3VPDA

Lysx from thermus thermophilus complexed with amp-pnp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
281
Chain Sequence
b'MLAILYDRIRPDERMLFERAEALGLPYKKVYVPALPMVLGERPEALEGVTVALERCVSQSRGLAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIGSWGRLLAKVTDRAAAEALLEHKEVLGGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRRSAHWITNTARGGQAENCPLTEEIARLSVGAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILRYAWEVARG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein S6 modification protein
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 86
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 6.3.2.43: [Amino group carrier protein]--L-2-aminoadipate ligase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3vpdA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpdA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpdA01
5IYZF 4YAKB 2W6OA 2V5AA 4IZOA 2R84A 4EGQA 3HO8A 2FPIB 1EHIA 3VA7A 1A9XA 4L1KA 4TV9F 2R7KA 5GONF 3UFXB 3ETHA 3RUPA 1GLVA 1KJJA 3TINA 2R6FA 1PX2A 1UC8A 2W6ZA 4I4TF 1E4EA 2J9GA 3SE7A 2DLNA 2ZDQA 4O2BF 1KJ8A 5HBRB 4M99A 2FB9A 4IHJF 3VMMA 3Q2OA 3VPBA 2W6NA 3VOTA 3TIGA 2GPWA 4EGJA 2ZDGA 3K5HA 2W6PA 4O4LF 2R87A 4E4TA 2XCLA 2YRXA 1EYZA 2YZGA 5JQWA 1EZ1A 2W6QA 2GPSA 4XYLB 4C5AA 3GLKA 4MV3A 2SCUB 3WNZA 1JKJB 2YZMA 5BMVF 4HQ6A 4MV6A 4DLKA 5LP6F 1IOVA 4QSHA 4ZQIA 3G8DA 3TQTA 1E4EB 2Z04A 2ZDHA 1DIKA 2YW2A 3BSSA 4C5CA 5I47A 4XX0B 5C1OA 1T36A 4FU0A 5C1PA 4Y8VB 4HR7A 2CZGA 1AUVA 3WO0A 2FPPB 3MJFA 5CA0F 1B6SA 3MWEA 5LA6F 2W71A 1CE8A 4XYMB 4RZQA 2NU8B 2VHEA 5CA1F 4EAAA 3OUZA 2R86A 5JVLA 3AW8A 5JVDF 1BXRA 4TUYF 4DIMA 1SCUB 4J6EA 2PBZA 1KBLA 1C3OA 3E5NA 1CQIB 4MV1A 5LOVF 4WD3A 1CS0A 5BPHA 1KJQA 2YL2A 4M9UA 4YAJB 4O4HF 2FPGB 4C5BA 3RV4A 4ZOLF 4O2AF 4HNUA 3WO1A 3MWDA 4TV8F 3I12A 2R82A 2DZDA 5H80A 5BPFA 1DV1A 5CB4F 2VQDA 3QFFA 5JH7F 1JDBB 1GSHA 3VPCA 2W6MA 2YYAA 4WBNF 1AUXA 2R85A 3G8CA 5KX5F 5K2MA 2CQYA 4I55F 2YRWA 2NUAB 3TW6A 5J2TF 1B6RA 2PVPA 4XZ3B 2NU9B 2GLTA 2QF7A 1VBHA 2R7NA 1VKZA 1VBGA 3R5FA 2QK4A 4MA0A 4MV8A 4YB8B 2W70A 2NU7B 5LYJF 1EUDB 3RFCA 1KJIA 2I87A 2NU6B 4MV9A 2PN1A 4M98A 3ETJA 3HB9A 1KEEA 2VPQA 1UC9A 1ULZA 3N8DA 3VPDA 3JRXA 2DWCA 3TIIA 3N6RA 2DIKA 3ORRA 1EUCB 2OLSA 1I7LA 4MV4A 3BFPA 2YZNA 4YJ2F 3LP8A 3ORQA 2V58A 3HBLA 1W93A 1JDEA 1PK8A 4I50F 3V4ZA 2V59A 4YBZB 4EA9A 3U9TA 3Q1KA 5J2UF 4IWYA 4HNVA 3OUUA 2X0SA 2IP4A 4MA5A 5EZYF 2I8CA 1GSOA 2VR1A 4O4IF 3R23A 3BSYA 5DMXA 1KC7A 4ME6A 1KJ9A 5C8YF 1M6VA 3BSWA 3RV3A 3R5XA 4HNTA 3K3PA 1W96A 1WR2A 1JLLB 4EG0A 2R7LA 3JRWA 5CAEB 3U9SA 2YS6A 1C30A 2FP4B 1GGOA 4ZI7F 1GSAA 3JZFA 4EABA 2R7MA 4IWXA 4M9CA 3JZIA 4YJ3F 3R5HA 5LXTF 2HJWA 2XD4A 5D8DA 1IOWA 3GIDA 3K5IA 3LWBA 2YS7A 4MAMA 2C00A 2I80A 2NPOA 1DV2A 2P0AA 5KKNB 1BNCA 4GGMX 3BG5A 3AX6A 4EA7A 4EA8A 4ZHQF 5HV6A 1CQJB 1I7NA 3V4SA 4MV7A
chains in the Genus database with same CATH superfamily
4CGZA 1EE9A 5ECWA 4P4NA 2AUMA 1KSGA 4LJRA 3HDQA 5H5JA 4DIOA 4GGOA 4TV9F 3IP6A 4PNZA 1JKJA 3RB8A 3I64A 3HU1A 4O5AA 3U48A 5TE9A 3JAWB 1KEUA 4HRVA 1A7UA 2R8IA 3LOQA 1A04A 1KQPA 1A3CA 4MEBA 4W7HA 4F4FA 4Y9UA 4MJ3A 1KRWA 2V55B 3EXAA 4BJ1A 3ZBUA 4BLUA 4CMAA 4FFSA 5F52A 2GX6A 3BQ9A 1MJHA 1OROA 1YCHA 4WK4B 1EYZA 3LUPA 2NU8A 4S0ZA 4C88A 4MVCA 2AWOA 5ECGC 3WLEA 1ECGA 3R0VA 3W9YA 2X1VA 2YTZA 1AY0A 1SR8A 4R2MA 2Q4TA 1PK9A 1FPMA 4I4LA 3DGEC 1K86A 1V6AA 4P54A 4F5DA 3BTVA 4HH4A 5C5JA 3RVPA 1WUIS 3DMGA 1ZMOA 5JD4A 3BC1A 2R5FA 3ZWYA 5C7OO 2O8DB 4RMIA 2DABA 1SA0B 2J5KA 3L8MA 4BZZA 2ZUSA 3OAAD 2BONA 4F6LA 5I7WA 3O2JA 1ZRSA 2QSYA 2WFLB 2MJLA 1RXEA 3H05A 3KL4A 4ZU6X 4CLOA 2CXSA 4HVLA 3D6HA 1UR5A 3C5EA 4RVSA 2BHSA 3KTFA 4J6EA 1TEZA 1P2SA 1N33H 1K83A 3ECSA 4H7DA 1U63A 5IJZA 3EUAA 2XYPA 4RXMA 5LL6b 4X64H 1QZZA 4YQZA 3TW7A 3VR0A 4FKZA 1U2QA 4GWKA 4RFLA 2QVXX 3HRHA 4W6ZA 4ZT7A 2D1QA 3B3AA 5FPRA 5HUJA 3TTVA 5L95A 4GNRA 2Z6AA 1O3YA 4KFSA 4UEJA 2FUNB 1VCOA 5C4IA 1HE5A 1GPBA 4K6OA 2Q9AA 3JYOA 3QXXA 4EYIB 4UNNA 5BOVA 4CETA 4L2IA 5M34A 3V7UA 4YR7A 5B1IA 3TEFA 4WACA 3I42A 2XDWA 1H2ZA 1Y7IA 4CM8B 2B94A 2GZ3A 1BW9A 4HATA 1P80A 1BJKA 3CXUA 3A9UA 3NHYA 5G1NA 4YB8B 4KZPA 3A9WA 4JAVC 1Z5PA 2IYSA 1F51E 1HQKA 2H1IA 4BRUA 3P9IA 2CDAA 4KAAA 1QRDA 3LZ6A 3U7IA 5KVSA 3CNEA 3BWXA 2PYZA 5AOCA 3JWPA 4UTXA 3E9MA 5KNCD 4LVNA 4JI1H 3BFPA 3M6UA 3I5UA 3B9QA 4R2WA 1G20E 1EXMA 3D6MA 3BGVA 2G72A 4FCVA 4QOHA 2BFOA 2VL7A 5M5BA 2PS3A 4YCDA 5KFNA 1GQFA 1QQ6A 3EW9A 1QCZA 3PNBA 1SAYA 1KMNA 3KUXA 4BLWA 3U40A 3S2ZA 4ENVA 4TXMA 3DEKA 3FLMA 3JQAA 4B4DA 1U28C 3RSQA 1CE8B 1TW2A 3UJ7A 2XOKA 3EUWA 4ENTA 3KBOA 2JI7A 2R3SA 5EYPA 4OMDA 2CFRA 3SC3A 2I2BA 1U8EA 1I4WA 4Y2QA 1N7IA 3CB4A 5LLSA 1M1NA 4HZGA 4MIEA 3RU9A 2QBYA 16PKA 4XB1A 5KDDA 1T2FA 4F3CA 1DRJA 1VLJA 2PGAA 3JR7A 3C6KA 4JUCA 5KO2A 1PJ4A 1QV6A 4KOEC 1F2VA 5KTSA 1KH1A 1TA9A 4ZICA 2N0SA 4AG3A 3FGNA 3QVGA 1THMA 1XTSA 4I1OA 4ONEA 1IM8A 3FDZB 1FP2A 2HCTA 4E2WA 3EA4A 3NC4A 1VKHA 2AJBA 2LIVA 1I7NA 4IO1A 3R9XB 4DLZA 2B5VA 1J97A 5K03A 1U9YA 3AFGA 1XD9A 4DV4B 3X43A 1VHWA 3MJSA 4KBGA 1VLZA 3KP1A 1UNNC 3JQ8A 3ZDDA 1SKMA 4X54A 1GZ4A 2EFEB 5DPMA 4ZAGA 3AG6A 2Z2XA 4DLXA 5AVVA 1PBNA 2XMDA 