3MWEA

Truncated human atp-citrate lyase with tartrate bound
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
424
structure length
424
Chain Sequence
SAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the citrate-binding site of human ATP-citrate lyase using X-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ATP-citrate synthase
total genus 132
structure length 424
sequence length 424
ec nomenclature ec 2.3.3.8: ATP citrate synthase.
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16114 Citrate_bind ATP citrate lyase citrate-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mweA01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mweA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 3mweA03
2NUAB 3AX6A 1EZ1A 4HQ6A 3WO0A 4XZ3A 2R86A 1DIKA 2NU8A 1CQIB 4O84A 4MA0A 4TV8F 3K5IA 1JKJA 2FPIB 4XX0B 1OBGA 3R5HA 1M0WA 1B6RA 2CNVA 1VKZA 2YV2A 1Z2OX 1Z2PX 4FFNA 4ZHQF 2OLSA 4O7LA 2P0AA 1CQJA 5LA6F 2W6ZA 5IYZF 2R7MA 1AUXA 4MV6A 1A48A 4Y8VA 3RV4A 4O4LF 3R5XA 4O4IF 1JKJB 3GIDA 3LWBA 2V59A 2X0SA 2ZDGA 1KC7A 2YRWA 2YW2A 2CSUA 2YZLA 4QSHA 4XZ3B 2V58A 1DV2A 1I7LA 4O7TA 1JLLB 1KEEA 3U9SA 2C00A 3KREA 3LP8A 2R7LA 5EZYF 4XX0A 5LXTF 2YRXA 3RV3A 2VR1A 4IIJF 3MWDB 2R7KA 1KJIA 4FE2A 4I55F 3K3PA 5K2MA 2FPGB 2CNUA 1E4EA 1JDBB 1EUDB 2PN1A 1GLVA 1KUTA 2NU7A 4FFMA 4O2AF 5J2UF 4EG0A 4Y8VB 5CAEB 5BPHA 3UFXA 1IOWA 2W6PA 1I7NA 1W96A 5JH7F 2Z02A 2FP4A 3HB9A 2CQYA 4MV9A 3PFFA 1B6SA 2V5AA 2DZDA 2I87A 4RZQA 5BPFA 2IP4A 4EGJA 3TINA 4YB8A 1DV1A 3VPCA 4MV4A 4FFOA 1IOVA 4MV3A 3VMMA 3R9RA 2W6QA 4HNUA 4O83A 4HR7A 1GSAA 2DIKA 5JVLA 2Z04A 5C8YF 5LP6F 3SE7A 1SCUA 4FFLA 2FP4B 3HO8A 2GQRA 1PX2A 2XCLA 2YZGA 3MWEB 2SCUB 3G8CA 4M9UA 2NU9A 4HNTA 1CS0A 5JQGF 4XYMA 2R87A 5C1OA 3KALA 3N6RA 4O7RA 4TV9F 3ETHA 1CQJB 4EGQA 2VPQA 4YB8B 2DLNA 1T36A 4YJ2F 1JLLA 1KBLA 3ETJA 1WR2A 3TQTA 2QF7A 3TIIA 4ZI7F 1SCUB 3VA7A 4DLKA 4O81A 4O7NA 2ZDQA 4I50F 2YS7A 4XYLA 3BG5A 4NYEA 3U9TA 2DWCA 3OUZA 3ORQA 4C5CA 1A9XA 5KX5F 3TW6A 1JDEA 1E4EB 4O7WA 1VBHA 3MWDA 1GGOA 3MJFA 2CNQA 4FFRA 1KJQA 4O7ZA 4IZOA 1KJJA 3JRXA 4I4TF 1CE8A 5C1PA 3KAKA 2GLTA 3WNZA 5LOVF 2R84A 4MV1A 4YAKB 2CZGA 2YL2A 4IHJF 4MA5A 4C5BA 3E5NA 3OUUA 5FNVF 4TUYF 4YBZA 1BNCA 5I47A 2FPPB 4FGRA 3UFXB 1C3OA 4O82A 5HV6A 3R5FA 1KJ9A 4IWYA 3RFCA 3V4ZA 2QK4A 3RUPA 1OBDA 1Z2NX 2NU6B 5DMXA 4DIMA 1UC8A 3VPBA 4FFPA 3GLKA 5GONF 1KJ8A 3NUAA 5HBRA 2YZNA 2WYOA 5J2TF 4O4HF 5CA0F 4YJ3F 2NU6A 2YV1A 3TIGA 3K5HA 2J9GA 2FB9A 1M6VA 2YYAA 3JZIA 2FPIA 4O7VA 2GPWA 2YS6A 3U54A 5JQWA 4MV7A 3MWEA 2YZMA 4XYMB 5H80A 2NU9B 1EYZA 1EUCB 4ZOLF 3JRWA 2GPSA 4WBNF 2HGSA 2I8CA 2NUAA 2YWVA 3KAJA 4IWXA 4YAJA 4O4JF 1M0TA 2W6NA 3AW8A 2ZDHA 2R82A 5LYJF 3VPDA 4HNVA 2I80A 3VOTA 1AUVA 3HBLA 2FPGA 3Q1KA 5CB4F 5HBRB 3DF7A 1C30A 4MV8A 3V4SA 2NU8B 2W6OA 3WO1A 1W93A 1EUCA 3JZFA 5CAEA 1ULZA 5D8DA 4O86A 3DMYA 4L1KA 4O7SA 4WD3A 2R7NA 4C5AA 5JVDF 4YAJB 4ZQIA 4O7YA 2XD4A 5BMVF 3G8DA 2R85A 5CA1F 4XYLB 2PBZA 1EUDA 2W6MA 2VQDA 3Q2OA 1CQIA 1BXRA 4YBZB 2W70A 2FPPA 5KKNB 1OI7A 2PVPA 4O2BF 2HJWA 2R6FA 1GSOA 4YAKA 1EHIA 4FU0A 4ME6A 1PK8A 3ORRA 3R23A 2GQSA 3I12A 3U55A 2NU7B 3N8DA 4MAMA 1GSHA 2W71A 4E4TA 1UC9A 1VBGA 2SCUA 3QFFA
chains in the Genus database with same CATH superfamily
5EUCA 4GOMD 1BWSA 2NUAB 2ZAGA 1EZ1A 3GT7A 1DIKA 2RI0A 2NU8A 1OLXB 2CL5A 2DY1A 3LY8A 1F2DA 3N0XA 1RYZA 1CLUA 2PJUA 4R83A 3F3KA 3NOOA 4MQ6A 4C6HA 3AFNA 3D7LA 4FZ5A 4ETIA 4ZICA 1NWCA 3WGVA 5IC6A 5KTOA 5TEVA 4A9AA 4DYHA 3KXIA 2ILVA 5DK6A 5TQ0B 1H2XA 3RHFA 5BUCA 3FB1A 4BNXA 4D8TA 3F1LA 3MQ2A 4D7AA 5PNTA 4HWKA 4JJFA 5FBHA 2WF9A 5IK2D 2E4VA 1TVKB 3U56A 1JIQA 2BELA 3IE0A 1ODKA 1OT3A 2ONZA 1XD2B 3GU3A 5AM2A 3B6JA 3VU9B 1XXHB 2FFRA 1PUJA 1EE1A 1X2BA 1WRVA 5KG2A 4G0QA 4RTSA 4GMHA 5DE3A 1KVRA 1TZCA 2X13A 4J9LA 4M86A 3FIJA 2VATA 4YROA 4BO1A 3ADCA 1L5WA 4KTVE 1GADO 2ZPTX 3DAAA 2B5WA 3FZEA 2ZE7A 3L9WA 4GPAA 3COWA 3QKSB 3OTOH 1PQUA 4MGHA 5J40A 1C7RA 1AKMA 1FTNA 3R7BA 4X63A 3QPWA 2Z6QA 2MSNA 1F2VA 4G0UA 2P6OA 4BXOA 5LMUH 1PBNA 3DZGA 1E0JA 2D7JA 3HVIA 1R8QA 1WEHA 1VL0A 1WUJS 3I5MA 4AJ2A 1QV9A 2AEJA 3T1HB 3PWZA 1H0KA 3CVZA 3RBZA 4DG5A 4PLWA 4LOKA 4CMCA 3BWDD 3CTMA 5DBIA 3OMWA 1ZW6A 4C7VA 4RD0A 4K2AA 1MX3A 1VM6A 2J3LA 2XQKA 5DDIP 1GQFA 5EJ5A 2FSVA 4NK4A 4ZT3A 5K8VA 1VCIA 3R6DA 2Z98A 2CHFA 3GIDA 1ZUHA 5JYBA 1N2ZA 2FUG6 3V6MA 2JA6G 1NQTA 2VHWA 1SAYA 3QMMA 4FDUA 2GERA 1FX0B 3Q3HA 4CQMD 2X0JA 4EB0A 2O8CA 1ESNA 1Z08A 2A7XA 1TC2A 4FEYA 3QE2A 4FYYA 5JYEA 5KTRA 3Q7SA 1KH3A 5ADVA 2QGNA 3HADA 1SD2A 1VRVA 1X92A 2G1UA 2IZOA 3JWIA 5BUQA 3V1TC 1FTGA 3RI3A 3GG2A 4LFCH 1DPGA 4GIBA 1UBKS 4PANA 3WLHA 5BW5A 1K7SN 5C32A 3D3KA 3MIIA 4F12A 3HZOA 3IQDB 3UJDA 1SVLA 3AMVA 3QFRA 4YDSA 1K7XB 1PAUA 1XPJA 3DBVO 1HEYA 5HYVA 2XTMA 4JOSA 5HGXA 4H7IA 4Z4QA 1EG7A 1GILA 2Z8XA 4KE7A 1E5DA 5AOVA 3NBQA 4KXUA 5AVVA 3N0WA 3IR7A 1Q3HA 3IH5A 5MGNA 3MWDB 3K9LA 2A2ZA 4ZPJA 4OL9A 1CRWG 1KVTA 1PL7A 4MUJA 3QF4A 1DUVG 1PDOA 3L1JA 5JQGA 1NX6A 4RYLA 4LSAA 1QIGA 1HEUA 2B94A 2ZRDA 3RAPR 4DILA 3BFKA 3HJFA 3SC2A 4BNJA 4WCDA 3WNCA 5EOVA 1ZOPA 4O4IA 2Q2QA 5HNKA 2Q5HA 5T6BA 1XTSA 2J3QA 1KNQA 2YHSA 