4UFZA

Synthesis of novel nad dependant dna ligase inhibitors via negishi cross-coupling: development of sar and resistance studies
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Negishi Cross-Coupling Enabled Synthesis of Novel Nad(+)-Dependent DNA Ligase Inhibitors and Sar Development.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ufzA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ufzA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ufzA02
1HNWB 4GKKB 4UCTA 4CC5A 4DRFA 1I94B 1XDNA 3S24A 2HIVA 4JI8B 4LF7B 4NXMB 4AQYB 3L2PA 1B04A 3W1BA 2HVSA 4JV5B 3T1HB 1VS0A 3NBZB 1J5EB 1FVIA 2HHHB 4JI0B 1CKNA 2CFMA 4DV2B 3W1GA 4DUZB 2VUGA 4DV3B 2Q2UA 4TOIA 3GB8B 4E6NA 1XMOB 5DISC 5LMUB 4CC6A 1CKMA 2HIXA 3BAAA 4DV1B 1IBKB 4LF9B 3TY9A 3TY5A 3W5OA 4DV0B 4UCRA 4JI3B 4JI7B 4UCUA 4JYAB 1XNQB 1HNXB 3NC0B 4DV7B 4JI1B 4UFZA 2E5LB 3T1YB 1CKOA 1XMQB 4PZ8A 4JI6B 2VQEB 1N34B 4LFBB 2OWOA 4LF6B 1HR0B 4EEQA 4X64B 2HVRA 1N36B 5D1PA 3VNNA 4DR7B 4YY3B 4LH7A 5LMNB 4DR5B 4UCSA 1IBMB 1HNZB 4DV4B 2UUAB 4DR3B 4DUYB 3TY8A 1A0IA 3KYHC 4DR6B 2ZM6B 1S68A 4DR4B 3UQ8A 3GDEA 3GJXB 4DV6B 5FPRA 5D1OB 4B3RB 5IWAB 3RR5A 1XK5A 3BA8A 1TAEA 4LH6A 4LFAB 4OX9B 4LF4B 4UCOA 4LF5B 2F4VB 4EFEA 5BR8B 1DGSA 5FPOA 4LF8B 4B3MB 4GLXA 3SGIA 1FJGB 4PZ7A 4DV5B 4X66B 4JI5B 4DR2B 1N32B 4PZ6A 4KHPB 4EFBA 4K0KB 4JI4B 3BABA 2UU9B 1IBLB 5D1OA 2VQFB 1TA8A 3BA9A 4B3SB 2HVQA 1XNRB 3OTOB 4DR1B 4B3TB 2UUBB 1P16A 4JI2B 4UCVA 1P8LA 2UUCB 4X62B 1CKNB 3RTXA 1ZAUA 3JSNA 3JSLA 3NBYB 1V9PA 2UXCB 2UXDB 4GKJB 1N33B 3PN1A 4EQ5A 4NXNB 4YHHB 3QWUA 2UXBB 1X9NA 2Q2TA 4LFCB 4X65B
chains in the Genus database with same CATH superfamily
1LNQA 4RNOA 4EBEA 1K7DA 3FB6C 3S24A 1EBOA 2HIVA 2W9BA 3OW2U 4LF7B 5LOVF 2CW8A 3L2PA 1R6KA 5KFLA 4DR1O 1VS0A 1J5EO 2GLTA 4DAAA 2FPGB 2C28A 1KKCA 4JI8H 1JX9A 2X6AA 4B3SH 3T5HA 3HO8A 3EFFK 2CH7B 4PA3A 4CC6A 3FMAA 3CVZA 3BAAA 2Q5ZA 4DL7A 4YHHO 2UXBO 5KS8A 3STLC 1I7LA 3J7AU 5JJNB 4JYAB 1V51A 4UCUA 2HG5C 2UXDH 4DV7O 1NI8A 4JI1O 3HR0A 2JA5A 1Q7YW 3CSWA 2Y4TA 2R82A 1HW7A 2DOSA 2E3CA 4FJCC 4C5AA 1S5JA 4RB3C 3CRQA 2ITCC 4TUYB 3KAKA 1LR1A 3CRRA 4X88A 1VQ4V 3QZ8A 3WG7C 1F4NA 3D8CA 5J2TB 4F50A 5KLVH 1DLBA 2XNDG 3APQA 4R8UA 2HHFB 1EKVA 1A0IA 3PJSK 4DR6O 4CH6A 4O7RA 2CE4A 1AI4A 2A9HA 1WAZA 1BCCH 5KX5F 3B2EE 1H38A 1AI7A 1VARA 4HNTA 3IFXA 2JS3A 1TAEA 1Q8IA 4BWAA 3BFRA 4LFAO 3R5HA 2MW2B 4YAJB 2R7KA 3MR6A 1N34O 1K34A 3L70H 3OT7A 3ZX6A 2E2IA 1AP5A 5KG5A 5BR8B 3LSSA 2CNQA 4LWSB 1NT2B 2WB1A 2PMZE 1FJGO 2E5LH 4G28B 3N41B 4QJFA 4DV5B 4CKCA 4WBNB 4NZNA 3R5FA 1FKAO 3I5DA 4ETSA 2CAZC 4YJ3F 5LP6C 4ICGA 1NS1A 3BABA 2WLKA 1AVMA 4X66H 5J2UA 3RVZA 4O3NA 1M7JA 1PP9H 1Q90D 4Q20A 2GSMB 1YTFD 3DSQA 2VQFH 3JSNA 3TJTA 3TXSA 4PBCA 3VQXA 1XNRH 4FFPA 3KKYA 5KFCA 1JQ0A 2FMAA 4ASUG 2FK1A 1GTOA 1R3KC 3BHPA 1M5IA 1TWHA 4UV8A 2UUCH 3L72H 5KFOA 4LFCO 3F8NA 2ASDA 3H1IH 5LA6F 2R8IA 4O3PA 4IWXA 2EILC 2M6YA 3AG4C 4Q8FA 1K33A 2WLLA 3JAWA 2ZXWC 4AQYB 1AI6A 1Z2OX 3LP8A 5L9XA 4ECXA 3T1HB 1GYFA 3I4NG 4MTOA 4N23A 4F6RB 4JUZA 1VQ6V 2CNUA 3G6BA 1MZBA 1F4MA 3L4JA 4A3BG 1MG1A 2YYAA 4IWYA 1I5XA 4X62H 1AJNA 2R8JA 1TVKB 3CRAA 5BY1A 2WYOA 5KFTA 4JI3B 1HNWO 3HBLA 3PR4A 2IJIA 2W6IG 1BHBA 2FKLA 4GKKO 2C00A 3DGEA 4LF9H 3T1YB 1Y76B 2LP7A 5KFJA 3TXQA 1XMQO 5CA0F 5BWWA 4XX0B 3GVMA 5I5SA 3UFXB 4JI6O 1GRJA 3MWEA 3CWBH 2Y0SE 4EEQA 2P22C 5JVLA 2ETNA 3KREA 3ZBHA 4BIUA 3VNNA 4NZMA 1R9TA 4LNUB 4DR7B 4JAVA 3JD2A 3AK3A 4YY3B 2HHHO 4RCNA 4IR1A 4BR6A 1P4RA 5L1IA 1ZTEA 4DV4O 4JV5H 2P90A 1Q6IA 5FL7G 2CH7A 4CS4A 1RPOA 1OBDA 1S68A 1M57C 2PYLA 5KFDA 4DV0O 4ED2A 4DV6B 1NU1H 3D36A 1VF5B 4XDLA 3SYOA 1FXKC 2D2CB 2YS8A 5CBFA 1YI2V 1AB3A 4DR3H 5KFFA 3ASNC 3CCRV 3BVOA 2GPWA 4BY7G 2GV9A 4U7OA 1TWGA 3FFQA 1IVSA 3O65A 4O4HF 1A9XA 1GM8A 3K5IA 4TUYA 4YXWG 2ODMA 5IYZB 2NN4A 4NR1A 5J2TA 4FM2A 1BGWA 1WP8A 3CS5A 4TSFG 3CE2A 3SPJA 5C4XG 1XI1A 1KJIA 2HHFA 4IYIA 5JUMA 5JQGB 4TQFA 3HOZG 4DR4O 1MZEA 4J80A 3RAXA 1TUEB 1TA8A 1S0VA 2JIZG 1YITV 3RN4A 2UVWA 2QM8A 4JI2B 1CEZA 3X2QC 1WRVA 1NTKH 4G2KA 1Q81W 1BQZA 3SPIA 3JASB 3T7AA 3K3WA 4LWSA 3OTOH 3ABKC 3CMEV 1CP9A 1T3NA 3PN1A 1X59A 2H8PC 4WBNA 2Q2TA 4R6ZA 2JGDB 3JRWA 4IR9A 4JASA 4KHPO 1S97A 3JD1A 3A8TA 2X6CA 1RSOB 2NU9B 3N6RA 3T5KA 3ABUA 3VPBA 3F7YC 2A06H 3ZIAG 4J7JA 2CTRA 4X65H 2Q8VA 2X0SA 2OH2A 4PJ0Z 3WWHA 2JK5C 3CCLV 2GQRA 3PW4A 2B5UA 5HFLA 3T9EA 1QLEC 2M05A 4A3MG 5DGAA 3W1GA 4DV2B 4NXMH 4J9YB 1L8DA 4MTXA 1Y1WG 3HOWG 2ZINA 5LMUO 5CBHA 4QE7A 2BCCH 3ZHUA 2PY5A 5F2VO 5JJEB 2DQ3A 3V6HA 4O2BB 2ZKOA 1AILA 4TV9F 4MAMA 1VQPV 3DTGA 3VMMA 2WSSG 4CH4A 2QWNB 1K3EA 2J6TA 3M7MX 3T9CA 4FFBB 4X1KB 4GZRB 4LFBB 2OWOA 2HVRA 1KQSU 2OIEA 1YJNV 3ETQA 2LJ2A 1QHTA 5LMNB 4F6RA 1WNSA 4RO2A 2EIKC 5KHIA 1ZUQA 3E8HA 4I7ZB 4R50A 4TWKA 5JJJB 1HNZB 2J9GA 2E2HA 3LSUA 2P4KA 3H1JH 5KG0A 1ZSPA 5TISZ 3K5MA 1K8AW 3VQYA 3GIQA 1XHXA 1C30A 5D1OB 1IBMH 1TVKA 4O3RA 4JI7O 2ZDIC 2IBZH 1JKJB 1I7FA 1A0GA 3FB5C 2DQ0A 1XL6A 2FLLA 3SPGA 2ZM6H 2CKZB 4OX9B 1Y76A 2V58A 4MTFA 2QM7A 2N05A 2VQEO 3RW0A 3JRXA 4JZ2A 4NKGB 3LUTB 4TV8F 1XUQA 4LNUA 1PD3A 1VQ9V 1I08A 1VQNV 2F4VH 2NUAB 4LF6H 3EYYA 5KFHA 3PZPA 4RAIA 2XASA 3HKDB 3FDSA 1S77D 3RFCA 1XQ8A 4K0KO 3PO3G 2RDJA 1R73A 2OTJV 4DYLA 3OSPA 5EZYA 4B3RO 2XCAA 3BG5A 4DR1B 4DUYH 4RNNA 3E35A 1KYOF 4XYLB 4I4TB 3ZHRA 4QWBA 5IP7G 4IRDA 4AI8A 3G6VA 5K3WA 4B7EA 1V9PA 5I5XA 4MV9A 1EZJA 1J95A 5IYZA 3HOVG 2EJRA 1WA8B 2OT5A 4YHHB 2UXBB 3AG2C 3MHSC 5CB4B 2J6SA 5JQGA 4GX2A 3RYCB 1WCMA 2YCHA 1XDNA 2NU8B 3H0GG 1M56B 4DR2H 3T9DA 3CC4V 2PGGA 1WR2A 3TW6A 1B04A 2XT9A 3S3XA 4H0LB 1RYRA 4J9QA 3FD9A 3IG0A 3JASA 1W93A 2XC9A 4IHJB 5E1AC 1WN7A 1I5YA 2F93B 5FD6A 2HVKC 3UCSC 3W5OA 4A3LG 2JGDA 5DAAA 5LP6F 4W4LA 4DV3H 4NYKA 1XNQO 3QF7A 3NC0B 1XMOH 2R86A 1N48A 3RB6A 4UFZA 4RUFA 4MV1A 4FS2A 1N33H 1R3LC 1RSOA 2F43G 2I87A 1HDJA 1GSAA 3ZN0A 2WDTA 1IBKH 2FB5A 4KL1A 2HDKA 3AG3C 4EYHB 3GTJA 4MVZA 1N34B 3GIMA 1N36B 3AG7A 1B6RA 2JEFA 1OCOB 1E1RG 1EKPA 4GCZA 4DR5B 1GLVA 3SYQA 4A2BA 4LCUC 3KHGA 3QO7A 5KAFZ 4ECRA 3N44B 4HNAB 1VQ5V 4O4IF 4ED8A 2UUAO 1QR9A 1VF6A 1ENVA 2ALZA 3ZMUA 4DUZH 4FS1A 3W7UA 2YRWA 3H01A 3ZMVA 1ZHQA 2GPSA 2B63G 4JYBA 4FLUA 2Q7DA 2YDEA 3ETJA 4FFBA 4X1KA 4RU9A 1GM9A 4X64O 2FJZA 1DF4A 1Y1VG 3ZCCA 4GLXA 4B3MO 2HJFC 3M9MB 1EN4A 3PO2G 4LF4H 4WFGA 4O2BF 2XCLA 1IX9A 2J6UA 5C8YB 3WB0A 3CPWU 1PV0A 2A1HA 3T54A 4FFNA 2NVXA 4DL4A 4ED3A 2Z04A 3WO0A 1IBLB 1E4EB 3RYFB 3LDCA 1W0JG 5D1OA 5LYJF 2JA7A 1N32H 3K3PA 4PI0A 4B3TB 4JTCB 1HP8A 4EEYA 2E76B 2L35A 3HKCB 4MA0A 5BWXA 1VF7A 2EULA 2QSAA 4NTYA 5LHHA 1EUDB 3WO1A 4QIWF 2UUBH 3EXAA 2YICA 3AEIA 3OMAB 3I12A 5B1AC 3QWUA 4M0JA 4LMYA 3JAMW 3PR5B 3P32A 4UV9A 4MVUA 1HNWB 1GAXA 3HKDA 1WCMG 2R70A 4GKKB 5IE9A 2R84A 3UKMA 1AUVA 2ZDQA 4Z1VA 4JI8O 4B3SO 2DN9A 4PDVA 5CBGA 3N2GB 3GTGA 3N40P 2V4QA 1SFOA 2JEIA 3ABTA 3VPCA 5JH7F 1T5EA 1OBGA 4JI4H 4CS2A 2W9AA 4I4TA 3ZMSA 2HHHB 3TQTA 2DYSC 2ZNIA 2F1MA 4LF7H 4HYKA 1AR4A 1Q6HA 1OCCB 2PBZA 1Q6UA 1M9NA 2EINB 3RBZA 2UXDO 2RN9A 3ZHTA 1KBLA 1EFRG 1I0HA 4FGRA 3SNOA 5DQIA 4DV0B 3LMLA 5CB4A 4PA6A 1VP7A 3WU2Z 5I60A 3RYCA 5JWPA 1FXHA 1SESA 1N8RW 5EBMC 2LW1A 4JTDB 4JYAH 4H13B 2SCUB 1KJ9A 3WWIA 5ITZB 1QVGU 4UUJC 1JMKC 5DG9A 5KFWA 4R8UB 5KAIZ 1M4UA 5CB4F 3D36C 1ET0A 4IHJA 4YB8B 4BY1G 4JPRA 2R87A 3Q8RB 4E4EA 4CHIA 4J7KA 4DR4B 2F95B 5KFSA 4ECTA 2AHYA 5B1OA 3GV7B 5CE8A 2O03A 2XHBA 3C90A 3VA7A 5CN0A 1RPRA 1IOWA 1WH2A 2E5LO 4D7SA 4FLXA 2EJ7A 4O4JB 3ZMTA 3THOA 1PL0A 4IHJF 4E4TA 4O84A 1TUBB 3MR3A 5DGIA 2R9RB 5IYCO 3ZHVA 1SZTA 1XOUA 1G4YB 1GM7A 3HKBB 1JJ2U 4X66O 1BMFG 4XYMB 5F9LA 5BR8H 2KQXA 3DTUB 4KHPB 3CJHB 4J11A 3HKZA 2V4RA 4K6NA 2NNUA 2AQ4A 2VQFO 1SYXB 4J9SA 3K79A 2KG7B 3G67A 4B7KA 3LQSA 4NB5A 1XNRO 4ZHQB 3ABLC 3GB7C 1VQLV 4K3AA 2CW7A 3E8GA 4MV6A 3ASOB 2R72A 1GSOA 2UUCO 3MJFA 3UZBA 4I50F 1BNCA 4FFLA 4MSWC 2DYRB 4MVQA 4PDRA 4AILC 1L1FA 1IURA 3U0GA 4O7ZA 4JV1A 3ZMZA 5KKNB 4GKJB 5CR5A 5I5TA 4I5SA 5EOYA 