4MA5A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
365
structure length
363
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with an ATP analog, AMP-PNP.
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 115
structure length 363
sequence length 365
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma5A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma5A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma5A01
2XCLA 3JZFA 4YAJB 1OBDA 2R7KA 2ZDQA 5DMXA 1JKJB 1Z2NX 1EZ1A 3VA7A 3VPBA 4YJ3F 4EA7A 3KREA 3U9SA 4HNTA 3KAKA 1GGOA 4EA9A 1EYZA 2FP4B 2YS6A 2WYOA 3Q1KA 1KUTA 4O7NA 5JVDF 2YL2A 4YBZB 3U9TA 4MV7A 4E4TA 2ZDHA 3LWBA 3GIDA 4O81A 3BSSA 2YZMA 5HBRB 1IOVA 3BG5A 1M0TA 3I12A 1B6SA 1PK8A 2YZGA 1GSOA 2R85A 2DLNA 2DZDA 4Y8VB 2QK4A 1BXRA 1BNCA 3K5HA 4FFPA 3RFCA 3K3PA 5LOVF 3DF7A 3GLKA 1A9XA 3HO8A 3Q2OA 3KAJA 2CNQA 5BPHA 2R7NA 3VOTA 1GSAA 1I7LA 3U54A 4FFNA 4O2AF 3TIIA 2W6QA 4MV3A 2SCUB 2NUAB 1KJ8A 4O7SA 1EUCB 1M0WA 5JQWA 1AUVA 1KJ9A 2YWVA 2YRXA 5BPFA 4M9CA 5J2UF 1PX2A 5J2TF 2W6NA 4O7VA 1A48A 1DV1A 3WNZA 4O84A 3ETHA 5LP6F 2P0AA 3ORRA 2W70A 1M6VA 5IYZF 4YAKB 4EA8A 1KJQA 4IZOA 2YW2A 4MV1A 4DLKA 5C1OA 4I4TF 4O7TA 3BFPA 1GSHA 2HGSA 4O82A 5GONF 5H80A 3RV3A 1OBGA 2ZDGA 4FGRA 2I87A 2W6ZA 3UFXB 4TUYF 5FNVF 2YS7A 4J6EA 2FPIB 4TV8F 2W71A 2W6OA 4MA0A 2YRWA 2VQDA 1I7NA 5LA6F 1C30A 2FB9A 2DIKA 2GQSA 4NYEA 5EZYF 4O86A 4O2BF 2R84A 4I50F 3OUZA 2C00A 1C3OA 4FU0A 1AUXA 2NU6B 2V59A 1JLLB 3KALA 4WBNF 1VBGA 2R82A 1EUDB 1VBHA 4YJ2F 2VHEA 3U55A 3G8DA 3V4SA 1KBLA 1T36A 3G8CA 3RV4A 4HQ6A 4EGJA 3HB9A 1VKZA 4HNVA 5KKNB 4O7LA 2FPGB 4ZOLF 5LYJF 3R23A 4FFLA 4FE2A 3MWEA 2VR1A 4MAMA 1W96A 2CNVA 2R7LA 4IHJF 3MJFA 1Z2OX 1DV2A 3HBLA 3WO0A 4EAAA 4HNUA 4MA5A 3R5HA 3N6RA 4M99A 4WD3A 2W6MA 3BSYA 3E5NA 5JVLA 2CQYA 4EG0A 2NU7B 2V5AA 2FPPB 2PVPA 3RUPA 3N8DA 5CB4F 1WR2A 4MV4A 4FFRA 4XX0B 3NUAA 2J9GA 3TW6A 4O4IF 1UC9A 1E4EA 1Z2PX 2NPOA 2NU9B 3JZIA 1JDBB 3AX6A 3ORQA 2HJWA 3VMMA 3TQTA 1ULZA 3R9RA 4C5CA 4M98A 4O4HF 2GPSA 5CA1F 1CS0A 5JQGF 2W6PA 4GGMX 1KC7A 3QFFA 2R7MA 4ZI7F 5LXTF 3R5XA 1KJJA 3JRWA 2R87A 3K5IA 5JH7F 2OLSA 5HV6A 4C5BA 3VPDA 2IP4A 1DIKA 2VPQA 5C1PA 2X0SA 2PBZA 5KX5F 3JRXA 2V58A 4O4LF 5D8DA 2QF7A 2GQRA 2YZNA 1KEEA 3MWDA 2GLTA 1CE8A 4O4JF 4IWYA 4MV6A 1CQIB 3ETJA 4MV9A 4O83A 3VPCA 3AW8A 1KJIA 2YYAA 3SE7A 2I8CA 5CA0F 1W93A 4O7ZA 1B6RA 4TV9F 5C8YF 4QSHA 4FFOA 3OUUA 4O7WA 2DWCA 4IIJF 3WO1A 2YZLA 2CNUA 4ZHQF 4XZ3B 4YB8B 1SCUB 1CQJB 4EABA 4I55F 5K2MA 4O7YA 4FFMA 3LP8A 4EGQA 4M9UA 4IWXA 4XYLB 4HR7A 1JDEA 4C5AA 2R86A 1GLVA 4MV8A 3TIGA 4O7RA 2NU8B 4ME6A 3R5FA 2R6FA 5CAEB 1EHIA 2Z02A 3BSWA 1IOWA 2PN1A 3V4ZA 2XD4A 1E4EB 2CZGA 2I80A 1UC8A 2GPWA 4DIMA 2Z04A 4RZQA 4XYMB 5BMVF 5I47A 3TINA 4L1KA 4ZQIA
chains in the Genus database with same CATH superfamily
4NMHA 2FQQA 5SYMA 1NBAA 4FDTA 1USVA 5G41A 2M6KA 2XV1A 5FL7D 1V47A 2IUEA 3R6DA 1J99A 2MJLA 4YV0A 1BO6A 5EJGA 4BB0A 3IG0A 4MRNA 4E4TA 3KPYA 5JRDS 1IOVA 1NTOA 2FSUA 1IZYA 5C34B 3LCCA 2Z43A 1SXQA 2R9VA 1P91A 2BVNA 1AD2A 4KZKA 2N42A 3UAYA 2WHXA 2A9PA 4M46A 1OYWA 2PKXA 1I2AA 3OQIA 1S6YA 2WNIA 1GZDA 4ECYA 3LQ2A 5F3WB 1T1RA 4PONA 3IVGA 3OQMA 3S2ZA 2DHEA 3RYHB 4PGMA 4EPYA 5B55A 4B2LA 3P8ZA 5D00A 1L1EA 4FILA 4KU4A 2G83A 1PG2A 5JDIC 5HMMA 1QG4A 2X0EA 3R6LA 3NYWA 5HS4A 3HXMA 4UARA 4OPMA 3DDHA 2W70A 1H5QA 3IAAA 721PA 1R3UA 4Z51A 4C6TA 4LRUA 4TTVA 4FS1A 1OXSC 2PQ0A 4WZAE 4KBFA 4Z1MA 2BSQA 1T8WA 3ZV5A 5ED4A 1U0NA 2JRLA 1V6CA 1U1GA 3VAYA 1FS6A 2RHGB 4QTYA 5GGXA 3V6KA 2B82A 4B3BA 3RVQA 4RORA 2X0DA 2R6HA 3C1TA 3UAZA 1VB5A 4JEIA 4H77A 2C9YA 2GQSA 3R44A 2Y66A 2HM7A 4NATA 1GPKA 1H3FA 2C4HA 4LJLA 3UK0A 3JYOA 5IJ0A 3GLRA 1NP3A 2IYEA 2E0IA 4PO1A 3ZNQA 2HHJA 2WAXA 2ONKA 3DTGA 4KQHA 2WHPA 3QLEA 3W5JA 1ENPA 3DBLB 1WUTA 1SBHA 2UZ3A 1CKNB 4BVGA 2P1RA 5KI6A 1E2KA 1KP3A 4MVJG 1XYGA 3CY6A 4BXXG 5G3YA 2OCKA 3DV9A 2W9CB 2PFGA 3CZCA 2HPHA 3DWFA 3MOIA 2E4UA 2QP3A 5HRUA 4PZ9A 1SHUX 3IP7A 1ENZA 5JVLA 2ZB4A 4RK6A 1M2GA 3SSMA 4IV8A 1G5PA 3P32A 4IDPA 3WS7A 3EQ9A 3GLTA 3BJYA 3UKOA 2RK4A 1XRPA 5G3ZA 5TVGA 5JQGA 3NOVA 5TQJA 1YHZA 1OVMA 3SS9X 2FFJA 2WZDA 2V7QA 3RAGA 5B7GA 2PT7A 1EK5A 4DDUA 3PLAE 4AMUA 1H0HA 4J3FA 4XJTA 1L7MA 3WFJA 1E98A 1YL5A 2BDEA 1ZMXA 2XTNA 1QYCA 2R6R1 3ASZA 4YX9A 4U6PA 4ZWNA 4YHHH 1O0SA 4J2HA 4IJMA 4DFDA 3T3HA 2OLSA 1H1LA 2PA3A 2XYPA 3L02A 4GUDA 1B0UA 4WECA 4UPEA 5U4XA 1CE8A 2AHOA 1FE8A 4K9DA 1G98A 5E1BA 4NJOA 1JIXA 3INRA 1MQ9A 3MRVA 5JXIA 2ZRPA 4O7ZA 4PPGA 4JJEA 2EKPA 1X1EA 1KH1A 2BEUB 2J6TA 1MZVA 2QJFA 2Q45A 1C7QA 2V6GA 4AQYB 3MNFA 1VYTA 3IV7A 1RVV1 3L1IA 3ZS8A 3GIJA 4ZAGA 5CX4A 3G5MA 4U02A 5IFKA 2G71A 2JIDA 1E60A 1J09A 3X1ZA 1XT6A 2F8TA 2IP1A 3FY4A 1MVLA 1TJ5A 5ALDA 1G3UA 3GB9A 4URHA 1NJ5A 4UFPA 1N2ZA 2NV2B 4HPJB 2XCSB 2QZ4A 3LXRA 3SFZA 4D7AA 5FJ8G 4GYYA 1Z0ZA 2X4LA 3LRXA 4B79A 3QVVA 2AGQA 3R8CA 1CG6A 2V9ZA 5GIOE 2XUGA 3CQZA 2PZLA 4QVKA 1T5OA 3ZLJA 1XELA 4FWTA 2FW9A 1XVIA 1T4CB 5B37A 3DTFA 3SI8A 4K9KA 3SMQA 4IIEA 1LSJA 3P4XA 3GJQA 3H0GA 2C83A 4URFA 3MCUA 1ZD8A 4JYBA 1K8ZB 4EATA 1WQ3A 3QOXA 1EA7A 4LWOA 2Q5CA 5A7GA 