4MA5A

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
365
structure length
363
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase, ATPase subunit
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with an ATP analog, AMP-PNP.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 115
structure length 363
sequence length 365
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ma5A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ma5A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ma5A01
3VPCA 3BFPA 3R5HA 5JQGF 3QFFA 1GSHA 5HV6A 4EA9A 1C3OA 3TQTA 1Z2OX 2W6OA 4IHJF 1VBGA 2I8CA 4DIMA 2W70A 5CAEB 2GPSA 3OUZA 2XD4A 3JZFA 1DV2A 4ZQIA 3KAJA 2CZGA 2YRWA 2YZMA 4M98A 1AUVA 2R87A 2YZLA 4FFPA 1M0WA 1OBDA 1W96A 1M0TA 4EG0A 2YYAA 5JQWA 3TINA 2YRXA 2I80A 4YAKB 2DZDA 3LP8A 2R7NA 5JH7F 4ZOLF 4FU0A 3UFXB 2ZDHA 1JDBB 3R23A 2Z04A 3I12A 5KX5F 4FGRA 2V58A 4EAAA 3K5IA 3JRXA 2C00A 2R84A 4HR7A 3ORQA 4I4TF 1GLVA 4MA0A 1A48A 4EA7A 4ZHQF 2NUAB 4XZ3B 2YS6A 4O2BF 1OBGA 1EUDB 5HBRB 2P0AA 2NPOA 3KALA 4MAMA 2PBZA 1CQJB 2X0SA 1BXRA 4ME6A 2IP4A 4M9CA 4L1KA 3G8DA 2YW2A 4IWYA 1EUCB 5BMVF 3JRWA 3RFCA 4XYLB 1VKZA 2SCUB 4O7WA 1JKJB 1KJJA 1VBHA 5BPHA 5CB4F 3KAKA 3ETHA 4MV6A 2V5AA 3Q2OA 2W6PA 4I55F 1WR2A 1KUTA 3RUPA 5EZYF 3K3PA 1EHIA 2HGSA 3V4ZA 4E4TA 3ORRA 4O7TA 1JLLB 5IYZF 3AX6A 3BSSA 3BSYA 3GIDA 4IIJF 4WD3A 4O7NA 2V59A 3MWDA 3U9TA 5K2MA 3BSWA 1DV1A 4Y8VB 1KEEA 1KBLA 4O4LF 2CNVA 2GPWA 4O4JF 3WO1A 4TV9F 1I7LA 4EGJA 4DLKA 2VPQA 4O7SA 5I47A 2NU8B 4YJ2F 3MWEA 4FE2A 4QSHA 5LP6F 4RZQA 3JZIA 2W71A 4XYMB 2R7LA 4O83A 4MV1A 3WO0A 4FFMA 3K5HA 3MJFA 5C1OA 4HQ6A 2GQSA 3BG5A 5LXTF 2R6FA 2DLNA 4EA8A 2W6NA 1Z2PX 4FFNA 1CQIB 1E4EA 2HJWA 4XX0B 4TV8F 4I50F 1ULZA 3G8CA 1BNCA 1T36A 4WBNF 1KC7A 4HNVA 4YAJB 4O82A 1B6RA 4O7LA 2FPGB 1EZ1A 1IOVA 1GGOA 1M6VA 5BPFA 5H80A 1SCUB 5CA0F 2CQYA 3HO8A 3U54A 4J6EA 4C5AA 2YS7A 1PK8A 4YBZB 2J9GA 1JDEA 5LYJF 4YJ3F 5LA6F 4MV3A 3U55A 2FPPB 4MV8A 2FB9A 3NUAA 2GLTA 3E5NA 3TW6A 2DIKA 2YWVA 4O7YA 2VHEA 1B6SA 5C1PA 2NU9B 1Z2NX 4EABA 1IOWA 4IZOA 4O2AF 5GONF 5JVLA 4FFLA 4MA5A 4O84A 2FP4B 2FPIB 5JVDF 3OUUA 2DWCA 5J2TF 1GSAA 4O4IF 3VOTA 2R86A 3HB9A 5DMXA 3Q1KA 3RV3A 2W6ZA 1A9XA 4IWXA 4FFRA 3HBLA 5C8YF 3DF7A 2R85A 1UC8A 4NYEA 4MV9A 2YZNA 2Z02A 3SE7A 1C30A 2QK4A 2I87A 1EYZA 2CNUA 1W93A 4O86A 3U9SA 5FNVF 1KJ9A 5LOVF 2PN1A 2YZGA 2PVPA 3GLKA 2OLSA 1CS0A 2NU7B 4O7VA 2W6MA 3ETJA 1GSOA 4TUYF 3TIIA 3N6RA 2NU6B 2XCLA 5KKNB 5J2UF 2VR1A 2WYOA 2YL2A 4O4HF 4M99A 3LWBA 2W6QA 4O7ZA 4O7RA 2ZDQA 5D8DA 3VA7A 1PX2A 2R7KA 4EGQA 3RV4A 3AW8A 1DIKA 4MV7A 2CNQA 3KREA 2R82A 4HNUA 3R9RA 1KJ8A 3VPBA 1AUXA 1CE8A 4MV4A 4ZI7F 1KJQA 4YB8B 1UC9A 3TIGA 3N8DA 3VMMA 3WNZA 3R5XA 2ZDGA 4GGMX 4O81A 3R5FA 4C5CA 4M9UA 1KJIA 2R7MA 3V4SA 1E4EB 2QF7A 3VPDA 1I7NA 5CA1F 4HNTA 4C5BA 4FFOA 2VQDA 2GQRA
chains in the Genus database with same CATH superfamily
2OXFA 1PTKA 2E7ZA 1PJCA 4AZSA 5CA1B 1SXQA 2FWIA 2KYRA 3GLUA 2ZRBA 1C3OA 3TB6A 1SO8A 4K1XA 4DBVO 1WPRA 3OFND 4RPGA 2ETXA 3FUUA 5C35A 2BSAA 4QDOA 1G21B 4U7DA 2GDZA 4XDZA 4WJKB 1EMDA 3H1FA 2IA6A 2ZIEA 3QM1A 4A3MG 5C5DA 4O3SA 4FS1A 4QOSA 1A1VA 2B5OA 4M7WA 3W5SA 5K8CA 4XJSA 1Z5GA 4E6EA 1ZQ1A 4QFMA 4UFNA 3ME5A 5CMLA 2XYQA 1AC5A 1JQDA 4I4CA 4ESOA 2QQEA 1JQBA 5I7WA 2R84A 4CCWA 5AJYA 5K3DA 4DLZA 3FJ1A 1F2DA 1UT5A 4JMLA 4NMMA 2H54A 2WD8A 1UOPA 1P6QA 3B9QA 4EEXA 1AG9A 5JZVA 4LF5B 2WT8A 2C4WA 5JAOA 1H22A 2C9MA 5LNK1 5AQEA 1AQLA 1J1UA 1EK5A 2KMLA 4PQEA 1E9BA 1BEZA 4N49A 2BDEA 2MTBA 2VKTA 2X2EA 3GIWA 4A92A 4BPRA 3QEAZ 1H5NA 3X1ZA 1BHSA 2RMKA 1Z0ZA 3K1AA 3NPAA 2A33A 3DVSX 1YJQA 4X92A 4P4LA 1HDOA 3L1UA 5F7XA 4B1FA 5T6MA 4O7TA 2Z2YA 1GNLA 4HYYA 1CZNA 1YBMA 1JRLA 3KSDO 4O2LA 2ZAYA 2GTPA 4J0FA 3GP3A 3BSWA 4OKNA 1TQHA 3BE6A 2V6JA 1A76A 4MQMA 5FJJA 3BTOA 5F76A 4B80A 4AO6A 4UJ3A 4DL2A 4ITRC 1UJMA 2WWIA 2WB1E 3ZWAA 3GI1A 1BEEA 2AN1A 3FNHA 3OCYA 3GAZA 1X0VA 5KNBA 1VIDA 1ULTA 4NENA 1FLAA 1JU4A 1C9EA 4RD3A 3RRBA 3KRTA 2B82A 3GTMA 5LXTB 3QLVC 3EXFB 1BE1A 2OWEA 3FX2A 3W2IA 4OAQA 1CZHA 3RB3A 2B4AA 2ICAA 5CA1A 3A1FA 4WBNB 2HSJA 3CUEF 3S2EA 3HR7A 1II0A 3OEYA 1ICEA 4ZTBA 4J9PA 3T3IA 2JJ1A 1E2UA 3BXOA 1T9CA 2XWSA 2PRKA 1EQ2A 1FB5A 1T2CA 3EEIA 4GLJA 3SK0A 4G81A 4MROA 5C37A 5K05A 1LUAA 3K05A 3MERA 3NC4A 3OP1A 3HZHA 3VR0A 1A9QA 4WNCA 5K0ZA 4PWQA 3C7TA 1S8AA 2DC1A 5HCNA 5D84A 4R3NA 4UEKA 1DKRA 3CRQA 5CUQA 3T5BA 1IXZA 2P69A 2QLFA 4HZUB 2D8AA 2Q5QA 5IP9G 4EUEA 4DQVA 1IQPA 1NQAO 2BKUA 3GWGA 3DGEC 1XU7A 4KWTA 3PXDA 1VFNA 5NLLA 1Q5PA 4NLLA 1IDN1 2CSUA 4OHYA 2ZWOA 4PYIA 4KG7A 4NYMR 2W8BB 2B4RO 4MS3B 1KEZA 1PWYE 1JBKA 2XTNA 2ZYGA 1JFTA 1E2JA 3L6RA 4B4KA 3FPHA 1KYVA 6AT1A 1ZITA 4O4HF 3SS9X 4EY3A 3CF0A 4Y6GB 1RVV1 1AN0A 5L4LA 1W75A 2PGOA 1JAIA 3X2SA 3OWOA 1ZH0A 1KJ8A 2BZGA 3LUAA 5DXJA 3AFOA 1E1RA 3I4NG 2Q50A 4GXNA 1X13A 1QO9A 3C7KA 4A5OA 2VZ0A 1J97A 4ECAA 1V3QE 1BMFD 3N2EA 1I7NA 1LK5A 2AT1A 1SQSA 1K6IA 4A1OA 3FPSA 4M7EA 1WMDA 2GAFA 1OD6A 1P5ZB 1QSGA 1ECLA 1I4TD 3W9YA 4N39A 2ADFA 2C28A 1BCRB 4KXQA 4IOJA 3WL7A 5A0TA 3LV8A 1OB5A 4R3UC 3F4KA 3QG1A 2W98A 3OIYA 4O02B 1SHKA 4ARAA 