4UFZA

Synthesis of novel nad dependant dna ligase inhibitors via negishi cross-coupling: development of sar and resistance studies
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Negishi Cross-Coupling Enabled Synthesis of Novel Nad(+)-Dependent DNA Ligase Inhibitors and Sar Development.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ufzA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ufzA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ufzA02
4EEQA 3BA9A 3BAAA 1XMOB 3GB8B 4LF4B 1CKNA 3L2PA 1VS0A 4LFCB 3GDEA 5D1PA 4X62B 2OWOA 3OTOB 2HVQA 1HNWB 2Q2TA 4UCSA 4LH6A 4DV2B 4JI7B 4GKKB 4UCVA 3SGIA 5D1OA 3T1HB 1P16A 3TY8A 1CKOA 4JI5B 3BA8A 4E6NA 3KYHC 4JI3B 2UXCB 2HVSA 4DR4B 4DV3B 3UQ8A 3PN1A 1HNXB 3QWUA 1XNQB 4PZ6A 1XK5A 3NBZB 1IBLB 2VUGA 1ZAUA 4JI2B 4LF5B 4B3SB 4JI0B 3W1BA 4JI4B 3W5OA 4PZ8A 2HIVA 1S68A 1CKNB 1XMQB 2Q2UA 4DR3B 1I94B 4LF8B 4DV4B 4LFAB 1TAEA 2UUAB 4EFEA 2HHHB 4K0KB 1IBMB 2UXBB 4X66B 1X9NA 1N34B 1N36B 2CFMA 4UCUA 4OX9B 3W1GA 4LF6B 3JSNA 2E5LB 1A0IA 4PZ7A 5DISC 5D1OB 3NBYB 1P8LA 1B04A 4JI1B 1J5EB 4DRFA 4AQYB 5LMNB 4KHPB 4CC6A 3VNNA 4DR6B 4DUYB 2HIXA 2UU9B 4B3TB 3JSLA 4DR2B 4JYAB 5FPOA 4DV7B 3RTXA 2HVRA 4UCRA 4DR1B 4GKJB 1FVIA 4DR7B 3TY5A 1HR0B 4EFBA 3T1YB 1N32B 4CC5A 4DV5B 1V9PA 4YHHB 1HNZB 4JV5B 3GJXB 4EQ5A 4JI6B 4NXMB 1XDNA 4DUZB 4DV0B 2UUCB 1DGSA 1FJGB 3RR5A 4LFBB 1TA8A 4GLXA 4B3MB 4YY3B 3BABA 4X65B 3NC0B 4UCOA 4UCTA 3S24A 5LMUB 4LH7A 4DV1B 4LF9B 3TY9A 2VQEB 4TOIA 2F4VB 2VQFB 4UFZA 4JI8B 4NXNB 2ZM6B 5FPRA 4B3RB 2UXDB 5IWAB 4DR5B 4LF7B 5BR8B 1IBKB 1N33B 1CKMA 2UUBB 4DV6B 4X64B 1XNRB
chains in the Genus database with same CATH superfamily
1M0WA 2X5RA 1K9MW 1S0VA 3N40P 5LMNO 1JJOA 1U96A 1QR9A 2F4VH 4JI8H 3JD1A 1H2KA 5KFHA 1Q5OA 4KUMA 4CMDA 1ZL8A 1UC9A 2QWPB 1VAJA 4DR3O 4EBDA 2Z5UA 2P4KA 4O2BA 4UCSA 1HR0O 1IBKH 5BWXA 2F43G 2HJFC 3TGUH 4TWKA 4O3PA 1WB7A 3KYHC 1XMOH 4LCUC 4E2LA 4DV3B 3CVZA 3SPIA 5L1KA 1IBLB 1US6A 2DYRC 3DXRA 1ZAUA 4RAIA 4XDJA 2JGUA 4K0KH 1QNMA 2BCCH 1R73A 1TVKB 2PTMA 2JEIA 3CWBH 4O4JF 3RBEA 5EC2C 5FJ8G 4BXXG 2DE0X 3D36A 3D3IA 4LF8B 3OHAA 4MSWC 1TUBB 3OMAB 1TAEA 2PBZA 3I4NG 3JALB 5T14A 1X9NA 1DK1A 5BWWA 1C30A 1QLNA 4MT8A 4CBCA 4NZMA 3WNZA 4JPRA 5LOVB 4JV5O 3UT5A 4YJ2A 4DUZO 5CMUA 4PDLA 2LJ2A 3AEIA 3JARA 2EILC 2X6BA 4BBSG 3A2FA 3RYFB 1KJ8A 4GUNA 3I12A 4DUYB 2R7MA 4WFAV 1IBMH 3E8HA 1JCHA 1P84F 5K3WA 3IAYA 4ZOLF 3OTOO 2DPIA 1KB9F 1WLEA 2C00A 1IYDA 4O4JB 3AW8A 4PDMA 3ZRWB 4XDLA 2CZGA 4N23A 3BG5A 3NUAA 5KFTA 4JI5O 1XHZA 3UCSC 2YZLA 2R84A 4KFMA 4JYYA 4HNUA 2WB1E 5KFCA 2UVWA 1XDNA 3MWEA 3BHPA 4RQEA 3K3PA 3K3VA 3JATA 3CC4V 5JVDB 2YI8A 2NN4A 4ETSA 2XT9A 3RAQA 4X65B 4I50A 1SCUB 2A3QA 2FK1A 1BGWA 3AG2C 2E2IA 4J7KA 5CA0A 1UFIA 2AHZA 2FKXA 4D6TH 4IRCA 2EJ0A 1Y74B 3RVYA 1YITV 1VQ4V 2BTQA 1SQQH 4YQWA 2R9RB 5KT2A 3V4ZA 2RF4A 4ECUA 3OGCC 3TK1A 4RZQA 4U3JB 3JRWA 1DV1A 4F4YA 1VIBA 4TQRA 3BCCH 3APOA 4YY3H 3K9AA 1XHXA 4QW8A 1GSAA 5TISZ 2YW2A 5EWFA 4H0LB 1BS3A 1VQMV 2J6TA 1E1QG 3JRXA 3J81N 3GDEA 3APQA 4UV8A 1QLEC 3T1HH 5HNEA 2YZMA 4M0JA 5IJ0A 1L0LH 4FK5C 1S5HC 4P9OA 4TV9A 4DV2B 1WR2A 2BSKA 2F1MA 2UVVA 1WSCA 4U6PA 4IYHA 2NU9B 2RMKB 4FFBB 2W71A 5J2TB 5JVDA 2HR3A 1QHTA 1SETA 2QKSA 4MV7A 1R3JC 1AR1B 2V4DA 2Q6AA 2IM9A 3CCRV 1IYEA 4LSAA 2ZCEA 2YWVA 1XEQA 2YUAA 4AYBA 4IRKA 2CNVA 3WFVA 1RM1C 4B3MO 5KG4A 3IC7A 4TUYF 4GKKH 2ZNIA 1DAAA 5LMUO 3RBZA 2PUSA 1QVFU 2JA6A 4PA7A 5LGNA 2ZE7A 3JASA 4NXNO 3Q8SB 4ECVA 4J9SA 2ZR2A 1W2BU 5BXZA 4R6ZA 2J6UA 1IZ3A 3W1GA 5KLVH 4HNTA 4DO2A 2QK4A 5CA1F 3LUTB 1ZETA 4JI4H 4JI1B 1UPGA 5DQGA 4Z1MG 3ZS8C 4DRFA 2XCAA 4JAUA 4MVZA 1S3JA 4PDVA 5CR5A 3DTGA 4KHPB 2DN9A 2Q7GA 2W6JG 4FS1A 3CCJV 4TQSA 2ARHA 4ABMA 2A0LA 1OWTA 5LA6F 3CMEV 5H80A 4DR2B 2X6CA 2V7QG 4JYAB 1PD3A 4OX9H 4IAJA 2Q7DA 4DR1B 1FVIA 1P4RA 4RB0A 5J2TA 4TUYB 1I7NA 2EIMC 1VQ5V 1F4MA 4ZBMA 4XX0B 2C2DA 4JI6B 2ASJA 2HVJC 3CC2V 2ADQB 5KFIA 5CA1B 2E75B 5LBQA 5B5EZ 3GTOA 5EWEA 4ZI7B 1CS0A 1TWCA 3GIJA 3SI8A 3ZMUA 3T1YH 4LF9B 1VF6C 1I94O 1NR7A 1AUXA 2W9BA 3I55V 5KS8A 5KFBA 5LA6B 4LP8A 3CRMA 4YJ3F 5DMXA 2E2HA 2YRXA 2CGNA 3AG1B 4NTXA 5DN6G 3GIPA 3CCQV 4DV3O 3GTJA 3BA9A 3ZIAG 2QF7A 1SESA 3ABMC 4DR6O 1H2MA 1VQ8V 5KFWA 4X89A 2ZNJA 2B1GA 1OCRB 3E89A 3TINA 2FP4B 5I5TA 4H44B 5L9XA 4FE2A 4LF8O 1HNWB 4DR7O 2B5UA 3E83A 4JI7B 2YIBD 3T4ZA 1AP6A 3OAAG 1S76D 4X64H 5KX5F 4MVMA 2KSDA 1EKVA 3G6XA 4MV3A 3ETEA 3P3PA 5LL6Y 4BIZA 4YHHO 1EKFA 2V4QA 3B8MA 4YJ3B 1M56B 3MR2A 2GPWA 1GN6A 3AK3A 4CH3A 2W9CB 3RYCA 4JI2B 4X62H 1EM1A 3K5OA 4JI0B 4R8UB 2MK3A 1YI2V 3FAVB 3W5OA 4WBNF 1YZBA 3SYCA 2EX3A 4R7CA 1EN6A 1I50A 1B06A 3CRQA 4J41A 3ZHQA 1WCMA 2NVYA 5C8YB 1RSOB 2W57A 2CFMA 2ZT9B 1XBLA 3AK1A 3HOUG 2RCVA 3CCVV 3GTGA 1K5SA 3R5FA 1H8EG 1EN4A 3G80A 4YBZB 1IOVA 5KFZA 3RYIA 5CB4A 4LR3A 4LFAH 3H1KH 2JA6G 1BNCA 3T5LA 1NH2D 1QQCA 2CK3G 2FK2A 3RVZA 5B1AC 2JRIA 1AJNA 4JV1A 1FFXA 4WBNB 3GV8B 3RYHB 4JZGA 4Z2WA 1R1BA 2QKAA 5EIBC 4IHJB 4A5UB 3LWBA 2IH3C 1K5QA 2R82A 2R85A 4J9LA 4GC7A 3FX7A 5LGUA 2Q67A 2UUCB 2UU9H 4GX2A 4IIJA 3CQZA 3EXAA 3PW4A 4HN2A 2YCHA 2R7LA 2EINC 3T9CA 3OUSA 3L71H 1Y76B 2WLLA 3EFFK 4FFKA 1Q86W 1WP7A 2M6YA 4UFZA 1NR1A 2UUAO 3GTPA 5A2QW 2YSUB 2B9ZA 3TQTA 1N34O 1VQLV 2QGNA 5BPHA 1PL4A 4KL1A 4DK1A 5E25A 4IGGA 3A0BZ 3AG4C 2R72A 5B1BB 1IURA 2Y69B 1AJPA 1JQ0A 2YL2A 4DV6B 2COJA 1XNRB 1OCOB 3QO7A 4A2AA 3VOTA 3CHXA 3VQWA 1F4NA 3WWIA 1DF5A 2VQEH 1KKDA 2VQFH 1ZTEA 1D5AA 2OH2A 4LFCB 1Y6XA 1JDEA 4B3RH 4RUCA 3DC6A 4NTWA 2HKOA 1GGOA 3Q8RB 4IHJA 5IWAH 4O4LF 5BR8H 4UCVA 1E4FT 1YJNV 5K1XA 4H37A 5BWTA 4MTOA 1XQ8A 5B3SC 5HFMA 1VF6A 4AI8A 4DR4B 1I6UA 4LF4H 1HNXB 1W96A 2YZNA 2DZDA 4X1YB 2R7NA 3P30A 2ODTX 2CW8A 4LF5B 4I55A 1J95A 3ASOC 1OBGA 1AILA 2EZOA 1WP8A 4FFNA 1XL4A 4QIWA 3X2QB 2J6SA 3T9AA 3MWMA 4JYAO 3ETHA 3IFXA 2F4VO 4UVBA 1K8AW 4WF9V 4JI8O 1SC5B 4DV4B 4RNOA 4X1KB 4JI3H 2CUGA 5IP9G 3OE7G 2UXBB 4G3IA 5GW7A 4I4TF 4X66B 3R9RA 2XCLA 4PA9A 2QTOA 1JPXA 2OYQA 4O4LB 1DV2A 4Q4DA 3MHSC 1IBKO 1Z2NX 1BQZA 1SFOA 4JAAA 3NBYB 2Q9LA 3G4SV 1V55B 4JI6O 2AU0A 1R6NA 1BL8A 2DLNA 2QTSA 4RNNA 4F4LA 5CBGA 1XMOO 5JJNB 1XMQH 5LMNB 3K59A 3VBBA 2F93B 2R8GA 4MVUA 3JSLA 5D5PA 5BWRA 1WCMG 3OUUA 2VUMA 3LNNA 1EZ1A 2GPSA 1N36H 2IBZH 3N2GA 4ZKIA 1B6SA 2RDJA 3TY5A 2JEXA 1HR0B 3A8TA 4EFBA 3H01A 4CC5A 5A9GA 3RN4A 4AQYH 2AHYA 5B1NA 3R5XA 4FLUA 5J2UF 2BQUA 3B2EE 3CE2A 1GH6A 1M5IA 2QWNB 1H2LA 2DPJA 4RAYA 5KFKA 5CN0A 2JS3A 3OEHG 4ECYA 2VA3A 3EVKA 3T7AA 3QG5A 4MTEA 2K1EA 5LYJB 4X1KA 4O7LA 2ZIMA 2JEGA 4X1IB 4O2AF 5EYPB 2N74A 2P4VA 5H6QA 3F8NA 4FLZA 1CQIB 1IBMO 2W6OA 1NBMG 3LNMB 3U0ZA 4W4KA 3GVMA 3T9BA 5C1OA 3BVOA 3EPGA 1K7DA 2WE6A 1FXHA 5I60A 1GLVA 4TM5A 4JUZA 3SYOA 2R86A 2A06H 1QU7A 4DV1H 5B1OA 5J2UB 3L2PA 1VS0A 4YR3A 1NS1A 2FTKA 2EIYA 4JZ2A 3IC9A 3OR6C 4DL3A 4I0XB 3EYYA 2BE3A 1F23A 4DR5H 3OTOB 2QWOB 3KKYA 3IJ4A 1ZHSA 4LBEC 2UUBH 3K58A 3TY8A 1OV9A 2YDEA 4JI5B 4ZHQF 1N0JA 2JJ2G 4O4HA 2WA4A 1T94A 2HVSA 4BY1G 3R66A 3PZPA 4PZ6A 2HEPA 2OT5A 5DG8A 3D36C 2PVPA 3K06A 1X59A 1WJZA 4YY3O 1EBOA 4A3CG 5FLMG 3ML0A 1UC8A 3F5WC 2KSWA 3JAMN 5DLGA 4RUEA 4PHZA 2W6NA 3A0HZ 4EGJA 4O3QA 2FPPB 2CKZB 1RPOA 3KCYA 2WLIB 3CC7V 5IP7G 4AHCA 5CA3A 1F7YA 4DL4A 3FKSG 2K9PA 2Q4PA 1N8RW 3QF7A 3V6KA 3PFFA 3L4KA 3B40A 4I7ZB 1VQKV 1ROPA 2D3OW 4LWSA 5IYDO 2HVRA 4PDRA 5JH7F 2VS0A 5L3EA 4GKKO 4TV8A 3IN5A 3CRAA 2P67A 2ILMA 2ADPA 1K34A 5JVLA 4HYOA 3C3SA 4QSHA 3DC5A 2JK5C 4JTCB 3FYIB 3QZ7A 3EPIA 3BQ1A 2HJWA 4KP4A 2VUMG 3H3VH 4JI4O 4B3MB 2LFSA 2AW9A 1MZEA 4J9KA 4UCOA 5EBWC 3W7SA 3HKZE 5LMUB 1KTAA 1RJPA 4PJ0Z 2HJDA 4NXNB 1VBGA 2HHHO 1SQPH 3GIQA 2WDTA 4RUAA 5FPRA 2QM8A 1ZWIC 2DWDC 4YIPA 2ZGIA 4NXMH 4PV1B 5JQWA 4OX9O 1I3QA 5LP6F 3GIIA 3E5NA 1S0NA 5KHHA 2YICA 3TIIA 3Q2OA 3G6EV 1WRVA 3ZHSA 5HFLA 1VQPV 3J80N 4UVAA 3BAAA 2HHFB 2WLNA 4FMTA 4BAYA 1VF7A 4LNUA 3ORRA 4QWEA 4GT1A 5HV6A 4RB3C 2PMZE 3ZHRA 5FL7G 4LF7H 2HVQA 4JF3A 1BQ0A 4HBNA 1FKAH 4DV4O 3BFRA 3SGIA 1KJJA 