4MA5A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
365
structure length
363
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with an ATP analog, AMP-PNP.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 115
structure length 363
sequence length 365
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma5A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma5A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma5A01
3N8DA 3ORRA 1Z2NX 2DLNA 2PBZA 3V4ZA 1CE8A 4FGRA 5CB4F 5JVDF 1BNCA 3JRXA 4DIMA 2P0AA 5BPHA 3R5HA 4C5BA 4HNVA 2FPIB 4O4JF 5CAEB 4L1KA 1CQIB 2R7NA 1DV1A 4DLKA 1VBGA 4O4IF 4MV6A 5CA1F 1KUTA 3JRWA 2R85A 3TINA 1ULZA 3LWBA 4O7VA 3VPCA 2W6NA 2GQSA 4EGJA 2IP4A 5K2MA 2Z02A 1GSHA 2R82A 2NPOA 1JDEA 4YB8B 2NU6B 4FU0A 1W96A 4E4TA 3AX6A 3N6RA 4MV1A 3Q1KA 1UC8A 4O84A 5FNVF 5LOVF 3TIIA 5CA0F 2YL2A 3UFXB 4O82A 4O7NA 4Y8VB 5C1PA 3V4SA 2R7LA 5KKNB 2YZGA 4IWYA 2XCLA 5LP6F 4YJ3F 3U9SA 5DMXA 2VR1A 2R84A 2R87A 1GGOA 3NUAA 2I8CA 3WO1A 2DZDA 2W71A 3MJFA 1E4EB 3VA7A 3LP8A 4GGMX 4FFPA 3E5NA 2FP4B 3VMMA 1KJ9A 3R5XA 2I87A 3JZIA 1M0TA 2YRWA 3ORQA 3RV3A 4XX0B 4O7WA 4YBZB 4TV8F 1JLLB 5HBRB 4O7LA 2R7MA 3U54A 3K3PA 2NU9B 2W6OA 5JVLA 1EZ1A 1A9XA 5LA6F 1KJJA 4WBNF 1KJIA 4MA0A 4HQ6A 1EHIA 4MV3A 1M6VA 2NUAB 3DF7A 5BMVF 3OUZA 2J9GA 4ZOLF 2PN1A 1Z2OX 2PVPA 1EUCB 4HNTA 3BSWA 3KAJA 1M0WA 1KEEA 3WO0A 2ZDHA 4XYLB 5J2TF 3JZFA 2WYOA 5JH7F 3K5HA 2YYAA 2YZNA 1B6SA 2V58A 2W6PA 4FFLA 4FE2A 4EA8A 4RZQA 4HNUA 4M99A 1I7NA 1EYZA 4MV4A 4O2AF 3RFCA 2HGSA 1AUVA 3BSSA 5GONF 1GSAA 3MWDA 4QSHA 3GLKA 2R7KA 5D8DA 4M9UA 2YZLA 1KBLA 2QK4A 4IHJF 4IIJF 5C8YF 5LYJF 3RUPA 2GQRA 1C30A 2R6FA 1T36A 4NYEA 2CZGA 3AW8A 3ETJA 1AUXA 3VPDA 2YWVA 4IWXA 4MV8A 4ME6A 4TV9F 3TIGA 3BFPA 3I12A 2CNUA 5JQWA 2VPQA 1UC9A 2W70A 2YS7A 1KC7A 1CS0A 3R5FA 4M98A 2QF7A 3VPBA 2YZMA 1DIKA 1PK8A 5C1OA 1DV2A 2GPWA 2NU8B 4YAKB 1KJ8A 4EABA 3G8CA 2YW2A 4ZHQF 3TQTA 3KALA 3KAKA 1JDBB 3K5IA 4J6EA 2R86A 4EAAA 3G8DA 1PX2A 4M9CA 2V5AA 3HO8A 4I4TF 2GLTA 4C5CA 5LXTF 3SE7A 2CNVA 4WD3A 3OUUA 1GSOA 2Z04A 4O83A 2ZDQA 1IOVA 4EA9A 3ETHA 4O7SA 1Z2PX 2C00A 3BSYA 1KJQA 2FPPB 4O7YA 2GPSA 3BG5A 4YJ2F 2CQYA 2W6ZA 4IZOA 1C3OA 4MV9A 4FFRA 4O7RA 2CNQA 4ZI7F 1BXRA 3HB9A 3GIDA 2NU7B 3R9RA 2W6MA 3TW6A 4HR7A 5HV6A 5JQGF 4XYMB 4EA7A 2YS6A 3WNZA 1JKJB 4YAJB 4I50F 2YRXA 2FB9A 2V59A 4FFOA 4O7TA 3RV4A 2OLSA 2VHEA 5IYZF 4MV7A 1OBDA 4EG0A 4O4LF 1B6RA 4MA5A 4C5AA 4O86A 1IOWA 2ZDGA 4O81A 4XZ3B 4ZQIA 5H80A 1WR2A 4O2BF 1E4EA 5EZYF 2X0SA 3HBLA 1GLVA 4FFMA 2HJWA 4EGQA 4O4HF 5I47A 4FFNA 4MAMA 1I7LA 2SCUB 3QFFA 4I55F 2DIKA 3KREA 2DWCA 4O7ZA 2FPGB 2XD4A 4TUYF 3Q2OA 3VOTA 3R23A 1VKZA 3U9TA 1SCUB 1EUDB 3MWEA 5KX5F 3U55A 2W6QA 1W93A 2VQDA 5BPFA 2I80A 1CQJB 1OBGA 1VBHA 1A48A 5J2UF
chains in the Genus database with same CATH superfamily
3PE6A 4G23A 3CYFA 3FTQA 3ORRA 3SQMA 2Q9BA 4X54A 4CGYA 1QORA 1K7CA 3NQ41 4W9NC 3BHMA 3G6KA 3PF8A 3DC2A 5CA0A 1QF6A 1O4WA 1M6WA 2EJCA 1MJ5A 5I9TA 4LFCB 2PQ6A 3BB1A 4E6NA 1SVWA 2HHHB 5LYJB 1I4OA 2GD0A 1R4MA 2OXRA 3FI9A 1R16A 1XTBA 1XVAA 1LA2A 4KV9A 4BKUA 1I8TA 4HVAA 3BM5A 4OHBA 5JASA 1XA0A 1Z35A 4KMOA 1M2VB 5AKHA 1PFKA 3O3MB 1ETUA 2AWNA 4H0NA 4Z0HO 4NONA 2XTJA 5L1IA 1M1NA 4GWKA 3EPIA 4NAVA 4PANA 2HUPA 1QS0B 1G18A 3EPPA 4OAPA 1XNHA 3DFFA 3WGKA 5EIBD 1NKVA 1A4IA 4XUEA 2X0EA 1AHHA 3PNBA 4CMBA 3I4NG 2YHAA 3LI2A 1RAGA 3K6RA 3FWZA 4TLCA 3TIXB 1X8KA 4Y6GB 1OFUX 1DBVO 1ZEJA 3BS4A 1BX0A 3ASYA 4PZYA 4QHSA 2H06A 3TO5A 2BELA 2OR3A 2DTDA 3BL6A 4JLPA 3NAGA 3ROKA 1ESCA 3RTCA 1QFYA 5SZHB 3UICA 1EX9A 3RE1A 1UP7A 1GYPA 5C37A 2FZKA 4H9GA 5KWEA 2ZBGA 1XLTA 2AWOA 4B9AA 3I52A 3K9GA 1UDWA 2F3UA 3MLBA 3F9IA 5JNTA 3WRXA 1B6SA 1WXFA 4JLDA 1SKBA 3JW8A 1MP0A 1EUQA 4EMTA 3R9WA 3FGNA 1PR0A 4JS0A 1RXUA 3DLTA 3CE9A 5IMSA 2J3IA 1R6UA 3I9OA 1RFGE 4UBJA 4R54A 2O4UX 3THWA 4BJ1A 1EDDA 5LBTA 2DVMA 3SICE 1E64A 1XZIA 2GEDA 3I12A 3KVRA 4GLLA 1WM1A 4EUNA 4IV8A 4OJNA 1I50A 1JR2A 1U7UA 1WEKA 5HFAA 4D81A 4KDFA 3DSRA 3FMVA 1U7DA 3FPLA 5FEMA 2DY0A 2IH2A 1TD9A 4TSRA 1Y8ZA 3NDRA 3HFSA 3ZV6A 3VZSA 2CJXA 1T8TA 1LK7A 4MQEA 1ZZGA 1ISPA 3AR5A 5CHYA 1A0OA 4OQPA 3NUZA 5JD5A 5GPBA 1OBHA 2ETXA 5HTOA 3SR4A 2X8BA 4ZAXA 1XRSB 1KMNA 4NPAA 5IAAA 4N76A 1WMSA 3ET4A 1HDXA 2BVNA 1NP7A 2XOXA 2Y93A 3FDSA 2WG0A 1JH9A 2H1LA 1CUBA 2GVDC 1XEXA 3Q0EA 4XYMB 1UM9B 1JHAA 1NF2A 2R4UA 1G17A 1T2DA 1TCUA 2NPIA 1CB7A 2Y0CA 4BMOB 5F3WB 2HRZA 5DMHA 3AFNA 1GOTA 2PZEA 3B8EA 2X7XA 2DKNA 1JQ5A 1Q1NA 5F5NA 4UUMA 1ZKMA 2C2YA 1E7MA 4CMJA 1K4KA 5A62A 1IJBA 3W8NA 5SY4A 5I47A 2XD9A 2DBZA 5I7AA 3ENVA 2PEYA 4DYHA 3E9QA 3CPHA 4Q3CA 4C0AC 2DG2A 2Q4EA 4U2FA 3TAUA 4A6XA 5AVYA 1VKZA 2ECOA 2EERA 4TS4A 2BQ3A 4ZKEA 1TJNA 4EYKA 2HCBA 5AW0A 1ST3A 1YR2A 1XF1A 2EZTA 1FQJA 1RABA 4DMUB 2H59A 2PMEA 4JL8A 3STVA 2JA5A 3IHWA 2QRVA 5JO9A 3FAKA 3NI2A 4A0RA 1KZ4A 2UXCB 1L4HA 3I6IA 4FUTA 4ND8B 1KSHA 4BCCA 4RAZA 1PT8A 4DWVA 3D8TA 3L9XA 4AI6A 4EYGA 2Q5CA 3V9AA 2VVTA 3G9ZA 4XTRA 2B7LA 4AP5A 3QX8A 1OE0A 2CKMA 2PT5A 3CJRA 3L5OA 3KYDB 2PMFA 2E5WA 4ZQFA 4PX5A 1K7FB 1H2BA 1QQTA 3JAMW 4JL5A 2WIJA 4PQFA 4BXOB 3L1VA 1T8WA 