4MA5A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
365
structure length
363
Chain Sequence
b'MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with an ATP analog, AMP-PNP.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 115
structure length 363
sequence length 365
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma5A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma5A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma5A01
4DLKA 3Q2OA 2VQDA 3WO0A 1JLLB 1BNCA 4TUYF 2GPSA 5GONF 4I4TF 5BPFA 1A9XA 1WR2A 3ORQA 2SCUB 3U9SA 2DIKA 4M99A 4EGQA 1JDBB 2GPWA 4YBZB 4FFOA 4O84A 3K5IA 4O7SA 3DF7A 2NU7B 4O81A 3N8DA 5LP6F 4FFNA 2DZDA 5LOVF 3VA7A 3KALA 1AUVA 3RV3A 3VPBA 3VOTA 1KBLA 5JVLA 3U54A 5K2MA 2GQSA 1B6SA 3MWEA 3AW8A 4M9UA 5H80A 1PX2A 3N6RA 4O7TA 4MA0A 4YAJB 1JKJB 3LP8A 4Y8VB 3G8CA 5FNVF 4EGJA 4J6EA 2R7KA 3JRXA 2FPGB 2W71A 2YS7A 2GQRA 1GSOA 4YJ2F 1EUDB 2NU6B 3K3PA 1IOVA 4MV6A 4FFLA 5J2UF 1GSHA 1B6RA 4MAMA 4XYMB 2FP4B 1EHIA 3V4ZA 2YZNA 1KEEA 1UC9A 2YL2A 1CE8A 3ORRA 1I7LA 2I8CA 1Z2OX 1SCUB 4O4IF 1EZ1A 1E4EB 4O7NA 4HR7A 4ZHQF 2OLSA 4M9CA 2XCLA 2ZDGA 2I80A 5BMVF 1ULZA 4O86A 4ZQIA 1Z2PX 1BXRA 1PK8A 2YZGA 3RUPA 5EZYF 4O83A 3BSYA 1VBGA 2GLTA 5BPHA 4TV8F 2W6QA 4HNUA 3OUZA 2R7MA 4IIJF 2NU8B 1KUTA 2W70A 4FU0A 2YZLA 3WO1A 1M0WA 4I55F 3R23A 2R82A 1KJ9A 2YYAA 3AX6A 3GIDA 5HV6A 4MV9A 4EA9A 1EUCB 4C5AA 2FB9A 3U55A 2YRXA 4ZOLF 4MV1A 1KJIA 2R86A 2VPQA 4NYEA 5CB4F 4E4TA 3BFPA 4TV9F 1GGOA 4MV3A 1DIKA 5C1PA 2PBZA 2J9GA 5D8DA 3TW6A 1Z2NX 2WYOA 4EG0A 1UC8A 2VHEA 4C5CA 4IHJF 4C5BA 2ZDHA 4WBNF 3LWBA 2YRWA 1KC7A 5J2TF 4EABA 1KJ8A 3MJFA 2HJWA 2V5AA 2YWVA 2R7LA 4FFPA 2X0SA 4FE2A 4O4HF 5JQGF 4HQ6A 4HNTA 4FFRA 2CQYA 3R5FA 3JRWA 2ZDQA 3UFXB 4ZI7F 2VR1A 3K5HA 5IYZF 2W6ZA 3GLKA 2P0AA 4WD3A 4O7ZA 2PN1A 4MV4A 5DMXA 2CNUA 2Z02A 4FGRA 3BSWA 1C3OA 2YS6A 2QF7A 3VMMA 3TQTA 1DV2A 2NUAB 4MV7A 2R84A 2CZGA 1CQJB 3KREA 1KJJA 4XZ3B 3KAJA 5CA0F 2PVPA 4GGMX 2W6MA 3SE7A 2R6FA 3R5HA 2CNQA 3HBLA 4O7VA 4O2AF 1I7NA 5LYJF 4O2BF 1T36A 4EA7A 1EYZA 4RZQA 1W93A 3E5NA 3RFCA 1E4EA 2NPOA 4IZOA 3TIIA 3QFFA 3HB9A 2DLNA 1OBDA 3TINA 1M0TA 2R87A 3OUUA 1GLVA 3WNZA 4EAAA 3VPDA 4O4LF 2W6PA 3VPCA 5CA1F 2Z04A 2W6OA 3TIGA 5C1OA 1VBHA 2NU9B 5LXTF 1KJQA 4QSHA 1AUXA 3HO8A 3G8DA 3R9RA 4DIMA 3ETHA 2XD4A 4XYLB 3NUAA 3R5XA 2YW2A 3KAKA 2DWCA 1JDEA 1M6VA 3MWDA 5LA6F 1A48A 1VKZA 4YAKB 1DV1A 4MA5A 1GSAA 5C8YF 2R7NA 4ME6A 4XX0B 1C30A 4YJ3F 1OBGA 4O7YA 4IWYA 4M98A 2QK4A 3U9TA 1CS0A 2CNVA 3ETJA 1IOWA 4MV8A 4O7WA 3BSSA 5JQWA 5JVDF 4FFMA 2FPIB 2FPPB 5I47A 3V4SA 2YZMA 3JZIA 2V59A 3I12A 2R85A 5HBRB 3BG5A 3RV4A 5CAEB 4IWXA 4HNVA 4I50F 3JZFA 5KX5F 2C00A 1CQIB 2W6NA 4L1KA 5JH7F 4O7LA 4EA8A 2HGSA 4YB8B 2V58A 4O82A 4O4JF 2IP4A 4O7RA 5KKNB 3Q1KA 2I87A 1W96A
chains in the Genus database with same CATH superfamily
3VO1A 4WN9A 4M0FA 4G9GA 1T25A 3BA8A 4B73A 3L0YA 4JDPA 4HV4A 5AFSA 7MHTA 1QOZA 3FDZA 4YWHA 3YASA 4NZPA 5MHTA 1C29B 4WCFB 2KM1A 3HXPA 3O74A 2IZ0A 4Z9FA 2WWIA 3A7EA 5HIJA 2Z4RA 4F8JA 2O2ZA 5IBCA 4PLZA 3IOCA 3VNNA 2BKXA 3VO9A 5J2TB 4J9SA 5DHAA 1PQ4A 5EYPB 3M9NB 1I6LA 4EEQA 1AV7A 2H29A 4DCOA 1AT1A 3RJZA 1CULC 3GX1A 4GPAA 2WAAA 2X4LA 5E0OA 1L5GB 1VAJA 1UCFA 3AUSA 2JAHA 4JV1A 1IVYA 4W63A 4LSGA 1U0LA 1BS1A 3NDRA 4ROSA 1FSSA 1OTHA 3Q3JB 1CZRA 4Q3NA 3E58A 2B4QA 3CLKA 1ZQ1A 4ZMRA 3NP7A 1SUCA 4L7QA 1XFAA 4BRUA 1XTPA 1Y7TA 3W1EA 2OV3A 3HPQA 4PCUA 1U0FA 3D6JA 5LZ2A 4RTJA 2JA5G 4LSWA 4KX5A 5LPNA 1BGXT 3C1AA 2R7MA 4GNKA 4HB3A 1VLMA 2WAMA 1U28A 3ZE0B 1Q91A 5L45A 4RKEA 2B6NA 3AB7A 2IEAA 2R82A 1EFDN 1TVEA 4DWOA 3KD3A 3GT3A 4IEIA 4JOBA 1JSZA 4JHLA 3HVJA 1S03G 5JU6A 2BLNA 1SC9A 5AKGA 4TWIA 4D26A 3FYUC 3DUWA 3JASB 3CE6A 1SC3A 3RYIB 1Z4JA 3V7FA 5TQ2B 2BFFA 3H2GA 4E5SA 3DBIA 3E8XA 5DDIP 4O0MA 4X1KB 3H1BA 3QOFA 5EP2A 4M86A 1UKEA 1L1RA 4ZPJA 4K1LA 3W8FA 3MJDA 3Q12A 2O1EA 1KKUA 2ZUFA 1V8BA 4MS1A 2CLSA 2WG0A 2GLXA 1ZISA 5HKLA 2OENG 5AXCA 3EXIA 4YJ2B 1OQAA 4YROA 3OQMA 1CU1A 5LIRA 5DLEA 1LSUA 2J31A 3REOA 4A16A 2P0AA 1OJLA 3N2IA 4G4GA 3R77A 4PQYA 3T5KA 3OCWA 1J25A 1HQDA 1IHOA 1J2UA 4EBBA 4J9MA 1SULA 3BIFA 1E9FA 4CF6A 3DA8A 4ND1A 1HE2A 1WDTA 2OCGA 1YRYE 2ZOSA 5EXEA 1A9ZA 5C34B 2CLEB 1SU8A 3NBYB 2IZ5A 4DZZA 2ZTLA 1OB2A 4GOOD 3K6KA 4JVLA 1WQ4A 1N7JA 1VGQA 3I01M 3KSAC 4BRWA 4FGWA 1V4YA 5AM0A 1W46A 4JH0A 5KFVA 2IH2A 2VNSA 4CMFA 4RPLA 3JPYA 3JQ8A 2G40A 2XX3A 3N86A 2XKAA 3PTAA 2O1SA 2L17A 1WDMA 2UXDH 4OKSA 2IBMA 1IL0A 1DQZA 1ILEA 2ZSIA 5I9TA 3RIMA 3ZGXA 1IBSA 5J47A 3PJGA 4CL3A 2YCLA 4RXTA 3E61A 4QL3A 1SXPA 1JEYA 3LNCA 4QULA 2CKMA 1SKMA 1ESMA 3L4BA 3CVWA 4F72A 1CZUA 3VSAA 3JAKB 1ODIA 2E4ZA 4D99A 4M76B 4DR2H 5DCUA 4AN1A 1GT91 3NW9A 4IO1A 1U8XX 4HUQB 4GM0A 4LGCA 4F2WA 1TT5A 4D0SA 4E1VA 4XYGA 4YLYA 4BFSA 4ZTUB 1TM7E 3PHHA 2DPGA 4PR0A 5CP8A 2CHFA 2A9FA 3NBQA 4MVJA 1CIJA 1ILWA 4KYUA 1G9SA 4GKJB 5D87A 2ZCJA 4LMPA 1UBKS 4QELA 2I1WA 1N5IA 2G88A 5LYJB 1YT5A 3FMOB 4TSFD 2HZ7A 4HVTA 5DT2A 2I87A 1H6AA 4QOFA 3NJ8A 2DUUA 3QLVA 3B3AA 5CBKA 1IB6A 2ODNA 1VXRA 4ZQGA 4EGQA 1OX4A 4JLPA 2JG3A 2VDMB 1HYHA 1NV9A 2HX1A 4Z9YA 2ZQ5A 2XQFA 2ZETA 