4UFZA

Synthesis of novel nad dependant dna ligase inhibitors via negishi cross-coupling: development of sar and resistance studies
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negishi Cross-Coupling Enabled Synthesis of Novel Nad(+)-Dependent DNA Ligase Inhibitors and Sar Development.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ufzA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ufzA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ufzA02
1N33B 3QWUA 4LF4B 2HVRA 4EFEA 2OWOA 4UCTA 4LF5B 4LF9B 3PN1A 2CFMA 3GB8B 3BAAA 1IBKB 4DR7B 1XNQB 3GJXB 5D1OA 3TY8A 2UXCB 1CKMA 1CKNA 3W1BA 3NBZB 5D1OB 1P8LA 4JI6B 2UUCB 2VUGA 1CKNB 4NXNB 2HIVA 3TY5A 1IBMB 4JI4B 4DV2B 4JI5B 4UFZA 3BA9A 4LF7B 4LFBB 2UXBB 5DISC 4EFBA 4B3RB 5LMNB 4UCVA 2Q2TA 4B3SB 3T1YB 3NC0B 4EQ5A 2UUAB 4KHPB 3JSNA 3RR5A 2F4VB 4B3TB 1ZAUA 4JYAB 1XMOB 4UCOA 4DV3B 1HNXB 1J5EB 4OX9B 1DGSA 3BA8A 4JI8B 1FVIA 4JI2B 3SGIA 4CC5A 5D1PA 4DV4B 2HIXA 4JI3B 2HHHB 1HNZB 4YHHB 1XNRB 4GLXA 2HVQA 5LMUB 4UCRA 4DV7B 4UCSA 4B3MB 4YY3B 4K0KB 1XDNA 4NXMB 2E5LB 4PZ6A 4LF6B 1VS0A 4DV5B 1B04A 4UCUA 4DRFA 2VQEB 4DR1B 4DR3B 4AQYB 3L2PA 5IWAB 3W5OA 3GDEA 4JI1B 1HR0B 2Q2UA 3S24A 4JI0B 3OTOB 2UU9B 4GKJB 3VNNA 4LF8B 3BABA 1N34B 1N36B 3UQ8A 4LFCB 4X62B 2UXDB 4DR6B 4LH6A 3T1HB 4X64B 2UUBB 4X65B 1TAEA 2HVSA 4PZ8A 4LH7A 4GKKB 1S68A 4DR5B 1N32B 3RTXA 1XK5A 3JSLA 1TA8A 4DV0B 1P16A 1IBLB 4DR4B 5FPRA 4CC6A 1I94B 4TOIA 1HNWB 4DV1B 4DUZB 4DUYB 4JV5B 1V9PA 1XMQB 4PZ7A 4E6NA 1CKOA 3TY9A 1X9NA 4DV6B 4X66B 3KYHC 2ZM6B 4DR2B 3W1GA 5BR8B 4LFAB 5FPOA 4JI7B 4EEQA 2VQFB 1FJGB 3NBYB 1A0IA
chains in the Genus database with same CATH superfamily
1N33B 4BR6A 4PA7A 1BGWA 2HHHO 2OWOA 4R8UA 4IRDA 2AXTZ 4FZ0A 1H2GA 3PN1A 1ZTEA 3E22B 1YZBA 4MVZA 4J7KA 3CCSV 5CA1F 3RN4A 1S0OA 4PDBA 2XAGA 3CQZA 2CNVA 4JI3O 1VQOV 2ZKOA 4ZKIA 2PYLA 4PA9A 3OEEG 3SYQA 2AGOA 3FX7A 1IBKH 4JV0A 2ASLA 3SYOA 2UXBB 4YY3O 2YRXA 4TQDA 4GX1A 4NKGB 2UUAB 1Q6IA 1TVKB 5DGIA 4LNUA 3STZC 3JAMW 1YCIA 2WAMA 3RV3A 2P90A 4WBNA 4OX9B 1Q3EA 2B1GA 2NLJC 4I5SA 2ZR2A 1O9GA 3IC9A 3SGIA 4NB5A 4CBCA 3W7TA 3GLKA 4CKBA 3E8BA 4A3EG 3V4ZA 4GCZA 1Q86W 2NU9B 3ABKB 3CC7V 2CQYA 3AG2C 4TQRA 2WPDG 1J95A 4MTDA 4YJ3F 3CSWA 1SQPH 4IRCA 3SR2C 3G4SV 1VQKV 3Q2OA 4U3JB 2EJ7A 3PW7A 1IXBA 5L3EA 3JAWA 4O86A 2NU8B 2W6NA 1OCCC 1M9NA 4I0XA 3SPHA 5FR9A 1IURA 5K1PA 4IAJA 1I08A 2YXYA 3RYHB 3K79A 4ME6A 3K3PA 2Z5UA 1QR9A 4F4LA 4DL3A 3OTOB 3VPBA 1WA8B 1PNKA 2E3CA 1X4TA 3RV4A 2ZGIA 1ZETA 4JYCA 3MFIA 4J9LA 3JCZA 2VOBA 3KTMA 2IH3C 1ENVA 3K3VA 2A79B 2W71A 3N2KA 3JD4A 1GM9A 2DE0X 4O2BA 2W6JG 4ED0A 5EBLC 4PZ8A 4X1IB 4N21A 1ULZA 4QJFA 1AI6A 3U9SA 5EC1C 5KFPA 3CRAA 3UT5B 4BXXG 2WLIB 4UVBA 2ZM6O 1B06A 2RF4A 3MHSC 4LWSB 3N2KB 4DW1A 1GSHA 3SNOA 2JGDB 4FFRA 3SJAC 4IYHA 4DYLA 3FB5C 5IWAO 1K8AW 1XILA 4K8XA 1SQFA 4Q4DA 1G6UA 3DC6A 3E8GA 4JGSA 2Y4TA 2ZDQA 1K3EA 3GWKC 3VOTA 1HNXH 2UXCH 5DN6G 1Q90D 5KG0A 2AHZA 3HBLA 2YC0A 2Q8VA 4EFEA 2P5OA 4JI5H 3N6RA 4DRXA 3J81N 5D1OA 3EVKA 5DG7A 1S9FA 2PZSA 3CCJV 4DV0O 1TWAA 3SPJA 4E2LA 1CKNB 1PNLA 4YJ2B 2HLDG 4NXNB 1JPXA 3GILA 5FLMG 2IU3A 3BA9A 4LF7B 4EGJA 2EINB 4G28B 2UXDO 2M05A 2E74B 2V5AA 1KD1W 3E86A 1VQLV 4FBUA 1D5AA 5B3SC 1Y6XA 1QVGU 3BACA 3K57A 2FB5A 1Y1WA 1U96A 3ORQA 5CMUA 4DV3B 4B3SO 3LDDA 2IBZH 1ZX3A 3LNMB 4LFCO 5C1OA 2YIAA 3ZX6A 1RSOB 1DTOA 3TQTA 5DGAA 4DV6O 4JUZA 3G71V 1S0NA 1XNRH 4X9QA 1KBHA 3JCUZ 3HKEB 3AK2A 3M7MX 1I1MA 5BXZA 3TK1A 3TQ1A 5KHHA 1HR0H 4FFOA 5J2UA 4LFBO 2CNUA 4HNUA 3RYIA 3JALA 3ZHTA 5C5JA 3ZEDA 4X66O 4MAMA 4I50F 2Q2UA 2XOKG 2COGA 3VNNA 1Q5OA 4CH4A 3G67A 1WH2A 1M1KW 1KU9A 1N36B 3OTFA 1UC9A 4LFCB 1YIJV 5LOVF 2ZR3A 3JALB 2XNDG 5KG5A 4MT8A 3QNEA 1H2LA 2OIGA 4ZBMA 2QWNB 1R1BA 1KTAA 4NR1A 2W6MA 5KT4A 1XL6A 2ODMA 4EBCA 1QLEB 1TA8A 2ZT9B 5E25A 2BTQB 4CMFA 1KYOF 1SA0B 5BPFA 5C4XG 1XHZA 3GIPA 4DR3O 4X62H 2ASJA 3JAMN 5LMNH 2QR4A 2C28A 4MV7A 4X89A 1Y74B 3CRRA 2JGDA 3RFRA 3AG3B 2ZM6B 3A0HZ 4CE5A 5CB4F 3ZMSA 1YXBA 4GKJO 3K0GA 2GQRA 1FS0G 4Q8EA 1FXVA 2NVYA 4EEQA 1VQ8V 1FFXB 2Q4PA 2DJVA 3E2EA 3E22A 3K5IA 1MABG 4A2BA 3GTKA 4KL1A 2Q69A 1WNSA 5CBHA 1Y74A 3UZOA 3GJXB 1P7GA 4TV8A 5L1KA 3MDSA 2R8JA 1FKAH 1R3IC 5EK0A 3W7XA 2J6SA 2ALZA 4BWAA 3BHPA 3TCUA 1OZ0A 1Y1VA 2OLSA 4EFBA 4J10A 3ETQA 1N0JA 2WA4A 2X0SA 3KREA 5I5WA 1GK9A 1RJQA 3R5HA 4DQNA 2XTAA 1KJQA 4DR1H 1RK5A 4BBSG 2QM4A 5LYJA 5LYJF 1TUBA 4R50A 1J5EB 4NTYA 4TQSA 3GIJA 2XASA 1IX9A 4O2AF 2W70A 4H37A 5KG7A 4NXMO 2CKZB 5JH7B 4DV3H 5KG2A 3KCYA 2JA7G 2PGGA 3EPIA 3K0DA 2YI9A 4B3MB 1K97A 3ABTA 1XDNA 4YR3A 4AYBA 4TUYA 3WB1A 1JQ0A 3S3XA 2IBKA 4BY7G 3ZIAG 4PZ6A 4JI7O 3N6XA 5I5TA 4FBTA 3LQSA 2YCHA 3NXSA 2ATLA 2QM7A 3N2GB 2HP8A 1K7DA 4DUYO 3PW2A 1QQCA 1KJ9A 2Z0AA 4J11A 3CCUV 1EN4A 2PBZA 2H3OA 1XDCA 2UXCO 2BTOA 3GV7B 5L1JA 1SKVA 5HNEA 1QR8A 5KFYA 2EILC 2HHFA 3F8NA 5KFZA 4F50A 3EYYA 5BYAA 4O7LA 3M99B 3ORRA 1V51A 1H2SB 1GH6A 2UVVA 3P32A 3MWMA 2JEJA 1EKFA 3CJHB 1NU1H 3OEHG 4X66H 4FZ1A 3EXAA 4JV5H 4X20B 4X1IA 4J80A 4QJFB 5CA1A 3HKZE 2QWRB 4RO2A 4J9OA 2W6IG 2CAZC 2QWQB 4LSAA 2FPGB 2R70A 1K9MW 5IJ9A 5BWTA 1WR2A 4DUYB 1XMQB 3RF2A 4DR5O 4MTGA 4RB3C 1JXLA 4G27B 4K3AA 3DXRB 2A9HA 1KC8W 1WN7A 5AG2A 5KT7A 5FNVF 2ZNJA 3L74H 5KLVH 3W1GA 4LF9O 3DSQA 1RFYA 4O4HB 3STLC 4X88A 5BWRA 4I55A 1XREA 3AG3C 5FLXW 3JD2A 1H2NA 3VQYA 3KG2A 4JI8O 2PUSA 1T36A 3TGUH 2ETNA 4AQYH 1T5EA 4YHHO 1CS0A 5IDJA 2VRZA 4ZI7F 3LP8A 4MVUA 1R3JC 4QE9A 3GIDA 4MA5A 1NH2D 4EB6B 2ZE5A 3ZHUA 1NTKH 4DV2B 4YJ3A 2HGWA 5L3FA 2W9BA 1I7LA 4DV5O 3WB0A 4FFKA 3B8MA 4BW9A 3HOUG 1HNWH 1KC7A 1M56B 4NXMH 3ETEA 1Y1VG 4U7OA 4A93G 1EZJA 5L9XA 3ASNC 4I7ZB 5I5UA 4DR5H 3VPCA 4JYAB 2VR1A 1XMOB 5EOYA 3C0FB 4U3JA 1BJTA 5FL7G 2EZOA 4JI2B 5DECA 4WHXA 4DV4B 3CXCU 1PX2A 3QO5A 1GYFA 3ZRVA 3J80N 1S0VA 2EJ2A 2FTKA 2JK5C 1TUBB 2OTLV 3H0GG 1I7FA 4FS1A 4GKKO 1L2ZA 2ATKC 4TSFG 1UJWB 3FFQA 3OUUA 3RYIB 4AI8A 4Q45A 4KHPO 1YHQV 1E4GT 3GTQA 2ZDIC 5J2UB 5EZYF 4AQYB 3L2PA 5IWAB 3CCVV 4FIPC 4R7CA 3W5OA 2LFSA 2YEVB 3JD1A 4QSHA 4JYAO 1JOYA 4D7TA 1S77D 4O83A 1RYSA 3GV8B 2FLLA 1K34A 3UT5A 3GVMA 4RUCA 1MNGA 4ZIBA 2CGNA 1GRJA 1QVFU 4DUYH 5KX5A 1VAJA 3BQ1A 1EZVH 4JYBA 5GW7A 1N33O 2WE6A 3ZMUA 4YQWA 2YU9A 2UUBB 5IP7G 5I5VA 2QKCA 1JDBB 1NS1A 4ECZA 4DV6H 4GKKB 5EWFA 4DV1H 4LF6H 3B4SA 2UVRA 1JIHA 1NKDA 3C3TA 4GC7A 2X0LA 2YDEA 2EULA 2IH1C 5LL6Y 3G6EV 3GTLA 1K33A 2IMWP 3SPGA 5KT6A 1EM1A 2BR0A 3VQVA 2UXNA 2W6PA 4MV4A 2J6UA 3K5LA 1FJGB 2RN9A 3SJBC 2B9ZA 4RAZA 4LCUC 2ITCC 4LF4B 2WB1A 3OHBA 4YR0A 5EZYA 2BSKA 1SCUB 4DW0A 2CH7B 1PL0A 5I5YA 3M9OB 2VQFO 3RVYA 3DTUB 1V55C 3CMEV 2Y0PA 1CKNA 1XOUA 1CQJB 2GPSA 1GAXA 2GV9A 4B3RO 1M93A 4JI7H 5CB4A 2YZLA 3RGXA 1IBMB 4DL5A 3ASOB 4UFZA 3T2MA 3J81W 3HOVG 1EHIA 1BCCH 4J7ZA 2J6TA 1RM1C 2FYUH 3CCQV 5CE8A 3FYIB 5IYCO 2Y0SE 3MR2A 4WFGA 2I87A 3C3SA 3D3IA 3ABMB 2GTSA 3AX6A 3FDSA 2F95B 3F5TA 5LMNO 1SZXA 3KXYT 3P3NA 2X6BA 5JQGB 1IYEA 4C5CA 4GKKH 4WD3A 2R93A 1Q82W 1HNXB 3H20A 4J41A 5DQGA 5LMUH 2JA6G 2EX3A 4B3MH 4JI3B 4CS2A 2W6ZA 1Y67A 3RGBA 4ECWA 1F23A 4TV9F 2QWPB 4DV7B 2JS5A 3DAAA 3ZJZA 3RB3A 1DV2A 4B3RH 2ZINA 1I50A 2UVWA 2ZD9A 4O2AA 1DF4A 3QQMA 1SF9A 4DR3B 4EG0A 2DYSB 3LDEA 3VA7A 4LSXA 2YXLA 3GIKA 2PY5A 5KHKA 3OUZA 3SJCC 2IA6A 2COIA 2L6LA 4Q0YA 4GKJB 3AK3A 4AQYO 5KFVA 4O4IA 4G3IA 2UXBO 1BE3H 2OYQA 1N34B 3Q8PB 1KKCA 4DL7A 3OM3B 3R5FA 1E4EA 4YAJB 1NTMH 3H1LH 3L71H 3T1HB 3AYHB 5H6QA 2X6CA 5IY5C 1GM7A 2UVUA 4MVRA 4O7SA 5H5NA 3KHLA 1AI5A 4DV5H 1XMQO 2ARHA 3ZBHA 4DR5B 2JIZG 2DWDC 5CN0A 4CS3A 4FLXA 4QWCA 3K5HA 5BR8O 1I94B 4TOIA 1HNWB 1S5JA 4QIWA 4A3JG 2CDYA 1WB8A 1IBLO 3QG5A 2F43G 3B2EE 3D36C 2CW7A 2O57A 4PJ0Z 4LF8O 5IT9W 5EBMC 1A0IA 5BWWA 3QWUA 4MV8A 3KZIZ 4JTAB 1XNRO 2JA8G 4LF5B 2Q68A 3VOUA 2CW8A 3GTJA 3KAJA 5KG1A 2VQDA 3BJYA 5JJJB 3BCCH 2DOSA 4NTXA 4JI0O 4TV9B 3R65A 1UPGA 1VQ9V 2K1EA 4HNTA 3G6VA 3WG7B 3T4DA 5BWVA 3OMNB 1YJ9V 1ZL8B 5JQWA 2UUBO 1Z2GA 2KG7B 3RYFA 3TEKA 5JJNB 4LFAH 3ZHQA 1FPOA 