4C2MA 2J30A 4CFZA 2VTKA 1Z83A 4ZCRA 3ICQB 2E5LB 1F8FA 2DH5A 1LVUA 1U1EA 2R68A 1KORA 1RVDA 3PEWA 4YMSA 2B63A 3V1TC 3N8GA 3IMEA 4MICA 3F1KA 1YRBA 4UM8B 4YRDA 4HNAB 4LBWA 1QUEA 1J2EA 3EXFB 2PL3A 3R0VA 1DO2A 3SEZA 4WACA 1V2GA 4FYJA 5JD6A 3TFQA 4HVCA 1GNQA 2G7MC 2NTEA 3LG2A 5KT4A 5JHGB 3EDYA 1GL9B 2XQGA 4M8SA 3L8MA 2R93G 3NW9A 4Q7QA 4Y9RA 3KZMA 3IMKA 5KNLA 4HI0E 2ZG6A 2V59A 2ONYA 5J4KA 4FC7A 3KE8A 4LOAA 1Z22A 5J2UB 5C7YA 4B0OA 2X6QA 3LUHA 2OO7A 2IEIA 1Z2DA 2P9QA 2XCQA 2WFMA 1FDIA 1OXBB 2HF2A 5LDHA 3DEKA 3IDFA 1HWYA 4OKIA 2PH5A 3FBTA 1S1MA 1IMOA 5AJZA 1EAMA 4PICA 2PV7A 3VNUA 4MAMA 3ZZUA 1W96A 4MRPA 2P4QA 2I2WA 4EL5A 5K3BA 3ORHA 3EG9A 1A4XA 2P9HA 2R48A 3A3PA 2Q4TA 3GFBA 4TV8A 4M99A 5KFUA 4ZRMA 5JC8A 3K09C 5FBZA 3PU6A 4DAEA 2VT2A 3B6IA 1ZAUA 3FNFA 2P9FA 3PD7A 5KFJA 1TTPB 4UVDA 2COJA 2WE6A 4DQDA 2VT3A 5HHTA 1RYRA 1E3TA 2IS4A 3IPYA 4BKUA 2WJAA 3GUYA 3TQFA 2DY0A 2V7XA 1LBQA 2GXAA 3LXMA 3QVXA 5KOIA 1BDBA 1QDLB 1M2NA 1A72A 3VI4B 2PZ8A 3FETA 1E0SA 3ENQA 3EEBA 1UIMA 3ROEA 2C5HA 3FLMA 4MULA 3ZR4B 3KJGA 4EG6A 3N2GB 2J0VA 2WZQA 4LXIA 1LLDA 2ATCA 4E5NA 1EUQA 4WGGA 3E58A 3IP3A 5F5XA 3WQQA 3AI2A 3RB6A 4UUGA 3CF4A 3U9LA 5KJ6A 1P8JA 4N7JA 2X23A 1HDXA 2W90A 1OT5A 2YVQA 4TV9F 4X90A 1Z4OA 3RSOA 4ZO4A 3VR5D 4LY0A 2QTLA 4QC2A 1YMQA 1JFVA 4K3VA 5LA6B 3D3WA 3NC4A 3UMFA 4MMYB 4L4ZA 3GBVA 5CRIA 1YDGA 4DUYB 3G0IA 3A7DA 2FI1A 2QMQA 2R86A 1NE2A 4ER5A 3SHFA 4TMXA 1LEHA 3R5FA 2B98A 3A04A 1J0XO 3X1YA 5C81A 5EMNA 4GZ3A 3GVPA 2VJPA 1BU5A 4C20A 4PYLA 4Q82A 5E6UB 4RTSA 3S1AA 1CB7A 3LE8A 4FGWA 2P79A 2CFTA 1TA9A 3PVCA 2PKCA 2HI0A 1IAQA 1ODJA 4OQEA 3A3OA 3FYHA 3ZXYA 3ET5A 4CMAA 1MUUA 1QDEA 3AQIA 1BG6A 2IGBA 2VP5A 4YCSA 2YJ4A 1EG2A 4MUGA 2ZIGA 4D42A 3MMZA 3TAHA 5FDFA 3OSUA 2C99A 3AP3A 3RUCA 3OSNA 4BGVA 1RRVA 2EWMA 4MUKA 3VRHA 4BN4A 3EWSA 4M7RA 4IQGA 2BFCA 4EFNA 2HCJB 1T2NA 4Q43A 4WHXA 4ZGBA 3MRXA 2CNKA 4DA8A 4JR0A 1NE7A 3GNSA 3GHHA 3WLKX 3NHYA 3ISJA 5I7UA 3AUSA 3E05A 4BAGA 4A3BG 1IRIA 5LPNA 3I05A 3USZA 4HAXA 5DGDA 3DLPX 3G0HA 3TQQA 4NFYA 1I7PA 3H9EO 3HJBA 4G5RA 2YNMC 4U7HA 3LGXA 4O2LA 4DTIA 3DFKA 2QGNA 4Z5XA 1G7SA 4FJ0A 5BQFA 1PT9A 4K9PA 1PD0A 4MYRA 4P38A 2V3VA 5DHQA 3DOHA 4OLHA 2D13A 1D6NA 3R0XA 5DNUA 4AZVA 3ZC3A 4YJHA 4D41A 3CR7A 4LWZA 2CE2X 2ZAYA 3L4BA 4X6YA 4XD7D 2K7FA 1C3EA 2JBWA 4ED6A 2AR7A 3V6MA 4IQ8A 2ZZNA 2V6BA 4DEYA 4MA0A 3ESAA 2C35B 4I3HA 2NVOA 1BJKA 5IASA 1GZ3A 3BORA 2CXNA 3R4CA 5DM1A 2HREA 2HUPA 1GPDG 3EMVA 3SJZA 3TRFA 5AK5A 1L1FA 3OBIA 3KVYA 1KL7A 3U55A 1EKPA 5L3ZA 2HEIA 3QTLA 2JH3A 4UBOA 1ZVMA 4AZTA 4F8EA 2WAOA 1X9IA 4JDPA 1YAHA 1G2PA 3F6EX 3F9RA 2ODQA 1VS0A 1D1SA 3E5MA 1P1CA 1SPBS 1F5SA 3JYLA 3RC3A 3GRYA 3K20A 4BNNA 3B7PA 4PWQA 1PN3A 3WO0A 1LJLA 4JI7H 5FIUA 2CLFB 3PQ4A 4PPQA 2KSWA 5BVHB 1G2IA 5IF3A 5BT9A 2J45A 3L77A 1QF7A 4Q7KA 3KVNA 5FTNA 1ZISA 4G5XA 3VJKA 1NBWB 3TDNA 2EW2A 1E1QD 4M8LA 4QBIA 2FWJA 3CUYA 13PKA 5EEGA 2XTJA 2QD4A 1PBTA 4QGGA 4PPYA 3GR6A 5FOTA 1R8XA 5CLIA 2ZZMA 4QOJA 1U7DA 1UZUA 4Z86A 4G81A 5FBLB 2MR5A 3ZVNA 2NT4A 3P94A 1MCZA 5HRCA 3NXKA 4LZJA 2AWNA 1L5NA 1M5TA 4CTNA 3OWXA 5KOHB 1UBLS 4RK4A 2IW1A 2FP4A 4O4LF 1KZ9A 5CP8A 1HE5A 1BRTA 3WIOA 4YMTA 2BJVA 1M0EA 2JFYA 5REQA 4REQB 2XUAA 2VG8A 3AB3A 1C7EA 1QHYA 1VIVA 3CUVA 1N4DA 1G8YA 4DV0H 3CJTA 3DNMA 1G19A 5KDLA 3GTLA 1GGMA 3F9IA 5HGXA 1ZQ7A 1R0XA 2IH4A 1U0RA 1JECA 3WFIA 3U7RA 3V6JA 1ULUA 4A8JA 1R5BA 1ZM4A 4OXIA 3D8HA 5KOYA 2YMLA 1HSZA 1V41E 3GDOA 4J9LA 4X6LA 5CA1A 1AHNA 2KLHA 2ZVJA 2PGDA 1JGTA 1P2SA 1E5XA 3BIXA 3OZBA 4I8IA 1SM4A 2J5BA 3IJ5A 3HE3A 3EFHA 2AEMA 5HE8A 3A1FA 4RKYA 3BKWA 4ND2A 2XIGA 5FV7A 4PO3X 1GVHA 3K73O 2O0JA 5KBYA 3CBGA 4LJ8A 3O94A 3RFFA 1MJ5A 1NURA 4XWTA 3JQFA 4OXKA 3OFVA 3VUFA 2HJ9A 3AMVA 3KQVA 4KIGA 3OCCA 1ZFNA 4CT4B 3C8MA 4IDBA 2HRCA 5EMHA 2X0RA 1M0TA 2Y3IA 2OQVA 4ZICA 4JLAA 5F51A 1WIWA 4MS4A 4MDFA 3H5RA 2NUTB 4KREA 3JS5A 4AY5A 3ICVA 4XCXA 3GGJA 2J0UA 3QMWA 3LLCA 3JQAD 2FR0A 1PS0A 4HN9A 3FGNA 3G0GA 3H7AA 4XM0A 4DCNA 1X13A 1C9KA 4H2DA 4G36A 4P5DA 3HR7A 4Z9BA 3VSCA 1X14A 4EHKA 4LCEA 1V51A 1E9SA 2ZJ2A 3PC8C 3I5YA 1DKOA 1E5DA 1KVUA 3OLVA 5MGBA 1YV9A 2AW5A 4JVOA 4I1VA 2OGUA 4YAKB 1SZCA 1TWCA 3N2YA 4URUR 2P67A 2W2XA 4YLEA 4RHXA 2GBIA 4QDXA 3KHSA 2HHHB 2AFIE 2N47A 1XPOA 2WLTA 5C80A 4HH4A 2NADA 3ZU5A 4FLEA 4G2NA 3F7MA 1NN3A 2ZROA 1R66A 1L7AA 1KJWA 3KQMA 4ZT7A 4OI0A 5LA6F 1WBJB 2HHCA 3AOGA 4KL8S 2I7TA 4JLOA 3IKMB 4D8VA 4D46A 1VE7A 2LCQA 3GEBA 4OHCA 3FTFA 4KPUA 4FIDA 3A3NA 3KALA 2ZE7A 1NNI1 4X92A 3J81W 4INZA 4R0VA 2MHCA 4DYDA 1EWKA 2P9YA 4JB8A 3CFYA 1PW7A 3D3KA 5D51S 4LDAA 4RDHA 3PNSA 3U6BA 1XR3A 3WJ2A 1S8NA 5AKHA 3KYDB 4P7BA 2PZGA 4WQMA 1XAHA 4BLWA 4CCYB 4OJYA 1NQOA 4QUDA 5A3VA 4HDRA 3L8CA 4B3RH 2X41A 1WNFA 4H27A 4TMTA 1FFYA 4WN3A 2AOXA 5KCMA 1ZEMA 6CHYA 4NBTA 4J9KA 3M49A 2A0XA 1KZGB 5L6MB 1ATIA 4L6IA 1NXPA 4NXMH 1NFQA 3V3TA 2PUHA 5FWXA 3DQZA 1XEWY 3E3AA 3GGCA 1E5LA 2OVBA 3IEVA 2R0QC 2ESRA 2YJ3A 4EFEA 4TWBA 3TGLA 3UANA 3OA0A 3IAEA 4CC5A 2YWDA 2CMFA 1NSFA 4B4VA 1KTIA 1GU7A 2NU9B 3EOZA 4DDKA 3NVKI 1LBSA 4B81A 4BFTA 3JZ6A 1W73A 5FADA 5AM2A 3AUYA 2VA9A 2FW7A 5KHOC 3D59A 3NT2A 