4UFZA

Synthesis of novel nad dependant dna ligase inhibitors via negishi cross-coupling: development of sar and resistance studies
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
b'MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Negishi Cross-Coupling Enabled Synthesis of Novel Nad(+)-Dependent DNA Ligase Inhibitors and Sar Development.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ufzA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ufzA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ufzA02
5LMUB 4B3TB 3BAAA 4GKKB 4JI2B 3NBYB 4E6NA 4LH7A 4DV0B 1IBLB 4DR6B 4LF8B 4DV3B 4DR5B 4JI6B 4DRFA 3T1HB 4LF7B 4UCOA 4LF4B 4JI1B 2UXDB 4JI7B 4JI5B 1IBMB 4TOIA 3KYHC 3NBZB 4LF9B 1CKNB 1V9PA 1TA8A 4PZ8A 4X64B 3W1GA 4DUYB 2HIXA 4DV7B 2VQFB 4K0KB 1ZAUA 3JSNA 2HVSA 1CKOA 2HVQA 4EEQA 1XK5A 1X9NA 1P16A 4DV4B 1HNZB 4CC6A 4EFEA 1N33B 4UCVA 1P8LA 2UUCB 2F4VB 4LFBB 1HR0B 3GDEA 4DR4B 4UCSA 4DR7B 4PZ7A 4DV5B 1N34B 2UU9B 4DR3B 2HIVA 4GKJB 4LH6A 3RR5A 1XNRB 3S24A 2UUAB 4X66B 4B3SB 3T1YB 3VNNA 3PN1A 4DUZB 4LF5B 3QWUA 4UFZA 2HVRA 4EQ5A 5DISC 3GB8B 1TAEA 3SGIA 4UCRA 2HHHB 4YHHB 1XNQB 3JSLA 2CFMA 3GJXB 4JI8B 1IBKB 4OX9B 4B3RB 2UXBB 4JV5B 3OTOB 4JYAB 4B3MB 4NXMB 4X62B 4DV2B 1CKMA 4JI0B 3TY8A 4JI3B 4EFBA 4DV1B 5IWAB 4LFAB 4YY3B 1N36B 3NC0B 3TY9A 2Q2UA 2VUGA 3BA8A 3W1BA 1VS0A 4JI4B 2Q2TA 5D1PA 1FJGB 2VQEB 1S68A 1HNXB 4DR2B 5D1OA 1B04A 3TY5A 1N32B 1I94B 3BA9A 1XMQB 2UXCB 4X65B 4PZ6A 2E5LB 5FPRA 1CKNA 4LFCB 2ZM6B 1XDNA 4GLXA 2UUBB 5FPOA 4DV6B 3W5OA 5D1OB 5BR8B 1J5EB 2OWOA 3UQ8A 4LF6B 4UCTA 4KHPB 1A0IA 4CC5A 1HNWB 4AQYB 5LMNB 4UCUA 4DR1B 3BABA 1FVIA 1XMOB 1DGSA 4NXNB 3L2PA 3RTXA
chains in the Genus database with same CATH superfamily
2W6NA 2Y48A 3SYPA 3MWDA 3JYCA 2CNUA 1QHTA 1SQFA 1WN7A 2QTOA 4OPHA 5C1OA 5IWAO 2R92G 3MR2A 4GKKH 1NR1A 1AJQA 3OGIB 1BGWA 1I5YA 3VBBA 2OTLV 4OPAA 1ZQ7A 4LF4B 3FKSG 3CPWU 3CE2A 4J42A 4ECZA 1AP5A 3N2KB 1AUXA 4HNTA 4O4IA 4D7TA 1TUEB 4CMFA 3X2QB 4DK1A 3GIDA 5DGHA 2Y0SE 3OAAG 1VQKV 4CH3A 5KFRA 5KG1A 2Y69B 4TUYA 4RB1A 2Q0AA 2YL2A 4J80A 1JXLA 3QNEA 1ZAUA 1GN2A 4O2BB 5JWPA 1AILA 2HVQA 4FS1A 5K2MA 3T1CA 1WH2A 2R8KA 2YU9A 3RYIA 5CA1B 4ECQA 1N0NA 2Q73A 4HNVA 3RIZA 2F4VB 4O2AB 5CA0A 1K5SA 4O2BF 1Y6XA 3GDEA 2MCTA 3KHHA 5CA1F 1LUWA 3CXHF 5KFZA 2BQRA 4A3JG 4DR7H 3ZS8C 1AR5A 2BTQA 1KECA 4PA4A 4F4YA 1IX9A 1KP2A 2N05A 4GX0A 2UUAB 2XUMA 3D3IA 5BWRA 4DR3H 3JARA 1WSCA 1XNRH 1YEWA 2V7QG 2WLLB 2BSKA 3FDSA 4DUZH 4TSFG 5KT5A 3GV8B 3L4KA 4QIWF 4FBUA 5LA6B 4HNUA 3F5WC 5KA5A 3ETQA 4FMTA 3K08A 5DAAA 3DXRA 4I55A 5LA6F 2PI4A 4DV4O 5C93A 1IBKH 1FS0G 1B06A 1VARA 3L71H 4BIUA 3KHRA 3RB4A 4BY1G 5EZYB 5L3FA 1V4YA 4ABMA 1VQ4V 2PTMA 5D5PA 3N44B 3M9MB 3I4MG 5CE8A 3K0DA 4N23A 3ABKB 1AB3A 5EZYF 3MHHC 5KFKA 3A0HZ 4E2LA 2OH2A 3BHPA 2Q7GA 5L1IA 5A2QN 1YJWV 2W70A 3ABLB 5KFWA 4ASUG 4J41A 1QR8A 3JZ6A 5GTIZ 4DL5A 1GM7A 2ZDIC 4ICGA 3UZBA 1I94H 3NUAA 3ZHTA 4MA5A 4MTFA 3NXSA 1S10A 4LF6B 1Q8IA 2ASDA 1W59A 1WB7A 1FXVA 1MG1A 3K0GA 3HOXG 4MVQA 2ASLA 3GIJA 1F51A 2R84A 3PW4A 4NXNB 2C35B 2JEFA 2A79B 5L3GA 1BJTA 4JYAO 4X88A 3KHLA 1VQ5V 4DV2O 2XAQA 1V54C 1TWAA 2YIAA 1H8EG 5KG6A 2M6YA 3WO0A 2JEXA 5J2TB 4MVRA 4YY3O 1OJHA 2FJZA 2F4VH 3L4JA 3WWHA 3F5TA 2ZCEA 5J2TF 1BS3A 1XREA 3B09A 3DTUB 4Z1MG 1N32O 4H44B 4LR3A 1IURA 4DK0A 2W6JG 4X1KA 3G8CA 5KHHA 4RZQA 1JDEA 3CB2A 2UUAH 1VQ7V 4O7WA 1VQMV 3H3VH 1BGYH 1Y74A 3RBZA 4IL6Z 4NZMA 4Z2WA 1YCIA 4FIPC 1XOUA 2HKOA 3KAKA 4K0KH 3DF7A 3HKBA 4U7NA 1H2LA 5KFCA 5JQGF 3MR3A 4AYBA 1SS3A 1W0JG 2P4KA 3JALB 1U96A 2LQTA 4RUEA 3VPCA 2IJJA 4MTOA 1QNMA 5A2QW 5DGIA 4PZ7A 2R7NA 3JZFA 1GK9A 2ZXWC 5HFLA 4LF8O 1PP9H 3VQWA 2WAMA 4JI6O 3RV4A 2NR5A 2GSMB 1WP7A 1SKVA 4O7SA 3U0GA 5LL6Y 3M8AA 5LBQA 4LCUC 1YDXA 2HLDG 4B3SH 1JX4A 3D36C 4J9KA 5KHGA 4NKGB 2ZDIA 4WFHA 3WO1A 5JVDF 1G2WA 3EYYA 3CJHA 4ED0A 1M0TA 2HHHB 4L8JA 5FD5A 2O57A 3RB0A 1HWYA 3H0GA 4Q4CA 3JD1A 2YW2A 1IVSA 4MVSA 2DQ0A 3HOVG 2LP7A 2NN4A 5JQGA 1AI4A 2UUCO 2XAHA 4FPPA 5IYDG 3ETEA 2V4DA 1QR9A 4GX2A 3I55V 1OCRB 1YJNV 2FPIB 4MV7A 5LGUA 3K3WA 3B40A 3NC0B 4R6ZA 4RAYA 4DXWA 4DV1H 3AG1C 5CN0A 4ECUA 1FPOA 3R23A 4WHXA 2WYOA 3V6JA 4OXSA 3ZRWB 3ZMUA 3K57A 4O4JF 2WLKA 1R6KA 4FK5C 4DW0A 4IWYA 4F6EA 4PI2A 5HV6A 2QSAA 1XDNA 2QKCA 4X9QA 5JJNB 5FPOA 2PI5A 3WNZA 1I5XA 2XD4A 4BIOA 4CH4A 1F7YA 3Q4HA 4KHPB 1XNQO 1S5HC 1DK1A 4HN2A 1VQPV 3T9AA 2IW5A 3ZHUA 3CVZA 5KFDA 1US6A 5LMNH 2O03A 1S9FA 4FS2A 2KSWA 4IHJA 2GHYA 4JI0O 3CMEV 4GC7A 5H9CA 4JI2B 2LGQA 3F8NA 1IBLB 3H1JH 4I9QA 4DRFA 3T1HB 4LF7B 5HBRB 2ZE5A 4U6PA 2XAJA 3ZMTA 4KL1A 5FNVA 4PJ0Z 4XDLA 3CCJV 3L9DA 4QWBA 4BXXG 2FB9A 4J9MA 4J7ZA 5BYBA 2ASJA 3D36A 5DG9A 2ZINA 1PNLA 2R9IA 3RGZA 3JATB 1HW7A 3E8BA 3JASB 3J81N 4AQYO 5EOYA 3K58A 2AW9A 3CSWA 3FKIA 2QKAA 3GB7C 1JA8A 5EBMC 5KFMA 2X6BA 2ABJA 3STLC 5KFQA 3JAMN 1GAXA 1FYJA 4DV3O 1H2NA 1YSCA 3TGUH 4R8CA 1YVWA 1FFXA 3CD6V 3A0RA 4RQFA 4X66B 3T1YB 3SE7A 4GKJH 2UVWA 4FM1A 3ETDA 4FFNA 4C5CA 2ZNJA 3PW0A 2W57A 3UO3A 4JYYA 1EZ1A 4TQRA 4UCRA 3HKCA 1MSDA 3AX6A 1RFYA 1K7DA 5FR9A 2VQFO 1VF5B 1OV9A 5KLVH 1RJQA 2RN9A 3QVNA 2RDJA 1HNZO 4TV9F 4PDLA 4NXMB 4KHPH 1ZL8B 3TY8A 1Y67A 1Z5VA 4RO2A 2V4RA 2YXHA 3IC9A 2J9GA 1W96A 3C90A 1OCZC 2I87A 2QK4A 2Q5ZA 1N36H 1UFIA 3CP1A 5EYPA 3ZRXA 4JI4H 3H40A 5L3EA 5BWXA 4ECRA 1VQ9V 2H94A 3J81W 4PDRA 2FKLA 3RW0A 2UVRA 2OT5A 3K3PA 2E5LH 4Q8FA 5BR8B 4IIJB 4DV6H 3UT5B 4QWDA 1KJJA 4JI8O 1Y66A 4ED1A 2YRXA 3K5IA 3RF2A 4UCUA 2NVXA 1AJPA 1FXKC 4O4LA 2R8HA 5IJ0A 4B3RO 3JAMW 4JV5O 3QZ8A 2A06H 1Z2GA 1EKFA 4TV9A 2JIZG 4P30A 5C4XG 1WLEA 3VQYA 1FKAO 4I50A 2WTFA 1XUQA 3APOA 2AZ0A 1JFFB 1OCCB 2AGQA 1S0OA 3RYCB 5IYCG 2WDTA 2PMZA 3IFXA 4A3MG 1Y1WA 4DR6H 4UCOA 2UXDB 1FJGO 2XAFA 4JI5B 3KYHC 4FFBB 4K35A 4HBNA 4JI7H 4EKWA 2NLJC 3H4DA 2A1HA 3WB0A 1BQ0A 1OHHG 4QJFB 4FFKA 2ZDGA 3T1YH 2EINC 2ILMA 4FFLA 2BR0A 4JV2A 2ZIOA 2XHBA 1A0GA 1F4NA 3T7AA 4CS4A 2V1DA 1I2KA 1AJNA 5LMUO 3RYHA 3HKDA 5GONA 5IYBO 4GKKO 4A3IG 1RK5A 4O7TA 2A0LA 2DZDA 3H4BA 2JGDB 4QWCA 2QGNA 1KD1W 2H3OA 4GUNA 2HJWA 2HIVA 3IN5A 2HG5C 4DL4A 4RAZA 2YS8A 4LF5B 2YYAA 4O3PA 2WAQE 3HO8A 1K1SA 2W7OA 5C8YB 2ATKC 4DL3A 1SQPH 4YAJB 3WB2A 3BCCH 3JSLA 2HVKC 5C44G 3M9OB 3WFVA 4DRXA 5LYJB 2YDEA 5EWEA 2YXYA 3F7YC 3FB7C 1FXKA 4KP4A 4JTCB 1NT2B 5LYJF 4MV8A 3CRAA 5L3BA 1CKMA 2W6MA 1GH6A 4I4TF 4MV3A 1GTOA 1N4CA 4DR7O 4ZIBA 1IXMA 5KA6A 4H33A 1SESA 5B3SC 4LFAB 3TY9A 3ZCCA 3QTCA 1IDSA 1AROP 4XX0B 4LC1A 2OCCC 2B63A 4DR3O 2Q2TA 1E1RG 3CRRA 2DWEC 4RAIA 5E1AC 1XNRO 3E83A 1Y1VA 1I3QA 2JEIA 4TVIA 4DUZO 2F93B 3R66A 4PDBA 3SR2C 3L75H 3Q8PB 5D1OB 2OWOA 4LFCH 2WLNA 4JI5H 3ZMZA 1JPXA 2RNBA 1CQIB 3FMAA 2E2IA 2A7WA 2CUGA 1JOYA 3ETGA 4EBCA 1IBKO 2AU0A 2KKWA 4RWUA 1T94A 2AHYA 1SRYA 1QLEB 1KQSU 1P7GA 5I5UA 1AVMA 5F2VO 2PY5A 3B2EE 4DV0H 2HHFA 3OUZA 1WJZA 5E25A 4DR5H 5BMVA 2PYJA 3E5NA 5FD6A 1BZKA 4BWSC 5JJEB 1IBMB 2VQEO 2YI9A 2HGWA 1R3KC 3H1LH 4LF9B 3ZN0A 1I94O 5EBWC 3RWRD 1DIKA 2W9CB 4NZNA 5KG4A 4B08A 1H8HG 4BR6A 1AP6A 4YJ3B 5KX5A 1XEQA 1ET0A 1SA0B 1O75A 1Q82W 3GIIA 2ZKOA 4YJ3F 1X9NA 4A3FG 3LNNA 3V4ZA 3H01A 1XL4A 1BMFG 4LFBB 1U97A 2Q68A 5DGAA 4QE9A 2DYSC 1GM8A 1YIJV 4J7JA 5JH7A 1OWTA 3ASOC 2PF4E 4UB8Z 2BQ3A 3CWBH 4U7CA 1Y76B 2Q9LA 5JCOC 3CYOA 3W7WA 1N34B 3W7TA 2ADQB 4R8UA 2AGOA 5EIBD 4X20A 3VQXA 2QM7A 1CP9A 1VP7A 4RNMA 5KFLA 4O4HB 1EUDB 4RZRA 5JVLA 1TAEA 4DYLA 1KKDA 3BACA 2IP4A 3T5LA 4TQSA 2FB5A 4K0KO 4ED3A 1VKZA 4O4HF 1CPYA 4FFRA 2HJDA 4HYOA 4YHHH 4PA9A 2R7KA 2ZDHA 3GV5B 2C28A 4Q8EA 2R93G 3AG4C 2WLIB 1Q7YW 1IOWA 4CZZA 5FL7G 3OTOH 3AK2A 4X89A 1W93A 4DV5O 4YJ2B 2BOBC 2JJ1G 3S3WA 3F7VC 2R7ZA 2VQDA 5KMGA 1L8DA 3SJQC 2ZT9B 3H20A 2VUGA 4DIMA 3ABMB 4LWSA 4YR3A 3W1BA 2IMWP 5CBHA 2EX3A 2ITCC 4DR2B 4B3SO 3G6EV 2Z0AA 2GPWA 3OR6C 2UXCB 4X65B 2R7LA 5CR5A 3HPLC 2K9PA 4TV8B 3UO2A 2UXXA 2ZM6B 1DAAA 1AR1B 1BHAA 2W9BA 1XMQH 1J5EB 4A3LG 1CXZB 1M56C 1IBMH 1M57B 3ZMVA 4TV8F 1GRJA 4TWKA 1B6QA 2AHZA 4RNNA 4QW9A 4LBEC 1EYZA 