2NVUB 3I6ZA 2E4AA 4F12A 2OZEA 4F45A 3U5TA 1EP3B 2VT7A 3FZYA 4LFAB 4IIEA 1UC5B 2CLMB 1FTGA 4M83A 4Z7NB 4ZT6A 2G4LA 2I4LA 1G5RA 3GIIA 1O9HA 5KTOA 1ZBQA 1UMCB 4Z86A 3ABOB 1KKLA 4EFKA 3IEKA 2CNWD 5FAXA 1VIYA 3JWJA 1FP6A 3G6XA 3PQEA 2IWHA 1RYZA 4JI3B 1DFGA 1E3WA 3IP7A 2BOVA 1XZEA 2BZSA 4LRXA 1N33B 3UOAB 1KP9A 3QW4B 1E2BA 2VCHA 1DAIA 3N7UA 5CB8A 1RR6A 2FW8A 3OQNA 2VTBB 4L8FA 2P9QA 4I7HA 4ISBA 5F1PA 5FAKA 1V1MB 3P32A 5KFGA 4JJ6A 1GAXA 3CF2A 2BKXA 4DR1B 4OXKA 2X1MA 4E5NA 4B74A 1I1NA 1UBUS 3GPBA 2GBGA 2I1LA 1RD4A 3Q9SA 2P5YA 2XZTA 3HKBB 4QPZA 4U2EA 4LKOA 4TQ9A 4G9GA 1MB9A 4O2AF 3FKIA 4FKZA 5K3OA 1U1GA 3L2OB 4J0HA 3AR7A 5K01A 1UWKA 1TYAE 2C97A 2RGYA 1MX9A 3DQPA 1DO2A 2G6TA 4H4DA 3DBIA 3DT8A 3OY7A 3WIUA 2VAWA 2BQUA 5ALRA 4MWGA 2IYEA 4TOIA 4HAVA 4HUTA 4R2JA 1UDAA 4A3KG 3KUCA 1PUXA 1OLUB 4G0XA 1Y1LA 2G0TA 4NE2A 1ZDMA 1NUPA 4YO7A 3R7WA 1VHDA 3U13A 3HCRA 2O5CA 1BFKA 3UVEA 1QYVA 2JLAA 4QYTA 3U1VA 4CMDA 3AWIA 3CF0A 5LUAA 4HS4A 2VH1A 1WUYA 3AI3A 2CLDX 3CEHA 1E6EA 4YUWA 1QGUA 2PUCA 5JUWA 4LJRA 3QKTA 1C0KA 1E63A 4YECA 3JQ8A 2W6JA 2FR0A 3BB3A 2FN9A 2XITA 4IP0A 3UCEA 1NG9A 4RIIA 1KNXA 1HDGO 3F1KA 4KR3A 4CF4A 4ENQA 2DTXA 3PQ6A 5DWDA 3RS4A 2BM9A 3HY4A 1K6MA 3ILYA 4O4HA 5IT0A 1ESNA 2Y66A 4YMWA 4TRRA 1Z13A 2C58A 3HOZG 2O3UA 2CXRA 3JZ6A 2JJYA 3PUJA 1LWOA 2LCFA 3L84A 3OIGA 2NW6A 5JHHB 3H83A 1BX1A 2VNAA 2DABA 3GIKA 3SS8A 2MCFA 3HKCB 3EAFA 3ZE0B 4A6DA 4B7AA 3I1IA 2YXPX 2CWDA 2R8ZA 3PPVA 4R5MA 1P9NA 1NVEA 1YJAA 1VCNA 2P6PA 1W35A 1O95C 3UXYA 1NJ1A 4MAMA 4COKA 4JWTA 3PICA 2CNDA 4AM8A 4JXKA 1L7EA 1RXIA 3DMRA 4JNKA 3Q2OA 1TMOA 3F4KA 2IDMA 2YOHA 1LI7A 5IHPA 3OKAA 4JVSB 3A4VA 3T1NA 2Z6UA 4CU2A 4DBZA 2AF4C 2GAAA 3T3PB 3V7YA 1L5KA 1E9CA 2WE7A 2DQ4A 4DIDA 1PQ4A 2AZ4A 4D25A 3U4HA 5C35A 5JV5A 5TT0A 5GV7A 4GE0A 3BD7A 3Q2IA 2R25B 5AKLA 4FTWA 4DT1A 4P80A 4ABYA 4Z9XA 4CKBB 3Q87B 3F6CA 3H87A 4ZRDA 1XL0A 4ASUD 1VBKA 1IH8A 3ANXA 1GP2A 4IUCS 1U8EA 2Q7XA 2O8CA 3IE1A 5EXXA 1CVLA 1YASA 4DKXA 2CF5A 1VKNA 1RLJA 1LKZA 1KAMA 3D8HA 4EYOA 1VMEA 2YL2A 3UJAA 5F2NA 2Q21A 5KNDD 1JQJC 4YJFB 3LRXA 1C5KA 4LRTB 1H4QA 2G4CA 3HUFA 2QNIA 1R9TA 3P26A 2Y1WA 4K1LA 1C9MA 2XWJI 1NPTO 4HWKA 1JEOA 1TUBA 1UL1X 2A86A 3REFA 1SHZA 3IXQA 4X65B 1TAUA 4OK6A 2ZZMA 2A94A 5B58T 4JB3A 2QZSA 4JBWA 3SDSA 5IKEA 4N7BA 1NW7A 3UB4A 1N5KA 2WY2D 3UUFA 3I04M 3H84A 3CH7A 2A4MA 3RS8A 4BMPB 1L7NA 5F64A 1P1FA 3JQ6A 1MR3F 1GLNA 1K27A 1UK6A 2H00A 1K68A 2LD4A 2OWOA 2NUAB 3GXBA 4WBXC 3SVTA 5CLIA 4A2AA 4M53A 4YAJA 4UQOA 3I64A 1TVMA 2ZPTX 3HZHA 1CR1A 4HVLA 1RM5A 2C3MA 2HIAA 4TS1A 4M86A 4YUXA 1JTVA 2DECA 1IM2A 1JR3A 2JAQA 1TZMA 4OXXA 2WT8A 2QI9C 1ZVJA 1XTQA 2W2OA 4GLXA 3V6MA 3N2IA 1NQTA 3TFQA 5IJ0A 1MEEA 4D0GA 4MW9A 3O9VA 3K6KA 1GSAA 3N9IA 3KELA 1PNQA 1UINA 2QZ9A 4OG2A 4N6GA 4KE9A 3OU7A 1T36A 3GGOA 4QO7A 1ZCJA 2PZGA 1Z34A 4PIPA 1JHPA 2DHDA 4BRSA 4NXMH 4TTSA 1WUHS 4HQFA 4LE1A 2XVYA 4GSKA 4O5OA 5I8WA 3FTFA 4DCJA 1UKEA 4NX2A 4BNXA 1I7DA 3IHKA 3ACCA 2EL7A 3QBDA 2XMRA 2R86A 2Q6TA 1GITA 5CUQA 3NYRA 4GOXA 1LFAA 4XQCA 3EN0A 3UQYS 4EJ0A 4IDDA 3O3NB 3N3BC 3TW8B 2DX7A 1WXDA 4WHMA 2PEZA 4ZEOA 4X24A 1QHGA 3KAQA 3QBVA 5ILGA 3QP9A 3PNSA 5AM1A 5IAJA 1XZ8A 3Q4GA 4GP7A 16PKA 1K0FA 1N9GA 4QQNA 2VK4A 3EJ6A 3GVCA 1XMVA 4J6FA 1RYRA 2BUCA 4BTLA 2VDKB 4A0GA 5CBKA 5IXSA 4CCAA 3RH0A 4FS2A 4UULA 4B6EA 5BURA 1OFHA 4F6RB 3F0TA 3MGAA 2Q7DA 3KL2A 4ITUA 1SUPA 4MTLA 2OZKA 3LMKA 5FPKA 2EGGA 2QJFA 2NZYA 2OV3A 2F64A 2JC3A 3S27A 1TM1E 2ZYRA 3O8NA 3L0YA 4U7CA 5ISMA 2IYUA 1SRQA 4RQUA 4FFVA 1X7WA 4XFDA 3PNYA 1X77A 3C3EA 4EFLA 3SXUA 2QGFA 2YHIB 1BO6A 1BDJA 3TTVA 4ZAYA 1E62A 2Y2UA 1BWRA 1Z8FA 1K0UA 3HCWA 1YCDA 4EG3A 4LXGA 2V7WA 2R6CA 3NBYC 1QGED 1TJ4A 2FSIA 4MWBA 2DXIA 1Q0ZA 4WCFA 3TDNA 4S05A 3DLAA 4RIEA 1JF8A 1KH3A 5EYPB 1AKYA 3GLHE 3IQZA 2O7VA 1GL6A 1E96A 1GCIA 4MVYA 3FOBA 4L4YA 3G0IA 1DJNA 4AURA 4JSRA 1U04A 2XYHA 2A0XA 1O95D 3OCCA 3H2HA 2J9ZB 1Y1VA 3LYUA 1Q7CA 3P7MA 4JOSA 4Q9JA 1Y9EA 2C0PA 4XRGA 5E9QA 3BQ1A 3P4YA 2HK6A 2RONA 5FYDA 1JN0A 1OPXA 1VJGA 4G1UC 4U6QA 2BHNA 3GCDA 2ZJ4A 5DN6D 2X0NA 4MLDA 3T54A 4EBEA 2WSBA 3U44A 1SXQA 1FMCA 4AG6A 3DJYA 3RT7A 3Q9UA 4UAGA 2ZB7A 4IJKA 4X8MA 1G1AA 4RBNA 4ZCMA 4C0XA 1U2TA 2YN0A 4FYJA 3C87A 4JJ7A 1DHTA 1I24A 4TUYB 3JQFA 1UDRA 4EKYA 3U9SA 4OJMX 4FGZA 2ZQZA 1MEJA 3U0GA 1VS0A 1MX1A 1HYHA 4B3FX 1NX6A 4OI0A 3BERA 2B1QA 4Q7QA 4P34A 5H3CA 3ICPA 3HDVA 3CT4A 2I2BA 5JSZA 3PQ4A 3NCHA 4Q4JB 1KJIA 3M4ZA 2BKVA 4JHXA 4Q47A 1AQJA 1WVIA 4H2DA 2RIPA 5E95A 2OQVA 2CE2X 2C54A 3OPYB 1M10A 4R83A 4BVLA 4Q9IA 3HT5A 3AY0A 1Q0SA 1LPMA 1NWCA 3NUGA 4CNQA 4EHKA 5LIPA 5DJ5A 1J09A 4LF6H 3WO0A 2FETA 3LXXA 3F2VA 4XYLB 3KXIA 1U98A 3OKCA 2BTEA 2H07A 521PA 5FUWA 4XIYA 3FRHA 4RENA 5J9FA 4P31A 2C8LA 2JLSA 2WSSD 1ENOA 3VR2D 4O0MA 4BNDA 3G6YA 2JJ2A 4EY6A 1Y34E 3DBHB 4NZPA 3FSGD 3QE3A 4M9UA 3L4JA 3DL2A 1ZJ5A 4X3OA 3SFVA 3FUUA 4AX4A 2C20A 3SNHA 3A9VA 4LHZA 1ADFA 1E2EA 2J7PA 3J80A 1TLTA 3B3JA 1EP1B 2X0JA 1MZVA 2V7XA 2IOQA 3D6HA 3OZBA 4J9SA 4WZBE 1ZD4A 5IAKA 3G2JA 5EPEA 3PRKE 1P4AA 2HPZA 4HUJA 1S01A 3FNRA 3M4JA 2YY7A 3QUTA 2O5RA 2BLLA 5DNAA 5B1YA 3A6EA 1VP9A 3G2PA 