3C6MA 3AG5A 2V8OA 4PLYA 4Q7JB 3SXUA 2W98A 3H0KA 3OLXA 1R0WA 4NMWA 2HRRA 5JROA 4D3XA 2IOYA 2H2HA 3FYTA 3P9ZA 5DYTA 1HZJA 1JQLB 4AO6A 3PXUA 3LECA 2ZJ4A 3LO5A 3SIWA 1W35A 4NCJA 4Z0TA 2VDUE 4EHFA 1ORTA 2QGFA 1NP7A 3H2IA 4GWGA 2A7QA 4ZDJA 1KFEB 1P2DA 3E3NA 3V48A 1Q1AA 4L9WA 4MJXA 4KHPH 4FEGA 1J1IA 2CNUA 4HEA6 1AKEA 2GDZA 3DOUA 3JAWB 2MYPA 2G80A 4JT2A 3WQHA 4C22A 5HQ3B 1Y1VG 4FNAA 3Q5EA 4CHTA 3C7AA 4EEYA 5KFPA 1SC1A 2HCFA 1RWVA 4PX3A 2CHVA 2WE8A 1UOPA 4NFHA 3C0FB 5FEUA 1GQQA 3RS4A 3VR3D 1WMFA 1W5AA 1PTJC 5FA6A 1ZXXA 1RXVA 2JEYA 4X45A 1JTEA 4BBZA 5EE3A 2IXEA 2QI9F 4JLUA 4BMVA 5IBQA 4G1BA 3PZRA 4V0MA 4MB6A 3FX2A 3BQNB 4IV5A 3HK2A 3T54A 3RSSA 5KFTA 2W6CX 2FEOA 3SU8A 1H2FA 5IM4F 1Z45A 2DWUA 3ZWBA 4ASUD 4ZMBA 2CT8A 5DTIA 3Q3VA 4DZZA 2QMHA 1JPUA 1E1MA 4GBGA 2OKCA 1I6MA 2XA1A 2J3KA 3GRRA 1WV0A 4JP3A 4KO3S 4GI5A 4RS4A 3CNNA 4GM4A 2GEUA 2GD6A 4CI0B 2ZZKA 4X1IB 1WMSA 4X66H 3LIPA 3Q41A 4LF5H 1DARA 4MDHA 1N2EA 1P3DA 4ECTA 1FFBA 1P72A 4HZIA 2ZAGA 4AAYA 4E30A 5AWFC 1WKVA 3MAAC 1UMCB 4L5IA 4HDNA 4XWAA 4OM8A 1QS0B 3BXGA 5EHNA 1IZ8A 3CIFA 1IBLB 3CLUD 2V9CA 3CLRC 1WU7A 2OXCA 3O90A 1MNAA 4IGIA 4JQOA 2O19A 3AYZB 4GOND 4UUPA 1NU6A 2J87A 1TYCA 3OIWA 2C57A 1T5IA 2NVYA 5IEBA 4S0ZA 4QQ8A 3SKXA 1BHJA 3Q8QB 1M1YA 4Y67A 2OPBA 3L6DA 4YECA 1MC5A 3NCHA 3SFTA 4RZUA 4N39A 3QEMB 5JSUA 3GILA 1E5TA 4PTYA 3H1FA 3FD8A 2IW3A 1TC1A 3BGIA 4ZGWA 4KWEA 3FAKA 1U2QA 1CQWA 4LJKA 3D0QA 5EJFA 4PZ0A 3WGGA 2JHGA 1T9AA 3HI4A 1TAHA 2I1QA 4MR8A 4BB6A 4NECA 1AB5A 4ZO7A 1G5IA 3QXSA 1VL0A 4WSOA 4DJJA 2XSZA 2O8CB 4L75A 3ZY5A 1GZ5A 4TYNA 3VVMA 1S2IA 3PDCA 1RRMA 4HB3A 4YUAA 4B3HA 4PBTA 4A2BA 1Z2OX 2AMJA 4D4HA 1BW9A 3T5TA 2XGPA 4Z9AA 4BO1A 3ONFA 4OAQA 1V0JA 3BXEA 5JO9A 2NU7B 4P4TA 4O2BA 4A27A 1K5GA 1ZW6A 3VC3A 3EXHC 2QRNA 3HKCB 1VJCA 5AQEA 1R4AA 4JWKA 4JU8A 3GG2A 3KE9A 1B76A 2GPAA 4A3FG 4TN1A 4WTOA 5GGYA 3TVTA 3QHPA 4XX0A 3GRFA 4XB2A 4M7PA 1WDTA 2F3SA 3R9RA 3PKZA 3DV0B 3B8EA 2JIZD 1VJGA 4W8GA 3BZUA 3WRYC 2H57A 2HIGA 3CZAA 3QKSB 3A37A 2Q2WA 3GLIB 1JIKA 4WK2B 1ZR4A 3V4VB 3SC4A 3TBKA 2C5LA 1M67A 4RJIA 5LBTA 2OBYA 5KX5F 4E5SA 4K6OA 1W0KA 4PG4A 3KB2A 2YHIB 5EXEA 2JA2A 4KLNA 4WX2B 2FJZA 2LCIA 3SYRA 3GN2A 4DLVA 5BORA 1TF7A 4FE3A 3C6QA 4ZKEA 2PKEA 3O5AA 1TE2A 4F8YA 2JA1A 5JJBA 2B8NA 2FK3A 4LK2A 3L1HA 4GT1A 2W6JA 4DBZA 4ZI7B 4HH1A 4DA6A 3UT5A 3C7DB 4Z4HA 5EHZA 3BICA 3FR8A 2CY0A 4UUMA 3T5PA 4ZALA 4W1RA 4DRFA 2X2PA 4LSGA 1EIWA 1QIMA 1IOZA 1JKJB 2NQ2C 3L0PA 3CNLA 4ZAYA 3BFVA 1YR9A 2YCLA 3GGPA 4KODA 4OQ4A 5JV5A 1IHOA 5LD2B 4LJ4A 2OCBA 4WZ6A 2PZEA 1ESNA 3FYUC 2DSTA 2D3WA 3V32A 4S2EA 3T7DA 4RVHA 5HCNA 4MEJA 1GPH1 4QOIA 1REQB 1XP5A 1EFPB 1TWAA 4JLBA 4P6VF 1F60A 3ETLA 1TRHA 1CVLA 3A9WA 3BWMA 2VWHA 3S2EA 1T9HA 2NZXA 1PFVA 1N25A 2AF4C 5C0OE 1CIPA 4RCNA 4TSFA 1T3TA 3UJ7A 4RTMA 3RAEC 5CVEA 3M33A 5FO0A 1R4MA 5LQSA 4PHGA 4PFSA 3OQNA 4L78A 1J1UA 4RNCA 4E33A 1NW4A 4QPPA 4IBOA 1S5PA 2R92G 5C46F 3FMIA 4Q24A 1IY1A 2VNKA 1JXAA 5AXCA 3W3AA 5BUSA 5IZ4A 3G2JA 3NU1A 3CB2A 1JJAA 1P44A 5C1OA 4JJIA 1Y5LA 4HUJA 5LMUB 4N7MA 4IVPA 2JFQA 2NZWA 2CKZB 3BM5A 5KTRA 1NN5A 4N0QA 2DXIA 1EVYA 2VRWA 3N59A 4EKDA 1GRVA 1B1AA 3DPUA 2VJCA 2PKQO 1Z7YA 1XJ5A 3K4PA 3I62A 1LDYA 3RC8A 4U1RA 3MELA 3MT7A 3G9ZA 1Z8DA 2ZJYA 2J4FA 3U4QA 4QFDA 1OWOA 4B74A 4G8JA 2Q9BA 1M1UA 4LFBH 2O05A 2IEYA 4YJFB 3Q6NA 2GN0A 2EXXA 1ZSVA 1RAIA 4C7KA 2KQUA 3BAAA 4HQ6A 1JDZA 1VZ3A 1LI4A 3E22A 1X8LA 4KN6A 4ZOQI 5FPOA 4PAOA 4X60A 2ONCA 3BD9A 1FDWA 3OJ0A 4DL5A 2FUEA 3S2GA 1WM1A 4Q4LA 3GFVA 4NFSA 2ECFA 2J41A 2HA7A 2OKGA 2EZ4A 1DDIA 1D4FA 1G8GA 1R15A 1AX9A 2QRJA 4WNCA 1IONA 3MBIA 2HO5A 2WAYA 1N5LA 4N5IX 2VTVA 3W05A 3D7KA 4P08A 5HJ2A 2ZUCA 3BK2A 4Q4JB 1NG9A 3B1ZA 4Y2QA 2CNWA 1ABBA 1Q1NA 2WK1A 3GNTA 3SYMA 1S9FA 1S0OA 4HGYA 3LA6A 1E9AA 3K1YA 4MQEA 2FZEA 3U5TA 1RJDA 3RRMA 1WH2A 4HMQA 4YAEA 1ZS9A 5ANRB 4YUZA 5KWSA 1KAQA 4FNGA 3PEUA 4CL8A 3KZXA 1UK7A 4WDQA 3BFXA 4UU1A 1SBYA 4EHBA 4R3WA 3S7ZA 3VC7A 4BVLA 1KJJA 5CCEA 1SQFA 2CL5A 1N8NA 1JDNA 2GZRA 4JEMA 1AXGA 4EPVA 5FUWA 5DE3A 2XCUA 1Y5NA 3ADOA 2ZRMA 2NVXA 1DUSA 3QY0A 3VO1A 3W9BA 5ILQA 4PLGA 3OSPA 1AKTA 5JBIA 4Q6BA 4PR3A 2ZBQA 4BFUA 3TNYA 3EMKA 2IS2A 4FFMA 3IR6A 3T4EA 3W1WA 5JZ9A 1D0SA 1EWQA 5JZBA 3ZD8A 4YP1A 3M5CA 4Q4AB 3PXDA 3UM9A 1J90A 3LAWA 1F6WA 2G25A 4KQJA 1Y8CA 1L5KA 1PR3A 1BEEA 5HQTA 3L6EA 3QE3A 2OESA 3QWAA 4N40A 5A4FS 4D81A 4RK0A 3BABA 1I13A 2ZJOA 2VJYA 2D1FA 3KEMA 4YRQA 2D5CA 3UH1A 4LF9B 5LQRA 1NW5A 3NVDA 2I99A 2VSXA 3NGDA 2BEWA 2GCNA 4RKEA 2WKSA 3HXOA 4L0CA 1UK9A 1HTTA 1M7GA 2E6UX 3N0RA 4HY3A 4QM7A 4O1HA 4NMXB 4A36A 3NJ4A 4Q3OA 3UAXA 1HTBA 1HNWH 2R85A 3MR2A 1N56A 1E8NA 3R24A 4K0KB 4E03A 2UXDH 1GFZA 4CIAA 1VECA 4B48A 2EJCA 4XOUA 2ASDA 3OTWA 1RWWA 3Q98A 2CXRA 4D43A 5I7OA 5F2NA 2QN8A 3U54A 3HZOA 4ZJZA 3PUYA 5AXDA 3WDMA 2YUTA 2PZMA 3D3NA 2V6IA 2VT7A 3CEAA 4QVGA 1HH4A 4UZSA 2C3UA 4U3JB 3S3TA 2HQSA 3T7IA 4C03A 5FYDA 2F3UA 3BKXA 2FPRA 3MJRA 3UB3A 1VMDA 1UFOA 5FWDA 1EXDA 1YKSA 2R79A 1JMVA 3KQTA 2FZ4A 5JTTA 1Z3CA 1ZCBA 3RGWS 2AU0A 1O4VA 1W88A 1M1ZA 3QIAA 3W7BA 5DHAA 3SGIA 5B30A 3I4CA 4YRJA 2BM9A 1XMOB 2HJGA 2X1HA 1WSCA 