4MA5A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
365
structure length
363
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with an ATP analog, AMP-PNP.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
total genus 115
structure length 363
sequence length 365
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma5A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma5A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma5A01
2VQDA 4HNVA 3WNZA 3R5HA 2Z02A 1KBLA 3Q2OA 5CA1F 2XD4A 1IOVA 5CA0F 1GSHA 3K5IA 2NU9B 4MV9A 3N6RA 1B6RA 2W6OA 3OUZA 4QSHA 4EA9A 1KJJA 3VPCA 4ZI7F 4XZ3B 3QFFA 1UC8A 2R86A 2IP4A 2FPIB 2I80A 2CNQA 2FB9A 4MV4A 2DZDA 3VOTA 4MA0A 4ME6A 2DLNA 4MV3A 4L1KA 3UFXB 3U54A 1EYZA 3WO0A 4XX0B 3Q1KA 5EZYF 3ETHA 5LOVF 2WYOA 5JQGF 3TQTA 4YB8B 2GPSA 4M98A 4YBZB 3VPBA 2FPPB 4EGJA 3HO8A 3MWEA 4ZHQF 3RV4A 2YW2A 4Y8VB 1M6VA 3V4SA 4O86A 4DLKA 5FNVF 3U9SA 2YWVA 3BSWA 4FFOA 3HB9A 2GQSA 4E4TA 1KC7A 5C8YF 1Z2PX 2J9GA 4MV1A 3LP8A 3R5FA 4IWYA 1KJ9A 5LA6F 5GONF 4MV6A 4MA5A 2R85A 4YJ3F 3R5XA 3KALA 2YS6A 5C1OA 5JQWA 2QF7A 1CE8A 2GPWA 4FE2A 2ZDQA 1EUDB 1DIKA 4ZOLF 2VHEA 4FGRA 4EA8A 2GLTA 5BPHA 4MV7A 5JH7F 3DF7A 1JLLB 3SE7A 4EG0A 5C1PA 2CQYA 4O82A 3VPDA 1GLVA 1IOWA 2V59A 4M9UA 3VA7A 5CAEB 4O7LA 4O84A 3TINA 5J2TF 1OBGA 4HNUA 2NU8B 3JZFA 5JVDF 2HGSA 1AUVA 2NPOA 1PK8A 4WBNF 3K3PA 4FFRA 4FFMA 1CS0A 1GSOA 4YJ2F 4TV9F 2V5AA 1C30A 2NU7B 2W70A 2YYAA 4I4TF 4DIMA 1M0WA 1KJIA 3BSSA 3JZIA 4C5CA 1JKJB 2YZNA 4O7YA 4EAAA 4O83A 3NUAA 4WD3A 3ORRA 1BXRA 2P0AA 2X0SA 2NUAB 4O4JF 3N8DA 2V58A 3KAJA 3LWBA 1UC9A 2Z04A 3MWDA 4O7VA 5LXTF 4O4HF 5K2MA 4O2AF 2NU6B 2C00A 4M9CA 2YRXA 4YAJB 3ETJA 3G8CA 2R7MA 3BSYA 3GIDA 1JDEA 2W6QA 4C5AA 2FPGB 3U9TA 2YL2A 2W6NA 1I7LA 1T36A 1AUXA 1A9XA 2W6MA 5BMVF 2SCUB 4O7RA 4FFLA 3U55A 2I87A 2PN1A 3RFCA 2R84A 4RZQA 1KEEA 3VMMA 2GQRA 1B6SA 4YAKB 4M99A 5HBRB 1ULZA 3AW8A 2PVPA 4MAMA 4O4LF 4TUYF 1KJ8A 4NYEA 5KKNB 1VBHA 1Z2OX 5D8DA 5LYJF 2YZMA 2R6FA 4EABA 4GGMX 1W93A 1VKZA 4J6EA 3JRWA 1Z2NX 4O81A 1A48A 1CQJB 3TIIA 1E4EB 4IHJF 2R7KA 1M0TA 4HNTA 2ZDHA 2DWCA 3MJFA 4TV8F 1GGOA 2DIKA 5CB4F 2CNUA 3WO1A 1CQIB 4MV8A 2YRWA 1I7NA 4FFNA 5KX5F 5LP6F 2R7NA 5I47A 3GLKA 3BFPA 3R23A 5J2UF 2HJWA 4O7ZA 3V4ZA 2R7LA 2YZLA 3OUUA 2OLSA 2CZGA 1WR2A 1OBDA 2YS7A 2XCLA 5IYZF 3BG5A 1EHIA 1KUTA 2R87A 3R9RA 2VPQA 4O7TA 3KREA 2FP4B 4FFPA 3AX6A 1KJQA 2W71A 4I50F 2W6PA 3G8DA 3ORQA 2I8CA 4EA7A 3K5HA 2PBZA 1EUCB 3RV3A 5JVLA 1JDBB 2ZDGA 4FU0A 1C3OA 4I55F 5DMXA 2W6ZA 2R82A 4O7NA 3RUPA 5H80A 3TIGA 1DV1A 2VR1A 1PX2A 3TW6A 1EZ1A 4ZQIA 3KAKA 4O7WA 4IZOA 4C5BA 4O7SA 4EGQA 4O4IF 4IWXA 1BNCA 4HQ6A 2YZGA 4HR7A 2QK4A 2CNVA 4XYMB 1SCUB 5HV6A 5BPFA 4XYLB 4O2BF 1E4EA 3E5NA 3JRXA 1VBGA 3HBLA 4IIJF 3I12A 1DV2A 1W96A 1GSAA
chains in the Genus database with same CATH superfamily
2IP1A 3V1UA 2PX6A 1RWBA 2H2HA 4NH4A 4NRDA 4OQYA 2ZJAA 2A9KA 3HFJA 2H16A 2ZGIA 2Q3CA 5ICMA 2X9LA 3PC2A 2CSXA 3HJHA 4OO3A 1HDIA 3RIMA 4KV9A 4B45A 4MINA 4E1AA 1GXSB 5GGXA 1E0DA 4GI2A 3HL4A 1DKLA 4MRMA 3VAAA 2FW8A 1S2MA 2G1KA 3SD7A 1OWTA 1SHKA 2Y1KA 2ZCUA 2NAFA 3PFIA 2H65A 2VJCA 2ID8A 2X5JO 2XDQA 3BB4A 2R8JA 3KQPA 1C80A 3OTQA 4PSDA 4YAOA 3K92A 2UYCA 5LZ8A 2B6NA 1FVXA 2BDEA 1KR2A 4JR0A 4GMKA 3ZQ6A 1WXQA 3O82A 3IIEA 3CUEF 3BIJA 3QGMA 3UF0A 1YXMA 4UMVA 5DHPA 3SBXA 2FEPA 5DGHA 1K3FA 3D0QA 3FCCA 3QF7A 3KK0A 5DN6A 1O97D 3ZI4A 4MKXA 2DBQA 3OFNA 3QY0A 3ZW8A 4QXPA 1EP2B 1LKZA 1HQDA 1UINA 1Y9AA 2IY8A 1FF9A 2P68A 1OR8A 3AIKA 3GJ3A 2QG6A 3K1TA 2FZ4A 4A23A 1JDVA 1U9JA 2X2FA 3EQ2A 3LRXA 1RYRA 4MW7A 4BLWA 1ULSA 1JWLA 5CMLA 3CXUA 2GEVA 2WZDA 3CZMA 3RS3A 2ZRDA 1APBA 3I37X 1QKJA 2VN8A 1MJHA 4PEVA 1QMPA 1Y8RB 1ZEMA 3ENNA 1T43A 1I80A 3KEGA 3JYQA 4MCHA 4TS4A 1Z4QA 4YMIA 5E1DA 3CF4A 2FPIB 3IUNA 1LPAB 2AQ8A 1JEQA 3EOAI 3P0HA 3GU3A 1GGNA 3KUUA 4BDSA 2V9ZA 2AG0A 2FOLA 5TV2A 3FUXA 2H48A 5SICE 1JHAA 2A59A 1FYXA 4ME6A 4I9FA 4EHLA 3BMCB 2AKAB 4UOZA 1J23A 5IP7G 4ZYZA 2Y4RA 1JFRA 2Q3FA 4HZUA 3R7NA 4CI9A 4PAOA 3OMXA 5FORA 1V6CA 5FI1B 3NORA 3WO0A 2CKDA 4LQ4A 5C4MA 4RNOA 1O94A 3U5ZB 4IIHA 5A7FA 4R2JA 1RQNA 4KP7A 4TMVA 3WB9A 1H5QA 3ELYA 5SV2A 2XB8A 1OXMA 2YWBA 1QG4A 3K0BA 1G38A 4KR7A 2ZJOA 1F2VA 3PQDA 4G56A 4OX9H 1CY8A 3EGEA 1ECPA 3HUUA 4D5GA 1RPNA 3E27A 3DWGA 2BMJA 1VJCA 4MYTA 1NJ5A 1JPNA 1RMYA 4ENWA 5KMGA 3C1UA 1AUOA 2F4VH 1EH5A 3HUTA 4TV8B 2XZDA 4ZMRA 4RDXA 3IV9A 4FYIA 1G42A 1OH6A 4PAMA 3OPMA 1M6VA 3T54A 3HC7A 4MR9A 1THZA 4TTVA 2QT1A 3S28A 2GEBA 2I6TA 5EHQA 2Q2UA 1WUKS 2JCVA 2C4TA 1XZIA 4NJMA 3DG9A 3SQDA 4XM2A 1LQTA 2IJGX 1MN6A 3KQQA 3LX6A 1VKNA 2G7ZA 3IB3A 2IFTA 4HZIA 4M0EA 4HC4A 4BUCA 1J99A 2UYHA 1PR6A 3EIQA 4EBDA 2IYNA 1QOPB 3KZKA 1C9JA 1LK0A 3N53A 3TRHA 3K70B 1MA3A 3HTXA 3PZBA 4P53A 3ZYZA 3ZHTA 1TNDA 4ER6A 1XVAA 2IV7A 1KBZA 4IWYA 2YOGA 3VBCA 1RIIA 1RE1A 1XA4A 2FSHA 2JI9A 3NVDA 4R1PA 3LWZA 2XUPA 1XJCA 3PW7A 2R1VB 1EDBA 2M6KA 4M1KA 1D03A 3QFRA 2RIRA 4CQLB 1JR4A 3CLUC 3G5MA 4BEBA 3BL6A 1I2MA 1N7HA 1XZBA 2G0NA 1QS0B 3WGLA 2VF5X 1L5RA 1YDFA 4OHWA 2D7DA 2PX8A 3LSTA 2VZ8A 4UXHA 1AGXA 1KO4A 3LPDA 1NVTA 4JOBA 4FX5A 2PJRA 3OEEA 