3VPDA

Lysx from thermus thermophilus complexed with amp-pnp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
281
Chain Sequence
MLAILYDRIRPDERMLFERAEALGLPYKKVYVPALPMVLGERPEALEGVTVALERCVSQSRGLAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIGSWGRLLAKVTDRAAAEALLEHKEVLGGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRRSAHWITNTARGGQAENCPLTEEIARLSVGAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILRYAWEVARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein S6 modification protein
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 86
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 6.3.2.43: [Amino group carrier protein]--L-2-aminoadipate ligase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3vpdA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpdA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpdA01
4J6EA 3N6RA 3ORQA 2YZMA 1BNCA 3BFPA 1CQJB 5DMXA 4IWXA 1PX2A 4TV8F 4YAKB 4C5AA 4C5BA 1T36A 1JDEA 3U9TA 5BPFA 2IP4A 1DV2A 3RV4A 2R7MA 4HNTA 5LXTF 1M6VA 2R87A 2SCUB 2NU6B 4ME6A 1IOVA 4WBNF 4YB8B 2W6NA 3JRXA 2PN1A 5J2TF 3I12A 3BSSA 3TQTA 1KBLA 2CQYA 1KJJA 2R85A 4YJ2F 2PVPA 5K2MA 3RFCA 3ETJA 1JDBB 1KJIA 3TIIA 5HV6A 4O2AF 4M9UA 4EGQA 3V4SA 4IHJF 3R23A 1E4EB 1I7LA 4EABA 2DLNA 2V59A 2VR1A 1UC8A 3R5FA 1JLLB 2FPGB 3ETHA 3JRWA 2V58A 3G8CA 4DLKA 3OUUA 4M99A 1KEEA 2YRXA 3WO1A 1EUCB 3QFFA 1SCUB 1EYZA 1IOWA 3OUZA 2GPWA 4MV6A 1KJ8A 5H80A 1C30A 4C5CA 5HBRB 4M98A 1EUDB 5LYJF 1VKZA 2V5AA 5JQWA 4XYMB 2W6MA 4EA7A 2VPQA 4RZQA 5EZYF 1W96A 2DZDA 2R82A 3MWEA 4TUYF 2Z04A 3ORRA 5JVLA 1C3OA 3VOTA 2R7LA 3HO8A 1KC7A 3N8DA 3Q2OA 3R5XA 2OLSA 1AUVA 3R5HA 3AW8A 4M9CA 4EA9A 1KJQA 2C00A 4HQ6A 4EA8A 4I4TF 3E5NA 2VQDA 3LWBA 1B6SA 1KJ9A 1CS0A 2DWCA 4ZI7F 3LP8A 4FU0A 3BSWA 4GGMX 4ZHQF 1VBGA 3VMMA 3U9SA 5C1OA 4MV4A 4MV8A 4O4IF 5I47A 3GLKA 3HBLA 2X0SA 5IYZF 2W70A 5JVDF 3WNZA 2R84A 3V4ZA 1JKJB 5CAEB 1I7NA 5J2UF 4XYLB 2NPOA 3HB9A 2R7KA 2VHEA 4QSHA 4O4LF 4MV7A 2W6PA 2QK4A 3K3PA 3JZFA 2I80A 3TIGA 4IZOA 1GSOA 2YW2A 2CZGA 2P0AA 4DIMA 4EAAA 3RV3A 1EHIA 3GIDA 4MV1A 2FPIB 4ZQIA 5GONF 3AX6A 2W71A 2FP4B 1B6RA 5C1PA 4WD3A 5LP6F 3G8DA 2ZDQA 5BPHA 4YAJB 2R86A 5CA0F 5LOVF 1AUXA 2ZDHA 3JZIA 4EG0A 5C8YF 4TV9F 4MV3A 1GSHA 3MWDA 5LA6F 2YYAA 2R6FA 3Q1KA 2YL2A 3TW6A 1CQIB 2YZGA 2HJWA 1VBHA 2FPPB 2QF7A 2GPSA 4Y8VB 1GLVA 1DIKA 5JH7F 1GSAA 2NUAB 2NU9B 3K5IA 1WR2A 4YJ3F 4XZ3B 1EZ1A 4I55F 4XX0B 2YS7A 2PBZA 3TINA 1PK8A 2NU8B 1UC9A 1BXRA 2YRWA 3VA7A 3BG5A 2GLTA 4O4HF 3BSYA 4YBZB 2I8CA 2YZNA 5D8DA 3VPDA 3WO0A 2W6QA 1ULZA 5CB4F 1E4EA 3MJFA 4E4TA 4MV9A 4MAMA 4IWYA 5KX5F 4O2BF 2ZDGA 2NU7B 5KKNB 3SE7A 3VPBA 2W6ZA 4L1KA 2XCLA 4ZOLF 4HR7A 3K5HA 4MA5A 3UFXB 2J9GA 4HNVA 4I50F 2W6OA 4HNUA 1DV1A 2FB9A 4MA0A 3VPCA 1GGOA 2R7NA 3RUPA 2XD4A 2YS6A 2I87A 4EGJA 1CE8A 2DIKA 1W93A 5CA1F 1A9XA 5BMVF
chains in the Genus database with same CATH superfamily
3PFHA 4XYMA 4YY3H 1VAJA 2RGRA 4H18A 4PTYA 3VPSA 1NMYA 4MUHA 3U0GA 4KXUA 2HBZA 3SMQA 5E38A 4P7KA 3PD1A 1OH8A 1Y8RB 2OPHA 5HFNA 5AOAA 2O8DB 1J5EH 2R4QA 1JHPA 1M8GA 3VDNB 2XZDA 3C8UA 3N8IA 2XA9A 4F1JA 2EKQA 1J8FA 3L4BC 1GAJA 1OGIA 1KJJA 2XGGA 3B53X 2HGSA 2CW7A 3LBFA 1L4FA 1QQ7A 4FMBB 5B37A 3R0JA 1T0PA 5IW8A 1GXSA 2PK3A 1H2XA 5LU9A 5JZBA 4EBEA 1D2GA 2VJOA 2R11A 2RGEA 4CM6A 3JZMA 4MKIA 3TNDA 1BS2A 1II9A 5BR8B 3KUKA 4U7HA 1XNRB 4G36A 4CEHB 4RTLA 3DKRA 4LY6A 3R74A 1RLTA 1TRHA 1SULA 1JLLB 1V7QA 5DM1A 2DFDA 5ULLA 1ZMOA 4H1HA 4LFBH 4N5NA 4L3VA 4B6OA 1YOVB 2RHBA 4OI0A 1NLFA 3TNFA 3BWDD 1DEKA 2X76A 4CMFA 4Q18A 4QJFA 4H35A 1N1DA 4Y0AA 4ZAGA 3U3ZA 1D9XA 1FYFA 2ZJ2A 3G88A 2WI8A 5EZQA 1ODFA 4B48A 4BEWA 1ZUWA 2ZRKA 4IRXA 2B8EA 2BGTA 1JDTA 2IXDA 2ZS8A 1XYYA 4II7A 2GNOA 2Q9AA 2KLHA 1QF6A 1XEXB 3OI7A 4BATA 1G2IA 4EW2A 2QD4A 4CM8A 4F1KA 1IK6A 5BYKA 1Z2OX 1QR2A 4BWGA 4F92B 2D74A 4C0WA 3DTVA 3WIDA 1CETA 2VUIB 3M49A 4I4TF 2B0JA 5I51A 4PYOA 4ENSA 3HCAA 4B9EA 3K8OE 3LWNA 2VBIA 2ZBFA 3PP8A 1SD1A 3JWIA 3AWIA 4BNWA 5EA2A 1KS2A 2X8JB 5F5LA 4RVSA 4Z51A 1AGNA 5LZ4A 5D3QA 2OKGA 4GZ3A 4G63A 3ZI7A 4A3FG 4MWDA 1YB2A 1YRAA 2CNUA 2BTQA 4LZZA 2QUKA 3QOYA 4X60A 2I80A 4NV3A 4HC4A 3PC8C 5KYXB 2NN3C 3Q8LA 1P0QA 4ZYTA 2XPCA 2WSIA 1AUPA 1R6XA 1XP5A 3ZZNA 2JH3A 3AR6A 5IBQA 3MTBA 4J75A 1MX5A 3EMVA 4C3UA 1LWNA 2IA5A 3U37A 2E55A 3JYHA 1ZRHA 3EC2A 4DCCA 4TMXA 3CZQA 4ILEA 3F71A 3PB3A 1CUAA 2QZ4A 4M0CA 1C80A 2PUTA 2NUPA 3R7SA 1JHOA 2VJMA 2BQUA 5JOQA 1G6OA 2KLBA 2XCAA 2X0FA 3NKVA 1DWOA 3SF0A 3NHKA 3WQRA 1GQFA 1SHJA 3J81k 1ZCJA 1DRVA 3U4GA 5FFNA 4DA0A 5A5GA 5F7JA 2P9CA 3A6DA 4BCBA 2WPNA 2RHLA 5CURA 4TYQA 4GI3A 2X58A 1P16A 1P4SA 4XD2A 4C2UA 1XEFA 3QOWA 2IYEA 3DP9A 5IYZA 3MJFA 2A86A 2GKSA 3JAKA 3K73O 4GG1A 4XXHA 1YJBA 3A6ZA 4Q3CA 4I19A 1NW6A 3N7UA 5K1ZA 1T34A 1BN7A 1Q5PA 1MTZA 4ZV4A 1TCCA 1GNRA 3KHKA 1Y3AA 1MX3A 4BEVA 3JTMA 4D3SA 3EVDA 5MDHA 2IQIA 1P1JA 2X8LA 1KSJA 4ENTA 4DF3A 1RXIA 2LTAA 2PMZE 3PDHA 3E48A 4RKRA 2D2EA 1M66A 2WIAA 1U2QA 3DOFA 1GZHB 1VB3A 3TG8A 3DXZA 4YRKA 4RD0A 2RGYA 5CH5A 2WVJA 2JVJA 1OX4A 1XTRA 3DHWC 5D5HA 4YLEA 5G53C 2WAOA 1J09A 2XECA 4BMDA 3JVVA 3ZLBA 3I2GA 1KJWA 1ORVA 1P4RA 1K0UA 5HW0A 3KSBC 