4XQEA 4JI5B 1EVZA 4D9NA 1XF9A 1Z5WA 3LHKA 3ZUPA 3WYCA 2PM8A 2ZBVA 1N5IA 1O1YA 2BI7A 1HFKA 4PBSA 2Q3HA 2Z5VA 4RQTA 4JLKA 2JGIA 2WPDA 4NBKA 1N1EA 4ZU3A 3D2AA 4DLYA 1HFEL 3NM6B 4DM3A 5DLFA 2J48A 4KFTA 1DT3A 4IFEA 4A82A 1L4BA 2XC9A 2H3EA 5G0SA 2Q0SA 3DOOA 5K3EA 3MUNA 2RGVA 2OD7A 3ZVRA 3EGEA 2GAJA 5JW6A 4WGFA 4WK4B 2ZAOA 2J31A 1CF4A 2AZ4A 3EVGA 4BNDA 4H6WA 4LRWA 4ZYTA 1EFKA 3WA7A 3V9AA 3LMLA 1YR2A 4P3YA 3QI7A 2ZPTX 4IIXA 4FHZA 3MTQA 3I39X 4WEQA 3K6SA 2GD1O 3OCVA 2GEBA 4ECZA 2C2MA 4V0LA 3IBGA 1NKSA 4KHZA 3AONB 3EFOA 5JY1A 2PYIA 4EELA 3STTA 4RPCA 5ALKA 1G3MA 4ZCMA 3T0IA 3ND8A 5E2AA 3QA3E 4QHYA 3LCMA 1YL6A 1HYEA 5ALVA 4LC0A 4HEQA 2EF0A 2II6A 2RHMA 3TNDA 4COKA 1QQ5A 1GVNB 1P0FA 4I1IA 1YJAA 4H4EA 1Q7TA 2IPXA 1AO3A 3NOOA 3QPUA 4P93A 4BVFA 5I7AA 1T2VA 5T7BA 5HV6A 4ZXPA 1YQEA 3ILSA 4D4MA 1EKVA 3VYSB 5BRNA 1W36B 2C2YA 4ZDIA 4N6OA 2QWXA 4P82A 3NIWA 2ZYGA 4MGEA 1OJLA 1WUJS 2JIQA 1RCTE 1DBWA 4GRIA 2UVPB 1UP7A 4HG2A 3KBOA 1XALA 1UC4B 4IIJF 2BFFB 4KLAA 3N9IA 1D4AA 3RVMA 4MB2A 3Q8LA 1OIWA 1YOBA 1QORA 1EVIA 1L5OA 3LHIA 4QXAA 3FOCA 3MGGA 4BKOA 1IN7A 3I92A 3BX1A 3WNQA 3SNKA 3TEFA 5FWNA 4U9UA 2ID4A 3TEMA 3MK31 4OUDB 1P5FA 3ESCA 2Z04A 2C3OA 3P9YA 4D3ZA 2VZLA 3RJZA 4PCUA 3S2IA 3WBBA 2G1KA 4I9NA 3NATA 3L4SO 3PR1A 4RPHA 2XKJE 5EQFA 4DIOA 2GK3A 3LT4A 4Z9XA 3C6ZA 2XCLA 4X1YB 2GBFA 5JYBA 4LW8A 1RQ2A 5KSYA 4TV9B 2AT1A 4NX2A 1BVHA 3SY8A 3DYVA 4Q15A 3VU1A 2A1HA 1UBEA 1I0ZA 1TW2A 2CLIB 3WMEA 1O57A 1YFLA 2IF0A 1A8QA 3ZBUA 1ZGCA 3AR4A 2VIIA 4B5LA 1L4LA 1X7XB 4L16A 2IIBA 3TIVA 1D7AA 3M6WA 4MUHA 4ZANA 1VP9A 3T5LA 3N2EA 4L02A 2PNJA 3QG1A 1CF2O 1W5BA 3VH1A 2QK4A 1BXRA 1T6BY 3NWOA 4KQIA 4QKQA 4NY1A 1K1EA 5BWXA 1XXHE 4EECA 2C5GA 1T3SA 4E14A 3AKEA 1LZLA 3L0YA 3F9CA 4CKYA 4QT0A 1R00A 3U61B 1ENYA 3GRCA 2R5WA 3R4VA 2BEVA 4ISBA 1IUPA 4BNHA 1QP0A 1MC1A 1LJUA 1SWVA 2QMYA 4DUGA 3WP1B 5FPTA 4TLMB 2JIBA 2ZXEA 1IEXA 1JI0A 3WGLA 1X7WA 4JI4B 3U4IA 1V25A 3RUEA 3AUKA 1YJQA 3KJHA 3RAPR 4RNNA 5DASA 3PE6A 3KT0A 2HGXA 4JEUA 5DOVA 3D3EA 1NUUA 1DXOA 4URYR 4X64H 3RSQA 3QE0A 3EEYA 4U0JA 1ISPA 1QIFA 4WN9B 3USCS 2VHZA 4Y6LA 3L6CA 1UBHS 1FP7A 4XB1A 3P5BA 2C3YA 2IXGA 4TKUB 2I33A 4A4DA 4XVRA 5DW3A 1K88A 1QZTA 2ZIXB 2I3DA 4JP8A 3DLIA 1V39A 1RQLA 1T29A 3L0IB 5MDHA 3DL4A 3MEQA 2RGYA 3HXQA 4CTMA 1SD1A 1PJTA 5K4HA 2JEJA 4AW9A 4QM6A 4OGFA 1HURA 1UXGA 2R60A 2ZVQX 1FQWA 2YN2A 4HYQA 2ACWA 2ZWPA 3MN1A 4KDFA 5K1ZA 2A5FA 4URXR 4NV3A 2XMQA 4D57A 1O96A 4D4KA 3IL2A 2D0PB 2PH7A 1SHLA 4WKOA 1JU4A 3ZHBA 3V2IA 5AOVA 4XYLA 2MSKA 4NZYA 4YRSA 3L4BC 2A8YA 2R44A 4XVHA 3FTNA 2RDIA 1F38A 3MWLA 1Z75A 1SVMA 1WR8A 4BY1G 1IPFA 5DXJA 2HJWA 1QO7A 4ZU1X 1QE3A 2GYVA 3WMFA 2W4QA 5FLMG 5KYYB 2BCGY 4NDNE 3OFND 5T5QA 1VG0B 2VF5X 3Q10A 3TSZA 2H4JA 4PVDA 2R8HA 2JW5A 4FP9A 4C7JA 3H7IA 3DW3X 2Y1EA 4IDEA 3ZCSA 2N0SA 2D0DA 3ADKA 3H11A 2XCTB 2GZSA 1P4JA 3I6QA 2VNSA 3M1AA 1JQ3A 1Y8QB 1QRAA 4CLHA 1FXWF 3DZ8A 2GBGA 2BH9A 1R6VA 1Y4UA 5ALZA 3KOZA 1JB9A 4K6GA 4C4RA 2BD0A 2YFQA 4EO7A 2N3ZA 4EIWA 3ADDA 1YB4A 3LT0A 4FYXA 4BIMA 1Y9DA 1WRBA 4G5SA 1ZPDA 4BO5A 4UNRA 5IVPA 2IS1A 2V9PA 1RMQA 4DIMA 5CBPB 2VI5A 3E7FA 4O4LB 1Z0UA 3JQCA 4EYHB 2OAEA 1Q0LA 4A6PA 3K8ZA 4K6NA 1XDZA 5IWCA 5K0BA 3RVDA 4AICA 5CW1A 3K70C 4DLTA 5H59A 3LV8A 2P27A 5K8IA 2RGDA 4JKYA 3HO6A 3GJ3A 3L0DA 3QKWA 4UPVA 2WWTA 2WG0A 1YGPA 1MZBA 2M1ZA 5BQOA 2CHFA 5ALHA 1TCUA 5KT3A 3FJOA 1M10A 5CLFA 3UV7A 1MO2A 2WUWE 2QRUA 4W5NA 3R0IA 4O81A 5ETJA 4DJDC 3OKPA 4WKPA 2DBZA 1QVAA 1VHWA 4DA7A 8ATCA 3ZY2A 1SFRA 1U4SA 1AVTA 1N7JA 1N9GB 4BOYA 4J1QA 5EXXA 3RJTA 3ES9A 1RLTA 1YQQA 1ZKDA 1SBQA 1OGYA 2XQFA 4ECRA 4CEJB 3O1IC 2PZFA 2JZCA 4O7SA 2XZTA 5TGZA 5I5UA 1SCNE 2ZT7A 3TE7A 1AGYA 1QAOA 1T5HX 4KLZA 4A8JC 5J4VA 4YGXB 4EY8A 3ORRA 4LG1A 2V97A 3UWPA 2SHKA 1ZRMA 2X4DA 3JZMA 2CF5A 2EJ3A 1EFRD 1FNMA 2UZ1A 3N76A 1CX9B 3KPVA 2BGTA 2P6OA 2X1LA 5BNZA 3MLBA 4Z6KA 1XDSA 3GBPA 4M9SA 4NK5A 1T8PA 1GYRA 2KM1A 4EUKA 3DG9A 2J3DA 1E3QA 2JH9A 3NTRA 3G2KA 1JG4A 2DCMA 3G49A 1VG1A 2WV9A 3L41A 3WWPA 5FOQA 3JQFC 4QXMA 4X44A 1RPAA 3AVXA 3JVVA 1BOOA 3Q0IA 4KG7A 4OQLA 3R3WA 5CNJA 1GUYA 3T4UA 4QEKA 5E4YA 5BURA 1JLLA 2OHHA 3HDTA 1KMHA 2BZ1A 1YBFA 3NEJA 3M8KA 4CLXA 4WXRA 3AU9A 2WKQA 4HCJA 2BM8A 2ZJ5A 3FE2A 1P1FA 3C3XA 3TR5A 4F85A 2UXBB 1OSNA 3PI6A 2CW8A 3G6YA 3ZN2A 2FA9A 3OHPA 3KLBA 1FY2A 1NT4A 4QICA 5ECWA 1YBMA 4A73A 1Z13A 3GFRA 2EJTA 1YB2A 3R41A 3IP9A 1QU3A 1ML4A 1PD1A 4D9HA 3KKNA 4GPEA 3LP6A 4G4GA 9ATCA 5LKAA 4KYIB 1QIKA 5H83A 1WHSB 2AKYA 3I8SA 1J0EA 4Y9UA 5GZ3A 2UVRA 2XYGA 5HIJA 1L5LA 5F7XA 2HIHA 4YT2A 1IN4A 4LOLA 4B34A 3HRHA 4EBBA 5EUMA 5KFOA 1I6LA 3MCZA 2FCRA 3L6UA 1OQAA 4TLEA 4FZ3A 2SNIE 1V11B 3QE2A 1FTNA 3WLJA 2RCNA 2DQKA 4EHJA 1TWGA 3U31A 4ECAA 1JHQA 4XLZA 3ICEA 3UAWA 1SCKA 1SC3A 5BSVA 3CUTA 2KYRA 1UBMS 2VLIA 3WZ2A 1Y3DE 3ZH2A 4ZYZA 2PBZA 3EXAA 3TLKA 3MYYA 1VLZA 4TXMA 2ON6A 4J9RA 1IJBA 3ZCQA 4F6CA 5K0FA 4KMSA 1Y7TA 2XQVA 3I2IA 2PVCA 2WU1A 5EJ4A 4ZXFA 2NQTA 2XT0A 2ZQYA 5HGJA 4UOEA 2B3TA 2YFHA 1JBKA 3CW2A 1J5EH 1M34E 1FUUA 3FDZA 3V8PA 4EI2A 1AF7A 1OWMA 3RKRA 2EFHB 4PZDA 1JDEA 5CVCA 1E3LA 2GWHA 1RQNA 3C3WA 3VTFA 2HCBA 