4UFZA

Synthesis of novel nad dependant dna ligase inhibitors via negishi cross-coupling: development of sar and resistance studies
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negishi Cross-Coupling Enabled Synthesis of Novel Nad(+)-Dependent DNA Ligase Inhibitors and Sar Development.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ufzA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ufzA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ufzA02
4B3MB 4B3TB 4TOIA 3QWUA 4DV0B 2UXBB 3BABA 1CKOA 3W5OA 1XK5A 4DV4B 4DUZB 1CKMA 4UCTA 3TY9A 4X62B 4DR4B 3GDEA 1HNXB 1A0IA 1XMQB 1N34B 3GJXB 4DV1B 1N32B 4DR6B 5LMNB 2ZM6B 3RR5A 4LF7B 1HR0B 4X66B 1FVIA 1XDNA 3W1GA 3L2PA 4X64B 4JI8B 1XNRB 1IBLB 1ZAUA 4UCOA 2VQEB 1IBMB 4YHHB 4LF5B 4PZ8A 3TY5A 1N33B 4DV6B 1TA8A 3SGIA 4PZ6A 4JYAB 2UUCB 4E6NA 3VNNA 4UCSA 4PZ7A 1VS0A 2HIVA 4GKKB 3NBZB 3BAAA 1HNZB 2Q2UA 5FPRA 4DV2B 5D1OA 3OTOB 4LFCB 3NBYB 4DV7B 4LH6A 3NC0B 2UU9B 2HHHB 5FPOA 4JV5B 4DV5B 4JI7B 1P16A 2HVSA 4UFZA 2UXDB 1X9NA 4X65B 1IBKB 4LFAB 2HVQA 1DGSA 1HNWB 2F4VB 4EFEA 3BA9A 4GKJB 4UCVA 3PN1A 3TY8A 1I94B 5IWAB 4LF6B 4JI2B 4JI4B 4B3RB 3T1YB 4JI0B 5BR8B 4JI6B 3KYHC 4DR7B 1CKNB 4K0KB 5D1OB 5DISC 4DRFA 4JI1B 3T1HB 3W1BA 4AQYB 2VQFB 4CC6A 3S24A 3BA8A 4DR2B 4LF9B 4EFBA 4LFBB 2HVRA 4NXNB 4EEQA 1CKNA 2E5LB 4UCUA 2UUBB 2UXCB 1S68A 2OWOA 2UUAB 4LF8B 4OX9B 4DR3B 1N36B 4KHPB 3RTXA 3JSNA 4CC5A 3GB8B 4DR1B 2Q2TA 2CFMA 4YY3B 4DR5B 4DUYB 4LF4B 1B04A 4EQ5A 4JI3B 1J5EB 4LH7A 1XMOB 5D1PA 4DV3B 4GLXA 4JI5B 2VUGA 1FJGB 4NXMB 4UCRA 5LMUB 4B3SB 1V9PA 3UQ8A 1P8LA 1XNQB 2HIXA 3JSLA 1TAEA
chains in the Genus database with same CATH superfamily
3CS5A 4HAMA 2HHHO 3Q8RB 4B3TB 4FFOA 1YJNV 2YIBA 2YZNA 4JV5H 1AI7A 3HPLC 3W5OA 3VQWA 1VIBA 2YIAA 2JEUA 4TV8A 3T54A 5ITZB 2LW1A 4DL2A 4X62B 5KA6A 2UUAO 3BY6A 2Z0AA 1KTAA 4DLKA 1R1BA 1NT2B 2GUZA 1FXVA 2Q7GA 1YXBA 5KHGA 4RB0A 5GONF 4RNMA 1K1SA 4YJ2B 2JGDB 4MV3A 3JRXA 5DGBA 5LXTA 1NH2D 3K9AA 5EC1C 4DK0A 4LP8A 3NXSA 4NKGB 1TA8A 4JAVA 2QM8A 3SGIA 2GQSA 2WLLB 5IYZB 1WP8A 2YZLA 2UUCO 3PW0A 3R5FA 1Z2NX 1RK6A 2CE4A 4O4IA 3ZRWA 1S0VA 1NVPB 3QG5A 2WLJA 2HHHB 3G80A 2P6JA 5IJ0B 2HGWA 3KKYA 5LA6A 1ET0A 2IP4A 1AN7A 2Q6AA 3OTOO 5B1AB 5B1NA 3CRCA 1RYSA 4WBNF 5LYJB 2AHYA 3GTJA 1HNWB 3PR4A 4DV3H 3JCUZ 2R72A 3M8AA 3ZHTA 3S3XA 2XD4A 3T1YB 4DV3O 4FLUA 4JTAB 1N36H 5KFLA 3CPWU 4X1IA 4DR7B 3W1BA 4O7SA 3UZBA 1O9GA 4Q43A 5B66Z 4PWQA 2HDKA 4CC6A 3CXHF 2QB5A 5IT9W 3HO8A 1XL6A 2AQ4A 4BY1G 4K3AA 4YJ3B 1Y1VA 2LQTA 1W59A 4UCUA 5KKNB 5IWAH 1K5SA 4X66H 4Z1MG 2UUCH 5KFRA 1I7FA 3MFHA 4LFCH 1WNSA 4RQEA 1KB9F 3R65A 1SFOA 4FM9A 1Y14B 3N2GB 5DGHA 2DLNA 4LF5H 5IYBO 3V6JA 3Q8SB 4DUYB 2FLNA 4O7NA 1K9MW 3E2EA 2A79B 2ETNA 4MTFA 2DPIA 2WPDG 2EIMB 2WAQA 3N41B 4NXMB 4HNAB 2ZKOA 2KKWA 4YXWG 1N34O 2Y4UA 4HNUA 3ABLB 4JI8H 2AU0A 5GONA 2VUMA 1XNRO 4IWYA 5EOYA 2UXBB 1RJPA 4XX0B 3JAKB 2Y4TA 3CC7V 3L71H 3GTGA 4MV9A 4FPPA 1IYEA 4R7RA 2DQ0A 2F23A 2ZDHA 4MA5A 1ZL8B 5CA1F 1NTMH 2NUAB 3RVZA 5LGUA 3AG3B 4ZOLB 4DV2H 2E75B 4K0KO 1JR9A 3GIDA 4JI6H 4C5CA 1PNMA 3QO7A 5C3EG 5KT7A 4J10A 4ZI7B 1W0KG 1PPJH 2B1GA 4JF3A 4ECSA 1BSMA 4JZGA 2A3QA 4IHJB 4TWKA 2QTOA 5B1BC 1PK8A 1XMQO 4PZ6A 2I87A 4A2BA 2WDTA 3FB8C 1F51A 4BIUA 2E5LH 4NZOA 2ZIOA 4O7RA 3JYCA 1L8DA 1L0NH 1TVKB 2BSKB 2PMZA 3BEHA 1LUVA 1BXRA 4MVQA 2UXBH 5J2UF 3K59A 1WLEA 4QE9A 3JD3A 4PA7A 2QWPB 3KREA 5EYPB 2DMXA 2FB5A 3RN4A 4MA0A 2QWRB 2AZ2A 2NVYA 4GKJB 4JV0A 1EUDB 4FLTA 2FLLA 3IJ4A 3RYFB 4LF7H 3OR6C 3MDSA 2QM4A 3SPIA 4I9WA 3J7AU 2EJ2A 2NU6B 1S10A 1R9TA 1M57B 4JI6B 2EZPA 3CSWA 3C3TA 4K0KB 1S5LZ 5KFTA 2BQ3A 4JYAO 4YR2A 4HQ6A 4O3SA 4OPHA 1FXKC 1DV1A 3SE7A 4U3JB 3ZMUA 1AR4A 4TQFA 3F8NA 2G38A 2R85A 4IT5A 5EIBD 3W7XA 2R84A 3U0ZA 4LF9O 2YICA 1H2SB 4JI1O 2PI4A 3LWBA 5I60A 3RTXA 4O4LB 2VQEH 2UXNA 3N43B 3T5HA 4A3GG 1QU7A 2FKXA 3N2KA 4NYEA 4MV8A 1RFYA 5JH7B 2JA5A 1THZA 4MVZA 3K04A 3MWDA 4J9QA 2DWCA 4A3LG 2D2CB 2W9CA 4GKKO 3GIMA 3OEHG 1FS0G 2V59A 3ZHRA 2HIXA 3ABKB 3QVNA 2W6IG 3ASNC 1CPYA 1YZBA 3DC6A 4B7KA 2R70A 4RUAA 4HNVA 4MVRA 4YB8B 2OTJV 2AW9A 4FBTA 5KX5B 2P7TC 3CC4V 3PVXA 5KG6A 1G1XB 1SQVH 4CS2A 4LC1A 4DR4B 1FXHA 2DOSA 4JTCB 5K2MA 3WWJA 4X1YB 4ECRA 1RSOA 2HG5C 4BW9A 4APMA 1I6UA 2PYLA 4RAYA 3I56V 2WLNA 3GB7C 2VQEB 1WA8A 1J5EO 1JLLB 3ZHUA 2MK3A 4KHPO 2FMLA 2COIA 2Q0OC 4PHZA 3ETGA 5TISZ 4Z1VA 3RUPA 4DO2A 5LBQA 5FNVA 4MTXA 4O4IF 1WPXA 3JAWA 2FPPB 4Z2WA 1KC7A 3M4IA 4PA3A 4CH4A 5CAEB 4JI5O 4GKKB 1VQ7V 1F7YA 5I5YA 3KALA 3OTOB 3ETDA 4IYHA 3LSQA 1N0NA 4O4LA 4FM2A 2QF7A 4JV5B 2WB1A 3T5LA 5H6QA 4OX9O 5KS8A 4DL5A 3L72H 4FE2A 1Y74B 3HKZA 3ZJZA 2F4VB 2DYSC 4B3SO 1WR2A 2KSDA 3E8FA 1HNZO 4YR3A 4J9ZB 3T9EA 2R8JA 1PNKA 1HWYA 4H37A 2Y4RA 3F5WC 1M9NA 3X2QC 3ETJA 4A3KG 5BR8B 1Q86W 3CCUV 3FDSA 4GX1A 2JK5C 3H1LH 4XDJA 3G8CA 4J11A 2W6JG 5BMVA 4MVSA 2UXDO 1ZX3A 2FPGB 1QLNA 4WBNA 2Z3YA 2EILB 2H8PC 1SA0B 4GCZA 1UJWB 3T1CA 1BHBA 1W96A 3Q2OA 1KD1W 5IYDO 3AX6A 4ECTA 4JV1A 2NU9B 3WWIA 4ZHQF 5LP6A 5FD6A 4QWDA 3C0FB 2HJFC 2PGGA 2WSSG 3E22A 1YDXA 4NYKA 4O3RA 4AILC 1FD9A 4BBRG 2IH1C 3X2QB 3UT5A 2MCTA 1DK1A 1AR5A 1YTFD 4EGJA 4P9PA 5A2QW 1AJQA 5IP7G 1FJGB 2EJ0A 1QR9A 1GM7A 3LSUA 2ZM6H 4B3SB 1BCCH 5LL6Y 3AG4B 3ICXA 3JALB 5IT9N 4CH5A 4O7TA 5JJEB 4YQWA 4B3RH 1H2KA 2ATLA 3JATA 3QF7A 4KL1A 1WB7A 3JATB 4ED8A 1EBOA 3CP1A 2FMAA 3QWUA 3E35A 3K5NA 2ZCEA 2JA6A 3GV5B 2ZDQA 1K83A 2P0AA 2XT9A 4YAJB 1MZEA 1ZL8A 4LF8O 4RCNA 2OTLV 3GQCA 3OT7A 1JCHA 4FFKA 3B2EE 4JI2O 4R50A 2X6CA 2YXYA 2QWOB 1EM1A 3RGZA 4JI8B 3BQ0A 1IBLB 1V4YA 3KHGA 4FLZA 2HLDG 2L6LA 2R92A 5KUKA 4RUFA 2W6PA 2IH3C 3ABMC 4G28B 2CTWA 5KFFA 1E4EA 3B8NA 3I4MG 2F93B 3OTFA 1FJGO 5JQGF 3ZMSA 2HR3A 5BYAA 3H1HH 5FPRA 3P30A 2XCPA 3L74H 1BHAA 3R23A 1VQMV 2BTQA 4LF5O 4RNNA 3FX7A 2QGNA 3TW7A 5KG5A 4O82A 1M93A 3V4ZA 5KFIA 2HVSA 2FK3A 3FYIB 1VQLV 4BWAA 4X9QA 5IWAO 2CNQA 1OCRC 3HXLA 5K3WA 4HNAA 2Q73A 2OIEA 4JI2B 1QVFU 2V5AA 4LF8H 1J95A 3F5TA 3F7VC 3GTMA 1FAFA 3VOUA 4MSWC 4O4HA 4LFAH 4LF9B 3E8HA 2PMZE 1B6RA 4I4TB 1M56C 5LA6F 2WYOA 4NXNB 4IRKA 1BZKA 5LYJA 1MNGA 3MR3A 3K79A 1OCRB 2B63A 3U55A 3T9AA 4RO2A 4ECYA 2SCUB 4KUMA 2FP4B 4FGRA 1M4UA 3OMIB 1QHTA 3OMAB 4KFMA 4F6RA 3IAYA 5C8YF 3AG1C 4CS3A 2C2RA 2CDYA 1O75A 1GN2A 4GLXA 4K35A 2YXHA 4IYIA 2EINC 5KFKA 2F66C 3B40A 3RYCB 3ZMTA 2CGOA 4B3MB 3NR7A 3LNMB 1BGWA 5L1JA 5KG3A 3WWHA 1IX9A 2UVVA 4PA9A 3I12A 1CKOA 2IM9A 2W0FC 3QZ8A 1M6VA 1NTKH 5DN6G 4DV7O 2HP8A 2ZE5A 5LOVB 2J6SA 2WLHA 2Q69A 5KFCA 1NKDA 1QBZA 4C7UA 4O7YA 5I5XA 4CE5A 3AG7A 1HNZH 4BIOA 4PA6A 2HJDA 4WFBV 1YEWA 3W1GA 4GC7A 1VARA 2R7MA 1KJIA 1OCCC 4J9MA 4TUYF 1JFFA 4QJFA 4O83A 4CH6A 3MWMA 2NN4A 2RN9A 2ARHA 3RB4A 2W6ZA 2FK2A 5EZYB 4U3JA 3LNNA 3VQXA 3JALA 1YIJV 2RDCA 1URFA 2FTKA 1E4FT 2ALZA 4IWXA 3ABUA 3ZHVA 2Y0SA 5KT5A 3T4DA 4QWEA 3RW0A 4B3MH 1IOVA 1JPXA 1RPRA 3U9TA 5B1BB 4EG0A 4GUNA 5E79Z 2FB9A 2N04A 1TWHA 3QO8A 1NVPD 2JA7G 4RB2C 1QQCA 4X1KB 5LP6F 4U7OA 1RJRA 1FJGH 2ZDIC 1KKDA 2HG8A 4H33A 5J2TB 4Q6GA 5IWAB 2YS8A 3TQTA 1HR0H 1R6KA 4B7EA 1BNCA 2CNUA 3V6HA 5F9NA 3O65A 5D1OB 1IDSA 3RB3A 2GHYA 1EKFA 1S03G 1R6TA 3G6EV 2JGUA 1V55C 3BACA 4WFAV 3GTOA 5HFLA 2E74B 2XIGA 2W8KA 3HOYG 1FKAH 2Y69C 5KFBA 3RBEA 4MVMA 4NXMO 4GKKH 4ECWA 2JA7A 5KA5A 1AI6A 2OWOA 4W4LA 4O3NA 1I08A 4YBZB 4NXNO 3B8MA 2WAQE 4K8ZA 2Q2TA 4QIWF 3J81N 5C1PA 3HKBA 5LGNA 2YI9A 1PL0A 3HKBB 2YU9A 5DG7A 2Q7DA 2FE3A 4JYBA 3T9CA 4CBCA 2AHZA 3WB0A 4X8AA 3MD0A 3H1IH 4H13B 4IR9A 1GTOA 2DQ3A 3JARB 4O4JA 1SERA 4RWUA 5HV6A 5BR8H 3DC5A 5L1LA 2VOBA 2NNUA 1N48A 1GYFA 5KT6A 4U7NA 1IBKH 3L75H 5K1XA 4UCTA 1R3IC 4DK1A 1VMGA 5L1KA 2KB1A 1SQPH 2R7ZG 4GKJH 4DR3O 3OD4A 2BE3A 2OIGA 1RM1B 1XMQB 1Q3EA 3Q4HB 4UVAA 1I94O 4I5SA 4PA4A 1Y66A 2NR5A 4I7ZB 3ASOC 4X66B 1OHHG 1K4CC 3STZC 1GSHA 4YR0A 4DR3H 1V54B 2CQYA 3JD2A 4YJ2F 5EDWA 5KFMA 4DL7A 5KFXA 4NZMA 1R3LC 1Z2PX 5KFOA 2QTSA 2WWWA 5IY5C 5FNVB 2YZGA 4TV9A 1P49A 4XYMB 2F1MA 1KYOF 1YJWV 1K73W 1ZSPA 4LMYA 1I1LA 