4OBWA 4YP6A 4D6PA 2F1OA 1XAHA 5FV4A 4P7FA 2Q3EA 2JFXA 1R6AA 4X84A 1JIIA 3FAZA 1YZGA 3ZU3A 3IE1A 2YBDA 2R3SA 4V38A 2R4UA 1XMOH 4KBFA 5CD1A 4EPRA 2C2WA 1E9DA 1JDBB 1YA4A 3JW8A 2AV6A 1SPXA 2E9SA 3DE5X 3SOPA 2JCVA 2HW8A 4JNCA 1PIWA 1I94H 1A8UA 4LRUA 1R74A 5TIIA 1MA3A 4NFLA 1I7LA 4NLGA 2F7SA 2JCSA 1N57A 6GPBA 2H9AA 4TM7A 3RU7A 4EZBA 2WABA 1G3RA 2JJMA 5ESWA 3EVFA 5C7IO 3NJRA 1QGDA 5C5DA 5B6JA 2KSQA 1H8ED 3K32A 4FBUA 2XHEA 1BCRA 2XE8A 2XOEA 5HJ5A 3RHFA 5LYJF 4CC5A 1HNZB 5C9ZA 1DBRA 1GPMA 2VTBA 4J1NA 4KE7A 4BNKA 1VP9A 1M75A 2GD6A 1VE1A 2ANBA 4EHBA 4WL0A 4WJLA 1HOXA 2WFAA 2H1IA 1YE5A 4HLUA 1AQ6A 4HLCA 2I1WA 3SZOA 4NOMA 2Z2JA 3VI4B 3Q8QB 4YCLA 3CB2A 3AY7A 1QB8A 4GMGA 1RS0A 3DBHB 5JH7B 1EJ2A 1WA5A 2GILA 3MR5A 1ZR2A 5JMPA 1F0NA 3GBVA 4BP8A 3WLNA 1J2JA 4Q8EA 2I2FA 1TA4A 1NX9A 4B83A 4JUIA 1QCZA 1JYEA 4DTIA 5FR2A 4U6PA 2W0MA 2LKDA 5HM6A 2O54A 2GZHA 3AF3A 1GAXA 4KXQA 2HO4A 1Y1WG 4JI6H 2RKOA 2QM8A 3GUZA 2IODA 1W1WA 2C7VA 4XA8A 3VU3A 2YZ7A 4WJKB 4AKEA 3WMGA 1M2EA 1E69A 4COOA 4EHNA 5CBPB 4W1PA 3K3PA 2WY2D 5BSKA 1B6TA 2D3WA 3UUEA 4J2TA 4RVOA 2X3YA 3L6RA 1VCMA 2I76A 4RX1A 4ABYA 2XV1A 3HI4A 4J3JA 4BZXA 3AR3A 4RLSA 3VU9A 5CCEA 3NRCA 4IIBA 2GAOA 2XBUA 2Q4DA 4O3RA 5BWMA 5CTAA 5FDFA 5AW6A 1LVGA 3T5PA 5HMLA 2UZ0A 4KGVA 2FPPA 3RG8A 2C3PA 1Q0SA 2JASA 4DVGA 3EF1A 3UMCA 3IRVA 3TGLA 5ERYA 3VU0A 4CZ2A 2AG8A 3LCCA 1H1TA 3X2SA 3OD1A 3KVOA 2HJVA 4FBGA 3TMAA 5DW0A 1QYXA 2FZLA 2XB4A 3AF1A 3OTHA 4TWRA 3WMEA 1DNPA 4JBLA 5E7IA 1UQRA 4J9UE 3WSVA 3DR3A 4UNRA 3H4MA 5CXSA 1Z6PA 4MI1A 3SXUA 5J2UA 3PC6A 1BRMA 3WP1B 3ABSB 13PKA 3IUPA 1T9HA 4ITVA 3A6EA 3N3AC 2HU7A 2AC7A 3O7MA 2F9MA 3N07A 4XIGS 3FVVA 2G04A 1JG2A 5F76A 1GEEA 2NZ8A 1EA7A 1IM8A 3C8MA 2XGQA 1TWGA 2A9KA 3ZVRA 5ALJA 1JMVA 3MJTA 1RE1A 3LMKA 3PHJA 3DMPA 4IS2A 2EKZA 3L02A 1HDXA 1WXDA 3DO8A 1VMIA 2QUBA 2D2XA 3DHNA 3GEHA 5IVIA 3AEXA 1UDRA 3BABA 1J8DA 1R6TA 3LK7A 5LLDA 4R1LA 1XQXA 4D3XA 4D46A 3K1YA 5B4UA 4EVRA 2W22A 4Y3UA 2ZKLA 3MGCA 1T35A 1RM4A 3TD6A 4RDXA 1A4UA 4KXNA 3C70A 4KAFA 4IDGA 2VK4A 3DL7A 3V8QA 3TSWA 3DKIA 4MVJM 2XNHA 1G16A 5JAIA 1WZNA 1C4XA 4X1OA 3RFCA 4NBLA 3EZ7A 1YRYE 5GGYA 1CK4A 1OXMA 3GDGA 3KC2A 4CODB 1M2HA 4R8UB 4A73A 2WLSA 2CLEB 1J00A 2EERA 4FNOA 3UKDA 3AO0B 5EWFA 3CMMA 2RAUA 5DZSA 2ZJ5A 8ATCA 3UXMA 1XYGA 4LJ4A 3TW4A 1WL8A 1CIJA 2HD4A 4RWZA 3WLOA 4K9RA 1E6MA 3ZHBA 1DDGA 3D2LA 1E1LA 4I8IA 8OHMA 4DA7A 3PV0A 2FLVA 2ISSD 3T1YH 4JV5H 4XQ9A 1H2ZA 1HBJA 2JAUA 5LBTA 1W0KA 2ODEA 3JYQA 4FMCF 2FW7A 3LVBA 5GIOE 4YRMA 4DBVO 4NBWA 3T5MA 2E2HA 4Q43A 3CUVA 3OU2A 3DDHA 1F38A 1W5SA 3MBOA 3RC7A 1AF4A 2VKQA 1ZU5A 4UOZA 4ZI3A 2B69A 1LF5A 4CG2A 4AQ7A 4DR7H 4L8GA 4OJYA 2LE0A 3BK1A 2D06A 2RHCA 1W52X 1NUQA 5DISB 3DZDA 2F1IA 2CYCA 1VPLA 4ZCPA 4EA8A 4YV1A 2JJ2A 5JRZA 2EXXA 1QYWA 2BUCA 1X14A 3SK0A 4PG5A 3K3VA 5BQXA 3MRTA 2ILTA 3C7TA 4RHFA 2I54A 1TMGE 2HSWA 4EB8A 3N8KA 1MH9A 5L40A 1I7NA 1SIOA 2I34A 5IAOA 4L76A 5IF3A 3EYYA 2GSWA 1WHSA 1N8TA 1T3HA 1GGFA 2MYNA 3AF0A 2Q0XA 5A06A 5CCXA 2CZGA 5IBPA 1WULS 3A0UA 4EAQA 3JZDA 3QE9Y 4AO6A 2OHVA 2WSBA 1YK1A 1ENYA 1NVFA 1VLHA 2BW0A 4UAVA 4H3VA 1KFKB 3QEJA 4EKNB 1ZBDA 1TQ2A 4Q0MA 1G8KA 3IXMA 1DAIA 2FOXA 2Y2UA 4YCDA 2DE0X 2C4TA 1I2MA 4WHXA 1QFJA 2RGNC 4TUYA 2QMHA 4RZXA 1R9JA 5ARBA 3EXHB 5KZMB 4PZ7A 3MOGA 1DXOA 4A4DA 4LOAA 4IDOA 3MJDA 4XLTA 1THTA 2XCSB 1K88A 3AVPA 1YTLA 1BX0A 1P7PA 5KUTA 2VZLA 4Q4HB 1ZRNA 4DV3B 5BV7A 4MB2A 1N9GB 1YE8A 4FE4A 4B3TH 2I1VB 1IPHA 3UB3A 3RVNA 2G5PA 4S2EA 2N46A 4LSWA 4KYUA 4IWYA 1EVQA 1ORWA 2ZS9A 4O8ZA 4BV9A 2I2AA 1EDBA 1L5MA 1NYQA 4FDLA 5BSEA 4CW7A 1WH2A 5C5IA 2O20A 3WMFA 4MA5A 1SBNE 3FCAA 1DPFA 3RYFA 4GLJA 3T9BA 3RGXA 1PT9A 3M9OB 4UCSA 4BBZA 1CKMA 3RT1A 4IRUB 3TH5A 2JKVA 3ZYZA 3OIDA 2UVPB 2CDBA 3GWGA 3AM1A 2Y8EA 3IT3A 2HDWA 1P2TA 4R5MA 4JQCA 3GJYA 4ARVA 3LTEA 1DAPA 3FIUA 5E6UA 1RSZA 2HK8A 3WGYA 4MARA 2QXYA 1ZSNA 5HQ3B 3D4IA 5I7HA 1VBKA 5EWJB 4A15A 4RHTA 1EVIA 5ES4B 4H2DA 3RLIA 3UUFA 1LB1B 5CXUA 3FUWA 5J1TB 4J9OA 3IMKA 3EHDA 3KU1A 2H92A 5AK6A 4YY3B 4H6VA 2EYUA 1HTBA 1ZIOA 3GEDA 3OMLA 4CL3A 1G20B 1KO5A 2WM9B 3UG7A 1OT3A 2JEFA 1BMQA 1KJIA 5BV1A 2NO4A 4HZGA 1P5RA 4IHKA 5F1OA 1E3EA 2WTMA 1NRXA 2RK6A 4MVXA 3DCIA 4RSMA 3L79A 1UOPA 2H17A 2CJYA 3NCHA 1T3LA 2MTBA 2FE1A 2B99A 2Q4RA 5KC8A 2V59A 2IL1A 4IIGA 3UN1A 4QTYA 2WJ6A 5JXGA 3IXQA 1SUFA 2ADFA 3L8YA 1DUIA 4ZQEA 1JJAA 1OB2A 4HNAB 1VJTA 4KBGA 2YOFA 1BDBA 2EVWX 4UULA 1G2PA 3I32A 1RPJA 2VWHA 4XLZA 2BGLA 4RIFA 5DKFA 3OICA 1C0IA 3AI2A 1R10A 3O8QB 4Z99A 3P2OA 1HDOA 3ECCA 3B1KA 4I66A 3V8RA 3A4VA 1Y3IA 5LQNA 1KGSA 3UF0A 3IAM6 5KQRA 1BXGA 3VPAA 5C37A 1L7AA 3O8BA 1CLEA 1KC7A 1VFPA 3MWEB 4M1OA 3PHCA 4Q1VA 5JADA 4BU0A 1WXIA 4LS3A 1GPWB 2QY6A 1N4DA 1ACLA 1AS2A 2YV2A 3VMFA 2GWRA 2HWWA 3WWIA 2C99A 3DH0A 1JZQA 1YUMA 3N9IA 3OH8A 4FP9A 1Z7GA 4ZDWA 3VO9A 3HR8A 3FNFA 3ADKA 4J91A 3ANYB 1THGA 5EG5A 4G41A 4WH0A 2DCUA 4U6NA 3PYMA 4HVLA 4JFRA 3KL2A 3WWEA 4X1KB 2P27A 4IGEA 2LDXA 3CVYA 1C9EA 4GBGA 4KWEA 4M1KA 3GHHA 2XYGA 1OIWA 2QP3A 1QIMA 4JBHA 4G6ZA 5L3SB 4Z0PA 4YVFA 4JT9A 3L41A 4QO8A 1FDWA 1DKOA 2XMBA 4O0LA 5CD9A 5G4LA 5F51A 2PKEA 3ZQJA 1VZ3A 1JHAA 3N2EA 1YQTA 4XTCS 4DQDA 4CMGA 3H5OA 