4OAQA 2ZB3A 2W0MA 1SUAA 3CRVA 3FBWA 3OQVA 1UXOA 2C59A 2ZFUA 4A0FA 3NGMA 2HLNA 5KFZA 1RJ9A 1FLVA 1Z0DA 1WZCA 3O8QA 5DGAA 5CGQB 4B47A 2ZTMA 5ALMA 2QB5A 4QNRA 4L2IB 3QW2A 3RARA 3GQBA 3CNNA 3TZBA 4FHEA 3SWWA 3GDWA 3CX7A 1XHEA 4HX9A 2AMFA 3LOPA 1T94A 1GUAA 3WMEA 2JA7A 3GN2A 1SC4A 2HG8A 3EG9B 5KFAA 3FNHA 5KNDH 2VK4A 4WN9B 3JD2A 3NBQA 2H29A 4OQNA 5FWDA 4NARA 4OEHA 5EJAA 4FBMA 2MIIA 5IN5A 5TPZA 5TQJA 1EXDA 1NJ6A 1K1EA 2DFDA 3WDKA 4P31A 2YJZA 4F92B 2WPDD 4YRNA 2AR7A 4O82A 5JEDA 1WY7A 1F6BA 1GLVA 5EMKA 2AJCA 1E4FT 1VSBA 4RS4A 5J59A 4PQYA 3UC9A 2E1PA 1E1KA 1O6GA 2X5KO 3K8YA 5CIWA 1L4EA 3EFBA 3H2GA 5DVZA 1H2YA 3Q1LA 1THGA 4DV2B 1V35A 4NR0A 4M83A 1Q15A 5A3SA 2WIAA 2QZ9A 4KAJA 1TPYA 1SAYA 4KBYA 4FXOA 4KIGA 2DBZA 4C6TA 4EMTA 2YHAA 4EVIA 2AW5A 1QHHB 1P4SA 2NU8B 1ZL0A 2P2SA 2X4LA 4G0ZA 4P33A 3ZY6A 3JD0A 2C94A 4WMLA 3P2EA 4Y2QA 4EFLA 3LW8A 3ELBA 4KQHA 1XTSA 2FW0A 2RMKA 4Y9DA 2FK1A 4YJ2F 3P2MA 5FPKA 2KSWA 3DAYA 1KY4A 4R1OA 3DOJA 3GCDA 4N5IX 2GO1A 3COYA 3L40A 3NLLA 4TYPA 3SYKA 1B7GO 1YQUA 4NCKA 1QFYA 4A3JG 1ONOA 4XCXA 5ALEA 1IN6A 2QI9F 3NFRA 1HE5A 1P33A 2PKEA 4BU0A 2FHPA 5K0NA 3BMQB 3KL2A 3MCWA 2AUMA 2H07A 2PKYX 3JZIA 1MO5A 1QYWA 2WNHA 1RLTA 1L4LA 5IYZA 4X6UA 1C5KA 2F6RA 2JI8A 3H86A 4QWMA 5GVRA 1G7TA 4LTNA 5I9NA 3PEWA 5DMHA 4R69A 1FTSA 2ZI5A 4U02A 2R8HA 4CM4B 2I3BA 3LPCA 3C6BA 1HORA 4RMHA 2EF0A 4P22A 3V1TC 1SBHA 2QM7A 3HRKA 4U2CA 2Q8PA 3NASA 1XTUA 3HVUA 1C0IA 1B8PA 1P4AA 4KPFC 3JWPA 3THXA 2W6JD 3FGPA 5I5SA 1YRAA 3ABOB 3M6XA 3R4VA 5DULA 1FNCA 2HIMA 2Z9DA 4JVOA 4QBFA 2YV4A 3MR6A 4TYQA 5DKFA 4DM3A 1N3IA 1U0JA 1QZXA 3KEQA 4BGIA 1PFKA 1AS0A 4GS5A 5KTMA 3AERA 2O59A 3T3GA 2F3SA 1H5NA 1PGOA 2JAQA 3H2BA 4AF6A 3QBJA 2QMUA 4LRTB 3UMYA 1KU6A 2COKA 4L8VA 3R7SA 3H11A 3BYZA 3UYYA 5SZJA 4EOGA 2NZYA 3I2HA 3C5EA 3IA2A 1T9BA 3USCS 4Q4LA 5KVCA 3L0SA 1UDCA 4OQQA 1ZMXA 4LNAA 1FMJA 2I4NA 2AXQA 1LBTA 2HXGA 3ETJA 4IDBA 1GQFA 2C5AA 4FS1A 5JMOA 4GC5A 2E5LB 2WUWE 5I5UA 5DX8A 4XFDA 4BQQA 1R3DA 4C5AA 2ONJA 4FLMA 3VGPA 1HA3A 1JHVA 1X9GA 3GB8B 2ARKA 3LRPA 3TLEA 1WZEA 2OBBA 4LRSB 4JJKA 4IDHA 3JYHA 2FMUA 1ZCZA 2BM9A 4OSOA 3UTCA 5JNTA 1WUTA 2BCGY 2QRPA 3KV1A 2WJZB 2FUNB 2QMHA 4HDRA 2Y1GA 1XP8A 5LM3A 4IZIA 1Q74A 2XCIA 1QF7A 4F4XA 1EFHA 3OQBA 2BFDA 2HHJA 1RWMA 3K2QA 3HKZE 4PYQA 3VR1A 5CLGA 2PSFA 1M6EX 3N43B 1KDPA 2H92A 5T14A 2O6HA 3IT0A 4XEUA 1CT9A 1WIWA 3UFXA 4D9CA 2IBTA 3IEVA 4PINA 3NETA 3QMVA 2CHQA 4IIGA 3UXMA 2YIMA 5KFXA 1RS0A 1PT6A 2BZSA 1EVIA 2PV0A 4YJFB 3NGXA 3ZUPA 5F35A 4C6HA 2AGPA 5ALPA 3M9LA 1OXBB 3PW2A 3B7GA 3DYBA 4MQFA 3K96A 2VSYA 2QSUA 5KFRA 1JJBA 4ZZ2A 3LULA 4FB4A 4UU7A 5CX1B 3KT0A 3H6KA 1G2QA 2O2GA 2CYAA 1SUCA 3RAQA 3QH4A 1EEXB 4NZNA 3ESRA 3MBOA 5JXWA 3GRUA 3KU1A 3I9MA 4TN1A 2JA6G 2Q7DA 1ZW6A 3T1HH 3DKRA 3CT4A 3GUZA 3H1BA 3KYBA 2CYBA 1R6VA 3NBZC 4LISA 3GHYA 4Q1EA 5TEWA 5IS2A 1U9IA 1VG8A 2UVDA 3MWKA 3N2GA 3JVDA 3QKWA 4GG1A 4IHJF 2XKAA 2JAXA 1SQSA 2JKVA 4NCXA 3GEBA 5EEGA 1ZH2A 2F00A 4YECA 1LI4A 1O08A 5FP0A 3TUZC 2HIXA 3EVAA 2WVAA 2CFCA 4I6EA 3ZZ0A 3TLAA 1O03A 3OQPA 3STYA 5HZHA 2WLSA 3HFRA 5L7WA 4M38A 2COUA 2MSDB 1Y7TA 4LY9A 1GGKA 1J8QA 3VVBA 3ILVA 4QQRA 3I5MA 1KI6B 1PQPA 3OIGA 4JNKA 4UE2A 2WNIA 2PZMA 2YZKA 2ZYVX 3HGMA 3MWEB 1JSZA 3BGIA 4RM2A 3U17A 1Z4MA 2GS9A 2WF7A 4V39A 3M5DA 3ZE1B 2RHBA 3PFKA 2XDYA 3STUA 1X77A 2YXPX 3FDXA 1X1EA 3A1FA 3NWPA 3ZWPA 3D6AA 2ONKA 1PJBA 3DZDA 4KIUA 4QHYA 1YB5A 5J2UF 1L1EA 3UAGA 1K06A 4TVKA 1HY3A 3HZZA 1QZ3A 4QM6A 4Z7QB 1EJ2A 1TQHA 4N40A 4UTXA 4RA9A 4ZYXA 3C5HA 5ITVA 5JECA 4EK9A 1CY2A 4QDJA 5KJEA 5C1DA 2ZUBA 3D59A 3QBTA 2I8AA 2WYIA 2F3TA 4J91A 2OPHA 3ED5A 4QARA 3D2BA 3ZIAD 2C20A 3PITA 1QUFA 2VK8A 5CX1A 5FBQB 4NTZA 3RSCA 2BMEA 3C3BA 3L0YA 3LT4A 3N2KA 4HYYA 2A9VA 2OORA 3PXEA 4CM7A 4C0HA 4XQ0A 1WBBA 1P1RA 1XRSB 5LXTA 1O77A 3LVFO 2G63A 4ZAVA 3PFCA 1M2KA 2YS7A 5KVQA 2W7OA 4UNNA 2J6UA 1IXSB 2OWDA 4CMFA 4WKPA 4C7JA 3LT5A 4RU1A 5B3JA 4CTNA 2AF3C 4E12A 4CQLA 1SEVA 1MFPA 1KQOA 4BBZA 5IYCG 3PC4A 4MVWA 3W34A 5FLMG 3IQDB 4L22A 3DTVA 1GITA 4HNQA 3NHZA 4BZPA 2A57A 1P4RA 2Q4RA 4J0EA 5EHGA 4AVYA 3HP1A 4J94A 4BX9A 3KXPA 1Y6QA 4KN8A 4G5HA 3FZQA 3VRHA 1XDZA 1N1GA 2ODTX 1W25A 3RVOA 2A4MA 4I50F 5G1PA 4UVGA 3VDMA 4S35A 2ZSJA 1TUIA 1QFMA 2OV3A 3KWJA 2YVAA 3TRKA 1SQ6A 4BVLA 4G63A 4W5NA 1VS0A 3RC7A 3EC2A 1UBCA 1IDOA 4BVJA 3J7AC 1UCFA 1YQDA 3OBIA 3MMSA 1GPDG 1MG5A 1FYVA 3PNYA 4ZV7A 2D2FA 3VO9A 3JWIA 1K8YB 1N32H 1XEXA 1UMCA 2QYTA 2CL7X 3KHKA 5F33A 4IKOA 1XTPA 3UWOA 3UPDA 1VRCA 3DOCA 2O19A 4QTUB 1L7RA 3FOBA 5K0ZA 4JQYA 4R7TA 3W6ZA 2CEAA 3KNZA 2DR3A 1S2NA 1UH5A 1UXKA 1T91A 1NI4B 4E2XA 2R5WA 2ZANA 3JARA 4IR1A 1Z39A 4JL6A 2HBQA 1MX1A 5IXYA 5IJXA 1HNNA 1OGYA 1R0LA 2H4JA 2ET6A 2PFSA 3A6HA 3AR5A 2G0TA 3CISA 1HDCA 4KH1A 3INYA 2DFNA 4PWYA 4S3MA 2IXTA 4CFYA 3T1YH 3H3JA 1Z4LA 3TIGA 1AZTA 2CDAA 4YONB 4D4MA 1GILA 3N2KB 4UREA 4RK0A 2YXBA 3C4QA 1BAPA 2E2HA 1O58A 4TL8A 1RPAA 3E7PA 2I65A 3KAPA 5DN9A 1X1CA 3TLGB 4ZCMA 5BR8B 1HNXB 1BC5A 2EFHB 3LA6A 9LDBA 1EZ1A 1IY1A 2G9VA 4ZV9A 5D85A 1Y4AE 2PMEA 4PGMA 6NULA 1G60A 2WMDA 4IQ4A 1VYVA 4LRYA 2BFNA 5CXSA 4C6TB 3WAJA 2W2TA 3OU2A 