4J4HA 4X20B 4F50A 1XZLA 4B7AA 4CKZA 3L06A 4B84A 5F1PA 1GGJA 3EZ9A 5JAOA 2FEKA 2WMOB 4FGUA 5IWAH 4FUTA 4PCVA 4Y98A 4MP6A 2CXXA 2NO6A 2DEUA 1F7UA 3TNJA 3M4YA 1L4EA 4B3SH 2JGEA 1YJBA 4QDKA 1YVUA 4IFTA 4RD1A 1Q84A 3IKJA 2QIOA 4BBRG 2OFXA 2HQBA 1JYSA 3UK2A 2LIPA 1C9NA 3CCFA 3GEDA 3L46A 4IGAA 3T1YH 4TM5A 1U8AA 2ZGVA 4INOA 3I12A 4AP6A 4Q9KA 4MWCA 1MFZA 1B00A 3H5WA 3HR4A 2A35A 4ABTA 1L8XA 2K87A 3DA8A 1VBNA 4W99A 4AQ7A 1SKAA 4C78A 1NXQA 2OBLA 1DC7A 3BCUA 2WUFA 5KFRA 2QTNA 3LDAA 1SOWA 2CSUA 3FTDA 1K9VF 5KT5A 4KPGA 2E82A 1ZHFA 3PX7A 3GJZA 1WZ2A 2BQ3A 1N3IA 4D9GA 3AWDA 1MX3A 5FPRA 1YZQA 3EAQA 3CKYA 2Y93A 2OE2A 3OG9A 4M22A 1OLSB 3AIOA 1DXQA 3IOBA 2H1WA 5HXAA 1AUOA 4HNSA 1U6IA 2X22A 2R5NA 2DUJA 3OY7A 4GBED 1YACA 1ZUD1 1XZ8A 1YUBA 1SO8A 4DIFA 1YQWA 3R9WA 4XX1A 4F3NA 3H0CA 2ZBRA 3QJ5A 1US8A 4OFWA 3SC6A 3AY7A 1TQHA 4QARA 4YRRA 2DPHA 2QM0A 1Z18A 1HLFA 1KEPA 5ECGC 2EKZA 1OAKA 3GIPA 5EZYF 2AN5A 1E63A 4RB1A 1E3JA 1WVMA 4GVXA 4S2UA 3SIRA 4RDCA 4FU0A 3QU7A 2BGRA 1S0MA 4CUKA 1RCFA 3ZCVA 2C7BA 3FNEA 3HSKA 4K2HA 3K0SA 1XCOA 3ESRA 1N6KA 1ECFA 2Q3LA 2C97A 2AQKA 2O2ZA 3IERA 4YPVA 1TPZA 4H31A 3D8BA 3RR5A 5JR3A 3ZWNA 4NL4H 1IHYA 5HP4A 1WVIA 2FW0A 4FGJA 2VEOA 4YRMA 2OXRA 1MH1A 2FGJA 3EF0A 4LYHA 3VNRA 3IC5A 1ZVQA 5TT0A 4ID9A 4UUQA 3HVRA 2XR1A 2FFRA 2LE0A 3IA2A 2HBRA 3ZGVA 4D02A 2XTZA 5H4GA 1L7PA 5AJVB 2QAGB 1CUVA 4X7PA 1E0AA 2XA9A 5CT4A 4ZIRB 1R0SA 4WLVA 4ROSA 5AVTA 2ZM6B 2J32A 2A59A 1AN9A 3F3KA 4AY6A 4MQ6A 3SSAA 1O77A 3RW9A 1EWVA 1W29A 3L05A 5AM1A 1YJCA 1HYBA 3Q3GE 4XDYA 3A9TA 2Q27A 1ZL2A 3IEUA 4PO8A 3ESBA 2HC9A 2E2HA 1S10A 2JGJA 1GNSA 1IDOA 5JS8A 2NQ8A 2OFWA 3IR7A 1IEWA 4LDQA 4TZ0A 4KK4A 3WGKA 2B35A 2PH1A 3GEHA 4OJQA 3RUIA 3E3OA 4L15A 4BQSA 4NENB 3FLBA 5E0KB 2FXVA 2ZJ3A 2XB9A 3IUBA 3OX4A 1V5GA 1W19A 2GH1A 2YX1A 1RHMA 2LXNA 2MT9A 5CH3A 2FMTA 2VZ9A 3GY0A 2QW0X 5IT0A 3QEAZ 1DEKA 3UCFA 3RM3A 2ODBA 2VA3A 2B8TA 1TZ2A 3QTBA 1KY4A 2IQ5A 3ANTA 1B1CA 3OT1A 3ECCA 2WUEA 3GIIA 1E4YA 3JQEA 1RR6A 1RWQA 5B1HA 4EMSA 1W6RA 3BAZA 4QAQA 1DIRA 2QRKA 4UCVA 2WJHA 3ZNPA 2CK3A 4S05A 1N36H 5KX5B 2WIJA 4WINA 1Z74A 3ROPA 3QFTA 5FRDA 5IP5A 1D4ZA 5M29A 3LW8A 1VJDA 4Q3DA 3ZV6A 2ZTHA 1EZ1A 1P9WA 2GM4A 4FSXA 1KQ3A 3TLGA 2IYVA 2VQSA 3KQOA 1PZMA 4O3NA 4E5VA 1BS1A 5ALYA 4NBUA 1T0UA 4R68A 1VSUA 4DV4H 1P9RA 3QHQA 2JGRA 1Z6PA 1ZJJA 3I1FA 3N8HA 3GU3A 2ANCA 3C3JA 2WSBA 3GIQA 1N75A 3AVQA 2OQRA 4CKEB 1H6AA 2NXWA 4BUJA 2YWFA 2Q4OA 1ISJA 4DJ5X 2L18A 2NXJA 3C16C 3ZYZA 3OJEA 5KYWA 4DMHA 2I4NA 1G2OA 3DBHB 2E2IA 5H3CA 5LL6b 1WLYA 2VJNA 1NI3A 2IOFK 5F76A 5FORA 4L4UA 3NBYC 3FYSA 1PX2A 4EHNA 5EP2A 4FHEA 1I2DA 1Y1KE 1U3DA 3X2FA 2DABA 1RQ7A 2CMHA 3GJXB 2FMAA 2DC1A 1MFPA 2GQ0A 4AF7A 4GPD1 1GSHA 2ROQA 1JSLA 3NAGA 1FRZA 2CVQA 3P2KA 1OAOA 1TFUA 4F0JA 3GW8A 5KNBA 1RRFA 2JCSA 5LDGA 3HV0A 4OB6A 1D2GA 1R5OA 2VUMA 3PUHA 4B6SA 3EUEA 2REQA 1BX1A 5CM2Z 3OE7A 1M72A 3HRIA 4NCBA 3DOFA 3MMPA 1ODFA 1RHJA 4IDGA 3RUAA 4AJHA 3GJ8A 4PC1A 1VJ0A 4X7MA 1MOSA 3DSRA 4HJRA 4Q5IA 4JGIA 3Q5GA 3JQGA 4G67A 2XH8A 4MMZB 4N1AA 4YQYA 5THXA 1SELA 1P39A 2NX2A 3ZHSA 4LQCA 4QJ5A 2HSGA 1NASA 2A67A 3CXUA 1TU0A 1KZ4A 3ETEA 5EP4A 5JATA 3DDOA 1W4BA 4N0MA 5TX7A 3QPCA 2AMVA 4PSKA 2ZUUA 4TMWA 4BMXA 3R5KA 1K4KA 4K8OA 3BTUA 2YY5A 3N6RA 1GPUA 5KFBA 1YHYA 1T1IA 3QBEA 3UTDA 1ZAKA 1UBNA 4I6GA 1R9TA 1QLWA 3WL8A 4LWPA 4C4SA 7GPBA 4TKZA 1JKFA 2WIBA 4PAGA 4FKMA 5I5EA 2PRSA 2CL6X 2JIMA 1ORDA 2V8BA 4YP6A 4D8XA 3PEVA 3NC0C 4KUEA 3T5DA 1Q22A 3MR6A 4FNOA 4X5OA 2CKMA 1U0EA 3DEAA 1W8DA 3PHLA 1FQKA 3R09A 4HX5A 1E4OA 4N47A 4QYTA 4YCDA 3GRUA 1HY3A 2YV2A 3C2QA 4YPOA 2NXEA 3NYQA 5H1YA 1JEQB 2FHSA 1ONNA 1U8EA 3K8QA 3U40A 5CCBA 2EIYA 3AVPA 4D8TA 2RGNA 5LQJA 4N4AA 4R2WA 2DFTA 4MH0R 3S55A 5EJEA 4MW9A 1WXEA 1WOYA 3TDKA 1P6UA 5DTQA 4F4YA 5JJCA 3MIZA 3ECSA 4BUCA 5GONB 3L49A 3GXOA 1G0OA 2I0FA 2IGTA 4YLGA 1MEEA 1MC4A 1X0VA 1IB0A 2GEKA 4GOLD 5A4KA 1RNLA 4BO2A 2OILA 4E6NA 2YVAA 1NR1A 4GRAA 2PYZA 1KR5A 1YT5A 3O3CA 4ARAA 1QIDA 5F9MA 1KE1A 4H7FA 4F2PA 4LY9A 1DZ3A 1JMKC 5KT7A 2BTQB 4JUDX 2GJ8A 4TWIA 1VLQA 2YWJA 4R1TA 2YVUA 3GPBA 2A5JA 3P45A 4DB4A 3LLMA 4CEIB 4TXJA 2V5UA 2VJKA 1GRCA 4OQDA 2W6ID 5M04A 5HW0A 3WLOA 3HWSA 1F0KA 1TIPA 621PA 2JG3A 1LK5A 1E2QA 1RACA 2CVPA 1R0LA 2OLKA 1P9LA 1YDEA 1ZI6A 4RY2A 2W2PA 1G6Q1 2Z08A 1L1RA 5KU1A 1WVGA 2EIHA 4HAVA 4UM9B 4ZHQA 2R6ZA 5KB3A 2V55B 5BT8A 1HNXB 2C9BA 3CPHA 2O3RA 2ZUVA 4MUXA 2HNBA 4R8SA 2ID8A 1TM1E 5AKKA 1Z7WA 4EHAA 1I4WA 2IZ7A 3W9UA 5DGIA 1NT2A 2DZDA 2YN0A 3MWFA 4F45A 5ALGA 3U4CA 3A1VA 1CZOA 1QE0A 5IXYA 1CRPA 4RZ3A 1EI9A 3W5SA 3PFCA 4FT2A 1QNFA 1ZY2A 1SY7A 2X5JO 2ZYRA 2FMKA 3R3VA 4KAAA 3QRWA 5DX0A 4DUPA 3RYHA 3F74A 1E2LA 4X65H 4FYWA 2QPLA 3ZHOA 5F5LA 2A0UA 2XWSA 3C5WP 3EGDA 2Y2VA 1QMPA 4HLDA 4WT7A 2H54A 1WD5A 5DEIA 1RAGA 4UE2A 1C9YA 3TWOA 3HBJA 1LPSA 5FJIA 1YFKA 3QLUA 5F73A 2GMWA 1U9CA 6ADHA 4ZU6X 3N0XA 1QB8A 4DV6B 3CVVA 1AKNA 4Q19A 2XUFA 3TZKA 4IIYA 4OYRA 4V02A 3GP3A 4M1WA 5FR2A 1QCYA 2OUKA 3RAXA 2QD1A 3WA6A 3DTVB 4BMCA 2QLTA 3VM6A 2HJHA 2QG6A 3FCEA 3UPTA 3GAFA 1EFVB 1R64A 4XPIB 2ID7A 4X8HA 4IRMA 5D3MB 1QYVA 2NYRA 4MVXA 1O03A 