3MWEA

Truncated human atp-citrate lyase with tartrate bound
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
424
structure length
424
Chain Sequence
SAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ATP-citrate synthase
publication title Identification of the citrate-binding site of human ATP-citrate lyase using X-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
total genus 132
structure length 424
sequence length 424
ec nomenclature ec 2.3.3.8: ATP citrate synthase.
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16114 Citrate_bind ATP citrate lyase citrate-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mweA01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mweA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 3mweA03
4MV4A 3K5HA 4O7NA 4XX0B 2CNVA 5JVLA 2GPSA 5JH7F 4XYMA 5BMVF 2FPIA 4YB8B 4MV7A 1DV2A 4WBNF 3AX6A 4YBZA 1Z2NX 5BPFA 2PN1A 1IOVA 4XX0A 4FE2A 2I80A 2P0AA 4YB8A 5H80A 2OLSA 5LA6F 2VR1A 4HNUA 5CAEB 3OUZA 5LYJF 3V4SA 2R7NA 2NU6B 2GQRA 2FPGA 2CQYA 4YJ3F 3VPBA 1CQJB 2W6MA 2PVPA 3JRXA 4O2AF 4YAJB 2YYAA 1I7LA 5CAEA 2WYOA 2NU6A 2R82A 1OI7A 2DWCA 4M9UA 3RV3A 4Y8VB 4O84A 2YZNA 1KUTA 1A48A 3Q1KA 4YAJA 2DZDA 4C5BA 2R87A 1EHIA 5JQWA 1GLVA 4MV6A 3VMMA 3VA7A 3R5FA 1OBGA 2GPWA 3DMYA 5IYZF 4Y8VA 3HB9A 3HO8A 2DLNA 3KAKA 4XZ3B 4IIJF 4O4HF 3R9RA 4MA0A 2YZMA 3N6RA 1M0TA 2I8CA 2YS6A 3MJFA 5CA1F 4TV8F 1ULZA 4XZ3A 2V59A 2ZDGA 1UC8A 2VQDA 1BXRA 2XD4A 4XYMB 2QK4A 5CA0F 4YBZB 3WO0A 3U9SA 5KX5F 2FP4B 4HNTA 4MV9A 4QSHA 2CZGA 1GSOA 3R23A 5JVDF 3DF7A 3G8CA 4O7RA 3U54A 4FFLA 3GIDA 3TIGA 4O7LA 4FGRA 3Q2OA 5D8DA 1W96A 2W6NA 3VPCA 2YV2A 2YZLA 2FP4A 3UFXB 1JKJB 4RZQA 4NYEA 1EUCB 2FPGB 2I87A 4E4TA 2R7LA 2QF7A 5K2MA 3JZIA 1KBLA 3U9TA 3LP8A 4DLKA 4O4LF 2FB9A 2PBZA 1KJ8A 3NUAA 1JDEA 2HJWA 2YL2A 2W70A 5JQGF 4EGQA 1JKJA 2VPQA 3UFXA 4O86A 1VBGA 2W6QA 4YAKB 1KEEA 1EUCA 1EZ1A 2V5AA 3KREA 3JRWA 5HBRB 3VOTA 2NU8B 2R85A 4I55F 2NU9A 3TW6A 4YAKA 2ZDQA 1CQIB 1B6SA 3ORQA 5HBRA 2NU8A 2CNUA 3V4ZA 2ZDHA 3TQTA 5GONF 2R7MA 2V58A 1CQIA 1A9XA 4O4IF 5DMXA 3JZFA 2R86A 4IHJF 4ZOLF 1Z2OX 3ORRA 4FFRA 1EUDB 1C30A 4I50F 2W6PA 2R84A 3ETHA 4MV1A 1CE8A 1GGOA 1PX2A 3LWBA 1M0WA 3RV4A 2DIKA 4TUYF 4IWXA 1DIKA 2YWVA 4FFPA 4FFOA 4IWYA 1EUDA 3MWDB 4O7VA 3HBLA 4O7ZA 4EGJA 1OBDA 5C8YF 5EZYF 3SE7A 2X0SA 4O7SA 1CS0A 5LOVF 3MWDA 2W71A 3RFCA 4FFMA 1VBHA 5KKNB 4MV8A 5BPHA 5I47A 1Z2PX 3PFFA 4MAMA 2YV1A 5J2TF 4C5CA 3TIIA 1UC9A 2W6ZA 2IP4A 1EYZA 2GLTA 4IZOA 1JLLB 4O81A 3U55A 4L1KA 3KAJA 3G8DA 3VPDA 1M6VA 2SCUA 2Z02A 1DV1A 5LP6F 3E5NA 2NU7B 2NU9B 1JLLA 4HQ6A 3WNZA 4XYLB 3OUUA 3N8DA 1KJJA 5FNVF 4DIMA 2Z04A 1W93A 4WD3A 5CB4F 2NU7A 1KJ9A 4ME6A 4O83A 4FU0A 3K3PA 2R7KA 4O7WA 4XYLA 2CSUA 4HR7A 4HNVA 4C5AA 4O82A 5LXTF 4O4JF 4MA5A 1AUXA 1SCUB 2YS7A 2YW2A 2GQSA 2YRWA 2YZGA 1I7NA 1PK8A 3K5IA 3RUPA 2FPPB 1C3OA 3AW8A 5C1PA 2R6FA 1T36A 1CQJA 3TINA 2XCLA 1KC7A 2C00A 1IOWA 3BG5A 2YRXA 4ZI7F 1JDBB 2NUAB 1SCUA 1GSHA 4O7YA 1GSAA 2FPPA 3GLKA 1KJIA 4ZHQF 5HV6A 1B6RA 1KJQA 2HGSA 4TV9F 1BNCA 2NUAA 3I12A 2J9GA 1WR2A 1E4EB 4YJ2F 3MWEB 4I4TF 4EG0A 2W6OA 4MV3A 3WO1A 3ETJA 3KALA 5J2UF 3QFFA 4O7TA 4FFNA 4O2BF 2CNQA 3R5HA 1E4EA 2FPIB 3MWEA 5C1OA 2SCUB 4ZQIA 3R5XA 1VKZA 1AUVA
chains in the Genus database with same CATH superfamily
4CU2A 2FR1A 5I9MA 2J3QA 1TJ5A 4ZC8A 3VVLA 3I1JA 4EEKA 1TVMA 3KE9A 1YC5A 4B7AA 2ORYA 2YZ7A 3H9UA 4L4RA 3TI7A 4NFHA 4LRWA 1XI2A 2C94A 5ITZA 4BTVA 1K1QA 2B69A 3C39A 1SIOA 1Z6TA 4N7BA 1P16A 4WHXA 2PFGA 2C29D 1Z7EA 1T0JB 1C3OB 4P5EA 5A5DA 1QNFA 3WB9A 2YWEA 1X1BA 1YVRA 5FO1A 5JW6A 4RJIA 1D8AA 4JJIA 3TTTA 1YRAA 4B33A 2R87A 1C9EA 3NVKI 1XYYA 2O5VA 1P9WA 1MOSA 3HJHA 1Y9AA 3CS3A 1WZIA 3WMGA 3TGPA 4B5LA 3ASUA 2FPOA 1QR6A 3DQQA 4P31A 2WF9A 3K0SA 1ZLYA 4J07A 2CF6A 4JXXA 3KPJA 3TFWA 4JLBA 4EJSB 1YZYA 4PZPA 4JR0A 3IPRA 1OFHA 1II9A 3ZJ4A 2G06A 3ND6A 3WLIA 3AM3A 3WV5A 4YHHH 3H9EO 2XVXA 5KG0A 3BWMA 3WYEA 1N2CB 5LNK1 1SZJG 3NAMA 2C9DA 3T7RA 1W96A 3VYVA 2OV3A 3DVRX 2EFYA 1SBYA 4CKWB 2UXCH 2XDQA 5KDDA 3NDJA 1ZHQA 5AHOA 1V41E 3I4FA 1YONA 2QF7A 4ZI3A 2PBZA 1Y3BE 2IH4A 2FUNB 2XNKA 1XVAA 3BH6A 4NEQA 1PR9A 3FKIG 2TSYB 4QM7A 3T5KA 2ZBVA 2JGEA 1OASA 4FGKA 3WBJA 2HDKA 4EHKA 1HURA 1PT6A 5HBRA 4S1NA 3PEVA 1Z6GA 1C7RA 1RC8A 4MR7A 2Z43A 1LTHR 3LRTA 4WY8A 3FYUA 5BSUA 5KKCA 4BZZA 1KYVA 1NUSA 1NNI1 1XUOA 1HDOA 2HRZA 1PUIA 2WQ6A 1DARA 3H8VA 3NTRA 2DJIA 3D6UA 4LRQA 4C7XA 5K0TA 4R8UA 3T3HA 1JTVA 4IDCA 1COZA 4DF3A 2BRUC 5ED0A 2M6LA 1VBKA 4J29A 1WIWA 2C2KA 5KFGA 1QG2A 1L5MA 4JI0B 5AI5A 2BMJA 3IFSA 1ZM7A 2QPLA 2BKLA 3RF7A 4Q21A 5KFXA 2LKCA 2WAAA 3MTDA 2X19A 1DAIA 3PN1A 5JYBA 3T7SA 3V8PA 4TPKA 2PJUA 3THWA 3ZV5A 2BY4A 4HDAA 4ZEOA 2JL1A 3LP5A 4H1HA 2HBYA 3SHOA 2ECQA 3PYMA 3GQCA 3SYKA 4TN5A 3D64A 3U4DA 5DNEA 1NQAO 4Y6OA 3GGCA 1TVCA 4WN9A 2PGNA 4AF7A 5FTKA 2JJ2D 3ICEA 5KOJB 1PZXA 3E4DA 3BG5A 2ANCA 3IKVA 1XDBA 4DWJA 2CZQA 3C5EA 2C77A 1Q92A 3ZY4A 4AKTA 1JEEA 3PXDA 1E32A 3ZDCA 4WGGA 4XXHA 1SZDA 1D6MA 4UTXA 1RACA 5BR1A 3MWFA 1E3JA 3DDHA 1JDUA 5I5UA 3KZMA 2WAQE 1C3XA 1F8UA 4NATA 4QPJC 3C3KA 1SWWA 4FOPA 4ALJA 4D4LA 1EQUA 1YBAA 4OHPA 4XVRA 4QQRA 