1VEWA 2B1IA 4HNVA 2HFEC 3EVKA 2C2DA 2HGSA 5BWUA 4KFMA 4O2AB 1L2ZA 1EYZA 1R6TA 5HNEA 3WB2A 2ZDGA 3CXHF 1I94B 3U10A 1E4EA 3RYFA 3CCEV 1RK6A 4TQRA 2CGOA 1WPBA 4HN2A 3W1BA 4ECVA 2HVSA 5B1BC 4J7ZA 4NVPA 1US6A 1FVIA 4O81A 4E2LA 2P06A 3U0ZA 5C8YF 3C3SA 4X62O 3HKCA 4EYIB 4AQYH 4C2MA 4LR3A 5DISC 3KZIZ 4XDJA 3T1HH 4X9QA 4FBUA 2DPIA 2PN1A 2YIBA 4DV1B 3IJ4A 2GUZB 4IIJB 4LF9O 2W6QA 4O3OA 3I55V 2ZT9B 4JI7B 4D7TA 1I6UA 5L3FA 1HWYA 4D6TH 3SR2C 2DABA 2JEJA 2FK2A 5I5WA 3GV5B 2VQEB 1HR0B 1EZ1A 1E79G 3N2GA 4RAYA 5H9CA 4JV5O 4P9OA 3B09A 4X8AA 5B3SB 3OTFA 1MNGA 4R8CA 2IMWP 4YJ2F 3T1YH 1D5AA 3D3QA 5KFQA 1KB9F 3CCUV 1H8EG 3PW0A 2HJWA 5IJ0A 4MVOA 1BE3H 2WA3A 2CDYA 2YXYA 1AUXA 4DR7H 4DR3O 1BJTA 5H80A 1CE8A 4RQFA 4BWSC 3DC6A 4B3RB 2HKOA 4MW8A 4ED1A 1FFTB 1GN3A 3P30A 4MW3A 4LH6A 5HV6A 2DE0X 5IT9W 4DV6H 3G4SV 2ADPA 5KFKA 5IDJA 4A93G 1EZVH 3JATB 2VQDA 5ITZA 4JGSA 2G38A 5JVDB 2Z02A 1N0NA 2UXNA 1SF9A 4CMDA 2AGQA 2ZIOA 5IJ9B 3T5JA 1PL4A 5EYPB 2VWKA 5A9GA 4J10A 3QNEA 1S03G 1THZA 1SQPH 3CRMA 5GONB 2D3OW 5BYAA 3OTOO 4YP3A 3HOXG 1KP3A 1PKXA 4O4JA 2BTQB 3FYIB 2OCHA 1GMGA 3K5OA 3RYIA 2IBKA 1TUBA 3ZRWB 3CRCA 2LFSA 4YBZB 1H2GA 2Y4RA 4JI2H 4X1IB 4MV8A 3HKBA 3ORRA 5KHKA 1C3OA 3B8MA 4X65O 1I1MA 3CJHA 3RBDA 1Y4MA 2QB5A 3HB9A 3CCMV 2V4DA 5K2MA 4NXMO 2EBOA 2KG7A 2Q73A 2Q4PA 5BYBA 4J9NA 1EKFA 4ZHQA 1YXBA 2BSKB 1K4DC 2AGAA 3S3WA 5C3EG 4F4WA 3BY6A 2KKWA 3VBBA 3GTLA 2DAAA 5J2UF 4WCEV 4ECWA 3JZIA 3T2MA 1DV2A 3TY5A 3L73H 4UCRA 2JEXA 4FLTA 1Y74B 4O2AA 1P49A 2YRXA 4J9KA 5LGTA 1QBZA 2UVRA 3TEKA 1JA8A 3J81W 2H94A 4PHZA 3CEIA 1T36A 1DIKA 4PV1B 4X64B 1CXZB 1R6NA 2X5RA 5BWRA 3CB2A 3QTCA 1G8MA 1Y1WA 4LSXA 5LMNH 2ZM6O 3B40A 1Z5VA 2GUZA 4IIJA 5FNVB 2R9IA 3K03A 1DV1A 4O86A 1AJQA 4O83A 3FYEB 3IN5A 3H4DA 1ZETA 2OLSA 2ILMA 3FX7A 3RF2A 1KC8W 4LF5B 3W7TA 2F4VO 4LF6O 3F5WC 2XAGA 2RDIA 3ZJZA 1IZ3A 2Y4UA 3E89A 5HBRB 4UXNA 1I50A 1W2BU 1JCHA 1VQKV 3QVNA 4PELA 4Q44A 4Q43A 3GQCA 3DXRB 1FPOA 3AK2A 2Y48A 1JXLA 4PZ6A 2VPQA 1VBHA 4B08A 4DUYO 2QDOA 1OWTA 2PI5A 4IAJA 3BQ0A 5EZYB 1EN5A 4B3SB 1SQFA 1S10A 2V59A 2HP8A 2QKAA 1XBLA 3GWOA 3OFNG 4DW1A 5CM0A 3KTMA 1CKNB 1XHZA 3J80N 1H2MA 2KSDA 4H33A 1KJ8A 1GKFA 3JATA 3BQ2A 4DR1H 1JLLB 1AROP 2UXDB 5E79Z 5JVDA 5AG2A 4NXNB 4WHXA 2WE6A 1PNKA 4DR2O 5DG7A 4A5UB 1ROPA 3MFIA 2Y0IA 3K04A 1H2LA 4FLZA 5DQHA 5IJ9A 1YTFB 5EYPA 1V54B 4JYCA 1KUQA 2YZLA 2YU9A 5GONA 4TUYF 2W6MA 3GIJA 1A48A 5J2TF 4YIPA 2XAJA 3L4KA 1M90W 3C0FB 1ZWIC 3TCUA 2BTQA 5EIBC 3RFRA 4JI0B 2CFMA 2VUGA 3M9OB 2Q2UA 5KT2A 4DV3O 4TOIA 3ZRWA 4QWCA 4Q6GA 3GB8B 4E6NA 3H40A 4RQEA 1XMOO 3ABMB 5KHHA 3WB1A 2UXCO 1N33O 4OGQB 4X1IA 2R7LA 1IBKO 3M9NB 1VKZA 2NU7B 1FAFA 2FLNA 3OEEG 1HNXB 5LGUA 1YCIA 2Q7GA 4OPAA 3RGBA 3SJQC 2E5LB 4YQWA 4ED0A 3H0GA 5KFRA 3KHLA 4A3GG 1SZXA 4JAUA 1KBHA 3VQVA 4H44B 5C5JA 5LL6Y 4WBNF 2BSKA 4I7HA 4FM9A 5H6RA 3JD0A 4F4ZA 3Q4HB 1N34H 4DUZO 4FIPC 4RB2C 2PTMA 2PMZA 4PI2A 1SQBH 1KKDA 1N36H 1LUVA 3N2KB 4F6EA 1Z2NX 1RJQA 5L3GA 3D3IA 1MABG 4MS2A 4DR5H 1YDXA 1UJWB 4RWUA 3ZHSA 1Y74A 5JCOA 2RQ6A 5IWAB 4NYEA 2EILB 4QGPA 5KMGB 2FB9A 2CQYA 4A3JG 4LF4O 1OCOC 4P9PA 2CNVA 2ZXWB 3R65A 3K5LA 3LSQA 4LF8B 1U97A 4MVRA 5BPHA 4HBNA 2FL4A 2PYJA 4DL2A 2EIMB 3QO5A 4O7TA 4QIWE 5KT6A 5KG3A 4GT1A 4L8JA 2WAQE 1VQ7V 5FNVA 2QWRB 4PDBA 2RCVA 1BHAA 4RAZA 2B63A 2ZE7A 2UUBO 2ZE6A 2MCTA 1IBLH 4X62B 4QSHA 3KCXA 4ECYA 1N56A 1Y1VA 1PNMA 3FB7C 4B3TH 3TK1A 4LSAA 3JD4A 4A2AA 3DXRA 3UZOA 4FPPA 1GN4A 1DF5A 4Q4DA 5KG1A 1SCUB 2Z3YA 5BZBA 2VS0A 4UUGA 4M9UA 4BW9A 4UCTA 4CC5A 4JI4O 1YEWA 1ZX3A 5K1PA 4FU0A 4JI5H 1B3QA 1M93A 2C2RA 2ZD9A 3CC7V 1FXKB 3L75H 4WFAV 1XREA 3SYCA 4JV5B 1J5EB 1OCZB 2HEPA 1S76D 2ABJA 2Y0SA 3CSXA 1CKNA 2XGPA 2RNBA 4IGGA 3G6YA 4QW8A 1UC9A 5KFNA 3RYHB 3PVXA 4R7RA 3JAKB 3T5LA 3DTFA 5EZYF 4OPHA 2W0FC 3PW5A 4WFBV 1IOVA 1NVPD 4DXWA 3Q1KA 4DV7B 1Q82W 4JI1B 2R7ZA 1MA1A 1A3GA 3H9VA 2AHZA 4PZ8A 2FLPA 4P30A 5EC2C 4DRXB 3CCQV 5IYZF 1OCCC 2W6ZA 4ECZA 4IL6Z 3VPDA 3A2FA 2EINC 2XAQA 4Z2WA 2ATLA 3GTKA 3SDLA 2IP4A 5JQGF 4UVCA 1I2KA 4ZBMA 3ABKB 2W7OA 4DR6B 3U9TA 2FE3A 3AYHB 3K0GA 1BZKA 4RB0A 1R3IC 2WPDG 1QNMA 2Q0OC 4TM5A 3NGDA 3V6JA 4LFAB 4M7EA 2YXHA 4X1YB 5JQWA 2VRZA 4O4LB 3G8DA 1FYJA 5KFBA 3TINA 1R3JC 1FJGB 1FS0G 3AG1C 4DK0A 4NZOA 3H4BA 4FFKA 3VOUA 3LDEA 3Q4HA 3P3PA 4FM1A 4ED6A 2VA2A 1K92A 3HKZE 1RP3B 5IYBO 5A2QN 3N2KA 4JXUA 3G6EV 1Y14B 3FKSG 3OE7G 5DM6V 2AGPA 1P7GA 4YR3A 2HR3A 2R8KA 1URFA 3KXYT 2CZGA 2R6FA 1K73W 5KMGA 2ITDC 1KD1W 1A32A 3K0DA 2Q68A 3RTXA 4DL5A 4L87A 3OMIB 2YEVB 2DIKA 2QYZA 3EPGA 3BQ1A 5LHIA 4DL6A 3V6KA 4KXRA 2R85A 3CCVV 4LFCB 3MWMA 1SERA 2DMXA 4GKJH 1DAAA 4UVAA 4F4LA 4PA9A 2IH1C 4ECUA 1NTZH 4AQYO 2DYRC 1ZQ7A 3T1HO 3GTMA 1KTAA 4FZ1A 5KFIA 4J9MA 2R9AA 3WFVA 1I94H 1WPXA 2UU9H 1S0OA 1PPJH 2IU0A 5LXTA 3T9BA 1NVPB 3Q8SB 2HGWA 1YF2A 5KFAA 5KFPA 2GBOA 3IAYA 4C5BA 4G27B 2CUGA 2LGQA 3HB3B 1SRYA 3QG5A 4X20B 3KCYA 4RNMA 2MK3A 3AK1A 2R7ZG 2OIGA 4MV4A 2QR4A 3Q8PB 4L1KA 4MVSA 3BJYA 2ZIMA 2YSUB 4DV1H 1CKOA 3T1YO 1XMQB 1ULZA 4EG0A 4JI6B 1Y66A 2ASJA 4LF6B 4JI7H 1FXKA 1Q86W 2A0LA 5LOVB 5D1PA 4DR7O 3GWKC 1OZ0A 2COIA 5D5PA 1JDEA 3OAAG 5C1OA 1HR0H 5IJ0B 4DV4B 2VUMG 2W8LA 3N27A 1BSMA 1BGYH 3RYHA 3P3NA 3JAKA 4DUYB 3TY8A 4EKWA 4MVMA 3KYHC 2WAMA 2ZR3A 1YZBA 4PA7A 3AG2B 5BPFA 1TWFA 2LQTA 4I4TF 4LC1A 4IZOA 1I3QA 3MFHA 2C2EA 2Q0AA 2WWWA 4K8XA 4BW5A 5EWGA 4DRXA 1NR7A 2W6JG 5KFXA 3GIKA 3UT5B 5IYCG 1OV9A 4HNUA 3M99B 3T99A 4AYBA 3HKEB 5KFYA 3T4DA 3RV3A 3EHBB 1EN6A 3CD6V 4EBDA 4DR2B 2R92A 3GTPA 3CXCU 1NKDA 3MR2A 4Y8VB 4FLYA 1KUTA 2R93A 4FK5C 2WLJA 1NJIW 5L1KA 4AHCA 3T9FA 2W6PA 4JF3A 2CTPA 2W70A 3PW2A 4JAAA 1N0JA 5KX5B 1P84F 2M7WA 4X1YA 1VAJA 2WB1E 4J9ZB 1SQQH 4P2ZA 1OCRB 4O4LA 3RYIB 5EWEA 2NU6B 2YZMA 1JX4A 3H3VH 3RIZA 2UXCB 3FB8C 2AU0A 1N33B 2IJHA 3MWDA 3E22B 2CK3G 2P5OA 3HOUG 4U6PA 4MV7A 2V9WA 1SQXH 3ETHA 4DV5H 4A3IG 2KSWA 3OD4A 4YJ3B 2DPJA 1PM9A 2XUMA 2CTWA 4J9PA 1S9FA 3DC5A 5CMUA 2PI4A 1JIHA 3HT5A 1CS0A 5KHGA 4JV0A 5H2FZ 2RGRA 4DUZB 2IJJA 3GV8B 4APMA 4WFFA 2YEVA 5LMUB 2EX3A 1BQ0A 3OR7C 4Q45A 3ZRXA 2QWOB 3CCJV 2B9ZA 5BXZA 2V5AA 2WLIB 2BTOA 4HR7A 1MMMA 2H3OA 2ZCEA 3APOA 2WLMA 5LA6B 1KMIZ 5KFEA 1RM1B 2ZDIA 2RF4A 2AZ2A 2DLNA 1PX2A 4EGQA 3MD0A 1ZL8B 5KG7A 2AZ0A 4K35A 2W9CB 4QW9A 1XILA 5LMNO 2JA8G 2Z5UA 1B33N 4C7UA 1K9MW 5DGHA 2ATKC 4U7NA 3H1KH 4C5CA 2NLJC 5KT7A 2XAHA 3ZS8C 3SPCA 1PK8A 3GJXB 4X20A 4KUMA 3RR5A 5DQGA 1JFFB 2EZOA 1AR1B 4GC7A 3BA8A 4U3FH 1NTMH 3IC7A 3GIDA 2VA3A 2WA4A 1W96A 1OHHG 4JI3H 3G8CA 5CA0B 3GILA 3RVYA 5LOVA 4U3JB 1K1SA 3E86A 2QJ1A 4PZ7A 2GHYA 2DYSB 1QU7A 2YL2A 4LF5H 1F23A 2PUSA 2R92G 4J42A 1YJ9V 5FJ8G 3RB0A 4RUCA 2UVVA 3MR5A 3NXSA 4YY3H 2R93G 2F66C 5IYDO 4K0KB 1O75A 4JI4B 4A3CG 3BA9A 2HVQA 3OGCC 1B6SA 5C93A 4A3DG 1AJPA 2KB1A 1OJHA 2W71A 2DWDC 4UCVA 1GGOA 4XBFA 1P8LA 1ORQC 1JDBB 2WLHA 1JPXA 5H5NA 1NBMG 3A0BZ 3JSLA 3UT5A 3K9AA 1E4FT 3CX5F 2HLDG 3L9DA 2XTAA 4O4HB 3CQZA 3HKEA 2L6LA 4EQ5A 3N43B 5J9PC 4YIOA 3OGIB 2NR5A 4OXSA 1UC8A 3OEHG 1YSCA 1KEEA 2FK3A 4I9WA 4BBRG 4NXNH 4J9OA 2C22A 1EHIA 3RT3C 3W7XA 2Q69A 3AW8A 1H2KA 5KX5A 4TQDA 1M6VA 1BL8A 2QA4V 2VOBA 3JZFA 2GTAA 3B77A 3LDDA 5DEDA 3HPLC 5KT5A 3DF7A 2GTSA 3TY9A 2B1GA 4JI0H 3KAJA 1V54C 4DLKA 3E22A 2C35B 3LNNA 3K5NA 1XNQB 5IY5B 5BMVB 4O4JF 2W57A 2P6JA 2EIJB 3K06A 3Q8QB 4KP4A 4FVMA 4YJ3A 2I8CA 1O9HA 1V55B 1SQVH 4EGJA 2OCCB 4YR2A 4FFRA 1HNXH 1N36O 4FE2A 1GN6A 3ABLB 2Y0PA 2WTFA 2Y69B 3ABMC 4RUAA 4DR5O 1AR5A 3GTOA 2UUAB 4CMFA 2YZGA 4Z1MG 4QE9A 1AP6A 3JARB 2Q67A 3UQ8A 2ZQMA 4DV2H 2XGQA 3GDEA 2JJ2G 4ZHQF 5LL6b 1H8HG 1VQ8V 2WLIA 4MTEA 5GTIZ 1XK5A 4HYOA 5I47A 4TV9B 5LA6A 3E2EA 5KT3A 1QR8A 2P0AA 4EFEA 2DW4A 3RUPA 1VMGA 5IWAH 1G2WA 1JR9A 3AX6A 1DTOA 4GLWA 5L1LA 5B1BB 4B3MB 1LUWA 1ZL8A 3SGIA 1E1QG 3EPIA 1VF6C 2W9CA 2ZE5A 1K83A 4O2AF 2IA6A 2CGNA 5KUMA 4LFBH 3R5XA 1IBMO 3VOTA 2RJZA 2W0XA 1UPGA 4LF8H 1QCEA 3TW7A 3I56V 2VWJA 3STZC 1IBLO 2IW5A 2BQ3A 1HNZH 1S5HC 4RZRA 4JTAB 4WF9V 1JFFA 4ZI7B 3G80A 