1W1IA 4E7PA 4UATA 4HP8A 2GWHA 1LDEA 5PNTA 5KNDH 4DS3A 4ZI2A 4S35A 1OXKB 3DAPA 4OX9Y 4IS3A 3P9IA 3BCHA 1TQ2A 4ZAVA 2NYVA 4E3ZA 3EDOA 1VXRA 3UFXB 2YY7A 2A88A 1O6CA 4M86A 4ZC1A 3VO2A 5LXTA 3EXFA 3W5UA 3LIIA 4U2GA 1BEUB 1E2FA 4UBKA 4WBNA 3BWBA 3T5JA 2F64A 1H93A 1CQZA 3NMUF 4QHYA 2RGXA 4ZKEA 1YBFA 4BWFB 4P98A 3SHWA 5K3FB 5IMBA 5EG5A 2C58A 3CQ9A 3FMOB 4LX0A 3EIHA 1UQRA 3SQWA 3AINA 4G09A 4GKJH 1WUKS 4BVLA 3MJRA 1Z0KA 2C94A 3PPIA 1ZJYA 3ICVA 1E2PA 4FW9A 3OZCA 4HZUA 1G55A 3X44A 5HGJA 5INTA 4K6HA 3ROEA 3VNAA 3D8NA 3TRFA 1A7JA 1QQ6A 5FR1A 5K7SA 5DGTA 4D25A 2E5WA 1XRSB 4QECA 2V7QD 1EKFA 3P9CA 1PNTA 3FYDA 3HVKA 5DBHX 2W8BA 1H8HD 2JATA 1Z0IA 1PLKA 4MS3A 4DUZB 3QU5A 2XC9A 2PZBA 1QH0A 4CMBA 1PG5A 2AX3A 3TB4A 5GJVC 1O94C 4P4NA 1O5OA 1MJFA 4PEVA 5KFZA 2QTTA 1HM5A 2GPWA 2IXGA 4EG1A 4P31A 4PO8A 4O7SA 4JV1A 2QT0A 3DMHA 1W2WB 3A9SA 4ZTUB 1JQJC 1P80A 2A9FA 3IP6A 2R7LA 2D1QA 4F4IA 1Y8AA 2H7YA 4ZXPA 1VHLA 1Y3CE 3H1GA 2I7VA 2GQSA 4BP9A 3R44A 3QEJA 3RAFC 1V5FA 1UDXA 3FFAA 1DBVO 4CTMA 5HNKA 4ES6A 4HNVA 3N70A 2VJOA 1Q0ZA 1R9JA 1IYEA 5ICSA 1A71A 5CA0F 2BE9A 4KGDA 5BRAA 3Q10A 5HUJA 1PK8A 1KMHB 3I05A 2ZUTA 3S70A 3WFJA 5I5UA 3EGOA 4TQGA 1BCRA 4N3NA 3R7SA 3IQGX 1KI1A 2IU0A 3TLMA 1GCIA 1MC4A 4P54A 3O73A 4AK9A 1SC1A 1FXSA 2XUPA 1RWNA 4DL5A 4LF8B 4FT2A 2ZEJA 3DFUA 3WKAA 5BUSA 2WM2A 4ALMA 1YRWA 4K6OA 2IYZA 4QRDA 2J6IA 3KFXA 1CIPA 3PFHA 4AJHA 1LQTA 3CJTA 2QMZA 4JEMA 1GT6A 2ORWA 4Q1CA 4XIJA 4BGIA 3ENKA 3UFXA 2Z02A 3RAPR 1PZHA 5JFOA 1R8JA 3E7PA 3EVZA 3ZLTA 1XHLA 2X15A 3A3OA 5FWDA 1AUPA 4UE2A 3B5IA 3AHDA 2CVQA 3PSHA 4Q4HB 1U3TA 3PUVA 4ZVNA 1XMIA 5TNXA 4QYMA 1TEZA 5LU9A 2HSGA 3RVBA 1L3CA 1QUFA 1X14A 2OORA 4MLCA 5K3FA 4B76A 3I4FA 4G65A 1KKUA 5J9FA 4E32A 5FJIA 4YV7A 2DHEA 3GFBA 4AMZA 2O3SA 3ETNA 5EGSA 3H6KA 1EM6A 2V9PA 1TXGA 2JLUA 2ZYTX 4JT4A 3DBHB 1OWOA 1CUEA 1VLJA 2FSHA 3KUUA 2PMZE 4CBVA 2R6DA 1BA2A 4G56A 1XCLA 2QRLA 4YRKA 3IERA 2J59A 3G2JA 4DJAA 3GNLA 2HOQA 3GF4A 2RJNA 5EGNA 2X7XA 3W5IA 1T5DX 5FBKA 4H6VA 1FMTA 2QN7A 2PPVA 2I5PO 3X1YA 4RAOA 2QBYB 5K4HA 2B98A 1E1MA 3S40A 2O6LA 1H4QA 3PDUA 3KD2A 3LECA 2WYHA 1SHLA 4DUGD 4QULA 4UCOA 3N9IA 4RDHA 2BYTA 2O8FB 1O6BA 1XPUA 3IEKA 1S7GA 4EW2A 1HQYE 2ZJ8A 5CNIA 4DDWA 1HYHA 1D8TA 3I3OA 3CH6A 2YVUA 1T2FA 1KK2A 4I9HA 1YMVA 1RQGA 3VU3A 4GMHA 4KR2A 1J0XO 3AG5A 2PANA 2YZ7A 3QK7A 5JH7B 3W34A 3AF0A 3R3JA 4TYWA 1QP8A 2K2WA 4IKOA 1G9XA 1SG0A 4ZK6A 1L5OA 3GVCA 4HEA1 1HY3A 4R7TA 3NTXA 3E5RA 2PZJA 1N8SA 4LNHA 3NTQA 1BYIA 5EWLB 3I4CA 4JP2A 1XCOA 1ZHQA 4Q1EA 4XLZA 2OHHA 1MZBA 4JVLA 3GFFA 4NJOA 4IUBS 1N9KA 5HF5A 5JTTA 1GAQA 3RB6A 1CNMA 1JDPA 1SQ6A 2AV6A 2X3YA 4PZPA 2JJQA 3PF9A 2WD7A 3DH0A 2B7CA 1P1FA 1VZ3A 1XTQA 2K5UA 3D5QA 3FG9A 4L4SA 3TBFA 3VPAA 4U7TB 1HOTA 4LJKA 3NOOA 5HYVA 4Q37A 4IQ8A 1OFVA 3DUFB 3AR7A 3M2PA 4CGZA 4UDOA 1C8BA 2V8OA 3GIDA 4Q4HA 4L72A 5AW5A 4EWLA 4MARA 5H3HA 3TQQA 3A32A 4YQYA 3WRYC 3VOSA 4K9PA 3M6VA 3RS3A 1TEHA 3C3JA 1Z6YA 3D8UA 1HT3A 4K7JA 4M1OA 2ZCJA 1HSZA 1C1YA 4ZOEA 4XIFA 4OI2A 5U4XA 3VR2A 4IWNA 2JIMA 4YMHA 4HGZA 2GEDA 2XWPA 3C8UA 3DBHA 4AWBA 1Q95A 3LT0A 4M0JA 2BKVA 2BD0A 1GR0A 1SKYE 3COYA 4BLVA 3IXLA 3ACCA 3M6XA 1J06A 2JCYA 2PZGA 2EJUA 4NBRA 3SYRA 4TKUB 1AGXA 4IJ5A 3Q7RA 3K4HA 2XA9A 1PNOA 2P1ZA 2DBYA 2ORED 1DNPA 3H9CA 3K0SA 3VDQA 2DVMA 4J9RA 5AXAA 4PGHA 5LYJB 3AYXB 3HC7A 1KO4A 2C2HA 3HGQA 5JHGB 1IM8A 4TMTA 1NNLA 2CL5A 2O8FA 1W0KA 2ZVDA 4WEQA 4BNIA 5JVDF 4UHDA 4MRPA 3UM9A 2WJYA 1YZFA 3DZHA 4B79A 1XO1A 4IIJA 3OZBA 5SY9A 3LBIA 3HOZG 2MSNA 5I5XA 3AW9A 4LZLA 4R1PA 3RUCA 1JTFA 4DGSA 2MSDB 4D4KA 3WB0A 1JYSA 3ZUPA 1M1ZA 4P82A 3RB0A 1PVDA 2TRSB 4BWYA 2YYYA 4LE1A 4QTTB 3L79A 5FNVB 1G2WA 1KQOA 3O7MA 2HNAA 3GA5A 4IIUA 4YRRA 1LBHA 3OHBA 5DXFA 3IBTA 5TS2A 3T3HA 2WFMA 4XEHA 2WAXA 1Y4SA 3HMQA 3W1EA 2Q46A 3FHCB 1QAMA 3T7SA 3UJ8A 3BA1A 3N6XA 1TZJA 1VAJA 1RYDA 2ZRNA 2IYQA 2DWQA 3GC6A 8LDHA 2Z9BA 4ISCA 3D6TB 4CQMA 2B6NA 3NVKI 3IMFA 1RQLA 3F5MA 3BE4A 2O8NA 3DB1A 1DAEA 3CM0A 2Z4SA 4FZVA 1M10A 3NGDA 3MR3A 2ATIA 4TTPA 4HB4A 3TLYA 2JFQA 1D5CA 3STVA 2CLIB 2UYGA 2I7TA 3DUFA 3LX5A 4CIAA 4JAVC 2R62A 1U94A 1U02A 4IF4A 3ZGNA 3JWEA 4PZAA 1ZVVA 4I8XA 4DV1H 4YHHH 1DEKA 4RGVA 4CF6A 1IN8A 1DIHA 5EPEA 2FQQA 3GN1A 1M76A 1S3FA 1SM4A 5HKKD 2RIPA 4OMUA 3INYA 1JAXA 4YWJA 5DLQC 3LS2A 5AVJA 2VBIA 1P0PA 5EINA 1PFVA 3EAFA 5I4BA 1NAIA 2YXBA 3EWNA 4TLEA 1XRQA 4RQTA 1DQZA 3DOJA 3PR3A 5JWOA 4MVJI 2OBMA 4F85A 4WCFC 2AFIB 5G1OA 3W04A 4Q9DA 3LZDA 4CVNA 1XZFA 2BGIA 4BO7A 2Q6OA 1FSFA 1Z8HA 3IAS6 2PUJA 1KI3A 2B25A 3QPAA 4PN3A 4V3CA 1P0QA 2JFFA 2I1WA 2W11A 1CLEA 4A93G 1I2CA 2CDAA 4AYBA 5LYJA 3V5NA 4BL5A 1M6WA 4EEQA 5E6SB 3QLUA 1ZCZA 3NVAA 3ZG6A 2FV8A 4QWCA 4DIKA 1H8EA 3VPXA 4FBMA 2VP4A 4TYQA 1P9OA 2YW2A 4QGHA 3IUSA 4JMPA 1GZVA 1EK2A 4YAOA 3K70D 4QGSA 2J5QA 1DAPA 2WKWA 2Z6VA 2IY7A 3S0JA 2IV3A 3A1TA 5F9FA 2WWTA 4AUEA 1J8QA 1WMEA 2HF2A 5I5EA 1G8SA 4ODIA 3QRWA 4LOLA 2ODWA 3ORRA 3V3KA 4UW9A 1UWLA 1KK3A 5FNVA 5JU6A 4XQ9A 1V9CA 3H9EO 3VR6D 2ZVJA 2QJFA 3C85A 3KT0A 4MUJA 3ADBA 3HDYA 4HS9A 4LV5B 2BDUA 1OFIA 3RBEA 5JRDS 1NF8A 1H9AA 2GNAA 2XMRA 3MUNA 3FNQA 1KQPA 4H59A 4JC4A 3S2ZA 4WRRA 