4RB3C 5KHHA 3RYIA 5KHIA 3E86A 4B3SH 2WA3A 2HIVA 1S77D 3H3VH 2B9ZA 5J2TF 3UM7A 2QJ1A 3FFQA 3DTFA 2EULA 4X65O 5LP6B 1XI1A 2UU9B 2AZ0A 2YCHA 5IYZA 4X89A 3CEBA 5KFZA 1G8MA 2FLPA 1N32O 3GTLA 4J42A 4NLGA 2GTAA 1AI4A 4NXNH 4ED6A 2Q67A 2YDEA 4FFBA 3APOA 1T94A 1G4YB 4GX2A 4Q4CA 1N32H 2HVKC 4EB6B 2D3OW 4QIWA 2QEXV 1JVMA 4P2ZA 1YVWA 4GX0A 1YF2A 4EKWA 1SEIA 1VQKV 3QTCA 5JQWA 2FK1A 4QPJA 3S24A 3M9OB 4BAYA 2Q68A 1S72V 1JIHA 4QSHA 5ITZA 5L3DA 3SYOA 3JAMW 3RB0A 1N34H 2Q5ZA 2YUAA 4CZZA 2YXLA 2ZDIA 3W7UA 4X20A 1HR0O 4ECVA 3K08A 5CR5A 2EIMC 4F50A 3HR0A 1EN5A 5BY1A 4QWBA 1MA1A 2W7PA 4U6PA 4ZQIA 3CJHA 4FZ1A 2UU9O 2X5RA 2EIJC 4ASUG 3K9SA 1TWCA 3JZIA 3RBDA 5LP6C 3D8CA 2PF4E 1SRYA 1XMOB 3HB9A 4WFHA 4B3MO 2XAHA 1GKFA 2W6NA 3G6BA 2H94A 5DG8A 4DUZO 4FVMA 2QWQB 4QW9A 2IBZH 2ZGIA 1X4TA 5BR8O 4GX5A 4YY3O 5KFEA 2ASJA 5DECA 2VQEO 4DV4B 4O81A 1VF7A 3HBLA 5JQGA 4FLWA 3T4ZA 2QR4A 2R93G 4LF9H 1V51A 5BWRA 3CMEV 4F4XA 5A9GA 1I0HA 2ITCC 5EYPA 3T9DA 2JEFA 4ED7A 4XDKA 4WD3A 4X1KA 3AG3C 1SQQH 4DR6B 3RR5A 2EILC 3KHHA 3LULA 2XCLA 1HR0B 4EGQA 4I55F 1XHZA 4J7KA 5LA6B 1PP9H 3BCCH 4DV5H 4YHHB 5CBGA 1N33B 4DV6B 1PL4A 1VQ8V 5JUMA 1MSDA 2XGPA 4QE7A 4MVUA 3RV4A 4ED1A 5EWFA 3CCEV 3UO2A 4FLXA 4E6NA 4Q45A 1M56B 3CB2A 1EN4A 1GN6A 4DAAA 5JCOC 3GILA 3BAAA 1HNZB 3SJBC 3G6YA 4JUZA 3T7AA 4LFCB 2VPQA 1YJ9V 4XZ3B 4WBNB 5LHHA 3T9BA 3OM3B 2IU3A 2WE6A 4CHIA 3N2GA 4A3BG 3TIIA 1N33H 4X65B 3CCJV 4JTDB 2HVQA 1RM1C 2ZR2A 4FFPA 3M9MB 1W93A 1NBMG 4R6ZA 1R3JC 4ECXA 4J7ZA 2DN9A 2QE7G 3SYQA 5DAAA 2NU7B 3K03A 5KHJA 2P4KA 4DW0A 1AB3A 4FU0A 2UUAH 2NVXA 3GLKA 4D7TA 3RBZA 3VPCA 3TEKA 2YIDA 5JVLA 4ECUA 3IFXA 2VWKA 3RT3C 1LR1A 4YHHO 2QA4V 1VP7A 4TVIA 2IJJA 3OGIB 1NS1A 3RYFA 1B6QA 1RP3B 1DIKA 4FS2A 5KHKA 2PYJA 1XNQH 3RFRA 3C3SA 1Z2OX 4EYIB 4A3DG 3AW8A 3H0GA 2CH7B 3FKIG 1BE3H 3A0HZ 3A2FA 2Q8VA 2GTSA 2FKLA 3K5HA 3OUUA 1T3NA 4OPAA 4F6RB 4B3TO 3CVZA 3ASNB 2R7NA 3N27A 5KG7A 1F4MA 5KLVH 3PW4A 4RAZA 3TGUH 3L4KA 1S9FA 2F4VH 4WF9V 3VQYA 4A3EG 2IJKA 4UXNA 5LMUB 4I9QA 2PI5A 3KAKA 3MJFA 3JSLA 4NTWA 4BBSG 1YTFB 5KT3A 3PO2G 5CM0A 5BYBA 4X1IB 1VQNV 2V9WA 1UFIA 5A2QN 1A0GA 1N0JA 3W7WA 2QM7A 2F95B 1JOYA 2IW5A 4DUZB 4I0XB 2UVRA 1R6NA 4FS1A 3ZMVA 4X66O 4GZRB 4J9RA 2Y48A 3TXSA 4FK5C 2ITDC 2XOKG 3HOVG 3U0GA 2VRZA 2NLJC 1NQTA 5EZYF 4ZHQB 4ECQA 4DL3A 2MW2B 5DQHA 4J7JA 5GTIZ 4EBEA 4JI2H 3RYHB 4C2MA 4DRXA 4BIZA 3EXAA 4O7ZA 4LF5B 5FJ8G 1BJTA 3ZIAG 3ORRA 5CA1B 3OAAG 4LSAA 3OFNG 2XASA 1SA0A 1COWG 3TETA 4LF6H 4UB6Z 5LMUO 1AUXA 3CE2A 4X20B 1WJZA 1S5JA 1PM9A 2NU8B 1I2LA 3F7YC 4O2AF 1P16A 3JAKA 1R73A 1AROP 2WA4A 3ABKC 1X9NA 1CQJB 4QWAA 4EYHB 5L3FA 4A93G 4YJ3A 5EK0A 1XMOH 2W6MA 3WFVA 3RVYA 4BW5A 5C8YB 1X59A 4EB6A 3DTGA 2BCCH 1WSCA 5JJNB 1XEQA 2YSUB 5KT4A 3RYCA 5DEDA 4X64H 3ABTA 1H2GA 3MR6A 5EIBC 4DYLA 5DISC 4N23A 3BVOA 3L73H 3U10A 2UU9H 1Q43A 2WLKA 4GLWA 4AQYB 3CQZA 3GIIA 3BFRA 5FNVF 4TM5A 4A3JG 4JV2A 1Y1WA 5KX5A 2UXDH 1OCCB 2COJA 3E8BA 3GTQA 3LSSA 2P67A 4LFBB 3CCLV 4MV7A 3IN5A 1Q81W 4J9SA 2GLTA 3H0GG 2E5LB 4F6EA 4H0LB 3TJTA 4GT1A 3OUSA 3CRAA 1E79G 1HNXO 4RB1A 3ZCCA 3ZN1A 1FXKA 4B3TH 5IJ0A 4TQSA 5E1AC 4CC5A 2AGQA 4RU9A 3KZIZ 4B08A 4QNHB 1QLEC 1EHIA 3TXQA 1SKVA 5KX5F 1TGOA 1XNQO 1AJNA 5L1IA 4F4ZA 2VA3A 2ODTX 2VUGA 4GYCB 1C30A 1KMIZ 4W4KA 4TQDA 2FJZA 2BR0A 5L3EA 4JI3O 3H1KH 1YI2V 1TUBB 4DV4O 4J9NA 2JEJA 1K34A 5D5QA 1TAEA 3A8TA 1XL4A 4PDBA 3P32A 2A9HA 3LP8A 3PR5B 3K5IA 2Z04A 2IJIA 5CBFA 2W9BA 1Y1WG 3Q1KA 2R8KA 1EFRG 4DR5H 4X65H 2ZM6O 3DGEA 1RK5A 3K3VA 1J5EH 1HNWH 3DF7A 1GLVA 5FL7G 4LFBO 3GJXB 5FLMG 2OT5A 4ZHQA 2ZT9B 3HKDA 5JJJB 1US6A 4OGQB 4LNUB 1N33O 3JZFA 4MTOA 5H2FZ 3QO5A 3KXYT 1Q6UA 1MABG 4ZKIA 2C00A 2IMWP 3TCUA 4I55B 3IGAC 3PJSK 1PV0A 5BZBA 4DR7O 2X0SA 1AUVA 5CA1A 3ZX6A 3K06A 1Q6HA 3SPJA 3ETEA 3TINA 4PZ7A 4AI8A 1I94H 3T99A 4GKJO 3GIJA 3NBZB 3T1YH 2COGA 4JASA 2Q2UA 4ZBMA 2OH2A 1IBKO 2ILMA 4RUCA 3S3WA 4C5AA 3RGXA 1Q8IA 1M57C 1A9XA 5KMGA 1SESA 4IRDA 4HBNA 4UFZA 3UT5B 1OWTA 2RGRA 1GM9A 2E2IA 4ZI7A 2FYUH 4P9OA 1KBLA 3A0BZ 3ZHQA 1JJOA 4X62H 2DIKA 4TV9B 1I7NA 1SZTA 1E1QG 4IGGA 4UCVA 4PDRA 3K5LA 3CWBH 1KJQA 3VOTA 3TQ1A 4DR6H 1I94B 2GSMB 4EBDA 4Y8VB 4J9YB 4B3RB 3DAAA 2JIZG 1MZFA 5LXTB 2YI8A 4XYLB 5EWEA 1Q82W 3GIPA 1NR7A 2ZE7A 4JI1B 5BWVA 2BSKA 5DGAA 1S0MA 4DUZH 5JWPA 4WFFA 3FYEB 5DM6V 4CKBA 3SNOA 5LHIA 4JYAH 4NXMH 3OSNA 4WHXA 2YRWA 1ZHSA 4ZOLF 4QWCA 2Y0IA 3D36C 2QK4A 4LWSA 2J6TA 4G3IA 5CA0B 3CJHB 3GB8B 4DR7H 2DYRC 5C44G 5B3SB 1KQSU 2RNBA 4AHCA 2YW2A 4MS2A 4ED2A 3JZ6A 3C90A 3K3WA 3CHXA 1G2WA 2N74A 4EQ5A 2GBOA 1AI5A 2ZE6A 3DTUB 3FKIA 1Q5OA 4DV3B 2C35B 3MFIA 4DV1H 2PBZA 5B1AC 1F4NA 2XTAA 1XNQB 5DMXA 1ZWIC 1CKNA 3RFCA 3ZEDA 4HR7A 1DAAA 4DR5O 4FFNA 2LJ2A 3T1HH 3AG2B 1IVSA 2Q7EA 1ROPA 3AYHB 3SPHA 1E1RG 5EBLC 2ABJA 5EBMC 1M0TA 2R7ZA 1CKMA 1OBDA 3GTKA 3WB2A 4G27B 1DF4A 5EBWC 2CW8A 3J80N 1B6SA 3G8DA 4PI0A 2ZM6B 1UNNC 5KG2A 5C4XG 2Q4PA 3L2PA 2P90A 5J2TA 5CA0A 2UVWA 1AJPA 3UKMA 4JGSA 3CC2V 1JJ2U 5IYCO 1EKPA 1GRJA 4JI7H 1EKVA 4MV1A 4DUYH 2PVPA 1M5IA 3K5OA 4KXRA 1XREA 5FLXN 2LGQA 2DABA 1B06A 3B09A 2QKCA 4PJ0Z 1VS0A 2GDSA 3L70H 4R7CA 2K9PA 1K97A 2W7OA 2KQXA 4X1YA 3RJ0A 2A0LA 4N21A 4DV7B 3J7AK 3ZRSA 4MT8A 5FPOA 3CRMA 1BGYH 3HT5A 4LF4H 1HW7A 4PDLA 1K8AW 2UXDB 2A06H 5K1PA 1IBKB 4PDMA 2EZOA 1M90W 2DPJA 1OCOC 4LBEC 3JASA 3EPIA 3BA9A 1WAZA 5LGTA 2ODMA 1Y76A 3ETQA 4IL6Z 3ZS8C 4D7SA 2CW7A 4A3FG 1QCEA 3SDLA 4O7WA 1N56A 3RAXA 2JGDA 1DV2A 4PI2A 3KYHC 3SJAC 4DV0O 1SETA 2ZQMA 5IYZF 4ABMA 4HZ3A 2DJVA 2X0LA 3L4JA 1TWGA 2E5LO 1VBGA 3CCRV 3HKZE 2RCVA 1QVGU 3OUFA 4NZNA 2F43G 1XBLA 4LF6O 1K3EA 1NJIW 1MOFA 2GPSA 5I5UA 4FFBB 4ED3A 4EEYA 2EJ3A 1OCOB 3UCSC 2YS7A 2UXCB 1IOWA 3WO1A 1DTOA 2YYAA 2R87A 4LSXA 2LW7A 2KSWA 4ZIBA 1IBMO 2K1EA 4QPKA 5DQGA 4AYBE 4K0KH 1NZ6A 1Y67A 5KFHA 4UUJC 2C28A 1P7GA 1D5AA 1CE8A 4JI3B 1J5EB 4G2KA 4FIPC 4FZ0A 2IU0A 1FKAO 2X6BA 1FXKB 4DXWA 3PO3G 1K33A 4RNOA 4A3CG 5KFVA 4R8CA 4O2BF 1XNRH 2LFSA 3CX5F 2W6QA 2ZJTA 2CZGA 2XGQA 1RSOB 2Z02A 3D3QA 2OCHA 4JI8O 1QR8A 2CH7A 1JDBB 2V4QA 3LQSA 5I47A 4J80A 1PD3A 2W71A 3QZ7A 5GTHZ 3ORQA 3GWKC 3FB5C 3CSXA 3CCSV 4IHJF 3KHRA 1N34B 2EIKC 5I5VA 1SS3A 1HDJA 2IA6A 3FB7C 5KAFZ 2E2HA 2F4VO 3I55V 5F2VO 1XNRB 3MR2A 2EJRA 1AVMA 4LFCO 1IBMB 1CEZA 3CYOA 1KP3A 3MHHC 2DZDA 3R5HA 1AP5A 5AG2A 4E2LA 1GK9A 5CB4A 5D8DA 2W9CB 1S5HC 5LOVF 2XAQA 3EHBB 1NH2B 3VBBA 1VF6C 4H44B 2ZXWC 2UUBO 2GQRA 2VA2A 4PV1B 3M9NB 1P7BA 4UVCA 1EN6A 4O4HF 3RIZA 4NVPA 4YIOA 3U54A 3T2MA 4DR1H 2AGOA 2PZSA 5KT2A 1IBMH 4YHHH 4BXXG 2VPSA 1JFFB 4QJFB 1KC8W 3UFXB 4B3RO 1BL8A 2DWEC 4MVOA 2BOCC 5CMUA 1BMFG 3OHBA 4FFRA 3TY8A 5KFSA 2BTOA 4O3PA 3IC9A 4JAUA 1TWFA 3GTPA 1AR1B 3AK1A 4NB5A 1H2MA 1Z2GA 2CNVA 2RDIA 5BWWA 3CRQA 3ABLC 4DV0H 2BTQB 4D6TH 3U9SA 2W9BB 5GW7A 1ULZA 2YEVA 4IR1A 4YJ3F 2P4VA 4EFBA 1JMKC 1DF5A 4KP4A 4A3MG 2W6OA 2JVDA 4DR2O 4F4WA 3WNZA 1BQ0A 4LF4O 4K8XA 2WLMA 2UUAB 4OX9B 1IXBA 3JSNA 3HKCB 1U97A 3G71V 1KBHA 3CCVV 5KFAA 2P22C 1KU9A 4I50B 3V4SA 1WCMA 5EWGA 1IBLO 4I50A 1MG1A 3E5NA 4OXSA 1K4DC 1W0JG 3LDEA 3G4SV 5H5NA 1V55B 1D5NA 5KFGA 4K6NA 2ADQB 3OMNB 5E25A 4LCUC 3PZPA 2R6FA 2UUCB 2V7QG 4OX9H 4TOIA 3M7MX 4JI7O 5L3CA 4O4HB 2X6AA 5EZYA 1GH6A 2PUSA 5JH7F 1H8HG 1B33N 2VUMG 4MW3A 5JQGB 4YY3H 2RDJA 3CD6V 2QWNB 2W57A 5T14A 1JX9A 4JI5H 2JS5A 5C8YA 5LMNB 2XAJA 2V1DA 4LF7B 2YIBD 3HKDB 2W0XA 3E22B 2XAGA 3KTMA 1EZJA 3CMAV 3T1HO 1GAXA 5BWXA 2A1HA 1L0LH 1VQOV 4RZQA 5GONB 4J9LA 4PZ8A 3N2KB 3TY5A 4FFMA 4PD4F 1CQIB 1OJHA 2RGVA 1S3JA 4NTXA 5IJ9A 2EIKB 1FFXA 3R5XA 3FAVA 3AEIA 4DV1O 3T9FA 3DXRA 2ZE8A 3ML0A 2Y0SE 3RAQA 3SYCA 4JAAA 1SCUB 1ZLZA 4NR1A 1MMMA 2UXXA 4YAKB 4LNUA 1TVKA 4O2BB 1OZ0A 4JI7B 1VQ5V 5L3BA 2ATKC 3WU2Z 1WH2A 5J2UB 4LFAB 4IAJA 5DQIA 3OW2U 4U7CA 5LOVA 4Q20A 4MV6A 4A5UB 2JJ2G 1JKJB 3UZOA 4EFEA 3VPDA 5KFDA 2DYSB 2X7RB 3GIKA 3PN1A 2CTRA 2R7KA 3EPGA 4Q44A 2EX3A 4I4TA 5LMNO 3MR5A 1S0NA 1H8EG 3BQ1A 3JAMN 3WG7B 1TWAA 2GPWA 2WLIA 2VR1A 2OCCB 4JYCA 3NGDA 3CCQV 1SYXB 