4NXNB 4Q9AA 1I6MA 2JLUA 2K2WA 3H5AA 4WX2B 4OSOA 2WJGA 2HXGA 1T1EA 1UCFA 2O7RA 2OAP1 3MJVA 1P7ZA 4EGSA 3ZK9A 2Z4TA 3RIYA 3UO8B 4FOOA 4PX2A 3D3EA 2HHHB 1IUOA 3NHJA 4C30A 1RABA 1IATA 1JVSA 3RJ0A 3EIQA 3HDJA 2V7GA 4QVIA 2VDQB 3LYLA 2VUHB 2OQVA 3IHWA 3D3KA 4B7ZA 5KYUA 5CHEA 2C2GA 4A3IG 3MMZA 3OZDA 5AJTA 1IN4A 3NV9A 4HMPA 5EQJB 3S2ZA 4WE3A 1L5HA 4NDNE 3Q1LA 4UOEA 1IXZA 4H0CA 3DZIA 1SEVA 5FOSA 3SZMA 1NUAA 2ZJ6A 3O9VA 4A26A 2VSFA 3CRQA 3QZUA 5AXAA 2V9ZA 5EIOA 3OJOA 2O4CA 1M0EA 1F2UA 4ZOAA 5DO9A 3DB2A 2RGVA 1IOLA 1UMBA 5JHGB 4LXUA 3E22B 2W8LA 1WW2A 4YHBA 3MYYA 2HPAA 3VXKA 5I8ZA 4O3PA 1V1JA 2JF0A 2HLNA 2CSXA 4ER5A 2DFLA 1QIDA 3O8OB 5HIKA 1YMUA 3Q6NA 2QVBA 4DHEA 4FFLA 4QJBA 2DFDA 3LM8A 5IDXA 2VF2A 2YV2A 4J2HA 4O4LB 3DLTA 1B14A 2CLHB 4KMOA 4BX2A 4NOKA 3UWOA 5KS2A 3D4IA 3AP3A 4M0KA 4DJEC 4QUGA 3WNBA 1W5BA 3KO8A 4PFQA 1SXGA 4C7VA 2OUKA 1AA6A 4G0OA 5F7ZA 3N2NA 3N5CA 3U56A 3FMOB 2ZSIA 4BMXA 2PZEA 3QBTA 4LQ4A 1M6YA 4IF4A 1MB0A 3FNGA 2RI1A 4XCQA 1JVBA 4EBCA 4OH7A 1HYEA 2IX9A 4JL5A 4C0JA 1SY7A 1FMJA 1W4LA 3OTIA 2G28A 2CNKA 4HB2A 2PZFA 5I7EA 3KL2A 2ON6A 3SJAA 2R84A 5FOXA 1WSCA 2C54A 2I2CA 1YD7A 3NALA 3U0BA 4YMWA 4ZJZA 3E3NA 2IOFA 5H70A 4B7CA 5BVGB 2WUWE 4I3GA 4M1WA 1IN8A 3WZMA 4BVHA 4ZMSA 1C1HA 2UYYA 4JT4A 5IJXA 2VK2A 4E2WA 2HGZA 4NECA 4AICA 1W87A 3COYA 2XGOA 2MSCB 1TB4A 1RXEA 1WVGA 2QD3A 2YTZA 4TSFA 3PFKA 5CPFA 2G7MC 3EVNA 4O8ZA 1AD2A 3T12A 1QS0B 4F5ZA 3L8FA 3ZXIA 3TMYA 2Q3HA 2CCKA 1ZJ4A 2BFDA 1SKQA 5LP1A 5T3YA 2UUBH 3EPLA 3NAQA 3KKNA 1E0AA 1BQEA 3E5NA 3VHXA 1YI0A 3HEBA 5CVJA 3PHBE 3GH3A 4OB7A 4ED2A 4BBPA 5J47A 5FPKA 3K70D 5ALVA 2AFVA 5FHRA 1G4AE 2W6JA 3Q3JB 4MS4A 4M21A 3SYMA 4P83A 1GQSA 1M72A 4JOSA 1TPZA 2GXUA 4A82A 4LCEA 3HU2A 3OFKA 3AJ9A 1FUEA 1J49A 1WXGA 2ZT6A 2NOAA 5EI5A 1R4NA 2YHUA 1YQDA 1SK8A 3ZI4A 2CHEA 1JFFA 2XA2A 4J90A 3QI2A 4CKBB 5CCEA 3L07A 2QQ0A 4UJ3A 1P2FA 4Q39A 1P0MA 1CY1A 1Y8RB 5EJ7A 1LK0A 2FZWA 5K8IA 5FEMA 2QP9X 3EIFA 1NFRA 2IZOA 1RWMA 3IAUA 4WPGA 2QZZA 4DLPA 3MR6A 4F06A 3A6DA 3ZWWA 2GDJA 2WZBA 1ADFA 3GZJA 2IZZA 4YGYA 4D26A 3IV9A 4LHWA 1JX4A 3LF2A 1L7OA 2O2CA 1HSOA 4DY4A 5MFZA 2R8KA 4YI5A 2OGTA 4W5OA 1TT7A 4EIWA 1NXWA 3TJZA 1MA3A 2AD5A 3X2EA 1KMIY 1RQXA 4PE5B 2PS1A 3RYFB 3GRAA 5H0IA 2R60A 1WDKA 3OX2A 3EXFB 4MCIA 4UJ5A 4B09A 2P27A 2WJPA 1HORA 5SY9A 5AUNB 2RHGB 3VU3A 5G3YA 5EIEA 4HNGA 4TYMA 5B36A 5DNDA 4KYIB 3I53A 2COIA 4CEIA 1E3MA 5CM9C 4F71A 3DCNA 2UKDA 4PAGA 2YZNA 4JEIA 1QHEA 1L2TA 1S03G 1DKOA 1GITA 3NHBA 2PMCA 1R8YA 2DPYA 1EEHA 2JGDA 2W42A 1FS5A 1O3YA 4U7WA 4QW9A 4EGFA 2VPYA 5EE3A 2GJSA 1SVLA 3K5WA 4ZQEA 3KZOA 4O4HF 1G17A 3FI0A 4RUKA 1ICIA 4BB0A 1ZIXA 4KXYA 4DBLC 5B3JA 3KZKA 3O38A 2QNIA 4HLNA 3GJ4A 1DWOA 1EXDA 3B2NA 4BX3A 4MQFA 3ZEIA 4KXNA 3GEEA 2BCEA 3TPCA 3DZGA 5GJCA 5JNWA 2BWJA 1Z56C 5CFPA 4FGRA 2ZTHA 3N42B 1R0LA 2VAVA 2BONA 4Y2VA 2EBHX 3ML1A 4YCSA 1DKNA 3GVXA 1JXQA 3OE4A 4BWSC 1BGWA 2QGNA 2HYDA 3IERA 3DS8A 4LTDA 1QPBA 3H7IA 4QWMA 1G2WA 4U5XA 1X15A 4F9FA 1ATZA 3T5DA 3CONA 2WMYA 3Q8QB 3VX3A 1N9GB 1U04A 5FOUA 2XA9A 2OB2A 2J6CA 2JD0A 4GL2A 3KUXA 3OPQA 2ZTUA 2YWJA 1FLDA 5GONB 3DTYA 2VPWA 5F5XA 4UU0A 2FW6A 3UMFA 4U2EA 2PXHA 2R8XA 4L16A 5CUQA 2PX5A 5M5BA 1CQIA 1LTQA 2NUTA 5A06A 1U2QA 3UTDA 4PXSA 3MB8A 2ABWA 4NESA 4BMYA 1P80A 2ZXFA 4TL6A 4F84A 4CDGA 3GYBA 5AI6A 2NYRA 5JSYA 5C8YB 3HWSA 1ZK2A 2I8AA 4TUYA 5KINB 1ND5A 4RHEA 3V7YA 4OHMA 1ICEA 4FZ3A 4GPAA 4X3PA 4KV7A 1QJ4A 1JJAA 4BOYA 1G5TA 2UVUA 3PLNA 1N33B 4DCNA 4ITVA 4RHFA 5JADA 2AF3C 1PS8A 3ZQ6A 2ZBFA 3U55A 1Y5MA 3I37X 1VXOA 3U49A 3QVVA 2EG9A 2RHOA 5IFKA 3THXA 3FTDA 2H2FA 3W2GA 3BS4A 3HCNA 4IJUA 4MUIA 4LPKA 2FKLA 4EYSA 1IZ9A 4TWRA 3AUSA 2UU9B 4W1RA 1KFKB 2P11A 3FCUB 1XN4A 5IK2A 2H1HA 3IVMA 5BN4B 3BCRA 5A9RA 3AESB 1TKBA 5DM0A 1FTQA 1ZK0A 3NHAA 3PZBA 2AGPA 1PGJA 1P6QA 3TINA 1E79D 1U0NA 2F3TA 4TKVA 4UULA 2COGA 5AUQA 1H42A 2JLRA 1JDBB 4P33A 2QKYA 4F56A 3CH4B 2I7DA 5HZGA 1N5IA 3NUZA 4DZRA 2RH5A 3A1SA 4HYTA 2FN9A 2G77B 4RMIA 4EFDA 1G7RA 5I7UA 5T8KA 1D6SA 1M1ZA 4XD7D 2Q9UA 1VMAA 2FGJA 3CLRD 2PH5A 2X5JO 1V8ZA 1ZU4A 4A27A 2QG4A 1NWCA 2XE7A 1WHSB 2VZLA 5C1OA 2QYZA 3JASA 8ABPA 1P9OA 4EFBA 2BUAA 4D9MA 3MINA 4R40A 1IZZA 3JQ9C 3CINA 3DKKA 3AFMA 4V0MA 3UHJA 2G0TA 1Q2UA 4I08A 4PC1A 2XBMA 1XAJA 3H8SA 3SDBA 3A6GA 4FUQA 3LUDA 2GFQA 4QYTA 3AKZA 5EMLA 2J67A 2ZYDA 3F49S 3M1AA 4YB8A 4BLSA 2DR2A 1TQDA 1XA0A 1AHNA 2J9XB 4YT2A 1JSLA 2XMBA 1ZAYA 4HGOA 2Z5FA 3C70A 1JG7A 2WAXA 4MKZA 4R6XA 3VU1A 1SD1A 4B3SB 2YWCA 4KPUA 4QAQA 4EHBA 3UAYA 2D7CA 4YROA 2A30A 5AVZA 1VE6A 3V8NA 4X20B 4PWQA 3C3WA 1G8MA 3MS2A 2R00A 2HV8A 3COSA 3VMMA 2A86A 4MVJI 1GPNA 1T9GR 3EPJA 5K05A 3IODA 2P35A 1E2PA 4UVGA 3TFOA 1DBSA 3PLAE 4QECA 3BJMA 4AYWA 1CV2A 4KWTA 3O8LA 3PUHA 4MVJM 1ZNYA 5KYXB 4LDRA 3U7QB 4DV1H 5CDHA 1L9XA 4BZQA 2H0AA 3H1FA 4A8TA 5FTNA 4J16C 4W6ZA 4ECTA 1IZYA 4B6GA 2QVLA 4YI3A 4I9HA 3D7SA 1A9YA 4O7LA 3AR5A 1FDVA 3GAMA 2GCPA 3DO8A 1RMTA 2HA2A 2GR9A 4LJ8A 1KAEA 5C31A 1KKLA 1TLTA 1Z8DA 3HWX1 3HGTA 5J59A 4K26A 2AD1A 2W2LD 5LUBA 2JEJA 4KG7A 4REQA 4P3NA 4JGIA 1SU7A 4NZZA 5CYPA 2LCFA 4EO9A 2CHFA 3OZCA 3LO5A 1WTAA 4RIGA 5CT8A 2J5KA 3DV2A 4ZOLB 1T15A 1C9NA 1Z6PA 