2NSYA 2PXCA 1EVIA 1XEXA 4YNBA 3LHKA 4O2BF 5AKHA 3QOYA 2WYOA 4J1QA 4PY2A 4IHJF 3W8NA 1AVTA 3L77A 4ECVA 4HD8A 1ZXBA 1YWGO 1HZZA 3DG9A 4QIHA 4TS9A 3Q7SA 4BDTA 3DKKA 5ALRA 5A6SB 1P4SA 3S2GA 1J9EA 1MN6A 1YIAA 3RSLA 2HBQA 1IOVA 2OYSA 4WDQA 4MGIR 3EIUA 3G9XA 4CHTA 2GF9A 4Q37A 1M5RA 2PMZE 5D1PA 1L9XA 4FHZA 1RHUA 2QE7A 1I3QA 2FEMA 2PGXA 1TU0A 3ANNA 3EGDA 2VP5A 3DVQX 5FJJA 4UATA 4ZALA 2XCUA 2ZTLA 3NETA 1I5OA 1ANKA 5EIEA 3JTEA 4XYGA 4KKXB 3ER9A 2PJRA 2BLLA 3BH0A 4X6UA 1M5UA 4E0BA 3DWGA 3ISTA 3A1NA 5E0OA 4FS8A 3BAZA 1Y5NA 2EP7A 1KYWA 4F2WA 2ODAA 5LOVF 4O25A 2JA5G 2Z95A 3CSWA 1W9MA 3PUKA 2YL2A 3AM4A 5DSZA 3PNMA 3KHKA 5LD2C 1PNTA 4Q9LA 2YOGA 4CQNA 2X1HA 1F3LA 1Q84A 1I3OA 2DHDA 4O4HA 4FNAA 1M1UA 1P5FA 4U2FA 1JQEA 5KWVA 3NHLA 1K9VF 4HTFB 3ZWMA 4ETSA 5E9QA 2YYAA 3VV2A 3FFWA 1R4MB 2CNNA 3U7RA 4CM6A 3KALA 5AVWA 3TZHA 5DCLA 1Z12A 3BBPA 3HJNA 1J0DA 3QM1A 3OM1A 2D5IA 3NGXA 2XTJA 1G64A 1TQ4A 3X2FA 4A3BG 4PWYA 4B3SB 1GL7A 2Y4RA 3WWCA 1I13A 2A33A 3EXEA 2BHRA 3KUUA 3AF0A 5CURA 4EEQA 3EZLA 1U02A 3E35A 2HHAA 2IX9A 3K71B 2GT1A 1ACJA 2D5LA 3OPYA 1IY0A 4H0CA 1FFXB 3WMEA 1IZ0A 3OJOA 4DMUB 4H9GA 3TGWA 2HNKA 4RDXA 3UMBA 4O83A 4YHHH 2GASA 3CC8A 3RRFA 4MIOA 2PLNA 3LZDA 3MCWA 3FSRA 3WNDA 3PLRA 3KIPA 4B3TH 1WX1A 2ZT7A 2O50A 1HDGO 2VHUA 3OZVA 5A4JA 3JY6A 5IAEA 3SQOA 4B4KA 3VR6H 2J32A 2Q41A 3UBMA 3LYLA 2R93G 1PLLA 4B9AA 2PX3A 4D0SA 2ZI7A 5BWBA 1FA9A 2Y1OA 1YDFA 4KE9A 3HV0A 5FI0B 3MR3A 3KFLA 1AKQA 4LTMA 5C8YF 4KQKA 3NOOA 1LPSA 3FY4A 3BA1A 5KU7A 3S5JA 4C76A 4L4UA 4EPRA 2J85A 3TPFA 3OE4A 5KCZA 5HILA 1YS2X 4G97A 3CRVA 4BUJA 1ZJWA 5IP5A 5AVSA 3ZGVA 2EQAA 4EVIA 1SKBA 4Q45A 5CJ2A 3GRVA 5J2UB 3I01A 2QP9X 2A9OA 2PX6A 4AICA 2RJNA 3VNBA 3DWEX 1OZGA 1M0TA 2NZ8A 2COEA 4DUZH 1SXIA 5KKNB 2WK1A 1OH5A 1PIWA 3AX6A 1NXTA 5JS6A 1XDWA 2D0DA 1WW3A 2IOQA 4J4HA 5D3QA 5G4KB 5A6VA 5FLXW 1HE1C 4ECZA 4OP3A 4LEIA 2R6ZA 2XE4A 1M6YA 3Q7RA 4FT4A 3ZDCA 3EGCA 4G8BA 2Y6UA 3PFKA 3KK0A 2YN0A 5AICA 4FLEA 3RARA 3E8MA 3S2YA 4JJIA 2D2EA 1RJGA 5CLGA 2JD2A 3C0KA 1WMEA 2FVYA 2PYIA 2IHZA 2RG7A 1ZINA 3ETEA 1M83A 4RB2C 1RJFA 3DQQA 4F85A 1N9GA 2EJWA 5AKJA 5BYAA 2L69A 5EMHA 3CR8A 5EN4A 1QK5A 1MG0A 3FUTA 5TF4A 2GBLA 4EJSB 3COSA 5CITA 3IIKA 3FSEA 4ARZB 3QPCA 1WMSA 5EE0A 3QXJA 3KXLA 4REQB 4B7UA 2BGKA 4F9EA 4HQOA 3BCUA 3VDXA 3I45A 2VUSA 3H1BA 3A1TA 3EIQA 3PC8C 1RHQA 4A2BA 1N33B 3OX2A 4O0LA 5I5SA 1Z6YA 2J33A 2VAVA 2I2CA 4MW0A 1M0WA 3H6HA 4X64B 5AUPB 1XGKA 3AYZB 2P7IA 3OCJA 4FGJA 1DTWA 3VVLA 2CNWD 2OK8A 5CEFA 4RSGA 4C07A 2YNMC 1XXHE 5ULLA 4IXWA 4AUMA 3JR3A 4IHAA 5JROA 1LPAB 3GV0A 5ES3A 4PG6A 1TA0A 4H6VA 4PYOA 4A1OA 1P0CA 4HDRB 4IFTA 1RMYA 4OHXA 1I2DA 1Z8FA 4FHDA 4WXHA 3OIWA 4QEKA 5E6UB 4POAA 4UUNA 1MR3F 2IKQA 3EQ6A 1HYGA 3ZK7A 4DQKA 2QUZA 1DDOA 5KREA 4DMKA 2O3QA 5FULA 3IC5A 5JOQA 4HYYA 1H4QA 3PGLA 2JVIA 1AHHA 3RS5A 3GIIA 2IXDA 3W5DA 4O8CA 1EFDN 5DIFA 2XMBA 3L1JA 6LDHA 1WUHS 3DULA 3DEYX 3KRTA 3PL1A 2Q1UA 4EFBA 3WSVA 5FBHA 5THXA 5DI3B 4R7TA 4WBNA 1ULUA 4X60A 2HWWA 1SQ5A 3B7GA 1PJZA 3JYPA 3AI7A 2PZAA 4ESVA 3W2IA 1GZ5A 5LU8A 4J7CA 3GCZA 4Y2GA 3FNHA 1EXNA 2Q7DA 1M73E 3PHBE 1UDCA 4YJFA 2FOXA 3DHNA 1K4KA 2R4QA 5E4JA 4EG4A 2WSSD 1T2UA 2EFJA 3RKUA 2IPOA 2PZJA 5B7QA 3FBGA 1WXWA 2QORA 1GZUA 5DULA 3FPSA 2R1UA 4TMFA 2AN9A 4S2EA 3ZVLA 1QKIA 2ADMA 3HACA 2EQBA 3KKNA 5J40A 1Z3IX 4LISA 5K5EA 4JSYA 5FJIA 1OFVA 3SQNA 2I1QA 3PRHA 1GJRA 4ZOLA 4JEIA 4M49A 4CODB 4BE7B 3DVAB 2ZYSA 4WNCA 3DBOB 1OWOA 3AW9A 1QTQA 3G0HA 4RHEA 1E3TA 2BR4A 4H3KB 4FYMA 2V6BA 2MU1A 4DCCA 5ILQA 1SOMA 5JWRA 4Q82A 4I5DA 3I37X 1Z0DA 3O2SB 3ECAA 2J0UA 3MS7A 5FH9A 2PKQP 2QI9F 5D3MA 3RS3A 1TCVA 1X87A 5L53A 4HUJA 1VL6A 4IJUA 4JLNA 2WZBA 3JAWA 3U5TA 1II0A 3L7JA 4DEYA 3FLEA 2C4TA 1VSQA 2OVBA 1G3UA 5JCJA 2I0FA 2IHJA 4X3CA 2BQUA 2F59A 2H06A 5AKXA 1SQGA 2WTFA 2ZBUA 3BDIA 2A9FA 1ZK4A 1FU4A 3NBZB 1IHPA 4ZI2A 5AW8A 2IXTA 5I60A 1G291 1PD0A 1L7PA 2HKIA 2F7SA 4WESB 1TO6A 5DRTA 1P1CA 3BWVA 5COQA 4B6QA 2CN1A 4MTCA 4QDKA 4DR2H 3TNDA 1YMUA 2XCAA 4YRBA 1XX6A 4OXQA 1SEIA 1Q1GA 4WLFA 4YRMA 2QJWA 1KA9H 2YJ4A 2XJ9A 4IFBA 4O33A 2EKQA 3DZDA 4LOHA 1J1UA 5L3QA 1ZH6A 2O8DA 2OESA 3C6YA 4HWSA 2FW6A 2EBUA 4RULA 1SA0A 1ZVKA 2YCBA 3AC0A 2PRSA 1NN1A 1PSDA 5AXAA 1N2CE 4PO8A 4OB8A 1DEAA 1TLTA 1A9RA 5JO0A 3D4PA 4EJ6A 4QUGA 3THSA 3EMKA 2DFPA 3UGJA 2D13A 1LDYA 4RLHA 5J3JA 1CJUC 3HB0A 2AC4A 5J1SB 2QVLA 3ENWA 2JEOA 4V1CB 2QRVA 1IWPB 1XWFA 4FUTA 4RQUA 1XPOA 3TOVA 3B1KA 3CZ9A 3H5WA 4OJQA 4MHSA 4B6OA 5CA1F 5IZ4A 2ARKA 1S4MA 4RK7A 1SM4A 1NZJA 5KQRA 4FX5A 3SEQA 4JUIA 3UAXA 4W1QA 4RNCA 3FYUA 3RPEA 5DNVA 3VKVA 4Q7KA 5ESRA 1KR2A 3IULA 4X63A 4CM8A 5JFOA 1P6UA 2K4MA 1Y98A 2CFIA 1Q1AA 3Q12A 1P3JA 3WICA 3K0AB 4YB8A 2QMZA 3I5YA 3ICVA 2J07A 3TQFA 1Z5ZA 4O2AA 1IRIA 4R9RA 4UM8B 1T3SA 4IDPA 3BDVA 3K1ZA 1MOQA 1O5OA 3RRXA 5LQMA 1XNGA 3N0TA 4OI2A 1AUXA 1T2AA 4BC0A 4XH9B 2V6IA 3KTAB 3GHHA 4YCAA 5A5VA 4B3CA 2Z4RA 4W1PA 3SSMA 4YHHB 1PT7A 4R51A 1JSCA 4UFOA 3BWEA 3DR3A 3C3JA 4OI0A 1AO0A 4OHCA 2ENWA 1OKKD 3P26A 5DW0A 1Y9JA 5EE5B 1S0NA 4YMUA 2NU7B 1WSBA 4UE2A 2Y4OA 1W2GA 4DWOA 1VOTA 4KMRA 2L17A 5JQGA 1C1DB 3I34X 3HHPA 4R6WA 3PSAA 3S99A 4GQIA 2I65A 5FBZA 2W57A 1W36C 1U0TA 