1UK9A 4Y1RB 5DBHX 3KXKA 3TOVA 4EECA 1YKSA 4NU5A 1R8SA 3OQIB 1KMCA 1LTKA 2FPWA 2GHRA 4V0MA 1WF6A 3TLCA 5IWAB 3M9WA 3T1NA 4DNQA 3KQNA 4N0MA 5K0EA 3WICA 3WHLA 2BKEA 3KC2A 2R2AA 3RM3A 3VYVA 3ZTYA 5CDYA 1ORWA 1XVIA 5KFKA 5I51A 3HDJA 4U9HS 4EGQA 3DMYA 4J9NA 4JB3A 5ED0A 2VYQA 4UMDA 1H93A 1P8JA 3LUDA 4OQPA 3G9QA 1K6EA 1HWYA 3IP3A 4RPIA 4DLLA 1O94D 1YQGA 2ZBEA 1YS7A 1DZ3A 4YCDA 1JKIA 2MR6A 3LNCA 4TRJA 1PZXA 3RVQA 2FKLA 3WIBA 3T9BA 4OKNA 4PFKA 2G9NA 1BMFA 1JYEA 1LSJA 2VYCA 3KLBA 1G7RA 1VYHA 3GH1A 3EULA 4OMFG 2EBWA 5GM2A 1GPMA 4BMYA 3S81A 3VPXA 1B0ZA 1PEAA 4HEA6 2VRCD 1RJPA 1FFGA 5HV6A 3FJ1A 5A04A 5DEOA 3PE6A 1LPOA 2E4AA 4H7FA 4BCBA 3EPIA 3VOAA 5E6UA 1F51E 3L7JA 4NEGA 1G8HA 2C2GA 2IHBA 1Y8CA 2JEFA 1O7JA 1QLJA 1WD5A 4M9RA 2JGIA 1AKRA 2JZOA 5LDHA 2ZZMA 5BWXA 1TIKA 5HK9A 1W5AA 2HD4A 1ZONA 2DUJA 4DGQA 2R79A 2ZU6A 4RD3A 4M0JA 3UBTA 1PQUA 1Z17A 3IBTA 4C3VA 3OA2A 3QUCA 2J9RA 1Q0SA 3FPSA 2Z02A 1BA2A 1UT8A 5AOBA 3OLXA 2XKKA 5M5BA 1HLPA 1OREA 1SBQA 3Q2OA 4PG4A 4RAZA 5KQPA 3TZ6A 3U3OA 2Y99A 4IH4A 1TT5A 1GL3A 1I2DA 4WI1A 4HLQB 1TXGA 2AZMA 1CQXA 5KT6A 2IY7A 4IXMA 2Q1YA 2XRYA 4IUBS 4RD0A 1DOHA 4W5QA 4AL4A 5CRIA 3H8JA 4NXNB 4M89A 4Z86A 5ABPA 1KZ6A 2VNIA 1DXQA 3GO4A 3M5PA 4BXOB 3A3YA 3Q0IA 5K3FB 3C6MA 3ZS9A 5J4YA 2C77A 1AKEA 2EZ9A 2XGJA 4ER7A 4HGPA 2ZYAA 5FI0B 2HSWA 4AYWA 2FN7A 5BWCA 3NJ8A 3QI2A 1M33A 4BKMA 1A27A 4B81A 1C7QA 1CRLA 2ZJ0A 4GNRA 1VXOA 4QZVA 1DDIA 1N9GA 2J3IA 4QU9A 3SF0A 3HFGA 1UEJA 2PBFA 3IQWA 1N0VC 5KSOA 4KE6A 4URVR 1FDVA 4UOEA 3A2NA 3BEOA 1W5FA 3ZGVA 1EKXA 4S12A 2R96A 3MHPA 4IWNA 2VNJA 3L6UA 3R0JA 1FKAH 1U2DC 1RQRA 1Z3IX 1AQIA 1UDXA 2BBOA 2VZEA 4J0FA 4N5NA 4ADSG 4IH9A 1CG6A 1FTGA 2R9VA 4FFBA 1MT0A 1W9HA 5JDCA 1XRRA 1NR5A 2WUVA 4XI9A 1LUAA 2DULA 4KR0A 2OOKA 5FDFA 4A6XA 5K3EA 4PSKA 2O50A 3G68A 3FFWA 4MUJA 3CLHA 4C43A 5IHPA 2H85A 4CC5A 1EJ0A 4RJJA 5BYBA 1V8FA 4MV3A 2Q0HA 5HYVA 2M6LA 3TI9A 4Y0AA 4JBIA 3B89A 2WSIA 3V8QA 3IP1A 2V0NA 4RJ2A 1PP4A 5DH9A 5EP3A 2QN3A 3ENQA 2IS2A 4IHJB 3BGOS 3D2CA 3EGDB 3O0TA 2YFYA 1TM7E 4OFBA 4TRRA 1MQ8B 2Y1CA 3DHNA 3GGOA 1JIIA 1XZPA 1C7IA 5IM4A 3FMGA 4D4IA 5FOSA 1SFRA 3LPMA 3WVNA 2R4QA 2XNHA 3GRZA 2A9OA 4ZEOA 1JJVA 3VPBA 5EINA 3ZD7A 1E58A 5LDGA 3HO8A 3F6SA 3JYOA 2C2KA 3A9UA 1MQ9A 3AINA 5FLYA 1QBGA 3VO1A 3PC8C 1RWKA 4QPDA 1VG9B 4CG3A 4CIYA 1WR8A 2Z3WA 4Y8VB 4U5XA 2VBFA 2FK2A 5LUBA 2DHQA 4ZP1A 5K3BA 1R7RA 4E7OA 4EO7A 3KJIA 5IFLA 3OFVA 2PKWA 3A6FA 1J2RA 1PGPA 3N05A 1ZHQA 5FPPA 4CU5A 2D7JA 4RB2C 3L8GA 2A67A 2VCEA 2ZBGA 3DHYA 3DZIA 2PPVA 1L4YA 3C0KA 5DHQA 1XL0A 3WJ2A 4N5HX 1Z2PX 1W19A 2IT1A 4E4YA 4HAVA 3H20A 4UQPA 1T8WA 3CUYA 2NOAA 3LECA 1EFCA 3L7DA 4QIHA 3TDMA 2YWDA 2XODA 3I1JA 3UAYA 5AJXA 1ECCA 3GBPA 2YY7A 5JCOA 1BKDR 1C9NA 1YJCA 4JP1A 4U2DA 4X93A 3SC6A 3F1LA 3TL6A 4BVBA 4EHAA 2G1UA 4YCLA 5CNKA 4GBMA 1A9QA 4YJ3F 1MT3A 1X1AA 2B1RA 2C54A 1XDWA 3NT4A 1TQ6A 1TA9A 3U6BA 3QMMA 1KDVA 2BGJA 1QDEA 1AA6A 1MO3A 2XGOA 1FRZA 2BGLA 4M8IA 4OSPA 2PYIA 3LX8A 1GQRA 3VU0A 2WB2A 1QZZA 5L45A 1MAUA 3IFSA 1O8CA 1YRBA 2VYFA 3TFOA 5DXAA 4FOOA 1BKYA 4LJ6A 1YR9A 4JP5A 4TLDA 4PTLA 3KQHA 4R9SA 3M9OB 1OBFO 2WV7A 3F3YA 3ABSB 4NESA 1YGPA 3MZ0A 2BTEA 3NHUA 2COEA 4R05A 1PJ8A 5BPHA 4F3KA 4HEJA 5EPOA 2GT1A 2A58A 4PXAA 5HIJA 4DXHA 3GJZA 1N3YA 1PR1A 4LRXA 5ALYA 3G8YA 3KCNA 3FRJA 3I0NA 1JR6A 1P7YA 3O1JC 3NW9A 1DIOB 4KXNA 1D5WA 3I0MA 5AJZA 1T8YA 1BTOA 2CHEA 1ZCBA 2XMCA 3QXSA 4IS2A 2FN8A 4JLMA 4KOAA 4LTDA 4L50A 3JQCA 3RQSA 5D7BA 4UEJA 1YDHA 4RKFA 2QX8A 1G63A 2X9QA 3QUSA 1VCIA 5FJJA 3W8NA 3CZ5A 4A91A 4FE3A 5E2BA 1LY1A 4DWOA 4OQZA 1NNLA 3LBAA 2G9QA 3EAQA 3GZNB 4Y9UA 2I6QA 3T3MB 1VB5A 1ZD8A 2BH9A 1NI4A 3W90A 1EB9A 1PT7A 2BMWA 2W2XA 1PFYA 3HDGA 2LIVA 3PR4A 5HF6A 3BRWD 4DV5H 2O4UX 3HFSA 1JT9A 1W48A 3DFMA 3V2UA 3F3SA 5LP6B 3E1KA 2RKWA 3FPLA 3NC1C 3FWPA 1WCMA 1VC2A 2VJKA 1Q22A 1KYWA 1RM3A 5JRDS 1AKTA 3U7IA 3VNUA 2QN9A 3PE4A 1JXQA 3TQFA 4NMXB 4S2EA 5HJ5A 4J0JA 5CM9C 2IPMA 3TCXB 3EEQA 1CHDA 3RAJA 3JD3A 1RXYA 3GIQA 1ZD5A 1QVVA 3AUSA 1FUYB 4R2IA 3PC7A 1PU2A 3NP9A 2Z5LA 5G4LA 3SICE 4D80A 1M0WA 4AN4A 3M4YA 4CCAA 3BSSA 3G0DA 1O5IA 4HV4A 1ZVVA 3DLTA 4R6WA 3QOWA 3WYNA 5BXQC 7ABPA 1Y3AA 3SG0A 1ODFA 1JUDA 2Q27A 1KDYA 3BE8A 4Z1OA 2FEAA 4J75A 2FR8C 5K0BA 1MVOA 2O3JA 1QH8A 1HG1A 2QJWA 3BMNA 4B1FA 3FHLA 4GF5A 2XMPA 1ZR4A 4QUIA 2A5JA 5EWLB 5AUQA 5HBRA 3LOUA 1XCGB 5HM8A 3L46A 1PG0A 1T1GA 2QIPA 1GPUA 2IIVA 1L5OA 2FRDC 3GEHA 2V7BA 3D7SA 3IHWA 4K6MA 4MICA 3TQIA 1TEVA 3QE9Y 4OATA 4O4HF 2H1IA 4F9GA 1KSFX 1PJLA 3B1KA 2GLXA 2QD3A 1HI9A 1LB1B 2YRFA 2FWNA 2GCIA 3IEIA 4OHPA 2XMSA 3HN2A 1N2CE 3A4NA 5HCNA 5IASA 3RB4A 1TUEA 4Q9JA 3QEMA 1W4BA 1X15A 4XOUA 4A3LG 4O29A 3O1IC 1UPAA 1PT8A 4X66H 1HQKA 5COQA 2HMSA 1PNVA 3FVRA 3I2IA 4X1IA 1KQPA 4ZT6A 3W5UA 4EQ6A 4LOKA 4ECRA 4CIBA 3I1IA 1R0WA 4E6NA 4BLUA 3QHAA 4YXFA 4DL7A 3B6IA 3DFKA 1RAEA 2HWUA 2K2QB 3JALA 2BFAA 2ZWPA 3NH6A 3SYLA 1K4YA 1O6FA 1UKYA 3DBLA 2HPHA 4FR5A 4URXR 2GPJA 2MDTA 3DEYX 3DDWA 4EF4A 2QJRA 5K05A 1K2VN 1YB4A 4XH9B 2N42A 2LGJA 4UEQA 2H51A 2P6NA 2R8RA 2D06A 3F4LA 4R2LA 3SXJA 3T35A 1RZRA 2F2TA 4XLZA 1WMDA 4X7PA 3QX3A 2QGZA 