5JJKA 5E6UB 1KIFA 3KJEA 2GCGA 3D0QA 5GVRA 3FUWA 5EXPA 1VMAA 3M8KA 4L4ZA 1JDZA 3EWNA 1JT2A 1JKFA 3QFTA 1T0IA 3A1FA 3A9WA 1U2DA 3F5DA 4PC7A 4O2LA 3IPXA 2B25A 4BN5A 3L8DA 1QP7A 3G79A 1O94C 2R00A 3WMFA 1J33A 3KSRA 5CFNA 3MPOA 1KYTA 5ALOA 2JHPA 1CEYA 2EBUA 1TL7C 1SOAA 2WC1A 3OM1A 4HUQB 1A95A 2ZUDA 2YYYA 4FFOA 1U0SY 3IYLW 4Q15A 5JZOA 1U28A 1N2JA 5TJ9A 3AKDA 1NA5A 1NBMA 3QRWA 4MITA 5DYWA 1KOJA 3KVOA 3K53A 1BDHA 1FTNA 2ZDGA 4F9EA 2BP7B 1PL8A 1HDIA 2J6UA 3IR5A 4NNPA 4FFBB 1MAAA 1VRCA 3AKZA 2V1XA 5REQA 1ZK3A 1SVLA 5C18A 2CCGA 3H5LA 1UMDB 2ICAA 3M4YA 3JQAA 4I50A 2GKGA 1W36C 3KPJA 1GPJA 1VM6A 2C1XA 3SIRA 5IYCG 3IDFA 4ESHA 3O1IC 4R1TA 4RK5A 3N8DA 3Q6IA 3A3YA 2LVBA 1X1AA 1GN8A 2H5LA 2HNKA 1CUZA 1NG1A 5IRCD 3NATA 7MHTA 2ZYWX 4O4JF 3T95A 2A2ZA 4IZHA 3DDWA 2G1JA 1OIVA 2E4YA 2XPCA 3MCZA 3KYCB 1VCOA 1G7SA 1YDWA 4ZC1A 1Z5NA 3UWSA 3VI3B 4N8SA 1DC5A 2FMHA 4FR2A 1W5TA 2GQSA 4MH0R 5BUQA 5I5WA 3DB1A 4QGHA 4IH4A 2VL7A 5D1OB 2GNPA 3QIVA 1ZIOA 2NPOA 3OFKA 2OZLA 2X77A 3FTCA 4GFDA 4RQTA 5TS3A 4YH1A 3BFJA 3AI7A 2UYYA 3EJWA 3DUFB 4RV5A 2A9VA 3EPJA 2AKYA 4QPNA 4DHWA 1Z7YA 4V0OA 3LY8A 3WLMA 1P1BA 1UXJA 3TSOA 1E2DA 1RE1A 4YQZA 5EESA 4PCUA 2AYXA 3TCNA 1SVUA 2W71A 4R8RA 3FNGA 4R6WA 3PQCA 1WXGA 3G0GA 4D92A 1QF7A 3W5HA 5TV2A 4S1NA 3CFYA 2ZANA 3QJ5A 5ESRA 3Q3CA 2YRWA 1PZFA 3KV3O 3LXMA 1N1GA 4CODB 3T3NA 3PFBA 5IJ9A 3UJ8A 4QDJA 2ZSFA 4Y2UA 1SU8A 3W78A 3C3AA 4ZALA 2PUBA 2ZBVA 5EE1A 1ZH6A 3FKQA 3DF7A 3LL7A 2JI8A 2DH5A 5F5LA 4ATNA 3B38A 1BX3A 5DZSA 1QRAA 1BVRA 1X1BA 2SKCA 5C8YA 1JHZA 1KF0A 3EZ6A 3MTDA 5IT5A 3SEZA 2HEIA 5FD8A 2WZBA 4XOUA 2RGBA 4DIEA 3K4QA 1HMPA 1T3GA 2JPDA 4ZYUA 4C4YA 5CB6A 3ROQA 2W8ZA 2BE9A 4FKBA 2OSBA 2VUHB 3R6WA 4ZYZA 2QG9A 5BSHA 3REQA 4BP3A 4LNUA 5IKMA 3MN1A 3FGOA 2VG8A 4AF7A 2G71A 1BU8A 5IK2D 3WHPA 2XADA 4D98A 4ENVA 1FMLA 2RDIA 2P7IA 4AMYA 4NRDA 3GQBA 1MIOB 1KWKA 5L4NA 2UXBH 4JI2B 4DUYH 1YT5A 1QKKA 4U9HS 3D1VA 2YKGA 5KTNA 1Y6GA 4EBBA 2FPWA 2YHUA 3NIGB 5AT1A 3CUEF 3FCOA 4G4JA 5BV8A 4FGWA 2MSLA 1M72A 2XUKA 5ITVA 4MS4A 3PG5A 2PD4A 3I9KA 2AGQA 3O0DA 5HFJA 4GC5A 4PR0A 1UZMA 3Q5GA 5F3DA 3I76A 4HB0A 2VPTA 1DG1G 3CLKA 5A1TA 4ECQA 2GVNA 4YT2A 1AA9A 3PQ8A 4DC0A 2ZSUA 4DSNA 2R1VB 3EW9A 4HNSA 4LUCA 1B15A 1AE1A 3L07A 4QUJA 2HA5A 2W98A 4ZK6A 4U02A 1DZIA 1CEQA 3CEPB 5G4KA 2BGIA 1NP6A 4Q1DA 4P4UA 4QPPA 4RC9A 3PGKA 3OF2A 2D1FA 5I5VA 1P0PA 2HA6A 1Y7HA 4H0CA 2ZATA 2H65A 3GNTA 2NO1A 3IX7A 2H16A 3SQNA 3JD3A 4DCNA 4C0HA 4CTJA 2Y1LA 2AOXA 4NIMA 4QGFA 4EHLA 4FEEA 2XJ9A 3HBLA 1YQXA 1O94D 1RRKA 2LCIA 2PKQO 4RSHA 5EJ7A 2IELA 2EFYA 4A8HA 4UE3S 1J24A 2DAPA 3BWVA 1I6UA 4HDRA 2HSJA 3CVVA 1QKJA 2O20A 4PG6A 4ZXFA 4Z3DA 4L3VA 1NUAA 5C4XG 2OM2A 1E5TA 4GMXA 1KEWA 2X9GA 3H4VA 4ZYXA 3C97A 3V8PA 3UG7A 2BHSA 1CVRA 2ZB8A 5CCXA 2BEVA 3RAFC 4D0RA 1ZOIA 2YQZA 1TYEB 3CN9A 4FLEA 5ADHA 1M54A 3HLYA 2PBFA 3BWXA 4WOPA 1R18A 2HV9A 4KLCA 2QY9A 2ONZA 3E53A 3A31A 4H7DA 2XGSA 1MC1A 4E3WA 3QKRB 1A2BA 3W6PA 1JE0A 3HVIA 3O82A 3A1UA 1CQPA 2OO5C 1U94A 2F3QA 2FPSA 4J3NA 3C6KA 3EFEA 3R0ZA 3HKDB 1KEZA 3E22A 4F9FA 4XD7D 5CX1A 2R6HA 1W36D 4Q4AB 1I3QA 3B1YA 3IRUA 2WMOB 2RDJA 1EG2A 1Q7EA 3LBFA 1UAYA 1UJ4A 5JIBA 2GMWA 1TC2A 2PMZE 1KMHB 4QVIA 4D42A 1FK8A 2VPWA 2CDBA 2VPZA 1YVEI 2AEMA 4I99A 2B8JA 4GX5A 2O7RA 4YQFA 3BTVA 4MA4A 1BGXT 1SBTA 4GZ3A 3DPIA 1F0KA 3ZKWA 2JGJA 4G0OA 4GGMX 4O29A 2O7QA 1CUHA 2ATCA 4F3KA 3H9QA 4R8SA 3T6KA 2TMGA 1XHLA 1RCFA 2QE6A 4R1NA 3F7TA 5L3ZA 3D54D 5LZ8A 2ZJZA 2R2GA 3GIPA 3NGDA 4IDNA 1FB5A 4TWIA 3K3PA 1OIWA 1P2BA 5JVLA 2WB4A 1T9CA 1EGMB 3NTRA 4P8RA 4YDQA 4YTEA 2MINA 3I34X 2ZRQA 1SD5A 3JAMA 3OVMA 5T4EA 2NAFA 3ZGNA 5CG2A 3R74A 4IMJB 4N49A 4D4MA 4L5CA 4LRQA 4DR2B 2BF4A 3BULA 5IT4A 5KQPA 1HDZA 1H2RS 3MQFA 5KYUB 3DTVA 3I2GA 4AJHA 2Z0MA 3WL7A 2IV3A 3ZVLA 4HT3B 1IZ9A 4F4DA 2PRKA 1GQYA 3S2IA 1WNTA 2XCAA 1GV0A 2AR0A 4JQCA 4N39A 4C78A 3RF6A 3T1YH 3NPMA 4GUAA 1TIKA 4PDBA 1ZUWA 1TK3A 3L7YA 1WL8A 4DLBA 3AHJA 1Z08A 5DHAA 1CJKC 4LOAA 3EQ8A 1QFSA 3INNA 2VOJA 2HHCA 2PT7A 4KR2A 2AN3A 1C1XB 2OO7A 3IVCA 4KRYA 1NGSA 1ORVA 4Z7JA 2DPMA 2DHEA 3LUGA 3Q3JB 3QVGA 5JCZA 4MZDA 4EKEA 4ARAA 2WVJA 3V46A 2FWNA 3KQTA 3K9NA 4FCCA 1AZSC 1MPXA 4BQPA 4Q7MB 2C2HA 3T61A 2FSUA 4C4OA 1NUUA 3VMFA 5DP1A 4QTXA 3R24A 2IS4A 2CSXA 2HIGA 1P31A 1DC4A 4ZT2A 1BH6A 1EFCA 1LSOA 1YK0A 2O8DB 2CBGA 3IE0A 5JANA 5TEWA 4IJWA 1ABFA 4RVGA 3MM4A 2XYPA 2AR7A 2R1ZA 1BOFA 3WKCA 1IATA 3PD7A 4DL2A 5IUKC 1DAFA 1H2YA 2HU2A 2Z8YA 2QN1A 1EFVA 5FD5A 5CHEA 1ZGJA 3AV3A 2ZIFA 5LZ9A 4DV6H 3RBEA 2RGVA 4IVNA 1CS4C 1UCFA 4OLAA 5JALA 4M2LA 3W2GA 4I8XA 1T1RA 2XE4A 1KE2A 4BYGA 4ZQIA 5H80A 2NTVA 3EIUA 3QXSA 5J5CA 3AERA 5MN6A 4UCWA 2GEJA 1SZPA 1SVOA 2QDKA 3MTAA 5AK6A 4X0EA 3W9UA 3T9DA 3KZOA 3D43A 3JARB 5DCUA 4YHHH 4NDZA 1G4HA 2BSXA 1A9TA 5LYYA 1Y1WA 1T5SA 4JOBA 2D7DA 1SIBE 4D8UA 5TSDA 3EK2A 2LW7A 4K6HA 4NP6A 4NEQA 4ALKA 3HA3A 3I5AA 1JEYA 2BEJA 3OA0A 3F8NA 2G77B 4FOTA 1L5OA 5JD6A 1BS9A 1L3BA 3V1TC 1UXOA 3M5DA 4DR5H 1DBSA 2G06A 1J99A 1VCMA 2D62A 2R751 4AX8A 2YYZA 4MCIA 5IG2A 2DCMA 2GGSA 4MPJA 1SM4A 4A2QA 5IC6A 2OG2A 3GG9A 3KFXA 3BHNA 3KOYA 4O2AB 3IQDB 2V9ZA 5DM60 