3MWEA

Truncated human atp-citrate lyase with tartrate bound
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
424
structure length
424
Chain Sequence
b'SAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-citrate synthase
molecule tags Transferase
source organism Homo sapiens
publication title Identification of the citrate-binding site of human ATP-citrate lyase using X-ray crystallography.
pubmed doi rcsb
total genus 132
structure length 424
sequence length 424
ec nomenclature ec 2.3.3.8: ATP citrate synthase.
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16114 Citrate_bind ATP citrate lyase citrate-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mweA01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mweA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 3mweA03
1BNCA 1KJ9A 4YB8A 4NYEA 2W6PA 4O7NA 4YBZA 3VPCA 1AUVA 1WR2A 3LWBA 4XX0B 4FGRA 2YRWA 3N6RA 3WNZA 4FFNA 1DV2A 5LXTF 3N8DA 3G8DA 2VR1A 1Z2NX 3HBLA 2WYOA 4Y8VA 1EZ1A 2NU7A 2FP4A 2R7NA 3NUAA 1SCUB 4I55F 1VBGA 1SCUA 4MAMA 1Z2PX 4YBZB 2YYAA 2W71A 1JDBB 4XYMA 4XYLA 2HGSA 3VPBA 4O4HF 1JKJA 3VOTA 5LOVF 4MV3A 1JKJB 3BG5A 2CNVA 2YZGA 1JDEA 2CNQA 2PVPA 5JQGF 4Y8VB 3DMYA 3MWDA 4YAJA 3GIDA 4EG0A 4O7RA 2FPPA 5JVDF 4IHJF 2R6FA 4O7VA 2CQYA 4QSHA 3U9SA 1CQIA 3U55A 2QF7A 1E4EA 4MA5A 3Q1KA 4TV8F 3MJFA 5CA1F 3ORQA 4O2BF 4HNTA 4YJ2F 2I80A 2YZLA 4MV8A 4ZQIA 3VMMA 1A9XA 2FB9A 2P0AA 3TQTA 3I12A 2GPWA 5JH7F 3RV4A 4IIJF 3ETHA 3R5HA 5FNVF 4ZI7F 2NU9A 3KREA 2X0SA 3DF7A 1CE8A 1JLLB 4MV1A 3UFXB 5JVLA 1EUDB 4ME6A 5C1PA 4XZ3B 3UFXA 1C3OA 1EHIA 2R82A 4I4TF 1E4EB 3V4SA 2V59A 2YS6A 4O4IF 2W6MA 2R85A 5LA6F 2DZDA 2I87A 4RZQA 2R7LA 3AW8A 4FE2A 1OBDA 4O2AF 2C00A 4EGJA 2DWCA 1KJ8A 5DMXA 5LP6F 4MA0A 3K5HA 1CQJA 3G8CA 4WBNF 4L1KA 2NU8B 1BXRA 3R5FA 2Z02A 4HNVA 2YV2A 2XD4A 4HNUA 4C5CA 1JLLA 2NU6B 5CAEA 1DV1A 2NU6A 2YS7A 5EZYF 3JRWA 2GLTA 4XX0A 4O4LF 3VPDA 2YRXA 1GSAA 2YW2A 4MV4A 3KAKA 1A48A 4FFMA 4YAKA 2YZMA 4O83A 3JZFA 2DIKA 1M0WA 4O81A 2R84A 1GSHA 5JQWA 2DLNA 2ZDQA 2GPSA 2W6OA 2CSUA 2VQDA 1EUCA 3E5NA 3ORRA 3U9TA 3KAJA 4HQ6A 3JZIA 5LYJF 1EYZA 1OI7A 4O7ZA 5CAEB 1W93A 4O86A 3R23A 5K2MA 2FPIA 2FPGA 4ZOLF 1IOWA 2FPIB 4MV7A 5I47A 1AUXA 2R87A 4O84A 1GSOA 5IYZF 4HR7A 5CA0F 3VA7A 4YAKB 2W70A 4ZHQF 3GLKA 2I8CA 4EGQA 3MWEB 2GQRA 2FPPB 1EUCB 3WO0A 2W6NA 4M9UA 3JRXA 5BPHA 3WO1A 1CQIB 2PBZA 1IOVA 2FP4B 4FFOA 4O4JF 1KEEA 4YB8B 3HO8A 2HJWA 5HV6A 1CS0A 2PN1A 3Q2OA 4DIMA 4XYMB 5J2TF 1OBGA 4XYLB 3KALA 2FPGB 5H80A 1KJJA 1GLVA 4FFRA 4WD3A 4O7SA 1UC8A 1I7LA 3TW6A 2CNUA 3TIIA 3MWDB 2R7KA 1KJQA 3MWEA 2QK4A 4IZOA 2NU7B 2Z04A 1PX2A 4YAJB 5C1OA 5KKNB 5BMVF 5KX5F 2SCUA 2OLSA 1KC7A 2ZDGA 5BPFA 2SCUB 3LP8A 3OUZA 2J9GA 3AX6A 2V58A 1KUTA 1KBLA 5C8YF 4FFLA 5CB4F 2IP4A 1B6SA 5D8DA 4TUYF 2W6QA 5J2UF 4DLKA 1CQJB 2XCLA 4O7TA 5GONF 2NU9B 3HB9A 4O7WA 1GGOA 4MV6A 3RFCA 3TINA 1EUDA 4I50F 4C5AA 4IWXA 3U54A 1VKZA 3TIGA 1VBHA 1B6RA 2CZGA 1Z2OX 4MV9A 4O82A 1T36A 1I7NA 3PFFA 1M6VA 4FU0A 2W6ZA 5HBRB 3RV3A 3V4ZA 1PK8A 3R9RA 3K5IA 2YWVA 2VPQA 1UC9A 2ZDHA 1W96A 3QFFA 2V5AA 4XZ3A 1M0TA 2NUAA 4TV9F 1KJIA 2YL2A 4FFPA 4O7LA 3SE7A 1DIKA 2NUAB 4IWYA 4C5BA 3OUUA 2YZNA 4E4TA 3ETJA 2R86A 5HBRA 1ULZA 3K3PA 2R7MA 3R5XA 4O7YA 2NU8A 2GQSA 1C30A 4YJ3F 3RUPA 2YV1A
chains in the Genus database with same CATH superfamily
5EWLA 3ZN2A 1LWNA 4JBYA 1YRBA 1RRMA 1TUBA 2H1CA 4YCBA 4EBFA 2JEIA 1EE2A 4L08A 3ZQ4A 4ZHQB 2A9RA 4D8TA 3BD8A 1D9XA 4QRDA 4ZV7A 4DCMA 1I1OA 3ND7A 4GLJA 1C7QA 4URUR 1O7JA 2FPUA 3VHXA 3GDHA 1Z39A 2JLXA 1AUVA 1QNLA 3BPSA 2DF8A 2I62A 4PZ8A 1T6BY 1BQ3A 1QK3A 1G42A 4UEJA 5DI3B 1Q57A 1NRJB 1VFPA 4F85A 1YA4A 3D0OA 1IH8A 5DM70 5DISB 1UZNA 4JI6B 4DCSA 2UVWA 2VQ6A 2ZEJA 2P4QA 4OU4A 5SZHB 4DG8A 2HMAA 3DA8A 4FZVA 5KKAA 4AJIA 4YUZA 1NXXA 5JRZA 4KH0A 3DBLA 4LUCA 1NULA 4OSPA 4R68A 3SY8A 4E03A 4EHHA 5IANA 3FOWA 4JA0A 2ZE5A 3F3SA 3X1JA 4ENRA 3JQQA 3FW1A 2E18A 4MUXA 1T8TA 3OPVA 2H57A 4GMKA 2RK6A 1E9RA 1A3GA 1EZ1A 1WUHS 2NACA 2P75A 1QWSA 3I4CA 4YBRA 3VU8A 1LRLA 2OP1A 1H2XA 1B2LA 1CUUA 1SBNE 2O0MA 3T7KA 3DKPA 4EQ5A 1K63A 3OD1A 3WMGA 5EKSA 3V4PB 2FEXA 4WACA 4EW2A 1TVKB 1R8QA 3VR5H 1KEEB 2QLFA 4GR4A 4XB2A 2AUMA 3JVUA 3AI2A 3QVJA 1QIKA 3PQ7A 1PZEA 4O1IA 1GLNA 2EXXA 4PR3A 5HFAA 2COKA 3O84A 4XPIB 4KV7A 2Q2UA 1YVEI 4A3CG 1RRKA 4KOEC 1YD7A 3FNFA 2P78A 4NBWA 1JJFA 2VKTA 4EL5A 2R6DA 5CM8B 2F90A 4UARA 4CKCA 2EX4A 3G5MA 1LS1A 3U0VA 4HDKA 3WQQA 4F2WA 3KQNA 5KYWB 5JVDA 1Z88A 4DR6H 3SLKA 4UBIA 3QVLA 2RHLA 4PZCA 5JZBA 1OJ7A 1W25A 3EIHA 5SYMA 1VMEA 4L8VA 2IKSA 5AUNB 5DLPA 3PUZA 2X4LA 4NPCA 1G6HA 1ND5A 3P4UA 2QTTA 3KQUA 2CNVA 1MG5A 2YZGA 2DP4E 3ZY6A 4MLPA 5J4HA 1FMLA 3R7BA 1YU9A 1H8ED 3MWDA 4FQ7A 4JV0A 4WJZA 1KE1A 4QVIA 1JT9A 3E9CA 1H42A 3L0DA 3EZ2A 4RK4A 2VQFB 4QZVA 1IEXA 1KI4A 1U0RA 1V5WA 3VZBA 5CB4A 3ITEA 5KSWB 4GPIB 3E7WA 2VXOA 4QD3A 1IWBB 2Q1UA 3DVQX 1GM5A 2ZIXB 2YJGA 4QSHA 3NAMA 1N9GA 1RXEA 4LE2A 3VR2A 4CLXA 1EG2A 3PG5A 5DISC 1XP5A 1DARA 3GK3A 2FW1A 4M89A 2LR0A 1VLHA 3F3KA 4JI2B 1ZMRA 3WKDA 3ZVNA 2L82A 3UJHA 4I8IA 1GRNA 5FPOA 1AUOA 1E0SA 2B1QA 4ROSA 1Q0HA 3AC0A 3QOYA 4JYBA 4X93A 2YN2A 4F9TA 3QU9A 