3MWEA

Truncated human atp-citrate lyase with tartrate bound
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
424
structure length
424
Chain Sequence
SAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-citrate synthase
publication title Identification of the citrate-binding site of human ATP-citrate lyase using X-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 132
structure length 424
sequence length 424
ec nomenclature ec 2.3.3.8: ATP citrate synthase.
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16114 Citrate_bind ATP citrate lyase citrate-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mweA01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mweA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 3mweA03
3AX6A 3VMMA 1OBDA 2FPIB 4WD3A 1M0TA 1E4EB 4M9UA 5JH7F 2I80A 4YAJB 4I55F 5CAEB 2V59A 5JVLA 3MWDA 3Q2OA 2GLTA 4WBNF 4IIJF 3JRXA 3VOTA 5J2TF 4MV6A 3LWBA 4IWXA 3DMYA 5D8DA 1EUCA 2QK4A 2CNQA 4IZOA 5HBRB 2PBZA 1CQJB 3RV3A 2V5AA 4O7SA 2W6MA 2NU8B 4FFNA 3LP8A 4YB8B 3V4ZA 3MWEA 3RFCA 5JVDF 2CNUA 2DLNA 2YS7A 5EZYF 2DWCA 1I7LA 2GPSA 4MV8A 1IOWA 2XD4A 3KREA 4XX0A 3TQTA 1DV1A 1EHIA 1DIKA 2YRWA 4O84A 4XX0B 1KBLA 4FGRA 3U9SA 4ZI7F 5CA0F 1KUTA 2DIKA 2FB9A 2YS6A 4MV1A 3MJFA 1Z2OX 3U54A 3I12A 2FPGA 2YV1A 3GLKA 3K5IA 2Z04A 2Z02A 2GPWA 4O81A 1KC7A 4YAKB 4MV4A 3ETHA 4TV9F 2FPPB 1W93A 2W6PA 5I47A 1GLVA 4O7WA 4O7YA 4HQ6A 1SCUB 4YBZA 4C5BA 3N6RA 2XCLA 4C5CA 2NU6B 4O7VA 4ME6A 2YV2A 4EG0A 4FFRA 3R5XA 2CQYA 1KJJA 2FPIA 2YW2A 1E4EA 2W70A 1Z2NX 5BPFA 3HO8A 2I8CA 4YAJA 1JDBB 1CE8A 3JZIA 5CAEA 1PX2A 2YL2A 4O4JF 2R7LA 4XZ3B 3JRWA 3R5HA 4DLKA 1BXRA 1M6VA 2YZNA 4O7NA 5IYZF 4O83A 5C8YF 3VPBA 4O7RA 1DV2A 1B6SA 1VBGA 1OBGA 5CA1F 5HBRA 1CQJA 1OI7A 5KKNB 3R9RA 2NU8A 2FP4B 4YB8A 3G8CA 4XYMB 3VPCA 4O7ZA 5LOVF 4MV9A 4HNVA 2CSUA 3ORRA 3GIDA 3PFFA 4HR7A 5H80A 5LYJF 1AUVA 3U55A 1EUDB 4O4IF 1WR2A 4YJ3F 2YRXA 3R23A 4O7LA 5FNVF 2NU9B 5J2UF 3KAKA 4TUYF 4I50F 4HNUA 4E4TA 1VKZA 2R7MA 2W6NA 4MA5A 5GONF 1UC9A 3AW8A 5LA6F 4I4TF 4O82A 1GSHA 2R7KA 4O4HF 4HNTA 4DIMA 4EGJA 3WNZA 4YAKA 1Z2PX 4O7TA 2W6ZA 2QF7A 2WYOA 2FPPA 2GQSA 2GQRA 2SCUB 1BNCA 1SCUA 1JLLB 2YZLA 2NU6A 4XYLB 3SE7A 4MV3A 1JKJB 5C1PA 1GSAA 4O2BF 4O4LF 2NU7B 2CNVA 2NUAB 4L1KA 4C5AA 2I87A 4YJ2F 2HGSA 5JQWA 4XZ3A 2OLSA 3N8DA 3UFXB 4MA0A 3HB9A 2R87A 4IHJF 3WO0A 2R82A 3E5NA 4ZHQF 1M0WA 2YZMA 3RV4A 4ZOLF 2PVPA 3RUPA 5LP6F 3VPDA 1EZ1A 2W6OA 4IWYA 4RZQA 1VBHA 3G8DA 2FP4A 1A48A 5HV6A 1CQIB 1C3OA 3WO1A 3VA7A 2YWVA 5JQGF 4XYMA 5LXTF 1KJ8A 5BPHA 3ETJA 1A9XA 1JDEA 3JZFA 3OUUA 2IP4A 4FE2A 2PN1A 1EUDA 2YZGA 3MWDB 3K3PA 5K2MA 2ZDGA 4QSHA 2NU9A 3HBLA 2CZGA 3R5FA 3K5HA 3NUAA 3DF7A 3OUZA 5CB4F 1B6RA 1EUCB 1KJIA 3QFFA 2R86A 1EYZA 5DMXA 3TW6A 4ZQIA 4NYEA 3MWEB 1T36A 4FFMA 2R84A 1CS0A 2V58A 2DZDA 2C00A 4TV8F 3TIIA 2SCUA 2VR1A 1IOVA 1JLLA 4XYLA 4Y8VA 2ZDHA 1GSOA 2W6QA 1JKJA 1ULZA 3TIGA 1AUXA 3ORQA 2YYAA 2VPQA 2NU7A 2R7NA 2NUAA 4Y8VB 2FPGB 1I7NA 5C1OA 3BG5A 2P0AA 2X0SA 1GGOA 1PK8A 1UC8A 2VQDA 2R6FA 3UFXA 2W71A 5KX5F 1W96A 1C30A 3KALA 4O86A 3V4SA 2J9GA 5BMVF 3TINA 4EGQA 4MAMA 2R85A 4FU0A 1KJQA 3KAJA 4MV7A 4FFPA 3U9TA 2ZDQA 3Q1KA 4YBZB 2HJWA 4FFLA 1CQIA 1KJ9A 1KEEA 4FFOA 4O2AF
chains in the Genus database with same CATH superfamily
2BBTA 2EP8A 2P9CA 2OORA 2GN9A 4YP6A 1KI6A 4YRCA 3ZWWA 2XV1A 4O1IA 3HKBB 1RIFA 4FHCA 1M2FA 3VU3A 1O9HA 1CNFA 2Q5FA 4ERXA 5AHXA 3U44A 3HFSA 3IDOA 4DQKA 1NQOA 2ENWA 3DJFA 1JG7A 1FMTA 3ICVA 5FPSA 5JS1A 1EA7A 2CXOA 1D03A 3M82A 2PMWB 1PN3A 3KREA 3HBJA 3RGXA 1KJNA 1L8OA 4BKUA 1NU6A 5DHSA 3PFBA 4UVGA 1P5FA 1J25A 7ADHA 1AHIA 4Y1EA 2G9NA 1J5EB 4DRYA 2J41A 3FJOA 1K3TA 1WCV1 2H7YA 3BPSA 5K05A 1NXVA 2OZPA 2WC1A 4O1MA 1E1QA 1P31A 1XLTC 4UNIA 5L40A 2VQFB 2WFLB 2RI6A 3LBNA 1UKCA 1XZNA 4DE5A 4NG4A 4DNFA 2DR0A 1YE3A 4ITUA 1LDEA 1ZGJA 5HDQA 1V11A 2IDJA 2I6XA 4ETMA 2NU6B 1W5TA 5FL7D 3EVDA 4A3FG 2I71A 5EXSA 5FTJA 1OGYA 3FROA 5HUJA 1KRXA 3E9YA 3F9RA 3PNBA 5AW1A 1QLHA 3ZKWA 5FD8A 3R0VA 2FG6C 3DE3X 3OZIA 5IXJA 3V4PB 3FE2A 2Q62A 4GI1A 3T1NA 3NCHA 3N9IA 2Q4BA 1TQHA 2C9MA 1JJIA 4I9FA 1TA8A 3DVLA 4MVJD 1KFCB 1CG6A 1K63A 3Q6NA 1QH8B 3GPLA 3I9OA 2BKLA 1JKXA 3A9VA 4E70A 3UT6A 2PKRA 3RAXA 2IXDA 2NT4A 1MV8A 3RHZA 3BH6A 4YR2A 3HZRA 1P3Y1 5KPDA 3ETGA 1BHJA 1JZTA 5DBHX 4RE6A 5K3FB 4KCGA 2AG6A 1SKYB 3FWHA 2VOBA 1K4KA 4NR0A 4J9VA 5EKTA 3QGMA 1EM8A 4MYRA 2IHJA 3HB5X 5C44G 5IXYA 4I0WB 1XCMA 1E0JA 4JYAB 1IY8A 4NPAA 4CLOB 1VJCA 5K8UA 5AUPB 2HDWA 4Q24A 2CCGA 1U9IC 4XCVA 4JVLA 4N01A 3SIWA 3F67A 3G68A 1OXXK 1TKBA 3C6QA 1JG2A 3W8FA 3UAWA 4RETA 1P45A 4MIKA 4DV2H 3D3JA 4KQEA 3TLKA 1QPBA 4P5EA 1P2VA 1BJTA 4ZA2A 2BSQA 2EBUA 1RKXA 4CQMD 5KUTA 2VYNA 2PS0A 2C4UA 3OBBA 4DS3A 2KSQA 4MEAA 4WL0A 1VMDA 1C9KA 2ZRMA 1ZGHA 3CLTC 1JAIA 4ZGBA 1K0FA 4TQGA 4D4GA 3UT5B 3LZCA 1WCWA 3AF5A 5EPEA 4WQMA 3ICOA 3LY7A 4KXXA 3F74A 5JROA 4YMGA 3H2YA 2IXGA 1H2RS 4ETWA 4O25A 4WCFC 1VSTA 1P80A 3OLYA 5DGCA 4NZ9A 3TX2A 1EYZA 2Y0PA 4UNNA 2BIFA 1VBMA 2NZXA 4I4LA 5JFOA 4B6OA 4JYPA 2EU8A 3JASB 5BMOA 3FYTA 2IHNA 1QG0A 4AF6A 4BV8A 3VHXB 4RXUA 2ZTMA 4CLRB 3G2JA 1JLLA 1U2ZA 3C5VA 1CJSA 1QONA 