3RB0A 4IYJA 3PWZA 2GQ0A 2X15A 5KHOC 2GETA 2FN4A 2Y92A 1OV6A 5KSWB 4GR4A 1L1QA 4ECSA 2HLPA 1CLEA 3QMMA 2HQSA 2OYSA 1YOBA 3TLZA 3NTXA 2QQ5A 4MVJH 2PAAA 4W7HA 1E99A 4US1R 2JKZA 5EKXA 1X15A 2HI0A 2HQRA 4PNPA 3EDMA 3U7GA 2QW8A 3GT7A 4Z6KA 4CCYA 1XQWA 1G59A 3IBTA 1IHUA 4EPYA 4ETSA 4CEIB 1MZPA 5AJZA 3UY4A 1C80A 2YWBA 5TRTA 5K6AA 3IIEA 3D0KA 3QQPA 2FFHA 1G6KA 3KR1A 5IUJC 3F6BX 4G84A 2WFLB 2JJQA 3PE4A 4DR3B 3N70A 2A0KA 4QQFA 3LQ2A 4MKFA 3N87A 5F5XA 3KD2A 2A35A 3UXEA 1L2TA 3O90A 1XU7A 1XVUA 3PJRA 2O2CA 2ZWAA 2R2AA 3HJUA 4IQ8A 2AEFA 2YWHA 2V54A 4BWYA 4GXQA 2V8OA 4TPKA 1E60A 6Q21A 4FVTA 1QC5B 1LLCA 3EDOA 1HC7A 2O8EA 4CHGA 4N48A 2R68A 4OOEA 5JH7F 4GZLA 3EX7C 2NU6A 3V8VA 2JK1A 3HSKA 2Q3HA 1DPGA 3WIDA 3MIZA 2OHVA 2ZI3A 4V0LA 4OMCA 1PBTA 3HWWA 5LFAA 2IZZA 2N0SA 1TI7A 4RTRA 4NMHA 4TSFA 3W8DA 1PLJA 3RJTA 2PO5A 3WJ1A 4S1PA 1KDRA 2GJ8A 4WV3A 3V6HA 1R9GA 1E9EA 421PA 1MA3A 1OLSA 4RYDA 2DUJA 3H5AA 3ZPXA 5JQWA 4OU5A 2H18A 1XK6A 3SZUA 1M1YA 4X1KB 2ZRFA 1I6LA 5JNLA 2SNIE 5FR1A 1PK8A 2DUMA 5FBHA 1WUIS 1DO8A 4ABTA 2PZJA 3F6EX 3RWOA 1JAHA 2QQ0A 4CE5A 2GTIA 1CY6A 2WEKA 1CV2A 4LSZA 2DT5A 3UMGA 1RJRA 2BFBB 3C45A 4ZYYA 4HTAA 1E7QA 1JU3A 3ZI0A 2GUWA 4XIGS 1L3IA 4C5CA 1KAOA 1NRXA 1ZW1A 4H3SA 4I2NA 5EJAA 5IABA 3BGDA 1E3SA 3KYJB 4CV1A 4N5NA 4R9NA 3IMCA 3JTEA 5ELMA 1IOVA 5A6SA 3PDJA 2FPPB 4NBRA 1E1NA 3G5LA 5C8ZA 3PTLA 2C5GA 1WF3A 2RI6A 2AMYA 4ND7A 3ETNA 3RYHA 4H1TA 1N2HA 5DGIA 2Q4DA 3R9RA 2YMQA 3AR3A 4ZCPA 4HR7A 5BW8A 4R1LA 3V7WA 3JSNA 1PGPA 1Y3AA 1J5EB 1GQRA 2W2LA 1JIQA 4Y8VA 4GRIA 1OBDA 4L28A 1Q77A 5K2OA 1NLMA 3RG8A 1VPDA 1XZHA 3H4DA 3TR5A 3PEVA 4EQ6A 5HHTA 4X90A 1T4BA 1QWSA 5CDSA 1X8XA 2OGUA 3PJEA 3P9PA 1F6DA 4YFVA 1YUMA 3IIMA 3CEAA 3V55A 1MQ9A 3ZWVA 1NVBA 3EXFA 1JHQA 3W6NA 5EXSA 1IEXA 2C61A 3UJHA 5AOAA 3AI1A 1GAWA 4AQYH 2GXUA 2OHIA 5F2KA 3NAQA 3BICA 3NBYB 3DM9B 5IH7A 4X6XA 3H04A 1OLXA 5T3UA 1F2TB 4C3ZA 3E8MA 2B63G 4K88A 2A9FA 4YR9A 2J87A 1IZZA 3PQ3A 2EX1A 2PMBA 4R8KA 2UZ0A 2AOTB 2COUA 4I8IA 2G9RA 4RVFA 4JB0A 5ITWA 1EXNA 3WISA 4ZCTA 5BWMA 4W99A 4R9SA 1UKVY 1G8SA 1M75A 1E8DA 2VDWB 2B2CA 2AOUA 3HOYG 3JSXA 1H2FA 1ATIA 2V7VA 5K05A 4UBKA 1I1MA 1OGIA 3VH4A 1OKKD 1RYFA 4XDYA 1QHHA 3DVLA 4DV2H 1JG2A 3BMQA 3HUUA 5JZBA 5I7UA 3PSAA 5CCDA 4XIIA 3GOHA 4E4TA 4Y1GA 4QEDA 1OYYA 4YI3A 2NVBA 4E3ZA 1G21E 3CLTC 3V8MA 1EFLA 4BO4A 4MV0A 2IXBA 2DHCA 3W2IA 1QVVA 2ASLA 3ZJYA 5KFOA 3OPYI 2B7CA 2FYTA 1P0CA 2A0WA 4OGGA 1KJYA 3WB2A 4B3HA 1JEEA 3R3WA 3G5UA 3FPFA 3M4NA 1NVAA 2REBA 4YRZA 4LOIA 4GP6A 2VSFA 1JDPA 3F3MA 2ST1A 1MO3A 2NU9B 2OQIA 1OXBB 2HB6A 2AEEA 5BY2A 3RVPA 4FBLA 3CNQS 1P33A 2NUPB 4ZRNA 1CRLA 1PLKA 2PSFA 3KWFA 4DMGA 3OURA 4DDHA 4GQIA 4P3OA 1CR2A 4W63A 4EI2A 4MKIA 4WZAE 4IICA 4J4HA 1R5BA 5LP6A 2RKBA 1YUNA 2EJWA 4WLFA 4ZVVA 2ORWA 3P2MA 1LDEA 2LDXA 2QP9X 3VR4A 4N03A 3PDIA 2VYCA 3N2GA 3U3JA 4YRDA 4ARVA 1HQDA 1R0YA 1L8LA 3R3UA 1QYCA 1O89A 1O5IA 2PGLA 2X13A 3H6HA 4IOLA 1TWAA 3OKFA 3OZIA 3GRZA 3OJ0A 2R6FA 3TKYA 3IIJA 4IRDA 2G63A 5FJIA 1FP4A 5IANA 2HQ1A 2M9MA 2D0IA 5A4IS 1JHUA 3H9UA 1G19A 1SCUA 2ACWA 3H5TA 5TT1A 1J0DA 3K2IA 4IGKA 2G5TA 1JDSA 4F72A 2HC9A 4FIZA 1Z12A 4YGXB 3VKFA 2B8TA 4P4SA 1MKYA 5H5JA 4WBNB 3KALA 1BRTA 2REQB 1E9DA 3QVOA 4HL6A 3FDJA 1ZR2A 3JASB 1EWTA 4RHCA 5KUTA 1MVNA 4MSUA 1SB8A 1QIDA 3AUAA 1G8GA 1X8JA 2J5XA 5LXTF 5JY1A 2CNVA 1L5YA 5EWEA 3I2IA 4LJYA 1GRCA 1YQEA 2WM9B 3HK2A 3W79A 3E8XA 3NWOA 3DV0A 4AJEA 1NXWA 1XF9A 2M6SA 4G65A 4FNMA 1RJWA 1H2AS 1RRMA 3WLQA 3S70A 1XZPA 2V6MA 3CIOA 3OH8A 5CYFA 4QD3A 4GLWA 4XFKA 3RJMA 2QTNA 3CSSA 1GZ3A 2WJ6A 3B82A 4GP9A 1TX4B 1QO9A 1XMIA 4WNAB 4XDGA 1IOWA 3ZWDA 3UJBA 1I1LA 4PXAA 2A33A 3OOYA 1R12A 4D9MA 3U7HB 1M2GA 1DAEA 3CRQA 2JGKA 1JDNA 3BQMB 4L6AA 1S6YA 4LHWA 2WZCA 4OSOA 1UJNA 3BHJA 1XXHB 1LDBA 5DG8A 2HAEA 1U11A 1GXSA 2P75A 4TMWA 4WT7A 2NV2B 4YT4A 2YBDA 2ZAGA 5CGQB 4NQRA 3PGJA 2QWXA 2VYVA 4EYHB 2NO9A 1G8YA 3AZOA 1EEXB 1XSEA 4WA8A 4YR3A 4UNSA 2AK3A 1F3OA 2NGRA 4KQHA 4ECTA 3GPDG 3KKNA 2NP7A 3U16A 1W36B 1M0EA 3BH0A 2Y68A 2W00A 1Z17A 4WXHA 3SYRA 1V8BA 5KVQA 1X7DA 2ZRKA 5CAEB 5A3VA 4QDOA 3A9RA 1VBGA 2P27A 2ZRNA 3PE3A 2HGZA 2XZLA 4BNLA 2P1DA 2GN2A 5JCXA 5JO0A 2ATLA 3COJA 1XTKA 4J0DA 4S2EA 2Q8QA 1G9SA 4ZT5A 3MBOA 2CLCX 5IDXA 3MOGA 5ICMA 4E5MA 3IAS6 2VPYA 2Y9PB 1F51E 4FQ7A 4BFVA 3L7JA 1PDVA 4FPXA 2Z83A 2XDWA 4AZ0A 3RBAA 3KU1A 4EUEA 4FYHA 5ERYA 2IW1A 2RHDA 1J7KA 1YBHA 4YXWA 4FFWA 4B31A 1FMJA 4JYBA 3PD1A 2XB8A 4LVCA 2AK2A 4RVCA 4KPYA 1R0SA 5HMLA 2GM3A 5DTMA 5JS8A 4RJLA 5CT4A 2TS1A 1L7MA 4KR7A 3P2YA 2X1VA 3DEIA 4OP3A 4ND2A 1QRTA 3ND9A 2W8BB 5AYVA 2I3DA 1WV0A 1IEVA 5LA6F 1TU3A 4H08A 3UUEA 1IHPA 2X4LA 3LD9A 5CVEA 4DTIA 3LPMA 4AXXA 2HMSA 3MR6A 1NX9A 2I03A 1R64A 2V55B 3CLTD 4WVFA 3RKRA 5KFDA 1JKJA 2P67A 1BIFA 3CH6A 1OLOA 5KSZA 1A97A 3ZZ0A 4BMYA 1Z68A 1NV8A 4JCCA 1GKUB 3HTXA 5C31A 1JDTA 1IBRA 3RYCB 2EOAA 4TMYA 3JYLA 3LQ1A 2DP4E 4M8KA 1GDDA 4MCHA 3GUZA 3E05A 2Y1OA 4UHHA 3OX4A 4EJ6A 2O2JA 2FGKA 5B36A 1I7NA 5HK8A 3MAAC 3O5AA 1OFIA 5K8UA 2WD7B 2Z5VA 1QPZA 3W7AA 2HGSA 4AICA 1QH9A 1K8XB 3QE4A 4BC1A 5ALHA 1B6GA 4IMIB 3VKUA 1LGYA 2WMNB 3BQ2A 4HZGA 