4KPFC 3BQNB 1X7XB 2GD1O 2YQ5A 5BNWA 1GNTA 5L3RA 3VTZA 1XDDA 4RAZA 2G9VA 4R2MA 3UHPA 1U31A 2VPXA 1T2UA 4B6OA 2Q3CA 5IW8A 1JEAA 1GQ2A 2W2TA 5J1SB 4YACA 4FS8A 4Q12A 3GB9A 3PEEA 3BAZA 3L4EA 2HWWA 1HDGO 3DEZA 4GP7A 5B2FA 2C4NA 2PGJA 2B2NA 3IAAA 1SR8A 3L6UA 1ZRSA 1UODA 4Y2TA 1HC7A 5DGTA 2QRVA 4UJ3A 1JFFA 1DINA 4YCLA 2FZEA 4F96A 3O4HA 4UJ5A 4L27A 4JI2B 3NWPA 1PWZA 3URMA 4J91A 1XP5A 1LK0A 1WAMA 1HE3A 5BWNA 3NETA 4JXJA 4KR3A 2QN1A 2XVMA 4BMCA 1MPTA 4XUEA 1R64A 4FYMA 1AXEA 1H9AA 5DXAA 5B4UA 1H2YA 2P9GA 1OYOA 1TYBE 4C6TB 2JFQA 3T5HA 4X6YA 4R9RA 4ETWA 4JI8H 4ENUA 3VOSA 1LNZA 4RD2A 2CD7A 5K1ZA 2EATA 5LB2A 2ONJA 2O20A 1M8JA 4RFLA 3S8YA 4DYVA 1R4AA 4LF5H 1U3GA 3MBOA 1BDIA 4JBLA 2AUMA 5TPWA 2GHTA 2B82A 2QBYA 2WYOA 2P7HA 4KR2A 4ZDIA 1ZONA 2O8FB 2XGGA 5I9MA 2ATCA 4Z8YA 1RPNA 4LV6A 1DG3A 2G1KA 5EIXA 3MHPA 5DGAA 2OZEA 1J5PA 3A1TA 1SZPA 2J09A 2DQZA 4A6DA 3OMWA 4FDLA 4TZTA 1ISSA 2XNCA 4HDOB 3V4RA 4J1SA 2BHSA 2EKLA 3DJYA 3DLHA 1DKPA 1KO1A 2YMLA 5KT5A 3V8MA 1N2CB 1ECLA 3GDWA 4BPBA 3WGHA 3T5AA 4QU9A 5KTPA 3AUAA 3CN7A 4V0ME 1RP1A 1NJSA 3EVTA 2JS7A 3I2GA 2V55B 1S9DA 4GX2A 1TK9A 4KXQA 4I5GA 1FVHA 1VI5A 5DRYA 4UMFA 5JE8A 4BWFB 3DFFA 3D6MA 5SY9A 3IURA 5H9VA 2BFCA 3A04A 4B6PA 3ZJTA 1CW2B 1G7SA 4BNFA 3DTTA 2OT3B 2Q6KA 1HT2E 3M9XA 1JB1A 4QGHA 1DKOA 1HZZA 4UOQA 1IXSB 1XHEA 2HV8A 2WWFA 4HYYA 1RVDA 3NDJA 3AFMA 4NEQA 3OIDA 3BM5A 1GGVA 3GIIA 3KXLA 1NVVQ 1Z5GA 1JFSA 4HQ0A 3B6MA 2Y93A 4DG9A 3CNBA 5F23A 2CJWA 1C7IA 3LX8A 1UMKA 1NUAA 3QW4B 1IBCA 4DMUB 1M6VA 3WMFA 4PLPA 4F5DA 2J3QA 3GJSA 2C4TA 1Z63A 2ZIZA 3DL0A 1UBRS 2C84A 2ECKA 4AXBA 5JTUA 1DKNA 4DBVO 5FOSA 3A70A 2WLSA 4YA6A 2RD2A 1PU2A 4DCCA 4GICA 1ZKMA 4L50A 3DAFA 4MTEA 5ESWA 1XZJA 4U7WA 5K8VA 1CP3A 2WSSD 4XUGB 2AMLA 2EC5A 3E05A 2ZM6B 3FNQA 3R4VA 3ICOA 1B93A 2IXFA 3T3IA 1ONSA 4X3OA 1P0MA 3CWQA 3T9BA 1Z37A 3B60A 3KSDO 1J9EA 4KLCA 2PKYX 3GWZA 1T26A 2WICA 4P34A 1C80A 1K98A 3RRYA 3K6SB 2VF2A 4NE9A 2GM9A 3EEQA 3E1SA 4RD0A 4Y18A 1QIJA 1V5FA 1W2HA 4CIWA 3FTFA 3G7SA 5M34A 4LDRA 3PCXA 3ORQA 5GZ3A 3DVAB 1O96B 2I65A 2ID9A 2FMAA 4KXMA 4LDZA 3ZWQA 2H31A 3BH7A 2WTAA 1SQSA 4O7SA 3IPCA 2UVUA 1WF6A 4YAWA 2DCMA 4EI7A 4ED6A 4CTKA 2F64A 4FUTA 1WMDA 5L3VA 2PT5A 1RI5A 5G2OA 3JWIA 4HC4A 3LW8A 1L7DA 1GT6A 2FXIA 1OZFA 1YONA 4HEA6 3QVGA 3ITDA 3ENKA 3P19A 5JNRA 3DV0B 2DWUA 4WUTA 7YASA 3M4ZA 4KK3A 4O3MA 3HVHA 2ALZA 4MWGA 3CEPB 3MR3A 1PCXA 2DUWA 1EM8B 1G0OA 1XYVA 1KKLA 3AR3A 4O2RA 3DLIA 4ZOBA 4ZVQA 4X65B 2JHFA 1WIWA 2ZRLA 4OTZA 5HMMA 1L1QA 3FFXA 3USCS 1E3LA 3HB7A 5KYXB 4X60A 1WV0A 4NS1A 5AKXA 3SYTA 4RV9A 4E5KA 1T1RA 4KWIA 1W6RA 2QA5A 3PUKA 3BA9A 3QZ7A 1ZLYA 2H2WA 2JFYA 2VQEH 4X64B 4JI0B 1TUIA 4EY5A 1TJNA 2ZBPA 3OZTA 2LGJA 1HY3A 4NAHA 3RYCB 2OXFA 4G1FA 3RS2A 3MMXA 1YF3A 2MWMA 1QB8A 1XDBA 4X7MA 3WAJA 5K0NA 4QGSA 3SC6A 4PR3A 2G5TA 5AW6A 2VZ8A 5FHQA 3R9XB 4WKPA 3AEXA 3RTXA 3WRXA 3GA5A 2Q9BA 3BD9A 1JLHA 4IRMA 5KFRA 4J2HA 5EVJA 1FDRA 3EIHA 5WRFA 3A9CA 3ZHQA 2JK1A 3H13A 1XRQA 4F84A 3OZSA 5LOVA 2JLUA 1M76A 1FZTA 1SBNE 5ADVA 2N1MA 4JEUA 4YP1A 4DLAA 2GA9A 2XNSA 3WBBA 4A3FG 5MN4A 1IYDA 4CIYA 4EUKA 1OV6A 2DLCX 3VHRA 2FWIA 2BM1A 2G9QA 2RSLA 1RJ9B 3S8MA 3D3KA 4D82A 5JFTA 4FB4A 3JRNA 3Q3GE 2E4WA 3A0RB 4LIPD 5A3QA 1GZSA 4XLLA 1UKVY 4RESA 5EXDA 1JFRA 2QYSA 3I1YA 4S04A 3ELDA 2GUWA 1K8YB 3KELA 1LB1B 4DCPA 1PD1A 3L8EA 3MAGA 4NE2A 3OQPA 2E48A 4GM4A 3RANA 3EJWA 1T3SA 5HP4A 4R40A 3DAAA 1AUQA 1TQ2A 2REQA 2AJDA 3RKSA 2JGDA 6PFKA 4KXUA 4QPZA 4L6IA 2I7VA 4DXAA 3WQQA 4ED8A 4QOGA 2XD4A 5C8ZA 3RC9A 2HA2A 5BWVA 1X7YA 1H65A 1AO0A 3TZKA 4FS1A 2D6FA 3ZDYB 5LKAA 1F2TA 3PLRA 1V3UA 3CIFA 4BKQA 3G0DA 4R9SA 3OH8A 4DCGA 4HRAA 4BEVA 2E2WA 4KXYA 2CZQA 3GF4A 3OZBA 4C2UA 2CXQA 2JNWA 1LJUA 2R6ZA 2J6IA 2CYCA 4LH7A 4IDQA 3TI7A 1WJGA 3EW7A 3KKKA 3FY4A 4TT3D 4BY1G 2FPIB 2P9CA 5ADUS 2VBIA 1GGMA 1OKKA 4RSHA 4IWXA 4RQBA 3S68A 3UGTA 2XUFA 3L7NA 5LP1A 3IJRA 1CUEA 4HWRA 1P60A 4QW8A 3WL5A 1Z08A 5CDTA 4HZUB 3SAJA 3L93A 3R0ZA 2W2OA 4M0KA 3WYEA 4O82A 3O3MB 4JC5A 4KBYA 4QOJA 5LM3A 2GVZC 2CFCA 4I3GA 2QXTA 3RAPR 3RHZA 1G16A 1H94A 1OPRA 3A6JA 4DE5A 1H1DA 3LKZA 1CJVC 3VDRA 1GITA 3IOYA 4YBZB 3RROA 4W5NA 3A9WA 1NVAA 3M5CA 4WACA 4MS4B 1DNPA 3M6FA 5JSUA 2V8OA 1HOXA 1V25A 1QVRA 4WEOA 4YMVA 4RD6A 1PLKA 2Q9UA 1IG3A 1CR4A 5C5DA 3KCNA 1T43A 3WKBA 2AV6A 1N5JA 1UAGA 3ZE2B 4QBKA 2WJ3A 5C8YB 2N47A 4LWZA 1EVQA 3B38A 3KYIB 4Q82A 4AO7A 3GR6A 1E18A 3IB3A 4BKOA 4PY2A 1RYMA 1VG1A 2JZOA 4AICA 4BKPA 3L02A 4AW9A 3AR5A 1FYDA 4WKGA 1EWVA 2P2SA 3MWGA 4J1TA 4CN9A 4MUMA 2HIVA 3Q7RA 4OUDB 3E2IA 4IBOA 1ZAYA 3U13A 4BOYA 2OM6A 3MW8A 3R44A 2A0WA 3HK2A 5KMGB 3GA7A 4F4IA 1R7RA 2ZRDA 3RTCA 4FSDA 1RLUA 2OAQ1 4E2YA 2VTBB 3E27A 3LRXA 2DFPA 2GLTA 2GN9A 2VHJA 3A4YA 4F5WA 1KVSA 5A71A 4LKRA 3RVPA 3VO2A 4JB3A 1D8AA 2IDJA 5TC4A 4H1VA 2JEYA 1Y8ZA 3G9UA 1YB4A 3AEQB 4ND4A 4CMCA 1P5FA 4C7XA 4Q3LA 3UTDA 4DMRA 4LGVA 5ITSA 2GEFA 2UXBB 3GCGA 5LLDA 3C0FB 2BVNA 2CMGA 5EIOA 2CVOA 2GDZA 2FQWA 3FDJA 2C8LA 4HX9A 3R4CA 4C5BA 1C0KA 4L85A 5KEIA 2RK4A 1OD6A 4UUPA 2EDCA 5EE3A 3JQ9C 4OFZA 3ZDDA 3N05A 1CYDA 4WOJA 5H3LA 4DOMA 3L6BA 5A6VA 1G20B 4LQCA 4BASA 