3BEHA 5B1NA 4B3TO 2W6OA 5CA1B 1GSHA 2W6NA 3ZEDA 1FXVA 4BAYA 4JV2A 2I80A 2YXLA 3PW7A 1U96A 2EIMC 3K3VA 1K4CC 1GO3F 2X6BA 5CA0A 2W7PA 3NBYB 3VQWA 3K5HA 1MSDA 4U3JA 4GX5A 4IIJF 4OX9H 4TV8B 1EM1A 1KC7A 2ASLA 2YIAA 4MTDA 1X9NA 2FPIB 4JI5O 3ZRVA 1BT8A 3OHBA 2Q6AA 2YWVA 2RGVA 4JZGA 2JA5G 4WD3A 5I5UA 4JI8B 4I55B 3RB3A 2LGWA 3N8DA 1X4TA 2ARHA 2QWPB 2Q9LA 4NTWA 5KFGA 3BPZA 3ETGA 5FD5A 4Q8EA 3T4ZA 2EZPA 4WFEA 1S3JA 3QO8A 1SETA 4GYCB 3ORQA 3UO2A 1J5EH 3WG7B 3FAVB 4O4HA 5KHJA 4O82A 3RV4A 2ODTX 4H37A 1S72V 2NVYA 1GN2A 2HGXA 1MZFA 2BOCC 3CYOA 5KA6A 4YHHH 1OCZC 2UXBH 4PDLA 5FLXW 5IP9G 5E25A 1W0KG 3V4SA 5JVDF 4DV7H 3RBEA 4JI1H 1FD9A 3B4SA 4ECQA 1TGOA 5I5VA 3JYCA 4UCSA 3JCUZ 2PZSA 4O7NA 5GW7A 1SC5B 1GK9A 5C1PA 2R8GA 3ML0A 2V1DA 2PF4E 3UYYA 4FFOA 5GONF 1M56C 1FFXB 4IYHA 3CEBA 4FMTA 4ZOLB 3KHHA 4U7CA 2AGOA 2Q7HA 5FLMG 3FKIA 5BMVA 5LP6B 2Q7EA 4DR6H 4PDMA 1Y67A 4UCOA 1TWCA 3W7WA 5KA5A 2XOKG 2ZDHA 3RGZA 1R1BA 4ABMA 5L3BA 4LFAH 3ETEA 2QEXV 3T9AA 3U11A 3LWBA 3ZHQA 4X66B 1SS3A 4RUEA 5BMVF 4GX1A 3JAMN 1MOFA 2F23A 1FJGH 4GUNA 1RFYA 4O4IB 4EFBA 3JARA 5EIBD 3BRCA 2FTKA 1IXMA 2HG8A 5L3DA 4YR0A 2VQFB 1FKAH 4QWDA 5GTHZ 1XNRB 1IDSA 4HAMA 4TV9A 3AG4B 4ZIBA 2E74B 1WSCA 2IJKA 5I5YA 2UUCB 5L3CA 1Z2PX 2P4VA 1ZAUA 4CS3A 5BWTA 5D8DA 4A3EG 2JEUA 2UXXA 2N04A 3K9SA 2QGNA 4GKJO 1IYEA 2XIGA 5KFMA 2DWEC 3OUZA 3JALB 4PA4A 1N32O 2JA6A 3RWRD 4IRKA 1Q43A 3QFFA 4PWQA 1F7YA 4Q4CA 2O57A 3IC9A 2UU9O 1I94O 2YZNA 4O3SA 4MV3A 2QKCA 1N4CA 4LFCH 3E83A 1QLNA 4ZI7A 5FR9A 3E8FA 3UM7A 5LYJB 1EUCB 1D2DA 5CA1A 2JS5A 1ZHSA 2X0LA 5LXTB 3BACA 3H1LH 5FNVF 3G71V 1CKMA 2HIXA 4TV8A 4DV1O 4LF9B 1BS3A 3RAQA 4MTGA 4DIMA 1S0MA 4ZI7F 3OR6C 2ZJTA 4PD4F 3O9OA 4CH5A 3OUFA 1YJWV 5CA1F 4G3IA 2CTQA 2FKXA 4ZKIA 1M57B 5KT4A 1JJOA 4I55A 4LF7O 4ED7A 3F5TA 5DLGA 1HNWH 1HR0O 1KJJA 5L1JA 1GH6A 5K1XA 3TIIA 3H20A 4GKKH 1I2LA 2JJ1G 3ASNB 4LH7A 2COJA 1XMQH 5KG4A 2XAFA 4UB8Z 3K57A 5JH7B 4ZQIA 4GC6A 4JI6H 3M8AA 3LNMB 3NUAA 2K9PA 2DJVA 1Y6XA 4QPJA 3N42B 4DR3B 1WB8A 5DG8A 4I55F 3FAVA 2QWQB 1T94A 2HHHH 1I1KA 4X89A 1NR1A 1H2NA 2BR0A 1WB7A 4JYAO 1P7BA 1E4GT 4DV4H 2X7RB 3FKIG 1MSWD 4ECSA 4XDKA 3ETDA 1KP2A 1V4YA 2R7MA 4DV0H 3G6XA 1NQTA 2A3QA 3OMNB 4AYBE 3F7VC 1KT8A 2YI8A 4FM0A 3X2QB 3LULA 5EK0A 1O9GA 2VUMA 5IYBG 2V7QG 1I1LA 1H2SB 5LBQA 4F4XA 2YIBD 3H1HH 3CMAV 3QZ7A 4DL3A 4IRCA 1SEIA 1FFXA 2YUAA 4ZOLA 1NZ6A 3OUSA 1YIJV 2WLNA 4EBCA 2QTSA 4QPKA 2RMKB 4FZ0A 3OTOB 3IGAC 5LP6A 4LBEC 1UFIA 4DR4H 2DWCA 3Q2OA 4A3KG 1AN7A 1RJPA 1VQOV 5BR8O 3R9RA 5HFMA 2QE7G 4CE5A 1XDCA 4I0XB 5D5QA 4CKBA 1QLEB 1Z5WA 2IH3C 4DV5O 4ZOLF 3JZ6A 1NH2D 2JA6G 1K5SA 4X65B 2N74A 3OHAA 2UXCH 4O4IA 4DRFA 3GIIA 2QM4A 1B6QA 2VPSA 4JYYA 4NXMB 3I4MG 1OCRC 1F51A 3U54A 3UO3A 5L3EA 4BIZA 1UNNC 2ZNJA 4KHPH 2YS7A 3NBZB 2FP4B 3R66A 3J80W 1G6UA 3BCCH 3CP1A 1WLEA 2XCPA 1AI5A 1WP7A 4I50B 3J7AK 3SJBC 4DK1A 2EIKB 3TETA 1VIBA 3JALA 1Q5OA 4O2BA 1VQMV 3L71H 1D5NA 1ZLZA 1COWG 4K8ZA 5LMUH 5CA3A 4HQ6A 1DK1A 3ASOC 1K97A 3SJAC 1W59A 2RDCA 5KFVA 2GQSA 4O7LA 5IT9N 1SA0B 2ZR2A 4MT8A 5CAEB 3E5NA 4BIOA 3JD3A 5LYJA 2COGA 5F9NA 5KG6A 3HOYG 1SQGA 1IBMB 2PVPA 2LW7A 5EWFA 3M4IA 3GTQA 4CBCA 1L0NH 3OM3B 4EB6B 3GLKA 4DO2A 1S0NA 2BQRA 1XL4A 2ZM6B 4QIWA 2JGUA 2FMLA 1RM1C 4JI3O 2WAQA 1S5LZ 1L0LH 4WFHA 5LXTF 3CCSV 2IM9A 4LF5O 2QTOA 2OYQA 2K1EA 2F4VB 3N6XA 3A0HZ 3CHXA 4NLGA 4J9LA 5EBLC 5DECA 2VR1A 4W4KA 4YY3O 4J0MA 3GIPA 1WJZA 5JH7A 4DQNA 4I9QA 2AXTZ 2VQEH 4YJ2B 4JI5B 1Z2GA 4FLWA 4RZQA 5C44G 5EBWC 3ZRSA 2LO1A 2FPPB 3RB4A 2JDIG 3DAAA 3SYPA 4GX0A 2QF7A 2W9BB 4DV6O 1K5QA 3A0RA 4CZZA 3E8BA 2EJ2A 4XZ3B 5B3SC 4K0KH 5B66Z 3OUUA 3WWJA 2LFRA 3JCZA 2EJ3A 4BXXG 4B3RH 4FLVA 1NH2B 3K59A 1YHQV 4UVBA 3MDSA 2YW2A 2AW9A 4FFMA 3RJ0A 3KG2A 5LHGA 4J41A 4NXNO 1WA8A 2JRIA 4O7WA 2FYUH 4CH3A 2GDSA 4IT5A 2OTLV 4O3QA 1KECA 2E75B 5KFZA 4UB6Z 1K1QA 3B8NA 3J81N 5KUKA 3K58A 3C3TA 2A7WA 1I7NA 1QQCA 4JI2O 1IYDA 1CQIB 2ZGIA 3U55A 1YVWA 3AG3B 4TT3G 3MAQA 5EC1C 4JI0O 2QKSA 4F4YA 2XD4A 2DZDA 4DV3B 1IXBA 5DGBA 1SKVA 3SI8A 1XMOB 1JOYA 4I0XA 1TWAA 3AG1B 2P7TC 3TIGA 1IBKB 5KFUA 5EDWA 2W8KA 2HVJC 1RK5A 4J9RA 2ADQB 3PFFA 1HNXO 3MHHC 1RYSA 1G1XB 2P67A 4O4LF 3SYAA 2C2AA 5LGNA 2UVUA 4Q0YA 4MA5A 1XNQH 5T14A 2EJ0A 3U9SA 1XEQA 4QJFB 4ME6A 4DV2O 4R7CA 3RGXA 2ZE8A 2IU3A 3L74H 4HNAA 4I50A 5IY5C 1M0WA 3HXLA 4N21A 2EIJC 4A3FG 5J2UB 4NTXA 5FPRA 2JA7G 3TGUH 5IWAO 1V55C 2UUAH 4O7VA 2JVDA 1CPYA 2OCCC 3SE7A 3KHRA 2YIDA 4LF4B 2Y69C 5DN6G 5KG2A 2R8HA 3NR7A 4LFBO 1CQJB 5DLFA 1SA0A 4FBTA 5B5EZ 1DGSA 4HZ3A 5FPOA 3CC2V 3R23A 4O7SA 1PNLA 4LF8O 3TQ1A 5DMXA 2EIYA 2BQUA 1JVMA 3QQMA 4DW0A 2YI9A 3SPHA 1KU9A 3K08A 4QNHB 1GO3E 1BXRA 2BE3A 1HNZO 4X64H 5C8YA 5JCOC 3SJCC 1N32B 1KJQA 1M1KW 2QK4A 2JEGA 4B3MH 1M0TA 4EB6A 1RJRA 5IYDG 2Z0AA 4O7YA 4RB1A 2UU9B 5B1AB 2WLLB 3JAWB 5FLXN 4LP8A 4BBSG 3T1CA 3KALA 4CKEA 2R7NA 2UUBB 1P16A 2YC0A 4OX9O 2BOBC 1B06A 2YS6A 5BWVA 2A79B 4QWEA 4TVIA 3V4ZA 4TQSA 4YAKB 3ZN1A 1VBGA 3WNZA 4QWAA 1QVFU 3OSNA 5H6QA 1Q3EA 4YJ2A 3ICXA 3W7SA 2HJDA 5A2QW
chains in the Genus database with same CATH topology
1HNWB 2RGVA 3HKDA 4BW9A 2R70A 4GKKB 4UCTA 4CC5A 1YEWA 3S24A 5K1PA 2HIVA 4JI8B 4I55B 4JI5H 1M93A 4LF7B 1X4TA 2CW8A 3L2PA 3N2GB 3BPZA 3N40P 5FD5A 4JV5B 1VS0A 1T5EA 1J5EB 4JI4H 4CS2A 2HEPA 4I4TA 2HHHB 4JI8H 3CSXA 2F1MA 2ZNIA 1CKNA 4LF7H 4B3SH 4GYCB 3RYHB 4CC6A 4R7RA 3JAKB 3FMAA 1J5EH 3CVZA 3BAAA 4O4HA 5KHJA 4DV0B 5JJNB 4JYAB 4UCUA 3LMLA 5CB4A 4DV7B 2UXDH 4JI1B 3RYCA 4YHHH 2UXBH 5FLXW 4PZ8A 1HW7A 2E3CA 4DRXB 1S5JA 4JYAH 4DV7H 4RB3C 4JI1H 4TUYB 3A2FA 5ITZB 3KAKA 1TGOA 5J2TB 1JMKC 4UCSA 2PZSA 1M4UA 4IHJA 1A0IA 4DR6B 2FE3A 4CH6A 4DR4B 2F95B 1FFXB 4RB0A 4ZOLB 3B2EE 2O03A 2Q7HA 2XHBA 5BMVA 5LP6B 1TAEA 1Q8IA 2Q7EA 4BWAA 4X1YB 4D7SA 4LFAB 1WH2A 4FLXA 4M7EA 4DR6H 4UCOA 4O4JB 4O4LB 3THOA 1TUBB 5BR8B 1NT2B 3RGZA 1FJGB 2E5LH 4DK0A 4LFAH 3N41B 3U11A 4DV5B 3HKBB 4X66B 4WBNB 4FM1A 5BR8H 4KHPB 4ETSA 3N2KA 1FJGH 2CAZC 4EFBA 4O4IB 5LP6C 3JARA 3BABA 5EIBD 3BRCA 4X66H 5J2UA 2VQFB 3KXYT 1SYXB 1FKAH 1XNRB 5KMGA 4ZHQB 4TV9A 2CW7A 4ZIBA 3DSQA 2R72A 2UUCB 3RTXA 1Z2PX 1ZAUA 4CS3A 2VQFH 3JSNA 3VQXA 4AILC 1XNRH 4GKJB 2XIGA 5EOYA 3BHPA 1M5IA 2UUCH 3JALB 2HGSA 4LFCB 4O2AB 3F8NA 3RWRD 1L2ZA 3MWMA 1Q43A 4GKJH 3WB2A 1I94B 3U10A 3RYFA 4LFCH 3JAWA 4AQYB 1WPBA 3W1BA 4ZI7A 2HVSA 1Z2OX 4NVPA 5LYJB 3T1HB 1GYFA 5CA1A 2JS5A 1FVIA 2R9AA 4F6RB 1I94H 2UU9H 3U0ZA 1ZHSA 3HKCA 5LXTB 5LXTA 4AQYH 4LR3A 5DISC 3T1HH 3IAYA 1CKMA 2HIXA 1MZBA 3L4JA 2YIBA 4TV8A 4DV1B 4LF9B 4IIJB 4X62H 2ZJTA 1TVKB 2WYOA 3QG5A 4X20B 4JI3B 4JI7B 4CH5A 4D7TA 1I6UA 3SR2C 2ZIMA 4DV1H 4LF9H 3T1YB 1CKOA 1XMQB 1JJOA 4I55A 4JI6B 2VQEB 4LF6B 1HR0B 4JI7H 4EEQA 2P22C 1HNWH 3N2GA 4RAYA 5LOVB 5K1XA 5D1PA 3VNNA 3H20A 4GKKH 4LNUB 4DR7B 3OTFA 4YY3B 4LH7A 3T1YH 1D5AA 1XMQH 3K57A 5D5PA 5JH7B 4JI6H 1HR0H 5IJ0B 4DV4B 5IJ0A 4JV5H 3RYHA 4CS4A 3N42B 4DR3B 3JAKA 4DUYB 3TY8A 4DR7H 3KYHC 2HHHH 1BJTA 1S68A 2PYLA 4BWSC 4DV6B 4B3RB 1E4GT 4DV4H 4DR3H 4LH6A 2Q0AA 4DV0H 5IT9W 4K8XA 4DV6H 2GV9A 3FFQA 4DRXA 3JATB 3UT5B 2YI8A 4FM0A 4TUYA 5ITZA 5IYZB 3HKEB 5JVDB 5J2TA 4FM2A 1BGWA 1O9GA 4DR2B 1XI1A 4FLYA 5JQGB 1H2SB 4TQFA 2YIBD 2ZIOA 5IJ9B 5EYPB 2VWKA 4AHCA 1S03G 1SEIA 1FFXA 1TA8A 4ZOLA 5GONB 3OTOB 5KX5B 5LP6A 4JI2B 4DR4H 4X1YA 4O4JA 2BTQB 1AN7A 3RYIB 4O4LA 3K5OA 3RYIA 1TUBA 3JASB 3OTOH 3RIZA 2UXCB 5D5QA 4JI2H 1Z5WA 4X1IB 1N33B 3PN1A 3HKBA 4WBNA 5KHKA 2Q2TA 3E22B 2P5OA 4X65B 4MV7A 2UXCH 4O4IA 4DRFA 4DV5H 2QM4A 2KSWA 4YJ3B 2VPSA 2V4DA 4NXMB 4X65H 4KHPH 2ZNJA 4ZHQA 3NBZB 5KHGA 3J80W 3W1GA 4DV2B 2RGRA 1G6UA 4NXMH 1L8DA 4DUZB 4APMA 2KKWA 4I50B 5LMUB 2ZINA 2EX3A 3J7AK 3SJBC 4DK1A 2PY5A 5JJEB 3TY5A 4O2BB 4UCRA 3JALA 1Q5OA 4O2BA 4O2AA 4FLTA 1P49A 2BTOA 4K8ZA 5LMUH 4CH4A 2ZCEA 3M7MX 5LA6B 3J81W 3SJAC 1KMIZ 4PHZA 4FFBB 4X1KB 4LFBB 1SA0B 2OWOA 2HVRA 4X64B 5LYJA 3ETQA 1QHTA 5LMNB 4F6RA 1WNSA 1SQGA 5KHIA 1IBMB 5JJJB 1HNZB 3M4IA 3CB2A 3QTCA 4LSXA 4EB6B 5LMNH 2ZM6B 