4MA5A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
365
structure length
363
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with an ATP analog, AMP-PNP.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
total genus 115
structure length 363
sequence length 365
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma5A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma5A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma5A01
4NYEA 3JRXA 2W70A 1IOVA 4FFMA 5GONF 2NU8B 3K5HA 4IWXA 3R5FA 2YZGA 2W6PA 4FFRA 4XYMB 5I47A 3R5HA 5JVLA 3WNZA 3MWEA 3Q1KA 1T36A 1KJQA 4O2AF 4O2BF 4EABA 4O4IF 4ZI7F 2R7LA 2NU6B 4Y8VB 4EA8A 2SCUB 4C5CA 3RFCA 3V4ZA 5FNVF 3BSYA 5LYJF 4MV8A 4ZQIA 1CQIB 2FPPB 4J6EA 4I50F 2YRWA 1AUXA 4EAAA 3QFFA 3VA7A 4FFNA 1DIKA 4O7TA 3R9RA 4DLKA 5EZYF 3LP8A 4HNUA 1CS0A 1EUCB 4MAMA 2PBZA 2V59A 1C30A 4O7LA 1VBGA 4HR7A 5LOVF 4MV6A 3N6RA 3U9SA 3DF7A 4YB8B 2ZDQA 3AW8A 1VBHA 1KUTA 1DV2A 4MV4A 4O4HF 2NPOA 2XCLA 4C5BA 1KJ9A 5CB4F 4L1KA 2FB9A 1KJ8A 3HB9A 3RV4A 4MA5A 1KC7A 4IWYA 3N8DA 3KAJA 4TV9F 3JZIA 3VPDA 3E5NA 4EGQA 1VKZA 4I55F 1E4EA 4XYLB 4O4LF 1E4EB 2Z04A 3OUUA 2YZMA 4EA7A 3ORQA 5IYZF 2R86A 3TIGA 4O7ZA 5BPHA 3Q2OA 3SE7A 2GQSA 2J9GA 4HNTA 5KKNB 4E4TA 1EYZA 4O7YA 4HNVA 2NU7B 2CNVA 2I87A 5LXTF 1ULZA 4O82A 3WO0A 4YBZB 5D8DA 4O7WA 3LWBA 5BMVF 4M98A 2OLSA 2GPSA 4O7SA 3I12A 2NU9B 2YZLA 3GIDA 3KREA 1EZ1A 5JH7F 1M0TA 3RV3A 4IZOA 3BSWA 5LP6F 4TUYF 3HBLA 4M9CA 1I7NA 1GSOA 4O81A 2YYAA 5JQWA 2R82A 3TW6A 2NUAB 3BFPA 1BXRA 4O86A 1OBGA 1GSAA 4C5AA 4O83A 4WBNF 2WYOA 5CAEB 1JLLB 2W6MA 5KX5F 4O84A 1C3OA 4MV7A 1IOWA 4YJ3F 2IP4A 3BSSA 3ORRA 4EG0A 2GPWA 1DV1A 2YWVA 2P0AA 5K2MA 1PX2A 4EGJA 2DLNA 5HV6A 3JZFA 4YAKB 2CQYA 3BG5A 2R7KA 4XX0B 3HO8A 4MV1A 3OUZA 4FGRA 2W6ZA 1B6SA 4XZ3B 4MV9A 2HGSA 2R7NA 1GGOA 4IHJF 2I8CA 3AX6A 2YW2A 3K5IA 3KALA 5H80A 5JVDF 5CA1F 1JDEA 1KJIA 3WO1A 1KEEA 3VPCA 2X0SA 2DZDA 2CNQA 4FU0A 5LA6F 4MA0A 1M6VA 1JDBB 2V58A 4O7RA 1SCUB 1B6RA 2YS7A 1A48A 3R23A 2DWCA 2VQDA 1EHIA 4HQ6A 3U54A 1WR2A 4YAJB 4GGMX 5J2TF 2FPGB 2R6FA 5CA0F 5DMXA 1KJJA 4I4TF 2W6QA 2R84A 3GLKA 4O7NA 5HBRB 2YL2A 1W93A 2PVPA 4FFPA 1KBLA 2DIKA 2PN1A 3MWDA 2CNUA 2VHEA 2R87A 1CE8A 2QK4A 2FPIB 3MJFA 4MV3A 4TV8F 2GLTA 4M9UA 2I80A 3V4SA 2ZDGA 1Z2PX 2GQRA 3TIIA 4WD3A 2W6NA 4IIJF 3VOTA 4ME6A 3VMMA 3G8DA 1GSHA 2R7MA 1AUVA 3ETHA 4O4JF 2R85A 3G8CA 4RZQA 1BNCA 3R5XA 3VPBA 2CZGA 5BPFA 2ZDHA 1GLVA 1CQJB 1M0WA 4ZOLF 4FE2A 1W96A 1OBDA 4EA9A 1PK8A 3NUAA 5J2UF 5C1PA 4O7VA 4QSHA 2W6OA 3JRWA 1Z2NX 2YS6A 1JKJB 1EUDB 3U9TA 4FFOA 3TINA 1UC9A 2XD4A 3U55A 5JQGF 4ZHQF 1A9XA 5C1OA 3TQTA 3RUPA 2W71A 3UFXB 4DIMA 4FFLA 1UC8A 4YJ2F 2YRXA 1I7LA 2C00A 2FP4B 2VPQA 2HJWA 5C8YF 2Z02A 3ETJA 2QF7A 1Z2OX 2V5AA 2VR1A 3K3PA 4M99A 2YZNA 3KAKA
chains in the Genus database with same CATH superfamily
2WSYB 1H2FA 4P4UA 3J80W 4FI3F 4IV5A 4IKPA 1JQKA 2AEFA 3KTOA 4CGYA 4OH1A 2COEA 4WW0A 4ZTBA 4FW8A 4XYMA 4MXDA 3QFHA 3RTEA 4KZKA 1PR9A 3STWA 1V9SA 4WNYA 2Q5LA 1K2VN 1ORWA 5TXGA 4NEHB 4DGSA 1AGXA 1WCWA 2R8BA 2ZIVB 2BFAA 2YZGA 3H0GA 1ID1A 4JI3B 1XTBA 1HEYA 1P1HA 2XGJA 2D62A 4WK2B 2FGKA 2N1MA 1N8NA 2ZM5A 3IQIX 5CR9A 2B8NA 3PDJA 1U9JA 1JR3D 4URZR 2IXGA 2XOXA 4LX0A 5DRYA 1C81A 3T7IA 2ZSIA 1NE7A 1IPHA 1FF9A 2HK8A 1KIMA 4MUAA 3Q1KA 3ZY4A 1ZHOA 2QMEA 4O2BF 3DB2A 4WQMA 1M6VB 4EG8A 4LRSB 4A6PA 1KZ6A 1NUPA 2EL9A 2F1KA 2G1UA 1OIVA 4NE7A 3ZD6A 2NMVA 4M0EA 3ZGXA 4C30A 4OQXA 2R93A 1WD7A 2H65A 3BXEA 2IRWA 1JE1A 3FFTA 4MW7A 4WA8A 1ZJWA 2AG6A 3DBHB 4AWBA 1E3TA 2HBRA 2OMKA 2P5UA 2PGJA 1TJ4A 3FETA 2B25A 2PZFA 1DBVO 3GU3A 2QUKA 4I55B 4DQVA 2AMJA 4D1YA 1DEHA 2CCKA 1A96A 4OJKA 3IL2A 5KQGA 5F23A 1M0SA 3QU2A 2IEYA 1UBRS 3VYSB 1RLJA 4Q3AA 4ZVMA 1HT1E 3V8MA 4KXNA 4RNOA 1THMA 2KLBA 2PTHA 5H9WA 1ODIA 1PZFA 221PA 2VHXA 1CQIB 3FF1A 1JLMA 3GJ8A 1Z6XA 3IQDB 2XH8A 4KQFA 3TG8A 3BF8A 2QD5A 1VE6A 3ND8A 1K86A 4EGSA 4TMYA 4CEIB 5LOVB 1MKYA 1FK8A 2BM9A 4IHAA 1Z62A 4TTRA 2ZSHA 3KYCB 4KLAA 3RARA 3MJSA 5IVHA 5DQGA 1KQ3A 1B15A 2X1VA 1PAUA 4UCRA 1QIGA 2VATA 3R3WA 2GN4A 3QUSA 1DTEA 3GG2A 4KGVA 3E82A 2WABA 2ZIFA 5EAIA 2F67A 2O2HA 3ZR4B 5K3OA 4XTCS 2X8BA 1P1FA 1RD4A 1ZETA 1GPLA 3BB3A 3K35A 3KKZA 3O3NB 1RCTE 4M37A 1M1XB 5CB8A 1QDEA 5TQJA 1EWKA 2PKCA 4US2R 5C2JB 1NQOA 4ZOBA 3ZQ4A 1P81A 1J2YA 1DE0A 3HOZG 1IYDA 2V0NA 4UVIA 2Q5EA 1R8YA 4UZEA 1N5RA 2HK7A 4GWLA 4H6XA 4HH0A 4PS1A 3ZLJA 2FSUA 3OZBA 4L9AA 2EJWA 1JHDA 2DH5A 4UVGA 5J59A 1MW9X 1WU7A 2PCJA 3WLKX 5J4YA 4M38A 4EGFA 1DKOA 3B1YA 3CY6A 3OZGA 2X1MA 4QJ3A 1CJTC 2FEKA 1RI2A 1Z6GA 2PJUA 3MMPA 4LNUB 2C2MA 1W5EA 4YR3A 3KTAA 4IIBA 1NY6A 1N2HA 1UC5B 1JYSA 2VJCA 3T6KA 1H65A 4CLRA 3M9MB 3REOA 4KN8A 4MGEA 3HCRA 1ESEA 2ZE7A 5CVUA 2EJ3A 1WMEA 2ORIA 2VXCA 3VZDA 4RFVA 1FKAH 4L50A 1GNPA 4ZCRA 4IHJB 3SJCA 5TQ0A 4UOZA 4S2EA 5B1HA 1IRXA 2H18A 2KM1A 3PJGA 3RTCA 4OA5A 1RJDA 3BK7A 4ZO6A 3GX1A 2AFHA 2Z5LA 5JMWA 2HHLA 2Q2TA 5KG2A 4G1VA 5EL0A 5A4KA 5C4IA 3HUEA 3AONB 4YROA 1HYQA 5AIAA 2XYHA 1UOPA 1NJ5A 4R69A 2QZPA 1PZEA 4EEZA 5TT1A 3LVQE 4YK7A 1N3IA 1Q6ZA 3GVPA 9ATCA 5J40A 3O74A 5K8JB 3AJAA 3W5VA 3UMSA 2EP5A 4TV9F 