3LDDA 2VQFB 2R9RB 4ZI7F 1QNMA 2EINB 1VF5B 2UXCO 3JAWB 4TUYB 3SR2C 1VBHA 1MZBA 1LUWA 2HVRA 4EEQA 4R8UA 3AG1B 3N8DA 3N42B 2C22A 2LP7A 1OCZB 3HKEA 4UB8Z 1I5XA 4M7EA 4PELA 5J9PC 2QSAA 4MTGA 3GV7B 4FBUA 3J81W 3HKCA 1UC9A 1WA8B 1I1KA 1RJQA 1Q7YW 3ZHSA 1NI8A 3OSPA 3N44B 3SI8A 4LF4B 3M99B 5DG9A 3W7TA 2J6UA 3TK1A 4UVBA 2ZNJA 1WCMG 1I3QA 4Q8FA 3A0RA 1I5YA 3G6VA 4O3OA 1PKXA 3VQVA 2JEGA 2EIYA 2RF4A 1S97A 3I4NG 1H2LA 1F23A 2HFEC 4UV8A 1KJ8A 4O84A 5HNEA 1EUCB 4E4TA 2YRXA 3N40P 4I55A 1L1FA 2W9AA 4ME6A 1O9HA 5BMVB 5CB4F 2V58A 4RZRA 2YEVB 1XOUA 1RYRA 3AK3A 2P06A 1ZQ7A 5D5PA 3UO3A 1YITV 1WPBA 2W8LA 2R8GA 3APQA 4LFBH 3OUZA 5BWTA 3TIGA 5BPHA 2PTMA 3RGBA 1XDNA 2UXCH 4CMFA 4MTDA 2HVJC 1KUTA 2PN1A 4FLYA 4MAMA 4I4TF 3HOUG 3E8GA 2BOBC 3H9VA 3K0GA 2I80A 1OV9A 2OCCC 3FB6C 4CMDA 4DV4H 4JI6O 4J9OA 4I7HA 4JI3H 4L8JA 2ZDGA 3G6XA 4JYAB 2XUMA 1FFXB 4DV2O 4EBCA 2JEXA 4DR4H 2VS0A 1XQ8A 2XAFA 4DRXB 3ZRXA 3I5DA 1SZXA 4KHPH 4LH6A 2HGXA 2DWDC 4UUGA 5F9LA 2HEPA 1AILA 1GO3E 4TSFG 3OHAA 3J80W 5JCOA 2JJ1G 3JASB 5IP9G 4IRCA 4WFGA 3E83A 1E4GT 4IIJF 1IZ3A 1SQBH 2JS3A 4JPRA 2WTFA 1H38A 2WLLA 1NR1A 2R82A 2HKOA 5HBRB 1ORQC 1K5QA 3LDCA 3RWRD 4O4LF 1VAJA 2ZIMA 4DRFA 3FMAA 1MSWD 2JA6G 2CTPA 4DR2B 1K1QA 4O2AA 2JEIA 3RYIB 3HOZG 1XMOO 3N6RA 5IYCG 2LO1A 3EVKA 3OEEG 5DLGA 4NTYA 3EFFK 2XHBA 4DR3B 2HJWA 4O2BA 5CA3A 2B5UA 2BQUA 1FPOA 3GWOA 3U11A 4JI1H 1ZUQA 1N4CA 2ASDA 4YY3B 2CTQA 4DIMA 1GSAA 1N36O 3BJYA 1XDCA 3QFFA 4LH7A 4TV9F 3AK2A 5IJ9B 1E4EB 3EYYA 5CN0A 3FAVB 1EYZA 4HNTA 4YJ2A 2ZXWB 1ZHQA 4DL4A 4AQYO 2W70A 4ETSA 1IBLH 5JVDA 5JVDB 4DV7H 3CEIA 2B1IA 2J9GA 3CCMV 4DV0B 3PW5A 1WP7A 1Q6IA 2FPIB 3FD9A 2O03A 3ZBHA 4WFEA 2JA8G 2Q0AA 4LF7O 3CXCU 3GIQA 4L1KA 4DR2H 4R8UB 3OGCC 2R93A 1HNXB 3BRCA 4J41A 1SF9A 1VQPV 5BPFA 1N32B 4HYOA 3K5MA 1K92A 4X64B 3OR7C 2C2AA 5LHGA 3WO0A 2UXBO 1ZAUA 4UCOA 3SJQC 1A48A 1M1KW 4XDLA 3KCXA 3WG7C 3W7SA 5KFWA 2E76B 2CK3G 2M05A 1R3KC 4GC6A 3JD1A 3VNNA 3B77A 2QDOA 1XMQH 1KP2A 2KG7A 2DW4A 4DV2B 1N8RW 5D1OA 3CRRA 4QGPA 1A32A 5IY5B 4LFAO 2C2EA 1I2KA 2YZMA 4BR6A 2R9AA 3RV3A 5FLXW 3KAJA 1VKZA 3GV8B 5IYBG 4DUYO 2R92G 2VQFH 5I5SA 2VWJA 1BQZA 1Y1VG 1V54C 5BXZA 2RJZA 1DGSA 2V4RA 5EC2C 5IYDG 1CS0A 1IYDA 2BQRA 4LF6B 3FKSG 3LUTB 1JA8A 2VQFO 4JI4B 2AXTZ 5IDJA 1XILA 4DL6A 1ZETA 4TQRA 1XUQA 5KMGB 3Q8QB 1XHXA 1GN4A 4O4IB 3ZRWB 5J2UA 2XCAA 5KFJA 2RQ6A 2OYQA 1OCZC 4JI0O 5KFYA 4JZ2A 4O4JF 3BA8A 4O7LA 1T5EA 2A7WA 2R86A 1YHQV 3JARA 4O4JB 3TW6A 1M0WA 2JRIA 2UUBB 1WRVA 1S68A 1NU1H 4LF8B 5H9CA 4MV4A 2N05A 4FJCC 1W2BU 2DE0X 2ASLA 1EZVH 3ZMZA 1B3QA 3PW2A 2CFMA 4UV9A 3ZN0A 2B63G 3H40A 3UYYA 2DAAA 5CB4B 5BMVF 3H4DA 5D1PA 5LYJF 4PBCA 4TV8B 4AYBA 4YP3A 3RYHA 2ZD9A 4MTEA 2XC9A 1P8LA 4ED0A 2KG7B 4JI4H 2V4DA 2HHFA 1U96A 2IJHA 4DV5O 1I50A 1UC8A 5B1OA 1VQ9V 4FLVA 1VQ6V 4CKEA 1A3GA 1T36A 3K3PA 4DV6H 1XK5A 1NTZH 4AQYH 3L9DA 3TY9A 2JDIG 4YIPA 5CA0F 2GV9A 3GDEA 4QW8A 3HOWG 4Q0YA 3VPBA 1FVIA 3KG2A 3OTOH 2H3OA 5IE9A 4X62O 2YC0A 4E4EA 1GGOA 5H80A 2C2DA 4A3IG 3Q8PB 3NUAA 1M7JA 3RB6A 4M9UA 2QYZA 3E89A 2AGPA 3MHSC 1Y4MA 4IHJA 3H20A 5LXTF 2CAZC 5KFNA 2YS6A 1KUQA 4RUEA 4C5BA 5BWUA 5KG0A 2IBKA 3H01A 3B4SA 3THOA 2WLIB 5KFUA 3NBYB 3K57A 1PX2A 3NC0B 3VA7A 4M0JA 5B3SC 4DV5B 3H1JH 5I5TA 2R9IA 1KKCA 3BHPA 1FFTB 4Q4DA 4F4LA 3BG5A 2FL4A 2GUZB 4JYYA 3K0DA 1Q90D 3MAQA 3D3IA 1CXZB 4HYKA 1L2ZA 2WB1E 4DQNA 2ZINA 2EJ7A 1P84F 1HNWO 1SQXH 4ICGA 4O3QA 3SYAA 4FFLA 2LGWA 4JV5O 1CKNB 5C93A 4WCEV 4LR3A 4TT3G 3T1HB 3VMMA 2HHHH 5KFPA 1Y76B 4DR4O 4ECZA 1YSCA 1GM8A 4I0XA 1D2DA 1K7DA 3P3NA 3P3PA 1SQFA 5LMNH 2QKAA 1VEWA 5CBHA 4DW1A 1ZTEA 3T5JA 5DLFA 2OLSA 1N36B 4KHPB 4DR1B 4J9KA 3PFFA 1QLEB 4J9PA 3R66A 2HHFB 4BWSC 4J0MA 3QQMA 4F4YA 2Y0PA 3ZRVA 2AGAA 4JXUA 4IIJA 2RMKB 3SPCA 5C1OA 4IIJB 1HNXH 4JI5B 4UCRA 5FR9A 5I5WA 3KHLA 4TUYA 1HP8A 1YCIA 2Q9LA 2O57A 3IC7A 1VF6A 2P5OA 2Q7HA 4O86A 4TV8F 2EIJB 4CKCA 4IZOA 3N6XA 2YWVA 3JRWA 4ZOLA 3BABA 5DGIA 2DYRB 4I50F 4O7VA 3LMLA 5KFQA 3DSQA 3IG0A 3QNEA 5L3GA 1GN3A 1OBGA 2XNDG 2R7LA 1S0OA 4X64O 1ENVA 1A0IA 4DV1B 1GSOA 3BQ2A 2JA5G 1WN7A 1I7LA 4FM1A 5H6RA 4L87A 2QKSA 1C3OA 1S76D 1WB8A 5KUMA 1BS3A 2M6YA 3R9RA 5HFMA 2I8CA 2CGNA 1IURA 1GO3F 1EZ1A 5CE8A 1KJJA 2Z5UA 4DR6O 4UCSA 1KJ9A 5LMUH 4CS4A 1SC5B 3OE7G 2ADPA 5FD5A 1TUBA 2R8HA 3HB3B 3Q4HA 4CH3A 1GMGA 2L35A 1KEEA 1Z5VA 3BPZA 3ABMB 3K58A 4LWSB 3RF2A 1JXLA 5L9XA 2YL2A 1KECA 4DV6O 3HOXG 4U3FH 1VQ4V 3ETHA 1AP6A 1BT8A 2CKZB 1G6UA 4O2AB 1Z5WA 2Y69B 3SPGA 3JCZA 3MWEA 4JI4O 1I1MA 3T1YO 1Y74A 4HN2A 5LL6b 3KCYA 1PNLA 1TUEB 4A2AA 3D36A 3HKEB 4PDVA 4XBFA 3STLC 4RQFA 4QIWE 3H4BA 5KG4A 3JD4A 3G67A 4FM0A 1DLBA 4JI0B 4X88A 5C5JA 2M7WA 3PW7A 1JDEA 1JX4A 1IXMA 4RAIA 2E3CA 4Q8EA 4P30A 2ZR3A 3ASOB 2UVUA 1SQGA 4FMTA 3O9OA 3AG4C 2LFRA 2EBOA 2CUGA 1P4RA 1Y6XA 5B5EZ 5KAIZ 1H2NA 1JQ0A 3T5KA 2R8IA 3GVMA 1LNQA 3AG2C 2VQDA 4JI0H 3SYPA 2PY5A 1CP9A 5KG1A 1FYJA 2ZNIA 1RPOA 4DR5B 2WAMA 1B04A 3V6KA 5JH7A 4DR1O 4BY7G 5JVDF 1UPGA 4MW8A 2HGSA 1V9PA 3DXRB 3JD0A 3UQ8A 3WB1A 2UUBH 3SJCC 1KT8A
chains in the Genus database with same CATH topology
4I55A 4B3MB 1BGWA 4B3TB 1O9HA 5BMVB 2YIBA 4JV5H 1CKOA 3W5OA 2IM9A 3VQWA 2YIAA 5D5PA 4DR5H 1WPBA 4TV8A 4X65H 5ITZB 3K3VA 1J5EH 5LOVB 4X62B 1HNWH 4LFBH 3DF7A 3GJXB 1NT2B 2PTMA 4ZHQA 2Q7GA 3HKDA 3RGBA 5KHGA 1HNZH 4RB0A 5JJJB 1XDNA 2UXCH 4LNUB 1YEWA 3W1GA 4MTDA 4YJ2B 4FLYA 3KXYT 4PDBA 1JFFA 5LXTA 4I55B 4CH6A 4DK0A 3MWMA 4DV4H 4I7HA 1TA8A 4L8JA 4JI3H 5EZYB 3SGIA 4JYAB 5IYZB 1FFXB 5CA1A 4U3JA 3LNNA 3VQXA 4DR4H 3JALA 4PZ7A 1XQ8A 1E4FT 1I94H 1Z2NX 4DRXB 3NBZB 3T1YH 2Q2UA 4O4IA 3QG5A 4B3MH 4KHPH 4LH6A 2HHHB 5IJ0B 3RGXA 2HEPA 5LA6A 1Q8IA 5KMGA 4HBNA 1AN7A 4UFZA 3UT5B 2RGRA 3J80W 5JCOA 4ZI7A 3JASB 5LYJB 4RB2C 1JJOA 1QQCA 4X1KB 1HNWB 4X62H 4TV9B 1E4GT 4DV3H 1FJGH 4UCVA 2R72A 3K5LA 4DR6H 1I94B 5J2TB 5IWAB 4Q6GA 1HR0H 4B3RB 3T1YB 4FLUA 1N36H 3RWRD 5LXTB 2YI8A 4X1IA 4DR7B 5D1OB 2ZIMA 4DRFA 3FMAA 4JI1B 3W1BA 1S03G 1O9GA 4DUZH 4CC6A 2JGUA 4DR2B 4JYAH 2XIGA 5IT9W 4O2AA 4NXMH 3RYIB 1FKAH 1ZHSA 4YJ3B 4GKKH 4UCUA 5IWAH 4X66H 2UUCH 2OWOA 2XHBA 1I7FA 4LFCH 4DR3B 1WNSA 4O2BA 5CA0B 3GB8B 4DR7H 3U11A 4K8ZA 4FM9A 3N2GB 4LF5H 2Q2TA 4AHCA 4JI1H 4YY3B 4DUYB 3HKBA 2YI9A 3CHXA 3HKBB 4EQ5A 2FE3A 4LH7A 1Q5OA 5IJ9B 4DV3B 3N41B 4NXMB 4DV1H 3EYYA 3WB0A 4HNAB 4YJ2A 1ZHQA 2KKWA 3JARB 4O4JA 1XNQB 4ETSA 1CKNA 1IBLH 5JVDA 4JI8H 5BR8H 3ZEDA 5GONA 5JVDB 4DV7H 2VOBA 4DV0B 2UXBB 5EOYA 3T1HH 2O03A 2Q7EA 3JAKB 1GYFA 2Q0AA 1M0TA 4MV9A 1IBKH 5K1XA 1CKMA 4UCTA 4DR2H 3WB2A 4R7RA 4DK1A 1HNXB 2CW8A 4GKJH 3BRCA 1XMQB 1Q3EA 1N32B 4PI0A 2ZM6B 4ZOLB 4DV2H 4X66B 3K5MA 3L2PA 5J2TA 4X64B 5CA0A 4DR3H 4JI6H 1ZAUA 4UCOA 4JI7H 1Z2PX 4ZI7B 4DUYH 5FNVB 1M5IA 3K5OA 4TV9A 1P49A 2F1MA 4IHJB 4PZ6A 4A2BA 2WDTA 3VNNA 4LMYA 4RB3C 5KHHA 3RYIA 5KHIA 1XMQH 4B3SH 1VS0A 2HIVA 2E5LH 2ZIOA 2QJ1A 4DV2B 3FFQA 5D1OA 4X1YA 3RJ0A 1L8DA 5LP6B 1TVKB 4DV7B 2R9AA 1XI1A 2UU9B 3KAJA 2YCHA 5FLXW 5FPOA 3J7AK 2UXBH 5IYZA 2VQFH 3K59A 2VWJA 4LF4H 1HW7A 2UXDB 5K1PA 1IBKB 5EYPB 2RJZA 1DGSA 3JASA 4NXNH 3BA9A 4GKJB 4FFBA 4FLTA 1N32H 3ZS8C 3RYFB 3ETQA 4D7SA 4EB6B 2CW7A 4LF7H 2QM4A 4LF6B 4JI4B 5KMGB 4JI6B 4PI2A 3KYHC 1XHXA 3SJAC 4K0KB 4O4IB 5J2UA 1SEIA 3QTCA 2RQ6A 2OYQA 3L4JA 3S24A 3BA8A 4U3JB 1T5EA 5ITZA 3JAMW 4TQFA 3JARA 4O4JB 3F8NA 1N34H 2YXLA 5EIBD 1M0WA 4X20A 4FFBB 3U0ZA 2UUBB 2UXCB 1S68A 4LSXA 1H2SB 4LF8B 2KSWA 4ZIBA 3RTXA 4O4LB 2VQEH 3N43B 4K0KH 2CFMA 3N2KA 1D5AA 5JH7B 4JI3B 5LP6C 1J5EB 5CB4B 1XMOB 5D1PA 4TV8B 3RYHA 4MTEA 1P8LA 2HIXA 4JI4H 2V4DA 4FVMA 1XNRH 2ZJTA 2R70A 1X4TA 4FLVA 4DV6H 4AQYH 1XK5A 4DV4B 5KX5B 1VF7A 5JQGA 4FLWA 3TY9A 4LF9H 4CS2A 2GV9A 5EYPA 4DR4B 3GDEA 3CSXA 1N34B 4X1KA 4DR6B 4Q0YA 3RR5A 4X1YB 1RSOA 4BW9A 1HR0B 1FVIA 3OTOH 1XHZA 4APMA 1I6UA 2PYLA 1XNRB 4RAYA 5LA6B 2VQEB 1IBMB 4DV5H 4YHHB 4PHZA 1N33B 4DV6B 5FNVA 5CB4A 3JAWA 4IHJA 3H20A 4FLXA 2CAZC 4E6NA 3CB2A 3M4IA 4CH4A 4GKKB 5JCOC 3BAAA 1HNZB 3SJBC 3THOA 3KALA 3RIZA 