2JGUA 1Z5VA 4IIJA 5FNVB 3ZS8C 3K5MA 3VQYA 1IBMH 1XHXA 3GJXB 5D1OB 1TVKA 4X20A 3RR5A 1I7FA 1JFFB 3BA8A 2ZM6H 4OX9B 3RF2A 4LF5B 2IM9A 3N6XA 2OYQA 2F4VB 4JI3H 3CHXA 5CA0B 5LOVA 4U3JB 4LNUA 2QJ1A 4PZ7A 4J0MA 4LF5H 5JH7A 2VQEH 4I9QA 2F4VH 4LF6H 2PUSA 4YJ2B 4JI5B 4FLWA 4PZ6A 3EYYA 4RZQA 4B08A 4YY3H 3HKDB 2F66C 4K0KB 1XQ8A 1O75A 4JI4B 4IAJA 5EZYB 5EZYA 3BA9A 4B3SB 2HVQA 1SQFA 4DR1B 4DUYH 4K0KH 4UCVA 4I4TB 1P8LA 1CKNB 1XHZA 4B3RH 4FLVA 3K59A 3JSLA 3JATA 3UT5A 1E4FT 1V9PA 4DR1H 4MV9A 3RJ0A 2UXDB 5IYZA 4O4HB 3HKEA 5JVDA 4EQ5A 4NXNB 2WE6A 4YHHB 2UXBB 3N43B 4CH3A 5CB4B 5JQGA 4FLZA 5IJ9A 3RYCB 2YCHA 5EYPA 1XDNA 4NXNH 4DR2H 2PGGA 5GONA 1B04A 3K58A 5KX5A 3L4KA 1QQCA 4TQDA 3C0FB 3MAQA 2VOBA 4JI0B 2BTQA 5EIBC 3RFRA 2CFMA 3IG0A 2VUGA 4DV3B 2Q2UA 3JASA 4TOIA 1SKVA 4IHJB 4Q6GA 3GB8B 1XMOB 1WN7A 4E6NA 3DF7A 3WB1A 5KHHA 2F93B 5FD6A 4X1IA 1IBKB 3TY9A 4JI0H 3KAJA 3W5OA 3E22A 4DV3H 3LNNA 3K5NA 1XNQB 1HNXB 3NC0B 1XMOH 3QF7A 5BMVB 2W57A 4UFZA 2Q7GA 1N33H 1RSOA 3RGBA 2E5LB 2WDTA 1IBKH 4KL1A 4FVMA 4YJ3A 1O9HA 1N34B 4Q0YA 1XNQH 3VQVA 1HNXH 1N36B 4I7HA 4DR5B 4FM9A 4A2BA 3RGXA 1N34H 4RB2C 2PTMA 3N44B 4PI2A 4HNAB 1N36H 2UUAB 4HNAA 3N2KB 4I50A 1M0WA 3HXLA 1Z2NX 3JARB 4DR5H 3UQ8A 4DV2H 5J2UB 4DUZH 3GDEA 5FPRA 5LL6b 5JCOA 2RQ6A 5IWAB 1ZHQA 4MTEA 2UUAH 2JVDA 1XK5A 5KMGB 4TV9B 5LA6A 4LF4B 4FLUA 4FFBA 4X1KA 4EFEA 1SA0A 5IWAH 1DGSA 3K5LA 5FPOA 4LF8B 4B3MB 4GLXA 3SGIA 4HBNA 4LF4H 2YI9A 1KU9A 2PYJA 4LFBH 5C8YB 4X64H 3WB0A 5C8YA 2RJZA 3SJCC 5JCOC 1N32B 4LF8H 4B3MH 1M0TA 4EB6A 4L8JA 2VWJA 4RB1A 2UU9B 5FNVA 1IBLB 3RYFB 1HNZH 4PDBA 3JAWB 5D1OA 1N32H 4RAZA 1JFFA 4ZI7B 3KALA 4PI0A 4B3TB 2UUBB 1P16A 5CA1B 3ZEDA 2MCTA 2YXLA 3HKCB 4X62B 1IBLH 1VF7A 3K3VA 5CA0A 3NBYB 4B3TH 3VQWA 4U3JA 2UUBH 4OX9H 4TV8B 4LSAA 4A2AA 2YIAA 4MTDA 1Q3EA 3QWUA 1X9NA 4LMYA 4YJ2A 3JAMW 3ICXA 5A2QW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW B;  4GKK B;  4UCT A;  4CC5 A;  4DRF A;  1I94 B;  1XDN A;  3S24 A;  2HIV A;  4JI8 B;  4LF7 B;  4NXM B;  4AQY B;  3L2P A;  1B04 A;  3W1B A;  2HVS A;  4JV5 B;  3T1H B;  1VS0 A;  3NBZ B;  1J5E B;  1FVI A;  2HHH B;  4JI0 B;  1CKN A;  2CFM A;  4DV2 B;  3W1G A;  4DUZ B;  2VUG A;  4DV3 B;  2Q2U A;  4TOI A;  3GB8 B;  4E6N A;  1XMO B;  5DIS C;  5LMU B;  4CC6 A;  1CKM A;  2HIX A;  3BAA A;  4DV1 B;  1IBK B;  4LF9 B;  3TY9 A;  3TY5 A;  3W5O A;  4DV0 B;  4UCR A;  4JI3 B;  4JI7 B;  4UCU A;  4JYA B;  1XNQ B;  1HNX B;  3NC0 B;  4DV7 B;  4JI1 B;  4UFZ A;  2E5L B;  3T1Y B;  1CKO A;  1XMQ B;  4PZ8 A;  4JI6 B;  2VQE B;  1N34 B;  4LFB B;  2OWO A;  4LF6 B;  1HR0 B;  4EEQ A;  4X64 B;  2HVR A;  1N36 B;  5D1P A;  3VNN A;  4DR7 B;  4YY3 B;  4LH7 A;  5LMN B;  4DR5 B;  4UCS A;  1IBM B;  1HNZ B;  4DV4 B;  2UUA B;  4DR3 B;  4DUY B;  3TY8 A;  1A0I A;  3KYH C;  4DR6 B;  2ZM6 B;  1S68 A;  4DR4 B;  3UQ8 A;  3GDE A;  3GJX B;  4DV6 B;  5FPR A;  5D1O B;  4B3R B;  5IWA B;  3RR5 A;  1XK5 A;  3BA8 A;  1TAE A;  4LH6 A;  4LFA B;  4OX9 B;  4LF4 B;  4UCO A;  4LF5 B;  2F4V B;  4EFE A;  5BR8 B;  1DGS A;  5FPO A;  4LF8 B;  4B3M B;  4GLX A;  3SGI A;  1FJG B;  4PZ7 A;  4DV5 B;  4X66 B;  4JI5 B;  4DR2 B;  1N32 B;  4PZ6 A;  4KHP B;  4EFB A;  4K0K B;  4JI4 B;  3BAB A;  2UU9 B;  1IBL B;  5D1O A;  2VQF B;  1TA8 A;  3BA9 A;  4B3S B;  2HVQ A;  1XNR B;  3OTO B;  4DR1 B;  4B3T B;  2UUB B;  1P16 A;  4JI2 B;  4UCV A;  1P8L A;  2UUC B;  4X62 B;  1CKN B;  3RTX A;  1ZAU A;  3JSN A;  3JSL A;  3NBY B;  1V9P A;  2UXC B;  2UXD B;  4GKJ B;  1N33 B;  3PN1 A;  4EQ5 A;  4NXN B;  4YHH B;  3QWU A;  2UXB B;  1X9N A;  2Q2T A;  4LFC B;  4X65 B; 
#chains in the Genus database with same CATH topology
 1LNQ A;  4RNO A;  4EBE A;  1K7D A;  3FB6 C;  3S24 A;  1EBO A;  2HIV A;  2W9B A;  3OW2 U;  4LF7 B;  5LOV F;  2CW8 A;  3L2P A;  1R6K A;  5KFL A;  4DR1 O;  1VS0 A;  1J5E O;  2GLT A;  4DAA A;  2FPG B;  2C28 A;  1KKC A;  4JI8 H;  1JX9 A;  2X6A A;  4B3S H;  3T5H A;  3HO8 A;  3EFF K;  2CH7 B;  4PA3 A;  4CC6 A;  3FMA A;  3CVZ A;  3BAA A;  2Q5Z A;  4DL7 A;  4YHH O;  2UXB O;  5KS8 A;  3STL C;  1I7L A;  3J7A U;  5JJN B;  4JYA B;  1V51 A;  4UCU A;  2HG5 C;  2UXD H;  4DV7 O;  1NI8 A;  4JI1 O;  3HR0 A;  2JA5 A;  1Q7Y W;  3CSW A;  2Y4T A;  2R82 A;  1HW7 A;  2DOS A;  2E3C A;  4FJC C;  4C5A A;  1S5J A;  4RB3 C;  3CRQ A;  2ITC C;  4TUY B;  3KAK A;  1LR1 A;  3CRR A;  4X88 A;  1VQ4 V;  3QZ8 A;  3WG7 C;  1F4N A;  3D8C A;  5J2T B;  4F50 A;  5KLV H;  1DLB A;  2XND G;  3APQ A;  4R8U A;  2HHF B;  1EKV A;  1A0I A;  3PJS K;  4DR6 O;  4CH6 A;  4O7R A;  2CE4 A;  1AI4 A;  2A9H A;  1WAZ A;  1BCC H;  5KX5 F;  3B2E E;  1H38 A;  1AI7 A;  1VAR A;  4HNT A;  3IFX A;  2JS3 A;  1TAE A;  1Q8I A;  4BWA A;  3BFR A;  4LFA O;  3R5H A;  2MW2 B;  4YAJ B;  2R7K A;  3MR6 A;  1N34 O;  1K34 A;  3L70 H;  3OT7 A;  3ZX6 A;  2E2I A;  1AP5 A;  5KG5 A;  5BR8 B;  3LSS A;  2CNQ A;  4LWS B;  1NT2 B;  2WB1 A;  2PMZ E;  1FJG O;  2E5L H;  4G28 B;  3N41 B;  4QJF A;  4DV5 B;  4CKC A;  4WBN B;  4NZN A;  3R5F A;  1FKA O;  3I5D A;  4ETS A;  2CAZ C;  4YJ3 F;  5LP6 C;  4ICG A;  1NS1 A;  3BAB A;  2WLK A;  1AVM A;  4X66 H;  5J2U A;  3RVZ A;  4O3N A;  1M7J A;  1PP9 H;  1Q90 D;  4Q20 A;  2GSM B;  1YTF D;  3DSQ A;  2VQF H;  3JSN A;  3TJT A;  3TXS A;  4PBC A;  3VQX A;  1XNR H;  4FFP A;  3KKY A;  5KFC A;  1JQ0 A;  2FMA A;  4ASU G;  2FK1 A;  1GTO A;  1R3K C;  3BHP A;  1M5I A;  1TWH A;  4UV8 A;  2UUC H;  3L72 H;  5KFO A;  4LFC O;  3F8N A;  2ASD A;  3H1I H;  5LA6 F;  2R8I A;  4O3P A;  4IWX A;  2EIL C;  2M6Y A;  3AG4 C;  4Q8F A;  1K33 A;  2WLL A;  3JAW A;  2ZXW C;  4AQY B;  1AI6 A;  1Z2O X;  3LP8 A;  5L9X A;  4ECX A;  3T1H B;  1GYF A;  3I4N G;  4MTO A;  4N23 A;  4F6R B;  4JUZ A;  1VQ6 V;  2CNU A;  3G6B A;  1MZB A;  1F4M A;  3L4J A;  4A3B G;  1MG1 A;  2YYA A;  4IWY A;  1I5X A;  4X62 H;  1AJN A;  2R8J A;  1TVK B;  3CRA A;  5BY1 A;  2WYO A;  5KFT A;  4JI3 B;  1HNW O;  3HBL A;  3PR4 A;  2IJI A;  2W6I G;  1BHB A;  2FKL A;  4GKK O;  2C00 A;  3DGE A;  4LF9 H;  3T1Y B;  1Y76 B;  2LP7 A;  5KFJ A;  3TXQ A;  1XMQ O;  5CA0 F;  5BWW A;  4XX0 B;  3GVM A;  5I5S A;  3UFX B;  4JI6 O;  1GRJ A;  3MWE A;  3CWB H;  2Y0S E;  4EEQ A;  2P22 C;  5JVL A;  2ETN A;  3KRE A;  3ZBH A;  4BIU A;  3VNN A;  4NZM A;  1R9T A;  4LNU B;  4DR7 B;  4JAV A;  3JD2 A;  3AK3 A;  4YY3 B;  2HHH O;  4RCN A;  4IR1 A;  4BR6 A;  1P4R A;  5L1I A;  1ZTE A;  4DV4 O;  4JV5 H;  2P90 A;  1Q6I A;  5FL7 G;  2CH7 A;  4CS4 A;  1RPO A;  1OBD A;  1S68 A;  1M57 C;  2PYL A;  5KFD A;  4DV0 O;  4ED2 A;  4DV6 B;  1NU1 H;  3D36 A;  1VF5 B;  4XDL A;  3SYO A;  1FXK C;  2D2C B;  2YS8 A;  5CBF A;  1YI2 V;  1AB3 A;  4DR3 H;  5KFF A;  3ASN C;  3CCR V;  3BVO A;  2GPW A;  4BY7 G;  2GV9 A;  4U7O A;  1TWG A;  3FFQ A;  1IVS A;  3O65 A;  4O4H F;  1A9X A;  1GM8 A;  3K5I A;  4TUY A;  4YXW G;  2ODM A;  5IYZ B;  2NN4 A;  4NR1 A;  5J2T A;  4FM2 A;  1BGW A;  1WP8 A;  3CS5 A;  4TSF G;  3CE2 A;  3SPJ A;  5C4X G;  1XI1 A;  1KJI A;  2HHF A;  4IYI A;  5JUM A;  5JQG B;  4TQF A;  3HOZ G;  4DR4 O;  1MZE A;  4J80 A;  3RAX A;  1TUE B;  1TA8 A;  1S0V A;  2JIZ G;  1YIT V;  3RN4 A;  2UVW A;  2QM8 A;  4JI2 B;  1CEZ A;  3X2Q C;  1WRV A;  1NTK H;  4G2K A;  1Q81 W;  1BQZ A;  3SPI A;  3JAS B;  3T7A A;  3K3W A;  4LWS A;  3OTO H;  3ABK C;  3CME V;  1CP9 A;  1T3N A;  3PN1 A;  1X59 A;  2H8P C;  4WBN A;  2Q2T A;  4R6Z A;  2JGD B;  3JRW A;  4IR9 A;  4JAS A;  4KHP O;  1S97 A;  3JD1 A;  3A8T A;  2X6C A;  1RSO B;  2NU9 B;  3N6R A;  3T5K A;  3ABU A;  3VPB A;  3F7Y C;  2A06 H;  3ZIA G;  4J7J A;  2CTR A;  4X65 H;  2Q8V A;  2X0S A;  2OH2 A;  4PJ0 Z;  3WWH A;  2JK5 C;  3CCL V;  2GQR A;  3PW4 A;  2B5U A;  5HFL A;  3T9E A;  1QLE C;  2M05 A;  4A3M G;  5DGA A;  3W1G A;  4DV2 B;  4NXM H;  4J9Y B;  1L8D A;  4MTX A;  1Y1W G;  3HOW G;  2ZIN A;  5LMU O;  5CBH A;  4QE7 A;  2BCC H;  3ZHU A;  2PY5 A;  5F2V O;  5JJE B;  2DQ3 