4WCEV 3EXAA 3R5XA 1XQ8A 2D2CB 1RSOA 2EILB 3HT5A 5GW7A 1JQ0A 3LDCA 3KZIZ 1Z5WA 4PV1B 1MABG 2SCUB 3LMLA 2X6CA 3FX7A 4BIZA 4B3TB 3BAAA 1UC8A 4HYKA 1B6RA 4DV1O 3JAKA 2FK2A 2V58A 3U54A 1SF9A 5I47A 1RM1B 1K5QA 1M7JA 4O84A 2FPPB 4TT3G 4JI1B 5JCOA 4CS3A 1PL0A 3KTMA 2RCVA 1P84F 1KJ9A 2JS3A 3J80N 3OEHG 4HR7A 1N56A 4E4EA 3O9OA 2Y69C 1EFRG 1R3IC 5JQWA 4FVMA 2YIBA 1R73A 5K1PA 4DV7H 4BBSG 5LGTA 2VUMG 5LMNO 4RQEA 3R5FA 5KG3A 1V55B 2I8CA 4I0XA 2WWWA 1FAFA 4FFOA 4JASA 2PBZA 4C5AA 3K3VA 1SQQH 5LGNA 3RYIB 4ZHQA 2Y0IA 1OZ0A 5I5VA 3Q8QB 3GIMA 4O7YA 2FTKA 3PW2A 4BAYA 2PZSA 1QBZA 4UV8A 3AYHB 3SPIA 3VNNA 1KEEA 2UU9H 3PN1A 2NUAB 2Q67A 3OM3B 3MFIA 4D6TH 1VQNV 1L0LH 1DF4A 3H1IH 5L1KA 4DR2H 3KG2A 4O3OA 1SCUB 3KREA 2UXCH 1E4EA 2L6LA 3JD0A 2AQ4A 4UB6Z 4NTXA 3B4SA 4OX9B 1WCMG 5KT3A 3DC6A 5IJ9B 4O2AF 4WBNB 4B3MB 2LFRA 5BWVA 2DYRB 5ITZA 4CS2A 1BL8A 1RP3B 4X62H 2W8LA 1Y14B 1M93A 4WBNF 3ABKC 2WA3A 3OUSA 2JA5A 1VEWA 2UXNA 4W4KA 4K8ZA 1BHBA 3J80W 2Q7DA 5KFSA 3ABLC 4N21A 1VS0A 4GKJO 4ED7A 3RGXA 1PNMA 4FZ1A 2QYZA 1S68A 3N2KA 2MK3A 4ME6A 3BA9A 2QTSA 5I5XA 2YXLA 4BW9A 2UVUA 2UUBH 2IBKA 4J11A 1A0IA 3BQ1A 3P30A 1HNWB 3IG0A 4O2BA 4DR1B 1XMOB 2DJVA 3IC7A 5CA1A 1GM9A 3N40P 3CC7V 2HR3A 4YBZB 4JI3O 1YZBA 5B5EZ 4O3RA 4Z1VA 2ZNIA 1JCHA 3PVXA 5LOVB 5DLGA 1N36O 4KXRA 3FAVA 4JI4O 2BE3A 5DECA 5LOVF 4PBCA 2CDYA 3T9DA 1W0KG 4LF4H 3GTKA 1HNXO 3T9BA 4L87A 3SJCC 2YZGA 3TXSA 2E5LO 1CKNB 1K83A 3P3PA 4QIWA 2W6IG 1AI7A 3PJSK 1R1BA 3STZC 4DV6O 4LNUA 5LXTB 3L74H 4DUYB 1HP8A 3U0ZA 2HIXA 4PI0A 4BWAA 5LA6A 2Z02A 1K33A 5KFOA 5LXTF 1EN6A 2RDIA 3K06A 1G1XB 3LNMB 3OW2U 1Y74B 5EZYA 3I4NG 4R50A 3G6YA 4MV1A 4GZRB 5DEDA 4DR6O 4CKBA 4J9QA 1NTMH 2W6OA 4CKEA 4B3MH 3EPIA 1NI8A 5B1OA 3RR5A 1EHIA 3JRXA 4JI7O 2W0FC 1RJRA 2W9AA 3B8MA 1MZEA 2YIDA 4ZOLB 1F23A 4JAAA 4EQ5A 5DISC 2WPDG 5DMXA 3OT7A 3SGIA 4ECWA 2E2HA 5FJ8G 1KJQA 4MVUA 2HFEC 3FD9A 3UM7A 5BXZA 2QDOA 2XC9A 3E22B 5IT9N 2R8IA 3I5DA 2W6ZA 2EJ3A 4J10A 4IAJA 2JA8G 1HR0O 3FYEB 1OCRC 1HNWH 3T9EA 3KKYA 5IWAB 1QVFU 5J2TA 3NGDA 1JJOA 3QZ7A 2Q8VA 1ZHSA 2P90A 2WAQA 5IDJA 2E74B 4O3SA 5KT4A 2QR4A 1GN4A 2QEXV 3MAQA 2Q7HA 1M9NA 4P9OA 3ASNB 4MTDA 4DQNA 1LUVA 4LF6H 4O81A 4B7KA 1BQZA 1IXBA 2UXBO 3E8FA 2D3OW 4ED8A 4JV1A 4O7NA 3RTXA 3M9NB 3Q1KA 3E89A 3JALA 2X0LA 4NXNH 4F50A 5GTHZ 1PNKA 2JA7G 4PDVA 4EGQA 2GTSA 4A93G 2EBOA 2P4VA 3KCYA 2DPIA 3HKEB 2ZDQA 3ABUA 3GIKA 4IYHA 4UUGA 5T14A 5JVDA 5KAFZ 5H5NA 3TETA 4GLWA 1G4YB 4IRCA 1Q86W 4LFCO 1SEIA 1YI2V 5IT9W 2XCPA 3CX5F 2FK3A 1KUTA 2HDKA 4GC6A 1K3EA 4WFEA 2HVSA 4EEQA 2ZR3A 5IP9G 3T5HA 4DV4B 1NBMG 3VOUA 1SQVH 3CEBA 2AGAA 2JA6A 5IYBG 4RUFA 1W2BU 5L1JA 4A3EG 4DV0O 1KP3A 5KHIA 4DR5O 2DIKA 3ZRVA 1ZHQA 2YC0A 3CCSV 1VBHA 4X8AA 4O4JA 4LH6A 2CNVA 2HVRA 4UVCA 4XDKA 2GBOA 3N2GB 4IYIA 1BXRA 4Q20A 3PFFA 3TINA 3CRMA 5TISZ 4RB0A 2KSDA 1MMMA 1GN6A 1Q6HA 2QWPB 2WSSG 3BFRA 2HHHH 3FYIB 4I5SA 2DW4A 1ENVA 1R6TA 4K8XA 2BQUA 4J9OA 3HKCB 3L72H 5F9LA 1N33O 4JYAB 4DV2B 2GQSA 1IZ3A 1WPXA 4DR4O 1I1MA 2KB1A 3QG5A 1NH2B 3CSXA 3G6BA 2DPJA 4I7HA 3MR6A 2XIGA 4YY3B 4TQDA 2G38A 3CQZA 2FMLA 1VQ6V 3HOUG 3TY5A 3AG3B 1N32B 3T54A 1MNGA 4PZ6A 5FPRA 3ZHQA 2V59A 3CEIA 2R70A 4R7CA 5HNEA 2QM4A 2R82A 2DWDC 3D3QA 3HB3B 2YZLA 2E75B 4YHHO 3OR7C 2NU8B 3JATA 2R86A 3JASA 1Q43A 3JD4A 1JIHA 4XDJA 3QQMA 2QF7A 1AI5A 3U9SA 4FBTA 3OTOO 4XYMB 1RPOA 5I5TA 3HOYG 3CC4V 3TK1A 5K3WA 3U9TA 1NQTA 1OCCC 2GDSA 2XCLA 4LF8B 3AG7A 2NVYA 4JI6B 4JI2H 5KFAA 1WA8B 1KU9A 1IBLH 3UZOA 1S3JA 1UJWB 3AG2B 2IH1C 4KFMA 4AHCA 3T1HH 4ED2A 5KFTA 2JA5G 4LF7H 1R3JC 2XASA 2W7PA 3CCRV 4ECSA 3NBZB 1EN4A 2K1EA 1GKFA 3GWOA 3E8GA 1XMQO 3WWIA 5KFJA 1N48A 4GT1A 4ZI7B 4MV9A 4A3CG 4K3AA 2NU9B 4IIJF 3W1GA 2DE0X 3QO8A 2DQ3A 1XHXA 4U3FH 4ZI7F 1AN7A 3N42B 2OIGA 3LDDA 2IJKA 4CMDA 5LP6B 2FL4A 3HOWG 1P8LA 2UUCB 4XBFA 3TEKA 3SYCA 1ZL8A 4UCSA 4NYEA 3LP8A 5H80A 5LP6F 4ZQIA 1M4UA 4W4LA 1M0WA 4J9PA 4J9NA 3MR5A 2WB1A 1SQXH 2R92A 1AUVA 2YEVB 3DAAA 2R8GA 1IYEA 5KFUA 1ROPA 1A48A 1TVKB 3APQA 1WP8A 4U3JB 5IYZB 4CKCA 3GLKA 4HNAB 1S77D 1S0VA 2CGNA 4X66H 3K9SA 4UFZA 1OCZB 3SPHA 5IYZF 1OCOB 5FLMG 3ICXA 2P0AA 4X64O 3JAWB 1JX9A 4ZKIA 2R8JA 4DV7O 1XNQB 3UT5A 4A2BA 3DTFA 5KFEA 4JYCA 3UKMA 4Q44A 2P6JA 1IOVA 2X7RB 1VF6C 4JI0B 3MWEA 3VPDA 2E76B 4JZGA 4NXMH 3T5KA 4WFGA 1JFFA 3RYCA 2ZE8A 5CMUA 3H1KH 2Q0OC 4IRDA 2UU9O 3A0BZ 2Y0SA 4WFFA 3RV3A 5A9GA 1GN3A 2FLNA 2GUZB 2PYLA 3CCLV 5KFBA 1S0NA 1R9TA 5C8YF 2RGVA 3JZIA 3DGEA 2AGPA 2VOBA 4JTDB 4UXNA 4FE2A 3HKZE 4DL6A 1F4MA 3N27A 4QJFA 4ZBMA 5KUKA 5BR8H 3RYFB 1NJIW 4CC5A 4MT8A 4DLKA 5KG2A 4MVMA 4AQYB 3SPJA 5D5QA 2PUSA 5EBLC 5BWWA 1XI1A 2QWQB 1QLEC 4X62O 4X1YB 5IY5C 4H37A 3ZMSA 5C1PA 1TUBB 4RNOA 5B1AB 1RYRA 4DV3B 3OFNG 4RB3C 2JGDA 4D7SA 4O3QA 3EHBB 4RCNA 2DMXA 2JK5C 3P32A 4X1IB 2UXDH 2HHFB 2ZIMA 2AZ2A 1K97A 5BMVB 2WLMA 2CTQA 1SERA 2CZGA 1PM9A 4QE7A 3PR4A 4ECVA 2UUBO 1HDJA 1A32A 3IAYA 4A3GG 2VQFB 5BWTA 3H0GG 2IU0A 5E79Z 1TWCA 1I1LA 3JSNA 1I50A 5LYJA 1CKOA 1XK5A 4FLUA 3SI8A 2EIKC 1GLVA 2A3QA 4I4TA 3RFRA 5KX5B 4CC6A 1HNZB 2COIA 4I9WA 2EIYA 2QWNB 5J2UB 3B77A 3CXCU 1VF6A 1KBLA 3LQSA 4KUMA 4E4TA 1YITV 2Y4TA 4CHIA 2J6UA 2KG7B 2IJHA 4AI8A 4A5UB 4LF4O 3ML0A 3ETJA 2DLNA 4F4WA 3U55A 2QA4V 4R8UB 5DQGA 3SYQA 1WR2A 2Z5UA 4LSXA 2EZPA 4LF5H 4L1KA 4HZ3A 1GSOA 4MV6A 1Q5OA 5D8DA 1MZFA 4JI8B 2ARHA 2QWOB 4B3RB 1BT8A 2A9HA 4JV5B 4F4ZA 1Q3EA 2DN9A 2H8PC 1KBHA 4DL2A 2F4VO 1BSMA 2X6AA 3GTPA 2RMKB 4A3DG 2YS7A 3WG7B 3BQ0A 3OEEG 3ZEDA 2EIMB 4JV0A 1S5LZ 1KB9F 1G6UA 2P67A 2VRZA 4LFAH 1M1KW 3H1HH 3MHSC 1FJGB 3BG5A 2UUAO 5KMGB 5C5JA 4FGRA 1KKCA 5BPHA 3ZHVA 4LWSB 5DN6G 2C2RA 2W9CA 4ECTA 2UVVA 1M57C 3RVYA 3QF7A 1WNSA 2EIJB 4YJ3A 1GO3E 2KQXA 5KFFA 2CTWA 1SA0A 3ZRSA 3K5MA 3KAJA 2CH7B 2EILC 2LJ2A 4F6RB 3FKIG 3TIIA 4BY7G 5C3EG 5LMUB 3KCXA 4GKKB 4YJ2F 1EKPA 3ZN1A 3NBYB 5F9NA 2WLJA 1KC8W 1RM1C 2FKXA 3WWJA 1S03G 1PPJH 1Y76A 3L70H 2ZGIA 3FB8C 3W7XA 4FFMA 4YP3A 2L35A 3JAKB 3HR0A 2HJFC 5CB4B 2YZNA 2IU3A 1I7NA 4J9RA 2DWCA 5CB4F 4LF9H 5LHGA 2ZD9A 1DV2A 3PO2G 4O4HA 3WU2Z 3EFFK 1MOFA 3GWKC 4LF6O 4YIOA 5KT2A 3K59A 3RB6A 3M99B 1V55C 4J9ZB 3IGAC 1OBDA 3SYAA 1E4FT 4NXNO 4EB6A 3RB3A 3J7AU 2OCHA 2WLIA 4GCZA 1XHZA 5KFGA 3EVKA 3MWMA 4LFBH 4DR7B 4O7ZA 5LL6b 4RU9A 4AILC 4MTXA 3SJBC 3HBLA 3PR5B 1S97A 3T4DA 3OSNA 2QKSA 1J95A 3AG4B 1OBGA 5KFHA 4ETSA 3X2QC 4DR3B 1P4RA 5L1LA 3BJYA 5KHJA 3FFQA 4YR2A 1XNRB 3S24A 1N34H 4FLTA 2IJIA 4FLXA 1UNNC 4O4IB 4DUZB 3QWUA 2PMZE 2HG8A 4TV8A 3BVOA 1C30A 4C2MA 4O4IF 5KG7A 4TUYB 3C3TA 4APMA 2F43G 2AXTZ 1IBKB 4JZ2A 4PA7A 2ZR2A 4TUYF 3T9FA 3CCQV 2FE3A 1M56B 1EZJA 4NTWA 4IR1A 1SQGA 5CA0B 1DLBA 2V4QA 2ZQMA 1BCCH 2F23A 1A9XA 4J9LA 1NH2D 4ECYA 2BOCC 5CA0F 3MD0A 5EDWA 3N6RA 1Y1WG 2B5UA 1PK8A 2BTQB 2XOKG 2ETNA 1PKXA 5LMUH 1KT8A 2VQEB 1NZ6A 4JUZA 3JARB 4YR0A 1I94B 2RJZA 2VWJA 2BSKB 4BBRG 1SZTA 1JR9A 5K1XA 3GVMA 4X65H 1GYFA 5B1BB 1NU1H 2Y4UA 2ZM6H 3UQ8A 3PO3G 1KTAA 1K73W 4LP8A 2HHHO 3HB9A 1J5EH 1WPBA 2JDIG 2Q7EA 1K4DC 1E1QG 1THZA 4NVPA 2LW7A 1T36A 2V5AA 1VQ8V 3OHAA 2C00A 3DXRB 2C2EA 4I55B 3VOTA 4DO2A 4YAKB 3G80A 4QWAA 1H2GA 2VR1A 4I55F 4H13B 5KT7A 1Q6IA 4B3TH 4Q4DA 5DQIA 1M90W 5I5SA 2NNUA 5EWGA 2YS6A 2RGRA 4FM9A 4TOIA 4JI1H 3GIPA 3JD3A 1EKVA 2B1GA 2LFSA 3FAVB 2N74A 2XNDG 2ODTX 4KHPO 4K0KB 2ATLA 2FPGB 1NKDA 4O2AA 1NR7A 5BWUA 4LNUB 4LMYA 2C2AA 5IJ9A 4A2AA 4WBNA 3AK3A 2CGOA 3UFXB 3Q8SB 1G8MA 1QVGU 2R6FA 3E86A 4MAMA 4DV5B 4JI2O 3RJ0A 1IBLO 2J6TA 2QM8A 3LSUA 3T1HO 5KFYA 4LF7O 4J9YB 1VF7A 4K6NA 2WLLA 2C22A 2B63G 2GQRA 1TWGA 4NZOA 3MJFA 1Y1VG 1RPRA 4B3SB 3I56V 4MS2A 1S0MA 3K79A 3ABTA 2W6PA 3TW7A 1MA1A 1YXBA 1ZUQA 3BPZA 4X1KB 3C3SA 3C0FB 1UC9A 5KKNB 2VQEH 1CS0A 2OTJV 2JEUA 1X4TA 3OSPA 4J9SA 4M0JA 1T3NA 2CKZB 4I7ZB 4G3IA 3HKBB 3E8HA 5B66Z 3OE7G 4EBDA 2CTRA 4Y8VB 3FB6C 2JS5A 3GILA 1PD3A 4UVAA 5JUMA 2C2DA 1GGOA 4OX9H 3GTQA 5H6RA 3LULA 1TGOA 4O7RA 4EFBA 3ORQA 4WD3A 4DV1B 2P7TC 5EIBC 5CBFA 2QB5A 5LOVA 3BY6A 2XGQA 3SDLA 2QE7G 5CBGA 1Q81W 4QGPA 4X66O 1MZBA 3T1YO 