2JCVA 5EQDA 4BQSA 3PQ3A 4B3TH 5TX7A 2ZJBA 1OVMA 2DE0X 4KXMA 4JH0A 5KFOA 1C30A 3OLZA 3QY9A 3IUMA 4QODA 1IJBA 5BQ3A 5AMXA 2YOFA 4Q44A 1FNMA 3P97A 1UANA 2EGHA 4QX6A 3OU2A 3MWDA 2DFTA 2FZCA 1S3GA 4KU4A 3G1TA 1L4NA 4E46A 5BN5B 2CLEB 1QH8A 2QROA 1TMKA 4U2BA 1QU3A 1MVNA 3ZWPA 5EJ5A 1WB6A 3EXG1 4ZQBA 1T2UA 5D1NA 1P1KA 4CN9A 1BW9B 3BFJA 3OTWA 1S2NA 4XM2A 1GCOA 5DHSA 3BIOA 1O54A 3QPWA 3IEVA 4E4RA 4MPTA 1HZJA 1ST2A 2XCRB 1WJGA 1VMDA 3D54D 3IP6A 2NVBA 3W2FA 1ZFNA 2IEAA 4FU0A 1QJCA 9LDTA 1XHFA 4ECZA 4WVFA 4D02A 1JI0A 2FSGA 4IVPA 2Y0SE 2NUPA 3RBDA 3L7NA 5HQ3A 3AERA 1IDOA 1PFKA 2MJLA 2FGKA 1LFDB 2JFWA 4U0KA 2FCAA 2W4MA 2O1SA 4ECAA 1JHYA 1TAGA 4KQIA 4UVEA 4RZIA 4NI5A 5U9CA 1G64A 4YJFA 1VRVA 1CZRA 3AF1A 4Q0YA 5JAZA 4D7AA 3RS4A 1LRLA 4X1YA 5KFCA 3S81A 5CXUA 4W9NC 3IAXA 3QF4A 4O3OA 521PA 3FAZA 2PKYX 4IHKA 2D00A 1MR3F 3K09C 4AWXA 2CFIA 1J21A 3URKA 2XAUA 4XEHA 2QL7A 3LPNA 5EJIA 3EAGA 1PK9A 1KT8A 1OHHD 3EDQA 5D85A 1T6BY 3L8ZA 4KVZA 4TLBA 4HAYA 4BJHB 1OZHA 1Z0DA 2J3LA 4LBYA 5EYPA 1UDAA 4KX3A 3LWNA 3EVZA 3WKAA 3HVJA 4KLAA 3V4SA 1DOAA 3HSSA 3ZWDA 3JALB 1P0PA 2CVHA 4JI2H 2P0YA 1UEIA 3VDNB 1OXUA 2Z6AA 2F3UA 1EHCA 4O2AF 1KIFA 3VHRA 2CFSA 1VJCA 4QT4A 3OFSA 1MHTA 1JL3A 3A6PC 3EZ9A 1G63A 1AKQA 1Y4DE 1P2SA 1IHXA 2D1TA 2Z3WA 4IXNA 5FWXB 3H3VH 3P19A 1YTLA 5CT4A 4BEWA 2FX5A 5DHFA 1HSZA 3EVDA 1GR1A 2DLNA 3G6WA 2HUNA 4LFCB 2GKGA 3ON5A 4IIJF 1ZMBA 4HVCA 4HX5A 4G5YA 4UBLA 1MB3A 3AH8A 5M34A 1YR6A 4F86A 3WQQA 1QTNA 4B7UA 2WWXA 4OXKA 3EVBA 4O3RA 4I36A 2QTAA 1PQYA 2VXYA 5JFTA 5IEBA 2O3TA 2OXEA 1NPYA 3VH3A 1AKVA 5BWXA 5F9MA 3GZTB 3VSCA 5BW4A 4NK4A 5ESDA 1X94A 4AYBE 5DHTA 5KVQA 1FUIA 2HW8A 5ICFA 3LNTA 2MYPA 3TUZC 5JS2A 4GKJH 3DD1A 3OCWA 4NCXA 4HB3A 4AS1A 3R3XA 1YRLA 3EMBA 1PIWA 3OEHD 3SY8A 3F97A 2NNWB 3RS3A 2BD0A 3VTAA 1J56A 1QMPA 2AQHA 3IAFA 4ZODA 3UWSA 4AB1A 3LZCA 4FD2A 4WCFA 1K9SA 2UUAB 2H6EA 1QORA 3ZOZA 2ZXUA 3RR5A 3LUGA 3DMTC 2W2KB 3IL2A 4L6AA 2IMWP 3OE1A 1C4OA 4HN2A 3BXHA 1ZC3A 2CW5A 3KZCA 2ORED 5EKTA 2NT3A 3NNDA 3TXAA 1GQOA 2B3TA 2CVQA 5DGXA 1MP0A 3O5AA 4TSRA 3CLVA 2GK7A 1RKBA 1V4NA 3EZFA 2H59A 3V9AA 2UXBH 1VJ0A 1QH1B 4KNWA 4IGFA 4OHUA 1UFQA 3CTMA 1DX9A 2DMRA 2NPFA 4X41A 2Z83A 3GJTA 2EEPA 1RI5A 1VP3A 2Y0EA 3PXBA 3NUGA 1PNOA 5JAMA 5J3JA 5IAEA 4CYMA 5AQ1A 1DADA 3JXEA 2C4TA 1RP7A 1ZA1A 3V8EA 1QFJA 3WXMA 3HRHA 1YDGA 3GH1A 4PAWA 5AH0A 4KVGA 3U7FB 2W7PA 4RAYA 4KR7A 4POAA 4F5WA 2DPJA 4LRXA 4Z4QA 1N1GA 4O82A 2C5FA 1I14A 3TKAA 5IVKA 1JALA 1QCYA 4U2CA 4J9RA 4F9TA 2YC4C 5IDWA 1ZGJA 1HDIA 2PO5A 5JBNA 4R2LA 2DOKA 2AJBA 1JXAA 3RADC 1UM9A 1L8AA 3ZX4A 4OLAA 4GBJA 5IDVA 2ZYUX 2XT9A 2BH2A 4TT8A 3EPHA 4FN5A 2JEFA 4BN5A 4RY0A 2JEOA 1XQVA 3RGZA 1P6UA 1YMQA 2JZNA 3TSWA 4FJ2A 3ZDYB 4G0NA 3KZNA 4GR9A 4Z86A 1KEKA 2VDOB 2B4AA 2R1TA 5HR5A 2ATLA 1SQ5A 1K8YB 3OF3A 4OYHA 2ZTLA 1F7VA 2R7AA 3W06A 3KQNA 4G4GA 2Q99A 5DIFA 2ZUDA 4M38A 3L93A 1PZFA 3QWBA 5BWLA 4ECWA 4L6CA 3QPUA 1ZH6A 4ZAXA 3ZZ0A 1DAGA 4GGOA 3MWGA 1TLFA 3MLEA 4LY9A 1L5GB 2WVHA 3F4KA 5KG5A 1VCOA 2O06A 1WL8A 4Q19A 1M1YE 4AU1A 4YJ3B 3VTFA 3H99A 4DMHA 4KGZA 2J7PD 1L1RA 5E2AA 1N1MA 4AG6A 1NWHA 2YYYA 3O8BA 4YRFA 3LOPA 3NTXA 2PQMA 3RBVA 1W88B 3B8EA 2IV2X 1N36B 4IQFA 2HIAA 2J0UA 2B2CA 1SELA 1G38A 5CX1B 4LVNA 1FLAA 3F6YA 4KREA 4UM5A 1GTVA 3MNFA 2UZAA 3STWA 3O8DA 3A2KA 5BVHA 1IMJA 1S2LA 5KHAA 4HDNA 1XJ0A 2BGMA 1GU7A 2OECA 3C7TA 3D3JA 1BXRB 2RKOA 1EVZA 1V1RB 3FGPA 1UKYA 3FFBA 1GRQA 1WH2A 1VBMA 3P27A 3FF1A 1E3TA 2ZITA 4NG5A 2V03A 4AJ1A 1RKUA 5I9IA 3X2SA 3CPHA 5LNK6 5IBRA 1Y82A 4NMWA 1LPPA 3VR5H 5H4GA 3GFQA 2PRYA 3N9IA 3GLIB 2GYYA 4R4JA 1K1SA 5ARCA 1XZFA 3ESDA 1JFVA 4ZAWA 3ZHXA 2YQ5A 1V9CA 1FF9A 4OQDA 5C4GB 1RM0A 4E4TA 2XC9A 1J1UA 3U9TA 4HF7A 5K6RA 5EINA 2FSPA 3N70A 1L8QA 2W8ZA 3WK4A 4JLKA 2Y1EA 3VR6A 1ZK4A 4S3MA 3JPWA 3T5HA 2X41A 1UK7A 2FJ0A 5C51B 4EPWA 2VHCA 1A8PA 3UY4A 1UINA 3B2EA 3DBOB 3FJYA 3N39C 1REQB 3C1AA 2OORC 2QD1A 6LDHA 5FOQA 1YAJA 3U60B 4KJXA 4IW3B 3RAQA 4PM4A 2VP2A 2YJ6A 1NBIA 5EOYA 4LJ7A 1Q7CA 4YALA 2RHCA 4JJZA 4HEJA 3OJLA 3L3BA 5DLEA 5LKRA 2Y6UA 1JQBA 1KPHA 4I50A 1Z5UA 3D31A 4GH5A 4BDTA 2LE0A 2RHLA 4US2R 2GRUA 4F91B 3AC0A 1G6Q1 1P2TA 3RRYA 4M9XA 1XNQH 4L22A 1C8LA 5BUSA 4FZ5A 2CLKB 5A7HA 3WGQA 1OC2A 1RXIA 3WP0A 5HJ5A 5TGZA 1M8JA 2BR5A 4L2IB 5JC8A 5IU6A 1M6VB 3NJ4A 4EHNA 1IXRC 4QEZA 3LMKA 4K1XA 1WUYA 1TT5A 1IBLB 4CHIA 4PBRA 1H8HA 1CRPA 2H3HA 3K16A 2SCUA 4FQ8A 4RW0A 2W11A 4PZ9A 1KZYC 1FNSA 4UBKA 4G9GA 2EJWA 1OY1A 5DYGA 4XWTA 1MQ9A 1MPTA 5LU8A 3L43A 1E3IA 4KPFC 1JJFA 3LDHA 1NP7A 4Q48A 3BOSA 4F72A 3V1YA 1WBDA 1MX3A 1CUGA 1P4JA 3ELYA 4D81A 1XPOA 1E1QA 2WJ6A 1N2SA 3L0BA 2JIBA 1TMOA 2Q7OE 4LF5B 4QLOA 4FKMA 2QLTA 1FNCA 3PUZA 1IY9A 4IRXA 3K8QA 4L8YA 1Q6YA 4NCNA 1EFRA 5KJCA 2RAPA 2OHVA 1SVMA 2H1LA 2WR8A 3QKIA 4TV9F 1BHSA 3NH9A 1T9BA 1AKNA 1FYXA 4REOA 5J2UB 4FR0A 4R0MA 2VJMA 4F6RA 4A8JA 4C6TB 3M9XA 3H9JA 4DLZA 1UXKA 5IHXA 2WJAA 3H97A 1RYYA 2IPOA 5BWBA 3NPMA 4FKZA 5C80A 1C5KA 2D6FA 1ZINA 1MJ5A 3ZGNA 2WE7A 3NC1C 5L3QB 5KC9A 4PNZA 3NBAA 2A1IA 5KQPA 5FUWA 4DA6A 2X7XA 4DIKA 3PC8C 4MJLA 4E2ZA 1YU6A 2XRYA 4PHHA 1U1GA 1L5KA 1VFPA 4FGLA 5CAEB 2QTWB 3FAKA 3WOHA 3E70C 3ET5A 