3NBZB

Crystal structure of the hiv-1 rev nes-crm1-rangtp nuclear export complex (crystal i)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
358
structure length
291
Chain Sequence
b'PLQLPPLERLTLSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTSSHSPDHPGCLMEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-1
publication title NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gtp-binding protein/transport protein
total genus 64
structure length 291
sequence length 358
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11538 Snurportin1 Snurportin1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3nbzB00
1VS0A 3W1BA 4EEQA 3BABA 3GB8B 3GJXB 3KYHC 5D1OA 3W5OA 4UCRA 3TY5A 1B04A 1P16A 4UCTA 4UCOA 2HIXA 3PN1A 4LH6A 4EQ5A 4UCUA 4UFZA 4DRFA 1CKMA 5FPOA 5D1PA 1XK5A 1X9NA 3JSNA 3NBYB 3BA9A 1S68A 2VUGA 5DISC 3RTXA 1FVIA 1XDNA 3TY9A 2HVSA 4PZ6A 2HVQA 4PZ8A 1CKNB 1A0IA 3L2PA 1P8LA 1CKOA 3BAAA 3TY8A 3NC0B 5D1OB 2CFMA 4EFEA 4UCSA 4GLXA 3RR5A 3BA8A 3QWUA 4CC5A 2HVRA 1TA8A 1DGSA 3VNNA 5FPRA 4PZ7A 2Q2UA 3UQ8A 3GDEA 4CC6A 3JSLA 2HIVA 4LH7A 2OWOA 4E6NA 3W1GA 4EFBA 2Q2TA 1CKNA 3S24A 1TAEA 4UCVA 3NBZB 1V9PA
chains in the Genus database with same CATH superfamily
2W6OA 3ETHA 3W1BA 4ZQIA 3GB8B 3GJXB 4EEQA 5KKNB 1W96A 5LA6F 3PFFA 2V5AA 1KJIA 2HJWA 4LH6A 3T9DA 4MV6A 4UCUA 3N6RA 4YB8B 1W93A 4UFZA 1CKMA 1CE8A 3LULA 4YAKB 1KJJA 3NBYB 1EKFA 4CMDA 4O2AF 5C8YF 5DISC 1BNCA 4Q4CA 3R5HA 5CA1F 1XDNA 4QSHA 1AUVA 3KALA 2NU6B 3DF7A 4IZOA 3T7AA 4PZ6A 2SCUB 1UC9A 1CQJB 3RFCA 3TW6A 3L2PA 2GPWA 1P8LA 3K3PA 3BAAA 3RV4A 4IHJF 4C5CA 2C00A 2YRWA 5D1OB 3V4SA 5C1OA 1SCUB 1I7NA 4MV3A 3UFXB 2YS7A 2DZDA 2YW2A 5DGIA 3WWIA 5CE8A 4O4LF 4O83A 4ZOLF 1GGOA 3TIIA 2IP4A 3BACA 3R23A 1EZ1A 1M0WA 3QWUA 4HNVA 1Z2OX 1TA8A 1EHIA 4EGJA 3G8CA 4O7SA 3LP8A 3N8DA 3VNNA 2QK4A 3U54A 1OBDA 1CS0A 4FGRA 4IWYA 4PZ7A 4NYEA 3AW8A 1IYDA 1AUXA 2Q2UA 1GSHA 4PBCA 1GLVA 3VPDA 4YAJB 4RZQA 2W6QA 4DLKA 3GDEA 5BPFA 5BWVA 1JDEA 2ZGIA 5HV6A 4NZMA 2I87A 4LH7A 2OWOA 1JLLB 3JRWA 