4JWTA 1GIAA 1KFEB 3NUQA 3JZAA 3U4IA 4PHTA 3R77A 2BFEB 2C78A 4W4TA 4WACA 1UL1X 1K5DA 4FGZA 3IPLA 1E2JA 1C1DB 4YY3H 3QZ8A 2FW7A 3V9PA 3TB4A 3DV2A 2HHAA 2C4KA 2XOXA 1R6XA 3AVOA 3V00A 2Q3JA 2UUPA 4I4CA 4L28A 3UMMA 4QLAA 1CRZA 1VKRA 2YICA 4LHVA 4LOJA 2WHEA 1BCRB 3IP6A 3T7CA 1XCLA 1O57A 2XUAA 1SVKA 2KM1A 5AK6A 4EHDA 3REOA 3U80A 4GVXA 2GFIA 2JJ8A 2W2PA 5FD5A 3PVZA 3S1AB 1N8NA 4ZU1X 1IJFA 4J4TA 1E5DA 1M8JA 2C61A 2V5VA 4QFBA 5TPWB 5TVGA 2ZUVA 2RK4A 3DOIA 3ZLUA 2D1RA 4O2AA 2IS4A 4R40A 4C2UA 2BBSA 4G0XA 4V0NA 3FLAA 1QV6A 3GFGA 1O97C 4BTVA 4N01A 4JOQA 1VKZA 4D9NA 3TR5A 3ZC3A 5BVGA 5KQLA 4JI7H 1GA4A 3P2IA 4ICIA 3M0EA 3UGKA 1UKCA 1G6Q1 4CKCB 4IG9A 5BSUA 2P30A 4HWTA 4C78A 2XCRB 3R3UA 4WE3A 5D01A 5B2ZA 3PFNA 4KXQA 4NG4A 4DAOA 3ZXXA 1YUMA 4XSHA 3FF1A 4RV4A 4DUPA 5I8PA 1XMQB 2ZT5A 2P2LA 3C74A 3RYIA 3T7TA 1LBIA 5FBZA 1V8ZA 2ZB7A 2PMKA 3IT2A 4IFEA 2PR7A 4N65A 1HKUA 4QHSA 3IUPA 3HR4A 3MJFA 1P4GA 5IKEA 2HZBA 5IN4A 3GLHA 5ES4B 1WSAA 1IVYA 4WUVA 4XA8A 4N76A 3EZXA 3TI7A 2C2WA 3WO1A 1AK2A 1IB0A 1L1QA 4JLOA 2JK1A 2LD4A 2RI0A 3DWEX 4E22A 3DBOB 2LZ0A 4LE0A 5DB4A 3BX1A 1IPHA 3P96A 4W99A 5AVKA 4BO1A 1SBCA 3UM9A 4JASB 2UZ4A 4R0VA 5FI3A 1A2BA 1XMOH 3ANNA 3W2IA 1B0AA 2IXAA 1G64A 2HEIA 4KTVE 1YR6A 3QHQA 4RW0A 3WMWA 2OO7A 2QRUA 1XVUA 5IAJA 4DJJA 4INJA 1V39A 3MR5A 4MV5A 4MI3A 5GONA 2O8EB 1YRLA 2JLQA 2ZUSA 2R97A 3LQYA 1TI7A 4LK2A 1XD8A 1K7FB 2QLNA 1AUQA 9LDTA 5HZKA 4BFVA 4RUCA 2G8NA 4DT1A 4G5SA 1LBSA 4PO3X 2VZ9A 1CS0B 4RVFA 1X3LA 3CYFA 1CSEE 1TCVA 1N57A 3V8RA 4IV5A 4HMOA 2Y1EA 4M76B 1X7XB 3O75A 4EB3A 5BO5A 1Q50A 2QBYB 2NVUB 1U2PA 1Z28A 3I53A 3PS9A 3FAZA 2H9YA 4Q18A 5FPTA 4BWGA 4XQGA 5LLDA 4E31A 1HRKA 4QOIA 1GSIA 5DTEA 5JNSA 1ZMOA 5AI0A 3V4FA 1GTVA 3VR6H 5HKKD 5INTA 3A04A 2C4MA 2JJYA 4LC9A 5TLSA 3UK6A 2XCAA 1JQKA 1U0NA 2BKUA 4LXGA 1QZUA 1Z38A 1I6MA 1OYYA 1X9HA 4Y2HA 1JIQA 4DC9A 3E7FA 3RFUA 1Y7IA 5EXTA 3IAUA 1RHKA 2I6UA 4WY5A 4B6JA 3KREA 4KRYA 1TZKA 2FP4B 1E0JA 1XDNA 3A2MA 4TXJA 3ZQKA 3DDUA 3WFJA 5EJ8A 2OFXA 4XXHA 3EEOA 2VEDA 3WLHA 4BB9A 4Q6WA 1TKCA 1XD9A 4GMFA 4R5MA 3H2IA 4JBGA 5TXGA 1I2BA 4JLKA 2IOYA 3EXHC 1ZI8A 1Z62A 3O73A 4RSRA 4RK5A 4OAOA 2NVUA 5KINB 3F7MA 2XYVA 2G9RA 2OCIA 5IBCA 2JIQA 3B1WA 2BGWA 2P4UA 4EHBA 5HNKA 1VGQA 5JXHA 2I2CA 4B32A 1SURA 4GPD1 4GPTA 4HWKA 5CNIA 4PHCA 2XIGA 5EKUA 2Q46A 2O8EA 2BCEA 1NVKA 5TDHA 3SGLA 5JO0A 2Z3ZA 4Z1MA 1T34A 1XRJA 3QPAA 4IAOA 3U13A 1URPA 2ZIEA 2ODPA 4YAJA 4BJ5A 3FJOA 4R71A 3ZGLA 3L1KA 4KX5A 5JALA 4JU8A 2HHHH 3ZQJA 1HXHA 2ZK7A 4C4YA 1PBNA 5D5QA 1HT2E 4FFWA 3F5FA 4OM8A 2CFIA 4DV3H 2ONYA 4JCCA 2HI0A 3WHKA 4EGAA 3T0GA 4OBEA 1H2WA 1Z68A 3QJ5A 3DZHA 4YJGA 3UGQA 4W5JA 4X20B 3VSCA 1Q92A 1T8RA 1SQGA 1E9BA 1DP4A 4TMTA 4LF6H 1DBWA 1DIHA 1T5TA 2Z09A 3EYWA 3HCBA 2VPXA 2PGAA 2WTBA 3HU1A 4ND2A 4Y2YA 3R7DA 4B6FA 3HCDA 4V1CI 1II9A 1M7HA 4EPVA 3VJRA 2C88A 1XHLA 3EQ6A 2OGTA 3PX7A 3QW4B 3OWXA 3H9JA 4FDLA 3AONB 3MIZA 4OMUA 3RI3A 3RU9A 1F5NA 4RPHA 1UFVA 1VI2A 3RK0A 3U44A 5A0VA 3VTFA 4G37A 1QNLA 1TMKA 4OMCA 4E5UA 1N7JA 1WJGA 2NG1A 4YBZA 4BBJA 1XMVA 2KPOA 5E6RA 4DFDA 5I45A 5CIQA 5AR1A 2WWGA 1Y9JA 1RR6A 2F1OA 3OJEA 3WZMA 2H08A 4F4HA 2Q5QA 1J00A 1XTVA 5LWQA 2R68A 4GQAA 2NVXA 1HTBA 2Q6IA 5IDVA 1EXMA 4MQEB 1N6KA 2IZ0A 4UVDA 4O4IF 1FUKA 4EL0A 5L8VA 4RHEA 3T1HB 4C04A 3E7WA 1ZXLA 4PDBA 1QHEA 4I4NA 1IQ0A 2OFPA 4OGGA 3ZY3A 4HR7A 2JFQA 3D8TA 3G2JA 5K1ZA 3FKIG 1VA4A 2IQIA 3G1TA 1MTOA 1W30A 3S40A 2BUBA 5FUXA 1N2SA 1NXQA 1U8CB 2AWNA 4Z0NA 4L78A 1TU4A 1EFPB 1U8TA 4JA2A 4JB8A 1GPJA 3QEBZ 1QVWA 4LWZA 4UZSA 4M88A 5DZSA 1J5XA 3MVEA 1A9RA 4JXXA 1EKVA 3KHHA 2H2FA 3FTDA 3X1YA 3O8DA 4A8JB 1AQLA 1R0CA 4Z9XA 4AMUA 1KH2A 1V11B 3HB5X 1H05A 3FHTA 3JRXA 1U7WA 1UEXC 4YCSA 2CFMA 1HL7A 2CLCX 2YX1A 1P7WA 3FB1A 1J49A 4BS9A 4DJAA 2PNFA 2DQKA 2W2OA 3RHSA 1IBLH 1XXHE 5KQRA 4C4PA 5I4CA 4LOHA 3G2KA 2H4FA 4BNWA 3BXHA 1QP4A 5CCEA 3JQDA 1O87A 2R4UA 2QG9A 1C2YA 1E3JA 2GRJA 5FWXA 4U39A 1JWAB 3PXBA 5CA1F 4QPNA 3VU9B 1PGNA 4TTPA 1B8VA 1ZD1A 2QRVB 3DOUA 2PXAA 5HK8A 4O59O 3FX2A 2Y1FA 3E9MA 2XD4A 2OD2A 4JGIA 4ZVNA 4EITA 1SVIA 3K32A 2GBLA 3KG2A 3OURA 4L8FA 2YVUA 1RJRA 5D6OA 3ZK9A 1WETA 1DU4A 1SR8A 4JJ7A 1M0SA 3C0FB 2H6EA 2I6FA 1TA0A 1ZXBA 5DLYA 1U6IA 2QMYA 3BWMA 1XL1A 1I94B 2O8CB 4ETIA 3QVLA 2VHYA 2V1UA 5KG5A 1QP7A 2QX4A 3N6VA 1XXHB 2B94A 2NU6A 3D4IA 4UTNA 4G1EB 4US1R 3RKUA 2W6OA 2Z2JA 2O8FB 1WHTB 1GGEA 4M9ZA 3O7MA 3DMTA 2JAWA 3WK7A 1DBPA 1RM5A 4KMOA 1KSHA 1G9TA 3D7LA 4H77A 4GR5A 3MRVA 4GR4A 5AKLA 2XBLA 3IB6A 2FCRA 4OB7A 2WD8A 4TLCA 4IQGA 4F4CA 1H3EA 2HBYA 3LO8A 3AEUA 3L5OA 3H5VA 4ZI7F 4BNLA 3E6AA 1WXDA 3COVA 1PNTA 3M8KA 3EIXA 4C87A 1TRHA 5IZCC 5DIZA 1I33A 4ED6A 4JK3A 4FYWA 4GOMD 4UVHA 1R6BX 3GP8A 2WG2A 4O4LB 3E8MA 4PCLA 3RU7A 4BKOA 1L7EA 1XKXA 2VOBA 4F4DA 2D2VA 2GDZA 2WIJA 2ZRCA 3AHEA 3HRHA 1ECGA 1KMIY 5C35A 2NXWA 2HN9A 1P3DA 2IEDA 4H16A 2PDAA 4KXVA 5H3LA 3IOEA 2G1PA 5JAQA 4R5HA 1DHTA 1G16A 1N9KA 1GUZA 1Q7CA 2CMHA 2JIRA 2EQBA 5L9XA 1ZGCA 2JIMA 2M1ZA 2YVQA 3FPBA 3UUGA 2WKQA 4L1KA 4IGEA 4DW8A 5JD3A 1Y1WG 1ZAYA 3NM5A 4WV3A 4N7MA 1R5JA 4A5SA 1B15A 4I2NA 1UBGA 5LOVF 2P5SA 1IBRA 4KG7A 