3VPDA

Lysx from thermus thermophilus complexed with amp-pnp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
281
Chain Sequence
b'MLAILYDRIRPDERMLFERAEALGLPYKKVYVPALPMVLGERPEALEGVTVALERCVSQSRGLAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIGSWGRLLAKVTDRAAAEALLEHKEVLGGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRRSAHWITNTARGGQAENCPLTEEIARLSVGAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILRYAWEVARG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein S6 modification protein
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 86
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 6.3.2.43: [Amino group carrier protein]--L-2-aminoadipate ligase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3vpdA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpdA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpdA01
5CAEB 3I12A 2YRXA 5C1PA 3TW6A 1JLLB 4ZOLF 1EZ1A 2XCLA 4O4HF 1M6VA 1C30A 3TIIA 5CA1F 3JZIA 5HBRB 4MV8A 5HV6A 1B6SA 3VA7A 4TUYF 4YJ3F 1ULZA 4M9UA 1JDBB 3RV4A 4WD3A 5JVLA 4ZHQF 5KX5F 4IHJF 2R87A 2YRWA 2YW2A 5DMXA 3VPDA 4J6EA 4O4LF 2V5AA 5IYZF 5JVDF 2R84A 4ZQIA 2W6PA 2GLTA 4HNTA 2GPSA 3WO1A 3HBLA 2GPWA 5LXTF 3VMMA 2R85A 2W71A 4M99A 2ZDQA 2DZDA 4EGQA 3E5NA 2XD4A 4IWYA 3N6RA 4ME6A 1DV1A 4YJ2F 4EAAA 2HJWA 3JRWA 1KBLA 5JH7F 4FU0A 5LOVF 4YBZB 4MV1A 2VPQA 1EUDB 2YZNA 4MV9A 2I80A 1CQJB 1W96A 1JDEA 3Q1KA 4DIMA 2R7MA 4C5CA 3TQTA 4EABA 4MAMA 4GGMX 5J2TF 3MWDA 5BPHA 4Y8VB 2CQYA 3RUPA 4MV7A 2I8CA 1EUCB 1C3OA 3GLKA 5LP6F 2QK4A 5BMVF 4YAJB 2OLSA 2W6QA 3WNZA 5JQWA 3HO8A 4RZQA 2CZGA 4XX0B 5LA6F 3ORQA 3K5IA 4L1KA 3G8DA 2YS6A 1UC9A 4XYMB 4MA5A 3LP8A 1GSAA 2SCUB 4C5BA 1GLVA 2FPPB 1VBHA 1EYZA 3MWEA 2R7KA 4MV6A 5LYJF 2YS7A 2DLNA 2R86A 2R6FA 4DLKA 2IP4A 3WO0A 4YAKB 1DV2A 2PN1A 3OUUA 3G8CA 2DIKA 1PK8A 2NU7B 3R5HA 4O2BF 2X0SA 5BPFA 2PBZA 5CB4F 2YZMA 3ETJA 3BSSA 3ETHA 2NU6B 1KEEA 2NU8B 3HB9A 2V59A 1B6RA 4TV8F 3BFPA 4HNVA 3BSYA 5C1OA 3GIDA 3LWBA 3UFXB 1T36A 4HNUA 