2B8EA 1IMJA 3SS8A 3Q4GA 2D4HA 3HA5A 4RUKA 1BX0A 4G8JA 1CB0A 4U7JA 5A7FA 1KK1A 2XWPA 3RRBA 1P4RA 4KIGA 1EGMB 3VOBA 5LZ2A 4J29A 3K8QA 3OQBA 2ZRDA 3U3XA 2FE4A 1IL0A 4KVZA 2OXRA 1E20A 4HNVA 1P2GA 3ZVMA 1MX1A 1WULS 3NTOA 4EO7A 1S2NA 5DE3A 3P8ZA 2OV1A 4AJ2A 5IYBG 3TXXA 4Q47A 3SPXA 4N9QA 3RWBA 1POWA 1I0IA 1SVOA 3BABA 4PBCA 2WPNA 4I7EA 2Z2YA 4F21A 3GCGA 2ACVA 2P4QA 3KOXA 3DH0A 1NJ8A 4FIZA 2ODTX 3FRJA 4HUQB 5CFOA 3NUAA 2AL7A 2Q49A 3ET4A 4ZK2A 1K8RA 3JQBC 5H9WA 5A7HA 1E3JA 3SKVA 2GCGA 2HSDA 3K53A 4IIDA 3RIYA 4LHEA 3BMOB 3U3OA 3CBQA 1NQOA 4G0XA 2QN2A 1W0KA 5KOJB 1B8VA 2RFLA 5MGBA 2BGMA 2V7GA 1UL1X 3G6XA 3CVXA 1GTL1 2P6MA 5T14A 3L0IB 2ZB7A 2WT9A 5SY9A 1GYRA 3CLTD 1RFLA 5CCBA 5E8RA 1OFIA 2WWXA 3UJDA 4TM5A 4E30A 4YAKB 1UBTS 3SSNA 2ZUUA 2UUBH 1ODTC 2OR3A 2ZYTX 2HQBA 1YJQA 1XDNA 4KPGA 2QM0A 2PUCA 4KQ2A 4R2IA 3CSUA 5DLYA 4EKDA 3KCNA 1K5GA 2G4VA 2MSWA 3JVEA 3QBEA 1J8QA 1CKEA 3SF8A 4DA0A 1O6FA 3RHZA 3FHOA 4J9OA 1BE0A 2WINI 5AUOB 1TTTA 3OT5A 1R0BA 3AHHA 5DG8A 1SVNA 1ZETA 4BNWA 2IA5A 1Y1SA 1KC1A 4IR9A 3GGGA 3EVEA 3P96A 1GZ7A 1V7CA 1PZNA 3UHAA 2VWPA 1UBRS 5F5NA 3N0VA 3M82A 1G2PA 1GGKA 2E5WA 3NGLA 2Y1WA 5EEGA 3M6FA 3PC4A 1GAEO 1MTOA 4CUKA 4CEHA 1OGIA 1IHYA 1D8AA 3MRVA 2FF7A 2XZOA 5FFFA 3HADA 3ZN2A 7MDHA 4DL6A 2BCEA 4IQGA 4UUPA 1XKTA 2ZTUA 3NKLA 2IL1A 1ADFA 2BMEA 3C8MA 2O7RA 3DLAA 1J39A 1F0YA 4Z0TA 4C7BA 2IDZA 4HTFA 1HPLA 5JYCA 1YGYA 1A98A 4F1JA 4IVRA 4QWMA 2UXCH 3I28A 4NPCA 621PA 3ZQKA 4UCWA 4JYCA 3X1MA 4HAYA 4IIYA 1X42A 2PANA 4QGFA 1KP2A 2BUAA 2R62A 2Y0PA 4UPVA 1VP9A 1S10A 3REQB 1DX9A 1T24A 4TQGA 1C0LA 3TH5A 4HMOA 1KBOA 1NNI1 1SXJD 4MI1A 1NPYA 1P9RA 2PT6A 3PVXA 2ZBGA 1QFJA 4EI2A 1FFXA 3A58B 1JDBB 3IAXA 3NGMA 4D9JA 5FPOA 1C8VB 5ITZB 1APBA 1RQGA 1A71A 1ZN8A 4D0NA 1JDUA 1SOWA 4V02A 4XVQA 1Q1QA 3T3PB 2QF7A 4EZIA 4IF4A 4XXHA 3D59A 3MCTA 1HYQA 2X0JA 2P40A 5BT8A 5JXJA 1OLUA 1IH8A 5HIAA 1HOTA 4E1AA 4A0RA 3VZDA 5I45A 5DQGA 1SWVA 5KJEA 4EKGA 1ULZA 3TQIA 1V1MB 3MOSA 4IOKA 1TVMA 3BXFA 3FNEA 5M7EA 5INTA 3W2GA 1C14A 1QF9A 4JH0A 4N3BA 4KXQA 1ENYA 3OPYI 2IHBA 4PR3A 2BFAA 3LP6A 2AKYA 3HOXG 5JD6A 5JE8A 3A1EA 1V8BA 5J2UA 4YAGA 4BY7G 1UKZA 4AJJA 4BBJA 3T6KA 5LMNB 3G9UA 3M9WA 3VKHA 2OORA 1N2HA 4LJKA 2V4UA 3ONEA 2DUJA 2D5CA 1D1QA 4YRJA 3W4IA 2JH9A 1LKZA 2R7LA 3J81A 3ICEA 3PQDA 4WNAB 3B1XA 1YFKA 1QK4A 2BPOA 2QRGA 1XI2A 4C0XA 2YDXA 2CZQA 2HHLA 1JHMA 2HXGA 1UT6A 3HI4A 4Q4AB 1CUVA 1X14A 4ZT3A 2PU7A 4TMVA 1CQWA 1GG9A 1M10A 1P9OA 3AB7A 3DLPX 2B69A 4DR2B 4KXVA 4RIGA 5DK4A 2GYYA 3ZLJA 1PI3A 3C3EA 1R0KA 5L3SB 1TEHA 1SMKA 3OEYA 4DAEA 4CHIA 3OI7A 2P6PA 2PMEA 3SS9X 3VTKA 2EFHB 1YOBA 5E4TA 4L0CA 4NMMA 4QDJA 3L1VA 1PZEA 3GJZA 4DS3A 2Y8EA 3QKTA 1D1TA 5JNLA 2C5LA 3DHWC 1R6VA 3N8HA 3ZUGA 4EJSA 5KNBH 1UEXC 3SYRA 1XYGA 5IUJC 4W7SA 1CY4A 4GLWA 4V0LA 2Z56A 3ZGYA 4TRMA 4RVFA 3K6SA 4YASA 3GFQA 3WA7A 1XV5A 1TQ8A 3F74A 4EMBA 1LLQA 4L3WA 1JSRA 5SZJA 3UAVA 4X90A 2HWKA 1T9KA 2QXTA 3QHAA 4KTVE 1ZNQO 1CHNA 2CV2A 2XUAA 2KX7A 1GQYA 3ZV3A 4PCAA 2C3MA 3WGKA 1ECFA 4IDGA 3R1IA 4IDAA 1W0CA 1W73A 2EZTA 2Q8NA 1DKRA 2ZS8A 3OPNA 1XALA 4ZJZA 2Q4OA 2CJFA 2O2ZA 1W85B 4MQEB 1M6NA 2ZYDA 3E5MA 2GKGA 3CJQA 5AIBA 5KIAA 2Z4TA 4RDCA 2GD1O 1JFSA 3GRYA 3OPQA 2XCQA 1EWVA 3T9DA 2JJ1D 1E9EA 2P9FA 3A14A 4RV5A 3IP1A 4EBCA 3PW4A 4Y8VB 4YH1A 1FRFS 2DFLA 1D2GA 3QEBZ 4E2XA 5HX7A 4ZCPA 1FLVA 3DLHA 5B5SA 4JCCA 3DTVB 1WD7A 4E5PA 1JIKA 4BMYA 1XSEA 3NTQA 3L0ZA 3LLSA 4EFEA 3FYSA 3LPMA 3PN1A 5HQ3B 1QYCA 3ZNQA 4YCNA 2M2IA 3K16A 5DI3A 2DSTA 3L4JA 4ED8A 2DU8A 4WFQA 2H1RA 1F12A 4QNMA 1Z35A 1RVDA 4QJIA 3I9JA 1YA8A 2D5AA 1J5XA 1W87A 2XRFA 1UQTA 1VIMA 4QQNA 1PFVA 1M76A 1MDFA 3HXLA 2ETXA 4P4TA 1P62B 3P94A 4JJKA 3GUVA 2IYWA 1OXXK 4PPQA 1WHSB 5AW3A 5DM4A 1VE9A 3LDGA 2XD9A 5LN1A 2FEWB 1NFQA 1T8UA 1MHTA 3TTWA 3V7WA 1MJGA 1CVLA 1Q0PA 1H5QA 4BQIA 2R96A 1AQNA 5AMXA 1A8UA 3H9BA 2JRLA 3NP9A 3LQ4A 2VJAA 3AEYA 2Y3IA 5HP4A 4LXXA 4E31A 3KBBA 1DAGA 3RGGA 4OYHA 2J31A 5G1OA 4RIIA 2DXIA 1EDBA 3MELA 4LVOA 5HQJA 4CKXA 2QLNA 1CSEE 5KG5A 3UV7A 1E3QA 3DVAA 3VO1A 3VUFA 1Z5NA 1KOLA 3JZAA 4ND4A 4K9OA 2QGFA 1QB7A 1IDN1 4GH5A 4UEQA 2QV7A 3PQCA 2LPMA 2BISA 5COAA 1ZL2A 1QVWA 1CTQA 2C5GA 4BFXA 4CI9A 3TW8B 1W4BA 5I4CA 3CUKA 4AYXA 4DYVA 2WWGA 2XZDA 2HAEA 4CV0A 1CUDA 1XD8A 4IQ4A 4X8OA 1S0UA 4K9MA 1JMVA 3MRSA 1CB7A 3RF6A 1XTIA 1AF7A 1ZGZA 2JDID 4XD2A 4EKEA 4YPOA 1IYZA 1QHFA 1YZGA 3FKIA 4QTXA 4D82A 2BL4A 5JAZA 1AQIA 5C37A 2PM8A 3LUDA 3R3WA 4G3IA 1EXDA 4KLAA 4CJXA 4OAOA 2P8SA 5KTRA 2TRSB 2H1OA 1E2LA 2WTXA 4AF8A 5HUHA 1TWAA 1PEAA 4IIEA 3WRVA 1CT9A 4BCCA 4KMMA 3R3UA 1PDOA 2OXCA 4TSFA 1MX5A 4OD0A 1MGPA 1I2KA 2JLZA 3H0GA 4EHHA 4WESA 4EQ6A 1G6HA 3KS9A 3EVCA 3QA3E 2DLCX 2BMJA 1RBQA 2UUBB 4TXLA 2WU3A 4GSYA 3QVTA 4B1FA 3ZZ1A 3GJ4A 1HE2A 1TO1E 3GLFE 1JA1A 1EDZA 1X0XA 2FI1A 1Q17A 1Y1KE 4BBZA 2Z1DA 1V16A 4OFXA 1NXSA 1SVLA 3HJCA 3TIXB 5K45A 2V3VA 4IKOA 4EG8A 2Q07A 1JJIA 3RIHA 5FLKA 3V1YA 1Z26A 1A7KA 1G0OA 4EGQA 2FW7A 4BB9A 2W8BB 2GH1A 1K08A 5AM3A 1CR2A 4IEIA 3W5IA 3HLTA 4RA6A 4J0GA 3SDZA 3A4VA 2CXPA 1RCUA 4LY0A 1RRKA 3I1FA 3ROFA 3RC8A 2XKBA 5BN3A 2AGVA 4KQ9A 2YUIA 1BQEA 1V5EA 1OWPA 3VPBA 3ZW7A 4UASA 2W6NA 3U7FB 5L3VA 1K5HA 