3OTOB 4NVPA 4LFCB 3NBYB 3K57A 3NC0B 4FM2A 4O4LA 4DR1H 4WBNB 2PZSA 4JV5B 4DV5B 1IBMH 4YHHH 2WE6A 3N2GA 2VPSA 1JFFB 3BHPA 1N33H 4X65B 2HVQA 2F4VB 3MAQA 3TY8A 1L2ZA 2BTOA 2ZINA 5KHJA 2UUAH 4D7TA 5BR8B 1CKNB 5BMVA 4LR3A 3T1HB 4DV0H 2HHHH 2VWKA 2BTQB 4WBNA 3RYFA 4EFBA 1SA0B 1JMKC 5KHKA 2PYJA 1SQFA 5LMNH 1XNQH 3RFRA 1Z2OX 2JVDA 5LP6A 4K8XA 2UUAB 4OX9B 5FD6A 1N36B 4KHPB 3A2FA 3C0FB 3JSNA 2PGGA 3E22A 3HKCB 4DR1B 4AILC 4F6RB 4J0MA 3CVZA 4BWSC 3UT5A 2MCTA 2P22C 1KU9A 4I50B 4I50A 4IIJA 4RAZA 3L4KA 5A2QW 4IIJB 1HNXH 2F4VH 4JI5B 3VQYA 1FJGB 4UCRA 5LMUB 2ZM6H 4TUYA 4B3SB 4I9QA 3ICXA 3JALB 3KAKA 2P5OA 3JSLA 4CH5A 5JJEB 4B3RH 2Q7HA 2UUCB 3JATA 4X1IB 3QF7A 4KL1A 4OX9H 3N6XA 3JATB 4TOIA 3M7MX 4ZOLA 3K5NA 3QWUA 2ZCEA 3BABA 4O4HB 5EZYA 2F95B 2PUSA 4DUZB 3LMLA 4YY3H 5JQGB 3DSQA 3IG0A 2W57A 1A0IA 4JI5H 4ZHQB 4DV1B 3B2EE 2JS5A 5C8YA 5LMNB 4LF7B 1WN7A 2YIBD 4JI2H 3HKDB 4FM1A 3E22B 3RGZA 3RYHB 4JI8B 4DRXA 1IBLB 4FLZA 4RZQA 5GONB 4LF5B 4PZ8A 3N2KB 3TY5A 2RGVA 1BJTA 5IJ9A 1FFXA 5CA1B 4LSAA 2F93B 4UCSA 5LMUH 1SA0A 4CS4A 3OTFA 5FD5A 4LF6H 1TUBA 4CH3A 5FPRA 4X20B 1Z5VA 3BPZA 1S5JA 3K58A 3RF2A 2BTQA 4LNUA 1TVKA 4O2BB 4JI7B 1P16A 3JAKA 1M93A 2HVSA 1G6UA 1X9NA 4BWAA 1WH2A 5J2UB 4O2AB 1Z5WA 4LFAB 4IAJA 5LOVA 4YJ3A 1XMOH 5LL6b 4EFEA 4A2AA 3HXLA 3PN1A 5C8YB 3HKEB 4EB6A 4HNAA 5JJNB 2EX3A 4I4TA 4FM0A 4JI2B 4LF8H 3RYCA 4X64H 4JI0B 5EIBC 5DISC 3U10A 2UU9H 1Q43A 4AQYB 1SYXB 2VQFB 4O4HA 2E3CA 5KX5A 2UXDH 4LFAH 4LF9B 3JAWB 4TUYB 1SQGA 3SR2C 4LFBB 4I4TB 2HVRA 1MZBA 2WYOA 4NXNB 4EEQA 4MV7A 5LYJA 2E5LB 3N42B 3HKEA 4RB1A 4B3TH 4JI0H 4M7EA 5IJ0A 4CC5A 2PY5A 3J81W 1M4UA 3HKCA 1QHTA 4B08A 2ZNIA 3N44B 4F6RA 4DR5B 1SKVA 4LF4B 3IAYA 1B04A 5JH7A 1TGOA 4CS3A 2ZNJA 1O75A 4GLXA 2VUGA 4GYCB 1KMIZ 3VQVA 4TQDA 2HGSA 2F66C 1V9PA 3UQ8A 3RYCB 1TUBB 3WB1A 2UUBH 3SJCC 5D5QA 1TAEA 3N40P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M B;  4B3T B;  4TOI A;  3QWU A;  4DV0 B;  2UXB B;  3BAB A;  1CKO A;  3W5O A;  1XK5 A;  4DV4 B;  4DUZ B;  1CKM A;  4UCT A;  3TY9 A;  4X62 B;  4DR4 B;  3GDE A;  1HNX B;  1A0I A;  1XMQ B;  1N34 B;  3GJX B;  4DV1 B;  1N32 B;  4DR6 B;  5LMN B;  2ZM6 B;  3RR5 A;  4LF7 B;  1HR0 B;  4X66 B;  1FVI A;  1XDN A;  3W1G A;  3L2P A;  4X64 B;  4JI8 B;  1XNR B;  1IBL B;  1ZAU A;  4UCO A;  2VQE B;  1IBM B;  4YHH B;  4LF5 B;  4PZ8 A;  3TY5 A;  1N33 B;  4DV6 B;  1TA8 A;  3SGI A;  4PZ6 A;  4JYA B;  2UUC B;  4E6N A;  3VNN A;  4UCS A;  4PZ7 A;  1VS0 A;  2HIV A;  4GKK B;  3NBZ B;  3BAA A;  1HNZ B;  2Q2U A;  5FPR A;  4DV2 B;  5D1O A;  3OTO B;  4LFC B;  3NBY B;  4DV7 B;  4LH6 A;  3NC0 B;  2UU9 B;  2HHH B;  5FPO A;  4JV5 B;  4DV5 B;  4JI7 B;  1P16 A;  2HVS A;  4UFZ A;  2UXD B;  1X9N A;  4X65 B;  1IBK B;  4LFA B;  2HVQ A;  1DGS A;  1HNW B;  2F4V B;  4EFE A;  3BA9 A;  4GKJ B;  4UCV A;  3PN1 A;  3TY8 A;  1I94 B;  5IWA B;  4LF6 B;  4JI2 B;  4JI4 B;  4B3R B;  3T1Y B;  4JI0 B;  5BR8 B;  4JI6 B;  3KYH C;  4DR7 B;  1CKN B;  4K0K B;  5D1O B;  5DIS C;  4DRF A;  4JI1 B;  3T1H B;  3W1B A;  4AQY B;  2VQF B;  4CC6 A;  3S24 A;  3BA8 A;  4DR2 B;  4LF9 B;  4EFB A;  4LFB B;  2HVR A;  4NXN B;  4EEQ A;  1CKN A;  2E5L B;  4UCU A;  2UUB B;  2UXC B;  1S68 A;  2OWO A;  2UUA B;  4LF8 B;  4OX9 B;  4DR3 B;  1N36 B;  4KHP B;  3RTX A;  3JSN A;  4CC5 A;  3GB8 B;  4DR1 B;  2Q2T A;  2CFM A;  4YY3 B;  4DR5 B;  4DUY B;  4LF4 B;  1B04 A;  4EQ5 A;  4JI3 B;  1J5E B;  4LH7 A;  1XMO B;  5D1P A;  4DV3 B;  4GLX A;  4JI5 B;  2VUG A;  1FJG B;  4NXM B;  4UCR A;  5LMU B;  4B3S B;  1V9P A;  3UQ8 A;  1P8L A;  1XNQ B;  2HIX A;  3JSL A;  1TAE A; 
#chains in the Genus database with same CATH topology
 3CS5 A;  4HAM A;  2HHH O;  3Q8R B;  4B3T B;  4FFO A;  1YJN V;  2YIB A;  2YZN A;  4JV5 H;  1AI7 A;  3HPL C;  3W5O A;  3VQW A;  1VIB A;  2YIA A;  2JEU A;  4TV8 A;  3T54 A;  5ITZ B;  2LW1 A;  4DL2 A;  4X62 B;  5KA6 A;  2UUA O;  3BY6 A;  2Z0A A;  1KTA A;  4DLK A;  1R1B A;  1NT2 B;  2GUZ A;  1FXV A;  2Q7G A;  1YXB A;  5KHG A;  4RB0 A;  5GON F;  4RNM A;  1K1S A;  4YJ2 B;  2JGD B;  4MV3 A;  3JRX A;  5DGB A;  5LXT A;  1NH2 D;  3K9A A;  5EC1 C;  4DK0 A;  4LP8 A;  3NXS A;  4NKG B;  1TA8 A;  4JAV A;  2QM8 A;  3SGI A;  2GQS A;  2WLL B;  5IYZ B;  1WP8 A;  2YZL A;  2UUC O;  3PW0 A;  3R5F A;  1Z2N X;  1RK6 A;  2CE4 A;  4O4I A;  3ZRW A;  1S0V A;  1NVP B;  3QG5 A;  2WLJ A;  2HHH B;  3G80 A;  2P6J A;  5IJ0 B;  2HGW A;  3KKY A;  5LA6 A;  1ET0 A;  2IP4 A;  1AN7 A;  2Q6A A;  3OTO O;  5B1A B;  5B1N A;  3CRC A;  1RYS A;  4WBN F;  5LYJ B;  2AHY A;  3GTJ A;  1HNW B;  3PR4 A;  4DV3 H;  3JCU Z;  2R72 A;  3M8A A;  3ZHT A;  3S3X A;  2XD4 A;  3T1Y B;  4DV3 O;  4FLU A;  4JTA B;  1N36 H;  5KFL A;  3CPW U;  4X1I A;  4DR7 B;  3W1B A;  4O7S A;  3UZB A;  1O9G A;  4Q43 A;  5B66 Z;  4PWQ A;  2HDK A;  4CC6 A;  3CXH F;  2QB5 A;  5IT9 W;  3HO8 A;  1XL6 A;  2AQ4 A;  4BY1 G;  4K3A A;  4YJ3 B;  1Y1V A;  2LQT A;  1W59 A;  4UCU A;  5KKN B;  5IWA H;  1K5S A;  4X66 H;  4Z1M G;  2UUC H;  5KFR A;  1I7F A;  3MFH A;  4LFC H;  1WNS A;  4RQE A;  1KB9 F;  3R65 A;  1SFO A;  4FM9 A;  1Y14 B;  3N2G B;  5DGH A;  2DLN A;  4LF5 H;  5IYB O;  3V6J A;  3Q8S B;  4DUY B;  2FLN A;  4O7N A;  1K9M W;  3E2E A;  2A79 B;  2ETN A;  4MTF A;  2DPI A;  2WPD G;  2EIM B;  2WAQ A;  3N41 B;  4NXM B;  4HNA B;  2ZKO A;  2KKW A;  4YXW G;  1N34 O;  2Y4U A;  4HNU A;  3ABL B;  4JI8 H;  2AU0 A;  5GON A;  2VUM A;  1XNR O;  4IWY A;  5EOY A;  2UXB B;  1RJP A;  4XX0 B;  3JAK B;  2Y4T A;  3CC7 V;  3L71 H;  3GTG A;  4MV9 A;  4FPP A;  1IYE A;  4R7R A;  2DQ0 A;  2F23 A;  2ZDH A;  4MA5 A;  1ZL8 B;  5CA1 F;  1NTM H;  2NUA B;  3RVZ A;  5LGU A;  3AG3 B;  4ZOL B;  4DV2 H;  2E75 B;  4K0K O;  1JR9 A;  3GID A;  4JI6 H;  4C5C A;  1PNM A;  3QO7 A;  5C3E G;  5KT7 A;  4J10 A;  4ZI7 B;  1W0K G;  1PPJ H;  2B1G A;  4JF3 A;  4ECS A;  1BSM A;  4JZG A;  2A3Q A;  4IHJ B;  4TWK A;  2QTO A;  5B1B C;  1PK8 A;  1XMQ O;  4PZ6 A;  2I87 A;  4A2B A;  2WDT A;  3FB8 C;  1F51 A;  4BIU A;  2E5L H;  4NZO A;  2ZIO A;  4O7R A;  3JYC A;  1L8D A;  1L0N H;  1TVK B;  2BSK B;  2PMZ A;  3BEH A;  1LUV A;  1BXR A;  4MVQ A;  2UXB H;  5J2U F;  3K59 A;  1WLE A;  4QE9 A;  3JD3 A;  4PA7 A;  2QWP B;  3KRE A;  5EYP B;  2DMX A;  2FB5 A;  3RN4 A;  4MA0 A;  2QWR B;  2AZ2 A;  2NVY A;  4GKJ B;  4JV0 A;  1EUD B;  4FLT A;  2FLL A;  3IJ4 A;  3RYF B;  4LF7 H;  3OR6 C;  3MDS A;  2QM4 A;  3SPI A;  4I9W A;  3J7A U;  2EJ2 A;  2NU6 B;  1S10 A;  1R9T A;  1M57 B;  4JI6 B;  2EZP A;  3CSW A;  3C3T A;  4K0K B;  1S5L Z;  5KFT A;  2BQ3 A;  4JYA O;  4YR2 A;  4HQ6 A;  4O3S A;  4OPH A;  1FXK C;  1DV1 A;  3SE7 A;  4U3J B;  3ZMU A;  1AR4 A;  4TQF A;  3F8N A;  2G38 A;  2R85 A;  4IT5 A;  5EIB D;  3W7X A;  2R84 A;  3U0Z A;  4LF9 O;  2YIC A;  1H2S B;  4JI1 O;  2PI4 A;  3LWB A;  5I60 A;  3RTX A;  4O4L B;  2VQE H;  2UXN A;  3N43 B;  3T5H A;  4A3G G;  1QU7 A;  2FKX A;  3N2K A;  4NYE A;  4MV8 A;  1RFY A;  5JH7 B;  2JA5 A;  1THZ A;  4MVZ A;  3K04 A;  3MWD A;  4J9Q A;  2DWC A;  4A3L G;  2D2C B;  2W9C A;  4GKK O;  3GIM A;  3OEH G;  1FS0 G;  2V59 A;  3ZHR A;  2HIX A;  3ABK B;  3QVN A;  2W6I G;  3ASN C;  1CPY A;  1YZB A;  3DC6 A;  4B7K A;  2R70 A;  4RUA A;  4HNV A;  4MVR A;  4YB8 B;  2OTJ V;  2AW9 A;  4FBT A;  5KX5 B;  2P7T C;  3CC4 V;  3PVX A;  5KG6 A;  1G1X B;  1SQV H;  4CS2 A;  4LC1 A;  4DR4 B;  1FXH A;  2DOS A;  4JTC B;  5K2M A;  3WWJ A;  4X1Y B;  4ECR A;  1RSO A;  2HG5 C;  4BW9 A;  4APM A;  1I6U A;  2PYL A;  4RAY A;  3I56 V;  2WLN A;  3GB7 C;  2VQE B;  1WA8 A;  1J5E O;  1JLL B;  3ZHU A;  2MK3 A;  4KHP O;  2FML A;  2COI A;  2Q0O C;  4PHZ A;  3ETG A;  5TIS Z;  4Z1V A;  3RUP A;  4DO2 A;  5LBQ A;  5FNV A;  4MTX A;  4O4I F;  1WPX A;  3JAW A;  2FPP B;  4Z2W A;  1KC7 A;  3M4I A;  4PA3 A;  4CH4 A;  5CAE B;  4JI5 O;  4GKK B;  1VQ7 V;  1F7Y A;  5I5Y A;  3KAL A;  3OTO B;  3ETD A;  4IYH A;  3LSQ A;  