821PA 3B5IA 1XZQA 3LNTA 1O6GA 1DWQA 2WAXA 2W2OA 5DDIP 2G9UA 4EB3A 1EFAA 4MR8A 1WX1A 3GJ6A 3DV0A 5CNKA 4EY8A 3EVAA 3EZGA 2C82A 3G1TA 1YONA 3JS5A 5BR8H 3WMXA 3U54A 1Q12A 1XNRH 1N5IA 3FZEA 3CLUC 3PRJA 2Z8YM 2BGNA 1Q7GA 4N6GA 5CDFA 4HEHA 2R93G 4OUDA 5AKJA 4ZO9A 2CF5A 9ATCA 4TTVA 2F4VB 1DBSA 3BRCA 4E51A 1PSDA 3PLNA 5CB4F 1JDJA 1W87A 4PHHA 1R4AA 2ZI4A 1MT3A 3PD0A 4IHJB 3FPCA 3R9WA 2OXRA 2V97A 3G0OA 3A1FA 4M55A 4WI1A 3OESA 4AJLA 5JNWA 5DBHX 2W6OA 2IW1A 1ZVKA 4ZVKA 4G0YA 3LBHA 4JROA 4AXBA 2R7NA 3TCKA 3KNZA 2H2FA 4MR7A 5H9WA 3W8RA 2PFGA 4D80A 4NS1A 4IG4A 4BQFA 5HBRA 3USZA 3OVMA 4E30A 1E8NA 4K6OA 2WQ6A 4IX1A 5AHXA 3VR4H 1WOYA 1NI5A 4EEYA 2BONA 3UK6A 3PNKA 3PA6A 3I9LA 3FWYA 4XTRA 4IWXA 3D8HA 3NKFA 3WWOA 5CA0B 4FHZA 4KTVE 4UEQA 3WK4A 3KJHA 5GIPE 1CR6A 4D8XA 1CSEE 1TJ5A 2JAPA 4UPDA 5A3JA 3FHTA 1NR1A 1JPUA 4HFRA 4TMZA 2MSCB 3OPNA 1T2CA 4ZJPA 2B8NA 3HXMA 4F56A 1V1RA 2Q6LA 5K3CA 2IX3A 3I72A 4GZ5A 4U7PB 4HYQA 1LDYA 4RZUA 2OBFA 3N58A 4MYUA 1LY1A 2NVUB 3OG9A 4O2BA 4J7XA 3T9AA 2PXHA 3R6TA 3ND7A 4YYEA 1ZMXA 3E9RA 4UDNA 4CIXA 2O5EA 4ZRDA 5AM1A 1C2YA 2WKWA 1I3NA 2DPXA 1M6YA 1XZLA 4WLFA 1NBEA 2BKAA 3TOCA 1RPNA 4KV9A 4TWIA 3JQQA 4Q7JB 2W00A 3WKEA 3CLUD 4W6ZA 2CC2A 5L1KA 2OO5C 3VC2A 3O8LA 2YY6A 1WM1A 3KETA 1FFBA 2AZ4A 3W1BA 2LW7A 1IN5A 4PBSA 1IBMB 2QVZX 3R4CA 1IOLA 2FI1A 4L7QA 3VPHA 2R8XA 3TW8B 1MAHA 2NQ8A 4NFYA 2G9NA 3FWHA 1M2GA 4TMFA 2WYIA 3O3NB 5FUVA 3R5XA 2CXRA 4LDNA 2M05A 4DJ5X 3COVA 1AG9A 4ZCSA 1TZMA 1WBDA 1JHMA 4RVNA 3ND9A 3KLNA 4UUAA 1U6JA 4O33A 3N2KB 3P0EA 1XDNA 3TPZA 4JUBA 3RUCA 1T9BA 3N43B 4C08A 1RWBA 2ZB7A 1RCTE 1N6HA 4GVPA 4B7UA 1NJ8A 3KUDA 1ONNA 3EPPA 5AIBA 4TTRA 4H0NA 4B73A 5KWIA 4D7AA 5HUJA 4BIIA 3F4LA 2BEKA 3VZRA 5EWGA 3WK5A 1IXSB 1G3UA 1V7ZA 3CE9A 1DKMA 3BBPA 4NHOA 3TXYA 5CFNA 3X1ZA 3VR5A 2QPAA 3QXSA 2GESA 2E89A 2ZIWB 2KJQA 4TVOA 3X44A 4MVJD 2PJDA 1I5EA 1S7GA 4OJKA 2JIRA 3GTJA 1LLQA 3RJ0A 2C2XA 2OV1A 4QWEA 2JD2A 2EV9A 4A3DG 1Z17A 1Z0IA 3VO1A 5KIAA 1FSGA 4QATA 2AG6A 4EYKA 4D02A 5IXSA 2VCHA 3F4BA 3ICOA 3WQBA 5SYNA 3T54A 2HJWA 4FXOA 2X41A 2WHPB 2AQKA 2YMPA 4YXWD 4F4WA 5KT7A 1KP9A 3W1VA 3EMKA 4U5XA 1HK7A 2ZBGA 4A6PA 1LTHR 3O1IC 2AN3A 5KSZA 4I55F 1K3FA 1ZJ6A 1S3IA 6NULA 3W5CA 2FYTA 2PGAA 4DL6A 2V7VA 1PEYA 2QXTA 5KHAA 3V9PA 1Z0AA 1XZPA 2FDCA 1YDHA 2QYZA 2AC2A 4KQCA 2GAJA 2PZAA 3BQNB 2PUHA 4OXKA 2FPGA 3ECAA 5FNZA 3FCXA 2ATCA 3FNIA 3FYUC 2BWJA 4E5NA 4LKOA 3UFBA 3P94A 1II0A 1V71A 2QR5A 5LJIA 2GGSA 3ACCA 4C29A 2W83A 2D00A 4B87A 2FHSA 1Q83A 1SUCA 1XEAA 4G2NA 3UJDA 3FX2A 4MS3A 1YJAA 2VI5A 4TYMA 4Z4CA 1TMKA 1Y34E 3IDZA 2Z95A 2HHAA 1RKBA 4YWJA 4FR2A 1IZ7A 4KXMA 5DV9A 2XLCA 3EGXA 4LZAA 3FI0A 2GHTA 4JKYA 1NN1A 2G1UA 1E4FT 1P9LA 2XDQA 4OHKA 5KYWA 4R3WA 3BGIA 1P17A 3WNVA 4ETWA 5I48A 3V6JA 1JMYA 4YJDA 2BFEB 3CX7A 4PSDA 3UQ8A 3PRYA 4Z9YA 3M4YA 3KQWA 1NOJA 2GOYA 5LSAA 3PE3A 4EYEA 1DX6A 3ONEA 1FIUA 4AXXA 3AFOA 2PXCA 3EGCA 2F55A 4HCJA 2O05A 1B2RA 2WAAA 2ALJA 4RD2A 6REQB 1ISFA 4KQIA 3G0DA 3IAXA 3R23A 4ND6A 1A4RA 1YA8A 2IE0A 4KH1A 4LWOA 3J80W 2L42A 2ZRDA 1NXSA 2CNQA 2I71A 2WE8A 1FL9A 1XFAA 4KQHA 1DC5A 4TYPA 1AY0A 1QQTA 1QPZA 1K7FB 1BAPA 4PGGA 1EJ0A 3VR2A 1Q1NA 4HZUB 3QEMB 3QEBZ 4XR4A 4FB4A 4AJKA 1MD9A 3QEAZ 2WWRA 1YS1X 1VL5A 1FTQA 2FSHA 3AR2A 3DFMA 3MMSA 4CJXA 4ZIRB 4FFNA 5JDCC 1NLYA 1ZCBA 4H4EA 1SUSA 4ZT6A 3K0SA 3GGJA 3DLBA 4BP3A 5C18A 3NH6A 3ZTYA 4X97A 3NHYA 4WY5A 3DEIA 5L3VA 1WETA 3VR6A 1QXSA 3FUUA 1GKYA 3NRJA 1P6UA 4BDSA 4Q19A 2ERXA 4F5ZA 3BMNA 4WKOA 1XJ0A 3IIMA 1JG3A 1KGDA 3NHZA 2W2PA 4R0NA 2DR0A 3H86A 2GBGA 1E79A 5EFOA 1D04A 3ZDXB 4Z4IA 5DM60 1UJ2A 4F38A 4CMAA 4LF5B 1DQPA 1PWZA 3L07A 4I8DA 2VOEA 1F8YA 3RU9A 2POCA 1DAFA 3GK3A 4NCHA 1KBOA 2QRVB 1L5KA 4JLPA 2Y4RA 1BWSA 2HMTA 1E1CB 3OT1A 3AUFA 3TLGB 2E21A 1ULAA 5DWDA 1L7DA 5DHRA 3I37X 3CUSA 1JHYA 2QE7D 1P19A 1NLUA 3K0FA 2HVRA 3FTNA 1JHUA 4P2BA 3ZDZB 4RFSB 2A14A 2F9LA 4GYJA 4S1VA 3T3HA 4BFWA 1CF2O 1PL7A 5DM4A 4L9SA 1QC5B 4DG9A 1Z62A 1N6OA 1QVWA 1QRDA 1Q3TA 1MN6A 4E5MA 2X42A 1QHHB 3QTBA 3V6KA 5JNSA 2ROQA 1UFQA 2QENA 3RAPR 3SS7X 3EGDA 1MUUA 3JALA 4YJ3F 1JS1X 4PHFA 5BRAA 3A2KA 2CLIB 2FSVA 3IOCA 3EXAA 2QX8A 1QM5A 1BU5A 5C5JA 3OMXA 1P1FA 2H1VA 3CIOA 1PYGA 2WIGA 4G07A 2I8CA 4ARZB 4O2AB 4TTQA 2A5FA 1GILA 2B7LA 1KA9H 1HRDA 3S1SA 1Z56C 1BOOA 3EUEA 1P45A 3OZIA 3UUWA 2JA6A 1T1RA 1FTYA 4MQ5A 1K06A 3A9SA 1X7XA 2OHJA 2R7AA 1DG9A 1I4WA 5HK8A 1GR0A 2FHPA 2VPSA 4NENA 1R00A 4RD3A 1MHTA 4O1IA 4EITA 3NWEA 2J3LA 3OF2A 1NQXA 1GPAA 3UMJA 5DTQA 4TVIA 5HHTA 1CE8A 2JFPA 3HSSA 1X2EA 1V47A 4G1VA 3SYKA 3TQIA 3OOWA 1ZD3A 1V0JA 1QSGA 1Z6XA 4X90A 3BWBA 4E13A 1P2BA 1EUQA 4NZYA 5DN9A 4MWGA 4FOLA 3ZGZA 3H2YA 2I2DA 4MYRA 3LA8A 2XQGA 1Y6ZA 3A70A 2WAQE 3E2PA 3K2IA 5LQAA 3OQIA 4LZJA 1YIDA 5E1OA 4ECXA 2J0UB 3TZBA 4DANA 2I4MA 2E87A 2IEYA 4KZKA 3BSSA 2R85A 3ER9A 1Z74A 1E2MA 4CKXA 2PWPA 1IN6A 1SC1A 3B2NA 2BR0A 4EGAA 5BW4A 2I66A 2P6PA 2YQZA 5YASA 3TIIA 2P1ZA 1EZZA 2QTVA 1PBTA 3DZHA 3WOVA 3ZEAA 5KFIA 4Y9UA 3VZSA 2XMDA 3DZBA 2M1ZA 4V3BA 2PS3A 3G5UA 1PGJA 2CZCA 3RS3A 5FWNA 3S29A 5FLKA 2FK8A 4LDQA 4EJSA 3DJYA 3GRKA 3GLHE 3L04A 1UF9A 1E62A 5KOYA 1SVWA 3HVUA 2D5IA 1YMVA 1A8HA 3CNOA 3RK1A 3VO8A 