5EJFA 5HF9A 1G5QA 3W8EA 2HWXA 1R6DA 1J5XA 3D43A 3F8TA 4CG0A 4K03A 3CVJA 2OSBA 3IILA 1WXFA 3RS0A 2FJUA 4UCWA 3FMIA 3OWXA 2XDQA 1AKTA 4MPTA 1PP4A 4YAOA 3ZWYA 2NU7A 5T41A 3DEYX 3CUSA 4BQRA 5HWSA 1RMTA 5K3WA 2B1RA 1PCXA 4HEHA 4IIFA 4UVGA 2ZUFA 5CAEB 3FTNA 1IJEA 4BU1A 4LBVA 4FZRA 1FTQA 1KZ9A 1H4TA 2BAGA 3BJMA 3MR2A 4F4YA 2OP0A 3N8NA 3DKRA 3U1VA 4PCUA 3ZCXA 4EG6A 1FJ2A 4EG8A 1A9PA 4G0YA 4K0KB 3UWPA 3Q5GA 3CMCO 3GGSA 4L5JA 5C37A 4DYDA 3EXEA 2D0DA 1REQB 2V5AA 1H2FA 2FG5A 3V4LA 2ZT6A 3DOCA 4LZPA 5EHGA 4B5KA 5CDYA 3HXPA 1QGOA 1ML4A 1GKKA 1C4WA 1ZI9A 3LYLA 5AMXA 3M4JA 2NVUB 4BLPA 5F3DA 3AGQA 3PX3A 3PQ6A 5BN5B 1LH0A 1SCBA 1SIWA 2HMYB 3LT2A 5DX1A 2GF9A 2P3SA 2GI4A 1FZQA 4UCOA 1IN7A 2YYZA 3DAYA 3FFWA 3NKVA 1BOFA 4K3UA 3LOQA 3NWOA 4Q9AA 2HF8A 3IMFA 5FUXA 1PR0A 4TWAA 4AWBA 1Q7TA 3LX4A 1U2GC 4ZU6X 1A8UA 5L3QA 1CULC 1J9EA 5CYFA 2DULA 5AKKA 1YR9A 3RQIA 5DN6D 2V65A 4F9TA 2DIKA 1DUSA 1T4GA 1MORA 1MZBA 3LBYA 5AKIA 2Z04A 1KVSA 3IUPA 2NQ2C 4X97A 3ZBTA 3I76A 4Q1BA 2HF7A 3UXHA 4ETMA 2CMKA 2O23A 3VMFA 4UEWA 4H7HA 3JWHA 5JCZA 5KYYB 1UP7A 2ZYHA 4HRVA 4KN6A 4J9MA 3OIDA 3KLPX 3QWBA 2B2CA 5JNSA 3G6XA 1W4AA 3ZZUA 5I4CA 4CMHA 1PZFA 2ABWA 4MB0A 1N5OX 2L82A 1V6SA 1Y7LA 1V5EA 2IUFA 3FUXA 4M9UA 5K0BA 1CUBA 1LTKA 4D43A 1F5NA 1EUQA 5BYKA 1GQ2A 4MHTA 4Q1CA 1O6CA 3V1UA 2H7XA 5FBQB 4I36A 5H83A 5EIEA 1TYZA 4QEZA 1EESA 3MPOA 2PV0A 1F38A 5JS7A 1EUZA 5F9LA 3A4NA 2J6UA 2ZFUA 3DNPA 2AGOA 3EBLA 1R16A 5K0FA 3DVRX 4G26A 1NLZA 3W9BA 2UVRA 4FJ0A 3NDIA 1U5BA 3ZKWB 3N6VA 3EIQA 3SIWA 1BFUA 3JWEA 3TRKA 4ZVLA 4ECSA 4YB8B 1R0KA 2IYWA 3H8SA 4PPYA 2DTDA 3SSAA 4DQLA 1U2TA 4BBRG 3L0BA 1ZUNA 4TZ6A 4LRSB 1NLYA 1JFFA 2FDXA 1KMNA 2HSEA 5M3BA 4A10A 4UPDA 1RQ2A 2EDAA 3MJVA 1RYRA 4KITB 1IRXA 2ZSDA 1GV0A 1T3NA 2HDWA 3BRQA 4X90A 5BOSB 3KTFA 2CNLA 1YVRA 1KBLA 4FYIA 2ODEA 2HRBA 2FPSA 1Q11A 2C2YA 3ETJA 3UZOA 2R66A 3GUUA 4HGNA 5E1MA 1XJ5A 2I4NA 2CFMA 3MTEA 3SR3A 4PAMA 1GTRA 4L0DA 4JKYA 4Q1DA 5G0VA 1SCUB 3UAOA 4J4TA 4PLZA 1M34A 1QPBA 4MWTA 5ALZA 3ZCRA 5FH9A 2H08A 1SU6A 2YV5A 4QW9A 4G4SP 1QQ5A 4DV5H 2F62A 4IUDS 3HK2A 1Z2AA 3B3AA 4TSRA 1RBYA 2YS7A 2DWPA 3QWUA 3AXTA 3ESBA 3NONA 2AI3A 3W9UA 3GXOA 4X6YA 5GIPE 3M34A 2RJOA 5KNBA 5KFFA 1ODTC 3O90A 4CHGA 3PUKA 1JIIA 4RPGA 3SF8A 2ZIUB 3AR4A 1N7HA 3FSGD 3EIFA 1TEXA 2VQSA 1CIVA 3DFZA 4RF4A 4BMSA 3SHVA 4DJEC 1IPFA 5JC1A 2R97A 4OHRA 4UNRA 1G6OA 1V5IA 4WLEA 3L1HA 2GARA 1L5OA 5DX0A 4WKPA 2B20A 2ZU6A 3DKIA 2XNCA 1UFOA 3G8BA 4GKAA 4UM8B 2I33A 3SEQA 2R93G 2WJWA 2DCUA 1TNDA 4XOIA 2FW6A 1Y3DE 4CQLB 5B64A 3KJXA 1PK9A 1VBHA 3M33A 1P62B 2DE0X 3MJFA 5BOSA 3ZDBA 2XADA 3BB3A 4OMUA 1FDRA 3HB1A 3A9VA 2DAPA 4WBNB 3FAKA 4TT3D 5FPOA 1NI3A 2MR6A 4IJUA 1BH2A 1SCNE 4KJZA 4EYSA 5JVDA 2VT2A 4DCPA 5KHLB 4IX1A 2FMIA 4RPIA 5CLJA 2JAUA 3DDCA 4U8HA 5KFPA 4B7UA 5JDIC 4HHEA 1TWAA 1K98A 4IDOA 4ZT4A 2JZNA 2QPOA 1QK3A 1K9SA 2ZIZA 4M55A 1MFPA 4A82A 1BFDA 2NVOA 4HB2A 1OZ0A 3UQZA 5LOVF 2AK2A 2V4ZA 3K9HA 4CLRA 1IEXA 4MV1A 4DVGA 1PD1A 4L5CA 2QJOA 4Q4JB 4GF5A 4IAOA 2H52A 2J9FA 3Q88A 4ZAXA 2Q46A 2JGMA 3L46A 5C5JA 3B3JA 3LX8A 1ONNA 5EWJA 3TX6A 3IAXA 2BE9A 4E5MA 4MUMA 3H9QA 1ONOA 1RQGA 1U98A 1WV0A 3P26A 4AQDA 5CHYA 2Q5IA 2QNRA 3B12A 4FFBA 5CITA 4FGRA 3BHMA 5FOWA 3STUA 5IFLA 1O03A 1DIRA 4H4DA 5C4GB 3FLEA 1G64A 2ZTLA 4KW7A 2WAAA 3WFZA 4A2CA 3ZCQA 4DCMA 1A2QA 4NTZA 4D9JA 4CM7A 4CIAA 2CVHA 3LU1A 1T3HA 2LCIA 3L2OB 4P5DA 4RGBA 5AM0A 5E7JA 4IXNA 3D8RA 4N0PA 4UUQA 4TN5A 2WWYA 1SN7A 2CFTA 1QIHA 3KVRA 1IBMB 4KR6A 4LX8A 4GRDA 1B0UA 1OBOA 4RMJA 5H7XA 1Q22A 3UICA 2C84A 2RHLA 3K31A 4FMBB 3ZDYB 5KNCA 2GN9A 1BS9A 3AHFA 3LKZA 1U4SA 3KZOA 2ECFA 4M4SA 1XEAA 4RH1A 1F4LA 2RHOA 4KODA 4WCFA 3NATA 1XZPA 2QL5A 1UC8A 1KR2A 4BFTA 3I30X 4BWYA 1JP7A 2WKRA 3HHEA 2BQ3A 3FTCA 1QBGA 2YVAA 1MPTA 3GUYA 3OBBA 3BM5A 3O2SB 4TMYA 4RK4A 2OQVA 2XCRB 2PKWA 4CF3A 3WGJA 2CVOA 3E9NA 3IKVA 5K6AC 4DNOA 1KQPA 3EGDA 4OB6A 1UBLS 4OXKA 4OB7A 1OLUB 4JYAH 4ZO9A 4R1NA 4HFMA 2C92A 2X23A 1GITA 3ZHCA 1G2PA 1C7FA 3KYCB 5CP8A 5C3MA 4P08A 4Q44A 1DKRA 1P7CA 4KO1S 4LTNA 4DMFA 4AO8A 3PNOA 1FOEB 3N2IA 1CY1A 3FTPA 5AXCA 4MJLA 2FMTA 1N3LA 3PKJA 2E3JA 3ZQJA 3GNSA 1UBUS 4PX2A 3OURA 4ZV7A 1FSZA 1JNYA 1YRYE 2ERXA 5AVZA 5FLXA 1ZMOA 5TMEA 1PVVA 1ILWA 1GNTA 1KDRA 1QHHB 3AF1A 1RIIA 5LJIA 1YZNA 4Z9AA 3EIEA 2XI4A 2C78A 1R0RE 3M81A 1R4NA 2NT4A 1H69A 3E3AA 3SLGA 3IALA 2Q9AA 2DR2A 1P16A 4ASUA 1X2EA 2W2VA 4ENRA 2V3WA 1ISHA 1ZCBA 5ES3A 2XWJI 4BFXA 4Y9DA 1P39A 3O4HA 4TLLB 3A4IA 3H1BA 4N0DA 2EAUA 3L8FA 1AHIA 4GXTA 4HN2A 3HDYA 1J97A 5KJ6A 3L18A 1F60A 4IMIB 4XQ9A 4J9SA 1ZONA 1QGED 3C45A 3QBDA 3ILYA 1XIVA 2KYRA 3OQJA 4BLRA 3DOJA 1U2DA 1MCZA 1M72A 1R00A 2D7CA 2DQYA 2FTKE 2WV7A 2ZITA 3G5LA 3R24A 4I9NA 4XVRA 4MB6A 4R6XA 1BDMA 5A4IS 2SKDA 4TRMA 2W2KA 1DQRA 4KXYA 4YUZA 3W90A 1GO3E 3TCKA 4NMWA 2X0DA 2YMMA 4H3VA 4DN6A 5ILOA 4OU5A 5LP1A 3VZSA 3U44B 3AIKA 4QFBA 2PGOA 1IZZA 3WB2A 2EFJA 1KDPA 2AD5A 1HXHA 3AF5A 3ASYA 3B1YA 4L27A 3S0JA 4N3GA 1VJGA 4YCDA 4AJIA 1A8HA 2WLSA 4ZO6A 5K3AA 1NW7A 2CLDX 4PC7A 3FYUB 3IA2A 3IEXA 5DWQA 3IXLA 3WL4A 3ZCSA 2CE7A 2M32A 3SOPA 2DKFA 4NAHA 4TUYB 3D0OA 1T8PA 1FJHA 3G2QA 3LP6A 2IX3A 1HYHA 3TY9A 