2F4NA 1TM3E 2GMWA 4D3ZA 1C7RA 2AGOA 1MQ8B 4JUDX 4V0ME 3CCCA 3ZW8A 3AG6A 5CFNA 5FWNA 3HL0A 3PCXA 4G9GA 3MCVA 3K31A 4OUDB 2X4IA 5LXTA 4INAA 1IZ0A 2X76A 4DCGA 4LHYA 3EEIA 3SJUA 4URXR 2FEOA 1RYHA 5D3KA 1OI2A 4Z3DA 4XEHA 4ZI7A 2B9VA 3FI9A 4JYBA 2VOBA 1E4EA 2DT8A 2Q28A 3SHWA 1ZR2A 1MNAA 1T5LA 3T5DA 5KSZA 1M72A 4GM0A 4UM9B 3OLWA 3RYHB 4AJNA 1E5VA 4PZZA 1AB5A 5LDHA 1A8HA 3N2GA 3L79A 4UM8B 5HF9A 3BJIC 3LCVB 5BN3A 2D3TA 3LIPA 5AQEA 4ZTZB 1JI3A 4HBZA 5TE9A 2VFAA 1O2DA 3VYWA 2C8KA 4O7ZA 2W90A 1VE3A 1BN6A 1L2ZA 1GAWA 4RWEA 2JEZA 1RIFA 4HGNA 3JU3A 3LUCA 4YRCA 3RROA 3W9SA 3DE2X 2J0VA 3MXTA 4MVWA 4PQYA 3L1UA 3KBBA 1SIWA 4DSNA 1UXGA 2AV6A 2JA7A 3AEYA 4YXWD 3FSEA 5F64A 3UH1A 3BA1A 4F11A 2VRCA 2I87A 1NQWA 1O08A 2EFDB 2NO0A 2OHIA 3NP7A 1M2NA 1R0YA 2ZR8A 1KVUA 3QV1A 3TPCA 5A3QA 4J94A 1FYWA 2PGAA 3RS3A 2C2BA 1NP7A 1FNBA 2AFIE 2GS9A 4DY4A 1CC1S 5BT9A 1U1CA 4E22A 5JATA 1BOOA 1B6GA 3PL5A 5AVQA 1M7BA 5DP1A 1CEEA 4LXHA 4V0MA 3FPCA 5IEJA 1D04A 3OLQA 1US8A 1WOYA 1EUYA 4MVJA 4QUIA 2HGWA 4XRRA 2P9CA 5BRJA 4H4CA 2FSSA 3PFHA 3D0RA 2Q07A 5FEMA 4ZYXA 1T29A 1PWHA 2R2AA 3UTCA 3ZGYA 2FK2A 2OM2A 4MSUA 3EHEA 1Z6YA 3V8NA 1DKUA 3LCRA 4MWOA 3IFSA 1Z4QA 2FLPA 1ISGA 3M70A 4QTTB 4GYYA 1AKNA 1H1LB 1X13A 4BRZA 3OLXA 2C1XA 3BQMB 3VPSA 1B0PA 3AUYA 3D1LA 4FYYA 4KW7A 2G5TA 3WK9A 2Z3ZA 3W5CA 2OBNA 1QONA 1L1RA 3EVCA 4PM4A 2M05A 3T38A 1D2RA 1EDOA 4HWSA 2VQEB 2CVHA 5LL6b 3I34X 4N3NA 3WP1B 1G21B 1I80A 3CIOA 3KSBC 1GSOA 2WHYA 3P0EA 5AVWA 1JHQA 4NXMB 2L18A 4OJTA 4OGLA 3PHIA 5EWEA 3WGLA 4AUEA 4D3XA 3KLNA 1U2SA 4YY3B 1QP0A 4HV4A 5KG0A 1J9ZA 4DV3B 4UZFA 2JCSA 4AYBE 2P2SA 2YIJA 5J2UB 3SX2A 3UK6A 1EWQA 3P27A 2EX1A 3HT5A 1TIPA 3T5CA 2EBHX 3BFJA 4P2BA 2EG5A 4MP3A 4RMHA 3G6XA 3OZEA 1T2FA 3JAWB 3LUBA 1EXVA 3G0DA 3HOYG 5AXDA 5L1KA 2DKNA 1S02A 3ON5A 5B1SA 4UHEA 5JPIA 1JYFA 1XROA 2A9JA 3CGWA 4JLWA 2CSUA 3D5TA 3E22A 5G4KA 4ENTA 5J47A 4IJUA 4FSXA 4TGLA 2H85A 1MJHA 2IJGX 2I1WA 3R3UA 3DMFA 1NNEA 2VUMG 1F8XA 1C3OA 4M76B 4NENB 4MUJA 3CYFA 1GTRA 2BHSA 1W1IA 2PYDA 2YUIA 4QBGB 1KZ9A 3JXEA 1K06A 4JJZA 2C20A 4MW1A 4X66B 3I04M 3R9WA 1YR8A 3C43A 1KU6A 2C4VA 4Q44A 4GZ5A 3VH1A 2Q6VA 3P9ZA 3PQFA 2GEUA 4JBYA 1KHTA 3I0ZA 2Z5FA 4BTLA 4YJ2B 4ESEA 4K9NA 4KQCA 3RSCA 2OCLA 4FIZA 3R8CA 2X6QA 1PX2A 1AZSC 1XJQA 2WD7B 5EJ9A 4XJTA 1JFVA 1L4KA 1PV4A 4LRXA 3V1YA 3A9SA 3BE6A 4GMGA 4ML3A 3PW2A 4QUJA 3CXRA 3PUHA 4K2AA 4BLVA 1WMAA 3PNMA 2CCGA 2Q8NA 2Z58A 3SK0A 3KJEA 1EWYA 1R5OA 4IPTA 4FGRA 4ZO9A 3G49A 1LTQA 3A0RB 1G8GA 4D4GA 1DKRA 1SC6A 1R3UA 2VJMA 1VMIA 1GXSB 2QUIA 2X77A 4JSRA 1QDUA 2AE2A 1WCMA 3YASA 4F8EA 3HMQA 2REXB 5FNZA 2DTDA 4WTOA 2C8VA 1WDTA 5HILA 5JVDF 2I7TA 1VJ5A 4I9UA 1G8HA 1AK9A 1SQ0A 2P6OA 2ZE8A 5C4GB 4E09A 5ICCA 5KOJA 1N56A 2OGTA 1QCZA 3EODA 3L6CA 2I34A 3PPVA 4H7HA 3WIEA 4A0SA 2WIDA 5JOQA 4GL2A 2P8SA 5ISMA 5DI3A 2BW0A 1UDWA 3ZV7A 3M9LA 4DUGA 3OHMA 3AP2A 2JI7A 2BMWA 3QVXA 4MKZA 4U0JA 2QTVA 3Q3JB 4BJHB 4C88A 2I3BA 1VJRA 2YHIA 3MILA 4HPXB 4QNMA 5EJMA 1FUEA 1XU9A 1QRTA 3CURA 4YMIA 521PA 3DMNA 3KYJB 3VC3A 1SFOA 5JNSA 1MLDA 1Q0TA 1VI2A 2ZRJA 1G5TA 2H4FA 5JISA 3WJ7A 3NIFB 1YDFA 4BMSA 2PANA 4EHHA 1PD1A 3KPWA 3GDFA 4WNAA 3TZBA 1HPLA 4OTZA 2ZZNA 1BD4A 1TCAA 1VYUA 1XEWY 3A6KA 3AR2A 1O54A 3RUEA 1C14A 1G8SA 2FPWA 2ONZA 1FFAA 2E5LH 2ZB4A 5FPPA 1VL1A 3VHRA 5GZ6A 5CFRA 1BFKA 3G8AA 3ZH9B 4YT2A 5HBRB 4A3GG 1IJEA 1NTOA 2WF8A 2C5EA 3MF4A 4M7RA 1J1UA 2RK6A 2OAEA 3GA7A 5BOSA 3ILVA 2EYUA 4QUBA 1CB0A 1U11A 1K27A 5FWAA 5C37A 2GEDA 3JD3A 4D9MA 1AMUA 3Q8WA 16PKA 2J0SA 1RWPA 3HGQA 1KBQA 1M6YA 5T6BA 3DEIA 4PZ8A 3UMFA 3AOEC 5JNLA 3ICQB 1MRSA 5IVKA 5A4JA 5GWXA 1LC3A 2EJVA 3D0KA 4QU8A 3S1AA 3R8FA 3GVHA 2IYPA 2VP9A 3FX2A 5D51S 4D43A 4JAVC 3ZI0A 4K6GA 4RJLA 2I4NA 1DIRA 1U31A 3C2QA 3E9CA 4LSWA 1CJCA 5GGYA 1GUFA 5KB3A 5CCBA 2XW6A 1EB9A 2OC9A 3H11A 4G84A 1RC8A 4DA0A 3KLBA 2O7RA 1NVDA 5I5SA 1WA5A 5IAAA 4KIFA 1QQAA 5D7NA 5HP4A 4WZAB 1WU8A 3D2AA 2Z2IA 3SC2B 5H02A 5B30A 1C2YA 2CDBA 2ZEJA 1VLZA 3R7DA 1YAHA 1Z2PX 4G5SA 1XTUA 2AFHE 2P3LA 1DAKA 1FX0B 3F8NA 1P33A 3IVMA 1WCV1 2GO7A 1LNZA 1WRBA 2QNRA 2XE6A 4HX5A 4I5IA 4DBLE 1FXWA 4H15A 4OI4A 3DC2A 3R5JA 3RYIA 1P3DA 4CU2A 4EBFA 5FBHA 1N33H 3QY9A 4UEOA 1P2VA 4I50A 4PZ6A 2PRIA 4IDCA 4X6XA 5IM5A 3VR4D 4RZQA 2ZU0C 5BV2P 2MMGA 1FOEB 2WU4A 4HDAA 4YGYA 7GPBA 1QVVA 1VB3A 3CMMA 3PC2A 2QRUA 1FRFS 5HE9A 5L3RA 1DBSA 5F21A 1CY7A 1UXOA 1XGKA 4P86A 2IELA 3AINA 4X3CA 4PYKA 4P0PB 4PHHA 2ZAYA 1YNOA 2HDWA 4EFKA 3QXXA 3GEHA 2P6RA 4QFDA 4Y2SA 4RAQA 3FRIA 5A6VA 3X1ZA 4QNRA 1R27A 2XEXA 1FFGA 5KNCH 1OREA 1FMCA 2YMMA 1OBDA 1OIXA 3K9LA 4L2IA 4NNJA 1I7SB 4IVQA 3QKTA 4UQLA 5B55A 2I91A 2IPOA 2RCYA 2XWPA 5CBPB 4F3TA 3PR5B 2QDKA 2BF4A 1TDJA 1A5TA 2JGDB 3QY0A 1VDMA 4L02A 5T41A 4DIEA 3DEFA 2V8OA 4DLUA 4J7XA 1JIKA 5JALA 5KG3A 1KI1A 2GRUA 3AFOA 3PX7A 1L5YA 2JNWA 1AO0A 2O8BB 2Y67A 4NBWA 3NETA 4M7EA 2OCKA 4MGYR 4BJ5A 2X19A 3TOCA 2JFBA 4XUGB 4GYJA 4CE5A 5BVHA 5BR8H 1FFSA 3HU1A 1E99A 4FQ5A 1U5CA 1MD9A 4A3EG 3PQ8A 1JZSA 2OUIA 1RRKA 3DFFA 5C5IA 1B33N 1JB9A 1SXJD 1TYZA 2HRQA 2PFKA 3HABA 4HUQA 5AJWA 1K7XB 5JYEA 3U16A 5BV7A 3JQ7A 4DV2B 4L72A 