4UFZA

Synthesis of novel nad dependant dna ligase inhibitors via negishi cross-coupling: development of sar and resistance studies
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA LIGASE
publication title Negishi Cross-Coupling Enabled Synthesis of Novel Nad(+)-Dependent DNA Ligase Inhibitors and Sar Development.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ufzA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ufzA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ufzA02
2HHHB 4UFZA 3W5OA 4JI8B 2VQEB 4DV6B 2CFMA 4UCTA 3OTOB 2F4VB 4LF7B 3UQ8A 1XMQB 1FJGB 5LMNB 4TOIA 5D1OB 4LH7A 4DR6B 4YHHB 4DUYB 4CC5A 3KYHC 1HNZB 4UCVA 5LMUB 2UUAB 2VUGA 4PZ8A 3JSNA 4JI1B 4EFEA 4LF6B 2HIXA 4OX9B 3GJXB 4UCUA 2Q2TA 5BR8B 1IBLB 1TAEA 4JI0B 3NC0B 1N32B 3W1BA 1FVIA 4LH6A 5D1OA 3NBZB 3VNNA 1TA8A 4EEQA 4KHPB 3L2PA 2OWOA 4X65B 2E5LB 2HVQA 1V9PA 4DV3B 4GKJB 3GB8B 1X9NA 3BA8A 4JI5B 2UXCB 4EQ5A 4JI6B 2HVSA 1CKNA 3TY9A 5DISC 1P8LA 1CKMA 1HNWB 4PZ6A 4LFCB 4LF5B 2ZM6B 3BA9A 4UCOA 2VQFB 1S68A 3GDEA 1I94B 3W1GA 1ZAUA 4DV2B 4LF8B 4DR7B 1A0IA 3T1YB 4K0KB 4DV7B 3BAAA 4NXMB 4B3RB 3S24A 5FPOA 1XNQB 4DR3B 4JI4B 3NBYB 4JI2B 3JSLA 1XK5A 4CC6A 4GLXA 1VS0A 2HVRA 4DR1B 3RTXA 4JV5B 4E6NA 1IBMB 4JI7B 4DR2B 4AQYB 1XNRB 2UXBB 1HR0B 4DUZB 4NXNB 4LFBB 4DV0B 4LFAB 4YY3B 3TY5A 4X62B 4DRFA 4B3TB 5D1PA 5FPRA 4UCRA 1HNXB 3RR5A 3TY8A 3T1HB 2HIVA 2UUCB 5IWAB 4DV1B 2UXDB 1IBKB 2Q2UA 3QWUA 3SGIA 1DGSA 2UU9B 4X66B 4UCSA 1N34B 4JYAB 4B3SB 4X64B 4DV4B 1J5EB 4LF9B 4DR5B 1N36B 1P16A 4DV5B 4LF4B 3BABA 1B04A 1N33B 1CKOA 4B3MB 4EFBA 3PN1A 4PZ7A 1XMOB 4GKKB 4DR4B 2UUBB 1CKNB 4JI3B 1XDNA
chains in the Genus database with same CATH superfamily
3OEEG 3L70H 2W6PA 2YRWA 2WLKA 3OAAG 3BPZA 4UUJC 5C8YF 2BQ3A 5LGUA 1BCCH 4WBNB 3OUZA 1C30A 5LGTA 4JI3O 1VQMV 2ODMA 1QHTA 3U9TA 2Q73A 2JA7G 4PA9A 4MV6A 4MTOA 3GIJA 4DV0H 1K97A 1HNZB 4KL1A 1WRVA 3WO1A 2YDEA 4EFEA 3TXSA 3P30A 2Y69B 5CR5A 3ZMTA 1K33A 5C1OA 1KJJA 3HOZG 2R93A 3E5NA 3N40P 5EIBD 4BR6A 4X9QA 2NU8B 2HG8A 2FL4A 2UVRA 1OCOC 1SQGA 3H4BA 3E86A 2XAQA 3GB8B 2DQ0A 1OV9A 1TUBB 3TINA 2DWEC 3JD4A 4NYEA 5BR8O 2B63G 2XAHA 1Y6XA 4EQ5A 1EUDB 1GN3A 3CRCA 4ABMA 1V55B 3RYHB 2FB9A 4HNUA 5BWUA 3IC7A 2RGRA 2FKXA 5KMGB 4DV2B 2H8PC 3TETA 5J9PC 4IYHA 3T1YB 2WLMA 2LP7A 2Q7EA 1A9XA 1EN5A 2JK5C 4LF6H 2LFSA 3L4KA 3KZIZ 4O7VA 1KTAA 4D7TA 2HVRA 2ASLA 2QGNA 2VQDA 2PMZA 5F9LA 3ABUA 5EC1C 1GM8A 5K1PA 5KFXA 2WLLB 3J81N 4HYOA 4LFBB 2XT9A 1XMQH 3RFRA 4J9KA 2WPDG 2ETNA 1WR2A 3MAQA 5FNVA 4AQYO 2SCUB 4YHHH 4KP4A 1IX9A 1GO3F 2UUCB 3LWBA 3K3WA 4AHCA 2XHBA 4LFAO 3M9OB 3B40A 4R7CA 4LF4O 2WLLA 4JPRA 4I0XB 4DR3H 3OM3B 1YVWA 3ETHA 1N0NA 2GUZB 3TW6A 1UNNC 3G67A 1K8AW 2A9HA 2DE0X 2COIA 1CE8A 4DRXB 1O9HA 3JZ6A 3PW2A 4ZHQF 1IBKO 2EIKB 2IJKA 4X64B 5KFIA 1J5EB 4O84A 4DV3H 4MVOA 1P16A 2ZCEA 2MCTA 4I0XA 3KXYT 3RJ0A 1IDSA 2GDSA 2GUZA 1SETA 5J2UF 3J80N 3GDEA 3T9BA 3SYCA 4DRXA 1AN7A 2XIGA 5L1LA 4JXUA 1Z2GA 2WLNA 3VMMA 5B1BC 3VPBA 4NXMH 4EB6B 3SR2C 4RNMA 1W59A 4PA6A 4B3MO 2VA2A 4H13B 1Q5OA 1NVPD 3CEIA 2ADPA 3UQ8A 4CE5A 2UUBO 2Y48A 1FYJA 4GX1A 5LA6F 4L8JA 1FFXB 1OCOB 1KQSU 4M7EA 2Y0PA 2J6TA 4J41A 4UVAA 4I4TA 2GPWA 1JXLA 3UT5B 3KYHC 3HOUG 5IYCG 3DTFA 3RAQA 2YCHA 4X8AA 1FJGO 4XDLA 5KFVA 3LDEA 2JIZG 1RFYA 3JALB 3JARB 1JDBB 4DR6O 4UV8A 5CA0B 3MR5A 1FFXA 2HHHH 3Q1KA 1O75A 4FM2A 5BWRA 2R7NA 2W6QA 3K5OA 4QWBA 4WFEA 1I5XA 2L6LA 3UT5A 5FLXN 1QLNA 1AUVA 4CH4A 4MS2A 3U11A 2AU0A 3JALA 3JARA 5BWTA 1G4YB 1LUVA 3DTGA 1K5QA 5I5SA 4XDJA 1S03G 4JYBA 4ZIBA 2UXCO 1HW7A 5CE8A 3NBYB 1QVFU 5KLVH 2ZM6O 5JH7F 1VAJA 5EWEA 3SPHA 1MSDA 4DW0A 3MWEA 4JI0H 5FD5A 1KP3A 4PHZA 5KFBA 4G3IA 2PYLA 1VQ8V 2PTMA 1XHZA 2ZIOA 1EM1A 3BHPA 4FE2A 3K5LA 1K1SA 4IZOA 3N6RA 1NBMG 5EYPA 4RB2C 4F4ZA 1XOUA 1Y76B 2DPIA 2HIVA 1RPOA 4DV1B 3W7UA 3OTFA 4X62O 4O81A 5D8DA 5IYDO 1MZFA 2FTKA 4YIPA 4KFMA 3AEIA 1M6VA 1GYFA 5BR8H 4X66B 4EBEA 3GTKA 2B1GA 3R65A 4NTYA 4NB5A 1Y76A 2CDYA 3DAAA 2BSKB 1M7JA 4U3FH 3N44B 3ZCCA 1KECA 1D2DA 2KSDA 3GTJA 5DLFA 1DV1A 4CS2A 3VPDA 4O3SA 3H20A 1RJPA 3SJQC 4DL6A 3K9AA 3W7XA 5IYZB 4FZ0A 3WNZA 1AI7A 5H6QA 3CQZA 2OT5A 4MW8A 1F23A 4O2BA 1BHAA 1VF7A 2YICA 3ORQA 2JDIG 3UO3A 2RCVA 1Y14B 4ECXA 1OCZB 1YEWA 3B8NA 4O3RA 2C28A 4AQYH 2EILC 4FFPA 2W71A 3TIGA 2PN1A 2AGOA 2O03A 5L3CA 4LF4H 2FPIB 4JI1B 2EIYA 1KC7A 3KHHA 4ED8A 3IC9A 4YR3A 2R72A 4I9WA 4C2MA 3WU2Z 5LYJA 1IBKH 3LUTB 1SZTA 1YDXA 2P4VA 3KREA 5BPHA 1XREA 5I47A 5I60A 3CS5A 5KUKA 3E35A 1I3QA 2HVQA 1B06A 2FLLA 4J9QA 4QIWE 1QBZA 5B5EZ 2Z0AA 1SA0B 4JI6B 1GN6A 1A3GA 1VQOV 1I1KA 2HJFC 5KHIA 3G8CA 3ABTA 2V4DA 4LCUC 4W4KA 4IHJB 2YXHA 3MDSA 2F1MA 1KD1W 3UYYA 1VQPV 4DL5A 1GN4A 5FPOA 3VOUA 4B3MH 1R6NA 4JI2B 5B3SB 3SYAA 3CCVV 2K9PA 1HNXO 1R6KA 3LSSA 5CA3A 1SA0A 1H38A 3R5FA 1NTZH 5K3WA 2W9CA 4JAVA 2Y0SA 2E75B 1YTFD 1X59A 3FKSG 2GLTA 1Y74B 3K04A 2P06A 2ZD9A 1H2LA 4IHJA 2HDKA 2YZGA 4GKJH 4YY3B 4YJ2B 4NKGB 2FLNA 3CRAA 2JRIA 2CZGA 4DR1O 3SE7A 3N2KA 4ECWA 5KT6A 1BZKA 1OZ0A 1R73A 1MNGA 1AB3A 4Q43A 4RNOA 1V54C 3K03A 2N74A 5CB4B 2Q2UA 1Y74A 2HJWA 3S3WA 4BWSC 4B3RH 4F4LA 3Q4HB 3WFVA 1MABG 1H2GA 5KFGA 2W6ZA 1THZA 4YJ2A 5KKNB 2IMWP 3T1HO 2GTAA 3OR6C 2Z04A 4FGRA 3UCSC 5IJ9B 4ECQA 1L0LH 1M1KW 3RN4A 2E2IA 2IW5A 5I5XA 3CHXA 4YBZB 3Q4HA 1GTOA 3W7TA 3BQ2A 4DV4O 1WP8A 4GKKB 2A1HA 3H0GA 4IIJA 1R3KC 1NZ6A 3B09A 5IJ0A 1N36O 1QNMA 5IJ9A 2HKOA 2JA5A 3W5OA 1MOFA 2QJ1A 4JI8B 4MAMA 3ETEA 2NU9B 3H3VH 2UU9H 4Q44A 2BE3A 2CH7B 1KBLA 3FD9A 4GT1A 3MFIA 2CTRA 5D1OB 5KFRA 2H94A 2HHFB 4GC6A 4LF9H 1M0TA 3JAWB 3WB1A 2YSUB 2VUGA 1K7DA 4FVMA 3K5MA 1PPJH 5KFWA 5LP6C 3H1HH 3HT5A 2CH7A 4PV1B 1G1XB 1RM1C 2YIAA 5D1OA 2UUAO 3HKCB 3G6EV 5LMUO 4G2KA 3CC2V 4X65B 2XCPA 3JASB 1W96A 3JAWA 3OTOH 4RZQA 5JJEB 1F4NA 1I7FA 2CTWA 1ROPA 3T9EA 3RYIB 4TV8F 4FFKA 5DN6G 3ZN0A 2EBOA 3I5DA 3AK1A 1VMGA 1RYRA 2WLHA 1GRJA 5JUMA 3OW2U 2XTAA 4Q45A 1IYEA 1EKVA 1CP9A 5KFJA 4K8ZA 3HKCA 2LFRA 4CKCA 4HYKA 1K3EA 2KSWA 3UO2A 2PGGA 1M56B 1U96A 3AK3A 3JSLA 2IJHA 4A3BG 2YIBD 3RYIA 1V54B 4LF5O 1M5IA 2RQ6A 2VQFO 3X2QC 1IBLH 3PW7A 3AG3C 4TM5A 5KG4A 1XNQO 1FXVA 2H3OA 4IR9A 2XGQA 1KP2A 2EX3A 4TQDA 3K3VA 1WB8A 2JEXA 4JTAB 4PDVA 2FK1A 1GSAA 1Z5VA 5KA6A 1Z5WA 4G27B 4DR2O 2EIMB 4FFMA 1I08A 3KAJA 5DEDA 3G8DA 5IWAB 4B7KA 4DUZO 1FXKB 4ICGA 3I12A 1OCCB 2Y0IA 3RB3A 4B3TO 2YUAA 1OHHG 3KCYA 4MT8A 1T36A 2DYSB 2IBKA 5BMVB 3CC4V 2AGAA 5KHKA 1IBMH 4I7ZB 2Y0SE 5GTHZ 2QWNB 3QF7A 2LGWA 1XNRH 3GV8B 2ILMA 1HR0H 3ABMB 4O2AB 4O7TA 2VOBA 1BL8A 1N33B 3HR0A 1WJZA 3TQTA 2M7WA 1PL0A 1I2LA 2QDOA 4JGSA 5KFYA 4TUYB 2CNQA 1SQVH 5EOYA 4J11A 1HNXH 4BIZA 2JS3A 3RV3A 4H0LB 4UFZA 3WG7B 3HOXG 2CGNA 2IU0A 4DO2A 5I5TA 2RDIA 3FB7C 2FPGB 5LP6B 2C35B 2JJ2G 2F4VB 3PW4A 4DR1H 4JASA 5LMNB 1ZHQA 5EC2C 2RDCA 4GCZA 1PKXA 4Q20A 2UVVA 2YIBA 2DLNA 3CXCU 5FNVF 4FPPA 3CCSV 2VQEO 1KUQA 4FS1A 1CS0A 1IVSA 3BJYA 2PZSA 4FM9A 2ZIMA 3MD0A 4Q4DA 2LJ2A 4J7KA 3SPIA 5E79Z 4O7SA 5KAFZ 4KHPB 2R7KA 4U7NA 4K3AA 3JD0A 2OCCB 3TW7A 4LF6O 3ZRXA 1JX4A 2Q8VA 1Q7YW 1HDJA 3JZIA 2FMAA 4O4IB 4JYCA 4FLXA 4QNHB 4JI5B 4I5SA 2HVSA 1SQQH 2MK3A 1Q81W 2R86A 1HNWB 4PZ6A 4LFCB 3C0FB 1S68A 4R50A 2F66C 3W7WA 3WWJA 3W1GA 3K9SA 2IH1C 2EJ3A 4GZRB 4K0KB 1QR9A 4EYHB 2RDJA 1CXZB 3K06A 2EINC 3BEHA 3DXRB 1H8HG 4O4IA 1TWAA 1I5YA 5IP7G 2PI4A 4BY1G 4A3JG 2FMLA 3J7AK 5IYBO 3DTUB 3BRCA 3P3PA 3RYCB 5EZYB 1I2KA 2W7PA 4DR3O 1I6UA 4I4TF 4NXNB 3QO7A 4CHIA 3KHGA 2W9BB 3TY5A 3ASOC 4X1IA 1Z2OX 2X7RB 1NTMH 1KT8A 1NR7A 4DV2H 2UUAH 3RYCA 5EZYA 4C5CA 1GLVA 3T1YH 5D5PA 1WH2A 4EYIB 2P5OA 3RB4A 2IJIA 3SYOA 2W9BA 1S0NA 3ASNC 4U6PA 4B3SB 3AW8A 5H9CA 1AI5A 4MTXA 1GK9A 3FMAA 4A3IG 5EWFA 3T4DA 1K4CC 4CH6A 4DR5B 1ZTEA 5L3BA 4LFBH 1TWCA 1RSOB 3AG4B 4X1KB 2R6FA 4O4HA 1A0GA 3C3TA 1LR1A 2HJDA 3F5WC 2V9WA 4DR4B 2VQFH 2OTLV 3R5HA 4FBTA 1VBHA 3KKYA 1A48A 4E2LA 4UB6Z 1XNQH 2VUMA 1JQ0A 3WWHA 4HN2A 5GTIZ 1P84F 1RSOA 4MV4A 4LF7B 4J80A 4DQNA 3M7MX 4BAYA 2HHHO 1XUQA 2UXNA 3ZRSA 2FE3A 4NYKA 