4QPKA 2WA3A 5KFQA 4R7RA 3I12A 5KMGA 1RPOA 3AG7A 4GT1A 3UO3A 3RT3C 3UKMA 4YP3A 1SQGA 2W6QA 3P3PA 5B5EZ 4O7ZA 1VBHA 1K1SA 5D5PA 3FAVB 4GX2A 4PDVA 2JJ1G 3N2GA 5EIBC 5B3SB 2GLTA 3DTFA 1WB7A 5EDWA 4Q4CA 4J9ZB 1K73W 2ASDA 1MZBA 2X6AA 4A2AA 5CAEB 1C30A 4ED3A 2D2CB 4MV3A 5LMUO 2F93B 4CKCA 2XT9A 2E5LB 3H1HH 4UVAA 5DEDA 2BQ3A 1FXKC 1CP9A 5E1AC 5IYZB 4DL2A 4F6RA 4RNNA 1WCMG 1KP2A 2WLHA 2DLNA 3T4ZA 4CKEA 5KFXA 3TXSA 1HNWO 4PWQA 1ZLZA 5J9PC 3VBBA 2WLNA 3APQA 1MA1A 4NXNH 1L0NH 3KHHA 4P2ZA 5JH7F 3UQ8A 1YTFD 1FJGH 3CCEV 4O4IB 3B09A 1Y76A 1OWTA 1GO3F 3K08A 3PW5A 2PMZE 2QF7A 4C7UA 5IJ9B 2WAQE 4FPPA 3PR4A 2WLLA 3HB9A 3OE7G 2HVSA 1N8RW 3R23A 3RBZA 2RGVA 1S68A 1Q43A 3G8CA 3N8DA 5L1IA 1P16A 3LWBA 2WB1E 2E5LO 1Z2OX 4X65H 1NI8A 4TQFA 2PI5A 5KFNA 4DV1B 3ZMTA 1E1QG 4CH5A 4P9OA 1QBZA 3LDCA 3J7AK 3OUFA 3ZMZA 4A3LG 3SI8A 4WFBV 2DPIA 5C8YA 5KA6A 3CPWU 3U10A 2VQFB 1MMMA 4WFAV 2PN1A 3N27A 5DGHA 4MW3A 2FE3A 5KFCA 2EILB 4EB6A 4O81A 4DL6A 2RGRA 4BIZA 2I8CA 5LA6A 1K5SA 1L8DA 5B1AC 2R9IA 3GIIA 5KG4A 2W8LA 2R92G 2QKSA 1SFOA 2N74A 3ABLC 4JI6H 5LMNB 1XI1A 3H4DA 3KHRA 3T5LA 4LF4H 4YHHH 1PP9H 5JVDF 4MVMA 2R7ZA 4ECVA 3JSNA 4B08A 5JQGF 1NTZH 3CWBH 2HFEC 4LC1A 5IYZF 5KG6A 3RBDA 4OX9H 3M8AA 4A3FG 3TW6A 3SE7A 1JFFA 2WLMA 1Y4MA 1CQIB 3HKZA 2RCVA 4FLTA 4CC5A 5JWPA 4RAIA 2M6YA 1PD3A 2JEUA 4J9KA 5EWGA 5F9LA 2ITDC 3LSUA 2HHHH 4X64H 5E79Z 3RAQA 1H38A 5KT2A 1UNNC 3WFVA 1R6KA 3A0BZ 3VQXA 4CZZA 3ABLB 5LHIA 4HBNA 4L87A 1FKAO 4F4XA 1VQPV 1S97A 3DTGA 4UCUA 4NZNA 1MOFA 3M4IA 1IBKO 2FPIB 1PL4A 2CZGA 4BAYA 1N33H 1R9TA 3EPGA 1HR0B 3CJHA 1RYRA 1ZSPA 4ED8A 4CHIA 3OT7A 5I60A 3HT5A 4J9SA 4FM2A 4RQFA 2C2RA 3V4SA 2NN4A 2ODTX 1IDSA 1W96A 3T1YO 5H80A 3WWHA 1VEWA 4B3MO 1JJ2U 1OCOB 4Q6GA 1WJZA 4ED1A 2IJKA 4IZOA 3IAYA 2EINC 2BE3A 4ZHQA 2YXHA 1S76D 4JI4O 2JJ2G 2B63G 4J42A 1P4RA 1DLBA 5KFOA 4RB0A 2YRWA 1I1LA 1BQ0A 1VF7A 2Y4UA 4IWXA 2XCAA 1BT8A 2BTQA 4JV5B 4R8UB 3N43B 1GO3E 4DR2B 3FB6C 2Y69C 2HJFC 4PBCA 4O7NA 4E4TA 5L3CA 3V6HA 2QWOB 5C1PA 1JLLB 4U7CA 2LP7A 1DIKA 2R85A 1YTFB 2CFMA 1TWHA 2P4KA 2UXCB 3G80A 1S72V 5JVDB 1JJOA 4JI6B 1VF6A 2ZNIA 4O7VA 3TIIA 5GTHZ 2R7KA 2FL4A 1O75A 2KSDA 2VS0A 1F51A 3QO8A 4FVMA 2YWVA 5DISC 4UCVA 4EKWA 1YDXA 4P30A 5KHJA 4YBZB 1BMFG 5FLXN 5C44G 3ETHA 1N4CA 3B8NA 4QGPA 4A3KG 4FLWA 1VQ7V 3CSXA 1TWCA 3T9AA 1VARA 2R7ZG 3X2QB 4IGGA 4U3FH 1MG1A 3S3WA 2VPQA 5BMVA 2YICA 1RSOA 4IIJA 1AR5A 2EIMB 1QCEA 2W0FC 4YY3H 1I5XA 1GMGA 5TISZ 5B1BC 2HIXA 3GIQA 2HVQA 4MA0A 2EIMC 1SEIA 3JD0A 2IJIA 3TIGA 5LXTA 1G2WA 3CC2V 2FKLA 1FAFA 3PFFA 2JVDA 1Y1WG 3OTOH 4TT3G 1AR1B 3L73H 1O9HA 3CC4V 3T5HA 1VS0A 1EBOA 4DRFA 4LR3A 2HDKA 3JRWA 4A5UB 2W9AA 1XNQO 1QU7A 2CGOA 4K35A 4JV2A 1E1RG 1XMOO 5JCOA 4UB8Z 3GDEA 5D5QA 2R8IA 2RQ6A 3KKYA 1YVWA 2DMXA 2WYOA 4A3MG 1RP3B 3ZMVA 2JEGA 1F4MA 3DF7A 4QIWE 1NVPD 3BVOA 4EEYA 3QO7A 4YAKB 5GONB 2HJWA 3VMMA 4FJCC 2PI4A 4DR6B 4ETSA 2YS7A 4LH6A 2YEVA 1RJRA 5GONF 3O65A 3TXQA 2ZDGA 3E5NA 3ABKC 4JAUA 2DN9A 2VA3A 1SQXH 5EBWC 1I1KA 1XK5A 1M5IA 4J9PA 3MWDA 5C8YF 2DZDA 1SERA 1KJIA 1IBMO 4UUGA 1SC5B 4PD4F 5EYPB 2ADQB 5LXTF 5IY5B 4O82A 3T9CA 1FXKB 1CE8A 3RB6A 1X9NA 1Q7YW 4QE7A 4FLUA 4DR4H 5FPOA 1IOWA 4K0KO 4DRXB 2Z3YA 2EJ3A 1SQVH 1Q6UA 2HJDA 4L8JA 4NXNO 1OJHA 4MV9A 1S03G 4UVCA 1R3KC 3HKDA 2DYSC 1URFA 1AN7A 4J0MA 4FM1A 1SQQH 3D36A 3HKBB 5KMGB 1OBGA 4O4JB 1XUQA 2BSKB 5IT9N 2FK1A 4HYOA 3ICXA 2YIBD 1NZ6A 1H2KA 3Q8SB 1SESA 3NC0B 5KFWA 1KECA 4JASA 4E4EA 2R8KA 4ECRA 4HN2A 5LYJB 1A0GA 3HKDB 2OH2A 3JATB 5J2UF 3SPIA 1YI2V 4B3TB 3JYCA 2HVKC 4FU0A 2Q73A 4JPRA 4O4LA 3BA8A 1Z2NX 1U97A 4JI8B 1VKZA 1HNZH 3G8DA 4M9UA 2X7RB 4OPAA 2Q7EA 4DR6H 1SQBH 1RK6A 2HHHB 4F4ZA 4YHHB 2HGXA 5KFHA 4F4YA 1S10A 3HOYG 3UFXB 4MTOA 4IHJF 1XMOH 3FB8C 4I4TB 3CP1A 4UB6Z 4YJ2F 1DV1A 3AG1C 2RDCA 1I5YA 4PA4A 1VQMV 1WA8A 4NXMB 1HW7A 5HFMA 3ASOC 4JI1H 5EC2C 4I7HA 1AJPA 4I4TF 4DV5B 4LFCH 4KP4A 2EJRA 1B6SA 2HG8A 3T1HH 4NZOA 4BIUA 3QZ8A 2YZMA 2FLPA 5KFTA 4ECQA 3H40A 4FGRA 3H9VA 3CRMA 2JA7A 1F7YA 2HHFB 4RAYA 1KMIZ 1PKXA 3L4KA 3LSQA 1YJNV 5JVLA 1FFTB 4OX9O 2PF4E 5T14A 2LGWA 2LO1A 4JI2O 2AZ0A 2YW2A 4OXSA 3NR7A 4CH3A 3HB3B 3OW2U 1HNZO 1AUXA 1COWG 2H94A 4X20A 4X65B 4XX0B 4O4IF 2F1MA 3RFCA 1G8MA 3K04A 5KAFZ 3JSLA 4RUFA 4JTCB 4FFMA 5FPRA 5K1XA 4I50A 4ECXA 1FFXA 4RQEA 2NU7B 2Y48A 4DUZB 5FNVB 2VWJA 1MZFA 1EN6A 2HR3A 4A3GG 2F4VH 5KFSA 2HGSA 2QKAA 1GM8A 5KFIA 1VQ5V 2UUAO 4ZI7B 4ZOLA 4JXUA 2UXXA 2XGQA 2HVRA 5EYPA 4O84A 4JI6O 3QZ7A 3SPCA 4UCTA 4LF9B 3BAAA 4DR7B 5LA6B 3OSPA 3T7AA 1Q81W 5HV6A 2UUCH 1CKMA 2ADPA 4MVQA 1V54B 5ITZB 4FM9A 2CTWA 2W9BB 1DAAA 2UUCB 2FJZA 1E79G 4FLYA 5CA3A 4DR7H 5K3WA 3OD4A 4JI5B 2R72A 3R5XA 4RNMA 2KB1A 4XDLA 3M9NB 5BYBA 4DR6O 2OTJV 3KHGA 4DUZO 4PELA 2I80A 4WFHA 2ZM6H 4QNHB 4GLWA 1VF6C 3HPLC 5DG9A 5L1LA 1SRYA 4IIJB 1RPRA 1SS3A 4LNUB 1JDEA 2W7OA 3OSNA 1IXMA 3TINA 3H4BA 3E89A 4W4KA 3ZS8C 1A3GA 1YEWA 4LF4O 2EIJC 1M90W 2EIKC 1OCZC 3WB2A 2B63A 2YUAA 4B3TH 1J5EH 4C5BA 3PZPA 2X5RA 3MHHC 1E4FT 1SYXB 2P22C 3W7SA 5IYBG 1WLEA 4R6ZA 2JS3A 2UUCO 3IJ4A 1T94A 4O3OA 2OT5A 1P49A 2UXBH 3T5JA 1N36H 4LF6B 2HKOA 2WDTA 3F7YC 5KUMA 1B33N 1BSMA 2VQEB 3MJFA 2ZXWC 3RUPA 4I0XB 3IG0A 3GQCA 2DWCA 3PVXA 1S0MA 2GDSA 1V4YA 3RB4A 2V9WA 3ZHSA 2GUZB 3K5OA 2CTPA 3R9RA 1AUVA 2OCHA 1KUTA 2AGQA 3BABA 4HNAA 4O2AB 3T1CA 5LHHA 5LP6A 2CTRA 2DQ0A 2V59A 4XDKA 1WPBA 2B5UA 3PR5B 5KUKA 3AG4B 4HYKA 3OMAB 4L1KA 1UC8A 4HZ3A 1R73A 3L75H 1E4EB 4LF5H 3IN5A 3ZHVA 2C22A 3JZ6A 4QW8A 3RTXA 2Q6AA 2GPWA 5BWXA 2VUMA 4DV0B 5KFFA 4DAAA 3C90A 3SDLA 2YZGA 1AP5A 2YYAA 3L4JA 5I5SA 4DR1O 5KAIZ 4JI5O 4E6NA 3OGCC 2Z02A 3GWOA 1N34H 2E2HA 4DV4H 3H01A 3O9OA 1S5HC 4HNVA 2C35B 4NTWA 1JCHA 2JA5A 1S3JA 3T9FA 4CMDA 1B6RA 3CCLV 4JYAH 1AJQA 3A0RA 4O4HF 2V4RA 4DV3O 4U6PA 3RYCA 5JVDA 2PTMA 2YSUB 1IBKB 5CB4B 1FJGO 3AEIA 3UYYA 4GUNA 4APMA 4NZMA 3HOWG 4Q20A 4ZOLB 1P8LA 4YJ3B 2CUGA 1TGOA 3G6XA 4LF9H 3MFHA 3L9DA 2HIVA 4DV7H 3K06A 2Y4RA 4LF8H 3CX5F 5DLGA 2VQEH 4MVSA 3OR6C 5H6RA 4C2MA 3E35A 5CBGA 4TV8B 3T1YB 4X65O 3T9DA 2YZNA 4EQ5A 4KXRA 3K03A 4LF7O 2F4VB 4FFLA 4DR3H 2NUAB 5BMVB 2PVPA 1N32H 4ICGA 1ZAUA 4U7NA 3GTPA 5A2QW 2C2AA 1DGSA 4WF9V 3GTMA 4O7YA 2W6OA 5B1AB 4KHPH 5BY1A 3W7WA 4AHCA 4DR4O 4GX0A 5FD5A 4MV6A 3JZIA 4I4TA 4GLXA 3JARB 4WFEA 1LUWA 2COJA 4JV5O 2W9CA 1XMQH 5DG8A 3E8FA 2VPSA 3R66A 4LMYA 2J9GA 4YIPA 1M0TA 2IU0A 4QW9A 4QWDA 2AZ2A 2K9PA 5CM0A 2XC9A 3FAVA 4DV7O 4TVIA 2CNQA 2W9CB 4MW8A 2A06H 3FD9A 4RUAA 1L1FA 3SYAA 2V4DA 5B1OA 1HWYA 3CEIA 1EN5A 4F6RB 5KFKA 4RCNA 2P6JA 3MR3A 3N40P 3ABMC 4AYBE 1N56A 3X2QC 1VMGA 4QWAA 2IW5A 3CCRV 1VQ4V 2FK2A 2OIEA 2YI8A 1RM1B 5KFMA 5IP9G 1Q8IA 1N34O 5DQHA 1M6VA 3WWJA 3CS5A 3U11A 1P84F 4HNAB 2R9RB 4K8ZA 2IJHA 1AROP 2RDIA 4MTEA 4DUZH 2UUBH 1I6UA 5A2QN 4H44B 1EYZA 1XBLA 5FD6A 2VUMG 1V9PA 2R7NA 5IYCG 3T9EA 2XAFA 2Q7HA 3H3VH 5IE9A 3IGAC 5BR8B 1JVMA 1WPXA 1I94O 1KJ8A 4ECYA 5CA0A 1BHBA 2VA2A 2CTQA 4BWSC 2VQEO 2W8KA 2XHBA 2FPPB 4DIMA 4ABMA 2JA5G 1X59A 4J9QA 2AW9A 4A3BG 1XNQB 1BL8A 3T1YH 4A3IG 5F2VO 2G38A 1UFIA 3HKCB 3OAAG 3CB2A 1W59A 4MTFA 4DO2A 3JZFA 3WU2Z 4O7WA 2VUGA 1H8EG 1JMKC 3BEHA 4FM0A 5JQGA 1PNMA 3DGEA 3K3WA 1BQZA 1BXRA 3PW0A 4IIJF 3CVZA 4YJ2A 1TWGA 1YF2A 3AG4C 3B77A 4HAMA 4H0LB 3JATA 4TV9A 1WRVA 2XCLA 4B3SB 2YIDA 5HBRB 4X1KA 4IWYA 4O3RA 4X64O 3ZRXA 1N48A 2Q9LA 3HOZG 3Q4HB 1AR4A 3UZBA 2DAAA 3CEBA 1GN4A 2NU6B 4UV9A 3OR7C 1Y66A 2B1IA 2R6FA 2AHYA 3LUTB 4X1KB 1HNZB 2A1HA 4JI8H 3VQWA 3M9MB 1ZQ7A 2BQRA 4H13B 1IZ3A 4LF6O 4YB8B 3KALA 3SYCA 2Q0AA 4JZGA 4O3QA 3D3QA 4GYCB 2KQXA 3WO1A 5CA0F 1KEEA 1T3NA 1WAZA 4DV0H 4AILC 4ED7A 4J9MA 2DIKA 5DM6V 3JAKA 2F66C 2P67A 3CHXA 3U0GA 2BOBC 2UU9H 3I4NG 1QHTA 1IOVA 4IT5A 3S24A 5LOVB 4K0KH 4O7RA 4RB2C 4G2KA 3I4MG 2JRIA 1Z2PX 2LQTA 5EWEA 3ABUA 4IYIA 2WLLB 2Q7DA 2VQFH 5JUMA 4ZHQF 1KT8A 1JX9A 1W2BU 4I50B 5EIBD 5KFJA 4JI3H 1WSCA 1DF5A 2P06A 2BQUA 1YSCA 2IJJA 4YXWG 3ZN0A 4JV1A 3ZCCA 4X8AA 1F4NA 1AB3A 1ZWIC 1J5EO 3JASB 1C3OA 4Z1MG 5IJ0B 1JKJB 