3DH0A 2XTNA 1EP3B 1YMQA 4GKJB 2W71A 2B36A 1TPZA 1HDXA 2AJ8A 4BB0A 1BAPA 2PMWB 2ZQZA 1U65A 1KFEB 4QPCA 4J0HA 3OCWA 1OAAA 3WHIA 1L5GB 4LWOA 3R4VA 1RLMA 4Q02A 2CFMA 3BTVA 4P7FA 4BXOA 2GA8A 4ZEXA 3NVMB 2VDWB 4BYGA 1GPWB 3GZNB 3IP6A 4XLTA 2Z02A 1JDJA 2WMOB 2QE7A 5I9MA 4C6HA 2ZBUA 2PRYA 4PAGA 3FUWA 2Z30A 3UJBA 4ZDIA 4B80A 3ECSA 2YUTA 1TQDA 4LHEA 2PUCA 4DLRA 5B3LA 1M2FA 1FMTA 2CYCA 2R1VB 3VKGA 1EJ2A 3K3PA 3KJQA 1Y5IA 5DHQA 3OZTA 4ZVTA 5IARA 1Q0PA 2IYYA 2KMLA 3AHJA 2BJVA 2X0DA 2J9FB 1UDAA 1QZUA 1YBVA 2OB1A 3EISA 1RYNA 3FXAA 4RZIA 2C2XA 2ACEA 4M8IA 3ZGVA 5JBQA 4J9VA 2PY6A 2X3FA 1IL0A 3WKEA 1P2SA 2EERA 3DP9A 3MAGA 3N05A 2XITA 1Y6ZA 4WI1A 1O8CA 4P8RA 3K9WA 5I45A 2D5CA 1Z6PA 1YS7A 3I8XA 5LVAA 2Z2KA 1Y3FE 1NI5A 5DGCA 1E79A 4FFRA 3OH8A 4PWYA 4JEMA 5I9BA 1J8FA 2A0XA 1P9OA 4HNRA 4DBLC 3ZWOA 1BOFA 1RC1A 2HNBA 3RRBA 5FTWA 4Q93A 1BMQA 1CKMA 1WNFA 1ZKMA 5JWHA 4TSKA 2BKVA 2XMGA 5U1PA 4CDNA 2AKEA 3HLKA 3QBTA 5BWNA 3OT5A 4DRYA 4TQ9A 4DLTA 1EK0A 2JEOA 4NFYA 3DV2A 2FY8A 4AF8A 1LJ8A 2H1RA 3PIIA 4Q1DA 1ZGAA 4LW8A 4CMHA 2QGFA 3MTEA 2H1IA 2L0XA 3PNOA 1ZHHA 3EMKA 2F3TA 1X19A 1M5RA 1I5RA 3RIYA 4JBGA 1GZUA 4K2HA 4HVCA 4V1CB 1CEQA 1P7CA 4EYSA 2GJ4A 2F3PA 3SJAA 3RI3A 5LYJF 3IT3A 4IO1A 4L16A 3WK5A 4D3FA 1I0LA 4EBEA 1NBAA 1ZIYA 4YPFA 2ZBQA 4EFNA 2GF2A 2F17A 5JD6A 3H5AA 5TSDA 2FPPB 4ZJUA 2WFMA 3WWYA 1P29A 3B8EA 1RI1A 2Q99A 2VAVA 4KQHA 3CNOA 4UM7A 1TUEA 4Z4GA 4ECVA 2JARA 5A0FA 1T1IA 4HI0E 1ZC3A 4RVUA 4MKFA 4OQMA 4Q19A 1ZZEA 3HB4X 4AZ0A 4B76A 4O2RA 2BEJA 4TN5A 3CVJA 2EC5A 2BUAA 4L0QA 1K7YA 4NIMA 2WB2A 4W1SA 2P68A 1VLMA 5BNZA 3C16C 5I5XA 2AQ4A 1UBHS 1ZLYA 3LVBA 2LD4A 4GMFA 4DLKA 4MRAA 3DMTC 1QWOA 3EVTA 5FWDA 1A9OA 4PO1A 2GNAA 2XBLA 4X54A 3H1GA 4LV5B 4RABA 4DV5B 4O7LA 4RD2A 3TBFA 5KFVA 3DCJA 3NHJA 4ZQCB 4LZWA 3L8DA 4AMGA 2RH5A 3MSXA 1O5IA 4D8WA 3K70C 3OOJA 2XDYA 3W90A 1IIRA 3FIJA 2QG4A 4KFUA 4KXWA 1XHLA 5EWGA 1CRZA 2QLNA 4IGKA 1O94D 2AH5A 2ORED 2X7HA 4KWEA 3T3GA 3WB9A 4D4MA 1YB5A 1XZ8A 2DG2A 1JIIA 2WPDA 4HQFA 4LVNA 4DWVA 3H8WA 5EQFA 3I73A 3VPGA 3WK7A 5B3JC 5I4CA 2FWBA 4APMA 1T35A 3ZK9A 1Z4JA 5IW8A 3K0CA 2WF9A 2G1KA 1G21E 3CH7A 2H1WA 4Q7EA 4GPIB 4NBKA 4EI9A 1F20A 4G63A 4BL5A 2QRLA 1RM5A 3RYCA 1SCIA 1YQTA 1ZUWA 3E70C 2AG1A 4QWBA 1RAHA 3U7RA 3T1YH 2RJNA 2WKPA 5F33A 4TMTA 5KOYA 1MVLA 3MLAA 4UM5A 1Q7BA 1BE8A 4Y8VA 3CLSC 4JV2A 1T8UA 2C0QA 1VOTA 1K7FB 2PKRA 3DULA 4NG4A 3T4EA 4ERXA 3CF4A 2X1HA 3FKQA 1KF0A 2H1HA 1YKSA 3EF3A 3HDVA 4LXUA 4TUYB 1MZVA 1YJBA 1KC7A 4NLLA 3K96A 2XOEA 3WE7A 4BU0A 1DRWA 1TU4A 3R09A 5JPDA 1SPBS 4Q9LA 3KAJA 2L42A 2VQFH 3GH3A 1G6KA 3FYUB 3NEAA 1UBCA 1MB3A 1MP0A 1QGED 2ZIEA 3HI6A 4OBWA 4YAFA 1OX5A 1DMRA 2IXTA 3OIGA 3KV3O 4Z0HO 4CLXA 1SY7A 1Z2CA 3HKBB 3ZIAD 3PFKA 5GTDA 4ZT4A 4BQEA 6Q21A 2PJDA 3HCFA 3E5NA 3IJPA 1PG5A 4NCIA 4B75A 1E9CA 1QC5B 5DULA 1L8XA 4B2IA 2H06A 3X1DA 1E3SA 3M5PA 2PEYA 1Y37A 3IURA 5EHQA 1UBGA 1Y9AA 1XLTC 2O9JA 4F2HA 1ONPA 3CTPA 4R7RA 4DQXA 3H1FA 1RZRA 4INZA 4QA9A 1G3QA 1WUKS 1HL7A 1UT5A 2R4UA 4X00A 4BMXA 1JEAA 3IIJA 2H1LA 3U4QB 5AD1A 2XRMA 4BKUA 3AESA 3H4MA 3ILHA 2YZMA 4EA7A 5JBNA 4R8SA 2CKZB 4PLPA 1FFDA 2D1RA 4E1BA 4EGCB 2I3DA 3X3HA 3ZX4A 2VAXA 4IL5A 2GBFA 4II7A 1VXOA 2BBOA 5B7QA 2I5PO 1TTHA 3VNVA 4MYSA 1X7YA 1PR4A 4BGVA 4HH4A 2CL6X 1JIVA 2HNAA 1P18A 2ZYDA 2P2YA 2LZ0A 1GAEO 1W1UA 4YT5A 3X1WA 4DMCA 4F96A 3HDYA 2WG0A 5A9SA 1ICEA 2PMZE 3NBFA 1DC8A 1ZGCA 2HB6A 5H5JA 3TMYA 4B3BA 2FWPA 5K20A 4HG2A 4J6FA 1G1AA 2R00C 2LVBA 4FHFA 3WQHA 1GZVA 1MVNA 3N70A 4I5GA 3VYRB 3FKJA 3ENKA 3B6IA 1ISPA 2D5BA 6REQB 2YV1A 1VSUA 1II8A 3K92A 1LPAB 3KJZA 4M98A 3WL3A 2F00A 1YUMA 4FMDB 4AL4A 4EUKA 1TJYA 4MVJI 5IM4A 3O0TA 3RE1A 4KRGA 1RIIA 3UA3A 4W4TA 2YDXA 1V11A 1Q22A 3GHHA 3MFYA 4IFEA 4PINA 3C0FB 5TF0A 2JLAA 2PXHA 5LBIA 2QB5A 2K5UA 4AFNA 4II3A 1ZCBA 1KOLA 4IIVA 5EIEA 3WAGA 2ZZKA 4XYGA 2TMYA 1OPXA 1TPYA 2NVYA 1U4SA 4J9MA 1MT0A 1PUIA 4HLUA 3TNYA 2XZLA 3MGBA 1GGMA 4BVEA 1I7DA 3IQWA 1TRHA 4UE2A 3ZDDA 1YQUA 3B6KA 1BCRB 1ZJYA 5LB4A 3PHGA 4JB2A 5KFUA 1TUBB 1W4AA 3UJ7A 2ZI3A 4G1FA 3TMAA 3LE8A 1G9SA 2P9EA 4PYJA 5EUQB 1QIJA 1E9FA 1TD1A 2RHHA 2Y0BA 2OG2A 3BE8A 3M4NA 1N6LA 1E9DA 3D8BA 1IN5A 4QUKA 2W7TA 4AJ1A 1RAAA 2PQMA 2FUG6 3JYPA 4FFSA 1HNZB 1NSYA 4V2UA 4B44A 1IN4A 1FU4A 1NI4B 4HY3A 4JGGA 4OGFA 4UHKA 1XRRA 4ED8A 2FPUA 5HYVA 3C8DA 1F9EA 2EJUA 2G25A 1DC4A 3BWEA 2VOJA 3PFCA 3TLJA 3TOVA 4C5AA 5FQOA 1V9CA 4AQYH 4DJEC 1P5RA 3V9AA 1XYVA 4A23A 2VSOA 1LRJA 1EFKA 3AEKB 4WPGA 1HEUA 4XR4A 4YP3A 2UXCH 5L1JA 3P4YA 4B3HA 4IW3B 1RQLA 3OZIA 5E38A 1CWUA 3ZWDA 5IF3A 4O84A 1JRLA 3DE7X 3OFSA 4CODB 2Z6UA 4CEHA 1ECLA 1M5UA 1DPGA 4NMHA 4OK5A 3MBIA 3ORRA 4RMGA 4IJ6A 1ZWLA 1L5HB 3PFGA 3E8MA 4R6XA 3NJ4A 2OE2A 3ILXA 3PWSA 3BORA 3AVYA 4QXAA 4MQ6A 2AYZA 3BFVA 8LDHA 4NH4A 1J2RA 1TEZA 4C4TA 2OD9A 4V1CA 1HMPA 1EJ6A 4D5GA 1ELOA 1V8OA 4PGMA 4QE3A 1E0SA 1Q74A 3AF5A 1NN1A 3F0TA 4R2HA 3RIXA 3W2TA 5C81A 4GE0A 3V8RA 5F2EA 2NUAA 4C9BA 1D5WA 1FYXA 1B14A 1NJGA 1PO7A 3BMCA 3LCUA 3UWKA 4YJDA 3ER8A 5JDIC 1I2AA 2H2DA 2R7KA 3ZXIA 1X7HA 3NGXA 4YQFA 1UBFA 1R4MB 2OV3A 2R4QA 4IJQA 3L02A 4FE3A 5JSYA 4RJJA 5FWXB 