4ZI5A 2XIGA 4B6PA 2Q2NA 5TLSA 1L5LA 4S1PA 5JATA 4U7DA 4CTJA 3RM3A 5FLXW 1B8VA 4B3CA 2BGKA 1VCOA 3RC8A 5A71A 3C4QA 2QLTA 1CJSA 4WLEA 4QM6A 2I22A 2VTKA 3H0GA 3W3AD 4DV3H 3OE5A 4U8HA 2XW6A 5ITZB 1G42A 2I4OA 3CVXA 3O94A 2DPLA 4II3A 1XNJA 3WLQA 5I4IA 4G0PA 4IDEA 1V9CA 1CY1A 2NSJA 1CW2B 1UJMA 3FOAA 2C9DA 2I65A 4IP0A 5AVOA 4EJ0A 5EL0A 1FTWA 4ED7A 3PJDA 3DW3X 2WD7A 4FGUA 1FNNA 4C3OB 3JR7A 2EZ4A 3GPDG 1XDDA 4KACA 4GZMA 3KX2A 3RBZA 3MWJA 4OQXA 1YAJA 2JLVA 2LPMA 4EHLA 4XDYA 1NVVQ 1EX1A 4H1UA 2FZWA 3FYTA 3M6FA 4B3MB 2Y0CA 3IH5A 4ZZIA 3L1IA 1SQ5A 2QW0X 4MQEB 1T43A 4F4IA 1N2GA 1SUWA 1Y80A 1MIHA 3T34A 3W6UA 4K81B 2HC9A 4MRPA 5AJXA 1EXWA 1NX6A 5MGNA 4LZOA 3SQWA 1VRVA 2W8LA 3T7TA 1G2WA 1WCXA 2JA5A 2EKDA 3LUAA 4RD4A 1P4GA 5BYJA 4ZAWA 3NT4A 4M6WB 5I7AA 4QA9A 4BDTA 5L51A 4NATA 2FKNA 2BMWA 4ROTA 3MR3A 3D3EA 4L7VA 3U17A 5LD2C 4FCTA 2QZ9A 5EUCA 2GJ8A 1RQ7A 1E66A 1QP7A 2OOSA 1YU6A 1BRTA 3FWKA 3BIFA 3UT6A 1SD2A 1RXCA 5TEVA 3GLTA 1U9CA 1D2HA 4DMCA 5ELXA 3MRSA 3LUCA 1JKXA 1WR2A 5DSZA 4QO7A 2V7WA 1SYXB 2YS7A 2C5AA 4OXIA 4BB5A 4DTCA 3C97A 3P9IA 1EX6A 2G5GX 4JVNA 1WQ4A 2FLKA 2GEDA 2CLLB 4KK3A 3OQ1A 3JXEA 1ZQ7A 1Z6YA 1Q7TA 3DEHA 4YRAA 1W5FA 3VNAA 3H2GA 2GMWA 4JJ8A 4HR7A 5DLGA 4K6NA 2R00A 4U00A 3BFVA 5AJUA 3DGEC 4RVGA 1Z4MA 4R71A 3H9GA 2IZZA 4NZOA 4X5OA 1SOWA 4LGCA 2B7CA 4JJIA 4H1TA 2B6HA 4FYPA 3FTEA 4C5AA 3R5KA 2Y1FA 3IQXA 1DCKA 2V4MA 4B17A 1PNQA 4UCWA 4R98A 4JU8A 2HIGA 5IFKA 2H1OA 2JHCA 1P1IA 3LHFA 1IK4A 1U2RA 1JF8A 1Q0UA 3ZC3A 5H3HA 1IY2A 4UBKA 2ZE7A 3O4JA 4P5DA 5G4KB 3BWCA 4Z0TA 4O63O 1ECBA 5JSZB 1C7QA 1X3LA 5TQVA 3HY4A 3KJZA 2NACA 1FUIA 2HWUA 3TSOA 1XPOA 3NBMA 4P58A 4PYIA 4AZ3A 3ZWPA 3E22A 3HCRA 3ZE0B 1JA9A 1HA3A 4O84A 2IVFA 1KOJA 5FORA 4RAYA 3DQPA 5KG2A 3ZWOA 3RRJA 2BI8A 4V0OA 4WZBB 1VHJA 1QHXA 4PWQA 4RMGA 4FB5A 4DY4A 4RU1A 3HA5A 3TR6A 1OU4A 1XDUA 3UAZA 3KWFA 2Z43A 5IJZA 4D9JA 4IZHA 3W4JA 4DC9A 4FBTA 3MUEA 4MX8A 1H2YA 4XH9B 3LVRE 2RMKA 4F2HA 4WVLA 3OCJA 4CR6A 1AHHA 4ALJA 2FSGA 3T1QA 3MTQA 5K3OA 5F1PA 2QTFA 3DC7A 3F46A 5JVLA 4U6QA 2FDXA 3WHKA 1Y1QA 4P81A 2IX9A 5ICMA 2F4VH 3O31A 4F5WA 3CKLA 1G19A 3ZE6A 5KCMA 3IDQA 3QE2A 4NQZA 3QLJA 1MAVA 3ICQB 1U0LA 2P3OA 1M3SA 4IIDA 1WV0A 2I6QA 4LOLA 3D6TB 3L92A 1NF3A 3DAHA 2WIBA 3SF8A 1P18A 5CU7A 3H1FA 1GVHA 3IV6A 3M8KA 3MPOA 1OAOA 5BN3A 2GT1A 1G3IA 3O3OB 4D4HA 3T5JA 4FIDA 5ENVA 1QORA 4CM9A 1I6MA 1CZLA 1RYHA 5KAMA 1F8GA 1XDZA 5ALNA 5EPEA 1VLJA 3T5BA 3BIWA 5HTKA 3ZCUA 2R6HA 3B1FA 5DYIA 4RCNA 1UZNA 5FBRB 4KWTA 4YJHB 4OYHA 1PJQA 4ECAA 2V6JA 4ND3A 4JUDX 2ZI3A 4UDOA 1KYYA 3ETCA 4EPYA 1KWGA 1ABBA 2CK3D 3OAAD 4Q45A 2BELA 4IVNA 3N42B 4RQTA 2QMYA 3N44B 3IESA 4NH4A 2XZLA 4DV4B 3C3MA 2RH5A 1VMDA 1XTQA 4C6SA 1P2UA 3A14A 1XTTA 4UMDA 4NYMR 1U31A 4MGZR 1CS4C 1AKRA 1DOAA 2QMZA 2GLXA 1SZJG 4RA9A 3ZXSA 1SOVA 1DAAA 4H77A 2P6OA 8MHTA 3DE2X 4B3IA 4AO7A 1LD3A 2JGKA 3F49S 1KMMA 3A04A 3ZOZA 2GLTA 3OQHA 1BMDA 5KT2A 1WUIS 4G23A 4IHQA 5IKEA 2FMUA 2JW5A 2C5HA 5KAPA 1DL5A 4UTVA 5DPMA 4HYKA 3U3OA 3ABRB 4NV0A 1L5SA 4ECSA 3CEJA 3QPDA 1DBVO 1JLHA 3E7FA 5EHNA 5HE9A 1IBMH 5FQOA 2YWDA 1AKMA 3I39X 2BDUA 3SI7A 3IHWA 3MMPA 3R9IA 3W4KA 1YMQA 1MOSA 1WB4A 3ROZA 2BJHA 4QUKA 5BMVF 5JPIA 3OLQA 3ENZA 4ZV9A 3KQMA 5IEJA 1EP3B 3L7NA 1SQ0A 2H7XA 4BC1A 2J0VA 1HM5A 2OO7A 2OQ2A 5HOQA 3S7ZA 1QIDA 5BPFA 1CRLA 2MMCA 3UEOA 1TUBA 3WKCA 5CJPA 5H7XA 3G3EA 3RB8A 3OEHD 2E4XA 1NR7A 1G5QA 5TJHA 1Y14B 2HHHH 5MFZA 4ZTBA 2HQ1A 2OXIA 2W6JA 1CUZA 5SV2A 1VS0A 4K2HA 5DBEX 4XX1A 2P1RA 4C01A 5EMNA 3AKYA 4IJQA 1L5GB 1OYOA 1XTBA 2ERCA 1J0DA 2J3MA 2YMQA 3HYRA 2VA3A 5EWLB 2N1MA 1QGED 1K5PA 2H1SA 3MT0A 4LHSA 1OI3A 2G17A 2R7ZG 4NWIA 3JQGB 3KHSA 1YZLA 4EW3A 4U3JA 1H94A 2GPJA 1EFUA 2HG8A 1B93A 1RI5A 2YCLA 4MLDA 4NMLA 1NBHA 1EGHA 3AZQA 3UV7A 2WYOA 3ER6A 3LLMA 4G0XA 3MC1A 1GNPA 1H6BA 1NFRA 1CZHA 3QEKA 1KVQA 2BE9A 4E6EA 5FPYA 1CDOA 4MW2A 3ILYA 1H1DA 4WE3A 2ZRIA 1V26A 3ZY3A 2D0OB 1JXLA 1TM7E 3WRXC 1IJFA 5IJ0A 1C4KA 5L7TA 4XGIA 1I6LA 3Q2OA 2GJKA 2NU9A 3H5NA 1SFRA 3AYHB 3GLVA 1DBQA 4ZVRA 5JO9A 3CGWA 4PC2A 2V7QA 1VCHA 2QNBA 4M76B 2WPDA 2JIDA 3F5MA 4EB6A 4ZI7F 1WBJB 1N2IA 3LCMA 4UM5A 4NDAA 1IHDA 5KHOC 4QZVA 4BKRA 2W8ZA 3AEQB 3VKWA 1I6UA 5BVHA 4DNXA 5T67A 2FTKE 4Y1FA 4XDGA 1O9HA 2VAVA 2A7XA 3ZI0A 4D5EA 3NC0C 1JKJB 4P0PB 1HE8B 3KV3O 3GT3A 5H3LA 1U0HC 4DXAA 3W5AA 3FPAA 2B35A 5KFNA 4WAUA 4YMGA 3FKSD 4BQRA 1RYNA 2PWAA 4A2QA 3IAEA 4EKGA 2Y6VA 1F20A 1W5TA 3CJQA 5HDQA 5TR9A 1Z2PX 5IT0A 1CHDA 3ESBA 1P0CA 1QVRA 2AWNA 4N03A 3KJIA 3ZD9A 2CJWB 3QVUA 1Y4DE 4HUTA 1QRTA 2WM2A 2QNIA 3DAYA 4RUKA 4Q1AA 4R2HA 4AULA 3RGGA 3CEMA 5HKAA 4MV3A 2RCNA 5EYPA 5H81A 1Z13A 2QPTA 4EG4A 3H8SA 2R6FA 2YXNA 5L53A 3OETA 3MOSA 4YB8A 5FJIA 3HUFA 4PZAA 1X1RA 1E2LA 4MCIA 2YZGA 4Y2PA 1JH9A 3QG5A 4L22A 2XUOA 2B8WA 2ZU6A 2ZWPA 1JWLA 1RHQA 5LDDC 4QLOA 1WEKA 3KYIB 2CFOA 4KO2S 1COWD 2JA1A 1ZNQO 3PLRA 3AETA 4RTMA 3FLEA 1YDGA 4EL5A 1UBCA 4JIGA 3G0CA 2GN6A 5I7UA 2ZBRA 4NU6A 4PHCA 2IF0A 4NJEA 1NDUA 3ICEA 3IEPA 1TJNA 5HOEA 1E3WA 2ZTLA 1NUSA 3LQFA 1C7IA 2QVXX 4ECTA 3E9NA 5E0OA 1BFDA 1TRKA 1YJCA 1CX9B 1HETA 2IKQA 1T25A 2EKBA 1TLLA 1CTQA 5HZHA 2GK7A 1WO8A 2VHVA 5DN6D 2J9ZB 5DCWA 3PXGA 3ELUA 