5B55A 4C6HA 3BFPA 5DX0A 4P7KA 1VAJA 5ALMA 1PZXA 1VPVA 4TTAA 2GPWA 2JHGA 3FWYA 4ONEA 2HWXA 2B21A 4LOHA 2QG4A 4XM2A 3K94A 2WDZA 5CB0A 2XBLA 3NEPX 4O4JB 1HBJA 4WASA 4BJ6A 4YCAA 3DW3X 3WP1B 5KFAA 3LUKA 4MJLA 5JLAA 4FCWA 4JP2A 1IBCA 2PJUA 4QU8A 3ETEA 1FRQA 4MS1A 4E12A 3JD1A 3HEBA 1SELA 4EMUA 1RRCA 4D41A 4F2GA 4E1AA 5DSZA 1CQWA 2UZ1B 3D64A 4EB6A 2V45A 3DDOA 3VR5H 1E9AA 3LUBA 4IXWA 1ISMA 3BRSA 3NBZC 2NVYA 2YS6A 2VJKA 1T8RA 3IP9A 4G09A 4AMGA 2BUBA 1P2UA 2Y4NA 1PWZA 1L9XA 1BRMA 4OHCA 3R9XB 4A7PA 2WWIA 1IN5A 4NBWA 3VPGA 1XWWA 2CHEA 5JHGB 2EV9A 5JG7A 1JSRA 5F7XA 4A0FA 1UIMA 4E13A 3AL0C 3LDUA 4ENRA 1Y3BE 4GKKH 2IHYA 2LGJA 3QXHA 4E31A 3M2TA 3IKTA 1UOOA 3SHOA 4I5EA 3KK0A 3JQBA 4TRNA 1ADJA 2HIVA 4N3AA 1UBCA 2H4ZA 1CERA 3LQFA 3U26A 5HDBB 3LBNA 3IQIX 3MWEA 1X9GA 3K5PA 2HJ9A 1WBJB 3EEYA 1E1KA 2DBQA 1BWPA 3RARA 1U3GA 1DT3A 4MR9A 5CCEA 4UDNA 2EZ9A 1KPGA 2HA7A 3V4ZA 2AI3A 5EJ2A 3VNVA 1AO0A 1Q19A 1H5NA 4QLBA 2VHVA 1ZHFA 5EOYA 3ET5A 4CT4B 1Q0PA 1PFWA 5THKA 4KLNA 1DIHA 4O4IF 2OHFA 3GQVA 1TRHA 3QHAA 4E6PA 3LWBA 1RI2A 3P5SA 4AO7A 3TTXA 2J59A 1DADA 3PUYA 3JV7A 4I1OA 4IVQA 4H6VA 4YDSA 1L7PA 5JPCA 1HURA 1UT6A 3NBAA 3RRMA 1SD2A 3AR6A 2YHSA 4U0JA 3DE0X 2AN5A 2CJPA 4ZVOA 3AX6A 5AICA 5FNVF 3BIOA 3DVSX 4QQKA 4XX1A 3AW9A 2I7XA 3HJFA 1ZGBA 2ZB3A 2PLAA 4D6XA 3RAGA 3NYQA 4R2XA 4EI7A 1AO3A 2Z58A 5JJLA 2EXXA 1TA8A 1LTKA 2F1KA 1LZLA 3HWRA 1QPBA 1PQPA 1XKLA 3SYMA 3OICA 2ENWA 1VZ3A 1PZMA 1XNGA 3RV3A 3SZRA 2JAPA 2C9YA 1EI9A 3EGVA 3G59A 3TKLA 4YP0A 5K4HA 4L8YA 1M1ZA 3UUWA 3PC8C 3VPXA 3VR1A 1HNXB 1FFWA 2ZR8A 3S24A 3H9EO 1E0JA 2WP8J 4L8VA 3I2KA 3OD1A 5LJLA 3RRBA 4CMFA 2J9GA 3KSBC 4D1YA 2YFKA 1VJCA 5DG9A 4IRMA 1XWIA 1HUQA 2NOAA 4BO6A 3RWBA 4P2GA 4PZUA 3E23A 3AFIA 5LD2C 5ALVA 3GMDA 4PBCA 4LZAA 3GFQA 3DO6A 2G9UA 4QEKA 1PJ4A 3LT5A 4RD3A 4MGYR 1W9HA 2QP3A 4S1TA 4J0EA 4PFQA 3LMLA 4C29A 1TC1A 3PKJA 2DULA 1YZGA 5B2FA 2IYNA 1XZBA 1SC6A 3LFUA 4JJZA 3NYWA 4B6OA 2IVFA 4RH1A 4IJQA 4IIYA 3B3FA 5CPFA 2B8WA 1EGVB 1EK0A 3GDEA 3TH5A 4MUFA 5EMJA 4TMTA 4E2FA 3LFTA 4D79A 3ZNOA 2W2XA 1AQNA 1UIRA 3V2HA 3OCWA 4AZSA 1LF5A 3GJXC 1YZYA 3IMGA 3STXA 4Q3LA 3H9GA 4QU5A 2CXXA 4MHOA 3U40A 3OZGA 2QRHA 5LMUH 1ZWKA 4S0ZA 1RKXA 1X1TA 2VHXA 2ZZKA 4PO3X 4TMVA 4W5HA 5EJ5A 1Q0QA 1U3UA 4XYBA 4J7XA 3KWLA 3HB0A 3DVAA 3QPBA 4P1ZA 4Q01A 5K03A 4DSAA 2X42A 2IYXA 3JWEA 4TLLB 4AKGA 3FDIA 2C2WA 2EFGA 4K6KA 4A3EG 3OQBA 5I7SA 1ZZEA 4ZCRA 4O81A 4W1PA 1SWVA 1SUFA 4U8GA 2OT3B 3OSUA 2D7CA 3KKZA 3QPUA 3L8HA 3NZEA 3CTMA 3LKDA 2XNHA 3T1QA 2Z56A 1I9GA 2AFIA 3IO3A 1DXQA 2EKBA 1GD1O 1SA0A 3BZWA 1I7LA 1WD7A 5GZ6A 1PI3A 1V9PA 4M46A 1YDHA 2R7ZA 2C2OA 4PE5B 2FX2A 1TGVA 4TLBA 4EGCB 3RIYA 1GPDG 3R23A 4TVSA 1ET0A 4ZGWA 4RD1A 5FOTA 1QGZA 4TZTA 4FJ2A 2XT0A 4JX8A 4QRHA 3M6VA 4I9FA 3T9EA 4TLEA 3IDOA 1HFJA 9GPBA 2Z4SA 1VG8A 1MV8A 2OXCA 1NI5A 4DG9A 3UANA 3CH4B 3FTDA 3RYTC 2BMDA 4OQXA 2EU8A 5CIYA 1S2GA 3FY4A 4DA4A 2P2DA 1A7UA 4LMPA 1NATA 3OO0A 4O7VA 3GJ5A 1QX4A 4JR0A 3R4VA 2YRFA 4K6FA 4W5WA 2GA8A 2PUDA 2FEMA 1GR0A 5ECWA 3AEQB 3HJNA 2FMIA 1QVAA 1DX9A 1ZICA 3CLRC 4UBMA 5EJFA 4XJSA 3ZWKA 4Q9AA 1V7ZA 4YAKA 2H1OA 1MPTA 1W6RA 1BEZA 3PEWA 3MHTA 3HABA 5CDYA 4EOGA 3LIIA 3PXXA 2Q99A 1N5JA 3WYNA 4AW9A 2C84A 1U8YA 3NYIA 3KXKA 3B9RA 4LSAA 2FRDA 2GTPA 5KFYA 2IIPA 1PFYA 1UBEA 4XKJA 1T2AA 3STHA 3RAEC 3TRDA 4Q1BA 4ACAA 4O7LA 3UAOA 4Z4EA 2QX4A 3C14C 4NENB 1CW2B 3IAAA 4J1TA 4IS2A 3O92A 4RANA 4RIHA 1DB3A 2XE8A 1X1RA 2RK3A 2YCBA 2WAAA 5DXAA 1A2OA 4GE3A 3OJEA 1RNLA 5AVRA 1FA9A 1LFDB 5JSUA 5I8ZA 1RWNA 2GHIA 1T91A 4Z7QB 1FCJA 3DZHA 3RHSA 1SFOA 2K7FA 5K0LA 4MLCA 3RDPA 3SHTA 2PH3A 1TPYA 4KR9A 1F3LA 2B2NA 1JI0A 3T3HA 2X19A 2R7AA 4FXOA 3G2HA 5CEEA 3F5FA 3KR9A 1RPAA 3L8MA 2H85A 2AN1A 2GF9A 4G0MA 3R20A 4QWEA 4N01A 2G70A 4AIRA 3V42A 2X9VA 3F98A 1LK5A 3O2QB 3A3PA 3VPDA 3VHRA 1WKBA 4BB0A 3EZNA 3N74A 1RHMA 4FNGA 3UK0A 2C7BA 2D5CA 4DMFA 2R66A 4B45A 1L5QA 4M7OA 1U3CA 2J3EA 6PFKA 5GOZA 3B3AA 2F2TA 3CRW1 3EIXA 3S8MA 1UBHS 5CNMA 4ECYA 3H18A 2DLCX 1G291 3W5SA 2AX3A 1RAIA 1FP7A 4ESOA 5FCDA 1LC3A 1K63A 4YY3B 2V7GA 4HDCA 5KG7A 2XCIA 1X9NA 4MEBA 2ZRGA 3MINA 1WWKA 2J41A 3R7NA 3WMXA 1PUIA 2OCBA 2BGMA 1YJ8A 3CVUA 1E2JA 2QVBA 4ZMRA 2QXYA 5A4KA 4DVJA 2IGBA 2O0LA 3RANA 5ABPA 4Y3UA 3H6GA 1KI6B 1TWHA 1RXSA 4DSOA 3LDAA 2WMYA 3GW8A 2GSWA 2YVLA 3ASZA 1C1YA 3ZD9A 4I6EA 5A0FA 1SURA 3TI9A 4HAYA 1TEZA 4DY6A 1NBME 2ACVA 5KNCD 3U3XA 1OCEA 2W22A 4QLAA 2BMEA 2XXJA 2RB5A 3D1JA 1YR8A 5JBNA 2IYZA 5DPMA 2GFQA 2AZMA 5AFSA 3KE9A 1KMCA 3FGZA 3OLQA 4LF8B 1AM4D 1FFBA 4ZOAA 3AFOA 3WFIA 2YQ5A 4G0YA 4JC4A 3PF9A 5F23A 3KD3A 2FQXA 2Q1TA 4N1AA 4Y6OA 1L8AA 1UXGA 1A04A 4PLFA 5CDHA 3AG5A 5JH7B 1XD2A 1UXHA 4UAJA 4E21A 4F3YA 1TK2A 2K87A 1MQSA 2O8BA 2VWGA 3DBVO 5C46F 5COBA 2FZCA 4J4BA 5B57C 3PCTA 3HDHA 3T4UA 4U6PA 1Z4LA 3AJRA 5L7YA 1YR7A 3REOA 2PSEA 3Q6NA 3VDMA 2JAXA 4U9UA 5ULLA 1U7HA 5BVGB 2Q07A 1U0TA 3EF1A 4J9KA 4LXXA 1VA5A 5DSXA 3FPKA 2CFCA 3EFOB 4MLZA 4F4XA 4QTZA 4DV3H 1C9NA 4JUZA 1ECFA 4P7GA 4DL7A 5LMZA 5M34A 3FHTA 5CA0F 1T6YA 4I5DA 1A4UA 1BMFA 3LPNA 1RJGA 3DAOA 2NSYA 4CQMD 3PQFA 4JLWA 3HJHA 1QDUA 2PUFA 1IVNA 