1Z39A 3NHPA 2GF0A 2QSYA 1J8YF 4E1BA 5EUQB 3BGDA 1JEJA 2C3MA 2B0CA 2IU0A 4HMOA 1RPTA 2HIHA 1G5QA 3LQKA 1GPH1 4GPZA 5ILOA 2BTEA 1NULA 2CLDX 4TTTS 1CR6A 4ZHQB 4S1WA 3USZA 2G1PA 4UCXA 2ZJ2A 2BN4A 5JRDS 4QTXA 3P71T 2P6OA 4JI5B 4AJ4A 1L3BA 4U5QA 1C41A 5F7JA 5B12A 5G3ZA 1P7CA 2ZWOA 3K6KA 1V8FA 1UBJS 1E6WA 1VYUA 4FILA 3UMMA 1KYTA 4KBGA 4MV9A 2AYXA 4PX5A 1I7DA 3EPRA 3X3HA 4K1LA 3BB4A 2MSKA 5CRIA 3JATA 5DBEX 4DMMA 1CYEA 2YZLA 3PKJA 1YE5A 4PIVA 4C4ZA 2Y2VA 3MK31 2ZPUA 4MO9A 1Z6XA 3SIXA 1E8NA 4K9LA 4YS6A 3TDNA 3MGBA 1WZ2A 2W70A 2WWGA 5JQGF 2H52A 1TQ4A 4UBNA 1CKMA 4DMGA 4MVJA 4LXGA 1BMQA 3OWOA 2RHBA 4M1KA 3ND7A 3P9QA 1N34H 1QBKC 3L5OA 1KVSA 1FQWA 1BYIA 2WHQA 4G01B 2RGUA 2X1VA 5C52B 1X19A 1Y4UA 4YNBA 3IUNA 1QRTA 4RYLA 2VDRB 2JKVA 2SKCA 2OP0A 2LCIA 4MQ6A 1UXJA 5MFPA 5K3SA 3BMNB 4OA8A 4O2RA 1OTXA 4LSMA 2Q2OA 1G8JA 3CLUD 1RSZA 3CSUA 2VJKA 3AXSA 3PBKA 4WOJA 3RVQA 3OAAA 1VE1A 5JSHA 1NZJA 4Q7MB 3S5UA 3QITA 5J5CA 3SKXA 1ZRNA 1RD4A 1Y7IA 3DR5A 1RI2A 1TJYA 1H5UA 1KYQA 4C20A 3HL0A 4RJKA 2H31A 3L06A 1KRWA 3U4CA 1ESZA 3PWTA 4PZAA 1P2VA 4JFAA 1L5LA 3QVUA 4V0NA 1EMDA 1ISMA 3UBTA 1UXOA 2B21A 3EPPA 3IMEA 5AW4A 1WXWA 4P9NA 4YP9A 4MWCA 3A3NA 1NBMA 1O95A 2W2PA 1ISSA 3G2NA 1A9TA 3HBJA 2F43B 4TLEA 5I7VA 3RS8A 3IP1A 3GR6A 2VQEH 5HKLA 2X6RA 1U90A 3UK2A 5IANA 1YJ8A 1E7WA 5HMLA 1X8XA 2W57A 1KQ3A 2I29A 3RS9A 3EGCA 3ANLA 1YSCA 3M4XA 4KBFA 1GRRA 4B82A 4BB6A 1A8SA 3PNBA 2YX1A 2VF4X 2YUIA 2GPTA 4ESOA 2P9HA 4OYRA 3ROKA 4XWWA 1E6CA 3ZDAA 4JV2A 1XWIA 2C7BA 3P0IA 3NHMA 4PG6A 4ZK2A 1YMVA 5I4BA 2DC1A 2ZRAA 4WRRA 2BDUA 1R12A 5KNBD 5DZSA 2VYCA 4O2BF 3UJBA 3OFNA 1LLCA 4NHOA 5EESA 1QG4A 2W48A 2RHDA 1PZMA 3AFNA 1Z73A 1D04A 1NVVR 2GD0A 3KUKA 3MHTA 3I1IA 3WLSA 5C8XA 3FLMA 2QL9A 1HL3A 2Q0QA 1BMFD 5LA6B 3TQOA 4DLLA 1NUQA 2D7DA 3LULA 2WJWA 2A9PA 3R0XA 5CG1A 2VIIA 1ZLXA 1XQWA 1MGOA 4L5YA 4BXXG 2XY4A 2C4WA 5G4LA 3HEAA 1TCCA 3KVOA 4RPKA 4YAJB 1BX3A 5KAMA 4XIFA 2OQRA 3TD6A 2OFFA 3B1ZA 1KOJA 3ZZ1A 1YDHA 3LQFA 4ZEMA 2Y05A 2Y77A 4MTLA 1X0XA 2JFGA 1NAHA 1FP6A 4R84A 3N44B 4D3DA 4CKZA 5D00A 4NR0A 1AN7A 4WZBE 5EE0A 3OZAA 2FE4A 1DX6A 3MUFA 3ZK8A 4KHZA 1L5VA 3PJRA 2BMVA 4GD3Q 1EWRA 3N40P 2ZSAA 2CDRA 2CVZA 3WGOA 4A8HA 1RYFA 3SBDA 5FL7D 4D3YA 1J0CA 2FX3A 4EB3A 1YBFA 4RXMA 4IIVA 4MW9A 4IX1A 5JDIC 5TF0A 1SCQA 3CW9A 3NBUA 3AKCA 5EFZA 4KJZA 5FUVA 5DHRA 3SC4A 3EHEA 4DG9A 2GUWA 3QVSA 1NR5A 1TA0A 1J99A 4KITB 4CEHA 4DUYH 1GD1O 1UBCA 4YRNA 4IDDA 5K3AA 4OXNA 5E4JA 2XLCA 4P86A 1T3HA 3ZS8A 5SZIA 2GEKA 1P4RA 2JI7A 1SUIA 4D8VA 5LWHA 5LQNA 1BCSB 4EW6A 4D9HA 3UPDA 3LUAA 4NU5A 2AZTA 3M6LA 1IPFA 3CZ4A 1GUBA 1SUAA 4M0JA 5JSZB 2I3AA 5JCOA 3PB3A 3U13A 5C4XG 4HDOB 3CNNA 1H1TA 1S4QA 5L1JA 4FKBA 1LGYA 4UTZA 4PO8A 3DEYX 5CLQA 2YWBA 4H27A 2M1XA 1T2FA 3U17A 4PY2A 4IHJB 4CQMA 3CCFA 4UNSA 5AKKA 3JY6A 2PHZA 3QE4A 3HZHA 4DABA 3NBXX 5H68A 3ILHA 1ADGA 3ZU3A 1RRVA 1W48A 2I3GA 3KKMA 3QG1A 2P6PA 1BVRA 1DIKA 4B87A 4EJ0A 3QRWA 3C43A 4JYCA 3V7UA 3VDRA 2PEZA 1I5OA 2MSWA 3D8NA 2FK3A 5JD6A 2G72A 4WEQA 4LMBA 3TUIC 3VTKA 5EKSA 4JVNA 1GN9A 2ODBA 1D9ZA 3KOUA 2Z8YM 2V7TA 1JXLA 2Q3FA 3II6X 3CXRA 1PJ3A 4JYMA 5TVGA 1H9AA 1LSSA 3HVRA 3HVHA 1DUIA 1JWAB 1MH9A 3O92A 2WJJA 3R09A 1II0A 3ENWA 1ZUNA 2HJRA 4BRSA 4J7AA 4RUCA 1Y34E 4PNHA 1QTIA 2DPHA 3OUTA 3K0AA 1U9JA 2JC3A 4H1TA 1JDZA 3HZRA 1KMMA 3EQ8A 4DBLE 3GDHA 2JA8G 3WG9A 4HPXB 2B1RA 1D0IA 5JS6A 5MGBA 5C4IA 5D84A 3L77A 2PJDA 2QB5A 2VTKA 5DXAA 3KTAB 4D3FA 2AQKA 4O1HA 1XA4A 2IVFA 2GX6A 1Y1QA 4HLUA 5IKEA 4DLVA 2FVYA 5T57A 2C35B 3LWDA 3DYIA 3PD0A 1TK9A 4IJWA 5EXPA 4OLBA 2POQX 3M70A 1MBZA 2VDUE 1I94B 3KU4A 2J9GA 2H54A 1DHRA 4KMRA 4D45A 3A8TA 2RH8A 5E1MA 3BRWD 1TVKA 5HF8A 2AMFA 3UF0A 2JIMA 2CNQA 4RVHA 2ZZMA 2P3OA 3X1WA 3EMDA 3SSAA 4B6QA 3DEFA 3M4NA 4B0PA 2QZSA 3UJCA 1N9KA 1YKFA 5L6LB 3CNQS 2OPBA 5DB4A 3PHCA 3BIWA 1BQ3A 4EI2A 2C8JA 5C1BA 1MAAA 1AKTA 4GMFA 3RVJA 2GS9A 3EQZA 4O3FA 4RNDB 1EWVA 4BNUA 3CZMA 4Z1MD 4A93G 3FTNA 3G5LA 4CR8A 5K6AC 4BVEA 5CNIA 3W5DA 1US8B 3ZCTA 4ZTZB 1YACA 2W9AA 1SZPA 5E6SB 2H65A 1CIPA 2NSHA 1A48A 2V0NA 1NUUA 3D02A 2ZIUB 3SYLA 5JQWA 4L3OA 2ZETA 3DMRA 2NO9A 3NG1A 1W2HA 3RS2A 3D3NA 1IQPA 1MABA 3OQ1A 1JPNA 1HE3A 3ZJ5A 2QIOA 3TSAA 4CKEB 1XZDA 1LI7A 5KSZA 3LDFA 3VPHA 3JQDA 5CVCA 2J5BA 2F2TA 1Z4IA 3P2JA 1HE2A 4HCJA 1BHQ1 2ORVA 5HPYB 1S3FA 4OXQA 2WWWA 4OXYA 2XCUA 2QUBA 1UBEA 2Q41A 4M9SA 4LDPA 5HQJA 4YBZB 2H00A 4DSAA 3MHPA 5L3RA 4HATA 5DM4A 3LYHA 5FF9A 4P3PA 3W0LB 1VL2A 4AP5A 4UCRA 3SC6A 4AWBA 2HADA 2DXIA 1X2BA 1AUPA 3WY9A 1LPSA 4RHYA 3PDIA 3GA5A 1E5XA 3K8ZA 3KELA 1E9VA 5KT7A 3DTVB 4EFMA 1I1KA 3BD9A 4BNYA 4OQFA 3TO5A 4DWOA 4K6KA 1PV1A 2ST1A 3L8DA 5NLLA 3ENVA 4G37A 4I55A 3OJEA 1VDMA 1NASA 4QO8A 2D0OB 2B5OA 1KMHB 1Y4ZA 2ESRA 1YI8A 4UOZA 3ZGYA 4M9ZA 3A26A 2BM1A 1VYVA 4RYDA 5CTAA 1X1QA 2I6XA 1R4ZA 2ODAA 5GZ1A 1PEKE 3CY6A 1M10A 1Q0RA 3TXXA 1PNVA 2R93G 1UEXC 3NS7A 1JHOA 1WULS 1RQLA 3NCTA 1TADA 4QQNA 1P61B 1NQXA 3N8HA 1YS6A 1G2IA 3LHDA 3V9PA 1LK5A 4NZYA 2ONYA 4YUAA 1J1IA 4U02A 1YFZA 4FT4A 1UKVY 4NYJR 3PIRA 3IESA 2VJYA 1B2RA 4CQNA 4PCUA 4HADA 3BIFA 5K0LA 4EUSA 2CLCX 2G1JA 1MMFB 2GHRA 4E13A 3UT5A 5AJZA 3MD0A 2GH1A 3CX4A 3KCNA 5CFMA 