1MPTA 4R7GA 3VSDA 2Q4EA 3GRUA 4IR1A 2ZJ4A 4TV8F 3SHQA 4HAZA 1YRBA 2IDKA 4Q44A 4F71A 2G6TA 3S1AA 4X3OA 3K6JA 3FJOA 3C24A 2P5SA 3MMZA 4B3JA 2W0SA 1Z0SA 1V25A 2R8EA 2JARA 5AXDA 1IATA 4DVJA 2JKZA 3A6JA 3ZHCA 4LF5H 3VZDA 4O7ZA 3R6GA 5KKAA 1GFSA 4Q9IA 3NORA 4D56A 4N7RA 4HB0A 4PAWA 2J6SA 3G2OA 1LSJA 4RVUA 4AZTA 2CHFA 5A7GA 2HEGA 4CMHA 2FQXA 4PRKA 1SVSA 4HB3A 2I2WA 5FWXA 1RYBA 4HWRA 5FO0A 3WL7A 4GICA 4HI0E 4JEUA 1JXMA 4HKTA 2FE3A 4KLCA 2YZLA 3MB5A 2EWVA 3KDAA 1CQZA 2OV2A 1TUGA 3VV3A 2FPIA 4R9RA 1G8FA 2ATVA 1EQAA 3ESRA 1EUCB 4UUQA 1N0VC 2J1LA 1PQUA 1S89A 1VECA 2PQ6A 3F6RA 3SM3A 4CT4B 2YIJA 3HDHA 1KDZA 2R8BA 3ZY2A 4GL2A 4PFQA 1ECGA 3LF2A 1EAYA 1I2DA 4M7WA 1MDBA 3NOVA 4LBZA 1YZ3A 2XYRA 3ZY6A 2K87A 1CQIA 3AVOA 1CUCA 3A05A 1TIBA 5IKOA 5G02A 1P2VA 2WKSA 2D4HA 1OZHA 3QVGB 4JB8A 4P1ZA 2ACWA 1ZL0A 2I7VA 3W6PA 5KTRA 1X7YB 2VCYA 3F2IA 3KKNA 3K96A 2Q2VA 3WY9A 5KINB 1JFFA 4EGCB 4FFRA 4Z7OB 3T06B 2DPJA 3HXQA 3I6YA 4CL8A 1WG8A 2O2YA 3U9SA 3B7PA 2D62A 1Z2NX 1MRZA 5A4MS 1CRWG 4BX8A 1JLSA 5CM9C 1CZOA 3QENA 4ENPA 4CETA 1PVDA 2H51A 2VRBA 2R4TA 1INLA 3C3YA 2WF8A 5BSTA 1RWNA 4N8SA 3CVZA 4BQIA 3KPUA 3FKQA 1YIOA 4ZU1X 1I3KA 2XIQA 1Z83A 4OXXA 3AV0B 3CE6A 3ZWBA 3QU5A 2AG0A 1TFRA 1NKSA 3LX4A 5FBWB 2D59A 1FLAA 2AT1A 2PGLA 2GTIA 3PHBE 3E81A 2A3RA 2ZIUB 1KI4A 2QR2A 2WU3A 3EQ2A 3DXYA 3L6BA 4NG4A 3DMRA 2QTHA 2JRCA 2MMGA 1J97A 4LMBA 5KTYA 2B1IA 3ANMA 3X1XA 1I2KA 3I4MG 4LDAA 1PEDA 1U7ZA 5KFLA 3U3DA 1IUNA 2AZTA 2WHQA 5F52A 3D5QA 2XBLA 2D13A 2IUEA 3L6UA 4HFJA 4CR7A 4OK5A 1NZDA 1OLSB 5TPZA 521PA 3F3MA 4Z0NA 2AU0A 4AQDA 4RLHA 2IPAB 2B30A 1PBNA 2IYLD 1YR9A 5KSWB 5AVRA 4KFRA 5C32A 1VLMA 3I6ZA 1U11A 5BQFA 1EWQA 4BKOA 2ZITA 2HSEA 4PLHA 1N6RA 2PT9A 5TQ2B 4FFOA 5E9WA 1Y9JA 1UJ6A 3UCFA 1Y4AE 4DBLE 3L0SA 5IYCG 1O57A 2OH2A 2VP6A 4O0MA 4KVAA 2OLEA 3HJUA 5GONA 4DQKA 4OKSA 4JLAA 4I99A 3PR2B 1NONA 3PCRB 4ZN6A 1P7YA 2VHYA 5EMLA 1L4BA 1XCBA 1JDEA 3QSGA 5TVGA 3BXFA 4TVKA 1E2QA 1N9KA 1O75A 1ZETA 5IT9W 5AM3A 3PW4A 1UK7A 2B2CA 4HNSA 1NXPA 1YBAA 2XTNA 2NXCA 2IPXA 2PUWA 4B3MH 5A6VA 3QG1A 3BICA 4G4SO 3HOVG 5KJ1A 3KQHA 1Q17A 4PZ0A 3I2JA 1JHVA 4UBLA 4LSGA 2HHLA 3A1CA 3HOXG 4R9UC 4EP1A 1YDWA 4G01B 4IRMA 1O96B 3EY4A 4K1XA 4ZPXA 4JZKA 2BQRA 5I5VA 1LC0A 1I14A 5BV8A 1ULTA 2XB2A 1N6LA 3P2JA 3QSYA 3JWGA 2V6GA 4AJPA 4FGLA 1SK8A 4D92A 4G8CA 4P3XA 4Z4QA 1QGUA 1FU8A 5IK2D 1I0IA 2QX6A 5CLQA 2QN3A 4KSCA 1W59A 2YXEA 1E2UA 1VQ1A 1D1TA 1K8XB 4OAPA 5GJCA 2HVSA 1XQWA 4REQB 3HL0A 1U1GA 2WVAA 5AJWA 4P7GA 3PIDA 3DBIA 1I7DA 4NABA 1R0ZA 3OKFA 4TXLA 1FS4A 2JBWA 1YC5A 2Z04A 1M0EA 1Q1ZA 3I9KA 1L7MA 3NYIA 2W9BB 3I5MA 4RV9A 2PRJA 3RAGA 3QX9A 3ES9A 2VHZA 4UNIA 1XZDA 3IQFA 3E8SA 4YMSA 1U2DA 4X61A 2D2VA 2YC4C 2H7YA 2ZSIA 3BRWA 3KT0A 4UHKA 2WG0A 1CS0A 1XLTA 1KYTA 4JL5A 3LP8A 3BSWA 1N1GA 4DL7A 3N2ZB 3OIYA 3BXZA 4D79A 3KXDA 3RVQA 3GB9A 4K87A 3T99A 4BFUA 1EK1A 2P6UA 3K31A 1EXMA 1N2HA 4L0MA 1YI1A 3RYTC 2JJYA 3DS8A 4DADA 4EDHA 4U5QA 4NNPA 2P0YA 2CVQA 4Q1BA 3HCPA 5FWYA 4Q4CA 3A6GA 1WUYA 1M2OA 3I05A 2YWRA 4H4CA 1ZGGA 4Q6WA 4DSZA 3MS4A 2OE2A 2WIDA 3V32A 4DFDA 3EB9A 4FFBB 3TG2A 4R2MA 4RF3A 2ZVQX 3R0XA 1SUDA 1A9SA 3PQ2A 2WNIA 1A5ZA 1QGZA 3GFFA 3ZNPA 3ETEA 1HNNA 4DB4A 1YQXA 4D5GA 1ZAKA 2P4HX 2HCFA 2E4AA 5FPQA 2WDTA 1C3EA 2AG1A 1TTPB 4OP2A 2OXCA 1GN9A 3IGFA 5HZMA 2Y1KA 4RTRA 4RCVA 1B73A 4LF8B 2YN2A 4GRIA 3HS3A 1P1HA 3VPGA 3IP5A 1O54A 3SI8A 4DRXB 2PWBA 3H99A 4EL0A 3R5SA 5DMHA 3BSFA 4V1CB 2DHDA 2QAJA 2DU8A 3WGVA 4QWDA 4YASA 4EF4A 1AD2A 3H0CA 4BJ5A 5AOBA 4YAIA 1FJGB 3VNVA 1Q3HA 1YSCA 3BA8A 1D1PA 1KZ7B 5I5EA 4I3GA 1XZHA 4FXPA 5KJCA 4DREA 2IHKA 2Q6TA 2DFPA 3D0OA 3EASA 5EKDA 1JGTA 2QV0A 2HOQA 3O4GA 4W4TA 1RFGE 3NXKA 5HIKA 5LWQA 4BYMA 4LXXA 3PYXA 221PA 1W36C 3U4HA 2RGAA 2G88A 4TV9A 3C7CB 1AHIA 4AURA 1UBRS 5BR1A 4S12A 4BPRA 4PRZA 1I1QB 4TMKA 5A6SB 5A04A 4HLQB 5KG7A 3FSEA 4PO1A 2IUTA 3REFA 4OAQA 5DK4A 5J5VA 1Z4JA 4ZT4A 5B64A 2A33A 2B5VA 3PRHA 4BJ1A 3CWCA 3BREA 1E9EA 1M2VA 3VYWA 4U63A 1N2EA 3DOCA 3MEQA 2VIIA 3N6VA 2G80A 1PI3A 2ZIEA 4X6LA 1VXRA 3EF0A 3B2QA 3WLJA 4F5DA 1N25A 1J7JA 1T2EA 5AXAA 1KO8A 1DJMA 1PNOA 2VNAA 3E05A 5GAJA 2EGHA 3DCNA 2ZTSA 2XXAA 3A0RB 3GPBA 2VJNA 1XKQA 1S03G 1MTOA 3AERB 1CUXA 2MOKA 2CHVA 1B7GO 2HHHB 3AP2A 4DC0A 4GX5A 3FA2A 3U7IA 2CDRA 1CUFA 3KVYA 1VL1A 2JBAA 2W2NA 4ZO6A 4DV4H 5ECDA 1Q2XA 1ZIDA 3GDFA 2C97A 5JJKA 1PGOA 1ECFA 3K9LA 2V4ZA 1R3DA 3AEYA 2HMVA 4JLUA 2KM1A 3LI2A 1CY6A 3BWMA 4PINA 1LTQA 1IOZA 4JP2A 2WIFA 5KU7A 1MAWA 2PSEA 1GCUA 4IIUA 1NJFA 4Q9AA 5FA6A 1OYVA 3LP5A 4WBNA 3JWJA 2WWIA 4KR2A 4DW8A 3C48A 5BN5A 5G3YA 4IYRA 5BT9A 5JY1A 2E85A 5LMUB 1JJBA 1ZN2A 4M0JA 3NI2A 3VU1A 4I9NA 4MIKA 3FLBA 2O1EA 2C88A 1HMPA 4PYMA 3T7RA 2IQ5A 3GNLA 4H6WA 4PSKA 3RS5A 3PLAE 2P5TB 4BRSA 1Z28A 4QHSA 1TA9A 2AMYA 1W36D 2X1VA 3ZCRA 2OQIA 2YJ4A 4UHFA 3VU8A 2Z8XA 1CDZA 4XRGA 4F9GA 4IUDS 4Q37A 4YV2A 3F8NA 4MV7A 2Y4OA 2CUNA 2OHOA 4QUIA 4IVPA 4AJEA 2GN9A 3EHEA 4BNFA 3SSAA 3P9YA 3ZU2A 5EHIA 5ALYA 4C1NA 4R01A 5H3CA 4MV1A 2PVSA 4Y9RA 1ZH6A 4EY4A 1RHRA 1JR4A 1NV9A 1YVDA 5C4GB 3BCRA 4A3JG 2V7PA 4YAJB 3A58B 3C1AA 3A8TA 4ZEXA 5C8YF 2PMEA 2JIQA 3D4NA 2COUA 5AK5A 3EIXA 3H8VA 1K86A 1OFVA 4GBMA 