3QYPA 5IU6A 3FROA 3UENA 3MMSA 3OQOA 4P4NA 1NMYA 1T6BY 2EJTA 1YHNA 2J6TA 4J0KA 4ZZIA 3SX2A 3I9JA 1XDWA 4UUBA 2Z9BA 4BQIA 1CEXA 4DLTA 2A9PA 3GEHA 1Z9BA 5C4MA 3CLRD 5IP7G 4BFXA 1HF3A 4PHFA 4X45A 1OXUA 3KSAC 3ZHBA 1NQ5A 4X6UA 4OQ4A 3GLIA 1B3RA 3RFXA 3RHFA 1SEIA 3MYRA 4OB6A 3HJAA 2AXQA 1SCJA 3USZA 3SR3A 1M0WA 3AF1A 3DBRA 5BVHB 4JP5A 1V8OA 2XJ4A 3RVQA 4AROA 3INYA 4DMCA 1IBLB 2YC4C 1Z5PA 1CUFA 3SKXA 2OGWA 2VS1A 1AKEA 4LC1A 3AF2A 1PSZA 4C05A 1OX6A 1W4BA 1C1DA 4CL8A 1THMA 2TYSB 1L5HA 5JDCC 3RUPA 2C94A 3OPQA 5M04A 4FR5A 4JI4B 5ARDA 3MWJA 1F6BA 3R09A 4QXOA 4UNQA 3HBMA 1GJRA 2XMQA 5FWDA 3E5HA 3UK1A 1VE6A 2GT1A 2GN4A 1SHLA 2PR2A 2CLIB 3RIXA 4P0PB 1J5XA 3FYDA 4JP8A 1OHHA 2RGNA 1U31A 3K8QA 4H6PA 2Q1SA 1KH2A 2MCTA 4PVDA 1SU6A 3FPJA 3GEMA 4OIMA 2WVHA 5C7IO 2YVQA 2D2EA 4NG5A 2IDJA 3CEBA 3R6DA 4CIBA 4ALNA 3R5KA 3ZU3A 1XDBA 4LKRA 1AMUA 4DUZB 4OQFA 2LZ0A 4TTTS 1NOIA 5AJUA 3UATA 2HHLA 2ZIAA 3B20A 3GLHB 3EMBA 3UZOA 3DEFA 3DTYA 4OM7A 1FUEA 3D8BA 1W4ZA 5DYIA 2NO0A 1F2DA 3DHWC 3RNLA 5TIIA 5BSEA 1ML3A 3MMNA 4WINA 1CWUA 3IP8A 1DBQA 4ML3A 3R6LA 4X64B 3PC4A 5K8JB 1XHEA 5LBIA 1T6ZA 4I7EA 3H1FA 3QIAA 5GQSA 4XQ0A 2ZE8A 3W05A 5JRJA 4DDVA 1K5DA 2QJRA 4DGQA 3W5OA 4EEQA 1DIGA 5CJJA 3FWPA 4FFMA 2ZE5A 3WLJA 1NE2A 4RF3A 1IRXA 1R2QA 1N7GA 5KYTA 1I4DD 1E3EA 5FWXA 3A9CA 4BJ3A 2ASDA 2WJ4A 3RFVA 2PKWA 3CURA 2QVGA 4M37A 5FBRB 2J6SA 1XEWY 1T6NA 2F67A 4QPDA 4PCAA 1TCVA 2X0RA 4MWCA 1E6WA 3VQTA 1MGPA 3HDYA 2CVOA 4L0CA 3HGTA 1MD9A 2Y6VA 5C7LO 1TYCA 1T2CA 2AHRA 1U2PA 2TSYB 1BXGB 3AUFA 4CIWA 3ZVNA 5JISA 4CJXA 5HUHA 4DMLA 1CFJA 4D9KA 5BNIA 1N3IA 1Z5ZA 5C32A 1RYYA 1T1SA 5KG2A 3OPXA 2OCYC 5J4YA 2VNIA 2CMDA 3STTA 1T6XA 1Q1BA 4EATA 3A2NA 2WAQA 1V8PA 3B6ZA 4GI7A 2RHLA 4FT4A 1D6MA 1NT4A 4PHHA 3OECA 1HR0B 2VNSA 4TYNA 2PK3A 1DZ3A 3M3PA 2CGEA 2H1CA 3TKAA 2A9OA 3KV1A 2F1JA 3GBPA 1V47A 1FNDA 1YS4A 4CQLA 3PIRA 5EQFA 1G7CA 3D2CA 1G20E 5H1YA 5C0OE 5JRZA 4IJMA 3TFOA 2REOA 1MFZA 3PW4A 3ZV3A 4MRAA 1UEIA 5LXTB 1RHJA 2OB2A 1E7RA 2BTQB 4DAAA 1GKIA 4WZBB 3VC3A 4BL5A 4BY1G 2ZJBA 5I5EA 4ETMA 3IDAA 4O8ZA 3RR5A 2G9ZA 3UJ7A 4QJIA 2GESA 2CDCA 4URUR 4JT8A 5TQVA 3VNQA 3NETA 1QYRA 1XQVA 2P1ZA 3MR3A 2E85A 3HG7A 3N59A 5BSTA 2WV7A 3OLXA 2O7NA 4M0KA 1Z2DA 2O48X 5CK5A 5B3JC 4OQNA 4HH4A 1IOLA 5EFZA 3WAGA 3FG9A 2XA1A 3IAM6 1M33A 3AMVA 3UMVA 2VI5A 3VR6D 4DLYA 4ZAZA 1Q15A 2Q49A 4OTZA 1MJHA 3KLPX 4C9BA 2GPAA 3E4CA 1NPDA 4CM7A 821PA 2BFDB 4LN1A 3H5IA 2QORA 2VJOA 3KQHA 2H0RA 4D4IA 6REQA 2FWRA 2BI4A 2BR4A 4RF2A 1NQUA 2W9CA 2IYOA 4A23A 2KW5A 2G25A 1ZRNA 4JI5H 5F9NA 3D7KA 4MYHA 3GEIA 1HT1E 2PWZA 2V9CA 1QTRA 2W70A 3DZCA 2EYQA 4WK0B 3VPBA 3FMIA 1ICIA 4KQMA 4M3NA 4B83A 2OFXA 1P2FA 2ISCA 3KBOA 1C3EA 1RZUA 3IUBA 1II0A 2A5JA 2IHJA 3AYXB 3EQ6A 2OP0A 1YNSA 5LJIA 1KO4A 5BR1A 5T7BA 3L0DA 2Z8YM 4CTOA 3M81A 1ZRMA 5AOCA 4RA9B 3ZKAA 3I09A 5H0IA 2I55A 2Q9AA 4O4LA 2QJTA 3NTOA 3VZCA 2DPYA 2H51A 1TEXA 3UV6A 3I01A 2QVZX 4UMFA 5I9BA 2OHHA 5KFQA 3G8AA 5KS2A 1PEYA 1FU8A 1EBUA 3R7AA 2WWXA 2FSSA 4Q0YA 1E0KA 5LQRA 5AVJA 3NOQA 5AP9A 1KY5A 2PUWA 5LZ4A 1EINA 3NBZB 3IG0A 3OQMA 1ZINA 1U3WA 4QG7A 4GKVA 2J0UB 3FGPA 3GLUA 4PYNA 4EKGA 4MUBA 4BFSA 4PC2A 1F5NA 2I5PO 2Q28A 4P5DA 3TG8A 2QZZA 2ZJ8A 2NUTA 2NXWA 5CJ2A 3RUAA 3KT0A 4DV4H 4Z1OA 2ETVA 4D26A 5JAZA 4OHKA 4O4HF 1B42A 4B4OA 1JNXX 1ZUNA 3I01M 5LA6B 2F90A 5GM2A 2X5KO 1IXRC 3U0VA 1YBVA 1YS9A 1ADBA 4YIHA 3ZI4A 4KEAA 2UV8A 1FFEA 1CQJB 3VNRA 3PNLA 1EUCA 3FSEA 1X2BA 2Q6IA 4B32A 3RVOA 3KJQA 4QREA 1L7VC 4JLSA 4JI6B 2DUWA 4NCJA 4LOJA 4UTNA 1UZNA 3PK0A 4AO6A 3UAGA 2X0DA 2FG5A 1I1KA 1XTUA 4ZFNA 1IJFA 1PR1A 4Y2SA 4TQRA 3ZEIA 1N8SA 4NL4H 1E9SA 3CF6R 1RWMA 2I2XB 4M6WB 3HA2A 2P7HA 2EKLA 1FYWA 1TZJA 4MRVA 4TKUA 3AM5A 5KFMA 3N40P 3A14A 5K3BA 2NYAA 1HNWH 3T9CA 5EHIA 2RARA 4M1EA 1P2VA 1ULBA 3GCWA 1YL7A 3OAAD 4TL8A 4YCSA 2ODWA 3KU4A 5T67A 4C06A 4M1YA 3TTSA 3I9NA 5AKIA 3LT4A 3ASVA 1DJOA 4B6JA 4ZJPA 1N6KA 3X44A 1C7FA 4N9WA 5BQPA 1G8HA 1RYDA 1IBMB 5AKEA 3WVNA 4UCQA 4QVKA 1IBKB 2UVPA 5LWHA 5E4FA 5H3LA 1E2LA 5BWWA 1F6WA 4Q66C 1EZ1A 1A5BB 4K8OA 1YTUA 3Q7RA 4JCOA 1P80A 3T06B 3I5XA 2CDNA 3WDLA 1NF3A 2OBYA 1TT5B 3X2FA 3LUAA 3DL0A 5HJEA 2KSWA 1TAHA 5EY5B 3VU9B 2G3YA 1WSBA 3H2ZA 2GH1A 1KVRA 4MCAA 4EBFA 4AJ4A 3MAJA 2VNJA 4I9GA 5A4FS 1I51A 2NQTA 1AUVA 3TZEA 5LD2B 3CRZA 3UHFA 2Z8XA 1FJGB 1JZTA 1GU0A 3UZUA 1RI3A 3QOYA 4E08A 4XSGA 3OCYA 1T15A 4M88A 1Z06A 4UU8A 5GADl 1E1CA 1HNZH 3H75A 3O1LA 721PA 1E1QD 3KPWA 1MH1A 4MP8A 4ME6A 5JZMA 3QV1A 3DFMA 3UGJA 5ADVA 4FZ5A 1M7HA 4CMIA 4RELA 1M1YE 5HF9A 1QAOA 2TRSB 3TLBA 3W1VA 4KC0A 1W6UA 1PWYE 4O3MA 4X84A 1A9SA 3PXBA 3VJLA 3K5IA 1X6VA 3HI6A 1ODJA 3SCZA 3HM2A 4M21A 1OH7A 1FJ2A 1IUOA 4DPLA 2UUBH 4O4IB 4YJDA 4REQB 2VYND 1J0XO 4JU9A 1LSJA 2XGOA 3WWJA 3GJXB 4H60A 1JIJA 5BN5B 4BLWA 2PKEA 4F38A 4V02A 5IDYA 3BG5A 4MYUA 4MV9A 4H27A 5AXBA 4JVOA 1RWKA 3V4VB 1IG3A 1YZNA 2FG7C 1DXYA 3MLEA 3VPHA 3T5JA 2ZE6A 1UNNC 2J6BA 5FNVB 4Z2AA 1X39A 3GROA 2PUAA 4ILKA 4U2BA 3W3AH 5K7SA 3DAGA 1PS9A 1UFVA 3BXXA 3V4OA 4HJRA 5ALNA 3FM9A 4EHBA 5A1JA 4UM5A 3O4JA 5FQNA 2XSZA 5J2UA 2IEIA 4MVJA 1MRNA 2ZREA 2AMVA 1HORA 