A;  3V6H A;  4O2B B;  2ZKO A;  1AIL A;  4TV9 F;  4MAM A;  1VQP V;  3DTG A;  3VMM A;  2WSS G;  4CH4 A;  2QWN B;  1K3E A;  2J6T A;  3M7M X;  3T9C A;  4FFB B;  4X1K B;  4GZR B;  4LFB B;  2OWO A;  2HVR A;  1KQS U;  2OIE A;  1YJN V;  3ETQ A;  2LJ2 A;  1QHT A;  5LMN B;  4F6R A;  1WNS A;  4RO2 A;  2EIK C;  5KHI A;  1ZUQ A;  3E8H A;  4I7Z B;  4R50 A;  4TWK A;  5JJJ B;  1HNZ B;  2J9G A;  2E2H A;  3LSU A;  2P4K A;  3H1J H;  5KG0 A;  1ZSP A;  5TIS Z;  3K5M A;  1K8A W;  3VQY A;  3GIQ A;  1XHX A;  1C30 A;  5D1O B;  1IBM H;  1TVK A;  4O3R A;  4JI7 O;  2ZDI C;  2IBZ H;  1JKJ B;  1I7F A;  1A0G A;  3FB5 C;  2DQ0 A;  1XL6 A;  2FLL A;  3SPG A;  2ZM6 H;  2CKZ B;  4OX9 B;  1Y76 A;  2V58 A;  4MTF A;  2QM7 A;  2N05 A;  2VQE O;  3RW0 A;  3JRX A;  4JZ2 A;  4NKG B;  3LUT B;  4TV8 F;  1XUQ A;  4LNU A;  1PD3 A;  1VQ9 V;  1I08 A;  1VQN V;  2F4V H;  2NUA B;  4LF6 H;  3EYY A;  5KFH A;  3PZP A;  4RAI A;  2XAS A;  3HKD B;  3FDS A;  1S77 D;  3RFC A;  1XQ8 A;  4K0K O;  3PO3 G;  2RDJ A;  1R73 A;  2OTJ V;  4DYL A;  3OSP A;  5EZY A;  4B3R O;  2XCA A;  3BG5 A;  4DR1 B;  4DUY H;  4RNN A;  3E35 A;  1KYO F;  4XYL B;  4I4T B;  3ZHR A;  4QWB A;  5IP7 G;  4IRD A;  4AI8 A;  3G6V A;  5K3W A;  4B7E A;  1V9P A;  5I5X A;  4MV9 A;  1EZJ A;  1J95 A;  5IYZ A;  3HOV G;  2EJR A;  1WA8 B;  2OT5 A;  4YHH B;  2UXB B;  3AG2 C;  3MHS C;  5CB4 B;  2J6S A;  5JQG A;  4GX2 A;  3RYC B;  1WCM A;  2YCH A;  1XDN A;  2NU8 B;  3H0G G;  1M56 B;  4DR2 H;  3T9D A;  3CC4 V;  2PGG A;  1WR2 A;  3TW6 A;  1B04 A;  2XT9 A;  3S3X A;  4H0L B;  1RYR A;  4J9Q A;  3FD9 A;  3IG0 A;  3JAS A;  1W93 A;  2XC9 A;  4IHJ B;  5E1A C;  1WN7 A;  1I5Y A;  2F93 B;  5FD6 A;  2HVK C;  3UCS C;  3W5O A;  4A3L G;  2JGD A;  5DAA A;  5LP6 F;  4W4L A;  4DV3 H;  4NYK A;  1XNQ O;  3QF7 A;  3NC0 B;  1XMO H;  2R86 A;  1N48 A;  3RB6 A;  4UFZ A;  4RUF A;  4MV1 A;  4FS2 A;  1N33 H;  1R3L C;  1RSO A;  2F43 G;  2I87 A;  1HDJ A;  1GSA A;  3ZN0 A;  2WDT A;  1IBK H;  2FB5 A;  4KL1 A;  2HDK A;  3AG3 C;  4EYH B;  3GTJ A;  4MVZ A;  1N34 B;  3GIM A;  1N36 B;  3AG7 A;  1B6R A;  2JEF A;  1OCO B;  1E1R G;  1EKP A;  4GCZ A;  4DR5 B;  1GLV A;  3SYQ A;  4A2B A;  4LCU C;  3KHG A;  3QO7 A;  5KAF Z;  4ECR A;  3N44 B;  4HNA B;  1VQ5 V;  4O4I F;  4ED8 A;  2UUA O;  1QR9 A;  1VF6 A;  1ENV A;  2ALZ A;  3ZMU A;  4DUZ H;  4FS1 A;  3W7U A;  2YRW A;  3H01 A;  3ZMV A;  1ZHQ A;  2GPS A;  2B63 G;  4JYB A;  4FLU A;  2Q7D A;  2YDE A;  3ETJ A;  4FFB A;  4X1K A;  4RU9 A;  1GM9 A;  4X64 O;  2FJZ A;  1DF4 A;  1Y1V G;  3ZCC A;  4GLX A;  4B3M O;  2HJF C;  3M9M B;  1EN4 A;  3PO2 G;  4LF4 H;  4WFG A;  4O2B F;  2XCL A;  1IX9 A;  2J6U A;  5C8Y B;  3WB0 A;  3CPW U;  1PV0 A;  2A1H A;  3T54 A;  4FFN A;  2NVX A;  4DL4 A;  4ED3 A;  2Z04 A;  3WO0 A;  1IBL B;  1E4E B;  3RYF B;  3LDC A;  1W0J G;  5D1O A;  5LYJ F;  2JA7 A;  1N32 H;  3K3P A;  4PI0 A;  4B3T B;  4JTC B;  1HP8 A;  4EEY A;  2E76 B;  2L35 A;  3HKC B;  4MA0 A;  5BWX A;  1VF7 A;  2EUL A;  2QSA A;  4NTY A;  5LHH A;  1EUD B;  3WO1 A;  4QIW F;  2UUB H;  3EXA A;  2YIC A;  3AEI A;  3OMA B;  3I12 A;  5B1A C;  3QWU A;  4M0J A;  4LMY A;  3JAM W;  3PR5 B;  3P32 A;  4UV9 A;  4MVU A;  1HNW B;  1GAX A;  3HKD A;  1WCM G;  2R70 A;  4GKK B;  5IE9 A;  2R84 A;  3UKM A;  1AUV A;  2ZDQ A;  4Z1V A;  4JI8 O;  4B3S O;  2DN9 A;  4PDV A;  5CBG A;  3N2G B;  3GTG A;  3N40 P;  2V4Q A;  1SFO A;  2JEI A;  3ABT A;  3VPC A;  5JH7 F;  1T5E A;  1OBG A;  4JI4 H;  4CS2 A;  2W9A A;  4I4T A;  3ZMS A;  2HHH B;  3TQT A;  2DYS C;  2ZNI A;  2F1M A;  4LF7 H;  4HYK A;  1AR4 A;  1Q6H A;  1OCC B;  2PBZ A;  1Q6U A;  1M9N A;  2EIN B;  3RBZ A;  2UXD O;  2RN9 A;  3ZHT A;  1KBL A;  1EFR G;  1I0H A;  4FGR A;  3SNO A;  5DQI A;  4DV0 B;  3LML A;  5CB4 A;  4PA6 A;  1VP7 A;  3WU2 Z;  5I60 A;  3RYC A;  5JWP A;  1FXH A;  1SES A;  1N8R W;  5EBM C;  2LW1 A;  4JTD B;  4JYA H;  4H13 B;  2SCU B;  1KJ9 A;  3WWI A;  5ITZ B;  1QVG U;  4UUJ C;  1JMK C;  5DG9 A;  5KFW A;  4R8U B;  5KAI Z;  1M4U A;  5CB4 F;  3D36 C;  1ET0 A;  4IHJ A;  4YB8 B;  4BY1 G;  4JPR A;  2R87 A;  3Q8R B;  4E4E A;  4CHI A;  4J7K A;  4DR4 B;  2F95 B;  5KFS A;  4ECT A;  2AHY A;  5B1O A;  3GV7 B;  5CE8 A;  2O03 A;  2XHB A;  3C90 A;  3VA7 A;  5CN0 A;  1RPR A;  1IOW A;  1WH2 A;  2E5L O;  4D7S A;  4FLX A;  2EJ7 A;  4O4J B;  3ZMT A;  3THO A;  1PL0 A;  4IHJ F;  4E4T A;  4O84 A;  1TUB B;  3MR3 A;  5DGI A;  2R9R B;  5IYC O;  3ZHV A;  1SZT A;  1XOU A;  1G4Y B;  1GM7 A;  3HKB B;  1JJ2 U;  4X66 O;  1BMF G;  4XYM B;  5F9L A;  5BR8 H;  2KQX A;  3DTU B;  4KHP B;  3CJH B;  4J11 A;  3HKZ A;  2V4R A;  4K6N A;  2NNU A;  2AQ4 A;  2VQF O;  1SYX B;  4J9S A;  3K79 A;  2KG7 B;  3G67 A;  4B7K A;  3LQS A;  4NB5 A;  1XNR O;  4ZHQ B;  3ABL C;  3GB7 C;  1VQL V;  4K3A A;  2CW7 A;  3E8G A;  4MV6 A;  3ASO B;  2R72 A;  1GSO A;  2UUC O;  3MJF A;  3UZB A;  4I50 F;  1BNC A;  4FFL A;  4MSW C;  2DYR B;  4MVQ A;  4PDR A;  4AIL C;  1L1F A;  1IUR A;  3U0G A;  4O7Z A;  4JV1 A;  3ZMZ A;  5KKN B;  4GKJ B;  5CR5 A;  5I5T A;  4I5S A;  5EOY A;  1VEW A;  2B1I A;  4HNV A;  2HFE C;  3EVK A;  2C2D A;  2HGS A;  5BWU A;  4KFM A;  4O2A B;  1L2Z A;  1EYZ A;  1R6T A;  5HNE A;  3WB2 A;  2ZDG A;  3CXH F;  1I94 B;  3U10 A;  1E4E A;  3RYF A;  3CCE V;  1RK6 A;  4TQR A;  2CGO A;  1WPB A;  4HN2 A;  3W1B A;  4ECV A;  2HVS A;  5B1B C;  4J7Z A;  4NVP A;  1US6 A;  1FVI A;  4O81 A;  4E2L A;  2P06 A;  3U0Z A;  5C8Y F;  3C3S A;  4X62 O;  3HKC A;  4EYI B;  4AQY H;  4C2M A;  4LR3 A;  5DIS C;  3KZI Z;  4XDJ A;  3T1H H;  4X9Q A;  4FBU A;  2DPI A;  2PN1 A;  2YIB A;  4DV1 B;  3IJ4 A;  2GUZ B;  4IIJ B;  4LF9 O;  2W6Q A;  4O3O A;  3I55 V;  2ZT9 B;  4JI7 B;  4D7T A;  1I6U A;  5L3F A;  1HWY A;  4D6T H;  3SR2 C;  2DAB A;  2JEJ A;  2FK2 A;  5I5W A;  3GV5 B;  2VQE B;  1HR0 B;  1EZ1 A;  1E79 G;  3N2G A;  4RAY A;  5H9C A;  4JV5 O;  4P9O A;  3B09 A;  4X8A A;  5B3S B;  3OTF A;  1MNG A;  4R8C A;  2IMW P;  4YJ2 F;  3T1Y H;  1D5A A;  3D3Q A;  5KFQ A;  1KB9 F;  3CCU V;  1H8E G;  3PW0 A;  2HJW A;  5IJ0 A;  4MVO A;  1BE3 H;  2WA3 A;  2CDY A;  2YXY A;  1AUX A;  4DR7 H;  4DR3 O;  1BJT A;  5H80 A;  1CE8 A;  4RQF A;  4BWS C;  3DC6 A;  4B3R B;  2HKO A;  4MW8 A;  4ED1 A;  1FFT B;  1GN3 A;  3P30 A;  4MW3 A;  4LH6 A;  5HV6 A;  2DE0 X;  5IT9 W;  4DV6 H;  3G4S V;  2ADP A;  5KFK A;  5IDJ A;  4A93 G;  1EZV H;  3JAT B;  2VQD A;  5ITZ A;  4JGS A;  2G38 A;  5JVD B;  2Z02 A;  1N0N A;  2UXN A;  1SF9 A;  4CMD A;  2AGQ A;  2ZIO A;  5IJ9 B;  3T5J A;  1PL4 A;  5EYP B;  2VWK A;  5A9G A;  4J10 A;  3QNE A;  1S03 G;  1THZ A;  1SQP H;  3CRM A;  5GON B;  2D3O W;  5BYA A;  3OTO O;  4YP3 A;  3HOX G;  1KP3 A;  1PKX A;  4O4J A;  2BTQ B;  3FYI B;  2OCH A;  1GMG A;  3K5O A;  3RYI A;  2IBK A;  1TUB A;  3ZRW B;  3CRC A;  2LFS A;  4YBZ B;  1H2G A;  2Y4R A;  4JI2 H;  4X1I B;  4MV8 A;  3HKB A;  3ORR A;  5KHK A;  1C3O A;  3B8M A;  4X65 O;  1I1M A;  3CJH A;  3RBD A;  1Y4M A;  2QB5 A;  3HB9 A;  3CCM V;  2V4D A;  5K2M A;  4NXM O;  2EBO A;  2KG7 A;  2Q73 A;  2Q4P A;  5BYB A;  4J9N A;  1EKF A;  4ZHQ A;  1YXB A;  2BSK B;  1K4D C;  2AGA A;  3S3W A;  5C3E G;  4F4W A;  3BY6 A;  2KKW A;  3VBB A;  3GTL A;  2DAA A;  5J2U F;  4WCE V;  4ECW A;  3JZI A;  3T2M A;  1DV2 A;  3TY5 A;  3L73 H;  4UCR A;  2JEX A;  4FLT A;  1Y74 B;  4O2A A;  1P49 A;  2YRX A;  4J9K A;  5LGT A;  1QBZ A;  2UVR A;  3TEK A;  1JA8 A;  3J81 W;  2H94 A;  4PHZ A;  3CEI A;  1T36 A;  1DIK A;  4PV1 B;  4X64 B;  1CXZ B;  1R6N A;  2X5R A;  5BWR A;  3CB2 A;  3QTC A;  1G8M A;  1Y1W A;  4LSX A;  5LMN H;  2ZM6 O;  3B40 A;  1Z5V A;  2GUZ A;  4IIJ A;  5FNV B;  2R9I A;  3K03 A;  1DV1 A;  4O86 A;  1AJQ A;  4O83 A;  3FYE B;  3IN5 A;  3H4D A;  1ZET A;  2OLS A;  2ILM A;  3FX7 A;  3RF2 A;  1KC8 W;  4LF5 B;  3W7T A;  2F4V O;  4LF6 O;  3F5W C;  2XAG A;  2RDI A;  3ZJZ A;  1IZ3 A;  2Y4U A;  3E89 