3CD6V 3R66A 1EZVH 3GVMA 2Q0AA 4TVIA 1J5EH 4J9SA 2ITDC 2NLJC 4TT3G 3HB9A 1P7GA 1F51A 5JVDA 2ASDA 5F2VO 2V7QG 3G80A 3MR3A 3MR2A 1GAXA 1D5AA 3W1BA 4AYBE 3AG2B 3VNNA 3F8NA 1TA8A 3ZS8C 1KJIA 2RGVA 2AGPA 2WDTA 2M6YA 1GKFA 5IT9W 1IXMA 2HP8A 4F4YA 3GLKA 1BSMA 2DIKA 2XOKG 4JI0O 3VBBA 5EIBC 3ZRVA 5HBRB 3CB2A 4J7JA 1NKDA 3K79A 3K5NA 1GN2A 3BA9A 1AJNA 3PW5A 4ZQIA 3ZMSA 1FKAO 3S24A 4J0MA 4O2BF 3PO3G 4YXWG 4WBNA 3CC7V 4UVCA 2E76B 1SC5B 4JV5B 4CH3A 4H44B 4DV7O 2VQEH 1TVKB 2YL2A 5BY1A 4NZMA 5KFMA 2O57A 4C5BA 3CCEV 1R3JC 5KFQA 4J9NA 3T1CA 4J9ZB 3ORRA 1S77D 2COGA 1HWYA 1SFOA 5H6RA 1B6RA 1W93A 4N23A 5LYJF 1VF6A 4XBFA 4ECSA 1TVKA 2CNVA 2EULA 2QM8A 1TUBA 4RQEA 4WF9V 1K1QA 4I50B 4ZKIA 3B77A 4WFAV 3IJ4A 3K5HA 1N34B 2UXDO 3RYHA 2R92G 4X88A 3ZHTA 5KMGA 2HFEC 4B08A 4QWDA 4MTEA 2AW9A 4WCEV 3GV7B 3WB0A 1MMMA 5BYBA 4JZ2A 3TCUA 1CKNB 4YJ3F 1FS0G 3GIKA 1Y66A 3WO0A 1S5JA 3EPGA 4RB1A 3N8DA 2CFMA 2YS6A 4UCTA 4IHJF 4OXSA 4CS3A 4JUZA 3AX6A 3OEHG 4RAIA 3HBLA 3CMEV 4X66H 3MR6A 3JRXA 2LW7A 2OLSA 4GC7A 1Y1VA 1K34A 4A3KG 3H1LH 4HBNA 1FFTB 4DV6O 1SCUB 3M99B 5KHHA 3EVKA 2JA6A 2QKAA 2YWVA 4PZ8A 3OSPA 5CBFA 4QPKA 3N6XA 4H37A 4Q0YA 4R7RA 4YJ2F 5EK0A 3VQVA 4MTGA 3M4IA 2NNUA 3LNNA 5GONB 1SQXH 2F93B 1AILA 2Q0OC 2VPQA 2E5LB 1V9PA 2FLPA 4IRKA 3GWKC 2YZMA 5J2TB 3OHBA 1JLLB 1X9NA 3K0GA 2A3QA 4DK1A 2E3CA 1SYXB 4ZBMA 5I5YA 4CBCA 4GLWA 4IIJF 5BWWA 5GONA 3MHHC 4LBEC 4GKJO 2KG7B 2J9GA 5KFPA 3HKBB 4TQSA 4EB6A 4DR7B 1NI8A 3HOWG 2ZDQA 4FLWA 1E4GT 3H4DA 3JCZA 2HGXA 3OFNG 4AILC 4M9UA 2EIJC 2ZE7A 4E6NA 4EKWA 1WCMA 4JI7B 1AR4A 3ABKC 2WTFA 4B3RO 5JQGB 4MVZA 2R8GA 5FLMG 2KG7A 3HKBA 4DV0B 5LL6Y 4O4LB 4ED7A 1Y1WA 2Q9LA 1RK6A 4ZI7B 5D1PA 3U0GA 2YU9A 2KB1A 4JI6H 1X4TA 3U55A 5CA0A 1Z2PX 4C7UA 2R82A 1ET0A 2AHZA 1S10A 2BTQB 2NR5A 1DGSA 4JI2H 1MG1A 1T5EA 3JAMW 5EWGA 2W6OA 2VRZA 4TV9B 4ED3A 1VEWA 1XEQA 4JYAB 4K6NA 4RZRA 2JA7A 2ITCC 1AP6A 5LXTB 5KX5B 1E79G 4DW1A 1JPXA 1FKAH 1XILA 2BTQA 4NTWA 4DV5B 2UU9O 2F4VO 1B04A 2YZNA 3GB7C 4MA0A 1YITV 3TQ1A 2R7ZG 4CMFA 4EFBA 4IGGA 4Q8FA 4TV9A 2F23A 4LF9O 3RGXA 1XDNA 2N04A 4D7SA 2WLIB 4ZOLB 4MVRA 1EBOA 1I7LA 4DV7H 1WSCA 1DLBA 1VARA 2ZQMA 2W0XA 4TWKA 2CTPA 2WLJA 4HNTA 3ZMVA 2B63A 1AUXA 3GWOA 1XMQB 1GSOA 1EZ1A 4DL7A 2P67A 3SNOA 5B1BB 3NR7A 2RJZA 1Y67A 2PMZE 4OPAA 4K8XA 4YHHB 2QB5A 4DUYB 2WLIA 5KFNA 4ZOLA 4RQFA 3OTOO 3PR5B 5C8YB 2NU6B 4FS2A 3FB6C 4CH5A 3E2EA 1S76D 2WAQA 1L1FA 1XL4A 4OX9B 1M93A 2WB1A 3BY6A 2JJ1G 2DYRC 1EFRG 2C2RA 3L71H 1HNWO 2OIGA 2UXDH 1PNKA 1N32B 3ZIAG 2COJA 1KJ9A 1CEZA 4ECVA 1VF5B 5LOVF 2BSKA 2DMXA 2W6MA 4O3OA 4DV3B 4JI8H 4OGQB 3H01A 2EIJB 2XAJA 1NH2B 1IBLO 1E4EB 5IP9G 2XAFA 4NZOA 1E4FT 2A7WA 4NVPA 3QNEA 5IYZA 1P8LA 4IWXA 4FFOA 3STLC 5CA1B 2JS5A 1I94B 4X20B 5IE9A 2GV9A 3CXHF 4J9RA 3ZHUA 1S72V 4NXMB 4JI4B 1K5SA 1BQ0A 2CQYA 2FK2A 3T9FA 3CRRA 4QWEA 2IM9A 2FK3A 2FPPB 5JCOC 1EKFA 2V4RA 5B66Z 1YIJV 5LBQA 1VQ7V 4X65H 5CA1A 4DV6H 2ZDIC 4X20A 3RYFB 1Q8IA 1W0KG 4MV3A 2DOSA 2KQXA 2ALZA 1IBMO 2BR0A 1QQCA 3ABLC 3RR5A 1XNRO 3RBDA 4LC1A 1HR0O 4ECUA 4DR5O 4BW5A 4PDLA 4IRCA 1XI1A 1TWGA 2M05A 2AXTZ 2JGDB 3T54A 2JVDA 2GHYA 3RYFA 2ZE5A 1SQFA 1VKZA 2QR4A 3UZBA 4EG0A 4UB8Z 3O9OA 3RB6A 1Z2NX 1TGOA 3ZJZA 4E4TA 1AP5A 3UFXB 2RMKB 4NR1A 2P22C 4AI8A 1KBHA 2CNUA 2B1IA 4BIUA 4GUNA 3K57A 4FK5C 4A3GG 2W0FC 1QVGU 4HNAB 2DN9A 2XASA 2ODTX 4FFBB 4ZHQB 1JJOA 2P6JA 2WA3A 2E2HA 2JEIA 4JI3B 3I55V 1YCIA 3FKIG 3RV4A 5IWAH 1L0NH 4PDMA 2X5RA 5HFLA 4QSHA 2GTSA 4YQWA 4PDBA 2ZDHA 5J2UB 3JYCA 4RO2A 4HNAA 3QO5A 5K1XA 1B3QA 4FFBA 2Y4RA 4ZHQA 2QKSA 1US6A 1Y4MA 4LH7A 4PD4F 5EDWA 3F7YC 3ETGA 1EN4A 3D3IA 4CS4A 5C5JA 1I0HA 5CB4A 2P90A 4I9QA 4RUFA 4RB0A 4UCVA 5EZYF 1LNQA 3JAKB 1N33H 5KT7A 3OMIB 4JZGA 5IY5C 2EILB 5LA6B 2JEUA 4MSWC 1PP9H 2NUAB 5J2UA 5BR8B 3SJCC 2Y4UA 1YJNV 5L3FA 4QPJA 3AG1C 1HNZO 3UM7A 1R6TA 5DMXA 1K92A 3H1IH 3CJHB 2ZJTA 3ZRWB 3IG0A 1V51A 1VQKV 1E1RG 1YJ9V 2F4VH 3JAKA 4O4JB 1BS3A 2XUMA 3RWRD 2OYQA 1I50A 3BA8A 4O4HF 5LMNH 5IYDG 3LMLA 4W4LA 4DLKA 3APOA 3JRWA 5DG8A 5BPFA 1ZAUA 4LF8B 3SI8A 2DWDC 2RNBA 5L1IA 2YW2A 3CJHA 1L2ZA 4F4WA 4FFLA 1ENVA 4C5AA 3IGAC 2WB1E 4XDKA 3TJTA 4O4JA 2R8HA 3H40A 2QWPB 1P7BA 4DV2O 4DIMA 2B5UA 2HHFA 3T1YO 1CPYA 3N41B 4KHPH 4AQYB 2UXBB 4PBCA 2B9ZA 2V59A 2QYZA 4LFAB 2Y4TA 4QJFB 1ZX3A 4WHXA 2XC9A 3Q8PB 4JI5H 4B7EA 5JH7B 5JVDF 2VWJA 1HNWH 1P4RA 4LFBO 1IBKB 1P49A 2NN4A 3QWUA 1H8EG 3JASA 4FLTA 3TGUH 3GIPA 4QJFA 3LDCA 1BE3H 3U9SA 2DABA 5ITZB 2UUCO 4BBRG 1M57C 3GIQA 1WNSA 2AQ4A 3JD3A 2W6JG 4XX0B 1K9MW 5T14A 4NXNH 3HOYG 1XDCA 2Q7DA 2R70A 2XD4A 3KTMA 4PWQA 3K3PA 5KG0A 3AK2A 4B3MB 4WBNF 4X64O 3V4SA 1J5EO 1M0WA 2UUBB 1CQIB 2BQRA 3C3SA 5ITZA 1G2WA 3D36C 4PJ0Z 3S3XA 1TWHA 1VQNV 4ECYA 5EBWC 1ZQ7A 2PBZA 1BJTA 2CAZC 1Q3EA 1FJGB 5BYAA 4IYIA 1DAAA 3LSQA 1JMKC 4B3SH 3APQA 1KU9A 2K1EA 3HKDB 4I7HA 1FXKA 1JR9A 2A79B 1H2KA 4J10A 3ML0A 4DR6B 3U54A 2Q5ZA 4DR5H 2Z3YA 2WYOA 2JA8G 3QTCA 3RGBA 5L1KA 4J7ZA 5C44G 3NXSA 3T2MA 4YAKB 1ZSPA 4J9OA 3GJXB 5BMVA 3H1KH 3L4JA 2R7ZA 3I4MG 5KG5A 3CRQA 4JTCB 1KJ8A 3HKDA 4ED1A 3K0DA 3GIMA 5IT9N 4O2AA 2R8KA 2F95B 1RM1B 3BQ0A 4LF7H 3HKZA 3K08A 5KFHA 2QK4A 4TUYA 2BOBC 2X6CA 2UXCB 2QWQB 3FX7A 2JEFA 1CKMA 1BGYH 2Q7GA 3E8HA 2ZM6B 2XGPA 2JGUA 1W0JG 4LMYA 2N05A 5DGHA 1M4UA 1AI4A 5GW7A 5LP6A 5KFOA 1I1LA 4Q8EA 4JYYA 4ME6A 2GSMB 3L75H 2QEXV 2QWRB 3LP8A 3SYQA 1MZBA 5H2FZ 1OCRC 2MW2B 3ZMUA 2ATKC 1JKJB 2QM7A 3M9MB 3EHBB 2ZXWC 1K83A 2R93G 4UV9A 1S5HC 3T5HA 3I4NG 3BFRA 3X2QB 3KHLA 2IP4A 1VQLV 3ZHSA 3AG3B 4X62B 4O7WA 4J9LA 5A2QW 3EFFK 3B4SA 2XNDG 5B1AC 2ABJA 4A2AA 3PJSK 1Q82W 1COWG 5JJNB 3GTOA 3ETQA 4J42A 2QF7A 4UXNA 1HNZH 2HG5C 4RUCA 2LGQA 3DSQA 4WFFA 1Q6IA 4QGPA 4DV5O 4O7YA 2QTOA 3G4SV 5L3DA 2VR1A 5DLGA 4F6EA 1NU1H 2XAGA 1JVMA 4DV1O 4JV5H 1Q6HA 3GTQA 2ADQB 1IOVA 2YZLA 4NLGA 1VQ5V 3RUPA 3OGCC 5KA5A 4MTFA 2BTOA 5GONF 2PI5A 1LUWA 3MWMA 4DL2A 1S3JA 4X66O 3GQCA 4PA4A 3DXRA 1RK5A 4FFRA 2A06H 3KALA 2KKWA 5KFDA 3DC5A 4ECTA 2P4KA 2FJZA 1ORQC 3FAVB 1IXBA 4MTDA 3QZ8A 3JD1A 1JX9A 2FB5A 4OX9O 3QVNA 5LGNA 3CCUV 2PF4E 3H9VA 5E25A 3BG5A 1JOYA 1N34H 4TOIA 2R84A 4MW3A 2AGQA 5CA0F 1QU7A 2OIEA 5L1JA 2Y69C 4A3FG 3V6KA 2FYUH 1ZUQA 4BW9A 1YSCA 4LWSB 3DF7A 3FAVA 2CW8A 3V4ZA 3RAXA 5FD6A 3RFCA 3ZHVA 2ZGIA 3CVZA 2UUCH 4M0JA 2EJ0A 3GTMA 1BHBA 1I94O 1VQ4V 4U7OA 1S97A 2OTJV 3LQSA 3ZN1A 4JI1O 3Q8SB 4X1KA 1YF2A 1V55C 4LWSA 3SPJA 4EEYA 3MJFA 4A2BA 3VPCA 2ZXWB 4E4EA 2Z02A 1PX2A 2IA6A 4X64H 1XHXA 1H2NA 4KXRA 4TV9F 1JIHA 3A8TA 1N8RW 4DL4A 5DG9A 2I87A 2DWCA 2NVYA 1MA1A 1M90W 3QZ7A 4TV8B 4JI6O 5KT3A 1XK5A 3L74H 4JV1A 4ED2A 4PA7A 4DR1B 4A3MG 2Q68A 5IYCO 2W6IG 3PZPA 2EINB 1EYZA 2E74B 3N43B 4JI2O 4ZOLF 1NR1A 1J95A 3HKZE 1R9TA 2PYJA 3T5JA 2YI8A 1B6SA 3T1HB 1DK1A 3T9DA 3ASOB 3E22B 3D3QA 2FKLA 4YY3O 2PVPA 4DR7H 5CMUA 3BQ1A 5KAIZ 5DGIA 3JAMN 2EIKC 2Q67A 5CBHA 5FR9A 3J7AU 4EBCA 3IAYA 3T9AA 3Q8QB 2C2EA 1K4DC 3RB0A 1AR5A 4JI7H 4DV4B 5IYZF 1T3NA 2QSAA 2ZE8A 5C93A 3ASNB 1IYDA 3A0HZ 3E22A 1N36B 2GQRA 4LP8A 1UC8A 2L35A 1RYSA 1U97A 4FM0A 1XMOB 1URFA 5KFZA 3C90A 2R87A 2DQ3A 1B6QA 1I1MA 4TQFA 4WFBV 5KS8A 4I55B 3PO2G 1H2MA 1RJQA 4EBDA 2CUGA 5CA1F 4D6TH 3VQXA 4GKKO 4Z2WA 5BZBA 5A9GA 3THOA 4JYAH 4APMA 3EPIA 5I5UA 4RNNA 4F4XA 4JI8O 1BQZA 4ASUG 2ZDGA 2ZT9B 4I55A 4Q4CA 4FZ1A 3NGDA 3A0BZ 5LMUB 2UUAB 5KG2A 4Z1MG 4DV5H 3L72H 4I50A 5IYBG 2AZ2A 1ULZA 3FFQA 3CRMA 3JD2A 2P7TC 1VQ9V 3Q2OA 3TEKA 4QWCA 2X6BA 1F7YA 2PUSA 2W6NA 3OSNA 5FNVB 4DV1H 3GIIA 2YS7A 1M9NA 2HVJC 3KAKA 3SDLA 5KT5A 4LF8O 3NBZB 3QQMA 2OWOA 2VWKA 2HGWA 3AYHB 4QW8A 2C2AA 4LNUB 3ZX6A 4RUEA 4PELA 1CKNA 1DF4A 5AG2A 4Z1VA 3CCQV 1YI2V 1SQPH 4LF5B 2ZNIA 4UCOA 3HKEB 3OE7G 4X65O 2VQFB 2UXBO 2CKZB 4DUYH 3OT7A 2QA4V 5L9XA 2BQUA 2ZE6A 1XNQB 2EJ2A 1KMIZ 5FL7G 1OWTA 5D5QA 1FAFA 4MV1A 4UUGA 4OX9H 4MV9A 4LNUA 3F5TA 4YIOA 1EN6A 3SJAC 5LHIA 2J6SA 1PM9A 1N32H 1N4CA 2QE7G 1S0VA 3RIZA 1Q43A 2GBOA 4DR2B 3HKEA 3ZEDA 2YRXA 1PNLA 4O7NA 4BBSG 4DUZB 5JVLA 5CB4F 4QE7A 4R6ZA 3GTPA 4B3TB 