1CKOA 1K33A 4YJ2F 5ITZA 4FGRA 1PNLA 2NUAB 3ETQA 1CE8A 4A3KG 1NH2B 2YXHA 5JQGF 3UQ8A 2PYJA 2ODMA 3CXHF 5JCOA 2EJ3A 4ECSA 4IWYA 2WWWA 1BGYH 1S72V 4QWDA 2HP8A 2PGGA 3SYQA 4ED7A 4O4IA 4O84A 1VKZA 2J9GA 3U9TA 1Z2GA 1I94B 2WB1A 3RF2A 1BT8A 3ABTA 4MVRA 2JIZG 2IJHA 3FFQA 2P90A 4PZ7A 4RO2A 4HNAB 5IYBO 3SE7A 4ECTA 3JD4A 4JTDB 2AGPA 2EJ2A 5FD5A 1FFTB 2ABJA 2WPDG 2IH1C 3K0GA 1GYFA 4J9RA 1VEWA 2V4RA 5BMVB 1WNSA 3ABKB 1GN3A 4DR6B 5JQGB 5DG9A 4DR1H 1Z5VA 1NVPB 4X62O 4EB6B 2GUZA 1JX9A 5D8DA 4TSFG 2P6JA 4DL5A 5EZYA 3TQ1A 4DR7B 5H6RA 3L9DA 2JVDA 1XDCA 5LXTF 4JGSA 4DL2A 4YHHB 1H8HG 1Q6UA 3ZEDA 3FB7C 2OIGA 1S77D 1M4UA 3RB4A 1ORQC 1PM9A 3RFRA 1KBHA 4GKJH 5BWVA 4BW5A 4TV9F 3AK2A 4G27B 3TY9A 3C0FB 1KU9A 3ASNB 4LFAO 3SJCC 3QTCA 4L1KA 1HNZH 1L0NH 5L3DA 4U7NA 1K83A 1YEWA 1V51A 4DV0H 2Y0SE 3KZIZ 4X9QA 3BEHA 5C1PA 4BY7G 3PO2G 5BMVA 4XBFA 1Q3EA 1CKMA 3UZBA 4I9QA 3CCMV 4JV0A 1SQBH 1TVKA 4J9OA 3H20A 3IG0A 4EGQA 4ECRA 5KG7A 5FNVF 1CEZA 2UU9O 1ULZA 2Y4TA 2V5AA 3K5IA 1E4EB 1TUBA 1SQVH 3ZMVA 2BOBC 3JALA 3H1IH 3GIKA 2OWOA 3CRCA 4M9UA 5GONF 2ZXWB 2Q7HA 2RGRA 1JMKC 2Y48A 1Y67A 5LOVA 1GAXA 4PI0A 1TWHA 4U7OA 4ZOLB 1Y4MA 4QPKA 1IX9A 1Y66A 4NTYA 5L3BA 1EZJA 4FVMA 4CZZA 4O86A 3RYFA 2O03A 3OT7A 3FKIA 3KALA 5KAIZ 1WH2A 3ZX6A 3W1BA 1XOUA 2W8LA 5IY5B 3QVNA 1BZKA 2FLNA 2PN1A 5I5XA 1PNMA 4O4JA 2VQEO 3ZRWA 2VWJA 2VQFO 4MW8A 5FNVB 2UUAB 1GM8A 2XNDG 3HKDB 5DGAA 2M05A 1TGOA 4B3RO 2R92A 1OCRC 1HWYA 1N34B 1JLLB 1Z2PX 3QFFA 2UXDO 4C5AA 5IWAO 1I08A 1K73W 1I2KA 5GONB 1VQ9V 3LQSA 3E8FA 4BWAA 4B3SH 1P8LA 1YTFD 1Q8IA 5I5YA 1ENVA 3LDEA 4JAVA 4J80A 1E4EA 2ZKOA 5KFJA 1S5JA 3DGEA 3O65A 4JASA 4LF4O 4PDBA 3K04A 5KFLA 3ZHVA 1KBLA 2CTWA 1LR1A 3W7UA 1M56C 1Y74A 2ZR3A 4EEYA 5BYAA 3E22B 2QDOA 1PP9H 4U3JA 2C35B 1ZQ7A 3CCEV 1J5EH 3LP8A 4LMYA 3P3NA 4J9YB 3D8CA 4JI3O 4HAMA 1R3LC 2YXLA 1XNQO 2CAZC 3HOXG 2BQRA 4RUFA 2XC9A 3MD0A 1SS3A 1WPXA 1JIHA 4DYLA 1M93A 1M0TA 2EBOA 2AGAA 2CNQA 1G6UA 2B1IA 3VQVA 1XMQO 1JJ2U 4DW1A 2F4VB 4CS3A 3OM3B 2Q8VA 2V9WA 4JI8B 3WU2Z 4FFBA 1BCCH 1N36O 1XNRH 2I8CA 1SKVA 1WA8B 5KFUA 2FLPA 1V4YA 1IBKB 4ED3A 3KREA 5KG0A 2ZIOA 4O83A 2LFRA 4AQYO 1OCCB 1XMOB 5FD6A 1RJQA 2QM4A 4IRDA 4FM1A 3L70H 2RJZA 2WAQE 5DG7A 2PZSA 4FLTA 4FLWA 3FD9A 4OXSA 2R93A 2YS7A 2IU0A 3MAQA 3PR5B 3THOA 3J81W 4WFGA 2DQ3A 4LH6A 2XAGA 1O9GA 2PI4A 3N6RA 1KJIA 1B6QA 2V58A 3BA8A 4FM9A 4LF5H 5L1IA 2DWEC 3PN1A 5KFYA 3AG2B 1EHIA 2GDSA 5CB4F 4QWBA 1AI4A 1Q81W 4RCNA 3WB1A 1P49A 5B1BC 3GLKA 1SA0B 1AI5A 2Y69C 5KG3A 2HIVA 3CB2A 1QR8A 4DV1O 1OCOC 4TUYA 3MWDA 5KG2A 4MV1A 4J0MA 2I80A 1EYZA 3VQYA 4O7TA 4A3LG 1IBMB 3HKCB 2JS5A 2EIKB 4A3BG 2Y0PA 4DR5O 5KFFA 5FLXN 4WFFA 3M9NB 3N2KB 5D1OB 3FKIG 2X7RB 2IJIA 2UUBO 4IIJF 1QLEB 4UB6Z 5CA1A 1FXKB 1Q82W 1LNQA 3FDSA 2Z02A 3T9EA 4ZI7A 4DR3H 5KA6A 4PA6A 1VP7A 2R8IA 4CH5A 4RB2C 2W6IG 2H3OA 3R5HA 3HB9A 5LL6b 5LA6A 3JYCA 5KAFZ 3KHGA 2R92G 4LF6H 2E5LH 3M9OB 3CCSV 3U54A 5EK0A 3STZC 3X2QC 3K57A 2JGDB 3GTLA 1JFFB 1Q7YW 3N6XA 1G2WA 3UYYA 1SA0A 2ASDA 1HW7A 5KX5B 5KFQA 4DV7H 2C22A 5AG2A 3GTMA 5H5NA 2FL4A 1CP9A 1AUVA 2GTAA 4YY3B 1V55C 3CSXA 3SJBC 1GTOA 3RB0A 2ZDQA 4FS2A 1JDBB 4DLKA 2FB5A 1N32H 4CMFA 1IVSA 2IBKA 1Y1VA 1YHQV 3GQCA 3N2KA 4JV5H 2R87A 4L8JA 2HDKA 3RWRD 4UXNA 4DUZH 2IMWP 3VA7A 1JX4A 3UM7A 4YJ3A 3OMNB 1FJGH 4LFBH 3N42B 2XGQA 2EZPA 2W9CA 4Q45A 5IT9W 4UUJC 4R8UA 4Q6GA 3M99B 4A3FG 3SR2C 4FZ0A 3FAVA 4QIWF 2Y4UA 2L35A 1K1SA 3TW6A 3SJQC 3M9MB 2KG7B 3K5LA 1Q43A 2ZM6H 3M4IA 4CKEA 2EIMB 5C8YA 3K0DA 1RSOA 2C2AA 1M90W 4GKKB 3T54A 3TJTA 3N8DA 1P16A 4K8ZA 3L4JA 3FB5C 4YB8B 4FZ1A 4NXMO 3L74H 1NVPD 3QO8A 3JAKB 5I5UA 2WLHA 5C3EG 5IJ9B 4M7EA 2IJKA 4ED8A 4J10A 4DW0A 5BZBA 1PK8A 1YJWV 4JI4B 2R93G 1VF5B 1AR4A 2VOBA 1DIKA 1Z2OX 1S68A 3WO0A 1E79G 1CKNB 4WBNA 4APMA 3HT5A 3RYHA 5KT6A 2VQDA 3ZBHA 2O57A 1YIJV 2HHHB 2UXCH 3KHHA 1MA1A 4GX0A 5KMGB 2XIGA 2ZINA 2QEXV 4WFHA 4NLGA 3ETJA 3ABMB 2KQXA 4OX9B 4LF7O 4EYHB 3TXSA 1A0IA 1FKAO 1XL6A 1XREA 1Y1WA 4IT5A 5KFVA 1OCZC 1A32A 2Q73A 5C4XG 2YRWA 4K8XA 1Y14B 1KMIZ 5H9CA 4O7SA 2DYSB 1Y76A 2Z04A 2ZDIC 4NYEA 2ALZA 3ABLB 1V54B 2RDCA 2UXNA 5KA5A 1D5NA 4WFEA 4UV9A 4XDKA 4RQFA 4QJFB 2XAQA 1ZLZA 1EN5A 4FJCC 4FM2A 3CS5A 2XGPA 1NU1H 2BTOA 3TW7A 5D5QA 3T1YB 3AX6A 3ETGA 1V9PA 3SPJA 4O7YA 2XOKG 1DF4A 2XAJA 4PBCA 1RJRA 5KT5A 4B3TH 2PI5A 3SPGA 3I56V 3J7AK 3OUZA 3U9SA 1AI7A 5CBHA 2FLLA 3G8CA 4IWXA 5KHGA 2NR5A 3NC0B 3AYHB 4LH7A 2QSAA 4Z1VA 1YDXA 4DV5H 5KHIA 3VPDA 1FXVA 1K4DC 4K0KO 5KFNA 2XASA 1WPBA 2H94A 5KHKA 4D7SA 2COIA 4TQDA 4MAMA 4DAAA 1L2ZA 3N44B 2CQYA 4YP3A 1OZ0A 1F51A 4UB8Z 2X0SA 3GTKA 4FU0A 2BQ3A 1G4YB 2JA5A 4X1YA 5DM6V 5DGBA 5KFEA 1I7LA 3KAJA 4A3DG 4MTXA 4X64B 4I4TB 4A3EG 4X20B 3OHBA 1KECA 4UVCA 3QO5A 3RV3A 3JZIA 1NTMH 1R9TA 4A3GG 1FYJA 2OIEA 2W6QA 1Y1VG 1IDSA 2QWQB 4CH6A 1MABG 3ZRSA 1KYOF 4X62B 1YTFB 4GKJO 1JA8A 3H0GA 5JCOC 5KFPA 3WWJA 1VQ7V 1FS0G 1H2GA 1ZUQA 4DIMA 2CTQA 1N33H 4O4LA 3ZRXA 2P5OA 4NR1A 1N56A 1MZFA 1CQJB 1EFRG 4Q8EA 5JUMA 1HNZO 3W7TA 5IYZF 3UKMA 2EINB 4MTFA 3PW2A 4DV0O 2EJ7A 2W0FC 4Q4CA 5DLFA 4FLYA 4YAKB 1KP2A 2ZQMA 1GSOA 1Q6HA 5KFAA 3JAWB 1PPJH 3KHLA 2YI9A 4HZ3A 4RAZA 4F4ZA 1PX2A 4LFAB 1MNGA 1A0GA 4GX1A 2XCPA 3N27A 4QIWE 4DV3H 2ITDC 2WLJA 4DL7A 1I7FA 1I5XA 1IBLH 4O2AB 4X20A 1VBHA 2FJZA 1W0JG 1NTKH 4J7ZA 3GIMA 2AGOA 2F95B 3F7VC 4Q44A 4FFOA 2Q0AA 4PA3A 5LYJA 2Y4RA 3O9OA 5B66Z 5IYZB 4LF8H 1K4CC 4E4EA 2ZE5A 3OW2U 4X1IA 4YR2A 5EYPA 3CPWU 2UU9B 2V1DA 2R8HA 3PR4A 3IGAC 3HKEB 4O7VA 2Q0OC 3GV5B 5L1LA 4OPAA 4F6RB 1LUVA 5B3SB 4ED0A 2H8PC 3CMAV 1YVWA 4FM0A 1GM9A 4CKCA 3T1HO 1Y1WG 4OPHA 3QZ8A 3MR6A 2E76B 2FKLA 1T5EA 2OCCB 5J2UA 4PI2A 4DUYH 3BQ2A 3CSWA 1M7JA 4O3RA 4ZHQB 3JD0A 1I1MA 4B3SO 4Q43A 4I0XA 4EKWA 5I47A 4IR9A 4X8AA 3SPCA 1ZHQA 3HOYG 3RGZA 3KTMA 1NTZH 3JZFA 4X88A 5L3CA 4ZIBA 2VQEB 2W7OA 4KXRA 2VQFB 2AZ0A 4O2AA 1S0OA 3F5TA 4P30A 4B3RB 2UVUA 4NVPA 3FMAA 2ZDIA 2UXDB 5IWAB 5BR8B 1BHAA 2LW1A 1J5EO 4D7TA 1W59A 2NLJC 5IYCO 4X65H 5L3GA 2LQTA 4U7CA 4QE7A 4GCZA 2CGOA 3G6VA 1AB3A 4P9PA 3LDDA 3BY6A 4O4IF 4F6RA 4LF4B 5JWPA 4MS2A 4Q0YA 3T2MA 1M57B 3B4SA 4O2BF 4LC1A 4C5CA 1VARA 1SEIA 1T3NA 5L3FA 4MTGA 1P7BA 2YEVB 2JA5G 3T1CA 4MV6A 3V6JA 2PYLA 4P2ZA 5EC1C 3H4DA 2XAHA 4JI3B 2WLIA 5C44G 3B8NA 4ZHQA 2BR0A 5JH7B 3CCLV 3EHBB 1XNQB 3UZOA 1XK5A 4NKGB 4R50A 4QPJA 3TETA 5KT3A 4A3MG 1SZXA 1XI1A 3T5HA 3RV4A 2C2EA 4DV2H 4IZOA 3H0GG 5EZYF 4AILC 1XMQB 2CTRA 3E2EA 1ZSPA 5EBLC 2VPQA 4QE9A 5CM0A 4O3SA 2CE4A 4TQFA 3HOVG 1ZL8B 4EG0A 1GKFA 1N36B 3T1YO 2ATKC 4O2BB 2F23A 4K6NA 2Q7EA 1MZBA 5DISC 3MFHA 2EJRA 3NR7A 2IW5A 1JKJB 2ZXWC 2YIBA 3HR0A 2QR4A 4AQYB 3OD4A 5LP6B 4CC6A 5DAAA 2VR1A 3G67A 3ZMTA 3H1HH 5KKNB 5E79Z 2Y0SA 5IYBG 3ETDA 4I9WA 1S10A 1KKCA 3MHHC 3HB3B 2R9AA 3FB6C 5IY5C 4H13B 2C2RA 4JI1H 4JYBA 2ZD9A 1EUCB 4MV4A 4O7RA 2HGXA 4MV9A 5KFOA 3MJFA 4KHPH 3TCUA 4QGPA 3CRRA 3AG3B 4O81A 3DF7A 2HHFA 3T9FA 2IU3A 3T99A 2VPSA 1RYSA 2JA7A 4MVOA 3ZJZA 4QNHB 1DGSA 5CE8A 4X64O 4DR2H 2P0AA 2IA6A 2LGWA 4JYAH 1NI8A 4MVQA 3LULA 4RB1A 4FBUA 4YJ2B 3UT5B 2MW2B 4I50F 2L6LA 2Q68A 4O7ZA 1A3GA 3JARB 3RW0A 5CA0F 2QYZA 1AR5A 4UCTA 1UNNC 4DV1B 3B77A 3CEIA 4TOIA 2RDIA 3K08A 5LOVF 5KFMA 4R7RA 5KFSA 4JI6H 1I1KA 3GILA 3PW5A 1NZ6A 4LF6O 4DR5B 2E5LO 5L1JA 3OR7C 2KB1A 1GM7A 5LP6A 2UUBB 2WSSG 2X6AA 4NZOA 2NNUA 1A48A 5DEDA 2W70A 3WG7B 4LF9H 1MOFA 3K5NA 2WAMA 3JATB 1O75A 4J9ZB 4BWSC 3J80W 2B63A 4CKBA 1R6TA 5FR9A 1GRJA 2AXTZ 4WD3A 4DV7O 1R6KA 1VQ6V 4I50B 5DQIA 3OFNG 2W7PA 5DGHA 5CA0B 4HNAA 3U0GA 2FK3A 4YR0A 4OGQB 1N32O 2Y0IA 5JVDF 2BTQB 1XILA 3WO1A 4IYIA 4FFMA 5I5VA 3QWUA 2ZE6A 5JQGA 3BRCA 1FJGO 2VUGA 4FLXA 4LFBO 1BHBA 5LXTB 5KFGA 2R7KA 1W0KG 4IL6Z 4R8CA 4EB6A 2DWCA 1HNWH 4JI7H 1H38A 3ABUA 3HOZG 2Q2UA 1OCCC 4JYCA 5KT4A 3DTUB 4ICGA 3K5HA 4EFEA 5I5WA 2ZM6O 3I4MG 2VRZA 3B09A 4MV8A 5IJ0B 4TV9B 1BMFG 3V6HA 3KHRA 3VQXA 2BSKB 4U3FH 4JI2H 4JI0H 3T4DA 1SZTA 2C28A 2EIJB 3ZHUA 3CXCU 4J9PA 3H1LH 3TXQA 4DK0A 2HIXA 3AG1C 2JEFA 2UVRA 2W6PA 4ED1A 