1T0BA 3CNOA 1YDMA 3UZUA 4N0MA 1K1QA 3VYUB 4PPGA 2OXEA 2UXBB 2X8BA 4RQTA 5AKYA 1MIOA 1OFHA 1GZ4A 1GGOA 5BWXA 1VJDA 2AN1A 1TIPA 2CLSA 5EIXA 3I23A 4PQYA 3KALA 1TD9A 1L5KA 4OM7A 3CFYA 4PAWA 1Z33A 3EA4A 3SZMA 2IYNA 3BCRA 2IK8A 3JQ7A 4HVAA 3QUQA 1Q0QA 1UBLS 3PQ4A 3VJMA 1F6BA 2HA3A 1JGTA 3L3BA 1Z2DA 3GD5A 1X1QA 2QNBA 1KDZA 5FWYA 2R1UA 3GJXC 2OLJA 4FYIA 1GU7A 3AKEA 3O3CA 3HPRA 3KR9A 3USZA 5FV7A 4RHXA 1YS1X 5KU7A 4KVZA 3TZCA 1Y33E 3EQ8A 3F0TA 3PE4A 1TUBB 2HU8A 4WZBB 5MN5A 1N2IA 4RK4A 5EZYF 3IIEA 1JI3A 2F67A 1EVIA 1ZH6A 2W9AA 4MV8A 3MTAA 1JQJC 4JLVA 4HDMB 1YI8A 3O0TA 1JFSA 3EMBA 4C7OA 4QWBA 4JUZA 1VMEA 3G6YA 4WCDA 5DNWA 2I1VB 1Q91A 1TZJA 3C3BA 3MUEA 3Q41A 2J9RA 2Y1FA 5AKXA 5KFMA 1KYVA 2Z5FA 1U9ZA 3QU7A 3KYJB 4WLUA 1TJ3A 2OP1A 4E6PA 4UTZA 2QN3A 1M83A 4R1NA 1OB5A 5HZGA 4BDTA 4R0MA 3UPUA 2YWFA 1ZUWA 1SBZA 1OIVA 3BL6A 3FBTA 4C03A 3CNQS 4OGLA 5FFMA 2UUCH 2A9VA 4WK0B 2VDRB 1SHKA 1I5EA 1AKNA 5KKNB 1JB9A 4PLYA 3L7OA 1E32A 1U8EA 4RUAA 3C6KA 3GEMA 2ENUA 1XZJA 4O3FA 1VB3A 1P7VA 4UM5A 1Y1QA 2E5FA 4DSZA 4PBSA 3WMXA 4YP7A 2BFEA 2FFBA 4CMEA 1LWNA 3HEBA 2IQ5A 1YTUA 3RS8A 2R60A 5KJCA 2WOOA 4Q3CA 1YDHA 2OBBA 4WXHA 1XMQB 1QO0A 2QTLA 4JI2B 1D0VA 1NXOA 1ZD3A 3ENQA 2NUPA 3PW7A 2FSIA 1U0SY 2VDWA 3V8EA 3O3MB 3W3AA 2E1PA 1G2WA 3E7FA 3QM1A 3W7AA 1SG6A 1U0EA 2FLLA 1NVUQ 5KS2A 1CUFA 2Y1WA 1C81A 4FM9A 1SURA 4G0XA 5DSXA 1VECA 2VUHB 1K8XB 2QVZX 10MHA 2OPBA 3CT6A 3ZZMA 2HSDA 4NYIQ 2Q5CA 4FNAA 1HYEA 2XUAA 1ZJ4A 3FPBA 3PXDA 2JLCA 4M7RA 2X2FA 3HFGA 4XUCA 5AVKA 3IQGX 2R8BA 4UNPA 2FX2A 1ORIA 1N9GA 4ZZIA 3VPDA 1N75A 1AT1A 3RIMA 4EHLA 2C7VA 4QBFA 3KDPA 4RKWA 3S1SA 3WWDA 5L51A 5KTRA 4F3RA 1BHQ1 5TQ2B 2IELA 4BB5A 3F9CA 5I4IA 1RZRD 3DCYA 3UXHA 3L77A 4EBFA 2NU9A 2WLTA 4RENA 3MINA 3NNNA 1VA5A 4LQLA 1VI5A 2VF5X 1W25A 2W9BA 1ZH4A 3SBXA 1N9ZA 4NYEA 4CV2A 1TJPB 1XEWY 3NGXA 4MH0R 3RAPR 3VZPA 4YALA 3CRNA 2LTAA 3R3HA 3DOIA 1E1LA 3IVGA 4P7BA 3WHKA 5LSAA 3GGCA 4AMYA 1H0SA 1SXJD 4GX0A 4IIHA 1GM5A 4LE2A 3UJNA 3M4YA 3M89A 3VC7A 3QVOA 1PFUA 4BV3A 4OQZA 1LPBB 4US2R 4JOCA 4YREA 2XMCA 5KFKA 4C4TA 1RT9A 1CJTC 4PCAA 1JR3A 1MJHA 4EY3A 3CZ4A 5DLDA 1XMVA 3NIBA 3FUWA 1VYUA 1DUSA 4F86A 3BDVA 1ZLYA 1UM9B 3PQ8A 4KACA 4LOIA 2ZWIA 4PLVA 4J7UA 4ED0A 2AN5A 3Q1KA 1S0MA 4UHCA 2TSYB 1FYVA 1O6CA 5JANA 3RU2A 4IAOA 4PHTA 4TSRA 4RNDB 4KDEA 2A9OA 2ZPTX 1OFIA 3WGLA 2BGTA 2D54A 3N2EA 3VAZA 3QVLA 4B4KA 2W11A 5EZYA 1V16A 4Q1AA 1NA5A 1EVLA 1G41A 5FEMA 3TAHA 1KVSA 3NBFA 2XB4A 3OJWA 3DE2X 1O77A 2RHCA 3PS9A 4CNBA 3CLVA 4LQ4A 2DE0X 2VQSA 4AG3A 2YRWA 4MLZA 4BMDA 5FWAA 4XW2A 1QSGA 3U4HA 1O54A 5DYTA 5DEIA 2VK1A 4PZZA 5C34B 2DQZA 3QLEA 1RAGA 4REQA 1V7QA 1PZFA 2IF0A 5DP2A 3SC2B 1N0VC 2XBUA 1P16A 4E15A 4MWDA 4S1VA 3UTDA 5A5VA 3OTOH 2BFOA 1QP4A 3GZ4A 3ZTTA 1TT7A 2IY8A 4KXVA 1RMQA 1RLJA 3W1WA 5EJ4A 4XWKA 4Q7QA 2ZQYA 3HO8A 2I8CA 2WZQA 3FY4A 2IH5A 1BE0A 4OQFA 3LT0A 4Q1BA 3HB7A 4B3RB 2FFAA 2W7PA 3V4VB 1EX7A 4BB9A 3U3RA 1IMJA 3IQZA 2XUHA 3KQTA 4Y2PA 3ZD8A 4EUHA 2H3EA 1EFLA 4ZAFA 3ODGA 1GTJ1 3OTWA 1AH2A 1JEEA 5H80A 4AY6A 3ZQKA 3R40A 3QBTA 3CKYA 2Q8QA 4Z4HA 4NBUA 2VRCA 3AM1A 2XMGA 2QG9A 2VP6A 3EUAA 3TQ1A 3MW8A 1C29B 2ZUVA 5IS2A 3NWPA 4OQEA 5EWLA 2WEKA 5DSTA 1ZI6A 3EIUA 1TQ4A 1TJYA 2Z3WA 4PVDA 5D5HA 1WPGA 2D2VA 2Y77A 3DJYA 5JEEA 1KSFX 2IWRA 1NVXQ 2QL5A 4LXUA 1LKZA 1ZQ9A 2AHOA 2DHEA 2PUVA 2AVDA 2G07A 3H1TA 4EELA 2XYHA 4WCVA 3JQGA 1BGXT 3MMZA 3K9FC 4F5ZA 4CLHA 3GG2A 2XXAB 4BMOB 4PZDA 4O2AB 2QM0A 1T8WA 1LCIA 4M0EA 1Y7HA 1AC5A 4UMVA 5TPZD 4QO7A 1AA9A 1A7JA 4YCAA 2E2HA 2Y9MB 2V6FA 3LOQA 2GHIA 3RF6A 5DLPA 4IDGA 4A3IG 2ODQA 4DR3H 3H04A 1CEQA 2WWRA 2GRJA 3RS3A 1SVIA 4D43A 3K5HA 2XQGA 4Q1EA 2V3CC 2REQB 3AHJA 2EG9A 4CYMA 1Q11A 3OZDA 4X8MA 2R92G 2I0FA 5CIQA 3WLOA 3PXUA 2V5UA 4MYUA 5KT2A 1TRHA 1T2DA 4Q3LA 2ZAYA 4LI0A 5AXBA 4BO2A 3A32A 5GADl 2ZAGA 2JLSA 1QFYA 4GF5A 2V7VA 4FQ7A 2IOHA 4MW4A 4LVCA 3A58B 4RY9A 5FQOA 1XZ8A 1CYEA 4QOSA 3B6IA 4OQPA 3OIDA 1MJFA 2Z98A 4AAYA 3U3JA 3F1KA 3AHHA 4Y0AA 1TX4B 1DU4A 3HJNA 4OTZA 1VE3A 1IBKH 2FWNA 1PL0A 1Y7LA 2KMLA 1SM4A 3DUFB 4EYOA 4QJ5A 2AX3A 3F49S 5BXQC 3GOHA 1BKSB 3MQ2A 2HQOA 5CJPA 1X1EA 4DV4B 2QU7A 1QR2A 3WQQA 1CVRA 4KO8A 1PX0A 4DV3B 1YR6A 3GCWA 1DEXA 4C0HA 16PKA 3KB6A 5I9IA 1FUKA 5DM70 1NMQA 1Q1AA 3EEQA 1UXGA 3OU6A 3GDFA 2LBPA 3JSXA 2VTKA 3C15C 2FEOA 2SBTA 1FP2A 4UCQA 4PN7A 4GKJB 1GZ3A 5C5CA 1GT91 4D79A 2B99A 1ZQ7A 2ZS9A 2A0KA 2NXEA 1WL8A 4TVIA 1T5DX 3QBEA 1AV6A 3KQMA 3C7AA 3LZDA 4D4MA 3KWJA 3HCFA 1WP9A 1PGQA 1A72A 4DR7H 1RRKA 4EUKA 4D81A 1XTPA 5CFNA 3A9WA 3SE0A 4FI3C 2VPPA 5DVZA 3VR0A 1U65A 2CE2X 2NACA 2PMDA 4NABA 1CJKC 3C98A 5DB4A 2OGZA 5BN5A 3LLUA 3KQYA 3LX5A 4J1NA 2HK7A 4NZZA 4P3KA 4HFRA 1YNOA 1ZJ6A 1C7RA 4RD3A 4K7JA 1DX4A 4BV9A 3WK9A 3GDEA 4CM9D 1YAHA 4TRMA 4YAUA 4GUDA 4LF4H 3U7HB 3JVEA 2VZ8A 2YW2A 1D0IA 1PJ8A 3GJQA 1O97C 3OTGA 2VF7A 1ZJWA 2O2GA 3A06A 4D25A 2B35A 2I2DA 3QV2A 1IB6A 5KT3A 2ZZNA 4EG3A 2PRZA 4RZHA 1E2EA 3OBIA 3PE6A 2ZYGA 3FLMA 5JFTA 2GPYA 5H68A 1EIWA 5HEKA 2WUVA 5L4LA 1SBIA 3COVA 4JMPA 1GPDG 2WHQA 3KOOA 1S2IA 4UOEA 1Z0IA 3MG9A 1ZAYA 2DQKA 1SUSA 1QDUA 5IFKA 3VR5D 2QRGA 2D0IA 1QZTA 3COZA 4KRFA 1R0LA 2CLHB 1WHSA 3DL0A 2ZR0A 