4UFZA

Synthesis of novel nad dependant dna ligase inhibitors via negishi cross-coupling: development of sar and resistance studies
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negishi Cross-Coupling Enabled Synthesis of Novel Nad(+)-Dependent DNA Ligase Inhibitors and Sar Development.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ufzA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ufzA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ufzA02
4DV1B 3BA8A 4LH7A 4JI0B 1CKMA 3KYHC 5FPRA 5LMUB 4DV7B 1B04A 3T1YB 4GKJB 1A0IA 4DV2B 4LF5B 4UCUA 5FPOA 4JI6B 4UCOA 3NC0B 4OX9B 4DR2B 3GJXB 1I94B 4LF8B 1CKOA 3VNNA 4JI5B 2UUCB 4EFEA 4DR4B 4UCTA 4EFBA 3QWUA 4LF9B 2VUGA 2UXBB 3SGIA 1N34B 2HVRA 1ZAUA 2Q2UA 2CFMA 1CKNA 3NBZB 1XNRB 3W1GA 4DR7B 3RTXA 3W5OA 2VQFB 4DR5B 1XDNA 1XMOB 1P8LA 4LFAB 4DRFA 1IBLB 4LF7B 3RR5A 2UUAB 3JSNA 1HNWB 3OTOB 1VS0A 1TAEA 4CC6A 3TY5A 1HNXB 4JI1B 5D1PA 2HVSA 2HIXA 4JI4B 2E5LB 1CKNB 1XNQB 4DV4B 4UCSA 1N32B 3GDEA 3W1BA 4KHPB 4DR6B 4X62B 4EEQA 1FJGB 3S24A 2UUBB 4JI8B 4DV3B 4DR1B 4NXMB 2HHHB 3BA9A 2VQEB 4B3TB 1S68A 4K0KB 1P16A 4DR3B 4CC5A 4JI3B 2OWOA 2HVQA 1IBKB 1N36B 4PZ7A 3JSLA 4EQ5A 4DUZB 2HIVA 1TA8A 5D1OB 4LFCB 4UCRA 5LMNB 1V9PA 3PN1A 2F4VB 3L2PA 1HNZB 3TY9A 4YHHB 4NXNB 4LFBB 2Q2TA 1N33B 4DUYB 2ZM6B 4JV5B 5IWAB 4TOIA 4JI7B 4X66B 4LF4B 4GKKB 4YY3B 3UQ8A 1IBMB 4B3MB 4X64B 5BR8B 3NBYB 4PZ8A 3BABA 4E6NA 3T1HB 4AQYB 4X65B 4UCVA 4PZ6A 1XMQB 2UU9B 1DGSA 5D1OA 4GLXA 4DV5B 5DISC 4B3RB 2UXCB 4UFZA 3TY8A 4DV0B 1HR0B 4JI2B 3BAAA 4DV6B 4JYAB 4LF6B 1J5EB 4B3SB 3GB8B 4LH6A 1XK5A 1FVIA 1X9NA 2UXDB
chains in the Genus database with same CATH superfamily
3ABLB 5KFDA 1K9MW 1CKMA 3Q2OA 2XIGA 3JAKA 4GKJB 1DLBA 1WB8A 1IYDA 4MW3A 3SE7A 4UCUA 5IP7G 2PN1A 4TV9B 3GIDA 4MVUA 4ECUA 4O2AF 5C8YA 3T1CA 5BY1A 2HVJC 4DR6H 3JASB 4LF9B 5KG0A 1JJ2U 4DR1O 2F1MA 4TM5A 1HNWH 2Q4PA 3QFFA 4QW9A 1FXHA 2DWCA 1CP9A 3R5HA 1VAJA 3G80A 3OSPA 1H8EG 1M5IA 4WBNA 4UVAA 3BQ2A 2ZDHA 4GC7A 2JEXA 1GSOA 3A8TA 3H01A 3H0GG 4DV6O 4EG0A 5LYJB 3ABUA 1OCOC 1BNCA 4JTAB 5KUKA 2VQFO 1FXVA 5B1NA 2ZJTA 3K5IA 4DLKA 5KT5A 5E1AC 2HG8A 5LBQA 1T36A 2E5LB 3LWBA 4DV1H 1S77D 4UUGA 4CS4A 4O7VA 1W59A 5KG1A 1LR1A 1AR5A 1N32B 1J95A 3ZN0A 2PMZA 1V54C 3QNEA 4H37A 4A3EG 3BY6A 2V58A 4FLZA 2I87A 2FTKA 3N6XA 4JAVA 1MG1A 3HKBB 3CCRV 4D7SA 3PJSK 2QWRB 4PWQA 4DR3B 1OZ0A 2DYRC 3B4SA 2OWOA 2YICA 2QWNB 2P4VA 3N6RA 3OHAA 1S3JA 4X62H 1AJPA 4B3TO 1CS0A 3A0BZ 3UZOA 1RYRA 4I4TF 1BE3H 1AP6A 5KFCA 4HZ3A 3RB3A 1S0NA 4NXNB 3DC6A 5DEDA 1JLLB 3AG3C 2FMAA 4J9LA 3GTJA 5KFRA 3OHBA 5IWAB 2EIJB 4WHXA 3RB0A 1XMQH 4KXRA 3JAWA 5DGAA 3QTCA 1RPRA 5C8YB 4TT3G 1MSDA 3K0DA 3CRCA 4EYHB 4DV0O 1NR1A 2Z02A 3R23A 4QWEA 5LP6C 4HBNA 3NUAA 1MZFA 4ME6A 3PO3G 4JI2B 4DV7O 1IBKH 1S72V 5BYBA 4QWCA 3GTQA 3VMMA 2AZ2A 1A32A 4LF8H 3F7VC 4CS2A 2PTMA 3E89A 1OJHA 4Q6GA 4F4ZA 1WLEA 5FPRA 3N2GB 3JZ6A 3WO1A 4XX0B 1B04A 1NI8A 1US6A 4FE2A 3AEIA 3FKSG 2PMZE 4FZ0A 4UCOA 1D5AA 1AR4A 5LA6A 2FPGB 1CKOA 2EIKB 1COWG 2W9BB 2M7WA 2Q0OC 1G2WA 1SCUB 4GKJO 1GN3A 3SGIA 2HVRA 1ZETA 2WAMA 3GB7C 4I50B 4FIPC 2C2DA 2Y0SA 4MA0A 3ZRWA 1JOYA 5B3SC 3HXLA 3MFHA 2Y48A 4O84A 4DRXB 2OIGA 3TJTA 2E76B 3ETHA 3JZIA 2PI4A 1ZWIC 1HNXB 4ECTA 3RYHA 1LUWA 4JI4B 1LNQA 1CKNB 2BTQA 3JAMN 2J9GA 3HR0A 1B3QA 3TK1A 4U7NA 3A0HZ 3GDEA 1PNLA 5EBWC 4XBFA 5BWVA 1VQ6V 4FPPA 4ZBMA 5CBFA 3VPBA 4DUZO 4YIPA 5JJEB 1K7DA 2WLIB 2ASJA 3H4DA 2DPJA 4DRXA 1I0HA 1VIBA 2HVQA 2E75B 2UUBO 4PZ7A 1GAXA 2OCCB 5D1OB 2R8HA 4MT8A 1I08A 3L72H 1YI2V 4RB0A 3BPZA 1IBMO 2YEVB 3U9SA 2R8GA 3GVMA 4NZOA 3JALA 4UB8Z 4IHJA 2Q7HA 5KFPA 1Q3EA 1GKFA 1WN7A 5IYDO 4JTCB 5IYZF 5KT7A 4PA7A 5LA6B 2R7NA 2YZMA 3GIIA 1XEQA 1QLEC 3M8AA 2CGOA 4M7EA 2EX3A 2IJKA 4UCVA 2IMWP 3ASOC 1BSMA 1N33H 2VQEH 3L73H 5KA6A 5D1OA 5IWAH 4FBUA 2LQTA 4CZZA 1GRJA 3DGEA 2NU7B 3TY8A 1VQNV 2RDIA 3QZ7A 1Q5OA 1H2LA 4MVRA 3KTMA 4BAYA 2X6AA 1R73A 1YJWV 2YZGA 4EGQA 4DV7B 4YR3A 1QQCA 2GTSA 3B8MA 5KFZA 5C4XG 3ZMVA 2XT9A 4DXWA 3KHHA 3SJAC 3JD4A 5B5EZ 1E4FT 4YJ3B 3C0FB 3TIGA 3FKIA 4F4XA 2VA3A 2OYQA 4JASA 4L1KA 1AI7A 4JI7H 3TCUA 2ZKOA 5CM0A 1IBLH 2DZDA 3ABMC 1R3IC 5HFMA 5EC2C 1WPBA 4MVQA 3RTXA 5KFVA 5H6QA 2LW1A 3QQMA 1TUEB 2FLNA 2YSUB 1K8AW 2WLNA 3C90A 4JI1O 2L35A 3RGBA 2CTWA 4UV9A 1K5QA 5B1OA 4MTDA 3JRXA 4DYLA 2XAHA 3EPIA 4TV9A 1B6SA 4A3FG 2K1EA 2EZOA 2KKWA 4X62O 4B3TH 5B3SB 2XCPA 4X66O 2VRZA 1FD9A 2GPWA 4UCSA 1ZL8A 4MV8A 2CAZC 4RB2C 3ZJZA 3OSNA 4DR3O 3AW8A 2HVKC 4ECSA 4JI3O 1FJGB 1NTZH 3F5WC 2YW2A 1EYZA 3VA7A 4O4IF 1V51A 5KG7A 3K59A 4ZHQF 4HAMA 1OCRB 2JDIG 4O3SA 2R7KA 2FB5A 2ALZA 1TUBA 1AUVA 2ZNJA 4LCUC 2EJ0A 5A9GA 2P0AA 1N56A 4Q43A 5IYZB 4DUZB 1TA8A 4NYEA 4FFMA 5LGTA 2I8CA 5LMNB 4TQFA 3ASNC 1VKZA 2NU8B 1VF6C 3ZHRA 4ZQIA 4JXUA 3RYIA 2C22A 4TSFG 3RIZA 3P32A 4JAAA 5L3BA 4L87A 3T4ZA 5LXTB 4DR2O 4JV5B 3KXYT 3TQTA 1NR7A 1BXRA 1WH2A 1H2GA 3K04A 1QNMA 1N34O 2QYZA 2DE0X 5I5WA 2N74A 3C3TA 4AQYB 1RJPA 1X59A 5IYBG 4RAYA 3ABLC 2HJFC 3AX6A 3JD2A 4YJ2A 2QM7A 2WLLB 4DV5B 4GLXA 3RYCB 4ED6A 2W6MA 4UFZA 1KD1W 3WB1A 5D8DA 3HKZE 4MTEA 2JGUA 2QKSA 2ZIMA 4LH6A 4DK1A 4UUJC 1ENVA 1MNGA 3D36C 4K8XA 1CXZB 1I50A 2CGNA 4K3AA 4LH7A 3OR6C 3GIJA 1RYSA 4ED1A 2QTSA 5JJNB 5LMUB 5IDJA 3T1YB 4LF5B 3FB5C 5KFSA 5KFBA 4TQDA 2AHYA 3TINA 4G28B 2PZSA 1PNKA 4TWKA 2R7MA 2DYSC 4UCTA 3SJCC 5DG9A 3C3SA 2R8IA 5D5QA 2P4KA 4UXNA 1NS1A 2ZE8A 2NLJC 4JUZA 2YIAA 4GKKH 1JDBB 5CA1A 4Z2WA 4DR7B 2BSKA 2W7PA 4DV2H 1KC7A 2V4QA 2VQFB 2QK4A 4RUAA 2KQXA 1S5HC 2A0LA 3JATB 2P5OA 1K1QA 1TUBB 1TWFA 3KZIZ 3F7YC 5DECA 4P2ZA 2BOCC 2Y69C 4NTXA 5BWUA 2CQYA 1OCCC 4RCNA 3J80N 3OE7G 5KFKA 4QNHB 3K58A 1RK6A 2V4RA 1JVMA 1KJQA 4J9RA 4JI1B 4U3FH 2UUAO 2XAFA 4JTDB 4MTGA 1TWAA 1HNWO 3OEEG 1XI1A 5DLFA 3SR2C 2BSKB 5FLXW 1KP3A 4ABMA 3E35A 4X62B 5BYAA 1NZ6A 1AI6A 2WA3A 5DG8A 4ZHQA 4PDBA 1JFFB 2WLHA 3TETA 2LFRA 4DW1A 3BQ0A 2CW7A 3LMLA 4YQWA 1F4MA 4R7CA 5J2UB 1FJGH 5IWAO 1V9PA 4JZ2A 2CH7B 3HPLC 4FLUA 3E8HA 1SA0B 2ILMA 1Y76B 1IYEA 3TY9A 3T9FA 3U10A 3DXRB 5KFOA 4QJFB 5LMNO 1R3JC 3RAXA 4O4HB 4B7KA 4B3MB 4FFPA 2XC9A 4Y8VB 2FKXA 5LGNA 4RAIA 3MFIA 1EZ1A 3N40P 1DV2A 4X1KA 3FKIG 4XDKA 5L1KA 1Y74B 1THZA 3WG7C 3VOUA 5KKNB 3HKDB 2DYSB 1DF5A 1NH2D 2C00A 1OCZC 4J9KA 1XILA 1VBGA 2YYAA 3HO8A 3T2MA 3STLC 4LSAA 1YF2A 1VP7A 1J5EB 5KFJA 2EIKC 4AQYH 2XAJA 3MR6A 3P30A 4DV1B 5EBMC 3KYHC 4CMFA 2B9ZA 1BHAA 4FS1A 3ETQA 5BMVB 1N32H 4LFBO 3CRRA 4DV4O 1S0OA 4JI6B 2H94A 3WO0A 4OX9B 5DG7A 2WDTA 2FK3A 3SNOA 4H0LB 2ZDGA 1ZAUA 3WWHA 2YI8A 5IYDG 2VA2A 2R9AA 2JGDB 2Z0AA 2B1GA 1PM9A 2BQ3A 4LF8O 3CXCU 4DR4O 5LYJA 1PP9H 2JEFA 4JI3H 1K33A 1KC8W 3W7UA 4LFAB 1NTKH 3RT3C 3D3IA 1XOUA 4TV8F 1EFRG 1YITV 1XNRO 3D36A 3HOYG 1AILA 1KJ8A 2JVDA 1QVFU 4YIOA 2QGNA 1FPOA 3OTOB 2EIMC 2JA5G 1BS3A 1EN4A 2KG7B 3RFRA 2WAQE 1Z5WA 1URFA 5JWPA 5KMGB 4RB3C 4I9WA 2IBKA 4HNAA 3TXQA 3ZHSA 1YJNV 4GKJH 3CB2A 3M9OB 3TGUH 2ZNIA 2WPDG 4LF5O 2BCCH 3R65A 2Y4UA 1BCCH 2R72A 4F6EA 4MTXA 1O9HA 5I5UA 4OX9H 4X1YB 3AK2A 1I94O 3W1BA 2C35B 3PO2G 3OT7A 4BW5A 4LF9O 1ZUQA 2UUBB 4FFBA 4MVMA 4F6RA 3VPDA 3LQSA 5LL6b 4ZOLB 4WBNF 4JYBA 4NB5A 3NR7A 1IBKB 2FKLA 4HQ6A 2XUMA 5KFYA 3RBZA 3CCEV 4JI0O 1R1BA 2OTLV 3L2PA 2RNBA 4U7CA 2PF4E 1ZLZA 2Z5UA 5GTIZ 3KKYA 3K3WA 2ZM6B 4MVOA 2X5RA 1Z2OX 3UO2A 4RNOA 3KHLA 4I5SA 4F6RB 1PK8A 3ZEDA 2GTAA 1H38A 2ZQMA 2XCLA 2W8KA 2R8KA 1AN7A 4R8CA 1NH2B 5EDWA 4YHHH 1QR8A 4KP4A 2QEXV 4O7TA 2VPSA 4JV5H 2UUBH 3PW5A 5KFWA 2VUMA 1GSAA 1I5XA 3I4NG 2VR1A 5LXTF 4K0KO 2OTJV 3ETEA 4ZOLA 5KHKA 4WF9V 4O4JA 5DISC 3G6VA 4PDLA 2CNVA 2A7WA 3IC7A 3R5FA 5GONA 3QVNA 2B63A 4MV6A 1Y14B 4E4TA 1EBOA 4JI5O 4GCZA 2R84A 3BJYA 2QWOB 5D5PA 3HOVG 3JRWA 3GTPA 1B06A 2ZR2A 4HYOA 2ZM6H 1SQPH 4GX1A 5HFLA 5KT6A 4LF6H 4O4IB 2HHHH 2Q67A 2M6YA 3QWUA 2W6ZA 3H40A 3ASNB 3JD3A 3VQXA 1VQPV 4LF7O 3MHHC 1W93A 2OH2A 3U9TA 4DR5B 3LSUA 4YP3A 4I50F 4I50A 3B77A 2KSDA 2UUAB 4O4HF 3JSNA 2RN9A 4I55F 1E79G 1HNWB 5GONB 3ZRSA 2WLKA 2FP4B 4C5AA 