2OTLV 3SJAC 4IR1A 2V59A 2JJ1G 5J2TF 2FE3A 2LO1A 2QB5A 2Z3YA 1JR9A 3JASB 2QA4V 1WB8A 1B33N 5KFXA 5EIBD 1BE3H 5BR8O 2UXCO 2WAQA 5LXTA 1IOWA 3GJXB 2E3CA 4NXMB 4I7HA 2A9HA 1M9NA 1KEEA 2JEUA 3ZN1A 4EBEA 2QKCA 1Q90D 2WLKA 4TT3G 2EIKC 1SQFA 2W8KA 3PVXA 2LGQA 1S9FA 1C3OA 3RJ0A 3TIGA 1FXKC 3Q8PB 4BR6A 3NGDA 4MA5A 5KUMA 4ZOLA 3ZHTA 2CDYA 4MTDA 1B6RA 2UUCH 2JA7G 4FLVA 2DYRB 1DTOA 4LF7B 3E86A 1SQXH 2ZDGA 4MW3A 3ZN0A 3P32A 1BJTA 1OJHA 1KC7A 4K35A 3R23A 4EYIB 3F7YC 3K79A 2VWKA 2R70A 4B3TO 2JEJA 1KP3A 1CPYA 1GN2A 5FNVA 3HKDA 1LUWA 4GLWA 4DXWA 4Q20A 3CP1A 2FB9A 3S3WA 5GONA 2SCUB 5H2FZ 1GK9A 2W9BB 4DV6H 4DV5O 2EILB 1KUQA 5C5JA 2CH7B 2RNBA 5GTHZ 5KG1A 4ZI7F 3RFCA 3GTQA 1AP5A 1Z5WA 4LFCH 4B7KA 2Q69A 2B63G 5E1AC 2DIKA 2HHHH 2W9AA 3E22A 4RNMA 3RGXA 2QM7A 2NU6B 3G6YA 2ZJTA 1YSCA 3E8GA 2GBOA 1OBDA 5C93A 1ET0A 4K0KB 4DR4H 2R9IA 1N0NA 1HNXH 1RK5A 4F4XA 1KT8A 4GYCB 5JJEB 4F50A 4J11A 2FPGB 5F9LA 2ATLA 3JSNA 3VMMA 3ZCCA 1N33O 4FIPC 3RT3C 4PD4F 4O3OA 5F9NA 1TWFA 5KG6A 1SQGA 2GQSA 3LDCA 4DV4H 4EBCA 2W6MA 1E1RG 3RYCB 3K03A 2UXBH 3GIDA 4JV2A 2YZGA 4W4LA 3ICXA 5CBFA 4X66H 4ME6A 1AROP 3RTXA 3L75H 4O7WA 1K3EA 4C2MA 4GKJB 4AYBE 3RUPA 2CH7A 3UO2A 1WA8A 2GHYA 2QE7G 5EWGA 5IT9N 2GTSA 3DAAA 5K2MA 3RB3A 3CEBA 3OSNA 2HG5C 4YAJB 2HVKC 1H2NA 2I87A 4ECQA 2FMLA 2IJJA 5LMNH 1HNZB 3BJYA 2FYUH 1B3QA 2XTAA 4I5SA 4DV0B 4XZ3B 3RBDA 2A1HA 1IBLO 3RR5A 1SYXB 4GLXA 5C8YF 3BABA 2HGWA 4JTAB 5A2QN 1HR0H 3RYIB 5CB4B 5DQHA 3N41B 3CD6V 3Q8QB 2E74B 2KKWA 2DYSC 4NB5A 4L87A 3J7AU 3PW0A 3ABLC 4K3AA 1V54C 1FFXB 3C90A 4J9NA 2RGVA 1RM1B 2RQ6A 3FYEB 3DSQA 4CHIA 2N04A 1FD9A 3GB8B 3FB8C 1I0HA 4DUYO 2G38A 4IIJB 1BSMA 5F2VO 4IHJF 3PO3G 2CNUA 2OCHA 3HKCA 2D2CB 3AG7A 3ZMZA 1PL0A 4BIOA 2WLLB 1E4GT 3STLC 3E35A 5D1OA 1GO3F 3T1HB 1YCIA 3BPZA 2DABA 2XUMA 1FXKA 5BY1A 1PNKA 2YS8A 2PF4E 3ORQA 3HXLA 1IXBA 3LSUA 4MA0A 1NT2B 1HDJA 3GWKC 4I55F 3KG2A 2DQ0A 4B3SB 1G8MA 3OTOH 3S3XA 4X65O 4ASUG 3OEEG 1W93A 3A0RA 4PWQA 1COWG 1QVGU 2IP4A 4JI5H 3GV7B 2QJ1A 3RIZA 1K97A 2JGDA 3R65A 4FPPA 4MVSA 2CW7A 2ASLA 1JFFA 2XAFA 4J42A 4A3IG 1M6VA 1HP8A 3ZRVA 2YIAA 1JXLA 5KX5A 2A7WA 3JD2A 1J5EB 3HKBB 5IE9A 1TUEB 5FLXW 2ZDHA 4GX5A 3VNNA 1GMGA 5BYBA 5I5SA 4N21A 1GSHA 2R8KA 2AGQA 4I55B 3HOWG 3V4SA 4BIUA 5DECA 3ZMSA 5KFDA 4WHXA 4B7EA 5LHHA 4DV2O 1R3KC 4F6EA 1IXMA 4QWAA 3G71V 2NU7B 2OLSA 2W6ZA 2WTFA 4WCEV 1YF2A 2KG7A 1TWAA 1THZA 3NXSA 2FMAA 4QW9A 1N48A 3S24A 1NKDA 2UXDH 1AI6A 1EZVH 1PV0A 4CS2A 2HG8A 2DMXA 3C3TA 1PKXA 5EOYA 2HLDG 2HGSA 4DQNA 2M7WA 3N2GB 1AJQA 2YC0A 3HKBA 2AQ4A 1YXBA 3JAKA 3T9DA 4RU9A 4LSXA 5IJ9A 4JI1O 4B3MH 5KHJA 1R3IC 1MSDA 1I5YA 4F4WA 5LMUH 4KHPO 1D2DA 1K1QA 1CXZB 4HYKA 1CKNA 4CH4A 5DGIA 4DL6A 4RWUA 4FFLA 4NXNH 3BQ0A 4DR2O 4ECZA 2OCCC 5D1PA 1M1KW 1S0MA 2DJVA 4YIOA 5KMGA 4DR1O 2JDIG 3VPCA 3LMLA 1XNQH 4O4HF 5KT7A 1N4CA 2R6FA 2AZ2A 3K5MA 4ZQIA 3SDLA 1MG1A 5LHGA 5EDWA 3LSSA 1JOYA 5LYJF 3H4BA 5BPFA 3W7XA 4UUGA 4CS4A 1RFYA 5B1AB 3Q4HB 2MCTA 2GLTA 1AVMA 2PY5A 4PZ8A 3TEKA 3UO3A 1I2LA 4QWCA 4HQ6A 3OSPA 4QJFA 4LF9O 3MFIA 4DR3B 1RYRA 3E8BA 4FBTA 3SPHA 1M57C 2P22C 4UCUA 3H9VA 4LF6B 2E5LB 5BWUA 4Q8FA 4GZRB 4O4HB 3OMIB 1S5LZ 1S97A 1VQOV 3JCZA 5CAEB 2DW4A 3T5KA 2YS6A 2YYAA 1I94H 2ITCC 3HPLC 2ZE8A 1GO3E 3U11A 1JVMA 4J7JA 3WB2A 4PA4A 3RGBA 5FPOA 4J9MA 3AG4B 1K92A 4DV7B 3I5DA 4TV8F 1HNWO 3K3WA 4TVIA 4JI7O 4XYLB 2GSMB 1N32B 2R7ZA 4H33A 1TWGA 3WWHA 3PW7A 3JCUZ 4I4TA 2GV9A 1P7GA 1MMMA 4JV5B 1H2SB 4EQ5A 3Q4HA 4DR6H 4DUZB 3MDSA 5LGTA 4ED6A 3HKZA 2LW7A 2WA3A 1FJGB 2YXYA 4LFBB 4YXWG 3RB6A 4JI2O 4JI0O 5IDJA 3QQMA 3GB7C 4A93G 2P06A 3JD3A 3G8DA 4DR7H 2OTJV 3HBLA 3JZ6A 1OHHG 5GTIZ 5LP6C 2R8JA 1OCZB 3SYAA 3VPBA 3L72H 4YHHH 1WAZA 2ZM6B 4LWSB 3Q1KA 2WYOA 1QCEA 4J9QA 4G28B 4FFRA 4B08A 4TV8B 5KFRA 2W0XA 5JJJB 3ASOB 3CYOA 5J9PC 4XYMB 3U55A 2NVXA 3KAKA 2PMZA 3KXYT 5KG5A 4EEQA 5IYDG 3JAWA 1YJ9V 4NYKA 1VMGA 2YIDA 2X0LA 3AG3C 3CJHB 3L73H 2DAAA 4A2BA 2HFEC 1FPOA 1BXRA 1WN7A 2YU9A 3D3QA 2Q2TA 3SYPA 1SF9A 5KUKA 4PELA 5IYCG 3ABKC 2FPIB 3MR3A 2JA8G 3RAXA 4NZNA 4DRXB 4E6NA 4E4TA 2BOCC 1G1XB 2XD4A 4ECWA 2UXCB 4G2KA 2ETNA 3OGIB 2UUCO 5IYZA 3MR5A 3NBZB 4ED2A 3SNOA 2A79B 3HO8A 5LHIA 2LP7A 3HKEA 1RP3B 2CTPA 4LNUB 1U97A 4GC6A 1SRYA 3WG7C 3OTFA 1URFA 2UXXA 3K9SA 1RK6A 1VQNV 2COGA 4O82A 1AN7A 1S03G 1XUQA 2RN9A 3U10A 3ASNC 1B04A 5ITZB 4DV6O 1KQSU 1KJ9A 3G6BA 3LSQA 1XNRO 2N05A 3T5JA 2QWRB 3CJHA 3M8AA 1GN4A 3CX5F 4BW9A 1L1FA 3H40A 3WB0A 3CCUV 4LFCO 2UUAH 4B3TB 1X4TA 3VOUA 3GWOA 1NQTA 3W7WA 1SERA 4O7NA 4WFBV 1FAFA 4A3JG 1KUTA 3UFXB 1N34H 3KCXA 5K1PA 4UCRA 4DRXA 4O4IB 1Q6IA 1EUDB 1NJIW 4C5BA 5EBMC 4CE5A 1KC8W 1EKPA 4DV5B 4HNVA 4ECXA 2NU8B 3JAMW 2DOSA 2EULA 4DR4O 3QNEA 4C7UA 1HNXO 3N43B 4RZRA 1O9HA 2GQRA 1DLBA 3OUFA 3PJSK 3M7MX 1I1LA 1TA8A 4LF5O 4HR7A 4Y8VB 1RPRA 2P7TC 3H1JH 4BBRG 1A9XA 2WLMA 3DXRB 4JXUA 1KD1W 3BACA 2EIJC 2YEVA 1UJWB 2R7ZG 2UXBO 2XHBA 2Z0AA 2GUZB 4X66O 1L8DA 5EZYB 1MSWD 5JH7A 5BMVF 3DTFA 2VA2A 1KJQA 1ZX3A 4O3NA 1N33B 1T36A 5HBRB 2F66C 4FFPA 2Q5ZA 1QBZA
chains in the Genus database with same CATH topology
1M0WA 3SR2C 4DV1H 3N40P 1JJOA 5J2UB 2F4VH 3L2PA 2VWKA 1VS0A 4JI8H 2R70A 3K5LA 1Q43A 2ZM6H 1Q5OA 3M4IA 5FNVA 3HKDA 3EYYA 5C8YA 4DR5H 1RSOA 3OTOB 4O2BA 4UCSA 1IBKH 4GKKB 1ZHSA 5GONA 2UUBH 3K58A 4DV6H 1P16A 3TY8A 4JI5B 4K8ZA 4O4HA 3L4JA 3KYHC 1XMOH 2HVSA 4DV3B 3CVZA 3JAKB 4PZ6A 2HEPA 1Z5WA 4LFCH 5IJ9B 1IBLB 4M7EA 1ZAUA 2JGUA 4JI4B 2PTMA 4K0KH 2HHHH 1TVKB 2VOBA 3E22A 1Z2OX 1S68A 3RGXA 1CKNB 2ZJTA 4WBNA 4APMA 3RYHA 4LF8B 2KSWA 1TUBB 1TAEA 4K0KB 2HHHB 2UXCH 4DR4H 3JALB 5KMGB 2XIGA 1HNXH 1X9NA 2ZINA 4PHZA 4GYCB 5JJEB 4OX9B 3JSNA 1A0IA 5LOVB 3UT5A 4YJ2A 4AHCA 3JARA 4K8XA 1SQGA 1KMIZ 3A2FA 3RYFB 3QF7A 4DV4H 4DUYB 3L4KA 3RYCB 1IBMH 2UXBH 4X66H 3ICXA 3RTXA 3IAYA 2HVRA 4GKJB 4FM2A 4O4JB 4TV8A 2BTOA 5D5QA 3T1YB 1XHZA 1V9PA 5LMNH 1HNZB 1XDNA 3BHPA 4DV0B 4B3TH 3K3VA 3JATA 3RR5A 1SYXB 3J7AK 5JVDB 2YI8A 4GLXA 4B3MB 5KHGA 4ETSA 3BABA 4I50A 4X65B 3NC0B 4UCOA 1HR0H 3RYIB 1BGWA 5CB4B 5LMUB 4LH7A 5CA0A 4DV5H 5KHIA 3N41B 4NXNB 2KKWA 2WDTA 1WPBA 5FPRA 2BTQA 5KHKA 4NXMH 4D7SA 4TQDA 1L2ZA 3N44B 4RZQA 4U3JB 1FFXB 5KHHA 2RGVA 2RQ6A 4X1YA 3KAJA 4X64B 4YY3H 4I4TB 3DSQA 1XHXA 4X20B 3BAAA 3GB8B 1VF7A 4LNUA 4IIJB 4RB3C 3GDEA 3T1HH 4CH6A 4X62B 3HKCA 5IJ0A 2HVQA 4TV9A 4LF7H 5JCOC 4HBNA 1FKAH 4DV2B 1N33H 1E4GT 4O4LA 2P5OA 2F1MA 3SGIA 5D1OA 3T1HB 1CKOA 3BPZA 5ITZA 4FFBB 3ETQA 5J2TB 5JVDA 1QHTA 3UQ8A 2PYJA 3HXLA 4MV7A 5JCOA 2V4DA 4LSAA 2IM9A 1NT2B 2ZCEA 4FLYA 4B3SB 2PGGA 3OTOH 3JAWB 4GKKH 2ZNIA 2YI9A 4O4IA 4RAZA 2PUSA 1I94B 4JI5H 3JASA 4LFAB 3RF2A 2QJ1A 3RIZA 4DV3H 2CW7A 1JFFA 1I7FA 3FFQA 3W1GA 4PZ7A 1IBLH 4O2AB 4HNAB 4X20A 2YIAA 5FD5A 2F95B 5KX5A 4JI4H 4JI1B 1J5EB 3HKBB 3ZS8C 4DRFA 1GYFA 5FLXW 2Q0AA 5LYJA 1WNSA 5BMVB 4KHPB 2Q7GA 3VNNA 5IYZB 4DR6B 4DR1H 4LF8H 5JQGB 1Z5VA 4X1IA 5EYPA 2UU9B 4DR2B 4JYAB 3HKEB 4I55B 4F6RB 4EB6B 4OX9H 4IAJA 4DR1B 5EZYA 1FVIA 4DR7B 4RB0A 5J2TA 4TUYB 4FM0A 2JVDA 4YHHB 1T5EA 4JI6B 5J2UA 4PI2A 4DUYH 3ZEDA 4ZHQB 1M4UA 5CA1B 3RFRA 4GKJH 1ZHQA 3RGZA 4ZI7B 3S24A 3T1YH 4LF9B 2UXDH 3TY9A 3C0FB 1KU9A 4ZIBA 2VQEB 2VQFB 4CS2A 3SJCC 3QTCA 4O2AA 1HNZH 5LA6B 4B3RB 1YEWA 2HGSA 5EOYA 3N2GB 4NVPA 4DV0H 3FMAA 2UXDB 3HKBA 5IWAB 3JAKA 5BR8B 5BMVA 4LSXA 5IJ9A 1Q3EA 1CKMA 4I9QA 4B3MH 5KHJA 4D7TA 4X65H 3BA9A 1TVKA 3H20A 5LMUH 3IG0A 4F6RA 4LF4B 1CKNA 4CH4A 4Q0YA 4NXNH 2ZNJA 1TUBA 5D1PA 3JALA 5KMGA 1SEIA 2OWOA 1HNWB 4JI7B 2YIBD 2Q7HA 2RGRA 3LMLA 1JMKC 1XNQH 4X64H 5LOVA 4PI0A 2PYLA 3K5MA 4ZOLB 4JI3B 4ZHQA 5JH7B 4FVMA 4YJ3B 3RYFA 1XNQB 1XK5A 2O03A 4CS4A 4CH3A 3KALA 3RYCA 1WH2A 4JI2B 4X62H 3K5OA 4JI0B 3W1BA 1XI1A 2MCTA 2PY5A 3W5OA 4PZ8A 4DV2H 4AILC 2EX3A 1XMQB 4O4JA 4DR3B 2VWJA 4TQFA 5FNVB 2UUAB 3HKDB 5C8YB 1TGOA 2P22C 1N34B 1N36B 2W57A 2CFMA 4UCUA 4O2BB 1Z2PX 2Q7EA 4LF6B 2E5LB 5DISC 1MZBA 5GONB 4BWAA 4B3SH 1P8LA 2YIBA 4O4HB 1Q8IA 4AQYB 5LP6B 1S5JA 4CC6A 3RYIA 1I94H 5CB4A 4PDBA 