1B04A 3V4SA 4ZOLF 1XILA 4JXUA 2YZMA 1CKNA 4GLXA 3CJHB 5DG7A 3ZHRA 1L2ZA 5LXTA 2W71A 2Z04A 3ASNC 3OGCC 1A3GA 5BZBA 1SFOA 5BYAA 1QLNA 5LMNB 3BABA 5FLXN 1EM1A 2Z3YA 2NU6B 4DR1H 3S3XA 5JQGB 4C5BA 1XMOH 2BTOA 4NXMO 4O86A 1D5NA 2MW2B 1H2SB 1T5EA 1C3OA 5LHHA 2YCHA 1V54B 3RGBA 5KS8A 3K5NA 1SETA 3M7MX 2WLHA 1YTFB 2R7MA 1I7FA 2EJ2A 3RAQA 2HEPA 4DV5H 3PZPA 3CC2V 2Q6AA 4ZOLA 2EZOA 1E4GT 3HKZA 1V9PA 4QPKA 1GSAA 4PZ8A 5HFMA 4MA0A 1R6NA 5JVDB 5BR8O 2HGXA 3Q4HB 3VA7A 2XCAA 1ZLZA 1RJPA 4O3NA 1O9HA 4DUYH 4Q0YA 1PL4A 1R3LC 4YIPA 3E22A 3T9CA 3KHGA 4CH6A 1NTKH 3LUTB 1I7LA 4IHJB 5KUMA 4DL7A 1KJIA 4MW3A 3GTGA 2R7ZG 3UYYA 3AK1A 4IHJF 2ZXWB 3DTGA 2NU7B 5KT6A 1I08A 1K92A 4H0LB 3K5OA 2ADPA 1IYDA 1CQJB 4GKJB 1KMIZ 1E79G 3GIQA 2UXDO 3U11A 4JI5O 3E2EA 1JDBB 5FNVB 3OD4A 3TXQA 1Z2NX 2F1MA 4IT5A 1VQLV 2GTAA 2X5RA 4O4JB 5LHIA 2CQYA 5FNVF 4NYKA 5FLXW 2YUAA 1UPGA 4BW5A 2CFMA 3GJXB 4EGJA 2OLSA 3R5HA 2R9AA 2JJ2G 4FM2A 2JEJA 1QCEA 1I0HA 3OMAB 2IH3C 1K8AW 3NR7A 5EC2C 4JI3B 3GQCA 3J7AK 1FD9A 1Y4MA 1I6UA 1SQBH 3ZRWA 3AW8A 3CCMV 1N36B 2Q2UA 5IWAH 3HKEA 2VA2A 1FFXB 1QQCA 1B6SA 3AG1B 4JI4B 2GV9A 1PV0A 3AG3C 4EEYA 4TM5A 2M7WA 1HNXB 1K1QA 5EC1C 5L3DA 1VBGA 4LF5O 2YRWA 3RAXA 2E5LB 2JGUA 3W7SA 1GO3F 3DSQA 5DQHA 1RYSA 4DV6B 2W6QA 1AR4A 1Z2OX 5AG2A 3L73H 2COGA 1SYXB 2R9RB 3CCUV 5KHKA 1FVIA 1ULZA 3CMAV 3JCZA 1NVPB 3AEIA 2R93A 3OMIB 4FLWA 1H2KA 4G2KA 2PGGA 2PVPA 3GTMA 5DLFA 4XZ3B 2V9WA 3SYOA 4DR6B 1L1FA 4O83A 4LFAO 3AG2C 2OIEA 1K34A 4FLYA 4QSHA 4JI7B 5EYPB 1ZWIC 2F95B 2GLTA 3A8TA 3R9RA 3LSSA 4NB5A 4TQFA 4HQ6A 1EBOA 3G67A 4YXWG 4F4XA 3N2GA 1TA8A 3QO5A 3H9VA 3ZHSA 3RBEA 1XDCA 5H2FZ 4YB8B 5IP7G 1DTOA 4O7VA 4RB2C 2VPQA 4WF9V 1TWHA 4JTAB 4O4LB 2FYUH 5IJ0B 2Y0PA 5LP6C 4IWXA 1COWG 4EFEA 3A2FA 2YIBD 3R65A 4TV9B 4DV4H 1HR0B 4O4LF 3BQ2A 4QW8A 1Z2PX 2R87A 1V51A 1NS1A 3CHXA 4I50B 3G71V 1BE3H 4QWEA 4C7UA 2B1IA 2ZE7A 4QPJA 3OUUA 3KALA 4I50F 5KFPA 4JI3H 1IBMO 1ORQC 3MFHA 2RDCA 3W7UA 4LF9O 2HP8A 1OCOC 1XBLA 1AI6A 2EJRA 5KFXA 4A3BG 2LGWA 3TIGA 4FM0A 1FXHA 5KG0A 1HNXH 3UCSC 3SPGA 3TQTA 3K04A 4QIWE 2VUMA 3CCEV 4IZOA 2UXBB 1B3QA 4RUCA 4JPRA 3ZIAG 1CE8A 1TWFA 4EG0A 1S76D 4FU0A 4LFBO 2CNQA 4JYAH 5IYDO 3RYHB 4DV2H 3HKDB 5GONB 4O82A 2VPSA 3GTLA 3K5LA 2JEGA 1WA8A 5GONF 3M4IA 1N34O 4YY3H 4CE5A 3DC5A 2N04A 2F66C 3SNOA 4IIJA 3G6XA 4ED6A 3K03A 2B9ZA 5J9PC 1N32H 4LFCB 4ZI7A 5B1NA 2QJ1A 4EYIB 4EBEA 3TW6A 3KXYT 3CS5A 3LDEA 1S72V 4UUJC 4FLZA 1VMGA 5H6QA 2IM9A 4DRXB 3GTJA 2JRIA 2DABA 3T2MA 5CA3A 1WCMA 1FXKB 5LP6A 2P06A 4AYBE 3RVZA 3ORRA 1LNQA 2WE6A 5B1AC 4LH7A 4DV0B 4JF3A 2IA6A 4DR5B 1H38A 3MDSA 3T5JA 4FFBA 4PA6A 3I12A 4ECXA 2YEVA 3RUPA 2P22C 2FP4B 2M05A 1BNCA 4JI6H 1HR0H 4LF8H 2R72A 1TVKA 3OHBA 4F4LA 4U3JA 5IYZA 4DR2O 2EJ7A 1XL6A 4HNAA 3N8DA 3V6KA 1ZTEA 2E3CA 2UXCO 4X65O 3RT3C 4FLVA 3TQ1A 2ZM6O 2CW7A 3GTOA 3JAWA 1J5EO 2FLLA 4IRKA 2COJA 4QNHB 2P5OA 5DGBA 2OYQA 4YQWA 2R85A 1K4CC 3G4SV 2EINB 3E35A 1WRVA 4A3KG 5BPFA 1P49A 1LR1A 3LSQA 2Q69A 1P16A 4UVBA 1N33B 5L9XA 1L0NH 2GPSA 2VWKA 4MVOA 4DR4B 2UUCH 4B3TO 2LO1A 4I4TB 5KG5A 1D5AA 2XGPA 2UXBH 4MW8A 2CTPA 2ALZA 3TCUA 3WB1A 4CBCA 3P3NA 4JI1O 5C8YA 2RQ6A 4IGGA 2QWRB 5BMVF 2GUZA 5I5WA 2EULA 4Q43A 3QFFA 3T99A 3GB8B 1JLLB 3Q2OA 3SPCA 4YHHB 2CK3G 4P2ZA 3T4ZA 3RYFA 4PWQA 4FFPA 1XNQH 2J6SA 1N8RW 4JAVA 5KX5F 4NLGA 1YJ9V 1KC7A 3RBDA 3OTOB 4PELA 5L3CA 4DW1A 4X1YA 3JRWA 2YI8A 3CRCA 5J2UF 3RFCA 3VPBA 3WG7C 1I2LA 5JH7B 4JI0H 1TUBA 4P9PA 1JKJB 1SZXA 3O65A 2EIMC 1O9GA 3THOA 4M7EA 5IY5B 2DOSA 5B3SB 5CAEB 5JH7F 5CM0A 3BA8A 2OCCB 1KYOF 2YSUB 1QU7A 5EK0A 2YWVA 1NTZH 5D1OA 4X1IA 3G8DA 2JVDA 5JJJB 2Q4PA 4X20B 1XMQB 5DG8A 2VA3A 1KUQA 4MV4A 4LSAA 3G6VA 3W5OA 1EN5A 3ZJZA 2EIJC 1EZVH 3BRCA 2XTAA 4MTGA 1ZSPA 4PHZA 5I5YA 3BEHA 4UCTA 1D2DA 1FFTB 3HXLA 1P7BA 5KFIA 4G28B 5I60A 3SJAC 2W8KA 4OX9O 3V6HA 3LWBA 2LW1A 4Q45A 4AQYH 3ETHA 4B3MO 3OTFA 1H2MA 2ODMA 1Q90D 3ABMC 1ZETA 2PN1A 5J2UA 2ITDC 2JA6G 1S5JA 4E6NA 2EIKB 2DAAA 1JMKC 3D8CA 2KG7A 4OGQB 5IYCO 1N33H 1VQOV 4DV3H 1K9MW 1YTFD 2FK1A 3GV7B 4DR4H 2I80A 4FZ0A 2HVJC 1VIBA 1I1KA 1PX2A 3CCVV 3B8NA 2W0XA 2W9BB 3ZX6A 3U10A 4X64B 2EJ0A 3OMNB 3K9AA 3ZBHA 3HOZG 4DV7B 5BY1A 1HNWO 2CW8A 4GX1A 1N0JA 2ZE6A 1JJ2U 2WA4A 4O7LA 2VQFH 4DR1O 1RSOB 3Q8RB 1XMOO 3FB5C 4PA3A 4UCVA 3N41B 4MSWC 1HNZH 4R7RA 2DYSB 4IR9A 4EB6B 2JA7A 2CAZC 3OUFA 4NTYA 3ASOB 1SC5B 1DV1A 4PDMA 2UU9B 1MSWD 4GX5A 1Q6UA 3JD2A 1JVMA 1WB8A 4J0MA 1M5IA 5KFNA 3PW7A 2CE4A 4JAUA 4B7EA 5KFVA 1YHQV 4CH5A 3IJ4A 1KJ8A 5DM6V 1B33N 2XAGA 3PW5A 4EYHB 1X59A 4DUYO 4XYLB 5KAIZ 1URFA 2BCCH 2ZJTA 4G27B 1VAJA 4JI8H 2CH7A 4F6RA 4I0XB 2XT9A 3CRQA 4YJ2A 4GYCB 3RN4A 1M6VA 2HGSA 4B3RH 4X62B 4J7KA 4JV5H 2YICA 4JGSA 4ZHQB 1WAZA 2IBZH 1ZX3A 5EWFA 4NR1A 4PD4F 1FKAH 1GSHA 4UV9A 4WFAV 4ZHQF 4Q6GA 3TJTA 1GMGA 4HAMA 5D1PA 2FLPA 1EUCB 1YF2A 5CB4A 3EPGA 3QO7A 1FJGH 2WB1E 4FJCC 1RK6A 3N43B 5IE9A 2UUBB 5B1BC 4JYBA 4WFBV 3N6XA 2VS0A 4MVZA 1CEZA 2DYRC 3JCUZ 3VQVA 4RUAA 1E4EB 1DF5A 4U7OA 3K5HA 2FMAA 1DGSA 4MTEA 2X0SA 4X64H 4DAAA 3VMMA 2Y4RA 3L2PA 1NVPD 2RF4A 5ITZB 4M9UA
chains in the Genus database with same CATH topology
1H2SB 1T5EA 2YCHA 1QHTA 1SQFA 1WN7A 3RGBA 2PY5A 4LF8B 3K5NA 3B2EE 4GKKH 4JI6B 4JI2H 4DV0H 1KU9A 1IBLH 3M7MX 1BGWA 4DR5H 5BMVA 2PYJA 4LF4B 1I7FA 4AHCA 5FD6A 3T1HH 4LF7H 4BWSC 5JJEB 1IBMB 2HEPA 3N2KB 4DV5H 3NBZB 2YI9A 4O4IA 4LF9B 4D7TA 4ZOLA 1E4GT 3RWRD 4ZI7B 4DK1A 1V9PA 4MV9A 4PZ8A 4B08A 3W1GA 5JVDB 4CH3A 4YJ3B 5KX5A 1XHXA 4TUYA 4RB1A 2Q0AA 1O9HA 1SA0B 4DUYH 1O75A 4Q0YA 1AN7A 1ZAUA 3N42B 4O2BB 2HVQA 3E22A 1X9NA 1WH2A 3LNNA 3RYIA 5CA1B 5LP6B 4CH6A 1P8LA 2UUCB 2F4VB 4O2AB 5CA0A 4LFBB 3RIZA 4IHJB 3GDEA 2MCTA 4UCSA 5JH7A 1M4UA 1M0WA 4DR7H 3ZS8C 2BTQA 3K5OA 5JCOC 1N34B 4GKJB 1KMIZ 1TVKB 2UUAB 4U3JB 5IYZB 3U11A 4DR3H 3JARA 4HNAB 5FNVB 1Z2NX 5EIBD 1YEWA 2F1MA 4X20A 3VQXA 4X66H 4UFZA 1XNRH 4O4JB 4DUZH 4O4HB 3ICXA 5FLXW 3JAWB 1TAEA 3L4KA 1XNQB 3UT5A 4A2BA 5LA6B 2CFMA 3GJXB 3ETQA 4YHHH 2R9AA 4I55A 4FM2A 1IBKH 3OTOH 5EZYB 4JI0B 4NXMH 4JI3B 2PTMA 5D5PA 3N44B 3J7AK 4YJ2B 1JFFA 3RYCA 5KMGA 1I6UA 1N36B 1L8DA 2Q2UA 3H20A 2VUGA 3HKEA 5IWAH 1FFXB 1QQCA 3BHPA 2Q7GA 3W1BA 4JI4B 2GV9A 2EX3A 1HNXB 4DR2B 2PYLA 2UXCB 4X65B 2E5LB 2JGUA 2RGVA 4TV8B 2ZM6B 3DSQA 1I94H 1XMQH 2VOBA 4DV6B 1Z2OX 1J5EB 4LF6B 1IBMH 1Q8IA 5BR8H 3RYFB 1SYXB 4CC5A 4AQYB 1XQ8A 5KHKA 1FVIA 1RSOA 5D5QA 2PUSA 4NXNB 1XI1A 1BJTA 1Z5WA 4FLWA 4X1YB 3LMLA 4B3TB 3BAAA 2PGGA 2YIAA 1TUBB 4DR6B 3JAKA 4DV3B 5J2TB 4RB3C 4D7SA 2F4VH 3L4JA 4JI1B 2ZCEA 5JCOA 4FLYA 4CS3A 5EYPB 4JI7B 2F95B 4X1IB 2UXDH 2ZIMA 4TQFA 5BMVB 4LR3A 3N2GA 4DK0A 1TA8A 4X1KA 5KHHA 4RZQA 2UUAH 3CB2A 4FVMA 3IAYA 2VQFB 2YIBA 5K1PA 4DV7H 3KAKA 3JSNA 4RB2C 5LYJA 4K0KH 3DF7A 1CKOA 3HKBA 4O4LB 1XK5A 4FLUA 5IJ0B 5LP6C 4I4TA 3RFRA 5KX5B 4CC6A 1HNZB 4EFEA 3A2FA 2YIBD 4TV9B 3JALB 1HR0B 4DV4H 3K3VA 5J2UB 1Z2PX 5A2QW 4PZ7A 3CHXA 3RYIB 4I50B 4ZHQA 3VQWA 2PZSA 3KALA 1SKVA 4JI3H 3VNNA 2UU9H 3PN1A 4B3SH 5KHGA 4LSXA 3EYYA 4LF5H 1M0TA 4FM0A 1Q5OA 4L8JA 2HHHB 5FD5A 1HNXH 4DR2H 4JI8B 2UXCH 4OX9B 4B3RB 2UXBB 4JV5B 5IJ9B 1Q3EA 4WBNB 5JQGA 4B3MB 5ITZA 4JYAH 4CS2A 2V4DA 3RYHB 4X62H 4DV2H 3HKDB 5GONB 1M93A 2VPSA 4MV7A 3K5LA 3ZEDA 3NC0B 4K8ZA 4RAYA 3J80W 4DV1H 3M4IA 4LFAH 1G6UA 4YY3H 1VS0A 3RGXA 1FJGB 2F66C 1S68A 5KMGB 2WYOA 3N2KA 3K57A 4IIJA 3BA9A 4PI2A 1N32H 4LFCB 4ZI7A 1XDNA 2YXLA 5JJNB 5FPOA 4BW9A 2QJ1A 4CH4A 3QF7A 1WNSA 4YJ3A 2UUBH 3KXYT 4KHPB 1A0IA 4FLZA 1SA0A 1HNWB 3K5MA 3KAJA 2IM9A 4DRXB 3IG0A 4O2BA 4DR1B 4F6RB 3CVZA 1XMOB 5LMNH 2O03A 5CA1A 5LP6A 3N40P 2KSWA 4IHJA 5LMUB 2WE6A 4GKKB 4JI2B 3NBYB 4LH7A 4DV0B 3F8NA 1IBLB 2ZNIA 4DR5B 5LOVB 1S03G 4FFBA 4I9QA 4DRFA 3T1HB 4LF7B 4LF8H 2P22C 4JI6H 1HR0H 2R72A 1TVKA 3JAKB 4LF4H 4U3JA 4KL1A 5CB4B 5IYZA 5FNVA 4HNAA 3SJCC 2E3CA 1CKNB 4FLVA 4LF9H 2CW7A 4O4HA 2ZINA 3JAWA 4LNUA 5LXTB 4DUYB 2HIXA 3U0ZA 2P5OA 4PI0A 2OYQA 4BWAA 5LA6A 3K59A 3RGZA 3JATB 1HW7A 3JASB 1P49A 5EOYA 1P16A 3K58A 1E4FT 