4IEFB 3IV6A 1ZH4A 2ZWIA 2O8BA 1OYOA 4BEWA 2JH8A 3H17A 3AZPA 2A5JA 1EZ1A 1XLTC 4H7HA 2WIKA 1QCYA 2Q4BA 3PR2B 3M4IA 2R47A 5IAAA 1AHNA 2P6RA 3MRXA 5HIMA 1Q7CA 4JI6H 2UXCB 2PRJA 5I47A 1ZK0A 2O3RA 5JHGB 2VJDA 2OGWA 3C5HA 2BJHA 3PT9A 2LCQA 1E2QA 3K0AA 1I01A 4CCYB 1Q2UA 2RGAA 1UK6A 3M1LA 1I94B 3QF4B 2TMKA 3PUJA 4KXUA 2FMAA 1SRQA 4X91A 1Y42X 1GFZA 2IFTA 2A35A 4TLAA 1PX0A 3C8DA 3DXXA 5BRJA 1E8DA 4IAOA 1YR1A 4O7NA 4RZSA 2CV0A 3KQKA 4AZTA 1RQ7A 1NLFA 3ES9A 2J46A 3HJUA 4JN6B 1NBIA 1F6DA 1LDGA 4YAJB 4ZAWA 2RIPA 1EB8A 4YCBA 4ZT6A 2PSHA 2OHOA 3C16C 4F0JA 2HDWA 4GZ3A 3LS2A 3VR6A 1R0YA 1L4UA 4Q4HB 1QWSA 3GTLA 3O6VA 1C1DA 4DM3A 1N5IA 2XGGA 3FMGA 3QHPA 4D3XA 1OGJA 1O6ZA 2JCGA 3V42A 2R85A 3UT5A 2Z30A 4M0LA 5DGHA 3OO1A 5CX4A 3IEKA 4Y1EA 1J99A 4DLRA 1XELA 2FF5A 4BFUA 5IDVA 5BN4A 3EEQA 5ADVA 4FGKA 3WB2A 2FEKA 2V45A 3P4YA 1Q6ZA 4EGCB 3EOAI 5KYWA 1K6MA 1KFKB 3UMCA 3CO0S 3Q9SA 1W35A 3A36A 5TIIA 3CPSA 4F91B 4Y1FA 5IANA 3GYBA 2F3UA 2J0SA 4A3EG 3BA6A 2QPOA 1JG3A 2EIYA 1ZVQA 3GQCA 4ECYA 4HN4B 4HUQA 4RWZA 3ZOKA 1WTAA 2AC2A 4DARA 3RF7A 2XDYA 2CVOA 4TYPA 3E7PA 2F3TA 4DJDC 2C88A 3AUFA 3PI7A 2P3SA 1HWYA 2JAQA 4FYXA 1A0OA 2I3AA 3PX2A 3L1IA 1EXVA 4IRCA 4TYMA 1BOOA 1E1RA 2MSLA 3KXIA 3JPWA 2FW9A 1YS7A 4ZDIA 2QVGA 1QNLA 4PC3A 2H5EA 1CUHA 3T54A 1E59A 3C85A 4QUBA 4PO9A 2W9XA 3SCZA 4MP6A 1G20B 4F60A 2ERXA 1WP4A 4Q7EA 4US2R 3GJ8A 2OZEA 3O1HB 3QLTA 5TV2A 3WGUA 4Y2HA 1IPFA 5D8DA 3GTOA 2RGVA 1ZH8A 5LFAA 1AMNA 1J33A 3F98A 2L0XA 1HRKA 1XQVA 4MVJI 2BJVA 4XVRA 1WZUA 4IILA 2NVXA 2D8AA 1NVEA 4AXXA 4CM9A 5ITSA 3S2SA 1G6Q1 3ZVKA 4F4ZA 3UHOA 4L5JA 2SICE 3IHLA 4FDMA 4Y6OA 5H16A 3VU3A 5HNKA 3WWHA 4WLVA 4E14A 3TJRA 4C87A 3CZ4A 3MEQA 4ZU3A 2QGZA 4FMDB 4A3LG 4NJMB 4WPGA 4MO9A 3G2JA 2RHMA 1I1HA 5FP0A 3NBQA 4AQYB 2H00A 1VDZA 4CXMA 3ZH2A 3WSWA 2GPBA 3PPXA 4KPUB 2OEPA 4OPMA 1ZIXA 4NBVA 2CCJA 5LUBA 3HN2A 1J0AA 3BD6A 2FUG1 5L8VA 2W2PA 3ZGXA 4XVUA 2GRJA 3F96A 3IUMA 2M6KA 1PTJC 3GRUA 3B12A 2HWXA 5K0NA 1DDGA 5JT1A 9MHTA 5CT6A 3IODA 3IT3A 3AKCA 2X5KO 5I7SA 3Q8XB 2ZCUA 3K73O 2CNDA 3G5AA 1GU1A 4KSCA 2KBFA 3A11A 4M9XA 1M6VB 3KV1A 4LYJA 3V8RA 4OAQA 1NY5A 3REQA 1JUDA 2JFHA 2PKYX 1ZAYA 5IW8A 2JHPA 3GRPA 1RWXA 4LJ9A 3D4LA 3I73A 5LA6F 1Q16A 1F2UB 3RVNA 1FMFA 4RZQA 3G17A 1FYFA 4M60A 5C4MA 3HM9A 1GQOA 1PL0A 3R7AA 2VHTA 2DM6A 1GRVA 3MGCA 5DM1A 3G0CA 3MJEA 5ITZA 5CX1A 3FCOA 2P41A 2Q3HA 2AFHE 1HNZH 2PAAA 2Q1YA 1QS0B 5J43A 1B0ZA 1U2GC 3OEWA 1Z2DA 1FNNA 4IJQA 4KJZA 5GJBA 4HRAA 1DU4A 1MW8X 3KZOA 3QKUA 5CDHA 2KBEA 1K68A 1WVGA 3NC1C 4FDAA 5KHLB 1DXQA 5JXIA 1B0AA 4OLFA 4DAAA 3LXRA 4OQNA 1JFVA 4FEYA 2NZJA 3QWHA 4JGGA 1I4LD 4TV8A 2J6CA 3DT8A 1UBLS 1YR7A 1J90A 2W98A 3O74A 3WC4A 1NBOA 1F60A 4I6JA 4FHEA 3TB6A 2GMWA 2Z3ZA 2OV6A 1SIOA 2CE7A 3FDSA 1MFPA 2R7NA 2ISCA 4BNNA 3LWDA 3LBNA 2ATCA 1E2JA 3OESA 4XWAA 4R7GA 2P65A 3MWLA 1E2PA 3GGCA 1ISJA 2A9PA 4OYRA 1M7GA 4AQDA 3BM5A 3PPYA 3NHJA 5THQA 4R3UC 1NE2A 1AUQA 1GKUB 4JXXA 3MFHA 2ONZA 4O2RA 4HLUC 3UGQA 4Y30A 2AHRA 4IGAA 1CG6A 5DT9A 3SHWA 821PA 4W9NA 3FFBA 1BYIA 4C2UA 3N6XA 2UYQA 1XNJA 1UBHS 4JLMA 5BNTA 5AW0A 1S2LA 3D4OA 1KRXA 2FSIA 1E8MA 3BZUA 5B1YA 4U9IS 2GZHA 1S2GA 3SZUA 4P8RA 4NCBA 4IR7A 2CEAA 3QZ8A 4B34A 3DAGA 3R23A 4DXDA 2FY8A 5CD9A 1R15A 2NZUG 5B58C 1YZVA 1FCJA 5K4GA 1IIRA 4Q3LA 4DXAA 4YP5A 3OHPA 2OBYA 1JDTA 2OC4A 5AQ1A 1GZ6A 4MH0R 3HRKA 5BSWA 4YJDA 3VH3A 1BS2A 2JA7G 2K2QB 2I7DA 3KR2A 2OB1A 1AZTA 1QYDA 1WMFA 3QU4A 2YJZA 4OJNA 4R81A 5ICSA 3VTFA 3A3PA 1FP7A 4KX3A 1C29B 4DIFA 3DEIA 2GO7A 2PCJA 2QVCA 3NAGA 3P9ZA 4YYEA 2OP0A 5IUNC 4JWTA 4DR1H 2DBYA 3KYHC 5F33A 4C7JA 5IG2A 2YNMD 2PO7A 1EFRA 5AXCA 3N0XA 4QBKA 2PQ2A 3QFHA 3MR2A 5DZSA 3DMPA 1YHYA 4AL4A 3HFRA 1E61A 2W7TA 3AONB 4MI3A 5E7IA 2XA9A 1YU6A 3BGSA 1GVHA 4YIHA 3RAJA 1W85A 4MQEA 1UJNA 3FUWA 1C9NA 2V6FA 4JI6B 3KAKA 2O8EA 2NNLD 3HABA 4Y8VA 4MHTA 5A03A 5AOVA 1S9FA 5SZKB 2IIQA 4AZ0B 4YQFA 5I9BA 2W6PA 4O4LF 3HPQA 4HSGA 2B61A 4UW9A 4BNZA 5B55A 2WVGA 3BILA 1C8KA 2WJ6A 3NJ8A 5HR5A 2OE2A 3DTVA 1O8BA 3WGGA 1R0ZA 2QYZA 3ZIAD 1ZUHA 1FQOA 1YI8A 1SZCA 2H92A 2HLNA 2JRCA 5HQ3A 4G5FA 1M75A 3BORA 3WGIA 1U0JA 3W7BA 4EYOA 4CV1A 3CZCA 4MYRA 2HUPA 3IYLW 2WYVA 1CBUA 4PZ8A 3JQ7B 3WVNA 2QXYA 2KJQA 3DZFA 1ZEJA 2J6BA 3KVRA 1OX6A 1UXKA 4Z9FA 2EERA 1IULA 1J25A 1VRVA 3H18A 2A0YA 2ZI5A 1P1FA 421PA 2OECA 2WWRA 3WRXC 4YLYA 4RY0A 5AVRA 4NHEA 3UJPA 3SD7A 1PFYA 4R0MA 4ZQGA 3K70B 4RF5A 2A1HA 4BNTA 1G9SA 2IKSA 1JHDA 1RHKA 3LP5A 3HB1A 2HCRA 1U7HA 4GMXA 5HBGA 2Y9PB 4OLBA 1X1TA 5DISC 3UJNA 2JPDA 1O5TA 1CY7A 1NC1A 3FGPA 1VMDA 2AVDA 5K8VA 1YDWA 4Z4CA 1Y5RA 2PUVA 4KLNA 1XXHB 4AURA 3B8HA 4O8ZA 2FNAA 1ZIDA 4EY8A 1V37A 3J80W 1ZD4A 3HCOA 3I23A 3QYPA 2XXBA 3FFAA 1LPOA 2JLWA 5M2QA 3KT0A 3ZHSA 3MINB 3PKIA 2JLQA 2Q3CA 4Q1FA 3TW8A 4ABTA 4C4AA 4LZAA 2E0IA 4ML3A 1XVTA 3RH0A 4DKXA 3N2KB 5JCZA 5AR1A 1XF9A 2HPHA 1Y6JA 1KAMA 4EBDA 5IH3A 2NYUA 4G0QA 3C8UA 3N2EA 4N0DA 4NNOA 4KXNA 3D8RA 5FCDA 3HB7A 1TKBA 4PC7A 1FU7A 4PX2A 4E1BA 1ZRHA 4LNAA 5JPIA 5JAHA 3ERCA 1FVOA 3P9YA 3GELA 2KE5A 3CTPA 4LCJA 4QU0A 1WUTA 2HDHA 1Z8DA 1IXZA 1GR0A 5JRDS 3NHFA 4KNYA 2QROA 5IBRA 4F4IA 2H8GA 1JV2B 5I4KA 2AFRA 2CJYA 3U61B 3L7CA 2VUIB 5GIOE 4UBJA 