1DTWB 1TTQB 1OWTA 5AI8A 3FNHA 1WOYA 1ZETA 4NE9A 1WUJS 3K7EA 4ND7A 1GSHA 4DLNA 1GUFA 3R1IA 4U0KA 4EGJA 2HVSA 2VP5A 1ND5A 4GHWA 2JPDA 4L5JA 4BGUA 3DOUA 2J9XB 5KEIA 1MPTA 2PKWA 3DHWC 3PDIA 3E2IA 5KG5A 2D1QA 4K6MA 2RK4A 4X85A 1WJGA 3HP1A 1C9DB 1GL3A 2V7XA 4CN9A 1SQSA 1OR8A 4CMCA 4FJ1A 1EKXA 5EWFA 3P4UA 3PFWO 5LC1A 1N25A 5CT5A 1NQXA 5AP9A 1ISHA 5E7IA 4RHEA 2XMBA 4IQ4A 2CL5A 3EAFA 3PIRA 4UTXA 3ZVRA 3Q11A 3B82A 3IUSA 3AUUA 2CUZA 4K40A 3GUCA 3S2FA 2NVUB 4UNSA 4KRYA 4FGLA 2WG2A 1A7KA 3D7MA 3WNVA 1AKWA 3T6KA 2IE8A 1YRQA 2HF8A 3IA2A 4Z4EA 3JRNA 3RTAA 2BFBB 3RYIA 3PA8A 4MINA 4RE5A 3QQ5A 2Q6IA 3PC8C 5HE9A 3WG9A 2CZGA 4J0FA 1AKUA 3DZFA 3CG4A 5HTOA 1TAGA 4DG5A 4DXHA 3EY4A 1P0FA 4NJMA 4A0QA 2H1CA 2PEZA 3CX6A 4Q3EA 3DM9B 1JX4A 2D0OB 2O0HA 4S2EA 4FYYA 3E3LA 3KKOA 1X7ZB 5K45A 2I29A 1LZKA 2EKBA 2PSHA 4BVHA 4LMPA 2O5VA 2IV2X 2LNDA 3WLSA 1DKQA 3BWVA 1QFMA 4XQEA 5F2KA 4QVKA 3TDMA 1P44A 2IOYA 2VWQA 2GARA 3VO8A 3N40P 4M0FA 4EMSA 3G6XA 3LCCA 4U7HA 4HEA6 3CT4A 2X3FA 2I2XB 4KR2A 4Q05A 2VPXA 1FP7A 2Y1DA 2BV3A 2REOA 1E60A 2O2ZA 1M8KA 3C8DA 1J0BA 2QA5A 3BFKA 5FUWA 2RK3A 1SC9A 4PPNA 4GE0A 4MV7A 2VI5A 1QKJA 5IT4A 3LPCA 2E5LB 3R0JA 4ABTA 4CIWA 3IBFA 1QHHA 1R6TA 2YJ5A 1P77A 3EXHA 1A98A 5AOCA 5E1OA 3S0JA 3P5SA 4URWR 4LAFA 1S3GA 3VPSA 4JMLA 1MAAA 3GAFA 5DG8A 1XQXA 3RV3A 4AS1A 4O4IB 1LS6A 4UUAA 1SHLA 1E6WA 4GI7A 2ZRCA 1MGOA 1ZKDA 1DXHA 4BASA 4Z1MD 3M3PA 5EOVA 4BNGA 3E22A 5DBFA 5HS4A 3VH4A 2PG3A 3FOAA 3ANSA 4XYEA 5LA6B 2D2EA 1CC1S 5E1DA 1IHYA 2W8BA 2WVJA 1NTRA 1ZXLA 3VDQA 3ORHA 5D01A 5A4AA 4FLEA 1EFPA 2W98A 1O5IA 4BMPB 4C7JA 5D1NA 4LXQA 4HDSB 2QPTA 1THGA 1L4HA 2ZROA 2IYEA 2D8MA 3CJQA 1IWPB 4APMA 2K5UA 3O2NA 4O7WA 3OM8A 4LRQA 3AJRA 1XRPA 3H8WA 1OFVA 3UB3A 1U0RA 2F3PA 3QF4B 2M6LA 4I4IA 3BIOA 1VHJA 4XDHA 2Z56A 1VJ5A 1CY8A 5CM9C 1ZC4A 2NM0A 3LKVA 4O7RA 2WK1A 4O3SA 1ORDA 1TA0A 1ZIPA 2QIPA 1O96A 2PLNA 4C07A 4PQRA 3BJMA 1E0KA 4NLGA 4MYTA 1GUDA 3FF4A 1J0DA 5CIWA 3WB1A 4BZZA 2D62A 3PJEA 2HN9A 2NADA 4P8RA 2OMKA 3T5CA 1F4VA 1BEEA 5FKJA 4D74A 3O84A 1KO5A 4OXRA 2JASA 1P3JA 4LF8B 2JIBA 2EX1A 1IZZA 4FZVA 1PJ2A 3HSSA 5CRIA 2QYZA 2WJ4A 2DPXA 1KH2A 1SQFA 5KVCA 3BABA 5H9WA 2GVNA 3DEFA 4JQCA 4Q45A 2E4ZA 5IP7G 1M2WA 3FRHA 4QARA 3Q2IA 3LU1A 3GLRA 5E9JA 3L05A 1USUA 1OHHD 3SYNA 5L95A 1EP2B 5K5EA 4RUKA 4UULA 4ENTA 2KX7A 2I4RA 3BRQA 3IEIA 3G5MA 3VZRA 5E2AA 4C78A 1YV9A 1VP9A 1VCHA 1TUGA 3RUPA 2BGNA 2QRQA 1G7TA 3HR8A 4BTVA 2OQRA 3FW1A 4WHXA 1GUYA 1SC3A 2XZPA 5DHFA 5DBGA 5ALTA 1UPTA 4EKYA 3GTJA 2IYLD 1W29A 1HNWB 1E94E 4XXHA 2ZU0C 3AZQA 3FWPA 4PRKA 4XRRA 5AVQA 2ZYRA 4X7BA 1HRKA 4DOMA 3L5KA 4JI3B 2ZIEA 2YR0A 5DN6A 1Q0LA 1NRJB 3A6DA 1K5GA 4MEJA 2UVRA 2ISSD 4DCOA 2H9YA 3JWEA 3AM5A 2J3JA 3E1SA 5KFUA 1U7TA 4YT2A 2O8EB 4MJ3A 4DMMA 3DP9A 3BA8A 2NYAA 4DL3A 1Z4JA 3FKJA 4RH3A 2CDAA 3UG7A 3V4OA 3M1LA 3B70A 1RXSA 2KB0A 4CTKA 4JCOA 4EI8A 1YRWA 1KF0A 4AN0A 2XQKA 1X15A 1G5HA 3CVWA 1JUDA 2PWYA 4KQHA 2IPNA 1YR2A 1HDZA 1F5SA 4DSAA 1OA1A 1FMCA 2IYYA 2HJWA 1CQIA 1W88B 4ZCPA 3HA5A 3H84A 5ICMA 5AJTA 3GGJA 1QRSA 1QHXA 2PD3A 1U1GA 5ELXA 4J0QA 2GN8A 4Q15A 3Q2OA 2CXHA 5DCYA 2B92A 1NONA 2JGIA 2ZTHA 1X8JA 1I14A 2QGFA 3ITKA 5F1KA 3OCUA 3M1YA 5HMMA 3NUGA 3ZY2A 3KYCB 4GM0A 5KYXB 3ET5A 4DXAA 2WJ6A 1PK9A 3BMNA 1XF1A 4B2IA 3VSCA 4ED8A 1V43A 2G0NA 4XOIA 4R2KA 1DIKA 1KAOA 5HKAA 4DB2A 4ALNA 1TWCA 4G4GA 4R05A 3RSGA 1V1MA 4IJ6A 2I3DA 4MVJE 1ESCA 1XO1A 3VC3A 5GM1A 1YHYA 4FCVA 4L9WA 2HWUA 4V02A 4OP2A 4I46A 5HFAA 2VVTA 4B47A 1OXSC 3NYRA 3P0EA 4CGYA 2UZ1B 2QX6A 1LSJA 1T3TA 4DUGD 3GMTA 4XJVA 1A7UA 3PGKA 4D44A 3E53A 2BAGA 4RPIA 5DI9A 2GX6A 2ADFA 5IJ9B 1THTA 3ZG6A 3I72A 3OJFA 1MTZA 5HF9A 2C3UA 3GWGA 4MWEA 2JHPA 3ZR4B 1RCUA 1DOHA 4OKIA 3EFOA 1YZYA 2CVOA 4XE5A 2DU8A 2XQIA 2IDMA 2PS3A 1KDRA 5AMXA 3KHTA 3KYDB 3T5DA 3ZV6A 4OYLA 4HJXA 1B3BA 4YXWA 3MQ4A 1ZC3A 2OXTA 1SD5A 2DWOA 1B04A 3FUUA 1BXKA 4RCNA 2AGOA 1BMDA 1PWZA 3G8AA 4DIKA 3ETNA 4CUZA 2A1TS 3FYSA 1EKVA 1GGNA 3IIKA 4I4TF 2W2TA 3CO0S 1DBSA 1WIWA 4XX1A 2R7KA 5LQNA 3EMDA 4MCJA 2UXDH 3N2GA 4HDRA 3HP4A 3JALA 5DHPA 3K9LA 4F3CA 4ZCLA 2L82A 2TMYA 2QRVA 4A9AA 2HWKA 2HLDD 5EYPB 2QUBA 1RE1A 3DGEC 3TW0A 1UJ6A 2JLVA 2ZEJA 4PC1A 4UQLA 2WMYA 3OU7A 1RHMA 1LBIA 2PCLA 1JE0A 4YJ2F 5LMUH 2QTRA 4CKCB 3H18A 4TLCA 1K2WA 3QBVA 2H7CA 4KOEC 1GG5A 5DX0A 3AF1A 4V0RA 3NEJA 4U5QA 4JOBA 4TT3D 5FT9A 4JKIA 4J4BA 4LY0A 2EOAA 3SVZA 3H8VA 2EAUA 2H54A 5IHXA 4HFNA 4KO3S 3QQPA 1RBMA 4UBJA 3L7AA 4I1UA 2XRZA 2Y67A 5EKXA 3RVOA 2BRUA 2WKWA 4F96A 3E70C 5HMLA 3EOBI 4EY6A 3AI2A 1D4FA 3AESA 3KAPA 4A2AA 2UU9B 4POAA 4XYBA 4WY8A 4BQFA 4KV9A 2CE7A 4EDFA 5FLKA 1L7VC 3QY0A 3PICA 4NFHA 4HDNB 2DZDA 1ODFA 4CIXA 1M66A 1WCXA 3VYTB 2CF5A 3FMVA 2YHIB 1NRXA 2WJZB 3AL0C 5JJBA 4AKTA 3MFQA 1A4UA 3A6GA 3UQZA 3T4PA 3KQWA 3KUXA 4Y3UA 1EI9A 2PV7A 2FJUA 3EEYA 3OZAA 2QVXX 1ZA1A 2ZDQA 2HXYA 5FOTA 1QIDA 4XGKA 3G9XA 4MWGA 3Q7TA 1LBSA 4WACA 3QEAZ 3WICA 3QSGA 3JSNA 4L2IB 3ZI4A 4PO9A 3CCBA 3C87A 1NDQA 2GJKA 5SICE 4NOLA 3VNRA 1DKOA 3NWBA 5CEEA 4OGGA 5ALDA 2WD7A 3GDGA 5KQPA 2V3WA 4NSNA 4K2HA 1NJ2A 2DKNA 4O7SA 3X2FA 3EZ7A 4JR0A 1H0RA 3GBPA 2J3DA 1IRXA 2VCYA 1JWAB 5ALQA 5MGNA 3KFXA 3VNVA 