3N41B 2ZJTA 4ZI7A 4LWSA 1P7BA 4D6TH 2ZE7A 1CPYA 4MSWC 1BZKA 2A3QA 3B40A 5EZYB 1PM9A 1N32O 4Z1VA 4BBRG 2MK3A 2RJZA 4LFBH 3A8TA 2KSWA 2Y0SA 4FFNA 3KYHC 4J9YB 3THOA 3ZRWB 1M57C 5ITZA 5BWUA 3ZN1A 5CA1B 4OPHA 4JI7B 5A9GA 2ABJA 4O3SA 1PPJH 2V4QA 1M0WA 3LMLA 1K5QA 2GHYA 1H2MA 3L72H 4PDRA 2HVJC 3IFXA 3JRXA 1EKPA 4NLGA 5B1BB 3DXRA 1K83A 3F7VC 3E8HA 5KS8A 3TY8A 4I9QA 4EYIB 3W1BA 3I56V 2JEXA 3CMAV 4YR2A 2D3OW 2DYRB 4Q44A 1JX4A 3N44B 2ZIOA 2C2EA 5KHGA 1BHAA 4GZRB 4XZ3B 4LFBB 1NQTA 3UM7A 3V6JA 2DPJA 5H9CA 4JZ2A 4KHPB 2E2IA 4DR2H 2BCCH 1BNCA 5KKNB 4UV8A 3AG2B 1GSAA 2Y0IA 3CRCA 1VQNV 4XYLB 2AGAA 4O4JF 1A32A 4DLKA 3HKBA 3RVZA 2FMLA 3MD0A 2FP4B 4PI0A 1N36O 2VWKA 2Q0OC 3OFNG 2EJ0A 2R87A 2AQ4A 2Q5ZA 3HOXG 1LNQA 1V55B 1WP8A 3J7AU 3K58A 4W4LA 5JH7A 2QDOA 4O4LB 4K0KB 5I5XA 2A0LA 2DW4A 2Q67A 1ZHSA 1AJNA 2M7WA 3ETGA 3SJQC 1GN6A 3BPZA 5IWAH 1K4DC 3GIMA 4DR1B 4IHJA 5LXTB 3OUSA 4B3TO 2P0AA 3GV5B 2GUZA 2XAJA 5LBQA 1XL4A 2QM8A 2DYRC 3PW4A 2MCTA 5KFDA 1ZHQA 4Z2WA 2V1DA 1HDJA 4LF8B 2XIGA 5BZBA 2PMZA 2JGUA 3Q1KA 4TV8F 4X62B 1YJWV 4J9RA 2W57A 3PJSK 4X64B 1TAEA 2GTAA 3WG7C 2R7LA 4PHZA 4RZQA 1M57B 3K5NA 1G4YB 4ZOLF 4ECTA 4FK5C 5GONA 1A9XA 1K4CC 1GKFA 3K9SA 3MR6A 3PO3G 4FFPA 5IJ0A 3HXLA 2YS8A 1NT2B 5LL6b 3LSSA 5J2TF 5J2TA 4JAVA 4EGQA 2QJ1A 2GQSA 2P7TC 3SYPA 5C93A 1N0NA 4I55B 3BY6A 3NUAA 5CA0B 3DC5A 4LFAB 3LNNA 5LGUA 4X1YB 5KA5A 2DABA 5LHGA 2XCPA 1VBGA 3P30A 1XEQA 2QTSA 5KFBA 4X62O 1PV0A 2WSSG 4OGQB 2PYJA 2HG5C 3AW8A 4FLZA 3T5KA 4JAAA 3OTOO 2KG7A 2RMKB 3RYFB 4TUYF 2O03A 4J9NA 2ZXWB 1QLEC 4MVOA 2SCUB 2HEPA 1Z5VA 3APOA 1ROPA 3OHAA 4ECSA 4GC6A 2WLJA 1JFFB 4TM5A 4B3RB 4JYYA 4KUMA 4BW5A 2WWWA 3I55V 5KX5F 1M56C 1AILA 4JTDB 2AGPA 3H0GA 2FB9A 3RW0A 2MW2B 2LJ2A 2EIKB 1NR1A 2EIJB 4UCOA 2QA4V 1KBLA 2DWEC 1K1QA 1M7JA 1NBMG 3IC7A 2RNBA 2YS6A 1I94H 4DK0A 5C3EG 3Q4HA 4WBNB 2QSAA 4HQ6A 4JF3A 3RBEA 1XNRB 3GB7C 4PV1B 4LF7H 4O3PA 4TUYB 3T99A 4UCSA 4CH6A 1G1XB 5KG3A 4RNOA 3BRCA 3EHBB 4RUEA 3G6YA 3CCMV 4FFBA 2YIBA 5L3GA 1GLVA 4DR7O 1ORQC 5LOVA 4WCEV 1W0JG 1GSOA 4GKJH 4N23A 2UXDH 4I55F 1K92A 1EKVA 2QTOA 4DL4A 1I2KA 4A3DG 3AK1A 4ZHQB 1VF5B 1MSWD 3WNZA 4ED6A 2CK3G 3PO2G 2F23A 4A3CG 4GX5A 3H1JH 4FS2A 2XAHA 3ML0A 5KHIA 1H8HG 5HFLA 4ZQIA 3J80W 3U0ZA 1YITV 4DK1A 4PA3A 4YIOA 2OCCB 3TW7A 5BMVF 1N32B 4Q43A 4R8CA 4IR1A 1MSDA 4NVPA 2IP4A 4DR2O 5IYBO 2WLIA 1HR0O 2ILMA 3RYCB 1GGOA 2XUMA 4PZ7A 2QEXV 2WAQA 4RU9A 3E83A 3LULA 4F4WA 5KFAA 1AI7A 2Y69B 3QF7A 2BOCC 3VPDA 5H2FZ 4MV1A 5DMXA 1SZTA 1SA0A 3BQ2A 3L70H 1GN3A 3NBYB 3UO2A 1HP8A 5FNVA 2ZCEA 5KT5A 3GB8B 3W7UA 3K59A 2Q7GA 5D8DA 3U54A 2N04A 3RAXA 1I2LA 2JEIA 4JI1O 2EBOA 4QIWF 1KB9F 5C8YB 5KFRA 4QWEA 4ED2A 5B66Z 4LF5O 1V54C 3TY5A 1RJPA 3TETA 4MTXA 2E75B 5JCOC 3FKIA 4IR9A 2W7PA 2E5LH 1ET0A 2FK3A 2ZQMA 4B7EA 2RDJA 1OV9A 1PK8A 4K6NA 4EBDA 3BQ0A 5K2MA 4NYKA 4BY1G 1US6A 1FVIA 2R7MA 2WLKA 3I5DA 1ZL8A 4D7SA 4RB1A 1R3LC 1NJIW 2XGPA 2FMAA 3ETDA 2C2DA 1SETA 1AVMA 4UCRA 1DK1A 1QNMA 2R86A 1Z5WA 2ZDHA 4WBNF 3JAWB 4B3SH 1JA8A 3G6BA 4QWBA 4XYMB 3RJ0A 3CD6V 4IHJB 3HKEA 3QTCA 1Y14B 2F4VO 2LGQA 1EUDB 2R84A 2EIYA 4ASUG 1D2DA 1R6NA 1I3QA 2UUAH 1B6QA 5KX5B 1THZA 3K5MA 2R82A 5LP6F 4RZRA 3F5WC 1Q6HA 1OCZB 3RB0A 4JI0B 3RYHA 3OMIB 2W0XA 4CS4A 5KFGA 2R8HA 1MZEA 2GSMB 1OHHG 5DGBA 3ASNB 4MS2A 4B7KA 1ZUQA 5LP6B 1GN2A 1LR1A 2NNUA 1VQ6V 1Y76B 3U9TA 1FXKA 1B3QA 5I47A 1GTOA 4XDJA 3TJTA 1FYJA 3HO8A 1AP6A 5IYDG 5KFEA 1IBLB 4DR4B 4CC6A 4I9WA 1CEZA 2P4VA 1FD9A 2OCCC 4LFAO 1KUQA 4O2BF 3CXHF 3ZRWA 2H8PC 4PA6A 2CH7A 4X66B 5J2TB 1KKDA 3BFRA 3BG5A 3CYOA 3KAKA 4DV1O 4EBEA 3Q8RB 4FLVA 1KJJA 3A2FA 3WO0A 1TWFA 4IRKA 3JD3A 2QE7G 1EUCB 1R6TA 1S5LZ 4O4JA 1IBMH 2ZIMA 4X1YA 5DQIA 2KKWA 4HR7A 2FKXA 3ZHRA 1I0HA 4DV2H 1BGYH 3HR0A 1FXHA 4QPJA 4DV4O 2V58A 2R9AA 3NBZB 2ZE8A 3NGDA 1OBDA 4O4HA 1TVKA 5D1OB 2LW1A 3CRQA 1JR9A 1XNQH 2LW7A 4BIOA 4JI4B 1NR7A 1QLNA 2GBOA 4Y8VB 2Q2TA 5KT3A 2JEFA 4Q8FA 5IYDO 3QFFA 1D5NA 4LP8A 4M0JA 3HKCA 5GTIZ 4ECUA 3RR5A 5BR8H 1TUEB 2JDIG 4FMTA 1L0LH 3H1IH 3GTGA 3FKIG 3MR5A 1NH2B 3MWEA 1IYDA 1OCRB 3RIZA 1KP3A 4EYHB 5LA6F 2QGNA 1XHXA 2A7WA 4LBEC 5D1PA 4M7EA 3Q8QB 1WCMA 5BPHA 5LMUB 3WWIA 2C00A 4O7TA 3T1HO 2QYZA 3RGZA 3T9BA 5KFLA 5LP6C 1W93A 3UCSC 4RWUA 4DV2O 3JARA 4IL6Z 5JJEB 4FE2A 4YY3B 4FFBB 2ZDIA 5DLFA 1NVPB 2XAQA 5IYZA 2L35A 4NYEA 3AG1B 1B04A 1VIBA 1WP7A 4UXNA 1A48A 4F6EA 2Z04A 5FJ8G 1I7NA 1BS3A 1CXZB 4O4LF 2ZE6A 4C5AA 4JI1B 3FYEB 4J7JA 5B1NA 4O2BB 4TWKA 2UU9B 2R93G 1OCRC 3D8CA 5LGTA 3GTOA 1VP7A 3FMAA 3K9AA 4PDMA 2JA6A 4H33A 3JAKB 4XBFA 4JI4H 3RWRD 2YL2A 3ZRSA 1XQ8A 3QVNA 5LGNA 4P9PA 5L3DA 3ETJA 4UUJC 2UXDB 1OCOC 2DQ3A 2QB5A 2WTFA 4WFFA 1M4UA 2AU0A 4PI2A 1IBLH 1AI4A 1EFRG 2CE4A 4LH7A 2N05A 2IM9A 3KCXA 3N42B 3V6KA 2NR5A 5CBFA 4O3NA 1HNXO 4JI2H 3T54A 2QK4A 1KQSU 3EFFK 3OGIB 2E76B 5DAAA 1IVSA 3CE2A 2R8GA 2XD4A 5L3BA 1CKOA 3U55A 3TY9A 2LFRA 2V7QG 3H1KH 4DV6B 3MAQA 5CR5A 5KFUA 5F9NA 3JASA 2FLNA 4KFMA 1OCCB 1W0KG 3FKSG 2UU9O 2R92A 3FB7C 4JI0H 1EZ1A 2NVXA 1LUVA 4DXWA 4PDLA 2EZPA
chains in the Genus database with same CATH topology
1N33B 4LF4B 5EZYA 1BGWA 2OWOA 4L8JA 3PN1A 4MV9A 1S03G 3E22B 3TY8A 4I9QA 4PDBA 1CKNA 3W1BA 2GV9A 3HKDA 1M93A 2PYLA 4JI7H 5CB4A 3RGXA 1AN7A 4J0MA 4FM1A 1IBMB 3N44B 1IBKH 2ZIOA 3HKBB 5KHGA 5KMGB 4UFZA 3J81W 4O4JB 4LFBB 2UXBB 3ICXA 2YIBD 4TQDA 3NC0B 2UUAB 4KHPB 4DR2H 5LYJB 3HKDB 1TVKB 3JATB 4LNUA 2F95B 3JAMW 4B3TB 3KXYT 5JQGB 4GKKH 3HKBA 1HNXB 4WBNA 4OX9B 4O4LA 3H20A 5LMUH 1Q3EA 3BA8A 1Z2NX 2EX3A 4JI8B 1HNZH 1O9GA 4PI0A 3SGIA 2VWKA 4B3MH 2Q7EA 4DR6H 4JI3B 4CS2A 2HHHB 3RGBA 4YHHB 4MTDA 1XMOH 3K58A 4I4TB 4DV7B 5JH7A 3SR2C 2JS5A 4O4LB 4U3JB 4K0KB 4NXMB 1HW7A 4B3RH 2ZINA 4JI1H 4I7HA 3JAWA 1ZHSA 4DV5B 4LFCH 5IWAH 3BPZA 4O2AA 5K1PA 4DR1B 4DR3B 4IHJA 4IAJA 5LXTB 4LSXA 3T1HH 2YXLA 3RYHB 2PY5A 5KHKA 3SJCC 3OTOB 2MCTA 2E3CA 4Q0YA 3L4KA 1X4TA 1KMIZ 4GKJB 1ZHQA 4RAYA 4O4IA 4LF8B 2XIGA 2OYQA 1N34B 2JGUA 2VOBA 4X62B 4CH3A 2W57A 3K3VA 3N2KA 3T1HB 4O2BA 4X64B 4X65B 4X20A 1TAEA 4PZ8A 4X1IB 4PHZA 4RZQA 4DV5H 2F1MA 3UT5B 3K5NA 4DR5B 3JSLA 4CS3A 4FLXA 5FPRA 5GONA 5K1XA 4I50A 5IJ0A 3HXLA 1FFXA 1I94B 3N2KB 1NT2B 4TOIA 1S5JA 1HNWB 4DUZB 5FNVB 5J2TA 5LL6b 2VWJA 3SJAC 2QJ1A 2F4VH 3QG5A 2HGSA 4K8XA 1SQFA 4I55B 5CA0B 4LFAB 3B2EE 4ZI7B 1G6UA 4ZOLA 2CW7A 3LNNA 4X1YB 5IT9W 1HNXH 2UXCH 1A0IA 3QWUA 2HVRA 5EYPA 4EFEA 2P5OA 2PYJA 4UCTA 4LF5B 4LF9B 4DRXA 4JI5H 5D1OA 3BAAA 4DR7B 5LA6B 2CW8A 3KAJA 4FLZA 2PZSA 2UUCH 5JJJB 1CKMA 5ITZB 3RYFB 2O03A 4FM9A 2HEPA 1Z5VA 2UUCB 1CKNB 4YJ2B 4FLYA 4NXNB 4DR7H 4TV9B 1JFFB 4JI5B 2R72A 3BA9A 4LF7B 4B3RB 3RYFA 2ZM6H 5JJNB 1D5AA 4LFAH 3K57A 4IIJB 4R7RA 4UCOA 5KMGA 4DV3B 4LNUB 1SQGA 1I94H 3ZS8C 4DK0A 1YEWA 2YIAA 3WB2A 4WBNB 1XNRB 5D5PA 5EIBC 3N2GA 4B3TH 1J5EH 4LF7H 1E4FT 1XNRH 1SYXB 2P22C 4TUYB 1MZBA 4A2AA 4UCSA 3HKEB 4CH6A 3BRCA 3M7MX 2F93B 5KHHA 1HR0H 1P49A 2E5LB 5J2UA 2UXBH 1N36H 4LF6B 2WDTA 4FFBA 2YIBA 2VQEB 3RYIA 5IYZB 4F6RA 5LOVA 3JALA 3IG0A 4GKJH 2UXDH 3ZEDA 2Q2UA 3K5OA 3VNNA 1Q5OA 4CH4A 3BABA 4HNAA 4ZHQB 1WH2A 4O2AB 4NXNH 1KU9A 5LP6A 3UQ8A 3OTFA 1N36B 1FJGH 4LFCB 4O4IB 3JALB 1WPBA 5IJ9B 5KHIA 4LF5H 2HVSA 3J80W 3U0ZA 4DK1A 2RGVA 1S68A 1Q43A 1N32B 3RTXA 1TA8A 4DV0B 1P16A 2BTQB 1Z2OX 4X65H 4NVPA 1SA0B 4TQFA 3L4JA 1XHZA 4DV1B 4X62H 3RYCB 5LMNH 4CH5A 4MV7A 4PZ7A 4E6NA 1N34H 3RFRA 3J7AK 4DV4H 2ZM6B 3QF7A 5C8YA 3U10A 4EEQA 1SA0A 2VQFB 1FFXB 3NBYB 3E22A 4A2BA 4JYAH 5FNVA 4KL1A 2ZCEA 3RYCA 2FE3A 3GB8B 1WNSA 2PTMA 5JVDA 1IBKB 3K59A 4EB6A 3GJXB 5CB4B 4TV8A 2Q7GA 2RGRA 4APMA 4ZOLB 1FKAH 5LA6A 1L8DA 4YJ3B 4BWAA 5C8YB 1P8LA 1TGOA 3BHPA 4LF9H 2HIVA 3TY5A 4DV7H 4LF8H 2VQEH 4EFBA 4JI6H 5LMNB 1XI1A 4LF4H 4YHHH 5JCOC 3ETQA 4TV8B 2E5LH 3T1YB 4EQ5A 3JSNA 4B08A 2F4VB 4DR1H 4DR3H 4OX9H 5BMVB 1N32H 1ZAUA 2QM4A 5LYJA 1TUBA 1JFFA 5A2QW 1J5EB 1DGSA 1FVIA 4FLTA 4CC5A 4KHPH 4AHCA 4D7SA 5FD5A 4RB1A 4I4TA 4GLXA 3JARB 5JH7B 4DV3H 1XMQH 2VPSA 2HHHH 4X64H 4UCRA 2PGGA 4LMYA 