5KFIA 1XMOH 5EYPB 1IXMA 3LNMB 3OTFA 3J81N 5FR9A 4LF4O 4DV4B 3K06A 1R3KC 2QKAA 3HOZG 3HB9A 4TQSA 2JGDA 3Q1KA 4J9QA 1ZQ7A 4DR1B 2HDKA 2VQEB 3W7WA 4ECVA 1S68A 2W9BA 3PW4A 4FFKA 2EILC 5FD6A 4CC5A 4B3RH 2UXCH 3SYCA 1VQ9V 4ZOLF 2D2CB 4DL5A 5LOVB 5JVDA 4YBZB 2HKOA 4OPHA 1W2BU 5JVDF 3KCYA 4Q4DA 2QM4A 4JPRA 3M9NB 2XGPA 4B3MO 4DV7H 1IBKO 1SESA 2W70A 5DLGA 5LA6F 2Q2TA 1Y1VG 1TGOA 3H1HH 1UJWB 1G8MA 3MAQA 1KU9A 3GIQA 1Q90D 2G38A 2QWPB 4ETSA 2W0FC 5CB4A 1N32O 4CE5A 5KFXA 2V1DA 2F23A 4LNUB 3B09A 4QWBA 4IR9A 1K92A 2A3QA 1JKJB 3PR4A 2Y0SE 2YXLA 2FPPB 1S5JA 1F23A 5KT4A 4O7SA 5LMUO 3T1YO 4O4LA 2AGPA 3FYEB 4JI6O 3M4IA 1KYOF 1ROPA 4J9NA 2HP8A 2ZXWB 5HNEA 2NR5A 4I0XB 3TIIA 3N41B 2R85A 1CQJB 4FVMA 2EILB 5FPOA 3SI8A 3IG0A 4R6ZA 4RU9A 4JI8H 2YEVA 4X9QA 4LF8B 2ZINA 1XQ8A 4DR4B 4HN2A 3CSWA 4A2AA 3GTLA 2UXBB 3H1KH 2Q2UA 2R93G 5KAIZ 2YC0A 1ET0A 1SS3A 1Y1VA 1XNRB 2EJ2A 2YZLA 5AG2A 5KG5A 1FKAO 1K1SA 3SYQA 4ECYA 1H2KA 4UB6Z 3ICXA 4Z1VA 4TVIA 1AI5A 1Y74A 2DOSA 1FS0G 2E3CA 4JYAO 4DR5O 4IHJF 3H1IH 3CEIA 3J7AU 2WE6A 2B63G 3V6KA 4DW0A 4YXWG 3Q4HB 5LP6A 1XNQB 5LP6F 4GKKO 1HW7A 3BQ1A 3T4DA 1QLEB 4E4EA 4F4YA 3I4MG 4FFLA 1TVKA 4M9UA 4ECRA 4LWSB 1Y4MA 1M7JA 2LJ2A 4J9PA 1T5EA 4JI8B 2UU9O 3N42B 3Q8PB 4I7HA 4W4KA 4XZ3B 2LGWA 4X88A 3CC7V 5KFLA 3T9BA 4DV6H 2QF7A 1KJIA 1V55C 1VEWA 4R50A 3G71V 4N21A 3L74H 3I56V 5KS8A 1SQQH 4J9MA 3JSLA 4L8JA 5LHHA 3ZCCA 2UVUA 2COJA 2JRIA 2VQEO 3T54A 2Q8VA 4BIUA 2DWEC 4A93G 4YR0A 1Y6XA 2CZGA 4BBSG 3M7MX 1ZHQA 4XDJA 4AI8A 1KUQA 5J2TB 5LOVF 4CH3A 1Y1WA 4GYCB 2HR3A 2R7ZG 4ZI7B 4PDRA 5B1AC 3KG2A 4TOIA 1SEIA 5KFFA 2WAQA 3N2GA 3LDCA 5B66Z 4X64B 5DGBA 5JCOC 3THOA 2H3OA 4DK0A 1T94A 5EC1C 4RZRA 1MZBA 4JI2O 5C1OA 3TW7A 3OR7C 4KUMA 2QR4A 3PZPA 3VOTA 5EWGA 1NKDA 2GBOA 1VQMV 2BQRA 3OGIB 5C93A 1IBLO 5FLMG 4FLVA 2O03A 3ZRXA 2E2HA 2AU0A 1M56C 2GHYA 2Q7DA 5FNVA 1FYJA 5LMNH 1M57B 1MSWD 1SZTA 4JI1H 5F9NA 3BCCH 1AR1B 5IYZA 1A0IA 5E25A 2W6JG 3UO3A 1K4DC 2C2EA 3CCVV 2PY5A 3CQZA 4FBTA 1Y66A 3P3NA 3K5NA 4CH5A 2WLMA 2JIZG 3OAAG 2ABJA 3BRCA 4LF4H 5LXTA 4LC1A 1TWGA 2V9WA 1I5YA 4FLWA 4KFMA 3MJFA 4CKCA 3BEHA 1AUXA 3DSQA 2W0XA 3IFXA 2ZE6A 2C28A 2F43G 2YU9A 3L71H 5IJ9A 5DQIA 3Q8RB 3T9CA 1VF7A 1HP8A 5JCOA 1XMOB 4YB8B 1WCMA 4GX5A 4JAUA 2B1IA 2J6UA 1JX9A 4OPAA 1BZKA 1DF4A 2UXBH 3SPGA 1IURA 3ZS8C 1BGWA 2WWWA 4P9PA 2JA7A 2HGSA 4O2BF 4O7WA 2R92A 1M0TA 4A3DG 1NTMH 5JQGF 3CRMA 2ZDQA 4B3MH 3JASA 4O3OA 4JYCA 1GLVA 2YS8A 3DXRA 4LFCH 3WB0A 4P9OA 3EVKA 4NZMA 4PDMA 3WB2A 3AG4C 2UVVA 3ETJA 3FD9A 5L9XA 1SKVA 4J9SA 2C2RA 1UPGA 4O4LB 4EQ5A 5C1PA 3RBEA 3TXSA 5BMVA 3SDLA 3OUUA 2IA6A 3ORRA 1DIKA 5KUMA 5K1PA 3STZC 3IGAC 3T1HH 2RJZA 3JAMW 2EINB 2R86A 2IP4A 3JD0A 3GTMA 4ED2A 4LF9H 1Y76A 4MVZA 1JCHA 2ZIOA 4WFHA 2D3OW 1Q6UA 3BABA 3WFVA 4NZNA 1N0NA 4BY1G 4C2MA 3GV5B 1KB9F 1NU1H 3FB8C 3LSSA 3HKBA 4NXMO 3K9SA 1PL4A 5DAAA 4AYBE 1SA0A 3GLKA 4PA9A 1JMKC 3APQA 1N48A 2DIKA 4RUEA 4X64H 4H33A 4EB6B 5CB4B 1FKAH 1S97A 1XL6A 4J41A 3U55A 3WG7B 1S03G 3E83A 4J10A 3RUPA 3H4BA 1HR0O 3T7AA 5FL7G 4JYAH 3CC2V 2ASLA 3SPIA 4DR5H 4HYKA 1OCOB 2EIMB 3AG1C 3JCZA 3VNNA 1MMMA 4YY3H 5A2QW 4MV7A 3MWEA 2UUAH 1A3GA 2AQ4A 2A9HA 1YVWA 3LUTB 1P7BA 1YIJV 5IJ0B 4X8AA 3E22B 4ICGA 4OGQB 1I7NA 3K5LA 3UYYA 1HNXH 2VOBA 5CA0F 2XTAA 1GK9A 1N36O 1B6RA 1M9NA 4DIMA 1IBLB 4RUCA 5CB4F 5B1BB 4PA3A 5T14A 4A2BA 3LDDA 5EOYA 1WAZA 1J5EO 3BG5A 2MK3A 4I4TB 4JZGA 1YDXA 2IBZH 4YAKB 1FJGO 2EZPA 1EKFA 4JI7O 4BWSC 4IHJB 2HGXA 3MWMA 4LF7H 1WA8B 2YIBA 1QCEA 4IYHA 3E8BA 1RJRA 3AYHB 4BY7G 3CCQV 3L4JA 3B40A 5LP6B 2IM9A 4BWAA 2EULA 5CMUA 3RYIB 1Q43A 3JAWB 3NXSA 2W6OA 3V4ZA 4QSHA 2AGQA 1VBHA 3E8FA 4MV3A 3R5XA 2Y0IA 2ADQB 1AJNA 3E22A 1WP8A 4LP8A 3MD0A 3E2EA 4C5BA 4O3QA 3B2EE 3HB3B 4RQFA 4YJ3F 3AK1A 1KEEA 2NVYA 2ZDIA 3PN1A 2F4VB 4X66H 4MW8A 1HNZB 5KLVH 4M0JA 1JQ0A 1D2DA 4XDLA 1ZSPA 4X1IB 4CBCA 2R9IA 1N33B 3RV4A 4AQYO 2R6FA 1PV0A 2V5AA 4EKWA 4AHCA 4ED0A 4WFGA 2R9RB 4C7UA 3JATA 4A3JG 4B3RO 2UXCO 2Q0AA 4ZIBA 3GTGA 2JJ2G 5EWFA 3E5NA 2W8LA 1DGSA 4LBEC 3FAVB 1KT8A 4MTOA 2FLLA 3RVZA 2ITCC 4FLYA 1AI4A 4J11A 3V6HA 2DYRB 3JCUZ 5K3WA 1RJQA 2FK1A 1WB7A 2W6NA 3OMIB 3UM7A 5K1XA 4JI0B 4TUYB 1VQ8V 1AB3A 3PW7A 4NLGA 3RN4A 4CKEA 1XNRH 5JH7A 5EZYA 5EZYF 5JH7F 2Y4TA 2UXBO 3J80W 2KB1A 1KP2A 1YSCA 1MOFA 2YXHA 4MA5A 5H6RA 3DF7A 1QR9A 3TEKA 2XCAA 4IWXA 2VPQA 1RPOA 2Q68A 5GTHZ 2VUGA 3VPCA 2CFMA 2JA5A 4NVPA 1KUTA 4WCEV 4ECQA 4JV0A 1XDCA 4JI6H 5B1AB 1F4NA 2QA4V 4G3IA 1RSOB 3B8NA 5KX5A 3RR5A 3OMNB 1L0LH 4JYYA 3ORQA 5KG6A 3GILA 3OUZA 1Q6IA 1TAEA 5CA3A 1JDEA 2N04A 3HKEA 5KT2A 2NU6B 4A3KG 4DUYH 5LGUA 4H44B 4PBCA 1VQLV 2XGQA 5EZYB 5KHHA 2XNDG 3KHGA 2V7QG 2NNUA 4TV8B 5B1BC 2QSAA 2PYJA 1M56B 3MWDA 2CNQA 2W6QA 2XD4A 1I3QA 1L0NH 5EIBD 1K34A 2ASDA 4GX2A 3S24A 3CCJV 4XYMB 4O4HA 3RV3A 4JV1A 4ECXA 2OLSA 4O4IA 3T5LA 3T9EA 5C44G 2IU0A 1I7LA 4KHPH 2ZR3A 4B7EA 4O2AB 4ZKIA 3QZ8A 3CC4V 3OGCC 1W96A 4LFAO 5JQWA 1Q8IA 2W6IG 4PDVA 5DGIA 3RYHB 4CHIA 3G6BA 2UVWA 3KALA 4X64O 1M0WA 3EHBB 3ZBHA 1B33N 3T9AA 2X7RB 3U54A 3GQCA 2QJ1A 1PKXA 5JJJB 2AW9A 5FD5A 5KFHA 5BPHA 4JI7B 3A2FA 2GUZB 4HNVA 2HFEC 3UQ8A 2BTQB 2HEPA 4ASUG 4BBRG 1HR0H 4O3RA 5DN6G 2PBZA 3E86A 4Q0YA 3V4SA 1UNNC 4WD3A 1AVMA 5KFQA 1HNZH 2P67A 2A06H 2OCHA 1GN4A 4MAMA 5LYJF 2JA7G 2W6PA 5ITZB 5GONF 2F93B 2VWJA 4QIWA 1BGYH 4WFAV 1GO3F 3DTFA 1CPYA 4B3RB 2UXCB 4J7JA 3W7TA 3HKCB 2COGA 2RMKB 2IW5A 1S0MA 3QO5A 3K3VA 3JARA 1G4YB 3CE2A 3G6YA 1XNQH 2Q73A 3AG4B 4PV1B 5E79Z 2DMXA 5EIBC 1K3EA 2GUZA 4FK5C 3U11A 3KAJA 3T5HA 2LGQA 5BWTA 1SQXH 3RF2A 1SZXA 1GN6A 5I60A 2VQFH 3S3XA 3T9DA 1FXKA 4JI2H 3GJXB 3OW2U 3ASOB 1BHBA 1EKPA 2FLPA 4QW8A 5IY5B 3JYCA 2LO1A 2ATKC 3W1GA 4X65H 5L1JA 1O9GA 3LDEA 2W7OA 2VUMG 2J6SA 3K9AA 2JS5A 4O83A 1HDJA 4PD4F 2L6LA 4CKBA 4JF3A 3IN5A 2ODTX 1OHHG 4HNAB 1Q6HA 2E5LH 1OCRC 4DAAA 4FFBB 4J42A 4WBNB 1VS0A 2EJRA 4X20B 3SYPA 4F4WA 1R6TA 3HBLA 4B08A 2DJVA 2Z04A 2ZXWC 4PJ0Z 1U97A 5BXZA 3ZRVA 4MV9A 3GIPA 2Q7EA 1RM1B 5IJ0A 4GLWA 3UZBA 4DR4H 2QB5A 2UXNA 1LUVA 4E2LA 2RDCA 4TUYF 2YRWA 1XMQO 3MR5A 3CHXA 1R6NA 2ZCEA 5EBLC 4YAJB 2COIA 2R92G 1MA1A 4FZ1A 4B3SH 3EXAA 1BQZA 1Z2NX 3QO7A 5I5TA 3K79A 2NN4A 5DM6V 1JA8A 4DL6A 2MW2B 4J9YB 2GQRA 1YTFD 2WLLA 4UCRA 2ETNA 2UXDO 1SYXB 1JJOA 3APOA 2R8JA 4LF5H 5EK0A 3T1YH 4LNUA 3SPJA 1I94H 1BL8A 2V59A 1EUCB 4K35A 1N0JA 5F2VO 4LFCO 3PFFA 4MTFA 3FDSA 4LF4B 4X66B 3K5HA 3CJHB 3ZMSA 4GKKB 1S76D 4R8UB 2F4VH 5IT9W 2M05A 4TUYA 4PZ8A 1W0JG 1K5SA 2GV9A 4ZI7A 3WWJA 3RWRD 2W9AA 1SFOA 4QE7A 4PZ6A 5L3GA 3ABKB 4U3JB 4JI8O 5BWWA 3ETGA 3H20A 4QWAA 5I47A 4JI0H 3H3VH 4FS2A 3T1HO 5BR8H 3GV7B 1HR0B 1H8HG 2DABA 3LP8A 1M90W 4B3SB 1O75A 2Y4RA 4Q4CA 3KHRA 1M6VA 3CRQA 3UFXB 5IYCG 2YDEA 4I7ZB 4NTYA 2XAGA 2HLDG 1VQ5V 4I55B 5CE8A 1OCCB 4DR2B 4JV5O 2UVRA 5JQGA 4D7TA 5I5YA 4NXMH 1SQFA 1FFTB 4IRDA 3ZIAG 4MSWC 1N34B 4K0KH 3AG2B 5CBGA 2XAQA 2CKZB 3W7SA 2R7ZA 1PPJH 5L3CA 2SCUB 2ARHA 5GW7A 3O9OA 2ZE5A 2IU3A 3N44B 5FNVB 4Q8EA 2CTPA 3CX5F 4K6NA 5IT9N 4DV5O 3KAKA 2UU9H 3D8CA 1JFFA 4LR3A 4GT1A 5LHIA 5JVLA 4QPKA 5KFNA 2LW7A 4DL4A 4J80A 5CN0A 2WTFA 2QWQB 4NR1A 4U6PA 4JGSA 5H80A 2X6CA 3N8DA 1VF6A 1AP5A 3ZMZA 3ETDA 2CH7A 1K83A 4Q8FA 2UXXA 4A3IG 1GSHA 4DR1H 4YJ3A 3MHSC 1IBMH 4O2BA 2WA4A 3DTUB 2X0LA 1BT8A 3DAAA 3RGXA 4KHPB 3HOUG 1GM8A 4FM1A 4RZQA 3V6JA 5IE9A 1HNXO 2UUCH 3KCXA 5H9CA 1YJ9V 5KFTA 1YCIA 5KX5F 1BJTA 1KKCA 2FK2A 4Q20A 1J5EH 3ZHTA 2RDJA 2CDYA 3G4SV 4ED3A 1XMOO 2EJ7A 4QGPA 2JEIA 2PVPA 4O4JB 2DAAA 4DV3H 1EN5A 3JAKB 1N33O 1Q7YW 2HGWA 2HHFB 2LFSA 5A2QN 1IZ3A 4DV1O 5DMXA 5IJ9B 3K5MA 3SJBC 5TISZ 2BQUA 2ITDC 2Q6AA 4A3GG 1SQVH 2AZ0A 4GX0A 1YHQV 4LFBB 3G8CA 5KAFZ 2R70A 3O65A 4FM2A 3GTKA 3UKMA 3GTOA 4WFEA 1YZBA 2JJ1G 4UV8A 2EBOA 5CAEB 4FLXA 3ZHVA 2PI5A 2GSMB 4X1IA 4C5CA 4UVBA 1VMGA 1WJZA 4IGGA 3H0GA 3RVYA 1NQTA 4O3PA 3CEBA 1WNSA 1QLNA 4BIZA 1GN2A 2O57A 3G67A 5KG4A 3Q8SB 1KTAA 2RQ6A 1GGOA 4X65O 2F95B 4LF6B 1SETA 4G27B 3BVOA 3OUSA 5J9PC 1FVIA 3VBBA 3X2QB 2Q69A 1P84F 