1CY0A 3OUUA 3O73A 1XCBA 3RB6A 3UK6A 3FCUB 3V33A 3W3AD 1WMDA 3AB3A 5T8KC 1I2CA 1CVIA 3AJ9A 4FS2A 2VDLB 4I0WB 3LXXA 5C35A 5B4VA 1NSFA 3B13B 3SC6A 1XP5A 1OMOA 2X58A 4EJ2A 3K1AB 4P84A 3G1TA 1ZGJA 4J75A 5HCUA 3KETA 3I76A 2EJTA 4X44A 4DTCA 3H1EA 3HYLA 5IVIA 1E1NA 3EWAA 3W6UA 3LQRA 4ZDJA 2Y1LA 3QOXA 4QUAA 5CR5A 3AM5A 1TZBA 5IT9W 3ZCTA 5E9JA 2OAP1 4UARA 2P0AA 2DT5A 3BUSA 1SBNE 4V0ME 3FBTA 4K03A 4NATA 1WL8A 2BN4A 1V7PC 3OZAA 4YAIA 1JXQA 1MO3A 1SXPA 1XDZA 5C5CA 4DRXA 4HS9A 3OBBA 2UVWA 4ZOAA 5GONF 1TQ6A 4WERA 3FKSD 2V0GA 1Y4SA 1GDTA 2P2NA 4WZBE 2X41A 3TY5A 5DOVA 2JFPA 2KM1A 3MZ0A 1JDVA 2EGUA 2RAVA 4V0QA 1NBME 3L84A 4G0YA 5ELXA 4F2DA 1EB9A 2P4SA 2FE3A 1RMQA 3TIGA 1U7TA 1NYTA 1BU8A 4CCYA 2G9VA 1E5TA 2EIXA 4IDEA 4JQOA 4G1VA 4KPYA 2Z9BA 3FJYA 2DAPA 4B3FX 4EGSA 2YRXA 2Y1CA 5UKDA 5KFWA 2QZZA 1UF9A 1RBYA 2JNWA 1Z0SA 3QE2A 1BD3A 3RUCA 2Z5GA 5DHRA 2VYQA 5HF5A 3H8VA 5BMVF 3V8VA 1GA1A 3D8SA 4DQLA 3SXUB 2GESA 5BV2P 4FDUA 4PQRA 4DMHA 1Z7WA 3UW3A 1AQYA 2H3HA 3HVRA 1HNZB 3IOMA 2DFTA 4FU0A 4J0MA 2BBWA 4C7MA 4AVYA 3EYWA 3ICPA 2HIXA 2FE1A 1G5RA 2G7MC 1NTOA 3VQTA 1TAGA 1FQJA 5EJAA 4EZBA 3ZUPA 1W36D 3GAZA 4JROA 4QHYA 1N2CB 3SEAA 2FR1A 4Q1DA 4Q4HA 1NR1A 5F4BA 4CTJA 3AVYA 3AW8A 2HLDA 3ZHXA 6ABPA 5IKPA 4F84A 4DL2A 3G02A 4N49A 5IUKC 3T5MA 1CFZA 2DYKA 4J0IA 5KG3A 4PX9A 1ZJJA 3QTTA 2XQJA 5DNYB 4I08A 3NG1A 4H31A 4LRWA 2D06A 3RV4A 2Y1XA 1X7WB 3HXQA 1EWYA 1J9GA 1EBUA 2A3RA 4G2NA 2OZLB 4AMYA 5D00A 5G2OA 4BNUA 2VA8A 3AXTA 5ICEA 5IAGA 1RYDA 2ZAGA 1XRRA 1SZPA 4QGAA 5JXHA 3OX1A 4JS0A 2H54A 3MD0A 4E09A 1XKLA 1N2ZA 3A0UA 4TX1A 3U56A 2I4LA 1R7RA 1AGYA 2Z98A 3KELA 2XQVA 1XTRA 3HU5A 3R5FA 2RHJA 5LMNH 2CDBA 1QDUA 4KHZA 2EFGA 2BH2A 1V4YA 3V8EA 2Q8PA 1JMYA 2A67A 3CB2A 3QSGA 3QQMA 5A71A 2V1UA 3FRHA 1VHJA 1VPVA 3ORRA 1M2JA 3MWMA 3E9ZA 2ZROA 4ODIA 3P0RA 2OGTA 4UTRA 4TTVA 5E9WA 2Q1SA 3LP8A 4WUTA 4NE9A 2BGIA 3TLMA 2LP4Y 1BO6A 1G20A 1VSUA 1XPUA 2ECKA 1Z7BA 2EKZA 2JIMA 1E5QA 3RS4A 4QYTA 4FBMA 2JKVA 3P9NA 3OP4A 4Q66C 2NWQA 1DIAA 2JA6A 4EHNA 1SCKA 4IJ5A 2HUNA 5JW6A 2QG9A 4EFNA 3JQ9C 1P29A 3LUGA 3IS3A 3QBTA 4JV5B 2P0EA 3DDUA 1IHDA 5IDQA 1Y4DE 3UFBA 4DR1B 4S35A 4KODA 3A2LA 3VC3A 4DT1B 5MHTA 2YS6A 2VDQB 1NFFA 4ZOEA 3UEOA 2IWRA 4H3VA 2WFLA 1YUBA 1SUCA 4FDVA 2H4YA 4CLHA 2OB2A 3C3BA 5J5VA 1Z37A 4OUKX 1RLJA 1N5OX 4MGEA 3ORFA 3BVPA 5C8ZA 1LV7A 3E2IA 2RHDA 2H07A 1QFSA 1ZD2P 4L8LA 1T1JA 2B5WA 5J4HA 5IK2D 4CHGA 4C7XA 4EHDA 3RFFA 4OQLA 2ZYRA 3PVCA 4EY7A 1TCUA 2FFHA 3KWMA 2AQHA 2QD4A 2V0CA 1RKQA 2W2TA 4GZMA 4CMDA 3GC6A 3DBIA 3R09A 2C7BA 4M54A 2BC9A 2MT9A 3MT9A 3V4SA 3RVLA 5IYZF 2REBA 3CWCA 1D2HA 1N75A 1JS1X 2FPIB 4QUIA 2PUAA 1NW8A 4QPJC 3RU7A 1YR2A 4M88A 4FYYA 4BOYA 2C82A 3IT1A 1JWBB 3A9TA 2R92A 1PWXA 4S04A 5ICGA 1PS0A 2W6ZA 1BN7A 4DNFA 4RPHA 1U1DA 2HSZA 5G0TA 1JQ5A 4I14A 5B37A 3A6LA 3F2IA 1FBNA 3PXDA 3JW8A 1H2YA 1XKQA 1AS2A 2KQUA 1WETA 1YZQA 2XGSA 1UM9B 1QG2A 2FZKA 5DWQA 2WIFA 1BG6A 1Z6ZA 1EX9A 2P1DA 1KOJA 4GXRA 2AEMA 4ZYYA 1Z25A 2OFPA 4EDFA 1U3CA 4G0PA 1NWHA 5G40A 4CIAA 2Y2UA 3LJKA 4BO0A 4E5VA 2MTBA 2R4TA 4TQSA 2Z04A 3TD2A 1Q1EA 3K8ZA 2G1KA 1QS0A 3AU9A 3DB2A 1R5JA 1C9YA 2PMZA 3PTAA 1D9XA 1A0GA 1CY8A 3EAFA 5JAIA 2R8KA 2FUG6 1OH7A 3Q3VA 3RANA 3AVXA 4OHMA 5K0ZA 1TIPA 2V7TA 1CE8A 4OJKA 5E2IA 3IB6A 3RIXA 1SBIA 1FEZA 3HVIA 4WEOA 5EJ7A 3PS9A 1ADYA 3PXBA 1EWQA 4JBNA 4NOKA 1E7RA 4LGYA 4JHXA 5D1NA 3IURA 5DJ5A 3CX8A 2KYRA 2H1WA 1I1QB 1W9HA 3GMDA 3EPIA 2ZQZA 3CVYA 1HRDA 3VOAA 3WLFA 2RGBA 4KR0A 3VGPA 3MTGA 1RLOA 1SB9A 3E61A 4DBVO 3GJ0A 2P35A 2ZUDA 5H80A 4R2KA 2XI4A 1Y1WG 4TZ6A 3OSZA 3G2KA 1GPKA 3FDZA 4YXWD 1DQSA 2P79A 3GH1A 4G1UC 4PAMA 1PR4A 1P60A 3R9XA 4KLZA 4R2HA 1UFKA 2WQ7A 1DFHA 1CS0B 5EKSA 4XZ3B 2JGMA 3HUEA 3WRYA 4TTAA 4YONB 4BMXA 5A9SB 3DYVA 1CJMA 4KLRA 2VJLA 1VFNA 4JP3A 2CVPA 2D0OB 4EUHA 3H2YA 4QQRA 4AG5A 3JASB 4Q03A 1R18A 1SCNE 1YQQA 4W5HA 4WHMA 4OSOA 4F1KA 2YWXA 4DLLA 3L0YA 1NATA 3MWKA 3P32A 1YNSA 1H3EA 4N9WA 4YTEA 3MFIA 3WQHA 4Y9SA 1NJ1A 2WKWA 4LJ8A 4LOKA 5A6SA 3B1WA 2A78A 1ATZA 1X13A 4HX9A 5CDFE 5I7UA 4QUEA 3HM2A 5ICMA 1PUXA 4O4IF 1GFIA 6REQB 1GFWA 1ILWA 1QU2A 1OBCA 5A4MS 3L8DA 5I5UA 2E48A 5KTOA 3GZ4A 1JH9A 2A4MA 1JXOA 3H16A 1SC6A 2IDKA 5B3JC 1L5OA 1NPTO 3IELA 1MDBA 1LQ2A 3II6X 2WDZA 4QM7A 3O9MA 4OSPA 5SY4A 4GMDA 3N2ZB 4X1IB 2VTEA 3K0BA 3C5VA 5A3QA 1JXMA 1DB3A 4K28A 5FL7D 1ULSA 1GADO 2QWXA 4EOGA 4PQYA 1VI5A 4WGFA 4AQ7A 3PP8A 1H0KA 2NW6A 3K20A 2ZTSA 2AKAB 1FLNA 1P2DA 4RKQA 1Y8ZA 3G49A 2ZRQA 4N3AA 5IJXA 2C7VA 3KQHA 1JHYA 3UVEA 1XAIA 1CQZA 4L8GA 3GAAA 3KTDA 1C2YA 1XRSB 3MNFA 4BPRA 1UCFA 1R8XA 4UQPA 3QUAA 2YFYA 3BHJA 1G19A 1G98A 3YASA 4YX9A 2PMWB 3EIXA 4G63A 3PW2A 1R4MA 3QVSA 3D6FA 3ML1A 5LYJB 1QOQB 1H4TA 2CZCA 3MQFA 4H17A 1OU0A 1XD2B 4JV1A 4TWZA 3TLAA 3TAHA 3A6EA 3BIFA 1I94H 4PC6A 2I7XA 4OV6B 4BV3A 4YLEA 2RAUA 4W8OA 2QLLA 3EH2A 2ORVA 4TGLA 4AK9A 1FTNA 5EUCA 3EPPA 5I9TA 2CD7A 3B3GA 3H9EO 4P5PA 1WCMG 4HNQA 2SCUB 5BSTA 1IEVA 5BUCA 2J3DA 4G67A 2PUTA 2OQ2A 4L9SA 4ZYUA 2BMWA 1I33A 2FWBA 3KPUA 1ISRA 1CEEA 1P5JA 3E82A 2ZGIA 4TMYA 2DWUA 3VJLA 3D9QX 4PX3A 2HREA 2FWIA 4YCSA 1K8XB 1SU8A 2AF4C 3B1YA 1A88A 5LIPA 4OB7A 4GC6A 2XKKA 2PJZA 1XXHA 2QPAA 