3RREA 1EGMB 1ZH4A 2BFCA 4J4TA 4AZ0A 1AQNA 3SQOA 1F0NA 4H7HA 4J16A 4IDNA 4HS9A 2OLKA 2BC9A 3GDWA 4Y9TA 3ZYCA 3LW7A 1K4MA 3E27A 2BEJA 4HFRA 2XZTA 4XJXA 4OYYA 2CJXA 4NEQA 2P6UA 1DQPA 1HYBA 721PA 4K9OA 3ZZMA 2VBIA 1GEEA 2G0AA 3H42B 3C70A 3ZXYA 4CDRA 2CVFA 2PIDA 1XZPA 4J94A 3C4VA 3WWPA 3Q88A 4TVSA 5JCZA 1OA1A 1FUIA 2GHRA 4JOBA 4ARAA 3ITKA 3BTVA 4Z2YA 1K2WA 3ZGZA 2UXBB 5H4GA 3RANA 5KPDA 4PXYA 2XB2A 2Y1LA 1IB0A 4QXQA 4ER0A 4IJVA 2P3SA 5CURA 3ELDA 3CNOA 1R6UA 1TJ4A 4AYTA 3CVVA 1SK8A 1RLUA 2WIGA 1VKHA 4FJ0A 4RGYA 5ELMA 2WA2A 4K9SA 3ZJ5A 2HJVA 5A6SB 5A7FA 4DXAA 1EUDB 1EP3B 4AKGA 1E2LA 1HTTA 1N9ZA 4PPQA 3VU9A 5C7YA 1G20A 4BBZA 8MHTA 1UM9B 2B8NA 2HPHA 2OENG 1KHHA 4DPKA 1M2FA 1XJ0A 5F51A 2VNSA 3IUEA 2MSDB 4PCAA 3FTFA 7AT1A 4OQZA 4PLYA 3H2ZA 4A8JC 2F3TA 3D3QA 1TZJA 1MQ8B 3ODGA 3RR2A 5CE8A 1V8BA 4M1YA 3B70A 2HF9A 2XKKA 1EDZA 2PM8A 1DIRA 3PRKE 5JUWA 1JBEA 1JIIA 4EGFA 4Q9IA 2Q29A 2XE7A 2QMOA 4JV2A 4G0YA 2NO4A 3BH7A 5JS8A 1HT1E 3JYPA 1X77A 1YNSA 1BEUB 2VJQA 3HZRA 4JT2A 1F2UA 4RDHA 2GN6A 5ILGA 1SPBS 3QU4A 4QXAA 4ZT6A 2VNJA 1YDGA 1X8KA 4IUYA 1QVWA 3U19A 3V8BA 1H8EA 3RUCA 3UJ3X 4J2HA 1ULAA 2VJAA 2ZRCA 3HKDB 2DULA 4A2BA 1ZH0A 3O2QB 3QEMB 3PJRA 1F3OA 2H52A 4WY2A 4RD6A 5IMSA 2CV1A 4G85A 3FPFA 2JRCA 2QN1A 3DBRB 5KS8A 1TWCA 1VSQA 4HNSA 4MEBA 2K2WA 3D3KA 2XEDA 4RETA 2B5OA 2DPXA 3I8XA 4YMUA 5EZYF 3PHHA 4FXPA 2XOXA 1ZL2A 2C94A 2OXEA 2F43B 2VCHA 4HDRA 4LJ7A 4BQNA 1CUXA 1RSZA 3ACCA 3PNLA 2AFHB 1DJNA 3DC7A 4YFVA 4C87A 5KNCD 1EUYA 1UOEA 3G2IA 1P9RA 3AIOA 3MT9A 2IE8A 1B6TA 4WN9A 1H66A 4CMDA 1NAIA 2SKDA 1C41A 2EF0A 1JPVA 4S1PA 3AU9A 1YB5A 3G49A 3OWHA 2OWEA 3F6BX 1YE3A 3MRSA 3IAUA 3PUKA 5KHOC 1I1HA 2DIKA 3D3WA 2ZG6A 4R69A 4UU8A 3AZOA 2R84A 5DBOA 3DWGA 4DNQA 3PPYA 4QFMA 3CZPA 3UOAB 2JEOA 4Q7EA 4RHUA 4ZCSA 3UICA 4LH7A 2A3RA 1T3HA 4IS2A 3LG2A 2GETA 4X7RA 1SOVA 4YRAA 1MB2A 3AETB 3NBFA 3L6BA 3X1XA 1X8JA 1B0UA 2HU7A 3FPCA 3ZWKA 3PEVA 4CL2A 3RBEA 4ARCA 2QVBA 3TZKA 1KVSA 3PF8A 1XMQB 3O2NA 1HT3A 5ARDA 7MHTA 1OI7A 3KUXA 2R96A 5BYAA 1RJGA 1L7OA 1Y81A 2ASVA 3GTGA 2PFKA 4AVYA 2EFDB 1RVDA 2ZROA 4FGZA 2AJ8A 1LS6A 4IGAA 2XB9A 4ZARA 2Q7OE 4RB3C 2W2LA 2WT8A 2F3PA 3RT1A 4F60A 2Q6IA 2UZIR 3EA4A 2ERCA 3T3EA 2F4VB 4AJ2A 3MTDA 4OFXA 3QPCA 3KYCB 1OZHA 4Q1AA 2QTFA 3TPZA 3WTBA 3TEJA 4BEBA 1UQUA 4V02A 2FPIB 1WSCA 4JI5H 1C81A 2RAPA 1LVHA 1M6HA 1YRQA 3CZCA 3MCAA 4O84A 3BA9A 1GSOA 1FW8A 1JFFB 2IYTA 5TJ9A 1J07A 3KAQA 3O8QA 1QZUA 5AW0A 3EPJA 1AM4D 3I30X 2QBYA 3M6LA 4ILEA 1OWPA 4ETWA 5HIKA 3VYRB 2J0EA 2W6IA 3BRCA 4MSUA 1V8FA 4YNBA 5K4AA 2I8CA 5JG7A 4ID9A 4EHFA 5AOAA 3O8CA 3HVKA 1GD1O 3MWEB 3VX3A 2RJNA 3L7AA 4W6ZA 4Q0MA 3RUEA 4PHCA 1YR8A 4I46A 1YR7A 1I33A 4L8LA 4EPTA 4L2IA 1WL8A 4RC9A 2EV9A 1WCMA 2GQRA 1XZEA 4HTAA 3ODPA 4Y2GA 3RHFA 1ZIPA 1PW5A 3CBQA 4YK7A 3UUFA 2J6SA 2YJ6A 5KG1A 1M2WA 3WO0A 4Q02A 4WKBA 1VXOA 5EVCA 3R1IA 2YHSA 1L7MA 1J4AA 1SMKA 3FNGA 1J2YA 3MWGA 3JRXA 3DE4X 5BPHA 3L05A 4LDNA 3WO1A 3B6EA 4X63A 3KT3A 1JPUA 5F7JA 5BNTA 2EG5A 3W79A 5I4CA 4XQ9A 3HSKA 4H1UA 5AI9A 4B8YA 4N18A 1VCNA 1OI3A 1ESNA 1HKUA 4RLFA 1Z2CA 3OX3A 2YXDA 1GYRA 3EF0A 1M1NB 1VE5A 2ASLA 2OV4A 2P35A 2ACWA 2BZ1A 2XGOA 3HB4X 3HY6A 4YJ3B 4KQ6A 1RD4A 2VI5A 5I3ZA 2QX8A 4IR7A 2ZU0C 1U6JA 3QNMA 1Y7LA 1DKLA 2AGVA 2AHRA 2I6UA 2AG0A 2FMTA 4DSOA 4MUHA 3SCZA 3D8TA 1E7WA 2QP3A 3VDMA 3IC5A 1X13A 4D46A 3R7SA 1WZNA 4HLCA 2ORED 2XWBF 4RYLA 3URKA 3V1UA 5NULA 2GNOA 2R6CA 3A4LA 4OIMA 4Q3LA 3PL1A 2B4AA 5D3ZA 1T0HB 4P4TA 1OGJA 5AQ1A 2XECA 3B1FA 3LK6A 3C3KA 4K1XA 3NS7A 4G3XA 1GCOA 2FE4A 3KG2A 5G0VA 2C3PA 5KQLA 1ZJYA 3C24A 4YJGA 4W5QA 2OVBA 4IDGA 2QQ0A 3B2QA 3EDRA 4AIRA 5ADVA 2J46A 2GEFA 3NHLA 5D1PA 2Z04A 1H6BA 4J0QA 1P1KA 3HXMA 1YT5A 3FZYA 3P20A 4QTXA 4QYIB 1JXQA 4IL5A 2AEMA 2VCYA 4FD2A 3AB3A 4K2HA 5KX5F 4P2BA 4UEKA 5HCUA 3WL5A 3IL2A 1G8PA 1AIPA 4MWTA 5CUQA 1C3JA 2DAPA 2XDYA 3R4VA 3PN1A 2GJ4A 4M1OA 5ENVA 2X0DA 3H2BA 5I3CA 4MWGA 2J6BA 3SF8B 1L9XA 2NLOA 4QXRA 2IEBA 1HR0H 5KKCA 3W5HA 4EI9A 3M2TA 4KQGA 2GK3A 5JOQA 5BSHA 2Y0BA 5FFNA 1C1DA 1DC8A 2V58A 1XA0A 2A14A 3OZEA 4LDRA 5HTKA 4DBLC 5IHXA 1IRXA 4UM9D 5DXAA 2P9ZA 4KVZA 1HG0A 1QDUA 4ZYZA 1YZQA 5ER6A 1ZJ4A 3JD3A 4G36A 1KBQA 5C3UA 3KXPA 4LOAA 2PXXA 2W2QA 3RYIB 1XHLA 3EBOA 1C9NA 1FP2A 1NVUQ 1FVHA 1F4LA 3BS4A 3HM2A 1C9JA 5JO0A 1ADFA 4P7GA 4YGYA 5J2UF 1KC3A 4CR6A 3NH9A 4YY3H 2VP9A 3RWMB 4L4XA 3HL0A 3A11A 1JKXA 2O54A 2H7YA 1ID1A 1R6BX 3CWCA 4N7JA 2Z83A 3KYIB 4RBNA 1VKRA 4V3CA 2VHUA 2PUGA 3H8WA 4M37A 5JWHA 4QU9A 1IXRC 4O7WA 2G77B 2QQGA 3JAKB 1D09A 2IYNA 3M5WA 3V4OA 3WIDA 3D1JA 2QZ4A 4NV3A 4UM7A 2R65A 2IHUA 3DNFA 1E7MA 2Q4BA 3ZZ0A 1DI0A 3NTUA 2OV6A 4EFMA 3E03A 1U1FA 1PJZA 2AN4A 2GKSA 3ETDA 3KLNA 5DYGA 3X1WA 4D99A 1Q50A 4EECA 3EXFA 4C2TA 3LT0A 1UKCA 3A6DA 1L7XA 2UVUA 3RYFA 1E9AA 1DQRA 4DIBA 1MVOA 3K31A 1LPPA 1I94B 1TWGA 2WZCA 3E9YA 3ZIDA 1XLVA 2V55B 3KD3A 2BY4A 3RJMA 3GTLA 5ERXA 1KJWA 2K7ZA 3JQ7B 3FMVA 3H0CA 4Q82A 4D9MA 1J0CA 1XMIA 3O38A 5FIUA 3V80A 1K7YA 2XZOA 4D7AA 4QWEA 3GPIA 4OI2A 2UZ0A 1F8UA 4XSVA 3BA1A 5JDCA 5KTYA 1LW6E 3T1NA 2JI4A 3RTAA 5H1YA 5JWRA 4ENUA 3PNSA 2GLXA 3D6HA 2Y1CA 3ACDA 1JLSA 3CWZA 3JXEA 3GC6A 3HJBA 4MKGA 2BHSA 