1ZGGA 2EFEB 3GRYA 3MLAA 4NHOA 3LOQA 3VV3A 4AROA 3PW0A 3ZE6A 1ZUWA 5CBPA 4FSHA 1B26A 1N5RA 5A05A 1LJ8A 2E55A 2VAPA 3HVKA 3KQYA 4F8YA 5GIOE 1L4GA 4WCDA 3AT1A 1KRHA 3SLGA 1S4MA 3CLUD 1A2OA 1Z13A 5L1IA 3LDFA 4FOLA 5AJUA 4RMJA 4ATNA 2O2HA 2VT7A 2ZI4A 3LCJA 3ZGYA 5CHEA 2Y0CA 4PV7A 1Y89A 3VDNB 5FOQA 1E59A 3PR3A 4WZ6A 5LZ9A 4WN9A 1AF4A 4TS9A 4TN5A 1GZ6A 2FRXA 3VHXB 4DRXB 5D3MB 4XARA 2DB3A 2FRDA 1XFAA 1NVDA 2IS1A 4OM7A 2P5TB 3FDSA 3O4HA 1FUIA 2CT8A 3X1WA 3D9QX 3BCRA 3HCEA 3PNBA 4DUGD 3FM9A 3V1KA 3S2ZA 4L7VA 3C6XA 2ZUDA 3A6EA 4MRNA 1NDUA 3LZCA 4A0RA 4CUZA 3W06A 3GLIB 1FA9A 3NPMA 5LQSA 1JFVA 3NIWA 1LQUA 1Z7YA 4A3BG 2JLRA 3PQ3A 4Z2YA 5KOHA 4BO9A 3RC2A 1UMDB 4XPIA 3VZRA 1NSFA 2VQ3A 3EY4A 1U5BB 5L9AA 3VKHA 1VI5A 1DKMA 2O2SA 2QXUA 3VMFA 4IR9A 1G8YA 1C50A 1YZYA 6REQA 3WLQA 4RVHA 4MGHA 1PSWA 4RSHA 4WL0A 3DTNA 1DCFA 1KC1A 2AQKA 2F64A 3FFXA 3KYJB 1RKBA 4GO1A 4Q4JB 1KQNA 3VKVA 3B6EA 3ZGOA 1F06A 4C0QC 3MAGA 4CEHA 1BQEA 1N5MA 4MHSA 4PLCA 4R2WA 4EA8A 2XKBA 3OO1A 2HYIC 2V0GA 1I4EB 3G13A 4BVAA 3V6HA 3TTSA 4TZ0A 4R0MA 2HQRA 1F2UA 1K7YA 2KJQA 5JTUA 3VR5H 1YFZA 2HO4A 4IG4A 5HE8A 2AVDA 3MSXA 4B33A 1DWOA 2L0XA 4YUZA 3ELDA 2CBGA 3B1YA 1BHQ1 4PANA 4IOMA 5IC5A 1UIRA 2Y0DA 4KYVA 2X0EA 5C1PA 4B74A 2HL6A 3O9ZA 3AI3A 2XB4A 4BWFB 1YKGA 3U6KA 1Y6GA 2OBXA 5E9QA 1EFTA 2CLSA 1NMXA 2PKRA 4L27A 2DP4E 3W5AA 1FL9A 5J40A 1J5PA 1K5HA 4NI5A 4F4FA 1ILEA 5C1IA 3ADDA 3N74A 1I30A 1ZU4A 4G8CA 4LG1A 4J2TA 1XEWY 3KSUA 1L4MA 4O8ZA 5E8JA 1PYGA 4DCCA 1CFZA 3E3OA 5EJ6A 2NQ8A 4MW4A 5DF1A 5JCXA 5JADA 3RR5A 4EB6B 5IZCA 2CE2X 3HBNA 3M2PA 3NR2A 3ONVA 3IN5A 1WXXA 2E48A 4IDOA 3FTNA 3IBFA 4OHKA 5CAEB 3JZ6A 3KYCA 4KLAA 4UFOA 4W7IA 3M1AA 1BA3A 4HUJA 2ZVQX 2H4XA 3WNDA 5IH3A 4BJ1A 4COKA 1OBGA 1Y5IA 2ZIXB 1Y8ZA 1PKEA 2XB9A 1ZKDA 1NOJA 1YHYA 2YYZA 2QUIA 3FTCA 3Q8WA 4UHEA 1L7DA 5DU2A 4S1WA 2HGSA 1U2GA 2Q5LA 4UU0A 1N1EA 4YS6A 1DNPA 2GQ0A 3MXOA 1C0PA 1TGVA 1KKLA 2CLIB 2IYUA 3N8GA 3QWIA 4KO8A 4AZ3A 5KPDA 1GVNB 2ZB8A 1E5XA 2NZUG 2QRGA 3Q8PB 1GO3E 1K27A 1XF1A 2GKGA 1TDJA 2M32A 3M6UA 3QFCA 5IW8A 1M34B 2Q49A 1IBSA 1UBHS 2Z58A 4TYYA 2QUJA 3GXOA 4QWEA 2FE1A 3MJ4A 3WV4A 1VCMA 3SFZA 1FVIA 2ZSFA 3R3HA 4RTNA 1KJIA 4Q43A 4JYMA 1PNQA 3TWOA 5J2UA 3N76A 9GPBA 1ZQ9A 2IKSA 5ICEA 2VSFA 1FP4A 5ERGB 4HSGA 3FHJA 1KYVA 4XVHA 4O7YA 1L9XA 4NZYA 1RMQA 2WHPA 4BU1A 3FOEC 3Q5GA 5T5QA 4AY3A 3W1BA 2K7ZA 1RU3A 1JKFA 5TQ2A 1OYWA 3UB2A 3TQRA 4C4AA 2HDNB 3OHMA 4D3XA 4ZMBA 2AMJA 5JCOC 1RLJA 5AXCA 5F5XA 3WJAA 1RBZA 3ECCA 3PXCX 4JMLA 4ODIA 1DFGA 5CITA 2EFDB 3DEAA 2HYDA 4W5WA 3NMUF 4EL5A 2V58A 1CWUA 4EY3A 2OCKA 3EXEA 5LA6B 4F6RB 4IPTA 3GJXB 4FYMA 5DBIA 3TD6A 1P6XA 4BBRG 2BFBB 4RC9A 3TPZA 4YP1A 4LDPA 3W9SA 5HIIA 3NIGB 4AF7A 4D0SA 2DM6A 3BD8A 1D9ZA 1PFGA 3LKZA 3I76A 1QE0A 4L02A 4D9FA 5FF9A 4W82A 5BMVA 2I67A 2YHSA 3GCZA 3LPNA 3PO2G 3RBDA 1WX1A 1YI0A 3KU4A 3O0DA 4IVNA 2HFKA 5F1KA 4YV0A 5T7BA 1ODJA 1J33A 4WERA 2EW1A 4J9PA 4F6CA 4AG5A 4G25A 1KARA 2OK7A 1T26A 2XRMA 2YNMC 3PT5A 4RTSA 1SZPA 1TM2A 4KWIA 5KVAA 3DV9A 3JPWA 5ALJA 3AHJA 3TLBA 4O08A 1SOAA 4OHFA 1U7TA 1XQ1A 2Z2KA 3QI7A 4UMFA 5D3QA 3EVNA 1A9TA 1FYEA 5BNFA 4A73A 4G0UA 2IXGA 2G8LA 5KG1A 2O2XA 1WXIA 2Q2WA 1J8YF 1C4KA 1D6SA 4X8LA 2VH2A 5K45A 1S89A 3GP5A 2BFBA 1VHQA 4TVOA 4EY6A 3E22A 3P9SA 4AQYH 1BHO1 1YHZA 5ECWA 3ZHCA 1GV0A 3M6FA 4DLUA 3E5RA 2QU7A 1XTIA 4OXIA 1XLVA 4Z8XA 3TTXA 4A2PA 3M6AA 1E9DA 5AKXA 3KDPA 1TYCA 2BFCA 2EATA 2IXEA 3F8WA 3IP9A 5DGIA 5I7RA 4Z7NB 5AVUA 3AW8A 1S8NA 1OCEA 3N2GB 5JROA 2WYWA 1Y4ZA 3QV1A 1S6YA 2PQ0A 2BP7B 4F96A 4FZVA 1K3UB 1CRQA 2ZGVA 5HF8A 2I7TA 1CQZA 4WASA 5KTRA 2XUJA 2HPZA 4X61A 3I8OA 1BX3A 2GK4A 2EQAA 2HNKA 1BGXT 2HMAA 2GK7A 1NVXQ 1AS2A 3EC7A 5DTRA 3W4IA 1IN1A 3NCTA 2JKYA 3U4MA 1QGUB 5KC8A 1U2RA 2IYXA 5C44G 1TMOA 1AD2A 1TIPA 4DCNA 1SQFA 3QU5A 3FKSA 1JQEA 1JFSA 3TQOA 1B1AA 3JR3A 1CR6A 4CMDA 2AHOA 1UDRA 2Z57A 1UJ5A 1P0IA 2DPLA 1JHXA 3HJCA 3HUFA 3OG9A 2J0UA 5JSYA 5ESWA 4B2LA 2DKOA 4MDYA 1ID8A 2P91A 5BR1A 3WLNA 3EPLA 3AUTA 1XX6A 3BMOA 3GFSA 4UD2A 1BE1A 4DQUA 4NXMH 1L3CA 3P9QA 1KY2A 3T95A 4YMGA 2JEIA 2GERA 1Y7HA 3GYBA 2BRUC 2VZLA 1H0RA 4ALIA 4YUWA 4V3BA 1NN0A 1RI4A 1V0JA 2ZYGA 4Y1GA 5A4DA 3GLFB 2M6SA 1C30B 4TSKA 1YZHA 3UAZA 5D2CA 3PNSA 1QFZA 1SEPA 4S1PA 1VDMA 4JI6H 1Z3CA 3AB7A 4RFSB 5DSXA 3SS7X 5F23A 4JODA 2RBGA 3A3OA 5LC1A 4BWYA 1CQIB 4MV8A 2G88A 2YRWA 3NATA 4X24A 2YMMA 1HYBA 4KVZA 1HDOA 3T9FA 1WRVA 4WVLA 5I47A 1G291 1H2RS 1PTJC 1QDUA 4A1FA 1E0AA 1GG8A 3KJQA 1MEJA 1M2GA 1SVWA 2B69A 3BQ0A 2V6IA 2YQZA 4WK6A 1UMCB 2AFIB 3QP9A 3Q3VA 3HM2A 3OIFA 2GN9A 3W5JA 3PPIA 1L6IA 5F2OA 4BLVA 2QZPA 3I28A 1UXIA 3DTYA 4O7ZA 1ZOOA 3GLRA 4I3HA 1T0BA 3KTDA 3L43A 3V4ZA 3HCCA 2I7XA 3MOGA 4JVSB 4P38A 1TYZA 4B85A 2R8BA 2OM2A 3A6GA 2E4ZA 3M1IA 3O4RA 4J1SA 2X0FA 1JFLA 1E63A 1Z18A 3E9YA 1CF2O 1A1VA 4B3IA 3G5AA 4HDOB 2C1XA 4K86A 5AXAA 1TZMA 1MW9X 2EZ8A 5JARA 3P0IA 5GINE 1FPQA 1G7SA 3CRZA 5H82A 3VHRA 2RGDA 5IWAH 2WWRA 3DAFA 2JLCA 2F1JA 4AO8A 1N5DA 1NUTA 2RHDA 4D82A 3WIEA 4AG3A 4JUIA 3KHSA 2HRDA 1ENPA 3PUYA 3H9CA 2XV1A 2VAVA 4IV0A 4KBFA 3IODA 4MVJH 4ZO6A 3ZBPA 1UJBA 2YNMD 4U2KA 3ZZTA 