2P4QA 3QSGA 4IUYA 3EH1A 2I0FA 1KMMA 2H31A 2ZRKA 3CE6A 4J0GA 2ZYRA 2ECQA 1RLOA 1PP4A 2EDCA 2OZLA 1XNQH 4EYQA 3MJCA 1QMPA 5AO9A 1JFRA 2EXXA 2O1EA 1YT5A 2XNCA 1KDOA 1WBJB 2JFPA 4PQRA 3W1BA 3WYNA 4EG7A 2PS1A 3V6HA 5BOVA 4XLTA 2F1IA 3QV1A 1ZUWA 5CW2A 5DYYA 4JELA 4L9AA 2C5HA 4W9MC 4KNYA 2CCGA 3E5NA 1W5TA 4UBJA 5G02A 5HZHA 3KLPX 4GM4A 3HRHA 4IX1A 1H6AA 3CCCA 1ZM4A 3PUHA 4GPAA 3CY6A 3RBDA 1N4AA 5AVRA 3A9UA 3CNEA 4P36A 1PFQA 4TOIA 1TIPA 5I7EA 2R66A 1R0SA 2AFIA 3ISVA 4RGBA 4RELA 4FINA 2QVYX 2ZBVA 4PVCA 1Q77A 2AIRA 3INNA 4BNDB 1CR0A 5B58T 3UJHA 4QDZA 5K3CA 4QUGA 4RB2C 3WZ2A 5LZ5A 4WXMA 4X65B 2OR3A 3KR0A 5KKNB 5E6SA 3CX6A 3SVTA 1S2OA 5K51A 3I2YX 4C14A 2CV1A 4ZO7A 3E5MA 1O97C 4FOTA 3MGKA 1YFLA 1LJ8A 3WLQA 2XZOA 3BM5A 2FPLA 3GJ8A 1VSBA 1MV5A 4EQ5A 4EUFA 1DC4A 5KYGA 4W9NA 1SY7A 4YT5A 4BTLA 2C59A 3L0CA 4GNRA 4EYGA 1VJDA 4CM8B 4JITA 2RGYA 4DR5H 1QIGA 3IR6A 2DAAA 2C0QA 1A0GA 1YGYA 3PRJA 3TLGB 3AKYA 4YH1A 1J5EB 1JHMA 3IEPA 3DHYA 1TAUA 1KO7A 4RIGA 5FD8A 3A27A 2QSUA 4WJZA 2QRMA 2ZI4A 3ZWNA 2GEVA 4D74A 4FNMA 1WB5A 5CYOA 3TNLA 4PC1A 2BFNA 2QVXX 4KXXA 3UXHA 3ZU4A 4Y9DA 3BGWA 2YKGA 5CLHA 2CFIA 4P7JA 2IUUA 2FUEA 3RJ9A 3G0OA 2WF7A 4RHUA 2B63A 2POQX 4MGEA 2ET6A 3P9PA 2QAGC 3ZNQA 3KQNA 3KPYA 3ST7A 3AH8A 2IU6A 3N58A 2XKJE 2WWYA 5DYIA 3RTDA 4NCIA 4AJ4A 1TVMA 3MLBA 4EFLA 2YWJA 4AN0A 4E7OA 2F55A 4QU0A 3Q41A 3LDUA 3FVVA 4DR6B 3GBSA 2X6RA 2DR2A 2XYGA 5DIZA 3ZKAA 4RK1A 2R8HA 1KFEB 1E3TA 5I48A 2SKEA 4AVYA 1RXVA 3LQFA 3X1KA 3IEMA 3GT0A 2QRVB 3AU9A 2PUGA 1OU0A 3HA5A 1T26A 3IAFA 1JH9A 5ALRA 3UK7A 1NUSA 4F04A 5B1YA 1LXCA 5LUAA 4H0NA 1NXPA 2I3AA 5FADA 3HSYA 1N6NA 3RVDA 1MZVA 4I5FA 4Y2RA 3WE7A 4TM7A 1N7HA 1XEFA 5I4CA 5TQ2A 3ZHXA 2Z2KA 1HPLA 4L6CA 2GZSA 4D8WA 4WCDA 2L82A 3AEZA 2EBWA 5L95A 4F4JA 3EC7A 3GIJA 4H27A 4JI6H 2HNKA 2ZBUA 5CFLA 4GZ3A 3DLHA 2AD1A 2DPLA 2VVTA 2E4ZA 3ND8A 1I7QB 2ZRMA 4WESB 2OP0A 1SH7A 5IKPA 4Q7EA 1HDXA 1X1DA 4CM8A 2W2KB 2HK8A 4ETWA 1NM5C 1YI1A 2XA1A 4B34A 1EGQA 3WNQA 4IJVA 2CXNA 2A1TR 3TLGA 4TLCA 1Y5RA 5HIMA 1NZDA 1DPFA 1GO2A 4GPEA 4RKWA 2JNWA 1PJAA 2ZYIA 2CXSA 2HYIC 2PJUA 4YXFA 1LK7A 2F1RA 4NBUA 3LQ4A 3LPCA 3HP4A 2I67A 2Z83A 3FTPA 1G7RA 4KVFA 4NIMA 1ABFA 3H5LA 2RARA 5DN6A 1LGYA 2A0KA 5CCDA 4GLOA 1Z18A 3DE3X 3OICA 4PZ9A 5FEMA 4S12A 4HYKA 1MIHA 5MN5A 1JSLA 5F23A 4WKBA 3F5FA 4BS9A 4LHYA 4DG9A 3L7MA 1RCTE 4V02A 1S0MA 3BAAA 1KOFA 3DHEA 1UBOS 2FEOA 2WE7A 1ZAYA 4I9GA 1J0DA 3BT7A 1W19A 2QMYA 5FORA 1V47A 1D2EA 2LNDA 1T6XA 2OK7A 1U4NA 3QEBZ 2RHGB 2VA9A 4HX2A 4Q7JB 5HK9A 4KVGA 3QVWA 3W6UA 3VHXA 3R6WA 2JA7G 4BMDA 3I83A 5F3RA 4CM5A 3CVVA 4KAAA 1FVHA 1XGKA 4X64B 1FPQA 2D4AA 8ADHA 5LM3A 5C31A 5L8VA 2JGEA 2QE6A 3RC9A 2VUTA 2FYTA 3HCEA 3VYVA 1K1EA 4S24A 2WSIA 3WNZA 1UMKA 2Y1EA 1T9GR 4DCCA 5KDDA 1Z37A 2Q2NA 1JTEA 2TMYA 2HCTA 4KDEA 2XJ4A 3MM4A 3DMNA 1M6HA 4B3RH 1V5WA 3TVTA 4P08A 3CTMA 1V48A 3UEOA 5JISA 2WF8A 4DHWA 4PX5A 4GLXA 2X8WA 5J59A 2CUKA 2WM8A 1N2CE 1F4LA 4H1HA 3IEXA 4JBNA 1S3GA 3EXG1 1AHNA 4J8PA 1VHQA 1J4AA 2E4AA 4MITA 4UXHA 3JRNA 4IF6A 3OQMA 4FFPA 1DIGA 3DTVD 4HWGA 4EHFA 2NV6A 4IHQA 3KCNA 4AX4A 2JL1A 1Q3HA 1TUGA 5EUBA 2H51A 3HBNA 3UMJA 4ZT5A 4HZIA 2ZJFA 3NHMA 1S0OA 2JS7A 1RBMA 2QTWB 4NU5A 1Z6XA 3UWMA 1U7TA 3E0QA 2I6FA 3GUZA 5KCZA 2DFTA 3LX6A 2B8TA 3E3OA 3DO8A 4PXSA 1TO2E 4IDQA 2GN4A 3BK2A 1COWA 1Q6ZA 1NN5A 2PX8A 1CR6A 4JVOA 2OL4A 4DV4B 4JYBA 4ZVTA 2AVDA 3WHIA 5ADUS 2FSPA 5L3RA 4JB8A 1LPBB 3QA3E 3N5CA 3DAYA 2JFUA 2ECFA 2W6CX 3W2EA 1N2BA 4BKPA 5BNFA 5EJEA 5EIWA 2YV4A 2RGNC 3T1HB 1TMGE 2HGZA 1C1XA 5CVDA 4ZRDA 1Z0DA 1WW3A 1OB2A 2IXDA 1GPJA 3G2NA 4I55F 3ZBPA 5IC5A 3T9CA 1G5RA 1RWOA 3V2IA 2ZAMA 2HO4A 4OU5A 1D5WA 4DV7H 3KE8A 4UVDA 1M8PA 1N6PA 4J1QA 1YDGA 1Q3KA 2UVUA 4HGPA 2NMVA 4QICA 3PX2A 2GRAA 3NHFA 3HDTA 2FA9A 1YC5A 4YR9A 1W36B 4JKYA 1JQKA 2D5BA 1B2LA 1ODSA 2WMDA 2FHSA 1U2EA 5ALSA 5FUXA 3NI2A 3RSZA 2VNAA 4YUAA 1QXSA 3NU1A 4KIWA 2EQAA 2DLNA 5IK2A 2W6NA 2O50A 4EDFA 2X23A 3IULA 3HJRA 3TR6A 5DGCA 4UQPA 2C5EA 1I7DA 1NJ2A 1CUZA 2NTNA 5JDCC 5IH7A 4Z7NB 2O5EA 3ITDA 2AQKA 1Z8NA 3PA8A 1H6DA 2IPMA 2C1ZA 4XUCA 5D7NA 5CM2Z 4UTXA 4OJKA 1VCMA 4IAOA 3N75A 1L1EA 2OB2A 3G6WA 2P9CA 3CZ4A 2Q0SA 4V03A 1HLFA 4NEHB 1NOIA 2ZI6A 3DS8A 3PL5A 2HIXA 3DVRX 1IOZA 3ZE0B 5F5NA 3T99A 1A98A 2Q5IA 4U8GA 1KJNA 1R6TA 4KSBA 3S6JA 3V1MA 3OVMA 1B04A 3GUUA 5HKBA 5TVKA 2G4VA 3HA3A 1R1DA 2ZJBA 3U62A 4MUMA 2ALZA 1EM8A 1UBJS 2V54A 3ZCSA 5LB4A 3I4MG 1KZHA 1ZC4A 4BHTA 1RRKA 3USZA 3N2IA 4WMLA 2IEDA 3RGXA 5ICGA 3ZBUA 2Y1FA 2PZKA 1JPNA 1M6NA 5I9TA 4HNAA 4G5YA 4ZCMA 4UHBA 1C9JA 3ESCA 3AIOA 2OV4A 1O75A 4YYZA 4WVFA 4G5FA 4QOEA 5MGNA 1PX2A 3NS7A 3O4IA 3HOVG 1R10A 5JAQA 3GPDG 3O3CA 3MT7A 2DQYA 1DLIA 3OE5A 3SJ7A 3DP7A 3W3AD 3UT5B 2PKRA 4GSYA 4M89A 2BGTA 3M4NA 1SD2A 1HA3A 3SC6A 2CVZA 2RAUA 2JIBA 1UK6A 1M1YB 1QS0B 4CM9D 3G6XA 2BLLA 3F73A 2VRWA 3CVUA 1M0SA 3PGVA 1QP4A 4JYZA 3WA7A 3K6KA 4EA9A 2PA0A 3F74A 3N8HA 2QSYA 2J6CA 4KQWA 4LZPA 2B21A 3EZLA 2VHZA 1M74A 3NHZA 1LD3A 4E5DA 4M37A 3BD7A 2QX6A 3P9QA 2EZ8A 3BRWD 2C95A 3GB8B 1M7BA 1AV6A 4NU0A 3IR5A 4XSVA 1QPBA 3AIIA 4TYMA 1I4WA 2X86A 2DZDA 1A9PA 1DUVG 4NZZA 5KG5A 