2FKAA 2JJMA 3Q7QA 2XWSA 3NBFA 3DV2A 4WKCA 1BX1A 3QOXA 1W0KA 1WMSA 2J48A 3GROA 3P97A 4IKEA 3FH0A 4G97A 1JQAA 3R8CA 1IZ0A 4LAFA 5KNLA 1JAYA 5A6SA 4ZC1A 2WU4A 4FTWA 3ROKA 4DMKA 2JLYA 5SV2A 3F6BX 1EP1B 3Q3VA 4ED3A 2B7LA 3ZY5A 3ZBPA 4E2FA 4DHWA 1QE5A 4JI8H 1M0SA 4G07A 4X3OA 4WA7A 4YA6A 2YKGA 1KAQA 5KNCH 3KQOA 3MYYA 4ZEXA 5KT5A 1JSRA 5EHIA 4E5YA 1ARZA 4G37A 1B2LA 1DDIA 3EEQA 3IJPA 3RUAA 5BV8A 1DEAA 4HH3C 4LZJA 2HYIC 2I2DA 1OX4B 3FTEA 4MIEA 1V16A 2HJRA 4EBBA 3QKSA 2E1RA 2R6FA 1PJBA 1Z8DA 3MLAA 2JD1A 2DYKA 3VTFA 1CEYA 2QRMA 2PNFA 3KQHA 3ACDA 4ODIA 1U7HA 1N6PA 2IOQA 2NNLD 3EODA 2DH6A 2FX5A 3VKUA 1KJWA 1IE3A 3PJGA 4LNAA 3NEPX 5IT9W 1M1NB 2HPAA 2NVWA 3LHKA 5FO1A 4EKDA 1VSUA 4OLJA 3ZVKA 1ORWA 4IIYA 4QDTA 5LP6A 3I09A 3U55A 4NJMB 4Z4HA 2R92A 4M9SA 2BM9A 2I7XA 2XRFA 1WM1A 2P9QA 3RRJA 4IF4A 4F93B 1V5FA 2GPJA 1WHSB 1SUCA 4V1CB 5JD5A 3R0QA 2I2CA 2P8JA 3HYCA 4EYQA 4CNQA 1X1BA 4IV5A 2I4OA 4IDGA 4FWIB 4JSYA 1CRLA 4ER3A 4PYNA 4G41A 3FDSA 5JCOA 2OBYA 2ZQ5A 3H0CA 1RAFA 2RGWA 1XK7A 2R62A 1BVHA 4GPZA 3KQNA 3OX1A 3C1TA 1WKVA 2OZLA 4M8KA 1UKZA 2C9DA 3AB8A 3B6KA 1JPJA 3EOBI 4B6OA 1LBHA 4Q7KA 3RLFA 3GLIE 1QRSA 5D51S 4B35A 1ZGAA 3D6HA 4XYBA 3RUIA 2BFBB 3EWNA 3IRVA 4S1PA 4R7GA 2NYVA 2BHLA 3TB4A 1I9CA 4I9FA 4YJKA 4DKJA 4J0MA 1X74A 2IWHA 1DBIA 1FXUA 3CLRD 3JY6A 3C5VA 3R5HA 1CY2A 3ICOA 3PHBE 3QW2A 4URUR 5BYAA 1K92A 1MRNA 1UQRA 5IC5A 4EW6A 3FRIA 1JHUA 4TVSA 2QX4A 2B25A 1M0WA 1A27A 1R3DA 4I50A 1K1EA 1O57A 2AFRA 3L0CA 3T3EA 4F5WA 5IWCA 3HCRA 2OCAA 4DOMA 3IT3A 3K20A 1L7RA 1RI1A 2XGOA 2HBQA 1Z17A 2PH3A 2XLBA 4FFNA 1S8OA 2RGNA 4F6LA 1L7VC 4F3CA 3AIMA 1C1XB 4E4YA 5HILA 1C7QA 4MW6A 1X87A 3H6HA 3VGPA 1T8SA 3N58A 2JG3A 3DVAB 1V4BA 1OC2A 3IVRA 4EAAA 1MAVA 2VDUE 3ELBA 3I2YX 3KXLA 1YS1X 1JAIA 3QJYA 4LG1A 1RWKA 4IIUA 4JI7H 1EFRA 2GBFA 2VDQB 3VTKA 1NSTA 4MI6A 2OHOA 3Q12A 1UM8A 1Q3KA 2ZIVB 1P31A 3EVCA 4Y8VA 2P3QA 4YR3A 1ADFA 3D64A 1E3QA 3AKZA 2VJAA 1KOFA 4B5LA 4LF6H 3IT1A 3V5NA 5CB8A 4J9VA 2AR9A 2OHIA 3PLRA 5DM0A 4ZRMA 1VLMA 3W2IA 5LJLA 3KTOA 2HHFA 1LU9A 2AD1A 4A3BG 1TZMA 1HLPA 3T5CA 1J22A 1MN6A 1XFDA 4ZVUA 4JLDA 1CETA 1O58A 2ERCA 2YNMA 5ANRB 2IZ7A 2Q0QA 2EJTA 4KSYA 1RWXA 3H3VH 1XLWA 4TSKA 4ZU1X 3TI7A 5JSZA 2CKZB 4YT5A 5TMPA 4BMOB 2QR3A 2IH5A 7REQB 3LD9A 4BTEA 3TNJA 5E4TA 2BN4A 2HA5A 2GESA 5FHRA 3P9IA 1I33A 2M2IA 1QGUB 2YXEA 3FOBA 5G3ZA 2C00A 2WT9A 3AHJA 4YP1A 4DCSA 5KOIA 3MMZA 5KYNA 3WB1A 1LF5A 1VJ5A 1I1KA 2VH5R 4FCCA 4H0NA 4X20A 4C2UA 1WF6A 1WVGA 1ES9A 4XX0A 5C52B 1BROA 3QM1A 5LFAA 2IPMA 2WWHA 3ANLA 2TECE 4CKYA 2I65A 5I8WA 2EKPA 2WM2A 4G63A 4IDDA 4QNNA 1GZUA 2VHQA 4MCAA 2R7KA 4JIGA 1P29A 4C21A 5KFGA 5A4KA 3KPWA 5DMHA 4NXMB 3U7JA 4EG1A 4PG5A 1AN0A 1Q7GA 2WJGA 1XI2A 4Y9UA 2YFQA 1TKAA 5FJ8G 3FNQA 3LC1O 2LE0A 1JDBB 3NHFA 1BCSB 3VOAA 2R1TB 2ZTVA 2O1WA 2PN1A 1THZA 2AR0A 2J07A 2XMPA 3H2IA 1K97A 2BSAA 3EHEA 2GH1A 4KN9S 3V42A 4AN4A 3K2EA 1YRBA 3A9UA 5AKHA 2ACKA 3FVRA 3MWLA 3TE7A 5K3DA 4N76A 4JIMA 1KAEA 2D59A 4QXAA 5E6SB 5EYPA 1SPBS 2HMVA 2XH8A 2YRFA 3NHRA 5FUYA 4DZZA 1WB6A 3CYFA 2PEYA 4EMUA 3K1AA 1QDLB 1TQ6A 2WKSA 2Z02A 3RS8A 3ROQA 3IAS6 2UZ3A 1KOLA 3T7IA 2OCYC 4WCVA 4MV9A 4JLPA 5KNDA 2QY9A 1S4QA 1WB4A 1I36A 1ZD4A 2QSUA 3GDFA 3PO2G 1OASA 2F9FA 2VYVD 1VYVA 5E38A 1BE0A 1PYDA 1QGDA 1X1AA 2D2FA 3PA6A 3WWPA 1KOGA 3DDNA 1TTHA 2PGIA 2WAMA 3PJFA 4MKZA 2ZRMA 3UENA 3UMFA 1O5TA 1N32H 1D1SA 1Y4ZA 1NPDA 2HKIA 1TXGA 3A4LA 3CX4A 3ISVA 3BGSA 1DQZA 4G36A 4Q19A 4MDYA 3GLIA 3UWDA 2W2OA 5FOXA 2TRSB 3HG7A 1JEYA 3A2KA 1VL1A 3TZKA 4CTMA 1NRWA 4YFYA 1OAKA 3QLTA 1YVPA 1TYEB 4NCHA 1FP4B 1M6HA 1OI3A 2LR0A 3MGGA 3THXB 2FZ4A 4O29A 5K8LA 1QRTA 2UVWA 1BA3A 1YXMA 4G0NA 4B44A 1RPAA 2Q7OE 2YIDA 2AN3A 1M34B 1E62A 2Q6TA 3W1VA 4A27A 4A36A 2F67A 1JDNA 4X65H 3LFHA 4C9BA 1L3IA 3WIUA 2OCXA 3N8KA 2HVSA 1TYBE 1BH6A 3TWOA 1HFKA 2EFDB 1J4AA 4NJOA 5CM9C 2FP4B 1NN1A 3MAJA 2YZGA 5EWLA 1BXGB 1S1MA 1XEFA 2W6ID 1EVQA 3DF9A 5DQGA 3EMBA 1X7YB 2HRRA 3O4FA 4GLFA 4MJ7A 4MWSA 4HNTA 1SU4A 3AVUA 2BFNA 2XOKD 4C89A 4Y1EA 1W46A 4XDYA 3T6KA 3RK4A 1E1MA 4LE1A 2QZSA 1HM5A 5I4KA 4L9AA 5C1OA 2BKAA 2DUUA 2YNMC 6Q21A 4P1ZA 2Y27A 4A8JC 4KWIA 4B7XA 4IUYA 2HK8A 5AOBA 4YP9A 4AJOA 1DFGA 1P0FA 2G4LA 1DELA 5JNRA 1NQXA 3U4IA 4BN0A 1H3EA 5KG0A 6YASA 1INLA 2AH5A 1LLCA 5BWXA 2FVXA 2PL9A 2WIAA 5AIBA 1XNQB 1V3UA 3EHDA 4PY2A 1I2LA 4ZCIA 1JLLA 2EARA 2PYIA 3AINA 1OI4A 1U8XX 1ENOA 1I3NA 2Z6VA 3T35A 2G06A 5SY6A 1RMQA 1Y9DA 4R0NA 4JI1B 2ZOSA 4C4PA 4F9EA 2Q3FA 3A6GA 4O25A 4K1XA 5EESA 1X39A 1CUWA 1ZA1A 4LYFA 4TWIA 1PDVA 3NDBB 5FBLB 1SVNA 2B92A 1XTVA 1IFXA 1YTLA 2DSNA 2H29A 1TB4A 2WVGA 3P0IA 1LQTA 1B0AA 4URHA 4DWJA 4XYLA 2PQ6A 4CGZA 3RU9A 2W37A 2HJ9A 1LDEA 1W94A 2W8LA 2GN4A 4II2A 3EWSA 2D8AA 2RH4A 4HI0E 3IVXA 1SQSA 4O1MA 1AXGA 2V4RA 5CE8A 3AF4A 1WTAA 4C5CA 5HUJA 5IT5A 1RZUA 3PGLA 2YH2A 4WJKB 5E4YA 1FNMA 2MCFA 3TAXA 4DIOA 1B1AA 3OJXA 4L0CA 4EG3A 1QE0A 3DAHA 4MS3A 5KTSA 3OFND 1JHOA 3BQNB 2OHJA 1DTEA 4FDTA 4FINA 4LMRA 4J9NA 5LA6A 2PZGA 3BEDA 2JH3A 4NMLA 2ZB2A 1C7EA 2Q28A 3F2IA 4GBGA 4JROA 4RQUA 2FSGA 5C3UA 4WZZA 1DVRA 2E4WA 3AEQA 5D3MA 1EFVA 1N9GB 3WDMA 5KWSA 1VMDA 1ABBA 2BBWA 3L01A 2I4MA 2ID7A 