4PLTA 1A4XA 5P8WA 1R6VA 5C7LO 5C9ZA 4YDHB 3ZZ0A 3SQLA 2EF1A 2ZRLA 1CZRA 2GD6A 1WP4A 3TLAA 2PVCA 1SA0A 4U3JB 4YONB 4DLPA 3HVHA 4HKTA 4YWJA 4Q4CA 2FKLA 4LIPD 1AK2A 4EMTA 3H3VH 1F14A 2UUCH 3FUVA 1KJIA 4IIHA 1PJQA 4EB6A 3IPAA 5BR1A 4MI9A 3IA2A 4RIEA 5KNDH 1PDOA 2FNAA 3KB2A 4PG5A 5EJFA 3MIZA 2DBYA 4MGHA 3SYLA 3EUFA 4C4SA 4LVCA 5ITSA 5DB4A 1AU9A 3LL4A 4EPWA 5KOJB 3FYDA 2NSYA 1C80A 1JDBB 3TGPA 1E2UA 1YZFA 2OG1A 1CIJA 3AM4A 1X7DA 4C7OA 4H7FA 3CUKA 1CR2A 4NMWA 3CGGA 4EW2A 2NO9A 2VYVA 4HBGA 2RJ3A 3IIIA 2R1UA 3EGDA 4GC5A 2YQ5A 4KFSA 4PZAA 2FW0A 1KDPA 4DKJA 5E1MA 1J1IA 3OE5A 4OKNA 3AH8A 4S0ZA 3T4UA 2FXIA 4X6YA 2A33A 3Q8PB 5HSGA 2XNSA 5DGDA 3ZHTA 2JVKA 5AVXA 2BBWA 1QAQA 2X2EA 4L51A 5G0VA 3L2OB 4ETWA 4JJFA 2O3RA 3VGPA 2FEPA 3F8TA 3DZKA 4J2HA 2GDJA 2O19A 2ZTVA 4MRPA 4DCNA 4D9NA 3NNDA 2SCUA 4LHZA 5J4KA 1ZH0A 4EENA 1DZIA 5IBRA 1Y7PA 3M4XA 2VSXA 1VL8A 3MPOA 4A16A 4DR6B 1P77A 3LDAA 1RYBA 3SP1A 3L9WA 1G59A 4E94A 4EX7A 5LP6C 5DWDA 3QEMB 4LNUA 4ZQGA 5DXFA 2A58A 3I4MG 3DAPA 3FDSA 4XGKA 4B3IA 2X23A 2J4CA 2IUSA 4FE4A 4TZTA 2VNHA 1CERA 2YINC 3HSSA 5ALKA 1CUUA 2HO5A 2Q9CA 1N7IA 3FYSA 3GGSA 4PG8A 4YT8A 5TR9A 3RGWS 2CZCA 1CY4A 4LVOA 3GROA 5SYMA 4V2IA 3DZHA 1Z5VA 1SOVA 2KBFA 4C0AC 1YE8A 1PJBA 1EQAA 2I7VA 3OEYA 3EF1A 1QTIA 3CR7A 3UB4A 1T1GA 5CBPA 5I48A 5FLKA 4L27A 4WLUA 5EHGA 1YZHA 3K8OE 3KAQA 5E6UB 4BLWA 1EDBA 4EKDA 4Z4FA 3FTQA 2OYCA 3TECE 2ENWA 4F97A 4YCSA 1YR1A 2E5WA 3BQ9A 4Y2HA 4RPLA 3U7EB 2R62A 4OHRA 1AN0A 2RHMA 2XCUA 2GF0A 1Q19A 3SR4A 3WSTA 1YOVA 3A28A 4QGGA 2DPMA 2OWOA 1OKKA 3R5SA 4O2AB 1DFIA 2XLCA 1TKRA 1UNNC 3KHUA 3VMMA 3MCWA 2VWQA 3QEOA 1A97A 3OQBA 3OTQA 3RFUA 2CLKB 4OSEA 3WZ2A 1G21A 1T25A 3AO0B 1N3LA 1DUSA 4TWRA 3WGHA 1EI9A 3O84A 3B6MA 2EFCB 3TKYA 3R5XA 3UQ8A 3RYIB 2C7RA 5JRJA 3ZU6A 1JDZA 2FLNA 3Q3CA 2F3SA 1Y8CA 1XDNA 5TQVA 3W3AH 4UREA 2KSQA 2X0EA 4BEVA 5ALTA 4LFCH 1HURA 1YFKA 4S2UA 1NLFA 2B35A 5EQTA 3RK1A 5JZ9A 4BWSC 1G20A 2IYAA 1NLYA 1NVGA 1VMDA 3BMCB 3FBWA 3I8SA 3OUTA 4NPHA 4EITA 1Z37A 2DX7A 1UOOA 4GI3A 3SHVA 1QKIA 5BWWA 2GNOA 5TGDA 5L4LA 1L5RA 5K3SA 1BYUA 3HR7A 4JLMA 3M49A 2PX5A 3T7TA 2OV8A 3TOZA 5KTTA 2XAUA 1EUDA 2PKXA 2IYQA 4FGSA 4MRVA 3VM6A 4Q7QA 1THGA 2DOKA 3L0BA 4UU8A 1BHJA 3E4CA 2BMEA 3I53A 1QX4A 4NAHA 4UBKA 3TGWA 3DE6X 1U9YA 4ZCIA 1C50A 2IS6A 4EYHB 1X9IA 5AVJA 3TAXA 1H6DA 2C42A 2HT6A 2NSDA 3DPIA 1K4KA 1WO8A 4J9RA 4ZCTA 3OU6A 3RS4A 1LGYA 1ZOIA 2I0FA 2JAOA 3KD3A 3JRWA 2I3AA 3TE7A 1XLUA 3ZN2A 4KR0A 2XGPA 5HM8A 4JI2H 1QO7A 3X1YA 4II2A 1XLWA 3IOMA 4B9AA 5BORA 4WESA 1E6WA 1N92A 2C03A 2PJZA 4D74A 3T41A 2VRWA 1J8MF 2BCEA 3LQ4A 5HOQA 2IPMA 3VQTA 4P4SA 4IG9A 1MC8A 5DOZA 4JUIA 4MMXB 2ASVA 1KTAA 1TZCA 4CXMA 1DAAA 2GCIA 5C8XA 4UUPA 3RUPA 4MGKR 2DBVO 1DJLA 3KYDA 4ND6A 4LI3X 4YJGA 3UFXB 2AIRA 3W5SA 2IIBA 4CN8A 4FDVA 1ARZA 2FDRA 2G72A 4N5LA 4Q1FA 4Z9AA 3WLLA 4DADA 1G20B 1WCXA 1QB8A 5ADHA 4PC7A 5DLDA 5B7GA 4BRWA 1JEJA 4W7IA 4EHIA 4KZPA 1KIFA 3NAGA 5NULA 1HRDA 2V5VA 2FE1A 4RY9A 4CC5A 4X64H 4OREX 4WNAB 5EZ6B 2ZRDA 4ZN6A 3EMDA 2AHOA 4O4JA 3R3XA 3CVOA 4PY2A 1PFKA 1QRDA 2BONA 1LSSA 3ABOB 3N0RA 5E8RA 3NUGA 4QWCA 3UTDA 4PYLA 4ENQA 4GR4A 5IULC 4R8UB 2X6TA 3EEFA 1UMBB 1W30A 4GQBA 4XM2A 3ZU2A 4PZ7A 2GK3A 2XQGA 3M6FA 4OJQA 4LFBB 2IIPA 4O4IB 3P2YA 4F5ZA 1RE1A 4HVLA 1QYIA 1ZISA 1U9ZA 4QG7A 4DS3A 3ER6A 3P5SA 4EG5A 2G4LA 4GSYA 5AKKA 3SI7A 1V51A 2WWTA 3LNCA 3PJEA 3VPXA 1BCSB 1DQZA 2BFFB 4BASA 4NOJA 4M36A 4IWXA 4QBHA 2CUKA 4BDSA 3RSFA 4BO6A 5G0SA 4KQ1A 4RD4A 1BE1A 1SCUA 1NZDA 2WNSA 5FV7A 3WKBA 1J0EA 2YXBA 4BNLA 4NBUA 1N4AA 1VL0A 1XCJA 3GLQA 3TRDA 1JNXX 1OZ0A 5KVSA 1XYGA 1JXOA 5A5GA 3WNQA 5JBIA 1CEYA 2F1RA 1U3GA 3DTFA 2W5UA 2WTBA 2X14A 4M2LA 1RMTA 3T5HA 1GRQA 4CMIB 5I8WA 3C6MA 4PGAA 5DG7A 4CCYA 3GJ6A 4QRIA 2BRUA 5BQOA 1VHDA 4NBSA 4PZLA 5CTAA 3PVZA 1MB0A 4Q00A 1DWUA 2XWBF 3BEOA 1X87A 3O1LA 3Q3HA 5CU7A 4W9RA 1UWVA 1WQ1R 1ZM7A 4K9OA 1HLPA 4YALA 1RPJA 4EVSA 4BN0A 5LD2C 5IABA 2EHJA 5ES3A 1CRQA 2BGJA 2SCUB 4YRJA 3NHMA 4OL0A 2R8IA 1BMFD 3X1XA 5LFAA 3OKAA 3LX6A 2TMKA 2O5CA 1EJBA 1Y7HA 4MWCA 4UOQA 2Z2ZA 1QYXA 4ECZA 2C5GA 4ZYTA 4DL5A 3IE2A 4H77A 5HBGA 4YJ2A 1T5IA 4HAXA 3GUHA 1ADJA 3TZCA 3ZD9A 2LKCA 4RDCA 1FP6A 4TTSA 2DBRA 3KCQA 2G9VA 2CL7X 2MIIA 3G1TA 1XRSB 3O1JC 3Q0TA 4FEGA 1Y6GA 1G55A 1N2BA 2OY0A 1Z7EA 3C7KA 4ND4A 1SVSA 4Z53A 5KFMA 1CCWA 2B78A 2Z1MA 1EDEA 4YJ3B 2YRWA 1E60A 1DSSG 1XZJA 4W8OA 3BTUA 2JIOA 4YDRA 4B48A 2HA0A 5I4BA 1OCEA 3DLAA 1Z4IA 4DAEA 4BEWA 4QQRA 1CJBA 2A1UA 1R6BX 1Z6TA 1BDHA 3AEXA 3OIVA 3GCXA 4EY7A 3KZ1E 1E6CA 3AGQA 2CHUA 5F1KA 3H0CA 1SHUX 4GQAA 2NWQA 1CJVC 1NW5A 4AN1A 4LMPA 2YNMC 3E1GA 2FG7C 1A5SB 1U7HA 2CHQA 3EIQA 1IBRA 4R8UA 4U7GA 5L7TA 2QUJA 1BU5A 3H9CA 2FE3A 1N36H 3Q9NA 4KE8A 5ALQA 1E0DA 5F2KA 1UAYA 1PFYA 2NGRA 3KL4A 1M83A 2XTMA 4HR7A 3GJQA 4RFSB 1YACA 1E5XA 3F1KA 5EHNA 3S29A 1HTWA 1Z3CA 2PZJA 2YWGA 4KAAA 3NALA 3DTNA 2V7UA 3EEOA 2ISCA 4LOIA 4TM8A 3AR4A 5AM4A 2OMEA 1K0FA 4UUAA 2ZT7A 3CLUD 5CDHA 3T7KA 3MWDB 3ONNA 5E1BA 1I3LA 3DAGA 1T4CA 5T67A 3WWZA 1SUWA 3V4RA 3UATA 3T0FA 1L7DA 4C4PA 3DAHA 5DG9A 2WIGA 5JDCA 4J0JA 2YCBA 3FGPA 2O5RA 2AMYA 3EA0A 