A;  5HBR B;  4UXN A;  1I50 A;  1W2B U;  1JCH A;  1VQK V;  3QVN A;  4PEL A;  4Q44 A;  4Q43 A;  3GQC A;  3DXR B;  1FPO A;  3AK2 A;  2Y48 A;  1JXL A;  4PZ6 A;  2VPQ A;  1VBH A;  4B08 A;  4DUY O;  2QDO A;  1OWT A;  2PI5 A;  4IAJ A;  3BQ0 A;  5EZY B;  1EN5 A;  4B3S B;  1SQF A;  1S10 A;  2V59 A;  2HP8 A;  2QKA A;  1XBL A;  3GWO A;  3OFN G;  4DW1 A;  5CM0 A;  3KTM A;  1CKN B;  1XHZ A;  3J80 N;  1H2M A;  2KSD A;  4H33 A;  1KJ8 A;  1GKF A;  3JAT A;  3BQ2 A;  4DR1 H;  1JLL B;  1ARO P;  2UXD B;  5E79 Z;  5JVD A;  5AG2 A;  4NXN B;  4WHX A;  2WE6 A;  1PNK A;  4DR2 O;  5DG7 A;  4A5U B;  1ROP A;  3MFI A;  2Y0I A;  3K04 A;  1H2L A;  4FLZ A;  5DQH A;  5IJ9 A;  1YTF B;  5EYP A;  1V54 B;  4JYC A;  1KUQ A;  2YZL A;  2YU9 A;  5GON A;  4TUY F;  2W6M A;  3GIJ A;  1A48 A;  5J2T F;  4YIP A;  2XAJ A;  3L4K A;  1M90 W;  3C0F B;  1ZWI C;  3TCU A;  2BTQ A;  5EIB C;  3RFR A;  4JI0 B;  2CFM A;  2VUG A;  3M9O B;  2Q2U A;  5KT2 A;  4DV3 O;  4TOI A;  3ZRW A;  4QWC A;  4Q6G A;  3GB8 B;  4E6N A;  3H40 A;  4RQE A;  1XMO O;  3ABM B;  5KHH A;  3WB1 A;  2UXC O;  1N33 O;  4OGQ B;  4X1I A;  2R7L A;  1IBK O;  3M9N B;  1VKZ A;  2NU7 B;  1FAF A;  2FLN A;  3OEE G;  1HNX B;  5LGU A;  1YCI A;  2Q7G A;  4OPA A;  3RGB A;  3SJQ C;  2E5L B;  4YQW A;  4ED0 A;  3H0G A;  5KFR A;  3KHL A;  4A3G G;  1SZX A;  4JAU A;  1KBH A;  3VQV A;  4H44 B;  5C5J A;  5LL6 Y;  4WBN F;  2BSK A;  4I7H A;  4FM9 A;  5H6R A;  3JD0 A;  4F4Z A;  3Q4H B;  1N34 H;  4DUZ O;  4FIP C;  4RB2 C;  2PTM A;  2PMZ A;  4PI2 A;  1SQB H;  1KKD A;  1N36 H;  1LUV A;  3N2K B;  4F6E A;  1Z2N X;  1RJQ A;  5L3G A;  3D3I A;  1MAB G;  4MS2 A;  4DR5 H;  1YDX A;  1UJW B;  4RWU A;  3ZHS A;  1Y74 A;  5JCO A;  2RQ6 A;  5IWA B;  4NYE A;  2EIL B;  4QGP A;  5KMG B;  2FB9 A;  2CQY A;  4A3J G;  4LF4 O;  1OCO C;  4P9P A;  2CNV A;  2ZXW B;  3R65 A;  3K5L A;  3LSQ A;  4LF8 B;  1U97 A;  4MVR A;  5BPH A;  4HBN A;  2FL4 A;  2PYJ A;  4DL2 A;  2EIM B;  3QO5 A;  4O7T A;  4QIW E;  5KT6 A;  5KG3 A;  4GT1 A;  4L8J A;  2WAQ E;  1VQ7 V;  5FNV A;  2QWR B;  4PDB A;  2RCV A;  1BHA A;  4RAZ A;  2B63 A;  2ZE7 A;  2UUB O;  2ZE6 A;  2MCT A;  1IBL H;  4X62 B;  4QSH A;  3KCX A;  4ECY A;  1N56 A;  1Y1V A;  1PNM A;  3FB7 C;  4B3T H;  3TK1 A;  4LSA A;  3JD4 A;  4A2A A;  3DXR A;  3UZO A;  4FPP A;  1GN4 A;  1DF5 A;  4Q4D A;  5KG1 A;  1SCU B;  2Z3Y A;  5BZB A;  2VS0 A;  4UUG A;  4M9U A;  4BW9 A;  4UCT A;  4CC5 A;  4JI4 O;  1YEW A;  1ZX3 A;  5K1P A;  4FU0 A;  4JI5 H;  1B3Q A;  1M93 A;  2C2R A;  2ZD9 A;  3CC7 V;  1FXK B;  3L75 H;  4WFA V;  1XRE A;  3SYC A;  4JV5 B;  1J5E B;  1OCZ B;  2HEP A;  1S76 D;  2ABJ A;  2Y0S A;  3CSX A;  1CKN A;  2XGP A;  2RNB A;  4IGG A;  3G6Y A;  4QW8 A;  1UC9 A;  5KFN A;  3RYH B;  3PVX A;  4R7R A;  3JAK B;  3T5L A;  3DTF A;  5EZY F;  4OPH A;  2W0F C;  3PW5 A;  4WFB V;  1IOV A;  1NVP D;  4DXW A;  3Q1K A;  4DV7 B;  1Q82 W;  4JI1 B;  2R7Z A;  1MA1 A;  1A3G A;  3H9V A;  2AHZ A;  4PZ8 A;  2FLP A;  4P30 A;  5EC2 C;  4DRX B;  3CCQ V;  5IYZ F;  1OCC C;  2W6Z A;  4ECZ A;  4IL6 Z;  3VPD A;  3A2F A;  2EIN C;  2XAQ A;  4Z2W A;  2ATL A;  3GTK A;  3SDL A;  2IP4 A;  5JQG F;  4UVC A;  1I2K A;  4ZBM A;  3ABK B;  2W7O A;  4DR6 B;  3U9T A;  2FE3 A;  3AYH B;  3K0G A;  1BZK A;  4RB0 A;  1R3I C;  2WPD G;  1QNM A;  2Q0O C;  4TM5 A;  3NGD A;  3V6J A;  4LFA B;  4M7E A;  2YXH A;  4X1Y B;  5JQW A;  2VRZ A;  4O4L B;  3G8D A;  1FYJ A;  5KFB A;  3TIN A;  1R3J C;  1FJG B;  1FS0 G;  3AG1 C;  4DK0 A;  4NZO A;  3H4B A;  4FFK A;  3VOU A;  3LDE A;  3Q4H A;  3P3P A;  4FM1 A;  4ED6 A;  2VA2 A;  1K92 A;  3HKZ E;  1RP3 B;  5IYB O;  5A2Q N;  3N2K A;  4JXU A;  3G6E V;  1Y14 B;  3FKS G;  3OE7 G;  5DM6 V;  2AGP A;  1P7G A;  4YR3 A;  2HR3 A;  2R8K A;  1URF A;  3KXY T;  2CZG A;  2R6F A;  1K73 W;  5KMG A;  2ITD C;  1KD1 W;  1A32 A;  3K0D A;  2Q68 A;  3RTX A;  4DL5 A;  4L87 A;  3OMI B;  2YEV B;  2DIK A;  2QYZ A;  3EPG A;  3BQ1 A;  5LHI A;  4DL6 A;  3V6K A;  4KXR A;  2R85 A;  3CCV V;  4LFC B;  3MWM A;  1SER A;  2DMX A;  4GKJ H;  1DAA A;  4UVA A;  4F4L A;  4PA9 A;  2IH1 C;  4ECU A;  1NTZ H;  4AQY O;  2DYR C;  1ZQ7 A;  3T1H O;  3GTM A;  1KTA A;  4FZ1 A;  5KFI A;  4J9M A;  2R9A A;  3WFV A;  1I94 H;  1WPX A;  2UU9 H;  1S0O A;  1PPJ H;  2IU0 A;  5LXT A;  3T9B A;  1NVP B;  3Q8S B;  2HGW A;  1YF2 A;  5KFA A;  5KFP A;  2GBO A;  3IAY A;  4C5B A;  4G27 B;  2CUG A;  2LGQ A;  3HB3 B;  1SRY A;  3QG5 A;  4X20 B;  3KCY A;  4RNM A;  2MK3 A;  3AK1 A;  2R7Z G;  2OIG A;  4MV4 A;  2QR4 A;  3Q8P B;  4L1K A;  4MVS A;  3BJY A;  2ZIM A;  2YSU B;  4DV1 H;  1CKO A;  3T1Y O;  1XMQ B;  1ULZ A;  4EG0 A;  4JI6 B;  1Y66 A;  2ASJ A;  4LF6 B;  4JI7 H;  1FXK A;  1Q86 W;  2A0L A;  5LOV B;  5D1P A;  4DR7 O;  3GWK C;  1OZ0 A;  2COI A;  5D5P A;  1JDE A;  3OAA G;  5C1O A;  1HR0 H;  5IJ0 B;  4DV4 B;  2VUM G;  2W8L A;  3N27 A;  1BSM A;  1BGY H;  3RYH A;  3P3N A;  3JAK A;  4DUY B;  3TY8 A;  4EKW A;  4MVM A;  3KYH C;  2WAM A;  2ZR3 A;  1YZB A;  4PA7 A;  3AG2 B;  5BPF A;  1TWF A;  2LQT A;  4I4T F;  4LC1 A;  4IZO A;  1I3Q A;  3MFH A;  2C2E A;  2Q0A A;  2WWW A;  4K8X A;  4BW5 A;  5EWG A;  4DRX A;  1NR7 A;  2W6J G;  5KFX A;  3GIK A;  3UT5 B;  5IYC G;  1OV9 A;  4HNU A;  3M99 B;  3T99 A;  4AYB A;  3HKE B;  5KFY A;  3T4D A;  3RV3 A;  3EHB B;  1EN6 A;  3CD6 V;  4EBD A;  4DR2 B;  2R92 A;  3GTP A;  3CXC U;  1NKD A;  3MR2 A;  4Y8V B;  4FLY A;  1KUT A;  2R93 A;  4FK5 C;  2WLJ A;  1NJI W;  5L1K A;  4AHC A;  3T9F A;  2W6P A;  4JF3 A;  2CTP A;  2W70 A;  3PW2 A;  4JAA A;  1N0J A;  5KX5 B;  1P84 F;  2M7W A;  4X1Y A;  1VAJ A;  2WB1 E;  4J9Z B;  1SQQ H;  4P2Z A;  1OCR B;  4O4L A;  3RYI B;  5EWE A;  2NU6 B;  2YZM A;  1JX4 A;  3H3V H;  3RIZ A;  2UXC B;  3FB8 C;  2AU0 A;  1N33 B;  2IJH A;  3MWD A;  3E22 B;  2CK3 G;  2P5O A;  3HOU G;  4U6P A;  4MV7 A;  2V9W A;  1SQX H;  3ETH A;  4DV5 H;  4A3I G;  2KSW A;  3OD4 A;  4YJ3 B;  2DPJ A;  1PM9 A;  2XUM A;  2CTW A;  4J9P A;  1S9F A;  3DC5 A;  5CMU A;  2PI4 A;  1JIH A;  3HT5 A;  1CS0 A;  5KHG A;  4JV0 A;  5H2F Z;  2RGR A;  4DUZ B;  2IJJ A;  3GV8 B;  4APM A;  4WFF A;  2YEV A;  5LMU B;  2EX3 A;  1BQ0 A;  3OR7 C;  4Q45 A;  3ZRX A;  2QWO B;  3CCJ V;  2B9Z A;  5BXZ A;  2V5A A;  2WLI B;  2BTO A;  4HR7 A;  1MMM A;  2H3O A;  2ZCE A;  3APO A;  2WLM A;  5LA6 B;  1KMI Z;  5KFE A;  1RM1 B;  2ZDI A;  2RF4 A;  2AZ2 A;  2DLN A;  1PX2 A;  4EGQ A;  3MD0 A;  1ZL8 B;  5KG7 A;  2AZ0 A;  4K35 A;  2W9C B;  4QW9 A;  1XIL A;  5LMN O;  2JA8 G;  2Z5U A;  1B33 N;  4C7U A;  1K9M W;  5DGH A;  2ATK C;  4U7N A;  3H1K H;  4C5C A;  2NLJ C;  5KT7 A;  2XAH A;  3ZS8 C;  3SPC A;  1PK8 A;  3GJX B;  4X20 A;  4KUM A;  3RR5 A;  5DQG A;  1JFF B;  2EZO A;  1AR1 B;  4GC7 A;  3BA8 A;  4U3F H;  1NTM H;  3IC7 A;  3GID A;  2VA3 A;  2WA4 A;  1W96 A;  1OHH G;  4JI3 H;  3G8C A;  5CA0 B;  3GIL A;  3RVY A;  5LOV A;  4U3J B;  1K1S A;  3E86 A;  2QJ1 A;  4PZ7 A;  2GHY A;  2DYS B;  1QU7 A;  2YL2 A;  4LF5 H;  1F23 A;  2PUS A;  2R92 G;  4J42 A;  1YJ9 V;  5FJ8 G;  3RB0 A;  4RUC A;  2UVV A;  3MR5 A;  3NXS A;  4YY3 H;  2R93 G;  2F66 C;  5IYD O;  4K0K B;  1O75 A;  4JI4 B;  4A3C G;  3BA9 A;  2HVQ A;  3OGC C;  1B6S A;  5C93 A;  4A3D G;  1AJP A;  2KB1 A;  1OJH A;  2W71 A;  2DWD C;  4UCV A;  1GGO A;  4XBF A;  1P8L A;  1ORQ C;  1JDB B;  2WLH A;  1JPX A;  5H5N A;  1NBM G;  3A0B Z;  3JSL A;  3UT5 A;  3K9A A;  1E4F T;  3CX5 F;  2HLD G;  3L9D A;  2XTA A;  4O4H B;  3CQZ A;  3HKE A;  2L6L A;  4EQ5 A;  3N43 B;  5J9P C;  4YIO A;  3OGI B;  2NR5 A;  4OXS A;  1UC8 A;  3OEH G;  1YSC A;  1KEE A;  2FK3 A;  4I9W A;  4BBR G;  4NXN H;  4J9O A;  2C22 A;  1EHI A;  3RT3 C;  3W7X A;  2Q69 A;  3AW8 A;  1H2K A;  5KX5 A;  4TQD A;  1M6V A;  1BL8 A;  2QA4 V;  2VOB A;  3JZF A;  2GTA A;  3B77 A;  3LDD A;  5DED A;  3HPL C;  5KT5 A;  3DF7 A;  2GTS A;  3TY9 A;  2B1G A;  4JI0 H;  3KAJ A;  