2F66C 3OUFA 2IH1C 1KJJA 2RGRA 1X4TA 1NJIW 4XYLB 1FFXB 4X1KB 4HR7A 3G6XA 2E5LO 3U0GA 3T5JA 4IIJA 3BFRA 5CA1F 3NC0B 4DV0H 4X20A 2RF4A 4O2BB 3HKZA 4O7ZA 1UC9A 1TWHA 5KFAA 1A0GA 3VQVA 3ZHQA 4TV9F 4QIWF 4FFOA 2JEUA 3NBZB 4RAZA 1SC5B 2DWDC 1K73W 1YEWA 4H13B 5LMUH 3UT5B 4EYIB 4ECWA 4K8ZA 4AYBA 4DR3H 4CH6A 4MV1A 4PELA 4JI4H 4IR1A 1P8LA 5BWXA 3AK3A 4DRFA 5CA0A 1E1RG 2BR0A 5KFUA 5FNVF 3OMAB 5IYBO 2B5UA 3ZN1A 3LSQA 2X6BA 4I9QA 4IIJB 3K5OA 2ADPA 1TVKB 3GIKA 5LHGA 4J9ZB 3HOXG 2HVSA 4R8UA 2IJIA 2P06A 1GYFA 1IVSA 3HT5A 4I0XA 1VQ4V 2HJDA 2EIYA 1Y1WG 4WFFA 5BZBA 2QKCA 1PL0A 1F51A 4DR6B 4ED7A 2QDOA 5FJ8G 2DW4A 1H2NA 2XASA 1KBLA 5H5NA 1RK5A 4NKGB 2GDSA 1OBDA 5KMGA 1OWTA 4Q45A 2QE7G 1P16A 2GQSA 4JI3B 2FMLA 1N36B 5HV6A 2NUAB 1WCMG 1ZL8B 5J2UF 4LFCB 2QM8A 2Q9LA 4PI0A 1OBGA 2JEGA 2WLIA 2CTQA 4EGJA 3OTOO 2CUGA 5BR8O 1GO3E 2EJ3A 4TQRA 4O2AA 2JEJA 1PNMA 1IX9A 4IIJF 3RYFA 1P7GA 3G8DA 4J9OA 2YIBD 2R93A 2AGAA 2Y69B 1IXBA 1RFYA 1GMGA 2LP7A 3T1HB 2I80A 2YWVA 4MV4A 1VQ7V 2R87A 2A79B 1BQ0A 4O7NA 4YY3O 4IRCA 4A5UB 3CSXA 1WR2A 2N05A 5BMVF 3FB6C 4IRKA 4FGRA 5C3EG 1P4RA 4FLTA 3RB4A 3IJ4A 1N4CA 1OV9A 2WSSG 1R9TA 1L8DA 2DPIA 2FPIB 3AG3B 1E1QG 4DV2O 1XUQA 5I5XA 3CMEV 3RYCA 3K0GA 2PYLA 1X9NA 2A1HA 2ZGIA 2P22C 3N43B 1N36H 4A3CG 3BA8A 1I7FA 2BE3A 1IOWA 3CCUV 1WRVA 3CPWU 2WYOA 5IP9G 5DQHA 1WSCA 3CYOA 4QJFA 2C2AA 3K57A 1I1MA 4FU0A 2MCTA 4R7RA 5DQGA 3VQYA 1WPXA 1ZHSA 5EWEA 1DK1A 5JH7B 4CMDA 4FM0A 3T99A 1S0VA 3RJ0A 3U0ZA 1E4EA 1GM7A 2FYUH 3SYOA 3DTGA 1CKNA 2FE3A 1RSOA 1FXKC 2GLTA 2VWKA 1JXLA 2FB9A 1QBZA 2UUCO 4AILC 1XL4A 3HOWG 2H8PC 1XDNA 1S5LZ 1PX2A 3I5DA 1BMFG 5JVDB 2JA6G 3N27A 1MZEA 3FB7C 1QHTA 1R3LC 4Z1MG 4JV2A 1F7YA 1M4UA 1I6UA 5KHGA 4LMYA 5HBRB 1T3NA 4CC6A 4X89A 2QTOA 3M99B 3S3WA 5D1PA 1KKDA 1L1FA 4NTWA 1Z2GA 1XREA 5CBHA 3RAQA 1HWYA 5L3EA 1SQBH 2DQ0A 5L3DA 2KG7A 3DC5A 3JALB 5F9LA 2FL4A 1Y67A 3SYAA 3M9MB 1YXBA 3L75H 1QVGU 5L1IA 4DV3B 1U96A 2HHHB 2YS7A 1I1LA 1XBLA 2JK5C 2XHBA 4DL3A 2YUAA 3G6EV 2JA8G 2XOKG 1XHZA 1M1KW 1KJ9A 5CA1B 4PA6A 3PW2A 5KHJA 2E2IA 3F8NA 3FFQA 2PUSA 3ZRWB 1H2SB 1M93A 3MDSA 4IL6Z 2AGOA 3TW6A 3CD6V 4DUYB 3FYIB 5FLXN 2FJZA 1JPXA 3HKEB 5BR8B 4O7LA 4O7RA 4MS2A 1L2ZA 2V4DA 3SPHA 4NXNH 4X65B 3EYYA 4EEYA 4DR7O 4IZOA 2OCCC 3J7AK 2P90A 4YR2A 4IWYA 2W71A 2AXTZ 2UXDH 3OD4A 5J2UA 1KMIZ 4RQEA 5I5VA 2CE4A 5KG2A 3PVXA 2Z3YA 4DO2A 5C8YF 4JYAB 1WP7A 4A3LG 3IC9A 3GB8B 1XK5A 3ZMTA 3CS5A 4LSXA 2CNUA 2F4VO 1ZX3A 1CQIB 5KFEA 3AG2C 3KREA 4IT5A 2DQ3A 1Q82W 1V4YA 3ABMB 2K9PA 3H9VA 4DV2B 2WB1E 4WFBV 4LWSA 1CE8A 3EPGA 2AHZA 3FMAA 3EFFK 3TQ1A 2DLNA 1UC8A 5K2MA 3L9DA 4FFNA 3Q4HA 2CTRA 5BWRA 3FX7A 5KX5B 1JX4A 4D6TH 4I4TA 4O3NA 1ZTEA 4OX9O 5I5SA 1B6QA 4X1YA 3BHPA 1SERA 1RP3B 1WA8A 1EZJA 2Y0PA 2E74B 5H2FZ 1I1KA 4PA4A 2EIJC 4DUZH 4RB1A 3RBDA 4A3MG 2YS6A 5J2TF 3HKDA 1PD3A 4FMTA 4O82A 1A9XA 1DAAA 4RNNA 1EHIA 1FXKB 3OEHG 1I2KA 2ATLA 3NGDA 4HNTA 4DR6O 3UT5A 4YJ2F 3K08A 2BTOA 5C5JA 4CS3A 2JS3A 1GH6A 1SQGA 3JARB 1K97A 1D5NA 1K4CC 4EBDA 1TWCA 3OM3B 1NT2B 4F4LA 1Q86W 3CRAA 5KHIA 2NVXA 4U7OA 4J7ZA 5KT3A 4DV5H 3ML0A 2IJJA 1DTOA 3BA9A 1VARA 3ZX6A 4O4LF 2J6TA 1GM9A 1HNZO 4YHHO 4QIWE 4G2KA 4DL2A 1RM1C 4O7YA 2HG5C 1Q81W 4P30A 2ZDIC 4QE9A 2HIVA 3CCMV 2W9CB 2JA6A 3D3QA 4RO2A 4W4LA 2PGGA 3E8GA 3GWOA 1R6KA 3FAVA 3I12A 4HNUA 1VQOV 1NBMG 1S10A 4J7KA 4OXSA 1KECA 4APMA 3LULA 2ZT9B 1XNQO 4RUFA 1JR9A 4UVCA 4JI5H 4FM9A 3I55V 4O86A 3CMAV 5L3FA 2ZM6O 4NYKA 3T5KA 1N8RW 5KFMA 1XMQB 4EBCA 3X2QC 2UU9B 4LF6O 4DV3O 4BXXG 2CK3G 2HHHO 2VQDA 3AG7A 3SJQC 3R9RA 4BW9A 5KFGA 5IY5C 3VQWA 1E4EB 2WLJA 5IYCO 3H1LH 3RYFB 3JD1A 3K3PA 4DV0B 1KQSU 5CR5A 3A0RA 4DV6B 1V55B 4IAJA 2OT5A 3CWBH 5J2TA 2WB1A 3LNNA 4TV8A 3CJHA 1I2LA 2YXYA 2YRXA 5KA5A 1AJQA 3SPCA 5JQGB 1SF9A 3RGZA 3UCSC 3QO8A 1E4GT 3MR3A 3RB6A 4KL1A 3J81W 1A48A 1SRYA 1CEZA 1I94B 4PI2A 4JI5B 5LL6Y 4EFEA 2UUCB 3JZFA 4EFBA 4O4JF 2ZE7A 3H1JH 1FFXA 4BR6A 1ULZA 3WNZA 3F5TA 3WWIA 1XHXA 2VS0A 3P3PA 1QU7A 2YIDA 3W5OA 4ECZA 4DQNA 1M57C 4J0MA 3N2KB 5BPFA 1C3OA 1G1XB 4LF7B 4U3JA 2GPSA 2Q5ZA 4ZHQB 1FAFA 1OCZB 1VQKV 1Z5VA 4YJ2B 1JIHA 4LFBH 4DV4H 4B3SO 3CCLV 1V54B 3RW0A 3CXHF 1GTOA 3QF7A 3ZMUA 5KG3A 4ED8A 3TY5A 2HJWA 3GV8B 3MR2A 1NVPD 2RGVA 2HIXA 5CA0B 3CVZA 2HHFA 2ZD9A 2KSWA 1IDSA 4QWDA 4DL7A 5ITZA 5EYPA 4PHZA 2RCVA 1P49A 4CH4A 3WU2Z 4N23A 4GC6A 1MABG 3R66A 4EEQA 4JI4O 4I55A 4DR2H 4BIOA 4NXMB 4B3TB 2P6JA 5L1LA 1YTFB 4IYIA 4K0KB 1W0KG 1N34H 1DV1A 2YI9A 4GUNA 2P7TC 2CW8A 4NXNO 4EB6A 4RNMA 2YZNA 3RFCA 4DR7H 2IH3C 3ABTA 2X0SA 2DN9A 3ABKC 5DGHA 4DUYO 3W7XA 1EUDB 1S9FA 4YHHB 1EKVA 3GWKC 2W57A 1IOVA 4ZI7F 3OFNG 3ZHUA 3K03A 1C30A 1VF5B 3BACA 4F50A 3CP1A 1H2MA 1EN6A 1G6UA 2YCHA 4YY3B 1UFIA 4FFRA 3CCSV 1IBMB 3HKCA 3NBYB 2Q7GA 4GZRB 4E6NA 1Z2PX 1ORQC 5LOVA 4QPJA 4MVSA 4KHPO 2NU9B 3IAYA 2IJHA 2R82A 4LFAH 4EBEA 3AG1B 4A3BG 1EM1A 4RWUA 4O81A 3L70H 3QG5A 2ODMA 3PW0A 3GIMA 4Q44A 3OTOH 3L4KA 3Q8QB 2W9CA 3N2KA 1EZVH 3BAAA 2BOBC 2EINC 2YL2A 2OIEA 1NVPB 1KBHA 4FJCC 1AROP 2R7LA 5JUMA 3PR5B 2UXDB
chains in the Genus database with same CATH topology
4DV1B 1S03G 2F66C 3KYHC 1CKMA 2RGRA 1X4TA 1FFXB 4X1KB 2XIGA 3ETQA 3JAKA 5BMVB 4GKJB 1N32H 4JYAH 4UCUA 4JI6B 4IIJA 4DR5H 4TV9B 3NC0B 4OX9B 4DV0H 4X20A 2WDTA 5C8YA 3VNNA 4YY3H 5A2QW 3JASB 4O2BB 4MV7A 4DR6H 4LF9B 2UUAH 3VQVA 1ZAUA 2F1MA 2YI8A 4RAZA 2R9AA 3NBZB 1HNWH 5LMUH 1YEWA 3UT5B 4K8ZA 5IJ0B 3E22B 4DR3H 3K5LA 4CH6A 5LYJA 1HNXH 4JI3H 2VOBA 1M5IA 4JI4H 4WBNA 1P8LA 4LFAB 4DRFA 5CA0A 1IBLB 4A2BA 2JVDA 5LYJB 5EOYA 3OTOB 4I9QA 4IIJB 3K5OA 4I4TB 3RFRA 2ZJTA 1Z5WA 5KMGB 4RB3C 1TVKB 4HNAA 1GYFA 2HVSA 4GKJH 2E5LB 4DV1H 3CB2A 4BWSC 4IHJB 2ZNIA 3MWMA 4CS4A 4LF7H 2YIBA 2R72A 1O9HA 4OX9H 4X1YB 1N32B 3W1BA 4DR6B 3L4JA 5LP6B 2IM9A 4BWAA 2UUBB 3RYIB 4FFBA 1Q43A 3JAWB 4F6RA 4FLZA 5LL6b 3N6XA 4ZOLB 5KMGA 3HKBB 4D7SA 1P16A 4DR3B 3E22A 4JI3B 2OWOA 1IBKB 1N36B 3B2EE 4LFCB 4X62H 4PI0A 3PN1A 2F4VB 4X66H 3L2PA 1HNZB 4NXNB 4O2AA 4X1IB 1N33B 2ZM6B 3RYFA 5IWAB 1XMQH 1Z2OX 4AHCA 4F6RB 3JAWA 3QTCA 3ZEDA 2YIBD 5C8YB 1AN7A 3JATA 2Q0AA 4ZIBA 3T1HB 4YHHH 2VPSA 4JV5H 2UUBH 1DGSA 5LP6C 3CSXA 4HBNA 4ZOLA 5KHKA 4FLTA 4O4JA 5DISC 4FLYA 1L8DA 4JI2B 1IBKH 4NXMH 5GONA 4LF8H 4CS2A 2PTMA 3RYCA 2PYLA 1X9NA 2P22C 3N43B 1N36H 5K1XA 3BA8A 1I7FA 4Q6GA 4TUYB 5FPRA 4JI0B 3N2GB 5JH7A 5EZYA 1XNRH 5D5PA 2WYOA 1B04A 3J80W 3K57A 4R7RA 2MCTA 3VQYA 2ZM6H 4UCOA 1ZHSA 1D5AA 5LA6A 5JH7B 3DF7A 1CKOA 4LF6H 4FM0A 4O4IB 3RJ0A 2HHHH 3U0ZA 3QWUA 2VUGA 3SGIA 3VQXA 2HVRA 2CFMA 1CKNA 4NVPA 2FE3A 1RSOA 4I50B 2VWKA 4DR5B 4JI6H 4AILC 1XDNA 3HXLA 5JVDB 4I50A 5KX5A 3RR5A 1QHTA 2UUAB 1I6UA 1M4UA 3JSNA 4DRXB 5KHGA 4LMYA 1HNWB 5GONB 1TAEA 4CC6A 1XMOH 3HKEA 5EYPB 3OTFA 1HNXB 5D1PA 4DUYH 3RYHA 4JI4B 1CKNB 2BTQA 5EZYB 5KHHA 4DV4B 4TV8B 2PYJA 3GDEA 5EIBD 3JALB 3S24A 4O4HA 4DV3B 4DR1B 2HHHB 2VQEB 5JJEB 1S68A 4O4IA 2XHBA 5FD6A 4KHPH 4CC5A 4DRXA 4B3RH 2UXCH 4O2AB 1XHZA 2HVQA 4PZ7A 5CA1B 1Q8IA 5D1OB 5KHJA 5LOVB 5JVDA 3F8NA 3FFQA 3RYHB 2PUSA 1H2SB 4RB0A 2QM4A 3BPZA 1M93A 3KALA 1M0WA 4DV7H 3JALA 2Q2TA 1TGOA 4IHJA 2Q7HA 4DUYB 2QJ1A 1Q3EA 1WN7A 5JJJB 3MAQA 5FD5A 1KU9A 4JI7B 3A2FA 3UQ8A 3HKEB 4ETSA 2BTQB 5CB4A 2HEPA 5LA6B 5BR8B 1HR0H 4Q0YA 1HNZH 1L2ZA 2V4DA 4LNUB 4M7EA 4NXNH 2EX3A 4X65B 3EYYA 4UCVA 5ITZB 3J7AK 2F93B 1N33H 2VQEH 2YXLA 5D1OA 2VWJA 2UXDH 5IWAH 5J2UA 1KMIZ 1S5JA 4B3RB 2UXCB 3TY8A 4O4LA 1Q5OA 4JYAB 3GB8B 3HKCB 1XK5A 3M4IA 3K3VA 3JARA 4LSXA 1XNQH 5EIBC 3U11A 3KAJA 4DV7B 3N41B 4DV2B 3RF2A 1QQCA 4FVMA 5FPOA 2VQFH 3IG0A 4JI2H 3GJXB 3SJAC 3FMAA 4JI8H 1E4FT 4LF8B 4YJ3B 2ZINA 3C0FB 1XQ8A 4DR4B 2OYQA 4A2AA 5KX5B 2UXBB 4JI7H 2Q2UA 4I4TA 1IBLH 1XNRB 3W1GA 4X65H 1O9GA 1WPBA 3RTXA 4X1YA 3BHPA 2JS5A 3ICXA 4DUZH 4RB1A 3RGBA 4HNAB 2E5LH 2E3CA 3HKDA 4MTDA 4FFBB 4WBNB 1VS0A 4X20B 4TV9A 2WE6A 4B08A 2KKWA 3UT5A 4B3TH 2BTOA 5LP6A 1XNQB 4CS3A 1HW7A 1SQGA 3JARB 4UCSA 4MV9A 1TVKA 2Q7EA 2CAZC 4RB2C 5IJ0A 1NT2B 4DR4H 5KHIA 1FJGB 1T5EA 4JI8B 