4BJ5A 2IY9A 3NU1A 5ICSA 3FCAA 4RVUA 5BSRA 4AM8A 4EJFA 1N2OA 1PR5A 2NOAA 2ATCA 3FUCA 2OV3A 3L4BC 5A4KA 4U9HS 4I3FA 4MQMA 4NK4A 5H81A 3W5DA 3UUWA 1T3ZA 1YB6A 4PFSA 1RSZA 4UUQA 4IGIA 2DCUA 2HGXA 2Z3VA 1N2BA 4FDLA 2PR2A 4AG6A 2FPPB 1JHXA 3PG5A 3R8XA 2XUZA 1M5UA 2ZK7A 2C31A 5I47A 3RAJA 2JJYA 2ADMA 5HUQA 4MULA 3MF4A 1K6IA 2YFQA 2CJYA 4R31A 3QWUA 3ORFA 3C6YA 5KFWA 4HO1X 5A04A 4MVCA 3NFRA 1BMFD 2MCTA 2W6ID 2ZGVA 1SOUA 3GJ8A 3DZBA 2RGVA 1M3SA 1MNQA 4EHJA 3RU3A 4JGGA 4KWIA 4RB0A 2Q4DA 3GV0A 1E4VA 3RFVA 5U1PA 1NHGA 5K6AA 4A3KG 5INTA 5TT0A 4RVOA 2FMFA 1M74A 4RQUA 2X5RA 4BQPA 5JNVA 4YY3H 4PSVA 1P4AA 4KUGA 3RIEA 4I4TA 1UZMA 5E9QA 1X1CA 4KN9S 3DXXA 1L7MA 1LDGA 1Y1SA 3LUBA 3ONEA 4RV5A 1KBQA 1YI1A 1GPNA 1P7CA 2QX7A 3RCBA 3BMQA 4UXHA 3EAGA 1GYQA 3V1YA 4BZPA 2FKAA 1BAPA 3LC2O 1K27A 3I0NA 4MGEA 1FXUA 2ZJZA 2X2PA 1ZK3A 5IKXA 2RHRA 1C9NA 4CLEA 5JC8A 4YJ2A 1V0JA 2EVWX 2NXNA 2E7ZA 3DXZA 5KNDH 3B1ZA 4PTZA 2H1RA 1GTG1 1C3LA 4BVAA 2MTBA 3QEBZ 4J03A 2YCHA 5FUVA 2F55A 3J81W 1QFXA 1V6AA 4OHOA 2OHOA 2Q1SA 3L0DA 2Y6VA 3V97A 4D0SA 2BE7A 4DA8A 1TE2A 4CQMB 1N77A 4RKYA 2Q7DA 3HGMA 4UW9A 1NTOA 1A9OA 3H5VA 4E31A 1O4WA 5JOQA 2YJ4A 3TNYA 3WO1A 4EYIB 2KBFA 1NLZA 1Q2UA 2YDYA 2WHPB 2F3QA 2XWQA 3OA0A 4J8PA 1XPUA 5BWLA 2PX2A 3OURA 3PX7A 4E33A 5EP1A 4MW9A 3R5FA 3BSYA 2BONA 5TR9A 3CRW1 1TDJA 1EESA 4TROA 3OIFA 4YMVA 4CF3A 1U80A 2K2QB 3N2KB 1TYAE 3ND6A 3STHA 1ID1A 3C6XA 3QHQA 4A3GG 4JBLA 5JAPA 1JXQA 1WAMA 3IVMA 4UU8A 4K0KH 4KRXA 3LHDA 4RAZA 4ER6A 1ZMXA 1MR3F 1EEHA 4NEHB 3R9XA 2CYBA 1H6DA 3GLFE 3DDOA 3CVOA 4YQEA 4PY2A 1VB5A 1SJ9A 2KBEA 2PM8A 2HJGA 2QKYA 5SYMA 4BFSA 1E1KA 2JCBA 3L8DA 1G3MA 1AZWA 1YULA 3AEKB 2H4WA 2F9FA 2EFYA 3PRYA 3AYHB 4L4SA 3W8EA 3B1VA 4B76A 1MC5A 2C77A 2O6LA 2AFIA 3OZTA 3PLNA 2WUWE 5BVGA 1IPEA 2JH8A 3IMCA 1FJGH 4BV2A 1ONSA 4BMZA 2HBQA 1NURA 2AWNA 1GDHA 4KXYA 5FB3A 1CP3A 2PRIA 2WWWA 4QQFA 2NT3A 3IODA 3NWOA 4MLPA 4AP5A 4DR5B 5MFPA 3O1JC 2O2SA 2VA9A 5CPBA 4WK4B 5KC8A 4ED9A 5AI6A 3UW3A 3EJ6A 3F7NA 1ESZA 3FOWA 3FYHA 4KIFA 5CT4A 3U26A 1RKVA 4IVPA 5E7JA 3IVRA 1DAOA 4YROA 5A9TA 2IV7A 4XCQA 2AR7A 2XRFA 2VUMA 3DCIA 3MUFA 4CMBA 1ARZA 2FG5A 5CHEA 4N65A 4NX2A 1V37A 3U13A 1WSDA 4WECA 4Q5IA 4DTIA 3X1MA 3FZNA 1E1QD 3LTNC 2JI6A 3EZXA 2FZ4A 1RPZA 3LA6A 4NVRA 4HBZA 4LYAA 3C97A 2FCAA 1ZESA 2JCXA 5KQSA 2DSNA 4Z4IA 1HQCA 2QRKA 2HY7A 1WG8A 3GMDA 1BJKA 3ELWA 3W7BA 3IP6A 4ZHQB 3HVJA 1YMUA 2V7PA 1XNRB 4X24A 3W90A 4OHXA 2O2DA 1EQ2A 5AW3A 3A2MA 2OAP1 1QE0A 1DC6A 3S7TA 3T4XA 3SYMA 3ZBUA 3V4LA 2PD6A 4O59O 4DR1B 3LK7A 4LF5B 5CURA 3KX2A 1GEGA 1NQAO 3WWJA 2NU8A 5C1DA 3WMRA 2RH9B 3A25A 4Y1GA 5HDBB 4CM4A 1JEYA 2LVBA 1M7HA 4W9NA 2O5RA 2P11A 1A2QA 1PVDA 3AF6A 3BD9A 2XVAA 2PQMA 4AUMA 1TU4A 3M9NB 521PA 5IT9W 3VDMA 1PNOA 3QZUA 3M1AA 4UAJA 2ILTA 1ISFA 4L5AA 2MSDB 3ND9A 3A1EA 2OFXA 1CB7A 1N3BA 3V6KA 3A26A 2H6EA 2QQFA 2DJ5A 2I9KA 1ECJA 4EUEA 5EN4A 4DG9A 1NBHA 1XCLA 4WDQA 3RT7A 1GFZA 3HY4A 2VPTA 1KERA 2OV8A 5BMVB 1DTEA 3PW0A 3FX2A 1YWGO 2VF2A 5C4XG 4YPVA 1T9AA 1ENOA 1MOPA 2BMVA 4DM3A 4OHBA 4KIJA 2VA3A 3NT2A 4CVNA 3JQRA 2VYND 1Y98A 1TEXA 5JYEA 3EVBA 3S24A 1IOLA 2W2KA 3AR6A 3PU6A 2HSZA 1CUXA 1M33A 4KE7A 1W36D 2QMUA 3OOYA 1B15A 1MJGM 3A1UA 5HFNA 5HILA 3OMWA 3WC4A 1DC8A 1T34A 4ESHA 4K81B 2DBYA 2JCSA 3ABQB 2M6SA 3UK6A 4ZYUA 2HVRA 4D7AA 1E9CA 5FTKA 3DC7A 1NSFA 3BACA 4K9LA 2OB2A 3RTXA 1E3SA 1RS0A 5F35A 1C4KA 3ED1A 4DZRA 1LS1A 2OZLA 4AX4A 2XNHA 3H4BA 3LT2A 4I99A 3RGZA 2ZXUA 3GZNB 3WS7A 4RFSB 3PVZA 3IBYA 5BORA 1Q83A 1YA6A 3PD7A 3SZOA 4WFQA 4J1QA 4HAWA 1SU6A 4LTDA 3UQ8A 5EEHA 2BZ1A 3EBOA 1FFAA 2PLRA 1LC0A 3KB8A 5KTMA 1U9YA 1A9PA 4OSOA 4H1TA 5HSGA 5F64A 4LMRA 2Y99A 4FFPA 1U5CA 2P9FA 5KKCA 2XADA 1MAHA 5JRDS 2J45A 4MS3B 1BA2A 2QUIA 1RPTA 4UUPA 5HRUA 5L1LA 1ZH8A 4NE7A 1CR2A 2HMAA 4G5XA 3QUSA 1E7YA 1W1UA 3PPWA 3BTOA 3BSWA 5KYWB 3GLFB 1JVNA 4YB8B 4KR0A 4P4TA 2BHSA 4BNZA 4MR8A 1EHIA 1KI9A 1WZNA 1J22A 1RXCA 4W8GA 2OKGA 3DZ8A 4QBIA 3EHEA 3CW2A 4ZVOA 4B17A 2BE9A 1P9NA 1A88A 4R2JA 4UE6A 4RTSA 3TTXA 1BWPA 3T7RA 3K9QO 4M53A 4LYFA 3QEKA 4WLFA 2OEPA 4HWTA 1HR0B 4Z8XA 3VM6A 4Q4HA 2F1HA 2XR1A 1MENA 2B25A 3O6VA 4PG5A 1QIKA 3ABIA 3FTCA 1ACLA 4R01A 1K08A 1TZBA 4LSWA 3G59A 4GP9A 1HE8B 2Y1LA 1WNTA 3EB9A 3S8EA 1KVUA 5JDCC 4C6RA 1LW6E 3LMKA 3HTXA 5DI3A 2O2CA 1NWHA 1REQA 3U0BA 5K4GA 2CNKA 1N78A 1TM4E 5COAA 4PYRA 3ECSA 5LUAA 2BSAA 4LKRA 2HDNB 2OZKA 4ZYWA 4L6IA 1Z5UA 4BL5A 3F8NA 4JI5B 3DE1X 4C89A 3AGQA 5LQSA 2ANCA 2Q5JA 3OOWA 4R7RA 2JAPA 2QG4A 1Q7GA 4F8EA 3L7NA 1K8RA 3MWKA 4GEKA 1V3UA 1U4OA 2HJ9A 4ENQA 1YCFA 4Z9XA 1VL5A 4EGAA 1RI2A 2ONJA 2BTQA 1WNFA 4LZLA 3PW5A 3THYA 4HDKA 3VU8A 1X7HA 4AUKA 2FCRA 1QO0D 4F4YA 3KJIA 3IDSA 4NPHA 1I13A 1I6WA 2ZI5A 5IASA 2CUKA 5EQFA 1ZJ5A 5FOXA 2Y2UA 2C97A 5DP1A 3DAAA 2PNFA 3W3AD 4Y2XA 1SVSA 1B1AA 1SZDA 1CUYA 3M9MB 4LOKA 4OSEA 4AYBA 4I3GA 1GZVA 3PVSA 4J49A 3T35A 4RIEA 3TNJA 3K1AB 2J6TA 1RBYA 2HRZA 4PSKA 4X62B 3K09A 2GZDA 4BS9A 1VQ1A 5FX2A 1VIAA 2X0FA 4AZVA 1W2WB 1ZK1A 3AR7A 4O3NA 4OK5A 3FTDA 2YV4A 5C5EA 4B7UA 2P1DA 3I6MA 1JLHA 4BCCA 1UFOA 3AYXB 1F0NA 1VPLA 3Q6MA 1Y37A 4XYMA 4KQIA 1WZIA 4JA0A 3L0PA 2HLNA 5BSVA 2ROQA 2IP4A 1S2LA 