3CSXA 2OCHA 5L3EA 2HGSA 4FU0A 1W2BU 3JZFA 2I80A 2ZNJA 5C1PA 3I56V 1S0MA 1V4YA 3BCCH 1ZLZA 4EGJA 1I94H 4JF3A 2DZDA 4I4TB 2ZINA 3Q8RB 1VBGA 1SS3A 4JI1H 4JI4H 5J2TA 1JJ2U 4O7LA 4QIWA 3FB8C 3TK1A 5IWAO 4YAJB 1CQJB 4MA5A 3G6YA 3HO8A 3WWIA 3MFHA 4DK0A 5JQWA 2R9RB 2YEVB 1KYOF 3BABA 3OD4A 4CZZA 1CKOA 1HP8A 1L8DA 4XYMB 1G6UA 2AZ0A 4O4JF 1PV0A 4FM1A 4CMDA 5JQGA 4CKBA 1OCZC 4TQRA 1N33O 4FMTA 4O4LA 2VQEB 2NU7B 5CN0A 2YEVA 4R8CA 4ZI7A 3T7AA 1OJHA 5KG7A 2CGOA 3GV5B 3OUFA 5DECA 4GYCB 5B1NA 3GTGA 4YY3H 4CC5A 5CAEB 3GTLA 4QW9A 5DM6V 4J9MA 2IU3A 1NH2D 5LMNO 3FYEB 3JSNA 1XQ8A 1H2SB 2DJVA 4LF6B 4GX2A 2HIXA 5C4XG 1KB9F 3ZHQA 5CBGA 1NVPB 4O82A 2Q2TA 1EKPA 5EYPB 4JI3H 3H0GG 2HVKC 3ZBHA 4R8UB 5LXTA 5KFLA 5KX5A 1OBGA 5CM0A 2JA5G 1WP7A 4XYLB 3N2GB 1F4MA 1JFFB 1WPBA 5DQGA 1KUTA 3UKMA 2VS0A 2V4QA 4RCNA 2X0LA 5LHGA 2QKCA 3QO8A 3TY9A 2ASJA 4LR3A 4KHPO 1BXRA 4EGQA 1RJRA 5KFTA 2YIDA 5B3SC 4O7ZA 3SPGA 1D5NA 4R8UA 2CK3G 4O86A 4WD3A 2GPSA 2BCCH 4DR3B 4JI5O 2CE4A 2RF4A 4HNVA 1KJQA 4Q6GA 4GKKH 3N2GA 3BVOA 1JFFA 2R92A 4LFCO 1VS0A 1OBDA 5F9NA 1AI6A 4P9PA 2W9AA 2UXXA 1N0JA 4K0KO 1FPOA 2R7MA 4O2BB 2G38A 5C8YA 4FLUA 3RGZA 2LQTA 3J81W 3AG7A 3ABKB 1ZL8B 2EZOA 3LDDA 5BWXA 2R8IA 2QWOB 3IFXA 1NS1A 3CCRV 5BMVF 3TY8A 1NJIW 1WN7A 4FBUA 4NTXA 5DQIA 4NXNO 3PFFA 3L9DA 5TISZ 4LF8H 4ECRA 2I8CA 4PDRA 4O2AF 4XZ3B 3B8MA 4YP3A 1DF5A 1E4EA 1ZL8A 4OPHA 2ATLA 2YI9A 4UCSA 2CTQA 4TUYF 4A3LG 1PK8A 4O3NA 5DQHA 5LYJB 3CP1A 5BWVA 2DW4A 2X6AA 2UXBH 3MHSC 2YXYA 3RT3C 3KHRA 4LFAH 5FJ8G 3U0ZA 5LP6F 3E8BA 3E83A 4B3SO 4N21A 4RWUA 3SYPA 2P0AA 3J80W 1S9FA 2HHHB 3PW0A 1BT8A 1YHQV 2EJRA 1VQ6V 1SF9A 1DTOA 4QE9A 4BXXG 4BIOA 4JAAA 4DR4O 3P3NA 5HNEA 3HPLC 4YJ3B 2W9CB 4ECZA 4FIPC 4LF7O 2JGDA 4Y8VB 2LO1A 2WWWA 4MVQA 3N2KB 4O4IF 5KG6A 2A0LA 2WAMA 2YS8A 4JTDB 2C22A 2UUBH 2VPSA 4JI0B 5KFCA 4YJ3A 4YR0A 1GM9A 3LNMB 4EEQA 1XBLA 4A93G 2W57A 2DYRB 4MV7A 2W8KA 4K35A 5H5NA 4O3QA 3R9RA 4ETSA 5FLXW 1FJGH 4LSXA 3R5XA 4PI0A 5DISC 5I5WA 2D2CB 1M56C 2W70A 4DR6H 2IBZH 1MSWD 3CX5F 1SRYA 4U7CA 1I7NA 4DV7B 4UVBA 4NZNA 4RAYA 5K2MA 4RAZA 1GH6A 2V58A 4X1YB 4CC6A 4GLXA 3GIDA 3EXAA 1RP3B 4IIJB 1WLEA 5IJ0B 1BMFG 5DGBA 4JV2A 2HEPA 1A32A 4GX0A 5IDJA 1K73W 5A2QN 2EIMC 2FP4B 5LA6A 4DRFA 1FXKC 1YZBA 4JV5O 1OCCC 2UXCH 4YB8B 2WSSG 3RW0A 4X1YA 3RBZA 2YYAA 1DV2A 4QWAA 2ZM6H 4P30A 4X89A 2UXDB 1SKVA 3CWBH 4DYLA 1WB7A 2DYSC 3ZRWA 5JWPA 1YTFB 2WAQE 4RB3C 4HR7A 3ABLB 3OR7C 1EHIA 3SGIA 5KFUA 1Q90D 5JCOA 5JJJB 3HXLA 5LHHA 3VQWA 1XMOO 4CKEA 3ABMC 1WPXA 2ZDIA 1PNMA 3HB3B 3WB2A 3ICXA 2XCLA 3OUSA 3G6VA 1NT2B 4LF4B 4X62H 1JA8A 3WG7C 1N34O 1B33N 3M9NB 4A3EG 3VA7A 3STZC 5KG1A 3E89A 3PN1A 4PZ7A 1YXBA 4LFCH 2GQSA 2JEJA 2WA4A 3IN5A 1R3IC 1IOWA 4K0KH 2NVXA 4P2ZA 1KKDA 1QCEA 5HV6A 2JEGA 4PI2A 4TSFG 4DV6B 5KFEA 1N56A 1UC9A 3T9CA 4J9PA 2PY5A 4L1KA 5JH7A 2HR3A 2RN9A 5KFSA 4H33A 1UFIA 1T94A 1AJQA 1ZHSA 2CW7A 1Q86W 2Q69A 3N42B 2C2DA 3OHAA 1S5LZ 5KT2A 4O7RA 1FD9A 4UCUA 2OCCC 4JAUA 3SPCA 1JCHA 4HAMA 4RU9A 1R3LC 3NC0B 3QG5A 5IY5B 4O3PA 1FVIA 4JV0A 3ZMZA 5KG3A 3L2PA 1UPGA 4IT5A 1GMGA 3F7VC 4FLZA 4GKJB 2VUMG 3JCUZ 1EZJA 3AG1B 1SERA 2AHYA 4F6RB 5L3GA 1SEIA 5HFMA 5EBMC 1AJPA 3LSUA 3K58A 4RUAA 5KHJA 5LOVB 1QR8A 2E5LO 4MV8A 1E1QG 4P9OA 1ZWIC 3R23A 3PVXA 4MVSA 3OMNB 4BY7G 1A0IA 1KEEA 3BAAA 4B3RB 2D3OW 2EJ7A 3CPWU 1DIKA 1KC8W 1SESA 1VIBA 2QTSA 1NTKH 1G8MA 4DR4H 4WFHA 3E8FA 5LL6b 1BNCA 3RTXA 4F6RA 1GO3E 2DPJA 4DR7O 2W7OA 4A5UB 4IAJA 3MWDA 5LOVA 5I5VA 4DL3A 4I55F 1PL4A 2YC0A 1MZEA 3CCMV 4I50F 2V1DA 1RPRA 3RBEA 3CEBA 1IZ3A 4JI7O 3NUAA 3FKIA 3CCJV 1SZXA 2Z5UA 4DV0O 3H1JH 2UVWA 3VOTA 4F50A 4AYBA 3N27A 4U3JB 3FB5C 3OMAB 5H80A 3CMAV 3FYIB 2R85A 3K5IA 2R7LA 4IRDA 2UU9B 2XCAA 2BOCC 4FJCC 3T4ZA 3AG4C 3KCXA 4LF9B 4MVMA 4MVUA 4U3JA 1GSHA 3OUUA 3V6HA 1M57B 2IJJA 5B1OA 2UVUA 4WFGA 1O9GA 1AROP 4JYAO 2Q4PA 4L87A 3B2EE 3T1HH 3O65A 5C3EG 2VA3A 2YXLA 5KUMA 5KHGA 4FLYA 1YJWV 3JATB 3A2FA 3E8GA 3OTOB 1SQBH 2HLDG 3CSWA 1ZETA 3G6BA 3TXQA 3CE2A 3G71V 1QLEC 3T99A 1PD3A 3T5LA 4KUMA 4J9YB 1JDEA 4DV4H 1WA8B 3GILA 2QM4A 5DG7A 1N36H 1XMQO 2R9AA 3JATA 3AG2C 5J2TF 4X1IB 3UZOA 2Q6AA 3D36A 1XMOH 5KFFA 4QIWF 4YHHO 1TAEA 1IBLB 4DUYO 3RVYA 4BWAA 4LH6A 3ZHRA 3QFFA 4LSAA 1WA8A 2ZR2A 3TIIA 5BXZA 1XL6A 3HOVG 5DAAA 3SJBC 1GM7A 1IURA 4DAAA 3D8CA 4ED0A 3CCLV 1N32O 3DC6A 5KT4A 1GGOA 4DV3O 4IWYA 2C00A 1Y1VG 3OGIB 2W8LA 5JQGF 3V6JA 1FXHA 1KKCA 2EZPA 5LMUH 4PA3A 4HQ6A 4O4LF 2JA6G 4O4HB 3ETJA 1VF6C 1VP7A 3LULA 3L73H 1BGWA 4ZI7F 2J6UA 1C3OA 4G28B 2F43G 1R1BA 3G6XA 1TUEB 1IBMB 3DGEA 2R9IA 2R8JA 4NXMO 1XNRB 3BACA 4JI4O 1WAZA 1HR0B 1OCRB 1UJWB 3VQYA 5E1AC 1EUCB 1AR1B 3A0RA 3M8AA 3CYOA 2V5AA 3W7SA 3U10A 2OH2A 5FPRA 4UCRA 1HNXB 2ZKOA 4ED6A 1AVMA 4IL6Z 4LF5H 4HZ3A 2WE6A 5B1AB 4FLVA 5LXTF 5KFAA 4YR2A 1NQTA 5KX5F 1TWFA 2DAAA 4FFNA 5JVDB 3T5KA 3FDSA 4O83A 2X0SA 3RF2A 2Q7HA 3RVZA 2IH3C 3K59A 3ETDA 3KG2A 1N48A 1WCMG 2E5LH 4DR2H 4GX5A 2ZR3A 4DUZH 4A3DG 1QLEB 2ARHA 1Q6UA 3EYYA 5KFKA 3PR4A 4TV8A 1S0OA 2LW1A 4DXWA 1Y1WG 4B3TH 3P32A 4IR1A 5EBLC 4A3CG 5DGAA
chains in the Genus database with same CATH topology
4UFZA 5IWAH 5JQGA 4O4LA 5LP6B 3BPZA 2VQEB 4PDBA 2F4VB 4WBNB 4ZI7A 5J2UB 4DR1H 1ZHQA 5LMNB 4HNAA 5K1XA 2YIBA 1QHTA 4FFBA 4ZHQA 4GYCB 4LH7A 4CS4A 4DV0H 5CB4A 4I9QA 4YY3H 4CC5A 4RB0A 1HNZB 4KL1A 4UCVA 3JAKB 1N33H 2PZSA 3JSNA 1XQ8A 4EFEA 1H2SB 2ZIMA 5LA6B 4LF6B 2HIXA 4FM9A 5J2UA 2Q2TA 5BR8B 3SJCC 5EYPB 4JI3H 3N40P 5EIBD 5LXTA 4KHPB 5KX5A 1SQGA 2ZJTA 3IG0A 3GB8B 1TUBB 2F4VH 3N2GB 4O4IB 1JFFB 3JAKA 4O4JB 4FLXA 1WPBA 3RWRD 2OYQA 3BA8A 4JI5B 5LMNH 4EQ5A 2HVSA 3LMLA 3TY9A 4LR3A 3RYHB 1HNWB 4PZ6A 4LFCB 3C0FB 1S68A 2F66C 2RGRA 3W1GA 1ZAUA 5KMGB 4DV2B 4LF8B 3T1YB 4K0KB 2Q7EA 1L2ZA 4DR3B 4LF6H 3L4KA 4Q6GA 4GKKH 3N2GA 4O4IA 1JFFA 4O4JA 1VS0A 2HVRA 4D7TA 3J7AK 3BRCA 3RYCB 5EZYB 3N41B 4KHPH 4AQYB 2UXBB 5K1PA 4O2BB 1I6UA 5C8YA 4FLUA 3RGZA 4NXNB 4LFBB 3J81W 4LFAB 1XMQH 3RFRA 3TY5A 4X1IA 4JI5H 5JH7B 1Z2OX 2VWJA 3MAQA 3TY8A 5FNVA 4YHHH 1WN7A 1HNWH 2UUCB 4AHCA 2XHBA 4DV2H 4LF8H 1IBKB 1P49A 2UUAH 3RYCA 5EZYA 3QWUA 3JASA 4FLTA 3T1YH 5D5PA 1WH2A 2P5OA 4DR3H 2YI9A 4UCSA 5ITZB 4DRXB 1O9HA 4B3SB 1WNSA 4X64B 5LYJB 1J5EB 3FMAA 4DV3H 2UXBH 4DR5B 4CH6A 4NXNH 4LFBH 1P16A 4LFAH 2R70A 2ZCEA 4X1KB 3U0ZA 2MCTA 4O4HA 4B3MB 3KXYT 3RJ0A 4DR4B 2UUBB 3GDEA 1M0WA 2VQFH 5ITZA 3J80W 4DRXA 1AN7A 2XIGA 2HHHB 4NXMH 4EB6B 3SR2C 1XNQH 1BJTA 1Q5OA 1RSOA 2CAZC 3UQ8A 1Q3EA 4LF7B 1FJGB 3M7MX 4L8JA 1FFXB 1JMKC 4YJ3B 2FE3A 4M7EA 4B3SH 1KU9A 3HKDB 4I7HA 2Q0AA 1J5EH 4DR6B 4I4TA 4DR5H 3UT5B 3KYHC 2WYOA 3QTCA 3RGBA 2YCHA 5JVDA 3N2KB 3GJXB 5BMVA 3L4JA 3JALB 3JARB 2UUBH 5CA0B 4JI0B 2VPSA 1D5AA 1FFXA 4YJ3A 3W1BA 2HHHH 1O75A 4FM2A 3VNNA 3HKDA 3F8NA 1TA8A 3ZS8C 4EEQA 2RGVA 2WDTA 3K5OA 2W57A 4O2AA 4MV7A 3UT5A 5IT9W 2F95B 4FM1A 4LF7H 4ETSA 4CH4A 5FLXW 1FJGH 5EIBC 4TUYA 2UXCB 4LSXA 3U11A 3CB2A 4PI0A 5DISC 3JALA 3JARA 2Q7GA 3K5NA 1CKMA 2ZM6B 3BA9A 2JGUA 4DR6H 4LMYA 1M4UA 1S03G 3S24A 5LP6A 4DV7B 4J0MA 4ZIBA 4RAYA 1HW7A 4RAZA 3NBYB 4WBNA 4X1YB 1MZBA 4CC6A 4GLXA 4JI0H 4IIJB 4JV5B 5FD5A 4PHZA 5IJ0B 2PYLA 4CH3A 2HEPA 2VQEH 1TVKB 2PTMA 1XHZA 2ZIOA 3BHPA 4X62B 3K5LA 5LA6A 4DRFA 5A2QW 4A2AA 2UXCH 4X1YA 5JJNB 5EYPA 3ETQA 4RB2C 2ZM6H 2HIVA 4DV1B 2UXDB 1SKVA 1HNZH 3OTFA 3DSQA 4RB3C 1TVKA 1TUBA 3SGIA 4I50B 5JCOA 5JJJB 1GYFA 5BR8H 3HXLA 3VQWA 4X66B 1N34B 4JV5H 3RYHA 3WB2A 3ICXA 2BTOA 5KMGA 4B08A 4MTEA 1NT2B 4LF4B 3MWMA 3N44B 4X62H 3WB0A 4CS2A 3PN1A 4PZ7A 3H20A 4LFCH 1CKNB 5IYZB 3KALA 2KKWA 1S5JA 4K0KH 4O2BA 4RB1A 1VF7A 4MTDA 4PI2A 4DV6B 2CFMA 4UCTA 4CS3A 2PY5A 5JH7A 4X66H 1N34H 1YEWA 4TOIA 4AQYH 4HBNA 1ZHSA 5KHHA 2CW7A 4BW9A 2O03A 3DF7A 4LF4H 4PZ8A 3N42B 2CW8A 4JI1B 3N6XA 4Q0YA 5FD6A 4UCUA 4R7RA 3VQVA 3CVZA 3M4IA 3LNNA 2UUCH 2R72A 3NC0B 5GONB 3QG5A 5LYJA 2F93B 1IBKH 1FVIA 3L2PA 2E5LB 4FLZA 1V9PA 2HVQA 4X1KA 4GKJB 5J2TB 1X9NA 4A2BA 4DK1A 2E3CA 4F6RB 1SA0B 4JI6B 1SEIA 4X64H 1XHXA 1SYXB 3K58A 5KHIA 5KHJA 