1V54 C;  4DLK A;  3E22 A;  2C35 B;  3LNN A;  3K5N A;  1XNQ B;  5IY5 B;  5BMV B;  4O4J F;  2W57 A;  2P6J A;  2EIJ B;  3K06 A;  3Q8Q B;  4KP4 A;  4FVM A;  4YJ3 A;  2I8C A;  1O9H A;  1V55 B;  1SQV H;  4EGJ A;  2OCC B;  4YR2 A;  4FFR A;  1HNX H;  1N36 O;  4FE2 A;  1GN6 A;  3ABL B;  2Y0P A;  2WTF A;  2Y69 B;  3ABM C;  4RUA A;  4DR5 O;  1AR5 A;  3GTO A;  2UUA B;  4CMF A;  2YZG A;  4Z1M G;  4QE9 A;  1AP6 A;  3JAR B;  2Q67 A;  3UQ8 A;  2ZQM A;  4DV2 H;  2XGQ A;  3GDE A;  2JJ2 G;  4ZHQ F;  5LL6 b;  1H8H G;  1VQ8 V;  2WLI A;  4MTE A;  5GTI Z;  1XK5 A;  4HYO A;  5I47 A;  4TV9 B;  5LA6 A;  3E2E A;  5KT3 A;  1QR8 A;  2P0A A;  4EFE A;  2DW4 A;  3RUP A;  1VMG A;  5IWA H;  1G2W A;  1JR9 A;  3AX6 A;  1DTO A;  4GLW A;  5L1L A;  5B1B B;  4B3M B;  1LUW A;  1ZL8 A;  3SGI A;  1E1Q G;  3EPI A;  1VF6 C;  2W9C A;  2ZE5 A;  1K83 A;  4O2A F;  2IA6 A;  2CGN A;  5KUM A;  4LFB H;  3R5X A;  1IBM O;  3VOT A;  2RJZ A;  2W0X A;  1UPG A;  4LF8 H;  1QCE A;  3TW7 A;  3I56 V;  2VWJ A;  3STZ C;  1IBL O;  2IW5 A;  2BQ3 A;  1HNZ H;  1S5H C;  4RZR A;  4JTA B;  4WF9 V;  1JFF A;  4ZI7 B;  3G80 A;  3BEH A;  5B1N A;  4B3T O;  2W6O A;  5CA1 B;  1GSH A;  2W6N A;  3ZED A;  1FXV A;  4BAY A;  4JV2 A;  2I80 A;  2YXL A;  3PW7 A;  1U96 A;  2EIM C;  3K3V A;  1K4C C;  1GO3 F;  2X6B A;  5CA0 A;  2W7P A;  3NBY B;  3VQW A;  3K5H A;  1MSD A;  4U3J A;  4GX5 A;  4IIJ F;  4OX9 H;  4TV8 B;  1EM1 A;  1KC7 A;  2ASL A;  2YIA A;  4MTD A;  1X9N A;  2FPI B;  4JI5 O;  3ZRV A;  1BT8 A;  3OHB A;  2Q6A A;  2YWV A;  2RGV A;  4JZG A;  2JA5 G;  4WD3 A;  5I5U A;  4JI8 B;  4I55 B;  3RB3 A;  2LGW A;  3N8D A;  1X4T A;  2ARH A;  2QWP B;  2Q9L A;  4NTW A;  5KFG A;  3BPZ A;  3ETG A;  5FD5 A;  4Q8E A;  3T4Z A;  2EZP A;  4WFE A;  1S3J A;  3QO8 A;  1SET A;  4GYC B;  3ORQ A;  3UO2 A;  1J5E H;  3WG7 B;  3FAV B;  4O4H A;  5KHJ A;  4O82 A;  3RV4 A;  2ODT X;  4H37 A;  1S72 V;  2NVY A;  1GN2 A;  2HGX A;  1MZF A;  2BOC C;  3CYO A;  5KA6 A;  4YHH H;  1OCZ C;  2UXB H;  4PDL A;  5FLX W;  5IP9 G;  5E25 A;  1W0K G;  3V4S A;  5JVD F;  4DV7 H;  3RBE A;  4JI1 H;  1FD9 A;  3B4S A;  4ECQ A;  1TGO A;  5I5V A;  3JYC A;  4UCS A;  3JCU Z;  2PZS A;  4O7N A;  5GW7 A;  1SC5 B;  1GK9 A;  5C1P A;  2R8G A;  3ML0 A;  2V1D A;  2PF4 E;  3UYY A;  4FFO A;  5GON F;  1M56 C;  1FFX B;  4IYH A;  3CEB A;  4FMT A;  4ZOL B;  3KHH A;  4U7C A;  2AGO A;  2Q7H A;  5FLM G;  3FKI A;  5BMV A;  5LP6 B;  2Q7E A;  4DR6 H;  4PDM A;  1Y67 A;  4UCO A;  1TWC A;  3W7W A;  5KA5 A;  2XOK G;  2ZDH A;  3RGZ A;  1R1B A;  4ABM A;  5L3B A;  4LFA H;  3ETE A;  2QEX V;  3T9A A;  3U11 A;  3LWB A;  3ZHQ A;  4X66 B;  1SS3 A;  4RUE A;  5BMV F;  4GX1 A;  3JAM N;  1MOF A;  2F23 A;  1FJG H;  4GUN A;  1RFY A;  4O4I B;  4EFB A;  3JAR A;  5EIB D;  3BRC A;  2FTK A;  1IXM A;  2HG8 A;  5L3D A;  4YR0 A;  2VQF B;  1FKA H;  4QWD A;  5GTH Z;  1XNR B;  1IDS A;  4HAM A;  4TV9 A;  3AG4 B;  4ZIB A;  2E74 B;  1WSC A;  2IJK A;  5I5Y A;  2UUC B;  5L3C A;  1Z2P X;  2P4V A;  1ZAU A;  4CS3 A;  5BWT A;  5D8D A;  4A3E G;  2JEU A;  2UXX A;  2N04 A;  3K9S A;  2QGN A;  4GKJ O;  1IYE A;  2XIG A;  5KFM A;  2DWE C;  3OUZ A;  3JAL B;  4PA4 A;  1N32 O;  2JA6 A;  3RWR D;  4IRK A;  1Q43 A;  3QFF A;  4PWQ A;  1F7Y A;  4Q4C A;  2O57 A;  3IC9 A;  2UU9 O;  1I94 O;  2YZN A;  4O3S A;  4MV3 A;  2QKC A;  1N4C A;  4LFC H;  3E83 A;  1QLN A;  4ZI7 A;  5FR9 A;  3E8F A;  3UM7 A;  5LYJ B;  1EUC B;  1D2D A;  5CA1 A;  2JS5 A;  1ZHS A;  2X0L A;  5LXT B;  3BAC A;  3H1L H;  5FNV F;  3G71 V;  1CKM A;  2HIX A;  4TV8 A;  4DV1 O;  4LF9 B;  1BS3 A;  3RAQ A;  4MTG A;  4DIM A;  1S0M A;  4ZI7 F;  3OR6 C;  2ZJT A;  4PD4 F;  3O9O A;  4CH5 A;  3OUF A;  1YJW V;  5CA1 F;  4G3I A;  2CTQ A;  2FKX A;  4ZKI A;  1M57 B;  5KT4 A;  1JJO A;  4I55 A;  4LF7 O;  4ED7 A;  3F5T A;  5DLG A;  1HNW H;  1HR0 O;  1KJJ A;  5L1J A;  1GH6 A;  5K1X A;  3TII A;  3H20 A;  4GKK H;  1I2L A;  2JJ1 G;  3ASN B;  4LH7 A;  2COJ A;  1XMQ H;  5KG4 A;  2XAF A;  4UB8 Z;  3K57 A;  5JH7 B;  4ZQI A;  4GC6 A;  4JI6 H;  3M8A A;  3LNM B;  3NUA A;  2K9P A;  2DJV A;  1Y6X A;  4QPJ A;  3N42 B;  4DR3 B;  1WB8 A;  5DG8 A;  4I55 F;  3FAV A;  2QWQ B;  1T94 A;  2HHH H;  1I1K A;  4X89 A;  1NR1 A;  1H2N A;  2BR0 A;  1WB7 A;  4JYA O;  1P7B A;  1E4G T;  4DV4 H;  2X7R B;  3FKI G;  1MSW D;  4ECS A;  4XDK A;  3ETD A;  1KP2 A;  1V4Y A;  2R7M A;  4DV0 H;  3G6X A;  1NQT A;  2A3Q A;  3OMN B;  4AYB E;  3F7V C;  1KT8 A;  2YI8 A;  4FM0 A;  3X2Q B;  3LUL A;  5EK0 A;  1O9G A;  2VUM A;  5IYB G;  2V7Q G;  1I1L A;  1H2S B;  5LBQ A;  4F4X A;  2YIB D;  3H1H H;  3CMA V;  3QZ7 A;  4DL3 A;  4IRC A;  1SEI A;  1FFX A;  2YUA A;  4ZOL A;  1NZ6 A;  3OUS A;  1YIJ V;  2WLN A;  4EBC A;  2QTS A;  4QPK A;  2RMK B;  4FZ0 A;  3OTO B;  3IGA C;  5LP6 A;  4LBE C;  1UFI A;  4DR4 H;  2DWC A;  3Q2O A;  4A3K G;  1AN7 A;  1RJP A;  1VQO V;  5BR8 O;  3R9R A;  5HFM A;  2QE7 G;  4CE5 A;  1XDC A;  4I0X B;  5D5Q A;  4CKB A;  1QLE B;  1Z5W A;  2IH3 C;  4DV5 O;  4ZOL F;  3JZ6 A;  1NH2 D;  2JA6 G;  1K5S A;  4X65 B;  2N74 A;  3OHA A;  2UXC H;  4O4I A;  4DRF A;  3GII A;  2QM4 A;  1B6Q A;  2VPS A;  4JYY A;  4NXM B;  3I4M G;  1OCR C;  1F51 A;  3U54 A;  3UO3 A;  5L3E A;  4BIZ A;  1UNN C;  2ZNJ A;  4KHP H;  2YS7 A;  3NBZ B;  2FP4 B;  3R66 A;  3J80 W;  1G6U A;  3BCC H;  3CP1 A;  1WLE A;  2XCP A;  1AI5 A;  1WP7 A;  4I50 B;  3J7A K;  3SJB C;  4DK1 A;  2EIK B;  3TET A;  1VIB A;  3JAL A;  1Q5O A;  4O2B A;  1VQM V;  3L71 H;  1D5N A;  1ZLZ A;  1COW G;  4K8Z A;  5LMU H;  5CA3 A;  4HQ6 A;  1DK1 A;  3ASO C;  1K97 A;  3SJA C;  1W59 A;  2RDC A;  5KFV A;  2GQS A;  4O7L A;  5IT9 N;  1SA0 B;  2ZR2 A;  4MT8 A;  5CAE B;  3E5N A;  4BIO A;  3JD3 A;  5LYJ A;  2COG A;  5F9N A;  5KG6 A;  3HOY G;  1SQG A;  1IBM B;  2PVP A;  2LW7 A;  5EWF A;  3M4I A;  3GTQ A;  4CBC A;  1L0N H;  3OM3 B;  4EB6 B;  3GLK A;  4DO2 A;  1S0N A;  2BQR A;  1XL4 A;  2ZM6 B;  4QIW A;  2JGU A;  2FML A;  1RM1 C;  4JI3 O;  2WAQ A;  1S5L Z;  1L0L H;  4WFH A;  5LXT F;  3CCS V;  2IM9 A;  4LF5 O;  2QTO A;  2OYQ A;  2K1E A;  2F4V B;  3N6X A;  3A0H Z;  3CHX A;  4NLG A;  4J9L A;  5EBL C;  5DEC A;  2VR1 A;  4W4K A;  4YY3 O;  4J0M A;  3GIP A;  1WJZ A;  5JH7 A;  4DQN A;  4I9Q A;  2AXT Z;  2VQE H;  4YJ2 B;  4JI5 B;  1Z2G A;  4FLW A;  4RZQ A;  5C44 G;  5EBW C;  3ZRS A;  2LO1 A;  2FPP B;  3RB4 A;  2JDI G;  3DAA A;  3SYP A;  4GX0 A;  2QF7 A;  2W9B B;  4DV6 O;  1K5Q A;  3A0R A;  4CZZ A;  3E8B A;  2EJ2 A;  4XZ3 B;  5B3S C;  4K0K H;  5B66 Z;  3OUU A;  3WWJ A;  2LFR A;  3JCZ A;  2EJ3 A;  4BXX G;  4B3R H;  4FLV A;  1NH2 B;  3K59 A;  1YHQ V;  4UVB A;  3MDS A;  2YW2 A;  2AW9 A;  4FFM A;  3RJ0 A;  3KG2 A;  5LHG A;  4J41 A;  4NXN O;  1WA8 A;  2JRI A;  4O7W A;  2FYU H;  4CH3 A;  2GDS A;  4IT5 A;  2OTL V;  4O3Q A;  1KEC A;  2E75 B;  5KFZ A;  4UB6 Z;  1K1Q A;  3B8N A;  3J81 N;  5KUK A;  3K58 A;  3C3T A;  2A7W A;  1I7N A;  1QQC A;  4JI2 O;  1IYD A;  1CQI B;  2ZGI A;  3U55 A;  1YVW A;  3AG3 B;  4TT3 G;  3MAQ A;  5EC1 C;  4JI0 O;  2QKS A;  4F4Y A;  2XD4 A;  2DZD A;  4DV3 B;  1IXB A;  5DGB A;  1SKV A;  3SI8 A;  1XMO B;  1JOY A;  4I0X A;  1TWA A;  3AG1 B;  2P7T C;  3TIG A;  1IBK B;  5KFU A;  5EDW A;  2W8K A;  2HVJ C;  1RK5 A;  4J9R A;  2ADQ B;  3PFF A;  1HNX O;  3MHH C;  1RYS A;  1G1X B;  2P67 A;  4O4L F;  3SYA A;  2C2A A;  5LGN A;  2UVU A;  4Q0Y A;  4MA5 A;  1XNQ H;  5T14 A;  2EJ0 A;  3U9S A;  1XEQ A;  4QJF B;  4ME6 A;  4DV2 O;  4R7C A;  3RGX A;  2ZE8 A;  2IU3 A;  3L74 H;  4HNA A;  4I50 A;  5IY5 C;  1M0W A;  3HXL A;  4N21 A;  2EIJ C;  4A3F G;  5J2U B;  4NTX A;  5FPR A;  2JA7 G;  3TGU H;  5IWA O;  1V55 C;  2UUA H;  4O7V A;  2JVD A;  1CPY A;  2OCC C;  3SE7 A;  3KHR A;  2YID A;  4LF4 B;  2Y69 C;  5DN6 G;  5KG2 A;  2R8H A;  3NR7 A;  4LFB O;  1CQJ B;  5DLF A;  1SA0 A;  4FBT A;  5B5E Z;  1DGS A;  4HZ3 A;  5FPO A;  3CC2 V;  3R23 A;  4O7S A;  1PNL A;  4LF8 O;  3TQ1 A;  5DMX A;  2EIY A;  2BQU A;  1JVM A;  3QQM A;  4DW0 A;  2YI9 A;  3SPH A;  1KU9 A;  3K08 A;  4QNH B;  1GO3 E;  1BXR A;  2BE3 A;  1HNZ O;  4X64 H;  5C8Y A;  5JCO C;  3SJC C;  1N32 B;  1KJQ A;  1M1K W;  2QK4 A;  2JEG A;  4B3M H;  1M0T A;  4EB6 A;  1RJR A;  5IYD G;  2Z0A A;  4O7Y A;  4RB1 A;  2UU9 B;  5B1A B;  2WLL B;  3JAW B;  5FLX N;  4LP8 A;  4BBS G;  3T1C A;  3KAL A;  4CKE A;  2R7N A;  2UUB B;  1P16 A;  2YC0 A;  4OX9 O;  2BOB C;  1B06 A;  2YS6 A;  5BWV A;  2A79 B;  4QWE A;  4TVI A;  3V4Z A;  4TQS A;  4YAK B;  3ZN1 A;  1VBG A;  3WNZ A;  4QWA A;  1QVF U;  3OSN A;  5H6Q A;  1Q3E A;  4YJ2 A;  3ICX A;  3W7S A;  2HJD A;  5A2Q W; 