3OSPA 4GEGA 2UVDA 5DX1A 4KZKA 2ZE5A 4HUTA 3GT4A 5H3HA 3LGSA 2R8XA 3KZVA 4E6EA 3FI0A 4TT8A 1SNYA 2A94A 4NMXB 2R25B 5DISB 2V0GA 3QFFA 4FQ8A 3ZV4A 4IVQA 1JFVA 4QGFA 4E94A 1P72A 2R93G 3G0IA 2AK3A 3VH1A 4UAGA 5EIBD 3RK0A 2FWMX 1FB5A 1ABFA 2O59A 3O38A 2VWPA 3L4EA 2C2HA 1EK5A 4C4PA 2ZJFA 4QNRA 4AYTA 1IBLB 2V7UA 3LC0A 4B3TB 1L9XA 4F11A 2AL7A 3L0CA 2W9CA 3FOEC 1T24A 1PE0A 3MCZA 1JR3D 3EPLA 2OCKA 1YOBA 3L1JA 3AERB 4RANA 4J2TA 5EE9A 1KDTA 1P6XA 2JA2A 3BZWA 3GEBA 4G6ZA 2PZ8A 2AB0A 3FRIA 1T0PA 3FD8A 3U3KA 4A8TA 4DA7A 1QVVA 1THZA 1AE1A 3I62A 3W77A 4EB3A 4WLEA 2IF2A 3QLUA 2FLNA 3KSMA 3FPCA 4HNQA 2Y0EA 4KIUA 5IYZB 4FMPA 5BWBA 1I9GA 1VRWA 2Z8YA 5CAEB 4UUNA 5CG2A 2YJNA 3F3KA 5CXSA 4FZ3A 4H3VA 1EDBA 5CFRA 2C9DA 2K7ZA 3KQSA 5AOVA 5JRJA 13PKA 1IOZA 1YJ5A 1Y34E 2CNUA 1C7JA 1YZFA 4FZ5A 1NHWA 1B0UA 3CY6A 1I4TD 5I6DA 1BKYA 5GONB 1LBEA 3PF8A 3Q40A 2MU1A 3G0GA 1NIJA 1G8KA 2DYKA 3VISA 3M8KA 1Z7YA 1J6UA 3H83A 1V8DA 4Y98A 1UQRA 1XU7A 1OH5A 1WMDA 2VK4A 5G1NA 4HT3B 5ADVA 4Y2YA 1RQXA 1K7SN 4J9NA 2FN9A 3K9NA 2IBTA 3UZOA 1GA4A 2ZJYA 2DRIA 4L0DA 2CQYA 3PD1A 4PZPA 5MDHA 1PT9A 4ZO7A 3CSUA 1W94A 1ZCZA 2OCYC 4AKEA 5BNZA 3PX2A 3H65A 1NT4A 4AIIA 1H85A 1M72A 1Y48E 2JJMA 2Z6VA 5EHQA 4B3MB 2J9ZB 4BNJA 4B4WA 2EL9A 2M6RA 3FSRA 4XR9A 2JAXA 5EDWA 4FFBA 4HHEA 3TB6A 4KXLA 4X63A 3ZBTA 3B6MA 4MDYA 3NH9A 1NVBA 4RQAA 1QV6A 5ITSA 1QQTA 3HCAA 4NC9A 3HJBA 2HADA 2VFAA 3VZCA 4DYVA 2WYWA 1MOQA 1NP6A 1M6HA 2P4EA 2ODBA 4OHCA 3KXYT 1RRVA 4QWAA 5FNVF 4C7MA 2ECOA 3KFLA 1I51A 4TMYA 2GD1O 1IXYA 2VRCD 2X76A 2IP2A 2JLRA 4FBLA 1IY2A 3TN7A 4NRDA 4R83A 4F72A 1Z4OA 3VU9B 2WJHA 4PZ7A 2HA5A 2AX4A 3N28A 1QAMA 1JSZA 4R1UA 3D7SA 1L3IA 3IKMB 1O94A 5AW6A 3H97A 3PV0A 5GTDA 3L4JA 5EJGA 3PJRA 4Q48A 4B3XA 3NC0C 4ARCA 3OSUA 2KQUA 5BN3A 5H59A 3QENA 4DB4A 2BGJA 2O3TA 1MABA 4I4CA 3PJDA 5LMNH 2OESA 4HUJA 1TQ6A 3NATA 2P9QA 5CFLA 2GXQA 4HPXB 2ZSEA 2XE4A 4BNMA 1YC2A 1XYGA 2R68A 4Z3OA 5A1JA 2W5UA 5CH3A 4J0CA 3KPYA 2DVMA 4JT4A 1PYOA 4ZAZA 2PT7A 3FTFA 3AI3A 3URKA 1BDIA 3OCYA 4LTMA 4EYEA 3NKVA 3TBHA 4NQZA 2ZBPA 2FI1A 2GYVA 5G0UA 7REQA 2FZKA 4NCKA 1RXVA 1RAHA 4KHPB 4QGGA 4O33A 1JDTA 3HBAA 4TTIA 2DXIA 4HVLA 1WRVA 2NXCA 4JXXA 4FWBA 1N8NA 1XG5A 3HCBA 3DMDA 3E5MA 3CR8A 3QEMA 2ZE8A 2C5FA 4XIIA 4OAOA 3R9KA 1ZUD1 3VTZA 2C9ZA 3JQ8B 3A9TA 2BD0A 4LJAA 2BJVA 3GUYA 5KWSA 3W1VA 4DJEC 1Z5PA 1AMOA 2NAFA 3G7SA 4Q4AA 3MJ4A 2VQDA 3EXEA 3JQBC 2IYWA 4FE7A 4EUNA 1EDDA 1CV2A 1X8LA 1U3UA 3SEZA 4H6WA 3FVWA 4PZEA 3LRTA 2O57A 4MQ4A 3RW9A 3VYWA 2EBWA 4YJHA 2CMDA 4HAUA 5LQMA 1Z17A 4E5NA 4AXXA 1LV8A 3NGDA 2BM8A 2GEBA 3EDQA 1XFDA 2EDCA 3VC2A 3G1WA 3NX4A 1ZP6A 4Q8FA 3A4MA 2PT5A 3M6XA 3DZGA 4MO2A 1XTZA 4ZYZA 5DQGA 5DHUA 1KYTA 3DLAA 3FUTA 4BNFA 1R0RE 4BECA 5AXDA 3RTEA 5EESA 3EIEA 2JBWA 4XQ9A 4MGIR 4FBUA 4M83A 1DCTA 1LWOA 2PL3A 4V2UA 3ZJ4A 3UENA 3QOWA 5JSFA 3WK5A 1ISPA 1PGNA 3FIJA 1O95C 1Y8QA 4WINA 4AMZA 2ZT7A 4MIYA 5ARBA 4GMHA 2VPYA 4HWOA 2GBFA 2RDMA 1R8JA 1MH9A 3P9QA 3HYLA 1XR3A 3ES9A 5ENDA 4QJ4A 1G3UA 5B3KA 4ZQEA 4JN6B 3LV8A 3AQIA 2G4VA 4TYWA 3BAZA 1RQNA 1G59A 1H22A 3IKVA 3GRZA 4CPDA 4FXOA 1L5LA 3K6JA 5KFXA 2XLBA 4G5YA 5AJYA 1TFRA 2XTMA 3TSCA 2DKOA 4QX6A 3T1YH 3C5WP 1BHSA 2KLHA 4IVNA 2HXGA 5AR1A 2ZJ1A 2CCJA 2PANA 3PSHA 2UYHA 3WNCA 2PUTA 4YECA 1N5MA 5F7XA 1AUVA 4BJ6A 3U7QB 1TW3A 1DEKA 2E55A 4KPUB 4A2WA 2Y1EA 4O0LA 2AKAB 3G5TA 5IC6A 5CDTA 4Y6LA 3SJBA 4ZDIA 4ZQBA 1XQ1A 5EJAA 2ECKA 2EJVA 1HNZB 3STYA 3BIWA 5ALKA 2A88A 1H1LB 2B1JA 3IAHA 3TSZA 2HO5A 1WS6A 2A2ZA 1R0ZA 3F8WA 3KV3O 4O3OA 1VCNA 4LWZA 3AKCA 3MWMA 2R00A 3C3YA 3PUJA 2FZ5A 4M6WB 4PC6A 1VIDA 1JIHA 3I9NA 3PQFA 1DBRA 5F5NA 2YXPX 5DTRA 3NRBA 3PUIA 3IHLA 4INJA 1R2QA 1L8AA 2C96A 2CJXA 3FMPB 3V6LA 2WSLA 1K3FA 3EDCA 2R6AA 3LVFO 5BWVA 2ATLA 1P2GA 4V0LA 5HS6A 1Z7GA 2DHRA 9LDBA 2GF0A 1MQAA 1BKDR 3DZDA 1KZ1A 3LHSA 2BFFA 4HB4A 2CC2A 1BD4A 5LL6P 2IYUA 3OE1A 1K86A 3H2JA 2UYCA 3ML1A 1AKRA 1KMHA 3J80A 1FOEB 3NVKI 2KYRA 5K3SA 5AHOA 4FI3F 1KQFA 4WERA 2ZPUA 2GEJA 4OAQA 3MUOA 3A1VA 1KYYA 3EZ9A 5D1PA 3ENZA 4DA0A 2I9PA 2OCIA 5AM5A 4DWOA 3O03A 4UCOA 4ER3A 1TZCA 1UP4A 1OWOA 2H2IA 3N3BC 3H5WA 1SCKA 4EJSB 4B6SA 2N1MA 1C7EA 3KB1A 3DAOA 2NUAA 1RXIA 1E2GA 4HC4A 2EC5A 3CCCA 4XVUA 4RESA 4LF7H 2V4QA 1RM4A 1KY5A 4F8YA 1FDWA 821PA 3EMKA 5JY6A 4PAOA 4O63O 3GPIA 4Q1CA 3JQAB 2WVAA 2DECA 4C4YA 4DV7B 1J2TA 2YJ3A 3S2IA 1P4JA 4INAA 5JALA 4DL9A 1Q22A 2OTCA 1NLUA 4OAPA 2JEYA 1KK3A 4M9ZA 1CKMA 4KR9A 2UKDA 3UY4A 1JNYA 2ETVA 5F2NA 1QPZA 5F9MA 2YXLA 5KYYA 5LOVB 3RGGA 2QSZA 4U7CA 2QK4A 1YK1A 4AZTA 2D4HA 1RAEA 2CV1A 3A3PA 4J9SA 1O8BA 4DJFC 3UA3A 5D1OA 1QU3A 2YS7A 5BSGA 3H9EO 4BB6A 5DG9A 1QV9A 4DZTA 4RTPA 5B64A 5ALZA 1JHRA 5JWHA 4MUKA 4TPKA 1S2GA 4IDOA 1KXZA 2IW3A 1U2GA 3FJ1A 1ZM3A 1EHCA 1Z6AA 5ADHA 4MV1A 1Z47A 3K16A 2H8GA 5F3RA 1H5UA 3UCEA 3ZI7A 5EJ2A 2I76A 1EX1A 4BNYA 2Q3EA 1IVYA 1DKNA 1AKEA 1ZICA 1KC7A 1H42A 3U39A 2OHIA 2PX6A 4MQFA 2Q4RA 4MRVA 4Z0NA 1GL9B 3NJ8A 1F8XA 4JB3A 3RJ0A 2CLEB 2YHBA 3KR1A 4E12A 3FMGA 2HMYB 3G89A 5EWJA 4G8CA 5BPFA 3EUEA 4PLHA 2FWAA 2HUPA 4ARIA 3I04A 3JRWA 3QSYA 2G88A 5KMGB 2YOHA 5KFAA 4G0VA 4YP1A 2W2OA 2PSFA 3SHTA 4FZJA 4IH4A 1IN1A 3HJHA 4BLOA 3GFBA 