4DV5H 3N42B 3CHXA 4I7HA 3BA9A 3K59A 2ZCEA 4DV6H 4AQYH 1TUBA 4B3SH 2ZNJA 1Z2NX 3JSLA 4L8JA 5IYZB 4DUZB 2HIVA 1TA8A 1SYXB 4UCRA 5LMNB 1JJOA 4TQFA 3M7MX 4LF5H 2PGGA 1ZHQA 3RYIA 3T1YH 5J2TB 4CH3A 4LNUA 4GYCB 1I94H 3RIZA 4ZI7B 5LXTB 4JV5B 4APMA 4TOIA 4LF4B 4X66B 1SEIA 4GKKB 3N2GA 3KXYT 4FM9A 1WH2A 4JI5H 2F4VH 5IT9W 4TUYA 4X64B 4PZ8A 2GV9A 5JCOC 4ZI7A 3THOA 4DK0A 3RWRD 4AQYB 1MZBA 4PZ6A 1XMQB 4RAYA 4U3JB 2UU9B 4YJ2A 3H20A 4BW9A 4GLXA 4DV5B 3VQWA 3RYCB 4JI0H 3RYFB 4FLVA 4UFZA 2O03A 3WB1A 5BR8H 4DV0B 1HR0B 4DV6B 4IAJA 4MTEA 2JGUA 2ZIMA 5J2TA 4B3SB 1O75A 4LH6A 5FNVA 4DK1A 3LNNA 4TV8A 5LMNH 4K8XA 4LH7A 4JI1H 5JJNB 5JQGB 5LMUB 5IYZA 3T1YB 1A0IA 3RGZA 4LF5B 1E4GT 4I55B 2PY5A 4KL1A 3J81W 4TQDA 4DR2B 5JQGA 1I94B 4D7TA 2PZSA 4PI2A 4JI5B 3K5NA 1SQFA 4CH5A 4UCTA 3SJCC 4EFEA 4EFBA 2UUCB 5D5QA 3BRCA 1N34B 4K0KH 4LF4H 1FFXA 2YIAA 4GKKH 5LXTA 4FLWA 1XHXA 5CA1A 4DR7B 3DSQA 4DV2H 3N44B 3W5OA 5FNVB 2VQFB 5IJ9A 3JATB 2P5OA 4J0MA 1VF7A 3N2KB 1TUBB 5JCOA 1XMOB 3KAKA 2UU9H 4LF7B 1JFFA 4U3JA 4LR3A 4ZHQB 2UXBH 1Z5VA 4YJ2B 4LFBH 4DV4H 3ZS8C 1BGWA 3QF7A 3K58A 3TY5A 2HGSA 4JI1B 2RGVA 1M0TA 2HIXA 5CA0B 3CVZA 2KSWA 4DR1H 4YJ3A 5ITZA 1IBMH 5EYPA 4B3MH 3JASA 4O2BA 1XI1A 4PHZA 3SR2C 3RGXA 4KHPB 4FM1A 5FLXW 1P49A 4CH4A 4RZQA 2UUCH 4X62B 4LFCH 3WB0A 4EEQA 4I55A 4DR2H 4NXMB 4PDBA 3WB2A 4ZHQA 4B3TB 1JFFB 1BJTA 4K0KB 1N34H 1SKVA 2YI9A 1J5EH 2CW8A 4O4LB 2CW7A 3LMLA 4EB6A 4DR7H 4O4JB 4EQ5A 4DV3H 3JAKB 5BMVA 5J2UB 1FJGH 1V9PA 5IJ9B 4FLUA 1SA0B 5K1PA 3K5MA 3TY9A 4YHHB 3T1HH 3SJBC 2RJZA 2W57A 3JAMW 3U10A 4LFBB 2R70A 4FM2A 4LF9H 1G6UA 2YCHA 4YY3B 4O4HB 2ZIOA 1IBMB 3HKCA 4B3MB 3NBYB 2Q7GA 3BABA 4FLXA 4E6NA 1Z2PX 5LOVA 4X1IA 3IAYA 3N40P 4X1KA 4LFAH 3HKBA 1WNSA 3HKDB 3QG5A 1SA0A 1JMKC 2RQ6A 3OTOH 3L4KA 4X64H 3N2KA 3BAAA 4LSAA 2F95B 4LF6B 1J5EB 4EB6B 5CB4B 1FKAH 1FVIA 2UXDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 B;  3BA8 A;  4LH7 A;  4JI0 B;  1CKM A;  3KYH C;  5FPR A;  5LMU B;  4DV7 B;  1B04 A;  3T1Y B;  4GKJ B;  1A0I A;  4DV2 B;  4LF5 B;  4UCU A;  5FPO A;  4JI6 B;  4UCO A;  3NC0 B;  4OX9 B;  4DR2 B;  3GJX B;  1I94 B;  4LF8 B;  1CKO A;  3VNN A;  4JI5 B;  2UUC B;  4EFE A;  4DR4 B;  4UCT A;  4EFB A;  3QWU A;  4LF9 B;  2VUG A;  2UXB B;  3SGI A;  1N34 B;  2HVR A;  1ZAU A;  2Q2U A;  2CFM A;  1CKN A;  3NBZ B;  1XNR B;  3W1G A;  4DR7 B;  3RTX A;  3W5O A;  2VQF B;  4DR5 B;  1XDN A;  1XMO B;  1P8L A;  4LFA B;  4DRF A;  1IBL B;  4LF7 B;  3RR5 A;  2UUA B;  3JSN A;  1HNW B;  3OTO B;  1VS0 A;  1TAE A;  4CC6 A;  3TY5 A;  1HNX B;  4JI1 B;  5D1P A;  2HVS A;  2HIX A;  4JI4 B;  2E5L B;  1CKN B;  1XNQ B;  4DV4 B;  4UCS A;  1N32 B;  3GDE A;  3W1B A;  4KHP B;  4DR6 B;  4X62 B;  4EEQ A;  1FJG B;  3S24 A;  2UUB B;  4JI8 B;  4DV3 B;  4DR1 B;  4NXM B;  2HHH B;  3BA9 A;  2VQE B;  4B3T B;  1S68 A;  4K0K B;  1P16 A;  4DR3 B;  4CC5 A;  4JI3 B;  2OWO A;  2HVQ A;  1IBK B;  1N36 B;  4PZ7 A;  3JSL A;  4EQ5 A;  4DUZ B;  2HIV A;  1TA8 A;  5D1O B;  4LFC B;  4UCR A;  5LMN B;  1V9P A;  3PN1 A;  2F4V B;  3L2P A;  1HNZ B;  3TY9 A;  4YHH B;  4NXN B;  4LFB B;  2Q2T A;  1N33 B;  4DUY B;  2ZM6 B;  4JV5 B;  5IWA B;  4TOI A;  4JI7 B;  4X66 B;  4LF4 B;  4GKK B;  4YY3 B;  3UQ8 A;  1IBM B;  4B3M B;  4X64 B;  5BR8 B;  3NBY B;  4PZ8 A;  3BAB A;  4E6N A;  3T1H B;  4AQY B;  4X65 B;  4UCV A;  4PZ6 A;  1XMQ B;  2UU9 B;  1DGS A;  5D1O A;  4GLX A;  4DV5 B;  5DIS C;  4B3R B;  2UXC B;  4UFZ A;  3TY8 A;  4DV0 B;  1HR0 B;  4JI2 B;  3BAA A;  4DV6 B;  4JYA B;  4LF6 B;  1J5E B;  4B3S B;  3GB8 B;  4LH6 A;  1XK5 A;  1FVI A;  1X9N A;  2UXD B; 
#chains in the Genus database with same CATH topology
 3ABL B;  5KFD A;  1K9M W;  1CKM A;  3Q2O A;  2XIG A;  3JAK A;  4GKJ B;  1DLB A;  1WB8 A;  1IYD A;  4MW3 A;  3SE7 A;  4UCU A;  5IP7 G;  2PN1 A;  4TV9 B;  3GID A;  4MVU A;  4ECU A;  4O2A F;  5C8Y A;  3T1C A;  5BY1 A;  2HVJ C;  4DR6 H;  3JAS B;  4LF9 B;  5KG0 A;  1JJ2 U;  4DR1 O;  2F1M A;  4TM5 A;  1HNW H;  2Q4P A;  3QFF A;  4QW9 A;  1FXH A;  2DWC A;  1CP9 A;  3R5H A;  1VAJ A;  3G80 A;  3OSP A;  1H8E G;  1M5I A;  4WBN A;  4UVA A;  3BQ2 A;  2ZDH A;  4GC7 A;  2JEX A;  1GSO A;  3A8T A;  3H01 A;  3H0G G;  4DV6 O;  4EG0 A;  5LYJ B;  3ABU A;  1OCO C;  1BNC A;  4JTA B;  5KUK A;  2VQF O;  1FXV A;  5B1N A;  2ZJT A;  3K5I A;  4DLK A;  5KT5 A;  5E1A C;  2HG8 A;  5LBQ A;  1T36 A;  2E5L B;  3LWB A;  4DV1 H;  1S77 D;  4UUG A;  4CS4 A;  4O7V A;  1W59 A;  5KG1 A;  1LR1 A;  1AR5 A;  1N32 B;  1J95 A;  3ZN0 A;  2PMZ A;  1V54 C;  3QNE A;  4H37 A;  4A3E G;  3BY6 A;  2V58 A;  4FLZ A;  2I87 A;  2FTK A;  3N6X A;  4JAV A;  1MG1 A;  3HKB B;  3CCR V;  4D7S A;  3PJS K;  2QWR B;  4PWQ A;  4DR3 B;  1OZ0 A;  2DYR C;  3B4S A;  2OWO A;  2YIC A;  2QWN B;  2P4V A;  3N6R A;  3OHA A;  1S3J A;  4X62 H;  1AJP A;  4B3T O;  1CS0 A;  3A0B Z;  3UZO A;  1RYR A;  4I4T F;  1BE3 H;  1AP6 A;  5KFC A;  4HZ3 A;  3RB3 A;  1S0N A;  4NXN B;  3DC6 A;  5DED A;  1JLL B;  3AG3 C;  2FMA A;  4J9L A;  3GTJ A;  5KFR A;  3OHB A;  5IWA B;  2EIJ B;  4WHX A;  3RB0 A;  1XMQ H;  4KXR A;  3JAW A;  5DGA A;  3QTC A;  1RPR A;  5C8Y B;  4TT3 G;  1MSD A;  3K0D A;  3CRC A;  4EYH B;  4DV0 O;  1NR1 A;  2Z02 A;  3R23 A;  4QWE A;  5LP6 C;  4HBN A;  3NUA A;  1MZF A;  4ME6 A;  3PO3 G;  4JI2 B;  4DV7 O;  1IBK H;  1S72 V;  5BYB A;  4QWC A;  3GTQ A;  3VMM A;  2AZ2 A;  1A32 A;  4LF8 H;  3F7V C;  4CS2 A;  2PTM A;  3E89 A;  1OJH A;  4Q6G A;  4F4Z A;  1WLE A;  5FPR A;  3N2G B;  3JZ6 A;  3WO1 A;  4XX0 B;  1B04 A;  1NI8 A;  1US6 A;  4FE2 A;  3AEI A;  3FKS G;  2PMZ E;  4FZ0 A;  4UCO A;  1D5A A;  1AR4 A;  5LA6 A;  2FPG B;  1CKO A;  2EIK B;  1COW G;  2W9B B;  2M7W A;  2Q0O C;  1G2W A;  1SCU B;  4GKJ O;  1GN3 A;  3SGI A;  2HVR A;  1ZET A;  2WAM A;  3GB7 C;  4I50 B;  4FIP C;  2C2D A;  2Y0S A;  4MA0 A;  3ZRW A;  1JOY A;  5B3S C;  3HXL A;  3MFH A;  2Y48 A;  4O84 A;  4DRX B;  2OIG A;  3TJT A;  2E76 B;  3ETH A;  3JZI A;  2PI4 A;  1ZWI C;  1HNX B;  4ECT A;  3RYH A;  1LUW A;  4JI4 B;  1LNQ A;  1CKN B;  2BTQ A;  3JAM N;  2J9G A;  3HR0 A;  1B3Q A;  3TK1 A;  4U7N A;  3A0H Z;  3GDE A;  1PNL A;  5EBW C;  4XBF A;  5BWV A;  1VQ6 V;  4FPP A;  4ZBM A;  5CBF A;  3VPB A;  4DUZ O;  4YIP A;  5JJE B;  1K7D A;  2WLI B;  2ASJ A;  3H4D A;  2DPJ A;  4DRX A;  1I0H A;  1VIB A;  2HVQ A;  2E75 B;  2UUB O;  4PZ7 A;  1GAX A;  2OCC B;  5D1O B;  2R8H A;  4MT8 A;  1I08 A;  3L72 H;  1YI2 V;  4RB0 A;  3BPZ A;  1IBM O;  2YEV B;  3U9S A;  2R8G A;  3GVM A;  4NZO A;  3JAL A;  4UB8 Z;  4IHJ A;  2Q7H A;  5KFP A;  1Q3E A;  1GKF A;  1WN7 A;  5IYD O;  4JTC B;  5IYZ F;  5KT7 A;  4PA7 A;  5LA6 B;  2R7N A;  2YZM A;  3GII A;  1XEQ A;  1QLE C;  3M8A A;  2CGO A;  4M7E A;  2EX3 A;  2IJK A;  4UCV A;  2IMW P;  3ASO C;  1BSM A;  1N33 H;  2VQE H;  3L73 H;  5KA6 A;  5D1O A;  5IWA H;  4FBU A;  2LQT A;  4CZZ A;  1GRJ A;  3DGE A;  2NU7 B;  3TY8 A;  1VQN V;  2RDI A;  3QZ7 A;  1Q5O A;  1H2L A;  4MVR A;  3KTM A;  4BAY A;  2X6A A;  1R73 A;  1YJW V;  2YZG A;  4EGQ A;  4DV7 B;  4YR3 A;  1QQC A;  2GTS A;  3B8M A;  5KFZ A;  5C4X G;  3ZMV A;  2XT9 A;  4DXW A;  3KHH A;  3SJA C;  3JD4 A;  5B5E Z;  1E4F T;  4YJ3 B;  3C0F B;  3TIG A;  3FKI A;  4F4X A;  2VA3 A;  2OYQ A;  4JAS A;  4L1K A;  1AI7 A;  4JI7 H;  3TCU A;  2ZKO A;  5CM0 A;  1IBL H;  2DZD A;  3ABM C;  1R3I C;  5HFM A;  5EC2 C;  1WPB A;  4MVQ A;  3RTX A;  5KFV A;  5H6Q A;  2LW1 A;  3QQM A;  1TUE B;  2FLN A;  2YSU B;  1K8A W;  2WLN A;  3C90 A;  4JI1 O;  2L35 A;  3RGB A;  2CTW A;  4UV9 A;  1K5Q A;  5B1O A;  4MTD A;  3JRX A;  4DYL A;  2XAH A;  3EPI A;  4TV9 A;  1B6S A;  4A3F G;  2K1E A;  2EZO A;  2KKW A;  4X62 O;  4B3T H;  5B3S B;  2XCP A;  4X66 O;  2VRZ A;  1FD9 A;  2GPW A;  4UCS A;  1ZL8 A;  4MV8 A;  2CAZ C;  4RB2 C;  3ZJZ A;  3OSN A;  4DR3 O;  3AW8 A;  2HVK C;  4ECS A;  4JI3 O;  1FJG B;  1NTZ H;  3F5W C;  2YW2 A;  1EYZ A;  3VA7 