1N0N A;  4O4L A;  4FM2 A;  2QF7 A;  4JV5 B;  2WB1 A;  3T5L A;  5H6Q A;  4OX9 O;  5KS8 A;  4DL5 A;  3L72 H;  4FE2 A;  1Y74 B;  3HKZ A;  3ZJZ A;  2F4V B;  2DYS C;  4B3S O;  1WR2 A;  2KSD A;  3E8F A;  1HNZ O;  4YR3 A;  4J9Z B;  3T9E A;  2R8J A;  1PNK A;  1HWY A;  4H37 A;  2Y4R A;  3F5W C;  1M9N A;  3X2Q C;  3ETJ A;  4A3K G;  5BR8 B;  1Q86 W;  3CCU V;  3FDS A;  4GX1 A;  2JK5 C;  3H1L H;  4XDJ A;  3G8C A;  4J11 A;  2W6J G;  5BMV A;  4MVS A;  2UXD O;  1ZX3 A;  2FPG B;  1QLN A;  4WBN A;  2Z3Y A;  2EIL B;  2H8P C;  1SA0 B;  4GCZ A;  1UJW B;  3T1C A;  1BHB A;  1W96 A;  3Q2O A;  1KD1 W;  5IYD O;  3AX6 A;  4ECT A;  4JV1 A;  2NU9 B;  3WWI A;  4ZHQ F;  5LP6 A;  5FD6 A;  4QWD A;  3C0F B;  2HJF C;  2PGG A;  2WSS G;  3E22 A;  1YDX A;  4NYK A;  4O3R A;  4AIL C;  1FD9 A;  4BBR G;  2IH1 C;  3X2Q B;  3UT5 A;  2MCT A;  1DK1 A;  1AR5 A;  1YTF D;  4EGJ A;  4P9P A;  5A2Q W;  1AJQ A;  5IP7 G;  1FJG B;  2EJ0 A;  1QR9 A;  1GM7 A;  3LSU A;  2ZM6 H;  4B3S B;  1BCC H;  5LL6 Y;  3AG4 B;  3ICX A;  3JAL B;  5IT9 N;  4CH5 A;  4O7T A;  5JJE B;  4YQW A;  4B3R H;  1H2K A;  2ATL A;  3JAT A;  3QF7 A;  4KL1 A;  1WB7 A;  3JAT B;  4ED8 A;  1EBO A;  3CP1 A;  2FMA A;  3QWU A;  3E35 A;  3K5N A;  2ZCE A;  2JA6 A;  3GV5 B;  2ZDQ A;  1K83 A;  2P0A A;  2XT9 A;  4YAJ B;  1MZE A;  1ZL8 A;  4LF8 O;  4RCN A;  2OTL V;  3GQC A;  3OT7 A;  1JCH A;  4FFK A;  3B2E E;  4JI2 O;  4R50 A;  2X6C A;  2YXY A;  2QWO B;  1EM1 A;  3RGZ A;  4JI8 B;  3BQ0 A;  1IBL B;  1V4Y A;  3KHG A;  4FLZ A;  2HLD G;  2L6L A;  2R92 A;  5KUK A;  4RUF A;  2W6P A;  2IH3 C;  3ABM C;  4G28 B;  2CTW A;  5KFF A;  1E4E A;  3B8N A;  3I4M G;  2F93 B;  3OTF A;  1FJG O;  5JQG F;  3ZMS A;  2HR3 A;  5BYA A;  3H1H H;  5FPR A;  3P30 A;  2XCP A;  3L74 H;  1BHA A;  3R23 A;  1VQM V;  2BTQ A;  4LF5 O;  4RNN A;  3FX7 A;  2QGN A;  3TW7 A;  5KG5 A;  4O82 A;  1M93 A;  3V4Z A;  5KFI A;  2HVS A;  2FK3 A;  3FYI B;  1VQL V;  4BWA A;  4X9Q A;  5IWA O;  2CNQ A;  1OCR C;  3HXL A;  5K3W A;  4HNA A;  2Q73 A;  2OIE A;  4JI2 B;  1QVF U;  2V5A A;  4LF8 H;  1J95 A;  3F5T A;  3F7V C;  3GTM A;  1FAF A;  3VOU A;  4MSW C;  4O4H A;  4LFA H;  4LF9 B;  3E8H A;  2PMZ E;  1B6R A;  4I4T B;  1M56 C;  5LA6 F;  2WYO A;  4NXN B;  4IRK A;  1BZK A;  5LYJ A;  1MNG A;  3MR3 A;  3K79 A;  1OCR B;  2B63 A;  3U55 A;  3T9A A;  4RO2 A;  4ECY A;  2SCU B;  4KUM A;  2FP4 B;  4FGR A;  1M4U A;  3OMI B;  1QHT A;  3OMA B;  4KFM A;  4F6R A;  3IAY A;  5C8Y F;  3AG1 C;  4CS3 A;  2C2R A;  2CDY A;  1O75 A;  1GN2 A;  4GLX A;  4K35 A;  2YXH A;  4IYI A;  2EIN C;  5KFK A;  2F66 C;  3B40 A;  3RYC B;  3ZMT A;  2CGO A;  4B3M B;  3NR7 A;  3LNM B;  1BGW A;  5L1J A;  5KG3 A;  3WWH A;  1IX9 A;  2UVV A;  4PA9 A;  3I12 A;  1CKO A;  2IM9 A;  2W0F C;  3QZ8 A;  1M6V A;  1NTK H;  5DN6 G;  4DV7 O;  2HP8 A;  2ZE5 A;  5LOV B;  2J6S A;  2WLH A;  2Q69 A;  5KFC A;  1NKD A;  1QBZ A;  4C7U A;  4O7Y A;  5I5X A;  4CE5 A;  3AG7 A;  1HNZ H;  4BIO A;  4PA6 A;  2HJD A;  4WFB V;  1YEW A;  3W1G A;  4GC7 A;  1VAR A;  2R7M A;  1KJI A;  1OCC C;  4J9M A;  4TUY F;  1JFF A;  4QJF A;  4O83 A;  4CH6 A;  3MWM A;  2NN4 A;  2RN9 A;  2ARH A;  3RB4 A;  2W6Z A;  2FK2 A;  5EZY B;  4U3J A;  3LNN A;  3VQX A;  3JAL A;  1YIJ V;  2RDC A;  1URF A;  2FTK A;  1E4F T;  2ALZ A;  4IWX A;  3ABU A;  3ZHV A;  2Y0S A;  5KT5 A;  3T4D A;  4QWE A;  3RW0 A;  4B3M H;  1IOV A;  1JPX A;  1RPR A;  3U9T A;  5B1B B;  4EG0 A;  4GUN A;  5E79 Z;  2FB9 A;  2N04 A;  1TWH A;  3QO8 A;  1NVP D;  2JA7 G;  4RB2 C;  1QQC A;  4X1K B;  5LP6 F;  4U7O A;  1RJR A;  1FJG H;  2ZDI C;  1KKD A;  2HG8 A;  4H33 A;  5J2T B;  4Q6G A;  5IWA B;  2YS8 A;  3TQT A;  1HR0 H;  1R6K A;  4B7E A;  1BNC A;  2CNU A;  3V6H A;  5F9N A;  3O65 A;  5D1O B;  1IDS A;  3RB3 A;  2GHY A;  1EKF A;  1S03 G;  1R6T A;  3G6E V;  2JGU A;  1V55 C;  3BAC A;  4WFA V;  3GTO A;  5HFL A;  2E74 B;  2XIG A;  2W8K A;  3HOY G;  1FKA H;  2Y69 C;  5KFB A;  3RBE A;  4MVM A;  4NXM O;  4GKK H;  4ECW A;  2JA7 A;  5KA5 A;  1AI6 A;  2OWO A;  4W4L A;  4O3N A;  1I08 A;  4YBZ B;  4NXN O;  3B8M A;  2WAQ E;  4K8Z A;  2Q2T A;  4QIW F;  3J81 N;  5C1P A;  3HKB A;  5LGN A;  2YI9 A;  1PL0 A;  3HKB B;  2YU9 A;  5DG7 A;  2Q7D A;  2FE3 A;  4JYB A;  3T9C A;  4CBC A;  2AHZ A;  3WB0 A;  4X8A A;  3MD0 A;  3H1I H;  4H13 B;  4IR9 A;  1GTO A;  2DQ3 A;  3JAR B;  4O4J A;  1SER A;  4RWU A;  5HV6 A;  5BR8 H;  3DC5 A;  5L1L A;  2VOB A;  2NNU A;  1N48 A;  1GYF A;  5KT6 A;  4U7N A;  1IBK H;  3L75 H;  5K1X A;  4UCT A;  1R3I C;  4DK1 A;  1VMG A;  5L1K A;  2KB1 A;  1SQP H;  2R7Z G;  4GKJ H;  4DR3 O;  3OD4 A;  2BE3 A;  2OIG A;  1RM1 B;  1XMQ B;  1Q3E A;  3Q4H B;  4UVA A;  1I94 O;  4I5S A;  4PA4 A;  1Y66 A;  2NR5 A;  4I7Z B;  3ASO C;  4X66 B;  1OHH G;  1K4C C;  3STZ C;  1GSH A;  4YR0 A;  4DR3 H;  1V54 B;  2CQY A;  3JD2 A;  4YJ2 F;  5EDW A;  5KFM A;  4DL7 A;  5KFX A;  4NZM A;  1R3L C;  1Z2P X;  5KFO A;  2QTS A;  2WWW A;  5IY5 C;  5FNV B;  2YZG A;  4TV9 A;  1P49 A;  4XYM B;  2F1M A;  1KYO F;  1YJW V;  1K73 W;  1ZSP A;  4LMY A;  1I1L A;  4RB3 C;  5KHH A;  3RYI A;  5KHI A;  3E86 A;  4B3S H;  2WA3 A;  2HIV A;  1S77 D;  3H3V H;  2B9Z A;  5J2T F;  3UM7 A;  2QJ1 A;  3FFQ A;  3DTF A;  2EUL A;  4X65 O;  5LP6 B;  1XI1 A;  2UU9 B;  2AZ0 A;  2YCH A;  5IYZ A;  4X89 A;  3CEB A;  5KFZ A;  1G8M A;  2FLP A;  1N32 O;  3GTL A;  4J42 A;  4NLG A;  2GTA A;  1AI4 A;  4NXN H;  4ED6 A;  2Q67 A;  2YDE A;  4FFB A;  3APO A;  1T94 A;  1G4Y B;  4GX2 A;  4Q4C A;  1N32 H;  2HVK C;  4EB6 B;  2D3O W;  4QIW A;  2QEX V;  1JVM A;  4P2Z A;  1YVW A;  4GX0 A;  1YF2 A;  4EKW A;  1SEI A;  1VQK V;  3QTC A;  5JQW A;  2FK1 A;  4QPJ A;  3S24 A;  3M9O B;  4BAY A;  2Q68 A;  1S72 V;  1JIH A;  4QSH A;  5ITZ A;  5L3D A;  3SYO A;  3JAM W;  3RB0 A;  1N34 H;  2Q5Z A;  2YUA A;  4CZZ A;  2YXL A;  2ZDI A;  3W7U A;  4X20 A;  1HR0 O;  4ECV A;  3K08 A;  5CR5 A;  2EIM C;  4F50 A;  3HR0 A;  1EN5 A;  5BY1 A;  4QWB A;  1MA1 A;  2W7P A;  4U6P A;  4ZQI A;  3CJH A;  4FZ1 A;  2UU9 O;  2X5R A;  2EIJ C;  4ASU G;  3K9S A;  1TWC A;  3JZI A;  3RBD A;  5LP6 C;  3D8C A;  2PF4 E;  1SRY A;  1XMO B;  3HB9 A;  4WFH A;  4B3M O;  2XAH A;  1GKF A;  2W6N A;  3G6B A;  2H94 A;  5DG8 A;  4DUZ O;  4FVM A;  2QWQ B;  4QW9 A;  2IBZ H;  2ZGI A;  1X4T A;  5BR8 O;  4GX5 A;  4YY3 O;  5KFE A;  2ASJ A;  5DEC A;  2VQE O;  4DV4 B;  4O81 A;  1VF7 A;  3HBL A;  5JQG A;  4FLW A;  3T4Z A;  2QR4 A;  2R93 G;  4LF9 H;  1V51 A;  5BWR A;  3CME V;  4F4X A;  5A9G A;  1I0H A;  2ITC C;  5EYP A;  3T9D A;  2JEF A;  4ED7 A;  4XDK A;  4WD3 A;  4X1K A;  3AG3 C;  1SQQ H;  4DR6 B;  3RR5 A;  2EIL C;  3KHH A;  3LUL A;  2XCL A;  1HR0 B;  4EGQ A;  4I55 F;  1XHZ A;  4J7K A;  5LA6 B;  1PP9 H;  3BCC H;  4DV5 H;  4YHH B;  5CBG A;  1N33 B;  4DV6 B;  1PL4 A;  1VQ8 V;  5JUM A;  1MSD A;  2XGP A;  4QE7 A;  4MVU A;  3RV4 A;  4ED1 A;  5EWF A;  3CCE V;  3UO2 A;  4FLX A;  4E6N A;  4Q45 A;  1M56 B;  3CB2 A;  1EN4 A;  1GN6 A;  4DAA A;  5JCO C;  3GIL A;  3BAA A;  1HNZ B;  3SJB C;  3G6Y A;  4JUZ A;  3T7A A;  4LFC B;  2VPQ A;  1YJ9 V;  4XZ3 B;  4WBN B;  5LHH A;  3T9B A;  3OM3 B;  2IU3 A;  2WE6 A;  4CHI A;  3N2G A;  4A3B G;  3TII A;  1N33 H;  4X65 B;  3CCJ V;  4JTD B;  2HVQ A;  1RM1 C;  2ZR2 A;  4FFP A;  3M9M B;  1W93 A;  1NBM G;  4R6Z A;  1R3J C;  4ECX A;  4J7Z A;  2DN9 A;  2QE7 G;  3SYQ A;  5DAA A;  2NU7 B;  3K03 A;  5KHJ A;  2P4K A;  4DW0 A;  1AB3 A;  4FU0 A;  2UUA H;  2NVX A;  3GLK A;  4D7T A;  3RBZ A;  3VPC A;  3TEK A;  2YID A;  5JVL A;  4ECU A;  3IFX A;  2VWK A;  3RT3 C;  1LR1 A;  4YHH O;  2QA4 V;  1VP7 A;  4TVI A;  2IJJ A;  3OGI B;  1NS1 A;  3RYF A;  1B6Q A;  1RP3 B;  1DIK A;  4FS2 A;  5KHK A;  2PYJ A;  1XNQ H;  3RFR A;  3C3S A;  1Z2O X;  4EYI B;  4A3D G;  3AW8 A;  3H0G A;  2CH7 B;  3FKI G;  1BE3 H;  3A0H Z;  3A2F A;  2Q8V A;  2GTS A;  2FKL A;  3K5H A;  3OUU A;  1T3N