5JH7A 2WV7A 4JKIA 4AS1A 5KYTA 5F9NA 1KUTA 2UUBH 1ZJ6A 1EFVB 3GIQA 4HL6A 4Y1EA 5JS7A 4MV4A 4X1YA 3TKAA 4UCVA 3IUPA 3W1GA 5KFFA 2VT6A 4DM7A 4GKKB 2QTMA 1EWVA 1K0UA 4MUKA 1E89A 1O4VA 1U2RA 2ZETA 4QTXA 4ACBA 4DR4B 1DADA 5C3EG 3G8YA 4OP1A 3A2KA 3OT1A 4G24A 4W5OA 1UJ2A 4LOHA 3H05A 1T26A 2ONJA 1SUCA 3REQA 5D1NA 1HE5A 2O8VA 4D9GA 5FP0A 1OXVA 1ZCFA 1WB5A 4R51A 4RF5A 2DU8A 3FHOA 3VJLA 4QGFA 5DIZA 5AI5A 1Z56C 3E6AA 5IKOA 1KFJB 4XEUA 2R6CA 3QPCA 1Y0BA 1JU3A 4K81B 1YB1A 4DR7H 2VH1A 1YQ9A 2LUOA 4KPUB 4PLGA 1PTKA 2JCXA 3VYVA 4C7VA 1I7QB 3UGJA 1NTRA 3RAFC 1GA1A 4PONA 4JC8A 1XMXA 4B31A 4UTXA 3VYUB 4E2YA 3ZS8A 5AM0A 2FFJA 1ENPA 1V7QA 4I2NA 2PHZA 3IT0A 3QUTA 4PNEA 3F6EX 1G4HA 1QOPB 1HMYA 1PJ3A 2PUWA 5IC6A 2Y1EA 1Z39A 4Q3KA 3FWPA 1Y6FA 1FJGB 4JELA 4B3TH 4ED0A 1Q0HA 2J9XB 2DUMA 1AQ6A 2EIXA 2HU2A 2IPLA 2XBUA 3NM6B 3OTHA 5LZ9A 3VKHA 1WVGA 5FTJA 4OQFA 3TLKA 3OCZA 1TL7C 2BH9A 2IV2X 2JA6G 2BJWA 4ETNA 1NR7A 5LL6P 1SJ9A 2MSEB 3JRNA 1U80A 5DZSA 3CF0A 1F8UA 1YB2A 2HZ7A 4YV7A 4CDGA 3C87A 4IFTA 2GYWA 1Q20A 4BP8A 1U1DA 1DB3A 2EBWA 4N3BA 1DOAA 3C6YA 3BKXA 3W34A 4DARA 4X6LA 3E05A 4XB2A 2IS2A 2YFYA 2ZP1A 3A05A 4LYJA 1FFHA 1P4JA 4KMSA 1IZ9A 3CS3A 2RF4A 1RACA 2IDZA 2F9FA 1HEIA 3JWEA 5JJCA 3K3VA 3UXMA 2N9UA 4ED9A 3U49A 2JJ2A 4ID9A 3CR3C 4M21A 4NYIR 1CY6A 1GQYA 3QYAA 2J3IA 4LJLA 4YAIA 3JTEA 2Q7DA 1SZPA 1DKPA 3JZAA 4P9NA 1SB8A 3H1TA 3PDCA 3KHGA 1CUSA 4WY5A 4POOA 1C3LA 1QV6A 3I04A 3W5BA 3QEMA 1UKBA 1D9XA 4RQUA 1CY1A 4TTPA 5A7HA 1A8QA 3W1BA 5D3MA 3R76A 6REQA 3NYWA 4G5RA 5EUMA 3RAPR 2I8AA 4KRFA 4JROA 4J1NA 4KH0A 2YZLA 1PNQA 1JLRA 2VYFA 1GPDG 2YHSA 3CEMA 3OZCA 1GGJA 3EDOA 3PICA 4Z3KA 3DOJA 1D1PA 1NBMA 3GPIA 4XUCA 1NFQA 1PVVA 2ZI4A 2EX4A 3EZGA 3H18A 3PQ6A 4JI6H 2RFLA 1H0RA 1X6VA 4XIYA 3GTPA 1U81A 2RGAA 4KO2S 1YRWA 2R1VA 3AJ9A 1HO3A 3MPUA 3L77A 4OHPA 4XIGS 3JSAA 4B17A 1JJVA 2G1JA 1SKQA 1T9KA 4E4YA 4K7JA 4CKCB 1S1MA 4RD1A 1E2DA 4B7UA 3ENVA 2C22A 1XTPA 1C3EA 1ZGBA 2DVMA 4HDOB 4AN0A 4CKYA 1TAQA 2PH5A 4RDHA 4QKQA 1XB2A 1WBDA 5DNUA 3G23A 4EFLA 3F4KA 3CG4A 2J7PA 1JJBA 1PS8A 3R74A 4TX1A 1RKXA 3FBGA 3LY8A 4IMPA 2GH1A 3WAJA 1BS1A 5GVSA 4C7OB 1QWSA 4D25A 4UCTA 4F5WA 3VOAA 1WDLA 2VF5X 5LCXA 3BQ1A 1WKCA 1CLUA 3F71A 2GJ9A 1XD8A 1YONA 3VGJA 3Q41A 1W49A 4HUJA 2GN9A 2VJMB 3JVEA 1PSZA 2C2ZA 3KELA 4W6QA 4Q6BA 4OJMX 4ZVPA 4BNIA 5SY4A 4BFCA 3K9QO 3BSSA 2VYQA 1SEPA 5F5XA 5G0UA 4JS0A 1SUDA 3INGA 4YBRA 3P20A 4R3NA 4R6WA 1ENYA 3RYFA 3WL8A 5JSQA 1KNQA 1SXJA 4J7UA 1UJ4A 1V48A 1CUHA 4LQLA 1CETA 3TUJC 4NHOA 1ZRNA 1GGHA 1W73A 2TMGA 2VBCA 4HH3C 2R3SA 3KETA 1EVJA 1J5EB 2CVZA 1QH9A 4O1HA 2QLJA 1E3EA 1E1MA 1MORA 3E2PA 4KMOA 4OHOA 4CN9A 1O03A 2ZYGA 1NZJA 2VEDA 4ISBA 3ZBPA 1L8AA 5KI6A 2IF2A 3GRVA 3DNFA 3FUCA 1NF2A 3G9QA 3WLIA 5K0TA 4DG8A 1K6MA 3CRMA 2DWUA 3RB3A 2BGRA 2C2YA 3AP3A 5KTSA 1SC3A 3GLHE 3RRNA 1X7XB 2Q4BA 2ZITA 2WJGA 2J3MA 3QE3A 3AK4A 3CBGA 3LQRA 2XZTA 2DUUA 2OGZA 3I5YA 2I9KA 4CM5A 5CR5A 4PYRA 1AOXA 4B7ZA 2WI8A 4N4AA 4AMUA 1RJPA 5E9QA 5BUCA 4HLUC 4UHCA 2QVZX 3N87A 5KT6A 4DLSA 3AUKA 5HJ7A 3FNGA 2RI1A 3Q5EA 2W2KA 3BK2A 1X8JA 1R4AA 1N7GA 1ISHA 2NSJA 4JBHA 4RKQA 5LDDC 1EVLA 1R5JA 4FSDA 3UIEA 3P4UA 4DR1H 1OFIA 1FX0A 2GCGA 2YCHA 1C4XA 1P1KA 1XK5A 1SD2A 5HKAA 4XWOA 4O63O 2BHTA 1N34B 3KUXA 2GFIA 5JMOA 4ECUA 1QF9A 3SNOA 4E08A 1LZKA 3IUMA 2GAOA 2XDQB 3DBRB 4NV3A 2AG5A 3DV0A 4PFKA 4UDOA 2IWHA 4A0GA 1V1JA 3BGWA 1P44A 3HOVG 4FYJA 1K5GA 4LBWA 3RANA 3T06B 2QBYA 1D3AA 5LMNB 5HHTA 2AXNA 3NEJA 2YJNA 4BV3A 4IJKA 2UU9H 2P4UA 1LI7A 2ODQA 3I52A 2MR6A 4KUEA 5CVJA 3TNJA 2YJ5A 5EOVA 5BN4A 1GU0A 1EHIA 1ZD4A 3ZV4A 4PSUA 4ZIRA 1X1RA 1CUGA 1LKZA 4ACAA 1W47A 4FONA 1EBFA 1QORA 1D09A 4GXNA 4WN9A 4DJTA 4LGYA 4RM2A 4BS9A 2GXQA 3H20A 3K0EA 2HPAA 3OP1A 2GOYA 4WXEA 5GZ3A 5IDYA 1RWKA 1XLVA 4MS3A 2JHAA 2RB5A 4JUFA 2Q5QA 1QRAA 2GBCA 2VYCA 4MVJE 5HCIA 3O75A 4BNJA 2YWDA 4AJKA 4D80A 1A8UA 4TYWA 2HHHH 4MEAA 2V8BA 1USUA 4DR5B 4GG1A 4IXMA 4K6KA 3PJDA 1DX4A 3E9ZA 3DMPA 2XSZA 3ZYZA 4PAOA 1K9VF 2IX9A 3PD1A 4IIEA 5FI1B 4U4AA 1FDRA 2LR0A 2ZBEA 5J5CA 3F74A 2Y8EA 1UBLS 2HMSA 1SZDA 2UVWA 1D1TA 5EKTA 3WWIA 1QPGA 4F6LA 4FCVA 4N6OA 5HUQA 5CA0A 2BTQA 1GZ6A 3LFUA 1EVYA 2YY6A 4KI0A 5EIOA 4GE3A 1I5EA 1KK3A 2G9QA 5FR2A 1AJEA 4YJKA 5IKMA 5GJCA 4TV8F 2W11A 3CKMA 3HMKA 4M9UA 4PNPA 1GCIA 2W2OA 1QYVA 1XZLA 5F3RA 5CBKA 3K9BA 4ZEMA 4IDEA 4RHUA 3L49A 4AICA 3OIWA 1S3FA 1BRMA 5C8VA 1WEHA 1Q16A 2PUEA 3N2GB 2ZIAA 2GPBA 3OOHA 1O94A 3CV3A 5K8LA 1DHTA 4YJFA 5KYXB 1NN5A 1YBMA 4KACA 5FWYA 3W8NA 1W5FA 3NHZA 4IF4A 5FUBA 1HZZA 3M33A 1GYPA 3ZD7A 4AT1A 1JVSA 3EULA 4K40A 2QP4A 5E3JA 3BWMA 3ETHA 4O4JF 2BFDA 2O8CB 2CXOA 1AQUA 4Y6RA 3SOPA 5U9CA 1P5HA 1EG2A 4YHHB 5HX7A 4BXXG 1FBNA 2QLBA 1DCTA 2E0IA 3SKYA 2AZMA 4YUYA 4P0QB 4ZDKA 1T9AA 2YVLA 3VTZA 3IO5A 4ZTUB 2NVUA 3HKCA 1B1AA 3RSQA 2UVPB 2XEDA 1U8ZA 3E35A 3AKZA 1L1EA 3WGMA 4JEIA 4X7MA 1X9HA 2RCNA 2XNCA 5CNKA 3HXOA 2JG3A 3I64A 4QWDA 3E5RA 1GG5A 2P6UA 2RGEA 3SHQA 1GT6A 4LF5B 1KP9A 2O06A 3KKPA 5IEBA 3RS7A 3A2NA 3PXXA 7REQA 4L95C 1PZNA 2I6QA 1OY1A 5C1PA 2NN3C 2VP0A 3KXIA 4JI8B 4UMDA 3H3JA 3BJEA 3WOVA 1R0KA 1JEYB 1SAYA 4QSHA 