1VSBA 3QF4B 2OFWA 4PC6A 1G20A 3FB4A 2Z2XA 2HSDA 4FFRA 3BXZA 4AYTA 2NW6A 3P0JA 5T5QA 1ZM7A 3HN7A 1L7XA 2PLNA 2SHKA 1U5BB 4E2YA 1WSBA 1P1IA 5EXDA 3GEDA 4H0CA 1WHTA 4GEGA 1MVOA 1O7JA 3CUYA 3OZSA 1EVZA 3SS8A 1IHXA 4AS2A 3ME5A 3BGOS 3O84A 2GLTA 1NSFA 2P11A 5I9BA 5K8JB 2R84A 4LF9H 3J7AK 4XM1A 2JK0A 2WWTA 1PW5A 3OCZA 4GC9A 1XDDA 1LPAB 4MQEA 3AF0A 2WSSA 3KQQA 1KK3A 4IHJF 4O1HA 4P8RA 4PINA 3TLYA 4JBIA 3ZWPA 5LU8A 2P5TB 3OZEA 3R6LA 1ZMBA 4Z3DA 1FYFA 5IBPA 4N9QA 1T3ZA 2WLTA 4UBNA 4DMGA 3M7IA 3CF4A 5JI3E 5G41A 4Z0TA 1MO6A 3DS8A 2QVBA 3VPSA 4D0NA 3RWMB 4DSAA 4BZXA 2NMVA 5ALLA 2Z2JA 4O3QA 2GVZC 4ZRDA 2KBFA 1JG2A 3OFNA 3P94A 4GZ5A 4KSCA 4CGYA 5ALWA 3CNLA 2I2XB 4G56A 2HGXA 4LSXA 4Y1RB 5AQ1A 5AJWA 2JGAA 1YNOA 5KTKA 3EZ2A 4LS3A 3LWZA 1WD7A 1T9ZA 3FHJA 4RM2A 2NUTB 2XCQA 1CY7A 3PHCA 5KBYA 3VSBA 4DJJA 3QP9A 2C1EA 3UB3A 4AIIA 2FMKA 3EPIA 2FWIA 2YJGA 3GFSA 1OBDA 1NJ2A 2D5IA 2WG2A 2P35A 2WTXA 2NU6B 4PHGA 4ZT2A 4J3NA 3V55A 4ZQHA 1SCIA 3UMMA 1JQDA 4G3XA 5FOTA 1MX1A 1WXGA 5EE5B 2XEXA 3V4VB 4OATA 1WCYA 3BHNA 3ESAA 4EYKA 1CJTC 4M2LA 1QKIA 1SA0A 1WZEA 3WE7A 1UADA 3MXTA 2G0NA 4NYMQ 3P9YA 2OKGA 4OJKA 4QIHA 1QF7A 3N05A 5HBRA 4AIRA 1EKPA 3OP1A 1OB2A 4K8RB 1KZ6A 5E4FA 3EUAA 1CNFA 1JQKA 1KU6A 3GMSA 4MYUA 4O3RA 2WP0A 1Z06A 1CZNA 4YJ3F 3DWEX 4YWJA 3L6DA 3LUHA 3MD0A 1EXVA 3C39A 1BX0A 1KC3A 2JGRA 3LT0A 3GX1A 3TNDA 4DWWA 4YRZA 5CJPA 4YT2A 2ZPUA 5DWDA 3JARB 5EHQA 4LV5B 3R9IA 3FRHA 4JP2A 3HBFA 1FLNA 1LPBB 1ZHFA 1LSOA 1G38A 1UMKA 3O47A 1XMIA 4R8KA 4E88A 3PSHA 3OJCA 1S2NA 1XN4A 2P2CA 2O14A 2VTEA 2XE7A 3I5YA 4PYJA 4PZ6A 2VHVA 3F0TA 1MB9A 2QBYB 1Q14A 5G40A 3UO8B 4B40A 2CNWA 3CLTC 4YP0A 1BHJA 5DTIA 5BWMA 3L6EA 5C1IA 3QI2A 2G1KA 3HWRA 5FADA 1BXGA 1KY2A 2QZZA 3KYJB 1F06A 1GYPA 2FEAA 2NU9B 4M9ZA 3B5EA 2IS4A 4H27A 3QXJA 2BLNA 2DPHA 2QORA 2F00A 3K30A 2IHJA 5CNIA 4YMTA 4ECUA 2ZS8A 4IGIA 3VHRA 1UBFA 4J3JA 2Q27A 2HJHA 3O91A 5LR6A 3I0MA 5CYOA 2Y67A 3DTGA 1PJLA 3DHYA 4MVWA 5TMBA 3W4IA 1YBHA 5B6IA 2VYND 4HDQB 3ZGOA 1GUDA 4FS8A 2I71A 5BVHB 4Q4HB 2VXOA 1LDMA 3JWGA 1YE3A 1DX4A 1NM5C 4JCOA 3SFZA 2RGXA 4MWDA 4MHOA 4EEQA 3VPDA 4HOYA 3N1UA 4L4SA 1AO3A 1T9KA 4GOLD 4LC9A 4RSRA 4DUZB 3HSYA 2PU5A 1P2TA 4O4IB 4RENA 3M4YA 4L51A 3OPNA 4EG5A 1QH8B 2B69A 2G71A 1T9DA 3HBAA 3O9MA 4R2IA 5JMPA 1L5NA 2WY2D 3WIVA 1T1EA 3F3SA 3T61A 4IHAA 2I7DA 4D9MA 1ZXLA 4WW0A 5JBIA 1UR5A 5E2AA 2I55A 4RZIA 2XQFA 4RE6A 1IN1A 4KQGA 1RHRA 4F3KA 3K70B 1FDTA 1XTZA 1YV9A 3OHAA 1J2EA 1ULZA 1SFRA 4AQ7A 4C1NA 4PLFA 2VZLA 3VR4A 2LRHA 3EARA 2BEJA 3JASB 3KR2A 3QYPA 2NO4A 1XMXA 1XVTA 3JYLA 4M0PA 3WNDA 5JVDF 3KQLA 3U60B 3AEKB 4ZQIA 4FHDA 3VJMA 2DBRA 2A5GA 3E2PA 3PKZA 4P7KA 3LKVA 3R74A 3IQGX 1Z0AA 1QO9A 3GLRA 4IXMA 3A1UA 4S35A 3DPSA 3FUUA 4CM9A 5ALDA 4B2YA 2E7ZA 1D2MA 1TK3A 3L5KA 1Z47A 2I62A 3SZRA 4XWKA 4YBZB 5IG2A 3KB2A 4DLVA 3N8IA 1JKFA 4AJJA 2JLWA 3NIWA 3FDJA 3QFTA 3UT5B 2QVZX 5DASA 3HLYA 2G77B 4P4UA 3IG0A 3CLSD 2PIAA 2QUJA 4S24A 4KQFA 4DE5A 1CXZA 2CFSA 2NZUG 4OAOA 3OKFA 3ZOKA 1C1XA 3L7AA 3WS7A 3BZWA 2HJWA 2CK3D 2WSSD 3BCRA 2J9FB 2PUCA 3GDHA 1A5BB 1WIWA 1V7ZA 2NLOA 3C3BA 4MLPA 3WB9A 4F56A 2DHCA 3GHHA 1M7JA 3C6MA 4DRXB 4F84A 1XAHA 2QB5A 4G84A 3IE1A 3BMCB 3H8JA 1LEHA 3NUZA 5EXSA 5A2GA 5JMOA 5IVHA 2PUWA 2JGNA 5AJYA 2QG4A 2BDTA 5FFMA 3ETCA 3AUSA 3RUFA 4PE5B 1V9LA 3EGOA 3OE4A 3WJ1A 1O77A 3ITDA 5K8UA 1FSGA 1YIDA 1E3WB 1RLJA 1UKBA 2W48A 2P7HA 4O2RA 1E64A 4JI5H 1KDOA 1R9GA 4JELA 3GGCA 3JQFA 3R0XA 1RI2A 2JEOA 4JYMA 1TLTA 2YXLA 2IIPA 3ETGA 5FI1B 1NULA 2IE8A 4R9RA 4Y9RA 2LIVA 3EDRA 4HYEA 4DKXA 1P1RA 1R12A 4CM9D 2D1YA 1CUDA 5C34B 2IPAB 3KTAA 2JAQA 4UW9A 1AGYA 1RXWA 3IAM6 2RF4A 3D3JA 4RFLA 3OZIA 5BN3B 3P8ZA 4LOJA 1RXIA 3EC7A 4BHTA 2PTGA 3LHIA 3BACA 4Q15A 3PVZA 1GCGA 2FKNA 1VG1A 4MUIA 5KQMA 4F92B 1A1SA 5CHEA 4G81A 4MB2A 2Z5GA 4KQWA 2EBWA 2PGLA 5LWQA 3SG0A 5EHXA 3THWA 1L5LA 1HBJA 5SY4A 2ATCA 4HWRA 3VTZA 2V7GA 4TLEA 4KXQA 3RS9A 1B8VA 1SD5A 4IJQA 5DX8A 3VVBA 3WLJA 1G55A 4XWGA 4CU2A 4B34A 1HQYE 1XQVA 2ATLA 4OMCA 1RVDA 4QELA 3GA0A 3V6HA 1D4ZA 1M5RA 3P9QA 1FVXA 3AFMA 3CVXA 2L17A 5BV1A 1CKNA 1NVXQ 4IR9A 2IQ5A 4FS1A 1K83A 1YH3A 3F1KA 2BRUA 1OX4A 2FFAA 1D0SA 2HIAA 2JARA 3DFFA 2OLSA 3JAWA 1ZOSA 2NYAA 5EE9A 4D56A 4E3ZA 5ES4B 5DTJA 3Q1LA 1NQWA 5NULA 4ZO7A 3W8DA 3ZD8A 5GZ6A 3KXPA 1JE1A 3UB2A 1PJZA 3AZQA 4B46A 1VE5A 3C6XA 1QH9A 3MJHA 4XM2A 2H8KA 5CTJA 4M88A 3NJ8A 4YUVA 2VNSA 1XRNA 4ZCQA 5IEBA 3GGPA 4CDNA 3GZJA 3L2PA 3SD7A 4EH1A 2ZSJA 4CC5A 5AKEA 3JQ8B 4EGSA 1DQPA 4O4LF 4J9PA 4O4IF 3MTBA 4K40A 2H5EA 3ADOA 2ZCUA 3D6AA 1FKAH 2QXTA 3VV2A 3CLHA 1IYZA 1V47A 3IC5A 1Z34A 3VZDA 3ZQ6A 4B3FX 4PN7A 1BW9B 3SI8A 3CVWA 1LDBA 3GP3A 3KPUA 2DJIA 5LYYA 4CM4A 4K1LA 3DE7X 4GZ6A 2ASJA 1P1BA 2AT1A 1VJCA 5J5CA 4OLFA 4PS1A 5CVDA 3W2EA 5LMCA 3FYUA 2V58A 1V7QA 5K8TA 1V11B 1OFGA 1EJ6A 2PL3A 2P4EA 2VJDA 3MGKA 4IIBA 4N18A 2A5YB 4CMAA 3BB1A 1Y7TA 4FYMA 2VYCA 3GGDA 4P31A 2B99A 2A3RA 4A7PA 3QI7A 2I22A 5I45A 1YC5A 1KFJB 3WTCA 3HA2A 3UV7A 4DAOA 2XMQA 4FHZA 4FBUA 1SHKA 3HP1A 4PTLA 2AIRA 2ZSBA 3EIHA 5BXQC 1T4CA 1P19A 2HB6A 3A1DA 2JGKA 2BW0A 4M1OA 5K0GA 5F23A 1NONA 3RC9A 4FR5A 1BDBA 1ND5A 5JCJD 1CUCA 3T1QA 4E5VA 2CXXA 