A;  4OPA A;  4F6R B;  4B3T O;  3CVZ A;  3ASN B;  2R7N A;  3N27 A;  5KG7 A;  1F4M A;  5KLV H;  3PW4 A;  4RAZ A;  3TGU H;  3L4K A;  1S9F A;  2F4V H;  4WF9 V;  3VQY A;  4A3E G;  2IJK A;  4UXN A;  5LMU B;  4I9Q A;  2PI5 A;  3KAK A;  3MJF A;  3JSL A;  4NTW A;  4BBS G;  1YTF B;  5KT3 A;  3PO2 G;  5CM0 A;  5BYB A;  4X1I B;  1VQN V;  2V9W A;  1UFI A;  5A2Q N;  1A0G A;  1N0J A;  3W7W A;  2QM7 A;  2F95 B;  1JOY A;  2IW5 A;  4DUZ B;  4I0X B;  2UVR A;  1R6N A;  4FS1 A;  3ZMV A;  4X66 O;  4GZR B;  4J9R A;  2Y48 A;  3TXS A;  4FK5 C;  2ITD C;  2XOK G;  3HOV G;  3U0G A;  2VRZ A;  2NLJ C;  1NQT A;  5EZY F;  4ZHQ B;  4ECQ A;  4DL3 A;  2MW2 B;  5DQH A;  4J7J A;  5GTI Z;  4EBE A;  4JI2 H;  3RYH B;  4C2M A;  4DRX A;  4BIZ A;  3EXA A;  4O7Z A;  4LF5 B;  5FJ8 G;  1BJT A;  3ZIA G;  3ORR A;  5CA1 B;  3OAA G;  4LSA A;  3OFN G;  2XAS A;  1SA0 A;  1COW G;  3TET A;  4LF6 H;  4UB6 Z;  5LMU O;  1AUX A;  3CE2 A;  4X20 B;  1WJZ A;  1S5J A;  1PM9 A;  2NU8 B;  1I2L A;  3F7Y C;  4O2A F;  1P16 A;  3JAK A;  1R73 A;  1ARO P;  2WA4 A;  3ABK C;  1X9N A;  1CQJ B;  4QWA A;  4EYH B;  5L3F A;  4A93 G;  4YJ3 A;  5EK0 A;  1XMO H;  2W6M A;  3WFV A;  3RVY A;  4BW5 A;  5C8Y B;  1X59 A;  4EB6 A;  3DTG A;  2BCC H;  1WSC A;  5JJN B;  1XEQ A;  2YSU B;  5KT4 A;  3RYC A;  5DED A;  4X64 H;  3ABT A;  1H2G A;  3MR6 A;  5EIB C;  4DYL A;  5DIS C;  4N23 A;  3BVO A;  3L73 H;  3U10 A;  2UU9 H;  1Q43 A;  2WLK A;  4GLW A;  4AQY B;  3CQZ A;  3GII A;  3BFR A;  5FNV F;  4TM5 A;  4A3J G;  4JV2 A;  1Y1W A;  5KX5 A;  2UXD H;  1OCC B;  2COJ A;  3E8B A;  3GTQ A;  3LSS A;  2P67 A;  4LFB B;  3CCL V;  4MV7 A;  3IN5 A;  1Q81 W;  4J9S A;  2GLT A;  3H0G G;  2E5L B;  4F6E A;  4H0L B;  3TJT A;  4GT1 A;  3OUS A;  3CRA A;  1E79 G;  1HNX O;  4RB1 A;  3ZCC A;  3ZN1 A;  1FXK A;  4B3T H;  5IJ0 A;  4TQS A;  5E1A C;  4CC5 A;  2AGQ A;  4RU9 A;  3KZI Z;  4B08 A;  4QNH B;  1QLE C;  1EHI A;  3TXQ A;  1SKV A;  5KX5 F;  1TGO A;  1XNQ O;  1AJN A;  5L1I A;  4F4Z A;  2VA3 A;  2ODT X;  2VUG A;  4GYC B;  1C30 A;  1KMI Z;  4W4K A;  4TQD A;  2FJZ A;  2BR0 A;  5L3E A;  4JI3 O;  3H1K H;  1YI2 V;  1TUB B;  4DV4 O;  4J9N A;  2JEJ A;  1K34 A;  5D5Q A;  1TAE A;  3A8T A;  1XL4 A;  4PDB A;  3P32 A;  2A9H A;  3LP8 A;  3PR5 B;  3K5I A;  2Z04 A;  2IJI A;  5CBF A;  2W9B A;  1Y1W G;  3Q1K A;  2R8K A;  1EFR G;  4DR5 H;  4X65 H;  2ZM6 O;  3DGE A;  1RK5 A;  3K3V A;  1J5E H;  1HNW H;  3DF7 A;  1GLV A;  5FL7 G;  4LFB O;  3GJX B;  5FLM G;  2OT5 A;  4ZHQ A;  2ZT9 B;  3HKD A;  5JJJ B;  1US6 A;  4OGQ B;  4LNU B;  1N33 O;  3JZF A;  4MTO A;  5H2F Z;  3QO5 A;  3KXY T;  1Q6U A;  1MAB G;  4ZKI A;  2C00 A;  2IMW P;  3TCU A;  4I55 B;  3IGA C;  3PJS K;  1PV0 A;  5BZB A;  4DR7 O;  2X0S A;  1AUV A;  5CA1 A;  3ZX6 A;  3K06 A;  1Q6H A;  3SPJ A;  3ETE A;  3TIN A;  4PZ7 A;  4AI8 A;  1I94 H;  3T99 A;  4GKJ O;  3GIJ A;  3NBZ B;  3T1Y H;  2COG A;  4JAS A;  2Q2U A;  4ZBM A;  2OH2 A;  1IBK O;  2ILM A;  4RUC A;  3S3W A;  4C5A A;  3RGX A;  1Q8I A;  1M57 C;  1A9X A;  5KMG A;  1SES A;  4IRD A;  4HBN A;  4UFZ A;  3UT5 B;  1OWT A;  2RGR A;  1GM9 A;  2E2I A;  4ZI7 A;  2FYU H;  4P9O A;  1KBL A;  3A0B Z;  3ZHQ A;  1JJO A;  4X62 H;  2DIK A;  4TV9 B;  1I7N A;  1SZT A;  1E1Q G;  4IGG A;  4UCV A;  4PDR A;  3K5L A;  3CWB H;  1KJQ A;  3VOT A;  3TQ1 A;  4DR6 H;  1I94 B;  2GSM B;  4EBD A;  4Y8V B;  4J9Y B;  4B3R B;  3DAA A;  2JIZ G;  1MZF A;  5LXT B;  2YI8 A;  4XYL B;  5EWE A;  1Q82 W;  3GIP A;  1NR7 A;  2ZE7 A;  4JI1 B;  5BWV A;  2BSK A;  5DGA A;  1S0M A;  4DUZ H;  5JWP A;  4WFF A;  3FYE B;  5DM6 V;  4CKB A;  3SNO A;  5LHI A;  4JYA H;  4NXM H;  3OSN A;  4WHX A;  2YRW A;  1ZHS A;  4ZOL F;  4QWC A;  2Y0I A;  3D36 C;  2QK4 A;  4LWS A;  2J6T A;  4G3I A;  5CA0 B;  3CJH B;  3GB8 B;  4DR7 H;  2DYR C;  5C44 G;  5B3S B;  1KQS U;  2RNB A;  4AHC A;  2YW2 A;  4MS2 A;  4ED2 A;  3JZ6 A;  3C90 A;  3K3W A;  3CHX A;  1G2W A;  2N74 A;  4EQ5 A;  2GBO A;  1AI5 A;  2ZE6 A;  3DTU B;  3FKI A;  1Q5O A;  4DV3 B;  2C35 B;  3MFI A;  4DV1 H;  2PBZ A;  5B1A C;  1F4N A;  2XTA A;  1XNQ B;  5DMX A;  1ZWI C;  1CKN A;  3RFC A;  3ZED A;  4HR7 A;  1DAA A;  4DR5 O;  4FFN A;  2LJ2 A;  3T1H H;  3AG2 B;  1IVS A;  2Q7E A;  1ROP A;  3AYH B;  3SPH A;  1E1R G;  5EBL C;  2ABJ A;  5EBM C;  1M0T A;  2R7Z A;  1CKM A;  1OBD A;  3GTK A;  3WB2 A;  4G27 B;  1DF4 A;  5EBW C;  2CW8 A;  3J80 N;  1B6S A;  3G8D A;  4PI0 A;  2ZM6 B;  1UNN C;  5KG2 A;  5C4X G;  2Q4P A;  3L2P A;  2P90 A;  5J2T A;  5CA0 A;  2UVW A;  1AJP A;  3UKM A;  4JGS A;  3CC2 V;  1JJ2 U;  5IYC O;  1EKP A;  1GRJ A;  4JI7 H;  1EKV A;  4MV1 A;  4DUY H;  2PVP A;  1M5I A;  3K5O A;  4KXR A;  1XRE A;  5FLX N;  2LGQ A;  2DAB A;  1B06 A;  3B09 A;  2QKC A;  4PJ0 Z;  1VS0 A;  2GDS A;  3L70 H;  4R7C A;  2K9P A;  1K97 A;  2W7O A;  2KQX A;  4X1Y A;  3RJ0 A;  2A0L A;  4N21 A;  4DV7 B;  3J7A K;  3ZRS A;  4MT8 A;  5FPO A;  3CRM A;  1BGY H;  3HT5 A;  4LF4 H;  1HW7 A;  4PDL A;  1K8A W;  2UXD B;  2A06 H;  5K1P A;  1IBK B;  4PDM A;  2EZO A;  1M90 W;  2DPJ A;  1OCO C;  4LBE C;  3JAS A;  3EPI A;  3BA9 A;  1WAZ A;  5LGT A;  2ODM A;  1Y76 A;  3ETQ A;  4IL6 Z;  3ZS8 C;  4D7S A;  2CW7 A;  4A3F G;  1QCE A;  3SDL A;  4O7W A;  1N56 A;  3RAX A;  2JGD A;  1DV2 A;  4PI2 A;  3KYH C;  3SJA C;  4DV0 O;  1SET A;  2ZQM A;  5IYZ F;  4ABM A;  4HZ3 A;  2DJV A;  2X0L A;  3L4J A;  1TWG A;  2E5L O;  1VBG A;  3CCR V;  3HKZ E;  2RCV A;  1QVG U;  3OUF A;  4NZN A;  2F43 G;  1XBL A;  4LF6 O;  1K3E A;  1NJI W;  1MOF A;  2GPS A;  5I5U A;  4FFB B;  4ED3 A;  4EEY A;  2EJ3 A;  1OCO B;  3UCS C;  2YS7 A;  2UXC B;  1IOW A;  3WO1 A;  1DTO A;  2YYA A;  2R87 A;  4LSX A;  2LW7 A;  2KSW A;  4ZIB A;  1IBM O;  2K1E A;  4QPK A;  5DQG A;  4AYB E;  4K0K H;  1NZ6 A;  1Y67 A;  5KFH A;  4UUJ C;  2C28 A;  1P7G A;  1D5A A;  1CE8 A;  4JI3 B;  1J5E B;  4G2K A;  4FIP C;  4FZ0 A;  2IU0 A;  1FKA O;  2X6B A;  1FXK B;  4DXW A;  3PO3 G;  1K33 A;  4RNO A;  4A3C G;  5KFV A;  4R8C A;  4O2B F;  1XNR H;  2LFS A;  3CX5 F;  2W6Q A;  2ZJT A;  2CZG A;  2XGQ A;  1RSO B;  2Z02 A;  3D3Q A;  2OCH A;  4JI8 O;  1QR8 A;  2CH7 A;  1JDB B;  2V4Q A;  3LQS A;  5I47 A;  4J80 A;  1PD3 A;  2W71 A;  3QZ7 A;  5GTH Z;  3ORQ A;  3GWK C;  3FB5 C;  3CSX A;  3CCS V;  4IHJ F;  3KHR A;  1N34 B;  2EIK C;  5I5V A;  1SS3 A;  1HDJ A;  2IA6 A;  3FB7 C;  5KAF Z;  2E2H A;  2F4V O;  3I55 V;  5F2V O;  1XNR B;  3MR2 A;  2EJR A;  1AVM A;  4LFC O;  1IBM B;  1CEZ A;  3CYO A;  1KP3 A;  3MHH C;  2DZD A;  3R5H A;  1AP5 A;  5AG2 A;  4E2L A;  1GK9 A;  5CB4 A;  5D8D A;  2W9C B;  1S5H C;  5LOV F;  2XAQ A;  3EHB B;  1NH2 B;  3VBB A;  1VF6 C;  4H44 B;  2ZXW C;  2UUB O;  2GQR A;  2VA2 A;  4PV1 B;  3M9N B;  1P7B A;  4UVC A;  1EN6 A;  4O4H F;  3RIZ A;  4NVP A;  4YIO A;  3U54 A;  3T2M A;  4DR1 H;  2AGO A;  2PZS A;  5KT2 A;  1IBM H;  4YHH H;  4BXX G;  2VPS A;  1JFF B;  4QJF B;  1KC8 W;  3UFX B;  4B3R O;  1BL8 A;  2DWE C;  4MVO A;  2BOC C;  5CMU A;  1BMF G;  3OHB A;  4FFR A;  3TY8 A;  5KFS A;  2BTO A;  4O3P A;  3IC9 A;  4JAU A;  1TWF A;  3GTP A;  1AR1 B;  3AK1 A;  4NB5 A;  1H2M A;  1Z2G A;  2CNV A;  2RDI A;  5BWW A;  3CRQ A;  3ABL C;  4DV0 H;  2BTQ B;  4D6T H;  3U9S A;  2W9B B;  5GW7 A;  1ULZ A;  2YEV A;  4IR1 A;  4YJ3 F;  2P4V A;  4EFB A;  1JMK C;  1DF5 A;  4KP4 A;  4A3M G;  2W6O A;  2JVD A;  4DR2 O;  4F4W A;  3WNZ A;  1BQ0 A;  4LF4 O;  4K8X A;  2WLM A;  2UUA B;  4OX9 B;  1IXB A;  3JSN A;  3HKC B;  1U97 A;  3G71 V;  1KBH A;  3CCV V;  5KFA A;  2P22 C;  1KU9 A;  4I50 B;  3V4S A;  1WCM A;  5EWG A;  1IBL O;  4I50 A;  1MG1 A;  3E5N A;  4OXS A;  1K4D C;  1W0J G;  3LDE A;  3G4S V;  5H5N A;  1V55 B;  1D5N A;  5KFG A;  4K6N A;  2ADQ B;  3OMN B;  5E25 A;  4LCU C;  3PZP A;  2R6F A;  2UUC B;  2V7Q G;  4OX9 H;  4TOI A;  3M7M X;  4JI7 O;  5L3C A;  4O4H B;  2X6A A;  5EZY A;  1GH6 A;  2PUS A;  5JH7 F;  