1ZHOA 3EYWA 5ARDA 2X6QA 3GAAA 3PFFA 2NSHA 2JGKA 3LO5A 5JT1A 5EMJA 1QIFA 1TRKA 4W5NA 4DEVA 2GFHA 1PJRA 4R8UB 2PKEA 5IKPA 3HGTA 1XD2A 1HTTA 1NUSA 1A2KC 3WLPA 5IYDG 1P6UA 1PS0A 3G2OA 3FHLA 3E7DA 3T1TA 4IMRA 1B2RA 3OTQA 3HN7A 4G5QA 3SKYA 4RSGA 1Z7EA 1LJLA 3SDZA 1MC4A 3W5AA 4HX5A 3W5BA 1PZEA 3CUKA 3B78A 4A03A 1EAMA 3QK7A 2VQEH 2WAQE 2FDCA 2I03A 3G2HA 1DJPA 5K0ZA 1LDMA 3EPIA 4QVGA 3PCTA 4DQNA 4OH7A 5BO5A 3WGJA 3GP8A 3N8DA 1X3LA 1HE3A 2ZE6A 1IDOA 4Q4DA 4AO8A 4JCCA 2VHQA 1E7RA 1E3WA 4B6JA 1QRUA 2Z0MA 1C8BA 5JNWA 1LNSA 4NIMA 4KO4S 2J3MA 1I4DD 4RZ3A 4E51A 5HNKA 1RJWA 4Q6WA 5AW8A 3PPXA 3HCRA 4FE2A 1GNSA 5LZ4A 5KG4A 2XGQA 1SHTX 3A2LA 1VG0B 1YKFA 1X1DA 3L7IA 1K4MA 2UUPA 3GIIA 4AY3A 3WWYA 4L95C 1JPUA 4G0YA 2GTPA 1Z38A 1XFAA 4TTTS 4PIVA 4ZARA 5DM0A 1WMSA 4R7TA 4JI0B 1TJ4A 3OCVA 4R84A 2C42A 3MFIA 1P7WA 3TLBA 2ZIAA 1CJCA 4BZXA 1RRFA 2ZSKA 3AV3A 1W581 2EJBA 2J59A 4MGYR 2R48A 1QPGA 4RTOA 1E8MA 1JG4A 5AXCA 4BO4A 5IAJA 5D5PA 3ROQA 2IEBA 3TG8A 1UOPA 1V26A 1URPA 3DT9A 5A7FA 3BIJA 1J9ZA 4QDJA 3N0WA 1F12A 2QOEA 1BW9B 4QWMA 1U28C 1E8DA 3Q8XB 2AN9A 4L22A 3HVUA 3RABA 4FBGA 4K9SA 4MA4A 2IU0A 2WTBA 3UH0A 1YD7A 4K87A 1YA8A 3MRVA 5AKHA 4BJ3A 3GL9A 1SCNE 2DSTA 3M6MD 4UU1A 1K66A 2WQZA 4YBZB 4Q37A 5JZ9A 1QGUA 1Z7WA 1ZAKA 3AI1A 2H18A 3EIHA 5CR5A 4CC5A 2JB9A 4D42A 1HC7A 4TZ0A 3RR2A 3U1TA 3A1NA 3A05A 1E3MA 1DOAA 1PKXA 3A0RB 4B82A 4OQXA 3C3KA 4MDEA 1PYGA 4DLSA 3X43A 1WDLA 4LG1A 4JGBA 3V7NA 2V7GA 2BEKA 2HVQA 4M8NE 2BPOA 1J06A 4FN4A 2JIPA 1IM5A 4A8PA 1MVLA 2XUKA 3PKJA 3UJAA 4LRSB 4TMKA 3BGWA 3GLKA 4E2FA 1V39A 1MVOA 1BQ4A 4LZPA 1W1IA 3JWIA 1GTMA 5B2FA 1HNNA 1EWRA 2WA1A 4H7EA 3NAQA 3L84A 2I4TA 4AJNA 2YQ4A 1R66A 4IFTA 2IUTA 3MERA 2GASA 5DF1A 1HY3A 4IV0A 4OXXA 2DFLA 4S1TA 4EABA 5I9LA 4MARA 3PEVA 1NBOA 1XU4A 3OKPA 1U3FA 3DWGA 3EGIA 4RA6A 4EX7A 4ED3A 4N82A 1N34H 1Q1EA 4CQNA 1YQEA 2XEXA 1WCIB 4XB6B 3K4QA 5TC4A 4CM1A 1RWMA 4O4JF 2IITA 1PLLA 2OO7A 5KIAA 3DNPA 5LDDC 3ZV5A 4RO0A 1JLMA 1J2EA 4CG1A 3LE8A 3Q72A 3VSEA 3ENKA 2JF0A 4CKBA 2PH3A 5KVQA 1YACA 4F4DA 2Q9BA 2P40A 4QYIA 2PU5A 4PXAA 1XZLA 2C92A 2AUTA 5FPPA 4YXWD 1ODSA 1OAOA 5IZCA 1CEYA 4C0SA 2ALJA 4X6XA 4BYMA 4E3WA 2PAFA 4H9GA 4IAJA 1QHFA 1OU4A 2ZCVA 4WN9B 4C29A 4CTMA 2AWOA 3OJEA 3VOBA 4KV7A 4PICA 1T4MA 3P0JA 2AC7A 3EA0A 4PC7A 4S1WA 1YS4A 4GQIA 4QEKA 3QJ5A 2VK8A 2W42A 4EA8A 2ZYDA 2AZXA 1TVCA 3JQCA 2IEDA 1WWKA 5L45A 3TOVA 3D6NB 3RS4A 3I1YA 4MCHA 3RSQA 4PRLA 4EYHB 1X2BA 1YKGA 1RPAA 4PNZA 1EKPA 5JLJA 2AJBA 4EATA 3R75A 1KJ8A 1X7YB 2WF7A 3EVNA 3L7LA 5J2TB 5EIWA 3T1HH 1YIAA 4CDNA 2XDWA 3HA7A 3UC9A 4INPA 1IJEA 2ONCA 3WISA 1E2KA 3QELB 4NXMH 1WW2A 4WAUA 4DAEA 2XUFA 3L8GA 3KOYA 4JUFA 5H4HA 1FMJA 2W4QA 1RDFA 3C39A 4LWOA 1DX6A 5CB6A 5HM8A 1WDWB 4EQ6A 2HL6A 5GZ6A 1UPCA 3DOOA 3FTNA 1JS1X 4M1ZA 2GZAA 4D9HA 3HOYG 3LFTA 4M1TA 4XWOA 2H29A 1CJMA 4YJGB 1JHYA 3GLVA 1QVAA 3ANTA 1KETA 1I4WA 4L7VA 3GH3A 3LXUX 3EF1A 1IWOA 3P2IA 4E5SA 1T3LA 3NMUF 4B3HA 4TVOA 2UDPA 5BWOA 1Z73A 5A6VA 5DK4A 2UAGA 2JGEA 2HX1A 2R92A 1T2UA 3HI6A 5LKRA 1KE1A 4GW3A 2BGMA 1W19A 3W6ZA 5TPWA 2VC2B 3EQZA 1PNQA 3EODA 4TMXA 1YR3A 2QGZA 3PO3G 4XA8A 4IEIA 5IVPA 3N41B 1N6HA 2VNJA 5EMLA 3VOTA 1C7IA 2I3AA 3I28A 5EJIA 2C4KA 4QXMA 3LW8A 2YX1A 5DV9A 4E11A 4YUYA 3TMAA 2H4FA 2FR8A 4KI0A 3CH6A 1OJ7A 3DZJA 5KDOA 5L3RA 5FHQA 1IM8A 2NMVA 3T1OA 2INGX 4DR6H 4LOJA 1UC4B 3CN7A 3LYHA 3JWHA 2WWFA 1XKLA 1YIOA 2QD4A 3P32A 1DKLA 1I2CA 1Q57A 3H86A 4GR5A 1UBFA 3TK1A 2H1SA 2HA0A 3ZJUA 3ABOB 1Z5ZA 4HDOB 2PHZA 3R24A 3FPGA 3I3OA 2FFJA 1EBFA 3PQ5A 5A71A 4F5YA 4YMLA 3ODPA 4JBGA 1OPXA 4YT5A 4YQZA 1C3EA 5CX1B 4NI5A 2ZG6A 2A5YB 1FNMA 3ZHTA 2EWMA 1JG1A 4RJ2A 3VU1A 3F5SA 3WBJA 1FW8A 4O4JA 4MXDA 4C0XA 1IL0A 1T94A 4IDQA 5AVJA 4FCWA 1SUCA 3FOCA 4IHJB 3DFMA 1C4XA 5CK5A 2P9ZA 2OSVA 4XIGS 1CE8A 2Q49A 3AC0A 1SXJE 4AZ0A 1G2PA 3FYUA 1I94B 2ABJA 3PIIA 1KZ7B 2KE5A 4BBAA 5F4ZA 4L0QA 1J42A 3ZHXA 3B1JA 2MSWA 5K3OA 2BR3A 1E66A 5TMDA 4BP9A 2X9VA 4Y1RB 1CRPA 4Y67A 3ZWXA 1T1JA 1YAJA 3D8NA 1TAEA 3KM0A 3RVJA 6REQB 1J0EA 3EC7A 4CMGA 3AUAA 1E59A 2CFCA 5ICFA 3WGYA 5JNRA 3KQOA 2BR5A 2G5GX 5M3BA 5KFVA 3CPHA 3R6LA 4D9JA 1M6YA 2WF9A 3TL6A 2XVYA 3GGOA 3U0VA 3QVGB 4WTOA 4ZRDA 3MRXA 3EGXB 2R47A 4RELA 1YL6A 1EVYA 3II6X 4EI7A 3PNSA 4TVSA 1M67A 3KJXA 4DJDC 1T2NA 5K9ZA 2I55A 4LIPD 3TOXA 3M3DA 3ZW8A 3TD6A 1STOA 2EATA 3O3NB 3OEHD 1U8YA 1KYZA 1B23P 2B7CA 3IELA 2BFNA 3U31A 4LV6A 3MMPA 2VBGA 1O6FA 4OO3A 1YB1A 1E1CB 2JANA 5KYUA 4WZAA 3LOPA 1QO7A 2FLPA 3ZU6A 3IX7A 4YT8A 3DE0X 3PBKA 4ZAYA 1TMKA 1U8CB 3S81A 3V1MA 4H7JA 1JR3E 3RYHA 2GZHA 5F1OA 3S27A 1UBMS 3AIKA 1X74A 2BGLA 3F4LA 4B6QA 3OHPA 3H11B 1MQSA 3KCQA 4MR7A 1OGJA 2X1HA 1Q0UA 1WKVA 2O05A 1T9DA 5AM2A 1RP7A 3E6AA 4JIGA 3DOCA 3LHKA 1NSYA 4RHUA 3HCWA 5BOSA 3P2KA 2QRZA 4XUDA 2QLNA 1U99A 4LPSA 3TRJA 1SU7A 1J39A 4BO9A 4JC5A 3F7OA 2ZRJA 3ILSA 3VH2A 3FDJA 4OIMA 4BY7G 1JSRA 3R7WB 1CFJA 4HXYA 1XZDA 3NASA 1FS5A 3BB3A 4FFVA 5JS6A 4EBBA 3J80W 5M34A 4WY2A 4EJ6A 1LLCA 4IIBA 4TYYA 3I9LA 1PK8A 3O8OB 5E3HA 3Q0EA 2R8PA 3H5AA 1DXQA 3KU4A 3KOUA 3AHCA 3A1TA 1XTIA 4YAEA 3QZ8A 2F6RA 1DIBA 4IHQA 1LVGA 4TLBA 1GN9A 5JZSA 4REMA 3U9TA 1C0IA 5ALFA 5AI9A 