#chains in the Genus database with same CATH homology
 1HNW B;  2RGV A;  3HKD A;  4BW9 A;  2R70 A;  4GKK B;  4UCT A;  4CC5 A;  1YEW A;  3S24 A;  5K1P A;  2HIV A;  4JI8 B;  4I55 B;  4JI5 H;  1M93 A;  4LF7 B;  1X4T A;  2CW8 A;  3L2P A;  3N2G B;  3BPZ A;  3N40 P;  5FD5 A;  4JV5 B;  1VS0 A;  1T5E A;  1J5E B;  4JI4 H;  4CS2 A;  2HEP A;  4I4T A;  2HHH B;  4JI8 H;  3CSX A;  2F1M A;  2ZNI A;  1CKN A;  4LF7 H;  4B3S H;  4GYC B;  3RYH B;  4CC6 A;  4R7R A;  3JAK B;  3FMA A;  1J5E H;  3CVZ A;  3BAA A;  4O4H A;  5KHJ A;  4DV0 B;  5JJN B;  4JYA B;  4UCU A;  3LML A;  5CB4 A;  4DV7 B;  2UXD H;  4JI1 B;  3RYC A;  4YHH H;  2UXB H;  5FLX W;  4PZ8 A;  1HW7 A;  2E3C A;  4DRX B;  1S5J A;  4JYA H;  4DV7 H;  4RB3 C;  4JI1 H;  4TUY B;  3A2F A;  5ITZ B;  3KAK A;  1TGO A;  5J2T B;  1JMK C;  4UCS A;  2PZS A;  1M4U A;  4IHJ A;  1A0I A;  4DR6 B;  2FE3 A;  4CH6 A;  4DR4 B;  2F95 B;  1FFX B;  4RB0 A;  4ZOL B;  3B2E E;  2O03 A;  2Q7H A;  2XHB A;  5BMV A;  5LP6 B;  1TAE A;  1Q8I A;  2Q7E A;  4BWA A;  4X1Y B;  4D7S A;  4LFA B;  1WH2 A;  4FLX A;  4M7E A;  4DR6 H;  4UCO A;  4O4J B;  4O4L B;  3THO A;  1TUB B;  5BR8 B;  1NT2 B;  3RGZ A;  1FJG B;  2E5L H;  4DK0 A;  4LFA H;  3N41 B;  3U11 A;  4DV5 B;  3HKB B;  4X66 B;  4WBN B;  4FM1 A;  5BR8 H;  4KHP B;  4ETS A;  3N2K A;  1FJG H;  2CAZ C;  4EFB A;  4O4I B;  5LP6 C;  3JAR A;  3BAB A;  5EIB D;  3BRC A;  4X66 H;  5J2U A;  2VQF B;  3KXY T;  1SYX B;  1FKA H;  1XNR B;  5KMG A;  4ZHQ B;  4TV9 A;  2CW7 A;  4ZIB A;  3DSQ A;  2R72 A;  2UUC B;  3RTX A;  1Z2P X;  1ZAU A;  4CS3 A;  2VQF H;  3JSN A;  3VQX A;  4AIL C;  1XNR H;  4GKJ B;  2XIG A;  5EOY A;  3BHP A;  1M5I A;  2UUC H;  3JAL B;  2HGS A;  4LFC B;  4O2A B;  3F8N A;  3RWR D;  1L2Z A;  3MWM A;  1Q43 A;  4GKJ H;  3WB2 A;  1I94 B;  3U10 A;  3RYF A;  4LFC H;  3JAW A;  4AQY B;  1WPB A;  3W1B A;  4ZI7 A;  2HVS A;  1Z2O X;  4NVP A;  5LYJ B;  3T1H B;  1GYF A;  5CA1 A;  2JS5 A;  1FVI A;  2R9A A;  4F6R B;  1I94 H;  2UU9 H;  3U0Z A;  1ZHS A;  3HKC A;  5LXT B;  5LXT A;  4AQY H;  4LR3 A;  5DIS C;  3T1H H;  3IAY A;  1CKM A;  2HIX A;  1MZB A;  3L4J A;  2YIB A;  4TV8 A;  4DV1 B;  4LF9 B;  4IIJ B;  4X62 H;  2ZJT A;  1TVK B;  2WYO A;  3QG5 A;  4X20 B;  4JI3 B;  4JI7 B;  4CH5 A;  4D7T A;  1I6U A;  3SR2 C;  2ZIM A;  4DV1 H;  4LF9 H;  3T1Y B;  1CKO A;  1XMQ B;  1JJO A;  4I55 A;  4JI6 B;  2VQE B;  4LF6 B;  1HR0 B;  4JI7 H;  4EEQ A;  2P22 C;  1HNW H;  3N2G A;  4RAY A;  5LOV B;  5K1X A;  5D1P A;  3VNN A;  3H20 A;  4GKK H;  4LNU B;  4DR7 B;  3OTF A;  4YY3 B;  4LH7 A;  3T1Y H;  1D5A A;  1XMQ H;  3K57 A;  5D5P A;  5JH7 B;  4JI6 H;  1HR0 H;  5IJ0 B;  4DV4 B;  5IJ0 A;  4JV5 H;  3RYH A;  4CS4 A;  3N42 B;  4DR3 B;  3JAK A;  4DUY B;  3TY8 A;  4DR7 H;  3KYH C;  2HHH H;  1BJT A;  1S68 A;  2PYL A;  4BWS C;  4DV6 B;  4B3R B;  1E4G T;  4DV4 H;  4DR3 H;  4LH6 A;  2Q0A A;  4DV0 H;  5IT9 W;  4K8X A;  4DV6 H;  2GV9 A;  3FFQ A;  4DRX A;  3JAT B;  3UT5 B;  2YI8 A;  4FM0 A;  4TUY A;  5ITZ A;  5IYZ B;  3HKE B;  5JVD B;  5J2T A;  4FM2 A;  1BGW A;  1O9G A;  4DR2 B;  1XI1 A;  4FLY A;  5JQG B;  1H2S B;  4TQF A;  2YIB D;  2ZIO A;  5IJ9 B;  5EYP B;  2VWK A;  4AHC A;  1S03 G;  1SEI A;  1FFX A;  1TA8 A;  4ZOL A;  5GON B;  3OTO B;  5KX5 B;  5LP6 A;  4JI2 B;  4DR4 H;  4X1Y A;  4O4J A;  2BTQ B;  1AN7 A;  3RYI B;  4O4L A;  3K5O A;  3RYI A;  1TUB A;  3JAS B;  3OTO H;  3RIZ A;  2UXC B;  5D5Q A;  4JI2 H;  1Z5W A;  4X1I B;  1N33 B;  3PN1 A;  3HKB A;  4WBN A;  5KHK A;  2Q2T A;  3E22 B;  2P5O A;  4X65 B;  4MV7 A;  2UXC H;  4O4I A;  4DRF A;  4DV5 H;  2QM4 A;  2KSW A;  4YJ3 B;  2VPS A;  2V4D A;  4NXM B;  4X65 H;  4KHP H;  2ZNJ A;  4ZHQ A;  3NBZ B;  5KHG A;  3J80 W;  3W1G A;  4DV2 B;  2RGR A;  1G6U A;  4NXM H;  1L8D A;  4DUZ B;  4APM A;  2KKW A;  4I50 B;  5LMU B;  2ZIN A;  2EX3 A;  3J7A K;  3SJB C;  4DK1 A;  2PY5 A;  5JJE B;  3TY5 A;  4O2B B;  4UCR A;  3JAL A;  1Q5O A;  4O2B A;  4O2A A;  4FLT A;  1P49 A;  2BTO A;  4K8Z A;  5LMU H;  4CH4 A;  2ZCE A;  3M7M X;  5LA6 B;  3J81 W;  3SJA C;  1KMI Z;  4PHZ A;  4FFB B;  4X1K B;  4LFB B;  1SA0 B;  2OWO A;  2HVR A;  4X64 B;  5LYJ A;  3ETQ A;  1QHT A;  5LMN B;  4F6R A;  1WNS A;  1SQG A;  5KHI A;  1IBM B;  5JJJ B;  1HNZ B;  3M4I A;  3CB2 A;  3QTC A;  4LSX A;  4EB6 B;  5LMN H;  2ZM6 B;  2JGU A;  1Z5V A;  4IIJ A;  5FNV B;  3ZS8 C;  3K5M A;  3VQY A;  1IBM H;  1XHX A;  3GJX B;  5D1O B;  1TVK A;  4X20 A;  3RR5 A;  1I7F A;  1JFF B;  3BA8 A;  2ZM6 H;  4OX9 B;  3RF2 A;  4LF5 B;  2IM9 A;  3N6X A;  2OYQ A;  2F4V B;  4JI3 H;  3CHX A;  5CA0 B;  5LOV A;  4U3J B;  4LNU A;  2QJ1 A;  4PZ7 A;  4J0M A;  4LF5 H;  5JH7 A;  2VQE H;  4I9Q A;  2F4V H;  4LF6 H;  2PUS A;  4YJ2 B;  4JI5 B;  4FLW A;  4PZ6 A;  3EYY A;  4RZQ A;  4B08 A;  4YY3 H;  3HKD B;  2F66 C;  4K0K B;  1XQ8 A;  1O75 A;  4JI4 B;  4IAJ A;  5EZY B;  5EZY A;  3BA9 A;  4B3S B;  2HVQ A;  1SQF A;  4DR1 B;  4DUY H;  4K0K H;  4UCV A;  4I4T B;  1P8L A;  1CKN B;  1XHZ A;  4B3R H;  4FLV A;  3K59 A;  3JSL A;  3JAT A;  3UT5 A;  1E4F T;  1V9P A;  4DR1 H;  4MV9 A;  3RJ0 A;  2UXD B;  5IYZ A;  4O4H B;  3HKE A;  5JVD A;  4EQ5 A;  4NXN B;  2WE6 A;  4YHH B;  2UXB B;  3N43 B;  4CH3 A;  5CB4 B;  5JQG A;  4FLZ A;  5IJ9 A;  3RYC B;  2YCH A;  5EYP A;  1XDN A;  4NXN H;  4DR2 H;  2PGG A;  5GON A;  1B04 A;  3K58 A;  5KX5 A;  3L4K A;  1QQC A;  4TQD A;  3C0F B;  3MAQ A;  2VOB A;  4JI0 B;  2BTQ A;  5EIB C;  3RFR A;  2CFM A;  3IG0 A;  2VUG A;  4DV3 B;  2Q2U A;  3JAS A;  4TOI A;  1SKV A;  4IHJ B;  4Q6G A;  3GB8 B;  1XMO B;  1WN7 A;  4E6N A;  3DF7 A;  3WB1 A;  5KHH A;  2F93 B;  5FD6 A;  4X1I A;  1IBK B;  3TY9 A;  4JI0 H;  3KAJ A;  3W5O A;  3E22 A;  4DV3 H;  3LNN A;  3K5N A;  1XNQ B;  1HNX B;  3NC0 B;  1XMO H;  3QF7 A;  5BMV B;  2W57 A;  4UFZ A;  2Q7G A;  1N33 H;  1RSO A;  3RGB A;  2E5L B;  2WDT A;  1IBK H;  4KL1 A;  4FVM A;  4YJ3 A;  1O9H A;  1N34 B;  4Q0Y A;  1XNQ H;  3VQV A;  1HNX H;  1N36 B;  4I7H A;  4DR5 B;  4FM9 A;  4A2B A;  3RGX A;  1N34 H;  4RB2 C;  2PTM A;  3N44 B;  4PI2 A;  4HNA B;  1N36 H;  2UUA B;  4HNA A;  3N2K B;  4I50 A;  1M0W A;  3HXL A;  1Z2N X;  3JAR B;  4DR5 H;  3UQ8 A;  4DV2 H;  5J2U B;  4DUZ H;  3GDE A;  5FPR A;  5LL6 b;  5JCO A;  2RQ6 A;  5IWA B;  1ZHQ A;  4MTE A;  2UUA H;  2JVD A;  1XK5 A;  5KMG B;  4TV9 B;  5LA6 A;  4LF4 B;  4FLU A;  4FFB A;  4X1K A;  4EFE A;  1SA0 A;  5IWA H;  1DGS A;  3K5L A;  5FPO A;  4LF8 B;  4B3M B;  4GLX A;  3SGI A;  4HBN A;  4LF4 H;  2YI9 A;  1KU9 A;  2PYJ A;  4LFB H;  5C8Y B;  4X64 H;  3WB0 A;  5C8Y A;  2RJZ A;  3SJC C;  5JCO C;  1N32 B;  4LF8 H;  4B3M H;  1M0T A;  4EB6 A;  4L8J A;  2VWJ A;  4RB1 A;  2UU9 B;  5FNV A;  1IBL B;  3RYF B;  1HNZ H;  4PDB A;  3JAW B;  5D1O A;  1N32 H;  4RAZ A;  1JFF A;  4ZI7 B;  3KAL A;  4PI0 A;  4B3T B;  2UUB B;  1P16 A;  5CA1 B;  3ZED A;  2MCT A;  2YXL A;  3HKC B;  4X62 B;  1IBL H;  1VF7 A;  3K3V A;  5CA0 A;  3NBY B;  4B3T H;  3VQW A;  4U3J A;  2UUB H;  4OX9 H;  4TV8 B;  4LSA A;  4A2A A;  2YIA A;  4MTD A;  1Q3E A;  3QWU A;  1X9N A;  4LMY A;  4YJ2 A;  3JAM W;  3ICX A;  5A2Q W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...