1Z5WA 2YI9A 3JAWB 4B3MB 1M0TA 4B3SH 3VQXA 1XDNA 4TUYA 3WB1A 4HBNA 3RJ0A 4IHJB 3HKEA 4PZ6A 3N6XA 3QTCA 2YCHA 4UCUA 3M4IA 3N2GB 1QQCA 2UUAH 5KX5B 1N33H 3K5MA 2V4DA 1HR0B 4F6RB 4JI0B 3RYHA 2BTOA 1SKVA 4CS4A 4FM2A 3N40P 3F8NA 3EYYA 5LP6B 2YI8A 1H2SB 3MWMA 4Q6GA 1Q8IA 4X66H 3IAYA 3U11A 4HNAB 4ZHQA 4X20B 4JV5H 4K8ZA 4X1IA 5CA1A 1IBLB 4MTEA 4DR4B 4CC6A 4DUZH 2UUBH 2CAZC 4RB0A 4LSAA 1I6UA 2R70A 1VF7A 5IJ9A 2BTQA 5FD6A 4DUYB 4JV5B 1V9PA 1XMQB 3RF2A 4RB3C 3N43B 2Q7HA 1WN7A 4X66B 5J2TB 2ZNJA 4DR2B 3W1GA 5BR8B 3KAKA 3DSQA 4O4HB 4FLVA 4I55A 3A2FA 5CA0A 5FLXW 3VQYA 2PUSA 4BWSC 2XHBA 4O4JA 4AQYH 2ZIMA 1IBMH 1T5EA 4X1YA 2KKWA 4DV2H 2CFMA 1XNQB 3T1YH 2UXCB 3NBZB 2R9AA 5JVDB 3HKCB 5D1OB 1JJOA 1TVKA 3CB2A 4O4HA 4JI6B 4EB6B 2VUGA 2ZNIA 1JMKC 4FM0A 5JQGA 4JI4B 1XNQH 4DV2B 4YJ3A 1O75A 3CVZA 4FVMA 4YJ2A 3WB0A 5DISC 4TV9A 4UCVA 4BW9A 2Q2TA 3JATA 1HNWH 4B3SB 5KHJA 4NXMH 4X1KA 3HKCA 3RR5A 4FLWA 5BR8H 3CSXA 4DR5H 4JYAB 1XMOB 3RIZA 5EOYA 3C0FB 5BMVA 4U3JA 1RSOA 4IIJA 1BJTA 4JI2B 4YY3H 1XHXA 5D1PA 4M7EA 4DV4B 2HIXA 4X1KB 1HNZB 4JI8H 2HVQA 1GYFA 3VQWA 5LMUB 1SEIA 5LXTA 3RGZA 3KALA 5LP6C 1TUBB 2Q0AA 3JARA 1I7FA 5JJEB 1L2ZA 4GYCB 4YY3B 2JVDA 4FFBB 3OTOH 3FFQA 4DV0H 4AILC 1O9HA 3RYIB 5IYZA 3JAKA 1VS0A 4DRFA 1B04A 2F66C 4LR3A 1E4GT 5J2UB 4AQYB 3CHXA 3L2PA 2UU9H 5IWAB 3W5OA 5JCOA 3GDEA 4JI1B 1QHTA 5D5QA 2RQ6A 4O2BB 3S24A 5LOVB 2UU9B 2WYOA 4K0KH 4RB2C 3FMAA 1Z2PX 4D7TA 3DF7A 3JAKB 4JI4H 3RWRD 3UT5A 4ZIBA 1XQ8A 2VQFH 5GONB 4DUYH 4I50B 5EIBD 5KX5A 4JI3H 2UXDB 4DR6B 4ETSA 1M4UA 4LH6A 2WE6A 2UUBB 4PI2A 1IBLH 4LH7A 4DV6H 2IM9A 4GKKB 3JASB 4LF6H 3N42B 4DV1H 5IJ0B 1XK5A 3N41B 1M5IA 2ZJTA 4ZI7A 4JI2H 5EYPB 5EZYB 2RJZA 4LFBH 1CKOA 3TY9A 2KSWA 1X9NA 4DV6B 3VQVA 3MAQA 3KYHC 3JASA 3THOA 5ITZA 4FLUA 5CA1B 3K5LA 5FPOA 4JI7B 4JI0H 4DR4H 1FJGB 3SJBC 4RAZA 1M0WA 3LMLA 4DRXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 B;  3QWU A;  4LF4 B;  2HVR A;  4EFE A;  2OWO A;  4UCT A;  4LF5 B;  4LF9 B;  3PN1 A;  2CFM A;  3GB8 B;  3BAA A;  1IBK B;  4DR7 B;  1XNQ B;  3GJX B;  5D1O A;  3TY8 A;  2UXC B;  1CKM A;  1CKN A;  3W1B A;  3NBZ B;  5D1O B;  1P8L A;  4JI6 B;  2UUC B;  2VUG A;  1CKN B;  4NXN B;  2HIV A;  3TY5 A;  1IBM B;  4JI4 B;  4DV2 B;  4JI5 B;  4UFZ A;  3BA9 A;  4LF7 B;  4LFB B;  2UXB B;  5DIS C;  4EFB A;  4B3R B;  5LMN B;  4UCV A;  2Q2T A;  4B3S B;  3T1Y B;  3NC0 B;  4EQ5 A;  2UUA B;  4KHP B;  3JSN A;  3RR5 A;  2F4V B;  4B3T B;  1ZAU A;  4JYA B;  1XMO B;  4UCO A;  4DV3 B;  1HNX B;  1J5E B;  4OX9 B;  1DGS A;  3BA8 A;  4JI8 B;  1FVI A;  4JI2 B;  3SGI A;  4CC5 A;  5D1P A;  4DV4 B;  2HIX A;  4JI3 B;  2HHH B;  1HNZ B;  4YHH B;  1XNR B;  4GLX A;  2HVQ A;  5LMU B;  4UCR A;  4DV7 B;  4UCS A;  4B3M B;  4YY3 B;  4K0K B;  1XDN A;  4NXM B;  2E5L B;  4PZ6 A;  4LF6 B;  1VS0 A;  4DV5 B;  1B04 A;  4UCU A;  4DRF A;  2VQE B;  4DR1 B;  4DR3 B;  4AQY B;  3L2P A;  5IWA B;  3W5O A;  3GDE A;  4JI1 B;  1HR0 B;  2Q2U A;  3S24 A;  4JI0 B;  3OTO B;  2UU9 B;  4GKJ B;  3VNN A;  4LF8 B;  3BAB A;  1N34 B;  1N36 B;  3UQ8 A;  4LFC B;  4X62 B;  2UXD B;  4DR6 B;  4LH6 A;  3T1H B;  4X64 B;  2UUB B;  4X65 B;  1TAE A;  2HVS A;  4PZ8 A;  4LH7 A;  4GKK B;  1S68 A;  4DR5 B;  1N32 B;  3RTX A;  1XK5 A;  3JSL A;  1TA8 A;  4DV0 B;  1P16 A;  1IBL B;  4DR4 B;  5FPR A;  4CC6 A;  1I94 B;  4TOI A;  1HNW B;  4DV1 B;  4DUZ B;  4DUY B;  4JV5 B;  1V9P A;  1XMQ B;  4PZ7 A;  4E6N A;  1CKO A;  3TY9 A;  1X9N A;  4DV6 B;  4X66 B;  3KYH C;  2ZM6 B;  4DR2 B;  3W1G A;  5BR8 B;  4LFA B;  5FPO A;  4JI7 B;  4EEQ A;  2VQF B;  1FJG B;  3NBY B;  1A0I A; 
#chains in the Genus database with same CATH topology
 1N33 B;  4BR6 A;  4PA7 A;  1BGW A;  2HHH O;  2OWO A;  4R8U A;  4IRD A;  2AXT Z;  4FZ0 A;  1H2G A;  3PN1 A;  1ZTE A;  3E22 B;  1YZB A;  4MVZ A;  4J7K A;  3CCS V;  5CA1 F;  3RN4 A;  1S0O A;  4PDB A;  2XAG A;  3CQZ A;  2CNV A;  4JI3 O;  1VQO V;  2ZKO A;  4ZKI A;  2PYL A;  4PA9 A;  3OEE G;  3SYQ A;  2AGO A;  3FX7 A;  1IBK H;  4JV0 A;  2ASL A;  3SYO A;  2UXB B;  4YY3 O;  2YRX A;  4TQD A;  4GX1 A;  4NKG B;  2UUA B;  1Q6I A;  1TVK B;  5DGI A;  4LNU A;  3STZ C;  3JAM W;  1YCI A;  2WAM A;  3RV3 A;  2P90 A;  4WBN A;  4OX9 B;  1Q3E A;  2B1G A;  2NLJ C;  4I5S A;  2ZR2 A;  1O9G A;  3IC9 A;  3SGI A;  4NB5 A;  4CBC A;  3W7T A;  3GLK A;  4CKB A;  3E8B A;  4A3E G;  3V4Z A;  4GCZ A;  1Q86 W;  2NU9 B;  3ABK B;  3CC7 V;  2CQY A;  3AG2 C;  4TQR A;  2WPD G;  1J95 A;  4MTD A;  4YJ3 F;  3CSW A;  1SQP H;  4IRC A;  3SR2 C;  3G4S V;  1VQK V;  3Q2O A;  4U3J B;  2EJ7 A;  3PW7 A;  1IXB A;  5L3E A;  3JAW A;  4O86 A;  2NU8 B;  2W6N A;  1OCC C;  1M9N A;  4I0X A;  3SPH A;  5FR9 A;  1IUR A;  5K1P A;  4IAJ A;  1I08 A;  2YXY A;  3RYH B;  3K79 A;  4ME6 A;  3K3P A;  2Z5U A;  1QR9 A;  4F4L A;  4DL3 A;  3OTO B;  3VPB A;  1WA8 B;  1PNK A;  2E3C A;  1X4T A;  3RV4 A;  2ZGI A;  1ZET A;  4JYC A;  3MFI A;  4J9L A;  3JCZ A;  2VOB A;  3KTM A;  2IH3 C;  1ENV A;  3K3V A;  2A79 B;  2W71 A;  3N2K A;  3JD4 A;  1GM9 A;  2DE0 X;  4O2B A;  2W6J G;  4ED0 A;  5EBL C;  4PZ8 A;  4X1I B;  4N21 A;  1ULZ A;  4QJF A;  1AI6 A;  3U9S A;  5EC1 C;  5KFP A;  3CRA A;  3UT5 B;  4BXX G;  2WLI B;  4UVB A;  2ZM6 O;  1B06 A;  2RF4 A;  3MHS C;  4LWS B;  3N2K B;  4DW1 A;  1GSH A;  3SNO A;  2JGD B;  4FFR A;  3SJA C;  4IYH A;  4DYL A;  3FB5 C;  5IWA O;  1K8A W;  1XIL A;  4K8X A;  1SQF A;  4Q4D A;  1G6U A;  3DC6 A;  3E8G A;  4JGS A;  2Y4T A;  2ZDQ A;  1K3E A;  3GWK C;  3VOT A;  1HNX H;  2UXC H;  5DN6 G;  1Q90 D;  5KG0 A;  2AHZ A;  3HBL A;  2YC0 A;  2Q8V A;  4EFE A;  2P5O A;  4JI5 H;  3N6R A;  4DRX A;  3J81 N;  5D1O A;  3EVK A;  5DG7 A;  1S9F A;  2PZS A;  3CCJ V;  4DV0 O;  1TWA A;  3SPJ A;  4E2L A;  1CKN B;  1PNL A;  4YJ2 B;  2HLD G;  4NXN B;  1JPX A;  3GIL A;  5FLM G;  2IU3 A;  3BA9 A;  4LF7 B;  4EGJ A;  2EIN B;  4G28 B;  2UXD O;  2M05 A;  2E74 B;  2V5A A;  1KD1 W;  3E86 A;  1VQL V;  4FBU A;  1D5A A;  5B3S C;  1Y6X A;  1QVG U;  3BAC A;  3K57 A;  2FB5 A;  1Y1W A;  1U96 A;  3ORQ A;  5CMU A;  4DV3 B;  4B3S O;  3LDD A;  2IBZ H;  1ZX3 A;  3LNM B;  4LFC O;  5C1O A;  2YIA A;  3ZX6 A;  1RSO B;  1DTO A;  3TQT A;  5DGA A;  4DV6 O;  4JUZ A;  3G71 V;  1S0N A;  1XNR H;  4X9Q A;  1KBH A;  3JCU Z;  3HKE B;  3AK2 A;  3M7M X;  1I1M A;  5BXZ A;  3TK1 A;  3TQ1 A;  5KHH A;  1HR0 H;  4FFO A;  5J2U A;  4LFB O;  2CNU A;  4HNU A;  3RYI A;  3JAL A;  3ZHT A;  5C5J A;  3ZED A;  4X66 O;  4MAM A;  4I50 F;  2Q2U A;  2XOK G;  2COG A;  3VNN A;  1Q5O A;  4CH4 A;  3G67 A;  1WH2 A;  1M1K W;  1KU9 A;  1N36 B;  3OTF A;  1UC9 A;  4LFC B;  1YIJ V;  5LOV F;  2ZR3 A;  3JAL B;  2XND G;  5KG5 A;  4MT8 A;  3QNE A;  1H2L A;  2OIG A;  4ZBM A;  2QWN B;  1R1B A;  1KTA A;  4NR1 A;  2W6M A;  5KT4 A;  1XL6 A;  2ODM A;  4EBC A;  1QLE B;  1TA8 A;  2ZT9 B;  5E25 A;  2BTQ B;  4CMF A;  1KYO F;  1SA0 B;  5BPF A;  5C4X G;  1XHZ A;  3GIP A;  4DR3 O;  4X62 H;  2ASJ A;  3JAM N;  5LMN H;  2QR4 A;  2C28 A;  4MV7 A;  4X89 A;  1Y74 B;  3CRR A;  2JGD A;  3RFR A;  3AG3 B;  2ZM6 B;  3A0H Z;  4CE5 A;  5CB4 F;  3ZMS A;  1YXB A;  4GKJ O;  3K0G A;  2GQR A;  1FS0 G;  4Q8E A;  1FXV A;  2NVY A;  4EEQ A;  1VQ8 V;  1FFX B;  2Q4P A;  2DJV A;  3E2E A;  3E22 A;  3K5I A;  1MAB G;  4A2B A;  3GTK A;  4KL1 A;  2Q69 A;  1WNS A;  5CBH A;  1Y74 A;  3UZO A;  3GJX B;  1P7G A;  4TV8 A;  5L1K A;  3MDS A;  2R8J A;  1FKA H;  1R3I C;  5EK0 A;  3W7X A;  2J6S A;  2ALZ A;  4BWA A;  3BHP A;  3TCU A;  1OZ0 A;  1Y1V A;  2OLS A;  4EFB A;  4J10 A;  3ETQ A;  1N0J A;  2WA4 A;  2X0S A;  3KRE A;  5I5W A;  1GK9 A;  1RJQ A;  3R5H A;  4DQN A;  2XTA A;  1KJQ A;  4DR1 H;  1RK5 A;  4BBS G;  2QM4 A;  5LYJ A;  5LYJ F;  1TUB A;  4R50 A;  1J5E B;  4NTY A;  4TQS A;  3GIJ A;  2XAS A;  1IX9 A;  4O2A F;  2W70 A;  4H37 A;  5KG7 A;  4NXM O;  2CKZ B;  5JH7 B;  4DV3 H;  5KG2 A;  3KCY A;  2JA7 G;  2PGG A;  3EPI A;  3K0D