A;  4O4I F;  1V51 A;  5KG7 A;  3K59 A;  4ZHQ F;  4HAM A;  1OCR B;  2JDI G;  4O3S A;  2R7K A;  2FB5 A;  2ALZ A;  1TUB A;  1AUV A;  2ZNJ A;  4LCU C;  2EJ0 A;  5A9G A;  2P0A A;  1N56 A;  4Q43 A;  5IYZ B;  4DUZ B;  1TA8 A;  4NYE A;  4FFM A;  5LGT A;  2I8C A;  5LMN B;  4TQF A;  3ASN C;  1VKZ A;  2NU8 B;  1VF6 C;  3ZHR A;  4ZQI A;  4JXU A;  3RYI A;  2C22 A;  4TSF G;  3RIZ A;  3P32 A;  4JAA A;  5L3B A;  4L87 A;  3T4Z A;  5LXT B;  4DR2 O;  4JV5 B;  3KXY T;  3TQT A;  1NR7 A;  1BXR A;  1WH2 A;  1H2G A;  3K04 A;  1QNM A;  1N34 O;  2QYZ A;  2DE0 X;  5I5W A;  2N74 A;  3C3T A;  4AQY B;  1RJP A;  1X59 A;  5IYB G;  4RAY A;  3ABL C;  2HJF C;  3AX6 A;  3JD2 A;  4YJ2 A;  2QM7 A;  2WLL B;  4DV5 B;  4GLX A;  3RYC B;  4ED6 A;  2W6M A;  4UFZ A;  1KD1 W;  3WB1 A;  5D8D A;  3HKZ E;  4MTE A;  2JGU A;  2QKS A;  2ZIM A;  4LH6 A;  4DK1 A;  4UUJ C;  1ENV A;  1MNG A;  3D36 C;  4K8X A;  1CXZ B;  1I50 A;  2CGN A;  4K3A A;  4LH7 A;  3OR6 C;  3GIJ A;  1RYS A;  4ED1 A;  2QTS A;  5JJN B;  5LMU B;  5IDJ A;  3T1Y B;  4LF5 B;  3FB5 C;  5KFS A;  5KFB A;  4TQD A;  2AHY A;  3TIN A;  4G28 B;  2PZS A;  1PNK A;  4TWK A;  2R7M A;  2DYS C;  4UCT A;  3SJC C;  5DG9 A;  3C3S A;  2R8I A;  5D5Q A;  2P4K A;  4UXN A;  1NS1 A;  2ZE8 A;  2NLJ C;  4JUZ A;  2YIA A;  4GKK H;  1JDB B;  5CA1 A;  4Z2W A;  4DR7 B;  2BSK A;  2W7P A;  4DV2 H;  1KC7 A;  2V4Q A;  2VQF B;  2QK4 A;  4RUA A;  2KQX A;  1S5H C;  2A0L A;  3JAT B;  2P5O A;  1K1Q A;  1TUB B;  1TWF A;  3KZI Z;  3F7Y C;  5DEC A;  4P2Z A;  2BOC C;  2Y69 C;  4NTX A;  5BWU A;  2CQY A;  1OCC C;  4RCN A;  3J80 N;  3OE7 G;  5KFK A;  4QNH B;  3K58 A;  1RK6 A;  2V4R A;  1JVM A;  1KJQ A;  4J9R A;  4JI1 B;  4U3F H;  2UUA O;  2XAF A;  4JTD B;  4MTG A;  1TWA A;  1HNW O;  3OEE G;  1XI1 A;  5DLF A;  3SR2 C;  2BSK B;  5FLX W;  1KP3 A;  4ABM A;  3E35 A;  4X62 B;  5BYA A;  1NZ6 A;  1AI6 A;  2WA3 A;  5DG8 A;  4ZHQ A;  4PDB A;  1JFF B;  2WLH A;  3TET A;  2LFR A;  4DW1 A;  3BQ0 A;  2CW7 A;  3LML A;  4YQW A;  1F4M A;  4R7C A;  5J2U B;  1FJG H;  5IWA O;  1V9P A;  4JZ2 A;  2CH7 B;  3HPL C;  4FLU A;  3E8H A;  1SA0 B;  2ILM A;  1Y76 B;  1IYE A;  3TY9 A;  3T9F A;  3U10 A;  3DXR B;  5KFO A;  4QJF B;  5LMN O;  1R3J C;  3RAX A;  4O4H B;  4B7K A;  4B3M B;  4FFP A;  2XC9 A;  4Y8V B;  2FKX A;  5LGN A;  4RAI A;  3MFI A;  1EZ1 A;  3N40 P;  1DV2 A;  4X1K A;  3FKI G;  4XDK A;  5L1K A;  1Y74 B;  1THZ A;  3WG7 C;  3VOU A;  5KKN B;  3HKD B;  2DYS B;  1DF5 A;  1NH2 D;  2C00 A;  1OCZ C;  4J9K A;  1XIL A;  1VBG A;  2YYA A;  3HO8 A;  3T2M A;  3STL C;  4LSA A;  1YF2 A;  1VP7 A;  1J5E B;  5KFJ A;  2EIK C;  4AQY H;  2XAJ A;  3MR6 A;  3P30 A;  4DV1 B;  5EBM C;  3KYH C;  4CMF A;  2B9Z A;  1BHA A;  4FS1 A;  3ETQ A;  5BMV B;  1N32 H;  4LFB O;  3CRR A;  4DV4 O;  1S0O A;  4JI6 B;  2H94 A;  3WO0 A;  4OX9 B;  5DG7 A;  2WDT A;  2FK3 A;  3SNO A;  4H0L B;  2ZDG A;  1ZAU A;  3WWH A;  2YI8 A;  5IYD G;  2VA2 A;  2R9A A;  2JGD B;  2Z0A A;  2B1G A;  1PM9 A;  2BQ3 A;  4LF8 O;  3CXC U;  4DR4 O;  5LYJ A;  1PP9 H;  2JEF A;  4JI3 H;  1K33 A;  1KC8 W;  3W7U A;  4LFA B;  1NTK H;  3RT3 C;  3D3I A;  1XOU A;  4TV8 F;  1EFR G;  1YIT V;  1XNR O;  3D36 A;  3HOY G;  1AIL A;  1KJ8 A;  2JVD A;  1QVF U;  4YIO A;  2QGN A;  1FPO A;  3OTO B;  2EIM C;  2JA5 G;  1BS3 A;  1EN4 A;  2KG7 B;  3RFR A;  2WAQ E;  1Z5W A;  1URF A;  5JWP A;  5KMG B;  4RB3 C;  4I9W A;  2IBK A;  4HNA A;  3TXQ A;  3ZHS A;  1YJN V;  4GKJ H;  3CB2 A;  3M9O B;  3TGU H;  2ZNI A;  2WPD G;  4LF5 O;  2BCC H;  3R65 A;  2Y4U A;  1BCC H;  2R72 A;  4F6E A;  4MTX A;  1O9H A;  5I5U A;  4OX9 H;  4X1Y B;  3AK2 A;  1I94 O;  3W1B A;  2C35 B;  3PO2 G;  3OT7 A;  4BW5 A;  4LF9 O;  1ZUQ A;  2UUB B;  4FFB A;  4MVM A;  4F6R A;  3VPD A;  3LQS A;  5LL6 b;  4ZOL B;  4WBN F;  4JYB A;  4NB5 A;  3NR7 A;  1IBK B;  2FKL A;  4HQ6 A;  2XUM A;  5KFY A;  3RBZ A;  3CCE V;  4JI0 O;  1R1B A;  2OTL V;  3L2P A;  2RNB A;  4U7C A;  2PF4 E;  1ZLZ A;  2Z5U A;  5GTI Z;  3KKY A;  3K3W A;  2ZM6 B;  4MVO A;  2X5R A;  1Z2O X;  3UO2 A;  4RNO A;  3KHL A;  4I5S A;  4F6R B;  1PK8 A;  3ZED A;  2GTA A;  1H38 A;  2ZQM A;  2XCL A;  2W8K A;  2R8K A;  1AN7 A;  4R8C A;  1NH2 B;  5EDW A;  4YHH H;  1QR8 A;  4KP4 A;  2QEX V;  4O7T A;  2VPS A;  4JV5 H;  2UUB H;  3PW5 A;  5KFW A;  2VUM A;  1GSA A;  1I5X A;  3I4N G;  2VR1 A;  5LXT F;  4K0K O;  2OTJ V;  3ETE A;  4ZOL A;  5KHK A;  4WF9 V;  4O4J A;  5DIS C;  3G6V A;  4PDL A;  2CNV A;  2A7W A;  3IC7 A;  3R5F A;  5GON A;  3QVN A;  2B63 A;  4MV6 A;  1Y14 B;  4E4T A;  1EBO A;  4JI5 O;  4GCZ A;  2R84 A;  3BJY A;  2QWO B;  5D5P A;  3HOV G;  3JRW A;  3GTP A;  1B06 A;  2ZR2 A;  4HYO A;  2ZM6 H;  1SQP H;  4GX1 A;  5HFL A;  5KT6 A;  4LF6 H;  4O4I B;  2HHH H;  2Q67 A;  2M6Y A;  3QWU A;  2W6Z A;  3H40 A;  3ASN B;  3JD3 A;  3VQX A;  1VQP V;  4LF7 O;  3MHH C;  1W93 A;  2OH2 A;  3U9T A;  4DR5 B;  3LSU A;  4YP3 A;  4I50 F;  4I50 A;  3B77 A;  2KSD A;  2UUA B;  4O4H F;  3JSN A;  2RN9 A;  4I55 F;  1E79 G;  1HNW B;  5GON B;  3ZRS A;  2WLK A;  2FP4 B;  4C5A A;  5KFI A;  1XMO H;  5EYP B;  1IXM A;  3LNM B;  3OTF A;  3J81 N;  5FR9 A;  4LF4 O;  4DV4 B;  3K06 A;  1R3K C;  2QKA A;  3HOZ G;  3HB9 A;  4TQS A;  2JGD A;  3Q1K A;  4J9Q A;  1ZQ7 A;  4DR1 B;  2HDK A;  2VQE B;  3W7W A;  4ECV A;  1S68 A;  2W9B A;  3PW4 A;  4FFK A;  2EIL C;  5FD6 A;  4CC5 A;  4B3R H;  2UXC H;  3SYC A;  1VQ9 V;  4ZOL F;  2D2C B;  4DL5 A;  5LOV B;  5JVD A;  4YBZ B;  2HKO A;  4OPH A;  1W2B U;  5JVD F;  3KCY A;  4Q4D A;  2QM4 A;  4JPR A;  3M9N B;  2XGP A;  4B3M O;  4DV7 H;  1IBK O;  1SES A;  2W70 A;  5DLG A;  5LA6 F;  2Q2T A;  1Y1V G;  1TGO A;  3H1H H;  1UJW B;  1G8M A;  3MAQ A;  1KU9 A;  3GIQ A;  1Q90 D;  2G38 A;  2QWP B;  4ETS A;  2W0F C;  5CB4 A;  1N32 O;  4CE5 A;  5KFX A;  2V1D A;  2F23 A;  4LNU B;  3B09 A;  4QWB A;  4IR9 A;  1K92 A;  2A3Q A;  1JKJ B;  3PR4 A;  2Y0S E;  2YXL A;  2FPP B;  1S5J A;  1F23 A;  5KT4 A;  4O7S A;  5LMU O;  3T1Y O;  4O4L A;  2AGP A;  3FYE B;  4JI6 O;  3M4I A;  1KYO F;  1ROP A;  4J9N A;  2HP8 A;  2ZXW B;  5HNE A;  2NR5 A;  4I0X B;  3TII A;  3N41 B;  2R85 A;  1CQJ B;  4FVM A;  2EIL B;  5FPO A;  3SI8 A;  3IG0 A;  4R6Z A;  4RU9 A;  4JI8 H;  2YEV A;  4X9Q A;  4LF8 B;  2ZIN A;  1XQ8 A;  4DR4 B;  4HN2 A;  3CSW A;  4A2A A;  3GTL A;  2UXB B;  3H1K H;  2Q2U A;  2R93 G;  5KAI Z;  2YC0 A;  1ET0 A;  1SS3 A;  1Y1V A;  1XNR B;  2EJ2 A;  2YZL A;  5AG2 A;  5KG5 A;  1FKA O;  1K1S A;  3SYQ A;  4ECY A;  1H2K A;  4UB6 Z;  3ICX A;  4Z1V A;  4TVI A;  1AI5 A;  1Y74 A;  2DOS A;  1FS0 G;  2E3C A;  4JYA O;  4DR5 O;  4IHJ F;  3H1I H;  3CEI A;  3J7A U;  2WE6 A;  2B63 G;  3V6K A;  4DW0 A;  4YXW G;  3Q4H B;  5LP6 A;  1XNQ B;  5LP6 F;  4GKK O;  1HW7 A;  3BQ1 A;  3T4D A;  1QLE B;  4E4E A;  4F4Y A;  3I4M G;  4FFL A;  1TVK A;  4M9U A;  4ECR A;  4LWS B;  1Y4M A;  1M7J A;  2LJ2 A;  4J9P A;  1T5E A;  4JI8 B;  2UU9 O;  3N42 B;  3Q8P B;  4I7H A;  4W4K A;  4XZ3 B;  2LGW A;  4X88 A;  3CC7 V;  5KFL A;  3T9B A;  4DV6 H;  2QF7 A;  1KJI A;  1V55 C;  1VEW A;  4R50 A;  3G71 V;  4N21 A;  3L74 H;  3I56 V;  5KS8 A;  1SQQ H;  4J9M A;  3JSL A;  4L8J A;  5LHH A;  3ZCC A;  2UVU A;  2COJ A;  2JRI A;  2VQE O;  3T54 A;  2Q8V A;  4BIU A;  2DWE C;  4A93 G;  4YR0 A;  1Y6X A;  2CZG A;  4BBS G;  3M7M X;  1ZHQ A;  4XDJ A;  4AI8 A;  1KUQ A;  5J2T B;  5LOV F;  4CH3 A;  1Y1W A;  4GYC B;  2HR3 A;  2R7Z G;  4ZI7 B;  4PDR A;  5B1A C;  3KG2 A;  4TOI A;  1SEI A;  5KFF A;  2WAQ A;  3N2G A;  3LDC A;  5B66 Z;  4X64 B;  5DGB A;  5JCO C;  3THO A;  2H3O A;  4DK0 A;  1T94 A;  5EC1 C;  4RZR A;  1MZB A;  4JI2 O;  5C1O A;  3TW7 A;  3OR7 C;  4KUM A;  2QR4 A;  3PZP A;  3VOT A;  5EWG A;  1NKD A;  2GBO A;  1VQM V;  2BQR A;  3OGI B;  5C93 A;  1IBL O;  5FLM G;  4FLV A;  2O03 A;  3ZRX A;  2E2H A;  2AU0 A;  1M56 C;  2GHY A;  2Q7D A;  5FNV A;  1FYJ A;  5LMN