4D8TA 4EI2A 2RG7A 5C8DA 1XT6A 2PDAA 3TTSA 3AYHB 1YI8A 3D6MA 3HUDA 4WADA 3PQ5A 4N8EA 1JJFA 2VZ8A 3MGKA 3N07A 1QHFA 3P45A 4B46A 2C9DA 2F8MA 5JQGF 3ZOKA 1ACJA 3EGWA 4IAOA 4NFSA 3TXXA 4DRXB 1Z25A 4XCXA 1DX9A 3PKJA 3PNQA 1A9PA 1LW7A 1TEVA 3B6EA 1ZO8A 4YACA 4CW7A 1XMQH 1NMSA 3D8UA 4RO0A 2XYGA 3L06A 2X7XA 4XCQA 4M6WB 4NHEA 4QUAA 3ME5A 4IDGA 3VVLA 2PZLA 2B4RO 1ZJZA 3FSJX 3U44B 1V16B 2OGSA 3LF1A 3PW5A 4N8DA 3RVSA 4V0OA 3MJVA 3ORHA 4F9GA 5IS2A 4UUBA 1PG0A 4BUCA 3A4IA 2AC4A 5JSZA 1Q0UA 2OCYC 5LZ8A 4AY6A 5KYXA 2PL1A 1CP3A 2WAXA 2CKDA 2PM8A 4DCUA 2UYQA 3STUA 1MA3A 4RGBA 2J46A 4RHEA 1E9BA 3G2KA 3BWYA 3AUXA 3ICWA 2WG1A 4R1SA 3FM9A 5DCUA 1W76A 1FFCA 4QJBA 3LKZA 3R3JA 2WIBA 2TSYB 2FDXA 2IPXA 5E95A 3UICA 4YFYA 1E8NA 3L5KA 4DW8A 2P30A 1D4ZA 4IYJA 3DEHA 2GEBA 3HKBA 2OQ2A 1FFXB 4FDTA 4L5YA 5EJ4A 1JG3A 2AOWA 2NYRA 2NXEA 1XALA 3H2ZA 4FS1A 1W35A 2QPTA 2HFJA 3N41B 4LCEA 3GXOA 2Q2VA 5EJAA 3UT5B 3GLTA 3B6JA 1YWGO 2C77A 5B7PA 4JSTA 4TVIA 1UMCB 1XV5A 1NYLA 2VAPA 4NLGA 3LNTA 3U26A 4D9JA 3JQDA 2ZCVA 2ZAGA 2Z6VA 2QN1A 3G8BA 4JASB 3DYIA 1P7VA 2A0KA 4MK4A 4TV9A 2JHCA 3PDHA 5EN4A 4W5QA 3DDCA 3S1AB 3EIEA 4MR8B 3MWEA 3TZHA 1UKEA 1V8PA 1NI3A 3PG5A 4JLBA 1AF4A 4AD8A 5EJ7A 2Q4TA 4KLRA 5HDBB 3E7DA 1RXYA 2ZYHA 2PL5A 1Z8FA 3LXRA 3OU2A 4FQ7A 4DPKA 1XDBA 1SKAA 2W8KA 1UPUA 3RK4A 2YXLA 4E5DA 4NCAA 4O0MA 2M6RA 2VDRB 2ID8A 5TGTA 1G6HA 1U7DA 3KXLA 1DBWA 4BKPA 1EFAA 5KG4A 2CXSA 4CIYA 1BQEA 3GEDA 3VI3B 4BCDA 1H4QA 2IE0A 4W99A 4I1UA 2D2IA 2H16A 2GKSA 1QIEA 3DDZX 3LWNA 1WVMA 4W6ZA 1UODA 1HNWH 4JYAH 1UMDB 3LHDA 4QT0A 2IV7A 5KNBH 4DUZB 4MV8A 3KDSE 5CH5A 1H5UA 5A3RA 1JDNA 1CZNA 1HL3A 4KK4A 4MH0R 4RNDB 5REQA 4AZ3A 1C9JA 3F7TA 1WUJS 5IDQA 2QTAA 2GYVA 5H8WA 4DF3A 2QBYB 1BWQA 2B7BA 3U31A 3TSAA 2W9XA 3DOFA 3CZRA 4YP7A 1Q44A 4CHTA 1UADA 1PWEA 1VKNA 1BWPA 2AYYA 3DV0B 4AZSA 4Z1MD 5CLIA 5BVGB 1S0MA 1QGDA 1UDXA 5FORA 3SXUA 2VG8A 1U0EA 2M98A 2ZJ5A 3QF7A 3MT0A 3B1VA 4UVDA 2JBHA 4XE5A 3U3DA 1M3SA 4ARZA 2J4DA 4ECSA 5BSFA 4Z4IA 3MOIA 5BMVA 4RCNA 2EFJA 3PW0A 2C5HA 2HWXA 1A71A 1JWLA 1NUHA 1J0AA 2IBKA 1PSDA 1PYDA 3B1KA 3QEJA 4KV9A 2CL5A 5H81A 3WGJA 1PDVA 1M2OB 4B71A 4JI1B 3RU9A 3HYTA 4JYMA 4KYUA 1I94B 3JR7A 3LSYA 4U9HS 1RJQA 2JA8G 3D6FA 1P9WA 4YMUA 1G8JA 4MB0A 2Q21A 1E96A 4L5JA 5JAPA 1LK5A 1QH1B 4V0NA 2ON6A 4AMBA 1L4LA 4EKIA 2NTNA 1E3WA 1S6YA 3RTDA 4J90A 4ZJZA 3CLRC 3ZQUA 1V3UA 2XADA 3ZU4A 3A3OA 2X6RA 1WHSA 2FPRA 2FW7A 4RPHA 1UBOS 2CF6A 4E7PA 4PRYA 4IVNA 5CJ2A 3PEWA 3Q3EA 4F4YA 2R25B 3GBVA 1G5HA 4PGGA 3UMMA 2C2WA 2X1LA 4XFDA 2V7TA 3O4RA 3RS0A 2QQFA 4PIMA 3VR3D 3ZGLA 3E7XA 4KU4A 4ZD6A 3T5GA 2H1VA 3UYYA 4PR0A 2WAYA 4MUFA 3IBCA 4C5BA 2NVXA 4XDHA 5F9MA 5GPBA 2PWBA 1K88A 1POWA 4G3IA 4GP6A 1WPQA 3M34A 2QN7A 3QVUA 5DYYA 2WIKA 4MS4B 4MUYA 2ZIUB 3NX4A 2ZFUA 4J9OA 2H5LA 4QPPA 3SF0A 1C9DB 4OQPA 1XWIA 1QK3A 2BFEB 2RIRA 4DLBA 1TAUA 2HRCA 4BBAA 1NVMB 2HIHA 4PHTA 3T3NA 3MN1A 4DIBA 1BVHA 1K08A 4G5OA 3M6VA 5ARBA 4JJEA 1V0JA 1RAIA 4Y67A 3QJGA 3EZ7A 3DTGA 4LBVA 2BEWA 1RI5A 2ZULA 2ZW9A 3HY3A 4QDOA 5IJ9B 3V8PA 4DYDA 2OB2A 4LVUA 5EMJA 5FX2A 3GV7B 3T61A 2XVMA 2WJJA 1XEWX 4ZZ2A 5A5DA 5TIIA 1QZTA 1BFDA 5CVTA 4XGIA 2FQXA 2JI4A 5BOSB 3D3WB 2VRNA 4O4IA 3KYIB 1YC5A 3ABSB 2I2AA 1W5TA 5EJ6A 1RXWA 1OE0A 2C0PA 3U4QA 1P74A 3MGGA 1JQDA 1W2GA 4G8DA 4GXQA 3PPYA 1HDRA 3L7JA 3SYMA 5J63A 1OXSC 2JLRA 3G0OA 1ENOA 2RHJA 4F2WA 3EXG1 5SY9A 4E6EA 2H29A 3N5KA 3IRVA 1I6WA 3MLBA 3Q4GA 4FSHA 4G1CA 2W8LA 4UXHA 4BRSA 5IYZF 4WUVA 4DMUB 3U4DA 3M5WA 4KR2A 4G5YA 4HDKA 5KHLB 3KR9A 2A4MA 1J70A 5AOCA 4LXXA 2GVZC 2YXEA 4BVKA 4B74A 1FP4A 3Q9UA 2CLMB 1N1DA 1ORVA 3O8BA 2VT3A 5DW0A 4CMDA 3DEJA 2H2GA 2I4IA 4JL8A 4KDCA 1XHFA 2ST1A 1UXHA 4QPDA 4RGYA 5D6NA 1WULS 1F6WA 2BEUA 4O7YA 2WHXA 4ZXPA 1E58A 1VAJA 3PR2B 1FYFA 1G2WA 3SZ3A 4A6DA 1N7JA 1ODJA 5LP6B 4NJEA 4ZV7A 3FW1A 3FFBA 3TI9A 4PTYA 5HS4A 1F38A 4H35A 4J4HA 5ALXA 1P2FA 4QDUA 2AEJA 4WCVA 4ZI3A 3W5AA 4CIDA 3PEUA 5C31A 1I0ZA 1SRQA 4UUNA 4NK4A 2MCFA 4G86A 3OEED 4I5FA 4EJFA 4OMUA 4B43A 1A82A 1MX9A 2ADMA 2JEJA 1XA4A 2OLSA 3IMEA 2JFQA 3L7YA 4WERA 1BMFA 1KEPA 4AF7A 2YFHA 2PX3A 2E18A 2VP2A 1ESCA 5JAIA 1R15A 1I1QB 4N3AA 2XYQA 3BE5A 5K3FA 4YRFA 3EHDA 4LYEA 5AJXA 5CAEA 3W6OA 1P45A 3GNSA 5GM2A 1W6UA 1YRQA 1R8QA 1DWQA 4QO7A 4UW9A 3UV6A 4MQEA 2FZKA 4P33A 5KVVA 1RWMA 2VT7A 1NU6A 2W6JA 2Z56A 4IINA 4MS1B 3JQ9A 3V3TA 1APBA 3IEVA 1Y5RA 3F6SA 5B2FA 5E7MA 4EF4A 2NP7A 3MC1A 9ABPA 1QU3A 3TBKA 4GRDA 1EH5A 2IU4A 2QV7A 4Q5IA 4UQOA 4TMKA 3HP4A 3IXMA 4TUYF 3ZIUA 2Y0SA 1XK6A 4IIDA 4M9CA 1VHTA 5JU6A 3P9XA 3DEKA 2VDPB 5AJHA 2RGNA 2H54A 1BROA 4W9MC 3DC7A 4EA6A 2DB3A 4MWTA 1RU3A 2G5CA 2QZJA 1YBFA 5T3YA 4ZDWA 1BE0A 2OZEA 1HWYA 5TVGA 4D8UA 2F8TA 3A25A 4UATA 3C15C 4G01B 3T5PA 1BWSA 1PK7A 1Z5GA 4NU0A 1Z63A 2MYUA 1MOZA 3CEBA 2YNMD 5DI3B 5IJXA 1A9ZA 1IJBA 1ORIA 5I7RA 3LSTA 1B0ZA 2FPSA 3AUSA 3HOXG 2FPPA 3MUEA 4FS3A 4GIBA 1U9CA 4ETMA 2QSYA 5C1BA 1VPEA 3QTBA 5K3CA 2FZLA 2WAOA 3F5QA 2Q3DA 1XCBA 2FVYA 4G23A 2CJXA 4KFRA 2BKUA 4KV7A 3FSGD 3NG1A 4ESVA 2ICAA 2UYHA 1U3CA 5K4GA 1KEKA 1HM5A 2PZGA 2W2LA 4M1TA 1T0BA 1TFUA 2Z0MA 3FRJA 4BGDA 1LPOA 3DJYA 