5H83A 1SBQA 4GPD1 3KKEA 5KX5F 3GOQA 4H7FA 5C4GB 5FUBA 4DLVA 2WY2D 1F0KA 2ODPA 4EA7A 4BJ6A 3MTIA 2X76A 3PHJA 2X9QA 4FR2A 4JUAA 3DOUA 1NNI1 3E27A 4XVCA 2NPOA 1ZNZA 1QWSA 1FDRA 2F3QA 1I4EB 4O3NA 1ZRNA 1V4YA 1PR2A 5GY7A 5J3JA 4QU8A 3E9EA 3D54D 3AYHB 5EHXA 4EY8A 2JGFA 3SGIA 1GTJ1 2HIHA 3QHAA 3EULA 3A05A 1UBLS 2HU2A 1DAFA 1T13A 3NPMA 4L9SA 1GDTA 4JHLA 5EZYF 2FRDA 3HMKA 3T95A 3L46A 1H2RS 1AXEA 1NXTA 3F6YA 3GCWA 2PO5A 1YL7A 4IDPA 4FYMA 3WO1A 5BWTA 1OZHA 1N5OX 2RE8A 1CRZA 1XVAA 3ETGA 2XB4A 4ERXA 3DOHA 3DEJA 3KJQA 4BBSG 1AKMA 5HDQA 5G0SA 3GLRA 3DMYA 5THKA 3V4VB 3AZPA 5IJXA 1YB4A 1F9AA 4J2OA 2WJ4A 5FV7A 4IDCA 1M1YA 3ICOA 4MI1A 1KJZA 2WTBA 1L5SA 4QKQA 3ESRA 1JMVA 3S44A 3T8YA 1SUCA 1WHSB 3OEED 4NEQA 4ZIRB 4HJRA 1XYYA 4ZAGA 5A5FA 4R2KA 5E3IA 3KFLA 3SOPA 1XKXA 3QYFA 2PEZA 2XUHA 3OMXA 4ZGBA 2FJUA 2XTAA 1PLJA 1FDIA 3RJZA 4CCYB 3FTQA 4GWKA 3OT5A 2WP8J 5BSGA 3KPJA 1ZKDA 1FP7A 2XMSA 1L6RA 1YRAA 4JLDA 2CFRA 4OGKA 5J2TF 3H2KA 4BQNA 3GN2A 3RABA 2YOHA 2NPIA 3U80A 2OXTA 5IZ4A 1G4AE 3ILHA 1V1RB 3EOZA 2C4HA 1OYWA 4D9IA 4Q0YA 4RJJA 3A2KA 5B6JA 4W1RA 1V96A 3CR7A 2GK7A 3EY4A 2RD2A 2QDXA 4GG1A 2AZDA 2F6RA 4ZMBA 3FWKA 3A9RA 4GZMA 2AR7A 4AZVA 4HYTA 1XZKA 1VG0B 3O0TA 2P77A 2O7SA 1X2BA 3I30X 1XZDA 2Q9AA 2Y0SA 5ANRB 4C2UA 4ECQA 1WRVA 3KYCB 1P17A 3HA7A 5EP4A 3JQ9A 4F5YA 4MW0A 1ZM2A 2VA8A 4KRYA 1L4GA 4OLJA 4JOQA 1ZONA 2CZCA 4FSXA 1KPIA 1PL8A 3PXAA 5KMGA 3N7UA 2EWMA 2WE6A 4YCLA 1XKLA 2IUYA 3ISTA 1T3TA 3L4BC 1PVVA 2C4MA 5LZ9A 1JAYA 1PJSA 4UPVA 3DYIA 3MTEA 3C1TA 4LY0A 1MKYA 4M38A 5KYYA 3R5HA 1A7UA 1H3NA 1IBMB 4DV0B 1IWOA 4M3NA 3QKUA 1RFLA 3UPDA 1VBGA 3AF3A 4G41A 2Z09A 3MCAA 2YDXA 3FGZA 3ZC3A 1LFAA 5T57A 2QR5A 4CFYA 3N6VA 3I09A 5KTTA 3KUXA 3DONA 4GQIA 1BAPA 3AT1A 4HMPA 4A03A 1OAKA 3GDGA 4WAUA 1QO7A 3O4RA 4EJSC 4X7MA 3WOHA 4KIGA 4RDCA 5LIRA 5KFYA 4C3VA 1HT0A 1M5UA 1U8FO 1HL3A 2ZI7A 4I66A 1F60A 2WHYA 3AF1A 1RR6A 2I65A 4A27A 5KJ6A 3OFSA 3WHPA 1WHSA 4EATA 4ZIRA 3KWMA 1NQ5A 4F4XA 3OSNA 3KHSA 2EJ0A 4NU8X 3W7VA 1RWVA 4L4XA 4XYGA 1S5PA 3QEKA 5HX7A 3LG2A 5AJZA 2NVUB 3CIOA 3L0IB 3NBKA 2V9CA 3N44B 3C39A 2IOHA 1OH5A 4CCYA 1RRMA 1ZHOA 1DLJA 4CM1A 2ODQA 4GX2A 4IVPA 1TCBA 3P2KA 2QIPA 4IYRA 3VSBA 1S2DA 2DTXA 4FNGA 4ZV7A 1JJ7A 3LM8A 1W4LA 2HXGA 2Q4BA 3RG8A 1G21A 3OQOA 4ZU6X 3PVXA 2YWDA 2NQ8A 1NXQA 3BDAA 4ZVUA 3SNKA 4JP5A 1Y1QA 1WXDA 5TQVA 3L8MA 4BB6A 1V8ZA 1B14A 3LUFA 2ZJ0A 4BP8A 3F2VA 1QR2A 4KGZA 2J6UA 1U0TA 5KUTA 1BOFA 2EV9A 2FW8A 4BKMA 3SLRA 3HR8A 1JLRA 4ZO6A 1LS1A 4I3GA 2EP7A 3WADA 1JIHA 3MCTA 3C3BA 4ZTZB 1YULA 3PVSA 4UHEA 3KYCA 5A4KA 3UZUA 2Y2VA 4DJDC 2GD6A 1GVHA 2HIAA 3WMRA 4NZMA 4QG3A 3ITNA 4A0HA 4GF5A 4V39A 3HVIA 4N9WA 4TWBA 2YASA 2ZR0A 4JEUA 5D01A 3C3AA 2WWWA 4ECUA 5EMLA 4BLTA 3TQOA 1Q0SA 2A92A 2Y93A 1DAAA 3ZCRA 1EEHA 4ND2A 4J6FA 3RSGA 2IBTA 4DQLA 4DJJA 1ZQ7A 3RROA 2E2IA 6REQB 3H9GA 3GTJA 3B9PA 3Q8KA 3BIOA 3GGDA 4PPFA 3DT9A 1B6SA 5IMSA 3ELYA 2KJQA 4YP9A 4M9QA 4L73A 5JS7A 3OBBA 1KPGA 3AY6A 3TS1A 2O2IA 4KNWA 3E8MA 4O4IF 4FHGA 3N59A 4QFBA 2IV2X 1LLDA 1XQ6A 3FOEC 1YZVA 1V2HE 5FOVA 1PW7A 4CM3A 3O92A 5IBRA 4MV9A 4C2BA 3FPAA 4G8DA 3AONB 1ZIDA 1Y80A 3AXSA 4JZKA 3KT3A 3T7DA 5DTQA 3VNSA 2R1ZA 5AM4A 5KT7A 3W77A 3EGIA 2VDUE 3K31A 4DCSA 1C81A 3ND5A 4QO7A 1EDDA 4E07A 4TVIA 2YINC 1Z4IA 2HRZA 5AI5A 3SS8A 3CW2A 5KFIA 3ZJYA 2RK4A 1E62A 3ORSA 3IQHX 4KOAA 2WYOA 2FZKA 4IFTA 2P2ZA 2IS4A 2DCUA 3MWEB 4PC2A 3AW8A 1IATA 3DM9B 1TMKA 3U0BA 4BCCA 2JLQA 4MW7A 1L9XA 5M3BA 2PWYA 4OA8A 1ELOA 1QHYA 3IOMA 1NA5A 3BZBA 1VRWA 4ENTA 3S81A 3KJZA 2F8SA 1EP2B 4ZICA 3MD0A 3DDZX 2FOLA 1SB8A 3NAZA 2JAQA 2TECE 2JA6G 1W29A 4E2ZA 3G2OA 2KWIA 4B81A 4E13A 5AI6A 3V6LA 3BFVA 4QLAA 4KNVA 4WNAB 4WIAA 2XRMA 4LVNA 3UB2A 2NUBA 3NJ8A 3U3DA 2VG8A 3E7DA 4JC8A 4G23A 2IPOA 3N74A 3F96A 1FPMA 1IHOA 3JTEA 2AXEA 3KKLA 3PR1A 1Y5NA 3ZD7A 2QM8A 5AUPB 3NBZC 3ZS9A 3LUKA 3WB2A 1A5BB 2DQKA 2ODAA 2DQSA 2P0EA 3NAGA 1OWMA 3ZX5A 3T5PA 2Z5VA 5CBKA 4U5QA 5MGBA 3HP7A 1H2ZA 4Y9TA 1B4DA 3UGQA 2YYAA 1XMQH 3SI8A 5D1PA 1LEHA 3W79A 1QQAA 4KFTA 1Y6QA 1E3JA 3M9MB 2E4UA 4X20B 3P45A 4CLOB 1N0WA 2I3ZA 4WBSA 3RIYA 4TM5A 3TD2A 2CSXA 3JQBA 2PLAA 3TCXB 3MTJA 3CZMA 3NGLA 4I4TB 2CBXA 1ZK0A 1OBGA 4FKMA 4JQSA 1RCFA 2JEYA 4IHKA 1JHOA 3FLMA 3B3AA 4Y6PA 1ZZEA 4B4UA 4O8CA 4EB3A 4JUDX 1EVKA 2ASLA 4DHEA 1N1MA 1E3LA 2QW8A 4I5DA 5TC4A 4DEXA 4HEHA 4GZ6A 1LS6A 4U7GA 4RJLA 2EJ3A 1OBFO 3PQ8A 5KQRA 2NGRA 4U7WA 2DHRA 1PEAA 4YCMA 1RWPA 4KRGA 2GPYA 1HZZA 4J7UA 1N32B 1W25A 2A2ZA 3UK0A 3LLVA 3LBFA 3BMNB 3IT3A 3G0BA 2BQ3A 1E0KA 3D31A 3ELWA 5A6SB 4EPVA 2PA3A 3B6JA 2PKQP 3B9BA 4AJOA 2DQ4A 4X0EA 3SZOA 4C29A 3WR5A 2PV7A 5K0SA 4EB6B 3CA8A 3LKVA 1JG7A 1GGJA 1ID8A 3MWEA 2XCIA 1GU7A 1CKMA 4O83A 4ECZA 1YR8A 3U7GA 2WFZA 1D07A 1EG7A 3WO0A 4WFIA 4BIIA 4ARCA 3IE2A 3DE4X 1T5TA 1ORVA 1AS3A 3ZCXA 2HB6A 1PGQA 3QNWA 2V74B 3Q7SA 5C5EA 3T5DA 1BC5A 3S27A 2R5NA 1BWPA 4YCJA 1GA6A 1RABA 3SSOA 4TV8B 5H80A 4WNAA 5TXGA 3S1LA 2QXYA 3SMVA 3FF1A 4RTRA 1UMBB 4DCPA 2OCDA 5K20A 4I81A 4G1MB 2WAYA 2P5UA 5B1EA 1A4XA 4JT9A 1R12A 2VNIA 4I6GA 2QD2A 2RHLA 2XPCA 3DT8A 3GL9A 5A3QA 1Q12A 1CD5A 5TSDA 3VSAA 1D8AA 4E4YA 5DG8A 