4HZUA 4BZXA 5ERGB 1GG9A 2P1ZA 1NOIA 5ALNA 3H20A 2PS9A 3M9NB 4QLAA 4B80A 5L8VA 1QO0D 2C8LA 3G9XA 3H9BA 5FPPA 5B58T 3KD3A 5M2QA 4W8OA 4HNSA 4JLAA 4MYRA 4A91A 3R7BA 3TK1A 1JEOA 3K6JA 2A35A 3T7CA 2Q1UA 3VKGA 5KKAA 1SC9A 5ARBA 4MRMB 3HYCA 1E96A 2O2SA 4BKQA 1ORVA 2ZCVA 4UZEA 4I1RA 2WC1A 5G02A 1M1YB 3GFFA 1M9NA 3GK3A 1NMQA 2HKIA 1A5SB 4IZ6A 3Q5GA 4DIOA 5A7GA 3LW7A 4YECA 1NV8A 2IIQA 4LH7A 2AK2A 4KQMA 4WLOA 1V2HE 5C4MA 1AK1A 4AJJA 2HREA 3DTFA 4B4KA 1A9OA 2DJ5A 2BISA 1VCHA 3IQHX 1U8TA 5H3HA 2WU3A 2AN5A 3OZ7A 1WB4A 3L8MA 4GC5A 4E32A 2P3SA 2L42A 5TE9A 4EKNB 2HCRA 5TPZD 1NVEA 2BI7A 3HY6A 1YTUA 5FLKA 1T34A 1GOTA 2Q5OA 1WABA 5B1EA 2VXCA 1O57A 5JU6A 3TEJA 3EDCA 2QMQA 3VZBA 1KDOA 1N4AA 3FHLA 1NN5A 2ZCUA 3CSSA 1XDUA 1BXZA 3NOOA 4A0QA 3PR1A 4JWKA 1NZDA 4GM0A 1NF9A 3MPOA 1NMXA 2BI8A 1PNRA 2Q1WA 3G9TA 4P3OA 2QDXA 5CGQB 2HK7A 4E09A 2A5FA 5IYZF 1N3BA 4Y8VA 1N6KA 1T5LA 4BQNA 4J94A 1ZJ5A 4IUYA 1B0AA 3UMJA 2W7OA 5I7AA 2I5PO 4G85A 4D4KA 1DSSG 2I8CA 1LC3A 3TLGB 1R0ZA 4DANA 2C98A 3AHGA 5AM1A 3MR2A 2G6TA 1CUZA 2V45A 2GPBA 5CA0F 3WTBA 4R2WA 2GM5A 4PYIA 4HNTA 1P9LA 1RYHA 4DHWA 2FSVC 3FVRA 3KEQA 1G8AA 4D5GA 3MOSA 3F6PA 4INZA 3OTOH 4ZXFA 2L82A 4B5KA 1CKNB 1KYWA 4JP1A 5GIPE 1OFVA 1CRZA 5AI9A 1ZDMA 2W6QA 4MUMA 3KB2A 5FL3A 3VC3A 3AJRA 2CNWA 1AHIA 2HSGA 4G0PA 2YWRA 2DYKA 4OHYA 4XFJA 3BC1A 4KAXA 3UAGA 1UKEA 2XMZA 5KTKA 4CPDA 2XKBA 1BS1A 1C0EA 2UZ3A 2VQFH 4N8EA 2P40A 2PH7A 2J31A 2AFHE 3NU1A 3CG4A 1Y1WA 5JZMA 4EY5A 5BR4A 2ZUVA 3AY6A 4ZCMA 1KFCB 3SG0A 2GN4A 2O3QA 1E2BA 3DMPA 2I62A 5BSMA 1T9HA 4F45A 3SE7A 3WHIA 5EZYA 4NBSA 5KO2A 3KG2A 1AA9A 1XTZA 2O19A 2Z2ZA 5J2TB 3JQFC 3TWOA 2OHJA 1NTRA 4L6IA 4RULA 1S1CA 1MC1A 1TU4A 3WKEA 3PNMA 2W6ZA 1BEEA 2X6QA 4YRGA 5K8UA 3OJFA 3MC1A 1FVFA 1Z22A 1WM1A 4F5EA 3ITKA 1E7YA 1XFDA 4UHDA 3ZY6A 4Z2YA 5J63A 2G8LA 1U11A 1F20A 3GDFA 4O7WA 3TM4A 2QN7A 5FXMA 5LYJA 4KFTA 5EMNA 4B6PA 2IQ5A 1WKBA 2G67A 4F3NA 4XWYA 3ZDEA 2H7XA 2H1WA 2KJQA 3D1JA 4L8WB 4L0CA 1FU8A 1KI8A 3WLTA 3I45A 2ATVA 4ZFNA 4BE9A 3IVAA 3STVA 1GSHA 2QXUA 5DTJA 1XYVA 4Z4IA 5AI8A 4OJYA 2PX3A 3G49A 4NU6A 2ZRLA 5H5JA 2WF8A 1Z9BA 2HA6A 3GLHA 4K2HA 1GKYA 5K3FB 2XYQA 2OHGA 1XLTC 3RCBA 1NM5C 5A0FA 2V0CA 4MUHA 3U40A 3H1BA 4RESA 1QSGA 2HVRA 1FE8A 2QGFA 4E88A 3JQBC 3MWEA 4TLDA 2C03A 4OI0A 3ZQJA 5FR2A 1B0ZA 1Z15A 3C7CB 5A5EA 1OYOA 2CXXA 3T1VA 3HHPA 1L6IA 4YY3B 1XGKA 2JEZA 1UOQA 2IK8A 2OC9A 4IH9A 1DXQA 2UUPA 3V4RA 3B9PA 4LOIA 2V4RA 4K40A 2BM8A 2G9NA 3KOYA 4AUEA 5BN1A 4GOKA 3EODA 3VZRA 2W9XA 5FUMA 3P94A 5CVDA 4C89A 1KORA 4MP8A 3P45A 5EJGA 3QBEA 5TEVA 1F0PA 4AO8A 3AVOA 1HZZA 1R9MA 3C16C 4RZUA 4K9PA 1NXOA 1OMOA 4BLVA 4HH4A 1ARZA 5JATA 4G8JA 3WZ2A 4JB3A 3ZKAA 3L1KA 2GI4A 3VA7A 2XZDA 1RJPA 1G8SA 5GWXA 4UXJA 3WLOA 3G13A 4ZA2A 4RF4A 1YA6A 3RC9A 4ZJPA 2FLWA 5KQGA 5DPMA 5ALGA 2EATA 2JS7A 4HWPA 4KKXB 2ZXEA 3BACA 2HJSA 5I8PA 2RGBA 5FYQA 3S2GA 4NHEA 3DOEA 4MGHA 2OENG 4MLDA 3SQNA 4BNKA 3ZIDA 1N77A 1ZAUA 1B0UA 1JQEA 3WLHA 3G68A 3UQZA 4BMSA 3QKWA 3I28A 2O23A 5B1HA 3VU9A 1B8OA 1LVGA 2ZE6A 4G0YA 2WHPA 4L85A 2GVZC 5F78A 3SEAA 1CUUA 1NDQA 1V7CA 2EJ3A 1JFRA 1H6CA 2O3JA 4O5AA 3D3WB 5D1HA 2FZEA 2IGTA 2A0UA 1QVZA 4HB0A 2OBBA 1LY1A 3I4MG 4JNKA 4NE9A 1M67A 3IA7A 2L19A 1IM2A 2NU9A 1P19A 1P77A 2J09A 1ZJJA 3U4QA 4YJKA 2O7QA 3RHSA 4LHEA 4EI9A 4BFLA 1D4OA 2Q3LA 3CLSC 4G41A 2CLOB 1OX4B 2QW1A 5EVCA 4Q7LA 3VZSA 4ZRMA 3I2IA 2WG0A 4H6XA 1GGOA 2B78A 1PUXA 3CWQA 4YMIA 4QXAA 1XRJA 5KFBA 2P1DA 4WACA 4F4IA 2VP4A 3MWKA 3ELUA 2FY8A 2J33A 5LOVF 2OH2A 1QP4A 2NTYC 3WWZA 2FW9A 1MT3A 3PZRA 3IP5A 1UEJA 3TX6A 4C5CA 1Q84A 5DCLA 5DN6D 1ADJA 4BV8A 1JSCA 5IULC 2FMKA 2JH3A 3Q9UA 2WFMA 4QL3A 5HS6A 1BA2A 1E3QA 3RRJA 1W25A 5JY1A 3FLBA 3BJEA 3AIIA 3IHLA 1DCFA 1GL9B 1PWXA 2O3SA 3HR8A 3RJ9A 1RXWA 3E05A 3K71B 3TVTA 1OROA 3P9SA 3X0DA 4X6UA 3RK1A 1O0BA 1X9HA 3Q0IA 2OMKA 3P26A 3BGOS 2RKBA 2FZLA 2Z8YA 4YX9A 5CXXA 4W7IA 4QFBA 2LKDA 1CDOA 3AVQA 4DXAA 2RJNA 4BYGA 3FA2A 1DXYA 1QHNA 4AZWA 4JP8A 1GADO 1ENOA 4QXQA 1KDTA 4X60A 1KJIA 1W8IA 2ATEA 5F23A 1XZAA 3I8SA 1UDWA 1GGJA 3F73A 3KIPA 1FRVA 2VYVA 3LXXA 3FNFA 4NOMA 4IGEA 3BCSA 3JWPA 4OX9H 1CJTC 4F9EA 4H7FA 5JUWA 4EVIA 1G6HA 4DARA 2O54A 4YVFA 1U6JA 2ZIXB 1RLIA 5TQJA 4WZBB 1R0CA 3WAGA 2CXRA 2H4JA 1QHYA 3W8FA 2IQIA 4A2QA 5BMVF 4KQ6A 1VSBA 4ZT6A 4XDZA 4MWZA 2W9BA 2AQ4A 2R1UA 4KIJA 3BJZA 5AESA 5ER6A 3MM4A 3OECA 4CWAA 3NWBA 4J9UE 2D3TA 1ZO8A 5ALIA 1RJGA 3A2NA 2JIQA 2OO5C 5EMKA 2A78A 1J6UA 2NPIA 4V1CI 1JJ7A 3RBEA 2GA8A 4HS4A 1C8VB 3BB1A 1EP1B 2E49A 2CL6X 1S10A 1J5EH 1DZ3A 1X7GA 1DIBA 2A1TS 5BV2P 3HKDA 3C2QA 1E18A 4DMCA 3B78A 1RPZA 4FEAA 5HRCA 1M2HA 4QBHA 4FFWA 4K9NA 4YQWA 1G7SA 2ZJ3A 3WSTA 3A6EA 3BJIC 4XM0A 4FHGA 4J03A 1T5OA 2F1RA 4F93B 1BMDA 4B9EA 1ZITA 3QJGA 1QAOA 4G26A 1IEWA 1P7VA 2E37A 1VA5A 2J3IA 2J4CA 1T9GS 2VS1A 2JAXA 4TV8F 2PA0A 1PD0A 3EF3A 2WUFA 1CCWA 4B8YA 2YNMC 4DPLA 4F3CA 4TSFD 5KX5B 1D3AA 5EJ4A 3H19A 1E4OA 2BSQA 1SUCA 4ZQFA 1E6EA 1O4WA 3N2IA 1V0JA 1MAUA 1WXQA 1FQOA 4C3ZA 3GPCA 3SD7A 1YHZA 1LBTA 1Q7EA 2GYUA 3VX4A 3LUCA 5IEJA 2HYIC 1Z34A 3LL7A 4OTZA 3HY4A 3WNDA 1P60A 3EA0A 3LP8A 2W6JD 4CTMA 2PV7A 1W49A 3FPGA 5FRDA 5FA8A 2W98A 3HYLA 4RMNA 