5EFZA 3IUBA 3LX4A 3WJ1A 5AOCA 1X1SA 2IQIA 2QTRA 2R751 3BWYA 1RQ7A 5L3SA 5TARA 2YHAA 1ET0A 3TVDA 2VVTA 1I7QB 1PL0A 1WUTA 2W9XA 2O2YA 3W6OA 3NDIA 4E5DA 2GO1A 2VCEA 1FEZA 2QJTA 1WETA 4WERA 4MHOA 5JYEA 3BQ9A 3O7WA 3B89A 4JYAH 1WZCA 4JBIA 1YBAA 2H1CA 2QVLA 1G8YA 4QXAA 1XDZA 1VCOA 5E25A 4PPYA 3OIUA 1WNTA 1TAGA 4ZALA 1WBJB 4YQFA 1K86A 4RF4A 4G1MB 2ZYRA 5LU9A 1CRQA 1P7CA 3AESB 4RNOA 3H5OA 1NRWA 1TYZA 2W2NA 1U7XA 5JNTA 4RANA 2PLRA 5KS2A 1IYZA 1SY7A 3MBIA 1GAQA 3GCXA 4UVDA 4ZICA 3ANXA 3IKVA 1K7XB 1SU7A 4P86A 3Q72A 1KEVA 3UMSA 1JE0A 1A48A 1NULA 2NU9A 3L07A 1GRVA 1C1XB 2GZ2A 1SUWA 3Q9NA 1NP6A 1E66A 4L6CA 1E79D 4FZJA 2I4MA 4ARZA 4W5QA 4PTLA 2WJHA 2BDEA 1WB9A 3ZS8A 4EH1A 2Q2TA 4EKEA 3S70A 2R8JA 3EVZA 3DNFA 5CM0A 3GXOA 3UMCA 1UQUA 3GJTA 1CDOA 3I32A 4BVJA 3BT7A 1UEIA 4MGYR 2G5CA 3WBFA 1NMXA 4D6XA 4ZGWA 3QPDA 4YP6A 1JV2B 2I55A 2YU9A 4OKNA 4D81A 2BE9A 1X87A 3DAGA 1RPTA 5BMVA 3R0QA 4U7CA 3WSWA 3JPWA 1JH9A 5BVHA 5D3QA 3G5AA 4JQCA 5JMTA 5IDYA 5IP9G 1NJ2A 1QHIA 5HG0A 2ETXA 4OF4A 3W7VA 4BAUA 3IPXA 3ZHSA 2IHBA 3B3QA 1AMOA 3WDLA 1CQXA 4J16C 3M9OB 3L1IA 3S1SA 5DU2A 2HBYA 4TKMA 2TECE 1Z0KA 2DWPA 1CLUA 4ND7A 4Q03A 3IYLW 4MYTA 1SZDA 4QZVA 721PA 1U2EA 5H80A 1KT8A 1MNQA 5EZSA 2JGIA 1WTCA 1VYVA 3OX2A 3D1VA 3PQCA 5DCYA 1XCGB 2ZYVX 3CBQA 3N28A 3V34A 1VGRA 2IRWA 1JR3A 1CHNA 1S3GA 5TQ0A 5IM5A 4ZAGA 4E32A 4UDOA 4JWKA 1NAIA 4PNPA 3IUEA 3U62A 2X6RA 4HQNA 4MQFB 1LW6E 3RUAA 4MS3A 1ZG3A 1VS0A 3H5LA 4LXIA 1DIGA 3JS5A 2ASVA 2GXAA 1XNQH 3OOHA 5LLSA 5DNEA 4EPYA 2YYAA 1QF7A 2EFHB 2APJA 5E7JA 4CDRA 4RFSB 1BVYF 3L7OA 4G2NA 1XTJA 2G04A 3DW3X 3C3YA 5B2ZA 1HNWB 3FGOA 3MXOA 3KKPA 1TD1A 3NHJA 4J7XA 1R3UA 2J9GA 2VPIA 3GRZA 1RTKA 1HF3A 5CPBA 3SF8A 2AOVA 5KG1A 1PUXA 4Z9BA 2VOJA 5KB3A 2HADA 4WMLA 3ZV3A 2GNPA 5YASA 2FSHA 1SXJB 2POQX 3KG2A 2AYXA 1M2OB 3G6KA 1FE8A 3A9VA 2ZP1A 3R7WB 3DUFA 3JY6A 1SB9A 2HLPA 2ECPA 1D07A 2PZMA 4HGQA 3ISJA 4K40A 1C3OA 4UNSA 5JAPA 2FSSA 1O4VA 2QF7A 1LA2A 3JARA 3V8RA 5I5SA 4FJ1A 5JPIA 2J5XA 4LHEA 4RK5A 2GM3A 4E33A 1XU4A 2WYWA 4JFAA 5HUJA 5KSWB 2Q8NA 4IIJB 3LUAA 4V0OA 4NZZA 4X20A 4IAJA 3BILA 2AXQA 3N44B 1R6UA 3VNQA 4YCDA 1SVSA 1GL9B 1W36D 2I76A 3DOFA 3PXBA 4BZXA 5L6LB 4RORA 2GZAA 1W5BA 3MWFA 3QU5A 2F1HA 3FPGA 3I1FA 1ZGZA 2GSDA 7ADHA 1VL2A 5IK2D 2VT6A 3VPAA 3VTKA 1NDHA 2RHOA 2WM2A 4A93G 1T8UA 3SNHA 4CKCA 1T1JA 5TS2A 4MP3A 1Z6TA 1MAAA 1WU7A 3E9YA 2WSLA 4ZT2A 3LD9A 2JA2A 4CN8A 1Y14B 3WLFA 1W0CA 4BO1A 2B8JA 2COJA 3QF4A 2BSXA 2WYHA 3TOCA 3HVIA 1WOYA 3P2OA 2LRHA 5SZIA 4HAIA 5I8ZA 4Y1EA 1XDNA 3ZGYA 5KFHA 1U4SA 1GO2A 1LPSA 1P9WA 1LDEA 1FNMA 3QX9A 4YALA 1Z3CA 5HBGA 1OWMA 5BW4A 2KLBA 2OECA 1O9BA 3P9CA 4EOGA 4TMZA 4XD7D 4IJUA 5CG1A 4M7PA 3S5UA 1K3UB 3QPAA 4C05A 3ZDXB 3PENA 1RYSA 2VNAA 4DT1B 2HT1A 4EELA 4DR6B 2P6MA 2VZLA 3CH7A 1JYEA 2CF5A 3GMDA 1QTIA 3TL2A 2Q5OA 3WLQA 5T4BA 4JUIA 2WSIA 4LJRA 2P2DA 4ZYTA 5HF9A 3PYXA 1TM5E 4P7JA 5DCWA 2YBDA 3DWEX 4AJKA 3F8SA 1PW7A 4XGQA 3PDIA 5A4JA 1OIVA 1UANA 2YJ5A 1AURA 4RY9A 2NTVA 2HOQA 1W4LA 1XQVA 1MHPA 3ZVMA 3PDJA 4PGFA 2YASA 3K4PA 3NEJA 3OPMA 5I48A 5I9IA 2XB4A 3AF3A 1YRWA 4N7JA 1V96A 3FOBA 4FE3A 3W9YA 3G2NA 3OJOA 3REQA 4UNQA 2RFLA 3LOQA 2PY6A 3RFFA 2ZZNA 5TRTA 1FS4A 3PX3A 3DKIA 2VUHB 4RK6A 3PFNA 1AD2A 3PLAE 4KWTA 4BQNA 4FW9A 2CHUA 3BTVA 2JANA 4A15A 3MWMA 1APBA 4J1QA 4OXXA 4IFTA 1NA5A 6LDHA 2AFIA 3B9RA 3N8HA 5JAIA 2XAUA 3DPSA 2BJWA 3CSDA 1NP7A 2Y1DA 3L49A 1SHZA 4M9CA 2W8LA 1JSRA 1RWBA 3EYYA 1GUYA 1OA0A 3NBMA 1LC3A 3AR6A 5FI5A 5KNDD 1ND6A 2H4ZA 3IDAA 2EL7A 5FWNA 5DGBA 4GFDA 1YB7A 4EQ6A 3IBYA 2NLOA 3OKAA 3U3DA 1TA4A 2V1UA 4NCAA 4RZUA 4JJIA 1UJ5A 2GRUA 2MCTA 1M83A 4GKAA 1J2YA 5DHUA 2P7IA 2PZ8A 4LXHA 1RYFA 2Z9BA 4GDMA 4IOKA 4OA8A 1L5YA 3EXG2 3G2KA 4L95C 5G1NA 1RCUA 1N0HA 4MV3A 3TJMA 1RZVA 3PW5A 3KZ1E 3HJTA 1HTTA 2O0KA 2OXTA 4CLOB 1WOMA 1Z2NX 4C3ZA 1YQEA 3OE7A 2XMZA 2HDKA 4GI2A 1BQEA 1D09A 4NAUA 2L19A 4CKXA 1ZOPA 1JDSA 1QGZA 4Q3AA 1PV4A 4P3OA 5JCOC 2G36A 3N76A 2GF9A 3CFYA 5AW4A 2WJWA 1VHDA 3SZRA 1DAKA 1PNOA 2VP6A 4YP7A 4HHEA 2NT3A 1QX4A 2QZSA 3E22A 4AY6A 3V48A 1WR8A 2ANCA 1JPUA 3KHLA 2VATA 2XHZA 3U81A 1QU2A 4GMFA 1DOHA 4P81A 3GIPA 2J32A 4I5FA 3LDAA 1Y1RA 1P7PA 4IRCA 3E8SA 4O25A 2L69A 3W0LB 4JA0A 3GQVA 1N2SA 5J43A 3OBBA 3WADA 2JW5A 5CFPA 3K09A 2ZSJA 4O7VA 3TSZA 5IKEA 2BGWA 4I50A 4FW8A 4WINA 1SUIA 3T38A 1Q19A 1JJAA 2UVWA 3ORYA 1FVOA 3IAM1 5B6IA 2B61A 2I9KA 3L41A 4XXHA 4ZDWA 4KLZA 1MB9A 3WA7A 5KJ6A 5JHGB 4HEJA 4Y2VA 1D4AA 1Z6QA 5LQAA 1S3FA 1N0WA 3PEVA 3TSWA 4F50A 2AFHA 2EXXA 1UBUS 5ALEA 4D7AA 1J24A 3WX0A 3T5TA 1NYRA 3JU3A 5AW5A 3D3QA 3EPLA 3QELB 1CCWA 2ZATA 3BGDA 1VIMA 4CDNA 1XMQB 5CBPB 3WGVA 3A1EA 4B80A 4KPUA 4KVFA 4TMVA 3QE9Y 3I9KA 5K6AA 3Q6IA 4CQMA 1U9ZA 2NYAA 1A77A 1QV7A 2KWIA 5BR8H 1RXYA 2OG1A 3K3VA 4DNXA 3CZ9A 1BOOA 4OHXA 2EG5A 4M0DA 2OYRA 4BEWA 4PSVA 3QOYA 4H17A 4WNAB 4J9QA 5H4GA 5L1IA 4K7JA 3QEMA 3LMLA 2V4MA 3DYBA 4CMIA 4PG4A 1JW9B 1MIOB 3P9RA 1QCZA 2C00A 1D4FA 5BWTA 3VSBA 1CKNA 1NY5A 4ENSA 1KL7A 4NHOA 1BC5A 2JJ8A 2XYGA 5MDHA 4HTFA 4BQEA 3QKRA 4PZ7A 3PQ7A 3T41A 1CK4A 4WGGA 4X62B 2LVBA 3RCBA 4QAJA 1FK8A 3SKXA 3Q9SA 4S3MA 