4E6NA 4EFBA 2COIA 2X0SA 1EUCB 5I5VA 2EJ0A 4MA5A 1TAEA 2VQDA 2ABJA 4ZHQF 4FFNA 1VS0A 2W70A 5JQGF 3KYHC 1EKVA 3DTFA 3TY5A 1OBGA 4O86A 1P16A 4UCTA 4UCOA 4XX0B 2HIXA 5LYJF 1BXRA 3GIDA 3RV3A 2DABA 2DLNA 5DMXA 5CAEB 3ORRA 2ZDHA 5D1PA 1X9NA 3HT5A 4O7VA 2CNUA 5FR9A 1S68A 3VOTA 3KREA 3U55A 3CSWA 3U9TA 4I55F 2EJ2A 2J9GA 4O7NA 3LQSA 2HGSA 4FU0A 4FFLA 4FE2A 4O7ZA 2YZMA 4MAMA 2HVQA 3WWHA 2R7MA 2YZLA 4CKBA 2DAAA 2W71A 4YJ3F 1CKNB 4O7WA 1A0IA 1A0GA 1IOVA 5I60A 3JRXA 3TY8A 5LOVF 3NC0B 5I5UA 1DIKA 5EZYF 3VMMA 1KJQA 5BYAA 4EFEA 3MWDA 4GLXA 4XZ3B 2NU9B 1DV1A 3JZFA 1KC7A 3BA8A 1M6VA 1KT8A 2VPQA 3ORQA 4FFMA 4K6NA 4I4TF 1T36A 1C30A 3LWBA 4TUYF 5JQWA 1PK8A 4TVIA 3CEBA 2ODTX 4TM5A 1B6SA 1KTAA 5LP6F 4MV7A 5CR5A 3WO1A 1I1LA 2ZDQA 4HNTA 4O7LA 1E4EA 4NZNA 4HQ6A 2XD4A 3OUZA 3UQ8A 1I7LA 3SE7A 3AX6A 2R7KA 4HR7A 4ME6A 3DTGA 4CC6A 3R5FA 4O2BF 4TV8F 4YJ2F 5BWXA 3U9SA 5BYBA 3GLKA 2Y4RA 2R7LA 2FPGB 2Q2TA 5C1PA 2ZDGA 3S24A 4L1KA 2YS6A 3TEKA 3NUAA 4WBNF 3BABA 3VPCA 4O4HF 1CQIB 1EKPA 4I50F 2R7NA 4HNUA 3HBLA 2A1HA 3PN1A 4MV8A 3UZOA 3JZ6A 3SGIA 4MV9A 1I2LA 5I5XA 5FPOA 4XYLB 3VA7A 5J2UF 1XK5A 1KBLA 2COGA 2HHFA 3BA9A 4RCNA 5GONF 2PBZA 2FPPB 2NU8B 3R5XA 5I47A 5DGHA 4E4TA 5BPHA 2R82A 4IWXA 2COJA 2EJ3A 4XYMB 5I5YA 4CKEA 3TQTA 3QFFA 3T9FA 4Q4DA 5HNEA 2Z02A 2CNQA 1B6RA 5IYZF 2EIYA 5HBRB 3QQMA 3T99A 4CE5A 4CMFA 3JZIA 1KJ9A 4O7TA 2P0AA 3V4ZA 5I5TA 4DAAA 4EG0A 3T54A 5D8DA 2GLTA 4CKCA 4MV1A 4O4IF 1DV2A 3KAJA 5FNVF 4C5BA 4M9UA 3MJFA 5BWTA 4CC5A 1GSAA 1IYEA 3I12A 3UYYA 4O84A 2W6NA 4O7RA 2XCLA 2Q7DA 2VR1A 5JVDF 5CB4F 4IIJF 3BG5A 3TW7A 5DAAA 2NU7B 1WRVA 3MWEA 2R85A 2OLSA 3JSLA 2HIVA 5K2MA 1C3OA 4NZOA 1KUTA 4WHXA 2CNVA 3UZBA 2NUAB 5KS8A 1JDBB 3WNZA 3NBZB 1EUDB 1V9PA 2YL2A 2HGWA 3WO0A 2I8CA 2R86A 3RUPA 3Q2OA 2QF7A 5D1OA 3W5OA 4UCRA 4O7YA 4DIMA 1B04A 4EQ5A 2V58A 2W6MA 3TINA 4YBZB 5JH7F 4DRFA 1M0TA 3ETJA 1Z2NX 5BWWA 5J2TF 1EYZA 3JSNA 3DAAA 3T9CA 1KJ8A 3Q1KA 5E25A 1IOWA 1E4EB 2HG8A 5BWUA 3SNOA 2VUGA 1VKZA 1PX2A 4FFOA 1I1KA 3K5HA 4MA0A 4HN2A 3RTXA 1FVIA 2R87A 1VBGA 2V59A 2YRXA 