H;  1M57 B;  1MSW D;  1SZT A;  4JI1 H;  5F9N A;  3BCC H;  1AR1 B;  5IYZ A;  1A0I A;  5E25 A;  2W6J G;  3UO3 A;  1K4D C;  2C2E A;  3CCV V;  2PY5 A;  3CQZ A;  4FBT A;  1Y66 A;  3P3N A;  3K5N A;  4CH5 A;  2WLM A;  2JIZ G;  3OAA G;  2ABJ A;  3BRC A;  4LF4 H;  5LXT A;  4LC1 A;  1TWG A;  2V9W A;  1I5Y A;  4FLW A;  4KFM A;  3MJF A;  4CKC A;  3BEH A;  1AUX A;  3DSQ A;  2W0X A;  3IFX A;  2ZE6 A;  2C28 A;  2F43 G;  2YU9 A;  3L71 H;  5IJ9 A;  5DQI A;  3Q8R B;  3T9C A;  1VF7 A;  1HP8 A;  5JCO A;  1XMO B;  4YB8 B;  1WCM A;  4GX5 A;  4JAU A;  2B1I A;  2J6U A;  1JX9 A;  4OPA A;  1BZK A;  1DF4 A;  2UXB H;  3SPG A;  1IUR A;  3ZS8 C;  1BGW A;  2WWW A;  4P9P A;  2JA7 A;  2HGS A;  4O2B F;  4O7W A;  2R92 A;  1M0T A;  4A3D G;  1NTM H;  5JQG F;  3CRM A;  2ZDQ A;  4B3M H;  3JAS A;  4O3O A;  4JYC A;  1GLV A;  2YS8 A;  3DXR A;  4LFC H;  3WB0 A;  4P9O A;  3EVK A;  4NZM A;  4PDM A;  3WB2 A;  3AG4 C;  2UVV A;  3ETJ A;  3FD9 A;  5L9X A;  1SKV A;  4J9S A;  2C2R A;  1UPG A;  4O4L B;  4EQ5 A;  5C1P A;  3RBE A;  3TXS A;  5BMV A;  3SDL A;  3OUU A;  2IA6 A;  3ORR A;  1DIK A;  5KUM A;  5K1P A;  3STZ C;  3IGA C;  3T1H H;  2RJZ A;  3JAM W;  2EIN B;  2R86 A;  2IP4 A;  3JD0 A;  3GTM A;  4ED2 A;  4LF9 H;  1Y76 A;  4MVZ A;  1JCH A;  2ZIO A;  4WFH A;  2D3O W;  1Q6U A;  3BAB A;  3WFV A;  4NZN A;  1N0N A;  4BY1 G;  4C2M A;  3GV5 B;  1KB9 F;  1NU1 H;  3FB8 C;  3LSS A;  3HKB A;  4NXM O;  3K9S A;  1PL4 A;  5DAA A;  4AYB E;  1SA0 A;  3GLK A;  4PA9 A;  1JMK C;  3APQ A;  1N48 A;  2DIK A;  4RUE A;  4X64 H;  4H33 A;  4EB6 B;  5CB4 B;  1FKA H;  1S97 A;  1XL6 A;  4J41 A;  3U55 A;  3WG7 B;  1S03 G;  3E83 A;  4J10 A;  3RUP A;  3H4B A;  1HR0 O;  3T7A A;  5FL7 G;  4JYA H;  3CC2 V;  2ASL A;  3SPI A;  4DR5 H;  4HYK A;  1OCO B;  2EIM B;  3AG1 C;  3JCZ A;  3VNN A;  1MMM A;  4YY3 H;  5A2Q W;  4MV7 A;  3MWE A;  2UUA H;  1A3G A;  2AQ4 A;  2A9H A;  1YVW A;  3LUT B;  1P7B A;  1YIJ V;  5IJ0 B;  4X8A A;  3E22 B;  4ICG A;  4OGQ B;  1I7N A;  3K5L A;  3UYY A;  1HNX H;  2VOB A;  5CA0 F;  2XTA A;  1GK9 A;  1N36 O;  1B6R A;  1M9N A;  4DIM A;  1IBL B;  4RUC A;  5CB4 F;  5B1B B;  4PA3 A;  5T14 A;  4A2B A;  3LDD A;  5EOY A;  1WAZ A;  1J5E O;  3BG5 A;  2MK3 A;  4I4T B;  4JZG A;  1YDX A;  2IBZ H;  4YAK B;  1FJG O;  2EZP A;  1EKF A;  4JI7 O;  4BWS C;  4IHJ B;  2HGX A;  3MWM A;  4LF7 H;  1WA8 B;  2YIB A;  1QCE A;  4IYH A;  3E8B A;  1RJR A;  3AYH B;  4BY7 G;  3CCQ V;  3L4J A;  3B40 A;  5LP6 B;  2IM9 A;  4BWA A;  2EUL A;  5CMU A;  3RYI B;  1Q43 A;  3JAW B;  3NXS A;  2W6O A;  3V4Z A;  4QSH A;  2AGQ A;  1VBH A;  3E8F A;  4MV3 A;  3R5X A;  2Y0I A;  2ADQ B;  1AJN A;  3E22 A;  1WP8 A;  4LP8 A;  3MD0 A;  3E2E A;  4C5B A;  4O3Q A;  3B2E E;  3HB3 B;  4RQF A;  4YJ3 F;  3AK1 A;  1KEE A;  2NVY A;  2ZDI A;  3PN1 A;  2F4V B;  4X66 H;  4MW8 A;  1HNZ B;  5KLV H;  4M0J A;  1JQ0 A;  1D2D A;  4XDL A;  1ZSP A;  4X1I B;  4CBC A;  2R9I A;  1N33 B;  3RV4 A;  4AQY O;  2R6F A;  1PV0 A;  2V5A A;  4EKW A;  4AHC A;  4ED0 A;  4WFG A;  2R9R B;  4C7U A;  3JAT A;  4A3J G;  4B3R O;  2UXC O;  2Q0A A;  4ZIB A;  3GTG A;  2JJ2 G;  5EWF A;  3E5N A;  2W8L A;  1DGS A;  4LBE C;  3FAV B;  1KT8 A;  4MTO A;  2FLL A;  3RVZ A;  2ITC C;  4FLY A;  1AI4 A;  4J11 A;  3V6H A;  2DYR B;  3JCU Z;  5K3W A;  1RJQ A;  2FK1 A;  1WB7 A;  2W6N A;  3OMI B;  3UM7 A;  5K1X A;  4JI0 B;  4TUY B;  1VQ8 V;  1AB3 A;  3PW7 A;  4NLG A;  3RN4 A;  4CKE A;  1XNR H;  5JH7 A;  5EZY A;  5EZY F;  5JH7 F;  2Y4T A;  2UXB O;  3J80 W;  2KB1 A;  1KP2 A;  1YSC A;  1MOF A;  2YXH A;  4MA5 A;  5H6R A;  3DF7 A;  1QR9 A;  3TEK A;  2XCA A;  4IWX A;  2VPQ A;  1RPO A;  2Q68 A;  5GTH Z;  2VUG A;  3VPC A;  2CFM A;  2JA5 A;  4NVP A;  1KUT A;  4WCE V;  4ECQ A;  4JV0 A;  1XDC A;  4JI6 H;  5B1A B;  1F4N A;  2QA4 V;  4G3I A;  1RSO B;  3B8N A;  5KX5 A;  3RR5 A;  3OMN B;  1L0L H;  4JYY A;  3ORQ A;  5KG6 A;  3GIL A;  3OUZ A;  1Q6I A;  1TAE A;  5CA3 A;  1JDE A;  2N04 A;  3HKE A;  5KT2 A;  2NU6 B;  4A3K G;  4DUY H;  5LGU A;  4H44 B;  4PBC A;  1VQL V;  2XGQ A;  5EZY B;  5KHH A;  2XND G;  3KHG A;  2V7Q G;  2NNU A;  4TV8 B;  5B1B C;  2QSA A;  2PYJ A;  1M56 B;  3MWD A;  2CNQ A;  2W6Q A;  2XD4 A;  1I3Q A;  1L0N H;  5EIB D;  1K34 A;  2ASD A;  4GX2 A;  3S24 A;  3CCJ V;  4XYM B;  4O4H A;  3RV3 A;  4JV1 A;  4ECX A;  2OLS A;  4O4I A;  3T5L A;  3T9E A;  5C44 G;  2IU0 A;  1I7L A;  4KHP H;  2ZR3 A;  4B7E A;  4O2A B;  4ZKI A;  3QZ8 A;  3CC4 V;  3OGC C;  1W96 A;  4LFA O;  5JQW A;  1Q8I A;  2W6I G;  4PDV A;  5DGI A;  3RYH B;  4CHI A;  3G6B A;  2UVW A;  3KAL A;  4X64 O;  1M0W A;  3EHB B;  3ZBH A;  1B33 N;  3T9A A;  2X7R B;  3U54 A;  3GQC A;  2QJ1 A;  1PKX A;  5JJJ B;  2AW9 A;  5FD5 A;  5KFH A;  5BPH A;  4JI7 B;  3A2F A;  2GUZ B;  4HNV A;  2HFE C;  3UQ8 A;  2BTQ B;  2HEP A;  4ASU G;  4BBR G;  1HR0 H;  4O3R A;  5DN6 G;  2PBZ A;  3E86 A;  4Q0Y A;  3V4S A;  1UNN C;  4WD3 A;  1AVM A;  5KFQ A;  1HNZ H;  2P67 A;  2A06 H;  2OCH A;  1GN4 A;  4MAM A;  5LYJ F;  2JA7 G;  2W6P A;  5ITZ B;  5GON F;  2F93 B;  2VWJ A;  4QIW A;  1BGY H;  4WFA V;  1GO3 F;  3DTF A;  1CPY A;  4B3R B;  2UXC B;  4J7J A;  3W7T A;  3HKC B;  2COG A;  2RMK B;  2IW5 A;  1S0M A;  3QO5 A;  3K3V A;  3JAR A;  1G4Y B;  3CE2 A;  3G6Y A;  1XNQ H;  2Q73 A;  3AG4 B;  4PV1 B;  5E79 Z;  2DMX A;  5EIB C;  1K3E A;  2GUZ A;  4FK5 C;  3U11 A;  3KAJ A;  3T5H A;  2LGQ A;  5BWT A;  1SQX H;  3RF2 A;  1SZX A;  1GN6 A;  5I60 A;  2VQF H;  3S3X A;  3T9D A;  1FXK A;  4JI2 H;  3GJX B;  3OW2 U;  3ASO B;  1BHB A;  1EKP A;  2FLP A;  4QW8 A;  5IY5 B;  3JYC A;  2LO1 A;  2ATK C;  3W1G A;  4X65 H;  5L1J A;  1O9G A;  3LDE A;  2W7O A;  2VUM G;  2J6S A;  3K9A A;  2JS5 A;  4O83 A;  1HDJ A;  4PD4 F;  2L6L A;  4CKB A;  4JF3 A;  3IN5 A;  2ODT X;  1OHH G;  4HNA B;  1Q6H A;  2E5L H;  1OCR C;  4DAA A;  4FFB B;  4J42 A;  4WBN B;  1VS0 A;  2EJR A;  4X20 B;  3SYP A;  4F4W A;  1R6T A;  3HBL A;  4B08 A;  2DJV A;  2Z04 A;  2ZXW C;  4PJ0 Z;  1U97 A;  5BXZ A;  3ZRV A;  4MV9 A;  3GIP A;  2Q7E A;  1RM1 B;  5IJ0 A;  4GLW A;  3UZB A;  4DR4 H;  2QB5 A;  2UXN A;  1LUV A;  4E2L A;  2RDC A;  4TUY F;  2YRW A;  1XMQ O;  3MR5 A;  3CHX A;  1R6N A;  2ZCE A;  5EBL C;  4YAJ B;  2COI A;  2R92 G;  1MA1 A;  4FZ1 A;  4B3S H;  3EXA A;  1BQZ A;  1Z2N X;  3QO7 A;  5I5T A;  3K79 A;  2NN4 A;  5DM6 V;  1JA8 A;  4DL6 A;  2MW2 B;  4J9Y B;  2GQR A;  1YTF D;  2WLL A;  4UCR A;  2ETN A;  2UXD O;  1SYX B;  1JJO A;  3APO A;  2R8J A;  4LF5 H;  5EK0 A;  3T1Y H;  4LNU A;  3SPJ A;  1I94 H;  1BL8 A;  2V59 A;  1EUC B;  4K35 A;  1N0J A;  5F2V O;  4LFC O;  3PFF A;  4MTF A;  3FDS A;  4LF4 B;  4X66 B;  3K5H A;  3CJH B;  3ZMS A;  4GKK B;  1S76 D;  4R8U B;  2F4V H;  5IT9 W;  2M05 A;  4TUY A;  4PZ8 A;  1W0J G;  1K5S A;  2GV9 A;  4ZI7 A;  3WWJ A;  3RWR D;  2W9A A;  1SFO A;  4QE7 A;  4PZ6 A;  5L3G A;  3ABK B;  4U3J B;  4JI8 O;  5BWW A;  3ETG A;  3H20 A;  4QWA A;  5I47 A;  4JI0 H;  3H3V H;  4FS2 A;  3T1H O;  5BR8 H;  3GV7 B;  1HR0 B;  1H8H G;  2DAB A;  3LP8 A;  1M90 W;  4B3S B;  1O75 A;  2Y4R A;  4Q4C A;  3KHR A;  1M6V A;  3CRQ A;  3UFX B;  5IYC G;  2YDE A;  4I7Z B;  4NTY A;  2XAG A;  2HLD G;  1VQ5 V;  4I55 B;  5CE8 A;  1OCC B;  4DR2 B;  4JV5 O;  2UVR A;  5JQG A;  4D7T A;  5I5Y A;  4NXM H;  1SQF A;  1FFT B;  4IRD A;  3ZIA G;  4MSW C;  1N34 B;  4K0K H;  3AG2 B;  5CBG A;  2XAQ A;  2CKZ B;  3W7S A;  2R7Z A;  1PPJ H;  5L3C A;  2SCU B;  2ARH A;  5GW7 A;  3O9O A;  2ZE5 A;  2IU3 A;  3N44 B;  5FNV B;  4Q8E A;  2CTP A;  3CX5 F;  4K6N A;  5IT9 N;  4DV5 O;  3KAK A;  2UU9 H;  3D8C A;  1JFF A;  4LR3 A;  4GT1 A;  5LHI A;  5JVL A;  4QPK A;  5KFN A;  2LW7 A;  4DL4 A;  4J80 A;  5CN0 A;  2WTF A;  2QWQ B;  4NR1 A;  4U6P A;  4JGS A;  5H80 A;  2X6C A;  3N8D A;  1VF6 A;  1AP5 A;  3ZMZ A;  3ETD A;  2CH7 A;  1K83 A;  4Q8F A;  2UXX A;  4A3I G;  1GSH A;  4DR1 H;  4YJ3 A;  