4UXHA 5EZYA 4Y9RA 2GQ0A 1K6JA 3W2EA 3AK4A 3STUA 1MU0A 4KR9A 3KOWA 3EVNA 3QEOA 1JDBB 1NBOA 2H0AA 1F12A 3UB4A 1ADJA 3H9UA 1G6Q1 4TTTS 3QVTA 1PSZA 5A4AA 2FLKA 2Q4DA 2EFEB 1E3WA 3I6QA 3DZCA 1WCXA 4WY8A 5JS1A 4N39A 4HGYA 5ERGB 4RHCA 5DPMA 3LV8A 3A6LA 5H3HA 3F3YA 4NBSA 3CUUA 4NJEB 2PWBA 1Q16A 3M83A 3B3FA 2O8BA 2H5IA 2IYSA 1O1YA 5JD6A 1B6GA 2QN3A 2EBHX 2FWNA 5CH5A 4MA0A 4XSGA 3IQZA 4UAUA 1FNCA 2X5KO 3LS2A 1E63A 2JCVA 3UJ8A 2PV0A 3CWCA 1UINA 1HPLA 2VWQA 4EW1A 1EUDB 2XMGA 1R9TA 3OT1A 5FBQB 1I1NA 4LSMA 4Y1GA 3SXJA 1YVPA 4EQ5A 3MTBA 1GILA 1N2GA 3ND8A 3ZY3A 4EARA 1N5OX 3P4YA 4UVIA 5J4VA 1NNI1 1I2ZA 4OGFA 3RFTA 4IDBA 3GT0A 1LY1A 3P2MA 4TKUB 1K06A 1GNQA 5FULA 2R4QA 5HCUA 1IDOA 1VBGA 3IUSA 3Q9LA 3EAGA 3VYTB 1GTJ1 5F9FA 3PFBA 3HJGA 3EGEA 4FKMA 4M1SA 4QUKA 2YX1A 2IZ6A 1QMGA 2J08A 1Q1BA 5EMLA 1L8OA 3NTRA 1C4WA 1E77A 2YN2A 3GN1A 4BZWA 1Z7YA 1XBTA 2PBZA 4F6CA 1KQGA 2I0FA 1XMIA 2F43B 3QEBZ 1ML3A 1QZUA 2Y4OA 3Q8XB 1NVMB 2JL1A 3VDNB 3I4MG 3TRHA 4F3CA 4OI0A 3VVCA 5HKKA 3CLUC 4ROTA 1QH1B 1T9GS 1ADGA 4GXQA 5LUBA 1ZM2A 2WPDD 2ZR0A 5LFAA 1LFDB 3NM6B 3X1XA 2XB6A 3Q8LA 5GWXA 5CW2A 5A9SA 5KTNA 4DCSA 3EXEB 4I1UA 121PA 2OHIA 2RHBA 3BB1A 2JFXA 1VDZA 3LA8A 5E2BA 3W4KA 4NDNE 3TLEA 2ZBGA 1MPXA 1PZNA 3JQAD 2CNKA 1Z9BA 3MT7A 1QMPA 1XTIA 4RHTA 4I55B 1CUCA 3C48A 1TAUA 3TINA 4B9AA 3D3EA 4A2QA 2ARKA 3SYNA 4BFXA 4XQ0A 3G5LA 4CG2A 3KUCA 4J4TA 5ILOA 3FKQA 1OZ0A 2GJ9A 2Q0SA 3OJ0A 2I5PO 4JVSB 1KSHA 2LP4Y 2YYYA 4A3GG 1GYFA 3RW9A 2ZE7A 1XZDA 3VR5A 1IC6A 3OUTA 5DSTA 1M3SA 2O8VA 1KFJB 3RVSA 2ZWMA 1Q7EA 1CF4A 3S2ZA 3K32A 4UMVA 1ODTC 2HHFA 2AC7A 3TNLA 5JYDA 1CS0A 2X8BA 4FHZA 3B48A 3T3MB 4RELA 4QTTB 3QVLA 3LK7A 3AY3A 2Z8YM 1BE6A 3UFBA 2JJ2D 2PZJA 3BG5A 1EIWA 4F9EA 1ZNYA 3Q7SA 4BVGA 5AKZA 2IVZA 2FDRA 1H2XA 2J6UA 1NXQA 2B2XA 1FFAA 1ISJA 3ZHYA 4HAUA 5KYGA 1QYDA 1USWA 4I99A 4D4GA 3SEQA 1RI2A 2RKOA 4P53A 3TGLA 3PCRB 4IH4A 5C8DA 1OI4A 4BXOB 4XZ3A 1E5VA 1P80A 3EZNA 3D6FA 4KN6A 5L3QA 5LQNA 3UNXA 1MOSA 2QMEA 4XDGA 1MAHA 1YR3A 1SCBA 3LNTA 4MI6A 3PFIA 3U9SA 1YZQA 4OHFA 1OASA 4F6RB 1TVMA 2XYQA 4PQFA 1QK3A 4TWJA 3OO1A 1KQ3A 1Q74A 3OZWA 3TTXA 2PAAA 5CNIA 3QBDA 1CB7A 3NYIA 4DNPA 4P9NA 3LF2A 1J1UA 3P9ZA 3TQHA 3D7LA 3VR4A 4MGIR 3QUBA 2CWDA 3VOTA 1A4RA 2V0GA 1JZSA 2C1XA 1R5OA 4MKFA 1RWNA 1Z29A 2AOUB 1FJGH 1WY5A 3ZCVA 4PSCA 1W85A 1YKSA 3A6PC 3L1JA 3TLXA 4WA8A 5DGIA 3SM9A 4ZVOA 2VRBA 2Y9PB 4TLCA 3VM6A 2ZIGA 5ECGC 3NTQA 4KB5A 1M5TA 3K3PA 5T14A 5DWDA 2YDXA 3BE4A 4IFEA 5BV2P 4Q15A 4CI0B 3DZHA 1Q0TA 1R12A 1BROA 4TGLA 4XH9B 2OC9A 4U7FA 3TECE 2FPGA 5D1PA 1A5AB 2Y1EA 2UV8A 1JX4A 5CIYA 2K7ZA 2OFPA 1NLZA 3NOOA 4HFNA 3HXKA 2WDZA 1XZFA 2E0IA 4LFCB 3PFKA 1UBTS 4OLJA 2PSFA 5L4NA 4I4TB 3UK0A 4KTVE 1CKMA 4TLBA 5I9BA 4H31A 1IZ9A 1RZRD 3U0GA 5I5UA 2UXCH 1NVKA 1TCUA 4MV1A 4IEFB 2WFMA 2PUGA 4HB0A 1FFBA 4MHTA 3QVUA 3SS8A 5BW5A 2Q2QA 1WW2A 4PFQA 1Z2AA 1WSCA 3AVUA 2HHCA 1U0GA 5L51A 5HNKA 3UAVA 3QHAA 1R0YA 4R8UB 2E5LH 1RRMA 1ND5A 3MN1A 5ESDA 1JR3E 3T3DA 1JFVA 3ANNA 2NZXA 4YXWA 1XD2B 4Q6BA 1G21A 3PC4A 2QP3A 2NYVA 4M9ZA 4DL2A 5IP5A 2WJYA 3ZXXA 3A37A 5T4EA 5I7HA 3SVZA 3MRTA 2O1XA 3QE4A 3OCVA 4YDSA 1CKEA 4GLFA 1GZVA 1K1QA 2O03A 1YB6A 2C20A 4KUHA 3FBTA 4PC2A 2V4QA 1ZWKA 2ZYGA 4LFBH 3FJYA 3SK0A 3ONVA 4BNLA 4QTYA 3LY7A 5I60A 4R0MA 1NW4A 3AJAA 221PA 2V3CC 2AOTB 1DAPA 4HDKB 5C2JB 5HQ3A 2IKSA 1AGPA 3MLEA 4WKOA 4EHHA 3JYNA 3WQHA 1US8A 1EFKA 4QGBA 4MLCA 2Z04A 4ARCA 3NAMA 5DEIA 2XUAA 2JAPA 2HIAA 4OK5A 2G71A 2G83A 4MP8A 1ZCZA 4CC5A 1MX9A 4B8WA 4JMLA 3ZIDA 3SNKA 2GN8A 4IH9A 3G5MA 4N01A 4DWJA 2PCJA 1ZIOA 4WLVA 1PW5A 4N6OA 4BMXA 2DFDA 4GUAA 4I6EA 3VC2A 3EEIA 3JQFA 1EB8A 2BKEA 1G63A 5JXHA 2GNAA 3O8DA 1HFEL 4G9EA 2H5JA 1T9CA 5JS8A 1L5FA 7GPBA 2V0NA 4LHZA 3CH6A 5ILQA 1GKIA 4IIDA 1CR6A 4OFBA 4HEHA 1NVFA 2B5WA 1JGTA 2QUAA 1QUFA 1M2VA 4NECA 3TY9A 4CM3A 4FOSA 3R6LA 2WWWA 3LCCA 3RD5A 2VDWB 4FILA 1JLSA 1JMVA 2IOYA 5L9AA 3GA0A 1N6HA 5IZ4A 4EB3A 2XUZA 1E2UA 4GSYA 3HI6A 3DC2A 4X41A 1TQDA 1G2PA 2R6JA 2F3TA 1KWKA 3HWRA 5HE8A 3CLRC 5FPTA 4AQ7A 3HJUA 2EOAA 3HOUG 2F2TA 3WYBA 2R6GA 2H63A 4TTSA 4J29A 3ERCA 1U8FO 5DSXA 5DHQA 3QEJA 3VOAA 3GFRA 1V7CA 3R7AA 1NZJA 1S9HA 1L2ZA 3O21A 4DVGA 2VQSA 5I6DA 1KA9H 1UBEA 2V6MA 3O4FA 3FLMA 4J3NA 3PFFA 4JJ6A 1H85A 2V9CA 2FQYA 5KYYB 3HR7A 1VIAA 4EO9A 3KQTA 4ZT3A 3KU4A 3K1AA 3JQGA 3VR6H 2G8LA 1A69A 1V35A 4G4IA 2RH5A 3A0UA 4BB5A 3IKMB 3TW8A 5C5CA 1JKJA 2P27A 3BFKA 2UUPA 4XASA 4MQLA 1AS0A 1CR1A 1NU8A 2O14A 2JI9A 1X80B 3UW3A 5EWFA 3WYFA 4N5DA 5FUXA 1TRHA 2VJPA 5CVDA 5KFWA 5ELMA 3IXLA 2X0RA 3A4LA 2JI4A 1WD7A 2Z95A 1AHIA 1LS1A 5AUQA 4XKJA 2DBQA 4OJKA 1NVTA 4QBFA 3BUSA 3PUXA 3A6HA 1RWOA 1XJCA 3JQCA 3Q3EA 4H1WA 1QFMA 3LT1A 3LWNA 1XQWA 2XT6A 4W9NC 2O7SA 3EPGA 2O57A 1EX9A 4KHPH 2VHQA 1L7QA 1U90A 3LBYA 3ICQB 2C3MA 5BWCA 2LR0A 3PFHA 1DO0A 2BMVA 3ID6C 3LXRA 1R6DA 1EGAA 5FF9A 4G84A 4INZA 2A14A 1N8SA 4BVKA 2AKAB 3HKDB 5IT0A 3F3KA 2D0PB 5KIAA 1A8SA 4ZQEA 1F6DA 1EUYA 2CB9A 2IOQA 3EULA 1X38A 4LZNA 2AFIE 4M46A 1NMZA 3N39C 5D3MA 2QEQA 2V5VA 4MVJG 3CC8A 5L9XA 2F4VB 2JHAA 3H2IA 4DMFA 2N1BA 2FQ1A 3KKMA 2JBWA 5DF1A 4RA9B 2RHWA 3FTNA 