4XZ3B 3RV3A 4EG0A 3R5XA 5C8YF 2DWCA 3V4SA 3ORRA 3VPBA 4MV3A 1KJIA 3U9TA 1AUVA 1E4EA 1KC7A 2YZGA 4O2AF 2VR1A 4TV9F 2FP4B 5H80A 2VQDA 2ZDGA 5EZYF 1VKZA 1A9XA 3N8DA 3BSWA 2V58A 1UC8A 1KJ9A 3JRXA 3U9SA 1EHIA 4XYLB 2R7LA 1E4EB 1KJ8A 2W6OA 2W6MA 3QFFA 1SCUB 1W93A 3K5HA 4MA0A 4M9CA 3Q2OA 1CE8A 1DIKA 3TIGA 3VPCA 4M98A 5D8DA 5I47A 4IZOA 4IWXA 1AUXA 4HR7A 1GSOA 4E4TA 2VHEA 5GONF 3JZFA 1KJJA 4EA7A 2W6ZA 3MJFA 1GGOA 2C00A 3K3PA 2NUAB 2Z04A 1IOVA 3R23A 4C5AA 1CQIB 2QF7A 4YB8B 4EA8A 2FB9A 3AX6A 2P0AA 3SE7A 4O4IF 3VOTA 2YYAA 4MV4A 2FPIB 3BG5A 1I7NA 5CA0F 1CS0A 1WR2A 4EGJA 2R82A 1IOWA 2W6NA 4HQ6A 3V4ZA 4QSHA 1BXRA 1PX2A 1VBGA 3RFCA 4I4TF 4ZI7F 2I87A 2NU9B 3OUZA 2YL2A 1KJQA 4EA9A 1I7LA 1BNCA 5J2UF 2ZDHA 3AW8A 2W70A 1GSHA 1JKJB 4WBNF 5KKNB 2R7NA 4I50F 5K2MA 4I55F 2FPGB 2NPOA 2J9GA 2PVPA 3R5FA 3TINA
chains in the Genus database with same CATH superfamily
1Y9EA 2Y2UA 3U5TA 2PBFA 1O97D 5JSQA 3EHDA 3KHHA 4YQYA 5B4UA 4CLOB 2NOAA 2PKEA 3HI6A 4G8BA 1VG1A 5CVJA 2IV7A 4YV1A 1JWLA 3ZY6A 4XGNA 2CGEA 4NH4A 3GGPA 3DL7A 4TYNA 3TRFA 5EVJA 3KOOA 3FVWA 1S8AA 3HP7A 1CQXA 1SOWA 2Y05A 5HW0A 3UXYA 3E61A 3FFWA 2AMJA 2GAOA 4MRMB 3HZRA 5ED0A 2PKRA 2QLMA 4GI3A 2XUGA 5AW9A 4OCZA 3WTCA 2HVQA 3V3KA 3D7RA 5DHRA 2Z4TA 1NFRA 4A0HA 4FE2A 1AD2A 3U7RA 3D2BA 4XE5A 1E9CA 4ZVUA 4RD6A 1H8ED 3WK7A 2OXFA 4RTOA 1XKLA 3FLAA 1GGKA 2J6HA 1D1TA 2HJWA 4ED3A 2LPMA 3TGLA 2WHXA 2OZLB 1A4IA 4URWR 5A06A 1BVRA 4J9PA 4ZK2A 1TO2E 3ND9A 4BC1A 2B8NA 1M3SA 2XODA 3AXTA 1GGMA 3F6BX 4M8LA 5C5CA 3E3OA 4K6CA 5K0ZA 2O1WA 4JB0A 4X84A 3OKFA 2WYHA 3W6PA 1CR1A 1KO7A 3R44A 4EBFA 4N54A 1ZIOA 4XM0A 1P9LA 3N7AA 2PGAA 4CLHA 1NUUA 1XL0A 2X2FA 3FN4A 4E5PA 4LOJA 1DELA 2C4KA 1TI7A 1KGSA 1F8UA 2HADA 3CSDA 1W5FA 1Z62A 2GCOA 3KTDA 3JVIA 4AKTA 2PWBA 2B6HA 5LYJF 3EXFB 3DP7A 1FTQA 2YHAA 2OTCA 1MNQA 1PF7E 2QTLA 4L07A 3JYNA 3G8CA 4L73A 2CMHA 5IABA 1GGVA 1NR7A 2XB8A 4PNZA 2E1PA 1IMJA 3OTOH 3A4LA 5L45A 3S6JA 4NULA 4PU0A 1XSEA 1NTOA 3PHHA 1N3LA 3UJCA 5FD8A 1FTNA 1G2QA 3IA2A 