3U11A 4LR3A 4LFAH 3WB2A 3RGBA 1QQCA 5FPOA 4DV7B 3E22B 2R9AA 4U3JA 1FFXA 4WBNB 3RYHB 4JI1H 5EIBC 1J5EH 4IHJB 1N32B 4LMYA 4I4TA 4MV9A 2GV9A 4KHPH 2YXLA 4JV5B 1H2SB 4EQ5A 2VPSA 3DF7A 4DR6H 4DUZB 2CAZC 2UU9H 2UUCB 1DGSA 4DR2H 4JYAH 4RB1A 1FJGB 4IIJA 4LFBB 4YJ2B 3UT5B 1M93A 1M0TA 3JARB 4DR7H 2YCHA 1G6UA 4UCTA 3VQVA 4DV1B 2F4VB 4TOIA 5LP6C 4CS3A 4UFZA 4JI8B 5A2QW 4YHHH 2ZM6B 4R7RA 4FFBA 4JI6H 1XNRH 2WYOA 4KL1A 4DK1A 4B08A 4DR5B 1SKVA 4TV8B 2R72A 5JJJB 1IBKB 5LP6A 2UUBB 2ZIOA 4DV6B 3KAKA 3KXYT 1XNRB 4A2AA 4EEQA 3CHXA 3JAWA 3VQWA 1XMOB 5FD6A 4LF9H 2VQEH 2QM4A 3K5NA 4FM1A 3JATB 2RJZA 1O75A 4BWSC 3J80W 1D5AA 2PZSA 2VQFH 4LFCB 4FLTA 4FLWA 4B3RH 4A2BA 4I50B 4IHJA 3MAQA 1WN7A 5IWAH 5BR8H 2Q2TA 3THOA 3J81W 4LH6A 5CA0B 4HNAA 4UCVA 1E4FT 1O9GA 5K1XA 3BA8A 4DRXB 4E6NA 1XQ8A 2BTQB 4FM9A 4LF5H 2UXCB 1I6UA 4DR4B 4LF4H 3PN1A 1HNXB 3QWUA 5IYZA 3NBZB 5JQGA 3BRCA 4X1YB 2VUGA 4FLXA 5LXTB 2CW8A 3WB1A 4LF5B 3HKEA 1P49A 4I55A 1HNWH 1SA0B 4EB6A 4JI7H 2HIVA 3CB2A 3MWMA 4LNUB 2Q2UA 4TUYA 3OTFA 4J0MA 4DV4B 3VQYA 4X1KB 4EFEA 4JI3H 1IBMB 2UXBB 3HKCB 4X66B 5IJ0B 2JS5A 4TV9B 1AN7A 1S03G 3U10A 3VQXA 2OYQA 4O4LB 3N2KB 5D1OB 1Z2NX 4JI2H 3NBYB 4JI0H 1B04A 5ITZB 5CA1A 5JJNB 1XMQH 4BW9A 4ZI7A 5LMNB 4DR3H 3K59A 2F93B 4DK0A 3WB0A 4CH5A 2HIXA 4RB2C 2UUAH 4B3TB 1X4TA 3JSLA 5D5PA 5LL6b 3LNNA 3SJAC 1N34H 1N36H 5LA6A 5K1PA 4LF6H 3N2GA 4UCRA 2FE3A 4DRXA 4O4IB 2E5LH 3TY5A 1HR0B 4EFBA 3JASB 4CC5A 3K57A 4DV5B 5EIBD 3JAMW 4AQYH 4FLUA 1JFFB 3B2EE 5LXTA 3GJXB 1M5IA 2E3CA 4NXMB 4I7HA 3N6XA 3N43B 1O9HA 1SA0A 4RAYA 1HW7A 3M7MX 5KX5B 1TA8A 4DV7H 1SQFA 3QG5A 4MTEA 5LYJB 4YY3B 3SJBC 3CSXA 4X1KA 3RJ0A 2ZIMA 4X1IB 1N32H 5EYPB 3F8NA 4FLZA 3N2KA 4JV5H 2XHBA 3U0ZA 4L8JA 4ZOLA 1L8DA 3RWRD 4DUZH 5EZYB 4MTDA 2UUCH 5JH7A 4FLVA 4LF7B 4YJ3A 2WE6A 1FJGH 4LFBH 3N42B 1N33B 1BJTA 5IT9W 2F66C 4Q6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEQ A;  3BA9 A;  3BAA A;  1XMO B;  3GB8 B;  4LF4 B;  1CKN A;  3L2P A;  1VS0 A;  4LFC B;  3GDE A;  5D1P A;  4X62 B;  2OWO A;  3OTO B;  2HVQ A;  1HNW B;  2Q2T A;  4UCS A;  4LH6 A;  4DV2 B;  4JI7 B;  4GKK B;  4UCV A;  3SGI A;  5D1O A;  3T1H B;  1P16 A;  3TY8 A;  1CKO A;  4JI5 B;  3BA8 A;  4E6N A;  3KYH C;  4JI3 B;  2UXC B;  2HVS A;  4DR4 B;  4DV3 B;  3UQ8 A;  3PN1 A;  1HNX B;  3QWU A;  1XNQ B;  4PZ6 A;  1XK5 A;  3NBZ B;  1IBL B;  2VUG A;  1ZAU A;  4JI2 B;  4LF5 B;  4B3S B;  4JI0 B;  3W1B A;  4JI4 B;  3W5O A;  4PZ8 A;  2HIV A;  1S68 A;  1CKN B;  1XMQ B;  2Q2U A;  4DR3 B;  1I94 B;  4LF8 B;  4DV4 B;  4LFA B;  1TAE A;  2UUA B;  4EFE A;  2HHH B;  4K0K B;  1IBM B;  2UXB B;  4X66 B;  1X9N A;  1N34 B;  1N36 B;  2CFM A;  4UCU A;  4OX9 B;  3W1G A;  4LF6 B;  3JSN A;  2E5L B;  1A0I A;  4PZ7 A;  5DIS C;  5D1O B;  3NBY B;  1P8L A;  1B04 A;  4JI1 B;  1J5E B;  4DRF A;  4AQY B;  5LMN B;  4KHP B;  4CC6 A;  3VNN A;  4DR6 B;  4DUY B;  2HIX A;  2UU9 B;  4B3T B;  3JSL A;  4DR2 B;  4JYA B;  5FPO A;  4DV7 B;  3RTX A;  2HVR A;  4UCR A;  4DR1 B;  4GKJ B;  1FVI A;  4DR7 B;  3TY5 A;  1HR0 B;  4EFB A;  3T1Y B;  1N32 B;  4CC5 A;  4DV5 B;  1V9P A;  4YHH B;  1HNZ B;  4JV5 B;  3GJX B;  4EQ5 A;  4JI6 B;  4NXM B;  1XDN A;  4DUZ B;  4DV0 B;  2UUC B;  1DGS A;  1FJG B;  3RR5 A;  4LFB B;  1TA8 A;  4GLX A;  4B3M B;  4YY3 B;  3BAB A;  4X65 B;  3NC0 B;  4UCO A;  4UCT A;  3S24 A;  5LMU B;  4LH7 A;  4DV1 B;  4LF9 B;  3TY9 A;  2VQE B;  4TOI A;  2F4V B;  2VQF B;  4UFZ A;  4JI8 B;  4NXN B;  2ZM6 B;  5FPR A;  4B3R B;  2UXD B;  5IWA B;  4DR5 B;  4LF7 B;  5BR8 B;  1IBK B;  1N33 B;  1CKM A;  2UUB B;  4DV6 B;  4X64 B;  1XNR B; 
#chains in the Genus database with same CATH topology
 1M0W A;  2X5R A;  1K9M W;  1S0V A;  3N40 P;  5LMN O;  1JJO A;  1U96 A;  1QR9 A;  2F4V H;  4JI8 H;  3JD1 A;  1H2K A;  5KFH A;  1Q5O A;  4KUM A;  4CMD A;  1ZL8 A;  1UC9 A;  2QWP B;  1VAJ A;  4DR3 O;  4EBD A;  2Z5U A;  2P4K A;  4O2B A;  4UCS A;  1HR0 O;  1IBK H;  5BWX A;  2F43 G;  2HJF C;  3TGU H;  4TWK A;  4O3P A;  1WB7 A;  3KYH C;  1XMO H;  4LCU C;  4E2L A;  4DV3 B;  3CVZ A;  3SPI A;  5L1K A;  1IBL B;  1US6 A;  2DYR C;  3DXR A;  1ZAU A;  4RAI A;  4XDJ A;  2JGU A;  4K0K H;  1QNM A;  2BCC H;  1R73 A;  1TVK B;  2PTM A;  2JEI A;  3CWB H;  4O4J F;  3RBE A;  5EC2 C;  5FJ8 G;  4BXX G;  2DE0 X;  3D36 A;  3D3I A;  4LF8 B;  3OHA A;  4MSW C;  1TUB B;  3OMA B;  1TAE A;  2PBZ A;  3I4N G;  3JAL B;  5T14 A;  1X9N A;  1DK1 A;  5BWW A;  1C30 A;  1QLN A;  4MT8 A;  4CBC A;  4NZM A;  3WNZ A;  4JPR A;  5LOV B;  4JV5 O;  3UT5 A;  4YJ2 A;  4DUZ O;  5CMU A;  4PDL A;  2LJ2 A;  3AEI A;  3JAR A;  2EIL C;  2X6B A;  4BBS G;  3A2F A;  3RYF B;  1KJ8 A;  4GUN A;  3I12 A;  4DUY B;  2R7M A;  4WFA V;  1IBM H;  3E8H A;  1JCH A;  1P84 F;  5K3W A;  3IAY A;  4ZOL F;  3OTO O;  2DPI A;  1KB9 F;  1WLE A;  2C00 A;  1IYD A;  4O4J B;  3AW8 A;  4PDM A;  3ZRW B;  4XDL A;  2CZG A;  4N23 A;  3BG5 A;  3NUA A;  5KFT A;  4JI5 O;  1XHZ A;  3UCS C;  2YZL A;  2R84 A;  4KFM A;  4JYY A;  4HNU A;  2WB1 E;  5KFC A;  2UVW A;  1XDN A;  3MWE A;  3BHP A;  4RQE A;  3K3P A;  3K3V A;  3JAT A;  3CC4 V;  5JVD B;  2YI8 A;  2NN4 A;  4ETS A;  2XT9 A;  3RAQ A;  4X65 B;  4I50 A;  1SCU B;  2A3Q A;  2FK1 A;  1BGW A;  3AG2 C;  2E2I A;  4J7K A;  5CA0 A;  1UFI A;  2AHZ A;  2FKX A;  4D6T H;  4IRC A;  2EJ0 A;  1Y74 B;  3RVY A;  1YIT V;  1VQ4 V;  2BTQ A;  1SQQ H;  4YQW A;  2R9R B;  5KT2 A;  3V4Z A;  2RF4 A;  4ECU A;  3OGC C;  3TK1 A;  4RZQ A;  4U3J B;  3JRW A;  1DV1 A;  4F4Y A;  1VIB A;  4TQR A;  3BCC H;  3APO A;  4YY3 H;  3K9A A;  1XHX A;  4QW8 A;  1GSA A;  5TIS Z;  2YW2 A;  5EWF A;  4H0L B;  1BS3 A;  1VQM V;  2J6T A;  1E1Q G;  3JRX A;  3J81 N;  3GDE A;  3APQ A;  4UV8 A;  1QLE C;  3T1H H;  5HNE A;  2YZM A;  4M0J A;  5IJ0 A;  1L0L H;  4FK5 C;  1S5H C;  4P9O A;  4TV9 A;  4DV2 B;  1WR2 A;  2BSK A;  2F1M A;  2UVV A;  1WSC A;  4U6P A;  4IYH A;  2NU9 B;  2RMK B;  4FFB B;  2W71 A;  5J2T B;  5JVD A;  2HR3 A;  1QHT A;  1SET A;  2QKS A;  4MV7 A;  1R3J C;  1AR1 B;  2V4D A;  2Q6A A;  2IM9 A;  3CCR V;  1IYE A;  4LSA A;  2ZCE A;  2YWV A;  1XEQ A;  2YUA A;  4AYB A;  4IRK A;  2CNV A;  3WFV A;  1RM1 C;  4B3M O;  5KG4 A;  3IC7 A;  4TUY F;  4GKK H;  2ZNI A;  1DAA A;  5LMU O;  3RBZ A;  2PUS A;  1QVF U;  2JA6 A;  4PA7 A;  5LGN A;  2ZE7 A;  3JAS A;  4NXN O;  3Q8S B;  4ECV A;  4J9S A;  2ZR2 A;  1W2B U;  5BXZ A;  4R6Z A;  2J6U A;  1IZ3 A;  3W1G A;  5KLV H;  4HNT A;  4DO2 A;  2QK4 A;  5CA1 F;  3LUT B;  1ZET A;  4JI4 H;  4JI1 B;  1UPG A;  5DQG A;  4Z1M G;  3ZS8 C;  4DRF A;  2XCA A;  4JAU A;  4MVZ A;  1S3J A;  4PDV A;  5CR5 A;  3DTG A;  4KHP B;  2DN9 A;  2Q7G A;  2W6J G;  4FS1 A;  3CCJ V;  4TQS A;  2ARH A;  4ABM A;  2A0L A;  1OWT A;  5LA6 F;  3CME V;  5H80 A;  4DR2 B;  2X6C A;  2V7Q G;  4JYA B;  1PD3 A;  4OX9 H;  4IAJ A;  2Q7D A;  4DR1 B;  1FVI A;  1P4R A;  4RB0 A;  5J2T A;  4TUY B;  1I7N A;  2EIM C;  1VQ5 V;  1F4M A;  4ZBM A;  4XX0 B;  2C2D A;  4JI6 B;  2ASJ A;  2HVJ C;  3CC2 V;  2ADQ B;  5KFI A;  5CA1 B;  2E75 B;  5LBQ A;  5B5E Z;  3GTO A;  5EWE A;  4ZI7 B;  1CS0 A;  1TWC A;  3GIJ A;  3SI8 A;  3ZMU A;  3T1Y H;  4LF9 B;  1VF6 C;  1I94 O;  1NR7 A;  1AUX A;  2W9B A;  3I55 V;  5KS8 A;  5KFB A;  5LA6 B;  4LP8 A;  3CRM A;  4YJ3 F;  5DMX A;  2E2H A;  2YRX A;  2CGN A;  3AG1 B;  4NTX A;  5DN6 G;  3GIP A;  3CCQ V;  4DV3 O;  3GTJ A;  3BA9 A;  3ZIA G;  2QF7 A;  1SES A;  3ABM C;  4DR6 O;  1H2M A;  1VQ8 V;  5KFW A;  4X89 A;  2ZNJ A;  2B1G A;  1OCR B;  3E89 A;  3TIN A;  2FP4 B;  5I5T A;  4H44 B;  5L9X A;  4FE2 A;  4LF8 O;  1HNW B;  4DR7 O;  2B5U A;  3E83 A;  4JI7 B;  2YIB D;  3T4Z A;  1AP6 A;  3OAA G;  1S76 D;  4X64 H;  5KX5 F;  4MVM A;  2KSD A;  1EKV A;  3G6X A;  4MV3 A;  3ETE A;  3P3P A;  5LL6 Y;  4BIZ A;  4YHH O;  1EKF A;  2V4Q A;  3B8M A;  4YJ3 B;  1M56 B;  3MR2 A;  2GPW A;  1GN6 A;  3AK3 A;  4CH3 A;  2W9C B;  3RYC A;  4JI2 B;  