4DV4H 1RBQA 1II0A 2Q5CA 2PL1A 2QQEA 1VE6A 3MT7A 1MTZA 2O2ZA 3O94A 2VDWA 3E61A 3H9CA 2WFAA 3SEFA 1CZHA 1FYDA 4U7CA 1A8PA 3FCOA 4IIJF 2W22A 4QXOA 4QTTB 2WKPA 5EZ5A 3GLFA 1P6XA 1U8TA 2JAHA 1V41E 4F71A 2BVNA 1Z8HA 2EWMA 2H57A 1ZL0A 1GTZA 2I4LA 1E2PA 1K7YA 2O7VA 2OY0A 3R3SA 4MGYR 3FX2A 4US0R 4XPIA 1PSZA 2OFPA 1R0ZA 2GVNA 2VYQA 3FTQA 1IM5A 4MS3B 5K09A 4WBSA 4QQKA 2GRAA 3O8BA 3DV0A 4KRGA 3GRYA 4YEDA 3L7YA 3QY9A 2HU7A 4QU0A 1QFXA 1D8AA 1OZAA 2HSZA 2ZUVA 3FSEA 4OK6A 4YDHB 1YHNA 3C14C 4IILA 1KQNA 4ZCMA 1CX9B 1WETA 2POCA 2EEPA 2NZVG 3EDMA 5E1OA 4U7PB 4GMGA 1T6YA 3NHSA 1XZFA 4QDZA 3FBTA 1XLUA 3ZJ5A 1YDEA 4Y8VB 1U3VA 5EA2A 5BPHA 2EIYA 5EPOA 3NO4A 5CB0A 3O1HB 1GARA 4CKCA 4GLXA 1OZFA 1NXPA 3ABSB 3INTA 1E1CB 1MEEA 3TG2A 2FP4A 3RGGA 2PUAA 5EIBC 3U19A 4L3WA 1E4OA 1FE8A 3PA8A 1MB4A 2UXBH 3BRSA 2HMSA 1HZJA 3IEUA 4PBSA 5IKOA 2AX4A 3RWBA 1WCIB 2MHCA 4I4IA 4L9SA 2HGWA 4PYIA 4RVUA 5IABA 3BIJA 3BHIA 4NEQA 1L4BA 2YIMA 3L6BA 4J0DA 3P0RA 4YRBA 3DZDA 3T3PB 3ICCA 4L7VA 3VKGA 4XQ0A 1YMQA 1RZ3A 3TR6A 3H9BA 4YRIA 5LIRA 2QXYA 4JXUA 1K6EA 3DE1X 4ZGBA 1L7BA 5K2OA 1XEWY 3FMFA 5FO0A 1AH2A 2NPFA 1OFIA 2QXUA 2DSTA 3GJYA 4YS6A 1ZZEA 3O82A 3AM4A 5LLSA 3RVNA 4MHSA 1YTUA 3DWFA 3QWIA 3VMMA 4JODA 2JCBA 1JDJA 1U31A 1E6KA 2XXAA 1JDPA 3WGGA 4M0UA 4N0QA 4H60A 2Q4OA 5B7QA 5J23A 5LB2A 4C88A 2E5LH 1S89A 2YUTA 1SU8A 2QYSA 3NMUF 4I4TA 4LF5B 3ZZ0A 3TQHA 4CF4A 5CR9A 5MF6A 2JJ2D 1PS8A 1UBTS 3DDWA 3N2GB 5IC4A 1SO8A 4NCNA 1O89A 3T5HA 1X8KA 5DOZA 5CXUA 5I4BA 2XTZA 1PR3A 4F3TA 3HO8A 1NMSA 2ERYA 3V32A 1ZUIA 4NESA 1L1QA 2NUPA 3THXA 4D9FA 1U3CA 2H7YA 1YL6A 3QFSA 1TRHA 3QMVA 1GXSB 4Z1MA 1FUUA 3E3LA 1I5EA 4P3OA 2OMKA 1K5GA 5LNK1 4FBMA 3QXCA 1CK4A 4RNNA 1TAEA 5IHXA 1GRNA 2CHUA 3ZWVA 3WGNA 3LW7A 2C5BA 3WL5A 2GK4A 5F1OA 1ZVQA 16PKA 3MNFA 5F1YA 1LDGA 5CD9A 3M5DA 4GMFA 1JKIA 1WTCA 3HCFA 2CNOA 3NM4A 4JL8A 3DP9A 1IBLB 4BB0A 3U4MA 2OXRA 3U7QB 2FR8A 3LPMA 1EFLA 1RQPA 4KQEA 4RF2A 5CTAA 2Z4TA 5DNWA 3BULA 5JJLA 4DEVA 5DM1A 3V9AA 1YUMA 1SBHA 1JNXX 1O94D 1YOVA 5U1PA 2UXCB 4JB2A 1C9EA 4ZD6A 2HHHB 2QF7A 4DB2A 2ZVPX 5CM8B 1ZOOA 4HEQA 3PPWA 2KLBA 3MWFA 4H15A 4BO5A 2OCKA 3C8DA 1X80B 3RUHA 4Q8EA 4CFSA 3RAEC 1EFPA 1XROA 2L0XA 4WHXA 1HGXA 4U2DA 1IY2A 1J70A 4X7MA 2QTNA 2VNKA 3ZLVA 3OKCA 1M2OA 4ITVA 1A69A 2RGNC 4EUHA 2BY4A 2VC2B 4WK0B 4LF6B 5FBWB 2PX6A 3U62A 1TZ2A 1HQKA 1KMHA 3BG5A 2KWIA 3JTEA 4G8DA 4JMPA 4WZBE 1FBNA 4NYEA 2XNJA 1A8SA 2H1IA 4X41A 4ZREA 2AVNA 3NRCA 4HQLA 2PZMA 3TTWA 3ORQA 5F76A 1E9AA 1NNEA 1UINA 1UMBA 1K8YB 4OKNA 2XB2A 2EWVA 2JEZA 5EKDA 5F98A 3C0FB 2R00C 2VPZA 5EAIA 3PEYA 2RK4A 2HO4A 4K6OA 4I19A 3ELYA 3G9XA 1TO6A 4PNEA 3M9NB 1KZ4A 4GWGA 4LHVA 1H8EA 1ZY2A 2IXFA 1WP4A 2P78A 5G0UA 3KKZA 4LJ7A 3I4MG 2FE3A 1TJ5A 3FVVA 2PZKA 4TKUB 3G6VA 1A0OA 3MYRA 2LBPA 3O2NA 2FJ0A 4Q1EA 3OD1A 2VJNA 1DXYA 2ZSEA 3QPCA 4CDRA 2YWJA 5ED4A 2XNDA 4B9EA 5EFZA 2FP3A 3FUWA 2J0UA 5I5GA 3ASVA 4R31A 3SZGA 4MRAA 2WMDA 3C5WP 3HFSA 2CSXA 1G7TA 1FLVA 2C58A 3N0TA 4C07A 1CS4C 1G4AE 3CUWA 3LLVA 4B09A 2R92G 4WOCA 2QTWB 1KNXA 3SSNA 3KQVA 4AY4A 1ACMA 1ZK4A 1CVRA 3T9CA 4C5BA 5KG5A 3R3WA 4G01B 4I8DA 5E2IA 1DDGA 3WLTA 3GUZA 1JQLB 3WOVA 4C0AC 1GQYA 3NC0B 2JBAA 1IEVA 4JZYA 4KQ6A 1MG0A 2C8LA 4QXRA 5A02A 2H6EA 4M9XA 4MO2A 4CCAA 1AKVA 1T0UA 3V9PA 4AZ3A 1L4FA 3UFXB 2W8ZA 1HTTA 1KAHA 3JV7A 4NE9A 4PQFA 3B9PA 1M33A 2GN0A 3WHLA 2VF4X 4AJ4A 2XOXA 3H4TA 3I1FA 2GD1O 3WJAA 2IBTA 2QBYA 3QQMA 1Y1WG 1TAQA 3A6PC 5ABPA 2JVIA 3M5WA 2DUWA 4DREA 4LV6A 3RVBA 1AKWA 3OZGA 3H0EA 5F77A 2DH5A 1RJPA 2PUVA 3DYVA 5D01A 5DV9A 4GX2A 5GGYA 5A4DA 2CW7A 5IAAA 1N78A 2COJA 2IEYA 3KWJA 4MZDA 4X7PA 5JVDB 3CMMA 2J0UB 4ABTA 4F2GA 4JI4B 2NUBA 1L4HA 1P2UA 1W85A 4G0OA 2PZ8A 4HLCA 4QBFA 3KQUA 5DMXA 5A05A 3SYLA 1AN9A 1YBAA 2BM8A 4YUXA 2XWPA 4HMOA 4OI2A 1W48A 3AHCA 1LPNA 2QYTA 3VPBA 4AMGA 4X85A 4KKXB 1ENZA 1OH8A 1GNPA 1XLTA 1EX1A 1OKKA 4WH0A 1A7UA 4HLNA 2ZWAA 2AN1A 3GARA 1JH8A 4P3KA 2ZUCA 2PD3A 5E6UA 1GAXA 4DW8A 1F14A 2J3IA 3KBOA 4A2PA 2NU6A 3ZHXA 2VA9A 2YX1A 5EZQA 3KJNA 4YDQA 4DV6B 2IEIA 2CHGA 3GQBA 1SOWA 3L7DA 3KFXA 4RGYA 4YRFA 4XSGA 1MJHA 4LN1A 5FPSA 3J7AC 2XUDA 3O8OA 4LRUA 4XJSA 3WHIA 4EFMA 1ADYA 2DY0A 3IKJA 4Y6OA 5FWDA 5B2FA 1LY1A 2XKJE 2C3YA 5TB5A 2N42A 2BGLA 1ZHQA 1MP0A 2R1ZA 4O33A 3SJ7A 3E4DA 1VMEA 1Z0IA 2IEAA 1Q1NA 1R6AA 2IX9A 4PONA 3M89A 1V9PA 2I9KA 4GVXA 1FX1A 4OYYA 3RTEA 4U5QA 3IAS1 4RZRA 1MA0A 2QM8A 4ACAA 1TWHA 1YVEI 1PZEA 5FJIA 3L8GA 3R7SA 3ZNPA 3OM8A 1SVIA 2PH1A 2WFMA 2Q5OA 3DXFA 3L04A 2GXQA 4Q3KA 2IW3A 5TGTA 3SKYA 4V1CI 6ADHA 2Z1NA 1QYCA 1NVBA 4CUZA 4F85A 1KKUA 4NARA 2Y1DA 1B8NA 1K6IA 5JMTA 4QJIA 2YDYA 3IOEA 4RNOA 1NRXA 4RD4A 4YAJA 5JD6A 5DI3A 3KOWA 1SXIA 4PCLA 3W5VA 5B3JC 1KR5A 2PMFA 5C7YA 3GJ4A 1XJ0A 5DZSA 5CT4A 1NJFA 1PR6A 1IB0A 1ZRHA 1W44A 2OCLA 2Q3EA 1ZN2A 2WUFA 3PPYA 4PZPA 3V80A 3PX2A 1VKNA 1YRWA 3JQRA 4B7CA 4YJGB 1G291 4AULA 3CEBA 5LYJF 2SKEA 3WJ7A 2Q0SA 3QE4A 4BAUA 1SKAA 1T5SA 3O8QB 2VWHA 4GMDA 1ZD3A 2IU6A 2OKCA 9MHTA 5TPWB 1KEEB 5FEMA 2EERA 5H4HA 1MMFB 2XE6A 3EXIA 1HOXA 1P75A 2P1DA 4X66H 3A1WA 1J0AA 5AESA 4ESHA 3NW9A 3HE3A 3VKHA 3JTMA 1I9GA 4GH5A 1YZLA 1CQXA 1VLZA 4YMGA 1GPDG 3HUDA 2X9VA 