4EB6A 1N33B 2VWKA 5EZYA 1XHZA 4DR4B 3MWMA 2UUCH 4LFBH 4DR7B 5LL6b 4AILC 4I4TB 1D5AA 3SJBC 2UXBH 3WB1A 4B3MH 4ETSA 1FFXA 4DR3B 3RR5A 5KHJA 3FFQA 5C8YA 1XNRB 3S24A 1N34H 4X66B 2RQ6A 4FLTA 3T1YB 4GKJH 4FLXA 4FM1A 4O4IB 4DUZB 3QWUA 4ZOLB 2ZNJA 4TV8A 4EQ5A 2W57A 5DISC 3GB8B 3SGIA 4UCRA 3HKCA 4TUYB 4YHHB 3RYFA 4APMA 1XNQH 1IBKB 3E22B 2FE3A 3OTOB 4NXMB 1SQGA 5CA0B 4IAJA 4X1YA 4KHPH 2YI8A 3TY8A 1HNWH 1Z5VA 5JH7B 4JI0H 1TUBA 5IWAB 5J2TA 1JJOA 1O9GA 3THOA 4M7EA 2BTQB 3BA8A 1N36H 5LMUH 2VQEB 5EYPA 1ZHSA 5D1OA 4JI4H 4X1IA 3JARB 2JVDA 5JJJB 4X20B 1I94B 1XMQB 2RJZA 2VWJA 3J81W 4LSAA 5K1XA 4X65H 2E5LH 3W5OA 5BR8B 1GYFA 3MAQA 3BRCA 2ZM6H 2Q7HA 4IIJB 3UQ8A 4PHZA 4DV6H 4UCTA 3UT5B 1J5EH 1WPBA 4MTDA 3HXLA 2Q7EA 4LF6H 4NVPA 3RF2A 3SJAC 4UCUA 4O4LA 4I55B 5IJ0A 3JAMW 4AQYH 4TV9A 3OTFA 3RTXA 3JALA 4NXNH 5J2UA 1S5JA 3VQYA 4E6NA 4I50A 4B3TH 1JFFB 1JMKC 3RYCB 2WDTA 1N33H 4DR6H 3HKEB 4DV3H 4UCOA 2UXDB 4DR4H 2RGRA 4FM9A 4JI5B 4TOIA 3KYHC 4JI1H 4FFBB 5JVDA 4HBNA 4JI7H 3WB0A 3U10A 1SEIA 4X64B 5IT9W 4DV7B 3T1YH 4K0KB 4O2AA 2CW8A 2ZIOA 2XHBA 2HVSA 2VQFH 4EEQA 4LNUB 4DV4B 4LMYA 5IJ9A 4A2AA 4CS4A 4UCVA 3N41B 4WBNA 1HNZH 4R7RA 3RYHA 3HKDA 5GONA 4DV5B 4EB6B 2CAZC 3RJ0A 5KHIA 1ZHQA 1VF7A 2UU9B 4O4JA 2HIVA 4LH6A 4J0MA 1M5IA 4B3SB 4RAZA 4LF5B 2HVRA 4CH5A 3N2GB 3BPZA 5C8YB 4X1KB 3C0FB 3WB2A 4RB0A 2VQEH 1X4TA 3JSLA 2ZJTA 2HHHH 5LYJB 4DRXA 4K8XA 4JI8H 3HKBB 4F6RA 3HKCB 2JS5A 4YJ2A 4GYCB 4JYAB 2HGSA 4OX9H 4B3RH 1NT2B 4X62B 4JV5H 4DV2B 1CKMA 1TGOA 3QG5A 3CSXA 4EFBA 4ZHQB 4ZIBA 4DV1B 4I7HA 5EIBC 1FKAH 2XIGA 5LOVA 4LFAB 4YY3B 3TY9A 3QTCA 4TQDA 4Q6GA 2Q2TA 5D1PA 5CB4A 1MZBA 3TY5A 1B04A 1N32B 1FJGH 2F93B 4PZ6A 4PDBA 5FPRA 1CKNA 3N43B 3SR2C 4GLXA 2UUBB 2R70A 3N6XA 5D1OB 1L2ZA 2OWOA 4LFCH 2QM4A 5LXTA 4JI5H 3FMAA 3VQVA 3JATA 3JASA 1Q43A 5LMNB 3BABA 1DGSA 4MTEA 4X64H 4DR1H 2KKWA 5JQGB 3L2PA 1XMOH 2BTOA 5ITZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU B;  4B3T B;  3BAA A;  4GKK B;  4JI2 B;  3NBY B;  4E6N A;  4LH7 A;  4DV0 B;  1IBL B;  4DR6 B;  4LF8 B;  4DV3 B;  4DR5 B;  4JI6 B;  4DRF A;  3T1H B;  4LF7 B;  4UCO A;  4LF4 B;  4JI1 B;  2UXD B;  4JI7 B;  4JI5 B;  1IBM B;  4TOI A;  3KYH C;  3NBZ B;  4LF9 B;  1CKN B;  1V9P A;  1TA8 A;  4PZ8 A;  4X64 B;  3W1G A;  4DUY B;  2HIX A;  4DV7 B;  2VQF B;  4K0K B;  1ZAU A;  3JSN A;  2HVS A;  1CKO A;  2HVQ A;  4EEQ A;  1XK5 A;  1X9N A;  1P16 A;  4DV4 B;  1HNZ B;  4CC6 A;  4EFE A;  1N33 B;  4UCV A;  1P8L A;  2UUC B;  2F4V B;  4LFB B;  1HR0 B;  3GDE A;  4DR4 B;  4UCS A;  4DR7 B;  4PZ7 A;  4DV5 B;  1N34 B;  2UU9 B;  4DR3 B;  2HIV A;  4GKJ B;  4LH6 A;  3RR5 A;  1XNR B;  3S24 A;  2UUA B;  4X66 B;  4B3S B;  3T1Y B;  3VNN A;  3PN1 A;  4DUZ B;  4LF5 B;  3QWU A;  4UFZ A;  2HVR A;  4EQ5 A;  5DIS C;  3GB8 B;  1TAE A;  3SGI A;  4UCR A;  2HHH B;  4YHH B;  1XNQ B;  3JSL A;  2CFM A;  3GJX B;  4JI8 B;  1IBK B;  4OX9 B;  4B3R B;  2UXB B;  4JV5 B;  3OTO B;  4JYA B;  4B3M B;  4NXM B;  4X62 B;  4DV2 B;  1CKM A;  4JI0 B;  3TY8 A;  4JI3 B;  4EFB A;  4DV1 B;  5IWA B;  4LFA B;  4YY3 B;  1N36 B;  3NC0 B;  3TY9 A;  2Q2U A;  2VUG A;  3BA8 A;  3W1B A;  1VS0 A;  4JI4 B;  2Q2T A;  5D1P A;  1FJG B;  2VQE B;  1S68 A;  1HNX B;  4DR2 B;  5D1O A;  1B04 A;  3TY5 A;  1N32 B;  1I94 B;  3BA9 A;  1XMQ B;  2UXC B;  4X65 B;  4PZ6 A;  2E5L B;  5FPR A;  1CKN A;  4LFC B;  2ZM6 B;  1XDN A;  4GLX A;  2UUB B;  5FPO A;  4DV6 B;  3W5O A;  5D1O B;  5BR8 B;  1J5E B;  2OWO A;  3UQ8 A;  4LF6 B;  4UCT A;  4KHP B;  1A0I A;  4CC5 A;  1HNW B;  4AQY B;  5LMN B;  4UCU A;  4DR1 B;  3BAB A;  1FVI A;  1XMO B;  1DGS A;  4NXN B;  3L2P A;  3RTX A; 
#chains in the Genus database with same CATH topology
 2W6N A;  2Y48 A;  3SYP A;  3MWD A;  3JYC A;  2CNU A;  1QHT A;  1SQF A;  1WN7 A;  2QTO A;  4OPH A;  5C1O A;  5IWA O;  2R92 G;  3MR2 A;  4GKK H;  1NR1 A;  1AJQ A;  3OGI B;  1BGW A;  1I5Y A;  3VBB A;  2OTL V;  4OPA A;  1ZQ7 A;  4LF4 B;  3FKS G;  3CPW U;  3CE2 A;  4J42 A;  4ECZ A;  1AP5 A;  3N2K B;  1AUX A;  4HNT A;  4O4I A;  4D7T A;  1TUE B;  4CMF A;  3X2Q B;  4DK1 A;  3GID A;  5DGH A;  2Y0S E;  3OAA G;  1VQK V;  4CH3 A;  5KFR A;  5KG1 A;  2Y69 B;  4TUY A;  4RB1 A;  2Q0A A;  2YL2 A;  4J80 A;  1JXL A;  3QNE A;  1ZAU A;  1GN2 A;  4O2B B;  5JWP A;  1AIL A;  2HVQ A;  4FS1 A;  5K2M A;  3T1C A;  1WH2 A;  2R8K A;  2YU9 A;  3RYI A;  5CA1 B;  4ECQ A;  1N0N A;  2Q73 A;  4HNV A;  3RIZ A;  2F4V B;  4O2A B;  5CA0 A;  1K5S A;  4O2B F;  1Y6X A;  3GDE A;  2MCT A;  3KHH A;  5CA1 F;  1LUW A;  3CXH F;  5KFZ A;  2BQR A;  4A3J G;  4DR7 H;  3ZS8 C;  1AR5 A;  2BTQ A;  1KEC A;  4PA4 A;  4F4Y A;  1IX9 A;  1KP2 A;  2N05 A;  4GX0 A;  2UUA B;  2XUM A;  3D3I A;  5BWR A;  4DR3 H;  3JAR A;  1WSC A;  1XNR H;  1YEW A;  2V7Q G;  2WLL B;  2BSK A;  3FDS A;  4DUZ H;  4TSF G;  5KT5 A;  3GV8 B;  3L4K A;  4QIW F;  4FBU A;  5LA6 B;  4HNU A;  3F5W C;  5KA5 A;  3ETQ A;  4FMT A;  3K08 A;  5DAA A;  3DXR A;  4I55 A;  5LA6 F;  2PI4 A;  4DV4 O;  5C93 A;  1IBK H;  1FS0 G;  1B06 A;  1VAR A;  3L71 H;  4BIU A;  3KHR A;  3RB4 A;  4BY1 G;  5EZY B;  5L3F A;  1V4Y A;  4ABM A;  1VQ4 V;  2PTM A;  5D5P A;  3N44 B;  3M9M B;  3I4M G;  5CE8 A;  3K0D A;  4N23 A;  3ABK B;  1AB3 A;  5EZY F;  3MHH C;  5KFK A;  3A0H Z;  4E2L A;  2OH2 A;  3BHP A;  2Q7G A;  5L1I A;  5A2Q N;  1YJW V;  2W70 A;  3ABL B;  5KFW A;  4ASU G;  4J41 A;  1QR8 A;  3JZ6 A;  5GTI Z;  4DL5 A;  1GM7 A;  2ZDI C;  4ICG A;  3UZB A;  1I94 H;  3NUA A;  3ZHT A;  4MA5 A;  4MTF A;  3NXS A;  1S10 A;  4LF6 B;  1Q8I A;  2ASD A;  1W59 A;  1WB7 A;  1FXV A;  1MG1 A;  3K0G A;  3HOX G;  4MVQ A;  2ASL A;  3GIJ A;  1F51 A;  2R84 A;  3PW4 A;  4NXN B;  2C35 B;  2JEF A;  2A79 B;  5L3G A;  1BJT A;  4JYA O;  4X88 A;  3KHL A;  1VQ5 V;  4DV2 O;  2XAQ A;  1V54 C;  1TWA A;  2YIA A;  1H8E G;  5KG6 A;  2M6Y A;  3WO0 A;  2JEX A;  5J2T B;  4MVR A;  4YY3 O;  1OJH A;  2FJZ A;  2F4V H;  3L4J A;  3WWH A;  3F5T A;  2ZCE A;  5J2T F;  1BS3 A;  1XRE A;  3B09 A;  3DTU B;  4Z1M G;  1N32 O;  4H44 B;  4LR3 A;  1IUR A;  4DK0 A;  2W6J G;  4X1K A;  3G8C A;  5KHH A;  4RZQ A;  1JDE A;  3CB2 A;  2UUA H;  1VQ7 V;  4O7W A;  1VQM V;  3H3V H;  1BGY H;  1Y74 A;  3RBZ A;  4IL6 Z;  4NZM A;  4Z2W A;  1YCI A;  4FIP C;  1XOU A;  2HKO A;  3KAK A;  4K0K H;  3DF7 A;  3HKB A;  4U7N A;  1H2L A;  5KFC A;  5JQG F;  3MR3 A;  4AYB A;  1SS3 A;  1W0J G;  2P4K A;  3JAL B;  1U96 A;  2LQT A;  4RUE A;  3VPC A;  2IJJ A;  4MTO A;  1QNM A;  5A2Q W;  5DGI A;  4PZ7 A;  2R7N A;  3JZF A;  1GK9 A;  2ZXW C;  5HFL A;  4LF8 O;  1PP9 H;  3VQW A;  2WAM A;  4JI6 O;  3RV4 A;  2NR5 A;  2GSM B;  1WP7 A;  1SKV A;  4O7S A;  3U0G A;  5LL6 Y;  3M8A A;  5LBQ A;  4LCU C;  1YDX A;  2HLD G;  4B3S H;  1JX4 A;  3D36 C;  4J9K A;  5KHG A;  4NKG B;  2ZDI A;  4WFH A;  3WO1 A;  5JVD F;  1G2W A;  3EYY A;  3CJH A;  4ED0 A;  1M0T A;  2HHH B;  4L8J A;  5FD5 A;  2O57 A;  3RB0 A;  1HWY A;  3H0G A;  4Q4C A;  3JD1 A;  2YW2 A;  1IVS A;  4MVS A;  2DQ0 A;  3HOV G;  2LP7 A;  2NN4 A;  5JQG A;  1AI4 A;  2UUC O;  2XAH A;  4FPP A;  5IYD G;  3ETE A;  2V4D A;  1QR9 A;  4GX2 A;  3I55 V;  1OCR B;  1YJN V;  2FPI B;  4MV7 A;  5LGU A;  3K3W A;  3B40 A;  3NC0 B;  4R6Z A;  4RAY A;  4DXW A;  4DV1 H;  3AG1 C;  5CN0 A;  4ECU A;  1FPO A;  3R23 A;  4WHX A;  2WYO A;  3V6J A;  4OXS A;  3ZRW B;  3ZMU A;  3K57 A;  4O4J F;  2WLK A;  1R6K A;  4FK5 C;  4DW0 A;  4IWY A;  4F6E A;  4PI2 A;  5HV6 A;  2QSA A;  1XDN A;  2QKC A;  4X9Q A;  5JJN B;  5FPO A;  2PI5 A;  3WNZ A;  1I5X A;  2XD4 A;  4BIO A;  4CH4 A;  1F7Y A;  3Q4H A;  4KHP B;  1XNQ O;  1S5H C;  1DK1 A;  4HN2 A;  1VQP V;  3T9A A;  2IW5 A;  3ZHU A;  3CVZ A;  5KFD A;  1US6 A;  5LMN H;  2O03 A;  1S9F A;  4FS2 A;  2KSW A;  4IHJ A;  2GHY A;  4JI0 O;  3CME V;  4GC7 A;  5H9C A;  4JI2 B;  2LGQ A;  3F8N A;  1IBL B;  3H1J H;  4I9Q A;  4DRF A;  3T1H B;  4LF7 B;  5HBR B;  2ZE5 A;  4U6P A;  