5KIAA 3KSMA 6PFKA 5AVSA 2KBFA 2MINA 4EHIA 4QD3A 3TVYA 3DBIA 3MGAA 3QGMA 2FN3A 4IFIA 5D5HA 1ABBA 3PHIA 2ZRPA 4JBHA 4X64H 2WLSA 3AF6A 2G1KA 3ELDA 3Q2IA 2B20A 4H4CA 1OTHA 4KRXA 3NDPA 2WW8A 3B89A 1RI4A 2PMDA 1CUFA 3NDBB 1KI6A 1ISPA 3PUJA 2REQB 1X7ZA 4FFPA 3RM3A 3EE6A 1PDVA 4KE6A 1SXJC 1X7WA 2HEIA 1DOZA 3R0JA 3FPLA 4OVKA 4IS3A 1ORIA 4M0EA 5I9TA 5K0JA 1I4EB 3PFFA 3BSWA 5CMLA 2D8MA 4LF8H 4S0XA 1EYZA 4JI8H 2HF2A 3O84A 4RK7A 2MTBA 4MWEA 4NWIA 3G8DA 5LQRA 3G0OA 3EBLA 4ZYUA 3G0BA 3GCGA 4LQDA 3FZNA 1A69A 1U2ZA 4WA7A 1KS9A 5D1OB 3HA3A 3CNEA 3IG0A 1T9AA 4KKVA 2B8WA 2GEFA 5DGAA 4EQ6A 4F4YA 3EPKA 2EFEB 3FDZA 1JS1X 1QRAA 2IWRA 1G5FA 1RIFA 3HB5X 2H11A 3IKJA 4UREA 4JI7B 1XLVA 2W8BA 2N75A 2FW7A 4MA5A 3V46A 1IONA 2AGOA 2BMFA 1VXRA 1I3MA 1VL1A 3DEJA 4ZEVA 2ZBUA 1CJVC 4MRRA 4RJJA 4DZTA 2G6BA 3QU2A 5DYWA 2XCLA 4YRDA 5JS7A 2HFJA 2H7YA 4L0QA 4ZI7F 1XQYA 1VJDA 3L4KA 2H1FA 4BKPA 3TQHA 2VQSA 2HU5A 1HQYE 1WKVA 1IVSA 5F2KA 2HCTA 2JRCA 2ZYAA 4NEGA 4PQYA 2FF7A 3EGWA 4M54A 3L4BA 4Z99A 5HMMA 4YJ2F 5KFZA 5DK4A 4R8KA 5K8CA 2B1GA 1SRQA 4F2HA 1HH4A 4HRVA 4DXHA 1G5RA 1OLSB 4DV6H 2FJUA 4MIKA 1U2SA 3HOVG 3HGQA 4HRYA 4N47A 3JR3A 4CV2A 5JXGA 2HIVA 2ZROA 5CB8A 1ODJA 2OO3A 4MCJA 1KWKA 1IOVA 5DV9A 1DMRA 4YMHA 4DIBA 3NHFA 3B51X 2HPZA 3AONB 3AXTA 1EVIA 4G1UC 4A2CA 1KIMA 5LZ7A 3OESA 3VNQA 2Q2QA 1AQIA 2ZB3A 1RJ9A 5HTKA 1Q7GA 4GXTA 3PL5A 5I7RA 1XU9A 3UEOA 1GFWA 4MVCA 1YBHA 1NLYA 1FUUA 2JA7G 1BMTA 1YS2X 2JIZA 1CT9A 1WLYA 3L49A 1IHYA 4DDMA 1YDMA 3RREA 1H2FA 3HOWG 4MAAA 1CDDA 5AVUA 3F98A 1EHIA 2WD7B 1JVNA 1U2RA 1J5XA 4WDRA 1VCMA 1I2BA 1C8BA 3KAKA 2NP7A 2OYCA 4TTJA 4ZYXA 5B57C 4RA6A 4MTEA 5EPEA 4DTCA 1KHHA 4XVHA 3N6RA 2WE6A 3R41A 3BAZA 3TLAA 3V2HA 5JANA 1P91A 5K03A 4U2KA 3UJ8A 5EP4A 5BW6B 1PW5A 1FDRA 1DG9A 5EJMA 2YXNA 3IDSA 5BUZA 1Z6AA 3E0XA 1BGVA 3F67A 2DTDA 5CH5A 5ISMA 3Q12A 4UUNA 2VJPA 2EG5A 3ZU4A 2IUFA 2B98A 4MCHA 5KTMA 3G8BA 3ANYB 2CV2A 3HKCA 1E3LA 4KUEA 5G1NA 3Q7SA 3CZ5A 4GR4A 4J2OA 2CYBA 3QSGA 5KWVA 1L5QA 1GLNA 3ZXXA 4OHVA 4XUDA 4U9UA 5IK2D 4LI3X 1O97C 1TU3A 4X62B 3VH4A 4RL6A 5DRYA 4JY7A 1CEXA 3PTAA 2X9NA 1CQPA 4UXIA 2V7WA 3HSYA 3CH6A 3TX2A 4MCAA 3UV7A 1ZESA 4HDSB 4X65H 1R6AA 5HJ2A 2VSNA 3RG8A 3V4ZA 3DOHA 3GNLA 1AO3A 1GNPA 3L04A 3QLUA 4RQAA 3M6WA 3OT1A 1TO2E 4DEVA 1ZVKA 2R92G 3SHWA 1MFPA 2QAGA 4L4YA 3A7EA 4M1QA 3ETGA 2C7OA 2WJYA 4YCLA 2PSEA 5A71A 1USGA 4O7ZA 4P84A 4LGCA 4HNHA 2WG1A 5CDFA 4Z7NB 3T4PA 5FWYA 3DAFA 4TRJA 1TJ3A 2OCBA 4RPHA 3GF4A 2NPOA 5AICA 1JFTA 4MJ3A 3TLCA 3PG5A 3W3AA 3IB6A 1D09A 1PTJC 1OXSC 2JI6A 4JNCA 3VO2A 2OK7A 5FNZA 1IJKA 2IHNA 3ZWNA 3DBLB 4MYDA 3N7AA 4DRXA 4G8DA 3KOZA 2C7PA 4JI4H 1QZZA 2DAPA 2M2IA 3ABQB 4ZI2A 4TOIA 1UPUA 2AFIA 2IFTA 3E81A 3NORA 1L4LA 4JKIA 2ERYA 2AG8A 1DOHA 2XQGA 4UAJA 1X80A 1Z8HA 3SQXA 3SICE 1YJCA 4B74A 4XIJA 3T0FA 4FHFA 4ZZ1A 1CQJA 3OSUA 4MRSA 3K9NA 2WZDA 1FFWA 2EGUA 2R751 2EFDB 3N8KA 4EJ6A 1V3UA 2YMLA 4X6YA 2A9KA 2ZSFA 4BVLA 4BFUA 1RBYA 3FTCA 5DOVA 4QU0A 2OFOA 1EUYA 1C1YA 2A8YA 3JAKB 3C6YA 3VV2A 3MJSA 2F4NA 1KZ6A 3BDAA 4CNBA 1YZUA 4TZ0A 5HKAA 3D3QA 4RZXA 3K0CA 3UMCA 1NMYA 2WB4A 1FW8A 1RFLA 1RRMA 4KZPA 1AUVA 2LCQA 5B3LA 1HGXA 2AUTA 2JGRA 2OZLA 5B58C 5JBQA 3EXHA 4QYMA 3HA2A 4J9KA 4XVCA 1W7AA 3R7DA 1DPGA 1IE3A 3R20A 4B85A 2AKEA 4D42A 2P79A 3WIDA 3AX6A 3GJZA 3UYKA 1UOPA 5CBPB 1HBJA 1AV6A 4XX0A 5EJFA 4NCHA 2AN4A 3C5WP 4QYXA 2QM0A 5FTWA 1Q3TA 1X2EA 1SUWA 3FPHA 3NBQA 5I7WA 2FRVA 4HGZA 4HQNA 2V74B 3D8RA 4ALNA 1J8QA 5JD5A 2CGEA 1W4RA 3SHQA 4L75A 2EFGA 2R82A 4FP9A 2HMYB 4BVAA 5KFWA 5CITA 1BHJA 3LFHA 1GU0A 4HAOA 4D9NA 3BD6A 4HLCA 3S1AB 3E53A 5JZSA 3K53A 1OI3A 2XB6A 4OQLA 2I7XA 1PWZA 3P7MA 5EHGA 5EXEA 3N1UA 2Y0BA 3LC2O 1LLFA 1UBRS 4N0EA 1NA5A 1J09A 3PQDA 4MR9B 2XIGA 3Q72A 1JSXA 3ND8A 4OV6B 7REQA 5ALZA 1BDMA 1ET0A 3FJOA 2QZ4A 1ZSVA 4RM3A 4HOYA 1VLHA 1UJ6A 2KX7A 5I9NA 2YJZA 3ETCA 4NCIA 1GXSB 1NVAA 4Y1GA 3T9FA 3BDIA 4LA4A 1ZNQO 4HLDA 3CH7A 2AFHB 4OMFG 4W9RA 4MGYR 5JVDF 1VQ1A 5KHOC 1C1XB 3HFGA 1XCJA 5B4TA 2SECE 2IITA 1QK4A 2EIYA 3KS9A 3DAHA 1Z7WA 2FPXA 4X8LA 5GGXA 3GJSA 1OLUA 1ZOOA 4JKYA 4H9GA 1KY3A 1KEEA 2QM3A 2R48A 3WRYA 4NJEA 3IR7A 3F6SA 4K0KB 4QUHA 3ZHVA 4KFCA 1RBZA 3K6SA 2PLNA 3C3MA 2Q5HA 3KVRA 4ZPXA 1R4MA 3QYAA 3O90A 2O3UA 2UXDH 5FJIA 1RQ7A 5FR9A 5I7HA 2XOEA 2FFRA 2YHSA 3V7NA 3KT6A 3L7CA 4O4IF 4EMUA 1ZUHA 1A77A 4QG3A 1XEXA 4M87A 3HVKA 3JZ6A 2I4RA 2HHLA 2F3PA 3M49A 3OZIA 4WW0A 1KH2A 3GJXB 2CXOA 4RLQA 2OOKA 3PCXA 4WY2A 5LJIA 3HU1A 4UHCA 2JLAA 1I3NA 1HNZH 1XN1A 3SXUB 3B82A 1DJLA 2VP9A 1Q14A 5KPJA 3OU6A 1E0SA 2MYTA 1HKHA 1SN7A 3GC6A 3S2EA 1YR9A 5JDCA 3Q11A 4A2AA 2PIDA 4DV7H 3H4BA 3KQQA 1XQ1A 1ZW6A 1EJ0A 5CK4A 4B6OA 4ND8B 2J30A 1PKXA 3WQBA 3UJ9A 5C3UA 4TXHA 3ZDDA 1GNRA 1UT5A 4A0GA 1F4PA 3N2ZB 1NLMA 2F67A 4WBNA 1DMSA 4H2DA 5JXHA 2Q3DA 4LGVA 4J0JA 4ME6A 3OPVA 1RADA 1XXHE 5B53A 3UBMA 3LBAA 4D8UA 3DPIA 2ZAOA 1GUZA 1JBQA 4NU0A 2EL7A 2XPCA 2PKQO 1DQPA 4XWOA 4DPMA 3DBHA 1XU7A 4XW2A 3WLJA 2BFBB 1BXKA 2PSDA 3QXJA 4RIHA 4RGQA 1KC7A 5TPWA 2EJCA 2RGGA 1WOMA 4LWQA 1SULA 2CB0A 1CW2B 4UAGA 2CHVA 3WNVA 4A03A 3UGTA 3P52A 4OK3A 3ONNA 3CXUA 2WY2D 4RMJA 1RBQA 1FRFS 4EJMA 4DT1A 3E7FA 3ER6A 