2AQIA 2VYNA 3DCYA 2A30A 4JP1A 1V1RA 2PO5A 2G9QA 4MVJM 1RLOA 4WSOA 2W7OA 4ZI2A 2O8VA 1GKIA 1NUQA 3OE7A 3UHPA 3B20A 3P7MA 1RRCA 1UJ6A 1I94B 1FS6A 5KFHA 1W0CA 2JBHA 1RRPA 1JLKA 1JL3A 3JQAB 4KWEA 1F20A 2RC5A 3HY6A 1AKUA 4EO7A 1IM2A 1IY8A 2I3DA 1RU3A 4WKNA 4RNMA 3PZPA 4R3NA 1BJKA 1YCDA 4NCKA 3IPYA 1NQOA 4OIFA 1L8XA 4MYTA 4WT7A 3ZYZA 4B6GA 5HRCA 2O3SA 2WTNA 4AMUA 3F5SA 1PK7A 2OILA 1NI4B 4CF5A 4BY1G 1W19A 2VQDA 2JATA 3HZZA 1ZIOA 5K01A 3NPMA 5I5YA 1KYTA 2BSQA 4TLBA 1Y33E 4CE5A 3C6BA 3B70A 4F72A 2D74A 1IBSA 2G9NA 4C4ZA 2COGA 1A2OA 2IEBA 2RSLA 3GQVA 2Z08A 4KK4A 1JAZA 2Y66A 2ZTHA 4J2HA 4RHTA 3IVAA 3TSOA 4GYJA 2BP7B 3ZR4B 5FOVA 4D6PA 5H70A 4D9BA 4DM4A 1HSZA 4C7MA 4EFKA 4JI6B 2H16A 3IIEA 3R41A 5IVIA 2RHJA 4TV8A 3A36A 1PGPA 1V39A 3SQNA 4L0MA 1M54A 3W2GA 3ZJ4A 1A7AA 5K45A 4BO3A 3X1WA 4NABA 3AR8A 1SEVA 4P4SB 4D82A 1XTUA 1H85A 3RJMA 5E9AA 1X70A 3WWYA 2XUZA 2VIIA 4BMVA 1Z35A 5H16A 4EFDA 1T2FA 2BCEA 2J9XB 4QYMA 2YBDA 5EJ7A 1FNBA 3FUTA 1XLTC 1PZNA 2EKZA 1WV1A 3T4UA 4HVLA 4BV3A 3PGA1 1F0PA 3M4ZA 4MKFA 5B36A 2A9QA 1I3CA 2AXEA 3MTJA 3X2EA 5BURA 1BCRB 1XWFA 1KZHA 1K66A 2QT1A 4AROA 3C0KA 2VHYA 4PRZA 2OV3A 3AL0C 1JHZA 4WUVA 5REQA 4U63A 2R8GA 2NM0A 2BJWA 2FK2A 4JLMA 3N9IA 4LHSA 4P7JA 3DGEC 1Z68A 2SCUA 3JQQA 4WNIA 2FLLA 4LRTB 3Q0TA 4JI2B 2HI0A 2R6GA 2ZWOA 1W9MA 4LJRA 1L7EA 4KTTE 3RW9A 1E2IA 3OQHA 1VHWA 3T5AA 1CQIB 2BGRA 4FUQA 5BQFA 4OXNA 1E6CA 2ACWA 2GF0A 3NXSA 1XMQH 1R6UA 1M1YB 3GHYA 4N8SA 4Y67A 5BWOA 3ZKWA 4TV8F 1QAOA 1RP1A 1UJCA 1ZM4A 2COEA 3O3CA 3BFPA 2F1IA 1F8UA 3EG9B 3AQ4A 2QN2A 3AEKA 3GD5A 3LDUA 3MHPA 3QMPA 4MQBA 1WH2A 1J2YA 3PNSA 4IEIA 3D7KA 2JPDA 5F9NA 4LWQA 1EEHA 2FOIA 3CZ4A 3KZCA 3M3HA 4EYGA 2W2NA 1AS0A 3WMWA 3DR3A 4E31A 4MYCA 3RQSA 4C43A 3WQHA 1E3IA 4X8MA 3V7UA 1XVVA 4P3YA 4AFNA 3EBOA 1AKYA 2I6UA 1B6RA 3MCUA 1EGQA 3WYNA 1HWYA 5F5NA 4Z7NB 1VKZA 3D6JA 5ALYA 3OO1A 4R16A 1PJQA 4RUAA 3RUDA 4FGUA 2GR9A 1JSXA 4EABA 1WZCA 4G25A 2QTVA 3GXBA 3HR8A 2Y93A 4PS0A 2PJRA 1NI5A 1RJ9B 1P8AA 2F48A 3E5MA 3PV0A 1XJQA 3C48A 3X1ZA 1KOJA 1GPJA 5FUWA 2B5VA 1CYEA 1XFAA 2VAXA 3MILA 3A2MA 2JFZA 2BH2A 2ZREA 4ESEA 1XZHA 4GQAA 4JS0A 4XYGA 5A0VA 5A3VA 2O52A 1OR8A 4MUXA 3LTNC 2REQB 4AMYA 4R1OA 4V02A 5ICFA 5J3JA 3PNLA 5A9RA 1DXQA 1QC5A 3IL2A 2H1WA 5CCDA 4CEHB 4EUFA 1OVGA 4X1YB 1F8FA 3BXGA 3IODA 1BGXT 1OWPA 1ZVJA 2VQFH 1I1NA 4ONEA 1PR9A 2NG1A 3E8MA 4Q12A 1W36B 3ZWAA 3FHCB 2D1SA 1OXKB 1ZVMA 3H2KA 1V25A 3NBUA 1NVTA 4FX5A 3T3GA 5EJ4A 1Q3TA 2IHTA 1ZGCA 3LPNA 1IUNA 2AYZA 2QTLA 5B7GA 5AVQA 4XZ3B 2DM6A 3MUNA 5ALXA 2RBGA 4MW0A 3P9SA 4QX6A 1N33H 2AEEA 3KJZA 4OHFA 4ZT5A 1IVYA 3QPDA 4E5UA 2HVRA 2H4ZA 1TJPB 1GRCA 1UBSB 2BFFA 3NV9A 5G2OA 4BE9A 4UFPA 3O3MB 1FFCA 3S8MA 4YY3B 4J3FA 2RGYA 2YWEA 3KKOA 4F8EA 2JLVA 2TMYA 4NG4A 3ABRB 4QM7A 2FZEA 2QN6A 3IHWA 3LCCA 4AYBE 1L4MA 4C7OA 4M0DA 3RTBA 3H5LA 2R8HA 1EEXB 5HQTA 3HYSA 4W6ZA 1GQSA 3HBNA 5EE3A 1FA9A 1PFKA 4O2LA 3BSWA 3EXHB 5AWFC 3PXGA 1NY5A 1GY8A 2CLHB 2HIVA 3FNIA 2NTVA 3GFTA 4YR0A 3R4VA 4PTZA 4U4AA 3NTOA 3RV3A 4EYHB 1T2EA 2I3ZA 1XAJA 5B1DA 5KOJA 4CMDA 2ANBA 5KSZA 2QRUA 2Q6IA 4N82A 3SYMA 4APMA 1V6AA 3CT4A 4AKIA 1NU8A 2OB2A 1XMSA 2Z3WA 1KYXA 2VDKB 1MABB 4WZ6A 5K0TA 1Y1RA 1N6KA 2OM2A 4YPOA 3DL2A 3HR7A 4C3ZA 5FCDA 1R9TA 4BNNA 2D4AA 3HLKA 2CXHA 3E15A 4NFLA 2C2MA 4F8YA 2JLBA 2QVYX 2VJYA 2XCUA 1ADCA 3G89A 1IATA 4RUCA 3MAGA 4LV8B 1NM5A 1MPXA 3SR4A 4PF1A 4B84A 1Y3BE 2Z5VA 1MNQA 5DQIA 3ORFA 4QOFA 4QLBA 1N1MA 1U8AA 2PH7A 3LKBA 1PX0A 2WD9A 1Z6TA 3KQTA 3TCXB 1XPRA 4PIVA 1M5UA 3E9DA 1CZLA 3KB8A 1VIDA 2YC4C 4G4SO 5IP7G 4DCGA 5LYJB 5KT7A 1NW6A 4MP6A 2QGFA 3DMTA 4KQIA 5IKMA 4PQGA 4D1YA 2WG1A 3LC0A 3ZGXA 1II8B 2Q5FA 4E2ZA 1USUA 3A1FA 1RWVA 2GNAA 4HDCA 3SVLA 4M37A 3LI2A 3V1LA 5INTA 3QBVA 1P61B 3L7OA 2VDVE 3A04A 3CM0A 3DVAA 4A73A 1L7MA 4OHYA 5AVSA 1IXYA 1QDEA 4ZMRA 5HOEA 3CPEA 3H16A 1K1QA 4RLHA 2AU0A 1T15A 3ZDRA 1DKPA 1NURA 1GUZA 2ZBUA 3H5AA 3T06B 3KSUA 1GD1O 4AW9A 3B6MA 3IEIA 2BEUB 2YJNA 3ZTTA 1C3JA 2HLHA 4FEAA 4G3IA 4P4NA 4E1BA 3WLEA 1ZD1A 4ZXPA 3DMRA 3QVXA 1VE3A 2A94A 3PC4A 5DNCA 5TQ2B 1A2BA 4KVAA 3RODA 1Y48E 3HB0A 1IEWA 2XTNA 1LRKA 1P7VA 1YBMA 3MZ0A 1TPZA 2AGQA 2AEMA 4QJ3A 5HF5A 2PAAA 1PHPA 1U1IA 3IHKA 4QLAA 2ZKIA 5TQ0A 3MM4A 3AONB 3V8MA 3R7FA 2J9YB 2Y0SE 4RTNA 3ET4A 5FTMA 1RACA 3IBGA 3OQ1A 1CF9A 1H93A 2BUBA 2PZJA 2A14A 3DZIA 1PVOA 2BBTA 3BIXA 4PPGA 4AO7A 3W6NA 1JG6A 1T5LA 2HV9A 4ZYTA 1CQWA 2C0CA 2FW1A 1XXHA 4XGIA 3OTWA 3LXXA 3UJNA 3OJOA 3X2SA 3ZWOA 3RVKA 1EXMA 1R0YA 1K3TA 1ZSYA 5EWGA 1KJZA 1XTRA 1ZCAA 3I6MA 3JQ8A 5B30A 5SYAA 2IPOA 2XT0A 3MGAA 4FHEA 4N6GA 4OBXA 5EP3A 4A93G 3TJZA 3NVAA 1FRVA 3DCNA 5FUQA 1FDWA 5DG8A 4KDEA 2NWQA 2X4GA 2GM9A 3STXA 2Q3LA 3CLSC 4KYIB 1MQSA 3NKFA 4LDAA 1JRLA 3SQMA 3H05A 1F1JA 4Q9JA 5EP1A 3ZLUA 1RR6A 4ML3A 2D5AA 4HC4A 5K3FA 4B83A 1HRKA 4WHMA 4KOAA 1OZGA 4II3A 5J43A 2R8IA 4PGFA 4B48A 1T36A 3LUGA 4E3WA 5B4VA 1DAOA 4IJVA 1IHYA 2IYTA 1E2UA 3QEJA 1D2EA 3EQ7A 3MOSA 4UULA 5DISB 1HKUA 4EHJA 4Z1MD 5JWOA 1ITZA 2VFAA 1D2GA 2Q1XA 1N33B 4D3SA 1NZDA 3GILA 1V5GA 3AHDA 3DFUA 3N5CA 2J45A 4X24A 2KB0A 2XF2A 3JR7A 4KXMA 4B76A 1T24A 5HUQA 4MJXA 4R2HA 3LLMA 3IAM1 4YP3A 3GV8B 