4CEHB 1U3CA 4DRXB 4PO3X 5DBHX 3B82A 3OPYI 5K8JB 3HNOA 4S24A 1OBDA 3IAEA 3O5AA 4I9NA 3HU3A 4FI3C 3COZA 4UCSA 1AHPA 4RENA 3RSGA 3TEFA 1DTWA 1PT9A 3VJLA 3GL9A 2YIDA 5B12A 4RNNA 4B74A 4L9RA 4MQ5A 3BPSA 4BFUA 4B3TH 4U63A 4E13A 3LPMA 1VFNA 3G0IA 5LA6F 2C7OA 5KBYA 3WK5A 3FTEA 3RQSA 3L6OO 3VR3A 2YWEA 3W5AA 1YB1A 2C4UA 1U2PA 2J9FA 3FSJX 4EYKA 2C07A 1NBAA 3SDBA 1AZLA 3H7AA 1KBQA 3QPUA 1L3BA 1DG9A 4HLUA 3T3NA 4GR4A 4ZDKA 5IM4F 3MJ4A 2UZIR 1L0BA 1ZUHA 4UU0A 1OH5A 4NMHA 3CLTC 1L7RA 1ZD2P 5JSYA 2NAFA 4NDZA 4AIRA 1KVQA 3ETNA 2GX6A 3QFCA 2H1OA 4BN5A 3DQPA 4YJFB 4DIFA 1X6VA 4UUGA 2I2CA 3K1ZA 1HKUA 3IH5A 3NGXA 4RNMA 4JUFA 4BFYA 2X4GA 5KC8A 1O6ZA 3B9BA 4DKXA 3SR4A 3CEBA 4F1KA 2Q50A 4WFJA 4TUYF 4V24A 3WRYA 4G0XA 2X9VA 2Z08A 2EGGA 1B33N 1RWWA 2B4KA 1GFWA 3UB2A 3G0OA 1SJ9A 2PUJA 5J23A 3F9CA 3T94A 1K27A 1EK2A 4PINA 3OVMA 2OFWA 2AFHE 2C78A 4ALJA 5BWRA 3EMVA 2FE1A 4ND8B 1ZGBA 3R6TA 4CKWA 4IZHA 4LCBA 4NJOA 1R0ZA 2VPPA 2C28A 1YS9A 1V1MA 5CLJA 3BL8A 5EJ2A 4MIYA 4PYOA 1T9KA 3SDSA 4EFEA 4F4UA 2C2YA 3KZKA 1PTKA 2MINB 1P1IA 4ALMA 3G8BA 2B35A 2BMWA 4JKIA 4LK3A 4ED3A 3PFCA 2JIZD 1ML4A 2PX2A 2PMDA 2YQ4A 1Q50A 1WBBA 4OREX 1SB8A 3D2BA 4XX0A 2K2QB 4IV0A 1ZC3A 4G4SP 1HR0B 2HGXA 1KEEA 2FPMA 1JFTA 3D5TA 1MC4A 2BFDB 5TGDA 1LBEA 1EZ1A 3VZSA 3RWMB 1ZD9A 4QYIB 1XZKA 3IKJA 3R09A 1SWWA 3N8KA 2AJ8A 3HSYA 2FLVA 5CFZA 4ZVNA 2GYUA 1SEVA 1I94H 1TJ4A 3TQQA 1BOFA 2YINC 1Z62A 2IT1A 1VLLA 2FI1A 4UHEA 5KZMB 4LYYA 5C44G 2IYVA 4PPFA 3QY0A 4MKHA 1TU0A 4RMNA 2HI0A 1G60A 5JPCA 4NP6A 5FHRA 2WWVD 1QSGA 5ALHA 4J0FA 4Y9UA 5IZCA 5J4YA 5CB6A 3GYBA 1P9OA 4WCFA 2XH8A 2A0KA 3QUSA 4A0SA 2Y6UA 4BJ1A 4XLTA 3NUGA 3W3AA 1DCKA 5D6OA 4BNWA 4K46A 3T1YH 4BVHA 3AVWA 2P40A 3C8DA 3Q87B 1K7FB 1U2RA 3S99A 1FL9A 4FE4A 4KFRA 3ADCA 3QJGA 3C7DB 4F93B 1UMCB 3EGCA 3FB1A 4YJ3A 4Z54A 1T9GR 4ABYA 5EE1A 2C9MA 2PZKA 1QPGA 2EIXA 1U6JA 1T10A 3O73A 1X2BA 3QZ8A 1LBTA 3T52A 5HEKA 3COJA 3OF5A 1E3TA 1Z0AA 1JDZA 4MVXA 1C81A 3TQ1A 4AFNA 4QSMA 3G0BA 2V3VA 4QQNA 3SFVA 5F9HA 2HHAA 1RNLA 3ODPA 2WQ7A 2Q5IA 4DJDC 1Z34A 2V54A 2CV2A 1I3OA 3R5SA 4DR4H 3C87A 4XA8A 1VIVA 1BE0A 2NSDA 2Q3MA 4F3RA 3N74A 2I1QA 2RIPA 3JVIA 1L5HA 2IYPA 2WMNB 4AZ0B 3BWBA 1DWPA 4ZVPA 4G1EB 2KMLA 1QANA 2TMKA 1E94E 5HOQA 3IPLA 3MR5A 1VJ1A 1Y5LA 3H5RA 3HB1A 3FH0A 3Q3HA 3FAZA 1DUSA 4OYLA 3BMXA 5CDFE 3KTAA 3BX1A 4EY4A 1DFGA 3BDVA 4D9MA 2ODTX 3WWCA 1CPYA 4Q66C 3ELYA 4K9MA 3WIEA 3QGMA 4X1KA 4BX0A 1GA1A 1GU1A 2CY0A 5JFGA 1NKTA 5E95A 1MABA 2HPHA 5K8CA 3UANA 4F4HA 5TMDA 4YRAA 3EW9A 2OXEA 4Z86A 1TCCA 3OCCA 4PTZA 4O4HA 3E9RA 1OXMA 4ZCSA 4MRNA 4QPJC 1X7GA 5CYOA 1SUPA 3FCOA 2PQ0A 4NZ9A 2QX8A 2PR2A 3F5QA 3AVYA 1X14A 4QARA 4UE3S 2ZG6A 4MTCA 2QS9A 5G0SA 2GPAA 3ZWAA 3IP6A 3KFLA 2GFQA 2ID7A 3R3WA 4X63A 1QH8A 3IEVA 3WGOA 2YCHA 4QUJA 4EMBA 3LE8A 5T8KA 4R2WA 1GG5A 5JW6A 4R05A 1G3IA 3KB8A 3HRHA 2G5GX 1JLLA 4NULA 1E3QA 4G8DA 2AJBA 1Q22A 3HP1A 4ECUA 3NV9A 1DJOA 4YRCA 1PAUA 2EFJA 5C4GB 4R2JA 3VU0A 1XNRB 2W0MA 3EDYA 3HKCB 1KJZA 2HLNA 3EBOA 1Y7PA 2AMJA 4EB8A 2HMWA 1G18A 1BSVA 4WL0A 1MD9A 2P62A 4K0RA 2OFOA 2QKYA 1MRSA 3G0CA 2GA8A 4U9IS 2C9YA 4FFLA 2AWNA 2ZCUA 4D98A 3BMCB 1DFIA 1KZ9A 1M2JA 1EHIA 2CNDA 3R3ZA 1CT9A 1JSCA 2F1JA 3H86A 4ZHQF 4MPTA 1YBMA 1Z7WA 1XZAA 1XEWY 4DSZA 5H7XA 3JXEA 3LK6A 1MBZA 5IF3A 3DCYA 1MT3A 4IW3B 2XWPA 3IMEA 3OUZA 2QX6A 1T8TA 5JYCA 3O1LA 4IV5A 2D1SA 1MG0A 2Q8PA 3ZK7A 2DR0A 1P33A 1OXTA 1XB2A 5LYJA 5TE9A 4LF7B 1E3MA 3FFTA 4BMDA 2Z4TA 4WZZA 4IF4A 4O4JA 4FZVA 3Q7PA 3WBJA 1CVIA 4JV5H 4PPQA 4M9RA 3HA7A 4TMWA 4URZR 2XUKA 5G4LA 3DPUA 2PGXA 3ANMA 1B3RA 1YFKA 2H08A 3IR7A 4R1MA 2ZBRA 5KFFA 3BH6A 5LA6B 5J5VA 3VZQA 1FFGA 4LNAA 3ICCA 4AJEA 4JT2A 4DUGA 2ZM5A 1G5HA 1BCRB 3CVXA 4MZDA 4QDOA 2IQ5A 3K94A 4RF2A 2PYIA 1CB0A 4KX3A 4L3WA 3H9CA 1IWBB 2ZR7A 2BN4A 2G1AA 2DHRA 2AW5A 5KKCA 2OORA 3L4SO 2FE4A 4A4DA 3UAOA 4UHCA 4PAGA 2WHPA 4X71A 1R6BX 4ED1A 3NU1A 2GCOB 4JP2A 3C4JA 1YA6A 1EE2A 1NQUA 2PQMA 2QSYA 4RB2C 1HSOA 4V1CA 1FRQA 3BH0A 1QIIA 1U5BB 1I0IA 2HQRA 5EWMB 1BHSA 4WIAA 2HU2A 1DL5A 3TTWA 3KKOA 1ZJ5A 1ES9A 3B1YA 1WHSB 3R7NA 1X1DA 4AO8A 1VDMA 4M22A 4J90A 4B3SB 1N34H 2VP0A 3PGXA 3T7IA 4HB4A 2R11A 4LJ8A 3N59A 3AL2A 3HGQA 3MCZA 4A3DG 2PR7A 2WUDA 1JJIA 4TVIA 3WJ2A 3DXYA 1JBKA 3H99A 3G0HA 1Z6XA 4C6TA 1GQYA 3DB2A 5C1OA 4N8DA 1CEEA 2YJ6A 1JR2A 1UWCA 2L42A 3AU8A 1JQJC 4Y6RA 3ZWWA 1OBOA 3ITKA 1TX4B 4BZPA 2HSJA 1R9NA 2EZTA 4HB2A 1ORHA 3NNDA 1EFHA 4BN4A 3PRJA 1DG1G 3GBPA 1BXGB 3M5PA 2ZITA 2CHVA 1G21E 1A4IA 2O8FA 1CDEA 1RJEA 3DCIA 3PXXA 3FRHA 1UBSB 2JEGA 4BE4A 1ADYA 1K2WA 3FSGD 1LF0A 4K0KH 1C0PA 1JDUA 3CUKA 3V4SA 4AAYA 4J0QA 4JP3A 3KV1A 2QTZA 1NRXA 3TGPA 2ZUWA 2FQQA 2VEDA 4MVJE 1P4AA 3O8RA 3B51X 1CQIB 4DMHA 4LJLA 2OV2A 1SG9A 3WMGA 2C0QA 4YI3A 3HKZA 4L73A 4X7BA 3NHUA 1E5DA 4PPNA 2RKBA 3D8NA 5B30A 2WZBA 1SUSA 5DG9A 3PVXA 1FJHA 1VPEA 3BD7A 2WF6A 1Z88A 5FA5A 4XEHA 3PUHA 1IBRA 2VK4A 1CRLA 4YMIA 1CJBA 2QQ0A 4LF4H 4JB0A 1VL5A 4YMWA 1IG0A 2JD0A 1FSPA 1P0FA 3I8OA 3PJDA 4D0LB 1GFSA 5HJEA 4EUNA 2WR8A 3GDOA 2HO5A 3PGVA 1H6CA 4NBUA 4I14A 3VISA 1PG0A 3OTQA 1N33B 4GC7A 2O8EB 5BWMA 5HX7A 4MRVA 1PX2A 5F4BA 