4X62 H;  1EM1 A;  3K5O A;  4JI0 B;  4R8U B;  2MK3 A;  1YI2 V;  3FAV B;  3W5O A;  4WBN F;  1YZB A;  3SYC A;  2EX3 A;  4R7C A;  1EN6 A;  1I50 A;  1B06 A;  3CRQ A;  4J41 A;  3ZHQ A;  1WCM A;  2NVY A;  5C8Y B;  1RSO B;  2W57 A;  2CFM A;  2ZT9 B;  1XBL A;  3AK1 A;  3HOU G;  2RCV A;  3CCV V;  3GTG A;  1K5S A;  3R5F A;  1H8E G;  1EN4 A;  3G80 A;  4YBZ B;  1IOV A;  5KFZ A;  3RYI A;  5CB4 A;  4LR3 A;  4LFA H;  3H1K H;  2JA6 G;  1BNC A;  3T5L A;  1NH2 D;  1QQC A;  2CK3 G;  2FK2 A;  3RVZ A;  5B1A C;  2JRI A;  1AJN A;  4JV1 A;  1FFX A;  4WBN B;  3GV8 B;  3RYH B;  4JZG A;  4Z2W A;  1R1B A;  2QKA A;  5EIB C;  4IHJ B;  4A5U B;  3LWB A;  2IH3 C;  1K5Q A;  2R82 A;  2R85 A;  4J9L A;  4GC7 A;  3FX7 A;  5LGU A;  2Q67 A;  2UUC B;  2UU9 H;  4GX2 A;  4IIJ A;  3CQZ A;  3EXA A;  3PW4 A;  4HN2 A;  2YCH A;  2R7L A;  2EIN C;  3T9C A;  3OUS A;  3L71 H;  1Y76 B;  2WLL A;  3EFF K;  4FFK A;  1Q86 W;  1WP7 A;  2M6Y A;  4UFZ A;  1NR1 A;  2UUA O;  3GTP A;  5A2Q W;  2YSU B;  2B9Z A;  3TQT A;  1N34 O;  1VQL V;  2QGN A;  5BPH A;  1PL4 A;  4KL1 A;  4DK1 A;  5E25 A;  4IGG A;  3A0B Z;  3AG4 C;  2R72 A;  5B1B B;  1IUR A;  2Y69 B;  1AJP A;  1JQ0 A;  2YL2 A;  4DV6 B;  2COJ A;  1XNR B;  1OCO B;  3QO7 A;  4A2A A;  3VOT A;  3CHX A;  3VQW A;  1F4N A;  3WWI A;  1DF5 A;  2VQE H;  1KKD A;  2VQF H;  1ZTE A;  1D5A A;  2OH2 A;  4LFC B;  1Y6X A;  1JDE A;  4B3R H;  4RUC A;  3DC6 A;  4NTW A;  2HKO A;  1GGO A;  3Q8R B;  4IHJ A;  5IWA H;  4O4L F;  5BR8 H;  4UCV A;  1E4F T;  1YJN V;  5K1X A;  4H37 A;  5BWT A;  4MTO A;  1XQ8 A;  5B3S C;  5HFM A;  1VF6 A;  4AI8 A;  4DR4 B;  1I6U A;  4LF4 H;  1HNX B;  1W96 A;  2YZN A;  2DZD A;  4X1Y B;  2R7N A;  3P30 A;  2ODT X;  2CW8 A;  4LF5 B;  4I55 A;  1J95 A;  3ASO C;  1OBG A;  1AIL A;  2EZO A;  1WP8 A;  4FFN A;  1XL4 A;  4QIW A;  3X2Q B;  2J6S A;  3T9A A;  3MWM A;  4JYA O;  3ETH A;  3IFX A;  2F4V O;  4UVB A;  1K8A W;  4WF9 V;  4JI8 O;  1SC5 B;  4DV4 B;  4RNO A;  4X1K B;  4JI3 H;  2CUG A;  5IP9 G;  3OE7 G;  2UXB B;  4G3I A;  5GW7 A;  4I4T F;  4X66 B;  3R9R A;  2XCL A;  4PA9 A;  2QTO A;  1JPX A;  2OYQ A;  4O4L B;  1DV2 A;  4Q4D A;  3MHS C;  1IBK O;  1Z2N X;  1BQZ A;  1SFO A;  4JAA A;  3NBY B;  2Q9L A;  3G4S V;  1V55 B;  4JI6 O;  2AU0 A;  1R6N A;  1BL8 A;  2DLN A;  2QTS A;  4RNN A;  4F4L A;  5CBG A;  1XMO O;  5JJN B;  1XMQ H;  5LMN B;  3K59 A;  3VBB A;  2F93 B;  2R8G A;  4MVU A;  3JSL A;  5D5P A;  5BWR A;  1WCM G;  3OUU A;  2VUM A;  3LNN A;  1EZ1 A;  2GPS A;  1N36 H;  2IBZ H;  3N2G A;  4ZKI A;  1B6S A;  2RDJ A;  3TY5 A;  2JEX A;  1HR0 B;  3A8T A;  4EFB A;  3H01 A;  4CC5 A;  5A9G A;  3RN4 A;  4AQY H;  2AHY A;  5B1N A;  3R5X A;  4FLU A;  5J2U F;  2BQU A;  3B2E E;  3CE2 A;  1GH6 A;  1M5I A;  2QWN B;  1H2L A;  2DPJ A;  4RAY A;  5KFK A;  5CN0 A;  2JS3 A;  3OEH G;  4ECY A;  2VA3 A;  3EVK A;  3T7A A;  3QG5 A;  4MTE A;  2K1E A;  5LYJ B;  4X1K A;  4O7L A;  2ZIM A;  2JEG A;  4X1I B;  4O2A F;  5EYP B;  2N74 A;  2P4V A;  5H6Q A;  3F8N A;  4FLZ A;  1CQI B;  1IBM O;  2W6O A;  1NBM G;  3LNM B;  3U0Z A;  4W4K A;  3GVM A;  3T9B A;  5C1O A;  3BVO A;  3EPG A;  1K7D A;  2WE6 A;  1FXH A;  5I60 A;  1GLV A;  4TM5 A;  4JUZ A;  3SYO A;  2R86 A;  2A06 H;  1QU7 A;  4DV1 H;  5B1O A;  5J2U B;  3L2P A;  1VS0 A;  4YR3 A;  1NS1 A;  2FTK A;  2EIY A;  4JZ2 A;  3IC9 A;  3OR6 C;  4DL3 A;  4I0X B;  3EYY A;  2BE3 A;  1F23 A;  4DR5 H;  3OTO B;  2QWO B;  3KKY A;  3IJ4 A;  1ZHS A;  4LBE C;  2UUB H;  3K58 A;  3TY8 A;  1OV9 A;  2YDE A;  4JI5 B;  4ZHQ F;  1N0J A;  2JJ2 G;  4O4H A;  2WA4 A;  1T94 A;  2HVS A;  4BY1 G;  3R66 A;  3PZP A;  4PZ6 A;  2HEP A;  2OT5 A;  5DG8 A;  3D36 C;  2PVP A;  3K06 A;  1X59 A;  1WJZ A;  4YY3 O;  1EBO A;  4A3C G;  5FLM G;  3ML0 A;  1UC8 A;  3F5W C;  2KSW A;  3JAM N;  5DLG A;  4RUE A;  4PHZ A;  2W6N A;  3A0H Z;  4EGJ A;  4O3Q A;  2FPP B;  2CKZ B;  1RPO A;  3KCY A;  2WLI B;  3CC7 V;  5IP7 G;  4AHC A;  5CA3 A;  1F7Y A;  4DL4 A;  3FKS G;  2K9P A;  2Q4P A;  1N8R W;  3QF7 A;  3V6K A;  3PFF A;  3L4K A;  3B40 A;  4I7Z B;  1VQK V;  1ROP A;  2D3O W;  4LWS A;  5IYD O;  2HVR A;  4PDR A;  5JH7 F;  2VS0 A;  5L3E A;  4GKK O;  4TV8 A;  3IN5 A;  3CRA A;  2P67 A;  2ILM A;  2ADP A;  1K34 A;  5JVL A;  4HYO A;  3C3S A;  4QSH A;  3DC5 A;  2JK5 C;  4JTC B;  3FYI B;  3QZ7 A;  3EPI A;  3BQ1 A;  2HJW A;  4KP4 A;  2VUM G;  3H3V H;  4JI4 O;  4B3M B;  2LFS A;  2AW9 A;  1MZE A;  4J9K A;  4UCO A;  5EBW C;  3W7S A;  3HKZ E;  5LMU B;  1KTA A;  1RJP A;  4PJ0 Z;  2HJD A;  4NXN B;  1VBG A;  2HHH O;  1SQP H;  3GIQ A;  2WDT A;  4RUA A;  5FPR A;  2QM8 A;  1ZWI C;  2DWD C;  4YIP A;  2ZGI A;  4NXM H;  4PV1 B;  5JQW A;  4OX9 O;  1I3Q A;  5LP6 F;  3GII A;  3E5N A;  1S0N A;  5KHH A;  2YIC A;  3TII A;  3Q2O A;  3G6E V;  1WRV A;  3ZHS A;  5HFL A;  1VQP V;  3J80 N;  4UVA A;  3BAA A;  2HHF B;  2WLN A;  4FMT A;  4BAY A;  1VF7 A;  4LNU A;  3ORR A;  4QWE A;  4GT1 A;  5HV6 A;  4RB3 C;  2PMZ E;  3ZHR A;  5FL7 G;  4LF7 H;  2HVQ A;  4JF3 A;  1BQ0 A;  4HBN A;  1FKA H;  4DV4 O;  3BFR A;  3SGI A;  1KJJ A;  1CKO A;  1K33 A;  4YJ2 F;  5ITZ A;  4FGR A;  1PNL A;  2NUA B;  3ETQ A;  1CE8 A;  4A3K G;  1NH2 B;  2YXH A;  5JQG F;  3UQ8 A;  2PYJ A;  2ODM A;  3CXH F;  5JCO A;  2EJ3 A;  4ECS A;  4IWY A;  2WWW A;  1BGY H;  1S72 V;  4QWD A;  2HP8 A;  2PGG A;  3SYQ A;  4ED7 A;  4O4I A;  4O84 A;  1VKZ A;  2J9G A;  3U9T A;  1Z2G A;  1I94 B;  2WB1 A;  3RF2 A;  1BT8 A;  3ABT A;  4MVR A;  2JIZ G;  2IJH A;  3FFQ A;  2P90 A;  4PZ7 A;  4RO2 A;  4HNA B;  5IYB O;  3SE7 A;  4ECT A;  3JD4 A;  4JTD B;  2AGP A;  2EJ2 A;  5FD5 A;  1FFT B;  2ABJ A;  2WPD G;  2IH1 C;  3K0G A;  1GYF A;  4J9R A;  1VEW A;  2V4R A;  5BMV B;  1WNS A;  3ABK B;  1GN3 A;  4DR6 B;  5JQG B;  5DG9 A;  4DR1 H;  1Z5V A;  1NVP B;  4X62 O;  4EB6 B;  2GUZ A;  1JX9 A;  5D8D A;  4TSF G;  2P6J A;  4DL5 A;  5EZY A;  3TQ1 A;  4DR7 B;  5H6R A;  3L9D A;  2JVD A;  1XDC A;  5LXT F;  4JGS A;  4DL2 A;  4YHH B;  1H8H G;  1Q6U A;  3ZED A;  3FB7 C;  2OIG A;  1S77 D;  1M4U A;  3RB4 A;  1ORQ C;  1PM9 A;  3RFR A;  1KBH A;  4GKJ H;  5BWV A;  4BW5 A;  4TV9 F;  3AK2 A;  4G27 B;  3TY9 A;  3C0F B;  1KU9 A;  3ASN B;  4LFA O;  3SJC C;  3QTC A;  4L1K A;  1HNZ H;  1L0N H;  5L3D A;  4U7N A;  1K83 A;  1YEW A;  1V51 A;  4DV0 H;  2Y0S E;  3KZI Z;  4X9Q A;  3BEH A;  5C1P A;  4BY7 G;  3PO2 G;  5BMV A;  4XBF A;  1Q3E A;  1CKM A;  3UZB A;  4I9Q A;  3CCM V;  4JV0 A;  1SQB H;  1TVK A;  4J9O A;  3H20 A;  3IG0 A;  4EGQ A;  4ECR A;  5KG7 A;  5FNV F;  1CEZ A;  2UU9 O;  1ULZ A;  2Y4T A;  2V5A A;  3K5I A;  1E4E B;  1TUB A;  1SQV H;  3ZMV A;  2BOB C;  3JAL A;  3H1I H;  3GIK A;  2OWO A;  3CRC A;  4M9U A;  5GON F;  2ZXW B;  2Q7H A;  2RGR A;  1JMK C;  2Y48 A;  1Y67 A;  5LOV A;  1GAX A;  4PI0 A;  1TWH A;  4U7O A;  4ZOL B;  1Y4M A;  4QPK A;  1IX9 A;  1Y66 A;  4NTY A;  5L3B A;  1EZJ A;  4FVM A;  4CZZ A;  4O86 A;  3RYF A;  2O03 A;  3OT7 A;  3FKI A;  3KAL A;  5KAI Z;  1WH2 A;  3ZX6 A;  3W1B A;  1XOU A;  2W8L A;  5IY5 B;  3QVN A;  1BZK A;  2FLN A;  2PN1 A;  5I5X A;  1PNM A;  4O4J A;  2VQE O;  3ZRW A;  2VWJ A;  2VQF O;  4MW8 A;  5FNV B;  2UUA B;  1GM8 A;  2XND G;  3HKD B;  5DGA A;  2M05 A;  1TGO A;  4B3R O;  2R92 A;  1OCR C;  1HWY A;  1N34 B;  1JLL B;  1Z2P X;  3QFF A;  2UXD O;  4C5A A;  5IWA O;  1I08 A;  1K73 W;  1I2K A;  5GON B;  1VQ9 V;  3LQS A;  3E8F A;  4BWA A;  4B3S H;  1P8L A;  1YTF D;  1Q8I A;  5I5Y A;  1ENV A;  3LDE A;  4JAV A;  4J80 A;  1E4E A;  2ZKO A;  5KFJ A;  1S5J A;  3DGE A;  3O65 A;  4JAS A;  4LF4 O;  4PDB A;  3K04 A;  5KFL A;  3ZHV A;  1KBL A;  2CTW A;  1LR1 A;  3W7U A;  1M56 C;  1Y74 A;  2ZR3 A;  4EEY A;  5BYA A;  3E22 B;  2QDO A;  1PP9 H;  4U3J A;  2C35 B;  1ZQ7 A;  3CCE V;  1J5E H;  3LP8 A;  4LMY A;  3P3N A;  4J9Y B;  3D8C A;  4JI3 O;  4HAM A;  1R3L C;  2YXL A;  1XNQ O;  2CAZ C;  3HOX G;  2BQR A;  4RUF