2CXUA 1EDBA 3DWGA 1XEXA 4K88A 2H06A 4ZOLB 4QBGB 5L3SB 4KYVA 2CXTA 5AKJA 2W58A 1CE8B 3HNRA 4TXNA 1E1YA 5ESXA 3NBKA 3E0XA 4NY1A 1CY4A 4IRUB 1JBEA 1N34B 1ENPA 4AF7A 1DT3A 1KFCB 4YMVA 3QK7A 1T5BA 2QTTA 4G2NA 3HXMA 3OLZA 3GIKA 1T0BA 1TCUA 4GZMA 4ZVSA 1WDTA 4DR5H 5IEJA 4G4GA 2ECQA 2YOGA 4K86A 5KAMA 5CGQB 4LGCA 2F43B 1VDMA 2JIQA 2QRKA 3UH0A 2Z58A 1R74A 1ABFA 1XZJA 1E9DA 3VRHA 1I24A 3TTTA 2DBZA 4CIBA 3TXAA 3HB4X 4OSPA 3F6YA 1U5AA 1DKQA 2PFGA 3LSTA 3T8YA 5ADWA 1Z3CA 2AZDA 2YJ4A 3PFWO 1O96A 4N7BA 4FLFA 1T26A 2IMWP 3QIAA 2XWQA 4MKXA 4MICA 1H9BA 4F2PA 4QEDA 1E0DA 2V7QD 4ZJYA 3PNPA 3NU1A 1FP2A 1GTG1 2X2EA 3GRCA 5CDTA 4RJLA 5HPYB 2RKWA 3A3PA 3IXMA 5JCOC 3OLQA 3OX3A 4I4TF 3EZ9A 1CE8A 4YI5A 4EHIA 4PLCA 5CEEA 3THOA 3X1YA 3H5TA 3ZWNA 5L3SA 2JH8A 3OQMA 5H0IA 5EOYA 3GWZA 4RV5A 4UBJA 3ORSA 3ZGVA 1NXTA 4MMXB 4AZWA 3KEGA 3GYGA 1GHTA 4TKUA 3TKYA 2CD7A 1LX6A 4CKXA 3W5OA 1JA9A 2IEZA 3ANSA 3EMVA 3LHFA 3QJ5A 4RY8A 3RVPA 2QU7A 4E2WA 5CFOA 5EQFA 4ID9A 2HT1A 1L6RA 1T1RA 5E3IA 1PQYA 2EZ4A 4Y9TA 1FTSA 4DDUA 1X0XA 1K1SA 2WF7A 2YVQA 3NPAA 4MQ4A 1JFSA 4AJHA 3DGFC 4QG7A 4BQOA 4DMLA 2WWGA 3E48A 3NAGA 4A23A 2P9BA 1CVLA 3AY6A 4TX1A 1C3OA 3EPPA 5K20A 3NIFB 2CUTA 3OZFA 4RCNA 4KR3A 3UMBA 3X1JA 3GFRA 5A7HA 3OOEA 3T3OA 4RB1A 4NZZA 4QGAA 2WWWA 1E94E 2FEXA 1ZU5A 2Y9PB 5KYKA 1Z38A 4EX6A 1KMHB 4NECA 1OBCA 2XV1A 1ZETA 2QRLA 2ZE8A 2JI9A 5TPZD 5JATA 3W2FA 3F67A 5BQ5A 3KHTA 1PSWA 2IPNA 5CPBA 1GPMA 3D6MA 4JNCA 3JYHA 3VU0A 1NW9B 4R5HA 1H2AS 3CRRA 4XAQA 4KFSA 4W9MC 3DTFA 1USWA 3MMPA 4DLNA 2RAUA 4P54A 1CU1A 4PYMA 3W7VA 5A4MS 1T5IA 3DQPA 2WUVA 3V4OA 5HSGA 2Q3DA 1WCMG 2C42A 4M98A 3LGSA 1KJ8A 2IYZA 4IH1A 4BX3A 3OQOA 2EHDA 3ITKA 2ZB4A 2M6LA 3UAZA 4BO4A 3M3PA 3B1KA 4QXMA 4WFKA 2D13A 3O9ZA 2HEGA 2WU1A 4RW0A 3CC8A 6PFKA 1YFJA 1Y37A 4PLGA 3R9XB 4KXLA 1PWZA 3HKBB 3OZRA 1T8RA 3QF7A 8GPBA 3TTXA 4F5YA 4HYYA 3NH9A 4KFRA 4QBKA 4LJKA 5DLEA 1N8TA 3BFJA 1CKEA 2PJZA 1SQFA 2FPIA 3SJBA 2MT9A 4K9QA 4IIHA 3UA3A 3H04A 1Z6AA 4RIIA 1F8GA 3U7IA 3EZ7A 5THXA 3PE6A 3S2SA 4CM1A 3AV3A 2QG9A 3MTDA 4U7FA 1ZNYA 1S4MA 4BKUA 5LXTB 2PY6A 4ECYA 4HNHA 4QHYA 3SBEA 3T7JA 4IVNA 2V9ZA 3HI6A 3TD6A 3WRWA 4BJ1A 3TZ6A 5K6TA 4ZOLF 2TMGA 4FGKA 5AJVB 5CW2A 4UBOA 1ULUA 2FZVA 4WN3A 4OQXA 5SZIA 4FILA 3TQRA 2G4VA 2AHOA 1EDZA 2GILA 4OG2A 4EI2A 4UKDA 2R68A 2Y6VA 4O4JF 3UUFA 1A77A 3SBDA 2DFVA 1LPPA 1CDDA 1YJQA 2PX2A 4B3MB 2F8TA 1V7PC 4X3CA 1E2LA 3D2AA 3H87A 1GRQA 3TLMA 3GLFE 3IR6A 2ZLBA 2PNJA 3HTXA 4JJGA 1GXSA 3IBFA 3CNNA 3RROA 2N3ZA 2C82A 1EIWA 2K2WA 2RIPA 3K09C 1RHJA 3OCCA 1VPWA 2WM3A 2Y0CA 3WGQA 3UBMA 4DQDA 4DL5A 1O5IA 5FL7A 4ZMBA 1Q5PA 1Q6YA 1YCGA 2QTZA 3H8VA 3IPLA 4MCHA 2AOXA 4P4SA 5CMLA 4AAYA 5JZOA 4X66B 3PUXA 3DF7A 2HBYA 4U6NA 2B4AA 1C30A 1ORRA 1GSIA 1RAEA 1ZITA 2D0OB 3CE9A 4Z9BA 5C80A 3DQQA 5JYDA 1MKYA 3S2EA 4HH1A 4Q21A 4XQGA 3GJXB 3TL3A 4ZYVA 4GZLA 10MHA 2XOEA 4MPJA 2ISQA 3UQYS 1N5DA 1NPTO 1TIBA 2WD8A 2YBEA 3SYRA 2VRCD 2KE5A 2VRNA 2B4KA 1Z07A 2XQJA 3NHYA 1VIYA 3WLMA 4BQSA 5EJEA 3HVJA 4JC5A 4PSAA 1IN5A 5CDUA 3IGFA 1VLJA 4L50A 1A5ZA 5TS3A 4BPRA 3O8OB 4MVJF 1PYOA 1RFGE 1VMKA 3K0CA 3KFVA 4RK0A 5KQLA 1M2WA 1PUXA 2Z0MA 1TO1E 4BFSA 2C1ZA 1UZUA 3ND6A 2BFDB 4RACA 1CKMA 2CLOB 1GCUA 3FF1A 3PQCA 1NVDA 1UOOA 1OU4A 2PV7A 2C0PA 1FSSA 3J81W 1TE2A 2H9IA 3GEPA 5A5DA 2YCHA 1G0OA 1YB7A 4RBNA 3RADC 2LZ0A 2BGWA 1OCEA 3OE7D 1WB9A 1TCBA 1Z8FA 2B83A 1Y6JA 3CJQA 3FY4A 4PO3X 4UQOA 4RK1A 3D4IA 4MVYA 3MR5A 5FL7D 2Q41A 2XGGA 1RTTA 1M2VA 1M8PA 4Y2TA 1UKYA 3U9LA 2JA5A 1QF9A 3MWJA 3BA8A 3EJ6A 3RTCA 2PSDA 1XCOA 2QD1A 3AOGA 3G1WA 4EMTA 1BJTA 3ETNA 4RPLA 3BJIC 4BBJA 2BEVA 3G2PA 3IIJA 4A2AA 2IV7A 3WYCA 2R6CA 1WSCA 4FBTA 1C0PA 3AESB 5LLDA 4ECTA 2R00A 4YRKA 4JYBA 2DG2A 1Z5PA 4MWBA 1TT5B 3PFHA 4ZJPA 2AW5A 4DJAA 5IBQA 1ODFA 3ELUA 4QE3A 2GQSA 4U3JB 2G5CA 2IDJA 1N4AA 2D0IA 1Q7BA 2DGDA 4L3OA 4DIFA 2ZM6B 3N86A 4IM7A 4PZ7A 3ADPA 1WZNA 4TLCA 1ISFA 1SWWA 5L8VA 1JFVA 1RYBA 3Q0IA 3R0JA 1QFJA 3T9FA 1S0UA 2XZTA 4FJ1A 2JZCA 2WSLA 5EWLB 5HDBB 1FXSA 3GCZA 3U39A 1G2QA 2INGX 2PKEA 3MIZA 1APBA 4URWR 4J0KA 1HDZA 3OTQA 5TC4A 4OBEA 4BNKA 5E8JA 1V8DA 1KSJA 4D6XA 5DFAA 5K99A 4BO0A 2O2JA 3D4NA 3DBLA 4X71A 1FJGB 3CW9A 4CV3A 4KV9A 3V7WA 5ICEA 5KFTA 1CZOA 1K06A 4EPYA 4MYHA 1F6DA 1K3FA 2VJMB 3D8NA 4X1YA 3PQFA 3PWSA 4FW8A 3R9KA 4EITA 2IYUA 2VUUA 2TSYB 4EKNB 3L8DA 4L4ZA 5A3QA 1VE7A 1H8ED 4YP6A 1EZ4A 1JXQA 1YB1A 4TZ0A 3MWYW 4OI1A 1ECGA 2ZJZA 4G8BA 5TY0A 3SHWA 5L1JA 2IUUA 4XX0B 4MLDA 5FJJA 5L45A 3ZCPA 1ZWKA 1GJRA 4QULA 5LQRA 1RBMA 2RONA 3IURA 4RA6B 2GJ8A 1DLJA 5FNVB 1YFZA 2XNDD 1E7WA 3BSFA 2GHRA 5IT9A 2FCRA 2Z6UA 2R44A 4X7RA 3EQ2A 3VNSA 3JD2A 1WMBA 2GO7A 4R69A 1E7QA 2Z5LA 4P0QB 4RSGA 5F1KA 1NU6A 1DWQA 1PEKE 3I6IA 3A7DA 3PEWA 2YYYA 1H8HA 5C8YA 1Y6FA 4Y9SA 1J8DA 2C8KA 2PXXA 4FONA 4JGBA 3EVNA 4MUYA 4XD7A 1N1GA 2AV6A 1IIRA 5E4JA 3H2YA 5LBIA 4S04A 1P9LA 2ZXFA 4CEJA 4EHBA 5DHRA 1YQGA 521PA 3TL6A 5PGMA 3SHFA 4C0HA 2P0AA 1L5YA 4N3NA 3RVRA 4NXMH 2VUTA 1E92A 5BWUA 3WICA 3K09A 5IJ9B 2W4MA 4ND1A 4JVOA 3E3OA 3INGA 5CBPA 3W3AA 4KO3S 4L8GA 4MV6A 2FPLA 5G53C 5EYPB 3KNZA 2VI5A 4YJ3B 3UCEA 1H6CA 4TTSA 3LM8A 2NZ2A 3ZE9A 5A4JA 3N43B 1DAFA 