2P8SA 5FLMG 3EFBA 3T1VA 3LF1A 3QGMA 2BM0A 2DTEA 5E4JA 1C3EA 2WIFA 3I2IA 4QDJA 1XZ8A 1QJCA 1V4BA 1EE2A 3BRQA 4KEAA 4X20A 4E94A 3EFEA 3CVWA 4CLOA 2AQ4A 3KPVA 4QQRA 3LAWA 1H9CA 2A30A 3H5AA 3BJZA 2BC9A 1PFWA 3G3EA 1F9EA 2DYKA 2XNDD 2A9VA 4RZXA 3CUYA 3BQ0A 3AGQA 1XRPA 4CIYA 2YL2A 1T4BA 1XPJA 5DULA 4RKRA 1TO1E 2DFLA 3ZDFA 1E6WA 5DYTA 2B36A 1KMHA 2RHTA 3O8OB 1TM5E 3CRZA 5EKUA 1MX1A 2BGJA 4IDGA 4DCTA 3OZXA 7REQB 3ADKA 5FXMA 2ZK7A 3WYFA 4EITA 3R9KA 4DN6A 3DNMA 3CKYA 5A9RA 3BMNA 1K9SA 3SZMA 1GCOA 3C48A 3NOQA 5AP9A 5A6SA 1Z25A 2PTHA 4NCAA 1KK1A 5CFPA 1IK6A 1WL8A 1L4EA 3IMKA 4OBWA 4FLMA 4XEUA 3ZGOA 4X90A 2QRNA 2Y1GA 4BFXA 1NW9B 1YU6A 4P8RA 2JLXA 3OLWA 2VJNA 4WADA 4KQMA 4EB6A 1Z63A 3RS9A 1I2LA 1QC5B 4NULA 1YZUA 1TA0A 4V2UA 1QCYA 2WRZA 1NQXA 4UEWA 5THXA 1ISHA 4C0KA 1CY0A 1G7SA 3BL8A 5KFCA 1WDMA 1CRQA 3N07A 3FSGA 2CV0A 1JMYA 4C21A 5L3VA 5JCOA 3MAAC 4LSWA 4KR7A 4U2DA 3PXXA 2YVQA 4TV8A 5TF0A 1SEPA 1PK9A 3N0VA 1J33A 3C74A 1UMBA 3UTDA 4U0KA 2GM9A 4FMPA 1OLOA 3OZRA 2DE0X 1OWPA 3TNJA 2IEGA 2Q28A 3OAAA 2XDYA 4DA6A 3OTWA 4E03A 2EATA 1ONNA 2WZDA 3AUFA 4OPMA 4Y2QA 1I2AA 1V9LA 2CBGA 1GY8A 2QBYA 4QARA 2D1YA 2BFOA 1ZD4A 1M2NA 2Q0HA 5K0FA 3GV0A 1EJ0A 5A0FA 4NY1A 5ALFA 2R65A 3F3MA 4NABA 1G3RA 5DH9A 1E2QA 4Z5XA 4IIJF 4I9UA 2HIGA 2ZATA 3W2TA 3IA2A 3MCZA 1N92A 2DHDA 5JH7A 3KEOA 3MFYA 1ILEA 3WL6A 3RWOA 1PG2A 3B6ZA 2GBPA 2ZRDA 2C7PA 3O8OA 1O95D 3ZV4A 5B30A 2QEQA 4NEGA 1JP7A 5T7BA 4UHJA 2E4WA 1Z6AA 2C2BA 5ER9A 4DM7A 5EWLA 3IURA 4Q7MB 4CJXA 1FY2A 1P18A 3MSXA 3ZEIA 4UCTA 3NV9A 3HVJA 2YNMC 4LX8A 4GL2A 4F46A 1V41E 2OC4A 4IRXA 4BO1A 4TMFA 1TCVA 3RB4A 3EFHA 2B9EA 2VSOA 1FP1D 3E82A 4ENWA 3T38A 5ALPA 1EDOA 1PBTA 1ENOA 1GTSA 4B33A 1TDJA 2WUGA 4YA6A 3KSBC 1VYUA 3DMPA 1QC5A 2XVAA 2ALJA 4X85A 2D7CA 2M1ZA 4HDMB 3PC8C 4G1CA 4J07A 3FCXA 2MSLA 5CIYA 2YIMA 2OTCA 2C92A 4X44A 1SC3A 2NUTB 4HWSA 4JBHA 4E2FA 4EHBA 1V71A 4CLXA 3DF7A 3DZKA 1LSSA 4BY7G 1OPRA 4OFZA 3RB8A 2BAGA 3L4EA 3C5EA 3VZPA 1GZ7A 1L5ZA 3RHSA 4QUJA 1WOYA 1NW6A 1D1PA 2WBLC 3SOZA 3NANA 1GPNA 4I1PA 1NI4B 5IZCC 2JLZA 4JC0A 4UU7A 3KZOA 4Q4CA 4MVJH 1CZKA 1SJ9A 1BX0A 5DASA 1Z5NA 1UXKA 3CXUA 4E51A 2QMEA 5DBEX 5CURA 4M99A 4TKUA 2A6PA 4FT4A 2IHUA 2R7KA 3V42A 2A0WA 5KIAA 3H2ZA 2YHBA 5MN4A 1WCYA 4JX9A 1XAJA 3WAGA 4IVQA 3DXXA 4WGFA 5DM1A 3LP6A 4Q9HA 1EWQA 4WN9B 3LVFO 8OHMA 5E2AA 1ZAUA 2COUA 4XJXA 4PTLA 3H2SA 5L7TA 1G17A 2V5VA 3A6FA 4NU6A 5KNCA 4I2NA 2J0VA 3GILA 5ECYA 4ED6A 1R4ZA 1Q0QA 3C7DB 3TMYA 2FMIA 5AUOB 3Q9LA 4TWRA 2H4JA 4JK3A 4WKCA 5ENDA 4HAYA 2XHEA 3F46A 2I29A 2RC5A 4OXXA 1DX6A 4GU5A 4E6NA 3VR5D 5ITVA 1XLTA 1I10A 2HMWA 3T35A 4M98A 1HEUA 2C2YA 3AZQA 3QU7A 3MQFA 3BGDA 5T4EA 4I4NA 1DX4A 1LF0A 1VTKA 4ND8B 1RQ7A 5EMNA 2JARA 4UTOA 4ZVSA 1YTLA 3QE0A 3G5AA 4M2LA 4UU1A 2GRJA 1KA9H 3GXOA 2KQUA 2VJBA 1V8PA 3S8MA 1L8LA 4MMXB 4UCQA 4OV6B 2ZJ2A 1G8HA 3NT2A 1GZHB 1QAOA 3RVKA 4FE7A 3MCVA 1P1IA 4E11A 1NXOA 4ADSG 2YMLA 2C9DA 2GZ2A 2VJCA 2XGSA 1UJCA 4BMYA 3OC0A 5FUQA 2PGIA 2AKEA 2DCMA 1Z39A 3L6CA 1PDVA 3KXYT 4IMPA 4HDMA 1L3IA 3G8YA 1TFRA 5CR9A 4ZVLA 1DWPA 1N5MA 4O3QA 3O5AA 3KNZA 621PA 5IJWA 2NUTA 2MSKA 1C8LA 3WYAA 4K9DA 3QI2A 2D13A 3OX3A 1PVOA 4U6QA 5EHQA 3HOYG 3NKLA 1E5LA 2X8BA 2GLXA 2V5AA 1UKCA 5EJ2A 3THSA 4CU5A 1LDGA 1ZIYA 3HP1A 3W1WA 3TEJA 2ZI3A 3NDBB 4YRMA 1NI4A 2FFAA 5I5VA 1QTQA 1QGZA 1DKLA 5KFHA 2EHDA 3T5KA 4AICA 1GEEA 3U1TA 2R6HA 4WD3A 1UBTS 5EJ4A 2XGPA 2JCBA 1JEJA 3AM4A 5F4ZA 1VI6A 2BFWA 3GY0A 5GPBA 3ZWXA 3ZV5A 3KVRA 2VDQB 1B76A 5CYPA 1N6KA 4FE2A 3AOGA 3WGOA 3RCBA 2TYSB 1YMQA 1RZ3A 1KI9A 4FFMA 1HYEA 1LZKA 3EY9A 1QV6A 1HYQA 2J4DA 3HJUA 4BV9A 5H70A 1E1QD 1GL6A 4NMXB 1RP7A 5K0JA 4WN9A 1Q19A 3S8EA 4ETSA 3CX3A 4B43A 4FXOA 4X8OA 3A3YA 3IUJA 1DRUA 2WHQA 4LRTB 1NLZA 1QIFA 5DBOA 1P3Y1 5DOVA 2X8JB 2FZVA 2I9KA 4YT8A 2ZT8A 3QFRA 3NLLA 4UMVA 1K83A 5GOZA 2PT5A 1I0LA 4I5GA 3PNQA 5ARBA 3LC0A 1ZNXA 5GZ1A 4MA5A 3RJMA 3COWA 4KN9S 2GWRA 4NHEA 3ESQA 5B5SA 1TAEA 3CO5A 4ND8A 1RYNA 1U9ZA 4RL6A 3X1MA 4PYMA 1EVJA 4EW3A 1RI2A 1XVLA 4NTZA 2ZUVA 1GZDA 3NUQA 1GN8A 1B6GA 1CBUA 4R4JA 4TTRA 2FVXA 5P21A 4BB5A 1OFHA 3JWJA 1DIAA 5E9JA 2YN4A 3QVUA 3BXEA 3BQ9A 2O4CA 2A35A 2P2NA 2GZHA 4CIXA 3TF5A 1JZSA 2W93A 4GOMD 3THYB 3U3KA 3R09A 3TECE 1ZAKA 2QN9A 1XDGA 4P84A 1II8B 2Q2TA 2F4NA 5EN4A 2DLCX 2B7LA 1UEIA 4C30A 1SZJG 4MVJF 2IITA 2P2YA 1IJFA 4AQYH 5DG7A 1G9SA 1YS1X 4ZJPA 4LOKA 4YP6A 5LQMA 1I94B 3EN0A 3EXEB 3S2GA 2ZAOA 2OXEA 4MW9A 4II7A 3EEQA 2QN3A 4ZK2A 1N78A 4ILKA 3NRCA 5MN6A 2QENA 5BYKA 4EARA 2C29D 1MD9A 3HO6A 4IIYA 4AKEA 2W70A 3PC6A 2QVBA 3HEAA 1UPFA 1TWHA 3L8HA 1FUYB 4BNDA 1XF1A 3EDCA 5BYAA 2YUIA 1WCIB 4DR3H 4RMGA 1PL6A 1LBSA 4R8LA 4DWOA 4XFJA 2LVBA 3K9BA 2FX5A 1XLVA 3JZ6A 3AR6A 2V1UA 3AFMA 3WI7A 2NQTA 1R0CA 3RFXA 3T3PB 2CF5A 4OGGA 1U2SA 4OJTA 1HBJA 2X8JA 3NHAA 1RKUA 4RFVA 1QG4A 4LJLA 2H5EA 2XGQA 1Z4JA 3M6FA 3ZV6A 3UY4A 3R3HA 5GGYA 3PF8A 3SX2A 3BJMA 2D0IA 5DYNA 1GG5A 1VSQA 3LY7A 4HLUA 5H8WA 3F67A 4KXNA 3OHPA 2QLNA 5FPRA 3OJ0A 2QQGA 4ZGGA 4PZYA 4EI7A 2W9CB 3DD1A 2DR0A 4FFBB 1JG3A 1GILA 3A1WA 2HRCA 4N48A 2CNDA 3MYRA 4YT2A 2JA5A 4ED2A 2R7ZG 4HFNA 3M5DA 3RDPA 1NW7A 4MUFA 