1E2MA 4QUKA 5AHWA 3W5IA 1GUFA 1YAHA 2E85A 4IIDA 2CLKB 3CH5A 4DVGA 1M6VA 2VJDA 4G4JA 1WB4A 2D6FA 2QS9A 1X3LA 2PCJA 3ZVRA 2WWYA 4LFCH 3HHEA 3LO5A 1M2GA 4IGEA 4R1QA 1JLHA 3ZW8A 2WE7A 3TPCA 2UXDH 1SULA 1VL0A 3K30A 5F2EA 5HPYB 5JZMA 3IODA 2Y77A 3DXZA 2GJ8A 2EGHA 3IUSA 1RM5A 4TQGA 2HREA 4AG6A 5CEFA 3KLMX 4H6VA 5ERYA 4BZXA 3VO2A 1C4KA 2NV2B 3T1VA 1HFWA 3PWSA 1ZCZA 3LL4A 1R3UA 1RMYA 3F6YA 3IVMA 4WZBB 1LI4A 4BZZA 2ZYRA 1QH8B 2CCJA 1G2WA 1TIBA 4YDQA 4INZA 4YP0A 4RDIA 1K5HA 1SUCA 1EQ2A 1SVNA 4B3GA 1RAAA 4ZT5A 2AA3A 3T9BA 1WXIA 4MP6A 3RC7A 3GY0A 4MVJE 2BM1A 1TIPA 3P0IA 4N3AA 3RRMA 3O4HA 3KJNA 4OXXA 5DTJA 1A2QA 3OOEA 2LKDA 4PNPA 4ZVRA 3R7WA 2NUAB 1O6CA 4DPLA 1QH1B 4OM7A 5J1SB 1I6KA 1XP8A 1Q7GA 1Y33E 1IU9A 1JFVA 3FAKA 4I4CA 1EAMA 3B7PA 4INOA 4WLVA 2RARA 1ZI6A 2JPDA 5CX4A 2VNAA 4XI9A 1JQ3A 1JILA 1II9A 2VP0A 2CYBA 4XGRA 4I3GA 5TQJA 4J7XA 4DV2H 3E8MA 3HRKA 3DE3X 3PZRA 3W3AD 4KQXA 4M0DA 4LGVA 5A3SA 3M81A 4O63O 5EHQA 4F12A 3UXEA 5IJXA 1Q7EA 5LIRA 4DR4B 1P2TA 4DV1B 4CFZA 1KEPA 2NUTB 2V7PA 2AG8A 1E5DA 5KYUA 2B1RA 4W5HA 1FU4A 4C08A 1H85A 4MWDA 3EDQA 2YXEA 3NRJA 4TV9B 5JLJA 1TDJA 2QRNA 1OH6A 3Q8KA 3V1TC 1WXHA 3STTA 2XCAA 2AGOA 3U1BA 2CZQA 4V38A 2XKBA 2XQGA 3C3DA 1JBQA 2GKGA 5IJ9A 5DX8A 3LKDA 2F7SA 3RC1A 4II3A 1G16A 1W87A 1E8NA 2OHFA 4DMHA 4EVQA 1LBTA 4OP3A 6LDHA 4URHA 2WB4A 2QVCA 3G2LA 3N2ZB 1I7SB 5IU6A 2ZAIA 4NOMA 5FO1A 3VR5D 1U5BA 2FX5A 5KCZA 3SVLA 1C7ZA 1E1MA 1UMCA 3GHHA 1NJ6A 4PG7A 3BGWA 3R3VA 1UDWA 4FOTA 3BORA 4V03A 2OCYC 1MB3A 3N6RA 3L4EA 2C57A 3H9GA 1RAIA 4Z1OA 4NR0A 5EIFA 3IJRA 1ZUIA 1N1EA 1SD1A 3H97A 4KQ1A 3R0XA 1DV2A 3ILXA 5E6SA 2IWHA 2AB0A 4LWPA 5F2KA 3Q2IA 3E2PA 3L3BA 1I2LA 2Q27A 5JSUA 3SZMA 1PS9A 4M0FA 4ZYTA 2WYOA 1X7GA 4RJ2A 4P35A 1DJMA 1B8PA 1XHEA 3KJQA 3V8QA 3HP7A 2C4WA 2DWQA 4ZAYA 3OT4A 3OPYI 4EIWA 3DFFA 1XV5A 2BMWA 3IG0A 4A3BG 2J7PD 2ONZA 3BX1A 2WJAA 4FOPA 5D00A 1ZVKA 1SC3A 3QVKA 1PAUA 4A3EG 4AJKA 3MFIA 1RR6A 5BSWA 1WXQA 1O2DA 3QTLA 1QAOA 2M9MA 3HB0A 1QFYA 4CQMB 4KU4A 4YX9A 4FW8A 1QCCA 2OBYA 4HXGA 1F8XA 1O8CA 2PS3A 3DE6X 4OAOA 4PQRA 2F1OA 3NIBA 2O8BA 2JLVA 2E55A 4QPJC 1U99A 1WX1A 5IZCC 1XL1A 5C5IA 5ECYA 5HS6A 2W9AA 5AQEA 4EY4A 2W2KB 2D5AA 3QVGB 3GLIB 3GJZA 2RMKA 3EVZA 2CFRA 3HUDA 2N9UA 4GX0A 1QQ5A 1ZGHA 1ODLA 4EYEA 2QP9X 3DDSA 4KXMA 4N54A 4XWYA 2TRSB 4EHLA 2BR3A 2EKQA 2I29A 1XQ6A 3NBYC 1U8CB 1U7XA 2BGGA 3ED5A 3QV2A 1VG0B 4LISA 5JLAA 3AY7A 1WH2A 2MIIA 3DZJA 3MJ4A 3SBEA 3V1LA 3O0TA 3QKRA 4I66A 1JEJA 2IBTA 3QI7A 1JKJB 1R0LA 1TF2A 4B4VA 2JEGA 2G70A 2JBWA 1SA0B 3P1JA 4AMZA 1OBFO 2DQKA 2C0PA 1YZKA 3BMCA 4IG4A 4RF3A 3GJSA 5JSYA 1OUMA 1GR1A 4JI3B 4YRKA 1A97A 1YHNA 2IZOA 3A9TA 4ED3A 2QNBA 1NONA 2W6JD 3GZJA 2H2HA 4XTRA 5B3KA 3GIDA 5IPFA 2E6KA 2HGXA 3N05A 4FB5A 1NQWA 1RACA 4ZCLA 1LZLA 3W5VA 821PA 1E3SA 4YYEA 5CT9A 4IHJF 1JIKA 2LD4A 3ELWA 3O91A 4ECXA 1FSPA 2PUCA 2BGLA 1GADO 1EKXA 1Z3CA 1S2OA 4A0HA 3WKAA 4C4OA 3U9SA 2OKGA 4C7MA 4GGMX 2AQ8A 1O95C 2IX3A 5FHQA 5K3AA 2ONKA 3RS3A 2PUJA 4DRXB 2A3NA 2AKYA 1U0FA 1FTNA 3PJDA 1VL1A 4BJ6A 2HY7A 3EQ7A 3MERA 4FHDA 4DG9A 4ZT4A 3JQ7A 5JXHA 5FPQA 2ODBA 1ABEA 4BAUA 3DM5A 5JZ9A 3GLHA 4MQ4A 1DBQA 1JDNA 4O2BF 1UKAA 2QUIA 3B3GA 4AS2A 5F1OA 5K0EA 1UMDA 1FB5A 1JHZA 1A3CA 2O2SA 3LDAA 2QQFA 3N2GB 9MHTA 3IKTA 3LXUX 1UBEA 2EQBA 2NQ2C 3BULA 1RHJA 3S68A 3SJUA 3X2FA 3REFA 4LCEA 4Q3EA 3JSNA 2FN9A 2GYWA 2G7ZA 3S2IA 5BNZA 2WB1A 2FZGA 4IIJF 3A9UA 4L0DA 2KE5A 1N3BA 1BX3A 3F3MA 5ARCA 3B6IA 1THMA 4QJIA 2XBLA 3O26A 1Y6GA 1QIFA 3K6SA 1UWKA 4BMDA 1XK6A 5B6PA 3V7UA 5LL6b 1TGVA 4X60A 3CEPB 5COBA 4DR3H 1YZFA 2XAAA 1GAQA 4IVQA 1UJBA 4CL0A 1UJ4A 1F8YA 1W6UA 1DDIA 3MW8A 1R4MA 4NU0A 1UL1X 5DYIA 2V7VA 1T0PA 3L7BA 3AFMA 1JLLB 3EEIA 4PEVA 4PYNA 4Q3BA 4TZTA 1RYBA 1B76A 3DHWC 1Q7CA 1U3VA 3H65A 1OLXA 2HNKA 4Q7LA 4Y2SA 2OFFA 2CW8A 5HKOA 3PX2A 1SXHA 1CF2O 4PIMA 1MJNA 3VR6A 2PVSA 4H7KA 4S1TA 4BUCA 3LXRA 3K9FC 5HF6A 2XNSA 1EAYA 1EQAA 5C8VA 4V1CB 4ETMA 3WLIA 5TPZA 2R8KA 3GLVA 4JR1A 4WHXA 1RJQA 5A2QA 4MQ5A 2IP2A 5JECA 2DECA 3PC7A 5CLIA 4LWZA 2HHHB 2O3TA 1EM8A 4R1SA 2BMAA 2BONA 3X0DA 3SYTA 3EQ2A 3R3WA 1GL9B 2VJOA 3HK2A 4WXYB 3TLEA 5LD2B 3AFHA 1V9LA 2LV8A 5DQHA 2ECQA 1KO5A 4QELA 1G6KA 1TQ4A 2D2VA 6AT1A 3KDPA 1DFHA 2GLUA 4I4IA 1M8FA 2VK2A 1E3IA 2BD0A 3TLYA 4KO3S 2PAAA 2F4VH 3W2GA 4MMZB 2O2GA 1CS4C 4R7RA 1AKWA 3ONFA 4G5GA 5HCNA 1Q7RA 2XGGA 2I2CA 4B4WA 1Y4UA 2WNIA 3SQLA 3EGDB 2O06A 3U31A 4X54A 2WVHA 5I45A 1R6AA 3MLEA 3KSBC 1PJAA 5BQXA 2Z02A 1RCTE 1ECJA 1TD1A 2A30A 2A59A 1J24A 2HDHA 2R1TA 2PGDA 4P3NA 3BSSA 3CUVA 1TK3A 4MP3A 1W4AA 1F0YA 1WDWB 2WIAA 1UC4B 4WW0A 2RFLA 3TGWA 2I67A 2Q6LA 5KYXA 2O0LA 1YQQA 3OC0A 1AQUA 1Z16A 4PAOA 4F38A 2FSPA 1BQ4A 3CUKA 3OEHA 1JQJC 1QKIA 3HVUA 4HBGA 4HOYA 2IEAA 2VYNA 5BR4A 3INYA 2QT1A 5TMBA 2W2MA 2R62A 3EVGA 3L7LA 4ZI3A 5BYBA 4PBSA 3I34X 4IDOA 4AZSA 4HVLA 2GBIA 3IV9A 4AW9A 2N3ZA 4G5YA 3B6JA 4UXHA 4K9DA 2JCSA 1ZN7A 1FYDA 3EWIA 2WC1A 5CBPB 4CEIB 3VDNB 5K0FA 2ID7A 4JUCA 1QE5A 2JIPA 3E5HA 4FILA 4O83A 2BFBB 3L0CA 4IJKA 4JLKA 2I78A 1F6WA 2JASA 3AVOA 3ZV3A 4EYSA 3OHBA 3DLHA 1QZTA 1IJKA 3W04A 1CP2A 4ZQEA 5EEHA 2IUTA 1W5AA 2RG7A 1NPDA 5LQCA 2FEPA 4V39A 4AKHA 3V2GA 5KFKA 