2V4DA 5LOVB 5GONA 4IHJB 3HKBB 2F1MA 4EB6A 4DR7B 1A0IA 3BAAA 4B3RB 5FPOA 4B3MH 4FLWA 4TV8B 1E4GT 4JI2B 1XK5A 4DR4H 5LL6b 4DR1B 4AILC 3RTXA 4F6RA 1SA0A 4E6NA 4JI7B 5JQGB 4IAJA 5LOVA 4IHJA 3N43B 3HKBA 4DV0B 4GKJH 4O4LB 4YY3B 4YJ2B 2PYJA 3N2KA 4ZI7B 5D1PA 4JI6H 1X4TA 2YI8A 5CA0A 1Z2PX 3T1HB 3E22B 4U3JB 5CB4B 2BTQB 2Q2UA 4DR7H 4BWSC 4B3RH 1DGSA 4JI2H 1T5EA 4YJ2A 3JAMW 2UU9B 4TV9B 3IAYA 4JYAB 5IJ9B 4JI7H 4DV4B 4LF9B 5LXTB 1N36B 3E22A 5KX5B 1FKAH 4U3JA 3CHXA 2BTQA 4DV5B 1B04A 1O9GA 4FM0A 4EFBA 4TV9A 1XMOB 4GKKB 4IIJA 3RGXA 1XDNA 4TQFA 3B2EE 4D7SA 5IJ0A 3T1HH 4ZOLB 5IJ9A 4I55B 2YXLA 4DV7H 5KHGA 4FLYA 3W5OA 3JATB 3A2FA 2QJ1A 4JI8B 3OTOB 3VQXA 1XMQB 2UU9H 2RJZA 3THOA 4JYAH 5D1OB 4APMA 4DV4H 4K8XA 4YHHB 4LF9H 1M0TA 4DUYB 2QM4A 4ZOLA 1N36H 4I55A 3JAWB 3WB1A 5C8YB 2R9AA 4CH5A 5LMUB 2UUAB 2VUGA 4DV5H 3JATA 4I50A 3FFQA 3K5MA 1M93A 4FVMA 4X1IB 4OX9B 5LP6C 1XMOH 1IBLB 1TAEA 2PUSA 4DV1H 5FNVB 2UXDH 4BWAA 1N32B 2YIAA 3KAKA 4LH6A 5D1OA 3NBZB 4LSAA 3HKCB 2OWOA 2VWKA 4X65B 3JASB 4DV3B 4JI8H 3JAWA 3OTOH 3SJBC 4RZQA 5JJEB 1I7FA 3RYIB 4LNUB 1E4FT 4NVPA 1CKNA 5IYZA 1P8LA 4LF5B 2ZNIA 4UCOA 3HKEB 2VQFB 5CA1B 2JS5A 1I94B 4X20B 4DUYH 2GV9A 4K8ZA 3HKCA 5LMUH 4NXMB 1XNQB 2KSWA 1KMIZ 4JI4B 2PGGA 5D5QA 4O4HB 3JSLA 4OX9H 2YIBD 4MV9A 3RYIA 1BGWA 4LNUA 1M5IA 2IM9A 2RQ6A 1IBLH 5JCOC 3SJAC 1IBMB 1N32H 3RIZA 1Q43A 4DR2B 3HKEA 3ZEDA 1XNRB 4X65H 5CA1A 1HR0B 4DV6H 4X20A 4DUZB 3VQYA 3RYFB 2EX3A 1Q8IA 4TQDA 3K3VA 4B3TB 3CSXA 3U10A 5FPRA 2HGSA 1Z5VA 4UCRA 2ZNJA 1HNXB 1QQCA 3RR5A 1Z5WA 4LF5H 3KAJA 5IWAB 2WE6A 1I94H 4I4TB 4FLVA 1XI1A 2ZINA 4JI1H 4JI4H 2JVDA 5J2TA 3RYFA 1SQFA 5JVDB 5BMVB 1Z2NX 1TGOA 3RF2A 5KHKA 2Q7HA 1IBMH 2P22C 3K59A 2E5LH 4DR2H 3QF7A 1XNRH 4DK0A 1HR0H 4O2AB 4DUZH 2VOBA 3EYYA 3K57A 3BABA 1N33B 4TV8A 1CKOA 4B3TH 4HNAB 1L8DA 4FFBB 4TUYB 4ZHQB 1JJOA 5EOYA 1HNXH 1G6UA 4JI3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH B;  4UFZ A;  3W5O A;  4JI8 B;  2VQE B;  4DV6 B;  2CFM A;  4UCT A;  3OTO B;  2F4V B;  4LF7 B;  3UQ8 A;  1XMQ B;  1FJG B;  5LMN B;  4TOI A;  5D1O B;  4LH7 A;  4DR6 B;  4YHH B;  4DUY B;  4CC5 A;  3KYH C;  1HNZ B;  4UCV A;  5LMU B;  2UUA B;  2VUG A;  4PZ8 A;  3JSN A;  4JI1 B;  4EFE A;  4LF6 B;  2HIX A;  4OX9 B;  3GJX B;  4UCU A;  2Q2T A;  5BR8 B;  1IBL B;  1TAE A;  4JI0 B;  3NC0 B;  1N32 B;  3W1B A;  1FVI A;  4LH6 A;  5D1O A;  3NBZ B;  3VNN A;  1TA8 A;  4EEQ A;  4KHP B;  3L2P A;  2OWO A;  4X65 B;  2E5L B;  2HVQ A;  1V9P A;  4DV3 B;  4GKJ B;  3GB8 B;  1X9N A;  3BA8 A;  4JI5 B;  2UXC B;  4EQ5 A;  4JI6 B;  2HVS A;  1CKN A;  3TY9 A;  5DIS C;  1P8L A;  1CKM A;  1HNW B;  4PZ6 A;  4LFC B;  4LF5 B;  2ZM6 B;  3BA9 A;  4UCO A;  2VQF B;  1S68 A;  3GDE A;  1I94 B;  3W1G A;  1ZAU A;  4DV2 B;  4LF8 B;  4DR7 B;  1A0I A;  3T1Y B;  4K0K B;  4DV7 B;  3BAA A;  4NXM B;  4B3R B;  3S24 A;  5FPO A;  1XNQ B;  4DR3 B;  4JI4 B;  3NBY B;  4JI2 B;  3JSL A;  1XK5 A;  4CC6 A;  4GLX A;  1VS0 A;  2HVR A;  4DR1 B;  3RTX A;  4JV5 B;  4E6N A;  1IBM B;  4JI7 B;  4DR2 B;  4AQY B;  1XNR B;  2UXB B;  1HR0 B;  4DUZ B;  4NXN B;  4LFB B;  4DV0 B;  4LFA B;  4YY3 B;  3TY5 A;  4X62 B;  4DRF A;  4B3T B;  5D1P A;  5FPR A;  4UCR A;  1HNX B;  3RR5 A;  3TY8 A;  3T1H B;  2HIV A;  2UUC B;  5IWA B;  4DV1 B;  2UXD B;  1IBK B;  2Q2U A;  3QWU A;  3SGI A;  1DGS A;  2UU9 B;  4X66 B;  4UCS A;  1N34 B;  4JYA B;  4B3S B;  4X64 B;  4DV4 B;  1J5E B;  4LF9 B;  4DR5 B;  1N36 B;  1P16 A;  4DV5 B;  4LF4 B;  3BAB A;  1B04 A;  1N33 B;  1CKO A;  4B3M B;  4EFB A;  3PN1 A;  4PZ7 A;  1XMO B;  4GKK B;  4DR4 B;  2UUB B;  1CKN B;  4JI3 B;  1XDN A; 
#chains in the Genus database with same CATH topology
 3OEE G;  3L70 H;  2W6P A;  2YRW A;  2WLK A;  3OAA G;  3BPZ A;  4UUJ C;  5C8Y F;  2BQ3 A;  5LGU A;  1BCC H;  4WBN B;  3OUZ A;  1C30 A;  5LGT A;  4JI3 O;  1VQM V;  2ODM A;  1QHT A;  3U9T A;  2Q73 A;  2JA7 G;  4PA9 A;  4MV6 A;  4MTO A;  3GIJ A;  4DV0 H;  1K97 A;  1HNZ B;  4KL1 A;  1WRV A;  3WO1 A;  2YDE A;  4EFE A;  3TXS A;  3P30 A;  2Y69 B;  5CR5 A;  3ZMT A;  1K33 A;  5C1O A;  1KJJ A;  3HOZ G;  2R93 A;  3E5N A;  3N40 P;  5EIB D;  4BR6 A;  4X9Q A;  2NU8 B;  2HG8 A;  2FL4 A;  2UVR A;  1OCO C;  1SQG A;  3H4B A;  3E86 A;  2XAQ A;  3GB8 B;  2DQ0 A;  1OV9 A;  1TUB B;  3TIN A;  2DWE C;  3JD4 A;  4NYE A;  5BR8 O;  2B63 G;  2XAH A;  1Y6X A;  4EQ5 A;  1EUD B;  1GN3 A;  3CRC A;  4ABM A;  1V55 B;  3RYH B;  2FB9 A;  4HNU A;  5BWU A;  3IC7 A;  2RGR A;  2FKX A;  5KMG B;  4DV2 B;  2H8P C;  3TET A;  5J9P C;  4IYH A;  3T1Y B;  2WLM A;  2LP7 A;  2Q7E A;  1A9X A;  1EN5 A;  2JK5 C;  4LF6 H;  2LFS A;  3L4K A;  3KZI Z;  4O7V A;  1KTA A;  4D7T A;  2HVR A;  2ASL A;  2QGN A;  2VQD A;  2PMZ A;  5F9L A;  3ABU A;  5EC1 C;  1GM8 A;  5K1P A;  5KFX A;  2WLL B;  3J81 N;  4HYO A;  4LFB B;  2XT9 A;  1XMQ H;  3RFR A;  4J9K A;  2WPD G;  2ETN A;  1WR2 A;  3MAQ A;  5FNV A;  4AQY O;  2SCU B;  4YHH H;  4KP4 A;  1IX9 A;  1GO3 F;  2UUC B;  3LWB A;  3K3W A;  4AHC A;  2XHB A;  4LFA O;  3M9O B;  3B40 A;  4R7C A;  4LF4 O;  2WLL A;  4JPR A;  4I0X B;  4DR3 H;  3OM3 B;  1YVW A;  3ETH A;  1N0N A;  2GUZ B;  3TW6 A;  1UNN C;  3G67 A;  1K8A W;  2A9H A;  2DE0 X;  2COI A;  1CE8 A;  4DRX B;  1O9H A;  3JZ6 A;  3PW2 A;  4ZHQ F;  1IBK O;  2EIK B;  2IJK A;  4X64 B;  5KFI A;  1J5E B;  4O84 A;  4DV3 H;  4MVO A;  1P16 A;  2ZCE A;  2MCT A;  4I0X A;  3KXY T;  3RJ0 A;  1IDS A;  2GDS A;  2GUZ A;  1SET A;  5J2U F;  3J80 N;  3GDE A;  3T9B A;  3SYC A;  4DRX A;  1AN7 A;  2XIG A;  5L1L A;  4JXU A;  1Z2G A;  2WLN A;  3VMM A;  5B1B C;  3VPB A;  4NXM H;  4EB6 B;  3SR2 C;  4RNM A;  1W59 A;  4PA6 A;  4B3M O;  2VA2 A;  4H13 B;  1Q5O A;  1NVP D;  3CEI A;  2ADP A;  3UQ8 A;  4CE5 A;  2UUB O;  2Y48 A;  1FYJ A;  4GX1 A;  5LA6 F;  4L8J A;  1FFX B;  1OCO B;  1KQS U;  4M7E A;  2Y0P A;  2J6T A;  4J41 A;  4UVA A;  4I4T A;  2GPW A;  1JXL A;  3UT5 B;  3KYH C;  3HOU G;  5IYC G;  3DTF A;  3RAQ A;  2YCH A;  4X8A A;  1FJG O;  4XDL A;  5KFV A;  3LDE A;  2JIZ G;  1RFY A;  3JAL B;  3JAR B;  1JDB B;  4DR6 O;  4UV8 A;  5CA0 B;  3MR5 A;  1FFX A;  2HHH H;  3Q1K A;  1O75 A;  4FM2 A;  5BWR A;  2R7N A;  2W6Q A;  3K5O A;  4QWB A;  4WFE A;  1I5X A;  2L6L A;  3UT5 A;  5FLX N;  1QLN A;  1AUV A;  4CH4 A;  4MS2 A;  3U11 A;  2AU0 A;  3JAL A;  3JAR A;  5BWT A;  1G4Y B;  1LUV A;  3DTG A;  1K5Q A;  5I5S A;  4XDJ A;  1S03 G;  4JYB A;  4ZIB A;  2UXC O;  1HW7 A;  5CE8 A;  3NBY B;  1QVF U;  5KLV H;  2ZM6 O;  5JH7 F;  1VAJ A;  5EWE A;  3SPH A;  1MSD A;  4DW0 A;  3MWE A;  4JI0 H;  5FD5 A;  1KP3 A;  4PHZ A;  5KFB A;  4G3I A;  2PYL A;  1VQ8 V;  2PTM A;  1XHZ A;  2ZIO A;  1EM1 A;  3BHP A;  4FE2 A;  3K5L A;  1K1S A;  4IZO A;  3N6R A;  1NBM G;  5EYP A;  4RB2 C;  4F4Z A;  1XOU A;  1Y76 B;  2DPI A;  2HIV A;  1RPO A;  4DV1 B;  3W7U A;  3OTF A;  4X62 O;  4O81 A;  5D8D A;  5IYD O;  1MZF A;  2FTK A;  4YIP A;  4KFM A;  3AEI A;  1M6V A;  1GYF A;  5BR8 H;  4X66 B;  4EBE A;  3GTK A;  2B1G A;  3R65 A;  4NTY A;  4NB5 A;  1Y76 A;  2CDY A;  3DAA A;  2BSK B;  1M7J A;  4U3F H;  3N44 B;  3ZCC A;  1KEC A;  1D2D A;  2KSD A;  3GTJ A;  5DLF A;  1DV1 A;  4CS2 A;  3VPD A;  4O3S A;  3H20 A;  1RJP A;  3SJQ C;  4DL6 A;  3K9A A;  3W7X A;  5IYZ B;  4FZ0 A;  3WNZ A;  1AI7 A;  5H6Q A;  3CQZ A;  2OT5 A;  4MW8 A;  1F23 A;  4O2B A;  1BHA A;  1VF7 A;  2YIC A;  3ORQ A;  2JDI G;  3UO3 A;  2RCV A;  1Y14 B;  4ECX A;  1OCZ B;  1YEW A;  3B8N A;  4O3R A;  2C28 A;  4AQY H;  2EIL C;  4FFP A;  2W71 A;  3TIG A;  2PN1 A;  2AGO A;  2O03 A;  5L3C A;  4LF4 H;  2FPI B;  4JI1 B;  2EIY A;  1KC7 A;  3KHH A;  4ED8 A;  3IC9 A;  4YR3 A;  2R72 A;  4I9W A;  4C2M A;  3WU2 Z;  5LYJ A;  1IBK H;  3LUT B;  1SZT A;  1YDX A;  2P4V A;  3KRE A;  5BPH A;  1XRE A;  5I47 A;  5I60 A;  3CS5 A;  5KUK A;  3E35 A;  1I3Q A;  2HVQ A;  1B06 A;  2FLL A;  4J9Q A;  4QIW E;  1QBZ A;  5B5E Z;  2Z0A A;  1SA0 