1E3MA 4W6QA 2WTNA 3Q6IA 4F71A 4TGLA 3U4GA 3PK0A 1ZN7A 4AJ4A 3IQGX 4DV1B 1ODLA 2HL6A 1D9XA 2MIIA 1GD1O 1EPUA 1ITZA 3HP4A 5JYCA 3O0DA 3NONA 3P0HA 4GI2A 5I7VA 2V4QA 2XF8A 3N8NA 1WF6A 3W7VA 3ODGA 4FZVA 4KR7A 4KXNA 1TO2E 4KN9S 5KNDA 5D86A 4W5WA 5ALLA 3L0OA 2POCA 4BVEA 2VDJA 2WIGA 1SYXB 4WFKA 1KDZA 4V39A 2RIRA 2COUA 4FMPA 1XZKA 2OBBA 5ALUA 2DFVA 2F1IA 4IH9A 3QXJA 3OCYA 2HF8A 1BMFD 3ZS9A 4RNMA 3DHNA 4YRFA 1Q44A 3II6X 4MUFA 1NVWQ 1YZFA 5C3MA 4XD2A 4FOLA 4TL7A 3RRFA 5FNZA 1FW8A 5DI3A 3V4OA 4JUAA 4HXEB 4KXFB 4MGZR 1USWA 3GTPA 4EGFA 4S04A 1B73A 2CNNA 3K5IA 2D5LA 2C2OA 3ZEIA 2MSNA 1Q12A 4I0WB 4P1ZA 4O4JF 1EK2A 2JGNA 3WE7A 1B0ZA 2WB4A 1CS4C 3LPLA 6GPBA 2O7RA 2WAAA 2WVJA 1QTIA 1L7EA 3RNLA 2BDUA 3KQHA 3IT2A 5FD6A 1MIOB 4NLLA 4KKVA 4LEIA 1H5UA 2IP2A 3EOAI 1W4LA 4HRYA 1J7KA 1QG0A 4RE6A 1K7YA 1ONBA 4NOMA 4BRUA 1YE5A 4ISCA 2TMKA 4DF3A 2QUZA 5I5YA 2WF8A 2IPAB 4Y2UA 1GYQA 1OA0A 2R6FA 3NBUA 3OM8A 2IV3A 1UFKA 1M5RA 4P0PB 3A11A 4FWIB 4EF6A 1SKBA 5H9WA 2V1UA 1N6LA 2GJ9A 3ERCA 1WCV1 4MWSA 2JFNA 4L8GA 3NPMA 2Q6OA 3BA6A 2YXPX 5GJCA 4MROA 4N03A 1VRCA 3KTDA 3E9YA 1ZZEA 4DMCA 2ARKA 3O83A 3TPZA 1G291 2GWRA 4IIJB 4DG5A 1HK7A 4BXOB 5E3IA 1M66A 2G3YA 5DT2A 3B51X 1SCAA 1AKVA 4FB4A 1FP6A 1QLJA 5HILA 1CJKC 1R9MA 3VXKA 4I36A 3MFHA 1O95D 4TQAA 4HV4A 1KVSA 5FOVA 4RKRA 2XI4A 4GOJA 1UZLA 5JAIA 3PFBA 1T4CA 3AH8A 1M54A 2HFJA 4O6VA 1V3VA 4ZYLA 4EO4A 1LSUA 4RMGA 3E7XA 3KAJA 2VYNA 4Q02A 1T1JA 4ED3A 1I7LA 5KHLB 1TEVA 5CYPA 3AUTA 2I1VB 2INGX 2WG1A 2HSDA 4E0BA 2XXAA 5EWJA 4CRWB 2E4XA 2WWRA 1YI8A 1KJ9A 3FLAA 1W0JA 5CDHA 2A5LA 5ERGB 3UWMA 4UNIA 1S9DA 5IMSA 2YZ2A 4NE9A 2X1MA 4QGSA 1X39A 4WOJA 1U8ZA 3OQ1A 4DLKA 1ANKA 1EU1A 2P3SA 3UWOA 3AUJB 1E3EA 4BU0A 2ZYIA 5CBKA 5GONF 2IEAA 2J9RA 1L3CA 1M2OB 1VLJA 4A23A 2CCGA 4QO8A 1N6HA 4HNAA 1L7QA 2CGEA 3SLKA 1RC1A 3NT4A 3WLSA 3EXFA 4DCSA 2HJSA 4P83A 2FE3A 3E3MA 3H1EA 2GCGA 1R0KA 4PR0A 3V2HA 3OCUA 1CVIA 4LFCH 2PMFA 4J0CA 5DEOA 4RHYA 3L9XA 1SMKA 1UODA 3VDXA 1FPQA 2O8DB 3WRWA 3MHPA 1ZWLA 1FTYA 3TTSA 4XWGA 5AXAA 2YIMA 3ETCA 7MDHA 4GP6A 1KK2A 3DKIA 5J2UA 1CR0A 2PLAA 2C2DA 5H16A 1XRSB 2PLNA 4GDFA 5CDFA 3AQ4A 5KG5A 3PUJA 3ZI0A 3KAQA 5L4NA 3VZBA 4Y6GB 1IJFA 2BSXA 3PENA 2HLPA 5D3ZA 5E7QA 1M8GA 4QQRA 2BHTA 5KQRA 2RHBA 5DHSA 1YTLA 2J4CA 3THRA 1KSJA 2C82A 5H02A 1G5QA 1ZMOA 4LUCA 5JAUA 1H2AS 1IYZA 1C7IA 2GN4A 2FPPB 1ND6A 3WL3A 1OUMA 2DT8A 2QQFA 5FFMA 1M73E 2DMRA 5AVJA 3JQ8A 1QF6A 1I0LA 1GXSB 2XNHA 1MOPA 4BDTA 3T9CA 3GCZA 3EZLA 4I4IA 1YOVA 3BIJA 3LH5A 4EG1A 5LP1A 1AC5A 5IC6A 3H8VA 4AROA 3QKRA 3L7NA 2I62A 1Z29A 1QIHA 4D56A 3IN5A 3ROQA 1S2NA 1KI1A 4C21A 5LMCA 5ED0A 3N2GA 3BMQB 4GKVA 3PW7A 4OHZA 4B3CA 3P1JA 4LBYA 1VL6A 4IR9A 4HDSA 4OB8A 1UMKA 1O94A 4QPDA 4HX9A 3SDSA 3OE5A 4HAIA 3K0HA 5F9HA 1WY5A 5AW8A 3QX7A 2HFKA 4F4FA 3QU2A 2XNDD 3UJ3X 4K3UA 1GITA 3N58A 1QE5A 1GUZA 1N6PA 3IOMA 4ER6A 3ICOA 3HEBA 3N2NA 2VOBA 4KAXA 2ZOSA 3T1HB 1NW9B 5A7FA 6AT1A 1DELA 2O2YA 5E2IA 3GARA 3WBJA 2F1HA 3WLLA 1WCIA 5E7JA 2Q3CA 2IDZA 2YIVX 5JTUA 3CT4A 2JAPA 5C37A 1U8TA 2CD9A 5GWXA 3DWEX 1CUFA 1TQ6A 3OAAD 4R16A 1I4TD 4UUBA 4NSNA 2ZTSA 3IAM6 3PNVA 2P9JA 2Q3BA 1YFJA 5F12A 4L51A 3MOSA 4H15A 3VHXA 2UVQA 1B3RA 1M9NA 4DV7B 1L3IA 5L3SA 2Z3ZA 3T99A 4RTLA 2WTAA 1E69A 4JVLA 1A1SA 1BEUB 4DY4A 1S8OA 4BP8A 1EK0A 3EJ6A 2W4IA 2C7QA 2J9FB 3A6EA 4NPAA 4FS2A 4JV1A 2COGA 2PKRA 1RPNA 4DMMA 3WDLA 1SULA 4M1KA 5BPHA 3ZI4A 4RIGA 5I5GA 3BHJA 5F52A 2E4ZA 4ENWA 3EISA 4HNRA 2YWVA 2XLBA 4PC6A 5AVSA 3BJEA 4ERXA 2A3NA 4J07A 4L4XA 2Y27A 2J5QA 2PNFA 4TT3A 2FV8A 1KJQA 5FV4A 1LPBB 1W5SA 2H2IA 2R97A 3KETA 3REOA 1LCIA 3TVDA 1T9GS 1VPTA 2ID9A 2H4WA 4C04A 1MVOA 3PWZA 3P2OA 3E81A 2A9RA 4HZUB 4JI1H 1F0YA 2WIAA 5CURA 2QJOA 1NVBA 2V4RA 2GM9A 3PCRB 1DZIA 2IY7A 1MDBA 3IKTA 3EDMA 4AG3A 3CUWA 1OWNA 1GN8A 1Z6ZA 1DAHA 4FVTA 1V48A 1PZFA 2KWIA 2F17A 1RRCA 1XTSA 3MTGA 4DZTA 3SZLA 5IULC 2QUAA 2QM8A 4IIFA 1GJRA 4PX5A 1J2UA 2Z2JA 4UDXX 1U0SY 3HOVG 3BXHA 2HF9A 1QGZA 1WB9A 3HB9A 1HNZH 7ADHA 4DNXA 4CV1A 2WINI 3OPVA 3M83A 3AO0B 3OECA 4CN8A 1PNQA 1T2FA 1Y33E 5EXDA 2J08A 2LV8A 2AI2A 5AUNB 3LL4A 2ZIVB 4FMBB 4LNUA 3HLTA 4AU1A 2UUAB 4PRYA 1KI3A 4JP5A 4CMHA 2GVDC 2XF2A 3KZOA 2AWOA 2PSSA 2ATXA 1N5OX 3AEKB 2HT6A 1OHHD 4QDZA 3A1UA 4JQCA 4Q03A 3TW6A 2ZBFA 1K08A 3FPSA 3AXSA 4XSVA 5BWVA 2R1VA 5GP1A 5T6MA 2VAPA 1NRXA 3K92A 2RBEA 3HTXA 4KE7A 3O9ZA 4KGZA 1BGWA 5HIIA 3B2QA 4IZHA 2XNCA 1FUKA 1VCMA 1Z15A 3F5SA 4HP8A 3FW1A 4G07A 2E87A 5IDYA 1QBKC 2ODTX 4EQ5A 1HI9A 4ROTA 3JD4A 3ELUA 3GFQA 3CLTD 5FTLA 4INAA 3K1TA 4OLFA 3TM4A 5C1PA 1IM8A 2GN2A 1EXNA 4UXJA 1AU9A 4K1LA 4ALIA 3KFXA 3VSAA 3T3DA 4DQVA 1AKMA 3FDSA 4ZT3A 4AYWA 3VPHA 3A1EA 4UHCA 3ZGYA 2GRUA 4MQMA 4REQA 1FB5A 5K0LA 3ROFA 2GPNA 1E1NA 1VCNA 4BLPA 1ZUIA 3LX6A 3B1KA 1C14A 3HXPA 3JSXA 4EGQA 2PZBA 4N8DA 4TRRA 1UBFA 3W7AA 5DCYA 3V8EA 2IWHA 3BWEA 5KSPA 2G9UA 3PN1A 2EU8A 3Q7SA 1KEVA 2Q9AA 3AEUA 3JR3A 3BWXA 1FLDA 3V2GA 4EZBA 4H3VA 1KETA 4YQFA 3FWKA 4EX6A 1SVLA 3HA5A 5DXFA 4EARA 3T7RA 1EDEA 1J33A 8AT1A 5GQSA 3WSTA 1PR9A 1RI4A 5J59A 1TZCA 2UAGA 2UUOA 4TTRA 4JDUA 3NBXX 1I2MA 3RJMA 1MTOA 3NETA 1D0VA 1EYZA 