2XAJ A;  3ZMT A;  4KL1 A;  5FNV A;  4PJ0 Z;  4XDL A;  3CCJ V;  3L9D A;  4QWB A;  4BXX G;  2FB9 A;  4J9M A;  4J7Z A;  5BYB A;  2ASJ A;  3D36 A;  5DG9 A;  2ZIN A;  1PNL A;  2R9I A;  3RGZ A;  3JAT B;  1HW7 A;  3E8B A;  3JAS B;  3J81 N;  4AQY O;  5EOY A;  3K58 A;  2AW9 A;  3CSW A;  3FKI A;  2QKA A;  3GB7 C;  1JA8 A;  5EBM C;  5KFM A;  2X6B A;  2ABJ A;  3STL C;  5KFQ A;  3JAM N;  1GAX A;  1FYJ A;  4DV3 O;  1H2N A;  1YSC A;  3TGU H;  4R8C A;  1YVW A;  1FFX A;  3CD6 V;  3A0R A;  4RQF A;  4X66 B;  3T1Y B;  3SE7 A;  4GKJ H;  2UVW A;  4FM1 A;  3ETD A;  4FFN A;  4C5C A;  2ZNJ A;  3PW0 A;  2W57 A;  3UO3 A;  4JYY A;  1EZ1 A;  4TQR A;  4UCR A;  3HKC A;  1MSD A;  3AX6 A;  1RFY A;  1K7D A;  5FR9 A;  2VQF O;  1VF5 B;  1OV9 A;  5KLV H;  1RJQ A;  2RN9 A;  3QVN A;  2RDJ A;  1HNZ O;  4TV9 F;  4PDL A;  4NXM B;  4KHP H;  1ZL8 B;  3TY8 A;  1Y67 A;  1Z5V A;  4RO2 A;  2V4R A;  2YXH A;  3IC9 A;  2J9G A;  1W96 A;  3C90 A;  1OCZ C;  2I87 A;  2QK4 A;  2Q5Z A;  1N36 H;  1UFI A;  3CP1 A;  5EYP A;  3ZRX A;  4JI4 H;  3H40 A;  5L3E A;  5BWX A;  4ECR A;  1VQ9 V;  2H94 A;  3J81 W;  4PDR A;  2FKL A;  3RW0 A;  2UVR A;  2OT5 A;  3K3P A;  2E5L H;  4Q8F A;  5BR8 B;  4IIJ B;  4DV6 H;  3UT5 B;  4QWD A;  1KJJ A;  4JI8 O;  1Y66 A;  4ED1 A;  2YRX A;  3K5I A;  3RF2 A;  4UCU A;  2NVX A;  1AJP A;  1FXK C;  4O4L A;  2R8H A;  5IJ0 A;  4B3R O;  3JAM W;  4JV5 O;  3QZ8 A;  2A06 H;  1Z2G A;  1EKF A;  4TV9 A;  2JIZ G;  4P30 A;  5C4X G;  1WLE A;  3VQY A;  1FKA O;  4I50 A;  2WTF A;  1XUQ A;  3APO A;  2AZ0 A;  1JFF B;  1OCC B;  2AGQ A;  1S0O A;  3RYC B;  5IYC G;  2WDT A;  2PMZ A;  3IFX A;  4A3M G;  1Y1W A;  4DR6 H;  4UCO A;  2UXD B;  1FJG O;  2XAF A;  4JI5 B;  3KYH C;  4FFB B;  4K35 A;  4HBN A;  4JI7 H;  4EKW A;  2NLJ C;  3H4D A;  2A1H A;  3WB0 A;  1BQ0 A;  1OHH G;  4QJF B;  4FFK A;  2ZDG A;  3T1Y H;  2EIN C;  2ILM A;  4FFL A;  2BR0 A;  4JV2 A;  2ZIO A;  2XHB A;  1A0G A;  1F4N A;  3T7A A;  4CS4 A;  2V1D A;  1I2K A;  1AJN A;  5LMU O;  3RYH A;  3HKD A;  5GON A;  5IYB O;  4GKK O;  4A3I G;  1RK5 A;  4O7T A;  2A0L A;  2DZD A;  3H4B A;  2JGD B;  4QWC A;  2QGN A;  1KD1 W;  2H3O A;  4GUN A;  2HJW A;  2HIV A;  3IN5 A;  2HG5 C;  4DL4 A;  4RAZ A;  2YS8 A;  4LF5 B;  2YYA A;  4O3P A;  2WAQ E;  3HO8 A;  1K1S A;  2W7O A;  5C8Y B;  2ATK C;  4DL3 A;  1SQP H;  4YAJ B;  3WB2 A;  3BCC H;  3JSL A;  2HVK C;  5C44 G;  3M9O B;  3WFV A;  4DRX A;  5LYJ B;  2YDE A;  5EWE A;  2YXY A;  3F7Y C;  3FB7 C;  1FXK A;  4KP4 A;  4JTC B;  1NT2 B;  5LYJ F;  4MV8 A;  3CRA A;  5L3B A;  1CKM A;  2W6M A;  1GH6 A;  4I4T F;  4MV3 A;  1GTO A;  1N4C A;  4DR7 O;  4ZIB A;  1IXM A;  5KA6 A;  4H33 A;  1SES A;  5B3S C;  4LFA B;  3TY9 A;  3ZCC A;  3QTC A;  1IDS A;  1ARO P;  4XX0 B;  4LC1 A;  2OCC C;  2B63 A;  4DR3 O;  2Q2T A;  1E1R G;  3CRR A;  2DWE C;  4RAI A;  5E1A C;  1XNR O;  3E83 A;  1Y1V A;  1I3Q A;  2JEI A;  4TVI A;  4DUZ O;  2F93 B;  3R66 A;  4PDB A;  3SR2 C;  3L75 H;  3Q8P B;  5D1O B;  2OWO A;  4LFC H;  2WLN A;  4JI5 H;  3ZMZ A;  1JPX A;  2RNB A;  1CQI B;  3FMA A;  2E2I A;  2A7W A;  2CUG A;  1JOY A;  3ETG A;  4EBC A;  1IBK O;  2AU0 A;  2KKW A;  4RWU A;  1T94 A;  2AHY A;  1SRY A;  1QLE B;  1KQS U;  1P7G A;  5I5U A;  1AVM A;  5F2V O;  2PY5 A;  3B2E E;  4DV0 H;  2HHF A;  3OUZ A;  1WJZ A;  5E25 A;  4DR5 H;  5BMV A;  2PYJ A;  3E5N A;  5FD6 A;  1BZK A;  4BWS C;  5JJE B;  1IBM B;  2VQE O;  2YI9 A;  2HGW A;  1R3K C;  3H1L H;  4LF9 B;  3ZN0 A;  1I94 O;  5EBW C;  3RWR D;  1DIK A;  2W9C B;  4NZN A;  5KG4 A;  4B08 A;  1H8H G;  4BR6 A;  1AP6 A;  4YJ3 B;  5KX5 A;  1XEQ A;  1ET0 A;  1SA0 B;  1O75 A;  1Q82 W;  3GII A;  2ZKO A;  4YJ3 F;  1X9N A;  4A3F G;  3LNN A;  3V4Z A;  3H01 A;  1XL4 A;  1BMF G;  4LFB B;  1U97 A;  2Q68 A;  5DGA A;  4QE9 A;  2DYS C;  1GM8 A;  1YIJ V;  4J7J A;  5JH7 A;  1OWT A;  3ASO C;  2PF4 E;  4UB8 Z;  2BQ3 A;  3CWB H;  4U7C A;  1Y76 B;  2Q9L A;  5JCO C;  3CYO A;  3W7W A;  1N34 B;  3W7T A;  2ADQ B;  4R8U A;  2AGO A;  5EIB D;  4X20 A;  3VQX A;  2QM7 A;  1CP9 A;  1VP7 A;  4RNM A;  5KFL A;  4O4H B;  1EUD B;  4RZR A;  5JVL A;  1TAE A;  4DYL A;  1KKD A;  3BAC A;  2IP4 A;  3T5L A;  4TQS A;  2FB5 A;  4K0K O;  4ED3 A;  1VKZ A;  4O4H F;  1CPY A;  4FFR A;  2HJD A;  4HYO A;  4YHH H;  4PA9 A;  2R7K A;  2ZDH A;  3GV5 B;  2C28 A;  4Q8E A;  2R93 G;  3AG4 C;  2WLI B;  1Q7Y W;  1IOW A;  4CZZ A;  5FL7 G;  3OTO H;  3AK2 A;  4X89 A;  1W93 A;  4DV5 O;  4YJ2 B;  2BOB C;  2JJ1 G;  3S3W A;  3F7V C;  2R7Z A;  2VQD A;  5KMG A;  1L8D A;  3SJQ C;  2ZT9 B;  3H20 A;  2VUG A;  4DIM A;  3ABM B;  4LWS A;  4YR3 A;  3W1B A;  2IMW P;  5CBH A;  2EX3 A;  2ITC C;  4DR2 B;  4B3S O;  3G6E V;  2Z0A A;  2GPW A;  3OR6 C;  2UXC B;  4X65 B;  2R7L A;  5CR5 A;  3HPL C;  2K9P A;  4TV8 B;  3UO2 A;  2UXX A;  2ZM6 B;  1DAA A;  1AR1 B;  1BHA A;  2W9B A;  1XMQ H;  1J5E B;  4A3L G;  1CXZ B;  1M56 C;  1IBM H;  1M57 B;  3ZMV A;  4TV8 F;  1GRJ A;  4TWK A;  1B6Q A;  2AHZ A;  4RNN A;  4QW9 A;  4LBE C;  1EYZ A;  4WCE V;  3EXA A;  3R5X A;  1XQ8 A;  2D2C B;  1RSO A;  2EIL B;  3HT5 A;  5GW7 A;  1JQ0 A;  3LDC A;  3KZI Z;  1Z5W A;  4PV1 B;  1MAB G;  2SCU B;  3LML A;  2X6C A;  3FX7 A;  4BIZ A;  4B3T B;  3BAA A;  1UC8 A;  4HYK A;  1B6R A;  4DV1 O;  3JAK A;  2FK2 A;  2V58 A;  3U54 A;  1SF9 A;  5I47 A;  1RM1 B;  1K5Q A;  1M7J A;  4O84 A;  2FPP B;  4TT3 G;  4JI1 B;  5JCO A;  4CS3 A;  1PL0 A;  3KTM A;  2RCV A;  1P84 F;  1KJ9 A;  2JS3 A;  3J80 N;  3OEH G;  4HR7 A;  1N56 A;  4E4E A;  3O9O A;  2Y69 C;  1EFR G;  1R3I C;  5JQW A;  4FVM A;  2YIB A;  1R73 A;  5K1P A;  4DV7 H;  4BBS G;  5LGT A;  2VUM G;  5LMN O;  4RQE A;  3R5F A;  5KG3 A;  1V55 B;  2I8C A;  4I0X A;  2WWW A;  1FAF A;  4FFO A;  4JAS A;  2PBZ A;  4C5A A;  3K3V A;  1SQQ H;  5LGN A;  3RYI B;  4ZHQ A;  2Y0I A;  1OZ0 A;  5I5V A;  3Q8Q B;  3GIM A;  4O7Y A;  2FTK A;  3PW2 A;  4BAY A;  2PZS A;  1QBZ A;  4UV8 A;  3AYH B;  3SPI A;  3VNN A;  1KEE A;  2UU9 H;  3PN1 A;  2NUA B;  2Q67 A;  3OM3 B;  3MFI A;  4D6T H;  1VQN V;  1L0L H;  1DF4 A;  3H1I H;  5L1K A;  4DR2 H;  3KG2 A;  4O3O A;  1SCU B;  3KRE A;  2UXC H;  1E4E A;  2L6L A;  3JD0 A;  2AQ4 A;  4UB6 Z;  4NTX A;  3B4S A;  4OX9 B;  1WCM G;  5KT3 A;  3DC6 A;  5IJ9 B;  4O2A F;  4WBN B;  4B3M B;  2LFR A;  5BWV A;  2DYR B;  5ITZ A;  4CS2 A;  1BL8 A;  1RP3 B;  4X62 H;  2W8L A;  1Y14 B;  1M93 A;  4WBN F;  3ABK C;  2WA3 A;  3OUS A;  2JA5 A;  1VEW A;  2UXN A;  4W4K A;  4K8Z A;  1BHB A;  3J80 W;  2Q7D A;  5KFS A;  3ABL C;  4N21 A;  1VS0 A;  4GKJ O;  4ED7 A;  3RGX A;  1PNM A;  4FZ1 A;  2QYZ A;  1S68 A;  3N2K A;  2MK3 A;  4ME6 A;  3BA9 A;  2QTS A;  5I5X A;  2YXL A;  4BW9 A;  2UVU A;  2UUB H;  2IBK A;  4J11 A;  1A0I A;  3BQ1 A;  3P30 A;  1HNW B;  3IG0 A;  4O2B A;  4DR1 B;  1XMO B;  2DJV A;  3IC7 A;  5CA1 A;  1GM9 A;  3N40 P;  3CC7 V;  2HR3 A;  4YBZ B;  4JI3 O;  1YZB A;  5B5E Z;  4O3R A;  4Z1V A;  2ZNI A;  1JCH A;  3PVX A;  5LOV B;  5DLG A;  1N36 O;  4KXR A;  3FAV A;  4JI4 O;  2BE3 A;  5DEC A;  5LOV F;  4PBC A;  2CDY A;  3T9D A;  1W0K G;  4LF4 H;  3GTK A;  1HNX O;  3T9B A;  4L87 A;  3SJC C;  2YZG A;  3TXS A;  2E5L O;  1CKN B;  1K83 A;  3P3P A;  4QIW A;  2W6I G;  1AI7 A;  3PJS K;  1R1B A;  3STZ C;  4DV6 O;  4LNU A;  5LXT B;  3L74 H;  4DUY B;  1HP8 A;  3U0Z A;  2HIX A;  4PI0 A;  4BWA A;  5LA6 A;  2Z02 A;  1K33 A;  5KFO A;  5LXT F;  1EN6 A;  2RDI A;  3K06 A;  1G1X B;  3LNM B;  3OW2 U;  1Y74 B;  5EZY A;  3I4N G;  4R50 A;  3G6Y A;  4MV1 A;  4GZR B;  5DED A;  4DR6 O;  4CKB A;  4J9Q A;  1NTM H;  2W6O A;  4CKE A;  4B3M H;  3EPI A;  1NI8 A;  5B1O A;  3RR5 A;  1EHI A;  3JRX A;  4JI7 O;  2W0F C;  1RJR A;  2W9A A;  3B8M A;  1MZE A;  2YID A;  4ZOL B;  1F23 A;  4JAA A;  4EQ5 A;  5DIS C;  2WPD G;  5DMX A;  3OT7 A;  3SGI A;  4ECW A;  2E2H A;  5FJ8 G;  1KJQ A;  4MVU A;  2HFE C;  3FD9 A;  3UM7 A;  5BXZ A;  2QDO A;  