5A4FS 4URFA 5FBHA 1UZLA 2DTEA 3LUJA 2WHRA 4ED8A 3K8YA 2R8RA 4DC1A 4RDIA 1ECLA 1G2PA 2ZWVA 2FG7C 3L9XA 4RY2A 2WZCA 3WJ2A 1R6TA 4M6WB 1VJGA 2ZE5A 1P81A 2HNKA 3GGGA 2FH5B 3GD7A 1XPUA 1X14A 2WAOA 2C95A 2G71A 1XZQA 1V6SA 2DLDA 1V3VA 3OQ6A 2G88A 4XQGA 4N3GA 2VA9A 3QOWA 2YY7A 2XB8A 4GSYA 1IZ8A 3ZVMA 2FUKA 4J91A 4XR9A 3T5MA 4GKAA 1DEKA 4QHSA 2PVSA 4OU5A 2XGQA 4U63A 4LS3A 3LF1A 4K3UA 2VDJA 2R11A 4QDXA 2C5HA 3QUAA 2B34A 4QG7A 3OICA 3L7AA 4BCDA 1XWWA 2ZYHA 5I5YA 1KVRA 3FCYA 1NW4A 3ROPA 2AMVA 4PFJA 4HAXA 4E15A 2W6CX 3FSGA 1D4AA 4LJRA 1Z7BA 4TM8A 1HPLA 1B0PA 4LNUA 4HY3A 4OK5A 1M6NA 2AXNA 1U9CA 4JLDA 2IC5A 1GAJA 5CEEA 4URVR 3JVDA 1SNYA 3KLMX 3WQRA 3ZXYA 3JQ8A 2JFBA 4S1TA 3E7DA 1P4HA 2QK4A 3F6EX 2FWNA 3OQHA 2DQSA 4ZYVA 3T5BA 1J39A 2ZI4A 3OEWA 4IVNA 1N0UA 1U4SA 3O1IC 2OLKA 4II7A 2ZM6B 4ND2A 4A2BA 3DBVO 1NNLA 5BWMA 1IAQA 2V4UA 1H3NA 1GL3A 1FB5A 2JLYA 2X0NA 3QI7A 3S1LA 3BGWA 4IGAA 1Z5WA 1JE0A 3UFXA 1OYVA 1LF0A 4AN4A 1ZK3A 4BCCA 1O2DA 4FVTA 5DP1A 4FQ7A 2VUIB 3C3AA 2WT8A 4MO2A 4DQUA 1Q83A 4ZP1A 5TB5A 3UV3A 4OQEA 4LF6B 1XDDA 3FDFA 3QZ8A 1YQTA 1CUSA 1ND6A 1VBNA 1MVOA 4NBUA 3DE2X 5ENVA 1P7WA 1CJMA 2VTEA 2HD4A 3FTFA 4GLFA 1Z6YA 2QRUA 4QIWA 3NHSA 3V1MA 1HL7A 2WI8A 4G0WA 5FOTA 1FPMA 1QPGA 4N8DA 3WGMA 1I7QB 1LA2A 2VYNA 1I5RA 4TRNA 2GZRA 1YULA 1U7OA 4ICIA 5KNCH 3IT1A 2ZSDA 1DC8A 3R74A 3W5SA 1XZLA 1RWQA 1XMPA 3MJRA 4MUXA 2INGX 3UQ8A 1JMVA 4ZV7A 4PLHA 1CJKC 3FHCB 4LE1A 1XD9A 2F64A 2O0KA 4CMKA 3ZVKA 4ZT4A 1V8PA 2JRLA 2IEDA 4ZZ2A 3VYRB 4C22A 1GGEA 4WZAA 3VSAA 4PZCA 3ZU6A 3SQLA 1KC3A 1Y63A 5KNLA 1V5IA 2C4MA 3S2SA 3P9IA 1R0SA 5T6BA 2OGSA 3MAAC 3G2IA 1QRRA 3TY5A 4AM8A 5FI5A 4I5IA 2HPVA 1OXXK 3BXGA 2EIXA 1E2KA 3TLBA 1UDCA 3G7SA 1IH8A 5IASA 2QTTA 1UQTA 3DZHA 1W76A 2VHJA 3ISTA 1UIRA 2X0DA 2J59A 2IXFA 3OZRA 3DQZA 2C8KA 1PJ8A 1PL7A 1W0JD 5ULLA 1H4VB 1B3RA 1SO8A 3TIVA 3A10A 2HCFA 3FWPA 5A3JA 1ZEMA 5T67A 3N43B 1WCMA 1QC5B 2H9AA 4DJ5X 3JWIA 1IVNA 2V3CC 5IFLA 2RF4A 1IEQA 721PA 2BLLA 4B2LA 2V65A 1SVKA 2OYRA 1AG9A 3T1QA 2P6RA 2G9UA 5F1PA 3O75A 4XAQA 5D5QA 1PBTA 1T5HX 4LOAA 1DAMA 3ZX5A 1B16A 4MQEB 3FE2A 2C78A 1Y14B 1NIPA 1RYBA 5ALFA 1OTYA 2XODA 3ER9A 4C0BA 3C74A 4NBVA 4ARCA 2RJOA 4F2WA 2DBRA 2Q7DA 5CB4B 3QVMA 4GKKH 4MQBA 4WNAA 5H02A 3F8WA 2HXYA 5C81A 3S7TA 1G42A 3CA8A 2WJHA 5K0NA 3UN1A 3E18A 1QHHA 2WTXA 4BNXA 2F90A 4ANFA 3TR6A 4QICA 3RHTA 2CKDA 1DC4A 4QEKA 3LKVA 4YUVA 5TEWA 3ED1A 3CH5A 4W99A 4Y3UA 3QNWA 4WQMA 3GAZA 4NXMH 2TMKA 4LPSA 5GOZA 4RHTA 2V7QA 2B1QA 3NIBA 1DIHA 1XIVA 2FXVA 4CMEA 3ET4A 3CZRA 3K2IA 4K87A 3D8BA 2XQVA 1U8EA 1HO3A 3HKBA 1DRVA 1GA6A 5AVOA 1S89A 3OCVA 4F60A 2OZVA 1WU8A 4GRDA 4D92A 1GFSA 3DCJA 2B36A 5BSGA 2P30A 4KFSA 2N0SA 4E30A 2YRFA 5TVKA 2GESA 2JGAA 2F1OA 2XD4A 3GCXA 4CG1A 3NOQA 4FDLA 4FGZA 4JXUA 2OSVA 3IP7A 3MTBA 5IMBA 3NVAA 2A58A 5CDTA 2PX6A 2GPAA 3L8CA 1RC1A 4DR1B 3H2KA 3ZN2A 2I6UA 2GN0A 2NZVG 4KHPH 5IDQA 2XIJA 3BH7A 1O58A 3AHHA 4I1UA 5AT1A 4RK4A 1Z0JA 4GC9A 4EPVA 4MI1A 4WBXC 3DDOA 1O94C 5IMSA 2FE1A 2UUCH 4C3OB 3O2SB 4QA9A 1FXUA 2RCNA 1HNXB 4PCVA 4I9NA 1E1QD 2HJ9A 4Y6GB 3ZVRA 3C3CA 1H2AS 2BFEB 4BBJA 3UJNA 5I4IA 4AXXA 4ND7A 5CLIA 2CNUA 2DHEA 4LI0A 3Q7RA 5EWLB 1PI3A 4DFDA 1EFRD 2WPDA 4LQCA 1KAGA 4BNNA 4ENQA 3MMPA 1YRWA 3RTCA 2N46A 3RW9A 3ORRA 1KPIA 4US1R 4MIOA 4PLTA 4H31A 1G8PA 2OC4A 2PAFA 4BKMA 4O7VA 4IKEA 1BROA 4JOBA 3DZCA 2XKAA 3I52A 2YHAA 5KYWB 2UZ0A 3UJ3X 2YC2C 1NW7A 3UZOA 1G9XA 1NIJA 1MNQA 1ISFA 5CR5A 6REQB 1EVQA 3N0RA 4RGVA 4MWSA 1SCIA 1FJGB 4WOCA 3GJ7A 3D7KA 2I66A 1U28A 2JW5A 1HDXA 3N2EA 2WPNA 3N3AC 4V2UA 5LP6B 5KFTA 2VKQA 2WOJA 2DTXA 2Z02A 4CMJA 2FUCA 4P36A 3RJMA 1TD9A 2X0KA 3PJGA 5FNVF 4KXFB 4B83A 1WP4A 4E5KA 2GCNA 4OP1A 4QTZA 1G8GA 1BJKA 3MFQA 5F52A 1M8PA 1WWKA 4QOJA 3AKEA 1FX1A 1NXTA 1A7JA 2PZAA 1RVDA 2PUTA 5LXTF 4O4JF 1VLLA 1ZIDA 4GPIB 3BTUA 4NC9A 3EN0A 1QM5A 3KVNA 3IO3A 2I4OA 4Q3CA 1O9GA 1WSWA 2F3RA 4DE5A 3WSWA 3GLSA 5DWVA 4J7UA 1Z4PX 4RVSA 4ENRA 1I6KA 1CC1S 1O7JA 3AUKA 3ZHQA 5E2IA 3ZDZB 2IYXA 5TDHA 2A5GA 3FNQA 4IV5A 1L8LA 1QX3A 3OI7A 4FBUA 2ADMA 1V5GA 2E21A 3WWYA 4JMPA 4DILA 1W8DA 4R41A 3AY3A 3AB3A 2MR6A 2JIOA 3K9WA 2FPSA 4ZCSA 2VDVE 4ED3A 1I36A 1PG2A 1OD6A 3CEAA 4TZTA 3DL7A 3ZWKA 3PU6A 4R0VA 1KPGA 2IV3A 2EJTA 1EGHA 4KXLA 5CD9A 4GF5A 2FPGA 1QIMA 5A4KA 4J0HA 3LIPA 4M4SA 4XSVA 1CF4A 4QATA 5G53C 5AUOB 1II8B 4PVCA 1UWVA 3L1IA 3W7BA 2V0GA 3UKOA 1SPBS 4WASA 4YJHA 1V8DA 3B3JA 1GEGA 4PZEA 3RSHA 2V9WA 3FCCA 1OBGA 2GPWA 2RI0A 1XALA 3IJRA 3PFGA 1RPAA 2ACVA 1LSUA 2OCYC 5CA1B 2ZB7A 3OTHA 3EQ7A 1M75A 4LSXA 1FSPA 3QPVA 2WKPA 2XRFA 4PEVA 2COEA 2YMPA 1MXHA 4LRUA 3IT0A 3UC9A 4BC0A 5A4IS 3PGMA 4G8CA 2JAHA 2VHZA 4P5DA 3SKVA 4HH3C 4J7CA 3R7NA 4Q1AA 4L5IA 5IM4A 3DTNA 1C0PA 3PHHA 2IYVA 1K7YA 4MULA 1R37A 1JEYA 1HOTA 3CNBA 2OZPA 7AT1A 4B31A 3RROA 2B9VA 4EB6B 1NX9A 4LZPA 3K70C 4CLOB 2WWFA 3BHJA 4PYLA 1NBMD 1O95D 2O0JA 2FRDA 3KAQA 4GKVA 1CTQA 1GP2A 3SNOA 2NTEA 1PLKA 4MUFA 4F38A 1A1VA 1XDWA 3UFBA 1B8NA 4YXFA 3IOEA 5AW2A 4DR6B 1R88A 1DBWA 2AGVA 3WI7A 4D97A 1NHWA 2BJVA 4F4JA 1OXBB 4QM6A 4PYMA 3KHUA 4GEKA 5ESXA 3CUWA 4HLQB 3L4SO 4R2KA 5L3ZA 3VFDA 3UJ7A 4WOPA 4P8RA 2RARA 2H1VA 1C50A 3C1OA 5IZ4A 