A;  2XC9 A;  3MD0 A;  1SS3 A;  1WPX A;  1JIH A;  4DYL A;  1M93 A;  1M0T A;  2EBO A;  2AGA A;  2CNQ A;  1G6U A;  2B1I A;  3VQV A;  1XMQ O;  1JJ2 U;  4DW1 A;  2F4V B;  4CS3 A;  3OM3 B;  2Q8V A;  2V9W A;  4JI8 B;  3WU2 Z;  4FFB A;  1BCC H;  1N36 O;  1XNR H;  2I8C A;  1SKV A;  1WA8 B;  5KFU A;  2FLP A;  1V4Y A;  1IBK B;  4ED3 A;  3KRE A;  5KG0 A;  2ZIO A;  4O83 A;  2LFR A;  4AQY O;  1OCC B;  1XMO B;  5FD6 A;  1RJQ A;  2QM4 A;  4IRD A;  4FM1 A;  3L70 H;  2RJZ A;  2WAQ E;  5DG7 A;  2PZS A;  4FLT A;  4FLW A;  3FD9 A;  4OXS A;  2R93 A;  2YS7 A;  2IU0 A;  3MAQ A;  3PR5 B;  3THO A;  3J81 W;  4WFG A;  2DQ3 A;  4LH6 A;  2XAG A;  1O9G A;  2PI4 A;  3N6R A;  1KJI A;  1B6Q A;  2V58 A;  3BA8 A;  4FM9 A;  4LF5 H;  5L1I A;  2DWE C;  3PN1 A;  5KFY A;  3AG2 B;  1EHI A;  2GDS A;  5CB4 F;  4QWB A;  1AI4 A;  1Q81 W;  4RCN A;  3WB1 A;  1P49 A;  5B1B C;  3GLK A;  1SA0 B;  1AI5 A;  2Y69 C;  5KG3 A;  2HIV A;  3CB2 A;  1QR8 A;  4DV1 O;  1OCO C;  4TUY A;  3MWD A;  5KG2 A;  4MV1 A;  4J0M A;  2I80 A;  1EYZ A;  3VQY A;  4O7T A;  4A3L G;  1IBM B;  3HKC B;  2JS5 A;  2EIK B;  4A3B G;  2Y0P A;  4DR5 O;  5KFF A;  5FLX N;  4WFF A;  3M9N B;  3N2K B;  5D1O B;  3FKI G;  2X7R B;  2IJI A;  2UUB O;  4IIJ F;  1QLE B;  4UB6 Z;  5CA1 A;  1FXK B;  1Q82 W;  1LNQ A;  3FDS A;  2Z02 A;  3T9E A;  4ZI7 A;  4DR3 H;  5KA6 A;  4PA6 A;  1VP7 A;  2R8I A;  4CH5 A;  4RB2 C;  2W6I G;  2H3O A;  3R5H A;  3HB9 A;  5LL6 b;  5LA6 A;  3JYC A;  5KAF Z;  3KHG A;  2R92 G;  4LF6 H;  2E5L H;  3M9O B;  3CCS V;  3U54 A;  5EK0 A;  3STZ C;  3X2Q C;  3K57 A;  2JGD B;  3GTL A;  1JFF B;  1Q7Y W;  3N6X A;  1G2W A;  3UYY A;  1SA0 A;  2ASD A;  1HW7 A;  5KX5 B;  5KFQ A;  4DV7 H;  2C22 A;  5AG2 A;  3GTM A;  5H5N A;  2FL4 A;  1CP9 A;  1AUV A;  2GTA A;  4YY3 B;  1V55 C;  3CSX A;  3SJB C;  1GTO A;  3RB0 A;  2ZDQ A;  4FS2 A;  1JDB B;  4DLK A;  2FB5 A;  1N32 H;  4CMF A;  1IVS A;  2IBK A;  1Y1V A;  1YHQ V;  3GQC A;  3N2K A;  4JV5 H;  2R87 A;  4L8J A;  2HDK A;  3RWR D;  4UXN A;  4DUZ H;  2IMW P;  3VA7 A;  1JX4 A;  3UM7 A;  4YJ3 A;  3OMN B;  1FJG H;  4LFB H;  3N42 B;  2XGQ A;  2EZP A;  2W9C A;  4Q45 A;  5IT9 W;  4UUJ C;  4R8U A;  4Q6G A;  3M99 B;  4A3F G;  3SR2 C;  4FZ0 A;  3FAV A;  4QIW F;  2Y4U A;  2L35 A;  1K1S A;  3TW6 A;  3SJQ C;  3M9M B;  2KG7 B;  3K5L A;  1Q43 A;  2ZM6 H;  3M4I A;  4CKE A;  2EIM B;  5C8Y A;  3K0D A;  1RSO A;  2C2A A;  1M90 W;  4GKK B;  3T54 A;  3TJT A;  3N8D A;  1P16 A;  4K8Z A;  3L4J A;  3FB5 C;  4YB8 B;  4FZ1 A;  4NXM O;  3L74 H;  1NVP D;  3QO8 A;  3JAK B;  5I5U A;  2WLH A;  5C3E G;  5IJ9 B;  4M7E A;  2IJK A;  4ED8 A;  4J10 A;  4DW0 A;  5BZB A;  1PK8 A;  1YJW V;  4JI4 B;  2R93 G;  1VF5 B;  1AR4 A;  2VOB A;  1DIK A;  1Z2O X;  1S68 A;  3WO0 A;  1E79 G;  1CKN B;  4WBN A;  4APM A;  3HT5 A;  3RYH A;  5KT6 A;  2VQD A;  3ZBH A;  2O57 A;  1YIJ V;  2HHH B;  2UXC H;  3KHH A;  1MA1 A;  4GX0 A;  5KMG B;  2XIG A;  2ZIN A;  2QEX V;  4WFH A;  4NLG A;  3ETJ A;  3ABM B;  2KQX A;  4OX9 B;  4LF7 O;  4EYH B;  3TXS A;  1A0I A;  1FKA O;  1XL6 A;  1XRE A;  1Y1W A;  4IT5 A;  5KFV A;  1OCZ C;  1A32 A;  2Q73 A;  5C4X G;  2YRW A;  4K8X A;  1Y14 B;  1KMI Z;  5H9C A;  4O7S A;  2DYS B;  1Y76 A;  2Z04 A;  2ZDI C;  4NYE A;  2ALZ A;  3ABL B;  1V54 B;  2RDC A;  2UXN A;  5KA5 A;  1D5N A;  4WFE A;  4UV9 A;  4XDK A;  4RQF A;  4QJF B;  2XAQ A;  1ZLZ A;  1EN5 A;  4FJC C;  4FM2 A;  3CS5 A;  2XGP A;  1NU1 H;  2BTO A;  3TW7 A;  5D5Q A;  3T1Y B;  3AX6 A;  3ETG A;  1V9P A;  3SPJ A;  4O7Y A;  2XOK G;  1DF4 A;  2XAJ A;  4PBC A;  1RJR A;  5KT5 A;  4B3T H;  2PI5 A;  3SPG A;  3I56 V;  3J7A K;  3OUZ A;  3U9S A;  1AI7 A;  5CBH A;  2FLL A;  3G8C A;  4IWX A;  5KHG A;  2NR5 A;  3NC0 B;  3AYH B;  4LH7 A;  2QSA A;  4Z1V A;  1YDX A;  4DV5 H;  5KHI A;  3VPD A;  1FXV A;  1K4D C;  4K0K O;  5KFN A;  2XAS A;  1WPB A;  2H94 A;  5KHK A;  4D7S A;  2COI A;  4TQD A;  4MAM A;  4DAA A;  1L2Z A;  3N44 B;  2CQY A;  4YP3 A;  1OZ0 A;  1F51 A;  4UB8 Z;  2X0S A;  3GTK A;  4FU0 A;  2BQ3 A;  1G4Y B;  2JA5 A;  4X1Y A;  5DM6 V;  5DGB A;  5KFE A;  1I7L A;  3KAJ A;  4A3D G;  4MTX A;  4X64 B;  4I4T B;  4A3E G;  4X20 B;  3OHB A;  1KEC A;  4UVC A;  3QO5 A;  3RV3 A;  3JZI A;  1NTM H;  1R9T A;  4A3G G;  1FYJ A;  2OIE A;  2W6Q A;  1Y1V G;  1IDS A;  2QWQ B;  4CH6 A;  1MAB G;  3ZRS A;  1KYO F;  4X62 B;  1YTF B;  4GKJ O;  1JA8 A;  3H0G A;  5JCO C;  5KFP A;  3WWJ A;  1VQ7 V;  1FS0 G;  1H2G A;  1ZUQ A;  4DIM A;  2CTQ A;  1N33 H;  4O4L A;  3ZRX A;  2P5O A;  4NR1 A;  1N56 A;  1MZF A;  1CQJ B;  1EFR G;  4Q8E A;  5JUM A;  1HNZ O;  3W7T A;  5IYZ F;  3UKM A;  2EIN B;  4MTF A;  3PW2 A;  4DV0 O;  2EJ7 A;  2W0F C;  4Q4C A;  5DLF A;  4FLY A;  4YAK B;  1KP2 A;  2ZQM A;  1GSO A;  1Q6H A;  5KFA A;  3JAW B;  1PPJ H;  3KHL A;  2YI9 A;  4HZ3 A;  4RAZ A;  4F4Z A;  1PX2 A;  4LFA B;  1MNG A;  1A0G A;  4GX1 A;  2XCP A;  3N27 A;  4QIW E;  4DV3 H;  2ITD C;  2WLJ A;  4DL7 A;  1I7F A;  1I5X A;  1IBL H;  4O2A B;  4X20 A;  1VBH A;  2FJZ A;  1W0J G;  1NTK H;  4J7Z A;  3GIM A;  2AGO A;  2F95 B;  3F7V C;  4Q44 A;  4FFO A;  2Q0A A;  4PA3 A;  5LYJ A;  2Y4R A;  3O9O A;  5B66 Z;  5IYZ B;  4LF8 H;  1K4C C;  4E4E A;  2ZE5 A;  3OW2 U;  4X1I A;  4YR2 A;  5EYP A;  3CPW U;  2UU9 B;  2V1D A;  2R8H A;  3PR4 A;  3IGA C;  3HKE B;  4O7V A;  2Q0O C;  3GV5 B;  5L1L A;  4OPA A;  4F6R B;  1LUV A;  5B3S B;  4ED0 A;  2H8P C;  3CMA V;  1YVW A;  4FM0 A;  1GM9 A;  4CKC A;  3T1H O;  1Y1W G;  4OPH A;  3QZ8 A;  3MR6 A;  2E76 B;  2FKL A;  1T5E A;  2OCC B;  5J2U A;  4PI2 A;  4DUY H;  3BQ2 A;  3CSW A;  1M7J A;  4O3R A;  4ZHQ B;  3JD0 A;  1I1M A;  4B3S O;  4Q43 A;  4I0X A;  4EKW A;  5I47 A;  4IR9 A;  4X8A A;  3SPC A;  1ZHQ A;  3HOY G;  3RGZ A;  3KTM A;  1NTZ H;  3JZF A;  4X88 A;  5L3C A;  4ZIB A;  2VQE B;  2W7O A;  4KXR A;  2VQF B;  2AZ0 A;  4O2A A;  1S0O A;  3F5T A;  4P30 A;  4B3R B;  2UVU A;  4NVP A;  3FMA A;  2ZDI A;  2UXD B;  5IWA B;  5BR8 B;  1BHA A;  2LW1 A;  1J5E O;  4D7T A;  1W59 A;  2NLJ C;  5IYC O;  4X65 H;  5L3G A;  2LQT A;  4U7C A;  4QE7 A;  4GCZ A;  2CGO A;  3G6V A;  1AB3 A;  4P9P A;  3LDD A;  3BY6 A;  4O4I F;  4F6R A;  4LF4 B;  5JWP A;  4MS2 A;  4Q0Y A;  3T2M A;  1M57 B;  3B4S A;  4O2B F;  4LC1 A;  4C5C A;  1VAR A;  1SEI A;  1T3N A;  5L3F A;  4MTG A;  1P7B A;  2YEV B;  2JA5 G;  3T1C A;  4MV6 A;  3V6J A;  2PYL A;  4P2Z A;  5EC1 C;  3H4D A;  2XAH A;  4JI3 B;  2WLI A;  5C44 G;  3B8N A;  4ZHQ A;  2BR0 A;  5JH7 B;  3CCL V;  3EHB B;  1XNQ B;  3UZO A;  1XK5 A;  4NKG B;  4R50 A;  4QPJ A;  3TET A;  5KT3 A;  4A3M G;  1SZX A;  1XI1 A;  3T5H A;  3RV4 A;  2C2E A;  4DV2 H;  4IZO A;  3H0G G;  5EZY F;  4AIL C;  1XMQ B;  2CTR A;  3E2E A;  1ZSP A;  5EBL C;  2VPQ A;  4QE9 A;  5CM0 A;  4O3S A;  2CE4 A;  4TQF A;  3HOV G;  1ZL8 B;  4EG0 A;  1GKF A;  1N36 B;  3T1Y O;  2ATK C;  4O2B B;  2F23 A;  4K6N A;  2Q7E A;  1MZB A;  5DIS C;  3MFH A;  2EJR A;  3NR7 A;  2IW5 A;  1JKJ B;  2ZXW C;  2YIB A;  3HR0 A;  2QR4 A;  4AQY B;  3OD4 A;  5LP6 B;  4CC6 A;  5DAA A;  2VR1 A;  3G67 A;  3ZMT A;  3H1H H;  5KKN B;  5E79 Z;  2Y0S A;  5IYB G;  3ETD A;  4I9W A;  1S10 A;  1KKC A;  3MHH C;  3HB3 B;  2R9A A;  3FB6 C;  5IY5 C;  4H13 B;  2C2R A;  4JI1 H;  4JYB A;  2ZD9 A;  1EUC B;  4MV4 A;  4O7R A;  2HGX A;  4MV9 A;  5KFO A;  3MJF A;  4KHP H;  3TCU A;  4QGP A;  3CRR A;  3AG3 B;  4O81 A;  3DF7 A;  2HHF A;  3T9F A;  2IU3 A;  3T99 A;  2VPS A;  1RYS A;  2JA7 A;  4MVO A;  3ZJZ A;  4QNH B;  1DGS A;  5CE8 A;  4X64 O;  4DR2 H;  2P0A A;  2IA6 A;  2LGW A;  4JYA H;  1NI8 A;  4MVQ A;  3LUL A;  4RB1 A;  4FBU A;  4YJ2 B;  3UT5 B;  2MW2 B;  4I50 F;  2L6L A;  2Q68 A;  4O7Z A;  1A3G A;  3JAR B;  3RW0 A;  5CA0 F;  2QYZ A;  1AR5 A;  4UCT A;  1UNN C;  4DV1 B;  3B77 A;  3CEI A;  4TOI A;  2RDI A;  3K08 A;  5LOV F;  5KFM A;  4R7R A;  5KFS A;  4JI6 H;  1I1K A;  3GIL A;  3PW5 A;  