3Q1KA 3RAJA 2WF6A 5CITA 4F1JA 1DQPA 3GLFB 3HDVA 3BG5A 3OJXA 2WTXA 4QYIB 5BOVA 3RO7A 4XVUA 4U2BA 2JLVA 3IFSA 2Q8NA 3P9IA 3G85A 7ABPA 3R7FA 2P9EA 4ZJUA 2FSGA 5CG2A 1IUNA 4KI7A 3CE6A 1TKBA 4BEVA 5KFIA 1FMCA 2BMVA 4KX3A 1TMGE 2FLWA 4JJ8A 2QQEA 3TIIA 1ORRA 1YR1A 4AXXA 4I08A 1A8UA 1CRQA 1LXCA 2XCOA 4KVZA 2UXCH 2EQ5A 4LV5B 5JLJA 3KKLA 1Z5UA 4M9CA 1ONPA 3QTTA 5TIIA 4UTVA 3NTUA 4EEKA 4LGCA 4GXTA 4GLWA 1HM5A 3W2IA 1KMQA 1OYVA 2EHDA 2J67A 3UCXA 3CVZA 4UMEA 2ZE5A 1V6AA 4YAKA 3QYAA 1P0PA 4MA4A 2TMDA 3H4DA 1XKQA 4J6EA 4ZTUB 2FK8A 5E4TA 1PFUA 1JX6A 2F9FA 3T1VA 3W2TA 3CXRA 2M2IA 4A92A 3D1JA 2JGMA 3SYKA 3HGTA 4OKSA 1IQRA 1JV2B 3U3RA 5I9IA 1XI2A 1U2EA 3QHAA 2G70A 1M6NA 1GQFA 4GS5A 3BHMA 4IS3A 2G67A 3EZGA 3G13A 5IKPA 1T2EA 1GUFA 1XDNA 4P7FA 4E31A 3ZHRA 3B6EA 3C3EA 3GUUA 3A1SA 1SBCA 4I3GA 3PJEA 5T4EA 2GVZC 4E5PA 4IHJA 5FLKA 2LD4A 2FEMA 3RSLA 1SEPA 1ZGGA 3B6MA 3IBYA 3AL0C 4HS9A 4EB0A 4EUNA 1VKZA 1KKMA 1SKQA 3JATB 2AIRA 1XSEA 3C4JA 4GRDA 1KS2A 2P6NA 2QL9A 2O5VA 2WD9A 5DISB 1TECE 2WAQA 1SHJA 1Q0QA 5EZYB 1EM6A 2VPZA 3NTLA 5LBIA 3QENA 3VKGA 3TOCA 2BFWA 4DV5B 2H0AA 1W1IA 3MMXA 1R0CA 1UANA 4Z7OB 3DFFA 1VJ1A 1WCMG 3P20A 2JS7A 3AZQA 2R11A 3QKIA 3K9WA 4FOTA 4IP0A 1R6XA 5DULA 5DBIA 1F4LA 4ZVOA 1T9KA 3BTVA 2HRZA 3H3FA 3VNQA 3IVCA 1AK2A 3DO6A 1WD7A 2GFHA 1ESEA 4N7RA 3GN1A 2PKQP 2JCGA 2NU9A 5LLSA 1JUDA 1GG9A 4RK1A 3OKFA 1V8FA 5KYTA 2O0LA 2GO7A 1LTKA 3NVAA 2DM6A 2RAPA 2CXSA 3DJYA 3L6BA 2Y1GA 4BZQA 2I7XA 1QQTA 1I6WA 1E9VA 4W6ZA 3OZDA 2A1UA 2DPJA 1HSOA 4AKEA 3VH4A 4MGYR 1YJXA 1ZJ6A 2DWQA 3D6TB 2AQ4A 2FSVA 1NI4A 4G5OA 1NW6A 3QPAA 3C6YA 1CR4A 4KW7A 1D07A 5IUJC 3O2NA 2KBFA 3I6MA 3X2EA 4ND1A 4PC7A 3HJGA 1PJ8A 1ZD4A 4MVJF 2PX2A 3TH5A 3TOXA 2ZWMA 3ZJUA 4AWBA 5BUQA 2Y4RA 2ZAMA 3FMAA 1J4AA 1PJBA 2JJ1D 1NSYA 3L0ZA 2V54A 5HQ3A 4QQNA 1PZHA 5E6SB 4K26A 2F8MA 1MVNA 2Q28A 4Q3BA 3ZWQA 1RKXA 1U65A 1HE8B 1L5HB 4PFQA 3WV5A 3ETNA 3EARA 3THOA 1T3LA 2QUIA 2E49A 1PT5A 3T34A 2OA0A 3N2KB 3C5HA 4KXMA 3ZQ6A 1U02A 2VAWA 2BFAA 2FR1A 3IMCA 4BGIA 2IIPA 2HT1A 1GPWB 4C2BA 2PWAA 3EWIA 4AYXA 3H1AA 3HP7A 1F1JA 1ZKMA 4V0KA 2KJQA 3TUIC 1P4GA 1M3SA 2Q6TA 1LQUA 2FKAA 2ZDHA 1NJ2A 1R8JA 3O3NB 4M9XA 3DQQA 1N2XA 3BSSA 4MRMB 2YZMA 3SWWA 1M1NB 4RGVA 3ED5A 4P31A 4LVNA 1BXGA 3QWBA 3O73A 4M60A 4U0KA 2DOKA 5FPKA 1GTSA 4HWGA 3I0ZA 1JVBA 1TTHA 4OMCA 4HVLA 1Z4PX 3GG9A 2IZ6A 2PGXA 4DV3H 3EW7A 2P78A 5P8WA 4HK4A 2AFHE 3Q7TA 4EUHA 2GBCA 1IU9A 2QR3A 1EVEA 5J2TF 3PLRA 4O7VA 4RENA 1DV1A 2OLEA 5T57A 1XDUA 2CZCA 1QS0A 4NZZA 2X8WA 1QPGA 3NWJA 3DL2A 4BTEA 2B7BA 3PDWA 3TX6A 1ZK1A 4MUJA 5CLHA 2BFBB 3ODPA 4HMPA 5EKTA 7MHTA 1QZXA 2C5EA 2VDWA 4DC9A 3UH0A 1ZSNA 4ENQA 5ALMA 1SNYA 2XRZA 3SCZA 2AG6A 5C35A 1CB0A 1WTCA 2A1IA 2C7OA 3ZGNA 1ECJA 5AW1A 4KO2S 3N1UA 1HKUA 4AECA 1A97A 3VYVA 1DKRA 4MJLA 4WLEA 3WIBA 4ITRC 1J9ZA 2JFZA 4PC2A 3N53A 2I3AA 2Z30A 4Q6WA 4HPWA 5CNMA 1X9NA 4BNJA 4KVAA 3LZCA 4PIMA 4Q37A 4QUBA 1UK8A 3IQHX 4BKQA 1IBMH 1TCAA 3N74A 4LZZA 4U6NA 1QP4A 3BQ2A 2NP7A 3TRDA 4ALKA 3P2JA 4BPBA 4ZT2A 1CBUA 3GLGE 2YXBA 4G5HA 2LUOA 3WGJA 2AOWA 4H7PA 2QRQA 4ZCLA 3MW8A 1U5BB 4BBSG 3UHFA 2G9RA 2NU7A 1PK7A 1WBDA 1XPRA 4WK6A 3BSFA 3PB3A 1OAOC 4JASB 4MO9A 1N92A 1IL0A 5KT2A 5KSOA 3BK1A 2QBYB 3V42A 3LQYA 3TQCA 4D9MA 4MTLA 1JR2A 1CFZA 5K2OA 2Y0DA 4ARBA 5HS6A 3L2PA 4PPFA 2IU3A 4K9QA 4IKOA 3D81A 2H9YA 4L9RA 3W5HA 1PEKE 1PO7A 3A4IA 3GLIA 4Y6QA 3FCAA 4XA8A 4F2WA 2H4XA 3J80A 5B1DA 2IBMA 3HY6A 2XGGA 4BL5A 3ENWA 5C32A 4TUYB 1U0JA 4K40A 3X1KA 3KJNA 5KINB 4FD3A 3X43A 2VHUA 3LX4A 1B42A 1XTIA 2H92A 4GX0A 2Y68A 1JKIA 2WICA 2FSPA 4ECXA 4BNTA 2C2XA 4B44A 3AFOA 2X5RA 4PCAA 2P2NA 3IILA 5KKCA 1H8HD 1AY0A 4ZQFA 1W2WB 1L5ZA 1ET0A 1IOWA 3DC7A 2NO0A 1N33H 3SEQA 5FBWB 4LXXA 2JVJA 1SU8A 4MI1A 3C3DA 4P4SB 3LBYA 1BE0A 3INYA 4ZI7A 2V03A 4WLFA 3EMDA 1H6BA 2P91A 1QHXA 1XDBA 1E3IA 5D85A 3F90A 2CW5A 2PKWA 1XKXA 2R7KA 1VCHA 3K0FA 4ZOLB 3SM9A 1K27A 2JFUA 2JH8A 3DPSA 2W42A 1XK7A 5HPYB 2ACEA 2OG2A 4DCOA 3F5QA 4NFLA 3B3FA 1C3JA 4IV0A 4MWZA 4Q0YA 1A82A 6NULA 3MS7A 3HOUG 2ZUDA 2RGNC 2XMCA 5U9CA 1DEXA 3KHGA 3EEOA 1REQA 1EFPA 4M49A 4W4TA 4P2BA 1D8TA 1YI0A 2LBPA 4Q44A 2PPLA 3HFGA 1H4SA 3UGKA 2Q7OE 3B7WA 1G16A 4MKIA 1ID8A 4OL9A 3VOTA 2APJA 5BWTA 3AVUA 2PD3A 5ICMA 3IT0A 2QNRA 5JQWA 1RQXA 2X9NA 5BPFA 1J9GA 1MTZA 3CGWA 4HQKA 4RS3A 1JJVA 4XGKA 1BVYF 3OQBA 2GJSA 2WTBA 1K0UA 3KG2A 1K8YB 5LXTB 2ZBDA 1TGYA 3W2EA 3VNBA 4YCAA 4UDYX 3JQ7B 4RH3A 1Z6TA 2PYDA 5CJJA 3RLIA 4US0R 1U6JA 3QUQA 5BSTA 1TD1A 1GN9A 1FJGH 4I81A 2BW0A 3KHRA 3P2EA 4IUBS 1Y89A 1VPLA 5FNVF 2RCYA 3O4HA 1G66A 3A6GA 3PKIA 1QXSA 3WR5A 5E3HA 2YV1A 1MOQA 4TTSA 2XADA 3RE1A 1RFLA 3DBRB 3I01M 4YUYA 1FMJA 3A32A 2BQUA 1UMDB 4PLZA 2NU6B 1L7VC 1SVWA 3SICE 3C6KA 4PEVA 2AC4A 5C1IA 2G5TA 3MJHA 2WB1E 4LY3A 3WHKA 5LQUA 3FBWA 4D3DA 3QVKA 1KDYA 3OUTA 3MSCA 3EGOA 5T64A 5EDWA 3DDUA 4ODIA 2QT1A 4UFZA 1KI6A 3N6VA 4D3FA 1ZJ5A 4CXMA 3VBEA 1G0NA 4LFAB 2AXNA 1RWPA 16PKA 1TLLA 3SOPA 4AYBE 1RYNA 2XDQB 3HEAA 5HZHA 3MINA 1GTVA 4A2AA 2E2WA 4WZBA 3E35A 4LQLA 4MIYA 1I5RA 5JAMA 2A3RA 5AJUA 5BW8A 3A28A 3H9CA 3V33A 5HA5A 3QLUC 3FRJA 2AG1A 3FG9A 1I36A 