1O6ZA 1GVNB 4NULA 5L3SB 4RXUA 5KFIA 2Y8EA 3HYRA 2AB0A 1NAHA 1W85B 5LMNH 4G26A 3D4LA 5I7WA 2ET6A 4EFDA 1SOUA 2QTVA 3JCZA 4FCVA 5AXAA 1FNCA 2YW9A 4B5LA 3R3VA 3ID6C 1ODCA 3WGZA 2RHMA 2H48A 3ZQ4A 3VYTB 3AZPA 5DP2A 4ER5A 1DCMA 1FQKA 4NZMA 2ZT6A 1FZQA 1V4BA 3RSGA 2QL7A 1Y3FE 3ANNA 5G02A 4Y6RA 2DQSA 5AI9A 4CQMB 2NSHA 2EBWA 3EPKA 4ZYWA 5AM2A 3SJ7A 2ZVDA 4MVJM 1YJQA 4DA8A 4NCXA 4DQNA 1S8AA 2F9MA 2R93G 4FP9A 2LP4Y 3QFSA 2QGNA 4M0PA 2AJ8A 5TPZD 3DQZA 2BKAA 2W2VA 2HU7A 3GG2A 1NNLA 2AFRA 1Q74A 3KTAA 1KMMA 3U7FB 2GZRA 1UKCA 1FJXA 2R8EA 3Q5EA 2O3RA 1P29A 4UCOA 3GFFA 4O82A 1TCCA 3DOUA 2FX5A 2R7LA 2CHQA 4HGOA 3IAFA 2OAGA 4J1NA 5J40A 4IRXA 1DAOA 1ZESA 2CXQA 3I6QA 2DETA 2JIZD 2YQ4A 4K40A 1S0OA 4H1VA 2HFJA 1SEPA 3EVAA 1OOEA 3B51X 3NOOA 2PTHA 2XA2A 3IBCA 2VHZA 3TK1A 3KHLA 1GWNA 1L1EA 1Q7RA 4C1NA 1XRLA 2FKLA 4AK9A 5IZ4A 1PT7A 1PSWA 3L6RA 3TBKA 2IF0A 5ICEA 4MV3A 3L06A 5E9JA 5HJ5A 1PVOA 2PZBA 5JUMA 1J90A 2D4HA 2QN7A 1CG6A 2FGJA 2RIRA 2WNIA 3AKYA 3KKPA 4DA0A 3O93A 2I3ZA 4I1UA 1ELOA 3VYRB 2R8KA 2C04A 3B5EA 3IQWA 3KUUA 2JG3A 3BT7A 3G68A 4GGOA 4I1PA 4LDJA 2E49A 1L2ZA 1P72A 1A4XA 1U3VA 4W82A 2HMWA 3NBMA 4QFDA 5AKXA 1X3LA 2NZVG 1P6XA 2B1JA 4AFNA 5D8DA 1KBLA 4IDFA 1JHOA 5KYYB 2CZGA 2WFMA 3DWFA 1K86A 2YDXA 1BFDA 1W25A 4JJ8A 4IWXA 3C3DA 4D9IA 2XUIA 4OQMA 1L5WA 4CYMA 4OMDA 4EENA 1OFVA 4ECZA 1IAQA 4JV2A 2C83A 2MSKA 4FMDF 3E70C 3ZR4B 2OZPA 3VR3A 3B12A 5AUQA 4JI7B 1CZLA 5GOTA 3LGAA 4Q4DA 2H2FA 3R0IA 2PA0A 2R6R1 3RTXA 2KM1A 5FI1B 3KXDA 4LC0A 3SZ3A 5T3YA 5B1EA 5K3EA 1HE4A 4UCXA 1H6DA 1J8VA 1M67A 2O1EA 4O83A 2XDQA 3I5MA 4LYJA 4RO0A 3I3OA 4G4GA 3WFJA 2Z5FA 3WP0A 1E69A 2GI4A 4CKCB 1L5LA 4C0KA 5FPSA 5EXEA 3TQCA 5IP9G 3W34A 2YVUA 3K8ZA 1OVMA 4XJTA 4R84A 3N6VA 1U4NA 1UQUA 1B33N 5J59A 1AKTA 1TA4A 3IJPA 4U8HA 2WSLA 4C6SA 3KJXA 2BFCB 4Q39A 4R5HA 1H9BA 3DV9A 4UFNA 4B80A 2C5FA 4NXNH 5DGDA 4GC7A 4F3CA 3JD4A 1IRIA 3DT9A 4GYYA 4F7WA 1DJPA 3HV0A 4Q24A 3K0EA 4LYAA 3WYGA 2HGWA 1S9FA 3O74A 4OCZA 3G23A 3RVLA 5ED0A 3FDXA 4DEYA 3BCSA 2WM8A 3GLSA 1RYEA 2ZTLA 4RABA 2JKYA 4UBOA 2Q2OA 3CUYA 1G4UR 3UB3A 1NFRA 3GLRA 4NU8X 1LI5A 1E2IA 2BN4A 3D6NB 3N05A 2EFCB 3WA6A 2NZWA 2IYTA 4B6RA 1F8XA 3PW5A 4O3PA 2DUNA 1B1CA 3GZNA 1YMQA 3OTGA 2AQ8A 4G89A 2XF2A 2JA6A 2PKYX 3QF4A 3BN3A 1CQIB 3SLKA 3BA1A 1K75A 4WDQA 3CC8A 4WRRA 4HYTA 3C6ZA 3FR7A 1RWXA 4MXDA 2P6MA 1XDGA 5KI6A 2EP7A 3PPIA 1MAHA 3TUJC 4JMLA 4UZSA 1XPJA 3HB5X 4FX2A 1JP7A 2AEJA 4AZTA 3GXOA 1WP4A 2Y2VA 1NYTA 5AW6A 2IHUA 4YJHA 1Z62A 3MFIA 2O0KA 3ZCQA 3K0FA 3LZ6A 2HK9A 1LVHA 4ACBA 4GM4A 5AI6A 2QRJA 4LQ4A 2B9EA 1A5SB 2JVKA 1BJTA 4Q1FA 4CE6A 3Q7SA 2IRWA 2QX7A 3WC4A 3M6FA 3WI7A 3D0RA 3MK31 4B6SA 5KKCA 2O2DA 1Q1ZA 1NQWA 1ZRHA 1A5AB 4NOLA 1CZOA 4D3FA 2J32A 2Y3IA 1DBIA 5IDVA 1DEAA 3ABQB 5FH9A 5JAIA 2F7SA 3L49A 5LB2A 3WWIA 4BEVA 4AY2A 2WJVA 3ADCA 2GCIA 5JCJA 4X1IA 2VDRB 3B1VA 5ESWA 2J3DA 3BCUA 2G82A 2W6CX 2C5HA 3OE7A 3L8GA 4A8JA 1V5WA 3UWMA 3PCXA 4OHMA 3TLXA 5DI3B 1J8DA 1C7JA 2QUHA 4U7GA 2OFFA 3GVXA 4DN6A 2IBTA 4JLOA 3LO5A 5I7VA 4BGIA 5FDFA 1IY0A 4R6XA 2M1ZA 2I8LA 5K3AA 3PNKA 2OCXA 4CM3A 3DCYA 4Z53A 5C8YF 2NTYC 3S8YA 2XQGA 2GQRA 1Z63A 2WKQA 1WSWA 3HJBA 4V0NA 1WUKS 3E48A 4F8YA 3DKRA 3S99A 4Y0AA 4NV1A 1SIWA 3OJWA 5AH0A 4G86A 3MCWA 2ATXA 1FW6A 5C1OA 1XI2A 2ZE7A 1WHTA 3WQQA 1DRJA 3HL0A 3BXGA 4K6GA 1XMQB 3MJTA 4OP1A 3KTDA 3WYBA 2QTLA 4QUKA 4QARA 2Z3ZA 1J5PA 1FVHA 2YOGA 4P3KA 5DRYA 4MRMB 1MIHA 3TBHA 1GSOA 2A7QA 2QTMA 4PFSA 5CW2A 3ZWAA 3UXHA 1Z4JA 2VJMB 4Q7JB 2VK2A 5E8JA 1MT3A 2ZIXA 1I01A 4QOJA 3M33A 3FMPB 5CNJA 3E9YA 2RBGA 1ZN9A 1LPBB 4NAUA 2NNWB 3HCEA 3RV4A 3AVPA 1K98A 2Q3LA 1TJPB 4KOEC 3FKIG 2BMWA 2ZTUA 4F5EA 1KL7A 3AETB 2O52A 3PDCA 4CMAA 3JATB 4HRYA 1N75A 1R4MB 1W0KA 4LV8B 3O21A 1B8UA 3F46A 8GPBA 4A3BG 4WA7A 4KXMA 1Y9ZA 3L7BA 1JG1A 4EF5A 1IHYA 2XYGA 4KQEA 5JVDA 4K9MA 4CI9A 1G21B 1T9HA 2C2MA 4P32A 4PG5A 3O2JA 2VJNA 3V4PB 3DB2A 3GT4A 2OENG 2C5SA 1M1NB 4MVJP 3LXRA 4J7AA 1BW9A 1VSUA 1L5ZA 2NO6A 2V7UA 2I3AA 2WTAA 1LTQA 4PBTA 4LYDA 2QTZA 1CJSA 4FGLA 2AD5A 4KODA 4BWSC 4WFJA 4TXHA 4DCPA 5LU8A 5BSWA 2IWRA 3K1AB 4DLSA 2XMGA 4U7PB 1Z6PA 1J0EA 5PGMA 4RAYA 4WGGA 4MVWA 4EYSA 1AH2A 2FPIB 4QJ4A 4F60A 2PUVA 4QHYA 1YRQA 1R66A 2G9QA 5DGBA 1KK3A 5TQ2B 4AKSA 4YUAA 1I3KA 3CZCA 4D4LA 3EA0A 1E20A 3GILA 2GN0A 1YFKA 2HGXA 1XC7A 4WZAB 3TL6A 1JR3E 1TZKA 3MT8A 3GTJA 3C7CB 3PLRA 4W1SA 4TGLA 1Z83A 5KJCA 3MTGA 2Z9DA 3UGTA 2WWVD 1E9BA 1DAPA 2J0EA 2J9FB 2RHHA 1PL7A 2UYHA 2BONA 5LOVF 4FDAA 1IY1A 2ODEA 1JPJA 1VYUA 3M1LA 2YZGA 4ARIA 1H8ED 1R5OA 4IWYA 5T8KC 1JIHA 2FUKA 4N65A 1X7ZB 2D3TA 4BEBA 3THWB 1OAKA 4S1OA 3QA9A 3MTBA 4RY0A 2DMRA 2ABWA 3U4GA 5GGYA 1QVRA 4FK8A 1NIPA 1YDEA 4N0EA 4YPVA 5DNEA 4ZJYA 4BBRG 2D5AA 3UPDA 5F7OA 3GBVA 3KG2A 3NALA 1NF8A 4OV6B 4XSVA 3X3HA 5K3CA 1QF9A 2IKSA 2W2NA 1E9VA 2H31A 3ESCA 1OI2A 3BK2A 2MSCB 4MQEB 1O87A 4KJZA 1M6VA 4WLNA 4WLOA 4HWSA 3HZRA 4WN9B 4BMVA 5BYBA 4YI5A 2PGIA 3DHVA 5JPDA 1ZCAA 3V2UA 3RT1A 2PHZA 5I7RA 4B6PA 1K88A 3TD2A 1NVGA 4UVIA 5I4BA 2D5LA 1CZUA 3WTCA 3D8NA 3U80A 4O3OA 2X2OA 4WOBA 5C81A 1RP7A 1ILEA 1KK2A 1I0LA 1K92A 3BIWA 2WHXA 1BEUB 2GPNA 