1NZ6 A;  4LF6 O;  4DR5 B;  2E5L O;  5L1J A;  3OR7 C;  2KB1 A;  1GM7 A;  5LP6 A;  2UUB B;  2WSS G;  2X6A A;  4NZO A;  2NNU A;  1A48 A;  5DED A;  2W70 A;  3WG7 B;  4LF9 H;  1MOF A;  3K5N A;  2WAM A;  3JAT B;  1O75 A;  4J9Z B;  4BWS C;  3J80 W;  2B63 A;  4CKB A;  1R6T A;  5FR9 A;  1GRJ A;  2AXT Z;  4WD3 A;  4DV7 O;  1R6K A;  1VQ6 V;  4I50 B;  5DQI A;  3OFN G;  2W7P A;  5DGH A;  5CA0 B;  4HNA A;  3U0G A;  2FK3 A;  4YR0 A;  4OGQ B;  1N32 O;  2Y0I A;  5JVD F;  2BTQ B;  1XIL A;  3WO1 A;  4IYI A;  4FFM A;  5I5V A;  3QWU A;  2ZE6 A;  5JQG A;  3BRC A;  1FJG O;  2VUG A;  4FLX A;  4LFB O;  1BHB A;  5LXT B;  5KFG A;  2R7K A;  1W0K G;  4IL6 Z;  4R8C A;  4EB6 A;  2DWC A;  1HNW H;  4JI7 H;  1H38 A;  3ABU A;  3HOZ G;  2Q2U A;  1OCC C;  4JYC A;  5KT4 A;  3DTU B;  4ICG A;  3K5H A;  4EFE A;  5I5W A;  2ZM6 O;  3I4M G;  2VRZ A;  3B09 A;  4MV8 A;  5IJ0 B;  4TV9 B;  1BMF G;  3V6H A;  3KHR A;  3VQX A;  2BSK B;  4U3F H;  4JI2 H;  4JI0 H;  3T4D A;  1SZT A;  2C28 A;  2EIJ B;  3ZHU A;  3CXC U;  4J9P A;  3H1L H;  3TXQ A;  4DK0 A;  2HIX A;  3AG1 C;  2JEF A;  2UVR A;  2W6P A;  4ED1 A;  2OTL V;  3SJA C;  4IR1 A;  2V59 A;  2JJ1 G;  5J2T F;  2FE3 A;  2LO1 A;  2QB5 A;  2Z3Y A;  1JR9 A;  3JAS B;  2QA4 V;  1WB8 A;  1B33 N;  5KFX A;  5EIB D;  1BE3 H;  5BR8 O;  2UXC O;  2WAQ A;  5LXT A;  1IOW A;  3GJX B;  2E3C A;  4NXM B;  4I7H A;  2A9H A;  1M9N A;  1KEE A;  2JEU A;  3ZN1 A;  4EBE A;  2QKC A;  1Q90 D;  2WLK A;  4TT3 G;  2EIK C;  1SQF A;  2W8K A;  3PVX A;  2LGQ A;  1S9F A;  1C3O A;  3RJ0 A;  3TIG A;  1FXK C;  3Q8P B;  4BR6 A;  3NGD A;  4MA5 A;  5KUM A;  4ZOL A;  3ZHT A;  2CDY A;  4MTD A;  1B6R A;  2UUC H;  2JA7 G;  4FLV A;  2DYR B;  1DTO A;  4LF7 B;  3E86 A;  1SQX H;  2ZDG A;  4MW3 A;  3ZN0 A;  3P32 A;  1BJT A;  1OJH A;  1KC7 A;  4K35 A;  3R23 A;  4EYI B;  3F7Y C;  3K79 A;  2VWK A;  2R70 A;  4B3T O;  2JEJ A;  1KP3 A;  1CPY A;  1GN2 A;  5FNV A;  3HKD A;  1LUW A;  4GLW A;  4DXW A;  4Q20 A;  3CP1 A;  2FB9 A;  3S3W A;  5GON A;  2SCU B;  5H2F Z;  1GK9 A;  2W9B B;  4DV6 H;  4DV5 O;  2EIL B;  1KUQ A;  5C5J A;  2CH7 B;  2RNB A;  5GTH Z;  5KG1 A;  4ZI7 F;  3RFC A;  3GTQ A;  1AP5 A;  1Z5W A;  4LFC H;  4B7K A;  2Q69 A;  2B63 G;  5E1A C;  2DIK A;  2HHH H;  2W9A A;  3E22 A;  4RNM A;  3RGX A;  2QM7 A;  2NU6 B;  3G6Y A;  2ZJT A;  1YSC A;  3E8G A;  2GBO A;  1OBD A;  5C93 A;  1ET0 A;  4K0K B;  4DR4 H;  2R9I A;  1N0N A;  1HNX H;  1RK5 A;  4F4X A;  1KT8 A;  4GYC B;  5JJE B;  4F50 A;  4J11 A;  2FPG B;  5F9L A;  2ATL A;  3JSN A;  3VMM A;  3ZCC A;  1N33 O;  4FIP C;  3RT3 C;  4PD4 F;  4O3O A;  5F9N A;  1TWF A;  5KG6 A;  1SQG A;  2GQS A;  3LDC A;  4DV4 H;  4EBC A;  2W6M A;  1E1R G;  3RYC B;  3K03 A;  2UXB H;  3GID A;  4JV2 A;  2YZG A;  4W4L A;  3ICX A;  5CBF A;  4X66 H;  4ME6 A;  1ARO P;  3RTX A;  3L75 H;  4O7W A;  1K3E A;  4C2M A;  4GKJ B;  4AYB E;  3RUP A;  2CH7 A;  3UO2 A;  1WA8 A;  2GHY A;  2QE7 G;  5EWG A;  5IT9 N;  2GTS A;  3DAA A;  5K2M A;  3RB3 A;  3CEB A;  3OSN A;  2HG5 C;  4YAJ B;  2HVK C;  1H2N A;  2I87 A;  4ECQ A;  2FML A;  2IJJ A;  5LMN H;  1HNZ B;  3BJY A;  2FYU H;  1B3Q A;  2XTA A;  4I5S A;  4DV0 B;  4XZ3 B;  3RBD A;  2A1H A;  1IBL O;  3RR5 A;  1SYX B;  4GLX A;  5C8Y F;  3BAB A;  2HGW A;  4JTA B;  5A2Q N;  1HR0 H;  3RYI B;  5CB4 B;  5DQH A;  3N41 B;  3CD6 V;  3Q8Q B;  2E74 B;  2KKW A;  2DYS C;  4NB5 A;  4L87 A;  3J7A U;  3PW0 A;  3ABL C;  4K3A A;  1V54 C;  1FFX B;  3C90 A;  4J9N A;  2RGV A;  1RM1 B;  2RQ6 A;  3FYE B;  3DSQ A;  4CHI A;  2N04 A;  1FD9 A;  3GB8 B;  3FB8 C;  1I0H A;  4DUY O;  2G38 A;  4IIJ B;  1BSM A;  5F2V O;  4IHJ F;  3PO3 G;  2CNU A;  2OCH A;  3HKC A;  2D2C B;  3AG7 A;  3ZMZ A;  1PL0 A;  4BIO A;  2WLL B;  1E4G T;  3STL C;  3E35 A;  5D1O A;  1GO3 F;  3T1H B;  1YCI A;  3BPZ A;  2DAB A;  2XUM A;  1FXK A;  5BY1 A;  1PNK A;  2YS8 A;  2PF4 E;  3ORQ A;  3HXL A;  1IXB A;  3LSU A;  4MA0 A;  1NT2 B;  1HDJ A;  3GWK C;  4I55 F;  3KG2 A;  2DQ0 A;  4B3S B;  1G8M A;  3OTO H;  3S3X A;  4X65 O;  4ASU G;  3OEE G;  1W93 A;  3A0R A;  4PWQ A;  1COW G;  1QVG U;  2IP4 A;  4JI5 H;  3GV7 B;  2QJ1 A;  3RIZ A;  1K97 A;  2JGD A;  3R65 A;  4FPP A;  4MVS A;  2CW7 A;  2ASL A;  1JFF A;  2XAF A;  4J42 A;  4A3I G;  1M6V A;  1HP8 A;  3ZRV A;  2YIA A;  1JXL A;  5KX5 A;  2A7W A;  3JD2 A;  1J5E B;  3HKB B;  5IE9 A;  1TUE B;  5FLX W;  2ZDH A;  4GX5 A;  3VNN A;  1GMG A;  5BYB A;  5I5S A;  4N21 A;  1GSH A;  2R8K A;  2AGQ A;  4I55 B;  3HOW G;  3V4S A;  4BIU A;  5DEC A;  3ZMS A;  5KFD A;  4WHX A;  4B7E A;  5LHH A;  4DV2 O;  1R3K C;  4F6E A;  1IXM A;  4QWA A;  3G71 V;  2NU7 B;  2OLS A;  2W6Z A;  2WTF A;  4WCE V;  1YF2 A;  2KG7 A;  1TWA A;  1THZ A;  3NXS A;  2FMA A;  4QW9 A;  1N48 A;  3S24 A;  1NKD A;  2UXD H;  1AI6 A;  1EZV H;  1PV0 A;  4CS2 A;  2HG8 A;  2DMX A;  3C3T A;  1PKX A;  5EOY A;  2HLD G;  2HGS A;  4DQN A;  2M7W A;  3N2G B;  1AJQ A;  2YC0 A;  3HKB A;  2AQ4 A;  1YXB A;  3JAK A;  3T9D A;  4RU9 A;  4LSX A;  5IJ9 A;  4JI1 O;  4B3M H;  5KHJ A;  1R3I C;  1MSD A;  1I5Y A;  4F4W A;  5LMU H;  4KHP O;  1D2D A;  1K1Q A;  1CXZ B;  4HYK A;  1CKN A;  4CH4 A;  5DGI A;  4DL6 A;  4RWU A;  4FFL A;  4NXN H;  3BQ0 A;  4DR2 O;  4ECZ A;  2OCC C;  5D1P A;  1M1K W;  1S0M A;  2DJV A;  4YIO A;  5KMG A;  4DR1 O;  2JDI G;  3VPC A;  3LML A;  1XNQ H;  4O4H F;  5KT7 A;  1N4C A;  2R6F A;  2AZ2 A;  3K5M A;  4ZQI A;  3SDL A;  1MG1 A;  5LHG A;  5EDW A;  3LSS A;  1JOY A;  5LYJ F;  3H4B A;  5BPF A;  3W7X A;  4UUG A;  4CS4 A;  1RFY A;  5B1A B;  3Q4H B;  2MCT A;  2GLT A;  1AVM A;  2PY5 A;  4PZ8 A;  3TEK A;  3UO3 A;  1I2L A;  4QWC A;  4HQ6 A;  3OSP A;  4QJF A;  4LF9 O;  3MFI A;  4DR3 B;  1RYR A;  3E8B A;  4FBT A;  3SPH A;  1M57 C;  2P22 C;  4UCU A;  3H9V A;  4LF6 B;  2E5L B;  5BWU A;  4Q8F A;  4GZR B;  4O4H B;  3OMI B;  1S5L Z;  1S97 A;  1VQO V;  3JCZ A;  5CAE B;  2DW4 A;  3T5K A;  2YS6 A;  2YYA A;  1I94 H;  2ITC C;  3HPL C;  2ZE8 A;  1GO3 E;  3U11 A;  1JVM A;  4J7J A;  3WB2 A;  4PA4 A;  3RGB A;  5FPO A;  4J9M A;  3AG4 B;  1K92 A;  4DV7 B;  3I5D A;  4TV8 F;  1HNW O;  3K3W A;  4TVI A;  4JI7 O;  4XYL B;  2GSM B;  1N32 B;  2R7Z A;  4H33 A;  1TWG A;  3WWH A;  3PW7 A;  3JCU Z;  4I4T A;  2GV9 A;  1P7G A;  1MMM A;  4JV5 B;  1H2S B;  4EQ5 A;  3Q4H A;  4DR6 H;  4DUZ B;  3MDS A;  5LGT A;  4ED6 A;  3HKZ A;  2LW7 A;  2WA3 A;  1FJG B;  2YXY A;  4LFB B;  4YXW G;  3RB6 A;  4JI2 O;  4JI0 O;  5IDJ A;  3QQM A;  3GB7 C;  4A93 G;  2P06 A;  3JD3 A;  3G8D A;  4DR7 H;  2OTJ V;  3HBL A;  3JZ6 A;  1OHH G;  5GTI Z;  5LP6 C;  2R8J A;  1OCZ B;  3SYA A;  3VPB A;  3L72 H;  4YHH H;  1WAZ A;  2ZM6 B;  4LWS B;  3Q1K A;  2WYO A;  1QCE A;  4J9Q A;  4G28 B;  4FFR A;  4B08 A;  4TV8 B;  5KFR A;  2W0X A;  5JJJ B;  3ASO B;  3CYO A;  5J9P C;  4XYM B;  3U55 A;  2NVX A;  3KAK A;  2PMZ A;  3KXY T;  5KG5 A;  4EEQ A;  5IYD G;  3JAW A;  1YJ9 V;  4NYK A;  1VMG A;  2YID A;  2X0L A;  3AG3 C;  3CJH B;  3L73 H;  2DAA A;  4A2B A;  2HFE C;  1FPO A;  1BXR A;  1WN7 A;  2YU9 A;  3D3Q A;  2Q2T A;  3SYP A;  1SF9 A;  5KUK A;  4PEL A;  5IYC G;  3ABK C;  2FPI B;  3MR3 A;  2JA8 G;  3RAX A;  4NZN A;  4DRX B;  4E6N A;  4E4T A;  2BOC C;  1G1X B;  2XD4 A;  4ECW A;  2UXC B;  4G2K A;  2ETN A;  3OGI B;  2UUC O;  5IYZ A;  3MR5 A;  3NBZ B;  4ED2 A;  3SNO A;  2A79 B;  3HO8 A;  5LHI A;  2LP7 A;  3HKE A;  1RP3 B;  2CTP A;  4LNU B;  1U97 A;  4GC6 A;  1SRY A;  3WG7 C;  3OTF A;  1URF A;  2UXX A;  3K9S A;  1RK6 A;  1VQN V;  2COG A;  4O82 A;  1AN7 A;  1S03 G;  1XUQ A;  2RN9 A;  3U10 A;  3ASN C;  1B04 A;  5ITZ B;  4DV6 O;  1KQS U;  1KJ9 A;  3G6B A;  3LSQ A;  1XNR O;  2N05 A;  3T5J A;  2QWR B;  3CJH A;  3M8A A;  1GN4 A;  3CX5 F;  4BW9 A;  1L1F A;  3H40 A;  3WB0 A;  3CCU V;  4LFC O;  2UUA H;  4B3T B;  1X4T A;  3VOU A;  3GWO A;  1NQT A;  3W7W A;  1SER A;  4O7N A;  4WFB V;  1FAF A;  4A3J G;  1KUT A;  3UFX B;  1N34 H;  3KCX A;  5K1P A;  4UCR A;  4DRX A;  4O4I B;  1Q6I A;  1EUD B;  1NJI W;  4C5B A;  5EBM C;  4CE5 A;  1KC8 W;  1EKP A;  4DV5 B;  4HNV A;  4ECX A;  2NU8 B;  3JAM W;  2DOS A;  2EUL A;  4DR4 O;  3QNE A;  4C7U A;  1HNX O;  3N43 B;  4RZR A;  1O9H A;  2GQR A;  1DLB A;  3OUF A;  3PJS K;  3M7M X;  1I1L A;  1TA8 A;  4LF5 O;  4HR7 A;  4Y8V B;  1RPR A;  2P7T C;  3H1J H;  4BBR G;  1A9X A;  2WLM A;  3DXR B;  4JXU A;  1KD1 W;  3BAC A;  2EIJ C;  2YEV A;  1UJW B;  2R7Z G;  2UXB O;  2XHB A;  2Z0A A;  2GUZ B;  4X66 O;  1L8D A;  5EZY B;  1MSW D;  5JH7 A;  5BMV F;  3DTF A;  2VA2 A;  1KJQ A;  1ZX3 A;  4O3N A;  1N33 B;  1T36 A;  5HBR B;  2F66 C;  4FFP A;  2Q5Z A;  1QBZ A; 