4PHGA 3THRA 4R83A 4QHTA 3N2LA 5EP4A 3HB0A 1VHJA 4LE2A 1DAIA 4JNKA 1JTEA 1W5EA 4WPGA 3KE9A 4V0QA 1RTTA 4OSEA 5JJLA 2WWGA 4ZK2A 2DU8A 2EKDA 1B04A 3K0KA 4KSCA 1ZRNA 1GM5A 3FTQA 2JLBA 5AWFC 3U3ZA 1DAGA 1N9GA 2HTFA 2E37A 3QQPA 4DWVA 2DKNA 4RVHA 2PGDA 5AUOB 3T8YA 3SHTA 4ZWNA 3KR9A 3GQBB 4M7EA 1ZK4A 2EV9A 3GJQA 4A8JB 7REQA 2DH5A 1C3VA 3EUEA 3D4BA 3I9V6 4C2AA 1D6SA 3A31A 2XCTB 4CM8B 3A9RA 1N5MA 3V1KA 2RAVA 1WG8A 2FGKA 1VRCA 2BWJA 5CTJA 2OAEA 1ZA1A 4RHFA 5HGXA 3DVAA 4JSYA 2I7DA 1VI6A 3AT1A 3W7BA 4CMHA 3AJ9A 2GM4A 4NXMH 3QUCA 2ZJZA 3P20A 1ODCA 4JMPA 4KN5A 3GFPA 2AEMA 3LHSA 2B8WA 2DETA 4AY4A 1MMFB 3R3HA 2Z83A 3P26A 1YGYA 4FC6A 3JRWA 3N3BC 1F5SA 4DR5H 2H9YA 3CM0A 4YUXA 1LSSA 4H3VA 3DV0A 3GAAA 1CIVA 1CQZA 2I2DA 1HT3A 2R5WA 2J4FA 2Y2UA 1J4AA 4TKZA 2O3TA 4HXEB 2GJKA 4LZJA 2BGGA 5CA0F 3PD0A 5C1IA 1U3TA 3G9XA 2Y0SA 2AXPA 2PVSA 3BJEA 2IV3A 1NJFA 1XKQA 4B3CA 5KYXA 1G8MA 2Y9MB 4JSRA 2Q1XA 3KJHA 5TX7A 3DEFA 2KLHA 5A6SA 1E7WA 4DAAA 3OPVA 3IP7A 4OHBA 2OB1A 1BEZA 4FOOA 1P1BA 1G1MA 5LL6P 2H5EA 1B8PA 3D59A 1H9CA 1H66A 4UUMA 1RQLA 1VMEA 3GH1A 4QUGA 4GI7A 5E9QA 3RYCA 2J9YB 3R9RA 4ERNA 1CNMA 3I30X 1OB5A 1XV5A 4G0OA 4W1PA 3D64A 4QXQA 1EHYA 3R9XA 3LX5A 5ESRA 4N5NA 3AR7A 3GTOA 1ZK1A 4QOSA 2ANBA 2C4HA 4Q6WA 4GVLA 4E6NA 4QFMA 3PNBA 3JAWB 1G3QA 3WBKA 2J7PA 3NB0A 5JSQA 3LXMA 4S1WA 2J5RA 4J8PA 4RWEA 3I2KA 3AHEA 3JZIA 3SYRA 4LH6A 3K16A 3QPWA 3R6GA 4ZHQB 4PLWA 4K9SA 1OFIA 1XQ1A 3I3OA 4QJIA 5BYBA 2A92A 1EX1A 5DTRA 3LDGA 4B5KA 4EDFA 3GLUA 2CNLA 1RJ9A 2AOWA 1JAIA 5DTJA 1X1TA 4ZGGA 2DX7A 3Q1KA 5ALVA 5FPSA 3SPXA 1F3LA 3NM5A 1AUPA 3WNCA 5GOZA 1P2UA 5A3JA 1ESEA 3LMKA 1RI3A 1QRTA 3C3DA 2YWGA 1IEQA 1ZAKA 1MB0A 5C80A 2FMUA 4DFDA 3O4GA 4NMXB 3CRZA 2I7CA 2WSYB 2JJ1D 4PYRA 2GBFA 3IGFA 2DOKA 1JH8A 1PX0A 1U9YA 3H4IA 3O1HB 3HCNA 2VRCD 3EHDA 5B1EA 6ABPA 4AB1A 1HFJA 3HNRA 3GUUA 3NZEA 1WPQA 3E5MA 4RKFA 3A25A 4TQ9A 4WI1A 4ZCQA 4FS2A 4NKRA 4NV0A 1KEPA 3R0IA 4W8GA 1L1FA 5DRTA 2W22A 4KVZA 4DDWA 4QX6A 2ENWA 1GCIA 2XYPA 4LFAB 4IJ6A 1SUFA 3LBHA 2Y1KA 1Z0UA 4DUPA 3Q8RB 4DQNA 5K8IA 3F6SA 1M2NA 3R75A 2HRBA 2W90A 1OAKA 1VE9A 2FPIA 1QZ3A 1EJBA 1NLMA 4RC9A 4Q9HA 4E3WA 4LXUA 4H7KA 5T7BA 4BWGA 4DUYB 1UDWA 4KZKA 1B6TA 4TV8F 1H6DA 3DBRB 2BBOA 4WEQA 5KT6A 4OX9B 4CIXA 2I6UA 4C6HA 4B3RB 4LSXA 3CUSA 2P77A 4N3GA 2OGWA 4DGQA 2VUUA 2Z98A 1NL3A 4B8YA 2YMMA 1OX6A 4M89A 5DLPA 5CB4F 2UKDA 3STTA 2PH1A 3FE2A 5DNVA 3IIKA 5C31A 5L53A 4W8OA 4H0CA 3VTAA 5DISC 4JK3A 1KYYA 2RF4A 4ZQCB 3LDUA 1E4YA 4P3XA 1LUAA 2IZZA 1I3KA 3A3YA 3PF8A 2JLAA 4MS4A 5IN4A 4M36A 3PR3A 1R1DA 4PIPA 3ZNQA 5KTMA 4ZMSA 1WUJS 4P93A 2MDTA 3IDOA 4G07A 2VXYA 3CCBA 3KYHC 3KQPA 1SIBE 5C35A 1KSGA 3SWWA 2HLDA 1AQIA 1UADA 1Y89A 1XQXA 5EJ4A 4PZ0A 4KKXB 4DYDA 4BQPA 3TQFA 3WQSB 1KGDA 1W36B 2G09A 4LOHA 4HUJA 3EGWA 1LLFA 4EUHA 4RABA 3P4UA 3OJFA 3N0RA 1LW7A 4RTPA 4FOTA 3EX7C 1JG2A 3MD9A 3WWEA 1E5QA 5ICFA 2PS9A 2VTBA 3BL6A 5CFOA 2OZLA 1N36H 3FMAA 1FLVA 3OEHD 3WA6A 3PGLA 4AJHA 3ZY6A 5G0UA 4ASUD 2IOFA 3PPVA 2DAAA 1H2RS 3C3EA 3JX9A 2WQZA 3ETLA 2JFNA 1GGHA 3BK2A 1EKPA 1TQHA 4P0PB 2G07A 2C2EA 4V3BA 2YWJA 1E61A 5FJIA 3WLKX 1X74A 4LJAA 2Q8QA 3U9LA 2UAGA 3OHAA 5IJZA 1LTHR 3IKTA 3A2MA 4Y30A 3U9TA 2HA3A 4HOYA 4ZVSA 1CE8B 1GPKA 2NPIA 1TA9A 3K0CA 3O26A 3P9SA 5I7FA 1OGIA 4ZGBA 2VAPA 1N2JA 2ZPUA 3PQ2A 2ERXA 1I2AA 5THQA 1SQGA 4E7PA 4WZAA 3QTTA 4E70A 4AQDA 1URPA 1ENZA 1ZZEA 1D9XA 2OO5A 2H5LA 1P2VA 1EVYA 4Y2PA 1GN8A 4MYHA 5JS2A 5HJ2A 1PFUA 1T3TA 4NCIA 1XRRA 2I71A 1T5HX 4L22A 3M6XA 3Q9UA 4MB0A 4IHQA 2F8LA 4DHEA 6REQB 2XMSA 3ITNA 1ST3A 2QUIA 3C8UA 1HM5A 3OFND 2RC5A 4YQYA 4TVBA 4UASA 2IEGA 5C52B 4BGEA 2WIDA 4LWPA 3JATB 3HFGA 5AMXA 2ZR8A 4PO9A 4AULA 3ZVNA 4AJ1A 4YT4A 1E3DA 4WXRA 2DPLA 1C4OA 1DEHA 1GZ4A 2GCEA 3C1OA 4JLNA 5EY5B 1AQYA 3EMKA 1DPFA 3OU6A 3BF8A 4UZEA 1PD0A 4AU1A 1OWOA 3AW8A 1IWPB 1WXDA 5DI3A 2WNIA 3KPYA 2ZRCA 4OJTA 2PPLA 1C3JA 3GJ5A 2GSWA 4BX8A 5AVXA 5J2UF 5M2QA 1WP9A 3LVRE 2GLUA 1X1EA 4MO2A 5CFMA 2XB8A 4HQFA 2JJMA 4DLSA 1W19A 1H5QA 4US1R 3OQJA 5KT7A 4MTLA 2RJNA 2FZLA 1U9JA 4TWBA 4NEGA 2ON6A 1ZYUA 1QGUB 3DOEA 4DTIA 1UM9A 5I45A 1JMYA 1N8NA 3STHA 5AI8A 1GZ6A 2JFUA 1Z6ZA 3TSAA 1X92A 3D8HA 1UL1X 3IC5A 3ZHBA 4LNUA 2QORA 1MO5A 2I03A 4ZOLF 4NV3A 2IS6A 3KQUA 1FXWA 3G85A 3TPCA 3W6PA 4TV9F 3DEKA 4HCJA 5JSZA 4KRGA 1ZDMA 3WIVA 2REBA 2CEKA 2A1HA 4KXLA 1IN1A 3OLQA 3UGJA 1Q5PA 1OWNA 3L0BA 2ZKLA 5E4JA 2BEUB 4HN2A 3QWIA 4UCWA 4F45A 1T0BA 3EPHA 2F9LA 3RAGA 1GAEO 4UNIA 1GNVA 4YT5A 1Z16A 3ZI0A 3UYLA 4FX2A 3UHAA 5J4KA 1K9VF 1UBJS 2HRZA 2H1RA 3VR2D 1IOLA 3C14C 3CX4A 4GP9A 3UYKA 2QE6A 2VHUA 5FTKA 1J2JA 3V3TA 1JDVA 1I24A 3KZMA 3SCZA 4Z4IA 2PRJA 3ZVKA 2QT0A 3M9MB 5E1MA 4RM2A 1K68A 2ZYUX 4P22A 3KAQA 1M1YA 4GVPA 2NZ2A 2BI4A 2D00A 2LD4A 4MUGA 1VJTA 3FI0A 4OLFA 3TS1A 5BNIA 1YSCA 2VDNB 2ZKIA 4B6QA 1SVWA 3EGVA 4B6JA 5CXXA 2G7ZA 3MRSA 1W48A 4OHUA 4RFSA 3KXYT 2WMDA 2WV9A 2PRKA 4HD8A 2NXJA 4DJEC 2HRDA 2YW2A 2ADOA 2IYZA 3FVTA 1DKQA 2QYTA 4QODA 3DXFA 2BP7B 2I6XA 2OVFA 4K6FA 1S1MA 4NI5A 3ZTTA 4BMSA 3AERB 1G2WA 3BMQA 1V26A 5LYYA 2BFPA 3G1TA 1QCDA 1NATA 3AM5A 3UKJA 3NBZB 2JIRA 2BKVA 1DGSA 4OB7A 2O3UA 