4BC0A 4V3BA 3OQ1A 3VR5A 1Z3CA 2C2EA 1LH0A 4F4UA 2PX8A 2EF0A 4OHXA 5L6LB 4QOEA 4Y7CA 2XWBF 3PUKA 3E9ZA 3AEUA 3DS8A 4L9WA 2R8IA 3W7BA 2UUOA 4PWQA 4KKXB 4F91B 2VSYA 4BN0A 3RU7A 1I10A 3OT5A 2G08A 1GO2A 3FLAA 2IY9A 1NI3A 4N9QA 3UC5A 4MVCA 4OLHA 1X42A 1UDXA 5C44G 5DNYB 2I9PA 4KQJA 1QWOA 2YNMC 2IL1A 1WETA 3OLVA 1E6LA 1IPFA 2C9MA 2VP2A 1NBMD 4C4SA 2Z04A 4ER7A 4V03A 2RGDA 2BZGA 3P96A 3AM3A 3GHHA 5BNWA 2XUAA 4OQLA 4MDYA 2W6ZA 4OUKX 2B0JA 4ER6A 4COOA 1Q0RA 2FW1A 4YB8A 1I6KA 1ZWLA 4LJ9A 3V6LA 2NU7B 1VE9A 1AUPA 3TW6A 1VP3A 2PL9A 5E7IA 4RTNA 1T24A 1KI3A 4RZ3A 4C7VA 1R10A 3PR1A 1LD3A 4O7TA 4NSNA 4AULA 2E87A 4I55A 3HCDA 1QHYA 1RM4A 3JQAD 3M34A 3WRYC 1VKRA 1EB8A 3B7GA 4EECA 3OIWA 3E84A 4OGLA 1PV2A 1ZN7A 4JXUA 4IR9A 4UNRA 4EUSA 1EKFA 4U0KA 4FUQA 2BUAA 2DLDA 2XODA 1VYVA 1FTSA 1C0EA 3GMTA 4WXPA 2XQKA 4CM1A 1N6OA 4RZ2A 4DA7A 4WERA 1SUWA 3F1LA 2PRSA 3OWHA 3SKVA 1D7OA 5JBIA 5BUCA 2PLWA 3L18A 2KB0A 1XEAA 2X86A 4QXQA 1XFAA 4DV1B 3R7DA 4B2YA 4H7JA 3OT1A 4CDNA 3NC0C 3C6YA 5DXJA 1QZXA 1SBIA 1OXVA 1ZUHA 1QFMA 5DBFA 4QEZA 1E3WB 1FRNA 3L93A 3FYSA 3UT5B 1RKVA 4UFOA 1EBFA 4PC3A 2WDTA 2FZ4A 4RETA 2JNWA 4MK4A 1BVUA 1NYRA 2WHPA 2D1TA 2Q1UA 4GL4A 2AF3C 2B4AA 3GK3A 1VSBA 2VP3A 4HQNA 3VSBA 2I67A 3D6AA 1QNLA 5EWGA 3FUVA 2I4IA 3AB7A 5T14A 4JODA 4UNNA 2PIAA 5C9ZA 3FMOB 4IDQA 3V9PA 3AM1A 4JYAH 1HOXA 1D0IA 3B1JA 4YASA 3RUEA 2JH3A 4IR7A 3NWEA 1JQAA 1IJEA 2OB1A 3GLFA 3EXAA 4KNYA 4YQEA 1JJAA 5EE3A 1QAQA 1RI4A 3BMCA 4FB4A 4DR6H 1GUDA 1BQ3A 1RMTA 1SCBA 3HCPA 4IXMA 5BMOA 1VLLA 2B36A 5JYCA 1W1IA 1VLJA 4BNHA 1AZWA 4H6XA 4NMLA 2B99A 1X7GA 2WK1A 1I4LD 3C24A 2X2PA 1PT9A 4RK6A 3T5DA 3PW0A 3P8ZA 5JZ9A 1HZZA 1DE0A 3R7WB 3WLAA 1JA9A 3WL4A 4J3JA 3NRBA 1QBGA 5IHXA 4KGXA 1J8QA 1F0YA 1D1SA 1T0JB 4X95A 1ZJWA 3GAAA 3AH8A 3WK6A 5THQA 2QSJA 1QFXA 3VAYA 3S2UA 2Q5HA 1GUAA 4QXAA 4TKMA 4FM9A 3ZUPA 5G2OA 5TVKA 1CUIA 3TQ1A 2R8PA 4LSWA 1T1IA 4WEQA 1Q83A 2FEWB 5IVHA 3IOCA 4EA8A 1P6QA 2NVOA 3INGA 4P98A 4QT0A 3BX1A 3WK8A 1GZHB 3LPAA 2YU9A 4ARBA 1XYGA 4CKWA 2OWEA 4O4HB 4D3XA 1QK5A 5G0WA 2PFGA 1RCTE 3KSUA 2G80A 1P4JA 2RSLA 4LDQA 1QQ5A 3PUIA 3D7MA 3ANTA 3P9KA 3T35A 3RC8A 4TXNA 5IVIA 4YQWA 3NXSA 3R7SA 2I7DA 1ZVVA 3I83A 2Q3CA 1DIAA 4H7FA 1XP5A 3R5TA 4ZCLA 3E8SA 4OXIA 1MO6A 1CP2A 2W83A 1MORA 2WJAA 3GTLA 3OQIB 5AD1A 1S02A 4E30A 1NBHA 4PHGA 3MJ4A 5H7XA 2IX3A 2V0CA 5KQLA 2F43B 3BJEA 1KO5A 3WE7A 5JYEA 2WLTA 1WCYA 2B30A 1XNQH 1ZK4A 4Q1AA 5HKKD 3FCYA 1D6SA 1NTOA 5FHQA 4IUYA 1H0KA 4OBXA 1H93A 1BXRA 4D82A 1OX5A 3O2NA 3HDQA 5JFOA 4QNRA 1PNOA 3QKSA 4A15A 2YV3A 5JAHA 1HG1A 5CFMA 5KOIA 3UFXA 4NBSA 4XEUA 2YNMD 1J56A 3BA6A 1JHMA 3KDSE 1I4TD 5I60A 5F52A 4LGYA 2WIFA 2HG8A 1JNYA 4N5HX 5K8TA 3GAMA 3J7TA 2CUKA 4CHTA 3KPVA 1KFJB 3HCOA 1O9BA 1TQ4A 4JENA 4AJPA 4KFCA 2Q5OA 1C0PA 4WLVA 5CX4A 1XCBA 4INPA 5L51A 4FBMA 3NHFA 3GV8B 1U1EA 2QQEA 4PYRA 4M1KA 3DYIA 3K4PA 1RC0A 1V3TA 2HBQA 3RIZA 1TUBB 1TU4A 4V2UA 5C1BA 1Y4AE 3ZLJA 2QLMA 1NQAO 1MC5A 3FJ1A 3A28A 1QU3A 1XZFA 4X1YB 2PZMA 3QVMA 1JDVA 2FSGA 5JDIC 3RKUA 1V71A 3ORYA 3EZLA 2V9WA 2Q0QA 1VE5A 1IZ0A 2WWWA 3P9SA 1C7RA 4ZMSA 1ZAKA 3WSWA 1Q0TA 2AIRA 1SUEA 2B9VA 4P2BA 1TFRA 3J81A 3KHSA 4GXRA 5CM9C 5JADA 1M1UA 3ESXA 2MT9A 3S28A 3VNSA 4EI9A 2A30A 2QUBA 4UW9A 4ZYVA 2Q4OA 4LPSA 3HXQA 4ECUA 4PIVA 2IP1A 1BMQA 1TNDA 3DAYA 4JNCA 3K2QA 2HDNB 1EFPA 4CLEA 1NBEA 1ZIYA 1Q95A 4PINA 2VTKA 1JB1A 2BFMA 1YZUA 4FGUA 4Y1FA 2CLHB 2KQUA 3CNLA 2G1UA 5BNFA 3ZBPA 5HM6A 1CFZA 1GGFA 1VXOA 1OWTA 4F4JA 4EY8A 4B09A 5F4BA 5FFFA 4AG5A 3ZGZA 4YRKA 2DKFA 4K9SA 4OQQA 3PHHA 1C9YA 2PG3A 3JZIA 4HQ0A 1KS9A 4KBYA 1JEJA 4DV7H 3EXIA 2OAP1 4B6GA 4MRSA 1FYXA 2VH2A 5KOJA 3WS7A 3H1EA 3LCMA 2HF2A 4L0QA 3PC3A 5AR1A 2R79A 4N0DA 2VJYA 4JLNA 3LZCA 3NO4A 3N7AA 3QEOA 1UK9A 1GPYA 4G5SA 1MMFB 2JVIA 5KINB 1SHJA 3BA8A 3QWIA 4MUYA 3FIJA 4L76A 4K2AA 1OH5A 1N32B 4HEJA 1OVGA 2QN2A 2A67A 3MJCA 3A27A 3KJFA 3K0CA 4OYLA 2O03A 2CHVA 4Z8XA 1P3DA 5I7EA 2VHCA 1QCDA 2FI1A 4KH0A 3UHPA 3KC2A 5LQSA 4UJ3A 3ZDEA 3MVEA 4RZXA 1N5OX 4FGJA 8ABPA 2QRQA 2GEVA 4JI8H 4XLZA 1QO0D 1O97C 2JLZA 3STWA 1KC7A 3LKBA 4TTJA 3RABA 2PRZA 4HDAA 4RPIA 4IYRA 2ZAYA 1KJ8A 1MJNA 3B6EA 4LI0A 4PQEA 4YUYA 1GUYA 3TMKA 4NBTA 4XOIA 2ALJA 2NTNA 1P3Y1 4D0SA 3B85A 2HT6A 4MGKR 2OBLA 1T13A 3MWYW 4DLAA 2WVGA 2PV0A 5GONA 2SBTA 2VPIA 1S8NA 3GAZA 1J42A 4MO2A 2ZUBA 4YCMA 4QM7A 4GSLA 3V8BA 2R62A 3RRJA 3DXZA 2JIRA 3DMPA 3ZC3A 1R0WA 2F6RA 2JI9A 3KSDO 4UHBA 2ZBRA 1R6XA 4DANA 1PFVA 1HFWA 4ITRC 3P0EA 4X63A 1DIRA 4YO8A 4OBEA 4B3RH 4I1SA 2FVXA 4FB5A 1J8YF 1XLTC 5H4GA 5KFUA 1PL6A 3HBFA 2Q50A 2W6IA 3BIXA 1KRHA 5ARCA 3WRXC 1FC0A 3KB2A 1QP0A 4X20A 1RAEA 1Z2AA 3HHPA 4NC9A 2P5TB 5TQ0B 1DC6A 5HIAA 1CULC 4KSCA 3N0VA 3NB0A 4OHWA 2VDLB 2WU3A 2Z6AA 4PLPA 1YRBA 2VUTA 3UGQA 1Z6QA 5BSRA 2WUEA 4E1VA 1GCGA 1GQFA 5AVTA 2SKDA 1N56A 4M7PA 2GZSA 1ZO8A 1T4CA 1DOHA 1W87A 4NECA 1WCIA 2HSDA 3C16C 1PW7A 2B4YA 2Q2UA 1TVCA 1FL9A 2D1RA 1YB1A 5JXJA 5AJWA 3PR3A 3GNLA 1SBHA 1J70A 4G4IA 4PAMA 1YDGA 2JLBA 4M7RA 4JBHA 4DJEC 2JEOA 4QWMA 4FS8A 2R7NA 3MBIA 3C7AA 3CX4A 4U3JA 5H16A 1J7JA 1KAGA 2DB3A 2J85A 2WAQE 3PKIA 4YJ3A 3GTKA 2H7CA