3MHS C;  1IBM H;  4O2B A;  2WA4 A;  3DTU B;  2X0L A;  1BT8 A;  3DAA A;  3RGX A;  4KHP B;  3HOU G;  1GM8 A;  4FM1 A;  4RZQ A;  3V6J A;  5IE9 A;  1HNX O;  2UUC H;  3KCX A;  5H9C A;  1YJ9 V;  5KFT A;  1YCI A;  5KX5 F;  1BJT A;  1KKC A;  2FK2 A;  4Q20 A;  1J5E H;  3ZHT A;  2RDJ A;  2CDY A;  3G4S V;  4ED3 A;  1XMO O;  2EJ7 A;  4QGP A;  2JEI A;  2PVP A;  4O4J B;  2DAA A;  4DV3 H;  1EN5 A;  3JAK B;  1N33 O;  1Q7Y W;  2HGW A;  2HHF B;  2LFS A;  5A2Q N;  1IZ3 A;  4DV1 O;  5DMX A;  5IJ9 B;  3K5M A;  3SJB C;  5TIS Z;  2BQU A;  2ITD C;  2Q6A A;  4A3G G;  1SQV H;  2AZ0 A;  4GX0 A;  1YHQ V;  4LFB B;  3G8C A;  5KAF Z;  2R70 A;  3O65 A;  4FM2 A;  3GTK A;  3UKM A;  3GTO A;  4WFE A;  1YZB A;  2JJ1 G;  4UV8 A;  2EBO A;  5CAE B;  4FLX A;  3ZHV A;  2PI5 A;  2GSM B;  4X1I A;  4C5C A;  4UVB A;  1VMG A;  1WJZ A;  4IGG A;  3H0G A;  3RVY A;  1NQT A;  4O3P A;  3CEB A;  1WNS A;  1QLN A;  4BIZ A;  1GN2 A;  2O57 A;  3G67 A;  5KG4 A;  3Q8S B;  1KTA A;  2RQ6 A;  1GGO A;  4X65 O;  2F95 B;  4LF6 B;  1SET A;  4G27 B;  3BVO A;  3OUS A;  5J9P C;  1FVI A;  3VBB A;  3X2Q B;  2Q69 A;  1P84 F;  2F66 C;  3OUF A;  2IH1 C;  1KJJ A;  2RGR A;  1X4T A;  1NJI W;  4XYL B;  1FFX B;  4X1K B;  4HR7 A;  3G6X A;  2E5L O;  3U0G A;  3T5J A;  4IIJ A;  3BFR A;  5CA1 F;  3NC0 B;  4DV0 H;  4X20 A;  2RF4 A;  4O2B B;  3HKZ A;  4O7Z A;  1UC9 A;  1TWH A;  5KFA A;  1A0G A;  3VQV A;  3ZHQ A;  4TV9 F;  4QIW F;  4FFO A;  2JEU A;  3NBZ B;  4RAZ A;  1SC5 B;  2DWD C;  1K73 W;  1YEW A;  4H13 B;  5LMU H;  3UT5 B;  4EYI B;  4ECW A;  4K8Z A;  4AYB A;  4DR3 H;  4CH6 A;  4MV1 A;  4PEL A;  4JI4 H;  4IR1 A;  1P8L A;  5BWX A;  3AK3 A;  4DRF A;  5CA0 A;  1E1R G;  2BR0 A;  5KFU A;  5FNV F;  3OMA B;  5IYB O;  2B5U A;  3ZN1 A;  3LSQ A;  2X6B A;  4I9Q A;  4IIJ B;  3K5O A;  2ADP A;  1TVK B;  3GIK A;  5LHG A;  4J9Z B;  3HOX G;  2HVS A;  4R8U A;  2IJI A;  2P06 A;  1GYF A;  1IVS A;  3HT5 A;  4I0X A;  1VQ4 V;  2HJD A;  2EIY A;  1Y1W G;  4WFF A;  5BZB A;  2QKC A;  1PL0 A;  1F51 A;  4DR6 B;  4ED7 A;  2QDO A;  5FJ8 G;  2DW4 A;  1H2N A;  2XAS A;  1KBL A;  5H5N A;  1RK5 A;  4NKG B;  2GDS A;  1OBD A;  5KMG A;  1OWT A;  4Q45 A;  2QE7 G;  1P16 A;  2GQS A;  4JI3 B;  2FML A;  1N36 B;  5HV6 A;  2NUA B;  1WCM G;  1ZL8 B;  5J2U F;  4LFC B;  2QM8 A;  2Q9L A;  4PI0 A;  1OBG A;  2JEG A;  2WLI A;  2CTQ A;  4EGJ A;  3OTO O;  2CUG A;  5BR8 O;  1GO3 E;  2EJ3 A;  4TQR A;  4O2A A;  2JEJ A;  1PNM A;  1IX9 A;  4IIJ F;  3RYF A;  1P7G A;  3G8D A;  4J9O A;  2YIB D;  2R93 A;  2AGA A;  2Y69 B;  1IXB A;  1RFY A;  1GMG A;  2LP7 A;  3T1H B;  2I80 A;  2YWV A;  4MV4 A;  1VQ7 V;  2R87 A;  2A79 B;  1BQ0 A;  4O7N A;  4YY3 O;  4IRC A;  4A5U B;  3CSX A;  1WR2 A;  2N05 A;  5BMV F;  3FB6 C;  4IRK A;  4FGR A;  5C3E G;  1P4R A;  4FLT A;  3RB4 A;  3IJ4 A;  1N4C A;  1OV9 A;  2WSS G;  1R9T A;  1L8D A;  2DPI A;  2FPI B;  3AG3 B;  1E1Q G;  4DV2 O;  1XUQ A;  5I5X A;  3CME V;  3RYC A;  3K0G A;  2PYL A;  1X9N A;  2A1H A;  2ZGI A;  2P22 C;  3N43 B;  1N36 H;  4A3C G;  3BA8 A;  1I7F A;  2BE3 A;  1IOW A;  3CCU V;  1WRV A;  3CPW U;  2WYO A;  5IP9 G;  5DQH A;  1WSC A;  3CYO A;  4QJF A;  2C2A A;  3K57 A;  1I1M A;  4FU0 A;  2MCT A;  4R7R A;  5DQG A;  3VQY A;  1WPX A;  1ZHS A;  5EWE A;  1DK1 A;  5JH7 B;  4CMD A;  4FM0 A;  3T99 A;  1S0V A;  3RJ0 A;  3U0Z A;  1E4E A;  1GM7 A;  2FYU H;  3SYO A;  3DTG A;  1CKN A;  2FE3 A;  1RSO A;  1FXK C;  2GLT A;  2VWK A;  1JXL A;  2FB9 A;  1QBZ A;  2UUC O;  4AIL C;  1XL4 A;  3HOW G;  2H8P C;  1XDN A;  1S5L Z;  1PX2 A;  3I5D A;  1BMF G;  5JVD B;  2JA6 G;  3N27 A;  1MZE A;  3FB7 C;  1QHT A;  1R3L C;  4Z1M G;  4JV2 A;  1F7Y A;  1M4U A;  1I6U A;  5KHG A;  4LMY A;  5HBR B;  1T3N A;  4CC6 A;  4X89 A;  2QTO A;  3M99 B;  3S3W A;  5D1P A;  1KKD A;  1L1F A;  4NTW A;  1Z2G A;  1XRE A;  5CBH A;  3RAQ A;  1HWY A;  5L3E A;  1SQB H;  2DQ0 A;  5L3D A;  2KG7 A;  3DC5 A;  3JAL B;  5F9L A;  2FL4 A;  1Y67 A;  3SYA A;  3M9M B;  1YXB A;  3L75 H;  1QVG U;  5L1I A;  4DV3 B;  1U96 A;  2HHH B;  2YS7 A;  1I1L A;  1XBL A;  2JK5 C;  2XHB A;  4DL3 A;  2YUA A;  3G6E V;  2JA8 G;  2XOK G;  1XHZ A;  1M1K W;  1KJ9 A;  5CA1 B;  4PA6 A;  3PW2 A;  5KHJ A;  2E2I A;  3F8N A;  3FFQ A;  2PUS A;  3ZRW B;  1H2S B;  1M93 A;  3MDS A;  4IL6 Z;  2AGO A;  3TW6 A;  3CD6 V;  4DUY B;  3FYI B;  5FLX N;  2FJZ A;  1JPX A;  3HKE B;  5BR8 B;  4O7L A;  4O7R A;  4MS2 A;  1L2Z A;  2V4D A;  3SPH A;  4NXN H;  4X65 B;  3EYY A;  4EEY A;  4DR7 O;  4IZO A;  2OCC C;  3J7A K;  2P90 A;  4YR2 A;  4IWY A;  2W71 A;  2AXT Z;  2UXD H;  3OD4 A;  5J2U A;  1KMI Z;  4RQE A;  5I5V A;  2CE4 A;  5KG2 A;  3PVX A;  2Z3Y A;  4DO2 A;  5C8Y F;  4JYA B;  1WP7 A;  4A3L G;  3IC9 A;  3GB8 B;  1XK5 A;  3ZMT A;  3CS5 A;  4LSX A;  2CNU A;  2F4V O;  1ZX3 A;  1CQI B;  5KFE A;  3AG2 C;  3KRE A;  4IT5 A;  2DQ3 A;  1Q82 W;  1V4Y A;  3ABM B;  2K9P A;  3H9V A;  4DV2 B;  2WB1 E;  4WFB V;  4LWS A;  1CE8 A;  3EPG A;  2AHZ A;  3FMA A;  3EFF K;  3TQ1 A;  2DLN A;  1UC8 A;  5K2M A;  3L9D A;  4FFN A;  3Q4H A;  2CTR A;  5BWR A;  3FX7 A;  5KX5 B;  1JX4 A;  4D6T H;  4I4T A;  4O3N A;  1ZTE A;  4OX9 O;  5I5S A;  1B6Q A;  4X1Y A;  3BHP A;  1SER A;  1RP3 B;  1WA8 A;  1EZJ A;  2Y0P A;  2E74 B;  5H2F Z;  1I1K A;  4PA4 A;  2EIJ C;  4DUZ H;  4RB1 A;  3RBD A;  4A3M G;  2YS6 A;  5J2T F;  3HKD A;  1PD3 A;  4FMT A;  4O82 A;  1A9X A;  1DAA A;  4RNN A;  1EHI A;  1FXK B;  3OEH G;  1I2K A;  2ATL A;  3NGD A;  4HNT A;  4DR6 O;  3UT5 A;  4YJ2 F;  3K08 A;  2BTO A;  5C5J A;  4CS3 A;  2JS3 A;  1GH6 A;  1SQG A;  3JAR B;  1K97 A;  1D5N A;  1K4C C;  4EBD A;  1TWC A;  3OM3 B;  1NT2 B;  4F4L A;  1Q86 W;  3CRA A;  5KHI A;  2NVX A;  4U7O A;  4J7Z A;  5KT3 A;  4DV5 H;  3ML0 A;  2IJJ A;  1DTO A;  3BA9 A;  1VAR A;  3ZX6 A;  4O4L F;  2J6T A;  1GM9 A;  1HNZ O;  4YHH O;  4QIW E;  4G2K A;  4DL2 A;  1RM1 C;  4O7Y A;  2HG5 C;  1Q81 W;  4P30 A;  2ZDI C;  4QE9 A;  2HIV A;  3CCM V;  2W9C B;  2JA6 A;  3D3Q A;  4RO2 A;  4W4L A;  2PGG A;  3E8G A;  3GWO A;  1R6K A;  3FAV A;  3I12 A;  4HNU A;  1VQO V;  1NBM G;  1S10 A;  4J7K A;  4OXS A;  1KEC A;  4APM A;  3LUL A;  2ZT9 B;  1XNQ O;  4RUF A;  1JR9 A;  4UVC A;  4JI5 H;  4FM9 A;  3I55 V;  4O86 A;  3CMA V;  5L3F A;  2ZM6 O;  4NYK A;  3T5K A;  1N8R W;  5KFM A;  1XMQ B;  4EBC A;  3X2Q C;  2UU9 B;  4LF6 O;  4DV3 O;  4BXX G;  2CK3 G;  2HHH O;  2VQD A;  3AG7 A;  3SJQ C;  3R9R A;  4BW9 A;  5KFG A;  5IY5 C;  3VQW A;  1E4E B;  2WLJ A;  5IYC O;  3H1L H;  3RYF B;  3JD1 A;  3K3P A;  4DV0 B;  1KQS U;  5CR5 A;  3A0R A;  4DV6 B;  1V55 B;  4IAJ A;  2OT5 A;  3CWB H;  5J2T A;  2WB1 A;  3LNN A;  4TV8 A;  3CJH A;  1I2L A;  2YXY A;  2YRX A;  5KA5 A;  1AJQ A;  3SPC A;  5JQG B;  1SF9 A;  3RGZ A;  3UCS C;  3QO8 A;  1E4G T;  3MR3 A;  3RB6 A;  4KL1 A;  3J81 W;  1A48 A;  1SRY A;  1CEZ A;  1I94 B;  4PI2 A;  4JI5 B;  5LL6 Y;  4EFE A;  2UUC B;  3JZF A;  4EFB A;  4O4J F;  2ZE7 A;  3H1J H;  1FFX A;  4BR6 A;  1ULZ A;  3WNZ A;  3F5T A;  3WWI A;  1XHX A;  2VS0 A;  3P3P A;  1QU7 A;  2YID A;  3W5O A;  4ECZ A;  4DQN A;  1M57 C;  4J0M A;  3N2K B;  5BPF A;  1C3O A;  1G1X B;  4LF7 B;  4U3J A;  2GPS A;  2Q5Z A;  4ZHQ B;  1FAF A;  1OCZ B;  1VQK V;  1Z5V A;  4YJ2 B;  1JIH A;  4LFB H;  4DV4 H;  4B3S O;  3CCL V;  1V54 B;  3RW0 A;  3CXH F;  1GTO A;  3QF7 A;  3ZMU A;  5KG3 A;  4ED8 A;  3TY5 A;  2HJW A;  3GV8 B;  3MR2 A;  1NVP D;  2RGV A;  2HIX A;  5CA0 B;  3CVZ A;  2HHF A;  2ZD9 A;  2KSW A;  1IDS A;  4QWD A;  4DL7 A;  5ITZ A;  5EYP A;  4PHZ A;  2RCV A;  1P49 A;  4CH4 A;  3WU2 Z;  4N23 A;  4GC6 A;  1MAB G;  3R66 A;  4EEQ A;  4JI4 O;  4I55 A;  4DR2 H;  4BIO A;  4NXM B;  4B3T B;  2P6J A;  5L1L A;  1YTF B;  4IYI A;  4K0K B;  1W0K G;  1N34 H;  1DV1 A;  2YI9 A;  4GUN A;  2P7T C;  2CW8 A;  4NXN O;  4EB6 A;  4RNM A;  2YZN A;  3RFC A;  4DR7 H;  2IH3 C;  3ABT A;  2X0S A;  2DN9 A;  3ABK C;  5DGH A;  4DUY O;  3W7X A;  1EUD B;  1S9F A;  4YHH B;  1EKV A;  3GWK C;  2W57 A;  1IOV A;  4ZI7 F;  3OFN G;  3ZHU A;  3K03 A;  1C30 A;  1VF5 B;  3BAC A;  4F50 A;  3CP1 A;  1H2M A;  1EN6 A;  1G6U A;  2YCH A;  4YY3 B;  1UFI A;  4FFR A;  3CCS V;  1IBM B;  3HKC A;  3NBY B;  2Q7G A;  4GZR B;  4E6N A;  1Z2P X;  1ORQ C;  5LOV A;  4QPJ A;  4MVS A;  4KHP O;  2NU9 B;  3IAY A;  2IJH A;  2R82 A;  4LFA H;  4EBE A;  3AG1 B;  4A3B G;  1EM1 A;  4RWU A;  4O81 A;  3L70 H;  3QG5 A;  2ODM A;  3PW0 A;  3GIM A;  4Q44 A;  3OTO H;  3L4K A;  3Q8Q B;  2W9C A;  3N2K A;  1EZV H;  3BAA A;  2BOB C;  2EIN C;  2YL2 A;  2OIE A;  1NVP B;  1KBH A;  4FJC C;  1ARO P;  2R7L A;  5JUM A;  3PR5 B;  2UXD B; 