3ZZ1A 3F7NA 4BNUA 1KKMA 3IQHX 3FUUA 1CF2O 3X2EA 1M2OA 2ORVA 4P5EA 3BXGA 3RB8A 3E48A 3L8DA 4TV8B 1IHPA 2CUZA 1NAHA 3UY4A 2PZGA 1ZS9A 3WZMA 1BJTA 4IRDA 1P39A 4DANA 1Y5IA 1N2EA 3FWZA 3IDSA 3BEDA 1PWXA 4NOKA 4IIJA 2DQKA 4XB2A 5EAIA 4DV7H 2LIVA 1M1NA 2JA1A 4MQ4A 1OU0A 1U2TA 3T7JA 4RXUA 4OK6A 4KR0A 1J8FA 4YT8A 3FSEA 3R3XA 4MRMA 1ULSA 4MRSA 4E5MA 1Z5ZA 2BL4A 4Q45A 4QNNA 2KSQA 1NWHA 4KDRA 3ZZUA 4EA6A 4JL8A 3QVOA 3FKJA 4MYDA 1JHOA 4PZCA 4K87A 2YWBA 3LKDA 3MILA 2N46A 3F98A 2CLOB 2VJYA 4X7PA 1TFUA 4UAJA 2XSZD 4OBWA 1L5WA 2XZOA 1Q1QA 1PT7A 3QVVA 5FQOA 4FQ5A 1O95C 4CCYA 1ST2A 4C14A 4TQRA 3WLMA 1RAAA 4LXXA 1KIMA 5KDDA 3NHFA 5KC9A 4DLZA 1CJSA 2DKFA 2I8AA 1CTQA 2O7NA 4F5EA 2VNKA 3FMPB 1QG4A 3HKZE 3HB4X 4E5VA 2AEJA 4I0WB 4LRXA 4WNYA 1BGWA 1HMPA 4PG8A 2UUBH 3CW8X 3QLTA 2C3PA 1M75A 1ORIA 1Z33A 1S3SA 1XMSA 2E18A 4EY6A 2W7TA 1LPOA 4GKKH 3GP3A 4ZKEA 3WTBA 3ZK8A 5KX5A 4X3CA 1NPDA 4JITA 2W8ZA 1XXHB 3QRWA 2F8TA 4IIFA 1NYQA 3UO8B 4OQDA 4ZOEA 5COBA 2K5UA 2UZ0A 4X97A 2HA5A 3RRFA 4DT1A 4L5IA 4CUZA 2E6KA 3LQKA 1E7YA 3RE1A 2O5CA 4MI9A 3ZD8A 1W76A 3R0XA 5CYPA 3CCCA 4LJ7A 3PNPA 2GRAA 2BEWA 3M0EA 1XLWA 4LHXA 4DSAA 1RI1A 1Z4PX 1FFCA 4V0RA 2IBSA 1OZHA 4CFZA 2FW8A 1T5DX 3LVBA 4JR2A 2ZE8A 4JYCA 2IE8A 4RACA 1FQOA 2L82A 3R5FA 1WKBA 3JQAB 1U1DA 5BN1A 2OR3A 4G5YA 3IHLA 1TMKA 4F7WA 3M7IA 3H1AA 4J49A 2PN1A 1SCQA 1SVNA 2GR9A 4CM9A 4ES6A 3CZRA 2QGFA 3IMGA 4BTEA 2RAFA 1N0IA 4YMSA 4TLLB 3DD5A 2B1IA 2PVPA 1ZJYA 1T9HA 5KWIA 4QICA 3D4OA 3WJAA 1V9PA 4EX6A 1U9IA 2N42A 2MSNA 4PN3A 3JD3A 5H8WA 5I5TA 4FLFA 1QV9A 4XVCA 5F76A 1HTWA 2NAPA 2XOKA 3I5AA 1P2FA 4ANFA 3LGXA 4I6JA 3TIGA 3TLBA 4FN5A 4LYFA 2H07A 2H1SA 4F60A 2D7DA 4IIBA 4KI7A 5KFOA 3I9FA 1KYTA 3PQ4A 5K0GA 4CTOA 4A0FA 1ZQ7A 1X9IA 4JEMA 4L9WA 2ZJYA 3DTYA 1T0PA 4LX8A 2IK8A 5LBIA 3L7JA 3MPOA 4CKBB 4M98A 1K7CA 5K6TA 4MW0A 2CLHB 2OHFA 3OQVA 5CT8A 2YV3A 3ADBA 1CVRA 1OUMA 3LPCA 1MOQA 4JLDA 1KSFX 1J6UA 2VBCA 3GTJA 1T2VA 3GLRA 4P7BA 5CCEA 4DQDA 3W5IA 2XB9A 1XPJA 3FNEA 2AE2A 1W581 4MARA 4YV0A 1Y4AE 4D3XA 2IELA 2C9OA 4BUCA 4F2PA 1DC6A 2PFSA 3NDPA 4FGJA 3O9VA 4P0TA 1A4XA 4ER3A 1HT0A 4YB8B 4FZ5A 2X8JB 1PWEA 3LM8A 2HSGA 5DIZA 3FCAA 3TUJC 2PKRA 4L3VA 3WDSA 5E1DA 2VDRB 2NTJA 4P92A 4LF6B 3GFGA 4O2AA 1U1FA 4R2IA 1HDOA 2Q2VA 3CXUA 1UWKA 4HYTA 3ESRA 2OHXA 1LF5A 1K97A 1E8NA 1F5NA 2ZVQX 5ARBA 3VPHA 4TKLA 3N8DA 2A0UA 1JHRA 3W9UA 3DM9B 2AT1A 2JHCA 1ZM3A 4MYRA 4G0WA 2EIYA 5HF8A 1T3HA 1T9ZA 2DFVA 1BW9B 3SFTA 4N12A 2VA8A 3PQ6A 3ZDRA 3I83A 3RUEA 5HQJA 1HURA 5DM0A 5LQDA 2DE0X 1JWLA 5DLYA 4NK5A 3KUXA 4II2A 3DKRA 4JUZA 4U6PA 1U7OA 3AJEA 5CBPA 3FLBA 1B41A 3GLIA 4PWZA 5J40A 3K5PA 3SIXA 1LVHA 2HJRA 5ENZA 2OSVA 4OQFA 3TGWA 1UQTA 4DL3A 1CV2A 3MCWA 2P4HX 3MC1A 4G4JA 1UJ2A 3V8EA 4WNAA 1DXYA 1Z2PX 4N76A 2AQ4A 1GZ5A 3DLAA 4IXMA 1Z06A 4ZU3A 2NU8B 1MIOA 1KUTA 2G9ZA 2H2GA 2ZYSA 3R9IA 3WLTA 4JQOA 1NQWA 3A2NA 4UD6A 5AOVA 4H7FA 3DDZX 2IHUA 1W88B 2YHIB 4II7A 4R1TA 4EF6A 5KYVA 2PFKA 2XUQA 2ZK7A 4AURA 1GYQA 2LBPA 4ZODA 2OWEA 3PRYA 4Z0PA 1UOQA 4L5AA 4Z3DA 1J2TA 2PD3A 4F85A 4EG0A 3AP2A 2QRKA 4C5CA 1K4KA 4EB0A 3U7RA 4LYDA 2O0HA 4BECA 1ZITA 2E4UA 1IY0A 1WLSA 3OSZA 3MINB 5ERYA 1CG6A 1UP7A 4BX9A 3NR2A 3H11B 2FKLA 4YJGB 4RPIA 3KJGA 2R5FA 3GRUA 4DV0B 2DQ4A 1B2RA 3FWPA 4D02A 1UOOA 5TT0A 2XJ9A 3DE7X 3FKIA 3L0CA 3X43A 3LC1O 3V4OA 1KJWA 1XKTA 4B3XA 1V5GA 4ZREA 2VYND 2O3JA 1NMQA 4KRYA 2Z02A 3E9ZA 4Q1EA 2WC1A 3TQRA 1EUDA 1L7NA 3TXXA 2GXQA 3G49A 3ZK9A 4DDMA 2H3EA 2JKZA 1GGNA 5EMNA 3WI7A 5CVVA 3ILVA 5SICE 3W90A 4PZPA 2X3FA 2GZRA 1JIXA 1X7HA 4ZPXA 2CSXA 1KFCB 3DC7A 2QM8A 1JAYA 3FWHA 3KOUA 3QFFA 2DLNA 4C6RA 4FBGA 2C61A 4PLHA 5IKOA 1BWPA 3BREA 3THWA 4QKQA 3TOSA 4M8LA 4ZKDA 2C59A 2BQRA 3QYFA 3GZJA 1HK7A 2ZYDA 2OUIA 3FPFA 4QUHA 2NSYA 4LGMA 3ROMA 5EP3A 4FOPA 3B78A 3JVVA 2QUKA 2P4UA 2KBEA 4BLSA 1KBZA 1VKZA 5J59A 5EHNA 2GESA 2O2CA 2ZIXB 4BS9A 1V9CA 1CC1S 2YY7A 2PO7A 2Q3DA 2XYVA 5GJVC 4QYXA 4MV0A 3DM5A 1BQ3A 3VRHA 3W6NA 4YY3B 3KTOA 3SEAA 1JFLA 1JNYA 2PE5A 3D8BA 1KYWA 3B2EA 5I9NA 3PLNA 1RIFA 3RHTA 1CDZA 4GHWA 4MIEA 4DA9A 3BRSA 4GMGA 3R7BA 1IJBA 2AVDA 1UDAA 3ZU6A 2XNHA 4TQAA 3FPLA 1AKWA 5TVKA 3OQNA 1PJ4A 4KITB 3A1WA 2WSMA 4TKVA 3WB9A 4Q7EA 2DGDA 4BVFA 1QVWA 2GXSA 5BPFA 4QWAA 1A3CA 3D8TA 2Q6IA 1AS2A 2NO0A 4L4ZA 4UCRA 5JY6A 3DV2A 2ZI4A 2BD0A 4I55A 1VM6A 1A72A 2FTKE 3DSRA 2PX4A 1E9DA 5KNCA 2R8HA 2JHGA 5T3YA 4A3IG 2MR5A 2O07A 2PUBA 2YMQA 1YCHA 2EJTA 3VMFA 3DLTA 3DMDA 4EO7A 1QU3A 1CUJA 2WAYA 1VP9A 3OJLA 1N6RA 2XWSA 1KFKB 1CLEA 2H8GA 1RE0A 2TMYA 4YR0A 3BB3A 1WXXA 3CLVA 3GBVA 1AG9A 3I8XA 1XL0A 5L4LA 5J2TA 1BDMA 2H59A 5EYPA 4IVPA 5DIFA 2CMFA 5JZVA 2B92A 5AT1A 1D5CA 2DM6A 2VPTA 4MI3A 5EPOA 3DCNA 4MNTA 1BMFA 4WZAE 3ICVA 2L2QA 4O4IF 2ACVA 2X19A 2VLBA 2JEJA 3KSRA 3B6ZA 3Q2KA 1CJTC 1OAAA 1W0JD 1O7JA 5FCDA 4A5SA 2GJSA 3L1UA 3I23A 2NUPB 4BB6A 2GOYA 4OHCA 2RHGB 1G6HA 1MO3A 1R18A 1TI7A 4KQ6A 4XSVA 1GCAA 3QWFA 3T4XA 1P5ZB 2XVZA 1J99A 1NVVR 2AR9A 4DILA 4BXOA 4LC9A 5FL3A 1NN0A 4D8WA 2YRXA 1M74A 3C7AA 2V7QA 1EAYA 1G3MA 5H70A 4A8TA 1YDWA 2DF8A 2Z1DA 4JD5A 2HWYA 1NJ6A 2VWGA 2K4MA 1OGJA 4OQNA 5G0WA 1Y6JA 1XQ6A 