A;  2YI9 A;  4B3M B;  1K97 A;  3ABT A;  1XDN A;  4YR3 A;  4AYB A;  4TUY A;  3WB1 A;  1JQ0 A;  3S3X A;  2IBK A;  4BY7 G;  3ZIA G;  4PZ6 A;  4JI7 O;  3N6X A;  5I5T A;  4FBT A;  3LQS A;  2YCH A;  3NXS A;  2ATL A;  2QM7 A;  3N2G B;  2HP8 A;  1K7D A;  4DUY O;  3PW2 A;  1QQC A;  1KJ9 A;  2Z0A A;  4J11 A;  3CCU V;  1EN4 A;  2PBZ A;  2H3O A;  1XDC A;  2UXC O;  2BTO A;  3GV7 B;  5L1J A;  1SKV A;  5HNE A;  1QR8 A;  5KFY A;  2EIL C;  2HHF A;  3F8N A;  5KFZ A;  4F50 A;  3EYY A;  5BYA A;  4O7L A;  3M99 B;  3ORR A;  1V51 A;  1H2S B;  1GH6 A;  2UVV A;  3P32 A;  3MWM A;  2JEJ A;  1EKF A;  3CJH B;  1NU1 H;  3OEH G;  4X66 H;  4FZ1 A;  3EXA A;  4JV5 H;  4X20 B;  4X1I A;  4J80 A;  4QJF B;  5CA1 A;  3HKZ E;  2QWR B;  4RO2 A;  4J9O A;  2W6I G;  2CAZ C;  2QWQ B;  4LSA A;  2FPG B;  2R70 A;  1K9M W;  5IJ9 A;  5BWT A;  1WR2 A;  4DUY B;  1XMQ B;  3RF2 A;  4DR5 O;  4MTG A;  4RB3 C;  1JXL A;  4G27 B;  4K3A A;  3DXR B;  2A9H A;  1KC8 W;  1WN7 A;  5AG2 A;  5KT7 A;  5FNV F;  2ZNJ A;  3L74 H;  5KLV H;  3W1G A;  4LF9 O;  3DSQ A;  1RFY A;  4O4H B;  3STL C;  4X88 A;  5BWR A;  4I55 A;  1XRE A;  3AG3 C;  5FLX W;  3JD2 A;  1H2N A;  3VQY A;  3KG2 A;  4JI8 O;  2PUS A;  1T36 A;  3TGU H;  2ETN A;  4AQY H;  1T5E A;  4YHH O;  1CS0 A;  5IDJ A;  2VRZ A;  4ZI7 F;  3LP8 A;  4MVU A;  1R3J C;  4QE9 A;  3GID A;  4MA5 A;  1NH2 D;  4EB6 B;  2ZE5 A;  3ZHU A;  1NTK H;  4DV2 B;  4YJ3 A;  2HGW A;  5L3F A;  2W9B A;  1I7L A;  4DV5 O;  3WB0 A;  4FFK A;  3B8M A;  4BW9 A;  3HOU G;  1HNW H;  1KC7 A;  1M56 B;  4NXM H;  3ETE A;  1Y1V G;  4U7O A;  4A93 G;  1EZJ A;  5L9X A;  3ASN C;  4I7Z B;  5I5U A;  4DR5 H;  3VPC A;  4JYA B;  2VR1 A;  1XMO B;  5EOY A;  3C0F B;  4U3J A;  1BJT A;  5FL7 G;  2EZO A;  4JI2 B;  5DEC A;  4WHX A;  4DV4 B;  3CXC U;  1PX2 A;  3QO5 A;  1GYF A;  3ZRV A;  3J80 N;  1S0V A;  2EJ2 A;  2FTK A;  2JK5 C;  1TUB B;  2OTL V;  3H0G G;  1I7F A;  4FS1 A;  4GKK O;  1L2Z A;  2ATK C;  4TSF G;  1UJW B;  3FFQ A;  3OUU A;  3RYI B;  4AI8 A;  4Q45 A;  4KHP O;  1YHQ V;  1E4G T;  3GTQ A;  2ZDI C;  5J2U B;  5EZY F;  4AQY B;  3L2P A;  5IWA B;  3CCV V;  4FIP C;  4R7C A;  3W5O A;  2LFS A;  2YEV B;  3JD1 A;  4QSH A;  4JYA O;  1JOY A;  4D7T A;  1S77 D;  4O83 A;  1RYS A;  3GV8 B;  2FLL A;  1K34 A;  3UT5 A;  3GVM A;  4RUC A;  1MNG A;  4ZIB A;  2CGN A;  1GRJ A;  1QVF U;  4DUY H;  5KX5 A;  1VAJ A;  3BQ1 A;  1EZV H;  4JYB A;  5GW7 A;  1N33 O;  2WE6 A;  3ZMU A;  4YQW A;  2YU9 A;  2UUB B;  5IP7 G;  5I5V A;  2QKC A;  1JDB B;  1NS1 A;  4ECZ A;  4DV6 H;  4GKK B;  5EWF A;  4DV1 H;  4LF6 H;  3B4S A;  2UVR A;  1JIH A;  1NKD A;  3C3T A;  4GC7 A;  2X0L A;  2YDE A;  2EUL A;  2IH1 C;  5LL6 Y;  3G6E V;  3GTL A;  1K33 A;  2IMW P;  3SPG A;  5KT6 A;  1EM1 A;  2BR0 A;  3VQV A;  2UXN A;  2W6P A;  4MV4 A;  2J6U A;  3K5L A;  1FJG B;  2RN9 A;  3SJB C;  2B9Z A;  4RAZ A;  4LCU C;  2ITC C;  4LF4 B;  2WB1 A;  3OHB A;  4YR0 A;  5EZY A;  2BSK A;  1SCU B;  4DW0 A;  2CH7 B;  1PL0 A;  5I5Y A;  3M9O B;  2VQF O;  3RVY A;  3DTU B;  1V55 C;  3CME V;  2Y0P A;  1CKN A;  1XOU A;  1CQJ B;  2GPS A;  1GAX A;  2GV9 A;  4B3R O;  1M93 A;  4JI7 H;  5CB4 A;  2YZL A;  3RGX A;  1IBM B;  4DL5 A;  3ASO B;  4UFZ A;  3T2M A;  3J81 W;  3HOV G;  1EHI A;  1BCC H;  4J7Z A;  2J6T A;  1RM1 C;  2FYU H;  3CCQ V;  5CE8 A;  3FYI B;  5IYC O;  2Y0S E;  3MR2 A;  4WFG A;  2I87 A;  3C3S A;  3D3I A;  3ABM B;  2GTS A;  3AX6 A;  3FDS A;  2F95 B;  3F5T A;  5LMN O;  1SZX A;  3KXY T;  3P3N A;  2X6B A;  5JQG B;  1IYE A;  4C5C A;  4GKK H;  4WD3 A;  2R93 A;  1Q82 W;  1HNX B;  3H20 A;  4J41 A;  5DQG A;  5LMU H;  2JA6 G;  2EX3 A;  4B3M H;  4JI3 B;  4CS2 A;  2W6Z A;  1Y67 A;  3RGB A;  4ECW A;  1F23 A;  4TV9 F;  2QWP B;  4DV7 B;  2JS5 A;  3DAA A;  3ZJZ A;  3RB3 A;  1DV2 A;  4B3R H;  2ZIN A;  1I50 A;  2UVW A;  2ZD9 A;  4O2A A;  1DF4 A;  3QQM A;  1SF9 A;  4DR3 B;  4EG0 A;  2DYS B;  3LDE A;  3VA7 A;  4LSX A;  2YXL A;  3GIK A;  2PY5 A;  5KHK A;  3OUZ A;  3SJC C;  2IA6 A;  2COI A;  2L6L A;  4Q0Y A;  4GKJ B;  3AK3 A;  4AQY O;  5KFV A;  4O4I A;  4G3I A;  2UXB O;  1BE3 H;  2OYQ A;  1N34 B;  3Q8P B;  1KKC A;  4DL7 A;  3OM3 B;  3R5F A;  1E4E A;  4YAJ B;  1NTM H;  3H1L H;  3L71 H;  3T1H B;  3AYH B;  5H6Q A;  2X6C A;  5IY5 C;  1GM7 A;  2UVU A;  4MVR A;  4O7S A;  5H5N A;  3KHL A;  1AI5 A;  4DV5 H;  1XMQ O;  2ARH A;  3ZBH A;  4DR5 B;  2JIZ G;  2DWD C;  5CN0 A;  4CS3 A;  4FLX A;  4QWC A;  3K5H A;  5BR8 O;  1I94 B;  4TOI A;  1HNW B;  1S5J A;  4QIW A;  4A3J G;  2CDY A;  1WB8 A;  1IBL O;  3QG5 A;  2F43 G;  3B2E E;  3D36 C;  2CW7 A;  2O57 A;  4PJ0 Z;  4LF8 O;  5IT9 W;  5EBM C;  1A0I A;  5BWW A;  3QWU A;  4MV8 A;  3KZI Z;  4JTA B;  1XNR O;  2JA8 G;  4LF5 B;  2Q68 A;  3VOU A;  2CW8 A;  3GTJ A;  3KAJ A;  5KG1 A;  2VQD A;  3BJY A;  5JJJ B;  3BCC H;  2DOS A;  4NTX A;  4JI0 O;  4TV9 B;  3R65 A;  1UPG A;  1VQ9 V;  2K1E A;  4HNT A;  3G6V A;  3WG7 B;  3T4D A;  5BWV A;  3OMN B;  1YJ9 V;  1ZL8 B;  5JQW A;  2UUB O;  1Z2G A;  2KG7 B;  3RYF A;  3TEK A;  5JJN B;  4LFA H;  3ZHQ A;  1FPO A;  4QPK A;  2WA3 A;  5KFQ A;  4R7R A;  3I12 A;  5KMG A;  1RPO A;  3AG7 A;  4GT1 A;  3UO3 A;  3RT3 C;  3UKM A;  4YP3 A;  1SQG A;  2W6Q A;  3P3P A;  5B5E Z;  4O7Z A;  1VBH A;  1K1S A;  5D5P A;  3FAV B;  4GX2 A;  4PDV A;  2JJ1 G;  3N2G A;  5EIB C;  5B3S B;  2GLT A;  3DTF A;  1WB7 A;  5EDW A;  4Q4C A;  4J9Z B;  1K73 W;  2ASD A;  1MZB A;  2X6A A;  4A2A A;  5CAE B;  1C30 A;  4ED3 A;  2D2C B;  4MV3 A;  5LMU O;  2F93 B;  4CKC A;  2XT9 A;  2E5L B;  3H1H H;  4UVA A;  5DED A;  2BQ3 A;  1FXK C;  1CP9 A;  5E1A C;  5IYZ B;  4DL2 A;  4F6R A;  4RNN A;  1WCM G;  1KP2 A;  2WLH A;  2DLN A;  3T4Z A;  4CKE A;  5KFX A;  3TXS A;  1HNW O;  4PWQ A;  1ZLZ A;  5J9P C;  3VBB A;  2WLN A;  3APQ A;  1MA1 A;  4NXN H;  1L0N H;  3KHH A;  4P2Z A;  5JH7 F;  3UQ8 A;  1YTF D;  1FJG H;  3CCE V;  4O4I B;  3B09 A;  1Y76 A;  1OWT A;  1GO3 F;  3K08 A;  3PW5 A;  2PMZ E;  2QF7 A;  4C7U A;  5IJ9 B;  2WAQ E;  4FPP A;  3PR4 A;  2WLL A;  3HB9 A;  3OE7 G;  2HVS A;  1N8R W;  3R23 A;  3RBZ A;  2RGV A;  1S68 A;  1Q43 A;  3G8C A;  3N8D A;  5L1I A;  1P16 A;  3LWB A;  2WB1 E;  2E5L O;  1Z2O X;  4X65 H;  1NI8 A;  4TQF A;  2PI5 A;  5KFN A;  4DV1 B;  3ZMT A;  1E1Q G;  4CH5 A;  4P9O A;  1QBZ A;  3LDC A;  3J7A K;  3OUF A;  3ZMZ A;  4A3L G;  3SI8 A;  4WFB V;  2DPI A;  5C8Y A;  5KA6 A;  3CPW U;  3U10 A;  2VQF B;  1MMM A;  4WFA V;  2PN1 A;  3N27 A;  5DGH A;  4MW3 A;  2FE3 A;  5KFC A;  2EIL B;  4EB6 A;  4O81 A;  4DL6 A;  2RGR A;  4BIZ A;  2I8C A;  5LA6 A;  1K5S A;  1L8D A;  5B1A C;  2R9I A;  3GII A;  5KG4 A;  2W8L A;  2R92 G;  2QKS A;  1SFO A;  2N74 A;  3ABL C;  4JI6 H;  5LMN B;  1XI1 A;  3H4D A;  3KHR A;  3T5L A;  4LF4 H;  4YHH H;  1PP9 H;  5JVD F;  4MVM A;  2R7Z A;  4ECV A;  3JSN A;  4B08 A;  5JQG F;  1NTZ H;  3CWB H;  2HFE C;  4LC1 A;  5IYZ F;  5KG6 A;  3RBD A;  4OX9 H;  3M8A A;  4A3F G;  3TW6 A;  3SE7 A;  1JFF A;  2WLM A;  1Y4M A;  1CQI B;  3HKZ A;  2RCV A;  4FLT A;  4CC5 A;  5JWP A;  4RAI A;  2M6Y A;  1PD3 A;  2JEU A;  4J9K A;  5EWG A;  5F9L A;  2ITD C;  3LSU A;  2HHH H;  4X64 H;  5E79 Z;  3RAQ A;  1H38 A;  5KT2 A;  1UNN C;  3WFV A;  1R6K A;  3A0B Z;  3VQX A;  4CZZ A;  3ABL B;  5LHI A;  4HBN A;  4L87 A;  1FKA O;  4F4X A;  1VQP V;  1S97 A;  3DTG A;  4UCU A;  4NZN A;  1MOF A;  3M4I A;  1IBK O;  2FPI B;  1PL4 A;  2CZG A;  4BAY A;  1N33 H;  1R9T A;  3EPG A;  1HR0 B;  3CJH A;  1RYR A;  1ZSP A;  4ED8 A;  4CHI A;  3OT7 A;  5I60 A;  3HT5 A;  4J9S A;  4FM2 A;  4RQF A;  2C2R A;  3V4S A;  2NN4 A;  2ODT X;  1IDS A;  1W96 A;  3T1Y O;  5H80 A;  3WWH A;  1VEW A;  4B3M O;  1JJ2 U;  1OCO B;  4Q6G A;  1WJZ A;  4ED1 A;  2IJK A;  4IZO A;  3IAY A;  2EIN C;  2BE3 A;  4ZHQ A;  2YXH A;  1S76 D;  4JI4 O;  2JJ2 G;  2B63 G;  4J42 A;  1P4R A;  1DLB A;  5KFO A;  4RB0 A;  2YRW A;  1I1L A;  1BQ0 