1SIOA 3GHHA 2E5WA 1E2HA 3JQ7B 3KSBC 3C3MA 1QC5B 4MTLA 3VGJA 4GDFA 2Y71A 4MRMA 4NECA 1S3SA 5FWYB 4BFLA 5KFIA 3QVSA 2ZJ3A 2GA9A 3OWXA 1IJFA 3L79A 2Q0QA 1IAQA 3ESQA 3WKDA 3KHGA 2GZSA 4EY7A 2B5OA 4QGHA 2H1IA 4CCYB 1WSCA 2QD5A 1B0ZA 1LK0A 3T15A 3G2LA 3LDFA 4KLZA 4WUVA 5ITWA 1DV1A 2AZTA 2ZRPA 4O4HB 3MB5A 2FMXA 3AXTA 2QI9C 2WWGA 1RK5A 3SX2A 2BGRA 1JQEA 1QE5A 1UPXA 3KOWA 1EBUA 3ESYA 3DLPX 1V5IA 2Z4TA 3KKLA 5JZBA 1A77A 1FVXA 1SUIA 3CLSC 2RMKA 1JHPA 5CDFE 5DWQA 1JDPA 4H16A 4UFOA 4Z53A 2ZSBA 2AOTA 3LQFA 2GJ9A 3A1FA 4GWGA 4QFBA 1ZH2A 4BQRA 4I2VA 2DH6A 1UDAA 3QMWA 1P1RA 3CB2A 4XLLA 2PSEA 5ENVA 1IB0A 3GV7B 1K75A 2ZQZA 3EJWA 1QH9A 1GDDA 4ARUA 5D3MA 5ES3A 5A9SB 5CVDA 2OCDA 4IXNA 2VKQA 1XZFA 1T4CB 4Q21A 1VDZA 1OLUA 3VI3B 2V9WA 4JXUA 3KYHC 3G6WA 3WJ7A 5BSFA 2A1HA 1XD8A 4A82A 2XHZA 2FZEA 3D3EA 1VYVA 3H3XA 2AG5A 2EEPA 3NEYA 3BJIC 3Q1LA 4TKVA 2HIMA 2APJA 5E6UB 2AW3A 2TYSB 5IUNC 1QS0A 1I36A 1HLGA 1YCHA 2IPAB 3BM5A 1LRKA 4UJ5A 3OF2A 4PG7A 1A9SA 1RYHA 1Z35A 3I1IA 1EGVB 5ITVA 3WLHA 5C8XA 3KJZA 5HZKA 1UK7A 2W6ZA 2PMKA 1X6VA 1XROA 1XWIA 1IEWA 2NLOA 1H2YA 1SXJB 2Z2JA 4GRDA 1JEQA 2P90A 1RJRA 1J9EA 4D9FA 4UCWA 4MKGA 4M86A 5K8IA 4QJ3A 2BM9A 5KFZA 3TH5A 3QPWA 1TKRA 2WSIA 3WGOA 2EL7A 1R5BA 5I9MA 1HDXA 3CNNA 1GD1O 2EXXA 4FYJA 2C5EA 1I6LA 3N8GA 4PNPA 1IRIA 4KOAA 1TVEA 5IBCA 4CR7A 3GXOA 2IYVA 3EK2A 4J76A 4GZ3A 1SCDA 4UAUA 1UM8A 3AUFA 5G0VA 3M9OB 2JA8G 3BC1A 5KFHA 4RDIA 1O0CA 2ARKA 3VNBA 1X94A 3SXPA 5H82A 2POCA 3A8TA 3GH1A 2BEVB 2CNNA 4Q1DA 2R8ZA 3GCDA 2H57A 3FFWA 4JX9A 4W1RA 3LTEA 3EGOA 1RM3A 2C99A 1YUNA 3CE9A 4FKZA 2ERCA 2FK3A 3MTDA 3GZTB 4TWAA 4GGOA 3RRNA 2ZRNA 4C14A 2CT8A 4ICIA 4R7ZA 2X19A 2ZM5A 4KH1A 5G4KB 1NM5A 3TGLA 5FIUA 1SC4A 1MXHA 4JL8A 2VPQA 3R6TA 2PUJA 1U2RA 3LX6A 1S96A 1BG6A 4W63A 3RVBA 1UMKA 2SKCA 3PFKA 4KSBA 1NX6A 4K46A 4X90A 1E61A 2QBYB 1GQQA 1Q50A 3V4SA 1NYTA 4B3RH 1YR1A 2WINI 3AIOA 2OFOA 3V48A 2UZ4A 3B7WA 7AT1A 2YV5A 3LW7A 3R7NA 2C0CA 5HJ5A 2CCKA 3QFTA 5DYWA 2Q3LA 2VJYA 4ZOAA 3NM4A 2I6SA 1XMOH 3W5IA 5LNK1 1PUIA 3OQ1A 3BD7A 5CVVA 2YNMC 1GAEO 2H5EA 5LP6C 1TAQA 1SCIA 3S2UA 1Q1GA 4D97A 1MJ5A 4LC9A 4OI2A 1ZWLA 4U3JA 3HUDA 1JIVA 4QU8A 4G9EA 4CI9A 2X0EA 4TRJA 1H23A 4HTAA 3ZHCA 3R44A 1NR7A 5DM60 5ALIA 2UZ3A 4M98A 4OUKX 3JQ9A 1G5TA 2XYRA 2HFJA 3TCNA 1KJWA 3SI7A 3FNIA 5BQ5A 1D5WA 5IT5A 2V0CA 1S2OA 4AJ9A 4D8YA 2NUTA 2R6CA 3HADA 3MMNA 2W6PA 4CIBA 5DM1A 1GLVA 1IYEA 5HE8A 1KMMA 4ZMSA 4UD6A 1YTLA 1RHRA 3B53X 1KI7A 4WSOA 4YPOA 3VUEA 3NLLA 3QNMA 3P9RA 2DUUA 4M0CA 3K8QA 4G1BA 1A5BB 1EFHA 2WB4A 4DUYH 2J9FB 2SNIE 1XVUA 2ZWAA 4DBZA 4EPTA 3VHLB 1WU8A 3N6XA 1UPBA 3BORA 4BLQA 1VJ1A 3SICE 1UOEA 4KNVA 4MS4B 1LLQA 3F73A 4DIBA 4D45A 1Q3KA 3FN4A 5I3ZA 1U0HC 3W6PA 3MCAA 1OZGA 2HHJA 2EBHX 1UBGA 2ON6A 4ML3A 3FLAA 4AKGA 2D4AA 2JLYA 4AN1A 1O57A 5CJ2A 5MF6A 4GMKA 1XLTA 5LU8A 5GIOE 3IYLW 1EPUA 4IICA 4B6GA 3A6KA 5HVNA 5IAKA 1AGNA 4A8HA 1Z0AA 2EZTA 2PMFA 2Q3JA 1W59A 3TR6A 2ZRAA 4OXYA 5C18A 1GVNB 1HOXA 1EINA 2QN2A 1IBRA 4ER0A 2O0JA 4OVKA 5FA8A 1K7XB 2JJ8A 3D2LA 4BQSA 4DFDA 3Q7SA 1EWVA 4D0GA 5HQJA 3ULKA 2QXUA 2ZRLA 3V7WA 3WB0A 2FUEA 1YU9A 2W2QA 2SHKA 4P4SA 4HX2A 4DV3H 4OP1A 2VNKA 4QYWA 3UFXB 1OTYA 2VDJA 4Q3KA 3ZY5A 1DHTA 2PYIA 3WQBA 4GKJH 4V1CI 1G5PA 4G5SA 1OXKB 4HNHA 1KK2A 2AGQA 3GLGA 5KYVA 5B5SA 3GBVA 4FLMA 1M34E 1KDOA 1BN6A 2XW6A 1C8KA 4L5IA 1Y5MA 1ZNWA 3B6ZA 2FWRA 5CT8A 1HZZC 4RJKA 4ZWNA 2G06A 2YQZA 1ECLA 7ABPA 4RKRA 4FBTA 5DTEA 5BW4A 3ZHUA 5EIOA 4D92A 3UPTA 1U9IA 1XZAA 4B7XA 4QUJA 2A1UB 3RUCA 3CR7A 4HN4B 2WE6A 3K3VA 2H2AA 1YHNA 4J3JA 5DNAA 4U6PA 5CDSA 3IP5A 3QIAA 5U4XA 1HSZA 3W9UA 2P5SA 5BW6B 2QR3A 2A9FA 5F1YA 2AC4A 2WIDA 5J58A 2JAQA 4DGQA 2MDTA 2PNJA 4RVNA 4PQEA 4FB5A 1SU8A 4MWSA 2ZVDA 3AP1A 2O7NA 4HDQB 2O0MA 4LMAA 3L6CA 4COKA 4KYVA 2X5XA 1TO6A 4D9IA 3EEBA 1CKNA 4KLNA 1I7DA 1RLOA 1O5OA 4IVRA 3QYFA 1JVBA 4WCFA 2OYSA 4L57A 2CDNA 1YA4A 4C0LA 3KYBA 2VHTA 1XRSB 2OGUA 4GPD1 4R2HA 2QU8A 3NW9A 3V8NA 2IE0A 3N05A 1HBJA 3SJCA 4H3SA 4OA8A 1XZBA 3RYCB 2A5GA 1E2MA 3Q7RA 1XK6A 2VJQA 1DINA 3EFBA 5FCDA 4BN5A 3CZRA 1NNEA 3T5MA 1NBEA 1HYBA 1J8FA 3PGMA 4WNYA 2C4VA 2EF1A 2C2OA 1NW9B 4LNAA 2ZKLA 4LHEA 4ENVA 5E9WA 2W48A 4CMKA 3T5PA 3L6RA 3SNKA 4TX1A 1J07A 2B2NA 1QNLA 1Z15A 4M22A 2QSUA 1CQXA 3ZH9B 4JLKA 4Q34A 4OBXA 4TMFA 4KDCA 4MV4A 2FQ1A 1PEAA 2HIXA 3VJRA 4TTJA 5I5VA 3CMCO 3EOAI 3MHPA 4CCWA 2RARA 1ZVJA 3OMLA 2SICE 4QDUA 5FUYA 1N7JA 1US8A 4TSFA 2ZUBA 2XGGA 4P0QB 2OV2A 1CUGA 3LUGA 4NCBA 3SBDA 1WB5A 5BWTA 4BNXA 2O3RA 5M5BA 1VBGA 4MTDA 2I78A 1PI3A 4LJ7A 1X19A 4NDNE 3TKAA 2PUGA 2FP4B 3PNMA 1N92A 4XVQA 3VPCA 2A9RA 3IOYA 3ON5A 5F3DA 4QWDA 2A14A 5T8KC 3I6IA 1DG3A 3WRVA 1LY1A 3CNHA 3EPRA 5LLDA 4YJ3F 1M1YA 4Z9BA 5DHRA 3PHGA 5IDWA 1JL3A 4YP0A 1E3DA 2EFJA 4HGYA 1XTJA 2WWYA 2GZ2A 1Y9EA 4O82A 1X1AA 4FS1A 1GNRA 4KK4A 3NIGB 1DRUA 1T36B 2UUAB 1BO6A 1OJLA 1EFTA 4O7TA 1ORRA 3PQ6A 4MP3A 1O94D 3IEVA 1YDGA 2DG2A 2JLUA 3D7NA 1GILA 4F6RA 3PL5A 1JXMA 2FPWA 4B7AA 3WLMA 3ST7A 4RGBA 2F3TA 2ZXFA 2HJHA 3E7PA 2W83A 4W4TA 1J1IA 2MMCA 3EC1A 2QJRA 1RW4A 2PMCA 1II0A 4PEVA 4WI1A 4MV0A 5DEOA 1CDDA 4JIMA 4B83A 2YMQA 2NTNA 1YDWA 2QNRA 4B3CA 3OPYI 3P0IA 4PYNA 4AF7A 