B;  4JI6 B;  1GN6 A;  1A3G A;  1VQO V;  1I1K A;  2HJF C;  5KHI A;  3G8C A;  3ABT A;  2V4D A;  4LCU C;  4W4K A;  4IHJ B;  2YXH A;  3MDS A;  2F1M A;  1KD1 W;  3UYY A;  1VQP V;  4DL5 A;  1GN4 A;  5FPO A;  3VOU A;  4B3M H;  1R6N A;  4JI2 B;  5B3S B;  3SYA A;  3CCV V;  2K9P A;  1HNX O;  1R6K A;  3LSS A;  5CA3 A;  1SA0 A;  1H38 A;  3R5F A;  1NTZ H;  5K3W A;  2W9C A;  4JAV A;  2Y0S A;  2E75 B;  1YTF D;  1X59 A;  3FKS G;  2GLT A;  1Y74 B;  3K04 A;  2P06 A;  2ZD9 A;  1H2L A;  4IHJ A;  2HDK A;  2YZG A;  4GKJ H;  4YY3 B;  4YJ2 B;  4NKG B;  2FLN A;  3CRA A;  2JRI A;  2CZG A;  4DR1 O;  3SE7 A;  3N2K A;  4ECW A;  5KT6 A;  1BZK A;  1OZ0 A;  1R73 A;  1MNG A;  1AB3 A;  4Q43 A;  4RNO A;  1V54 C;  3K03 A;  2N74 A;  5CB4 B;  2Q2U A;  1Y74 A;  2HJW A;  3S3W A;  4BWS C;  4B3R H;  4F4L A;  3Q4H B;  3WFV A;  1MAB G;  1H2G A;  5KFG A;  2W6Z A;  1THZ A;  4YJ2 A;  5KKN B;  2IMW P;  3T1H O;  2GTA A;  3OR6 C;  2Z04 A;  4FGR A;  3UCS C;  5IJ9 B;  4ECQ A;  1L0L H;  1M1K W;  3RN4 A;  2E2I A;  2IW5 A;  5I5X A;  3CHX A;  4YBZ B;  3Q4H A;  1GTO A;  3W7T A;  3BQ2 A;  4DV4 O;  1WP8 A;  4GKK B;  2A1H A;  3H0G A;  4IIJ A;  1R3K C;  1NZ6 A;  3B09 A;  5IJ0 A;  1N36 O;  1QNM A;  5IJ9 A;  2HKO A;  2JA5 A;  3W5O A;  1MOF A;  2QJ1 A;  4JI8 B;  4MAM A;  3ETE A;  2NU9 B;  3H3V H;  2UU9 H;  4Q44 A;  2BE3 A;  2CH7 B;  1KBL A;  3FD9 A;  4GT1 A;  3MFI A;  2CTR A;  5D1O B;  5KFR A;  2H94 A;  2HHF B;  4GC6 A;  4LF9 H;  1M0T A;  3JAW B;  3WB1 A;  2YSU B;  2VUG A;  1K7D A;  4FVM A;  3K5M A;  1PPJ H;  5KFW A;  5LP6 C;  3H1H H;  3HT5 A;  2CH7 A;  4PV1 B;  1G1X B;  1RM1 C;  2YIA A;  5D1O A;  2UUA O;  3HKC B;  3G6E V;  5LMU O;  4G2K A;  3CC2 V;  4X65 B;  2XCP A;  3JAS B;  1W96 A;  3JAW A;  3OTO H;  4RZQ A;  5JJE B;  1F4N A;  1I7F A;  2CTW A;  1ROP A;  3T9E A;  3RYI B;  4TV8 F;  4FFK A;  5DN6 G;  3ZN0 A;  2EBO A;  3I5D A;  3AK1 A;  1VMG A;  1RYR A;  2WLH A;  1GRJ A;  5JUM A;  3OW2 U;  2XTA A;  4Q45 A;  1IYE A;  1EKV A;  1CP9 A;  5KFJ A;  4K8Z A;  3HKC A;  2LFR A;  4CKC A;  4HYK A;  1K3E A;  2KSW A;  3UO2 A;  2PGG A;  1M56 B;  1U96 A;  3AK3 A;  3JSL A;  2IJH A;  4A3B G;  2YIB D;  3RYI A;  1V54 B;  4LF5 O;  1M5I A;  2RQ6 A;  2VQF O;  3X2Q C;  1IBL H;  3PW7 A;  3AG3 C;  4TM5 A;  5KG4 A;  1XNQ O;  1FXV A;  2H3O A;  4IR9 A;  2XGQ A;  1KP2 A;  2EX3 A;  4TQD A;  3K3V A;  1WB8 A;  2JEX A;  4JTA B;  4PDV A;  2FK1 A;  1GSA A;  1Z5V A;  5KA6 A;  1Z5W A;  4G27 B;  4DR2 O;  2EIM B;  4FFM A;  1I08 A;  3KAJ A;  5DED A;  3G8D A;  5IWA B;  4B7K A;  4DUZ O;  1FXK B;  4ICG A;  3I12 A;  1OCC B;  2Y0I A;  3RB3 A;  4B3T O;  2YUA A;  1OHH G;  3KCY A;  4MT8 A;  1T36 A;  2DYS B;  2IBK A;  5BMV B;  3CC4 V;  2AGA A;  5KHK A;  1IBM H;  4I7Z B;  2Y0S E;  5GTH Z;  2QWN B;  3QF7 A;  2LGW A;  1XNR H;  3GV8 B;  2ILM A;  1HR0 H;  3ABM B;  4O2A B;  4O7T A;  2VOB A;  1BL8 A;  1N33 B;  3HR0 A;  1WJZ A;  3TQT A;  2M7W A;  1PL0 A;  1I2L A;  2QDO A;  4JGS A;  5KFY A;  4TUY B;  2CNQ A;  1SQV H;  5EOY A;  4J11 A;  1HNX H;  4BIZ A;  2JS3 A;  3RV3 A;  4H0L B;  4UFZ A;  3WG7 B;  3HOX G;  2CGN A;  2IU0 A;  4DO2 A;  5I5T A;  2RDI A;  3FB7 C;  2FPG B;  5LP6 B;  2C35 B;  2JJ2 G;  2F4V B;  3PW4 A;  4DR1 H;  4JAS A;  5LMN B;  1ZHQ A;  5EC2 C;  2RDC A;  4GCZ A;  1PKX A;  4Q20 A;  2UVV A;  2YIB A;  2DLN A;  3CXC U;  5FNV F;  4FPP A;  3CCS V;  2VQE O;  1KUQ A;  4FS1 A;  1CS0 A;  1IVS A;  3BJY A;  2PZS A;  4FM9 A;  2ZIM A;  3MD0 A;  4Q4D A;  2LJ2 A;  4J7K A;  3SPI A;  5E79 Z;  4O7S A;  5KAF Z;  4KHP B;  2R7K A;  4U7N A;  4K3A A;  3JD0 A;  2OCC B;  3TW7 A;  4LF6 O;  3ZRX A;  1JX4 A;  2Q8V A;  1Q7Y W;  1HDJ A;  3JZI A;  2FMA A;  4O4I B;  4JYC A;  4FLX A;  4QNH B;  4JI5 B;  4I5S A;  2HVS A;  1SQQ H;  2MK3 A;  1Q81 W;  2R86 A;  1HNW B;  4PZ6 A;  4LFC B;  3C0F B;  1S68 A;  4R50 A;  2F66 C;  3W7W A;  3WWJ A;  3W1G A;  3K9S A;  2IH1 C;  2EJ3 A;  4GZR B;  4K0K B;  1QR9 A;  4EYH B;  2RDJ A;  1CXZ B;  3K06 A;  2EIN C;  3BEH A;  3DXR B;  1H8H G;  4O4I A;  1TWA A;  1I5Y A;  5IP7 G;  2PI4 A;  4BY1 G;  4A3J G;  2FML A;  3J7A K;  5IYB O;  3DTU B;  3BRC A;  3P3P A;  3RYC B;  5EZY B;  1I2K A;  2W7P A;  4DR3 O;  1I6U A;  4I4T F;  4NXN B;  3QO7 A;  4CHI A;  3KHG A;  2W9B B;  3TY5 A;  3ASO C;  4X1I A;  1Z2O X;  2X7R B;  1NTM H;  1KT8 A;  1NR7 A;  4DV2 H;  2UUA H;  3RYC A;  5EZY A;  4C5C A;  1GLV A;  3T1Y H;  5D5P A;  1WH2 A;  4EYI B;  2P5O A;  3RB4 A;  2IJI A;  3SYO A;  2W9B A;  1S0N A;  3ASN C;  4U6P A;  4B3S B;  3AW8 A;  5H9C A;  1AI5 A;  4MTX A;  1GK9 A;  3FMA A;  4A3I G;  5EWF A;  3T4D A;  1K4C C;  4CH6 A;  4DR5 B;  1ZTE A;  5L3B A;  4LFB H;  1TWC A;  1RSO B;  3AG4 B;  4X1K B;  2R6F A;  4O4H A;  1A0G A;  3C3T A;  1LR1 A;  2HJD A;  3F5W C;  2V9W A;  4DR4 B;  2VQF H;  2OTL V;  3R5H A;  4FBT A;  1VBH A;  3KKY A;  1A48 A;  4E2L A;  4UB6 Z;  1XNQ H;  2VUM A;  1JQ0 A;  3WWH A;  4HN2 A;  5GTI Z;  1P84 F;  1RSO A;  4MV4 A;  4LF7 B;  4J80 A;  4DQN A;  3M7M X;  4BAY A;  2HHH O;  1XUQ A;  2UXN A;  3ZRS A;  2FE3 A;  4NYK A;  3CD6 V;  3R66 A;  1EZV H;  3GVM A;  2Q0A A;  4TVI A;  1J5E H;  4J9S A;  2ITD C;  2NLJ C;  4TT3 G;  3HB9 A;  1P7G A;  1F51 A;  5JVD A;  2ASD A;  5F2V O;  2V7Q G;  3G80 A;  3MR3 A;  3MR2 A;  1GAX A;  1D5A A;  3W1B A;  4AYB E;  3AG2 B;  3VNN A;  3F8N A;  1TA8 A;  3ZS8 C;  1KJI A;  2RGV A;  2AGP A;  2WDT A;  2M6Y A;  1GKF A;  5IT9 W;  1IXM A;  2HP8 A;  4F4Y A;  3GLK A;  1BSM A;  2DIK A;  2XOK G;  4JI0 O;  3VBB A;  5EIB C;  3ZRV A;  5HBR B;  3CB2 A;  4J7J A;  1NKD A;  3K79 A;  3K5N A;  1GN2 A;  3BA9 A;  1AJN A;  3PW5 A;  4ZQI A;  3ZMS A;  1FKA O;  3S24 A;  4J0M A;  4O2B F;  3PO3 G;  4YXW G;  4WBN A;  3CC7 V;  4UVC A;  2E76 B;  1SC5 B;  4JV5 B;  4CH3 A;  4H44 B;  4DV7 O;  2VQE H;  1TVK B;  2YL2 A;  5BY1 A;  4NZM A;  5KFM A;  2O57 A;  4C5B A;  3CCE V;  1R3J C;  5KFQ A;  4J9N A;  3T1C A;  4J9Z B;  3ORR A;  1S77 D;  2COG A;  1HWY A;  1SFO A;  5H6R A;  1B6R A;  1W93 A;  4N23 A;  5LYJ F;  1VF6 A;  4XBF A;  4ECS A;  1TVK A;  2CNV A;  2EUL A;  2QM8 A;  1TUB A;  4RQE A;  4WF9 V;  1K1Q A;  4I50 B;  4ZKI A;  3B77 A;  4WFA V;  3IJ4 A;  3K5H A;  1N34 B;  2UXD O;  3RYH A;  2R92 G;  4X88 A;  3ZHT A;  5KMG A;  2HFE C;  4B08 A;  4QWD A;  4MTE A;  2AW9 A;  4WCE V;  3GV7 B;  3WB0 A;  1MMM A;  5BYB A;  4JZ2 A;  3TCU A;  1CKN B;  4YJ3 F;  1FS0 G;  3GIK A;  1Y66 A;  3WO0 A;  1S5J A;  3EPG A;  4RB1 A;  3N8D A;  2CFM A;  2YS6 A;  4UCT A;  4IHJ F;  4OXS A;  4CS3 A;  4JUZ A;  3AX6 A;  3OEH G;  4RAI A;  3HBL A;  3CME V;  4X66 H;  3MR6 A;  3JRX A;  2LW7 A;  2OLS A;  4GC7 A;  1Y1V A;  1K34 A;  4A3K G;  3H1L H;  4HBN A;  1FFT B;  4DV6 O;  1SCU B;  3M99 B;  5KHH A;  3EVK A;  2JA6 A;  2QKA A;  2YWV A;  4PZ8 A;  3OSP A;  5CBF A;  4QPK A;  3N6X A;  4H37 A;  4Q0Y A;  4R7R A;  4YJ2 F;  5EK0 A;  3VQV A;  4MTG A;  3M4I A;  2NNU A;  3LNN A;  5GON B;  1SQX H;  2F93 B;  1AIL A;  2Q0O C;  2VPQ A;  2E5L B;  1V9P A;  2FLP A;  4IRK A;  3GWK C;  2YZM A;  5J2T B;  3OHB A;  1JLL B;  1X9N A;  3K0G A;  2A3Q A;  4DK1 A;  2E3C A;  1SYX B;  4ZBM A;  5I5Y A;  4CBC A;  4GLW A;  4IIJ F;  5BWW A;  5GON A;  3MHH C;  4LBE C;  4GKJ O;  2KG7 B;  2J9G A;  5KFP A;  3HKB B;  4TQS A;  4EB6 A;  4DR7 B;  1NI8 A;  3HOW G;  2ZDQ A;  4FLW A;  1E4G T;  3H4D A;  3JCZ A;  2HGX A;  3OFN G;  4AIL C;  4M9U A;  2EIJ C;  2ZE7 A;  4E6N A;  4EKW A;  1WCM A;  4JI7 B;  1AR4 A;  3ABK C;  2WTF A;  4B3R O;  5JQG B;  4MVZ A;  2R8G A;  5FLM G;  2KG7 A;  3HKB A;  4DV0 B;  5LL6 Y;  4O4L B;  4ED7 A;  1Y1W A;  2Q9L A;  1RK6 A;  4ZI7 B;  5D1P A;  3U0G A;  2YU9 A;  2KB1 A;  4JI6 H;  1X4T A;  3U55 A;  5CA0 A;  1Z2P X;  4C7U A;  2R82 A;  1ET0 A;  2AHZ A;  1S10 A;  2BTQ B;  2NR5 A;  1DGS A;  4JI2 H;  1MG1 A;  1T5E A;  3JAM W;  5EWG A;  2W6O A;  2VRZ A;  4TV9 B;  4ED3 A;  1VEW A;  1XEQ A;  4JYA B;  4K6N A;  4RZR A;  2JA7 A;  2ITC