1K3TA 2CF6A 2R25B 1FRFS 5H3LA 2QEQA 2Z2JA 5DNUA 3L0IB 4PG4A 3E5NA 2C2BA 4FPXA 3Q8SB 3EX7C 3L6UA 2SBTA 2EL9A 2XUOA 4OFZA 1USGA 3VNNA 1LPSA 3GARA 4AJOA 4BCDA 1I3QA 2BRUC 2GHTA 5D01A 4HAWA 4J9MA 3JQ9C 5AM2A 3HLKA 4DNPA 4EYKA 3BABA 2O8VA 2AU0A 4PLPA 5D3QA 4ZV9A 5K6TA 2NTJA 3EXHC 4KLNA 2ZRMA 5D6NA 1JG7A 2K87A 4QT4A 4EA6A 2FPGA 4NE2A 2EZ4A 1SQSA 1G64A 1I5OA 1NIJA 2HSWA 2N1MA 4KO4S 4GMGA 4R5MA 1IOWA 3RHZA 1NE2A 4ARBA 5JJCA 4AS1A 5CM0A 2REOA 1GAXA 1JBKA 4H6PA 1F9AA 3FMPB 5IYZF 1QYVA 3O1LA 3B2NA 4PV7A 4B7XA 1T1EA 4L07A 2AR0A 4LOJA 4DVJA 4FNAA 4TROA 4KAJA 4TXMA 1AU9A 4MPTA 4YC7A 2ZI9A 4AJEA 3KKPA 2VP6A 3GGJA 3HCOA 4RDXA 2ZPUA 1C1XA 4J0DA 3OTOB 2FW9A 3A0UA 2R7AA 4ZO9A 4A0SA 2I7TA 2H63A 3ONNA 5IXSA 1OASA 2WSSD 3MLBA 3AR5A 3N7AA 3PI6A 1YS1X 4RA9B 2Z5GA 3VPGA 2OQIA 4LDJA 5E7JA 1H2RS 1FVOA 2G36A 3A4VA 4FS8A 4JH0A 3OSNA 3PCXA 4WASA 4V1CI 1HNWB 3S2UA 1ZBQA 1TVKA 1SKBA 2BHTA 3FETA 1DKNA 3QXCA 5A4DA 5GJCA 4RSRA 3MR2A 2A88A 2Z2IA 4TVBA 2QTMA 1DX9A 1XU9A 2JZCA 2REXB 4JLUA 2BEUB 4JS0A 5B1DA 3RKUA 2G07A 3PGA1 5REQB 4D74A 1IHYA 2JFQA 1ZSYA 3N7TA 1Z4QA 1J0BA 4DMLA 4ZHQA 1LFDB 1ZSVA 4FKBA 5EIXA 1F7VA 3HO8A 1R0RE 4KI7A 1JALA 5C5CA 1WPQA 1Y9AA 1FQWA 4N5HX 5K3SA 1BCSB 1NI4A 3C41J 3DG9A 4K05A 3PA8A 4R8RA 2O2ZA 4MUGA 5DRTA 2Q3DA 3K4PA 3LU1A 4PQYA 3LJKA 4XAQA 3D0RA 1RPZA 1BMTA 5ALQA 4NCXA 3RWOA 3LMLA 4N3BA 5DCLA 2YIVX 2QR5A 1NBME 1OFUX 3EASA 5ITZB 3KR9A 5PNTA 3UPDA 3L43A 1KVRA 5I5XA 1H0HA 2AQHA 1G8MA 4D81A 3O74A 2VJYA 1Q84A 1LF5A 2QVYX 2YJ3A 2IMWP 1UZMA 1JDTA 3I9JA 1SBQA 3O21A 4FYYA 5FA6A 3D5EA 2C78A 3MGKA 4KNYA 3W6ZA 2QVXX 2W2NA 3BXEA 1RYSA 3L6OO 4P08A 5I7WA 5JSZB 1NW4A 2VS1A 2AH5A 2F59A 2Q9BA 2J3HA 3AY3A 3M4IA 1SXIA 4MPDA 4I8DA 2Y1DA 3EBLA 2IHJA 4PBTA 1XDWA 1GFZA 2EP5A 2Q4TA 2CXXA 3EH1A 1FDUA 4KXLA 4RA9A 1KSFX 1J8DA 2IU3A 4C43A 5KMGB 3EFBA 5FI1B 3SSAA 5LSAA 1PX2A 1L1RA 2W57A 1C3LA 2FR0A 3EPPA 4HMPA 1UBSB 2DR2A 4B3XA 3WLSA 3LCRA 2VCEA 4LZLA 4W99A 4ZCRA 2F8LA 1QP4A 1U3WA 3JRNA 5IP9G 4XIFA 2X0FA 2MTBA 3D4LA 1ZLXA 4YWJA 2WV7A 3W6PA 3ZHXA 4R9NA 4DR4H 3FCXA 4DAOA 4V2UA 3EC1A 3DKVA 2EIHA 4DSTA 3GUZA 2JH3A 1U3CA 3HBAA 4JXJA 4ZU3A 5HIIA 3H5OA 1GN8A 1ZIYA 2OCDA 1EFKA 4MWSA 4X0EA 3VU0A 4J07A 3ADOA 2VTKA 1LLFA 3LLVA 4LYEA 1M2HA 3FVWA 2IXTA 2X8JB 5FJIA 3PUHA 1P9NA 4YO7A 3UK2A 1UXJA 2B5WA 3M1LA 3N2YA 2GZAA 4JWTA 4PONA 2OZLB 4RFLA 4TRRA 2QM8A 5GM1A 1G4AE 4ND4A 4RPCA 1ZYUA 1Z6XA 1I2DA 3B36A 1KQPA 4FX2A 4LOLA 4W5RA 2XA1A 4YAUA 3ZLTA 2F17A 5D8DA 1H0RA 5FB3A 5IH3A 2AN5A 1V3TA 2HHJA 2JIOA 2X6RA 2OGZA 3NNDA 1X7WB 4L72A 2DAAA 1LZKA 2QDXA 4Y30A 5GONF 3KEMA 4L5CA 2I71A 4ZFNA 5DTQA 1H6AA 1YZ3A 2Q3LA 1Q0LA 2A33A 5BXYA 3INTA 2JIQA 2P9EA 2VDWB 5HRAA 1GGOA 2O57A 1FJ2A 1JKIA 1XAJA 1UT5A 2QD3A 1K92A 2VUHB 2ZRIA 3CLUD 3DHEA 3HGQA 2VZ8A 3VRHA 2ATCA 2HK8A 1OC4A 1IPHA 1UJCA 2DABA 4J9LA 3LXXA 1IIRA 4ND3A 4QFDA 4XRGA 2NVXA 5JAHA 4MIKA 1OAKA 1T13A 2WWXA 1U7OA 2R8EA 3AUSA 3PD1A 3AOEA 3NX4A 4IUBS 4Z3DA 2J3KA 3CE6A 2WMNB 3MWLA 3NHPA 2NP7A 4IIJA 1I4TD 1DOZA 1I0ZA 3RC3A 1N92A 4HADA 1WEKA 2L19A 4LXHA 1XX6A 3ORHA 5B6IA 5E9WA 3GJXB 2QP4A 3B85A 4ERXA 4G26A 4Q12A 4ZIRB 4PC3A 2GTHA 3TS1A 1G6OA 1U5AA 3DO6A 1HX7A 1XC7A 3DZDA 5IWAH 2DQZA 3MQFA 4O82A 3TH5A 3B20A 5A3QA 1O94D 4AZ0B 2Q8PA 1PIWA 1GPMA 1E1QA 2Y76A 4HGQA 2H17A 2BFBA 3I9NA 4IKOA 3RT7A 5LZ2A 3CF2A 4S1WA 3NYQA 5KTTA 3P0RA 2DPJA 3G8BA 3ZU6A 1R0WA 1R74A 4YDHB 3VV3A 3IT3A 3NGMA 3UF0A 5HKLA 5NLLA 4FIZA 2NIPA 4F7WA 5AKZA 4TZ6A 2X9GA 2ZRHA 4LZWA 3IAEA 1RZUA 4OB8A 1Y7IA 1F5SA 2O8CA 2PK3A 1NV9A 2BT4A 1NE7A 5TRTA 3EVAA 1OF1A 4B0PA 1SKMA 1FS4A 1LI5A 3Q12A 2PBLA 4EPWA 3ELBA 3CSDA 3WLMA 1U0SY 1YRAA 3NHKA 3I8SA 4NZMA 4TXLA 3HJCA 5L95A 1AZSC 1XB2A 1WV0A 1CE8B 4M36A 3VYUB 3RVSA 3EIUA 1QPZA 1SRRA 1GQFA 2GI4A 3MTBA 3UV6A 1RWVA 1RWBA 2HV8A 1N3YA 4HH4A 4HX9A 2VH5R 4EEZA 2Y1XA 1G20B 3IAXA 3ANTA 1HR0B 4J0GA 2HUNA 2HRDA 2J9RA 1VDMA 2QZJA 5FPHA 1UZUA 5IM4F 2PLFA 2TS1A 3KKKA 2W4QA 3WYBA 4DLRA 3UPTA 4LTDA 4XQEA 3SR0A 1JSCA 3TSYA 3EIXA 4UDXX 1SY7A 2MINA 1J70A 2DJ5A 4JVNA 3ZGLA 4NKRA 5CG1A 1OWNA 1H5UA 1WKVA 5A2QW 2YZNA 3ICVA 5EL0A 4KAXA 4CMIB 4QUAA 3FYUB 3OZFA 2IZ0A 5A4MS 5J47A 5HKAA 4PGHA 2OO3A 4YN3A 1Z83A 2ZR8A 2WY2D 3WY9A 4JJ8A 3NBUA 3AKDA 3TZCA 3UBTA 1IY1A 5JTTA 2XC9A 1D8TA 3TB6A 2B63A 2OHOA 1LTQA 5HBRA 1RIIA 2R7MA 4JI8B 4EF4A 3HR4A 3ZNNA 1DOHA 2MU1A 2GXSA 2INGX 3BM5A 1ENPA 5C81A 4JB2A 5EUMA 4EFDA 4Q1EA 3TTSA 2JA1A 5U9CA 1JHMA 4M9QA 1DFIA 2QMQA 4J7AA 1JHXA 1M75A 3D8NA 1MO5A 3CJTA 3QLVC 4YRBA 2IXDA 1K86A 3BDAA 1SCIA 4E2FA 2V6IA 2ET6A 3AR8A 1ACMA 4NYEA 3NGLA 4BO0A 3COWA 4V0SA 1VJDA 4L0MA 3SS8A 5FL7A 1W4ZA 1CQPA 4DC1A 2OMKA 4RZSA 5LL6P 4MHTA 4K0KH 1C3EA 4WZAA 5EXTA 5TPWB 4S2EA 4KQIA 1TFUA 4WNAB 1U7ZA 1YOVA 1LW7A 1A9YA 2H29A 2ZIWB 1ESMA 2IEGA 1PGOA 3GFOA 3LX4A 1O87A 1MO3A 3NYWA 3OOSA 4RIIA 1IB6A 2F67A 3TZ6A 1JEYA 1YHYA 3WLFA 3USES 4H1WA 3EF1A 1KARA 3CEAA 3I28A 4U3JB 1Y8QA 5AP9A 2MSWA 4HEA6 3ZVLA 1R9NA 3AFIA 4R2WA 1GNTA 3KX2A 1L0BA 5JJBA 3HCRA 1P45A 2ZUVA 1L5LA 5KFXA 3SIWA 3GV8B 4HTFB 3N8DA 2A67A 1E1LA 3LWNA 3L02A 2E82A 2DPLA 3WGKA 1SVWA 2W4IA 1JFRA 2GVDC 3D3WB 3DXYA 4PLFA 1EVZA 4KMOA 1M10A 4TMZA 1VPDA 