A;  1VF7 A;  2Y4U A;  4IWX A;  2XCA A;  1BT8 A;  2BTQ A;  4JV5 B;  4R8U B;  3N43 B;  1GO3 E;  4DR2 B;  3FB6 C;  2Y69 C;  2HJF C;  4PBC A;  4O7N A;  4E4T A;  5L3C A;  3V6H A;  2QWO B;  5C1P A;  1JLL B;  4U7C A;  2LP7 A;  1DIK A;  2R85 A;  1YTF B;  2CFM A;  1TWH A;  2P4K A;  2UXC B;  3G80 A;  1S72 V;  5JVD B;  1JJO A;  4JI6 B;  1VF6 A;  2ZNI A;  4O7V A;  3TII A;  5GTH Z;  2R7K A;  2FL4 A;  1O75 A;  2KSD A;  2VS0 A;  1F51 A;  3QO8 A;  4FVM A;  2YWV A;  5DIS C;  4UCV A;  4EKW A;  1YDX A;  4P30 A;  5KHJ A;  4YBZ B;  1BMF G;  5FLX N;  5C44 G;  3ETH A;  1N4C A;  3B8N A;  4QGP A;  4A3K G;  4FLW A;  1VQ7 V;  3CSX A;  1TWC A;  3T9A A;  1VAR A;  2R7Z G;  3X2Q B;  4IGG A;  4U3F H;  1MG1 A;  3S3W A;  2VPQ A;  5BMV A;  2YIC A;  1RSO A;  4IIJ A;  1AR5 A;  2EIM B;  1QCE A;  2W0F C;  4YY3 H;  1I5X A;  1GMG A;  5TIS Z;  5B1B C;  2HIX A;  3GIQ A;  2HVQ A;  4MA0 A;  2EIM C;  1SEI A;  3JD0 A;  2IJI A;  3TIG A;  5LXT A;  1G2W A;  3CC2 V;  2FKL A;  1FAF A;  3PFF A;  2JVD A;  1Y1W G;  3OTO H;  4TT3 G;  1AR1 B;  3L73 H;  1O9H A;  3CC4 V;  3T5H A;  1VS0 A;  1EBO A;  4DRF A;  4LR3 A;  2HDK A;  3JRW A;  4A5U B;  2W9A A;  1XNQ O;  1QU7 A;  2CGO A;  4K35 A;  4JV2 A;  1E1R G;  1XMO O;  5JCO A;  4UB8 Z;  3GDE A;  5D5Q A;  2R8I A;  2RQ6 A;  3KKY A;  1YVW A;  2DMX A;  2WYO A;  4A3M G;  1RP3 B;  3ZMV A;  2JEG A;  1F4M A;  3DF7 A;  4QIW E;  1NVP D;  3BVO A;  4EEY A;  3QO7 A;  4YAK B;  5GON B;  2HJW A;  3VMM A;  4FJC C;  2PI4 A;  4DR6 B;  4ETS A;  2YS7 A;  4LH6 A;  2YEV A;  1RJR A;  5GON F;  3O65 A;  3TXQ A;  2ZDG A;  3E5N A;  3ABK C;  4JAU A;  2DN9 A;  2VA3 A;  1SQX H;  5EBW C;  1I1K A;  1XK5 A;  1M5I A;  4J9P A;  3MWD A;  5C8Y F;  2DZD A;  1SER A;  1KJI A;  1IBM O;  4UUG A;  1SC5 B;  4PD4 F;  5EYP B;  2ADQ B;  5LXT F;  5IY5 B;  4O82 A;  3T9C A;  1FXK B;  1CE8 A;  3RB6 A;  1X9N A;  1Q7Y W;  4QE7 A;  4FLU A;  4DR4 H;  5FPO A;  1IOW A;  4K0K O;  4DRX B;  2Z3Y A;  2EJ3 A;  1SQV H;  1Q6U A;  2HJD A;  4L8J A;  4NXN O;  1OJH A;  4MV9 A;  1S03 G;  4UVC A;  1R3K C;  3HKD A;  2DYS C;  1URF A;  1AN7 A;  4J0M A;  4FM1 A;  1SQQ H;  3D36 A;  3HKB B;  5KMG B;  1OBG A;  4O4J B;  1XUQ A;  2BSK B;  5IT9 N;  2FK1 A;  4HYO A;  3ICX A;  2YIB D;  1NZ6 A;  1H2K A;  3Q8S B;  1SES A;  3NC0 B;  5KFW A;  1KEC A;  4JAS A;  4E4E A;  2R8K A;  4ECR A;  4HN2 A;  5LYJ B;  1A0G A;  3HKD B;  2OH2 A;  3JAT B;  5J2U F;  3SPI A;  1YI2 V;  4B3T B;  3JYC A;  2HVK C;  4FU0 A;  2Q73 A;  4JPR A;  4O4L A;  3BA8 A;  1Z2N X;  1U97 A;  4JI8 B;  1VKZ A;  1HNZ H;  3G8D A;  4M9U A;  2X7R B;  4OPA A;  2Q7E A;  4DR6 H;  1SQB H;  1RK6 A;  2HHH B;  4F4Z A;  4YHH B;  2HGX A;  5KFH A;  4F4Y A;  1S10 A;  3HOY G;  3UFX B;  4MTO A;  4IHJ F;  1XMO H;  3FB8 C;  4I4T B;  3CP1 A;  4UB6 Z;  4YJ2 F;  1DV1 A;  3AG1 C;  2RDC A;  1I5Y A;  4PA4 A;  1VQM V;  1WA8 A;  4NXM B;  1HW7 A;  5HFM A;  3ASO C;  4JI1 H;  5EC2 C;  4I7H A;  1AJP A;  4I4T F;  4DV5 B;  4LFC H;  4KP4 A;  2EJR A;  1B6S A;  2HG8 A;  3T1H H;  4NZO A;  4BIU A;  3QZ8 A;  2YZM A;  2FLP A;  5KFT A;  4ECQ A;  3H40 A;  4FGR A;  3H9V A;  3CRM A;  2JA7 A;  1F7Y A;  2HHF B;  4RAY A;  1KMI Z;  1PKX A;  3L4K A;  3LSQ A;  1YJN V;  5JVL A;  1FFT B;  4OX9 O;  2PF4 E;  5T14 A;  2LGW A;  2LO1 A;  4JI2 O;  2AZ0 A;  2YW2 A;  4OXS A;  3NR7 A;  4CH3 A;  3HB3 B;  3OW2 U;  1HNZ O;  1AUX A;  1COW G;  2H94 A;  4X20 A;  4X65 B;  4XX0 B;  4O4I F;  2F1M A;  3RFC A;  1G8M A;  3K04 A;  5KAF Z;  3JSL A;  4RUF A;  4JTC B;  4FFM A;  5FPR A;  5K1X A;  4I50 A;  4ECX A;  1FFX A;  4RQE A;  2NU7 B;  2Y48 A;  4DUZ B;  5FNV B;  2VWJ A;  1MZF A;  1EN6 A;  2HR3 A;  4A3G G;  2F4V H;  5KFS A;  2HGS A;  2QKA A;  1GM8 A;  5KFI A;  1VQ5 V;  2UUA O;  4ZI7 B;  4ZOL A;  4JXU A;  2UXX A;  2XGQ A;  2HVR A;  5EYP A;  4O84 A;  4JI6 O;  3QZ7 A;  3SPC A;  4UCT A;  4LF9 B;  3BAA A;  4DR7 B;  5LA6 B;  3OSP A;  3T7A A;  1Q81 W;  5HV6 A;  2UUC H;  1CKM A;  2ADP A;  4MVQ A;  1V54 B;  5ITZ B;  4FM9 A;  2CTW A;  2W9B B;  1DAA A;  2UUC B;  2FJZ A;  1E79 G;  4FLY A;  5CA3 A;  4DR7 H;  5K3W A;  3OD4 A;  4JI5 B;  2R72 A;  3R5X A;  4RNM A;  2KB1 A;  4XDL A;  3M9N B;  5BYB A;  4DR6 O;  2OTJ V;  3KHG A;  4DUZ O;  4PEL A;  2I80 A;  4WFH A;  2ZM6 H;  4QNH B;  4GLW A;  1VF6 C;  3HPL C;  5DG9 A;  5L1L A;  1SRY A;  4IIJ B;  1RPR A;  1SS3 A;  4LNU B;  1JDE A;  2W7O A;  3OSN A;  1IXM A;  3TIN A;  3H4B A;  3E89 A;  4W4K A;  3ZS8 C;  1A3G A;  1YEW A;  4LF4 O;  2EIJ C;  1M90 W;  2EIK C;  1OCZ C;  3WB2 A;  2B63 A;  2YUA A;  4B3T H;  1J5E H;  4C5B A;  3PZP A;  2X5R A;  3MHH C;  1E4F T;  1SYX B;  2P22 C;  3W7S A;  5IYB G;  1WLE A;  4R6Z A;  2JS3 A;  2UUC O;  3IJ4 A;  1T94 A;  4O3O A;  2OT5 A;  1P49 A;  2UXB H;  3T5J A;  1N36 H;  4LF6 B;  2HKO A;  2WDT A;  3F7Y C;  5KUM A;  1B33 N;  1BSM A;  2VQE B;  3MJF A;  2ZXW C;  3RUP A;  4I0X B;  3IG0 A;  3GQC A;  2DWC A;  3PVX A;  1S0M A;  2GDS A;  1V4Y A;  3RB4 A;  2V9W A;  3ZHS A;  2GUZ B;  3K5O A;  2CTP A;  3R9R A;  1AUV A;  2OCH A;  1KUT A;  2AGQ A;  3BAB A;  4HNA A;  4O2A B;  3T1C A;  5LHH A;  5LP6 A;  2CTR A;  2DQ0 A;  2V59 A;  4XDK A;  1WPB A;  2B5U A;  3PR5 B;  5KUK A;  3AG4 B;  4HYK A;  3OMA B;  4L1K A;  1UC8 A;  4HZ3 A;  1R73 A;  3L75 H;  1E4E B;  4LF5 H;  3IN5 A;  3ZHV A;  2C22 A;  3JZ6 A;  4QW8 A;  3RTX A;  2Q6A A;  2GPW A;  5BWX A;  2VUM A;  4DV0 B;  5KFF A;  4DAA A;  3C90 A;  3SDL A;  2YZG A;  1AP5 A;  2YYA A;  3L4J A;  5I5S A;  4DR1 O;  5KAI Z;  4JI5 O;  4E6N A;  3OGC C;  2Z02 A;  3GWO A;  1N34 H;  2E2H A;  4DV4 H;  3H01 A;  3O9O A;  1S5H C;  4HNV A;  2C35 B;  4NTW A;  1JCH A;  2JA5 A;  1S3J A;  3T9F A;  4CMD A;  1B6R A;  3CCL V;  4JYA H;  1AJQ A;  3A0R A;  4O4H F;  2V4R A;  4DV3 O;  4U6P A;  3RYC A;  5JVD A;  2PTM A;  2YSU B;  1IBK B;  5CB4 B;  1FJG O;  3AEI A;  3UYY A;  4GUN A;  4APM A;  4NZM A;  3HOW G;  4Q20 A;  4ZOL B;  1P8L A;  4YJ3 B;  2CUG A;  1TGO A;  3G6X A;  4LF9 H;  3MFH A;  3L9D A;  2HIV A;  4DV7 H;  3K06 A;  2Y4R A;  4LF8 H;  3CX5 F;  5DLG A;  2VQE H;  4MVS A;  3OR6 C;  5H6R A;  4C2M A;  3E35 A;  5CBG A;  4TV8 B;  3T1Y B;  4X65 O;  3T9D A;  2YZN A;  4EQ5 A;  4KXR A;  3K03 A;  4LF7 O;  2F4V B;  4FFL A;  4DR3 H;  2NUA B;  5BMV B;  2PVP A;  1N32 H;  4ICG A;  1ZAU A;  4U7N A;  3GTP A;  5A2Q W;  2C2A A;  1DGS A;  4WF9 V;  3GTM A;  4O7Y A;  2W6O A;  5B1A B;  4KHP H;  5BY1 A;  3W7W A;  4AHC A;  4DR4 O;  4GX0 A;  5FD5 A;  4MV6 A;  3JZI A;  4I4T A;  4GLX A;  3JAR B;  4WFE A;  1LUW A;  2COJ A;  4JV5 O;  2W9C A;  1XMQ H;  5DG8 A;  3E8F A;  2VPS A;  3R66 A;  4LMY A;  2J9G A;  4YIP A;  1M0T A;  2IU0 A;  4QW9 A;  4QWD A;  2AZ2 A;  2K9P A;  5CM0 A;  2XC9 A;  3FAV A;  4DV7 O;  4TVI A;  2CNQ A;  2W9C B;  4MW8 A;  2A06 H;  3FD9 A;  4RUA A;  1L1F A;  3SYA A;  2V4D A;  5B1O A;  1HWY A;  3CEI A;  1EN5 A;  4F6R B;  5KFK A;  4RCN A;  2P6J A;  3MR3 A;  3N40 P;  3ABM C;  4AYB E;  1N56 A;  3X2Q C;  1VMG A;  4QWA A;  2IW5 A;  3CCR V;  1VQ4 V;  2FK2 A;  2OIE A;  2YI8 A;  1RM1 B;  5KFM A;  5IP9 G;  1Q8I A;  1N34 O;  5DQH A;  1M6V A;  3WWJ A;  3CS5 A;  3U11 A;  1P84 F;  4HNA B;  2R9R B;  4K8Z A;  2IJH A;  1ARO P;  2RDI A;  4MTE A;  4DUZ H;  2UUB H;  1I6U A;  5A2Q N;  4H44 B;  1EYZ A;  1XBL A;  5FD6 A;  2VUM G;  1V9P A;  2R7N A;  5IYC G;  3T9E A;  2XAF A;  2Q7H A;  3H3V H;  5IE9 A;  3IGA C;  5BR8 B;  1JVM A;  1WPX A;  1I94 O;  1KJ8 A;  4ECY A;  5CA0 A;  1BHB A;  2VA2 A;  2CTQ A;  4BWS C;  2VQE O;  2W8K A;  2XHB A;  2FPP B;  4DIM A;  4ABM A;  2JA5 G;  1X59 A;  4J9Q A;  2AW9 A;  4A3B G;  1XNQ B;  1BL8 A;  3T1Y H;  4A3I G;  5F2V O;  2G38 A;  1UFI A;  3HKC B;  3OAA G;  3CB2 A;  1W59 A;  4MTF A;  4DO2 A;  3JZF A;  3WU2 Z;  4O7W A;  2VUG A;  1H8E G;  1JMK C;  3BEH A;  4FM0 A;  5JQG A;  1PNM A;  3DGE A;  3K3W A;  1BQZ A;  1BXR A;  3PW0 A;  4IIJ F;  3CVZ A;  4YJ2 A;  1TWG A;  1YF2 A;  3AG4 C;  