2XC9 A;  3E22 B;  5IT9 N;  2R8I A;  3I5D A;  2W6Z A;  2EJ3 A;  4J10 A;  4IAJ A;  2JA8 G;  1HR0 O;  3FYE B;  1OCR C;  1HNW H;  3T9E A;  3KKY A;  5IWA B;  1QVF U;  5J2T A;  3NGD A;  1JJO A;  3QZ7 A;  2Q8V A;  1ZHS A;  2P90 A;  2WAQ A;  5IDJ A;  2E74 B;  4O3S A;  5KT4 A;  2QR4 A;  1GN4 A;  2QEX V;  3MAQ A;  2Q7H A;  1M9N A;  4P9O A;  3ASN B;  4MTD A;  4DQN A;  1LUV A;  4LF6 H;  4O81 A;  4B7K A;  1BQZ A;  1IXB A;  2UXB O;  3E8F A;  2D3O W;  4ED8 A;  4JV1 A;  4O7N A;  3RTX A;  3M9N B;  3Q1K A;  3E89 A;  3JAL A;  2X0L A;  4NXN H;  4F50 A;  5GTH Z;  1PNK A;  2JA7 G;  4PDV A;  4EGQ A;  2GTS A;  4A93 G;  2EBO A;  2P4V A;  3KCY A;  2DPI A;  3HKE B;  2ZDQ A;  3ABU A;  3GIK A;  4IYH A;  4UUG A;  5T14 A;  5JVD A;  5KAF Z;  5H5N A;  3TET A;  4GLW A;  1G4Y B;  4IRC A;  1Q86 W;  4LFC O;  1SEI A;  1YI2 V;  5IT9 W;  2XCP A;  3CX5 F;  2FK3 A;  1KUT A;  2HDK A;  4GC6 A;  1K3E A;  4WFE A;  2HVS A;  4EEQ A;  2ZR3 A;  5IP9 G;  3T5H A;  4DV4 B;  1NBM G;  3VOU A;  1SQV H;  3CEB A;  2AGA A;  2JA6 A;  5IYB G;  4RUF A;  1W2B U;  5L1J A;  4A3E G;  4DV0 O;  1KP3 A;  5KHI A;  4DR5 O;  2DIK A;  3ZRV A;  1ZHQ A;  2YC0 A;  3CCS V;  1VBH A;  4X8A A;  4O4J A;  4LH6 A;  2CNV A;  2HVR A;  4UVC A;  4XDK A;  2GBO A;  3N2G B;  4IYI A;  1BXR A;  4Q20 A;  3PFF A;  3TIN A;  3CRM A;  5TIS Z;  4RB0 A;  2KSD A;  1MMM A;  1GN6 A;  1Q6H A;  2QWP B;  2WSS G;  3BFR A;  2HHH H;  3FYI B;  4I5S A;  2DW4 A;  1ENV A;  1R6T A;  4K8X A;  2BQU A;  4J9O A;  3HKC B;  3L72 H;  5F9L A;  1N33 O;  4JYA B;  4DV2 B;  2GQS A;  1IZ3 A;  1WPX A;  4DR4 O;  1I1M A;  2KB1 A;  3QG5 A;  1NH2 B;  3CSX A;  3G6B A;  2DPJ A;  4I7H A;  3MR6 A;  2XIG A;  4YY3 B;  4TQD A;  2G38 A;  3CQZ A;  2FML A;  1VQ6 V;  3HOU G;  3TY5 A;  3AG3 B;  1N32 B;  3T54 A;  1MNG A;  4PZ6 A;  5FPR A;  3ZHQ A;  2V59 A;  3CEI A;  2R70 A;  4R7C A;  5HNE A;  2QM4 A;  2R82 A;  2DWD C;  3D3Q A;  3HB3 B;  2YZL A;  2E75 B;  4YHH O;  3OR7 C;  2NU8 B;  3JAT A;  2R86 A;  3JAS A;  1Q43 A;  3JD4 A;  1JIH A;  4XDJ A;  3QQM A;  2QF7 A;  1AI5 A;  3U9S A;  4FBT A;  3OTO O;  4XYM B;  1RPO A;  5I5T A;  3HOY G;  3CC4 V;  3TK1 A;  5K3W A;  3U9T A;  1NQT A;  1OCC C;  2GDS A;  2XCL A;  4LF8 B;  3AG7 A;  2NVY A;  4JI6 B;  4JI2 H;  5KFA A;  1WA8 B;  1KU9 A;  1IBL H;  3UZO A;  1S3J A;  1UJW B;  3AG2 B;  2IH1 C;  4KFM A;  4AHC A;  3T1H H;  4ED2 A;  5KFT A;  2JA5 G;  4LF7 H;  1R3J C;  2XAS A;  2W7P A;  3CCR V;  4ECS A;  3NBZ B;  1EN4 A;  2K1E A;  1GKF A;  3GWO A;  3E8G A;  1XMQ O;  3WWI A;  5KFJ A;  1N48 A;  4GT1 A;  4ZI7 B;  4MV9 A;  4A3C G;  4K3A A;  2NU9 B;  4IIJ F;  3W1G A;  2DE0 X;  3QO8 A;  2DQ3 A;  1XHX A;  4U3F H;  4ZI7 F;  1AN7 A;  3N42 B;  2OIG A;  3LDD A;  2IJK A;  4CMD A;  5LP6 B;  2FL4 A;  3HOW G;  1P8L A;  2UUC B;  4XBF A;  3TEK A;  3SYC A;  1ZL8 A;  4UCS A;  4NYE A;  3LP8 A;  5H80 A;  5LP6 F;  4ZQI A;  1M4U A;  4W4L A;  1M0W A;  4J9P A;  4J9N A;  3MR5 A;  2WB1 A;  1SQX H;  2R92 A;  1AUV A;  2YEV B;  3DAA A;  2R8G A;  1IYE A;  5KFU A;  1ROP A;  1A48 A;  1TVK B;  3APQ A;  1WP8 A;  4U3J B;  5IYZ B;  4CKC A;  3GLK A;  4HNA B;  1S77 D;  1S0V A;  2CGN A;  4X66 H;  3K9S A;  4UFZ A;  1OCZ B;  3SPH A;  5IYZ F;  1OCO B;  5FLM G;  3ICX A;  2P0A A;  4X64 O;  3JAW B;  1JX9 A;  4ZKI A;  2R8J A;  4DV7 O;  1XNQ B;  3UT5 A;  4A2B A;  3DTF A;  5KFE A;  4JYC A;  3UKM A;  4Q44 A;  2P6J A;  1IOV A;  2X7R B;  1VF6 C;  4JI0 B;  3MWE A;  3VPD A;  2E76 B;  4JZG A;  4NXM H;  3T5K A;  4WFG A;  1JFF A;  3RYC A;  2ZE8 A;  5CMU A;  3H1K H;  2Q0O C;  4IRD A;  2UU9 O;  3A0B Z;  2Y0S A;  4WFF A;  3RV3 A;  5A9G A;  1GN3 A;  2FLN A;  2GUZ B;  2PYL A;  3CCL V;  5KFB A;  1S0N A;  1R9T A;  5C8Y F;  2RGV A;  3JZI A;  3DGE A;  2AGP A;  2VOB A;  4JTD B;  4UXN A;  4FE2 A;  3HKZ E;  4DL6 A;  1F4M A;  3N27 A;  4QJF A;  4ZBM A;  5KUK A;  5BR8 H;  3RYF B;  1NJI W;  4CC5 A;  4MT8 A;  4DLK A;  5KG2 A;  4MVM A;  4AQY B;  3SPJ A;  5D5Q A;  2PUS A;  5EBL C;  5BWW A;  1XI1 A;  2QWQ B;  1QLE C;  4X62 O;  4X1Y B;  5IY5 C;  4H37 A;  3ZMS A;  5C1P A;  1TUB B;  4RNO A;  5B1A B;  1RYR A;  4DV3 B;  3OFN G;  4RB3 C;  2JGD A;  4D7S A;  4O3Q A;  3EHB B;  4RCN A;  2DMX A;  2JK5 C;  3P32 A;  4X1I B;  2UXD H;  2HHF B;  2ZIM A;  2AZ2 A;  1K97 A;  5BMV B;  2WLM A;  2CTQ A;  1SER A;  2CZG A;  1PM9 A;  4QE7 A;  3PR4 A;  4ECV A;  2UUB O;  1HDJ A;  1A32 A;  3IAY A;  4A3G G;  2VQF B;  5BWT A;  3H0G G;  2IU0 A;  5E79 Z;  1TWC A;  1I1L A;  3JSN A;  1I50 A;  5LYJ A;  1CKO A;  1XK5 A;  4FLU A;  3SI8 A;  2EIK C;  1GLV A;  2A3Q A;  4I4T A;  3RFR A;  5KX5 B;  4CC6 A;  1HNZ B;  2COI A;  4I9W A;  2EIY A;  2QWN B;  5J2U B;  3B77 A;  3CXC U;  1VF6 A;  1KBL A;  3LQS A;  4KUM A;  4E4T A;  1YIT V;  2Y4T A;  4CHI A;  2J6U A;  2KG7 B;  2IJH A;  4AI8 A;  4A5U B;  4LF4 O;  3ML0 A;  3ETJ A;  2DLN A;  4F4W A;  3U55 A;  2QA4 V;  4R8U B;  5DQG A;  3SYQ A;  1WR2 A;  2Z5U A;  4LSX A;  2EZP A;  4LF5 H;  4L1K A;  4HZ3 A;  1GSO A;  4MV6 A;  1Q5O A;  5D8D A;  1MZF A;  4JI8 B;  2ARH A;  2QWO B;  4B3R B;  1BT8 A;  2A9H A;  4JV5 B;  4F4Z A;  1Q3E A;  2DN9 A;  2H8P C;  1KBH A;  4DL2 A;  2F4V O;  1BSM A;  2X6A A;  3GTP A;  2RMK B;  4A3D G;  2YS7 A;  3WG7 B;  3BQ0 A;  3OEE G;  3ZED A;  2EIM B;  4JV0 A;  1S5L Z;  1KB9 F;  1G6U A;  2P67 A;  2VRZ A;  4LFA H;  1M1K W;  3H1H H;  3MHS C;  1FJG B;  3BG5 A;  2UUA O;  5KMG B;  5C5J A;  4FGR A;  1KKC A;  5BPH A;  3ZHV A;  4LWS B;  5DN6 G;  2C2R A;  2W9C A;  4ECT A;  2UVV A;  1M57 C;  3RVY A;  3QF7 A;  1WNS A;  2EIJ B;  4YJ3 A;  1GO3 E;  2KQX A;  5KFF A;  2CTW A;  1SA0 A;  3ZRS A;  3K5M A;  3KAJ A;  2CH7 B;  2EIL C;  2LJ2 A;  4F6R B;  3FKI G;  3TII A;  4BY7 G;  5C3E G;  5LMU B;  3KCX A;  4GKK B;  4YJ2 F;  1EKP A;  3ZN1 A;  3NBY B;  5F9N A;  2WLJ A;  1KC8 W;  1RM1 C;  2FKX A;  3WWJ A;  1S03 G;  1PPJ H;  1Y76 A;  3L70 H;  2ZGI A;  3FB8 C;  3W7X A;  4FFM A;  4YP3 A;  2L35 A;  3JAK B;  3HR0 A;  2HJF C;  5CB4 B;  2YZN A;  2IU3 A;  1I7N A;  4J9R A;  2DWC A;  5CB4 F;  4LF9 H;  5LHG A;  2ZD9 A;  1DV2 A;  3PO2 G;  4O4H A;  3WU2 Z;  3EFF K;  1MOF A;  3GWK C;  4LF6 O;  4YIO A;  5KT2 A;  3K59 A;  3RB6 A;  3M99 B;  1V55 C;  4J9Z B;  3IGA C;  1OBD A;  3SYA A;  1E4F T;  4NXN O;  4EB6 A;  3RB3 A;  3J7A U;  2OCH A;  2WLI A;  4GCZ A;  1XHZ A;  5KFG A;  3EVK A;  3MWM A;  4LFB H;  4DR7 B;  4O7Z A;  5LL6 b;  4RU9 A;  4AIL C;  4MTX A;  3SJB C;  3HBL A;  3PR5 B;  1S97 A;  3T4D A;  3OSN A;  2QKS A;  1J95 A;  3AG4 B;  1OBG A;  5KFH A;  4ETS A;  3X2Q C;  4DR3 B;  1P4R A;  5L1L A;  3BJY A;  5KHJ A;  3FFQ A;  4YR2 A;  1XNR B;  3S24 A;  1N34 H;  4FLT A;  2IJI A;  4FLX A;  1UNN C;  4O4I B;  4DUZ B;  3QWU A;  2PMZ E;  2HG8 A;  4TV8 A;  3BVO A;  1C30 A;  4C2M A;  4O4I F;  5KG7 A;  4TUY B;  3C3T A;  4APM A;  2F43 G;  2AXT Z;  1IBK B;  4JZ2 A;  4PA7 A;  2ZR2 A;  4TUY F;  3T9F A;  3CCQ V;  2FE3 A;  1M56 B;  1EZJ A;  4NTW A;  4IR1 A;  1SQG A;  5CA0 B;  1DLB A;  2V4Q A;  2ZQM A;  1BCC H;  2F23 A;  1A9X A;  4J9L A;  1NH2 D;  4ECY A;  2BOC C;  5CA0 F;  3MD0 A;  5EDW A;  3N6R A;  1Y1W G;  2B5U A;  1PK8 A;  2BTQ B;  2XOK G;  2ETN A;  1PKX A;  5LMU H;  1KT8 A;  2VQE B;  1NZ6 A;  4JUZ A;  3JAR B;  4YR0 A;  1I94 B;  2RJZ A;  2VWJ A;  2BSK B;  4BBR G;  1SZT A;  1JR9 A;  5K1X A;  3GVM A;  4X65 H;  1GYF A;  5B1B B;  1NU1 H;  2Y4U A;  2ZM6 H;  3UQ8 A;  3PO3 G;  1KTA A;  1K73 W;  4LP8 A;  2HHH O;  3HB9 A;  1J5E H;  1WPB A;  2JDI G;  2Q7E A;  1K4D C;  1E1Q G;  1THZ A;  4NVP A;  2LW7 A;  1T36 A;  2V5A A;  1VQ8 V;  3OHA A;  2C00 A;  3DXR B;  2C2E A;  4I55 B;  3VOT A;  4DO2 A;  4YAK B;  3G80 A;  4QWA A;  1H2G A;  2VR1 A;  4I55 F;  4H13 B;  5KT7 A;  1Q6I A;  4B3T H;  4Q4D A;  5DQI A;  1M90 W;  5I5S A;  2NNU A;  5EWG A;  2YS6 A;  2RGR A;  4FM9 A;  4TOI A;  4JI1 H;  3GIP A;  3JD3 A;  1EKV A;  2B1G A;  2LFS A;  3FAV B;  2N74 A;  2XND G;  2ODT X;  4KHP