5DM4A 1NQVA 4CNBA 3UNXA 1P4RA 3W5JA 1YTUA 3H17A 2WWIA 2WTAA 3OOYA 1KI9A 5D5PA 3ZWMA 4WKNA 3WLHA 1Y0BA 1BS2A 1XRQA 1Y3IA 2I8AA 2PWZA 3A27A 3G89A 4KEAA 4IVPA 4QJ5A 4QPPA 3BIOA 4XUEA 3TECE 3UPUA 3RYTC 4OQ4A 5EP3A 5FNZA 1ZK2A 1T9AA 1E0JA 1I50A 2R7NA 4ND6A 4JBNA 5LOVB 4A10A 1R8XA 1QO0D 5ILOA 2V6MA 2FR8A 3L4BC 4JELA 1NYQA 1DL5A 4B3SH 1XZIA 3DVAA 4FFBA 4NRDA 2HR1A 3C3WA 1B4DA 2NZJA 1RQ7A 4MAMA 1Z2PX 4A4DA 3QPUA 4P54A 4TQAA 3VKHA 1E3LA 4GYYA 3ADCA 2HG8A 2R8GA 1PNVA 3IILA 3KYCA 3PX7A 1AK9A 5LB4A 3N0TA 5KHAA 2P1DA 1S03G 2XUFA 4A6PA 2EBWA 4QTTB 1G98A 5KDDA 2JD2A 3OCYA 3G6YA 3OFKA 4EATA 4EG1A 3DXFA 1H0KA 4EW3A 1BRTA 4GE0A 4HEHA 3ENVA 3ZJ4A 1JDZA 2RI1A 1XQ9A 4Y18A 3UUEA 1E62A 1FNDA 1WMDA 1PT8A 2X8AA 5HGJA 1RBZA 4ZEVA 1SXQA 2Y0DA 3L8DA 4H4CA 4RNNA 1JHQA 2HBRA 3GRUA 2FK7A 1ANKA 3C8ZA 4TTVA 3W4KA 1T9BA 5CA0B 1KKLA 3GAAA 5L7WA 3QFSA 2AHOA 5JASA 3H99A 4DUYB 3L0BA 3OZUA 4IMIB 2O3RA 4EHKA 3NBMA 1WRVA 3F4LA 1BD4A 1WU8A 3M4ZA 3FIUA 4P5DA 5HA5A 3OQJA 4DA6A 1YDWA 2J5XA 5J5AA 1PE0A 3A4MA 1I5RA 3CUEF 5CXUA 3U55A 5J43A 3EGVA 3LOUA 4DRFA 4UZEA 4XVQA 1EXVA 1YS2X 4Z9BA 2OCPA 2ZJ6A 3UN1A 3GTKA 5DN9A 2YWBA 1IXYA 1T5OA 4Z4QA 3QVVA 4JI0B 2Z6UA 2PWBA 4B74A 1DAPA 1C8KA 1TK9A 2D2EA 3UAZA 2RHMA 4BV3A 4OAQA 3K1JA 3WYGA 2HLDA 2FNAA 4PFSA 1CQZA 4OQQA 2Y3IA 2ZGVA 3FTCA 4TWAA 4AB1A 4YUAA 2BM8A 4I6EA 1NKSA 2ZIGA 3VISA 3F6RA 4CQLA 1XVTA 5KJFA 2ZBEA 3WRXC 5D85A 4GM0A 4IRKA 4M7OA 4GYJA 1YAJA 3OHPA 2H0RA 4ZQIA 1TQ8A 4JEHA 1XNRB 3DV0B 3D1VA 5TB5A 1RYRA 4A0RA 5C7IO 1ZM2A 1ESCA 1XLUA 3F7NA 4TKLA 16PKA 2ZIAA 1WM1A 1DCTA 1KNQA 5I9MA 2GN0A 3QLTA 4I1IA 1UT8A 4KACA 1KBOA 2Q0QA 3MSXA 1E7SA 1QIGA 1XGKA 4PAGA 4BLUA 4FGJA 4LMBA 5CCBA 3BN3A 4N8SA 3GJ3A 1SCQA 4AN0A 2ODNA 1F51E 1ZD4A 3E9DA 3FN4A 3WNBA 4CI9A 4OK3A 1UBLS 1HDEA 1ZGAA 1RQXA 3LSYA 1OH8A 2I9KA 1SM4A 4UBKA 4G1MB 4F11A 2YY5A 4B6SA 1BKYA 3EDYA 2JF0A 4D3ZA 3UO8B 1BG6A 4J90A 3ORSA 4EJMA 3WDKA 3THRA 4XZ3B 3QHAA 3FCEA 4C3ZA 4TYYA 4DIOA 2HADA 2Z3ZA 4M0KA 4P22A 3Q5GA 4NX2A 5K0JA 5FCDA 2J9FB 1KAEA 1G2QA 3HEMA 3N0XA 2Q1SA 4AN1A 1YI0A 5BNWA 1PK7A 3AW8A 4NHOA 4PAWA 4R3UC 1RBYA 1VCHA 3CH7A 4HWPA 5HUQA 4BS9A 2E5WA 1E3WB 2XSZD 3S0JA 3RYIA 4O2AF 4PYKA 3I5AA 3K2QA 4R1UA 3UGJA 3NASA 2X7JA 1Z5VA 2ORWA 3O94A 3DL2A 4K28A 4AICA 1UIMA 3W8EA 4ZQCB 4MA0A 2AOXA 3UAGA 4EVSA 4UEQA 1JPJA 2CD7A 3L46A 1I1NA 3DBVO 4MINA 3HI6A 4ZXPA 1L4FA 3ORYA 3L7JA 4O4IA 3UGKA 4IWNA 4GNRA 1UMKA 4BYMA 1GCAA 1P1CA 1HDOA 4X62H 4DR5H 1N2CE 1O0SA 3RGWS 2WJPA 3O3NB 1G8JA 1U98A 2DBZA 5KQSA 1KO7A 3GQBA 1JTEA 4TLDA 5CLLA 1WSBA 1FFSA 4OXRA 4JT8A 2NUPB 4OJYA 4QQKA 4DJJA 1G3UA 2CLEB 5IDYA 2BSQA 1EP9A 2HCBA 2Q2WA 4Q3NA 4AZTA 1B73A 2O1XA 4A2PA 1S7GA 3SDZA 3FROA 2D54A 2V0NA 3JQAA 3R20A 3C97A 4QUBA 3NDPA 1R0XA 3TQCA 4DXDA 4HRAA 1P62B 4NCJA 5DN6D 2I4TA 3GROA 3JWIA 3H83A 4ZT2A 5J4LA 2ZAMA 1BWSA 2QBYB 2YZMA 3IHTA 4R7GA 3RIGA 2OKCA 4IOLA 1BX0A 4OYHA 3ZR4B 5CNKA 2GTIA 2PZMA 3PPWA 1IG3A 2A57A 3O7MA 3PWKA 1RI4A 4FGKA 4Q7JB 1OX4B 4RUCA 3M9NB 1OD6A 2FK8A 4D2IA 1P16A 4G4GA 3EFEA 3QYJA 2ICAA 5FORA 5BWOA 1HL7A 1S8AA 4TV9A 5BW6B 3LUGA 1J99A 3PXGA 3C3PA 4TV8B 4RSMA 1OFUA 3QKWA 3WWDA 3VNSA 2QUZA 1DBRA 3D9QX 3DV2A 4YQYA 1TCAA 4BV9A 3TOSA 4OHRA 1OLSA 4GP7A 3NATA 4UDOA 4X41A 2FTKE 2AMFA 1LPMA 3IAM1 3IKJA 1K3FA 5DBHX 2XRZA 1XEFA 2PXHA 1Y34E 4KPGA 5L4NA 4FFBB 4WXEA 1N6NA 2V7GA 2X42A 5L7YA 4DJ5X 1IN6A 1EXNA 2H1HA 4CEJA 4X7BA 5IAGA 1QP7A 4PXSA 1DUVG 1M8PA 1GZ3A 3VAZA 1OYOA 5AKGA 1CTQA 5LKRA 3ZK8A 3M49A 3LPLA 1XNJA 3FCSB 1WMSA 1Z7BA 1AZLA 2WAXA 1KPHA 3LY8A 1MA3A 3IKLA 4GRDA 4V0RA 3FVTA 4J9OA 3R7WB 4GLBA 3RK1A 1OCEA 1SQ5A 2Y99A 1K4YA 3O8DA 4XDZA 4F5YA 1A8HA 4R8MA 2ZTSA 4UOEA 121PA 1Z7EA 3P52A 3RR5A 1U0GA 2JFOA 3F8SA 4IIBA 4Q3CA 5HF8A 4Z49A 2PGLA 5DG8A 3H18A 3AR4A 1J1UA 4B4KA 4BRSA 3L7NA 1NVGA 2FLWA 1QE0A 3TRJA 4EH1A 1NPTO 3KM0A 4LJSA 1OX4A 4CKEA 2JBAB 1X1RA 2K7FA 3DR5A 2P6OA 3A1DA 4KMRA 4OXQA 3PR5B 2BM9A 7REQA 1M6WA 1QFXA 3A4IA 3GLUA 3KQYA 1ZHHA 3TLGB 4WA8A 1CQWA 3CGGA 3E2MA 1DKOA 4S3MA 3HCNA 4DCCA 2ZM6B 3LT5A 5EERA 1ZAUA 3M2PA 3U39A 4L75A 4WLOA 1BMFD 4Z4FA 4KYIB 4I7HA 3CBGA 3JCZA 3RIZA 3B82A 4DA4A 1IOVA 3F8WA 4N82A 5AXDA 1NOKA 3JQPA 3T5CA 3VYVA 3FFXA 1X70A 3IE2A 4CHGA 3VVCA 2XQFA 4G6ZA 3PXBA 1WF3A 3KTOA 2PN1A 2HA4A 5JYBA 4CQJA 4QDJA 1N0VC 2R4TA 2OA0A 5THQA 1S8OA 2G88A 4S35A 5B37A 5FUVA 4JI6H 2V3VA 1MX3A 3W0LB 4ALJA 4BN4A 4TYWA 1KSJA 1ZNYA 4Q7QA 1E2NA 1DXHA 1MC4A 1M7JA 4LH6A 3PO3G 5C1DA 3HCPA 1KSGA 4BPBA 3K70B 1KK3A 1CUCA 2GXUA 2V96A 4YAEA 3ECSA 1VJRA 2QNIA 1N56A 4LSMA 4TVKA 4UEWA 1DCMA 4LYFA 3DLTA 1K4KA 1TKBA 3TIIA 2MCTA 3HI4A 3I1JA 3SFVA 3X43A 3ZTWA 3CN7A 3BSFA 5JTUA 2Q1XA 3E18A 3Q98A 4JJKA 3JTMA 5ISMA 2OBFA 1BFDA 3ZDEA 1UDCA 4C6TA 1G291 1N2HA 4FOOA 3G2QA 3PS9A 2Z9BA 5EIHA 2F48A 4OPMA 3LFUA 5GJVC 4NZYA 2OC4A 5DNVA 4BNGA 4YAJB 2XTJA 6GPBA 3I04M 4H0FA 1E6EA 1P60A 1A5AB 3LQRA 3WWOA 3LX6A 2XNJA 1JIJA 3JQGA 1XKXA 2BKUA 1V4YA 1VI6A 1MB0A 2Q41A 5A71A 3ZGYA 4NCIA 2SCUB 3B5EA 3PXXA 3CE9A 1OR8A 5E1BA 1JFLA 3OUZA 1DELA 2CB0A 4HYQA 1RC8A 1KRWA 1ORIA 3TM4A 1F2TA 2ZKIA 4XASA 3U13A 3ZLUA 2CHGA 1TECE 2OV8A 3G0OA 4NNJA 1RHUA 2BTOA 2A5YB 1WUYA 2PH7A 1A76A 3PCTA 