4MUBA 2BSAA 4IYJA 4U7WA 1Q1GA 5EP3A 1PE0A 3HKDA 5FOWA 2L18A 2VWGA 3E35A 2AQ8A 5B6IA 3D6JA 3GN1A 1GAQA 1PWEA 2AL7A 1Y42X 1PP4A 2RC5A 3UPDA 3ZJVA 3O47A 3O4RA 2ZAYA 4ENWA 3P4UA 2VT7A 4OQNA 5ERXA 4R2XA 4G5QA 3BIOA 3RB4A 4B76A 2HIMA 2YRFA 2XNDD 3HZRA 1OLXB 5F21A 4LF7B 1C9NA 3DT8A 4LQ4A 4XGRA 1NLZA 1LSOA 4BKQA 3O74A 5KS8A 1J2YA 1OH7A 3FR8A 1ZITA 4ALLA 1F6DA 3OOJA 3GEBA 2W57A 2R8OA 1ZHOA 4JGIA 3LUJA 4W5HA 4GLFA 2OCAA 3PNYA 4BFXA 1E8MA 1M73E 4J9QA 4LJ5A 1VIAA 3ZWNA 1PWHA 4HGZA 4MHSA 3RS2A 2W9CB 1RZ3A 2WVGA 1P0FA 4R7RA 1XL0A 3LUFA 1DARA 2C7GA 4BMZA 1DFGA 1LW6E 2X8AA 4M8SA 3CLKA 1SVLA 4X6YA 1W4ZA 5FA8A 4BNIA 5EJ6A 5ES3A 3PQDA 5IJ9B 3DEFA 1ANKA 3L7YA 2G7ZA 1KEPA 4QWBA 4NE9A 3L1VA 2HSDA 5G1PA 4OQEA 3U3JA 1VPTA 2P9FA 4GE3A 4JENA 1PJRA 4REOA 1XEWY 2FUNB 3RRFA 1R5OA 3GI1A 2G70A 3DLPX 1RI1A 4EELA 1KZGB 4QQFA 4ACBA 4D9GA 4FMDB 4NI5A 2WUFA 3CY6A 2JEJA 4KQXA 4P22A 2CYAA 3OO0A 3SKYA 1GVNB 4QARA 5T4EA 1ARZA 1QHGA 2ZUTA 3RU3A 3U4MA 5KFFA 3V4SA 3X2EA 1E3DA 2EBWA 3UHOA 2R8KA 2R62A 1EDZA 3DBRB 4L3WA 3WJAA 1L4GA 3UAGA 1WVGA 2O7QA 3CIFA 3OY2A 1EJBA 4C6HA 2VR1A 2VJLA 3WMWA 3U4QA 3GJ4A 2XA2A 2BFPA 5AVYA 1ST3A 2G3YA 4LH7A 3OQ6A 1Y3DE 1K5HA 4RB0A 2W6IA 1F3LA 5DYNA 4M54A 5LN1A 3AKDA 4LOIA 4H27A 3RFVA 1LH0A 3UWPA 5THXA 4EBDA 3I01A 3ADCA 4RA6A 1CJMA 1L4YA 1VKZA 3RE1A 3D3WA 5CGZA 4H7EA 4O1HA 3RKUA 1O2DA 2WJJA 3KS9A 1WXEA 4LMYA 3KKZA 3EPHA 2X7JA 2ID4A 5BN4B 2O2HA 4ECYA 3H2KA 1U8ZA 1NJSA 2AFIB 1L6IA 4L4XA 1PW7A 2NTVA 4MI6A 4CKWA 2CXSA 3ZNOA 1DP4A 1KP3A 4EVSA 1XHLA 1IE3A 4Q5IA 3TBKA 3IO5A 5KFMA 2GYUA 1PFKA 3ED5A 1BZYA 4BVEA 2FZ4A 4TKMA 4OEHA 5DSXA 1UMBB 4CLXA 4A3SA 2IEBA 3USES 3NNDA 2J8ZA 3H2BA 3AOGA 1E2GA 3FKIA 2ECFA 5C4MA 4WXRA 3QZ8A 4JV2A 3RK4A 3GFPA 3D4LA 1IULA 3ELYA 1M72A 2ZQ5A 2Z1NA 1WRBA 1TJPB 2IY9A 3NFYA 3TIGA 1DIOB 2F1RA 1ECJA 3IELA 2GO7A 2BFBA 5KFBA 2F1KA 4EPVA 1KK1A 2QMOA 4G0MA 4TLLB 3RAXA 4KX3A 1P6QA 4IIHA 1V5EA 1T8SA 2YYZA 2P40A 1V7PC 2DAPA 1Z12A 1M8KA 3A11A 3HJFA 1OR8A 3DFIA 4I1UA 3N41B 4LZWA 3S2ZA 3DNFA 4DMUB 3CRVA 3PPIA 2QMEA 2P9JA 4KKXB 4U7CA 3OJWA 3LH5A 1G55A 3G5AA 3ZXYA 5KOHB 5ADHA 5J40A 2CUKA 2VA9A 1TYZA 1E0SA 1SCIA 4NYJQ 1PS8A 1TCVA 1WZ2A 9ABPA 3E8XA 5KG3A 4EI7A 1VJCA 2FAXA 3VFDA 4GP6A 4EATA 5JZMA 4HRYA 3I9V6 1Z4OA 3LVQE 3VHLB 4UUOA 3QITA 4DM7A 4RK1A 4GGOA 3UJ8A 3CUTA 2AOTA 2GEVA 4ROSA 4G0UA 2UUBB 3CKKA 3KZXA 4AN4A 4JOSA 3DZ8A 5D00A 1QHFA 3HOYG 4HNUA 3L1JA 3C41J 2HMSA 5AHKA 5JNTA 4MVJE 4PX2A 4XCVA 2XD4A 1NQOA 2PPLA 1QQ6A 2NIPA 4CQLB 1UWLA 2HXSA 3SKVA 4P7BA 4QTXA 2FU5C 4BJ3A 4P3NA 3NC1C 4Y7DA 5EUMA 4HEA1 3T4EA 5LIPA 1FW6A 5BN1A 2AQ4A 3AB3A 4C5BA 4QUAA 5FHQA 3BAAA 2IW3A 2IP4A 5AW9A 3G8AA 3O93A 4HDRB 2R1VA 5JQGB 3M6WA 3V6HA 1QH9A 2F64A 2NU6B 4OX9Y 3AP3A 4AG6A 4ZODA 3Q0TA 3O2JA 4WESB 1STOA 1GQYA 2AHOA 4LV8B 4RPGA 3EGWA 1SKMA 2GF0A 1Z2AA 4ARBA 4JI3B 4BGIA 1P33A 3JY6A 3NNNA 3Q7PA 5TARA 5HE8A 2FX2A 1UWVA 3JVUA 2C1XA 2Y9PB 3GFTA 3MT7A 2X0EA 4YMLA 4IUYA 3T3OA 1FFYA 5FLXA 1NJGA 3NVAA 1VGRA 3CF2A 2G1PA 2OILA 3ZD6A 2A9RA 4KSYA 2EQBA 3HB1A 1VRCA 4C4RA 1OX5A 5DNAA 5IJAA 1VHLA 16PKA 2PX3A 5K6RA 4Y2QA 4R0VA 2DLNA 4OOFA 3IDSA 3DPUA 4QQRA 1ZNWA 3P32A 1GZ6A 4DLKA 5EKUA 4HQNA 3I45A 2AXQA 1RM5A 3MT8A 1Y5IA 3SNHA 3DCJA 1IOWA 2RGXA 4MQMA 2RDJA 2ETVA 1WDWB 5B7PA 4N40A 1ZM9A 1V9LA 3D7NA 2IHBA 1EVJA 3AHIA 4JX9A 1UDAA 5H4HA 4O4JF 4P4SA 4B3FX 2VSQA 4E12A 2XT0A 3DYVA 2XVZA 4NZ9A 4RE6A 4MGKR 3DZCA 4NTZA 4TN5A 1XO1A 4DCSA 2EDCA 3ZLUA 2ZSJA 2QSUA 4QXOA 3BZBA 5HZGA 1JEYA 5K0LA 4XD7A 4TLAA 2ZJFA 3C6BA 1Y37A 1ENPA 1ADGA 1B6SA 1MJ5A 2OZLB 2ZS7A 2PX2A 2R25B 1EKVA 1IY9A 1JA0A 3QFTA 4CIDA 4U2CA 2R6ZA 3SBOA 5AKHA 4H7PA 3UB2A 4HAVA 2OUKA 1JLKA 2GPYA 4A36A 4C7JA 5HJEA 3I2HA 4C7MA 4HD8A 3DEYX 5I9SA 3B38A 3LS2A 3A3PA 5JBQA 4E1VA 2XDYA 1JU4A 4OQYA 4KYTA 3QK7A 1Z18A 2YIVX 4H1WA 3ROMA 2FOLA 4PLGA 5JLJA 1LU9A 2BH2A 3DR5A 2OWEA 5ICGA 3OIGA 4AN1A 1UDBA 1NQVA 2Z08A 3WGHA 3TTSA 4CQMA 4M1MA 4KXFB 3AY3A 3MNFA 1OPXA 5BSWA 1KWKA 3NBFA 1O6BA 3ZUPA 4FI3F 5I45A 3ZNNA 1Y9DA 4F21A 4X7PA 2AN9A 5TDHA 4CNQA 1MV8A 3TDMA 1TZ2A 4PAMA 3QVJA 5KFOA 3PS9A 3ZHOA 4GR5A 1YL5A 3KHGA 2GM5A 1N2CB 5B1IA 3HKCB 4E7PA 1U90A 4A8JB 5CCDA 3VC1A 5AI8A 4MUAA 5JSYA 4LYGA 4YR3A 2HY7A 3QU9A 1MB9A 2XADA 5F5NA 3SLKA 2WB1E 5ANRB 2WUEA 3IDOA 1NUAA 3PFCA 5HKKD 4B0PA 3U31A 1BJRE 1OLUB 4QM7A 1FVIA 2VSNA 3G0IA 2WICA 1CP2A 2VH2A 3VNSA 3PFIA 2A5JA 1R50A 4D43A 4V0ME 5DGXA 4F6CA 3SC4A 3ELWA 2UZ4A 2CNOA 2LCIA 5AVZA 1XTVA 4G4IA 2BZ0A 1YJXA 4QOIA 1BDIA 1QTIA 1CIPA 5B53A 2R8RA 3AW9A 3RYCA 2DHEA 4UBJA 1BMTA 4ALMA 3GV0A 4WBXC 4R2JA 2WV7A 2R44A 1YDMA 2ZPAA 1X7DA 2J3EA 2R6JA 3T5HA 4A91A 3KOZA 4OQZA 4G09A 4NU8X 2J09A 1P1CA 1WABA 3C14C 1Q0HA 3PA8A 3K0AB 3BOSA 2C9MA 3R7NA 3ZE1B 3I5YA 3A9CA 1UINA 4AUKA 1TK9A 1F60A 1UBLS 5ARDA 1C7FA 2WQ7A 3EK2A 1IHYA 4R1QA 3AUYA 1X8XA 3GLFA 4BUZA 4MH0R 4N54A 2NXNA 3GWZA 3K6SB 4EKYA 2DETA 4UM7A 3W8FA 3CG0A 1SXJB 1SBHA 1J23A 2ZUSA 3C7AA 1VPEA 3RNLA 4QW8A 3IPXA 3FXAA 1NTRA 1T5OA 1S2IA 1NPYA 2VJPA 2F48A 1T3GA 3TMKA 2XR1A 1DAOA 4ENQA 4IILA 2NXEA 2HDKA 1WPXA 3JQAD 1FNDA 2O0JA 4J0HA 1WE2A 5I3CA 4ECZA 4ZALA 4DLVA 2H16A 3CKMA 4MPPA 4LF8H 2WJ3A 1LBSA 3GH1A 3EVNA 