 3EZLA 3RVDA 4MUJA 3JD4A 4U2KA 2Q1UA 3IP6A 4BNIA 4L4YA 5E4TA 5I7WA 4D0NA 3SM3A 4UBLA 3LT1A 4D42A 1S2GA 4U2DA 4RVCA 3PZPA 4V2IA 4L0CA 4WZ6A 4JXJA 1XEWY 1LNQA 4DLRA 1V0JA 2PSSA 2AEJA 3TEFA 4MRSA 2QKYA 2HRBA 3EPRA 1QC5A 1AS0A 3FLBA 1DAEA 1O94C 4EBDA 4GGMX 3MCUA 3M6MD 1F0KA 2C4NA 1DP4A 3IN5A 1IQUA 2Y1EA 4NICA 1O4VA 2QYHA 5IANA 3NC1C 4N4AA 1ISJA 3AOEC 2HJHA 5MN4A 1QNFA 1X8JA 3HYSA 1V48A 1YA8A 3WB2A 1E92A 4O2LA 3W5AA 3UC5A 1PW7A 2H2DA 2BLLA 3BFPA 3LHKA 3UC9A 2I87A 1S89A 1LBHA 2D6FA 3RARA 2E4ZA 4RA6A 4K9SA 3C6YA 3GX1A 3U4GA 1CUXA 1ECLA 1XA3A 2OCBA 1B0ZA 3BH6A 3H97A 1JLLA 4P0QB 3ZE7A 2TSYB 2ANBA 4LZOA 3VR2D 5F5LA 3ELDA 3EUFA 1NUPA 1UDAA 4LJ6A 1G64A 2D1TA 3RI3A 1ADYA 2ZUTA 1J0CA 1OH6A 4ARAA 1G20B 1GJRA 4JVSB 4OHYA 5AJHA 4IBOA 3ASYA 3DHNA 3IMEA 2FWPA 4M3NA 4NP6A 4LS3A 5LQRA 2NUTB 4OP3A 3MTQA 4YWHA 4D3YA 4UTOA 3DWFA 3ZNPA 4J6EA 1PFWA 3BIFA 4BGVA 1GWNA 4KLRA 1I3MA 2X8BA 1XQWA 4DR4H 1S3GA 4LY9A 3GLFE 3EJWA 4NK5A 4XDHA 1Z47A 1P2VA 5CEEA 2OBYA 3JALA 2VWGA 4KWCA 1M2OB 3QY9A 2J8ZA 1NTOA 4MVJE 3K0AA 2H2GA 3IUQA 4QAJA 1CNMA 4J16C 4N49A 4EBCA 4JEIA 4Q1DA 3I0ZA 1OCEA 4FS2A 2RI1A 1UMKA 1I2DA 1V6SA 4I7HA 3IDAA 1BG6A 2W43A 1GGVA <