C;  1AP6 A;  5LXT B;  5KX5 B;  1E79 G;  4DW1 A;  1JPX A;  1FKA H;  1XIL A;  2BTQ A;  4NTW A;  4DV5 B;  2UU9 O;  2F4V O;  1B04 A;  2YZN A;  3GB7 C;  4MA0 A;  1YIT V;  3TQ1 A;  2R7Z G;  4CMF A;  4EFB A;  4IGG A;  4Q8F A;  4TV9 A;  2F23 A;  4LF9 O;  3RGX A;  1XDN A;  2N04 A;  4D7S A;  2WLI B;  4ZOL B;  4MVR A;  1EBO A;  1I7L A;  4DV7 H;  1WSC A;  1DLB A;  1VAR A;  2ZQM A;  2W0X A;  4TWK A;  2CTP A;  2WLJ A;  4HNT A;  3ZMV A;  2B63 A;  1AUX A;  3GWO A;  1XMQ B;  1GSO A;  1EZ1 A;  4DL7 A;  2P67 A;  3SNO A;  5B1B B;  3NR7 A;  2RJZ A;  1Y67 A;  2PMZ E;  4OPA A;  4K8X A;  4YHH B;  2QB5 A;  4DUY B;  2WLI A;  5KFN A;  4ZOL A;  4RQF A;  3OTO O;  3PR5 B;  5C8Y B;  2NU6 B;  4FS2 A;  3FB6 C;  4CH5 A;  3E2E A;  1S76 D;  2WAQ A;  1L1F A;  1XL4 A;  4OX9 B;  1M93 A;  2WB1 A;  3BY6 A;  2JJ1 G;  2DYR C;  1EFR G;  2C2R A;  3L71 H;  1HNW O;  2OIG A;  2UXD H;  1PNK A;  1N32 B;  3ZIA G;  2COJ A;  1KJ9 A;  1CEZ A;  4ECV A;  1VF5 B;  5LOV F;  2BSK A;  2DMX A;  2W6M A;  4O3O A;  4DV3 B;  4JI8 H;  4OGQ B;  3H01 A;  2EIJ B;  2XAJ A;  1NH2 B;  1IBL O;  1E4E B;  5IP9 G;  2XAF A;  4NZO A;  1E4F T;  2A7W A;  4NVP A;  3QNE A;  5IYZ A;  1P8L A;  4IWX A;  4FFO A;  3STL C;  5CA1 B;  2JS5 A;  1I94 B;  4X20 B;  5IE9 A;  2GV9 A;  3CXH F;  4J9R A;  3ZHU A;  1S72 V;  4NXM B;  4JI4 B;  1K5S A;  1BQ0 A;  2CQY A;  2FK2 A;  3T9F A;  3CRR A;  4QWE A;  2IM9 A;  2FK3 A;  2FPP B;  5JCO C;  1EKF A;  2V4R A;  5B66 Z;  1YIJ V;  5LBQ A;  1VQ7 V;  4X65 H;  5CA1 A;  4DV6 H;  2ZDI C;  4X20 A;  3RYF B;  1Q8I A;  1W0K G;  4MV3 A;  2DOS A;  2KQX A;  2ALZ A;  1IBM O;  2BR0 A;  1QQC A;  3ABL C;  3RR5 A;  1XNR O;  3RBD A;  4LC1 A;  1HR0 O;  4ECU A;  4DR5 O;  4BW5 A;  4PDL A;  4IRC A;  1XI1 A;  1TWG A;  2M05 A;  2AXT Z;  2JGD B;  3T54 A;  2JVD A;  2GHY A;  3RYF A;  2ZE5 A;  1SQF A;  1VKZ A;  2QR4 A;  3UZB A;  4EG0 A;  4UB8 Z;  3O9O A;  3RB6 A;  1Z2N X;  1TGO A;  3ZJZ A;  4E4T A;  1AP5 A;  3UFX B;  2RMK B;  4NR1 A;  2P22 C;  4AI8 A;  1KBH A;  2CNU A;  2B1I A;  4BIU A;  4GUN A;  3K57 A;  4FK5 C;  4A3G G;  2W0F C;  1QVG U;  4HNA B;  2DN9 A;  2XAS A;  2ODT X;  4FFB B;  4ZHQ B;  1JJO A;  2P6J A;  2WA3 A;  2E2H A;  2JEI A;  4JI3 B;  3I55 V;  1YCI A;  3FKI G;  3RV4 A;  5IWA H;  1L0N H;  4PDM A;  2X5R A;  5HFL A;  4QSH A;  2GTS A;  4YQW A;  4PDB A;  2ZDH A;  5J2U B;  3JYC A;  4RO2 A;  4HNA A;  3QO5 A;  5K1X A;  1B3Q A;  4FFB A;  2Y4R A;  4ZHQ A;  2QKS A;  1US6 A;  1Y4M A;  4LH7 A;  4PD4 F;  5EDW A;  3F7Y C;  3ETG A;  1EN4 A;  3D3I A;  4CS4 A;  5C5J A;  1I0H A;  5CB4 A;  2P90 A;  4I9Q A;  4RUF A;  4RB0 A;  4UCV A;  5EZY F;  1LNQ A;  3JAK B;  1N33 H;  5KT7 A;  3OMI B;  4JZG A;  5IY5 C;  2EIL B;  5LA6 B;  2JEU A;  4MSW C;  1PP9 H;  2NUA B;  5J2U A;  5BR8 B;  3SJC C;  2Y4U A;  1YJN V;  5L3F A;  4QPJ A;  3AG1 C;  1HNZ O;  3UM7 A;  1R6T A;  5DMX A;  1K92 A;  3H1I H;  3CJH B;  2ZJT A;  3ZRW B;  3IG0 A;  1V51 A;  1VQK V;  1E1R G;  1YJ9 V;  2F4V H;  3JAK A;  4O4J B;  1BS3 A;  2XUM A;  3RWR D;  2OYQ A;  1I50 A;  3BA8 A;  4O4H F;  5LMN H;  5IYD G;  3LML A;  4W4L A;  4DLK A;  3APO A;  3JRW A;  5DG8 A;  5BPF A;  1ZAU A;  4LF8 B;  3SI8 A;  2DWD C;  2RNB A;  5L1I A;  2YW2 A;  3CJH A;  1L2Z A;  4F4W A;  4FFL A;  1ENV A;  4C5A A;  3IGA C;  2WB1 E;  4XDK A;  3TJT A;  4O4J A;  2R8H A;  3H40 A;  2QWP B;  1P7B A;  4DV2 O;  4DIM A;  2B5U A;  2HHF A;  3T1Y O;  1CPY A;  3N41 B;  4KHP H;  4AQY B;  2UXB B;  4PBC A;  2B9Z A;  2V59 A;  2QYZ A;  4LFA B;  2Y4T A;  4QJF B;  1ZX3 A;  4WHX A;  2XC9 A;  3Q8P B;  4JI5 H;  4B7E A;  5JH7 B;  5JVD F;  2VWJ A;  1HNW H;  1P4R A;  4LFB O;  1IBK B;  1P49 A;  2NN4 A;  3QWU A;  1H8E G;  3JAS A;  4FLT A;  3TGU H;  3GIP A;  4QJF A;  3LDC A;  1BE3 H;  3U9S A;  2DAB A;  5ITZ B;  2UUC O;  4BBR G;  1M57 C;  3GIQ A;  1WNS A;  2AQ4 A;  3JD3 A;  2W6J G;  4XX0 B;  1K9M W;  5T14 A;  4NXN H;  3HOY G;  1XDC A;  2Q7D A;  2R70 A;  2XD4 A;  3KTM A;  4PWQ A;  3K3P A;  5KG0 A;  3AK2 A;  4B3M B;  4WBN F;  4X64 O;  3V4S A;  1J5E O;  1M0W A;  2UUB B;  1CQI B;  2BQR A;  3C3S A;  5ITZ A;  1G2W A;  3D36 C;  4PJ0 Z;  3S3X A;  1TWH A;  1VQN V;  4ECY A;  5EBW C;  1ZQ7 A;  2PBZ A;  1BJT A;  2CAZ C;  1Q3E A;  1FJG B;  5BYA A;  4IYI A;  1DAA A;  3LSQ A;  1JMK C;  4B3S H;  3APQ A;  1KU9 A;  2K1E A;  3HKD B;  4I7H A;  1FXK A;  1JR9 A;  2A79 B;  1H2K A;  4J10 A;  3ML0 A;  4DR6 B;  3U54 A;  2Q5Z A;  4DR5 H;  2Z3Y A;  2WYO A;  2JA8 G;  3QTC A;  3RGB A;  5L1K A;  4J7Z A;  5C44 G;  3NXS A;  3T2M A;  4YAK B;  1ZSP A;  4J9O A;  3GJX B;  5BMV A;  3H1K H;  3L4J A;  2R7Z A;  3I4M G;  5KG5 A;  3CRQ A;  4JTC B;  1KJ8 A;  3HKD A;  4ED1 A;  3K0D A;  3GIM A;  5IT9 N;  4O2A A;  2R8K A;  2F95 B;  1RM1 B;  3BQ0 A;  4LF7 H;  3HKZ A;  3K08 A;  5KFH A;  2QK4 A;  4TUY A;  2BOB C;  2X6C A;  2UXC B;  2QWQ B;  3FX7 A;  2JEF A;  1CKM A;  1BGY H;  2Q7G A;  3E8H A;  2ZM6 B;  2XGP A;  2JGU A;  1W0J G;  4LMY A;  2N05 A;  5DGH A;  1M4U A;  1AI4 A;  5GW7 A;  5LP6 A;  5KFO A;  1I1L A;  4Q8E A;  4JYY A;  4ME6 A;  2GSM B;  3L75 H;  2QEX V;  2QWR B;  3LP8 A;  3SYQ A;  1MZB A;  5H2F Z;  1OCR C;  2MW2 B;  3ZMU A;  2ATK C;  1JKJ B;  2QM7 A;  3M9M B;  3EHB B;  2ZXW C;  1K83 A;  2R93 G;  4UV9 A;  1S5H C;  3T5H A;  3I4N G;  3BFR A;  3X2Q B;  3KHL A;  2IP4 A;  1VQL V;  3ZHS A;  3AG3 B;  4X62 B;  4O7W A;  4J9L A;  5A2Q W;  3EFF K;  3B4S A;  2XND G;  5B1A C;  2ABJ A;  4A2A A;  3PJS K;  1Q82 W;  1COW G;  5JJN B;  3GTO A;  3ETQ A;  4J42 A;  2QF7 A;  4UXN A;  1HNZ H;  2HG5 C;  4RUC A;  2LGQ A;  3DSQ A;  4WFF A;  1Q6I A;  4QGP A;  4DV5 O;  4O7Y A;  2QTO A;  3G4S V;  5L3D A;  2VR1 A;  5DLG A;  4F6E A;  1NU1 H;  2XAG A;  1JVM A;  4DV1 O;  4JV5 H;  1Q6H A;  3GTQ A;  2ADQ B;  1IOV A;  2YZL A;  4NLG A;  1VQ5 V;  3RUP A;  3OGC C;  5KA5 A;  4MTF A;  2BTO A;  5GON F;  2PI5 A;  1LUW A;  3MWM A;  4DL2 A;  1S3J A;  4X66 O;  3GQC A;  4PA4 A;  3DXR A;  1RK5 A;  4FFR A;  2A06 H;  3KAL A;  2KKW A;  5KFD A;  3DC5 A;  4ECT A;  2P4K A;  2FJZ A;  1ORQ C;  3FAV B;  1IXB A;  4MTD A;  3QZ8 A;  3JD1 A;  1JX9 A;  2FB5 A;  4OX9 O;  3QVN A;  5LGN A;  3CCU V;  2PF4 E;  3H9V A;  5E25 A;  3BG5 A;  1JOY A;  1N34 H;  4TOI A;  2R84 A;  4MW3 A;  2AGQ A;  5CA0 F;  1QU7 A;  2OIE A;  5L1J A;  2Y69 C;  4A3F G;  3V6K A;  2FYU H;  1ZUQ A;  4BW9 A;  1YSC A;  4LWS B;  3DF7 A;  3FAV A;  2CW8 A;  3V4Z A;  3RAX A;  5FD6 A;  3RFC A;  3ZHV A;  2ZGI A;  3CVZ A;  2UUC H;  4M0J A;  2EJ0 A;  3GTM A;  1BHB A;  1I94 O;  1VQ4 V;  4U7O A;  1S97 A;  2OTJ V;  3LQS A;  3ZN1 A;  4JI1 O;  3Q8S B;  4X1K A;  1YF2 A;  1V55 C;  4LWS A;  3SPJ A;  4EEY A;  3MJF A;  4A2B A;  3VPC A;  2ZXW B;  4E4E A;  2Z02 A;  1PX2 A;  2IA6 A;  4X64 H;  1XHX A;  1H2N A;  4KXR A;  4TV9 F;  1JIH A;  3A8T A;  1N8R W;  4DL4 A;  5DG9 A;  2I87 A;  2DWC A;  2NVY A;  1MA1 A;  1M90 W;  3QZ7 A;  4TV8 B;  4JI6 O;  5KT3 A;  1XK5 A;  3L74 H;  4JV1 A;  4ED2 A;  4PA7 A;  4DR1 B;  4A3M G;  2Q68 A;  5IYC O;  2W6I G;  3PZP A;  2EIN B;  1EYZ A;  2E74 B;  3N43 B;  4JI2 O;  4ZOL F;  1NR1 A;  1J95 A;  3HKZ E;  1R9T A;  2PYJ A;  3T5J A;  2YI8 A;  1B6S A;  3T1H B;  1DK1 A;  3T9D A;  3ASO B;  3E22 B;  3D3Q A;  2FKL A;  4YY3 O;  2PVP A;  4DR7 H;  5CMU A;  3BQ1 A;  5KAI Z;  5DGI A;  3JAM N;  2EIK C;  2Q67 A;  5CBH A;  5FR9 A;  3J7A U;  4EBC A;  3IAY A;  3T9A A;  3Q8Q B;  2C2E A;  1K4D C;  3RB0 A;  1AR5 A;  4JI7 H;  4DV4 B;  5IYZ F;  1T3N A;  2QSA A;  2ZE8 A;  5C93 A;  3ASN B;  1IYD A;  3A0H Z;  3E22 A;  1N36 B;  2GQR A;  4LP8 A;  1UC8 A;  2L35 A;  1RYS A;  1U97 A;  4FM0 A;  1XMO B;  1URF A;  5KFZ A;  3C90 A;  2R87 A;  2DQ3 A;  1B6Q A;  1I1M A;  4TQF A;  4WFB V;  5KS8 A;  4I55 B;  3PO2 G;  1H2M A;  1RJQ A;  4EBD A;  2CUG A;  5CA1 F;  4D6T H;  3VQX A;  4GKK O;  4Z2W A;  5BZB A;  5A9G A;  3THO A;  4JYA H;  4APM A;  3EPI A;  5I5U A;  4RNN A;  4F4X A;  4JI8 O;  