3IXLA 4GAEA 4MO2A 4OL0A 4YONB 4M7EA 2QN6A 3GLIE 1YJXA 2YJTD 4FDLA 1KSHA 3EMVA 2PMFA 4GI1A 1I3OA 2CFTA 4R01A 4BFSA 1FEZA 3IIIA 1OB5A 2OCLA 3OFND 5BO5A 4RAYA 4NV1A 5CB6A 1EEHA 1VSVA 3LW8A 4J9PA 2C2MA 2A58A 4I50A 1SC4A 1KR2A 4Y9RA 1RQLA 1R4NA 2AUNA 1R27A 3EG9B 3F6EX 1O08A 3I32A 3AHFA 4UEOA 1DKRA 3VZCA 4JI0H 2X0KA 2X22A 3RTCA 3T3NA 2KYRA 2FKLA 4ZO8A 3LD9A 5KYVA 1ZK3A 4IH1A 2DRIA 5CT6A 1CEEA 3DMTC 4Z9FA 3E0QA 1Z5GA 1PT9A 2VG8A 2QUHA 4EG5A 1C8VB 2ISCA 1PNRA 2JK1A 4G01B 4QUJA 4I14A 4E1AA 4NEHB 1PNQA 4IS3A 4F3KA 5IHPA 3CR7A 2ATLA 2EJCA 4LBZA 2A4KA 1XVIA 2XMQA 4ZVTA 4DUYH 3PICA 1H2HA 4I50F 2O2HA 3BK2A 3NDIA 1VECA 4F9EA 1BDMA 3TFWA 2YZ7A 2AJBA 4O02B 3DVSX 1UBUS 1Y48E 2I91A 3HKEA 1VKZA 4HB4A 4M6WB 4HGRA 1U02A 3ENKA 2EFEB 1UWLA 2QR3A 5JI2E 4F3CA 1KK2A 5B2EA 1RZRA 4IHQA 5DHTA 1W5BA 1HNZH 1SGWA 3F97A 3CISA 3F7MA 4G25A 3KSRA 4RM2A 4AJLA 4Z3KA 4ID3A 1Z0UA 2JJQA 4PTYA 3COJA 1OH5A 4OAPA 1XWFA 4QODA 4U39A 3OZRA 1ZQ9A 1ISMA 4G9BA 4RW0A 2H3EA 3OIVA 1IOLA 3I05A 3THYA 4JLBA 1EM6A 2VAWA 4RTPA 4OHUA 2YOHA 3S5UA 3W2HA 3GLFE 1DZ3A 3NYRA 2EKBA 3HB5X 3UYKA 3VZDA 1E18A 1FY2A 2FA9A 2WM2A 3LSTA 3SC3A 4HSEA 2ZI4A 4MVJM 1UAGA 3JY6A 1ZD8A 3VV2A 3H4DA 2CNWA 4CMKA 3FFBA 1CYDA 1NXVA 3BQNB 3I9LA 4M55A 2G63A 4W5NA 3RSLA 1COZA 2XWQA 1Z73A 3RTBA 3PHLA 1Q20A 3QNUA 2VNHA 1Y80A 5LLSA 4DY6A 2VPQA 2G4LA 2OLJA 3B12A 5EE1A 3G02A 1SOAA 2RK3A 1W96A 2FK2A 2AC2A 3M89A 1E2JA 1B0PA 2EKZA 2LDBA 3W77A 2H7CA 3T5JA 4MVJD 1EGVB 1KO1A 2D1QA 2VZ0A 3EQ6A 2IYSA 4PSCA 3UKDA 5CEJA 4F4CA 1GO3E 4B35A 3ZDDA 4MTLA 3K70D 3MAGA 1L7DA 4DBVO 3F9CA 2C7GA 4O3SA 1FX0A 2FXVA 4B9AA 1NMYA 3QU5A 1CHDA 1HY3A 5EXPA 4I1PA 1MQSA 3OX1A 2JEZA 4HXFB 4KUEA 3IUBA 5L7TA 3C5HA 3AG6A 1E2HA 1ZMBA 2EKLA 3T5MA 2OFOA 3ZBUA 3WGHA 3E1GA 4RZRA 2PO7A 4HAUA 1LK7A 3H5IA 4JP5A 3TNDA 1N7GA 2QUAA 2PANA 2QVZX 3JWJA 4MUYA 3WI7A 2XB4A 3N2IA 1CY6A 2I22A 3ND5A 4MXDA 1JMVA 1RHMA 2P40A 3HADA 2WJ4A 4PO8A 1XBTA 1I7QB 3AQ4A 3F0TA 3CZMA 1SIOA 3ZHQA 3E9QA 1G59A 4C7OB 3GJ7A 4DEVA 5IF9A 3EXIB 2JI8A 1GVNB 5IC6A 4PZDA 1DKPA 3G6KA 4REOA 2PYZA 3FSJX 4TLEA 4W8OA 3WXMA 5KOHB 4O2AB 3N1UA 3S2FA 3KFLA 1RT9A 4F0JA 4KKXB 1T8YA 2YV1A 1PJLA 3WP0A 2IHYA 2C03A 2JHGA 4FYKA 4FZJA 4RXMA 5AVTA 5I8ZA 4KSYA 5MF6A 1P33A 3PPXA 1AURA 1KJ9A 2E4WA 1EG7A 3OETA 1OIXA 2J8ZA 3SXJA 4P3OA 4RA6B 4CGZA 3K6JA 3P5SA 4I9HA 4IIHA 2VDOB 4DIKA 4YP7A 5CX1A 4IIXA 1W5TA 2FFJA 3KYDB 3QA9A 4O33A 7YASA 4PR0A 3EGXA 3U3KA 1TK2A 4ZI7A 5LU8A 4IYJA 1CJUC 4XFDA 2R1VB 2XBUA 3OZWA 4RH3A 3RS7A 5DCYA 4E22A 1V1RB 3UYYA 3AR2A 3DZGA 4D1YA 4G07A 4K0RA 3T5PA 2A5JA 3ITDA 2NOAA 5G02A 1LTHR 1A69A 3A37A 2VT7A 1F4PA 4RSHA 3L1VA 1KYXA 4X85A 3NV9A 3OI7A 4E1BA 4RB2C 3GLGE 3JQBC 1RPTA 4WERA 1WHSA 3OURA 3AUUA 3DBLB 5CVCA 5C8DA 2EZ9A 3ZCTA 3DOFA 5CVUA 3ROFA 2ZU6A 3WGVA 1AD2A 3U81A 4QJ4A 3FVQA 2I4IA 1ISPA 1CEQA 2A9FA 5CVJA 2GOYA 5HMMA 1XKTA 4X6LA 5JNLA 1ZIDA 2CW7A 4LJ8A 1L5VA 2ZI7A 4W8GA 5K51A 5AVWA 4JGBA 3B1KA 1ZAKA 2YWEA 4L15A 1E61A 2R6R1 4NFHA 2GEDA 3AWIA 1V2GA 3PGKA 5GPBA 4HL6A 3TXYA 3DNMA 4PAQA 1MFPA 1W75A 3FKSD 3PENA 1H9BA 3MGAA 4UTPA 2WFLB 1ZRMA 1MNAA 2HVSA 4QUIA 1GT6A 2VBFA 4DWOA 2RGUA 4LWOA 2DFDA 4DG5A 2A86A 4GZMA 5EGSA 4Q4HB 2CBZA 2PD4A 1H5NA 1LWOA 1E2KA 4X1YA 4CF7A 1XNQB 4GSLA 1I6MA 2PJUA 5JAPA 4J1TC 1VYVA 1T5DX 2BPOA 3W1GA 2ZSAA 1VIYA 5IDWA 4INJA 4LV5B 1E5XA 5GY7A 3BQMB 1Q92A 3OZIA 5LC1A 3WYAA 4GMFA 2AW5A 3U9LA 5SZJA 1CNEA 2V3CC 3O3OB 1Z4IA 2Q5FA 4BMOB 3UT0A 4F50A 4ES6A 1DINA 3FGOA 2C9DA 3WSTA 1EWQA 5IP7G 1KYYA 3BH6A 3F96A 5F3RA 4CE6A 4EM6A 2DBQA 1JG4A 3QBEA 3I4MG 4UHEA 2QOEA 4O25A 1NUPA 1RI2A 1QP8A 3U26A 4EJSB 2JNWA 1F2DA 2F3QA 1I01A 4FCTA 3LBAA 4CM3A 2XXAA 3NRBA 5B7GA 5E7IA 1F8GA 3EWNA 1D5WA 1JEEA 3F5QA 4FKMA 4NG4A 1N0WA 4R3NA 4U2DA 3ZWVA 4DM4A 4DLPA 5FV4A 1VRCA 1Z22A 4KXNA 4M1WA 4MIYA 2XUGA 2WDTA 3U4IA 2CQYA 3PGMA 1E96A 5DIFA 1FBTA 3NVMB 3OESA 4TKVB 1MGOA 4B6JA 5B36A 1RXVA 1ZITA 2EJUA 4HYKA 4DLNA 3GEDA 4PW0A 1OZ0A 5L4SA 1CUZA 1L4HA 1ZH6A 5B7PA 3EZGA 2XUDA 5JCPA 3DF9A 5B3AA 1GQYA 1PJ8A 2BELA 3KOOA 4P8RA 3TM5A 4CMAA 2O2CA 4M8KA 2R0QC 2CVPA 5TC4A 1U9IC 4DIUA 5AVUA 1PSZA 3QLUA 2I2AA 3PQDA 1ZD3A 2PZGA 2XB6A 5BW8A 2FAXA 4Y2TA 5AI5A 4FS1A 3FHOA 5DXJA 5JT1A 3OAAA 5K8LA 4HAVA 1EKFA 3MTEA 3B3FA 3W1WA 5EPEA 1NFRA 2WF7A 1T8RA 1S8FA 1FDWA 2C5FA 3CRQA 4L57A 2EFHB 1Q0SA 2QD4A 3HCDA 5ERGB 1GGFA 5LIPA 3TXAA 4L16A 3RRXA 1IHUA 4BX3A 1GP2A 1UFQA 2CWWA 5BT9A 2O03A 2EU8A 1Z4NA 2F9MA 2H9IA 3IQZA 3L1UA 5DWDA 4BNHA 4E07A 2X1MA 3P9KA 5JCXA 2OBBA 3QZ7A 5KYTA 1FMFA 1T34A 1EVIA 3TNJA 1NNEA 2ZTVA 3MUOA 1O4VA 4KR2A 1S3IA 1G7CA 1XWWA 3HA2A 1JMKC 4GZ3A 4ZI2A 1RYDA 2QL9A 2ZYDA 3VR0A 3OHAA 1M2NA 1MR3F 3ICPA 2Z1MA 2VHJA 5JVLA 6ABPA 4ME6A 3CG0A 2AOUA 5BR8H 2P5UA 2XMBA 3QJYA 3VJKA 3MOIA 5T67A 2HA3A 3PQ8A 1WE2A 3F6SA 3HN7A 1NR5A 3G2NA 3ZE9A 4CM8B 1EFRD 1IDN1 1E98A 4EPRA 5CXQA 1ZLYA 3AFOA 2P3QA 5DHSA 5IAOA 4H08A 4IKPA 2F4NA 5JW6A 1H9CA 2I87A 3W6OA 3VH4A 4HV4A 2NVOA 2ORVA 2F1IA 2OZLA 3DBHB 1I5EA 4ZAGA 5ALJA 3I5MA 4IUCS 1Z6QA 4URYR 3VU3A 3U40A 1ITZA 3DDUA 4YMSA 2B8JA 4EGJA 1SCDA 2SKCA 3PTZA 3MT7A 4XVRA 5FXMA 2V1UA 2TYSB 4WFIA 4RIGA 5AUQA 3T0FA 2BGKA 4BTLA 3HCFA 3H3XA 