1H8H G;  1B33 N;  2VUM G;  4MW3 A;  5JQG B;  4YY3 H;  2RDJ A;  3CD6 V;  2QWN B;  2W57 A;  5T14 A;  1JX9 A;  4JI5 H;  2JS5 A;  5C8Y A;  5LMN B;  2XAJ A;  2V1D A;  4LF7 B;  2YIB D;  3HKD B;  2W0X A;  3E22 B;  2XAG A;  3KTM A;  1EZJ A;  3CMA V;  3T1H O;  1GAX A;  5BWX A;  2A1H A;  1L0L H;  1VQO V;  4RZQ A;  5GON B;  4J9L A;  4PZ8 A;  3N2K B;  3TY5 A;  4FFM A;  4PD4 F;  1CQI B;  1OJH A;  2RGV A;  1S3J A;  4NTX A;  5IJ9 A;  2EIK B;  1FFX A;  3R5X A;  3FAV A;  3AEI A;  4DV1 O;  3T9F A;  3DXR A;  2ZE8 A;  3ML0 A;  2Y0S E;  3RAQ A;  3SYC A;  4JAA A;  1SCU B;  1ZLZ A;  4NR1 A;  1MMM A;  2UXX A;  4YAK B;  4LNU A;  1TVK A;  4O2B B;  1OZ0 A;  4JI7 B;  1VQ5 V;  5L3B A;  2ATK C;  3WU2 Z;  1WH2 A;  5J2U B;  4LFA B;  4IAJ A;  5DQI A;  3OW2 U;  4U7C A;  5LOV A;  4Q20 A;  4MV6 A;  4A5U B;  2JJ2 G;  1JKJ B;  3UZO A;  4EFE A;  3VPD A;  5KFD A;  2DYS B;  2X7R B;  3GIK A;  3PN1 A;  2CTR A;  2R7K A;  3EPG A;  4Q44 A;  2EX3 A;  4I4T A;  5LMN O;  3MR5 A;  1S0N A;  1H8E G;  3BQ1 A;  3JAM N;  3WG7 B;  1TWA A;  2GPW A;  2WLI A;  2VR1 A;  2OCC B;  4JYC A;  3NGD A;  3CCQ V;  1SYX B;  3LDD A;  2VQF B;  2R9R B;  4ZI7 F;  1QNM A;  2EIN B;  1VF5 B;  2UXC O;  3JAW B;  4TUY B;  3SR2 C;  1VBH A;  1MZB A;  1LUW A;  2HVR A;  4EEQ A;  4R8U A;  3AG1 B;  3N8D A;  3N42 B;  2C22 A;  2LP7 A;  1OCZ B;  3HKE A;  4UB8 Z;  1I5X A;  4M7E A;  4PEL A;  5J9P C;  2QSA A;  4MTG A;  3GV7 B;  4FBU A;  3J81 W;  3HKC A;  1UC9 A;  1WA8 B;  1I1K A;  1RJQ A;  1Q7Y W;  3ZHS A;  1NI8 A;  3OSP A;  3N44 B;  3SI8 A;  4LF4 B;  3M99 B;  5DG9 A;  3W7T A;  2J6U A;  3TK1 A;  4UVB A;  2ZNJ A;  1WCM G;  1I3Q A;  4Q8F A;  3A0R A;  1I5Y A;  3G6V A;  4O3O A;  1PKX A;  3VQV A;  2JEG A;  2EIY A;  2RF4 A;  1S97 A;  3I4N G;  1H2L A;  1F23 A;  2HFE C;  4UV8 A;  1KJ8 A;  4O84 A;  5HNE A;  1EUC B;  4E4T A;  2YRX A;  3N40 P;  4I55 A;  1L1F A;  2W9A A;  4ME6 A;  1O9H A;  5BMV B;  5CB4 F;  2V58 A;  4RZR A;  2YEV B;  1XOU A;  1RYR A;  3AK3 A;  2P06 A;  1ZQ7 A;  5D5P A;  3UO3 A;  1YIT V;  1WPB A;  2W8L A;  2R8G A;  3APQ A;  4LFB H;  3OUZ A;  5BWT A;  3TIG A;  5BPH A;  2PTM A;  3RGB A;  1XDN A;  2UXC H;  4CMF A;  4MTD A;  2HVJ C;  1KUT A;  2PN1 A;  4FLY A;  4MAM A;  4I4T F;  3HOU G;  3E8G A;  2BOB C;  3H9V A;  3K0G A;  2I80 A;  1OV9 A;  2OCC C;  3FB6 C;  4CMD A;  4DV4 H;  4JI6 O;  4J9O A;  4I7H A;  4JI3 H;  4L8J A;  2ZDG A;  3G6X A;  4JYA B;  2XUM A;  1FFX B;  4DV2 O;  4EBC A;  2JEX A;  4DR4 H;  2VS0 A;  1XQ8 A;  2XAF A;  4DRX B;  3ZRX A;  3I5D A;  1SZX A;  4KHP H;  4LH6 A;  2HGX A;  2DWD C;  4UUG A;  5F9L A;  2HEP A;  1AIL A;  1GO3 E;  4TSF G;  3OHA A;  3J80 W;  5JCO A;  2JJ1 G;  3JAS B;  5IP9 G;  4IRC A;  4WFG A;  3E83 A;  1E4G T;  4IIJ F;  1IZ3 A;  1SQB H;  2JS3 A;  4JPR A;  2WTF A;  1H38 A;  2WLL A;  1NR1 A;  2R82 A;  2HKO A;  5HBR B;  1ORQ C;  1K5Q A;  3LDC A;  3RWR D;  4O4L F;  1VAJ A;  2ZIM A;  4DRF A;  3FMA A;  1MSW D;  2JA6 G;  2CTP A;  4DR2 B;  1K1Q A;  4O2A A;  2JEI A;  3RYI B;  3HOZ G;  1XMO O;  3N6R A;  5IYC G;  2LO1 A;  3EVK A;  3OEE G;  5DLG A;  4NTY A;  3EFF K;  2XHB A;  4DR3 B;  2HJW A;  4O2B A;  5CA3 A;  2B5U A;  2BQU A;  1FPO A;  3GWO A;  3U11 A;  4JI1 H;  1ZUQ A;  1N4C A;  2ASD A;  4YY3 B;  2CTQ A;  4DIM A;  1GSA A;  1N36 O;  3BJY A;  1XDC A;  3QFF A;  4LH7 A;  4TV9 F;  3AK2 A;  5IJ9 B;  1E4E B;  3EYY A;  5CN0 A;  3FAV B;  1EYZ A;  4HNT A;  4YJ2 A;  2ZXW B;  1ZHQ A;  4DL4 A;  4AQY O;  2W70 A;  4ETS A;  1IBL H;  5JVD A;  5JVD B;  4DV7 H;  3CEI A;  2B1I A;  2J9G A;  3CCM V;  4DV0 B;  3PW5 A;  1WP7 A;  1Q6I A;  2FPI B;  3FD9 A;  2O03 A;  3ZBH A;  4WFE A;  2JA8 G;  2Q0A A;  4LF7 O;  3CXC U;  3GIQ A;  4L1K A;  4DR2 H;  4R8U B;  3OGC C;  2R93 A;  1HNX B;  3BRC A;  4J41 A;  1SF9 A;  1VQP V;  5BPF A;  1N32 B;  4HYO A;  3K5M A;  1K92 A;  4X64 B;  3OR7 C;  2C2A A;  5LHG A;  3WO0 A;  2UXB O;  1ZAU A;  4UCO A;  3SJQ C;  1A48 A;  1M1K W;  4XDL A;  3KCX A;  3WG7 C;  3W7S A;  5KFW A;  2E76 B;  2CK3 G;  2M05 A;  1R3K C;  4GC6 A;  3JD1 A;  3VNN A;  3B77 A;  2QDO A;  1XMQ H;  1KP2 A;  2KG7 A;  2DW4 A;  4DV2 B;  1N8R W;  5D1O A;  3CRR A;  4QGP A;  1A32 A;  5IY5 B;  4LFA O;  2C2E A;  1I2K A;  2YZM A;  4BR6 A;  2R9A A;  3RV3 A;  5FLX W;  3KAJ A;  1VKZ A;  3GV8 B;  5IYB G;  4DUY O;  2R92 G;  2VQF H;  5I5S A;  2VWJ A;  1BQZ A;  1Y1V G;  1V54 C;  5BXZ A;  2RJZ A;  1DGS A;  2V4R A;  5EC2 C;  5IYD G;  1CS0 A;  1IYD A;  2BQR A;  4LF6 B;  3FKS G;  3LUT B;  1JA8 A;  2VQF O;  4JI4 B;  2AXT Z;  5IDJ A;  1XIL A;  4DL6 A;  1ZET A;  4TQR A;  1XUQ A;  5KMG B;  3Q8Q B;  1XHX A;  1GN4 A;  4O4I B;  3ZRW B;  5J2U A;  2XCA A;  5KFJ A;  2RQ6 A;  2OYQ A;  1OCZ C;  4JI0 O;  5KFY A;  4JZ2 A;  4O4J F;  3BA8 A;  4O7L A;  1T5E A;  2A7W A;  2R86 A;  1YHQ V;  3JAR A;  4O4J B;  3TW6 A;  1M0W A;  2JRI A;  2UUB B;  1WRV A;  1S68 A;  1NU1 H;  4LF8 B;  5H9C A;  4MV4 A;  2N05 A;  4FJC C;  1W2B U;  2DE0 X;  2ASL A;  1EZV H;  3ZMZ A;  1B3Q A;  3PW2 A;  2CFM A;  4UV9 A;  3ZN0 A;  2B63 G;  3H40 A;  3UYY A;  2DAA A;  5CB4 B;  5BMV F;  3H4D A;  5D1P A;  5LYJ F;  4PBC A;  4TV8 B;  4AYB A;  4YP3 A;  3RYH A;  2ZD9 A;  4MTE A;  2XC9 A;  1P8L A;  4ED0 A;  2KG7 B;  4JI4 H;  2V4D A;  2HHF A;  1U96 A;  2IJH A;  4DV5 O;  1I50 A;  1UC8 A;  5B1O A;  1VQ9 V;  4FLV A;  1VQ6 V;  4CKE A;  1A3G A;  1T36 A;  3K3P A;  4DV6 H;  1XK5 A;  1NTZ H;  4AQY H;  3L9D A;  3TY9 A;  2JDI G;  4YIP A;  5CA0 F;  2GV9 A;  3GDE A;  4QW8 A;  3HOW G;  4Q0Y A;  3VPB A;  1FVI A;  3KG2 A;  3OTO H;  2H3O A;  5IE9 A;  4X62 O;  2YC0 A;  4E4E A;  1GGO A;  5H80 A;  2C2D A;  4A3I G;  3Q8P B;  3NUA A;  1M7J A;  3RB6 A;  4M9U A;  2QYZ A;  3E89 A;  2AGP A;  3MHS C;  1Y4M A;  4IHJ A;  3H20 A;  5LXT F;  2CAZ C;  5KFN A;  2YS6 A;  1KUQ A;  4RUE A;  4C5B A;  5BWU A;  5KG0 A;  2IBK A;  3H01 A;  3B4S A;  3THO A;  2WLI B;  5KFU A;  3NBY B;  3K57 A;  1PX2 A;  3NC0 B;  3VA7 A;  4M0J A;  5B3S C;  4DV5 B;  3H1J H;  5I5T A;  2R9I A;  1KKC A;  3BHP A;  1FFT B;  4Q4D A;  4F4L A;  3BG5 A;  2FL4 A;  2GUZ B;  4JYY A;  3K0D A;  1Q90 D;  3MAQ A;  3D3I A;  1CXZ B;  4HYK A;  1L2Z A;  2WB1 E;  4DQN A;  2ZIN A;  2EJ7 A;  1P84 F;  1HNW O;  1SQX H;  4ICG A;  4O3Q A;  3SYA A;  4FFL A;  2LGW A;  4JV5 O;  1CKN B;  5C93 A;  4WCE V;  4LR3 A;  4TT3 G;  3T1H B;  3VMM A;  2HHH H;  5KFP A;  1Y76 B;  4DR4 O;  4ECZ A;  1YSC A;  1GM8 A;  4I0X A;  1D2D A;  1K7D A;  3P3N A;  3P3P A;  1SQF A;  5LMN H;  2QKA A;  1VEW A;  5CBH A;  4DW1 A;  1ZTE A;  3T5J A;  5DLF A;  2OLS A;  1N36 B;  4KHP B;  4DR1 B;  4J9K A;  3PFF A;  1QLE B;  4J9P A;  3R66 A;  2HHF B;  4BWS C;  4J0M A;  3QQM A;  4F4Y A;  2Y0P A;  3ZRV A;  2AGA A;  4JXU A;  4IIJ A;  2RMK B;  3SPC A;  5C1O A;  4IIJ B;  1HNX H;  4JI5 B;  4UCR A;  5FR9 A;  5I5W A;  3KHL A;  4TUY A;  1HP8 A;  1YCI A;  2Q9L A;  2O57 A;  3IC7 A;  1VF6 A;  2P5O A;  2Q7H A;  4O86 A;  4TV8 F;  2EIJ B;  4CKC A;  4IZO A;  3N6X A;  2YWV A;  3JRW A;  4ZOL A;  3BAB A;  5DGI A;  2DYR B;  4I50 F;  4O7V A;  3LML A;  5KFQ A;  3DSQ A;  3IG0 A;  3QNE A;  5L3G A;  1GN3 A;  1OBG A;  2XND G;  2R7L A;  1S0O A;  4X64 O;  1ENV A;  1A0I A;  4DV1 B;  1GSO A;  3BQ2 A;  2JA5 G;  1WN7 A;  1I7L A;  4FM1 A;  5H6R A;  4L87 A;  2QKS A;  1C3O A;  1S76 D;  1WB8 A;  5KUM A;  1BS3 A;  2M6Y A;  3R9R A;  5HFM A;  2I8C A;  2CGN A;  1IUR A;  1GO3 F;  1EZ1 A;  5CE8 A;  1KJJ A;  2Z5U A;  4DR6 O;  4UCS A;  1KJ9 A;  5LMU H;  4CS4 A;  1SC5 B;  3OE7 G;  2ADP A;  5FD5 A;  1TUB A;  2R8H A;  3HB3 B;  3Q4H A;  4CH3 A;  1GMG A;  2L35 A;  1KEE A;  1Z5V A;  3BPZ A;  3ABM B;  3K58 A;  4LWS B;  3RF2 A;  1JXL A;  5L9X A;  2YL2 A;  1KEC A;  4DV6 O;  3HOX G;  4U3F H;  1VQ4 V;  3ETH A;  1AP6 A;  1BT8 A;  2CKZ B;  1G6U A;  4O2A B;  1Z5W A;  2Y69 B;  3SPG A;  3JCZ A;  3MWE A;  4JI4 O;  1I1M A;  3T1Y O;  1Y74 A;  4HN2 A;  5LL6 b;  3KCY A;  1PNL A;  1TUE B;  4A2A A;  3D36 A;  3HKE B;  4PDV A;  4XBF A;  3STL C;  4RQF A;  4QIW E;  3H4B A;  5KG4 A;  3JD4 A;  3G67 A;  4FM0 A;  1DLB A;  4JI0 B;  4X88 A;  5C5J A;  2M7W A;  3PW7 A;  1JDE A;  1JX4 A;  1IXM A;  4RAI A;  2E3C A;  4Q8E A;  4P30 A;  2ZR3 A;  3ASO B;  2UVU A;  1SQG A;  4FMT A;  3O9O A;  3AG4 C;  2LFR A;  2EBO A;  2CUG A;  1P4R A;  1Y6X A;  5B5E Z;  5KAI Z;  1H2N A;  1JQ0 A;  3T5K A;  2R8I A;  3GVM A;  1LNQ A;  3AG2 C;  2VQD A;  4JI0 H;  3SYP A;  2PY5 A;  1CP9 A;  5KG1 A;  1FYJ A;  2ZNI A;  1RPO A;  4DR5 B;  2WAM A;  1B04 A;  3V6K A;  5JH7 A;  4DR1 O;  4BY7 G;  5JVD F;  1UPG A;  4MW8 A;  2HGS A;  1V9P A;  3DXR B;  3JD0 A;  3UQ8 A;  3WB1 A;  2UUB H;  3SJC C;  1KT8 A; 