4QFBA 2PH7A 5A5EA 2PS1A 2Z8YA 1W25A 3RROA 1EXWA 4RCYA 3JQQA 3DE0X 1GPLA 5BUZA 1UBCA 5H4GA 3G88A 4MGZR 2QAGC 1S96A 3W5OA 1B41A 3GJQA 3M6VA 4Q1VA 4IWNA 3N2KA 2G5PA 3WFJA 2J3QA 1PR9A 3E8SA 4S1NA 5IM5A 3RJ9A 4B32A 1O4VA 5B7NA 2PUWA 2FJPA 3KUCA 3QKWA 3O5AA 1P91A 4XFJA 3BL8A 3G8YA 4XR9A 2CXXA 1CJVC 4BX8A 2DZDA 1JYEA 3MJRA 2HVRA 4PYQA 2C2KA 1DHRA 4ND8B 2I8AA 4R0VA 3LY9A 1EKPA 1ZC3A 5G4KA 1P4GA 3FB4A 1J8VA 2FPLA 2B37A 2PX2A 5EHIA 4O7ZA 2JHAA 3DBRB 2BOVA 1WXDA 3HCWA 4TTIA 1Y0BA 4D80A 4RLQA 3WJAA 1KJZA 1Z83A 3WDKA 1CJBA 5DHQA 1N2IA 1NP6A 3UKJA 2O7QA 4DGSA 3AL3A 5IEBA 3MW8A 2BKLA 2EFCB 2Y05A 3IT2A 4RHXA 2R2AA 4MJXA 3PJRA 3W5JA 1U9JA 5IARA 1ZUNB 5JCOA 1BROA 1TQDA 3CJTA 4GOJA 3HKBB 1Z2NX 3HBLA 2OM2A 1NZFA 3K5PA 1XNQH 1DSSG 1JZTA 3BICA 2QUBA 1QGAA 3DZHA 1SY7A 1X7HA 4ARZA 3JQCA 1RXYA 2AV6A 4W9MC 1WXIA 4WA7A 5CT5A 1B04A 1I1KA 3HR7A 1UC4B 4REQA 4M0KA 2XUKA 2W2KB 1FJGH 3M89A 3KSZO 5EWLB 4KQJA 1JTFA 4H1WA 2VZ9A 4C2TA 4AUNA 3SC2B 1W7AA 1PR1A 3R5XA 2HSJA 1KETA 4KXWA 2H1VA 5JD3A 2BGLA 5K8JB 3N42B 2BM0A 1TKRA 1R12A 3WFIA 5T4EA 1GGOA 3QLVC 1YB5A 3PV0A 4INZA 3O9ZA 3T5GA 1L4KA 1LBEA 2VSYA 3V4LA 1IPHA 2OUKA 1SQ6A 4ZCQA 2X77A 5DX1A 4F4UA 3WBFA 4AQYH 1L7NA 2XW6A 3K6RA 4HDRA 3KJFA 1P4JA 2AI3A 2JBHA 1QU3A 5E6UA 3AILA 4MNTA 2WJJA 1CF4A 1KAHA 3NATA 3H7AA 1N6PA 2I54A 1DEHA 5C44G 1SK9A 4B7ZA 4ZANA 3D7LA 3W77A 4I9NA 4JC8A 2EV9A 1NR7A 4XWOA 3FROA 1T5HX 4WSOA 2C9BA 1E2KA 3PRYA 2HSGA 4DSOA 4Z0NA 4KIWA 1E7WA 2D1SA 4DCSA 4EHAA 5I6DA 3SXUA 3TI9A 1IYDA 1ZA2A 3WDLA 2JZOA 4XUEA 3P9SA 1E77A 2YRFA 1G5IA 3GLFB 3VMMA 3UMGA 1SPBS 4XD7D 2WF6A 3LT4A 3LXUX 4WCFC 3Q85A 4AKTA 1ZSNA 4GYKA 2GD0A 2VFAA 2IVFA 3VPGA 1RKVA 1LS1A 2AS0A 2OUIA 4EG1A 3EPHA 4II7A 2CYAA 4BKPA 1N2CA 3ILXA 4FSDA 4UXIA 1XE3A 3I04M 4R8LA 4GL2A 1UUFA 2ONYA 2HCFA 2WSMA 4K86A 3T8YA 3DP9A 3C41J 1X70A 1AKMA 3NDIA 2WIDA 3UZUA 5CFNA 4GWGA 3G89A 3H9CA 1FS4A 3VAYA 5KNDH 5E1OA 3FPBA 4LYAA 4WOKA 4RD6A 5E38A 3URKA 3SAJA 2JJ2A 1KI9A 3L7MA 3GOHA 4Y6LA 6AT1A 2JC3A 5LDHA 2JA2A 2HA0A 3I3OA 1PGQA 1I3CA 1JWLA 2JLSA 4HB4A 2EDCA 4Y6SA 4N7RA 1KMIY 5E1BA 1AT1A 4X8LA 2G67A 3PGMA 3GI1A 2ZRIA 1B6TA 1EBBA 1TYZA 2YDYA 2HR1A 1AQUA 2VS1A 2C2GA 3MAGA 2FV8A 3A4IA 4ESOA 4FYIA 3L8YA 4FEGA 5KYYB 5DCUA 5TQ0B 1T9ZA 3OOWA 2PRZA 2HF9A 3KZMA 4DLTA 5CDYA 3A6HA 3DR5A 1XTBA 4GAEA 1TDJA 2H2HA 1OQAA 3PFGA 4OA8A 1XHLA 1MIHA 1TF5A 2A9JA 4HQKA 5JH7F 1QZUA 1FFCA 3X1WA 1D4ZA 4FW8A 5J4VA 2ODBA 1T8YA 5AYVA 4HL6A 4NHOA 4O5OA 1S4QA 3PFBA 4JSTA 5JAQA 3AKEA 2FPXA 1O9HA 3AETB 2IK8A 2QZJA 4IDNA 4UBNA 4RHFA 5LUAA 2JFWA 3NHAA 3LI2A 4ZA2A 1QF6A 4NOMA 4Z0HO 4J3NA 4MA0A 5I5TA 2BFCB 1H3FA 2EDAA 3BKWA 4HYEA 5A9RA 3CH6A 2ZUCA 3IX7A 5ALOA 2CNOA 3NCTA 4PAQA 4OSEA 3INGA 4IICA 4A2AA 3KKQA 5I5EA 2WZDA 4GUAA 1BVUA 1RI3A 5BORA 1FTSA 3TN7A 2Q2TA 1MFZA 4I8XA 3Q8PB 3K35A 3T5TA 4GM0A 4GPTA 3LQKA 4DT1A 3GLSA 3ASUA 3EGEA 1X38A 3VO2A 2VHVA 3MR5A 5KPDA 4A15A 3AR9A 4LMRA 3IEIA 4DLWA 2CLFB 4KVAA 4J1TC 1J06A 2O0HA 1NU8A 1RQXA 1RJEA 2ORED 3W78A 1VJRA 4R1MA 3LX4A 2QT1A 5K3BA 1XLUA 3L4EA 2ZWAA 1M6WA 2X9QA 3PCRB 3WLHA 1J2TA 4NCNA 1YT5A 4V1CA 3HZOA 1JXLA 4WKPA 5J47A 1YBAA 2WI8A 3GN2A 4IZIA 2ZIUB 1AK9A 2ZKIA 1BA3A 3G0IA 4OFWA 5FOVA 3ZWWA 4UTNA 3BTOA 6GPBA 3EDQA 5JTUA 2R8RA 2RHRA 4OHUA 4G26A 4IH4A 2QQ5A 4F11A 3CLSC 2NXJA 4ZGWA 4IAJA 2WNSA 3AY0A 2CUKA 3DPIA 5JPDA 2XYRA 2FPIA 2RAPA 3AM3A 1PJLA 4DQXA 2AC7A 4DWWA 5A5FA 1KO7A 3VR4D 1JIXA 1OFGA 1SD5A 5K3DA 3H84A 3B2QA 1KI4A 3KAPA 4O3RA 1HTBA 1MX9A 1T5BA 1NGSA 4X66B 4IRDA 3AGQA 3AR5A 4EB8A 2JEZA 1WUKS 1UM9A 4M1TA 4H3HB 3THRA 1QO0D 1TAEA 2XUQA 1H5NA 4PYJA 3NM6B 2HLPA 2JJYA 4YJKA 4RIEA 1D0VA 4PXSA 2Y67A 5DNDA 1WY5A 3P4UA 3UFXB 1Z33A 4OYYA 1IBRA 2H9AA 4KFUA 3KTAA 3OJLA 1KKLA 1PX2A 1PG2A 3ND7A 3TLCA 2FN4A 1QIFA 4JR0A 5EZ6B 4PZYA 2W9BB 4BLPA 3T5PA 4GZLA 2NU7A 4PANA 2H17A 1T8RA 2OL4A 3LCMA 4GPAA 1IHXA 2C7OA 1P4HA 3NFRA 4Z7OB 4WOPA 4CL0A 4BP1A 5LPNA 1II8B 5CIYA 1G5HA 1R0RE 1JEJA 3IP8A 4ECXA 1ETUA 3H0KA 3T1HH 2C4MA 4BU0A 3O0TA 3NHUA 1Z17A 4KO8A 2PXHA 3AVPA 3V7FA 1KAEA 1TVCA 2I2XB 2OXIA 3B1FA 2H57A 1GN8A 1ODIA 2GWHA 1E9RA 3EHEA 3F97A 3MGBA 1EX1A 3L40A 3B6JA 1KZYC 1XTKA 4B46A 4LSWA 5JVLA 3LNCA 1YZYA 3B7WA 2CXRA 1R5NA 3GRKA 4YQEA 1DC3A 3CZRA 4DW8A 1C3JA 3DVLA 1VYVA 4WY5A 3HCFA 1CS0A 2Z2ZA 3G79A 2XZLA 4M55A 5HZGA 2H5LA 3BMOA 1PAUA 1WWKA 4ND7A 2FOIA 1I4EB 5KOJA 3DP7A 4GW3A 3PNPA 3UJCA 1RM5A 3F5FA 3QYJA 4ANFA 2IDJA 1Q0RA 3DQZA 3T0IA 1Y7HA 2ANCA 3M8KA 5TY0A 3JZMA 2V97A 4YO7A 3TECE 2CBXA 2B4QA 2OHIA 2HU8A 4EVQA 2JJ8A 5F23A 2J6UA 2PR7A 3L6UA 1XT6A 2AFHB 2IPXA 1DJLA 2E87A 2WWHA 4YAKA 4X85A 1HLDA 1C1HA 4OFBA 3QWBA 4RSHA 2QZSA 1FDUA 1TUGA 5JZ9A 1XNQB 2WMOB 1NN5A 4YRKA 3AKDA 2NTYC 4MV9A 3PJGA 5JARA 2PJDA 2C1ZA 3HL4A 4JZYA 6REQA 5K3WA 4QD3A 1FJGB 5AI9A 1V71A 4L75A 4R2LA 1H5UA 1KVSA 1NX6A 3KD3A 3AUUA 5DKFA 4G4JA 4GIBA 2NQ8A 2HU5A 3U55A 4M1YA 4QWDA 4U0JA 1U9ZA 2YZNA 4Y2PA 1E9CA 3ZU3A 1FSSA 2V7WA 4I50F 1NVWQ 1DELA 3ILVA 4X93A 3DAYA 2FJ0A 2QTZA 4B6EA 1LDMA 1M7JA 1OXSC 4RTJA 4ES6A 5KOHB 3CGGA 1TWCA 5DI9A 3ROZA 4LRSB 2H1FA 2KMLA 3NHBA 3EE6A 3HZZA 1FJXA 1JG4A 1Q1NA 2HMTA 1EX6A 1H85A 3OICA 4H08A 3I83A 1W5AA 3HCEA 4LOIA 