2OHIA 3NT2A 3AP2A 2I66A 4UCUA 2FQ1A 3LH5A 2FPKA 3ZIAD 5I8WA 2HVRA 1RFGE 1MW9X 4E33A 4RTJA 1TJ3A 3DQPA 3S1LA 1YJ5A 2R6JA 4XCVA 4E30A 1HE1C 4KWTA 4H7PA 1FSSA 2X6QA 5KVCA 2QSUA 2BTEA 3NO4A 4WI1A 1OFGA 3VKWA 5MGBA 4GKJB 1Z8FA 1IY2A 4L8WB 5KSOA 1DJLA 1YR1A 1GG2A 4KR7A 1T2FA 4R8UA 3TL2A 1WXXA 4E11A 4EB6A 2B4RO 4BASA 4Z7QB 4JLOA 5EXXA 5IH7A 2D1RA 4YAOA 4CKWA 3QA3E 3C1OA 3KQLA 2G1JA 1Z26A 2J45A 4JC5A 3RAXA 1N2JA 3SN6A 4ISCA 1Z56C 4PZ0A 4TQRA 5EJGA 1WQ4A 3H4BA 2Q6OA 1KY5A 2RGYA 3GH3A 2X15A 3BIJA 3IBGA 1JWBB 2HHFA 3O7WA 3AOEC 4K9QA 1G8FA 1ZOLA 2W2VA 1WOMA 1N2ZA 1MO6A 3T7JA 3U7FB 5AM3A 3IQDB 3LI2A 1X87A 3EZXA 1XDBA 3NHUA 4Q48A 4WVFA 2YHBA 2AZTA 5AHXA 1U4NA 3DO8A 5I9TA 2J59A 3F7TA 5I9LA 1YNOA 1W94A 2BLNA 1UJ6A 3I04A 3TZQA 5H82A 1S2GA 3HA5A 1I2ZA 3GPLA 3G9XA 1YONA 2IEYA 3SBOA 2I4OA 2X8BA 4D4JA 2A0KA 2FWAA 2ONYA 2GPSA 2MSKA 2W6OA 3CVJA 3HHPA 2JDID 3Q9UA 4Q9JA 4F71A 2XLCA 1XNRH 1GCIA 1I3MA 1W0JD 3SEAA 1UFRA 2VF8A 5EI5A 1OBOA 3ZWWA 2HWYA 4C7VA 1GL6A 4OHZA 1Y14B 5GGYA 2HLNA 1EFPB 2ZSFA 3AF2A 4P3YA 5ED0A 4I3HA 1C8LA 3M33A 4F1KA 2VUGA 4KL8S 1EYZA 2Y2UA 3QWHA 3TOVA 1V4VA 1PG2A 2ID9A 1PT7A 2FQYA 1J1ZA 4Y2QA 5DXFA 4QGBA 3OQNA 1QBGA 1U2RA 3GYBA 2XRMA 2YTZA 3FNEA 2OQVA 1SUPA 1G7RA 2BJHA 3IQXA 2KSQA 4UJ5A 2V8OA 1UKBA 2VP3A 3OPNA 4LFAH 1GUDA 4ZOLF 5EWGA 4U3JA 4WV3A 4JKYA 2YU9A 1FFBA 1WSWA 2CUZA 1DUIA 4GKKB 2UZ1A 4BLPA 1QS0A 2QMUA 5FT9A 3SJAA 1XMXA 4XFKA 1X8LA 3NC4A 2UVRA 2PMWB 1UKEA 5CA0F 3KS9A 1RZVA 3BMQA 4KQFA 4JU9A 4I55B 3PQ5A 4E12A 1OLUA 4JP1A 2OH2A 2EARA 1E9DA 1LBHA 1J42A 4KX3A 3TCNA 4U6QA 3V1NA 6REQA 3ZDAA 4KZKA 2NZWA 3K96A 4FSXA 2O0KA 4HDMA 4NL4H 4Z7JA 2YWCA 5I5UA 1GTJ1 4H1TA 3KB2A 3UHOA 1QYWA 2I1WA 1V16B 1DO0A 1J97A 1J7JA 1FUEA 2LPMA 3HA3A 1W29A 3JWPA 1A50B 1UKVY 3PPVA 4REQB 4E3WA 2YCBA 5FLXW 2GPBA 2WWRA 4GHWA 1UT6A 2GCPA 3UMCA 4YHHH 1WSAA 2DPYA 1THZA 4LYGA 3O4GA 5TDHA 3V4FA 4G8JA 2QTVB 4PIPA 1ZR2A 3BT7A 1RJEA 2Y9PB 3ANNA 3I92A 1MG0A 4WFKA 3FOCA 1H2YA 4WNYA 4CF3A 4DDMA 5KWVA 1E2BA 4ZJYA 3AXTA 3AI3A 2AJLI 3G0GA 2XIGA 4CC6A 4YCDA 3QZ8A 3GJ0A 1VIDA 4C0BA 1ZEMA 3KBOA 4AO6A 1J8VA 4LDZA 1C0EA 1ZIXA 2A2ZA 2AMVA 3HVRA 4GZ5A 4MX8A 3N9IA 4JZKA 1M2VB 3SEZA 5FPYA 2D0IA 4UE2A 4FFRA 5IBPA 1J39A 4E0BA 4F3TA 3N70A 3A28A 2DT5A 3H5NA 4DV3B 5K0ZA 1NKTA 5T14A 1TZMA 1WLYA 4QQFA 3ZYZA 4EG4A 5AVVA 1K9VF 3GFVA 5A0VA 3I72A 3V7WA 1I10A 1NC3A 3ZE7A 3ZHRA 4E14A 4H27A 1V9PA 3ETLA 4LE0A 3WLKX 1K5GA 4NWIA 1FS6A 4J4BA 5LJIA 3K09A 1KJQA 1TUGA 2C82A 2DFLA 1E59A 2V6BA 4E2XA 4GP6A 2R92G 2VRBA 5EG5A 2FZ4A 3ZI7A 3FMGA 2BR4A 4JXZA 2O8EA 1WBJB 3P2YA 1KGDA 4B3IA 2CKDA 3C3EA 2MDTA 3I6MA 2XE6A 3VX4A 5AJVB 3AZPA 2RGBA 1Y6RA 3RBZA 2CE2X 4DSUA 4YRMA 4QL3A 1XMOH 4TUYA 4WX2B 2J0SA 5LWHA 2XCRB 2FVYA 2X7HA 1AX9A 4DUPA 2C88A 4Z0HO 3O9MA 3GCGA 3BL6A 4D25A 3B9RA 5FKJA 4IF6A 1XCJA 4LXTA 2G9UA 1JECA 2DUWA 2W43A 3GMIA 3IOMA 4N5MA 1C1DB 1TFRA 2FUCA 3IV6A 4LE1A 2CFOA 4RUKA 1RYFA 1WAMA 4D9EA 4Z4GA 2JS7A 2QJFA 2ZIEA 4FBTA 2YHUA 3C74A 3GT3A 2WVAA 4FQ8A 4R40A 3TBFA 4I0WB 4M83A 4UATA 2GPNA 4JDUA 4LMAA 1BEEA 4WFQA 5JS7A 3THXB 3OVMA 3RJTA 4ZANA 1V5FA 3IMKA 1V96A 2P1ZA 3QE2A 2BCEA 3RUHA 4DQNA 2CK3A 4H35A 1SCJA 2ORIA 2AN3A 1IBSA 1TM2A 2LCFA 3EXEA 4UOQA 3AHCA 3ZQUA 2CN1A 2JLSA 2JIDA 1R9TA 3B1VA 3L0YA 3OSUA 4RLSA 3VSCA 3AGPA 4BGEA 3U09A 3OZXA 1ISFA 1MFZA 3NJRA 5AXCA 4DKJA 4GOLD 1MCZA 2BN4A 4PINA 5J4VA 4GPTA 2ASJA 3KPUA 3PD7A 4LDQA 5E3IA 4A1FA 3U16A 3IESA 1RRPA 3RSFA 2QNRA 5DRYA 3NORA 3RYFB 1PFGA 4PX9A 4WLNA 1K06A 4TS4A 2HXSA 2H2GA 4FQ5A 4N5LA 1XNHA 4IWXA 2PKQO 4NMMA 5AESA 5KC8A 1E3JA 3ILSA 4KN8A 5C52B 4MQFA 2RSLA 5AXAA 1V11B 2V9PA 1PJRA 3O82A 1KMHA 1JAZA 2FN8A 3GLFA 2PA3A 1RP1A 3ILYA 5EKTA 5AVKA 1GPBA 5TVKA 2YKGA 4G0UA 3L06A 2P65A 2FDCA 2VAXA 1SU4A 1ZM3A 5T8KC 3TDNA 5K99A 3KQTA 3VH1A 4BQRA 3MJRA 3DFZA 4CVNA 3I1IA 4CMHA 1OKKD 1OAOC 5FH9A 4MVJH 1XZFA 4FE4A 2GD0A 1EE1A 4CODB 5TLSA 3GNLA 3JQFA 1T36A 2H8GA 3CUTA 3LUPA 1N2SA 5E7QA 1EU1A 1SUBA 2Z2KA 2R6HA 4QPZA 4X97A 1R9MA 4ENVA 4RQTA 3FUXA 1WMEA 4UHBA 1EZ4A 5IT0A 1J49A 1GPNA 5DM1A 4CL3A 5AJWA 3GNQA 2VDLB 2J1LA 1O5TA 3KK0A 2QN7A 1CNMA 4O3MA 3HOWG 1JQEA 1V4NA 3GHYA 3K8YA 4BJHB 4CU2A 5BQFA 1G4HA 8ATCA 2C2EA 2BF7A 1RYNA 3T35A 2Z4RA 4ECTA 1T4CA 2O8DB 4OL9A 4HDCA 5C4XG 5G3ZA 2ZJBA 5HP4A 3SS7X 1J9EA 2CBXA 2REBA 1QV9A 3LVFO 2XJ9A 3SHQA 3A2MA 5CB0A 3KPYA 4XZ3A 5EP1A 1XJCA 3B1XA 3K0HA 5DNDA 1H1LA 2X6TA 4HQ0A 4HGOA 4UDNA 3RS9A 2ZIUB 3CCCA 4Z6KA 5HJ5A 2ZQ5A 4ZMBA 4HWSA 2HQSA 3H8SA 1NNUA 1I3KA 4O3QA 3R0IA 4C5BA 4MJLA 5EEGA 5SICE 3FDSA 4JI7B 2O7SA 3OEEA 3CRRA 4FYXA 1ESZA 3QXSA 2CNLA 3ED1A 2DBVO 3O6VA 5KFUA 2G76A 3R3SA 2I2XB 1UEXC 4GXNA 1AG9A 1NMEA 3HU2A 4I1OA 1DG1G 4MVCA 1L8AA 1PO7A 3W34A 4B2IA 2UZ4A 4L5BA 2P4UA 2IDKA 1BXKA 1TF5A 2ZUWA 4UCQA 2ZK7A 2PEZA 3C3BA 1ZW1A 3RGXA 3R41A 1HURA 1XTTA 1P2BA 2NTVA 4G2NA 4DNXA 1E6MA 5TX7A 4DUZH 1VXRA 5BSEA 3AUFA 1E2DA 5H83A 3S4YA 4X7PA 3LBNA 2GEUA 4J16C 5INTA 2WWFA 1DWQA 1PYGA 2HEGA 5EUCA 3ROQA 3CLKA 1U63A 3AONB 1IN4A 1PLKA 4QPDA 1W0KA 4O7NA 1Z0JA 2CVZA 4RVOA 1FCJA 5CITA 4MS1A 4WN9B 3RSZA 4H3KB 4O1MA 2BL4A 5B55A 4OLFA 3UA4A 3BWDD 3OE4A 5E95A 4B6PA 4F92B 4L5IA 1U28A 2FMIA 4N12A 