O;  4K0K B;  2ATL A;  2FPG B;  1NKD A;  4O2A A;  1NR7 A;  5BWU A;  4LNU B;  4LMY A;  2C2A A;  5IJ9 A;  4A2A A;  4WBN A;  3AK3 A;  2CGO A;  3UFX B;  3Q8S B;  1G8M A;  1QVG U;  2R6F A;  3E86 A;  4MAM A;  4DV5 B;  4JI2 O;  3RJ0 A;  1IBL O;  2J6T A;  2QM8 A;  3LSU A;  3T1H O;  5KFY A;  4LF7 O;  4J9Y B;  1VF7 A;  4K6N A;  2WLL A;  2C22 A;  2B63 G;  2GQR A;  1TWG A;  4NZO A;  3MJF A;  1Y1V G;  1RPR A;  4B3S B;  3I56 V;  4MS2 A;  1S0M A;  3K79 A;  3ABT A;  2W6P A;  3TW7 A;  1MA1 A;  1YXB A;  1ZUQ A;  3BPZ A;  4X1K B;  3C3S A;  3C0F B;  1UC9 A;  5KKN B;  2VQE H;  1CS0 A;  2OTJ V;  2JEU A;  1X4T A;  3OSP A;  4J9S A;  4M0J A;  1T3N A;  2CKZ B;  4I7Z B;  4G3I A;  3HKB B;  3E8H A;  5B66 Z;  3OE7 G;  4EBD A;  2CTR A;  4Y8V B;  3FB6 C;  2JS5 A;  3GIL A;  1PD3 A;  4UVA A;  5JUM A;  2C2D A;  1GGO A;  4OX9 H;  3GTQ A;  5H6R A;  3LUL A;  1TGO A;  4O7R A;  4EFB A;  3ORQ A;  4WD3 A;  4DV1 B;  2P7T C;  5EIB C;  5CBF A;  2QB5 A;  5LOV A;  3BY6 A;  2XGQ A;  3SDL A;  2QE7 G;  5CBG A;  1Q81 W;  4QGP A;  4X66 O;  1MZB A;  3T1Y O;  1B04 A;  3V4S A;  4ZOL F;  1XIL A;  4JXU A;  2YZM A;  1CKN A;  4GLX A;  3CJH B;  5DG7 A;  3ZHR A;  1L2Z A;  5LXT A;  2W71 A;  2Z04 A;  3ASN C;  3OGC C;  1A3G A;  5BZB A;  1SFO A;  5BYA A;  1QLN A;  5LMN B;  3BAB A;  5FLX N;  1EM1 A;  2Z3Y A;  2NU6 B;  4DR1 H;  3S3X A;  5JQG B;  4C5B A;  1XMO H;  2BTO A;  4NXM O;  4O86 A;  1D5N A;  2MW2 B;  1H2S B;  1T5E A;  1C3O A;  5LHH A;  2YCH A;  1V54 B;  3RGB A;  5KS8 A;  3K5N A;  1SET A;  3M7M X;  2WLH A;  1YTF B;  2R7M A;  1I7F A;  2EJ2 A;  3RAQ A;  2HEP A;  4DV5 H;  3PZP A;  3CC2 V;  2Q6A A;  4ZOL A;  2EZO A;  1E4G T;  3HKZ A;  1V9P A;  4QPK A;  1GSA A;  4PZ8 A;  5HFM A;  4MA0 A;  1R6N A;  5JVD B;  5BR8 O;  2HGX A;  3Q4H B;  3VA7 A;  2XCA A;  1ZLZ A;  1RJP A;  4O3N A;  1O9H A;  4DUY H;  4Q0Y A;  1PL4 A;  1R3L C;  4YIP A;  3E22 A;  3T9C A;  3KHG A;  4CH6 A;  1NTK H;  3LUT B;  1I7L A;  4IHJ B;  5KUM A;  4DL7 A;  1KJI A;  4MW3 A;  3GTG A;  2R7Z G;  3UYY A;  3AK1 A;  4IHJ F;  2ZXW B;  3DTG A;  2NU7 B;  5KT6 A;  1I08 A;  1K92 A;  4H0L B;  3K5O A;  2ADP A;  1IYD A;  1CQJ B;  4GKJ B;  1KMI Z;  1E79 G;  3GIQ A;  2UXD O;  3U11 A;  4JI5 O;  3E2E A;  1JDB B;  5FNV B;  3OD4 A;  3TXQ A;  1Z2N X;  2F1M A;  4IT5 A;  1VQL V;  2GTA A;  2X5R A;  4O4J B;  5LHI A;  2CQY A;  5FNV F;  4NYK A;  5FLX W;  2YUA A;  1UPG A;  4BW5 A;  2CFM A;  3GJX B;  4EGJ A;  2OLS A;  3R5H A;  2R9A A;  2JJ2 G;  4FM2 A;  2JEJ A;  1QCE A;  1I0H A;  3OMA B;  2IH3 C;  1K8A W;  3NR7 A;  5EC2 C;  4JI3 B;  3GQC A;  3J7A K;  1FD9 A;  1Y4M A;  1I6U A;  1SQB H;  3ZRW A;  3AW8 A;  3CCM V;  1N36 B;  2Q2U A;  5IWA H;  3HKE A;  2VA2 A;  1FFX B;  1QQC A;  1B6S A;  3AG1 B;  4JI4 B;  2GV9 A;  1PV0 A;  3AG3 C;  4EEY A;  4TM5 A;  2M7W A;  1HNX B;  1K1Q A;  5EC1 C;  5L3D A;  1VBG A;  4LF5 O;  2YRW A;  3RAX A;  2E5L B;  2JGU A;  3W7S A;  1GO3 F;  3DSQ A;  5DQH A;  1RYS A;  4DV6 B;  2W6Q A;  1AR4 A;  1Z2O X;  5AG2 A;  3L73 H;  2COG A;  1SYX B;  2R9R B;  3CCU V;  5KHK A;  1FVI A;  1ULZ A;  3CMA V;  3JCZ A;  1NVP B;  3AEI A;  2R93 A;  3OMI B;  4FLW A;  1H2K A;  4G2K A;  2PGG A;  2PVP A;  3GTM A;  5DLF A;  4XZ3 B;  2V9W A;  3SYO A;  4DR6 B;  1L1F A;  4O83 A;  4LFA O;  3AG2 C;  2OIE A;  1K34 A;  4FLY A;  4QSH A;  4JI7 B;  5EYP B;  1ZWI C;  2F95 B;  2GLT A;  3A8T A;  3R9R A;  3LSS A;  4NB5 A;  4TQF A;  4HQ6 A;  1EBO A;  3G67 A;  4YXW G;  4F4X A;  3N2G A;  1TA8 A;  3QO5 A;  3H9V A;  3ZHS A;  3RBE A;  1XDC A;  5H2F Z;  4YB8 B;  5IP7 G;  1DTO A;  4O7V A;  4RB2 C;  2VPQ A;  4WF9 V;  1TWH A;  4JTA B;  4O4L B;  2FYU H;  5IJ0 B;  2Y0P A;  5LP6 C;  4IWX A;  1COW G;  4EFE A;  3A2F A;  2YIB D;  3R65 A;  4TV9 B;  4DV4 H;  1HR0 B;  4O4L F;  3BQ2 A;  4QW8 A;  1Z2P X;  2R87 A;  1V51 A;  1NS1 A;  3CHX A;  4I50 B;  3G71 V;  1BE3 H;  4QWE A;  4C7U A;  2B1I A;  2ZE7 A;  4QPJ A;  3OUU A;  3KAL A;  4I50 F;  5KFP A;  4JI3 H;  1IBM O;  1ORQ C;  3MFH A;  2RDC A;  3W7U A;  4LF9 O;  2HP8 A;  1OCO C;  1XBL A;  1AI6 A;  2EJR A;  5KFX A;  4A3B G;  2LGW A;  3TIG A;  4FM0 A;  1FXH A;  5KG0 A;  1HNX H;  3UCS C;  3SPG A;  3TQT A;  3K04 A;  4QIW E;  2VUM A;  3CCE V;  4IZO A;  2UXB B;  1B3Q A;  4RUC A;  4JPR A;  3ZIA G;  1CE8 A;  1TWF A;  4EG0 A;  1S76 D;  4FU0 A;  4LFB O;  2CNQ A;  4JYA H;  5IYD O;  3RYH B;  4DV2 H;  3HKD B;  5GON B;  4O82 A;  2VPS A;  3GTL A;  3K5L A;  2JEG A;  1WA8 A;  5GON F;  3M4I A;  1N34 O;  4YY3 H;  4CE5 A;  3DC5 A;  2N04 A;  2F66 C;  3SNO A;  4IIJ A;  3G6X A;  4ED6 A;  3K03 A;  2B9Z A;  5J9P C;  1N32 H;  4LFC B;  4ZI7 A;  5B1N A;  2QJ1 A;  4EYI B;  4EBE A;  3TW6 A;  3KXY T;  3CS5 A;  3LDE A;  1S72 V;  4UUJ C;  4FLZ A;  1VMG A;  5H6Q A;  2IM9 A;  4DRX B;  3GTJ A;  2JRI A;  2DAB A;  3T2M A;  5CA3 A;  1WCM A;  1FXK B;  5LP6 A;  2P06 A;  4AYB E;  3RVZ A;  3ORR A;  1LNQ A;  2WE6 A;  5B1A C;  4LH7 A;  4DV0 B;  4JF3 A;  2IA6 A;  4DR5 B;  1H38 A;  3MDS A;  3T5J A;  4FFB A;  4PA6 A;  3I12 A;  4ECX A;  2YEV A;  3RUP A;  2P22 C;  2FP4 B;  2M05 A;  1BNC A;  4JI6 H;  1HR0 H;  4LF8 H;  2R72 A;  1TVK A;  3OHB A;  4F4L A;  4U3J A;  5IYZ A;  4DR2 O;  2EJ7 A;  1XL6 A;  4HNA A;  3N8D A;  3V6K A;  1ZTE A;  2E3C A;  2UXC O;  4X65 O;  3RT3 C;  4FLV A;  3TQ1 A;  2ZM6 O;  2CW7 A;  3GTO A;  3JAW A;  1J5E O;  2FLL A;  4IRK A;  2COJ A;  4QNH B;  2P5O A;  5DGB A;  2OYQ A;  4YQW A;  2R85 A;  1K4C C;  3G4S V;  2EIN B;  3E35 A;  1WRV A;  4A3K G;  5BPF A;  1P49 A;  1LR1 A;  3LSQ A;  2Q69 A;  1P16 A;  4UVB A;  1N33 B;  5L9X A;  1L0N H;  2GPS A;  2VWK A;  4MVO A;  4DR4 B;  2UUC H;  4B3T O;  2LO1 A;  4I4T B;  5KG5 A;  1D5A A;  2XGP A;  2UXB H;  4MW8 A;  2CTP A;  2ALZ A;  3TCU A;  3WB1 A;  4CBC A;  3P3N A;  4JI1 O;  5C8Y A;  2RQ6 A;  4IGG A;  2QWR B;  5BMV F;  2GUZ A;  5I5W A;  2EUL A;  4Q43 A;  3QFF A;  3T99 A;  3GB8 B;  1JLL B;  3Q2O A;  3SPC A;  4YHH B;  2CK3 G;  4P2Z A;  3T4Z A;  3RYF A;  4PWQ A;  4FFP A;  1XNQ H;  2J6S A;  1N8R W;  4JAV A;  5KX5 F;  4NLG A;  1YJ9 V;  1KC7 A;  3RBD A;  3OTO B;  4PEL A;  5L3C A;  4DW1 A;  4X1Y A;  3JRW A;  2YI8 A;  3CRC A;  5J2U F;  3RFC A;  3VPB A;  3WG7 C;  1I2L A;  5JH7 B;  4JI0 H;  1TUB A;  4P9P A;  1JKJ B;  1SZX A;  3O65 A;  2EIM C;  1O9G A;  3THO A;  4M7E A;  5IY5 B;  2DOS A;  5B3S B;  5CAE B;  5JH7 F;  5CM0 A;  3BA8 A;  2OCC B;  1KYO F;  2YSU B;  1QU7 A;  5EK0 A;  2YWV A;  1NTZ H;  5D1O A;  4X1I A;  3G8D A;  2JVD A;  5JJJ B;  2Q4P A;  4X20 B;  1XMQ B;  5DG8 A;  2VA3 A;  1KUQ A;  4MV4 A;  4LSA A;  3G6V A;  3W5O A;  1EN5 A;  3ZJZ A;  2EIJ C;  1EZV H;  3BRC A;  2XTA A;  4MTG A;  1ZSP A;  4PHZ A;  5I5Y A;  3BEH A;  4UCT A;  1D2D A;  1FFT B;  3HXL A;  1P7B A;  5KFI A;  4G28 B;  5I60 A;  3SJA C;  2W8K A;  4OX9 O;  3V6H A;  3LWB A;  2LW1 A;  4Q45 A;  4AQY H;  3ETH A;  4B3M O;  3OTF A;  1H2M A;  2ODM A;  1Q90 D;  3ABM C;  1ZET A;  2PN1 A;  5J2U A;  2ITD C;  2JA6 G;  1S5J A;  4E6N A;  2EIK B;  2DAA A;  1JMK C;  3D8C A;  2KG7 A;  4OGQ B;  5IYC O;  1N33 H;  1VQO V;  4DV3 H;  1K9M W;  1YTF D;  2FK1 A;  3GV7 B;  4DR4 H;  2I80 A;  4FZ0 A;  2HVJ C;  1VIB A;  1I1K A;  1PX2 A;  3CCV V;  3B8N A;  2W0X A;  2W9B B;  3ZX6 A;  3U10 A;  4X64 B;  2EJ0 A;  3OMN B;  3K9A A;  3ZBH A;  3HOZ G;  4DV7 B;  5BY1 A;  1HNW O;  2CW8 A;  4GX1 A;  1N0J A;  2ZE6 A;  1JJ2 U;  2WA4 A;  4O7L A;  2VQF H;  4DR1 O;  1RSO B;  3Q8R B;  1XMO O;  3FB5 C;  4PA3 A;  4UCV A;  3N41 B;  4MSW C;  1HNZ H;  4R7R A;  2DYS B;  4IR9 A;  4EB6 B;  2JA7 A;  2CAZ C;  3OUF A;  4NTY A;  3ASO B;  1SC5 B;  1DV1 A;  4PDM A;  2UU9 B;  1MSW D;  4GX5 A;  1Q6U A;  3JD2 A;  1JVM A;  1WB8 A;  4J0M A;  1M5I A;  5KFN A;  3PW7 A;  2CE4 A;  4JAU A;  4B7E A;  5KFV A;  1YHQ V;  4CH5 A;  3IJ4 A;  1KJ8 A;  5DM6 V;  1B33 N;  2XAG A;  3PW5 A;  4EYH B;  1X59 A;  4DUY O;  4XYL B;  5KAI Z;  1URF A;  2BCC H;  2ZJT A;  4G27 B;  1VAJ A;  4JI8 H;  2CH7 A;  4F6R A;  4I0X B;  2XT9 A;  3CRQ A;  4YJ2 A;  4GYC B;  3RN4 A;  1M6V A;  2HGS A;  4B3R H;  4X62 B;  4J7K A;  4JV5 H;  2YIC A;  4JGS A;  4ZHQ B;  1WAZ A;  2IBZ H;  1ZX3 A;  5EWF A;  4NR1 A;  4PD4 F;  1FKA H;  1GSH A;  4UV9 A;  4WFA V;  4ZHQ F;  4Q6G A;  3TJT A;  1GMG A;  4HAM A;  5D1P A;  2FLP A;  1EUC B;  1YF2 A;  5CB4 A;  3EPG A;  3QO7 A;  1FJG H;  2WB1 E;  4FJC C;  1RK6 A;  3N43 B;  5IE9 A;  2UUB B;  5B1B C;  4JYB A;  4WFB V;  3N6X A;  2VS0 A;  4MVZ A;  1CEZ A;  2DYR C;  3JCU Z;  3VQV A;  4RUA A;  1E4E B;  1DF5 A;  4U7O A;  3K5H A;  2FMA A;  1DGS A;  4MTE A;  2X0S A;  4X64 H;  4DAA A;  3VMM A;  2Y4R A;  3L2P A;  1NVP D;  2RF4 A;  5ITZ B;  4M9U A; 