5LXTF 2DIKA 3TY9A 2HVSA 5CA0F 4MV4A 2PVPA 4ZI7F 3R9RA 1A48A 4PZ8A 2W6ZA 1VBHA 5K3WA 2X5RA 3HB9A 1CKOA 5JVLA 3VPBA 1ULZA 2CZGA 4O82A 2CFMA 2FPIB 4GLWA 2FB9A 1I2KA 4UCSA 1ZAUA 4O4JF 3RR5A 3WWJA 4EGQA 3G8DA 1WR2A 5BWRA 1A9XA 2DWCA 4FFRA 4FFPA 1DAAA 5BMVF 2HHFB 3T9AA 4DQNA 5H80A 2HVRA 1DGSA 2HDKA 4M0JA 1ET0A 3KAKA 2R84A 5FPRA 2W6PA 5KX5F 1I1MA 2YZNA 2YYAA 3U0GA 2GQRA 5I5SA 4C5AA 2I80A 2WYOA 3TIGA 4JXUA 1JKJB 3E5NA 1G2WA 4UUGA 1KEEA 2QB5A 1UC8A 2GQSA 3T9BA 2FP4B 4CHIA 1Z2PX 1GSOA 3T9EA 2YWVA 3HO8A 4Y8VB 2Z04A 5I5WA 2HGXA 3W1GA 1A3GA 2PN1A 3OUUA 4TV9F 2GPSA 5CM0A 4O81A 1CKNA 4UCVA 2YZGA 3K5IA
chains in the Genus database with same CATH topology
1VS0A 3W1BA 4EEQA 3BABA 3GB8B 3GJXB 3KYHC 5D1OA 3W5OA 4UCRA 3TY5A 1B04A 1P16A 4UCTA 4UCOA 2HIXA 3PN1A 4LH6A 4EQ5A 4UCUA 4UFZA 4DRFA 1CKMA 5FPOA 5D1PA 1XK5A 1X9NA 3JSNA 3NBYB 3BA9A 1S68A 2VUGA 5DISC 3RTXA 1FVIA 1XDNA 3TY9A 2HVSA 4PZ6A 2HVQA 4PZ8A 1CKNB 1A0IA 3L2PA 1P8LA 1CKOA 3BAAA 3TY8A 3NC0B 5D1OB 2CFMA 4EFEA 4UCSA 4GLXA 3RR5A 3BA8A 3QWUA 4CC5A 2HVRA 1TA8A 1DGSA 3VNNA 5FPRA 4PZ7A 2Q2UA 3UQ8A 3GDEA 4CC6A 3JSLA 2HIVA 4LH7A 2OWOA 4E6NA 3W1GA 4EFBA 2Q2TA 1CKNA 3S24A 1TAEA 4UCVA 3NBZB 1V9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VS0 A;  3W1B A;  4EEQ A;  3BAB A;  3GB8 B;  3GJX B;  3KYH C;  5D1O A;  3W5O A;  4UCR A;  3TY5 A;  1B04 A;  1P16 A;  4UCT A;  4UCO A;  2HIX A;  3PN1 A;  4LH6 A;  4EQ5 A;  4UCU A;  4UFZ A;  4DRF A;  1CKM A;  5FPO A;  5D1P A;  1XK5 A;  1X9N A;  3JSN A;  3NBY B;  3BA9 A;  1S68 A;  2VUG A;  5DIS C;  3RTX A;  1FVI A;  1XDN A;  3TY9 A;  2HVS A;  4PZ6 A;  2HVQ A;  4PZ8 A;  1CKN B;  1A0I A;  3L2P A;  1P8L A;  1CKO A;  3BAA A;  3TY8 A;  3NC0 B;  5D1O B;  2CFM A;  4EFE A;  4UCS A;  4GLX A;  3RR5 A;  3BA8 A;  3QWU A;  4CC5 A;  2HVR A;  1TA8 A;  1DGS A;  3VNN A;  5FPR A;  4PZ7 A;  2Q2U A;  3UQ8 A;  3GDE A;  4CC6 A;  3JSL A;  2HIV A;  4LH7 A;  2OWO A;  4E6N A;  3W1G A;  4EFB A;  2Q2T A;  1CKN A;  3S24 A;  1TAE A;  4UCV A;  3NBZ B;  1V9P A; 