2GK4A 5CDTA 5K0LA 3H5WA 4YV1A 2H2WA 1FNSA 3AHIA 3PGLA 2HPVA 3ICPA 5T3UA 4EPTA 3CLTC 5CEFA 1PKEA 4OOEA 1RBZA 5KNBA 1PR2A 4ED1A 2CLCX 3IOEA 3V7YA 3NWEA 3KFVA 3QKUA 1LEHA 4KOAA 4BQNA 1IIBA 1RPNA 1YIDA 5CTJA 5F5LA 4EY4A 3LFHA 2GWRA 4TL6A 2WAQE 4QWAA 1A98A 1KEWA 3ESQA 2F3RA 1A3GA 1FSSA 1TZKA 1MO5A 4MV1A 1QJCA 1S2IA 4GOKA 4YIKA 4DT1A 5ABPA 3KE9A 4IQ0A 4G4SO 1Q11A 4BTEA 1NURA 2WZQA 3GGPA 4XZ3B 4RXMA 3SPXA 2IA6A 1IFXA 1PRYA 3N8GA 3PPIA 3IS3A 2DUJA 3U7IA 1NVUQ 4EPVA 3F8SA 5IBQA 3B52X 5J5AA 2MYNA 3ONVA 3UGTA 2GEFA 1I3KA 3KALA 4DGQA 3AR7A 2ODBA 3P9SA 4A2QA 2BVNA 1NKSA 3VPHA 1L5NA 4YMTA 5K0FA 2X22A 3PUJA 4HS9A 5HRAA 4Y7DA 1OXKB 1D8AA 1Q7RA 3NASA 1GPAA 2NV6A 1FXSA 1B23P 1DCFA 1JYEA 1WQ4A 6NULA 1KTVA 3GT7A 1X70A 4LYHA 3TTXA 5BN5A 4HLDA 4JLVA 4EO9A 2OBFA 3GLVA 3JAWA 3Q3GE 4MRSA 1EFUA 2JLZA 3HEMA 1DMSA 3HYSA 1UZLA 3TQOA 5ETJA 3USCS 1XTTA 4CF5A 1ZL2A 3QVTA 2V9WA 1AUOA 1ZH2A 4NDAA 4R1TA 3VAAA 3NNNA 5HUHA 2HA7A 2HA5A 1YQGA 4OOFA 5GAJA 1P2GA 3P1JA 2WSLA 3UQZA 3K70D 4ER7A 3ZLUA 3SM9A 1IWBB 1EX9A 2C3UA 5I60A 2DWCA 4DIUA 2VQEH 4JC5A 1IZ8A 5IH3A 2ZVQX 3AYZB 1UH5A 3QBEA 1OC4A 3O2QB 3ZY5A 2FWJA 3J81A 3NFYA 2OV4A 4EHLA 2XMCA 2FPGB 4MQLA 1GUBA 2R6FA 1GA6A 1NXOA 3EVAA 3RPEA 4RNCA 4X93A 3IILA 3ZK8A 1GYQA 4D46A 1TC1A 3TIXB 5E0OA 2PVPA 2WD7A 1XZKA 4HRAA 1D2CA 2J6UA 4Y2QA 5EJEA 3GP3A 1M67A 1ECJA 4EMUA 1VXRA 1RZ3A 3FNIA 2B4TO 2C9MA 1E9SA 4NNPA 5CIQA 3S2IA 3TMKA 1K97A 2E3JA 1X2EA 2CNUA 4KG7A 2H4HA 4BO2A 4HF7A 3K0FB 3OU7A 3OX2A 1PJRA 2UZ3A 1F0YA 3A1SA 3D9QX 1FL9A 4MRMA 4C06A 1V1MA 4HX2A 1YGPA 3DE4X 3UWDA 4N41A 3VH4A 1IPEA 4AMYA 1QS0B 3WGOA 4A36A 5LUAA 5TC4A 4G0WA 3KIPA 4HEJA 1E7WA 2Y6UA 1JIXA 4W8GA 1G2PA 2LV8A 4JB0A 4BNHA 4I46A 1UXIA 3L4EA 3QWAA 4LAFA 1M6HA 2WDPA 2A9RA 3M8KA 5C34B 4QRDA 4RJIA 1USIA 4UJ3A 3QYPA 4FNMA 2FA9A 4QOJA 3INYA 3VOTA 1EFRA 3AVQA 4CU5A 3WYAA 3RFTA 2ARKA 4Y6SA 3S2UA 1AH2A 1K98A 4L8FA 3VNRA 2JEFA 3F97A 3EUEA 1XNGA 1TZJA 1OHHA 3F67A 4XSGA 4TVSA 2VVTA 5KFWA 4R7TA 3LFTA 4TYPA 2QN6A 4ZAYA 3RJ0A 1R6TA 4EFEA 3SI8A 1U0OC 1BJTA 1KAGA 3KOZA 4JN6B 1R5BA 5KJFA 4DTIA 2NAPA 3EWAA 3QBVA 5BPFA 4W1PA 2QTWB 5CW1A 2L69A 4RGVA 4QT4A 3EZ6A 3WX0A 4KXMA 1NW7A 1OPRA 3BD8A 2UXDH 2X8JA 5G1PA 2R9VA 3ADCA 1PX0A 1NWCA 1RQGA 1T4DA 2ZUCA 4NYJR 1GPKA 2O23A 3ZLBA 2BGLA 4IRKA 4BNDA 4ZKDA 2E55A 1NSTA 2BLNA 3M3HA 4NAVA 4RHYA 2AJTA 2XCPA 1H8ED 2QXUA 3FIUA 1YUNA 3B60A 4QPNA 3L9XA 3QPUA 3LPAA 4FX5A 2JLXA 2H4YA 4K6NA 1C1DA 1V11B 5KSOA 4ZVSA 3ISTA 5EIFA 5KTKA 2YN2A 4C22A 1E1LA 2QMYA 3I5XA 2PUTA 3KHSA 5E7JA 1EUDB 3OPYI 4US0R 1SZCA 4L0MA 4TWZA 3LC7O 4AIIA 5FULA 1JG2A 1MDFA 2VUGA 5DGIA 1N0WA 4KWCA 3WIVA 4JR0A 1GV1A 4DXHA 3TAHA 1USVA 3WL6A 5LQAA 3U55A 3SIPA 2P4QA 2REQA 1NWHA 2V1UA 3JSLA 1RFLA 2C2HA 5AHRA 5TQ0B 1WKBA 5BQXA 4N7BA 3B1WA 5K0GA 4YS6A 4BUJA 5KJCA 3HN7A 1D2NA 5FBZA 3A6LA 4G5XA 3I72A 4QYWA 1Q0QA 3V2IA 1KO8A 1MPTA 3DM5A 1V26A 3RC2A 1XNQH 1J5XA 1FFEA 2WM9B 3FGZA 4C6SA 4CMCA 3DEAA 1I3MA 2YR0A 4QULA 1BS2A 2CEAA 5F7JA 1B73A 3R9IA 4NY1A 1OIWA 5L3QA 2IOQA 2XI4A 1IAVA 2ZJAA 1JX4A 4O2AA 2ZYIA 3K6SA 2BMJA 5CLHA 3THYB 4YPVA 1QBGA 4GZ6A 2R0QC 5FB3A 2DPHA 2QP3A 5KYWB 1PJ4A 1HSZA 3H9UA 3MS7A 3UV3A 1XMJA 3HO1A 3A2MA 3WWPA 4EUEA 4CKBB 1S2NA 2YZNA 3LO8A 1JKJA 4P84A 5E6UA 5THXA 3QP9A 1OROA 4IV0A 1Y7LA 2IITA 3C4JA 4BWYA 3T7RA 4FFBA 4EQ5A 2I4TA 1P2UA 1IEVA 2HTFA 3G9ZA 3H6GA 1JPJA 3K16A 2Q1TA 2C8JA 3QX9A 5FR1A 3W3ZB 2Y1GA 1OU0A 2A9PA 1JA9A 3R5TA 4RS3A 1BN7A 1Q0ZA 1NUTA 3H16A 3IMFA 3PHHA 3KTMA 3OE4A 1W87A 2UZIR 2PO5A 2XIGA 5ALUA 1EZZA 3PC7A 3WL4A 2WM2A 3KKLA 3W06A 4RTOA 4XUEA 2HU7A 4DV0H 4A8JA 2H4XA 1A5BB 4H0FA 3DP7A 1NDUA 3I6QA 2PS0A 4PBRA 2QSJA 1CRLA 4TKLA 2EKBA 5KQLA 4WGFA 3H04A 3P0JA 4Q3OA 1J6UA 3UHFA 4EYKA 4D26A 1U2QA 4KVFA 2JK1A 4ZCQA 1CW2B 5LBUA 2AX4A 1SULA 2H2HA 4HLCA 4I55A 4YB8A 1VBKA 1OJ7A 1YIAA 4I14A 3IDQA 4JP1A 3UXHA 2CLLB 4ARVA 2F3QA 4LMRA 4MITA 3TD6A 4ZZIA 4E5VA 1D4OA 2FMHA 4XWYA 5DSZA 3VO2A 3HUUA 5KC8A 2FOXA 2HJ9A 3IESA 4MTCA 1E4VA 4X71A 2GXAA 4HRYA 4E6PA 1OH7A 1BW9B 2R4TA 4RK0A 1VLLA 3ZBUA 3TKLA 3NHWA 2IYUA 4XFJA 2D4HA 2YOGA 3NW9A 2Z43A 1T6NA 5JNWA 1XYYA 4QU9A 1D0SA 1IHPA 4LNAA 1OVGA 4GOND 5HPYB 1TCCA 3W78A 2Z09A 3X2SA 3PLAE 3ZZ1A 2A5JA 5HDQA 4YRRA 2A9OA 3QFFA 1NNLA 1Y9EA 3GT0A 1ATZA 4FCWA 4JLNA 4EAAA 2PGOA 2C2OA 1Y1QA 1O77A 4YRSA 5DGAA 4AB1A 4EF5A 2I03A 1REQB 3OZUA 3IOBA 2VHTA 3FTPA 4ZP1A 2ZBVA 2COUA 2FFRA 4A26A 4NZOA 2AZTA 3I5AA 1EGHA 4BUZA 4MR7B 2HT1A 1KGDA 4HYQA 4KHZA 3P97A 4NZPA 2WNIA 5ELLA 3GIJA 4J9LA 1CUWA 1EE9A 4KAFA 5J9FA 3IPYA 2HXGA 2H57A 2ZRNA 3OA2A 1JXMA 4FJ2A 4Y6OA 3W6PA 4WDRA 3SNHA 5KFOA 3O83A 3RO7A 1FE8A 1KJNA 2AR7A 1BEUB 1NT4A 4IS3A 4WLEA 1RQ2A 2C5SA 2C2EA 2PL3A 3ED5A 1N32B 2F4VH 1M6EX 1QYDA 3CWQA 4DBZA 1TA4A 3AHHA 3K20A 4HZUA 5ALGA 3WR5A 2XGOA 3MW8A 1E8MA 3RTAA 3TTTA 5KYYA 1A9YA 1KBOA 1W88B 1I4WA 3O9ZA 4C0XA 3MD9A 1R6DA 2TMDA 1G18A 1E7QA 1XDGA 4ROSA 3I6YA 5BY2A 1BX1A 1WF3A 1I4OA 2O1XA 4LRUA 2AKYA 2ETVA 3TUIC 1ZIXA 1JALA 5A2QW 1L5WA 2OEPA 3BH6A 4C78A 5LIRA 3FMIA 4NVRA 3BGVA 2CJWA 3AVXA 5AVYA 3HDJA 3RR5A 2ZI7A 4RFLA 3EIWA 2HCFA 3GUZA 4L1KA 1E6LA 1L5HA 