1EFTA 3EYYA 1ZHHA 2PSJA 3V8PA 1CNMA 2J85A 1P7PA 3DE5X 1QQ6A 2R6R1 3GQBB 5DYYA 5KFUA 3HCOA 3VVLA 3USES 5J2TA 3ET5A 1QSGA 1XZCA 3B1FA 2X4LA 1LB1B 3OIUA 1KC7A 2ZJ3A 2OFXA 4YV1A 2FNAA 1RADA 2XIQA 1JDSA 2ZBRA 3UWSA 3WLFA 1W36C 1EFAA 3D6FA 5KYUB 1FRNA 1HZZC 2BGNA 4N5LA 2RGGA 1S0NA 3K0CC 3TUZC 2EYQA 3CQZA 3TY5A 2EP5A 2OPBA 2GAAA 3RJZA 4YCMA 2GJAA 3KSMA 2XQGA 4MRMB 4GSLA 5CRIA 4ALNA 1H0RA 2HPVA 1SIUA 3H84A 4INZA 1LC0A 2GEDA 1YBVA 4AY5A 1E3WA 4J1TC 4MRVA 1KO4A 3DHNA 4J0IA 1X9HA 1G3MA 2PGAA 4HDKA 4FGZA 4UHEA 4LHEA 1U0BB 3LP8A 1KXJA 5I5VA 2PQ0A 4XTRA 4IXTA 1DT5A 1XWIA 2CL0X 4QRHA 1N32B 3G0BA 3SC6A 3C6KA 4YLGA 2FY8A 1WVIA 2C3PA 3BTOA 2O5RA 3FPFA 4HAXA 4KWCA 1M76A 5J5AA 3V4FA 5K05A 3FNFA 1K5DA 3ZD6A 2F4NA 4DR3B 4OFZA 2VRWA 4RU9A 1MAAA 3O26A 2MMGA 5B3JA 5JWRA 4PG8A 4K0RA 2JB9A 3VR1A 3CLRC 3QWFA 2G6TA 3K16A 3FGZA 1XT6A 3QYJA 1U2EA 1FX0A 2FDRA 2WI8A 1ZD2P 3H3XA 3K1ZA 3PHHA 5H5JA 3RIHA 3LDGA 3T1OA 4Y0VA 3LUBA 1GGMA 2L42A 3L4BC 4GWLA 5CW1A 2GCOA 3HKDB 2H3HA 2VHZA 4DMMA 4YRLA 2Z8YA 1PG0A 4GUAA 1NMXA 1T5OA 3K5WA 2UYOA 3NCTA 1GYRA 3WWDA 4P4LA 1ECCA 2QX8A 3PEFA 4DABA 1YCHA 4BNUA 1BE8A 4CLDA 1PV1A 2FCAA 3PRHA 4S1WA 5I5TA 4W5RA 2IKSA 3OJFA 2HPHA 3E9EA 1SK8A 3ILSA 3FYSA 2P6MA 3ND9A 4JKOA 4KQ1A 5A3SA 4MUAA 3V7NA 4UARA 1HT1E 2Y0EA 3MJDA 1GCOA 2J46A 5EKTA 3INRA 5L40A 1QRUA 3TPZA 1XRPA 4H17A 5ALHA 1JKMA 4HJXA 2POQX 1GL3A 4BUJA 7GPBA 5HGJA 3RM3A 3U4AA 4DMUB 4QFDA 4MCIA 3HOVG 2DP4E 4DPMA 3QA3E 3C3WA 1J00A 2Q5LA 4JI0H 1VKRA 2H2GA 2WZCA 4IZHA 3EVZA 5K3CA 5C7IO 2BFAA 2I03A 4OGGA 2I87A 2FZGA 1PJ3A 2A7QA 1ZO8A 5TJHA 2IP4A 1NNI1 2HNKA 2GUGA 1KBOA 4K6GA 3JD4A 2NIPA 4NBNA 4J0EA 1GU0A 4XX1A 5JD3A 3H86A 2V7TA 4RABA 1GZHB 1GG8A 3G2HA 4EEXA 1TUIA 1P2DA 2ZJFA 3TX2A 2GEVA 4HNUA 1W6UA 3VYVA 1YI8A 5KIAA 1VI5A 3BILA 1ISMA 4O6VA 1GSAA 1EHYA 5EMLA 3A1CA 3V6LA 1MH9A 3NBYB 4UMEA 2J59A 3PW5A 1N3YA 4FFWA 2RHHA 2D1QA 1H2WA 1FFEA 1G6HA 3TW4A 1UANA 3I52A 4UCTA 4HTFB 1IBRA 2EDCA 4FVTA 4F7WA 1YMUA 4A15A 3ID6C 4J29A 3KKKA 2DECA 2V8OA 3NJ4A 4S12A 1ZGZA 3RABA 3UJ9A 1BOOA 1DIBA 4M7OA 3RIYA 5EQJB 1COWD 3BE4A 2H1VA 2D2VA 3N3BC 2IUEA 4TVBA 3TIFA 5HUHA 4I14A 5JNVA 1UM9A 1TVEA 3D1LA 5LYJA 5TJ9A 2GA8A 3EEFA 3TECE 1CT9A 1FL9A 3KUCA 1RM4A 4C7KA 4CCWA 1Z15A 4HXFB 3SLKA 5HKLA 3N6RA 1G41A 2B35A 3ZI0A 4KE9A 4TQGA 5EC8A 4Q9HA 3A9CA 4D25A 2BMVA 2J6HA 3VNUA 3BORA 4XB6B 5IMSA 1PG2A 4BV2A 1UBMS 4KR2A 4XOUA 3PR4A 1YRQA 5T4FA 4Z0PA 3OF3A 4OKSA 1VSVA 3G5UA 3QG5A 4D99A 4J1TA 5FPYA 1DINA 1Y6RA 1XA0A 4IIVA 1Y6ZA 4CQLA 5KX5A 3V1KA 1DOAA 4PHCA 2FWRA 1FJXA 3VR3A 4ARVA 4BY9E 3HKZE 4EUNA 5IJZA 5IKXA 1JHPA 4C2AA 1EVKA 1SKYB 3HMKA 1RC1A 4FFDA 4NE2A 4RTRA 1DC7A 4QC2A 4J7UA 1QB8A 1IWPB 3NBAA 2QJTA 2HNBA 1U0NA 3MF4A 4DL2A 1GPKA 5KPDA 2ZSUA 3H9GA 1ILEA 3LP5A 1TJNA 2V7PA 5HE8A 2K87A 4AP9A 4C6TA 4EKIA 2CBZA 1P7ZA 2QMEA 4JT9A 5HM8A 4CKCB 3UPTA 1WL8A 3BF7A 3O93A 2OD2A 1R27A 3SHQA 2F59A 1SUSA 4MDEA 2X5KO 1XSEA 2GBCA 2HLPA 2ZRLA 3JYNA 4L4XA 1U7PA 5CDGA 1A9RA 1U6JA 1F17A 2I2WA 2I78A 3A31A 3IPXA 4RD1A 3LX5A 4YC7A 5TDHA 3WNBA 4KUHA 3OHMA 4YAGA 3ER8A 2XZLA 1SB9A 4OLAA 1JVNA 2UZ1A 5JPDA 1RXSA 4DV1H 1O97C 2KW5A 4RHFA 4AU1A 4MNTA 3ZCUA 4F4IA 4JK3A 5K03A 2H48A 4ALIA 2J08A 3ENZA 3QFHA 4Q9IA 3QOWA 3PJRA 2AG5A 3AFHA 5TSDA 7MHTA 4GKBA 3QLVA 1ONBA 4RKRA 2ZYIA 5KSWB 4NBSA 2O2SA 2W83A 3EMKA 1QAQA 1U1CA 3T7RA 1QBKC 3KQWA 1EQAA 3A1VA 3T1NA 2J30A 2F6RA 1P44A 2Z4SA 3ZDFA 3DBOB 2JIZD 4BV8A 3LPLA 2YN0A 4O2BB 4AO6A 3RAGA 2OTCA 3LIIA 3RB8A 1B6GA 3QVMA 4L8VA 4L4YA 5L3ZA 1V4YA 1OPRA 2J6IA 3P2YA 5DH9A 1QS0B 4KIWA 2VUIB 4BDTA 4GYYA 3KZXA 2O2IA 4AUNA 5KNCD 1YQWA 4MYDA 1KQOA 3LQRA 1P5JA 3QOYA 1CJSA 3OFKA 1WS6A 1STOA 1W73A 4LDJA 4B3GA 4QUBA 2OR3A 3E5NA 4DV3H 1NQAO 1UK7A 2C22A 1UAGA 3OUUA 1Z0ZA 2FW9A 2JD2A 2G25A 2PKCA 3C3AA 3HU5A 1BVUA 4NJEA 3TPFA 3UJBA 1N7IA 4XH9B 3P4YA 4URFA 4O3OA 2UYGA 2O0MA 1XZMA 3GZTB 4GNRA 4XPIB 1JVBA 3Q87B 3M6AA 1O87A 4FEGA 2D54A 1SQ6A 1IY1A 1WVMA 2HWWA 4UCQA 2JI6A 1OYOA 2PFSA 4FXPA 5LDGA 5DCLA 1Q95A 1JJIA 4D97A 2PX3A 1S9FA 3HRHA 5HIJA 1TQ4A 1AF4A 1I2BA 1Q57A 1C50A 2Z57A 2ODPA 2G7ZA 4G09A 4EZBA 5DGHA 1HG1A 5THQA 2VBGA 5MN4A 3FIUA 1P33A 1XU7A 3C4JA 4RSHA 4WOBA 4YLYA 2CFOA 1C3VA 3BSYA 4RWZA 3LLCA 4BBPA 4F2DA 5K0LA 1A5TA 2GKGA 3PXAA 4MH0R 1FDVA 3CBGA 4UU1A 5BWCA 1CV2A 3PLAE 3AUKA 4NONA 4C4RA 3SDSA 1XMVA 2OK8A 2VJOA 4HAZA 1TM2A 4YCAA 1XKXA 2HAEA 3INNA 2P5YA 3WRXA 1QFYA 1VRCA 2DQ4A 3OPVA 4HUQA 1ZJ5A 1QX3A 3TW7A 4L5AA 5LA6B 3LQSA 4UPEA 1H22A 1I4OA 1LS6A 1PFUA 1XX6A 1YE5A 2KS6A 1JF8A 3KPVA 4IR7A 4LJ5A 5C53B 4X65B 4JXZA 3PGJA 5D2CA 4WESA 4RDCA 4R8SA 1NYRA 2V7QA 3CX6A 4Q45A 4AYXA 5H8WA 4NP6A 3NYWA 4LY6A 4XM0A 3W0LB 5L6LB 2NO6A 1S10A 2HCRA 5CEFA 1V1MA 2C4HA 3TMYA 2PVSA 3K96A 1QZXA 3FYUC 4UEOA 3GK3A 3I2HA 5I9LA 1EXDA 3F97A 1COWA 4LYHA 2G36A 4LC1A 1J0BA 2B3DA 4JWKA 3QHQA 4LJ6A 3QYFA 3JZIA 5E95A 3A2NA 3W34A 1H1TA 5EVCA 1Q0QA 2WTAA 5B7NA 3GAFA 2YIVX 1GEEA 4BMDA 5JQWA 5EPEA 1DG1G 2H7CA 1JSCA 5A2QW 1XMJA 1ZEMA 4M21A 3GT4A 2C9BA 2FF7A 3B9QA 1W5EA 3HCDA 4XYMB 1GNQA 5JSZB 1PVDA 3ZEAA 4NEGA 3ZPXA 5A9TA 3H3FA 4E5DA 4NZMA 3OQNA 1GTL1 1YAJA 1RHMA 2JJYA 5J63A 5KDDA 2P62A 3G0OA