#chains in the Genus database with same CATH topology
 2W6O A;  3ETH A;  3W1B A;  4ZQI A;  3GB8 B;  3GJX B;  4EEQ A;  5KKN B;  1W96 A;  5LA6 F;  3PFF A;  2V5A A;  1KJI A;  2HJW A;  4LH6 A;  3T9D A;  4MV6 A;  4UCU A;  3N6R A;  4YB8 B;  1W93 A;  4UFZ A;  1CKM A;  1CE8 A;  3LUL A;  4YAK B;  1KJJ A;  3NBY B;  1EKF A;  4CMD A;  4O2A F;  5C8Y F;  5DIS C;  1BNC A;  4Q4C A;  3R5H A;  5CA1 F;  1XDN A;  4QSH A;  1AUV A;  3KAL A;  2NU6 B;  3DF7 A;  4IZO A;  3T7A A;  4PZ6 A;  2SCU B;  1UC9 A;  1CQJ B;  3RFC A;  3TW6 A;  3L2P A;  2GPW A;  1P8L A;  3K3P A;  3BAA A;  3RV4 A;  4IHJ F;  4C5C A;  2C00 A;  2YRW A;  5D1O B;  3V4S A;  5C1O A;  1SCU B;  1I7N A;  4MV3 A;  3UFX B;  2YS7 A;  2DZD A;  2YW2 A;  5DGI A;  3WWI A;  5CE8 A;  4O4L F;  4O83 A;  4ZOL F;  1GGO A;  3TII A;  2IP4 A;  3BAC A;  3R23 A;  1EZ1 A;  1M0W A;  3QWU A;  4HNV A;  1Z2O X;  1TA8 A;  1EHI A;  4EGJ A;  3G8C A;  4O7S A;  3LP8 A;  3N8D A;  3VNN A;  2QK4 A;  3U54 A;  1OBD A;  1CS0 A;  4FGR A;  4IWY A;  4PZ7 A;  4NYE A;  3AW8 A;  1IYD A;  1AUX A;  2Q2U A;  1GSH A;  4PBC A;  1GLV A;  3VPD A;  4YAJ B;  4RZQ A;  2W6Q A;  4DLK A;  3GDE A;  5BPF A;  5BWV A;  1JDE A;  2ZGI A;  5HV6 A;  4NZM A;  2I87 A;  4LH7 A;  2OWO A;  1JLL B;  3JRW A;  4E6N A;  4EFB A;  2COI A;  2X0S A;  1EUC B;  5I5V A;  2EJ0 A;  4MA5 A;  1TAE A;  2VQD A;  2ABJ A;  4ZHQ F;  4FFN A;  1VS0 A;  2W70 A;  5JQG F;  3KYH C;  1EKV A;  3DTF A;  3TY5 A;  1OBG A;  4O86 A;  1P16 A;  4UCT A;  4UCO A;  4XX0 B;  2HIX A;  5LYJ F;  1BXR A;  3GID A;  3RV3 A;  2DAB A;  2DLN A;  5DMX A;  5CAE B;  3ORR A;  2ZDH A;  5D1P A;  1X9N A;  3HT5 A;  4O7V A;  2CNU A;  5FR9 A;  1S68 A;  3VOT A;  3KRE A;  3U55 A;  3CSW A;  3U9T A;  4I55 F;  2EJ2 A;  2J9G A;  4O7N A;  3LQS A;  2HGS A;  4FU0 A;  4FFL A;  4FE2 A;  4O7Z A;  2YZM A;  4MAM A;  2HVQ A;  3WWH A;  2R7M A;  2YZL A;  4CKB A;  2DAA A;  2W71 A;  4YJ3 F;  1CKN B;  4O7W A;  1A0I A;  1A0G A;  1IOV A;  5I60 A;  3JRX A;  3TY8 A;  5LOV F;  3NC0 B;  5I5U A;  1DIK A;  5EZY F;  3VMM A;  1KJQ A;  5BYA A;  