3B77 A;  4HAM A;  4H0L B;  3JAT A;  4TV9 A;  1WRV A;  2XCL A;  4B3S B;  2YID A;  5HBR B;  4X1K A;  4IWY A;  4O3R A;  4X64 O;  3ZRX A;  1N48 A;  2Q9L A;  3HOZ G;  3Q4H B;  1AR4 A;  3UZB A;  2DAA A;  3CEB A;  1GN4 A;  2NU6 B;  4UV9 A;  3OR7 C;  1Y66 A;  2B1I A;  2R6F A;  2AHY A;  3LUT B;  4X1K B;  1HNZ B;  2A1H A;  4JI8 H;  3VQW A;  3M9M B;  1ZQ7 A;  2BQR A;  4H13 B;  1IZ3 A;  4LF6 O;  4YB8 B;  3KAL A;  3SYC A;  2Q0A A;  4JZG A;  4O3Q A;  3D3Q A;  4GYC B;  2KQX A;  3WO1 A;  5CA0 F;  1KEE A;  1T3N A;  1WAZ A;  4DV0 H;  4AIL C;  4ED7 A;  4J9M A;  2DIK A;  5DM6 V;  3JAK A;  2F66 C;  2P67 A;  3CHX A;  3U0G A;  2BOB C;  2UU9 H;  3I4N G;  1QHT A;  1IOV A;  4IT5 A;  3S24 A;  5LOV B;  4K0K H;  4O7R A;  4RB2 C;  4G2K A;  3I4M G;  2JRI A;  1Z2P X;  2LQT A;  5EWE A;  3ABU A;  4IYI A;  2WLL B;  2Q7D A;  2VQF H;  5JUM A;  4ZHQ F;  1KT8 A;  1JX9 A;  1W2B U;  4I50 B;  5EIB D;  5KFJ A;  4JI3 H;  1WSC A;  1DF5 A;  2P06 A;  2BQU A;  1YSC A;  2IJJ A;  4YXW G;  3ZN0 A;  4JV1 A;  3ZCC A;  4X8A A;  1F4N A;  1AB3 A;  1ZWI C;  1J5E O;  3JAS B;  1C3O A;  4Z1M G;  5IJ0 B;  1JKJ B;  3N41 B;  2ZJT A;  4ZI7 A;  4LWS A;  1P7B A;  4D6T H;  2ZE7 A;  1CPY A;  4MSW C;  1BZK A;  2A3Q A;  3B40 A;  5EZY B;  1PM9 A;  1N32 O;  4Z1V A;  4BBR G;  2MK3 A;  2RJZ A;  4LFB H;  3A8T A;  2KSW A;  2Y0S A;  4FFN A;  3KYH C;  4J9Y B;  3THO A;  3ZRW B;  1M57 C;  5ITZ A;  5BWU A;  3ZN1 A;  5CA1 B;  4OPH A;  4JI7 B;  5A9G A;  2ABJ A;  4O3S A;  1PPJ H;  2V4Q A;  1M0W A;  3LML A;  1K5Q A;  2GHY A;  1H2M A;  3L72 H;  4PDR A;  2HVJ C;  3IFX A;  3JRX A;  1EKP A;  4NLG A;  5B1B B;  3DXR A;  1K83 A;  3F7V C;  3E8H A;  5KS8 A;  3TY8 A;  4I9Q A;  4EYI B;  3W1B A;  3I56 V;  2JEX A;  3CMA V;  4YR2 A;  2D3O W;  2DYR B;  4Q44 A;  1JX4 A;  3N44 B;  2ZIO A;  2C2E A;  5KHG A;  1BHA A;  4GZR B;  4XZ3 B;  4LFB B;  1NQT A;  3UM7 A;  3V6J A;  2DPJ A;  5H9C A;  4JZ2 A;  4KHP B;  2E2I A;  4DR2 H;  2BCC H;  1BNC A;  5KKN B;  4UV8 A;  3AG2 B;  1GSA A;  2Y0I A;  3CRC A;  1VQN V;  4XYL B;  2AGA A;  4O4J F;  1A32 A;  4DLK A;  3HKB A;  3RVZ A;  2FML A;  3MD0 A;  2FP4 B;  4PI0 A;  1N36 O;  2VWK A;  2Q0O C;  3OFN G;  2EJ0 A;  2R87 A;  2AQ4 A;  2Q5Z A;  3HOX G;  1LNQ A;  1V55 B;  1WP8 A;  3J7A U;  3K58 A;  4W4L A;  5JH7 A;  2QDO A;  4O4L B;  4K0K B;  5I5X A;  2A0L A;  2DW4 A;  2Q67 A;  1ZHS A;  1AJN A;  2M7W A;  3ETG A;  3SJQ C;  1GN6 A;  3BPZ A;  5IWA H;  1K4D C;  3GIM A;  4DR1 B;  4IHJ A;  5LXT B;  3OUS A;  4B3T O;  2P0A A;  3GV5 B;  2GUZ A;  2XAJ A;  5LBQ A;  1XL4 A;  2QM8 A;  2DYR C;  3PW4 A;  2MCT A;  5KFD A;  1ZHQ A;  4Z2W A;  2V1D A;  1HDJ A;  4LF8 B;  2XIG A;  5BZB A;  2PMZ A;  2JGU A;  3Q1K A;  4TV8 F;  4X62 B;  1YJW V;  4J9R A;  2W57 A;  3PJS K;  4X64 B;  1TAE A;  2GTA A;  3WG7 C;  2R7L A;  4PHZ A;  4RZQ A;  1M57 B;  3K5N A;  1G4Y B;  4ZOL F;  4ECT A;  4FK5 C;  5GON A;  1A9X A;  1K4C C;  1GKF A;  3K9S A;  3MR6 A;  3PO3 G;  4FFP A;  5IJ0 A;  3HXL A;  2YS8 A;  1NT2 B;  5LL6 b;  3LSS A;  5J2T F;  5J2T A;  4JAV A;  4EGQ A;  2QJ1 A;  2GQS A;  2P7T C;  3SYP A;  5C93 A;  1N0N A;  4I55 B;  3BY6 A;  3NUA A;  5CA0 B;  3DC5 A;  4LFA B;  3LNN A;  5LGU A;  4X1Y B;  5KA5 A;  2DAB A;  5LHG A;  2XCP A;  1VBG A;  3P30 A;  1XEQ A;  2QTS A;  5KFB A;  4X62 O;  1PV0 A;  2WSS G;  4OGQ B;  2PYJ A;  2HG5 C;  3AW8 A;  4FLZ A;  3T5K A;  4JAA A;  3OTO O;  2KG7 A;  2RMK B;  3RYF B;  4TUY F;  2O03 A;  4J9N A;  2ZXW B;  1QLE C;  4MVO A;  2SCU B;  2HEP A;  1Z5V A;  3APO A;  1ROP A;  3OHA A;  4ECS A;  4GC6 A;  2WLJ A;  1JFF B;  4TM5 A;  4B3R B;  4JYY A;  4KUM A;  4BW5 A;  2WWW A;  3I55 V;  5KX5 F;  1M56 C;  1AIL A;  4JTD B;  2AGP A;  3H0G A;  2FB9 A;  3RW0 A;  2MW2 B;  2LJ2 A;  2EIK B;  1NR1 A;  2EIJ B;  4UCO A;  2QA4 V;  1KBL A;  2DWE C;  1K1Q A;  1M7J A;  1NBM G;  3IC7 A;  2RNB A;  2YS6 A;  1I94 H;  4DK0 A;  5C3E G;  3Q4H A;  4WBN B;  2QSA A;  4HQ6 A;  4JF3 A;  3RBE A;  1XNR B;  3GB7 C;  4PV1 B;  4LF7 H;  4O3P A;  4TUY B;  3T99 A;  4UCS A;  4CH6 A;  1G1X B;  5KG3 A;  4RNO A;  3BRC A;  3EHB B;  4RUE A;  3G6Y A;  3CCM V;  4FFB A;  2YIB A;  5L3G A;  1GLV A;  4DR7 O;  1ORQ C;  5LOV A;  4WCE V;  1W0J G;  1GSO A;  4GKJ H;  4N23 A;  2UXD H;  4I55 F;  1K92 A;  1EKV A;  2QTO A;  4DL4 A;  1I2K A;  4A3D G;  3AK1 A;  4ZHQ B;  1VF5 B;  1MSW D;  3WNZ A;  4ED6 A;  2CK3 G;  3PO2 G;  2F23 A;  4A3C G;  4GX5 A;  3H1J H;  4FS2 A;  2XAH A;  3ML0 A;  5KHI A;  1H8H G;  5HFL A;  4ZQI A;  3J80 W;  3U0Z A;  1YIT V;  4DK1 A;  4PA3 A;  4YIO A;  2OCC B;  3TW7 A;  5BMV F;  1N32 B;  4Q43 A;  4R8C A;  4IR1 A;  1MSD A;  4NVP A;  2IP4 A;  4DR2 O;  5IYB O;  2WLI A;  1HR0 O;  2ILM A;  3RYC B;  1GGO A;  2XUM A;  4PZ7 A;  2QEX V;  2WAQ A;  4RU9 A;  3E83 A;  3LUL A;  4F4W A;  5KFA A;  1AI7 A;  2Y69 B;  3QF7 A;  2BOC C;  3VPD A;  5H2F Z;  4MV1 A;  5DMX A;  1SZT A;  1SA0 A;  3BQ2 A;  3L70 H;  1GN3 A;  3NBY B;  3UO2 A;  1HP8 A;  5FNV A;  2ZCE A;  5KT5 A;  3GB8 B;  3W7U A;  3K59 A;  2Q7G A;  5D8D A;  3U54 A;  2N04 A;  3RAX A;  1I2L A;  2JEI A;  4JI1 O;  2EBO A;  4QIW F;  1KB9 F;  5C8Y B;  5KFR A;  4QWE A;  4ED2 A;  5B66 Z;  4LF5 O;  1V54 C;  3TY5 A;  1RJP A;  3TET A;  4MTX A;  2E75 B;  5JCO C;  3FKI A;  4IR9 A;  2W7P A;  2E5L H;  1ET0 A;  2FK3 A;  2ZQM A;  4B7E A;  2RDJ A;  1OV9 A;  1PK8 A;  4K6N A;  4EBD A;  3BQ0 A;  5K2M A;  4NYK A;  4BY1 G;  1US6 A;  1FVI A;  2R7M A;  2WLK A;  3I5D A;  1ZL8 A;  4D7S A;  4RB1 A;  1R3L C;  1NJI W;  2XGP A;  2FMA A;  3ETD A;  2C2D A;  1SET A;  1AVM A;  4UCR A;  1DK1 A;  1QNM A;  2R86 A;  1Z5W A;  2ZDH A;  4WBN F;  3JAW B;  4B3S H;  1JA8 A;  3G6B A;  4QWB A;  4XYM B;  3RJ0 A;  3CD6 V;  4IHJ B;  3HKE A;  3QTC A;  1Y14 B;  2F4V O;  2LGQ A;  1EUD B;  2R84 A;  2EIY A;  4ASU G;  1D2D A;  1R6N A;  1I3Q A;  2UUA H;  1B6Q A;  5KX5 B;  1THZ A;  3K5M A;  2R82 A;  5LP6 F;  4RZR A;  3F5W C;  1Q6H A;  1OCZ B;  3RB0 A;  4JI0 B;  3RYH A;  3OMI B;  2W0X A;  4CS4 A;  5KFG A;  2R8H A;  1MZE A;  2GSM B;  1OHH G;  5DGB A;  3ASN B;  4MS2 A;  4B7K A;  1ZUQ A;  5LP6 B;  1GN2 A;  1LR1 A;  2NNU A;  1VQ6 V;  1Y76 B;  3U9T A;  1FXK A;  1B3Q A;  5I47 A;  1GTO A;  4XDJ A;  3TJT A;  1FYJ A;  3HO8 A;  1AP6 A;  5IYD G;  5KFE A;  1IBL B;  4DR4 B;  4CC6 A;  4I9W A;  1CEZ A;  2P4V A;  1FD9 A;  2OCC C;  4LFA O;  1KUQ A;  4O2B F;  3CXH F;  3ZRW A;  2H8P C;  4PA6 A;  2CH7 A;  4X66 B;  5J2T B;  1KKD A;  3BFR A;  3BG5 A;  3CYO A;  3KAK A;  4DV1 O;  4EBE A;  3Q8R B;  4FLV A;  1KJJ A;  3A2F A;  3WO0 A;  1TWF A;  4IRK A;  3JD3 A;  2QE7 G;  1EUC B;  1R6T A;  1S5L Z;  4O4J A;  1IBM H;  2ZIM A;  4X1Y A;  5DQI A;  2KKW A;  4HR7 A;  2FKX A;  3ZHR A;  1I0H A;  4DV2 H;  1BGY H;  3HR0 A;  1FXH A;  4QPJ A;  4DV4 O;  2V58 A;  2R9A A;  3NBZ B;  2ZE8 A;  3NGD A;  1OBD A;  4O4H A;  1TVK A;  5D1O B;  2LW1 A;  3CRQ A;  1JR9 A;  1XNQ H;  2LW7 A;  4BIO A;  4JI4 B;  1NR7 A;  1QLN A;  2GBO A;  4Y8V B;  2Q2T A;  5KT3 A;  2JEF A;  4Q8F A;  5IYD O;  3QFF A;  1D5N A;  4LP8 A;  4M0J A;  3HKC A;  5GTI Z;  4ECU A;  3RR5 A;  5BR8 H;  1TUE B;  2JDI G;  4FMT A;  1L0L H;  3H1I H;  3GTG A;  3FKI G;  3MR5 A;  1NH2 B;  3MWE A;  1IYD A;  1OCR B;  3RIZ A;  1KP3 A;  4EYH B;  5LA6 F;  2QGN A;  1XHX A;  2A7W A;  4LBE C;  5D1P A;  4M7E A;  3Q8Q B;  1WCM A;  5BPH A;  5LMU B;  3WWI A;  2C00 A;  4O7T A;  3T1H O;  2QYZ A;  3RGZ A;  3T9B A;  5KFL A;  5LP6 C;  1W93 A;  3UCS C;  4RWU A;  4DV2 O;  3JAR A;  4IL6 Z;  5JJE B;  4FE2 A;  4YY3 B;  4FFB B;  2ZDI A;  5DLF A;  1NVP B;  2XAQ A;  5IYZ A;  2L35 A;  4NYE A;  3AG1 B;  1B04 A;  1VIB A;  1WP7 A;  4UXN A;  1A48 A;  4F6E A;  2Z04 A;  5FJ8 G;  1I7N A;  1BS3 A;  1CXZ B;  4O4L F;  2ZE6 A;  4C5A A;  4JI1 B;  3FYE B;  4J7J A;  5B1N A;  4O2B B;  4TWK A;  2UU9 B;  2R93 G;  1OCR C;  3D8C A;  5LGT A;  3GTO A;  1VP7 A;  3FMA A;  3K9A A;  4PDM A;  2JA6 A;  4H33 A;  3JAK B;  4XBF A;  4JI4 H;  3RWR D;  2YL2 A;  3ZRS A;  1XQ8 A;  3QVN A;  5LGN A;  4P9P A;  5L3D A;  3ETJ A;  4UUJ C;  2UXD B;  1OCO C;  2DQ3 A;  2QB5 A;  2WTF A;  4WFF A;  1M4U A;  2AU0 A;  4PI2 A;  1IBL H;  1AI4 A;  1EFR G;  2CE4 A;  4LH7 A;  2N05 A;  2IM9 A;  3KCX A;  3N42 B;  3V6K A;  2NR5 A;  5CBF A;  4O3N A;  1HNX O;  4JI2 H;  3T54 A;  2QK4 A;  1KQS U;  3EFF K;  3OGI B;  2E76 B;  5DAA A;  1IVS A;  3CE2 A;  2R8G A;  2XD4 A;  5L3B A;  1CKO A;  3U55 A;  3TY9 A;  2LFR A;  2V7Q G;  3H1K H;  4DV6 B;  3MAQ A;  5CR5 A;  5KFU A;  5F9N A;  3JAS A;  2FLN A;  4KFM A;  1OCC B;  1W0K G;  3FKS G;  2UU9 O;  2R92 A;  3FB7 C;  4JI0 H;  1EZ1 A;  2NVX A;  1LUV A;  4DXW A;  4PDL A;  2EZP A; 