1WVIA 4CM5A 2OV1A 3I0NA 2VXOA 4JOSA 3IUPA 3DE1X 4ZVKA 3JASA 3PCTA 4J3FA 4KAFA 3RYIA 5TQ2A 3P96A 4EKIA 1KAMA 2BEVB 3VPXA 2J0UB 1GYPA 3HWWA 1WEHA 4DJJA 2AF3C 1ZWLA 2G1PA 1RI4A 1JG4A 2D1YA 4J0MA 5TPZA 5A2QA 4D92A 4D43A 4KVGA 4O8ZA 3WL3A 2PWAA 3ZE1B 4RE6A 1W4AA 4O1HA 4YJ2A 1JUDA 1WPXA 2HZBA 2ONZA 3M6VA 1ZN2A 4Q4DA 1KC3A 1H1TA 3A6KA 4BFWA 2OP0A 1QPBA 4C7VA 5TVGA 3U4GA 4OHOA 2PUTA 3D2LA 5D6NA 3DE5X 3EZ7A 5JAQA 2Q49A 1F1BA 2GBLC 3HZOA 3OUUA 2D2VA 3FRJA 3LYLA 5CA1F 4ZJUA 9GPBA 3WS7A 1LWOA 4ZT5A 2EX0A 5AW3A 1EK1A 4F0JA 5FH9A 4GSKA 1WCIB 5AM3A 2J9ZB 2HPAA 3JR7A 1H5UA 3SSMA 4ZZ0A 1FDTA 2LZ0A 3PNOA 3BF7A 2WB4A 2JAOA 4AQYH 2OK7A 4UUNA 4QTUB 3FCYA 3EH1A 4ZEWA 4YAGA 4W5JA 2R47A 4D6YA 2HSZA 4EHNA 4Z6KA 5D3ZA 2VDQB 3TEKA 3PIDA 2B4YA 4YRZA 4XJXA 1DARA 5F21A 1YVUA 2IYRA 5F3RA 4GGPA 2I3BA 1BD4A 1OYWA 3I1JA 4WWHA 3DTGA 3VZDA 1XD2A 4URWR 3JAKA 1G7RA 4KGVA 4JCCA 2P5TB 4C7KA 2WQ6A 2M1ZA 4UCQA 3O82A 1CVLA 2GHIA 3LYAA 2J3DA 4HUQA 5ALGA 2A5DA 2J87A 5FLKA 4MO9A 5C0OE 1M1YE 3SZMA 3ZWYA 3ZJVA 2DHDA 3JZMA 4IXTA 1XC7A 2HJVA 3DH0A 2O5VA 3QXSA 1XLTA 3G6VA 1FTSA 4TVKA 4I1SA 4QEDA 3OWXA 4WK6A 3EUFA 2ASDA 1GPH1 1WR2A 1YQTA 1NXSA 1FLAA 1FNNA 1AHHA 4HPJB 3LY8A 2G4CA 4AUKA 1FQKA 3EIOA 2YFKA 3U7GA 4LG1A 2ROQA 3IPYA 3AFHA 3L79A 5SYMA 4Y2UA 2NVUB 1XTKA 1NM5C 1X7XA 2Q07A 3NUZA 1MQ8B 1OBCA 3SE0A 3LWDA 3ESAA 1U1GA 2AG6A 4C04A 4Q34A 3K0AB 4BLTA 1YHZA 3NTOA 4RCZA 3KBOA 2ZJ2A 2A1TS 4HS4A 4LJ4A 2CZCA 2HK9A 2ZRBA 1D0SA 1GLGA 4CG0A 4YMHA 2F9FA 1FFEA 1Z28A 2OCKA 4PE5B 4RPKA 4P5DA 4OMDA 4YRNA 1AK2A 4NOJA 2CCJA 3CLSC 2ZAGA 1GAXA 3ADDA 1MQ9A 1ZH4A 1V6CA 4ZO4A 4NFHA 1C2YA 3DMFA 3NP9A 4OHMA 5K6RA 4TUYB 1Y80A 2HK7A 1NU6A 3P0FA 5JD4A 4K26A 1E9EA 1S2OA 4GPIB 4QDZA 5A0VA 3G1WA 3OM9A 5BNTA 4XGKA 1PJ3A 2DTEA 1CUDA 5C7OO 3IR5A 1EMDA 4ZCTA 3CLUD 1ZO8A 5HFJA 1J49A 1WMAA 3I5XA 4PSKA 3GP5A 1L7VC 2X9NA 4DR1H 4C3OB 1XQYA 5AUNB 4YASA 3IV9A 1MF7A 2FUKA 2GJ4A 4NRDA 2R93A 4HGNA 4XM1A 4NBRA 3JQ6A 3MK31 5EA2A 5KFYA 3N8IA 5KAMA 3GV7B 1N92A 3OCUA 4NWIA 1VRWA 3EA5A 3ROPA 4E51A 2DJ5A 3K9LA 2E7ZA 4PRYA 3CKMA 3JVEA 1UAAA 1TC1A 3ZE8A 2X8AA 2XVYA 2ZJ7A 2P5SA 4O2BF 1N2CA 2BZ1A 3N6XA 2V74B 4GWLA 4MW5A 5FUQA 5EUMA 4BV9A 2BQ3A 4YC7A 2LV8A 5HCNA 3LZDA 1B0UA 3M3DA 5JMOA 1M66A 1W6UA 3RODA 4CPDA 2QLJA 3V6LA 3D7NA 3PW4A 2Z43A 3KRTA 3BTSA 1QQAA 4WX2B 4KWCA 1GWNA 1U2ZA 4Q1DA 3ZY4A 3ENZA 4IDAA 2WU3A 3OTGA 2B78A 3AKCA 4ED9A 1P7WA 2PIAA 1A88A 2C0CA 3B1ZA 3T06B 2EBUA 2PDAA 4AYTA 4P80A 2J4CA 2JIDA 2ZAMA 1O94C 3RGXA 2ONKA 2YR0A 2ZAYA 2I2AA 2I3ZA 4BC1A 2AFVA 3GOHA 3HKDA 3OLCX 3WMWA 2D8MA 1RM3A 3UXYA 2V7XA 2XTAA 3Q0EA 4US2R 2OY0A 3SJUA 1D2MA 2GWRA 3I2JA 3A36A 2I54A 4IR1A 5E6RB 1XU7A 3KLPX 4D8TA 3ZQ6A 4RGYA 5FUVA 2FG7C 3DT8A 2VT3A 3KJNA 4Q7LA 2X2FA 1EFTA 4B40A 5KFAA 1ISRA 1ZKDA 4RA9A 3IVCA 1OFUX 4M99A 1ECBA 3U4HA 4DRXA 1TK2A 4DR7B 3QWBA 3L8MA 2HVRA 3K6SA 4Y2QA 5TXGA 1N25A 1Y0BA 2V6FA 1U2QA 5BWUA 3W2IA 2GZDA 3TR6A 4FMDF 1D2HA 2QD4A 5BSTA 3GLVA 1A9RA 4YUVA 1B3BA 1O96A 2XNJA 4OQ4A 5DGXA 4I1OA 2CFIA 3R3YA 1E6EA 5B36A 3DXZA 1V47A 4L0MA 1Q0SA 3K35A 2ZROA 4M9UA 4L5BA 5CVTA 2R8IA 3KVYA 4B47A 1KVTA 3SQLA 3N87A 4LF9B 4CLRB 3F71A 3IP1A 3LUPA 5ER9A 2R8ZA 3VBEA 1O6CA 2HIGA 3QYAA 5KNBD 2Q1YA 4KDEA 3FGZA 1W4ZA 2MJLA 1ZCAA 3HJNA 1ESNA 3PT9A 4ITUA 1SOAA 3KEOA 4G36A 2VSXA 4OCZA 4E2WA 3OM8A 4TSFA 1L4NA 2XXJA 3D7MA 2NX2A 1IBKH 3WHLA 3FOCA 1FUUA 4O7NA 2PS0A 1EU1A 4RQTA 1EM8A 4AKHA 3T7CA 5ALTA 4RYLA 1KMHB 3EZGA 4KUEA 1U2GC 4CG3A 2YXNA 1U9CA 3FTDA 2IYOA 1FSZA 4BNZA 4K9NA 4ZOCA 4D9IA 4B33A 4PBCA 3B6IA 4Y2RA 3UV3A 2C97A 4YJFA 1QGED 3LP5A 4K88A 4IHKA 4ND5A 1NKSA 1BHJA 2ZJ1A 2ATEA 3TSOA 1VKJA 2UZ3A 4U0KA 1TTTA 1E6KA 5G41A 3QZUA 4JASB 3V6HA 2DH6A 3PWSA 2HLHA 1ZU4A 1ZI9A 3K15A 3ZUGA 5LB4A 1D2RA 1A5TA 3NCHA 1RMYA 3WHPA 3D8SA 4CIDA 4D9BA 4UFPA 1X1CA 3QI2A 4FDAA 2COEA 4F9GA 1CSEE 4WHMA 4HWOA 4U2DA 3GLIE 4QUBA 4X95A 3WP0A 4IVRA 3G3EA 4DG5A 2I9PA 5CDHA 3UFXB 3UAYA 3UGKA 4JI3H 2NUTB 1KGSA 3B5IA 4HNAB 4IQ8A 3H97A 2MINA 4QEKA 3TBKA 4MJXA 5F5LA 1XQ9A 3R5KA 4MPRA 2X40A 1IXRC 1XHLA 2AYZA 1GD1O 3VMMA 3PA8A 3TKLA 3HBJA 3F8NA 4DA7A 5LP6C 3HI4A 5IXYA 3BICA 1DAEA 3QEAZ 3U17A 3GEIA 1WXIA 4J6FA 5CT6A 3D3WB 2O2IA 2RH8A 2FUNB 2BH9A 3CNNA 4MDFA 4BYGA 3V2UA 3KQWA 1QHGA 1UKZA 1UXIA 5EQTA 3G88A 3ENNA 1XDSA 4YVFA 1N0UA 4RMJA 2GVDC 2WM8A 1P61B 1D1QA 5BYAA 4LPKA 1VOTA 2B2CA 3ANYB 3ZE9A 1R8YA 2QSZA 3S0JA 5IT5A 3HXMA 3QFSA 6ADHA 2KYRA 2WI8A 4HRVA 1Q1AA 1DC8A 4ISBA 4HY3A 1PFVA 2AEEA 3SVTA 1J07A 3LLVA 5A5VA 3BDIA 5EPEA 2YXEA 1II0A 3O1JC 4U2GA 2ONCA 2D0IA 3Q10A 3V2GA 2OAP1 3B1FA 2FW1A 3O0DA 3N8NA 1YZFA 4RETA 2VK8A 2XMBA 1UZNA 4IQFA 1J90A 3MR6A 2P4SA 5FUYA 3LC7O 4HGZA 3GUVA 5LC1A 5FBZA 1ZETA 3BZUA 3BEOA 3W79A 4GLOA 5HBRB 3GFBA 1UEXC 4CE5A 2Y6VA 3Q8SB 1RYDA 3E82A 4HAYA 1U8EA 3AU9A 5DN6A 2Z6VA 4DSNA 3ZD6A 2QLLA 3U1TA 3CLRD 4B7UA 2JLRA 5JDCC 1Z35A 4J43A 2I3DA 5IU6A 3ZD7A 3DTVD 2XDAA 1E96A 1T91A 3SM3A 4PFJA 3R76A 1E58A 1J1ZA 1EFVB 4L8WB 2FK8A 2D1TA 4HZUA 3NT5A 4LHYA 3VR4H 5EG5A 3U56A 4B45A 1TADA 4YTEA 2GPNA 1GPJA 4CDMA 2Q46A 1MRZA 2X5JO 1P2GA 1XEXB 2C58A 1E1RD 1PTJA 3GGJA 3QHPA