4EFE A;  3MWD A;  4GLX A;  4XZ3 B;  2NU9 B;  1DV1 A;  3JZF A;  1KC7 A;  3BA8 A;  1M6V A;  1KT8 A;  2VPQ A;  3ORQ A;  4FFM A;  4K6N A;  4I4T F;  1T36 A;  1C30 A;  3LWB A;  4TUY F;  5JQW A;  1PK8 A;  4TVI A;  3CEB A;  2ODT X;  4TM5 A;  1B6S A;  1KTA A;  5LP6 F;  4MV7 A;  5CR5 A;  3WO1 A;  1I1L A;  2ZDQ A;  4HNT A;  4O7L A;  1E4E A;  4NZN A;  4HQ6 A;  2XD4 A;  3OUZ A;  3UQ8 A;  1I7L A;  3SE7 A;  3AX6 A;  2R7K A;  4HR7 A;  4ME6 A;  3DTG A;  4CC6 A;  3R5F A;  4O2B F;  4TV8 F;  4YJ2 F;  5BWX A;  3U9S A;  5BYB A;  3GLK A;  2Y4R A;  2R7L A;  2FPG B;  2Q2T A;  5C1P A;  2ZDG A;  3S24 A;  4L1K A;  2YS6 A;  3TEK A;  3NUA A;  4WBN F;  3BAB A;  3VPC A;  4O4H F;  1CQI B;  1EKP A;  4I50 F;  2R7N A;  4HNU A;  3HBL A;  2A1H A;  3PN1 A;  4MV8 A;  3UZO A;  3JZ6 A;  3SGI A;  4MV9 A;  1I2L A;  5I5X A;  5FPO A;  4XYL B;  3VA7 A;  5J2U F;  1XK5 A;  1KBL A;  2COG A;  2HHF A;  3BA9 A;  4RCN A;  5GON F;  2PBZ A;  2FPP B;  2NU8 B;  3R5X A;  5I47 A;  5DGH A;  4E4T A;  5BPH A;  2R82 A;  4IWX A;  2COJ A;  2EJ3 A;  4XYM B;  5I5Y A;  4CKE A;  3TQT A;  3QFF A;  3T9F A;  4Q4D A;  5HNE A;  2Z02 A;  2CNQ A;  1B6R A;  5IYZ F;  2EIY A;  5HBR B;  3QQM A;  3T99 A;  4CE5 A;  4CMF A;  3JZI A;  1KJ9 A;  4O7T A;  2P0A A;  3V4Z A;  5I5T A;  4DAA A;  4EG0 A;  3T54 A;  5D8D A;  2GLT A;  4CKC A;  4MV1 A;  4O4I F;  1DV2 A;  3KAJ A;  5FNV F;  4C5B A;  4M9U A;  3MJF A;  5BWT A;  4CC5 A;  1GSA A;  1IYE A;  3I12 A;  3UYY A;  4O84 A;  2W6N A;  4O7R A;  2XCL A;  2Q7D A;  2VR1 A;  5JVD F;  5CB4 F;  4IIJ F;  3BG5 A;  3TW7 A;  5DAA A;  2NU7 B;  1WRV A;  3MWE A;  2R85 A;  2OLS A;  3JSL A;  2HIV A;  5K2M A;  1C3O A;  4NZO A;  1KUT A;  4WHX A;  2CNV A;  3UZB A;  2NUA B;  5KS8 A;  1JDB B;  3WNZ A;  3NBZ B;  1EUD B;  1V9P A;  2YL2 A;  2HGW A;  3WO0 A;  2I8C A;  2R86 A;  3RUP A;  3Q2O A;  2QF7 A;  5D1O A;  3W5O A;  4UCR A;  4O7Y A;  4DIM A;  1B04 A;  4EQ5 A;  2V58 A;  2W6M A;  3TIN A;  4YBZ B;  5JH7 F;  4DRF A;  1M0T A;  3ETJ A;  1Z2N X;  5BWW A;  5J2T F;  1EYZ A;  3JSN A;  3DAA