1TYDE 4L5YA 1S6YA 2O1EA 3OFNA 4Q19A 2BWJA 1CYDA 2IOYA 3TQOA 3IP9A 4J8PA 3GIDA 3QY9A 5AVZA 4TQ9A 4UNRA 4RTOA 1M7HA 2RBEA 4LK3A 1XD2A 5C5EA 1IYEA 4A7PA 1WKCA 4PLYA 4RADA 1OXBB 1G8FA 1X77A 5I5XA 3ZU4A 1BE1A 1G7RA 1XA0A 5D6OA 4WK2B 3DPSA 4W5TA 4MMZB 1L5YA 3EJWA 1TM1E 2SCUA 3DZKA 2QW1A 3KT8A 4GFDA 1EINA 2IC5A 4DCOA 4IRUB 1Y7PA 3AERB 4BKMA 4ZVTA 4PZ0A 4U7PB 2F67A 4V24A 4TTTS 3DC2A 3K8YA 4N7MA 1C3LA 4O59O 1Z6XA 2ZU6A 5IH7A 3R40A 3NBFA 1P45A 4K9LA 3FNRA 1N7HA 1AZSC 2NADA 1VLVA 1V1MA 5B7PA 5LQCA 3OY2A 4R9SA 1B3RA 4Q3NA 1WNFA 4MEJA 2ZBPA 5HFNA 3GHYA 3KQLA 3K15A 4LZNA 3CEHA 2V9WA 3LT1A 4F86A 2R0QC 3G2LA 5FR1A 2DG2A 3HY4A 3ZKWB 4PNHA 1X3LA 4POOA 2YW2A 5DXFA 1UKYA 1AURA 2V7BA 5C51B 3IBGA 2G76A 3I9LA 5TGTA 1SVSA 3MQ4A 1YCDA 4C0SA 2BKVA 1H05A 4M1SA 4CT0A 3ZE9A 2QSZA 1RK5A 4MQFB 1U0RA 2B4TO 1YFJA 4PSKA 2HQOA 4NYMR 1T6YA 4KPEC 5JVDF 3WNQA 2VAPA 1PFGA 1MORA 4ND8A 4V3CA 4U7DA 1V8FA 3WIVA 4E5SA 2C54A 4WNAA 3LD9A 3ZDRA 1H8HD 5HWSA 1BHQ1 4Q4AA 4YUWA 1RAEA 4HKTA 3K09C 2FSVA 3DTNA 1Y33E 5GP1A 5T64A 3HB4X 3KQVA 1IOZA 3F3MA 1XTQA 3B82A 4M36A 1EUYA 1EAYA 3U3MA 3V1UA 1E2BA 3T1NA 1M34E 5JZOA 3E7XA 1JHZA 5L3SA 3DV2A 4PEVA 3QFFA 3O82A 3E3MA 4MKGA 4INPA 1O6GA 4EJFA 2X0NA 4ALIA 5F5XA 3QUQA 2AOVA 1ZIYA 3O8NA 3F90A 1S8FA 5AJHA 1Z2CA 1ZUNA 2R7ZA 3B6IA 1OY1A 3B1VA 3M6IA 3QPVA 1G5TA 4LE1A 4FFOA 3OU7A 2PL5A 5MDHA 4TZ0A 2PKQO 5K0FA 4MUNA 2FWRA 4WZZA 4I3FA 5D1HA 2GDZA 4JV5H 2HA7A 2Q5OA 5BN1A 3HJTA 2G4CA 1Z63A 1KTAA 5EWLA 1MXFA 1WB9A 3SNOA 3RNLA 4R8KA 1MC8A 5DP1A 1SQSA 4R68A 3HKDB 5TQJA 3N1UA 2ZM6H 1LY1A 3L1KA 3VR2A 3R6TA 1OFHA 4YMGA 1WZEA 4J1SA 4PG8A 1EUZA 3OLZA 1KTVA 2PPVA 4GYJA 4A3KG 3MTIA 3EHDA 2HIVA 1U1FA 1J2JA 1KYZA 1TAQA 3V4ZA 3ZXSA 2V9PA 3BD9A 4C01A 4BLQA 2VRNA 3BK2A 5BY2A 2PFGA 3LZCA 2IIPA 3TTUA 1Y1RA 3NIDB 3EQ8A 1G59A 3FOEC 4UHFA 3U62A 2YASA 2EKBA 1U80A 5KHAA 5LBTA 4Y6GB 3ADKA 3IEPA 3OKCA 3N5KA 1ZVVA 3GRCA 5BR4A 3EXG2 5DNEA 4MWGA 2ZUVA 2JEYA 1QHSA 4XA8A 2AN3A 3FWPA 3O75A 5FR9A 1WZCA 4RVUA 4FHCA 3GP3A 2CVFA 3GVPA 3PJFA 1X1BA 4MYUA 2OCGA 4O82A 4UQOA 3SQXA 5TPWB 5K7SA 2VOBA 4O4JF 2FK7A 1S03G 3I5AA 2NXEA 1NUAA 1PP4A 4X95A 1M33A 2DQZA 3GXOA 2FLNA 1T4GA 2GQRA 1BGWA 1N6HA 3N40P 1ONPA 3AIKA 1RAIA 1SKYB 2PZ8A 3Q5GA 2XQGA 4LY3A 3GLFA 4D0GA 1UAYA 3AF6A 3M6AA 4QSMA 1NJ5A 1KSFX 2PH5A 4F9FA 1WHSA 4Z3DA 3ZWAA 1C9MA 3Q0TA 1ISPA 3D3QA 2IZ0A 3T4EA 2DHEA 3OZFA 5JHHB 4PNEA 2WBLC 3T1HB 3DEZA 4A3CG 1OYWA 2FJUA 3N39C 5JAOA 5A3JA 3CVJA 1Z0ZA 2ZDQA 3DUWA 2OXTA 1BCSB 2CE2X 2A5LA 3ZK8A 3P20A 1EFCA 3HCBA 4ECAA 1LC3A 3LBAA 2R8JA 1XCGB 4JBHA 1HE3A 1NVTA 2LXNA 3W6ZA 1T91A 3IPLA 4RE5A 2NVUB 4L8YA 5EJFA 1IG3A 3EJ6A 5IULC 3LLCA 5CH5A 4KI7A 4FE4A 1SHJA 1KMCA 2RI6A 3IBTA 4Q21A 5TMDA 3C4QA 1LK0A 3MCVA 1UT5A 4WZBB 1ZPDA 5DGAA 4I9UA 4UBMA 1KPIA 3C24A 3LQQA 2GK7A 4XSVA 1LBQA 4V2UA 1HORA 2A86A 2FHSA 4MIYA 4B83A 3I6ZA 3FPKA 3D43A 1E1QD 4CIVA 4W63A 1LH0A 4JVOA 3VUEA 3EFHA 3STHA 5F2EA 4ETIA 4CIBA 3UWOA 2QP4A 2ZBEA 1VGRA 4RTNA 4ERNA 5CLJA 2QTVB 1EBFA 2R8OA 1U7WA 3PPWA 4GI2A 3HDHA 2B63G 4C0JA 4MMXB 5KVQA 2Z2JA 4OGLA 2QB5A 1UFRA 3HXPA 2YWHA 4UULA 1U9CA 2DVMA 5KB3A 4MV1A 1CDOA 3HO6A 1ZRNA 3AETA 2IDMA 3HUDA 1RWMA 1EUQA 3TLGB 3B1JA 1Z5GA 5SZIA 4EH1A 3ZWPA 3C6MA 2IZZA 3DE6X 1MH9A 3DDSA 5U4XA 1RKUA 3NYQA 1ZHSA 3TVTA 3F5QA 4AKHA 1SKYE 3E4CA 1U2TA 3P5BA 1GPYA 4KQMA 5SV2A 4R8RA 4UE6A 1JQDA 2JI8A 1QVAA 4K81B 3QVKA 5KDOA 5I9IA 2EHDA 3H4MA 2BMVA 4I4TB 2W8BA 2PUJA 2E1RA 2H4WA 4JUAA 4LJSA 3ZBQA 1CUJA 4CU5A 4RACA 1QP7A 3VKUA 3D6TB 2YMQA 2E18A 4PGGA 4CUJA 1BFKA 2ZANA 2FSPA 3EVDA 1AKWA 4EF4A 4MRNA 3OWOA 2AN5A 1Y6ZA 1DG9A 4HK4A 2GN4A 1KU0A 5GY7A 1SG9A 2QTBA 4EUFA 2QZ4A 2B8TA 2DKOA 4ZOCA 1UK9A 2J6HA 5JJLA 3CRNA 2PLAA 2V59A 4ACAA 2VAMA 4LX8A 4K6CA 1C80A 2CFSA 2Y1FA 2A0XA 2PIAA 4DA9A 1TPZA 3ND8A 2XDAA 4ISCA 1NUSA 2H1LA 4XSGA 3IB3A 5J4YA 2ZAIA 3K2QA 2IBKA 3UAYA 2QQGA 4YDSA 3C3KA 1R8JA 3K4HA 4OJTA 3GRZA 3EUFA 1NQ5A 3ESQA 2J1LA 4IMRA 3KB6A 3AJRA 4BBAA 5DNCA 4GGPA 3E9YA 2XT6A 3R0XA 2C7RA 4OXKA 4V1CI 3QF4A 3CCCA 3FNQA 1QE0A 1V11B 1KYVA 1TA8A 3VZBA 1HF3A 4NQRA 1JIQA 2HMYB 5JJ5A 3JZIA 1GTG1 1NW3A 5AVYA 4K6NA 2JIZD 2H4XA 1N6KA 2DQYA 2M6RA 3WL5A 1W4ZA 3UFXA 1NUHA 4BFVA 5BW4A 2BGNA 2EYUA 5F3WB 4GICA 2J3MA 2IYUA 1QPZA 1TMKA 3A9SA 2KSQA 2W9BA 1JAYA 4YAJA 1P1RA 3V9PA 4PZAA 4HGPA 1GRQA 1Y3DE 4EQZA 2B1GA 1XTUA 4Q7MB 1B93A 1Z7GA 1G5QA 2OGUA 5ALYA 3FUXA 4HC4A 5JS7A 3ZH9B 1SCAA 2W2LA 4TZTA 2D00A 5LXTB 4KIUA 2HO4A 4ENQA 5LDGA 3DC7A 2JCXA 3C97A 2RKOA 4U6QA 3ADBA 1Z38A 4I7HA 3CZMA 3FTQA 3D2AA 1RZRA 2X6TA 2FFRA 2OP1A 4NBWA 2ZJ0A 1L9KA 3P0JA 1RPNA 4BO1A 1S2OA 3WDSA 4MRPA 1J70A 4H77A 3KB8A 1XRPA 3G68A 1Z73A 3GXBA 3W5HA 5FPQA 5B4TA 3TG2A 3ZW8A 3OLXA 3T1TA 3GMSA 4EA6A 2XTNA 3BB4A 4AO8A 3TRKA 1MD9A 5FBVB 2IH4A 1PF7E 5A2QW 1P18A 1TK3A 2I8LA 3RM3A 3T0FA 4AMBA 4X7PA 4JBYA 4EO4A 5MN6A 3OECA 5TJHA 2C2ZA 1IATA 2Q7OE 1JJAA 2O7NA 5KT3A 2X40A 2C58A 1PLKA 5CFRA 2VF5X 4LVCA 3T7KA 4PHHA 5AW7A 2W71A 3W04A 3GRRA 3S1LA 3AL0C 4HJRA 4R6XA 5IXYA 4EAAA 2ZULA 1ULHA 4R1PA 4PWQA 1K7FB 4LN1A 2RDIA 2GAOA 4N6NA 3WS7A 3LOUA 1XWWA 2POCA 1ICIA 2ES4A 4OU4A 3LUCA 3VRHA 1J2UA 3GJSA 2AFHA 3R9IA 2WFMA 3USZA 1QRTA 4HGRA 