4JLNA 4Q18A 1AUOA 1LKZA 1TCUA 3MCZA 4AIIA 3QVGB 2BM9A 3TD2A 2IBTA 2NN3C 2KHZA 1MV8A 1KZ9A 4J6EA 4C29A 2Q6TA 2DBZA 4J9MA 3OFND 1LD3A 1SOMA 3CUTA 3SM9A 4EFEA 5LVAA 3U7HB 5F9NA 4FEEA 1A98A 3TE6A 2FEWB 2IKQA 4KDRA 3CRVA 1QF9A 1FSZA 5TQ0A 1XZPA 3UYYA 4CFSA 1F17A 2AZ4A 3KJQA 4E08A 2GN9A 1K7FB 4V3CA 2NSYA 3PE3A 1V11A 1CNMA 4FK8A 3I42A 3AQIA 3KQWA 3N53A 5L3VA 1YBMA 1H0HA 3P5BA 4G25A 4ZT5A 4PPFA 2ZANA 1LH0A 4EW3A 2O50A 5HDQA 1NG9A 2QTNA 1WHTB 3QTLA 3OT5A 5I5WA 2XWPA 4C0SA 4ISBA 5IVIA 5KSWB 4DNOA 3CX8A 3DDCA 1C29B 2XA1A 4DGQA 5I51A 3T9BA 4OGFA 3QE0A 5BR8B 2ZG6A 1E9RA 3IPXA 3NPAA 3GTGA 4RMHA 1UJCA 4BL5A 3NH6A 2BEJA 1UPTA 3NIDB 4KN6A 5EJEA 2DGDA 4YK7A 4NAHA 3B3AA 2BEWB 4ITRC 3U44B 1X77A 4XVQA 2R2AA 4KO2S 3D0RA 3DEHA 5LUAA 4H6WA 2JFQA 1JIIA 1KI2A 3J80A 4UEOA 2XJ9A 3ZH2A 1ZCJA 3HN2A 2ZUCA 4EL5A 4D4MA 2P91A 2CNVA 4YMSA 2VCYA 4UE3S 3NV7A 3SC2B 4PTZA 3FVQA 5ECYA 3GCZA 1IPHA 5TT1A 2QVYX 2ZOSA 3GV0A 5A3RA 4EKIA 4GI7A 3OIVA 4WKNA 3JAWB 1Z82A 2R62A 4PZDA 3SS7X 1WAMA 1R5JA 3RASA 2LTAA 3M9WA 4NPCA 2QRVB 3FPEA 1O96B 4IJMA 1JHDA 1R9JA 3TZ6A 1R5OA 4CQMD 3LCMA 1KA9H 4PN3A 2WNHA 3ZEAA 3GEMA 2A57A 3HS3A 1SBCA 4I5GA 1K4MA 9ATCA 2D1QA 2PG3A 3KCQA 3IRVA 2FZKA 4MA0A 4ONEA 2WU8A 2ZS8A 4ZV9A 4IBOA 2FLVA 4CL0A 3L0DA 2XCOA 3B6MA 4AVYA 4A3EG 1TZBA 1SR8A 3WO0A 3FSJX 4EJSA 2GZ3A 2ZI7A 2PT5A 1U3VA 1FYDA 2JA1A 2VJOA 3IR6A 4UCUA 5JYCA 1PNQA 1Z4NA 2DQ4A 2R7LA 2D13A 1N2CA 4I4LA 3H6GA 1WVMA 2FB9A 1W4AA 4Y6SA 2O3RA 1FMCA 3QMPA 4CKWA 3WGLA 1LWOA 2V6BA 1PFVA 4RZ3A 1Z36A 3QELB 4R7GA 1QFXA 1T2NA 2B8EA 2O2XA 2ZT7A 3QM1A 1X3SA 3FRHA 2JG3A 4HFRA 5EEGA 5I45A 3ZKWB 3UH0A 2UUOA 3JQGB 4BQFA 1K68A 2ZUUA 4I6JA 1PT7A 2J6HA 2X3FA 3NEPX 3HJCA 1NN0A 2WKQA 3D4OA 5JXIA 5EE1A 2PZLA 3TY8A 1WS6A 1TJPB 4JXJA 4KGVA 3GMIA 4MPRA 1W36C 4XUGB 5FUQA 2GCOB 1XP8A 5HNEA 3I5UA 4Y0AA 3RYIA 1YB7A 2PGXA 2GJAA 3SHTA 1MO2A 5DSTA 3LRXA 5A3SA 3CLRC 5KYTA 4FW9A 1QMGA 4MOWA 1VKOA 3LQYA 1UWCA 2NO0A 4EYEA 1DLIA 3DHEA 5KNBH 1TU0A 1EFPB 3RVSA 5DLPA 3RWMB 3IEPA 1K66A 4DJFC 1BFUA 4BBZA 3KQTA 1OIXA 1ZN9A 2XGJA 3E82A 3Q7QA 3HKZE 1VSQA 2IY9A 2NP6A 4NYMQ 2PKXA 1ZM4A 4NQRA 1KI3A 5CP8A 2WNSA 4R7RA 1AQNA 4BRUA 1NYQA 3UA3A 5KTOA 1QLHA 1PT8A 1Z07A 2OP1A 4K46A 5CYGA 3R8FA 2FX2A 4X8HA 3A25A 1S0UA 1AV7A 3BILA 2H9YA 4H77A 2A9OA 4CIAA 3CVZA 2O9JA 3T8YA 1OGJA 3N74A 5CXQA 2NV2B 3JD3A 3PCTA 1G291 3W4JA 4M7RA 3W8RA 4PZUA 4DV4H 3AUUA 4FSHA 4Z53A 1E61A 3H9QA 4HN9A 1UBUS 5FAXA 3R5JA 3F5QA 5IDYA 2ZS7A 1XFAA 5L51A 1V7ZA 4EP1A 1L4FA 3ZDRA 1YHYA 4DV5H 4RB2C 4DV0H 3PD7A 4N48A 4INJA 1V37A 2GRJA 1MFZA 5BN3B 3WAKA 3BREA 5KOJA 4GMKA 5KC8A 4BIMA 3CO0S 4C87A 4RY9A 3FYCA 3O91A 4Y9SA 5B4VA 1YQEA 1SM4A 3WLNA 4LHXA 3LH5A 1PQPA 4AN0A 3OY7A 3ZBPA 3G88A 3RGWS 2B5WA 3IQDB 3BXZA 3KAPA 4Q0MA 3HH8A 4TLAA 5I5SA 2R8BA 3VGJA 3YASA 3I2JA 4X6LA 2GM3A 4IJ5A 3SQWA 5LB4A 3ZUPA 2QT0A 2W2VA 3KXPA 2RG7A 3SX0A 1UXGA 4UUAA 4X94A 3ROXA 1UKZA 1T4GA 2IH2A 2X86A 5HEKA 1X92A 1ZS9A 3WB2A 2NU6B 4Y6RA 3CZ9A 2CHUA 1JPVA 5AVRA 2W8KA 1D6JA 4ZK6A 1SBHA 1E1DA 5EWJA 4QUIA 2QRZA 5DVZA 1Z5PA 1OA0A 1FP2A 4U8HA 2IYQA 3HDHA 1L3IA 2C7GA 4C1NA 3KETA 3LUHA 3MAGA 1CU1A 1DKMA 4JYZA 4GU5A 1QCCA 5FADA 1KBOA 3PKZA 1LNZA 4B9AA 1IAVA 3R9RA 1E99A 3F74A 1F3OA 4LECA 1GM5A 4NFLA 1OI4A 4OYLA 5HM8A 2DFVA 2Q1YA 3QV2A 2AOTA 4WFIA 2QU8A 2X6TA 4DL5A 5BRNA 1P5FA 3R3UA 2PSJA 1RAEA 3ZGZA 4KH1A 1E9BA 3BWCA 3E22A 4N12A 4S04A 1YK0A 2QJOA 3A06A 3GP8A 1WSBA 3H40A 4XSGA 4HFNA 2VK4A 2Q5JA 3LUBA 1R2QA 1YZQA 1EE1A 4O4LA 1EZ1A 4XLTA 1Y1TA 4GYKA 1XQ9A 5BNTA 3ZLJA 2R85A 3TBHA 5IN4A 1QV7A 1TI7A 4EG7A 1Z0KA 2QL5A 2HMUA 4CNQA 1CULC 2OQ2A 2QRMA 1Q7TA 3REOA 1JXOA 2HGWA 5DM70 3ZWBA 4AS3A 2V58A 2GHIA 1FYVA 1RJEA 2NZWA 1KEPA 2VI5A 3VR0A 3BRCA 5E6RB 3PNQA 1ZICA 2XCPA 4HYKA 1UWLA 5KJFA 4YRAA 2W6PA 1EVYA 1PKEA 2ATXA 4BNLA 1L2ZA 4MW7A 3QUTA 1B73A 2ZSHA 1YOVA 2ZK7A 3RAEC 3WWHA 4PZ6A 3L6EA 4N4AA 2H4FA 5JJKA 3B1KA 1VBHA 1Z8FA 1D5WA 3HPRA 4PYKA 4D8XA 2A9RA 2FK7A 2F48A 1E2LA 3JWHA 2VTDA 1NY5A 2GLTA 1BD3A 4ZZIA 1P4AA 1JAYA 1W0CA 1X1RA 3Q8KA 1P9RA 1QS0A 1A9ZA 3KYCB 5ES3A 4PZ8A 2ID4A 2EKPA 3TG2A 3TRKA 5E0OA 1HKUA 2PM8A 1DZIA 2QDKA 3RFFA 1A9QA 2VAMA 5CFZA 4P7FA 4IHAA 2HJHA 4UCOA 4IILA 2CXQA 2JKZA 1GCAA 4Z9AA 3L8EA 1F8GA 4ZT2A 1DEAA 2H06A 2EF0A 1XZHA 3B5EA 2X76A 1A27A 2MR5A 3RUPA 1CE8B 3J81W 2N47A 4MVXA 4UUPA 1LVHA 3AEUB 2CE7A 1PE0A 4D3SA 3IQFA 3KKLA 1U7ZA 3PW4A 4Q3AA 4TVKA 4DWVA 3GOQA 1XZJA 2J85A 1TA4A 4CKBA 1E5LA 1KJQA 5AHRA 5IW8A 1O08A 3KZVA 4PRYA 1WP9A 1AC5A 5B55A 5HSGA 2C96A 1Y8RA 1TAUA 4CMCA 1WUTA 3G0CA 5BWRA 1WZCA 1EH5A 1IJFA 3MD9A 1R15A 3LCCA 4WNCA 3F2IA 4V0KA 2YCLA 3HB4X 3GIIA 4AMBA 4G0QA 3DEAA 4DA8A 2NQTA 3T5GA 2VPIA 2R9VA 5G40A 3NTOA 1L4EA 1RVV1 2BR3A 1EXMA 3B1JA 3A58B 1HG0A 4NV1A 2GVNA 2FWMX 5AJUA 2JFZA 3W3ZB 4WESB 2CNWD 3W1GA 4FFBA 1GYPA 3RYFA 2V6GA 4UEJA 2GEUA 1Q15A 2DR3A 5E1OA 5DTMA 1OAAA 4CVNA 3PUIA 2OLEA 1XRPA 3IUPA 1MTZA 5K8VA 4NFYA 1GYFA 3M5DA 4FE7A 3DUWA 4JI1B 3RODA 4R1TA 1ETUA 1H2WA 5TGDA 4RUAA 5TS2A 3BMXA 4D9GA 2DG2A 3RF2A 3V8RA 4B6RA 4E3ZA 2BQRA 4ZO4A 2DWQA 1FTYA 4RVOA 2WV9A 2WABA 1FVOA 1KI9A 1ZHSA 1J8FA 3ICWA 3WIBA 4FB5A 4BNJA 2X7HA 2KWIA 2AI2A 3Q5DA