#chains in the Genus database with same CATH homology
 1M0W A;  3SR2 C;  4DV1 H;  3N40 P;  1JJO A;  5J2U B;  2F4V H;  3L2P A;  2VWK A;  1VS0 A;  4JI8 H;  2R70 A;  3K5L A;  1Q43 A;  2ZM6 H;  1Q5O A;  3M4I A;  5FNV A;  3HKD A;  3EYY A;  5C8Y A;  4DR5 H;  1RSO A;  3OTO B;  4O2B A;  4UCS A;  1IBK H;  4GKK B;  1ZHS A;  5GON A;  2UUB H;  3K58 A;  4DV6 H;  1P16 A;  3TY8 A;  4JI5 B;  4K8Z A;  4O4H A;  3L4J A;  3KYH C;  1XMO H;  2HVS A;  4DV3 B;  3CVZ A;  3JAK B;  4PZ6 A;  2HEP A;  1Z5W A;  4LFC H;  5IJ9 B;  1IBL B;  4M7E A;  1ZAU A;  2JGU A;  4JI4 B;  2PTM A;  4K0K H;  2HHH H;  1TVK B;  2VOB A;  3E22 A;  1Z2O X;  1S68 A;  3RGX A;  1CKN B;  2ZJT A;  4WBN A;  4APM A;  3RYH A;  4LF8 B;  2KSW A;  1TUB B;  1TAE A;  4K0K B;  2HHH B;  2UXC H;  4DR4 H;  3JAL B;  5KMG B;  2XIG A;  1HNX H;  1X9N A;  2ZIN A;  4PHZ A;  4GYC B;  5JJE B;  4OX9 B;  3JSN A;  1A0I A;  5LOV B;  3UT5 A;  4YJ2 A;  4AHC A;  3JAR A;  4K8X A;  1SQG A;  1KMI Z;  3A2F A;  3RYF B;  3QF7 A;  4DV4 H;  4DUY B;  3L4K A;  3RYC B;  1IBM H;  2UXB H;  4X66 H;  3ICX A;  3RTX A;  3IAY A;  2HVR A;  4GKJ B;  4FM2 A;  4O4J B;  4TV8 A;  2BTO A;  5D5Q A;  3T1Y B;  1XHZ A;  1V9P A;  5LMN H;  1HNZ B;  1XDN A;  3BHP A;  4DV0 B;  4B3T H;  3K3V A;  3JAT A;  3RR5 A;  1SYX B;  3J7A K;  5JVD B;  2YI8 A;  4GLX A;  4B3M B;  5KHG A;  4ETS A;  3BAB A;  4I50 A;  4X65 B;  3NC0 B;  4UCO A;  1HR0 H;  3RYI B;  1BGW A;  5CB4 B;  5LMU B;  4LH7 A;  5CA0 A;  4DV5 H;  5KHI A;  3N41 B;  4NXN B;  2KKW A;  2WDT A;  1WPB A;  5FPR A;  2BTQ A;  5KHK A;  4NXM H;  4D7S A;  4TQD A;  1L2Z A;  3N44 B;  4RZQ A;  4U3J B;  1FFX B;  5KHH A;  2RGV A;  2RQ6 A;  4X1Y A;  3KAJ A;  4X64 B;  4YY3 H;  4I4T B;  3DSQ A;  1XHX A;  4X20 B;  3BAA A;  3GB8 B;  1VF7 A;  4LNU A;  4IIJ B;  4RB3 C;  3GDE A;  3T1H H;  4CH6 A;  4X62 B;  3HKC A;  5IJ0 A;  2HVQ A;  4TV9 A;  4LF7 H;  5JCO C;  4HBN A;  1FKA H;  4DV2 B;  1N33 H;  1E4G T;  4O4L A;  2P5O A;  2F1M A;  3SGI A;  5D1O A;  3T1H B;  1CKO A;  3BPZ A;  5ITZ A;  4FFB B;  3ETQ A;  5J2T B;  5JVD A;  1QHT A;  3UQ8 A;  2PYJ A;  3HXL A;  4MV7 A;  5JCO A;  2V4D A;  4LSA A;  2IM9 A;  1NT2 B;  2ZCE A;  4FLY A;  4B3S B;  2PGG A;  3OTO H;  3JAW B;  4GKK H;  2ZNI A;  2YI9 A;  4O4I A;  4RAZ A;  2PUS A;  1I94 B;  4JI5 H;  3JAS A;  4LFA B;  3RF2 A;  2QJ1 A;  3RIZ A;  4DV3 H;  2CW7 A;  1JFF A;  1I7F A;  3FFQ A;  3W1G A;  4PZ7 A;  1IBL H;  4O2A B;  4HNA B;  4X20 A;  2YIA A;  5FD5 A;  2F95 B;  5KX5 A;  4JI4 H;  4JI1 B;  1J5E B;  3HKB B;  3ZS8 C;  4DRF A;  1GYF A;  5FLX W;  2Q0A A;  5LYJ A;  1WNS A;  5BMV B;  4KHP B;  2Q7G A;  3VNN A;  5IYZ B;  4DR6 B;  4DR1 H;  4LF8 H;  5JQG B;  1Z5V A;  4X1I A;  5EYP A;  2UU9 B;  4DR2 B;  4JYA B;  3HKE B;  4I55 B;  4F6R B;  4EB6 B;  4OX9 H;  4IAJ A;  4DR1 B;  5EZY A;  1FVI A;  4DR7 B;  4RB0 A;  5J2T A;  4TUY B;  4FM0 A;  2JVD A;  4YHH B;  1T5E A;  4JI6 B;  5J2U A;  4PI2 A;  4DUY H;  3ZED A;  4ZHQ B;  1M4U A;  5CA1 B;  3RFR A;  4GKJ H;  1ZHQ A;  3RGZ A;  4ZI7 B;  3S24 A;  3T1Y H;  4LF9 B;  2UXD H;  3TY9 A;  3C0F B;  1KU9 A;  4ZIB A;  2VQE B;  2VQF B;  4CS2 A;  3SJC C;  3QTC A;  4O2A A;  1HNZ H;  5LA6 B;  4B3R B;  1YEW A;  2HGS A;  5EOY A;  3N2G B;  4NVP A;  4DV0 H;  3FMA A;  2UXD B;  3HKB A;  5IWA B;  3JAK A;  5BR8 B;  5BMV A;  4LSX A;  5IJ9 A;  1Q3E A;  1CKM A;  4I9Q A;  4B3M H;  5KHJ A;  4D7T A;  4X65 H;  3BA9 A;  1TVK A;  3H20 A;  5LMU H;  3IG0 A;  4F6R A;  4LF4 B;  1CKN A;  4CH4 A;  4Q0Y A;  4NXN H;  2ZNJ A;  1TUB A;  5D1P A;  3JAL A;  5KMG A;  1SEI A;  2OWO A;  1HNW B;  4JI7 B;  2YIB D;  2Q7H A;  2RGR A;  3LML A;  1JMK C;  1XNQ H;  4X64 H;  5LOV A;  4PI0 A;  2PYL A;  3K5M A;  4ZOL B;  4JI3 B;  4ZHQ A;  5JH7 B;  4FVM A;  4YJ3 B;  3RYF A;  1XNQ B;  1XK5 A;  2O03 A;  4CS4 A;  4CH3 A;  3KAL A;  3RYC A;  1WH2 A;  4JI2 B;  4X62 H;  3K5O A;  4JI0 B;  3W1B A;  1XI1 A;  2MCT A;  2PY5 A;  3W5O A;  4PZ8 A;  4DV2 H;  4AIL C;  2EX3 A;  1XMQ B;  4O4J A;  4DR3 B;  2VWJ A;  4TQF A;  5FNV B;  2UUA B;  3HKD B;  5C8Y B;  1TGO A;  2P22 C;  1N34 B;  1N36 B;  2W57 A;  2CFM A;  4UCU A;  4O2B B;  1Z2P X;  2Q7E A;  4LF6 B;  2E5L B;  5DIS C;  1MZB A;  5GON B;  4BWA A;  4B3S H;  1P8L A;  2YIB A;  4O4H B;  1Q8I A;  4AQY B;  5LP6 B;  1S5J A;  4CC6 A;  3RYI A;  1I94 H;  5CB4 A;  4PDB A;  3U11 A;  4LR3 A;  4LFA H;  3WB2 A;  3RGB A;  1QQC A;  5FPO A;  4DV7 B;  3E22 B;  2R9A A;  4U3J A;  1FFX A;  4WBN B;  3RYH B;  4JI1 H;  5EIB C;  1J5E H;  4IHJ B;  1N32 B;  4LMY A;  4I4T A;  4MV9 A;  2GV9 A;  4KHP H;  2YXL A;  4JV5 B;  1H2S B;  4EQ5 A;  2VPS A;  3DF7 A;  4DR6 H;  4DUZ B;  2CAZ C;  2UU9 H;  2UUC B;  1DGS A;  4DR2 H;  4JYA H;  4RB1 A;  1FJG B;  4IIJ A;  4LFB B;  4YJ2 B;  3UT5 B;  1M93 A;  1M0T A;  3JAR B;  4DR7 H;  2YCH A;  1G6U A;  4UCT A;  3VQV A;  4DV1 B;  2F4V B;  4TOI A;  5LP6 C;  4CS3 A;  4UFZ A;  4JI8 B;  5A2Q W;  4YHH H;  2ZM6 B;  4R7R A;  4FFB A;  4JI6 H;  1XNR H;  2WYO A;  4KL1 A;  4DK1 A;  4B08 A;  4DR5 B;  1SKV A;  4TV8 B;  2R72 A;  5JJJ B;  1IBK B;  5LP6 A;  2UUB B;  2ZIO A;  4DV6 B;  3KAK A;  3KXY T;  1XNR B;  4A2A A;  4EEQ A;  3CHX A;  3JAW A;  3VQW A;  1XMO B;  5FD6 A;  4LF9 H;  2VQE H;  2QM4 A;  3K5N A;  4FM1 A;  3JAT B;  2RJZ A;  1O75 A;  4BWS C;  3J80 W;  1D5A A;  2PZS A;  2VQF H;  4LFC B;  4FLT A;  4FLW A;  4B3R H;  4A2B A;  4I50 B;  4IHJ A;  3MAQ A;  1WN7 A;  5IWA H;  5BR8 H;  2Q2T A;  3THO A;  3J81 W;  4LH6 A;  5CA0 B;  4HNA A;  4UCV A;  1E4F T;  1O9G A;  5K1X A;  3BA8 A;  4DRX B;  4E6N A;  1XQ8 A;  2BTQ B;  4FM9 A;  4LF5 H;  2UXC B;  1I6U A;  4DR4 B;  4LF4 H;  3PN1 A;  1HNX B;  3QWU A;  5IYZ A;  3NBZ B;  5JQG A;  3BRC A;  4X1Y B;  2VUG A;  4FLX A;  5LXT B;  2CW8 A;  3WB1 A;  4LF5 B;  3HKE A;  1P49 A;  4I55 A;  1HNW H;  1SA0 B;  4EB6 A;  4JI7 H;  2HIV A;  3CB2 A;  3MWM A;  4LNU B;  2Q2U A;  4TUY A;  3OTF A;  4J0M A;  4DV4 B;  3VQY A;  4X1K B;  4EFE A;  4JI3 H;  1IBM B;  2UXB B;  3HKC B;  4X66 B;  5IJ0 B;  2JS5 A;  4TV9 B;  1AN7 A;  1S03 G;  3U10 A;  3VQX A;  2OYQ A;  4O4L B;  3N2K B;  5D1O B;  1Z2N X;  4JI2 H;  3NBY B;  4JI0 H;  1B04 A;  5ITZ B;  5CA1 A;  5JJN B;  1XMQ H;  4BW9 A;  4ZI7 A;  5LMN B;  4DR3 H;  3K59 A;  2F93 B;  4DK0 A;  3WB0 A;  4CH5 A;  2HIX A;  4RB2 C;  2UUA H;  4B3T B;  1X4T A;  3JSL A;  5D5P A;  5LL6 b;  3LNN A;  3SJA C;  1N34 H;  1N36 H;  5LA6 A;  5K1P A;  4LF6 H;  3N2G A;  4UCR A;  2FE3 A;  4DRX A;  4O4I B;  2E5L H;  3TY5 A;  1HR0 B;  4EFB A;  3JAS B;  4CC5 A;  3K57 A;  4DV5 B;  5EIB D;  3JAM W;  4AQY H;  4FLU A;  1JFF B;  3B2E E;  5LXT A;  3GJX B;  1M5I A;  2E3C A;  4NXM B;  4I7H A;  3N6X A;  3N43 B;  1O9H A;  1SA0 A;  4RAY A;  1HW7 A;  3M7M X;  5KX5 B;  1TA8 A;  4DV7 H;  1SQF A;  3QG5 A;  4MTE A;  5LYJ B;  4YY3 B;  3SJB C;  3CSX A;  4X1K A;  3RJ0 A;  2ZIM A;  4X1I B;  1N32 H;  5EYP B;  3F8N A;  4FLZ A;  3N2K A;  4JV5 H;  2XHB A;  3U0Z A;  4L8J A;  4ZOL A;  1L8D A;  3RWR D;  4DUZ H;  5EZY B;  4MTD A;  2UUC H;  5JH7 A;  4FLV A;  4LF7 B;  4YJ3 A;  2WE6 A;  1FJG H;  4LFB H;  3N42 B;  1N33 B;  1BJT A;  5IT9 W;  2F66 C;  4Q6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...