4TTPA 4LKRA 3OD5A 3A27A 4GHWA 2LD4A 3M70A 5KNBA 3L01A 4UHBA 4DWVA 1E3DA 4QDXA 3USES 4BVAA 4PG7A 4AYWA 4KDEA 4BQPA 5EJ4A 3I1JA 3D6AA 5G0VA 1HSOA 2P27A 1XCJA 3BIWA 3O47A 1PGJA 3BWMA 1EX7A 2Z9CA 3DM5A 4HPWA 3RSHA 1YC2A 2NP7A 2W6MA 2XMZA 5K0SA 4KEAA 2RKBA 2ZM6B 1PZXA 3K92A 1V3TA 2C61A 2IEGA 1OAAA 4A3GG 3OEHA 4RK0A 5AJZA 5TARA 2E21A 2O5VA 4NJMA 3F78A 4A16A 1UOPA 2W70A 4C21A 5JAUA 4XUDA 4GOKA 4M7OA 2FETA 1RAHA 4MP3A 4ALNA 1IEWA 2FRDA 2I33A 3BD8A 4KPUA 4TQRA 4FONA 3JZ6A 3WL3A 2W6CX 3CWQA 4ZO7A 2GLUA 2XIQA 3A28A 4UVDA 4K3UA 2ZXUA 4OL0A 5JMPA 4PXAA 4MV4A 5KFJA 4XLLA 5EQFA 2OYCA 4B7AA 1Y1VA 3AEKB 3T7CA 1UAGA 4FCTA 3QUTA 3BL5A 5ED4A 3H1TA 1GPNA 4EWLA 3OIYA 3D1JA 4RQTA 1H6AA 1CEXA 2HY7A 5LB4A 1UBMS 2O2CA 4FQ5A 3WLKX 1ZY2A 1WNTA 4ARUA 1N8TA 3CLVA 1I2MA 1M6VA 3JQPA 3NEPX 4ICIA 1W2WB 3JRWA 4UDNA 5GOTA 4WNYA 5HS6A 3IDSA 5ARBA 2NAFA 4LQCA 2C77A 4FHFA 3IQHX 1F2UA 1IN1A 4B6JA 1IRXA 3U81A 4K9SA 2XHZA 1R64A 1ZHFA 2WE7A 4Q7JB 2PXAA 3W1EA 5I4BA 2DBQA 5H70A 4BMOB 1D6SA 1N2EA 1SPXA 3DEAA 1TMYA 4F45A 3VKGA 4Q93A 3HUTA 1O1YA 1ZGBA 3KQSA 4MVYA 3O8LA 2AIRA 3HY3A 4L5BA 1YS1X 1G21E 1CKNB 4ND5A 4U5XA 3GH3A 4OEHA 1VBFA 2WF8A 4N1AA 3IJPA 4B8WA 5KYGA 5JLAA 4R8UB 5FUYA 5B1SA 3WLNA 2QEQA 2D7DA 3BMXA 2A7QA 3OE5A 5FRDA 3HU2A 4ZFNA 5ECYA 2GNAA 5KNDA 1L5KA 4M7PA 1JF8A 1JQAA 3RSGA 3B52X 1I10A 1KSJA 2VDRB 2ZK7A 1A8IA 1FXSA 4EP1A 1PZHA 2YV3A 4A2CA 5D2CA 1QX3A 3MT0A 1X74A 2VRCD 2QMUA 3C5WP 3S27A 2R84A 2O9JA 1U5CA 2VLIA 2NUPB 1HURA 1E2EA 2GM4A 4FM9A 2IOHA 2A9KA 1UKEA 4GPZA 3OIDA 4BX2A 1FSGA 1OTXA 3F1LA 4M86A 3ZKWA 1B14A 1J7JA 3PUHA 1NXQA 2LKCA 3H6KA 4FIDA 2ZSKA 3CS3A 4XB6B 2ASVA 4PAGA 3RVKA 4WXPA 3GFFA 1ZZGA 3ZBPA 3PIDA 3VPXA 2Q3JA 1WB6A 3D6UA 3QLUA 2XNDD 3QKSB 3WGJA 2IYAA 5CRIA 1JIIA 5EHNA 3FTFA 3EWNA 4QSHA 4LRQA 1Z68A 2CFOA 4KQIA 3R0IA 1VCIA 4R1LA 1GILA 3AO0B 4UBIA 1RPTA 3SC4A 3UV3A 3RD5A 3GT0A 4J9PA 4EIWA 4HCJA 4YRTA 4MPPA 3G82C 4MPRA 2C4NA 1F2TB 1H1DA 1BMFD 3PNSA 1E69A 1YQDA 2QTCA 4L51A 4E21A 4IBOA 3HXMA 1XR3A 4HEQA 2NZWA 2C7PA 3O8BA 2VT6A 2EBHX 4QFDA 3OLCX 4KIJA 1SCUB 3AEXA 2GEDA 1JL3A 4PZUA 1UKVY 3EZ9A 2AJCA 2ZE7A 1LZKA 5BPHA 1W4CA 3SI8A 1T5SA 4PW0A 3SHFA 4M21A 3K9CA 5KG0A 4RO0A 3MGAA 1RYZA 5BWCA 3KR0A 3QI2A 3RSFA 1WPGA 3CYFA 1AXRA 1ZI9A 4NPHA 1GL6A 2I6UA 2YVUA 1B0PA 1OREA 1F6WA 4PIVA 1UXIA 4R3NA 3PJDA 1QIIA 1NFRA 1O94A 3HKDA 1GSHA 1U2DA 1MO2A 2VKQA 3JAMW 1GNVA 2C83A 3UHPA 3Q8KA 1LTKA 2NUAB 2HCJB 4IFIA 5LM3A 1P6XA 1XZPA 3O4GA 1T9HA 5C1IA 1YVEI 1VBGA 3ZKAA 5FWAA 2LIPA 4F1WA 1T35A 3VR5D 5A04A 1J5PA 1KF0A 3AV0B 2ONCA 4LZWA 1PV2A 4HBZA 1LJLA 1I80A 4FOPA 4X0EA 5B2FA 4MOWA 1FDTA 5A0TA 4YV1A 3TMKA 4C4OA 1AE1A 4IXNA 5ALNA 1K0FA 8MHTA 2CB0A 1G6KA 2QN1A 1KH2A 4RB3C 4AZ0A 2B8NA 5FQOA 1Y81A 4YJ2F 1JU9A 3CUWA 2PTHA 3DL0A 4ID9A 2ZSHA 1VL5A 3T35A 3ASVA 4DIDA 1A9TA 4LWQA 1JHAA 3ZD7A 3VVCA 2NO9A 4MR7B 5F73A 2EJUA 3SJBA 4WCVA 1W5BA 1C50A 5DMXA 3BRWD 4X66H 2NXCA 1D07A 1PW7A 2C31A 3OMLA 3T3GA 3L8EA 5KYXB 4J2OA 4YRIA 4Z4GA 2ICAA 4I5GA 3SQLA 3JQ7A 4FN5A 1XEWY 2GAFA 4X6XA 4YV0A 4LSZA 2IZOA 1VYTA 5J58A 3OCXA 1V43A 1AD2A 5HKKA 2C5SA 5IWCA 4AN0A 3TX2A 4XJVA 1Y5IA 4O7WA 2OA0A 5EQJB 1LI7A 1NJ6A 3K5IA 1BU5A 1QKJA 1Z74A 2HO5A 4B44A 3FOWA 1FPQA 3WA6A 1GO2A 3I6IA 1FSZA 1CF2O 1FP1D 2GJ9A 3VPHA 4MARA 3E0XA 2P4HX 2NG1A 2WU1A 1G3QA 4BMNA 3SDSA 1FS6A 2WPDA 4V0MA 2AMYA 2FRXA 2NSJA 3TSWA 3RR5A 5JLJA 2PA3A 4PZDA 3ONFA 4YLGA 3G9QA 2OFWA 2ZJ1A 1N8KA 3DA8A 2VXYA 1VL1A 3MXOA 5JASA 1WQ4A 2HIMA 1B16A 3TL6A 4X5OA 2QRMA 3MINA 2O2JA 3HVHA 3PFFA 1C5KA 1T8TA 4WZBA 4AYBE 4M1EA 4PPFA 3HPRA 1NDUA 2RK3A 3DNMA 2EJ0A 1L8OA 1NBMA 3WK9A 2ZIEA 3NC0B 5EWGA 2WHYA 1FTWA 5FOQA 2R48A 2DY0A 4Y2XA 1EFKA 5LZ9A 3LF1A 3SGLA 2NVYA 2FG6C 1K1EA 5AM5A 1Y82A 2OO3A 2DPXA 5JY1A 4K9QA 3GLKA 4BASA 5JNUA 4B3RH 5ADHA 4Y6RA 4YRSA 4JBLA 2B6NA 4C0KA 4TWIA 1XZJA 3U37A 2OBLA 3TLGA 3QU2A 4S05A 1YE8A 1TAUA 2E5FA 4MRSA 3V4VB 2YV4A 1U3WA 1CRLA 4YXFA 2VBGA 4C9BA 1XEFA 1XBTA 3C70A 2TS1A 4QULA 4N3GA 1WDTA 3SMVA 1L4GA 2QQFA 4F3KA 3D7KA 1JEQB 2IUEA 3GEHA 4AZWA 2WB2A 1BA2A 2GCEA 3EEBA 3NBXX 4NVRA 3MG9A 3K1AA 5JNVA 2Q99A 1DRKA 3KUKA 4I4TA 3WK5A 4YT8A 4CMEC 4TT8A 3UMJA 1HTTA 2WE6A 2EF0A 5EUQB 2CJXA 3TUZC 1YMVA 1KYQA 3AU8A 3O8DA 1KIFA 4Z0PA 1U1EA 3FZYA 1XDDA 5IRCD 1HLGA 4PPYA 1N5JA 3JYHA 3RODA 5G41A 3KQUA 1ZAUA 1S9DA 3CLSD 5WRFA 3COVA 1EJ0A 3FPJA 3IO3A 5FOSA 1Y3IA 2JBAB 4TV9B 4I55F 1LNQA 2PWYA 4UVHA 2NUBA 3KSAC 4MW6A 3DO8A 1AKEA 2WTMA 4Y7CA 4WEQA 4EL0A 1OTHA 5C0OE 5HS4A 1W59A 5U9CA 1I51A 4I1RA 4HMPA 1DO0A 2LZ0A 4ZYVA 1I7PA 3Q9NA 3OD1A 2E4WA 4B6FA 2ID9A 2EJBA 1PBTA 3PUXA 2CCGA 1VMKA 4PZLA 4GX5A 2CLIB 3HL0A 4A6EA 4XX1A 5ITVA 2JFVA 4OQZA 5E2BA 2PG3A 2FLLA 1NJ2A 4BO8A 3HLYA 4IH1A 4JD5A 2C9DA 2Y6VA 5IKEA 1V11A 4Z54A 3LGXA 2NVOA 1RCFA 5DWDA 1YFLA 3T7DA 4OX9H 3CBGA 1RPJA 3UENA 4HWTA 1COWD 2PVSA 2ABWA 3WDMA 1TO2E 4UAGA 4WLEA 2FCAA 2HMSA 2K7FA 1Z16A 3OIUA 2P3QA 2B7CA 2XNKA 3N05A 2G9UA 2J3HA 4WOBA 4N5MA 4PBRA 2BSQA 5TVGA 4YRPA 4PZCA 3N2YA 4U2GA 4DC0A 4PZ7A 3BS4A 2EIHA 1PO7A 1AV6A 4AKEA 4O1IA 3IBSA 1N48A 3PENA 2HJGA 5LXTA 2JFZA 3RVJA 1QPGA 5ALDA 4HO1X 2FK1A 1PHPA 4IXMA 2WTAA 4I6EA 5IWAH 5EWEA 3IHTA 1EQ2A