#chains in the Genus database with same CATH homology
 1H2S B;  1T5E A;  2YCH A;  1QHT A;  1SQF A;  1WN7 A;  3RGB A;  2PY5 A;  4LF8 B;  3K5N A;  3B2E E;  4GKK H;  4JI6 B;  4JI2 H;  4DV0 H;  1KU9 A;  1IBL H;  3M7M X;  1BGW A;  4DR5 H;  5BMV A;  2PYJ A;  4LF4 B;  1I7F A;  4AHC A;  5FD6 A;  3T1H H;  4LF7 H;  4BWS C;  5JJE B;  1IBM B;  2HEP A;  3N2K B;  4DV5 H;  3NBZ B;  2YI9 A;  4O4I A;  4LF9 B;  4D7T A;  4ZOL A;  1E4G T;  3RWR D;  4ZI7 B;  4DK1 A;  1V9P A;  4MV9 A;  4PZ8 A;  4B08 A;  3W1G A;  5JVD B;  4CH3 A;  4YJ3 B;  5KX5 A;  1XHX A;  4TUY A;  4RB1 A;  2Q0A A;  1O9H A;  1SA0 B;  4DUY H;  1O75 A;  4Q0Y A;  1AN7 A;  1ZAU A;  3N42 B;  4O2B B;  2HVQ A;  3E22 A;  1X9N A;  1WH2 A;  3LNN A;  3RYI A;  5CA1 B;  5LP6 B;  4CH6 A;  1P8L A;  2UUC B;  2F4V B;  4O2A B;  5CA0 A;  4LFB B;  3RIZ A;  4IHJ B;  3GDE A;  2MCT A;  4UCS A;  5JH7 A;  1M4U A;  1M0W A;  4DR7 H;  3ZS8 C;  2BTQ A;  3K5O A;  5JCO C;  1N34 B;  4GKJ B;  1KMI Z;  1TVK B;  2UUA B;  4U3J B;  5IYZ B;  3U11 A;  4DR3 H;  3JAR A;  4HNA B;  5FNV B;  1Z2N X;  5EIB D;  1YEW A;  2F1M A;  4X20 A;  3VQX A;  4X66 H;  4UFZ A;  1XNR H;  4O4J B;  4DUZ H;  4O4H B;  3ICX A;  5FLX W;  3JAW B;  1TAE A;  3L4K A;  1XNQ B;  3UT5 A;  4A2B A;  5LA6 B;  2CFM A;  3GJX B;  3ETQ A;  4YHH H;  2R9A A;  4I55 A;  4FM2 A;  1IBK H;  3OTO H;  5EZY B;  4JI0 B;  4NXM H;  4JI3 B;  2PTM A;  5D5P A;  3N44 B;  3J7A K;  4YJ2 B;  1JFF A;  3RYC A;  5KMG A;  1I6U A;  1N36 B;  1L8D A;  2Q2U A;  3H20 A;  2VUG A;  3HKE A;  5IWA H;  1FFX B;  1QQC A;  3BHP A;  2Q7G A;  3W1B A;  4JI4 B;  2GV9 A;  2EX3 A;  1HNX B;  4DR2 B;  2PYL A;  2UXC B;  4X65 B;  2E5L B;  2JGU A;  2RGV A;  4TV8 B;  2ZM6 B;  3DSQ A;  1I94 H;  1XMQ H;  2VOB A;  4DV6 B;  1Z2O X;  1J5E B;  4LF6 B;  1IBM H;  1Q8I A;  5BR8 H;  3RYF B;  1SYX B;  4CC5 A;  4AQY B;  1XQ8 A;  5KHK A;  1FVI A;  1RSO A;  5D5Q A;  2PUS A;  4NXN B;  1XI1 A;  1BJT A;  1Z5W A;  4FLW A;  4X1Y B;  3LML A;  4B3T B;  3BAA A;  2PGG A;  2YIA A;  1TUB B;  4DR6 B;  3JAK A;  4DV3 B;  5J2T B;  4RB3 C;  4D7S A;  2F4V H;  3L4J A;  4JI1 B;  2ZCE A;  5JCO A;  4FLY A;  4CS3 A;  5EYP B;  4JI7 B;  2F95 B;  4X1I B;  2UXD H;  2ZIM A;  4TQF A;  5BMV B;  4LR3 A;  3N2G A;  4DK0 A;  1TA8 A;  4X1K A;  5KHH A;  4RZQ A;  2UUA H;  3CB2 A;  4FVM A;  3IAY A;  2VQF B;  2YIB A;  5K1P A;  4DV7 H;  3KAK A;  3JSN A;  4RB2 C;  5LYJ A;  4K0K H;  3DF7 A;  1CKO A;  3HKB A;  4O4L B;  1XK5 A;  4FLU A;  5IJ0 B;  5LP6 C;  4I4T A;  3RFR A;  5KX5 B;  4CC6 A;  1HNZ B;  4EFE A;  3A2F A;  2YIB D;  4TV9 B;  3JAL B;  1HR0 B;  4DV4 H;  3K3V A;  5J2U B;  1Z2P X;  5A2Q W;  4PZ7 A;  3CHX A;  3RYI B;  4I50 B;  4ZHQ A;  3VQW A;  2PZS A;  3KAL A;  1SKV A;  4JI3 H;  3VNN A;  2UU9 H;  3PN1 A;  4B3S H;  5KHG A;  4LSX A;  3EYY A;  4LF5 H;  1M0T A;  4FM0 A;  1Q5O A;  4L8J A;  2HHH B;  5FD5 A;  1HNX H;  4DR2 H;  4JI8 B;  2UXC H;  4OX9 B;  4B3R B;  2UXB B;  4JV5 B;  5IJ9 B;  1Q3E A;  4WBN B;  5JQG A;  4B3M B;  5ITZ A;  4JYA H;  4CS2 A;  2V4D A;  3RYH B;  4X62 H;  4DV2 H;  3HKD B;  5GON B;  1M93 A;  2VPS A;  4MV7 A;  3K5L A;  3ZED A;  3NC0 B;  4K8Z A;  4RAY A;  3J80 W;  4DV1 H;  3M4I A;  4LFA H;  1G6U A;  4YY3 H;  1VS0 A;  3RGX A;  1FJG B;  2F66 C;  1S68 A;  5KMG B;  2WYO A;  3N2K A;  3K57 A;  4IIJ A;  3BA9 A;  4PI2 A;  1N32 H;  4LFC B;  4ZI7 A;  1XDN A;  2YXL A;  5JJN B;  5FPO A;  4BW9 A;  2QJ1 A;  4CH4 A;  3QF7 A;  1WNS A;  4YJ3 A;  2UUB H;  3KXY T;  4KHP B;  1A0I A;  4FLZ A;  1SA0 A;  1HNW B;  3K5M A;  3KAJ A;  2IM9 A;  4DRX B;  3IG0 A;  4O2B A;  4DR1 B;  4F6R B;  3CVZ A;  1XMO B;  5LMN H;  2O03 A;  5CA1 A;  5LP6 A;  3N40 P;  2KSW A;  4IHJ A;  5LMU B;  2WE6 A;  4GKK B;  4JI2 B;  3NBY B;  4LH7 A;  4DV0 B;  3F8N A;  1IBL B;  2ZNI A;  4DR5 B;  5LOV B;  1S03 G;  4FFB A;  4I9Q A;  4DRF A;  3T1H B;  4LF7 B;  4LF8 H;  2P22 C;  4JI6 H;  1HR0 H;  2R72 A;  1TVK A;  3JAK B;  4LF4 H;  4U3J A;  4KL1 A;  5CB4 B;  5IYZ A;  5FNV A;  4HNA A;  3SJC C;  2E3C A;  1CKN B;  4FLV A;  4LF9 H;  2CW7 A;  4O4H A;  2ZIN A;  3JAW A;  4LNU A;  5LXT B;  4DUY B;  2HIX A;  3U0Z A;  2P5O A;  4PI0 A;  2OYQ A;  4BWA A;  5LA6 A;  3K59 A;  3RGZ A;  3JAT B;  1HW7 A;  3JAS B;  1P49 A;  5EOY A;  1P16 A;  3K58 A;  1E4F T;  4EB6 A;  1N33 B;  2VWK A;  5EZY A;  1XHZ A;  4DR4 B;  3MWM A;  2UUC H;  4LFB H;  4DR7 B;  5LL6 b;  4AIL C;  4I4T B;  1D5A A;  3SJB C;  2UXB H;  3WB1 A;  4B3M H;  4ETS A;  1FFX A;  4DR3 B;  3RR5 A;  5KHJ A;  3FFQ A;  5C8Y A;  1XNR B;  3S24 A;  1N34 H;  4X66 B;  2RQ6 A;  4FLT A;  3T1Y B;  4GKJ H;  4FLX A;  4FM1 A;  4O4I B;  4DUZ B;  3QWU A;  4ZOL B;  2ZNJ A;  4TV8 A;  4EQ5 A;  2W57 A;  5DIS C;  3GB8 B;  3SGI A;  4UCR A;  3HKC A;  4TUY B;  4YHH B;  3RYF A;  4APM A;  1XNQ H;  1IBK B;  3E22 B;  2FE3 A;  3OTO B;  4NXM B;  1SQG A;  5CA0 B;  4IAJ A;  4X1Y A;  4KHP H;  2YI8 A;  3TY8 A;  1HNW H;  1Z5V A;  5JH7 B;  4JI0 H;  1TUB A;  5IWA B;  5J2T A;  1JJO A;  1O9G A;  3THO A;  4M7E A;  2BTQ B;  3BA8 A;  1N36 H;  5LMU H;  2VQE B;  5EYP A;  1ZHS A;  5D1O A;  4JI4 H;  4X1I A;  3JAR B;  2JVD A;  5JJJ B;  4X20 B;  1I94 B;  1XMQ B;  2RJZ A;  2VWJ A;  3J81 W;  4LSA A;  5K1X A;  4X65 H;  2E5L H;  3W5O A;  5BR8 B;  1GYF A;  3MAQ A;  3BRC A;  2ZM6 H;  2Q7H A;  4IIJ B;  3UQ8 A;  4PHZ A;  4DV6 H;  4UCT A;  3UT5 B;  1J5E H;  1WPB A;  4MTD A;  3HXL A;  2Q7E A;  4LF6 H;  4NVP A;  3RF2 A;  3SJA C;  4UCU A;  4O4L A;  4I55 B;  5IJ0 A;  3JAM W;  4AQY H;  4TV9 A;  3OTF A;  3RTX A;  3JAL A;  4NXN H;  5J2U A;  1S5J A;  3VQY A;  4E6N A;  4I50 A;  4B3T H;  1JFF B;  1JMK C;  3RYC B;  2WDT A;  1N33 H;  4DR6 H;  3HKE B;  4DV3 H;  4UCO A;  2UXD B;  4DR4 H;  2RGR A;  4FM9 A;  4JI5 B;  4TOI A;  3KYH C;  4JI1 H;  4FFB B;  5JVD A;  4HBN A;  4JI7 H;  3WB0 A;  3U10 A;  1SEI A;  4X64 B;  5IT9 W;  4DV7 B;  3T1Y H;  4K0K B;  4O2A A;  2CW8 A;  2ZIO A;  2XHB A;  2HVS A;  2VQF H;  4EEQ A;  4LNU B;  4DV4 B;  4LMY A;  5IJ9 A;  4A2A A;  4CS4 A;  4UCV A;  3N41 B;  4WBN A;  1HNZ H;  4R7R A;  3RYH A;  3HKD A;  5GON A;  4DV5 B;  4EB6 B;  2CAZ C;  3RJ0 A;  5KHI A;  1ZHQ A;  1VF7 A;  2UU9 B;  4O4J A;  2HIV A;  4LH6 A;  4J0M A;  1M5I A;  4B3S B;  4RAZ A;  4LF5 B;  2HVR A;  4CH5 A;  3N2G B;  3BPZ A;  5C8Y B;  4X1K B;  3C0F B;  3WB2 A;  4RB0 A;  2VQE H;  1X4T A;  3JSL A;  2ZJT A;  2HHH H;  5LYJ B;  4DRX A;  4K8X A;  4JI8 H;  3HKB B;  4F6R A;  3HKC B;  2JS5 A;  4YJ2 A;  4GYC B;  4JYA B;  2HGS A;  4OX9 H;  4B3R H;  1NT2 B;  4X62 B;  4JV5 H;  4DV2 B;  1CKM A;  1TGO A;  3QG5 A;  3CSX A;  4EFB A;  4ZHQ B;  4ZIB A;  4DV1 B;  4I7H A;  5EIB C;  1FKA H;  2XIG A;  5LOV A;  4LFA B;  4YY3 B;  3TY9 A;  3QTC A;  4TQD A;  4Q6G A;  2Q2T A;  5D1P A;  5CB4 A;  1MZB A;  3TY5 A;  1B04 A;  1N32 B;  1FJG H;  2F93 B;  4PZ6 A;  4PDB A;  5FPR A;  1CKN A;  3N43 B;  3SR2 C;  4GLX A;  2UUB B;  2R70 A;  3N6X A;  5D1O B;  1L2Z A;  2OWO A;  4LFC H;  2QM4 A;  5LXT A;  4JI5 H;  3FMA A;  3VQV A;  3JAT A;  3JAS A;  1Q43 A;  5LMN B;  3BAB A;  1DGS A;  4MTE A;  4X64 H;  4DR1 H;  2KKW A;  5JQG B;  3L2P A;  1XMO H;  2BTO A;  5ITZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...