2C77A 4CGYA 3Q3CA 2Q3EA 2HMUA 4G36A 1E2GA 4R5HA 3DOOA 4J3JA 2X7HA 1HLPA 4BZWA 4AKGA 1XZEA 4GC9A 2GAAA 2H3HA 2V3VA 2LP4Y 2NXEA 4Z4HA 3EMDA 1NYQA 1FYEA 3CGWA 3O8DA 1FUKA 4EF6A 4B3MH 5AI0A 2YFKA 5KJCA 1JSXA 3KUCA 1P61B 4FILA 4X95A 3THYA 3GVXA 1RPNA 5DGAA 2QTZA 3LK6A 3IVMA 4PCAA 2W42A 4BX2A 4OM8A 2G83A 4LHWA 1JHVA 1II8A 2EKBA 4RVOA 5DHTA 3RAXA 3FB1A 3GRCA 2WIAA 3Q4GA 1NBAA 4F2HA 3B48A 3GUHA 1EVZA 1RAHA 3FPCA 3EXEA 3CPEA 3QXHA 5FTKA 5I5WA 4KYVA 4QG7A 4K9QA 1YNOA 2CQYA 2JI6A 2XOXA 1P7WA 3LXUX 4TYPA 5DXAA 1BD4A 4EJ2A 4RVGA 4XOUA 3FKIA 3WB1A 2QRVA 4U9HS 2BUAA 3PQ6A 1KH2A 4Q21A 2HPHA 4ZDIA 2Z08A 3G2HA 3NALA 3RNLA 4TTSA 2NAFA 4LJSA 4QQ8A 1AIPA 1YDWA 1E9RA 3OSZA 1JPVA 1YB6A 3H42B 4Q3DA 3L2OB 1A2BA 2XODA 5FD6A 1QBKC 2JK1A 3PFBA 3TI7A 1WXWA 5A7FA 3DDHA 4P7FA 5GONB 1IJKA 4CG0A 5A7GA 2AI1A 4QPJC 3E7XA 2B1GA 5C8YF 4FS2A 3GDFA 4NK5A 3OPNA 3PZRA 4D7AA 2AK3A 3PITA 4B3DA 1GNSA 2YZNA 4QUKA 2PJRA 2GJAA 3DEFA 4WLNA 3HJGA 1A9OA 1JLHA 3UTCA 4EG3A 1LBIA 2QTBA 1UCFA 2B4QA 2OG1A 1W94A 3DKPA 1CYEA 3NIDB 2LIVA 4WESA 3EG5A 4BJ5A 1WXHA 2W2KA 2HYDA 1DQRA 1I5RA 1SVNA 4CLRB 1XXHB 3U4QB 3TXYA 5HUHA 3L05A 2ZDQA 1GFZA 2XQGA 4FFBA 1XKQA 1E2EA 2WTUA 2C3PA 4OM7A 3MMSA 1YQQA 4TLMB 1U5BB 2BI4A 1RZRD 4JNCA 4P5PA 3MWJA 2J85A 2VSFA 3E3MA 3F6RA 2W6JA 2BUBA 3WIEA 2ZVPX 3MJDA 4Z0HO 2FE3A 2QM3A 1NVVR 2YHIB 2WF6A 4IZIA 1RQPA 4CHTA 1ZICA 5KVVA 3I3SR 2HRBA 3QX7A 4H6WA 3TNYA 1B42A 1WCMA 2NG1A 5BVHB 4FZ3A 2JFBA 2EOAA 4TMXA 5ESXA 1U1EA 2CUZA 4BC1A 3LFUA 4LXYA 3RWBA 2W2TA 4JA0A 3LWNA 3I0MA 2CLKB 2F90A 3NM6B 1SELA 1VCOA 3IESA 3LYHA 5DNEA 2QTFA 5KFLA 2I80A 5AUQA 5BW8A 1NNSA 2OBYA 4YMSA 3ZZTA 3EISA 4Z9YA 2GPAA 1JDBB 4FE3A 4ZZ1A 1HNXH 4U02A 4YAEA 4TLLB 1PFYA 3OTIA 4PO3X 3QOYA 3UF0A 4UEQA 2C2DA 4AKHA 3DQZA 5DISC 3SIWA 3RUEA 4W5QA 4BWVA 3ZJTA 2NX2A 4F84A 5KFAA 1NF3A 4HGOA 5BNIA 1X7GA 1LTQA 2WLTA 2XEXA 3WGQA 5DGBA 3FZYA 3WGVA 5ADWA 1XQWA 3TQFA 2D5IA 5BWXA 3CLKA 5GONA 3KAQA 5E9AA 2CFTA 5LMUH 1CQXA 2XE8A 4IO1A 3RBVA 3FYHA 1IG0A 5B1IA 4BNVA 1N2EA 3UAGA 1XYVA 4FB5A 5DE3A 2W2MA 4QQFA 4JB3A 2OCAA 4OFWA 1LFDB 5L6LB 3TOZA 4BYGA 1RI1A 1K3FA 4R1QA 2VEOA 5K2MA 1Z15A 2DPJA 2D2EA 5AOBA 4CLRA 4M87A 5KOHB 2ZYSA 4L95C 1Y48E 2PT9A 4Q9JA 1IHPA 2G72A 2YMQA 5IF9A 2CLCX 2XKKA 4ZDKA 1PL7A 1U5BA 1P77A 3TN7A 2IPAB 1U63A 4MVYA 3C3KA 1LA2A 4JI4B 1TAQA 1XMOH 2IS1A 5CM9C 4W5JA 2F9MA 3KG2A 3VAAA 2O2XA 1S2NA 1CZUA 3KWFA 1ZOOA 3HPQA 1XQYA 2YHIA 1HETA 5KYUB 1D6SA 3QZUA 2IF0A 1P9LA 4C2TA 2JI9A 3BIJA 5JAPA 4M1ZA 4WINA 2FDCA 5BVHA 1VIAA 1FX0B 5ECGC 4GXQA 4B3TB 5IXYA 2HEGA 3DTYA 4LK2A 4K26A 3BF8A 2YFQA 3S2UA 3R3UA 1YZKA 5BNTA 2P2LA 3G6KA 3HXOA 4TMZA 1ET0A 4PR3A 4DUYB 1M0EA 1SURA 1YI8A 4C7KA 1DKQA 4U9IS 4B3IA 1JQ5A 3DL2A 3FHJA 1A8IA 4CL3A 3QFHA 5H3CA 1DBSA 3LZCA 2G04A 5KNBH 2OBLA 3L93A 4OHMA 2GF2A 1YAJA 1GKYA 1BU8A 1PYOA 3AKDA 1SU8A 1Z22A 4B35A 4GOLD 1T2VA 4BBAA 1FF9A 3GGSA 1QZUA 2XUGA 3GP5A 4X8LA 1NVFA 3IXQA 2D0PB 4MAFA 2QG9A 1SK8A 1VMIA 5DNAA 5JUWA 1BE8A 2IHNA 4KE7A 1RC1A 3RO7A 4FEGA 3WZLA 3U3XA 4RF4A 4KYTA 1JEEA 2IYXA 3K3VA 4ZI7B 1FTGA 3NAQA 4XWAA 5JCJD 4XE5A 1E6CA 3HZOA 3VBCA 4L8GA 3NC1C 4N3GA 4RNMA 1NY5A 2WG1A 2P1DA 3NR2A 4JH0A 2DUJA 5DAAA 4BFYA 1RJFA 4LGCA 4C2MA 1H2BA 4B6OA 4QW9A 1YZGA 4BVGA 3ZH2A 3PIRA 4ZZ0A 1MNAA 2X8AA 1TYEB 1GO3E 4LHEA 3HKDB 1WD5A 5F33A 5K0NA 5JNLA 5KOHA 1YE8A 1ZC3A 1FBTA 1U8YA 4M83A 5CX4A 2YJGA 1QIMA 3O93A 3WGTA 3CLHA 2JD0A 4LF5H 3IPRA 1DXHA 4I1RA 4IUDS 1U8UA 1XVTA 5E95A 3CUWA 1RVDA 2CLOB 2Q21A 3BIFA 5B7NA 3SMQA 2HVQA 4HDNB 4Z3OA 2IZ6A 2H08A 3OMLA 3WK8A 4D9MA 3FWZA 4KQHA 4D96A 3UT5A 3T54A 3AQ4A 4HR7A 5KYUA 1T8WA 1RLUA 3U1BA 2J3KA 4XIGS 4B0PA 1N0IA 3PU6A 2KLBA 1F8XA 4IS2A 1QS0A 4LJ5A 1FX0A 4DA0A 3HOUG 4IGEA 4X54A 4B3CA 1QWOA 5HIKA 2LR0A 1GRVA 3RTBA 5A2QA 3FBGA 4MIEA 3NATA 4XQ0A 2CNWA 1VE3A 5DKFA 4MDEA 1XN4A 4IGKA 3SDBA 2JCXA 1QORA 2VYVA 2V45A 2QNIA 3HKEB 1TVCA 2J9ZB 1DKNA 3KUDA 3ZHRA 4OK3A 5CDFE 1BTOA 4RTMA 5KG1A 2I55A 4B32A 2I33A 3RR2A 1X7ZB 4AY2A 3PP8A 5FBHA 2PH3A 4N4AA 3A6HA 4E2WA 3F5QA 1WETA 3LPNA 1JA1A 4RXUA 3EYWA 3AXTA 4WN3A 3DLIA 2YQ4A 2HJVA 4RKYA 4ETNA 4B7XA 1A9XB 4BU1A 4K9LA 2DT5A 4Y1FA 5FPQA 5BWWA 1U0GA 1P5FA 2GCGA 1ULAA 1A2QA 3WLPA 1W49A 2VRBA 3K5HA 4KN6A 3VR4D 2Q4OA 3OFNA 4ZI7A 5CT4A 1O54A 3FI0A 4WOCA 4LRUA 2WG0A 4C05A 4YO7A 3AR2A 4Q7KA 2NTEA 5M7EA 3EGXB 1YH3A 3ZNPA 4ZMRA 4D9BA 2ZR9A 1J20A 1BZYA 3HKDA 5KTPA 5AW7A 1DOZA 2XUJA 3K35A 3C6QA 1U7DA 3IILA 1A7KA 2BPOA 2EJTA 1DJQA 1IUOA 5F2NA 5HG0A 4GOOD 2JBAB 1XJWA 2E82A 4TKVB 1ECFA 3WWOA 1NUPA 1R64A 1DDIA 1WZEA 2HBYA 3TLBA 4FLFA 1LF5A 3PWSA 4HDNA 2HF8A 4BNNA 4YK7A 3M2TA 1PX0A 4BP1A 1XQXA 3AR5A 5DWVA 4WGGA 3PE3A 3I8OA 5DB4A 4BMCA 1BQ4A 2OLSA 3GRFA 2P2DA 2FR1A 1P19A 1QIHA 1RHMA 4K0KH 3Q6NA 4QYSA 3E2PA 1LV7A 3PQ3A 3SHQA 1FDVA 1UAYA 4E5PA 3GBVA 3H8VA 5DFAA 1PWZA 1T15A 3ORYA 2PIAA 1GHTA 13PKA 2ZJAA 4QVIA 2Q5OA 3R9RA 5HFJA 4DARA 2CLHB 3CNNA 3QLUC 3E3AA 5HZMA 2R8PA 1MA3A 2GHRA 1P4HA 4G0ZA 1J7JA 2IVFA 1HV8A 4QRHA 4DDTA 1SCKA 3OQPA 2L2QA 2DT8A 2WNSA 3HKEA 2IU4A 4UMEA 5GV7A 4GKVA 3V4SA 1UOOA 1G3IA 5BWLA 3TW4A 5CA1F 3I9MA 3EQ6A 5C34B 1MJ5A 3NETA 