A;  3T9C A;  1KJ8 A;  3Q1K A;  5E25 A;  1IOW A;  1E4E B;  2HG8 A;  5BWU A;  3SNO A;  2VUG A;  1VKZ A;  1PX2 A;  4FFO A;  1I1K A;  3K5H A;  4MA0 A;  4HN2 A;  3RTX A;  1FVI A;  2R87 A;  1VBG A;  2V59 A;  2YRX A;  5LXT F;  2DIK A;  3TY9 A;  2HVS A;  5CA0 F;  4MV4 A;  2PVP A;  4ZI7 F;  3R9R A;  1A48 A;  4PZ8 A;  2W6Z A;  1VBH A;  5K3W A;  2X5R A;  3HB9 A;  1CKO A;  5JVL A;  3VPB A;  1ULZ A;  2CZG A;  4O82 A;  2CFM A;  2FPI B;  4GLW A;  2FB9 A;  1I2K A;  4UCS A;  1ZAU A;  4O4J F;  3RR5 A;  3WWJ A;  4EGQ A;  3G8D A;  1WR2 A;  5BWR A;  1A9X A;  2DWC A;  4FFR A;  4FFP A;  1DAA A;  5BMV F;  2HHF B;  3T9A A;  4DQN A;  5H80 A;  2HVR A;  1DGS A;  2HDK A;  4M0J A;  1ET0 A;  3KAK A;  2R84 A;  5FPR A;  2W6P A;  5KX5 F;  1I1M A;  2YZN A;  2YYA A;  3U0G A;  2GQR A;  5I5S A;  4C5A A;  2I80 A;  2WYO A;  3TIG A;  4JXU A;  1JKJ B;  3E5N A;  1G2W A;  4UUG A;  1KEE A;  2QB5 A;  1UC8 A;  2GQS A;  3T9B A;  2FP4 B;  4CHI A;  1Z2P X;  1GSO A;  3T9E A;  2YWV A;  3HO8 A;  4Y8V B;  2Z04 A;  5I5W A;  2HGX A;  3W1G A;  1A3G A;  2PN1 A;  3OUU A;  4TV9 F;  2GPS A;  5CM0 A;  4O81 A;  1CKN A;  4UCV A;  2YZG A;  3K5I A; 
#chains in the Genus database with same CATH homology
 1VS0 A;  3W1B A;  4EEQ A;  3BAB A;  3GB8 B;  3GJX B;  3KYH C;  5D1O A;  3W5O A;  4UCR A;  3TY5 A;  1B04 A;  1P16 A;  4UCT A;  4UCO A;  2HIX A;  3PN1 A;  4LH6 A;  4EQ5 A;  4UCU A;  4UFZ A;  4DRF A;  1CKM A;  5FPO A;  5D1P A;  1XK5 A;  1X9N A;  3JSN A;  3NBY B;  3BA9 A;  1S68 A;  2VUG A;  5DIS C;  3RTX A;  1FVI A;  1XDN A;  3TY9 A;  2HVS A;  4PZ6 A;  2HVQ A;  4PZ8 A;  1CKN B;  1A0I A;  3L2P A;  1P8L A;  1CKO A;  3BAA A;  3TY8 A;  3NC0 B;  5D1O B;  2CFM A;  4EFE A;  4UCS A;  4GLX A;  3RR5 A;  3BA8 A;  3QWU A;  4CC5 A;  2HVR A;  1TA8 A;  1DGS A;  3VNN A;  5FPR A;  4PZ7 A;  2Q2U A;  3UQ8 A;  3GDE A;  4CC6 A;  3JSL A;  2HIV A;  4LH7 A;  2OWO A;  4E6N A;  3W1G A;  4EFB A;  2Q2T A;  1CKN A;  3S24 A;  1TAE A;  4UCV A;  3NBZ B;  1V9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...