1BQZ A;  4ASU G;  2ZDG A;  2ZT9 B;  4I55 A;  4Q4C A;  4FZ1 A;  3NGD A;  3A0B Z;  5LMU B;  2UUA B;  5KG2 A;  4Z1M G;  4DV5 H;  3L72 H;  4I50 A;  5IYB G;  2AZ2 A;  1ULZ A;  3FFQ A;  3CRM A;  3JD2 A;  2P7T C;  1VQ9 V;  3Q2O A;  3TEK A;  4QWC A;  2X6B A;  1F7Y A;  2PUS A;  2W6N A;  3OSN A;  5FNV B;  4DV1 H;  3GII A;  2YS7 A;  1M9N A;  2HVJ C;  3KAK A;  3SDL A;  5KT5 A;  4LF8 O;  3NBZ B;  3QQM A;  2OWO A;  2VWK A;  2HGW A;  3AYH B;  4QW8 A;  2C2A A;  4LNU B;  3ZX6 A;  4RUE A;  4PEL A;  1CKN A;  1DF4 A;  5AG2 A;  4Z1V A;  3CCQ V;  1YI2 V;  1SQP H;  4LF5 B;  2ZNI A;  4UCO A;  3HKE B;  3OE7 G;  4X65 O;  2VQF B;  2UXB O;  2CKZ B;  4DUY H;  3OT7 A;  2QA4 V;  5L9X A;  2BQU A;  2ZE6 A;  1XNQ B;  2EJ2 A;  1KMI Z;  5FL7 G;  1OWT A;  5D5Q A;  1FAF A;  4MV1 A;  4UUG A;  4OX9 H;  4MV9 A;  4LNU A;  3F5T A;  4YIO A;  1EN6 A;  3SJA C;  5LHI A;  2J6S A;  1PM9 A;  1N32 H;  1N4C A;  2QE7 G;  1S0V A;  3RIZ A;  1Q43 A;  2GBO A;  4DR2 B;  3HKE A;  3ZED A;  2YRX A;  1PNL A;  4O7N A;  4BBS G;  4DUZ B;  5JVL A;  5CB4 F;  4QE7 A;  4R6Z A;  3GTP A;  4B3T B;  3CSX A;  2OCH A;  5L3E A;  2HGS A;  4FU0 A;  1W2B U;  3JZF A;  2I80 A;  2ZNJ A;  5C1P A;  3I56 V;  1S0M A;  1V4Y A;  3BCC H;  1ZLZ A;  4EGJ A;  1I94 H;  4JF3 A;  2DZD A;  4I4T B;  2ZIN A;  3Q8R B;  1VBG A;  1SS3 A;  4JI1 H;  4JI4 H;  5J2T A;  1JJ2 U;  4O7L A;  4QIW A;  3FB8 C;  3TK1 A;  5IWA O;  4YAJ B;  1CQJ B;  4MA5 A;  3G6Y A;  3HO8 A;  3WWI A;  3MFH A;  4DK0 A;  5JQW A;  2R9R B;  2YEV B;  1KYO F;  3BAB A;  3OD4 A;  4CZZ A;  1CKO A;  1HP8 A;  1L8D A;  4XYM B;  1G6U A;  2AZ0 A;  4O4J F;  1PV0 A;  4FM1 A;  4CMD A;  5JQG A;  4CKB A;  1OCZ C;  4TQR A;  1N33 O;  4FMT A;  4O4L A;  2VQE B;  2NU7 B;  5CN0 A;  2YEV A;  4R8C A;  4ZI7 A;  3T7A A;  1OJH A;  5KG7 A;  2CGO A;  3GV5 B;  3OUF A;  5DEC A;  4GYC B;  5B1N A;  3GTG A;  4YY3 H;  4CC5 A;  5CAE B;  3GTL A;  4QW9 A;  5DM6 V;  4J9M A;  2IU3 A;  1NH2 D;  5LMN O;  3FYE B;  3JSN A;  1XQ8 A;  1H2S B;  2DJV A;  4LF6 B;  4GX2 A;  2HIX A;  5C4X G;  1KB9 F;  3ZHQ A;  5CBG A;  1NVP B;  4O82 A;  2Q2T A;  1EKP A;  5EYP B;  4JI3 H;  3H0G G;  2HVK C;  3ZBH A;  4R8U B;  5LXT A;  5KFL A;  5KX5 A;  1OBG A;  5CM0 A;  2JA5 G;  1WP7 A;  4XYL B;  3N2G B;  1F4M A;  1JFF B;  1WPB A;  5DQG A;  1KUT A;  3UKM A;  2VS0 A;  2V4Q A;  4RCN A;  2X0L A;  5LHG A;  2QKC A;  3QO8 A;  3TY9 A;  2ASJ A;  4LR3 A;  4KHP O;  1BXR A;  4EGQ A;  1RJR A;  5KFT A;  2YID A;  5B3S C;  4O7Z A;  3SPG A;  1D5N A;  4R8U A;  2CK3 G;  4O86 A;  4WD3 A;  2GPS A;  2BCC H;  4DR3 B;  4JI5 O;  2CE4 A;  2RF4 A;  4HNV A;  1KJQ A;  4Q6G A;  4GKK H;  3N2G A;  3BVO A;  1JFF A;  2R92 A;  4LFC O;  1VS0 A;  1OBD A;  5F9N A;  1AI6 A;  4P9P A;  2W9A A;  2UXX A;  1N0J A;  4K0K O;  1FPO A;  2R7M A;  4O2B B;  2G38 A;  5C8Y A;  4FLU A;  3RGZ A;  2LQT A;  3J81 W;  3AG7 A;  3ABK B;  1ZL8 B;  2EZO A;  3LDD A;  5BWX A;  2R8I A;  2QWO B;  3IFX A;  1NS1 A;  3CCR V;  5BMV F;  3TY8 A;  1NJI W;  1WN7 A;  4FBU A;  4NTX A;  5DQI A;  4NXN O;  3PFF A;  3L9D A;  5TIS Z;  4LF8 H;  4ECR A;  2I8C A;  4PDR A;  4O2A F;  4XZ3 B;  3B8M A;  4YP3 A;  1DF5 A;  1E4E A;  1ZL8 A;  4OPH A;  2ATL A;  2YI9 A;  4UCS A;  2CTQ A;  4TUY F;  4A3L G;  1PK8 A;  4O3N A;  5DQH A;  5LYJ B;  3CP1 A;  5BWV A;  2DW4 A;  2X6A A;  2UXB H;  3MHS C;  2YXY A;  3RT3 C;  3KHR A;  4LFA H;  5FJ8 G;  3U0Z A;  5LP6 F;  3E8B A;  3E83 A;  4B3S O;  4N21 A;  4RWU A;  3SYP A;  2P0A A;  3J80 W;  1S9F A;  2HHH B;  3PW0 A;  1BT8 A;  1YHQ V;  2EJR A;  1VQ6 V;  1SF9 A;  1DTO A;  4QE9 A;  4BXX G;  4BIO A;  4JAA A;  4DR4 O;  3P3N A;  5HNE A;  3HPL C;  4YJ3 B;  2W9C B;  4ECZ A;  4FIP C;  4LF7 O;  2JGD A;  4Y8V B;  2LO1 A;  2WWW A;  4MVQ A;  3N2K B;  4O4I F;  5KG6 A;  2A0L A;  2WAM A;  2YS8 A;  4JTD B;  2C22 A;  2UUB H;  2VPS A;  4JI0 B;  5KFC A;  4YJ3 A;  4YR0 A;  1GM9 A;  3LNM B;  4EEQ A;  1XBL A;  4A93 G;  2W57 A;  2DYR B;  4MV7 A;  2W8K A;  4K35 A;  5H5N A;  4O3Q A;  3R9R A;  4ETS A;  5FLX W;  1FJG H;  4LSX A;  3R5X A;  4PI0 A;  5DIS C;  5I5W A;  2D2C B;  1M56 C;  2W70 A;  4DR6 H;  2IBZ H;  1MSW D;  3CX5 F;  1SRY A;  4U7C A;  1I7N A;  4DV7 B;  4UVB A;  4NZN A;  4RAY A;  5K2M A;  4RAZ A;  1GH6 A;  2V58 A;  4X1Y B;  4CC6 A;  4GLX A;  3GID A;  3EXA A;  1RP3 B;  4IIJ B;  1WLE A;  5IJ0 B;  1BMF G;  5DGB A;  4JV2 A;  2HEP A;  1A32 A;  4GX0 A;  5IDJ A;  1K73 W;  5A2Q N;  2EIM C;  2FP4 B;  5LA6 A;  4DRF A;  1FXK C;  1YZB A;  4JV5 O;  1OCC C;  2UXC H;  4YB8 B;  2WSS G;  3RW0 A;  4X1Y A;  3RBZ A;  2YYA A;  1DV2 A;  4QWA A;  2ZM6 H;  4P30 A;  4X89 A;  2UXD B;  1SKV A;  3CWB H;  4DYL A;  1WB7 A;  2DYS C;  3ZRW A;  5JWP A;  1YTF B;  2WAQ E;  4RB3 C;  4HR7 A;  3ABL B;  3OR7 C;  1EHI A;  3SGI A;  5KFU A;  1Q90 D;  5JCO A;  5JJJ B;  3HXL A;  5LHH A;  3VQW A;  1XMO O;  4CKE A;  3ABM C;  1WPX A;  2ZDI A;  1PNM A;  3HB3 B;  3WB2 A;  3ICX A;  2XCL A;  3OUS A;  3G6V A;  1NT2 B;  4LF4 B;  4X62 H;  1JA8 A;  3WG7 C;  1N34 O;  1B33 N;  3M9N B;  4A3E G;  3VA7 A;  3STZ C;  5KG1 A;  3E89 A;  3PN1 A;  4PZ7 A;  1YXB A;  4LFC H;  2GQS A;  2JEJ A;  2WA4 A;  3IN5 A;  1R3I C;  1IOW A;  4K0K H;  2NVX A;  4P2Z A;  1KKD A;  1QCE A;  5HV6 A;  2JEG A;  4PI2 A;  4TSF G;  4DV6 B;  5KFE A;  1N56 A;  1UC9 A;  3T9C A;  4J9P A;  2PY5 A;  4L1K A;  5JH7 A;  2HR3 A;  2RN9 A;  5KFS A;  4H33 A;  1UFI A;  1T94 A;  1AJQ A;  1ZHS A;  2CW7 A;  1Q86 W;  2Q69 A;  3N42 B;  2C2D A;  3OHA A;  1S5L Z;  5KT2 A;  4O7R A;  1FD9 A;  4UCU A;  2OCC C;  4JAU A;  3SPC A;  1JCH A;  4HAM A;  4RU9 A;  1R3L C;  3NC0 B;  3QG5 A;  5IY5 B;  4O3P A;  1FVI A;  4JV0 A;  3ZMZ A;  5KG3 A;  3L2P A;  1UPG A;  4IT5 A;  1GMG A;  3F7V C;  4FLZ A;  4GKJ B;  2VUM G;  3JCU Z;  1EZJ A;  3AG1 B;  1SER A;  2AHY A;  4F6R B;  5L3G A;  1SEI A;  5HFM A;  5EBM C;  1AJP A;  3LSU A;  3K58 A;  4RUA A;  5KHJ A;  5LOV B;  1QR8 A;  2E5L O;  4MV8 A;  1E1Q G;  4P9O A;  1ZWI C;  3R23 A;  3PVX A;  4MVS A;  3OMN B;  4BY7 G;  1A0I A;  1KEE A;  3BAA A;  4B3R B;  2D3O W;  2EJ7 A;  3CPW U;  1DIK A;  1KC8 W;  1SES A;  1VIB A;  2QTS A;  1NTK H;  1G8M A;  4DR4 H;  4WFH A;  3E8F A;  5LL6 b;  1BNC A;  3RTX A;  4F6R A;  1GO3 E;  2DPJ A;  4DR7 O;  2W7O A;  4A5U B;  4IAJ A;  3MWD A;  5LOV A;  5I5V A;  4DL3 A;  4I55 F;  1PL4 A;  2YC0 A;  1MZE A;  3CCM V;  4I50 F;  2V1D A;  1RPR A;  3RBE A;  3CEB A;  1IZ3 A;  4JI7 O;  3NUA A;  3FKI A;  3CCJ V;  1SZX A;  2Z5U A;  4DV0 O;  3H1J H;  2UVW A;  3VOT A;  4F50 A;  4AYB A;  3N27 A;  4U3J B;  3FB5 C;  3OMA B;  5H80 A;  3CMA V;  3FYI B;  2R85 A;  3K5I A;  2R7L A;  4IRD A;  2UU9 B;  2XCA A;  2BOC C;  4FJC C;  3T4Z A;  3AG4 C;  3KCX A;  4LF9 B;  4MVM A;  4MVU A;  4U3J A;  1GSH A;  3OUU A;  3V6H A;  1M57 B;  2IJJ A;  5B1O A;  2UVU A;  4WFG A;  1O9G A;  1ARO P;  4JYA O;  2Q4P A;  4L87 A;  3B2E E;  3T1H H;  3O65 A;  5C3E G;  2VA3 A;  2YXL A;  5KUM A;  5KHG A;  4FLY A;  1YJW V;  3JAT B;  3A2F A;  3E8G A;  3OTO B;  1SQB H;  2HLD G;  3CSW A;  1ZET A;  3G6B A;  3TXQ A;  3CE2 A;  3G71 V;  1QLE C;  3T99 A;  1PD3 A;  3T5L A;  4KUM A;  4J9Y B;  1JDE A;  4DV4 H;  1WA8 B;  3GIL A;  2QM4 A;  5DG7 A;  1N36 H;  1XMQ O;  2R9A A;  3JAT A;  3AG2 C;  5J2T F;  4X1I B;  3UZO A;  2Q6A A;  3D36 A;  1XMO H;  5KFF A;  4QIW F;  4YHH O;  1TAE A;  1IBL B;  4DUY O;  3RVY A;  4BWA A;  4LH6 A;  3ZHR A;  3QFF A;  4LSA A;  1WA8 A;  2ZR2 A;  3TII A;  5BXZ A;  1XL6 A;  3HOV G;  5DAA A;  3SJB C;  1GM7 A;  1IUR A;  4DAA A;  3D8C A;  4ED0 A;  3CCL V;  1N32 O;  3DC6 A;  5KT4 A;  1GGO A;  4DV3 O;  4IWY A;  2C00 A;  1Y1V G;  3OGI B;  2W8L A;  5JQG F;  3V6J A;  1FXH A;  1KKC A;  2EZP A;  5LMU H;  4PA3 A;  4HQ6 A;  4O4L F;  2JA6 G;  4O4H B;  3ETJ A;  1VF6 C;  1VP7 A;  3LUL A;  3L73 H;  1BGW A;  4ZI7 F;  2J6U A;  1C3O A;  4G28 B;  2F43 G;  1R1B A;  3G6X A;  1TUE B;  1IBM B;  3DGE A;  2R9I A;  2R8J A;  4NXM O;  1XNR B;  3BAC A;  4JI4 O;  1WAZ A;  1HR0 B;  1OCR B;  1UJW B;  3VQY A;  5E1A C;  1EUC B;  1AR1 B;  3A0R A;  3M8A A;  3CYO A;  2V5A A;  3W7S A;  3U10 A;  2OH2 A;  5FPR A;  4UCR A;  1HNX B;  2ZKO A;  4ED6 A;  1AVM A;  4IL6 Z;  4LF5 H;  4HZ3 A;  2WE6 A;  5B1A B;  4FLV A;  5LXT F;  5KFA A;  4YR2 A;  1NQT A;  5KX5 F;  1TWF A;  2DAA A;  4FFN A;  5JVD B;  3T5K A;  3FDS A;  4O83 A;  2X0S A;  3RF2 A;  2Q7H A;  3RVZ A;  2IH3 C;  3K59 A;  3ETD A;  3KG2 A;  1N48 A;  1WCM G;  2E5L H;  4DR2 H;  4GX5 A;  2ZR3 A;  4DUZ H;  4A3D G;  1QLE B;  2ARH A;  1Q6U A;  3EYY A;  5KFK A;  3PR4 A;  4TV8 A;  1S0O A;  2LW1 A;  4DXW A;  1Y1W G;  4B3T H;  3P32 A;  4IR1 A;  5EBL C;  4A3C G;  5DGA A; 