#chains in the Genus database with same CATH homology
 1N33 B;  4LF4 B;  5EZY A;  1BGW A;  2OWO A;  4L8J A;  3PN1 A;  4MV9 A;  1S03 G;  3E22 B;  3TY8 A;  4I9Q A;  4PDB A;  1CKN A;  3W1B A;  2GV9 A;  3HKD A;  1M93 A;  2PYL A;  4JI7 H;  5CB4 A;  3RGX A;  1AN7 A;  4J0M A;  4FM1 A;  1IBM B;  3N44 B;  1IBK H;  2ZIO A;  3HKB B;  5KHG A;  5KMG B;  4UFZ A;  3J81 W;  4O4J B;  4LFB B;  2UXB B;  3ICX A;  2YIB D;  4TQD A;  3NC0 B;  2UUA B;  4KHP B;  4DR2 H;  5LYJ B;  3HKD B;  1TVK B;  3JAT B;  4LNU A;  2F95 B;  3JAM W;  4B3T B;  3KXY T;  5JQG B;  4GKK H;  3HKB A;  1HNX B;  4WBN A;  4OX9 B;  4O4L A;  3H20 A;  5LMU H;  1Q3E A;  3BA8 A;  1Z2N X;  2EX3 A;  4JI8 B;  1HNZ H;  1O9G A;  4PI0 A;  3SGI A;  2VWK A;  4B3M H;  2Q7E A;  4DR6 H;  4JI3 B;  4CS2 A;  2HHH B;  3RGB A;  4YHH B;  4MTD A;  1XMO H;  3K58 A;  4I4T B;  4DV7 B;  5JH7 A;  3SR2 C;  2JS5 A;  4O4L B;  4U3J B;  4K0K B;  4NXM B;  1HW7 A;  4B3R H;  2ZIN A;  4JI1 H;  4I7H A;  3JAW A;  1ZHS A;  4DV5 B;  4LFC H;  5IWA H;  3BPZ A;  4O2A A;  5K1P A;  4DR1 B;  4DR3 B;  4IHJ A;  4IAJ A;  5LXT B;  4LSX A;  3T1H H;  2YXL A;  3RYH B;  2PY5 A;  5KHK A;  3SJC C;  3OTO B;  2MCT A;  2E3C A;  4Q0Y A;  3L4K A;  1X4T A;  1KMI Z;  4GKJ B;  1ZHQ A;  4RAY A;  4O4I A;  4LF8 B;  2XIG A;  2OYQ A;  1N34 B;  2JGU A;  2VOB A;  4X62 B;  4CH3 A;  2W57 A;  3K3V A;  3N2K A;  3T1H B;  4O2B A;  4X64 B;  4X65 B;  4X20 A;  1TAE A;  4PZ8 A;  4X1I B;  4PHZ A;  4RZQ A;  4DV5 H;  2F1M A;  3UT5 B;  3K5N A;  4DR5 B;  3JSL A;  4CS3 A;  4FLX A;  5FPR A;  5GON A;  5K1X A;  4I50 A;  5IJ0 A;  3HXL A;  1FFX A;  1I94 B;  3N2K B;  1NT2 B;  4TOI A;  1S5J A;  1HNW B;  4DUZ B;  5FNV B;  5J2T A;  5LL6 b;  2VWJ A;  3SJA C;  2QJ1 A;  2F4V H;  3QG5 A;  2HGS A;  4K8X A;  1SQF A;  4I55 B;  5CA0 B;  4LFA B;  3B2E E;  4ZI7 B;  1G6U A;  4ZOL A;  2CW7 A;  3LNN A;  4X1Y B;  5IT9 W;  1HNX H;  2UXC H;  1A0I A;  3QWU A;  2HVR A;  5EYP A;  4EFE A;  2P5O A;  2PYJ A;  4UCT A;  4LF5 B;  4LF9 B;  4DRX A;  4JI5 H;  5D1O A;  3BAA A;  4DR7 B;  5LA6 B;  2CW8 A;  3KAJ A;  4FLZ A;  2PZS A;  2UUC H;  5JJJ B;  1CKM A;  5ITZ B;  3RYF B;  2O03 A;  4FM9 A;  2HEP A;  1Z5V A;  2UUC B;  1CKN B;  4YJ2 B;  4FLY A;  4NXN B;  4DR7 H;  4TV9 B;  1JFF B;  4JI5 B;  2R72 A;  3BA9 A;  4LF7 B;  4B3R B;  3RYF A;  2ZM6 H;  5JJN B;  1D5A A;  4LFA H;  3K57 A;  4IIJ B;  4R7R A;  4UCO A;  5KMG A;  4DV3 B;  4LNU B;  1SQG A;  1I94 H;  3ZS8 C;  4DK0 A;  1YEW A;  2YIA A;  3WB2 A;  4WBN B;  1XNR B;  5D5P A;  5EIB C;  3N2G A;  4B3T H;  1J5E H;  4LF7 H;  1E4F T;  1XNR H;  1SYX B;  2P22 C;  4TUY B;  1MZB A;  4A2A A;  4UCS A;  3HKE B;  4CH6 A;  3BRC A;  3M7M X;  2F93 B;  5KHH A;  1HR0 H;  1P49 A;  2E5L B;  5J2U A;  2UXB H;  1N36 H;  4LF6 B;  2WDT A;  4FFB A;  2YIB A;  2VQE B;  3RYI A;  5IYZ B;  4F6R A;  5LOV A;  3JAL A;  3IG0 A;  4GKJ H;  2UXD H;  3ZED A;  2Q2U A;  3K5O A;  3VNN A;  1Q5O A;  4CH4 A;  3BAB A;  4HNA A;  4ZHQ B;  1WH2 A;  4O2A B;  4NXN H;  1KU9 A;  5LP6 A;  3UQ8 A;  3OTF A;  1N36 B;  1FJG H;  4LFC B;  4O4I B;  3JAL B;  1WPB A;  5IJ9 B;  5KHI A;  4LF5 H;  2HVS A;  3J80 W;  3U0Z A;  4DK1 A;  2RGV A;  1S68 A;  1Q43 A;  1N32 B;  3RTX A;  1TA8 A;  4DV0 B;  1P16 A;  2BTQ B;  1Z2O X;  4X65 H;  4NVP A;  1SA0 B;  4TQF A;  3L4J A;  1XHZ A;  4DV1 B;  4X62 H;  3RYC B;  5LMN H;  4CH5 A;  4MV7 A;  4PZ7 A;  4E6N A;  1N34 H;  3RFR A;  3J7A K;  4DV4 H;  2ZM6 B;  3QF7 A;  5C8Y A;  3U10 A;  4EEQ A;  1SA0 A;  2VQF B;  1FFX B;  3NBY B;  3E22 A;  4A2B A;  4JYA H;  5FNV A;  4KL1 A;  2ZCE A;  3RYC A;  2FE3 A;  3GB8 B;  1WNS A;  2PTM A;  5JVD A;  1IBK B;  3K59 A;  4EB6 A;  3GJX B;  5CB4 B;  4TV8 A;  2Q7G A;  2RGR A;  4APM A;  4ZOL B;  1FKA H;  5LA6 A;  1L8D A;  4YJ3 B;  4BWA A;  5C8Y B;  1P8L A;  1TGO A;  3BHP A;  4LF9 H;  2HIV A;  3TY5 A;  4DV7 H;  4LF8 H;  2VQE H;  4EFB A;  4JI6 H;  5LMN B;  1XI1 A;  4LF4 H;  4YHH H;  5JCO C;  3ETQ A;  4TV8 B;  2E5L H;  3T1Y B;  4EQ5 A;  3JSN A;  4B08 A;  2F4V B;  4DR1 H;  4DR3 H;  4OX9 H;  5BMV B;  1N32 H;  1ZAU A;  2QM4 A;  5LYJ A;  1TUB A;  1JFF A;  5A2Q W;  1J5E B;  1DGS A;  1FVI A;  4FLT A;  4CC5 A;  4KHP H;  4AHC A;  4D7S A;  5FD5 A;  4RB1 A;  4I4T A;  4GLX A;  3JAR B;  5JH7 B;  4DV3 H;  1XMQ H;  2VPS A;  2HHH H;  4X64 H;  4UCR A;  2PGG A;  4LMY A;  1Z5W A;  2YI9 A;  3JAW B;  4B3M B;  1M0T A;  4B3S H;  3VQX A;  1XDN A;  4TUY A;  3WB1 A;  4HBN A;  3RJ0 A;  4IHJ B;  3HKE A;  4PZ6 A;  3N6X A;  3QTC A;  2YCH A;  4UCU A;  3M4I A;  3N2G B;  1QQC A;  2UUA H;  5KX5 B;  1N33 H;  3K5M A;  2V4D A;  1HR0 B;  4F6R B;  4JI0 B;  3RYH A;  2BTO A;  1SKV A;  4CS4 A;  4FM2 A;  3N40 P;  3F8N A;  3EYY A;  5LP6 B;  2YI8 A;  1H2S B;  3MWM A;  4Q6G A;  1Q8I A;  4X66 H;  3IAY A;  3U11 A;  4HNA B;  4ZHQ A;  4X20 B;  4JV5 H;  4K8Z A;  4X1I A;  5CA1 A;  1IBL B;  4MTE A;  4DR4 B;  4CC6 A;  4DUZ H;  2UUB H;  2CAZ C;  4RB0 A;  4LSA A;  1I6U A;  2R70 A;  1VF7 A;  5IJ9 A;  2BTQ A;  5FD6 A;  4DUY B;  4JV5 B;  1V9P A;  1XMQ B;  3RF2 A;  4RB3 C;  3N43 B;  2Q7H A;  1WN7 A;  4X66 B;  5J2T B;  2ZNJ A;  4DR2 B;  3W1G A;  5BR8 B;  3KAK A;  3DSQ A;  4O4H B;  4FLV A;  4I55 A;  3A2F A;  5CA0 A;  5FLX W;  3VQY A;  2PUS A;  4BWS C;  2XHB A;  4O4J A;  4AQY H;  2ZIM A;  1IBM H;  1T5E A;  4X1Y A;  2KKW A;  4DV2 H;  2CFM A;  1XNQ B;  3T1Y H;  2UXC B;  3NBZ B;  2R9A A;  5JVD B;  3HKC B;  5D1O B;  1JJO A;  1TVK A;  3CB2 A;  4O4H A;  4JI6 B;  4EB6 B;  2VUG A;  2ZNI A;  1JMK C;  4FM0 A;  5JQG A;  4JI4 B;  1XNQ H;  4DV2 B;  4YJ3 A;  1O75 A;  3CVZ A;  4FVM A;  4YJ2 A;  3WB0 A;  5DIS C;  4TV9 A;  4UCV A;  4BW9 A;  2Q2T A;  3JAT A;  1HNW H;  4B3S B;  5KHJ A;  4NXM H;  4X1K A;  3HKC A;  3RR5 A;  4FLW A;  5BR8 H;  3CSX A;  4DR5 H;  4JYA B;  1XMO B;  3RIZ A;  5EOY A;  3C0F B;  5BMV A;  4U3J A;  1RSO A;  4IIJ A;  1BJT A;  4JI2 B;  4YY3 H;  1XHX A;  5D1P A;  4M7E A;  4DV4 B;  2HIX A;  4X1K B;  1HNZ B;  4JI8 H;  2HVQ A;  1GYF A;  3VQW A;  5LMU B;  1SEI A;  5LXT A;  3RGZ A;  3KAL A;  5LP6 C;  1TUB B;  2Q0A A;  3JAR A;  1I7F A;  5JJE B;  1L2Z A;  4GYC B;  4YY3 B;  2JVD A;  4FFB B;  3OTO H;  3FFQ A;  4DV0 H;  4AIL C;  1O9H A;  3RYI B;  5IYZ A;  3JAK A;  1VS0 A;  4DRF A;  1B04 A;  2F66 C;  4LR3 A;  1E4G T;  5J2U B;  4AQY B;  3CHX A;  3L2P A;  2UU9 H;  5IWA B;  3W5O A;  5JCO A;  3GDE A;  4JI1 B;  1QHT A;  5D5Q A;  2RQ6 A;  4O2B B;  3S24 A;  5LOV B;  2UU9 B;  2WYO A;  4K0K H;  4RB2 C;  3FMA A;  1Z2P X;  4D7T A;  3DF7 A;  3JAK B;  4JI4 H;  3RWR D;  3UT5 A;  4ZIB A;  1XQ8 A;  2VQF H;  5GON B;  4DUY H;  4I50 B;  5EIB D;  5KX5 A;  4JI3 H;  2UXD B;  4DR6 B;  4ETS A;  1M4U A;  4LH6 A;  2WE6 A;  2UUB B;  4PI2 A;  1IBL H;  4LH7 A;  4DV6 H;  2IM9 A;  4GKK B;  3JAS B;  4LF6 H;  3N42 B;  4DV1 H;  5IJ0 B;  1XK5 A;  3N41 B;  1M5I A;  2ZJT A;  4ZI7 A;  4JI2 H;  5EYP B;  5EZY B;  2RJZ A;  4LFB H;  1CKO A;  3TY9 A;  2KSW A;  1X9N A;  4DV6 B;  3VQV A;  3MAQ A;  3KYH C;  3JAS A;  3THO A;  5ITZ A;  4FLU A;  5CA1 B;  3K5L A;  5FPO A;  4JI7 B;  4JI0 H;  4DR4 H;  1FJG B;  3SJB C;  4RAZ A;  1M0W A;  3LML A;  4DRX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...