1Z6TA 3TW0A 3AXTA 1U5BA 1J2EA 2WIKA 4KSYA 1JA1A 4BEWA 4C2TA 2MYUA 1NI5A 5A6SA 8ABPA 3OTWA 4V38A 4YQEA 5K5EA 3NBUA 1ISRA 1HDEA 1Z82A 1O6BA 2GYYA 2XC9A 4JEUA 4NFLA 1BDMA 3G8DA 1Y5RA 1ESNA 4FNAA 1JJFA 4JVNA 4WXYB 4XEHA 3LY5A 3R3JA 4DMRA 2V97A 4U3JA 3PSAA 4C22A 2RHJA 3D3NA 5EE3A 2AZDA 1YRYE 3H5AA 4P5EA 1K08A 4L4YA 3A0RB 3AR9A 3CE9A 1AKYA 1H2EA 4DBVO 2JEZA 1JDBB 3ZWQA 1XK5A 3VNQA 1IATA 1NKVA 2XY4A 2OYCA 3H4IA 2G67A 2ON6A 3QELA 4OGLA 2I99A 3ENWA 2XVZA 2Y1XA 3CNOA 3B1XA 3MR2A 4X1OA 3CY6A 1ESZA 2WHRA 3LC2O 4YQZA 4FKMA 3BHIA 4GBJA 2NV6A 5A6SB 4S2UA 1JYSA 1RZVA 3W5VA 4LXTA 7REQB 2XXAA 3HOWG 1BS9A 1CY6A 3ZEAA 1E2LA 2RGWA 2D2IA 3ZLBA 3IAHA 4NZMA 2J5QA 3HCRA 1ULHA 3VNAA 2FFQA 1P9LA 1OI7A 3D6HA 4KR3A 1FXUA 2RGCA 4YYZA 4BNZA 5CFZA 3BGSA 1QQBA 1KPIA 1P17A 3TW6A 2JNWA 5CCXA 4EPYA 2B9EA 4IW3B 2MMGA 4HVTA 3FIUA 3AWDA 3WK9A 4DJTA 3HOUG 3OZUA 3K4HA 3ER8A 5BWUA 5HFNA 1FQOA 5EZYA 4D9KA 1SXIA 3Q6IA 1WHSB 3QIAA 3P20A 3EMVA 3OZTA 2WSYB 4JLAA 4KO4S 1NBHA 1TKAA 2VAMA 4F4ZA 4KIWA 4KNVA 3GJ7A 3OJCA 2P8SA 5C7YA 3AVUA 5T57A 2AG1A 3O9MA 3CIOA 3Q3GE 3ESYA 3RBXA 5FV4A 4DANA 1DBVO 4C5BA 1JQ3A 1BH2A 1U98A 4UCWA 1R16A 2QRZA 3ZDRA 3R8FA 3I4CA 3PU6A 2H7YA 2QTHA 3OIDA 3RS9A 2IHNA 1FFDA 3SQMA 3QBDA 2P9FA 1ZGAA 2O7QA 4KODA 4X9XA 2PRZA 4B09A 8GPBA 1HTWA 2OZPA 3H18A 3D3JA 4K3UA 2HQOA 2C2ZA 5IYZB 2G17A 3MWYW 3KDSE 1FXSA 3JWJA 3D6JA 4CLEA 2XT9A 5A06A 1UMDA 2IYQA 4XPIB 3ASUA 3FWZA 3SJAA 1KO1A 3A31A 3LKBA 5EZYB 4JBYA 4O1IA 4KMMA 4L6CA 4AS3A 2DX7A 2DHRA 2ZYWX 4HQLA 1SCUB 5I5XA 2CJWB 2FK7A 2OG2A 2RGGA 2RKOA 3FOAA 1BQ3A 3O8OA 1DUVG 4FCWA 5EWEA 4M1YA 1JIJA 4WN3A 4XYLB 2H3HA 3VPSA 2REQA 1W4RA 1W75A 1Q11A 3NTUA 4L51A 1A8QA 1PG2A 2G0AA 1VCOA 2JGDA 3ACBA 3JQBC 3MS2A 3ZDDA 3I12A 4IM7A 5SYNA 3C5WP 3JPYA 2VUGA 5CE8A 4PF1A 4NBUA 2GH1A 4JLJA 3AI7A 1PNOA 1PJ4A 3UG6A 4N12A 5IJ0B 3NM4A 4GSLA 5LBUA 3BE4A 1ZAUA 4OH7A 3T1YB 2B98A 3IAS1 3OOJA 2DPGA 5LP6C 5BSEA 1O96B 2M2IA 3AL0C 2O8DA 1ICIA 4LWPA 4Y7DA 4ESEA 3EDYA 4MP8A 1NZFA 3KQUA 3CF2A 4MKGA 3NHRA 4TUYB 4QG3A 4NKRA 1D4ZA 4YC7A 5I9TA 3TNLA 1JWBB 4AKHA 2IPOA 5BW4A 2XT0A 4ZXPA 1G8MA 3OICA 4FSDA 3DZBA 2IZOA 1EVYA 4D8VA 1LV8A 3AUFA 3N41B 1XCMA 1KFKB 1VPTA 4XB2A 3SIXA 5DI3A 1ABBA 4WZAA 3WBFA 2GI4A 1B6RA 2C2EA 1FU8A 3TE7A 2ODNA 4CLDA 1IFXA 2FAXA 1T9ZA 2LDXA 3I61A 2VRNA 4DY4A 3SZGA 5DNVA 2R6AA 3T34A 3E22B 4IX9A 2Y0PA 4OQMA 2A0XA 3LA8A 3C41J 4GPEA 4TL6A 3Q7RA 1E9VA 1K88A 2BM0A 4RS3A 1CQJA 1KKUA 2WF8A 3A28A 4CWAA 5LQMA 3K0KA 1YASA 2ZJ1A 3S7ZA 5JBIA 1IHXA 1NVUQ 3KJNA 3TRFA 3W6UA 4D02A 1OGIA 4QRDA 5HKAA 2ASVA 3SEZA 2CJYA 1G41A 5KBYA 4NCNA 3H17A 3WWJA 1GG2A 2JHPA 3AETB 4L5JA 4NYJQ 4MUEA 2JGFA 3THWA 1WVIA 4OI0A 1Z34A 3ROPA 8AT1A 4EW3A 4MI1A 2CNQA 1W5EA 1MB2A 3D8BA 4FMDB 3L9WA 4PPQA 4EKEA 3ON5A 2I62A 2IYOA 3CR8A 2GCOA 4OXXA 1P0MA 2P8JA 3QBVA 1ISJA 2D2EA 2JHFA 5HE9A 5K4HA 3PHGA 2OYRA 5FV7A 4J76A 4TXMA 1RQPA 3USES 2NP7A 2B3TA 3W8EA 4BFWA 1KFJB 1OFVA 1NOIA 5EZYF 1ZUIA 3IMGA 3MJSA 5JY6A 4CXMA 4G36A 4XKJA 3TLZA 4KLNA 1NJGA 2E5FA 4I36A 3TRJA 3QLUA 3JQ9A 1PAUA 3WOHA 1ZOPA 3VKGA 1IHYA 4PZLA 3M6VA 2G04A 1QCZA 3WL7A 1K63A 3Q9LA 4FWIB 4XWTA 3HLKA 4RVDA 2FFAA 3OLVA 4PSUA 1CZOA 1J70A 2Q5JA 4OVKA 5JASA 4GMGA 1YRWA 1ZGBA 2YWVA 4R7RA 3Q8KA 2PS9A 1RXWA 1XLTC 2DUUA 1Y1KE 3QA9A 1VL2A 3N7AA 4OK5A 4OHOA 1SCIA 2PT9A 2R00A 4UBMA 1G8AA 4DCUA 1WNFA 5KT7A 4MWTA 1LDEA 1KK3A 2KW5A 2X58A 5F5NA 1F0NA 1SXJB 3B78A 1YB2A 1MO6A 1U28A 3KR2A 3HB4X 4C07A 1XDUA 3MB5A 5JR3A 4B4UA 2RH8A 1H4TA 1IHDA 3URMA 3IAM6 3MD9A 1B6GA 1QIJA 4REOA 4ZD6A 4C7OB 4IRXA 2AN3A 2YWHA 3CLTC 4FS3A 4MA5A 2IE0A 4GDMA 3BCHA 4K40A 3H9BA 3ILHA 4P3PA 3WYCA 4B7ZA 5BN5A 2NM0A 4PSCA 3SX2A 1ZJ5A 2E6UX 4RL6A 3ROGA 4KPGA 4DIUA 2OHXA 1XVVA 3P9ZA 3RGZA 3TECE 1U8ZA 4C1NA 3P9KA 2QD4A 2NUPA 3P9RA 3AUKA 5DWVA 4RF3A 2A84A 3TY8A 1NFRA 1TAHA 2HMTA 2IDMA 5DASA 4BLRA 4EI8A 5AW3A 5KT2A 1GU7A 2E4UA 4EW1A 4YDQA 3HN7A 3O4JA 4O3PA 2XVYA 2PD6A 4KDCA 3O8CA 1YQ9A 4LDNA 1RKXA 4CG2A 1X0XA 3H5IA 1TQ2A 4QYTA 1N8TA 1T8UA 2W8BA 3KB2A 4B44A 2XRZA 5A02A 1NW7A 4AT1A 3LTNC 1VYUA 2BP7A 3KWLA 2Q7XA 3HCNA 2BHRA 3FPGA 1BE8A 1ZQ1A 3B6ZA 4JYAB 4Z4EA 1T2VA 2GAAA 1T0JB 3LAWA 3N0XA 5JH7F 1R5BA 1TKBA 3NBYB 4YAEA 2ZUWA 1SHUX 2FVXA 3TXYA 1JDTA 4U0KA 4J9SA 3M89A 1EDZA 4YTEA 3K16A 4U7FA 3L4KA 4KLZA 3CW9A 5KUTA 2W93A 1T29A 1K3TA 4LQCA 5KAPA 1RYNA 1XKTA 3FNIA 3PYXA 2X9VA 4YREA 5C51B 3W5DA 2HM7A 3BXGA 1P7PA 2WVGA 2NADA 3OPXA 2NO1A 4DV1H 1RXCA 2EBUA 2G80A 3BM5A 3WLOA 5LU9A 2WAXA 1MDBA 4IZ6A 1H6CA 3EXFB 3LCVB 4TMWA 4BC1A 3ZHUA 2J0EA 3H65A 3QX8A 1N1MA 4YUAA 4N03A 3L41A 3GD7A 4PC3A 1J7KA 1LJUA 1DIBA 4CI0B 4EG4A 4XIJA 1P5JA 1KOFA 3WGYA 5A3RA 4Q44A 3HI4A 1BD3A 4D92A 3ONDA 1KO5A 1SMKA 5B2EA 2WTEA 3I6YA 3ME5A 4CKCA 1R0KA 1HLDA 2JFNA 1D9XA 3EPJA 1E2FA 1U0BB 3HWSA 3FNQA 3GC6A 4KXLA 3AGPA 1YVDA 4OI1A 3K3PA 1KZ4A 3DMPA 1GSOA 1R9NA 3RYIB 3K3VA 5EMMA 1KRWA 3WGNA 2WSBA 3OJLA 4F1KA 2DYKA 2GPYA 4AS2A 1Q14A 2BMFA 3KQKA 1VP9A 3K72B 5G02A 3KZMA 4FOPA 5BYKA 3VH2A 4BO8A 1B16A 2CCJA 1CDOA 1DCTA 2XTNA 1NLUA 2XAUA 5LB2A 1GEGA 3OWHA 3BH6A 4QEDA 2FPXA 3GXBA 4PQRA 4RWZA 1CK4A 3FDZB 4BMOB 