2P4UA 3WYFA 4AY3A 3DO5A 4LAFA 1E2JA 1ZK1A 1JEQA 4HLNA 3HO8A 1B15A 1P80A 1VSVA 4RB1A 1U0TA 1NIJA 3ZHXA 4DMRA 1M0SA 1IUOA 3O4FA 2D5BA 2P77A 2DKNA 3L5KA 1FJGH 1KYWA 4OJMX 2UXCB 3W5HA 2CLHB 3N0VA 2N0SA 2ZRJA 4YX9A 3H17A 3HJTA 3GUYA 3A1SA 1KQPA 3PF8A 1R6BX 1OBHA 5IKPA 1NPDA 2BT4A 1KVTA 4ZJYA 1I5RA 2QK4A 3I0NA 5JRDS 4AY4A 2IPLA 2XTMA 3STYA 1EINA 2P2GA 2ZAMA 4CF4A 5JCOC 2DFNA 4WCFC 3HNRA 5JAZA 6ADHA 1ACMA 3AJ8A 3IILA 2MDTA 4BO1A 4QUGA 2ZJ0A 5LQCA 2NO6A 3FDZB 3WWCA 2B4YA 4QOFA 1Z5PA 1W85A 5EE9A 2BKUA 2K4MA 1YB1A 4DV1B 1UOQA 4OHFA 2WHYA 1FX1A 3IIEA 1DU4A 1CUHA 4LYAA 4IJWA 2VYVA 3CR7A 1CUVA 3AU9A 4BNXA 4X20A 4Y8VB 4Z9FA 2JLRA 2P90A 1P9OA 5FR9A 4IMPA 1WDKA 3S2SA 3G82C 3QFCA 2NWQA 4DPLA 3EH1A 2IU4A 1QPGA 2PUCA 4AL4A 5T5QA 1O5TA 1IBRA 4FHEA 2B9VA 1J2UA 4AZ0B 5C35A 3A31A 4N5DA 3WTBA 1J90A 5EXEA 2EJBA 1W5BA 3G59A 3CC8A 2VDKB 3IAHA 3AJDA 2IEIA 3ND5A 4DR2B 4TSFA 3C45A 4EGSA 4U39A 3A7DA 3OE7D 3SIWA 2BFCB 1A7KA 3DBLB 1KU6A 3LE8A 5GM2A 4CV0A 1F4LA 2YHIB 4ZD6A 2HA5A 4LI3X 4ZP1A 3TL6A 1FJXA 3OCZA 1QIIA 2H4WA 1VYHA 1RJWA 5KFDA 4AY5A 3P0HA 4CM5A 5LMUH 4H6XA 4V3CA 4XRRA 3MQ2A 4EEQA 2IYQA 1JFRA 2VXBA 3NBUA 3RV4A 1R5NA 4KB5A 5LXTF 1U9IC 3QY9A 3REOA 1L4KA 1D4ZA 3U39A 4HAIA 5FL7A 4MNTA 4K2AA 3WK7A 2F17A 1EWTA 1NF2A 1GPBA 2Q6VA 3LPNA 2PVPA 5KYKA 1IVNA 3H9EO 5AKLA 3VSAA 5KT6A 2JFGA 1GL9B 3D2AA 5JVDA 1KDPA 2ZJ1A 4P4NA 1ZVJA 2ZJ8A 1Q3KA 4JX8A 2PY6A 3MGGA 3QX7A 1CG6A 4E03A 4N5LA 4X7MA 2VAXA 3KR1A 1C8KA 3H1PA 2K5UA 3CQZA 4DDWA 1G21B 1C1XB 5FIUA 3OZRA 1O0SA 3R09A 3OTQA 1CVLA 3OLZA 3MBKA 3DKVA 4J8PA 3IXLA 3KUUA 4ARAA 4GUAA 2VAWA 1ZCAA 2OV4A 2PKWA 1TDJA 1HDYA 2V6FA 4H08A 3DMDA 3ESQA 1YA6A 4ZQBA 2JFVA 3OTOB 1OAAA 1LGYA 2YWJA 1V37A 1U8EA 1F4PA 1CB7A 4L0DA 4U0KA 4EUNA 1TCBA 4RSHA 4ID3A 3TLXA 2HIAA 5EKTA 5KWJA 1QV6A 1IHXA 2BEWA 1N5RA 5LA6B 3ZYCA 3IVXA 2CL5A 3NBXX 1R4NA 4UQPA 2GBPA 4IHAA 4LF7H 1ELOA 1HDIA 4MXDA 3PNMA 3BHMA 1PFUA 2M6RA 4UE2A 4PW0A 3V7WA 3PXAA 4CXMA 1TM5E 3PFNA 2EFCB 4AP9A 1OBDA 3KKEA 1VMAA 4ZEWA 1N36B 3QW2A 3O8NA 1UKZA 2FUKA 4XIYA 1YVUA 2G08A 1CJBA 4INJA 3UWOA 5BSMA 2HK9A 3C43A 1D0IA 5D85A 1QVVA 2AFVA 3D6HA 1LX7A 1QGAA 2XB9A 5BWTA 3NHPA 3TTWA 3FMFA 2N47A 3IAUA 1Y1SA 4ZQFA 2BZSA 3RIGA 3COSA 4EYQA 3RO7A 3THYB 4AJIA 2WIKA 1RJ9B 1QS0A 1QIHA 4V0KA 3RV3A 4KWHA 3UAVA 1CQJA 4C0XA 5HVNA 1B76A 1N3IA 4YUZA 1FYDA 5CA0F 3OEWA 4JLSA 1C50A 1GPUA 4XE5A 3BFJA 4H4DA 3EMDA 4KXYA 1UFVA 2JK1A 5T8KA 4JI2H 2PX4A 3N86A 4YR2A 1P3JA 1RWMA 1DLJA 1SC9A 4YTEA 2ID8A 2RB4A 1KYQA 2C3OA 4IIJA 4GP7A 2RGGA 4IL5A 5BR4A 5FYQA 2PBZA 2F62A 1G8YA 3RBXA 3GFVA 3OC0A 1F2VA 1IXZA 4EQ6A 3JARA 1YR2A 1G4AE 3LBAA 4IF4A 3GCXA 4RTPA 3U7QA 5KKNB 4Z6KA 4JQYA 1UZMA 1IONA 3PZPA 4A2WA 3D4OA 1JTEA 3TQFA 4EMUA 4MUYA 4MRVA 2Q1UA 3OX2A 4BGEA 5DE3A 3EQZA 4NNJA 4A8TA 1G17A 4HDSA 3RIYA 1E98A 1RYFA 2WE7A 3DLAA 4ODIA 4EGJA 2D54A 2YVKA 2K2WA 1SURA 2NNWB 1G6KA 4HVAA 2ZBUA 4RHXA 4DL5A 1D5WA 1NLMA 1KAGA 4ZREA 4M4SA 5BNFA 4F60A 5KQMA 3GX1A 2WWXA 2CNLA 4QDKA 5DNYB 4PZEA 3NASA 4GECA 3ZD8A 3U9TA 4WOKA 2B8JA 5J63A 2VUHB 4PCVA 3FDXA 2IHNA 3SXJA 3U6KA 4UD6A 3LIPA 4YRRA 2DPMA 4H0CA 4QUDA 3I12A 3ZKWA 4ZT2A 2O8CB 3WBKA 3EZXA 5KFWA 1A1SA 3FPLA 2YCHA 2YWEA 4E11A 1NNEA 3S28A 4PSCA 2C5BA 3VTFA 3OLCX 2OECA 3CLVA 1HDGO 1X70A 3RTBA 4O4HB 3JQFA 4WZAB 5T6MA 1HZZC 3WYAA 4FZJA 3UY4A 3IKJA 1EZ4A 2V4UA 2HTEA 3D54D 5KG0A 3EEOA 4KDFA 3WGKA 1SCDA 4ERNA 5AW4A 2Q99A 3D02A 3L3BA 1AU9A 3IKMB 2PMZA 3R3WA 3EX7C 4FDMA 2HLHA 3MWLA 4A3EG 5FRDA 4KV7A 5T64A 5T3YA 1PDOA 1UBGA 3KQYA 4M0LA 2Q3LA 3OZ7A 1PYOA 1X1SA 4XYMB 2WP8J 1AS0A 4O3OA 3WLKX 1LLFA 3LYHA 5EZYF 1P5HA 1W0JD 3L6OO 5FULA 4Z9AA 4CWAA 1GTZA 5HX7A 5DVZA 3NJ4A 2VKTA 2JLQA 2VDWA 5EXSA 4MJ3A 3UHJA 3E1GA 2BMEA 2QGNA 2FK7A 5CE8A 2VQ3A 1AKVA 3TY5A 2JCGA 2UUBH 4RCYA 2NVXA 4ACAA 4DMMA 1F3OA 3UENA 4CPDA 4CUKA 5IP9G 1F1JA 1EWKA 3B9BA 1BX1A 3HKEA 1VBGA 1YR8A 4DV6B 4EX6A 1BW9A 1Y9EA 3GLKA 2SNIE 1I5OA 3LFTA 4QFMA 1QBKC 4WJZA 3P19A 3UWKA 3RGWS 1VE5A 2BVNA 2O5VA 5IDYA 4RGBA 1VPVA 1KZ9A 5I9MA 1S2MA 3TGPA 1WHTA 3IQEA 1AXEA 3D6FA 3ECSA 4LDJA 1U2GA 3KT8A 4W8GA 1JRLA 4HMQA 3FROA 2FSPA 1J0BA 2UAGA 4WXPA 2CVHA 2ZIFA 4ED0A 3BHIA 2GEFA 1SVOA 1UXGA 1V16B 1RI2A 2Z6QA 3GTOA 2DUWA 3BM5A 1K4YA 4XWYA 4WDQA 3GZTB 1P60A 4RYDA 2I91A 4JI3H 2I3DA 3WWYA 3WL5A 3A4LA 4G5OA 4MPTA 4PQYA 1PZNA 4RHEA 1C0KA 4GNKA 3AVVA 4TL9A 2CNDA 4H59A 2CFCA 2H4YA 4GM0A 4TTSA 3F3SA 4IEEA 2VA2A 2RONA 3UQYS 4JGGA 4RNMA 2EAUA 1GLVA 1U6KA 4QQ8A 4WGGA 5JTUA 4CM8B 3C5WP 1AKQA 2C59A 3EPGA 5KNDA 3RUHA 3DTVB 3HN2A 4KEAA 4A0FA 3PQ8A 1BHQ1 1PK8A 4LY3A 3GFBA 1PGQA 4J07A 3GCDA 4ZGBA 4DS3A 3RVMA 1DJLA 1FP4B 2E4UA 3ZKAA 3FUXA 2E5WA 4MIEA 3KDSE 1AN0A 1G1MA 1C1DA 3TZKA 2OCLA 5G0SA 4HYYA 5BOSA 4XGKA 2B94A 2VJYA 2J5QA 3TAXA 5IT9A 4R9VA 4G0ZA 2J0SA 2NPFA 2X8BA 3EPKA 2BTQB 3AEUB 2GEKA 2JGLA 4XUCA 4JR2A 5ALKA 1FFDA 4S3MA 3BQ1A 1KEWA 1PJ4A 5COAA 2YZMA 3C4VA 3VDXA 3DOHA 4EI8A 3RROA 2HH9A 1CUDA 5DYTA 4IKEA 2VP9A 5EMMA 3W2HA 2PL9A 3WJ1A 1C41A 3NV9A 4BIMA 4G1CA 3SC2A 3BULA 3LX6A 1AZLA 4LNUA 5AICA 4JC0A 3O84A 4D1YA 2HZBA 3KHUA 5DF1A 4XJVA 1CC1S 4E88A 3QU2A 4NV1A 4WCVA 2CXQA 3QPVA 3AGQA 2WU8A 2VJMB 4K40A 2CQYA 3NIGB 4AS1A 