#chains in the Genus database with same CATH homology
 4I55 A;  4B3M B;  1BGW A;  4B3T B;  1O9H A;  5BMV B;  2YIB A;  4JV5 H;  1CKO A;  3W5O A;  2IM9 A;  3VQW A;  2YIA A;  5D5P A;  4DR5 H;  1WPB A;  4TV8 A;  4X65 H;  5ITZ B;  3K3V A;  1J5E H;  5LOV B;  4X62 B;  1HNW H;  4LFB H;  3DF7 A;  3GJX B;  1NT2 B;  2PTM A;  4ZHQ A;  2Q7G A;  3HKD A;  3RGB A;  5KHG A;  1HNZ H;  4RB0 A;  5JJJ B;  1XDN A;  2UXC H;  4LNU B;  1YEW A;  3W1G A;  4MTD A;  4YJ2 B;  4FLY A;  3KXY T;  4PDB A;  1JFF A;  5LXT A;  4I55 B;  4CH6 A;  4DK0 A;  3MWM A;  4DV4 H;  4I7H A;  1TA8 A;  4L8J A;  4JI3 H;  5EZY B;  3SGI A;  4JYA B;  5IYZ B;  1FFX B;  5CA1 A;  4U3J A;  3LNN A;  3VQX A;  4DR4 H;  3JAL A;  4PZ7 A;  1XQ8 A;  1E4F T;  1I94 H;  1Z2N X;  4DRX B;  3NBZ B;  3T1Y H;  2Q2U A;  4O4I A;  3QG5 A;  4B3M H;  4KHP H;  4LH6 A;  2HHH B;  5IJ0 B;  3RGX A;  2HEP A;  5LA6 A;  1Q8I A;  5KMG A;  4HBN A;  1AN7 A;  4UFZ A;  3UT5 B;  2RGR A;  3J80 W;  5JCO A;  4ZI7 A;  3JAS B;  5LYJ B;  4RB2 C;  1JJO A;  1QQC A;  4X1K B;  1HNW B;  4X62 H;  4TV9 B;  1E4G T;  4DV3 H;  1FJG H;  4UCV A;  2R72 A;  3K5L A;  4DR6 H;  1I94 B;  5J2T B;  5IWA B;  4Q6G A;  1HR0 H;  4B3R B;  3T1Y B;  4FLU A;  1N36 H;  3RWR D;  5LXT B;  2YI8 A;  4X1I A;  4DR7 B;  5D1O B;  2ZIM A;  4DRF A;  3FMA A;  4JI1 B;  3W1B A;  1S03 G;  1O9G A;  4DUZ H;  4CC6 A;  2JGU A;  4DR2 B;  4JYA H;  2XIG A;  5IT9 W;  4O2A A;  4NXM H;  3RYI B;  1FKA H;  1ZHS A;  4YJ3 B;  4GKK H;  4UCU A;  5IWA H;  4X66 H;  2UUC H;  2OWO A;  2XHB A;  1I7F A;  4LFC H;  4DR3 B;  1WNS A;  4O2B A;  5CA0 B;  3GB8 B;  4DR7 H;  3U11 A;  4K8Z A;  4FM9 A;  3N2G B;  4LF5 H;  2Q2T A;  4AHC A;  4JI1 H;  4YY3 B;  4DUY B;  3HKB A;  2YI9 A;  3CHX A;  3HKB B;  4EQ5 A;  2FE3 A;  4LH7 A;  1Q5O A;  5IJ9 B;  4DV3 B;  3N41 B;  4NXM B;  4DV1 H;  3EYY A;  3WB0 A;  4HNA B;  4YJ2 A;  1ZHQ A;  2KKW A;  3JAR B;  4O4J A;  1XNQ B;  4ETS A;  1CKN A;  1IBL H;  5JVD A;  4JI8 H;  5BR8 H;  3ZED A;  5GON A;  5JVD B;  4DV7 H;  2VOB A;  4DV0 B;  2UXB B;  5EOY A;  3T1H H;  2O03 A;  2Q7E A;  3JAK B;  1GYF A;  2Q0A A;  1M0T A;  4MV9 A;  1IBK H;  5K1X A;  1CKM A;  4UCT A;  4DR2 H;  3WB2 A;  4R7R A;  4DK1 A;  1HNX B;  2CW8 A;  4GKJ H;  3BRC A;  1XMQ B;  1Q3E A;  1N32 B;  4PI0 A;  2ZM6 B;  4ZOL B;  4DV2 H;  4X66 B;  3K5M A;  3L2P A;  5J2T A;  4X64 B;  5CA0 A;  4DR3 H;  4JI6 H;  1ZAU A;  4UCO A;  4JI7 H;  1Z2P X;  4ZI7 B;  4DUY H;  5FNV B;  1M5I A;  3K5O A;  4TV9 A;  1P49 A;  2F1M A;  4IHJ B;  4PZ6 A;  4A2B A;  2WDT A;  3VNN A;  4LMY A;  4RB3 C;  5KHH A;  3RYI A;  5KHI A;  1XMQ H;  4B3S H;  1VS0 A;  2HIV A;  2E5L H;  2ZIO A;  2QJ1 A;  4DV2 B;  3FFQ A;  5D1O A;  4X1Y A;  3RJ0 A;  1L8D A;  5LP6 B;  1TVK B;  4DV7 B;  2R9A A;  1XI1 A;  2UU9 B;  3KAJ A;  2YCH A;  5FLX W;  5FPO A;  3J7A K;  2UXB H;  5IYZ A;  2VQF H;  3K59 A;  2VWJ A;  4LF4 H;  1HW7 A;  2UXD B;  5K1P A;  1IBK B;  5EYP B;  2RJZ A;  1DGS A;  3JAS A;  4NXN H;  3BA9 A;  4GKJ B;  4FFB A;  4FLT A;  1N32 H;  3ZS8 C;  3RYF B;  3ETQ A;  4D7S A;  4EB6 B;  2CW7 A;  4LF7 H;  2QM4 A;  4LF6 B;  4JI4 B;  5KMG B;  4JI6 B;  4PI2 A;  3KYH C;  1XHX A;  3SJA C;  4K0K B;  4O4I B;  5J2U A;  1SEI A;  3QTC A;  2RQ6 A;  2OYQ A;  3L4J A;  3S24 A;  3BA8 A;  4U3J B;  1T5E A;  5ITZ A;  3JAM W;  4TQF A;  3JAR A;  4O4J B;  3F8N A;  1N34 H;  2YXL A;  5EIB D;  1M0W A;  4X20 A;  4FFB B;  3U0Z A;  2UUB B;  2UXC B;  1S68 A;  4LSX A;  1H2S B;  4LF8 B;  2KSW A;  4ZIB A;  3RTX A;  4O4L B;  2VQE H;  3N43 B;  4K0K H;  2CFM A;  3N2K A;  1D5A A;  5JH7 B;  4JI3 B;  5LP6 C;  1J5E B;  5CB4 B;  1XMO B;  5D1P A;  4TV8 B;  3RYH A;  4MTE A;  1P8L A;  2HIX A;  4JI4 H;  2V4D A;  4FVM A;  1XNR H;  2ZJT A;  2R70 A;  1X4T A;  4FLV A;  4DV6 H;  4AQY H;  1XK5 A;  4DV4 B;  5KX5 B;  1VF7 A;  5JQG A;  4FLW A;  3TY9 A;  4LF9 H;  4CS2 A;  2GV9 A;  5EYP A;  4DR4 B;  3GDE A;  3CSX A;  1N34 B;  4X1K A;  4DR6 B;  4Q0Y A;  3RR5 A;  4X1Y B;  1RSO A;  4BW9 A;  1HR0 B;  1FVI A;  3OTO H;  1XHZ A;  4APM A;  1I6U A;  2PYL A;  1XNR B;  4RAY A;  5LA6 B;  2VQE B;  1IBM B;  4DV5 H;  4YHH B;  4PHZ A;  1N33 B;  4DV6 B;  5FNV A;  5CB4 A;  3JAW A;  4IHJ A;  3H20 A;  4FLX A;  2CAZ C;  4E6N A;  3CB2 A;  3M4I A;  4CH4 A;  4GKK B;  5JCO C;  3BAA A;  1HNZ B;  3SJB C;  3THO A;  3KAL A;  3RIZ A;  3OTO B;  4NVP A;  4LFC B;  3NBY B;  3K57 A;  3NC0 B;  4FM2 A;  4O4L A;  4DR1 H;  4WBN B;  2PZS A;  4JV5 B;  4DV5 B;  1IBM H;  4YHH H;  2WE6 A;  3N2G A;  2VPS A;  1JFF B;  3BHP A;  1N33 H;  4X65 B;  2HVQ A;  2F4V B;  3MAQ A;  3TY8 A;  1L2Z A;  2BTO A;  2ZIN A;  5KHJ A;  2UUA H;  4D7T A;  5BR8 B;  1CKN B;  5BMV A;  4LR3 A;  3T1H B;  4DV0 H;  2HHH H;  2VWK A;  2BTQ B;  4WBN A;  3RYF A;  4EFB A;  1SA0 B;  1JMK C;  5KHK A;  2PYJ A;  1SQF A;  5LMN H;  1XNQ H;  3RFR A;  1Z2O X;  2JVD A;  5LP6 A;  4K8X A;  2UUA B;  4OX9 B;  5FD6 A;  1N36 B;  4KHP B;  3A2F A;  3C0F B;  3JSN A;  2PGG A;  3E22 A;  3HKC B;  4DR1 B;  4AIL C;  4F6R B;  4J0M A;  3CVZ A;  4BWS C;  3UT5 A;  2MCT A;  2P22 C;  1KU9 A;  4I50 B;  4I50 A;  4IIJ A;  4RAZ A;  3L4K A;  5A2Q W;  4IIJ B;  1HNX H;  2F4V H;  4JI5 B;  3VQY A;  1FJG B;  4UCR A;  5LMU B;  2ZM6 H;  4TUY A;  4B3S B;  4I9Q A;  3ICX A;  3JAL B;  3KAK A;  2P5O A;  3JSL A;  4CH5 A;  5JJE B;  4B3R H;  2Q7H A;  2UUC B;  3JAT A;  4X1I B;  3QF7 A;  4KL1 A;  4OX9 H;  3N6X A;  3JAT B;  4TOI A;  3M7M X;  4ZOL A;  3K5N A;  3QWU A;  2ZCE A;  3BAB A;  4O4H B;  5EZY A;  2F95 B;  2PUS A;  4DUZ B;  3LML A;  4YY3 H;  5JQG B;  3DSQ A;  3IG0 A;  2W57 A;  1A0I A;  4JI5 H;  4ZHQ B;  4DV1 B;  3B2E E;  2JS5 A;  5C8Y A;  5LMN B;  4LF7 B;  1WN7 A;  2YIB D;  4JI2 H;  3HKD B;  4FM1 A;  3E22 B;  3RGZ A;  3RYH B;  4JI8 B;  4DRX A;  1IBL B;  4FLZ A;  4RZQ A;  5GON B;  4LF5 B;  4PZ8 A;  3N2K B;  3TY5 A;  2RGV A;  1BJT A;  5IJ9 A;  1FFX A;  5CA1 B;  4LSA A;  2F93 B;  4UCS A;  5LMU H;  1SA0 A;  4CS4 A;  3OTF A;  5FD5 A;  4LF6 H;  1TUB A;  4CH3 A;  5FPR A;  4X20 B;  1Z5V A;  3BPZ A;  1S5J A;  3K58 A;  3RF2 A;  2BTQ A;  4LNU A;  1TVK A;  4O2B B;  4JI7 B;  1P16 A;  3JAK A;  1M93 A;  2HVS A;  1G6U A;  1X9N A;  4BWA A;  1WH2 A;  5J2U B;  4O2A B;  1Z5W A;  4LFA B;  4IAJ A;  5LOV A;  4YJ3 A;  1XMO H;  5LL6 b;  4EFE A;  4A2A A;  3HXL A;  3PN1 A;  5C8Y B;  3HKE B;  4EB6 A;  4HNA A;  5JJN B;  2EX3 A;  4I4T A;  4FM0 A;  4JI2 B;  4LF8 H;  3RYC A;  4X64 H;  4JI0 B;  5EIB C;  5DIS C;  3U10 A;  2UU9 H;  1Q43 A;  4AQY B;  1SYX B;  2VQF B;  4O4H A;  2E3C A;  5KX5 A;  2UXD H;  4LFA H;  4LF9 B;  3JAW B;  4TUY B;  1SQG A;  3SR2 C;  4LFB B;  4I4T B;  2HVR A;  1MZB A;  2WYO A;  4NXN B;  4EEQ A;  4MV7 A;  5LYJ A;  2E5L B;  3N42 B;  3HKE A;  4RB1 A;  4B3T H;  4JI0 H;  4M7E A;  5IJ0 A;  4CC5 A;  2PY5 A;  3J81 W;  1M4U A;  3HKC A;  1QHT A;  4B08 A;  2ZNI A;  3N44 B;  4F6R A;  4DR5 B;  1SKV A;  4LF4 B;  3IAY A;  1B04 A;  5JH7 A;  1TGO A;  4CS3 A;  2ZNJ A;  1O75 A;  4GLX A;  2VUG A;  4GYC B;  1KMI Z;  3VQV A;  4TQD A;  2HGS A;  2F66 C;  1V9P A;  3UQ8 A;  3RYC B;  1TUB B;  3WB1 A;  2UUB H;  3SJC C;  5D5Q A;  1TAE A;  3N40 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...