1A5BB 4ZCIA 3AJDA 4DDUA 2YVQA 2Q3MA 3JQAB 1W19A 4Y9DA 4FGRA 4NU5A 1JLMA 1P7PA 3CO5A 4QOIA 3L1HA 4A3GG 4ZREA 1ADJA 3N8GA 4DJFC 2QN3A 4B7CA 4XGQA 3RSQA 1PNTA 4QBKA 4JYZA 4NP6A 2TMDA 4IHKA 2BGWA 2R6ZA 1HH4A 3E8SA 4HGZA 5CMLA 3U7JA 4FE3A 3TSWA 2BHRA 5EIOA 2VWGA 1TIKA 3GJYA 2BBWA 4FX5A 1NBEA 4KFRA 4JL8A 1DBSA 2BSXA 3PXUA 5DK6A 4RHFA 5K8VA 1QHNA 1VE7A 5FWXB 1ONNA 2NU7A 3FMOB 4KAFA 4DWVA 5IKXA 1JU4A 3LC1O 2HU8A 4BTVA 4M0LA 1WDMA 1ETUA 4ND5A 4TS1A 3VZQA 5BVHA 3HSSA 4BBSG 2ZTMA 4YP1A 1CUWA 2DFKB 1P0PA 2GWRA 3OEYA 4L8GA 3S2EA 3H9CA 4WH0A 2G40A 3IDFA 2Y05A 1ZA2A 1LNZA 1NMZA 2AW3A 2PKEA 3BWBA 4HQOA 5K8UA 1UF9A 1XQVA 2A5LA 3KPVA 3VYSB 4LFCB 2ZB7A 1KP2A 2GDJA 2GJAA 2VHWA 4Y6OA 1NRXA 4GX1A 2DJIA 4KGXA 1JXAA 2LP4Y 1EI9A 1Z4KA 3QTTA 2AZMA 1OX6A 4LKRA 5FL3A 4C4PA 2QJRA 4YBZB 2RCNA 2OXRA 1IM8A 1ZCJA 2GAOA 2CLIB 2XMZA 4KUHA 1DCKA 1UPCA 3HPQA 4CIBA 4C3UA 4D9IA 3IO5A 4R9RA 3HKZA 4HPWA 1HQKA 1U7TA 1E7RA 2LKCA 2R1UA 1VSBA 3CO0S 3STYA 1ZVVA 1X8XA 3C15C 3PFBA 3WFJA 3QKRB 2XV1A 4EKNB 5BWMA 1H4QA 3DUFB 2HF2A 5ALSA 3K20A 4DL2A 1KFKB 5FD8A 1G3RA 3D6NB 3BMCB 3VO9A 2FLVA 3ZH9B 2XNDA 4J9VA 1IMJA 1I94H 2VNIA 3L7DA 3U3JA 3W8FA 2OO5C 4Z0TA 3QF4B 5JQGF 4DR7B 5KB3A 1X74A 2R7ZG 1YBHA 2YHIA 4EG0A 1TZ2A 1YBAA 4HYYA 2EYUA 3ECAA 3GOHA 4MWEA 4Q16A 1JJIA 1JH9A 2BDUA 5TQ2B 4BNMA 4MPJA 4ZYWA 5BVHB 3BSWA 3VNUA 2AK3A 2OV3A 3S24A 1E2IA 4H7FA 3T7RA 1RMTA 3C48A 4RU1A 4KFCA 3OZDA 4IJ6A 5LQAA 2YXNA 1TLFA 1FMJA 2HNAA 2I9PA 5TV2A 4XSGA 2IPOA 1CPYA 3ZW7A 4ABTA 4MA5A 3VPSA 2Q3HA 2B2NA 5JC8A 4IXDA 4KO1S 4YJFB 1N1DA 3BXOA 3W8DA 3TLZA 5ENDA 5DGDA 4BEVA 5SY9A 3LZDA 4F4WA 4GM1A 2W42A 1XPOA 2P2DA 5CA1F 4EF6A 1AXGA 2B78A 2VDQB 2Y0SA 4AMUA 4YMGA 3DOEA 1SOUA 1LQUA 1NJFA 3UKOA 2PX8A 3WTCA 1K27A 2JJ2D 4FOLA 5CDSA 1P0QA 1VHLA 4US0R 1AHNA 1QGED 5FBQB 3ZHCA 4K6KA 1Y1VG 2OPHA 4BLOA 3AL0C 5HOQA 2BZGA 1SUSA 3L1JA 2WRZA 4ZU1X 3STUA 1ZQ7A 1F9EA 4Q37A 1Y1RA 2C2HA 3ORFA 2Z4SA 1NLUA 2A9PA 2BGRA 4QAQA 2L2QA 3CMCO 4IMPA 2GVNA 1TRKA 1BHSA 5MHTA 3QWFA 3TQSA 2AMYA 1VB3A 1T25A 2D5CA 3V1YA 3A1CA 3CTMA 4GM4A 4GMXA 2HUPA 2X0SA 1OV6A 3DXXA 2VJKA 2J9ZB 5EMKA 4EX7A 2HSGA 4MK4A 4Y9SA 2QI9C 3GBPA 3KV1A 5K0TA 3GH1A 1E3EA 3UOGA 1W36B 1OLXB 5E7MA 5CCXA 3UMBA 5C1BA 1EHIA 4I4TF 3VC3A 1JTVA 1TCCA 2LBPA 4OHKA 3PB3A 1OSNA 2V65A 3C3YA 4EO4A 4G86A 1GTZA 1UIRA 2BUAA 2ZIVB 4PPYA 4RNCA 3HL4A 1SZJG 4FK8A 1KDVA 1DTWB 1DCFA 2W48A 2DQYA 1EM8B 4RXUA 4H3VA 5GZ1A 3HFGA 3GB8B 1T9CA 4OKSA 1UK7A 1B7GO 1FP1D 3EY9A 3QIAA 4CIYA 5LP6F 1RLMA 1YQGA 1TB4A 2WMDA 4L51A 2ZUCA 1CQJA 2VPTA 4H4EA 3NPMA 3WHIA 1PW7A 4L1KA 2R1TB 2V7UA 4A2QA 5D5QA 3V42A 5BT8A 1KEKA 4LOIA 3DMDA 4J1SA 4Q4JA 4BVGA 3T9EA 4A91A 3OF3A 5G0WA 1HSOA 2FOXA 4JC0A 5LU9A 1DC5A 4DLYA 1BIFA 1NYTA 2HIMA 3V7YA 1BROA 3ESXA 5EHIA 3HB7A 1U1CA 1ZBDA 4D5EA 1U3TA 1AKTA 1F8FA 3RBVA 4CUZA 4CEHB 1HYHA 1LB1B 1X9HA 1Z4OA 3MINA 2DLCX 4ND8B 4W1SA 5C8ZA 4BECA 2VA2A 3IBCA 3LFHA 2VTVA 4DLUA 2WAYA 1GFWA 3P2MA 3I2HA 2O4CA 3N3BC 2Q50A 5DBGA 3ET5A 5FNVA 3VPDA 3OJWA 1C2TA 1BRMA 2ZOSA 3QBTA 3LNTA 5B3JC 1Y3HA 1GDTA 4MP8A 1QBKC 2QTBA 4MV4A 1P2FA 3BMXA 1U0OC 2HRBA 3ZLVA 1P1JA 3CLSC 4LMYA 4ECUA 4OLHA 3OQ1A 4LNUB 3QX7A 3TR0A 4LRYA 3DLCA 2FRVA 2C35B 3DAYA 4HPJB 2HSZA 5DEOA 4Y6SA 5CDUA 2AG1A 4JUDX 2PZ8A 2VOJA 4KRFA 4TYQA 4C6TB 1KYQA 1CZKA 5KYYA 5J5CA 2MHCA 2AFHE 2JGEA 2X86A 3PLNA 4MTCA 3LC2O 2VLIA 3BK1A 3GGCA 5FWXA 1UJNA 3DAHA 3RIMA 2ZI6A 3FWPA 4JDPA 4RVHA 3GZNB 1SD5A 5F78A 4RJTA 4EDFA 1ODTC 2J09A 3TCKA 4Z9XA 3TVDA 3USZA 2FCAA 3VYTB 3FR8A 1ZESA 2JGKA 1L5OA 3RSGA 2PQ6A 4ZYXA 3PC4A 3T95A 4RTOA 1Y6ZA 2B21A 3A05A 4HC4A 4G41A 4G0NA 2NVBA 4OXKA 3VH2A 1I9GA 4UU1A 4JR0A 4DSNA 4MVYA 3UT5A 1P5FA 1SB9A 2FMFA 1CJBA 1P9LA 2G71A 2R1VA 4B3RH 5EIBC 3AH8A 4F4FA 1UMCB 3LUFA 2YFQA 1E9VA 1Y1SA 3QBVA 2Q49A 4C4SA 2ZE6A 2GF2A 3MFHA 1ISRA 4HK4A 1AKRA 3VHXB 3WZLA 3JAMW 1X7ZB 1FU8A 2I3DA 4V0LA 1RHQA 4J75A 4MRNA 4N0QA 5EWMB 1Q16A 3WWYA 1K97A 5LMNB 1GFIA 3U7EB 2KQUA 3U7RA 4P36A 1A4IA 4UXJA 3T1HB 2R8XA 2K6GA 4BNNA 4F7DA 4DJTA 4JI3H 1J6UA 1R9JA 1PYOA 3IKMB 3BCUA 1S2IA 3ITNA 3L40A 3QUBA 5DLDA 3GP8A 3IN5A 4ZCMA 3G9ZA 3UC5A 2HRRA 4EVIA 5E25A 1JAHA 5K0CA 2GZDA 5KTRA 5E4TA 4IDDA 1VRVA 2GGSA 3UWOA 1ONPA 4G2TA 5BSMA 4JLAA 3GZNA 3F74A 1T5IA 4LY3A 2NQ8A 1VLLA 3DE5X 3LPDA 4FCVA 3UJ6A 3DJFA 4C07A 4FN4A 3H6KA 5KVVA 2I1QA 5I5SA 5M2QA 2XWPA 3K1YA 4PU0A 5AVSA 3FH0A 1GGEA 1KEEA 4M7PA 4YP6A 2X5XA 5ALMA 1F6BA 1UJ5A 2M32A 3FBGA 2MT9A 4XUCA 3TR6A 1L5KA 4OBBA 3N3AC 1YQ9A 2I6SA 4YRSA 5A4IS 5KOJB 1NSYA 1S1MA 621PA 3H2JA 4XOIA 4TVIA 4MI6A 3CPJB 4JYPA 4IR9A 4WXMA 5HW0A 2K5UA 2O3QA 2P27A 3NFRA 2VPPA 5EWMA 3REGA 4U7DA 1ODCA 3U3XA 3LQ4A 2FWJA 2RF4A 1JSXA 4GUAA 4R8VA 1TMYA 5DNWA 5F5LA 4Y0NA 3EK2A 3RF6A 5CT4A 3H75A 1KDTA 1OGYA 1Y7PA 1H2AS 3C6YA 4Y2XA 1IN8A 2FR8C 3L4BA 3OY2A 4B6GA 1CWUA 5BUCA 4JI4B 4Q01A 5U4XA 4KDCA 1AY0A 4UMFA 5CJPA 4YQWA 2QK4A 1ULBA 3RODA 2EWVA 3MC1A 3H2IA 3OQHA 2Q3EA 2IY8A 3WISA 2CXOA 4XUDA 1RRVA 1DGQA 1Z3IX 4O0LA 2X40A 1TQHA 3ELYA 4FJ2A 5IYZA 4J0KA 4KV9A 2E4AA 1XE3A 3ESBA 5HK9A 2PH3A 3CKLA 3IBSA 3QKSA 1BDIA 5DQGA 5FP0A 2VHCA 1DWOA 4HAZA 3W7AA 2IS2A 1GPJA 2I4RA 4EFKA 4CTMA 3B1WA 2QWXA</