2VATA 4IFTA 1SUPA 1Y9EA 1NUQA 1DJNA 1N0HA 5FTWA 1OE0A 3CN7A 4O83A 3OP1A 3VH4A 4F3RA 5A9SB 3ECAA 5IKMA 2REBA 3U3RA 3GAMA 5DI9A 3ITNA 2YR0A 5CBPB 1SG9A 5F52A 1P0CA 2P0AA 2X0SA 3HEMA 4JUCA 4YO8A 1ZL2A 5FXMA 4D9GA 1JKXA 3GIWA 4MK4A 2JA5G 4UJ3A 4X0EA 3RR2A 5BN1A 3E23A 3OLYA 1GAXA 3LQ1A 1CQPA 5JXJA 2XDWA 2GA9A 1FVFA 4RL4A 2H1FA 5E6SA 3JTEA 3AV0B 4ZICA 3EJWA 2NZ2A 4RVUA 5CEJA 1U1DA 1KZ9A 3LK7A 1KT8A 3F6YA 3QKSB 1ODIA 4LZAA 1OC4A 1UQTA 4MLCA 3DVRX 2PRIA 2PBRA 4Q4DA 3H9EO 2VSNA 4R3NA 4WEQA 1FFBA 2OA0A 1SOWA 3SJBA 3CX4A 5TJHA 1OX4B 1C1DA 1XMQH 5K0SA 1XOIA 4XCVA 5LMZA 3H13A 4QM7A 4KE7A 2O0HA 3CB2A 4OFZA 1KYTA 2E18A 4U3JB 5E0OA 2ZI3A 2BEVB 4NOKA 1KYQA 4WKGA 2R1TB 1XC7A 3B6JA 2P0YA 3ZYCA 3RTDA 4DR5H 3GTPA 2VDWA 1NMYA 2R7MA 3H4MA 1JH9A 4L72A 3HA7A 3IQEA 4LYAA 3R75A 4EMSA 1RAFA 2FP4A 4JIGA 5ICFA 5J2UB 3O5AA 4CBVA 1AVTA 3A25A 3V1YA 1QP0A 1RYZA 4U6NA 4DIOA 2OGSA 5E6SB 1VIMA 4CM9D 6YASA 1UFKA 3W2FA 4IUCS 5H4GA 3MCVA 2YW9A 3P5BA 2YIVX 3FDZA 3M3HA 5A4FS 2QTLA 5KFEA 2NTVA 1VKJA 1NT2A 2XADA 1FTQA 2NVBA 3GGJA 3EGWA 2I87A 2GAOA 5E1BA 5EVCA 2R84A 4DLBA 3AR2A 4WJZA 3P0RA 2RAUA 3T7DA 1N6RA 4MQ6A 2C5EA 1COWD 1GFSA 3OJXA 3U48A 1HZJA 3SQOA 1OBOA 1SU7A 2BFFA 2PPLA 1VIVA 2WYVA 3EAFA 4IHJA 2LCQA 3NHPA 3WGUA 1MPTA 5LMCA 4ZTZB 3QXXA 4E2YA 1OLSB 1V8DA 1EG7A 5EQJB 4FIDA 4Q3DA 1R1DA 5EHNA 4EGCB 1W6RA 2PY6A 4PFJA 3CJQA 2AJDA 2IC5A 3P2YA 3PUVA 3PYMA 4CUKA 1MJNA 1X9NA 3GLTA 5C3MA 5JG7A 1LI5A 4CMIA 1H4SA 4A3GG 1BOOA 2QGFA 4JI3B 1W46A 1I2ZA 1S8AA 3PQ5A 4BWVA 1KEVA 3F97A 1QYXA 3G82C 1OUMA 1V4YA 3N0TA 3T0FA 1CUVA 3HKEA 4N5DA 2C4WA 2RHGB 1JHDA 3QY9A 5E2AA 2QBYA 3U62A 2WFLA 4QJ5A 1TIBA 2GN8A 4K9RA 1TM5E 3DVAB 1XWIA 1Z2CA 5SZIA 1B43A 1V25A 4N82A 4DA8A 2B8JA 4TKLA 1QM5A 1JR3E 3E4DA 4O81A 4HDKA 4ND1A 2FEWB 3HEBA 4LNHA 2DY0A 2H1LA 4PAWA 1A48A 3TIIA 1UIMA 1U6KA 1IEXA 2IDZA 3QOFA 2DF8A 3COPA 4Q1DA 2DSNA 2R7KA 4KVGA 3QVXA 1ZM9A 2UYOA 3AILA 3AJEA 3EXG1 3WAKA 4UM8B 1S8FA 2J9YB 1QPZA 3RDPA 4LE2A 5H3CA 1KI1A 5CB4F 2BGMA 2AL7A 2VNKA 4CM5A 3V34A 1HNWB 2QYHA 3Q9UA 1DELA 3DEZA 4XX1A 2GEUA 1CKMA 1VLJA 1E6UA 4RKRA 3FSRA 3F6RA 1G21B 5K4AA 3BN3A 2HB6A 3O84A 1OWMA 1TO2E 2OM6A 1T6NA 2FQWA 2ZS8A 5DNWA 4JLNA 4R7ZA 2N1MA 4FFNA 4CMAA 1YVPA 5BWWA 3OFKA 1TZCA 3W6NA 4NHEA 1QC5A 1I3QA 5LJLA 4HAOA 3WLEA 5DXJA 3I4MG 1LFDB 2OORC 4WZZA 5EPUA 4UC0A 3CNEA 1YOVB 3MINB 1TAUA 3PDIB 2HGWA 1QGUA 2O5EA 3MFHA 2XUQA 4Q45A 4WK0B 5L7TA 4C0LA 3VNSA 1E96A 1TO6A 1P1FA 3L6EA 4G0WA 1X7ZA 4Y2VA 1CUGA 1BDBA 1PK9A 4Q3AA 5DAAA 2IODA 5B2FA 3QPVA 2YXEA 4GVPA 1QUEA 2CZGA 3A6ZA 1YDMA 4C05A 1KVRA 4LPSA 5C9ZA 1WR2A 4EG7A 5BV8A 4IO1A 2PKQO 3CG0A 5HQ3B 3DB1A 4UU8A 4B3BA 4K7JA 3I34X 3OX1A 5CCBA 1YCDA 3TNYA 5KYYA 4ZDWA 2GPBA 3F6CA 3HBFA 4MQUA 1Z8HA 3ICPA 4GNKA 4NE9A 3GEMA 2ASEA 3BIFA 4JDUA 1Y5MA 4FXPA 1KDRA 2BFOA 3DLCA 1MJFA 1ISHA 4J29A 5AHKA 2GX6A 1J4AA 2QN2A 1CQIA 3HACA 4NNPA 2XYQA 3HDTA 1AGRA 2O0JA 2G7MC 2EHJA 4MW0A 1P5HA 1CYEA 1OU4A 4RMNA 1P61B 5AJWA 4FW9A 4YWHA 4CTMA 2XZPA 4ZAGA 4NAVA 4WA7A 1EFUA 1Z7GA 3Q8XB 1L9KA 2CD9A 5K6TA 1TF7A 2UUAB 4UTOA 4UTRA 1DBSA 1HV8A 2LRHA 2QW1A 3EXAA 1KYXA 3R20A 1R74A 1C3OA 4NJEA 5HZMA 1XTZA 4KK3A 4ZWNA 3E58A 3WIVA 5AK0A 2XZLA 3H1PA 1CR1A 4HXYA 3A4TA 2KLHA 2RJOA 2W6ZA 3C3MA 5KMGB 1BVHA 1Z4PX 4HS4A 2OB1A 3KQMA 3AOGA 1J90A 5CJJA 2LV8A 1KXZA 2QQEA 4UPVA 4X91A 3WYFA 1KEEB 2GCPA 1HL3A 4M0LA 5CT5A 4EMUA 2BE7A 4HTFB 5KFTA 3HWX1 1M1ZA 1TAQA 4LYEA 3TNJA 3UQYS 4NPHA 3B82A 4MWSA 1VKHA 2XUKA 4O5OA 1JG4A 4ZQBA 3MIIA 2OMKA 2B8TA 2FSVA 4YV7A 4GAEA 1CLEA 2PLWA 5LJIA 1R66A 2UDPA 4PZCA 3UKJA 1PL7A 3K1JA 3NHLA 4H6WA 1EUYA 1BW9B 3B20A 3DAAA 3UT5A 4GQBA 3KAKA 4LAFA 4X90A 1GJRA 2ZR0A 3KYDB 2BUCA 5EUQB 5FUYA 4R7GA 1WL8A 4DVGA 1R64A 4GI3A 1SBTA 4MZXA 4NDNE 1FDRA 3VSAA 4BQSA 1TCAA 4DCPA 4ENRA 4DDWA 3EA4A 1R8QA 4L9AA 4E88A 1ST2A 4GX5A 4BNDA 3V42A 1J0EA 1TM4E 2B30A 4K28A 1XZEA 2DQYA 4N9QA 3AI2A 3WRXC 4HQ6A 4XD7D 4B76A 2MSCB 3IBYA 4V0QA 2DE0X 3L7NA 1Z5PA 1WZ2A 4UBOA 1E2IA 1XPUA 2PS1A 1LPBB 1K5GA 3WK8A 2CNVA 2C9DA 4BZQA 2BI4A 4NV0A 1DHRA 4PIPA 3V6MA 1J5EB 1BRMA 4ND3A 2AG8A 2WA2A 3WNVA 2XXAB 5FD6A 4RABA 5L40A 3W5IA 5ALXA 3RF2A 1QH8B 3FNEA 4WECA 3RSFA 1GTRA 2Q4TA 1G9XA 5CD1A 2B4RO 2ZRKA 3KKMA 4RK7A 1YCHA 1OPRA 1V5EA 1KJZA 5EPEA 5TMEA 1U4SA 2J4DA 4JXKA 3AJ8A 2R25B 4N6NA 2YWEA 4Q3OA 2NUTA 2V7UA 4PVCA 1IBCA 1RRPA 4DMLA 4C6SA 3EFEA 3A2LA 3FETA 1GSAA 5CG2A 4XWGA 2VQDA 4HNVA 4EEZA 3RJTA 3UQ8A 2DAPA 3PDHA 1MB9A 2LIPA 2WWVD 5AW6A 2E21A 1XAJA 1OROA 3A70A 5IZ4A 5IAAA 2BCJQ 3LH5A 3VFDA 3ZJ5A 3RRZA 3D4PA 4RNCA 3TZEA 5AXDA 4HEHA 3EF3A 4OMDA 4B87A 1QQ7A 4J9UE 1FCJA 1IOVA 1RWNA 1H1DA 2X2OA 4M4SA 5JC8A 3OQJA 3OFSA 5JTTA 3HCOA 4WGGA 2VWHA 3MELA 4BKUA 5KYUA 2WT9A 5GIPE 4II3A 1TYBE 4DR2H 5LZ7A 3OEWA 1Y8QB 3IOBA 3K94A 1V5FA 2VOEA 4RXUA 3ETGA 4CMHA 4E94A 5T6MA 4OHZA 3RFVA 4YRZA 1E3MA 3I5XA 1NXPA 3U5TA 4EY4A 2AFHE 3CC8A 1TE2A 1P2DA 3I4LA 3FVTA 4MVJP 4Y2SA 3ISJA 1DOZA 2A5YB 5JH7A 4LF5B 2WTFA 4Y7CA 1Z22A 4J2OA 2ZRLA 1LRKA 1Q21A 4HFRA 4NNJA 1Y7LA 2X9GA 3FLMA 4UNSA 4PNZA 3A0UA 2HRBA 2WZBA 4JUFA 4NMWA 3W7VA 1I01A 4ZVQA 4OHXA 5TVKA 3MAJA 4HGOA 