1X7ZA 2BHTA 3PNPA 4OBEA 3TJRA 2VC2B 3IPXA 1QMGA 3WV4A 1NPYA 4QPPA 2B83A 1Z2OX 1V1RA 4HB2A 1QNLA 3PXCX 3VOAA 2FXVA 4IDFA 2X6TA 4M54A 4YRTA 3LOQA 4A3FG 1RWQA 1AH2A 1AQJA 2C3OA 2R87A 2CYCA 1UM8A 3AG6A 4PRYA 2AGOA 3K8OE 1P0CA 1RFGE 1ZDMA 4KREA 1TM3E 4BNXA 3H17A 2OGWA 2XUFA 5DHPA 2Z04A 2GYWA 3UQYS 3EGXA 4N7MA 4AJ9A 5LCXA 1IAVA 3SZRA 4BFSA 4M21A 4QYXA 1FA9A 4UBNA 4MA0A 4CL0A 2HC9A 3HBFA 3GGCA 5FA8A 1G7CA 1ONBA 5HJ2A 3L0YA 3OM9A 3G2IA 1QGDA 5JXJA 3V9AA 2ZANA 1DJOA 4PQGA 2OSBA 4F91B 4MI3A 3MA0A 3IBFA 1LY1A 4DBLE 1BVHA 1TJ4A 3FPGA 2JBAA 2Q9UA 4TKVA 1TLLA 3W5HA 2Z2IA 1E89A 3AR9A 2FKAA 5EESA 1S4MA 3SY8A 1J2JA 4YMVA 5JANA 3RC7A 3N7TA 1U65A 4KKVA 1VXOA 4CMAA 1QVWA 4B7CA 1F17A 3SE0A 2R1VB 4M9ZA 3G9UA 4FYJA 4MLDA 1JLLB 2FQYA 4TTVA 1Z0SA 1B00A 1RBYA 4PAOA 4W6ZA 4F2GA 1SXJE 2AZTA 5JTUA 1NP3A 3T5TA 3NFYA 5GV8A 2UUCB 3FVTA 3AEYA 2N3ZA 4CG1A 3PG5A 4B71A 1TM7E 4LRSB 3GXBA 3GLHE 3I5YA 2B2NA 5EIEA 4AWAA 1UBSB 6CHYA 2BMEA 5K01A 3QQMA 1Y3DE 1PV2A 2FMHA 1IRXA 3U0VA 2NVUA 3ITKA 2N1MA 3ZW7A 1FVFA 1Z35A 1AZSC 1EFVB 4LF8H 3MR6A 2Q62A 4QW8A 5LXTF 3IV7A 2AZ4A 4D4IA 1IVNA 1ULZA 1Y1VG 4XPIB 4UE3S 4WBNF 2ZXUA 2R3SA 4OAOA 1HDIA 1NLFA 1FFXB 3HSSA 3ZX4A 1PSZA 2GGSA 4MTLA 4B6JA 1RPAA 4URYR 4NCHA 1C3LA 3H5VA 2Z6QA 4ARIA 4FJ2A 3LXRA 4BRSA 4U6PA 4MWZA 1V95A 3DWIA 5JADA 3UOGA 4HTAA 2PD3A 1JDUA 3E9RA 3WIUA 1M8KA 3R1IA 4N54A 1V7QA 3G1UA 1KP3A 4EYEA 5KBYA 4HWTA 3IMCA 2X1HA 4G0NA 2UVDA 4PQFA 3BN3A 3A3NA 4AG6A 4B7UA 3KT6A 3AY0A 1JQ3A 3GV5B 1NYTA 4RA6B 3I9LA 4BATA 1E9SA 4MDYA 4S1NA 3PUKA 3IAEA 2VPZA 2QMHA 1DJPA 1JZTA 4INOA 5JLJA 3L43A 2NU7B 1QK4A 5SZKB 1EP9A 1PGNA 2R8KA 1A97A 4IJUA 5KB3A 4F4FA 4X1YB 1YRLA 4URZR 2V7QA 3O2NA 5IM4A 2HT6A 2D6FA 1FDTA 3KSUA 3S55A 2HTEA 4M8LA 1DIKA 3Q8MA 1CQWA 1U2ZA 4R16A 2OAP1 1NRXA 6REQA 3ZZ1A 3I34X 2H1IA 2ZUBA 2Q5HA 3S2IA 2YWHA 4RXTA 3IV9A 3X2FA 3FIJA 4Q9NA 4M9UA 1JDTA 5FA5A 2JJMA 3NWBA 3DMRA 4C4RA 4CC5A 4C4SA 1P1RA 3MTAA 3M6UA 3NUGA 4C08A 4FX2A 3GFSA 1G0NA 5ITWA 3TEKA 2R1VA 2BJWA 1F14A 3F7OA 5BXYA 1JLLA 5JFGA 4UVIA 1O77A 4KXVA 1YJXA 2ZITA 3EEFA 4MEBA 1ZNYA 2B4TO 4D4JA 1QFMA 2X0RA 2IYSA 2ZRQA 3CG4A 5MHTA 1PUIA 3BWEA 3ER8A 1CQPA 4AYTA 3CLTD 5BT8A 2F2TA 3W8EA 3H9JA 1S9DA 3RH0A 4RZRA 1IL0A 3GB9A 5IPFA 1M3SA 2HBQA 1EFVA 2QG6A 2QL5A 1Z7GA 4WKGA 3CFYA 4NDNE 2X41A 2NW6A 2YXEA 4Z6KA 4L50A 1QHFA 3LUHA 3G0HA 3B89A 4P9NA 3LBAA 1FMLA 5HFAA 8GPBA 1RPTA 3KKKA 2VSNA 4CHIA 3H5IA 3QLTA 1X7YB 5F73A 4NR0A 4BMVA 4D9CA 4I6JA 5F1OA 3OWHA 3EWAA 1LDYA 3DV2A 1KZ7B 4C4XA 3MWFA 4RSHA 3R3ZA 2PHZA 2WAQA 1A48A 5FI5A 5LDDC 1YR3A 4PLTA 3RKUA 4OXKA 1CNFA 4WZBB 4OCZA 3JYQA 1NI5A 2MSWA 2RHMA 4IDEA 4KGVA 2Q1SA 2O48X 4MAMA 3E2MA 1LSOA 3AI7A 3COSA 4RLFA 1GQQA 5D86A 2FN9A 4EELA 1SWWA 3SHFA 1FDSA 2FR8A 2Z1DA 4R1OA 2V9WA 1T2AA 3IVCA 4G4JA 2YIDA 2JLRA 2UU9B 4NJMB 3D1VA 1JDSA 4N8EA 5B64A 2EJWA 1TWAA 1EXVA 3DO5A 4RA6A 5EQFA 4Q5IA 2BZSA 3OTQA 4PAWA 2AE2A 4L0QA 1XN1A 2BHRA 2JGLA 2VHXA 3OLYA 4BCBA 2PZ8A 1RKQA 3QYPA 1QU3A 3ENVA 1H2EA 4KLAA 4OUKX 4C22A 2ERXA 1D6NA 3X1DA 1KU6A 4UTPA 2JBWA 4AQ7A 4KR0A 3R0ZA 3L7AA 2A58A 4I4TA 2UZAA 2I7XA 2H2FA 4BVBA 4DIEA 5DT9A 4DUGA 1N2HA 1R0LA 4OHBA 3G8CA 3OLQA 3NBYB 2KSWA 3QVVA 3TCKA 2NNLD 2PSDA 1TMYA 2P9GA 3DKRA 1SCUB 3SQNA 1K8XB 4O3PA 2VTBB 5ILOA 3F47A 2BEWB 3O8NA 4KK3A 1OWTA 1E5QA 1JAZA 4QWBA 2CFSA 4K81B 2QVGA 2XRYA 3ZWWA 1TZBA 1YFKA 3FOFC 5FL7D 4DLBA 1IHUA 3DP9A 5HHTA 3OHAA 1RAIA 4RE5A 5J58A 4B6RA 4F4ZA 3K9QO 4DV2B 4QXRA 2JIOA 2P4EA 3S28A 5CB8A 3A31A 3B53X 3BC1A 3DCIA 3WJ7A 2A7QA 5JJCA 3LMLA 2PKYX 3OE1A 3VHRA 4NPCA 5EY5B 3GEGA 2ZR8A 3QPWA 5A05A 5HGXA 1RRFA 2KX7A 3UMGA 4LOAA 4GXRA 2VSQA 2DERA 1PGPA 1EX9A 4RY0A 2A3NA 1QVAA 1WO8A 1K86A 2G88A 2IEZA 3H1AA 5B4UA 1X1SA 1A8UA 2CDRA 3N8IA 4YLYA 2VPWA 4NZ9A 3P20A 1R8XA 3KHRA 4PZZA 5BQXA 5B7GA 4FWBA 2OVBA 4FWTA 3NHUA 3A9CA 3KJGA 4OATA 4Y67A 1I33A 1U7PA 3C5VA 1SC4A 4Q4DA 2XMZA 2DLDA 5FO1A 2H2IA 4CDGA 1EFAA 1VA4A 2APJA 2ZT7A 1USKA 3BHMA 2J67A 2XCAA 3ETEA 2B37A 4H6PA 2ZTLA 3G8BA 5FB3A 1IY9A 4MWTA 4Z1MD 4NJMA 3EZ7A 2GBLA 3I42A 4QJ3A 3K6JA 2H9AA 4BZQA 5K45A 3HPRA 3VTFA 2DFVA 1I2ZA 5CX1B 1N7GA 5KCMA 1BXRB 4UKDA 3MUFA 2F4VB 4PLFA 5A5DA 3DV0B 2UKDA 4KSCA 1Y1KE 3CR8A 3GGOA 5CLIA 2QLMA 4DIMA 3K94A 2IHKA 3FROA 4LSXA 1KO1A 5KFFA 1GKIA 2OD7A 1S68A 1I0ZA 2YVKA 3D0KA 4NNOA 5CLLA 5FD5A 2IV7A 5A3VA 3AIMA 1KZ1A 4Q1FA 1ESEA 1GPAA 2H9YA 5BSVA 1RTKA 4INJA 3NEYA 1R37A 1C4XA 4PSAA 1A9YA 1XTTA 1DL5A 4KHPH 3CZ9A 5JH7F 5DNYB 3HKZA 1ZMXA 3KM0A 5EMJA 1YQWA 4DNOA 5DM2A 1UAGA 4ZOLB 5SYNA 4KDCA 2I99A 4RLHA 4JGGA 5KYTA 2KB0A 1SCUA 4Q9IA 4GKKB 3K70B 1VLMA 2VTBA 4O29A 3K4QA 2EF0A 2BEWA 7REQA 4CLHA 3VX4A 1MPXA 5TARA 3G1TA 4DREA 1DXYA 1OFTA 3IT0A 1HSOA 4KO1S 2C9OA 1N5KA 3P8ZA 4DNPA 2D1FA 4O2BB 2F3RA 4U7FA 2UUBB 3KYBA 2P4UA 5HFNA 2FEAA 1FS6A 3R6TA 2QTAA 1XV5A 2QGZA 3ENWA 1NRJB 4UC0A 1ZOIA 2FQXA 1GADO 3RVLA 1UEXC 3TL3A 3L4JA 1K6EA 4YP0A 2XAUA 1GUBA 2ZU0C 1VS0A 1FBNA 4ZO8A 2BEJA 3RIMA 2C07A 3KYIB 2HGSA 4NKRA 4W9RA 1P2SA 5KYKA 3R41A 1PJ8A 3PQEA 5CU7A 3CTPA 2ZWVA 4B3BA 1ZISA 5GIPE 1ENYA 2C2OA 1ORWA 1TNDA 1U5CA 2ZB4A 4CIVA 3NYWA 5BQ3A 2WK1A 1X6VA 