#chains in the Genus database with same CATH homology
 4DV1 B;  1S03 G;  2F66 C;  3KYH C;  1CKM A;  2RGR A;  1X4T A;  1FFX B;  4X1K B;  2XIG A;  3ETQ A;  3JAK A;  5BMV B;  4GKJ B;  1N32 H;  4JYA H;  4UCU A;  4JI6 B;  4IIJ A;  4DR5 H;  4TV9 B;  3NC0 B;  4OX9 B;  4DV0 H;  4X20 A;  2WDT A;  5C8Y A;  3VNN A;  4YY3 H;  5A2Q W;  3JAS B;  4O2B B;  4MV7 A;  4DR6 H;  4LF9 B;  2UUA H;  3VQV A;  1ZAU A;  2F1M A;  2YI8 A;  4RAZ A;  2R9A A;  3NBZ B;  1HNW H;  5LMU H;  1YEW A;  3UT5 B;  4K8Z A;  5IJ0 B;  3E22 B;  4DR3 H;  3K5L A;  4CH6 A;  5LYJ A;  1HNX H;  4JI3 H;  2VOB A;  1M5I A;  4JI4 H;  4WBN A;  1P8L A;  4LFA B;  4DRF A;  5CA0 A;  1IBL B;  4A2B A;  2JVD A;  5LYJ B;  5EOY A;  3OTO B;  4I9Q A;  4IIJ B;  3K5O A;  4I4T B;  3RFR A;  2ZJT A;  1Z5W A;  5KMG B;  4RB3 C;  1TVK B;  4HNA A;  1GYF A;  2HVS A;  4GKJ H;  2E5L B;  4DV1 H;  3CB2 A;  4BWS C;  4IHJ B;  2ZNI A;  3MWM A;  4CS4 A;  4LF7 H;  2YIB A;  2R72 A;  1O9H A;  4OX9 H;  4X1Y B;  1N32 B;  3W1B A;  4DR6 B;  3L4J A;  5LP6 B;  2IM9 A;  4BWA A;  2UUB B;  3RYI B;  4FFB A;  1Q43 A;  3JAW B;  4F6R A;  4FLZ A;  5LL6 b;  3N6X A;  4ZOL B;  5KMG A;  3HKB B;  4D7S A;  1P16 A;  4DR3 B;  3E22 A;  4JI3 B;  2OWO A;  1IBK B;  1N36 B;  3B2E E;  4LFC B;  4X62 H;  4PI0 A;  3PN1 A;  2F4V B;  4X66 H;  3L2P A;  1HNZ B;  4NXN B;  4O2A A;  4X1I B;  1N33 B;  2ZM6 B;  3RYF A;  5IWA B;  1XMQ H;  1Z2O X;  4AHC A;  4F6R B;  3JAW A;  3QTC A;  3ZED A;  2YIB D;  5C8Y B;  1AN7 A;  3JAT A;  2Q0A A;  4ZIB A;  3T1H B;  4YHH H;  2VPS A;  4JV5 H;  2UUB H;  1DGS A;  5LP6 C;  3CSX A;  4HBN A;  4ZOL A;  5KHK A;  4FLT A;  4O4J A;  5DIS C;  4FLY A;  1L8D A;  4JI2 B;  1IBK H;  4NXM H;  5GON A;  4LF8 H;  4CS2 A;  2PTM A;  3RYC A;  2PYL A;  1X9N A;  2P22 C;  3N43 B;  1N36 H;  5K1X A;  3BA8 A;  1I7F A;  4Q6G A;  4TUY B;  5FPR A;  4JI0 B;  3N2G B;  5JH7 A;  5EZY A;  1XNR H;  5D5P A;  2WYO A;  1B04 A;  3J80 W;  3K57 A;  4R7R A;  2MCT A;  3VQY A;  2ZM6 H;  4UCO A;  1ZHS A;  1D5A A;  5LA6 A;  5JH7 B;  3DF7 A;  1CKO A;  4LF6 H;  4FM0 A;  4O4I B;  3RJ0 A;  2HHH H;  3U0Z A;  3QWU A;  2VUG A;  3SGI A;  3VQX A;  2HVR A;  2CFM A;  1CKN A;  4NVP A;  2FE3 A;  1RSO A;  4I50 B;  2VWK A;  4DR5 B;  4JI6 H;  4AIL C;  1XDN A;  3HXL A;  5JVD B;  4I50 A;  5KX5 A;  3RR5 A;  1QHT A;  2UUA B;  1I6U A;  1M4U A;  3JSN A;  4DRX B;  5KHG A;  4LMY A;  1HNW B;  5GON B;  1TAE A;  4CC6 A;  1XMO H;  3HKE A;  5EYP B;  3OTF A;  1HNX B;  5D1P A;  4DUY H;  3RYH A;  4JI4 B;  1CKN B;  2BTQ A;  5EZY B;  5KHH A;  4DV4 B;  4TV8 B;  2PYJ A;  3GDE A;  5EIB D;  3JAL B;  3S24 A;  4O4H A;  4DV3 B;  4DR1 B;  2HHH B;  2VQE B;  5JJE B;  1S68 A;  4O4I A;  2XHB A;  5FD6 A;  4KHP H;  4CC5 A;  4DRX A;  4B3R H;  2UXC H;  4O2A B;  1XHZ A;  2HVQ A;  4PZ7 A;  5CA1 B;  1Q8I A;  5D1O B;  5KHJ A;  5LOV B;  5JVD A;  3F8N A;  3FFQ A;  3RYH B;  2PUS A;  1H2S B;  4RB0 A;  2QM4 A;  3BPZ A;  1M93 A;  3KAL A;  1M0W A;  4DV7 H;  3JAL A;  2Q2T A;  1TGO A;  4IHJ A;  2Q7H A;  4DUY B;  2QJ1 A;  1Q3E A;  1WN7 A;  5JJJ B;  3MAQ A;  5FD5 A;  1KU9 A;  4JI7 B;  3A2F A;  3UQ8 A;  3HKE B;  4ETS A;  2BTQ B;  5CB4 A;  2HEP A;  5LA6 B;  5BR8 B;  1HR0 H;  4Q0Y A;  1HNZ H;  1L2Z A;  2V4D A;  4LNU B;  4M7E A;  4NXN H;  2EX3 A;  4X65 B;  3EYY A;  4UCV A;  5ITZ B;  3J7A K;  2F93 B;  1N33 H;  2VQE H;  2YXL A;  5D1O A;  2VWJ A;  2UXD H;  5IWA H;  5J2U A;  1KMI Z;  1S5J A;  4B3R B;  2UXC B;  3TY8 A;  4O4L A;  1Q5O A;  4JYA B;  3GB8 B;  3HKC B;  1XK5 A;  3M4I A;  3K3V A;  3JAR A;  4LSX A;  1XNQ H;  5EIB C;  3U11 A;  3KAJ A;  4DV7 B;  3N41 B;  4DV2 B;  3RF2 A;  1QQC A;  4FVM A;  5FPO A;  2VQF H;  3IG0 A;  4JI2 H;  3GJX B;  3SJA C;  3FMA A;  4JI8 H;  1E4F T;  4LF8 B;  4YJ3 B;  2ZIN A;  3C0F B;  1XQ8 A;  4DR4 B;  2OYQ A;  4A2A A;  5KX5 B;  2UXB B;  4JI7 H;  2Q2U A;  4I4T A;  1IBL H;  1XNR B;  3W1G A;  4X65 H;  1O9G A;  1WPB A;  3RTX A;  4X1Y A;  3BHP A;  2JS5 A;  3ICX A;  4DUZ H;  4RB1 A;  3RGB A;  4HNA B;  2E5L H;  2E3C A;  3HKD A;  4MTD A;  4FFB B;  4WBN B;  1VS0 A;  4X20 B;  4TV9 A;  2WE6 A;  4B08 A;  2KKW A;  3UT5 A;  4B3T H;  2BTO A;  5LP6 A;  1XNQ B;  4CS3 A;  1HW7 A;  1SQG A;  3JAR B;  4UCS A;  4MV9 A;  1TVK A;  2Q7E A;  2CAZ C;  4RB2 C;  5IJ0 A;  1NT2 B;  4DR4 H;  5KHI A;  1FJG B;  1T5E A;  4JI8 B;  4DV5 H;  3N42 B;  3CHX A;  4I7H A;  3BA9 A;  3K59 A;  2ZCE A;  4DV6 H;  4AQY H;  1TUB A;  4B3S H;  2ZNJ A;  1Z2N X;  3JSL A;  4L8J A;  5IYZ B;  4DUZ B;  2HIV A;  1TA8 A;  1SYX B;  4UCR A;  5LMN B;  1JJO A;  4TQF A;  3M7M X;  4LF5 H;  2PGG A;  1ZHQ A;  3RYI A;  3T1Y H;  5J2T B;  4CH3 A;  4LNU A;  4GYC B;  1I94 H;  3RIZ A;  4ZI7 B;  5LXT B;  4JV5 B;  4APM A;  4TOI A;  4LF4 B;  4X66 B;  1SEI A;  4GKK B;  3N2G A;  3KXY T;  4FM9 A;  1WH2 A;  4JI5 H;  2F4V H;  5IT9 W;  4TUY A;  4X64 B;  4PZ8 A;  2GV9 A;  5JCO C;  4ZI7 A;  3THO A;  4DK0 A;  3RWR D;  4AQY B;  1MZB A;  4PZ6 A;  1XMQ B;  4RAY A;  4U3J B;  2UU9 B;  4YJ2 A;  3H20 A;  4BW9 A;  4GLX A;  4DV5 B;  3VQW A;  3RYC B;  4JI0 H;  3RYF B;  4FLV A;  4UFZ A;  2O03 A;  3WB1 A;  5BR8 H;  4DV0 B;  1HR0 B;  4DV6 B;  4IAJ A;  4MTE A;  2JGU A;  2ZIM A;  5J2T A;  4B3S B;  1O75 A;  4LH6 A;  5FNV A;  4DK1 A;  3LNN A;  4TV8 A;  5LMN H;  4K8X A;  4LH7 A;  4JI1 H;  5JJN B;  5JQG B;  5LMU B;  5IYZ A;  3T1Y B;  1A0I A;  3RGZ A;  4LF5 B;  1E4G T;  4I55 B;  2PY5 A;  4KL1 A;  3J81 W;  4TQD A;  4DR2 B;  5JQG A;  1I94 B;  4D7T A;  2PZS A;  4PI2 A;  4JI5 B;  3K5N A;  1SQF A;  4CH5 A;  4UCT A;  3SJC C;  4EFE A;  4EFB A;  2UUC B;  5D5Q A;  3BRC A;  1N34 B;  4K0K H;  4LF4 H;  1FFX A;  2YIA A;  4GKK H;  5LXT A;  4FLW A;  1XHX A;  5CA1 A;  4DR7 B;  3DSQ A;  4DV2 H;  3N44 B;  3W5O A;  5FNV B;  2VQF B;  5IJ9 A;  3JAT B;  2P5O A;  4J0M A;  1VF7 A;  3N2K B;  1TUB B;  5JCO A;  1XMO B;  3KAK A;  2UU9 H;  4LF7 B;  1JFF A;  4U3J A;  4LR3 A;  4ZHQ B;  2UXB H;  1Z5V A;  4YJ2 B;  4LFB H;  4DV4 H;  3ZS8 C;  1BGW A;  3QF7 A;  3K58 A;  3TY5 A;  2HGS A;  4JI1 B;  2RGV A;  1M0T A;  2HIX A;  5CA0 B;  3CVZ A;  2KSW A;  4DR1 H;  4YJ3 A;  5ITZ A;  1IBM H;  5EYP A;  4B3M H;  3JAS A;  4O2B A;  1XI1 A;  4PHZ A;  3SR2 C;  3RGX A;  4KHP B;  4FM1 A;  5FLX W;  1P49 A;  4CH4 A;  4RZQ A;  2UUC H;  4X62 B;  4LFC H;  3WB0 A;  4EEQ A;  4I55 A;  4DR2 H;  4NXM B;  4PDB A;  3WB2 A;  4ZHQ A;  4B3T B;  1JFF B;  1BJT A;  4K0K B;  1N34 H;  1SKV A;  2YI9 A;  1J5E H;  2CW8 A;  4O4L B;  2CW7 A;  3LML A;  4EB6 A;  4DR7 H;  4O4J B;  4EQ5 A;  4DV3 H;  3JAK B;  5BMV A;  5J2U B;  1FJG H;  1V9P A;  5IJ9 B;  4FLU A;  1SA0 B;  5K1P A;  3K5M A;  3TY9 A;  4YHH B;  3T1H H;  3SJB C;  2RJZ A;  2W57 A;  3JAM W;  3U10 A;  4LFB B;  2R70 A;  4FM2 A;  4LF9 H;  1G6U A;  2YCH A;  4YY3 B;  4O4H B;  2ZIO A;  1IBM B;  3HKC A;  4B3M B;  3NBY B;  2Q7G A;  3BAB A;  4FLX A;  4E6N A;  1Z2P X;  5LOV A;  4X1I A;  3IAY A;  3N40 P;  4X1K A;  4LFA H;  3HKB A;  1WNS A;  3HKD B;  3QG5 A;  1SA0 A;  1JMK C;  2RQ6 A;  3OTO H;  3L4K A;  4X64 H;  3N2K A;  3BAA A;  4LSA A;  2F95 B;  4LF6 B;  1J5E B;  4EB6 B;  5CB4 B;  1FKA H;  1FVI A;  2UXD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...