1P6QA 4FEAA 3MGCA 3OEHD 4M1QA 1SVIA 1PDVA 1AZSC 1G8AA 2PK3A 1QR2A 1MPTA 4TLCA 1XQ9A 1EG7A 4DDMA 4RY8A 2EZ9A 1SVSA 2D5BA 4HATA 3AJ8A 2CJWA 4HWOA 2FN8A 3WL7A 2B6HA 3WSWA 3L9WA 5EE9A 3D3QA 1T1SA 1VKNA 3GLHE 4D74A 4QDUA 4MGKR 3FUVA 3C15C 3FIUA 5LNK1 4LJRA 5FAKA 3HGQA 4Q1DA 5ALFA 1Z7GA 3B9PA 4L7QA 3KYCA 4M7WA 4OHRA 3H8JA 1VCOA 3KQYA 3ZWPA 1UUFA 2OBNA 2UUPA 2ZI6A 1T1EA 4YXFA 1E7RA 2ZM5A 3PHJA 4N48A 2NYAA 2EARA 4G5YA 1U0OC 3DD1A 2PS1A 3C70A 3AESB 3H2KA 3ITEA 1QVVA 5KYUB 4QRIA 4RMHA 2QTWB 4RU1A 4RTOA 3L8HA 4D80A 1UXOA 4X3OA 2DPYA 3ILXA 1DHRA 1FX0A 5BV1A 3ZV3A 4AI6A 4Q4AA 2OORA 1BC5A 4O4JB 2VYVA 2I71A 1HGXA 4ZC8A 1NKTA 4NIMA 5GVSA 1KFBB 2PXCA 4N5MA 3EPJA 2FPWA 5I6DA 4H17A 2XX3A 1XMVA 4C0XA 3QVJA 3KOOA 3BRWA 4FFBA 1AS3A 5I5SA 1DG3A 4C05A 1SXGA 1VFNA 4WH0A 1Y82A 3LVRE 4ECEA 1TD9A 3RKSA 1QV6A 5AICA 3FNHA 2Y6UA 1GPNA 4B7ZA 2GSWA 3RADC 3V7YA 2JZOA 4TM8A 4WLNA 1ID1A 1ILWA 1L5QA 2LGJA 4UHJA 4ZVPA 1U9ZA 2AJTA 2WKRA 4LGVA 4P7KA 4M1OA 4ZZIA 1DGQA 3MWMA 4EB6B 3VVCA 3A2KA 2M98A 5FH9A 2FX2A 3IQXA 4B76A 3THSA 4RQUA 3OIYA 2PUFA 4IDAA 1RJ9B 2CXQA 1XPUA 1EVKA 3P5SA 3ZU2A 1P7WA 1ZHQA 5LZ4A 2FQYA 1C7ZA 2GT1A 1FSGA 1JMYA 3HYLA 1SUWA 4HNGA 5IAAA 2BISA 3GTOA 1BDHA 2WSIA 4F7WA 3RGXA 5DX8A 2EDCA 5AI4A 1GT6A 1A9RA 4TUYF 3RYIA 4B80A 1QH0A 3WB2A 3JQRA 1JHVA 3KSUA 1E7WA 2VAXA 3PIRA 1SR8A 3ZX4A 4BQOA 2JLUA 3PIDA 2P6UA 3VYUB 1A4IA 3IS3A 4GKKB 3RANA 2R84A 1RSZA 4DR4H 2DPMA 5CDSA 1ACLA 3TVYA 3RTGA 1LY1A 4XDGA 2FPUA 1HT3A 5ALJA 2R65A 2BMJA 4QXOA 3HDJA 3ROKA 1ADGA 3IAS6 2DUNA 4MPTA 4JH0A 2NXCA 3RS0A 2ZK7A 3SJCA 1RM0A 2J9XB 1CVRA 2ZKIA 1UEIA 3F7TA 5J23A 1IWPB 2CBGA 4AQDA 2VBCA 3QG5A 1ZNXA 4CDRA 2ZFUA 3MCVA 4ZCPA 4ZOLF 1ZGAA 4LYJA 4DR3B 5FLXA 3R23A 1ONOA 4A3IG 4ML3A 4Q8FA 2E1PA 1G4AE 2QE7D 4FFWA 4YR3A 1F8UA 5KTSA 2AVNA 1PR2A 2I76A 1JSCA 3DQPA 4XAQA 5T8KA 1YU9A 1MABA 4C0LA 2W6MA 2V7WA 4EW1A 2Y76A 3PC7A 4BQFA 2F62A 2FSHA 3G68A 1PU2A 2CC2A 4XB6B 3WL5A 1T3HA 1ZVVA 4QOGA 1GNPA 4JUCA 4JC4A 4XIJA 3ZWDA 3L92A 4I19A 2WJVA 1ZGBA 4TS4A 3TQTA 4DABA 2REXB 4RUKA 4FYIA 1KEUA 2FK7A 2X0NA 3WXMA 1X74A 3N43B 4D9IA 3Q3HA 1ZIPA 5HFNA 3G7UA 4KLRA 4G01B 3ON5A 4MCHA 4WFIA 4GZ6A 4MQBA 3BOSA 1ZOIA 4DEVA 5LXTF 3SQMA 2HZBA 4EG7A 2ZWIA 1Z6QA 3V7FA 2K6GA 2Q29A 4IMPA 1NP6A 1HL7A 2OQIA 3DEIA 4I4TB 3N8IA 4AT1A 4PZLA 1EFAA 3R0JA 1TX4B 5DP1A 1LVGA 2WDPA 2FZLA 5KS8A 3HR8A 3AF4A 1OI2A 3O2QB 3EASA 4EYSA 3BK7A 4BV8A 1PQWA 2FR8A 2IBTA 3DVSX 4X6UA 4YAGA 1QGYA 3C3YA 3VZRA 6LDHA 2JEGA 2OXIA 3OQPA 2A0WA 2GOYA 4IOKA 4IAOA 3AYHB 2ZU0C 3GCGA 5AK3A 4CMGA 3Q6MA 2F3PA 3LF2A 1JDSA 3C41J 2ZSKA 1ODCA 4JI3H 4Y3UA 3QI2A 1LPPA 4ZQGA 1YR7A 3OZGA 2P30A 4OUDA 3GVXA 3OQJA 4ZQIA 5LR6A 3OZ7A 4O3SA 3K05A 2XRMA 4CKWB 1FVOA 3OPYB 1TB4A 4XEHA 4DHWA 1HORA 3ECAA 3VX4A 4V2UA 4TPKA 4X1YA 4TS9A 2NSYA 4ZA2A 5C5CA 4TV9A 1XV5A 1VSVA 1I30A 1CHDA 3Q8XB 5AHKA 3G1TA 1ZH0A 1R12A 5HQJA 5BYJA 1G6HA 1X7XA 1E59A 4LQ4A 4UDOA 3EY4A 4EMBA 9LDBA 5A2QW 1O94C 5AUPB 5C31A 3NH9A 3O7WA 2BM1A 3T1NA 1A88A 5EZQA 3TBFA 4PNHA 3TAUA 1HE2A 3DBLA 4LPKA 2QYHA 4IICA 3JTEA 5ES3A 3GQVA 4DUZH 1CKNA 2VK8A 4LXYA 3PQ8A 2JFPA 5JJKA 3PC4A 2W0MA 2IY9A 2W9CA 5C4XG 1QLHA 2O59A 1K9SA 4EHDA 3DYIA 4JELA 1A9YA 2QMZA 2DQYA 3G0DA 5DGXA 1ZGJA 3H6GA 4UUOA 4QG3A 1EUYA 3BFPA 1E1KA 2O7VA 1U8FO 1SPXA 2DY1A 4HN2A 1EVJA 3A6FA 2PA0A 2WWVD 4R5MA 3G6XA 2J9YB 4P3NA 1BKYA 1V95A 4GKBA 2Y1OA 4EB3A 4M6WB 2WVGA 3M4JA 2O6LA 2W6OA 1O75A 1GG2A 3ZXXA 3TB6A 2B4RO 1RXWA 5J3JA 2PQMA 1AUQA 4NYEA 3QELB 3GQBB 3TUJC 2VBGA 2W2VA 4HQOA 4R1QA 1CY8A 4R40A 3WWOA 4LH7A 4Z7QB 3HBFA 1GQOA 2Q62A 1N2CB 2B37A 1A9XB 3BFKA 3RABA 4WN9A 4F5EA 3U7FB 2A0KA 3TCKA 4PYNA 1N34H 3VO2A 3WTCA 2H31A 3OZTA 2HUNA 1SXJD 4RIFA 2ALJA 4TKUA 3V8QA 4TWZA 5SZHB 3SK0A 1KSGA 4BB9A 1IUKA 4MX8A 2X7HA 4NH4A 4GYKA 5DNCA 2C0CA 5AJWA 3KZNA 1XZDA 3CMMA 1J0BA 3QPWA 1JEAA 1I4OA 1X8JA 4AKIA 4RADA 2BEUA 3PRHA 2O06A 3ZW9A 4DJTA 4R84A 4FM9A 1P5JA 1CJUC 3KJFA 5SV2A 2C4NA 2C1XA 3WGYA 1FQOA 4KWCA 3IP5A 1WB4A 4PLFA 4TMVA 3ZD9A 1DCKA 1C30B 3HFSA 4Y6OA 2VF8A 4LZNA 1S3IA 4D9EA 4JUFA 2QTCA 3JSLA 1EJ2A 3MWKA 2XNKA 2GASA 2QRMA 3HC7A 3MRSA 1OPXA 3G1WA 1XMPA 1JXMA 3I2HA 1LLQA 2NV0A 3DZHA 5HKKA 2J3HA 3I9MA 5KREA 4A26A 1ULHA 1FEZA 3N44B 4FQ8A 2HIMA 5CIYA 1Z88A 3LVQE 5IHXA 1X9HA 2O14A 4NAVA 4BBPA 1E0JA 5IM5A 3F5DA 4LX8A 1TIKA 3ZDFA 3Q3IA 4MKRA 4TKMA 3DJFA 1PVDA 5L4SA 1LI5A 3OFKA 4RU9A 3T3OA 4N12A 5FULA 4HN4B 3HU3A 4A5SA 3E82A 3H87A 3I2KA 3PD1A 1U80A 2VA8A 2OZVA 4DQXA 5T67A 3JYPA 4UUNA 2UVDA 2V7VA 4Y2YA 5BNFA 4YRKA 5DG8A 4DQNA 2YTZA 4IDNA 3CS3A 1CUBA 4X8MA 5F64A 1DUVG 2I66A 1JKXA 4YR9A 5K8LA 3EODA 4FR2A 1DKQA 5ADWA 4K05A 4R9NA 5J4YA 4HVAA 1JHZA 5LQMA 1VIYA 1NMXA 3CRQA 4IIHA 3ZBPA 4AULA 5H7XA 1NNSA 4O4LA 2ZDQA 3TQ1A 3JRNA 3V55A 1E7QA 1FVHA 1OU0A 3ZJVA 2ZRBA 3PW4A 3QKTA 4GW3A 3MFQA 2I55A 3PVXA 4CE5A 1TVMA 2QDKA 5DFAA 4AUEA 4A10A 1E77A 4YMIA 2ZUFA 4Q1VA 3OD5A 4R51A 3WK9A 1XGKA 2RF4A 4Z3DA 4BTLA 3U16A 3L6OO 4NG4A 1JHPA 2I34A 4IINA 1EDBA 4PX2A 1EGMB 1KRHA 3IUJA 4QHTA 1EZZA 5E0OA 1N9GA 4XCVA 4Z9YA 2VUSA 3N5KA 1ZJ4A 1MQ8B 4I66A 3GH1A 1LSOA 2VWQA 3CPEA 1E96A 1PGNA 5BWLA