3BUSA 2YCLA 1P7ZA 4FYHA 1ST3A 4YASA 1BOFA 3TZHA 1A9XA 4ZVQA 3FOBA 4TS9A 1FNCA 1MHPA 4YT4A 4IR7A 1F2TA 3ASUA 2HHLA 4ZC8A 3AJ9A 3DO6A 1P7YA 3PJFA 2A6PA 2X9LA 4PLWA 4WV3A 4YHHB 3BJZA 4U0JA 3UK0A 5KNLA 5KG0A 5MFZA 2PPVA 3S2GA 4AWAA 4JT9A 1ZBQA 4E5PA 4HWPA 4NY1A 2QAGB 1A50B 1TNDA 3Q0TA 3H42B 1R0CA 1RBQA 2OZVA 5FJJA 3RJTA 1Z6GA 1XK7A 1T6YA 3IFSA 3WK4A 1NL3A 2YIDA 3PWKA 3QVKA 2O0KA 1D2RA 4CRWB 1JKJA 2NO4A 4G37A 1RJPA 4YRIA 4NEQA 4WNIA 1JDSA 4GICA 1GRCA 4RPJA 1EE1A 2HA4A 2BDUA 1MAVA 2EX4A 2QPAA 5EE5B 1XZCA 2ZU6A 1M34B 4LFBB 4ZQGA 2D59A 2DTDA 4D3SA 3R20A 5ALYA 5GVRA 3GGDA 4FU0A 4XIJA 1NV9A 1ZIDA 5E25A 3PC4A 4UEWA 3LKBA 4AUNA 3RSOA 4GNKA 5LDGA 3V32A 3OWHA 2QW0X 1XCJA 1PD0A 1VFPA 5KJFA 4M9UA 2QLLA 1O4VA 1EDZA 3WIBA 5KNBA 5F9NA 2ZVPX 3IL2A 3K5PA 4X1OA 2XZOA 4IXWA 4BFUA 1GSIA 3IB6A 1XRQA 5TDHA 4EFLA 5IW8A 2JHGA 5FFFA 2OXFA 3RB6A 4ND3A 1YBFA 2B21A 5FNVA 1IHPA 4Q01A 5I5TA 4HN9A 3RS2A 1OPRA 2NVYA 3HKZE 2QAJA 2Y68A 4AJOA 3HA3A 2XQFA 4ZYYA 2GAIA 1H2FA 3KKNA 3LH5A 1C4WA 4BNVA 1ZFNA 2IEZA 3RIXA 5A7GA 1GIAA 1ICIA 3JVUA 2WR8A 3B6JA 1DWUA 4HSEA 1I6UA 3LY9A 5L7YA 4KUEA 1F3LA 4HADA 9MHTA 4L9AA 5TRTA 3KTAB 1DJQA 5GGYA 2IZ0A 3IT2A 1Y7TA 1FP4A 3RWOA 4E09A 3KJFA 4C21A 1BCRA 1M6EX 1FY2A 2J6HA 2HCFA 3R9IA 1RVV1 5BWWA 2G7MC 4JV5B 4BJHB 1COWA 2RGEA 4N3AA 2BCJQ 3KBBA 1L7PA 2GCOA 3DGFC 4AS2A 2JIOA 5AUQA 1E6UA 4FDMA 2RGNC 4ZOLB 2R7LA 3IT3A 4HTFA 4DTCA 3LLMA 3T3EA 4RMJA 3VPBA 2IPOA 4QRIA 1LLUA 2Y1KA 1SEPA 4I55B 3SC6A 5H7XA 1MNAA 1ZL0A 4U7PB 2GBGA 2OCGA 2V1UA 2OCXA 4KXWA 4H7HA 4QDKA 4XGNA 2QAIA 3ZJ5A 4GMDA 3EIXA 4MQUA 3P4YA 1Q1QA 2BYTA 4BP1A 4YA6A 3UATA 1FNSA 2P75A 3IEKA 5F51A 4BXOA 3W05A 2YBDA 1YU6A 2E4VA 4N48A 2GRAA 4D8UA 4G0WA 1A8HA 3W1EA 1DRVA 3FIUA 1J56A 3H05A 1YIDA 3P9ZA 4IS2A 4YXFA 4LX8A 2VHXA 2ZI6A 3BQ2A 4F21A 3T52A 4BQQA 1LF5A 5ENZA 5GJVC 4FN5A 2FE3A 4NMMA 1I9CA 2HSWA 4G1VA 3BQ1A 1ZUNB 3IV6A 1T6XA 1WVMA 3EWAA 3RI3A 1V6CA 3EG9B 2VXBA 2XTAA 2W8KA 4F06A 5JQWA 2HPVA 6LDHA 5JAQA 4U7TB 3DOFA 4Z7OB 5ADWA 3A4LA 1QV7A 1LTQA 2E4XA 4CIVA 5E2BA 2Q45A 3PEYA 3GEDA 4LHVA 3RK4A 4DDVA 2VJNA 1P4SA 2AJCA 2QL9A 3LD9A 4GMFA 1QXSA 2GBCA 5T4EA 1G60A 2C2GA 1BCSA 4O2RA 1PG2A 4LQDA 3VR6A 4RJIA 1D6SA 1X9IA 1IUPA 2O8CB 2X5NA 2FKNA 2IKSA 4AF8A 2C7PA 3OH8A 1GDTA 3T5KA 2V6MA 2ZUCA 1E79A 3GPBA 4CKYA 4B80A 4NP6A 2OQIA 4GPAA 2A1TR 4OJMX 3DT6A 5DLGA 3DTTA 4XLZA 4GKKH 4RTQA 2HNKA 3Q5GA 4Q9IA 4AJHA 1LJ8A 2G40A 3EXG2 5HFJA 4Q0YA 3WZLA 1FSFA 4A16A 5LD2B 3V46A 2VUSA 3BK2A 3FMIA 4U9IS 1FFHA 2E1RA 3C6ZA 1GQFA 4TTPA 1F4PA 3BJEA 4TTSA 2GJ8A 4TXHA 4PSDA 1UBKS 1ZMTA 5I5XA 3DBRA 1GV1A 4JASB 1N5JA 2QD2A 4JKYA 5JCZA 4MYDA 4LKOA 2ZIXB 1WABA 3KJEA 4ITRC 5CGQB 3RFFA 1PHRA 1NJSA 1LJUA 4PWZA 2HTFA 4Q0MA 2IY7A 1QFJA 3L46A 5KHLB 1FDIA 4IGAA 3SP1A 2P5YA 4ZVRA 1H94A 2JCVA 3N5KA 4RHFA 1IZ0A 4CLDA 5BN1A 2P2YA 4V2IA 3C6MA 3NDRA 1GTRA 3D4OA 5AK0A 2CV2A 5HIAA 1WPRA 2RJNA 1N4AA 2A8YA 2YIMA 5JD6A 1DBIA 3C0KA 3A3NA 3MLEA 3NVMB 4U2DA 3S2EA 3GIJA 3RAQA 1D6NA 4C6SA 4HH1A 4TYQA 4M8KA 3AYZB 4JZKA 4J9MA 3CONA 1BMTA 3U9SA 5IJZA 4MCAA 3UHOA 1KUTA 4FGZA 1QBGA 3B9PA 4K2AA 1VSBA 4GX5A 4L72A 1DJOA 4MRNA 4CGZA 2O14A 3OCZA 4DKJA 1V8PA 1T5IA 3IULA 1KHTA 2RF4A 3Q7QA 4WVFA 1HT0A 1S89A 1V96A 2G04A 1LPPA 2WDZA 3QNWA 4GDMA 4V0MA 3GLIA 2OL4A 2CLKB 4Y18A 5IWAB 2D1SA 4ECTA 4ZEOA 3QFCA 3J7TA 3KQHA 1UXJA 2FF5A 4EBCA 2Q3BA 1OYYA 3FHTA 4CFZA 3OFNA 1V3QE 4I1SA 2R8GA 4Q9LA 5DZSA 3T3IA 1AV7A 5AVOA 2X4GA 4N7MA 4JUCA 3ZYCA 2NQ2C 1DKUA 5E3JA 3IR5A 1VI6A 2WJGA 2YU9A 4NMWA 1J5PA 4LEIA 4G0PA 3PT9A 3VBCA 1PR6A 3WYAA 1CULC 2YY6A 4IO1A 3RSLA 3UK1A 1PZGA 4BBJA 4O7ZA 3ACBA 1C1DA 4X8HA 4M7EA 2L2QA 2B4RO 3QU5A 3N2LA 2N47A 2I62A 3U55A 1OX4A 4CN8A 2OT3B 5JW6A 4BEWA 3COPA 3ZWVA 4PTLA 5ES4B 3M5DA 5DN6D 1U6KA 5AOBA 1NYQA 3ZQUA 5THXA 3REFA 4AKIA 3ILYA 1X1BA 1Z5NA 2OD2A 2VH5R 3EQ6A 3GDHA 721PA 2A5LA 1YBMA 221PA 1BVRA 3GT0A 5IJ0B 4RTNA 4AL4A 1AUQA 4WRRA 3JQPA 1SBNE 1MH1A 1YZHA 1SH7A 3R7DA 2SCUB 2OM6A 3P96A 2HMWA 1X39A 1KKUA 2ZETA 3GLSA 4KSYA 2R5WA 1E63A 4M1MA 1Y8ZA 3R7LA 4OHKA 4WLNA 3QG5A 1FX0A 3KQLA 4EW2A 2NP7A 4L07A 1WY5A 5LQUA 4ECRA 1Z68A 4IMJB 5KNCA 2GGSA 3HWRA 2H1OA 1L4YA 2PYDA 1G291 4YYEA 1IBMB 5ULLA 3WTCA 4Q7KA 2G6TA 3B3AA 1U2DC 2QN1A 2QQEA 2HT6A 3LBFA 3K0FB 4G5HA 5EJ5A 4X91A 1ISJA 1JHDA 5EHIA 4S0ZA 1PGOA 3U3ZA 2O8BB 3WP0A 1T8TA 3UMGA 3LUAA 5AKJA 4Q18A 4DLBA 4DCTA 3DL2A 4G26A 3KWFA 2ZYWX 1I7QB 4MQEA 4EW3A 3TZLA 4R71A 1N0IA 4GBED 2JK0A 4PDBA 3FPHA 3I39X 3QPCA 5SZJA 5KZMB 4FE4A 4U4AA 3S44A 1Y8AA 4JX8A 1PK7A 4MI6A 4ZI7B 4XVHA 3TFQA 2H4XA 3D3QA 4BFWA 1QIIA 4C0KA 3L9XA 2JS7A 4TXNA 5JCPA 1KJYA 3K73O 4L51A 4I6EA 1S0OA 4EIWA 5KOYA 5JLAA 3FAKA 1XWWA 1FU8A 2R7NA 3HY3A 2JZOA 4CQLB 5KFFA 2ZT5A 3KSRA 4PXSA 3JSAA 1VYTA 5DLYA 3SF8B 4IG4A 4WOBA 4LC0A 3A3KA 2CLIB 4YMHA 4RCYA 1AKQA 4CCAA 4KYIB 3U5ZB 4IM7A 1GFIA 2BELA 2R93A 2OAGA 3PC8A 2ZSJA 4IMPA 3SBEA 2JVKA 2DQ4A 4ARBA 1XZPA 2OE2A 4JDUA 3PN1A 4DADA 2FHPA 3IGFA 4JH0A 4YRGA 4Q9KA 1C7QA 2I33A 5F5XA 2ICAA 1K1SA 5B7QA 3KQQA 1ZGGA 4EKDA 4X1KB 1SQ0A 4F8JA 4RIGA 4AQYB 1GTSA 2HXSA 2JFYA 3G0CA 1V6SA 2PVCA 3NWJA 5AW5A 4BC1A 1GKKA 2CK3A 1CWUA 4RORA 3UAYA 3LM8A <