3OHAA 5BQ3A 1XTSA 1SFRA 2OO3A 4DC9A 4IIGA 1CUBA 4AJ9A 2FB9A 5KZMB 1J8VA 3PGMA 1A04A 1L7AA 2SKDA 1IYZA 3O73A 4OFBA 4PAMA 4BO5A 5F7XA 1MO3A 2IBSA 4D92A 2CCJA 2BDTA 5J4VA 3FDZA 1K5DA 1Q1BA 3CNQS 2OILA 5DM4A 3ZWCA 5HVNA 1N5MA 4MUEA 4Q4HA 4ARCA 2JBWA 3O4IA 1C7QA 3GRUA 5LC1A 3C14C 1JHXA 1XNRH 2ES4A 3PE3A 1DTWB 2EBFX 3L05A 4O6VA 1D2GA 2XAAA 2NSLA 2IXAA 1HNNA 1KYWA 4GPD1 3OTOH 2OFWA 3EGXB 5DYIA 3RF7A 3X1KA 2AYXA 2J9FA 3CKLA 4RPGA 3FMGA 3SIXA 5F1YA 3NBYB 2ROQA 2OGUA 2Q3LA 4CV1A 3FFWA 3DZFA 1Q0SA 2A7XA 3IJEB 1AK1A 1CP2A 4B87A 1DUVG 4M8KA 3CE6A 3FTEA 4LS3A 1R9TA 5IN4A 2VSNA 4BVBA 1E4EB 5DEIA 4C05A 2EP8A 4ZRMA 2O5VA 1I0IA 3T1VA 1ZGZA 5A6SA 3TF5A 5T7BA 2OZLB 3DOEA 1W0CA 4ZCPA 3NIWA 5C0OE 1SG0A 3A3PA 4OGKA 4KSCA 5HCNA 4X65H 1QFZA 1WBJB 3R0QA 3WZMA 2VTBA 4QQNA 1DIOB 1NRIA 4HJRA 2VCHA 3EZYA 4DR2H 2BHRA 1HLDA 1RBYA 4BNKA 1U94A 2RARA 4HDRA 2A0WA 2B4QA 1NV9A 2JA1A 1JVBA 3D2LA 3IALA 5CHYA 3UWMA 1D2HA 1E20A 1QJ4A 2GPAA 1MO2A 4D9KA 4EFMA 3ZE7A 4EG4A 4C2UA 3G13A 4IXNA 1LVUA 3OPMA 1Y6QA 2WSSA 1AD2A 4E5SA 1W4LA 3R4CA 4D45A 1KDTA 3VSDA 1YR7A 2ZR9A 5DF1A 4GLWA 3GPLA 1KC3A 3T35A 4CG2A 1LH0A 1S7CA 4URYR 2W9BA 3UXYA 2BMDA 4XA8A 1RJ9A 1M73E 3DAFA 2BP7B 2JZOA 4RZ3A 4EFDA 3FPAA 3T7CA 3HFRA 3TL6A 3K9GA 4NEGA 3W04A 3AJRA 5F1PA 4ZZ0A 2FW6A 3SBEA 1CS4C 1R18A 3FPJA 1W5SA 1X38A 3EUWA 1ZN9A 3BRCA 4RH1A 5ER6A 4DMLA 5JZSA 5C53B 2BGGA 1HNXH 1YSCA 2KS6A 3RTXA 2VDVE 4TMVA 4CLRB 3PCTA 4DLNA 1J9EA 2VHUA 5GV7A 4EJSC 3EEBA 2DPLA 1TEHA 5BYJA 3SXUB 5FLXW 6ADHA 3N2ZB 1L4MA 1Q7GA 4BQFA 3MOGA 2V3VA 1UDRA 1IDOA 2P27A 1COWA 2QQ0A 2Q3HA 3V97A 4D4KA 2JGNA 1XPRA 2XUHA 4X7PA 3UPDA 2YZKA 3GJTA 4Z1MA 1THTA 4DMHA 2WWIA 5K8CA 1M0TA 1MFPA 4P92A 1TLLA 3IP5A 2FFHA 3FN4A 5IVIA 3W5HA 3ZHCA 3U5ZB 3CW9A 5HRCA 5JJKA 1C1XB 1Y1VA 2E6UX 3QW4B 4JUBA 2DWOA 3N8NA 1I1LA 4ALLA 1XXHE 5A3SA 4OK3A 3ZGNA 3R9KA 1O95C 3COJA 4O86A 1AS3A 3VXKA 4UPVA 1S89A 3PQCA 4PYQA 2DSTA 5H16A 1C8LA 4LF9B 2ZWPA 3VTFA 3JZDA 5IT4A 4DYVA 2H59A 1ANKA 3T7JA 4NI5A 1PLJA 1VLJA 1DVRA 2GARA 3P2KA 5I7FA 5E6RB 1O6GA 1UAAA 3GLGA 1Q6YA 2FTKE 2A57A 1FMJA 1OBFO 1N2CA 3RF2A 1QHSA 1QR6A 2PL9A 3B1XA 2GZSA 3NU1A 5ECWA 2QXYA 3OI7A 4REOA 1Y8ZA 3P52A 4TV9B 4G65A 2B4AA 3I9NA 1ZUNB 4RENA 2FJZA 1A9SA 2DJ5A 3V7WA 1N7HA 3UAGA 1IOWA 1V45E 4BLSA 1Z82A 2ZRCA 3UHPA 1KAQA 3ZVKA 1QFSA 2OCXA 3G17A 1JG1A 2EGHA 1V4NA 2VUIB 3C74A 1JFFB 1SXPA 2CK3D 3TRJA 1F8YA 4XX1A 1SVOA 4JOSA 4JU8A 4X91A 3MT8A 2W4QA 1DV1A 3U3OA 2H9YA 3WS7A 4EG3A 5IX8A 4N01A 3WGZA 3ZE8A 4Q21A 2OCDA 3IG0A 2WUWE 3LPLA 4RY8A 4UHBA 1TUGA 5D1HA 4Z0PA 3UT6A 3G5MA 1GDHA 4K0RA 4MRRA 3RYCB 1ZAYA 2AD1A 2YN4A 2QMHA 1M7GA 4NARA 4BBJA 3H8VA 3ZKWB 4BY7G 1Y98A 2K4MA 2CHFA 1S0NA 3RSOA 4MWBA 2FR8A 4IRUB 1OBCA 1SBZA 1MJNA 3UUGA 4DQNA 3U61B 1AGPA 2WTEA 2AZXA 1S10A 4H3SA 2R92G 3CPEA 4F4FA 2G5GX 4DL4A 5AM2A 3LUJA 1LFAA 1GN8A 1M1YE 1N2OA 3FWHA 2C4UA 5LD2B 2D2VA 2DPIA 2RKOA 5CCXA 3JAKB 2QJOA 3HO8A 1QQ5A 5K0ZA 2CXTA 3V6KA 1CUVA 1OC2A 4EB0A 3G3EA 3GTKA 1UBJS 3GQCA 3C1OA 3UT5A 1JH9A 5FLMG 1Z5PA 1YKGA 4F45A 1L5QA 4E21A 2NUPB 1P4GA 2FLWA 5FL7D 4O59O 4GVLA 3OSNA 5SZKB 1SCNE 3OE1A 4XM1A 2BZSA 1ML3A 1LSOA 3IT1A 4I1IA 1OV6A 1PJTA 1VIVA 4BO4A 4Z1OA 2BEVA 5DHTA 1M8FA 1GARA 2WAMA 4BU1A 1YBAA 1J09A 1J2UA 2C4TA 3CR8A 3DZBA 2A7QA 3IKVA 4OH7A 2FJPA 3M9WA 5F78A 5T5QA 2YHIB 3TNDA 2DWQA 2EWMA 4DMGA 5DYTA 5FUMA 4O3NA 2C99A 3JVUA 3A4LA 3JQAB 4GBMA 5BR4A 4AULA 4HQLA 4J7CA 1H6AA 1JSZA 2BFCA 3JCZA 1I36A 4ECQA 2FMKA 4I3GA 5KMGA 1LV7A 4KXXA 3WKAA 3LG2A 4BFUA 4DV4H 4A27A 1G7CA 2R1TB 1VJ0A 4KR6A 1L3CA 1U0LA 3U0GA 4ZQHA 2QX9A 2HDHA 2IHTA 3IMGA 4KUHA 4ZRNA 1N2EA 1C4KA 3RJZA 2IQIA 2F43A 4TVOA 3LX8A 2FJUA 1TYAE 1SBNE 4R84A 2Y2UA 3GILA 2AXQA 5ITZA 2EU8A 1FBTA 2QUAA 4EEKA 2FZEA 5FR9A 1OZHA 3QXSA 2C84A 3WGUA 4R2KA 1RRPA 2G82A 5K8VA 3TY5A 4MW0A 3PDWA 1KJJA 4A1FA 2PVSA 3QXHA 3RUDA 1BQ4A 2RGXA 4CKBA 4R1PA 1UFKA 2YL2A 3GDHA 2O8FB 2ZOSA 3AB8A 2PBLA 4I6JA 1X1BA 5CM0A 5DFAA 1GKIA 5CVCA 2EIHA 4YFVA 3VX4A 3MGCA 4Q7MB 3RKUA 3Q7SA 3WDKA 4EUFA 3RFXA 4YECA 4JI5H 1VPTA 2QYTA 1MXHA 2ZI6A 3E1SA 1D2AA 4ZOAA 5C8YB 5KNDD 1X0XA 4Y6PA 3HXKA 3JAMA 3HJUA 1QFYA 4N5MA 4CE6A 2IUUA 1BA2A 3A4TA 2P7HA 4BY1G 1RMQA 3KAPA 1BH2A 2H92A 2WJVA 4PX3A 5KEIA 3A4VA 2NO6A 2R87A 2WFZA 1E8DA 5KX5A 3KT6A 1JHZA 5C5CA 2IHKA 4LQDA 2RAUA 3OCJA 3FDIA 2I55A 2GT1A 5B2ZA 2FLKA 4JNCA 3LV8A 4H6WA 1Z5NA 2QVBA 3PXGA 4ECYA 5A5EA 3DTTA 4YRLA 1F1JA 3A9RA 3S6JA 1P80A 1FNDA 3HBJA 2VHYA 3DZGA 4WKGA 2YWRA 3VVMA 3DDWA 3NVDA 1O9GA 2EX0A 4GX1A 2WUGA 2GHIA 3F7NA 3QRWA 2IBMA 4M0FA 3VU9B 5IYDG 3W2HA 3T9BA 2CHVA 3HKDB 2PGDA 2MMCA 2V7BA 3GFRA 3IO3A 2IYRA 5HKKD 4LMAA 5HIKA 1GOTA 3IODA 1JKMA 1L7PA 2FZGA 3TPFA 4ZXFA 1WQ3A 1X7WA 3A11A 2Q1UA 2PWAA 4NYJQ 4HXFB 4Z9FA 4OI1A 4F4WA 1G6Q1 3BGOS 2I2FA 4NQRA 1Y4DE 3L6DA 5EXEA 3VU1A 2J6SA 1U9IA 5BNTA 1BE6A 1PV1A 2WEKA 4PG6A 5CT9A 2C2RA 1LQUA 3C5EA 3A9UA 3LP6A 5L6MB 2YBDA 4UEJA 2H7CA 4TQAA 3C3AA 2UYGA 4FBGA 4UU7A 1T5OA 1GADO 2J1LA 3JSXA 3NLLA 4IGIA 4CFYA 3QITA 3FPKA 1W46A 1GCAA 1GU1A 1ESMA 4M0UA 4QUDA 2ID4A 3G0BA 4YASA 5EKXA 1CKOA 2OQIA 5GMOA 1P0FA 3RHSA 1XVVA 4AJHA 5JFOA