#chains in the Genus database with same CATH homology
 4UFZ A;  5IWA H;  5JQG A;  4O4L A;  5LP6 B;  3BPZ A;  2VQE B;  4PDB A;  2F4V B;  4WBN B;  4ZI7 A;  5J2U B;  4DR1 H;  1ZHQ A;  5LMN B;  4HNA A;  5K1X A;  2YIB A;  1QHT A;  4FFB A;  4ZHQ A;  4GYC B;  4LH7 A;  4CS4 A;  4DV0 H;  5CB4 A;  4I9Q A;  4YY3 H;  4CC5 A;  4RB0 A;  1HNZ B;  4KL1 A;  4UCV A;  3JAK B;  1N33 H;  2PZS A;  3JSN A;  1XQ8 A;  4EFE A;  1H2S B;  2ZIM A;  5LA6 B;  4LF6 B;  2HIX A;  4FM9 A;  5J2U A;  2Q2T A;  5BR8 B;  3SJC C;  5EYP B;  4JI3 H;  3N40 P;  5EIB D;  5LXT A;  4KHP B;  5KX5 A;  1SQG A;  2ZJT A;  3IG0 A;  3GB8 B;  1TUB B;  2F4V H;  3N2G B;  4O4I B;  1JFF B;  3JAK A;  4O4J B;  4FLX A;  1WPB A;  3RWR D;  2OYQ A;  3BA8 A;  4JI5 B;  5LMN H;  4EQ5 A;  2HVS A;  3LML A;  3TY9 A;  4LR3 A;  3RYH B;  1HNW B;  4PZ6 A;  4LFC B;  3C0F B;  1S68 A;  2F66 C;  2RGR A;  3W1G A;  1ZAU A;  5KMG B;  4DV2 B;  4LF8 B;  3T1Y B;  4K0K B;  2Q7E A;  1L2Z A;  4DR3 B;  4LF6 H;  3L4K A;  4Q6G A;  4GKK H;  3N2G A;  4O4I A;  1JFF A;  4O4J A;  1VS0 A;  2HVR A;  4D7T A;  3J7A K;  3BRC A;  3RYC B;  5EZY B;  3N41 B;  4KHP H;  4AQY B;  2UXB B;  5K1P A;  4O2B B;  1I6U A;  5C8Y A;  4FLU A;  3RGZ A;  4NXN B;  4LFB B;  3J81 W;  4LFA B;  1XMQ H;  3RFR A;  3TY5 A;  4X1I A;  4JI5 H;  5JH7 B;  1Z2O X;  2VWJ A;  3MAQ A;  3TY8 A;  5FNV A;  4YHH H;  1WN7 A;  1HNW H;  2UUC B;  4AHC A;  2XHB A;  4DV2 H;  4LF8 H;  1IBK B;  1P49 A;  2UUA H;  3RYC A;  5EZY A;  3QWU A;  3JAS A;  4FLT A;  3T1Y H;  5D5P A;  1WH2 A;  2P5O A;  4DR3 H;  2YI9 A;  4UCS A;  5ITZ B;  4DRX B;  1O9H A;  4B3S B;  1WNS A;  4X64 B;  5LYJ B;  1J5E B;  3FMA A;  4DV3 H;  2UXB H;  4DR5 B;  4CH6 A;  4NXN H;  4LFB H;  1P16 A;  4LFA H;  2R70 A;  2ZCE A;  4X1K B;  3U0Z A;  2MCT A;  4O4H A;  4B3M B;  3KXY T;  3RJ0 A;  4DR4 B;  2UUB B;  3GDE A;  1M0W A;  2VQF H;  5ITZ A;  3J80 W;  4DRX A;  1AN7 A;  2XIG A;  2HHH B;  4NXM H;  4EB6 B;  3SR2 C;  1XNQ H;  1BJT A;  1Q5O A;  1RSO A;  2CAZ C;  3UQ8 A;  1Q3E A;  4LF7 B;  1FJG B;  3M7M X;  4L8J A;  1FFX B;  1JMK C;  4YJ3 B;  2FE3 A;  4M7E A;  4B3S H;  1KU9 A;  3HKD B;  4I7H A;  2Q0A A;  1J5E H;  4DR6 B;  4I4T A;  4DR5 H;  3UT5 B;  3KYH C;  2WYO A;  3QTC A;  3RGB A;  2YCH A;  5JVD A;  3N2K B;  3GJX B;  5BMV A;  3L4J A;  3JAL B;  3JAR B;  2UUB H;  5CA0 B;  4JI0 B;  2VPS A;  1D5A A;  1FFX A;  4YJ3 A;  3W1B A;  2HHH H;  1O75 A;  4FM2 A;  3VNN A;  3HKD A;  3F8N A;  1TA8 A;  3ZS8 C;  4EEQ A;  2RGV A;  2WDT A;  3K5O A;  2W57 A;  4O2A A;  4MV7 A;  3UT5 A;  5IT9 W;  2F95 B;  4FM1 A;  4LF7 H;  4ETS A;  4CH4 A;  5FLX W;  1FJG H;  5EIB C;  4TUY A;  2UXC B;  4LSX A;  3U11 A;  3CB2 A;  4PI0 A;  5DIS C;  3JAL A;  3JAR A;  2Q7G A;  3K5N A;  1CKM A;  2ZM6 B;  3BA9 A;  2JGU A;  4DR6 H;  4LMY A;  1M4U A;  1S03 G;  3S24 A;  5LP6 A;  4DV7 B;  4J0M A;  4ZIB A;  4RAY A;  1HW7 A;  4RAZ A;  3NBY B;  4WBN A;  4X1Y B;  1MZB A;  4CC6 A;  4GLX A;  4JI0 H;  4IIJ B;  4JV5 B;  5FD5 A;  4PHZ A;  5IJ0 B;  2PYL A;  4CH3 A;  2HEP A;  2VQE H;  1TVK B;  2PTM A;  1XHZ A;  2ZIO A;  3BHP A;  4X62 B;  3K5L A;  5LA6 A;  4DRF A;  5A2Q W;  4A2A A;  2UXC H;  4X1Y A;  5JJN B;  5EYP A;  3ETQ A;  4RB2 C;  2ZM6 H;  2HIV A;  4DV1 B;  2UXD B;  1SKV A;  1HNZ H;  3OTF A;  3DSQ A;  4RB3 C;  1TVK A;  1TUB A;  3SGI A;  4I50 B;  5JCO A;  5JJJ B;  1GYF A;  5BR8 H;  3HXL A;  3VQW A;  4X66 B;  1N34 B;  4JV5 H;  3RYH A;  3WB2 A;  3ICX A;  2BTO A;  5KMG A;  4B08 A;  4MTE A;  1NT2 B;  4LF4 B;  3MWM A;  3N44 B;  4X62 H;  3WB0 A;  4CS2 A;  3PN1 A;  4PZ7 A;  3H20 A;  4LFC H;  1CKN B;  5IYZ B;  3KAL A;  2KKW A;  1S5J A;  4K0K H;  4O2B A;  4RB1 A;  1VF7 A;  4MTD A;  4PI2 A;  4DV6 B;  2CFM A;  4UCT A;  4CS3 A;  2PY5 A;  5JH7 A;  4X66 H;  1N34 H;  1YEW A;  4TOI A;  4AQY H;  4HBN A;  1ZHS A;  5KHH A;  2CW7 A;  4BW9 A;  2O03 A;  3DF7 A;  4LF4 H;  4PZ8 A;  3N42 B;  2CW8 A;  4JI1 B;  3N6X A;  4Q0Y A;  5FD6 A;  4UCU A;  4R7R A;  3VQV A;  3CVZ A;  3M4I A;  3LNN A;  2UUC H;  2R72 A;  3NC0 B;  5GON B;  3QG5 A;  5LYJ A;  2F93 B;  1IBK H;  1FVI A;  3L2P A;  2E5L B;  4FLZ A;  1V9P A;  2HVQ A;  4X1K A;  4GKJ B;  5J2T B;  1X9N A;  4A2B A;  4DK1 A;  2E3C A;  4F6R B;  1SA0 B;  4JI6 B;  1SEI A;  4X64 H;  1XHX A;  1SYX B;  3K58 A;  5KHI A;  5KHJ A;  2V4D A;  5LOV B;  5GON A;  4IHJ B;  3HKB B;  2F1M A;  4EB6 A;  4DR7 B;  1A0I A;  3BAA A;  4B3R B;  5FPO A;  4B3M H;  4FLW A;  4TV8 B;  1E4G T;  4JI2 B;  1XK5 A;  4DR4 H;  5LL6 b;  4DR1 B;  4AIL C;  3RTX A;  4F6R A;  1SA0 A;  4E6N A;  4JI7 B;  5JQG B;  4IAJ A;  5LOV A;  4IHJ A;  3N43 B;  3HKB A;  4DV0 B;  4GKJ H;  4O4L B;  4YY3 B;  4YJ2 B;  2PYJ A;  3N2K A;  4ZI7 B;  5D1P A;  4JI6 H;  1X4T A;  2YI8 A;  5CA0 A;  1Z2P X;  3T1H B;  3E22 B;  4U3J B;  5CB4 B;  2BTQ B;  2Q2U A;  4DR7 H;  4BWS C;  4B3R H;  1DGS A;  4JI2 H;  1T5E A;  4YJ2 A;  3JAM W;  2UU9 B;  4TV9 B;  3IAY A;  4JYA B;  5IJ9 B;  4JI7 H;  4DV4 B;  4LF9 B;  5LXT B;  1N36 B;  3E22 A;  5KX5 B;  1FKA H;  4U3J A;  3CHX A;  2BTQ A;  4DV5 B;  1B04 A;  1O9G A;  4FM0 A;  4EFB A;  4TV9 A;  1XMO B;  4GKK B;  4IIJ A;  3RGX A;  1XDN A;  4TQF A;  3B2E E;  4D7S A;  5IJ0 A;  3T1H H;  4ZOL B;  5IJ9 A;  4I55 B;  2YXL A;  4DV7 H;  5KHG A;  4FLY A;  3W5O A;  3JAT B;  3A2F A;  2QJ1 A;  4JI8 B;  3OTO B;  3VQX A;  1XMQ B;  2UU9 H;  2RJZ A;  3THO A;  4JYA H;  5D1O B;  4APM A;  4DV4 H;  4K8X A;  4YHH B;  4LF9 H;  1M0T A;  4DUY B;  2QM4 A;  4ZOL A;  1N36 H;  4I55 A;  3JAW B;  3WB1 A;  5C8Y B;  2R9A A;  4CH5 A;  5LMU B;  2UUA B;  2VUG A;  4DV5 H;  3JAT A;  4I50 A;  3FFQ A;  3K5M A;  1M93 A;  4FVM A;  4X1I B;  4OX9 B;  5LP6 C;  1XMO H;  1IBL B;  1TAE A;  2PUS A;  4DV1 H;  5FNV B;  2UXD H;  4BWA A;  1N32 B;  2YIA A;  3KAK A;  4LH6 A;  5D1O A;  3NBZ B;  4LSA A;  3HKC B;  2OWO A;  2VWK A;  4X65 B;  3JAS B;  4DV3 B;  4JI8 H;  3JAW A;  3OTO H;  3SJB C;  4RZQ A;  5JJE B;  1I7F A;  3RYI B;  4LNU B;  1E4F T;  4NVP A;  1CKN A;  5IYZ A;  1P8L A;  4LF5 B;  2ZNI A;  4UCO A;  3HKE B;  2VQF B;  5CA1 B;  2JS5 A;  1I94 B;  4X20 B;  4DUY H;  2GV9 A;  4K8Z A;  3HKC A;  5LMU H;  4NXM B;  1XNQ B;  2KSW A;  1KMI Z;  4JI4 B;  2PGG A;  5D5Q A;  4O4H B;  3JSL A;  4OX9 H;  2YIB D;  4MV9 A;  3RYI A;  1BGW A;  4LNU A;  1M5I A;  2IM9 A;  2RQ6 A;  1IBL H;  5JCO C;  3SJA C;  1IBM B;  1N32 H;  3RIZ A;  1Q43 A;  4DR2 B;  3HKE A;  3ZED A;  1XNR B;  4X65 H;  5CA1 A;  1HR0 B;  4DV6 H;  4X20 A;  4DUZ B;  3VQY A;  3RYF B;  2EX3 A;  1Q8I A;  4TQD A;  3K3V A;  4B3T B;  3CSX A;  3U10 A;  5FPR A;  2HGS A;  1Z5V A;  4UCR A;  2ZNJ A;  1HNX B;  1QQC A;  3RR5 A;  1Z5W A;  4LF5 H;  3KAJ A;  5IWA B;  2WE6 A;  1I94 H;  4I4T B;  4FLV A;  1XI1 A;  2ZIN A;  4JI1 H;  4JI4 H;  2JVD A;  5J2T A;  3RYF A;  1SQF A;  5JVD B;  5BMV B;  1Z2N X;  1TGO A;  3RF2 A;  5KHK A;  2Q7H A;  1IBM H;  2P22 C;  3K59 A;  2E5L H;  4DR2 H;  3QF7 A;  1XNR H;  4DK0 A;  1HR0 H;  4O2A B;  4DUZ H;  2VOB A;  3EYY A;  3K57 A;  3BAB A;  1N33 B;  4TV8 A;  1CKO A;  4B3T H;  4HNA B;  1L8D A;  4FFB B;  4TUY B;  4ZHQ B;  1JJO A;  5EOY A;  1HNX H;  1G6U A;  4JI3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...