2ZWMA 3QKIA 2DT8A 4QGGA 1FJGB 2Z5FA 2C2RA 4L15A 4XE5A 2B5OA 1JE0A 1QHFA 1N0UA 1DX4A 3D3EA 3G0BA 5L4NA 1GVHA 3RRJA 2FB9A 1M3SA 2G07A 1IEWA 3GPDG 1E4YA 3P52A 1C7RA 1NVFA 3HLTA 2SICE 8ADHA 4IDNA 2UXBH 2A88A 1II8B 1Q84A 3KOYA 1EDDA 2BEUA 3R3XA 4RTLA 2DLNA 5IVPA 1PS0A 2JJ1D 1FMCA 3IAFA 3R6GA 5ER9A 2CHUA 3NVKI 3PXUA 1MRZA 1CJSA 3LLCA 5H83A 1RABA 3MJRA 1FDTA 3W3AA 1TECE 4PX3A 4DJ5X 4DXDA 5MF6A 1XZHA 4YRPA 4IJ6A 4QWBA 1X8KA 2GYVA 1O9BA 3GJTA 4DCSA 1XU4A 2PA0A 1ADFA 3QWFA 1HF3A 4G4JA 4MW6A 10MHA 3OBBA 3C2QA 4JA0A 1K8QA 4EGJA 3B1FA 3B60A 5ARCA 4D3YA 3ILSA 2VQ6A 3OZBA 3QOXA 4AUEA 5BUCA 1YA8A 3S55A 3BOSA 2J85A 4HFNA 2OZLA 3EZYA 3V4SA 4PYIA 1XCOA 1E3SA 4MUMA 4HTAA 3VVMA 5FNVF 1BMDA 4PG8A 3FTQA 4YP0A 3P4YA 4FFOA 3IIKA 4FMBB 2C7BA 1JHZA 3NG1A 2F8MA 3F74A 2H1RA 2QM3A 1I3MA 3FD8A 1LWOA 4HN9A 5F78A 3RAXA 3H7IA 6REQB 3BJRA 3INTA 4MS1B 2NSYA 1Z73A 4DR6H 1XP5A 3NAGA 3S2EA 3UG7A 4BB5A 3T9DA 1UAAA 3QVJA 4MYRA 4DV7H 2G5PA 4D0NA 3AETA 5KFJA 2JLWA 2WAYA 4XJSA 3PFFA 1R0ZA 2C5SA 3PEUA 2AOVA 4HQFA 5AVJA 3PO3G 2P1DA 2Q2NA 3KKZA 2NV0A 4DEXA 4BFSA 1D1QA 2WJ6A 1QDLB 2I2XB 4IVQA 1EVKA 5GONF 4KQMA 2ONCA 2IOHA 2HSJA 1A4IA 1HNZB 3QG1A 2WE6A 2C92A 2PZKA 1X7ZB 2X9NA 5KVVA 4DT1B 3DHWC 2JA8G 2GJ9A 4O3MA 3QUQA 3F73A 3L06A 1C2TA 3CE6A 3AEQB 3CNHA 1FFXB 5AUPB 4HAXA 2ZAMA 1Z5NA 5BR7A 3UMRA 1Y34E 5KNCH 3VI3B 1NTRA 1ATIA 1LZKA 3ZW7A 4DF3A 5JZSA 4R2KA 5BY2A 3SZRA 2FG6C 3KKKA 2CXPA 3BE5A 3FE2A 3LCMA 4R8UA 2PGDA 1TM3E 1HR0H 3LP5A 3MLEA 1JJIA 1G3UA 1UANA 1GQ2A 1WXEA 2IYRA 3EMBA 3DEHA 4MWDA 4NYMR 3DNPA 1JL3A 4NAHA 4Y9RA 5GZ3A 4O1HA 2R00C 4L16A 1QNFA 4AKIA 4LBZA 5AQEA 4D44A 2D0OB 1WLSA 4MV7A 1CUXA 4P4SA 5WRFA 3H9QA 2MR5A 4UHFA 3VVLA 5BN4A 4RB1A 1HYGA 3EJ6A 5EOVA 1XCPA 2CDRA 3A06A 3EVZA 4HRXA 1NG9A 1G59A 3QQPA 1NNEA 1UK7A 3UCFA 1QRSA 2YN0A 1ZH6A 3WQHA 5CX4A 3C39A 5JYEA 4PGAA 2VJMA 2WW8A 4X1KB 1IMJA 2Q2QA 1CKNB 2HVSA 1HDZA 3HZHA 3SYMA 1GZ7A 3PLRA 1G55A 5JI2E 4DMKA 1XU7A 4IIYA 5J1SB 3N2EA 1CU1A 3TAHA 4WOPA 5CTAA 4A3DG 1IU9A 1JDJA 1YR7A 2EYQA 3QE4A 3ZLTA 3IQXA 3E53A 1Q2UA 3TZQA 4L9SA 2JZCA 2HGXA 1OW3B 3EG5A 2XZTA 3JCZA 4UUOA 1KQGA 3IVMA 5U4XA 4RULA 4OLAA 5DHAA 5HQJA 4D56A 4MV0A 3E2PA 3U7QA 4N0PA 5ETJA 4MRPA 3V33A 3WSVA 2OE2A 4IR7A 4XDGA 1E3EA 3K53A 3RRBA 1ZHOA 2VOJA 3EGXA 3A1WA 3UXHA 4YX9A 2RGUA 3R0IA 421PA 4PNEA 5FNVB 3AEQA 3T5BA 2BZ0A 1L5QA 2A9PA 1LVHA 1KZ7B 1KETA 4RV9A 4EP1A 3JZFA 3NTVA 3RB8A 3R9WA 4G41A 2PZLA 4XVCA 1D6NA 1T3NA 1A71A 1TCCA 1AUVA 1CXZA 2IL1A 3D8RA 4YR0A 3DVQX 5KFQA 3GJQA 2C07A 3KR9A 3OZAA 5ALFA 3X44A 4BATA 4OHBA 4B75A 2I3ZA 3OZDA 1EE2A 2VJOA 4JLDA 2FK8A 1JQLB 4AECA 3UUWA 4AQYB 2NU7B 4MAAA 1I5OA 5AP9A 3UT5B 5IAOA 3EMDA 4CF3A 3HPQA 3TW4A 2NLOA 4WCVA 3MINA 4RIEA 5CEEA 1ZRNA 2OAGA 3EZGA 4QWAA 4PG7A 3ZY5A 1M72A 1XDGA 2YC2C 1N2CB 1AU9A 4ILEA 3RFXA 3ROXA 2H54A 2WG0A 4NK5A 5FNZA 1DKRA 3IBGA 4G0YA 4DA6A 3DQQA 3H5RA 3EZ7A 4YMTA 4EAAA 5LLSA 2ZAGA 3IV6A 2DTDA 5GPBA 4D97A 1LBEA 5CFRA 2CYCA 2ZRJA 5KHLB 2ZCVA 3F71A 3JAMW 2PUTA 4B6OA 2FMKA 1VJ5A 3Q8QB 3OLCX 4BFLA 3BWCA 4MVJE 1VTKA 3A1VA 3H1AA 1IUNA 1QU2A 4Q8FA 1GZUA 2VHJA 5KCZA 3HGQA 1IBKB 3TTUA 1M75A 4BN0A 3U0VA 1D1TA 5EWMA 3TNFA 5CH8A 4NBRA 2QL6A 2B37A 4B79A 2WIDA 5ALQA 4BLOA 2GASA 1E20A 4A8TA 5JSZB 2WJPA 1E3LA 4EPWA 3W1GA 4FUTA 5KTNA 2QS9A 1VSVA 5C5JA 3SJCA 3B8EA 3MCAA 3NI2A 4LMBA 3TZHA 4BJ3A 2Q2OA 4I1YA 2NU6B 5KFFA 1XXHA 1E79D 3M4NA 2V7VA 4J16A 3T1QA 3DFZA 4DLAA 1NZDA 1GNQA 2WU3A 1UBEA 2V8BA 1XNQH 2JGAA 2J5KA 2OCAA 5BWMA 3N2NA 1IONA 1A8PA 2VTBB 2GYWA 2H59A 2PUJA 4HGNA 2HCRA 1P2FA 1JMYA 5H16A 3D7KA 5H3HA 1K7EB 4DYDA 1SUDA 1VPLA 3GRVA 1DJLA 3GIDA 2HBRA 2J48A 5I7FA 1NN3A 2YOHA 3ETEA 4JMPA 5BV7A 2ODEA 1JB1A 1WOMA 3I2KA 3KLMX 4ZEWA 3ZWVA 3VU9A 3WYBA 1RJ9B 3ZE0B 4D43A 1B73A 2NO9A 4V02A 3G6YA 5D5PA 3TLJA 3BXOA 1CCWA 1K6XA 1UFOA 1JVNA 4KC0A 1QX3A 1QJCA 3OAAD 4L5BA 4OREX 3AF2A 1GZSA 1WDTA 2AC4A 2RHTA 1OXSC 2PX3A 4ECTA 3T5KA 1NMZA 1SC3A 1Z6PA 4URFA 1U2TA 1YVEI 5EJ2A 5HBGA 3G0HA 1SXJC 2CGEA 1B6SA 4QJFA 3OT1A 5JAZA 3IXMA 1X86B 2ZBVA 4ABYA 4B7XA 1TC1A 5DBEX 3DKIA 1P8LA 1X1SA 3JSNA 2BZ1A 4LBWA 1QMGA 2CFOA 4PLVA 5L6MB 5HS6A 3CRQA 3IHTA 3QQMA 1TT5B 3QUTA 4PX9A 5BV1A 1C9EA 4K6FA 2WAQA 4MR7B 4Q12A 4CKXA 5M2QA 3ZJVA 4O4LF 1Z4JA 1HFJA 1KJ8A 5FO0A 5JSZA 3ZKAA 5LQNA 4CM8A 1I0ZA 2G09A 2DLDA 1OC2A 2O23A 3MYRA 2FEKA 1EK6A 4Q7JB 4B6QA 1GAJA 3OE5A 3TQHA 4OFWA 7REQA 3MTQA 5HM6A 2H2DA 4NP6A 4V0OA 1DBIA 1C9KA 1SH7A 2FX3A 4FZ5A 4LHXA 1RAHA 5IBQA 4DQXA 3PRYA 3NNNA 4M3NA 2AIRA 3OE4A 1KMHB 4TQGA 5ESXA 3E9NA 4S04A 4X92A 2B2CA 2RBEA 2B1IA 4EG3A 5LQJA 4G0MA 5CM8B 1KMQA 3EXG2 2I54A 4RVGA 5H9VA 2KI5A 3B13B 3F5QA 1KWKA 1Z0AA 2TMGA 2NU8A 1RWQA 2TRSB 4Y1FA 1E1CB 2MINA 3M4ZA 2CVPA 2DEUA 1GYRA 4BEVA 2JFXA 4D4LA 3B9RA 4ZYVA 1P5FA 4RWEA 1Q83A 3Q87B 3SXPA 5FA8A 1LRJA 4JU9A 1PWXA 1VBNA 4WPGA 5AOCA 4B8WA 2QX9A 1PGQA 3MEQA 2PSJA 1I3NA 5A03A 1F3OA 4F5EA 3OTIA 4ZJZA 4DJFC 2EOAA 4L9WA 1XQVA 1SN7A 4P83A 3KJHA 4GKJH 1UXJA 1XNHA 3FJYA 2CNUA 4DADA 4E15A 3IQIX 4DSAA 2G5CA 1G20B 3O2SB 1Y5NA 4L74A 3SHWA 1JI3A 3AKCA 3IULA 4IICA 5U4QA 3VI4B 3EBLA 2WABA 4MCAA 4OA8A 3QXCA