3LLCA 3CBGA 1JB1A 1JKMA 2OQVA 1M6EX 4LF4H 3GUCA 1WAMA 2WYVA 3V55A 5EWGA 2C7BA 1CIJA 1E2MA 2EX4A 2F1HA 1RAEA 3VSEA 2ROQA 4PS0A 1I9CA 4L4RA 3U37A 5B3JC 5HKKA 1QVRA 4A3KG 4MTDA 3OD1A 5BV8A 5CX1A 4MVJG 3IQFA 4BZPA 3VVLA 4HWKA 2ZULA 1PK7A 3DV0A 4L02A 5LYJF 3EODA 4Y2UA 2CXTA 2EJVA 2J0SA 3BAFA 4MA4A 3DYBA 2VF5X 1HC7A 2F1JA 1BG6A 4U00A 4O7YA 3YASA 4A3BG 4MS4B 1X19A 2FUCA 4C7XA 2QLJA 3ONWA 1CEQA 3V7NA 4X65H 1E4VA 4W6QA 4RL4A 4EF5A 4MHOA 3CNOA 4GT1A 4WNIA 2CD7A 2R1TB 3EGVA 1ZHSA 1G4HA 1SUEA 1B26A 4FNOA 1DUSA 1NPDA 3BKXA 5IF3A 5A4FS 3Q3HA 1O8BA 2AGVA 3NP9A 1NVEA 1E1LA 5FNVF 2V3WA 4F3YA 3PEVA 1PTJA 2OLEA 4TSFD 4BZZA 1HZJA 4FP9A 2ATVA 5FPYA 2OVFA 3MSCA 1BDBA 4P7KA 4F4WA 2WB2A 3GWZA 3U19A 3GMIA 3W6PA 2IYFA 4V0ME 4BFUA 3LWBA 3VU1A 5L3QB 1CKNB 1F2TB 4O2BA 3H4MA 1IQRA 3NV7A 2Z4RA 2DPGA 3W1VA 4Y6OA 2YV5A 1VLHA 3C43A 3VR6A 5KFUA 3G0CA 4BY9E 2BCJQ 1IWBB 1RMQA 1FU8A 2MMCA 3PHCA 3LC2O 5HPYB 4FE4A 3UBTA 1GUDA 3OQVA 4E1VA 1X9HA 2XMQA 1BKDR 3GLFB 4ZFNA 1NOJA 3C5CA 1OUMA 1WMFA 3LKDA 1NJGA 4C4PA 5HV6A 1ZNWA 2BZ0A 1XPRA 3GV7B 4A2QA 3LY8A 2FRDC 4C7OB 5DLPA 1JLMA 1TA4A 2WJ6A 5A9SB 1M1XB 1Z29A 3R5TA 3T7EA 1Q50A 4JJGA 1JDNA 2VJDA 3VVMA 4BXOB 5DMHA 3KZNA 4ED7A 3UHJA 3WWZA 1DEHA 1N56A 3UUFA 3C6ZA 5LQUA 2TMKA 1NDQA 4FU0A 2C83A 4F60A 1NW4A 3TTTA 3PBKA 2P30A 3MPOA 5TMBA 3GQBB 4RACA 2QXUA 1PS8A 4G9EA 5AM1A 5HS4A 3IOBA 1XI2A 3BSFA 3SSAA 1Z4KA 3KCQA 2RGCA 3TH5A 1RK6A 2WI8A 4TKLA 3ND7A 1HDYA 4Q66C 4PG5A 1RNLA 2W5UA 1SOVA 2XUDA 3A4TA 3H5WA 3H0CA 4MJ7A 4Y3UA 3L7JA 4IJ6A 4YMWA 2IYLD 4M22A 1B74A 4LY6A 2AF3C 2MR5A 3CKMA 4AG5A 1NPTO 1Q1BA 3EF0A 1BWSA 5DHQA 4DV6B 4PLYA 3REGA 1F8FA 4XYLB 2R1TA 1WABA 4LBWA 4N3CA 2DUMA 3BXPA 2RF4A 3Q8RB 4GM0A 4EEYA 1RCUA 2XYVA 3IR7A 2R00A 3V1NA 1ZVKA 5CB4B 3F9IA 3OZIA 4RV5A 2Q45A 1PJZA 1EB9A 1RWWA 4KP7A 1CULC 1EWTA 2QUKA 1AQYA 1UZLA 2CC2A 3G5UA 3EXAA 4YDSA 4Y1RB 4K8RB 3CSUA 1RC0A 3ZWMA 3R9WA 1OY1A 1MU0A 1YRBA 3M1AA 5CCXA 4QBTA 4N5NA 1J90A 4YP1A 5FPOA 1OV6A 3CIFA 1MOSA 3PQ5A 4PG6A 4BMXA 2W4MA 3OEHA 1KR5A 5L3QA 2HVRA 5F7JA 1F2TA 2Q9CA 5L51A 3GFGA 4BLQA 4RZQA 5AW4A 5JYEA 1NBME 4NXMB 2X19A 4O33A 3OIGA 2UUAB 4N18A 2IGBA 3HNRA 3ANSA 3JQ9C 4C88A 5DI3B 3GLFA 4OL9A 3ZDXB 1TE2A 3C5HA 3TKLA 4B2IA 2VH1A 2NO7A 3T4XA 3O4HA 4OQNA 2OEPA 2PLRA 2JLBA 2MYPA 5KG2A 5C46F 1A27A 4R9VA 3NM5A 3J80W 1T5HX 4C7OA 3FDIA 2Z2XA 4DPMA 2ZKLA 1TC1A 4QXPA 5L3SB 1AK2A 5A9SA 1ESZA 2XGMA 4RPIA 2BW0A 2HFJA 4DPKA 3IJRA 3HCRA 4BXOA 1U8EA 4MUNA 1DCFA 1QX4A 5DVZA 3DXYA 1WCXA 1JNYA 1RLTA 4XWOA 1WUTA 3GQCA 2F8TA 4LC0A 1KZ4A 3PHGA 4X64H 2CEAA 3G2LA 1L1FA 3ONNA 4UULA 1C7RA 4FFRA 4PANA 5J5CA 4GR9A 5CB6A 5FULA 2VXYA 4A6DA 2E2HA 3GFPA 5CTAA 5BYBA 4IRDA 2AOUB 2XMCA 3RVMA 3GQBA 4K3VA 2OBBA 4URUR 4JJIA 3I5AA 3ZW9A 4B83A 2P90A 2Z95A 1CHNA 2BMDA 1HR0B 2YZGA 3WLLA 3F8SA 1SKAA 1OAAA 4G25A 3QE3A 3G2KA 4FCTA 2HLDD 5DSTA 3ICCA 3R3SA 5TPWB 4QXQA 3QNMA 3FMGA 1XZMA 3FDFA 4X6UA 2GZRA 1KFJB 5AJWA 5UKDA 4OOEA 1XLWA 2D1SA 3ZJ4A 3KWJA 4Z0PA 2IHBA 1M66A 3D3NA 1VGQA 3GFTA 4XYLA 1Z4OA 3M3HA 3VMMA 4X66B 1S8FA 4Y2XA 2RHCA 4UNRA 3LL7A 4I3HA 5BRJA 4F45A 5CG1A 1TK2A 5A9TA 1DOAA 3DTVB 3PQDA 5BWCA 1UZAA 4Y1RA 1NZFA 1V39A 3JYLA 5C4XG 1DBRA 1U0EA 1NNUA 2IK8A 1EFLA 3PFNA 4MKFA 1MXFA 5AW8A 1KXJA 5C1DA 5IAEA 3FB4A 1DG1G 1ZM7A 2G8LA 1FCJA 5KFJA 4DV4H 4BQQA 3HXTA 2BVNA 2D1TA 2R5FA 4MUEA 3PRHA 2HADA 1VYHA 2Z2JA 5EJ9A 1Q17A 4QVKA 3W5VA 3W8NA 2YY6A 2FWBA 5EOYA 1DMRA 4JQOA 5E1OA 2X5JO 4PC3A 1KMIY 4BFVA 5IM5A 3H2BA 2PMEA 4BGEA 3T1HH 4ED8A 3IODA 2VLIA 3L7OA 1YUBA 2V4RA 4XLLA 5LB2A 1E8NA 2GTIA 1QVVA 4LSMA 3I1FA 3BOSA 5HKOA 2G1KA 5TT0A 3T9DA 3HCAA 4F8EA 2C35B 1R6UA 2W4IA 1WXEA 1G5HA 4EG5A 4RTKA 1UDWA 5L3SA 2R4QA 3H3XA 1U4OA 1Q6YA 5L3ZA 4Z9BA 2QYZA 2E18A 2SBTA 3GIQA 1SBNE 4FCWA 5FAXA 4ND4A 1AA6A 3BAZA 4JASB 1GT91 2QORA 1Y6ZA 2VT2A 3UC9A 5JS1A 4TXLA 5ECDA 1B8UA 3GBPA 3IKTA 1GWNA 4P0TA 3U0GA 3RQSA 5JJBA 1FSZA 3EC2A 4V3BA 3OE7D 3N87A 3DEKA 2AOUA 2YWCA 4MB2A 3RK4A 3SNHA 4OB8A 5ALXA 3M4YA 3EWIA 1WCIA 2IYRA 1B23P 1JLSA 2EYUA 3FSEA 2Z6AA 2R8BA 5I60A 3PXBA 3E8SA 5DM60 4D43A 3CB2A 4B3FX 3HJFA 5T3UA 5TPWA 1DJLA 2JB9A 1NBIA 3TIXB 3PR5B 3V1UA 2EDAA 2QUZA 3R7BA 4NS1A 4F38A 1YA8A 4ZPJA 2X0NA 3IT2A 1K4YA 2H2DA 1Z13A 1GPDG 3AO0B 3TO5A 3A9TA 3VX3A 2H18A 1BHO1 5C7IO 2B8EA 2C97A 2WJPA 3RIHA 3TSZA 1XA4A 1TZ2A 2IH2A 2W9CA 4PYNA 2FEKA 5E2IA 2ZJ3A 1TTQB 1EAMA 2OCXA 5IT4A 5BYJA 3DTVA 3DFIA 2I2FA 2CJWB 1CJMA 4P0PB 2D59A 5FFFA 1OZGA 5B12A 1UOQA 3VJLA 1IZYA 4CQLB 1PZXA 4IYJA 2RGVA 1HRDA 1QFSA 4LH7A 1IPEA 1MW8X 2VBGA 3HLKA 3D4IA 3C7AA 4B3SH 1Q11A 1I2MA 3I2JA 1I3CA 3DA8A 2D7DA 3WRXA 3I28A 4AN1A 1M9NA 1UBEA 4FFLA 1L7PA 2OPBA 1OFGA 3CKLA 3F1LA 2FP4B 4PPNA 5COQA 4HB0A 1Q1ZA 2QJWA 2A1TS 2GZDA 2VQEB 3BFKA 3WS7A 1B3BA 3OI7A 3HBLA 3DV9A 3AF4A 1XF9A 1AHIA 4U9UA 2QMQA 2OCKA 4N5LA 1GL9B 2BMVA 3DSRA 2E3JA 5CK4A 3HKCB 2JRLA 4ZT7A 2JJ8A 4AUNA 2IYPA 4F1WA 3S1AB 3TM5A 3AIKA 4FCVA 3E1SA 3FWYA 3OMWA 4WFQA 1I7SB 1XTIA 4OHXA 4WZZA 3MAGA 1TWGA 2BR4A 2Q3JA 4FZRA 1J7KA 2ANBA 1EDZA 1UF9A 4R8VA 4COKA 3CH7A 1B8OA 3BTVA 4C1NA 3CLSC 5FTWA 4K9RA 5AVZA 4DRXB 4BVKA 3JQBC 4CXMA 4HRXA 3ASVA