4YJ2F 5C34B 4EHFA 3WGUA 2IWRA 1AA6A 4RAQA 2ZE5A 4XSVA 5J4YA 5EMJA 2UVWA 3AMVA 3D6UA 1E9BA 3QELB 3M6IA 2P9QA 3LZCA 1TVKA 1ZOLA 4B3HA 1WCMA 4U8GA 3U3MA 2BKEA 4ZAVA 3LYLA 2A9JA 5IYZB 1QYIA 2VNIA 2REXB 4ND1A 1ZGAA 1Z0UA 3HBFA 1DQYA 4MRMA 5LU8A 1EM8B 2I4TA 4B33A 3IUMA 3LLSA 4K9SA 4EECA 1I50A 1AZWA 1FX0B 5K6AA 4F50A 2EJVA 2X1HA 2XMZA 4I4CA 4QIWE 3FMPB 4WNCA 4OI2A 3BL6A 5L3RA 2I7TA 2Z4TA 4MCAA 2AZXA 5AVUA 2WWHA 1VKJA 4NU0A 5I8PA 4F4HA 4LHXA 2JGJA 4B3SB 2HSZA 3UV6A 1T8TA 2DZDA 1E7YA 4JI8B 4PRLA 3NX4A 1C3OA 1MAAA 2L82A 2O8VA 3SQXA 4OJQA 4H6PA 1VJ1A 2WMOB 3QPCA 4JJKA 1GU0A 1YRLA 2W2LD 2Q8QA 4HB4A 3CZPA 4QQNA 4M9CA 1T1SA 4EA9A 3KP1A 3PNBA 3QJGA 2Y9MB 3D2CA 3TLZA 1RR6A 3OHBA 2IXTA 1Y1TA 4BZWA 1ZO8A 3O90A 3GTKA 4Y2UA 2EFHB 4D45A 4IWNA 4MAAA 4XVUA 3Q5EA 3JZ6A 2OBBA 2BFAA 2O1XA 5KMGA 3P5SA 4G0VA 5KSPA 1QRSA 1E99A 2PO5A 5BWLA 2ZYWX 1RHMA 1N8NA 4BVJA 4YCBA 4GEGA 4O4LF 3ISTA 1Y6JA 3C3AA 2FCAA 3ZX4A 5FTKA 3DE1X 3KQQA 1KPGA 2ZCUA 5HFJA 5E6RA 4Z3OA 1K2VN 1P9WA 3AHCA 3AJEA 2YV1A 3ZZ1A 1H2FA 4BFCA 5DG7A 2QAGC 4RIGA 3HR4A 4YROA 5GZ3A 1XHFA 1BCRB 4LBVA 1TTQB 3G17A 2ZYAA 1Y1RA 1CJKC 1O95C 5CR9A 3K1JA 2IITA 2BGIA 1YQWA 2O2ZA 2ZE6A 4J9SA 5DH9A 7ABPA 1NW9B 2JGFA 2J07A 3E4CA 5DX0A 1G9XA 1GRNA 1MNAA 3TUJC 4NCKA 3RR5A 2XNCA 5A1TA 2MSKA 1AF7A 3ANTA 1HFKA 3QKSA 4KVFA 3VKFA 4UHCA 3CUYA 4Z9XA 4CUZA 4N8DA 1Y1VG 2A0WA 4LYYA 2H1WA 1JG7A 1SKBA 3IV7A 5CDHA 3B6MA 4PSVA 5CLHA 4LYDA 5C44G 2JEYA 1TK3A 3NYRA 5D8DA 3SBEA 5L3ZA 1TU0A 2E37A 3BRSA 1TAEA 2Y76A 3RB3A 3IN5A 2D0IA 4RXMA 2I7XA 3KXKA 4EYHB 4QE3A 3E1KA 1K8QA 3TY9A 1GL7A 4B4OA 1UK8A 1THMA 5CDSA 4ZOLF 4ZAXA 1T4MA 3PG5A 1TPYA 5SZKB 3KYHC 1SKQA 4DGQA 3I5UA 3LRTA 1RD4A 1U28C 3HY6A 4MICA 4YP3A 1AK9A 1F8FA 2IRWA 1HX7A 1IVYA 2C4VA 2UVVA 2COGA 1JDBC 5DRYA 3S3TA 4EO4A 3ZHSA 4O83A 3SGLA 2Z2ZA 1U80A 1YQ9A 3DL2A 1KKMA 4EDFA 3NAMA 4S1NA 5KYYA 2AEEA 4NBRA 4TYYA 1SVIA 5DLQC 2UXCH 4MO9A 4Y1EA 5K0FA 2XAUA 2VTEA 3EZ2A 1B41A 2IP1A 5HILA 1N4AA 4CMDA 3CRRA 5IS2A 4WFIA 3BD6A 1UBEA 3S2UA 2PN1A 4FKZA 1AB5A 1V6SA 3V1MA 5K2MA 1JXOA 5IZCA 1ZAYA 2XYHA 3BMCA 3EC7A 1EFRA 1DQNA 2WF7A 4JQOA 1NAIA 2KS6A 4RWEA 4ZCIA 4W63A 3TI9A 3NVDA 3QUTA 1JAIA 2JFUA 4CU5A 4RGVA 1NUPA 1O95D 4TWJA 5ED4A 4BMXA 1IDN1 2YJTD 4KQWA 4QECA 2FK1A 1GADO 2XCUA 5J2UB 3RT9A 1OJLA 2I5PO 4RPCA 4RB2C 4E08A 3QYFA 1WXGA 3QMPA 2YY5A 3ZD7A 4HG2A 3SM9A 3DE7X 5AXCA 4DV1H 4BOYA 1TIKA 3FLAA 1KNQA 3K8YA 2JGMA 3PJRA 3QW4B 1R37A 1KZ6A 1SO8A 1LVUA 4YYZA 5KSOA 4URFA 1KEVA 1UKAA 3K09C 4Q00A 1NASA 4OHRA 5K0ZA 1KFBB 2YUTA 4TWZA 3KG2A 4N7BA 3LO5A 2Q7XA 3DSRA 2O0MA 1A98A 4O7RA 3M3PA 3T6KA 4L5AA 5AW3A 3PQCA 1M33A 3L8HA 2UKDA 4N3AA 2O2XA 1CV2A 4DSAA 1FFEA 1N77A 3ABOB 5B55A 4MJ7A 1KDRA 1MB4A 3BGSA 5K0SA 3TL3A 1G6Q1 2O1WA 4MB0A 2XGJA 2IXBA 1KXZA 2F1HA 4DR2H 2O07A 1TOAA 3JYLA 1X2BA 5ETJA 4UARA 4OHVA 1DGQA 1Z0FA 1XDWA 5IM4A 3IPRA 3W6OA 2GPBA 3ZS8A 2NVBA 3LPDA 2V1XA 3X1DA 1GKKA 4OHCA 1TMYA 5LC1A 4FS3A 4GLXA 4JH0A 3X3HA 3V8VA 1U4SA 1L3IA 4GO1A 4ZYUA 1PL8A 4RAZA 3UYKA 1O03A 2QLLA 2ETXA 4LJLA 4P98A 1YTUA 1A0GA 1M9NA 3ZE9A 2W8BA 5JCJA 1MXFA 1R9GA 1KMQA 2GO1A 3G5TA 1FXWF 2XLBA 1MV5A 3KHTA 1QVZA 3U4CA 4JI4B 3J7TA 3VVBA 5CEFA 2QTZA 1TMOA 1OMOA 2QDXA 3JSLA 1ICEA 1RTKA 4L9AA 3J7AC 1B6GA 1IHPA 4MVJI 2A0YA 4D9FA 2NTEA 4V2UA 1OT5A 4GYWA 3D8UA 2VUMG 3LLUA 1MO4A 2NZJA 2FEKA 3A3KA 5CK5A 2YL2A 3V9AA 1Z5UA 1NN3A 5DCUA 3J80A 2FA9A 1OVGA 1PDVA 3FW1A 1Z8FA 4Q4LA 2FPSA 3A4IA 2V3WA 2ZWIA 3KJQA 3NDIA 1N6PA 3H05A 3T4XA 1A9QA 3I04A 3O0TA 4BQPA 1OZ0A 2OGTA 1M2KA 1W5AA 2PT5A 3JASA 1IIRA 1O94C 2E2IA 2VDRB 4JI2B 1DBPA 2ZU0C 4DT1B 2ZP1A 1Y5NA 3VJRA 2V9CA 1U2PA 4B7ZA 2R6AA 4GQBA 3OTOH 1TD1A 3KO8A 3H75A 2HJGA 5DHPA 4MITA 3N2IA 4YUVA 1RIFA 4ESHA 3GLGE 1MEJA 3EIUA 3MLAA 2HRDA 1EVYA 4C3ZA 4MA0A 3VPCA 3NAQA 1C8BA 5A9RA 1GGOA 4EPTA 3EEFA 3C3XA 2ZAGA 2AI2A 4FGRA 1SU8A 4JBNA 3HY3A 4FI3C 3WWZA 3F4KA 3RADC 1LQTA 1DJQA 3BA6A 3K70B 5CYFA 2ENUA 4JSRA 1UEXC 4IMRA 5CNIA 1SKYE 3PWTA 2Y99A 1NURA 2A2ZA 4GOXA 4EVQA 1KAOA 2IYNA 3MF4A 1I4DD 1R0WA 1OV4A 4RH3A 2G40A 4O1MA 1N36H 3JX9A 4MQ4A 3KD2A 4F3YA 4TUYB 1TLTA 1AQIA 2V4RA 4GL4A 5DLYA 3U0BA 5DHUA 4GMKA 4P80A 1SIUA 3HEBA 3HXPA 3L0PA 4LDRA 3L05A 3N2GA 4W9NC 1SRRA 3RREA 2QYOA 3ETJA 2XUQA 3NGXA 4Z5XA 4NXMB 3ZVNA 2PXAA 2ZVPX 3MFQA 5H59A 5IP7G 3JQPA 3VR0A 2PS0A 2E3JA 3IJPA 4W5WA 2FNAA 3B3AA 1EKPA 3LOUA 3MUNA 1VBMA 4DCMA 3NUGA 1MH1A 4HDMA 4WFKA 3RRMA 4MROA 2XMCA 1RJEA 2HLDD 3EBLA 1NG9A 4CQNA 5LUBA 1HURA 4FYIA 1RJPA 1FFSA 4KQFA 4IH1A 2JEZA 5GTDA 5SY6A 3BD8A 1EFKA 1XX6A 3RYFB 4JC8A 2UUPA 2CKDA 4Y30A 2CNKA 5A5DA 3Q1LA 5TE9A 1LI7A 1WCIA 2IPNA 2C84A 1GZ7A 2IA6A 4FS2A 2V5AA 1HDRA 1P5ZB 4DLWA 2FRDC 2WTAA 2CGEA 2JVIA 1PLLA 2H2HA 2BPOA 1NZJA 1O94D 3RARA 4A03A 1IQUA 2HRQA 3M4ZA 1QZ3A 3BDAA 3JQ6A 3H19A 3R2JA 1HSZA 2XMSA 4L8FA 1TWFA 1JHXA 4Y2JA 2Y6UA 1JILA 3I5XA 4YMWA 3TNLA 4NYIQ 5LQSA 1HKHA 2Q6OA 3J7AK 3WA6A 1KDYA 1E4OA 3H0EA 4ZMBA 3TEMA 4U7JA 4ZZ2A 1EGQA 4WNAA 2CJXA 3A9VA 2RAVA 1X0XA 2X5OA 3IQGX 1SQ6A 2FEXA 2HDNB 2EJ3A 3DD1A 1RBZA 5KG6A 2DERA 1EFPA 4CI9A 3HFSA 3JQ7A 2YN0A 5CXQA 1FU7A 4EUHA 3EXHC 3STUA 4XB1A 2FMXA 3ELDA 5LZ8A 2VYND 1YCDA 3OZGA 3STVA 3TOSA