3ZGVA 1H94A 3AKCA 3IVCA 4CJXA 2OILA 3JYHA 3ZHRA 3UFXB 1SO8A 1XVTA 3WRXA 1P8AA 4C2UA 2VRCA 4A10A 4OIFA 4XWOA 1FA9A 2AOVA 4J0QA 1GL6A 1HEUA 4F6RA 3W3AH 1KSFX 2UDPA 1NRIA 1VHDA 3DDSA 4QG3A 2XHZA 4GD3Q 3RAXA 3DHVA 1WXDA 1T2NA 4MI1A 1H23A 5IT9A 1PZFA 4MWGA 4MPTA 4F8YA 4ESHA 4RA6B 2C5SA 2C3YA 3ZLBA 2D5CA 5KFEA 3DOJA 3SS7X 5KHAA 4F6RB 4QRIA 1RCTE 1T0BA 3ICWA 1M0SA 2V9PA 3IE0A 1Q3KA 1O8BA 1SHJA 2L69A 5LNK1 4CM4B 1NOKA 3P97A 2FFQA 2WV7A 1M2NA 4AG3A 4HQKA 3WLEA 2VHUA 4OJMX 4IDEA 1SHLA 2O2GA 3FSRA 3ORHA 2DFNA 2OQIA 1FU7A 2OCKA 4WFJA 4MHTA 4IWXA 3ROZA 1DARA 2EEZA 5YASA 3VHRA 4UDYX 4NBSA 4FLEA 4Q93A 1LY1A 4XRGA 4E03A 4L8LA 3DP9A 2NSDA 4PAWA 3D9QX 2H8GA 1Y0BA 2O5CA 1DIRA 4URXR 4OGWA 3ONNA 3JQFA 2PZJA 2COGA 4C20A 1AS2A 3GO4A 3NTUA 4YFVA 4O3OA 5AW5A 5A7HA 1O57A 3V4ZA 3FFAA 4BVEA 2AI2A 1CD5A 4KXVA 3VDMA 1K5DA 3OPNA 1FNSA 2VOBA 4DZZA 3DAAA 2JLQA 2CVHA 1U8AA 2YQ5A 3R20A 4TMWA 4WW0A 2EG5A 3VGPA 5IYDG 1GO3E 1G1AA 4HHEA 1JVSA 2AUMA 1F0PA 2FW8A 3VNSA 3EVTA 3W04A 2W43A 2DH5A 1XMQH 2BGTA 2J3EA 1L4MA 4Y6SA 3QFHA 3WL6A 5FOQA 3QFSA 3FAZA 2C7GA 3WYFA 4RUCA 3U81A 1A8PA 1T8WA 4JC4A 5DHSA 4IDAA 4E2WA 3M1AA 3T5TA 1K9SA 2CBGA 3E5HA 1R4NA 4WZAE 2XD9A 1AGYA 5HFNA 3RF2A 2I6XA 5FA5A 2O1XA 4NCHA 4APMA 5BYKA 1Z45A 1FSGA 4DY4A 3NKVA 3KSZO 3A32A 1G2WA 5K09A 3UMJA 3RV4A 4ARSA 3UWKA 4JR1A 2BT4A 2FPMA 1FP1D 3MOGA 1R4NB 1D1QA 1VTKA 3VPDA 2GRAA 1E9SA 1X1SA 1NXWA 1UKBA 4DNQA 1U0EA 2XRYA 1C7FA 5IM5A 1E1QA 3HCAA 1VCMA 3G2OA 1FW8A 2JCGA 3GGJA 4QDZA 1ZCJA 3WWOA 1VL6A 1EVLA 1Z6ZA 5AYVA 4QUBA 5JV5A 4FNAA 2C2MA 1SQFA 2JIBA 3W6ZA 4DR1H 3KWLA 4CU5A 1D8TA 5EMKA 3VSBA 3RBAA 5DYGA 4DUYH 4RWEA 5JNVA 2W6CX 1NF3A 4L7QA 3B1XA 1WPXA 4BV8A 1VIDA 1VE6A 2M05A 4OLJA 3DEAA 4DV2B 1IPFA 4LXGA 3N6XA 1BE0A 3ESCA 3Q9LA 1T2EA 1ZIXA 3RB6A 4D4GA 3K05A 4BFWA 1Z4NA 2QN9A 2R8EA 1KRHA 3DB2A 2H5LA 1QVZA 1QVRA 3KO8A 2EFDB 1F0NA 2W2MA 2ZJ4A 2QZ4A 3HDQA 1QS0A 4JVSB 4LISA 3C2QA 2BBWA 4MWCA 1SPBS 3DYVA 3IPCA 3RVDA 4PFSA 1KARA 2B8TA 3B6KA 3A04A 2O19A 3O93A 3LM8A 4P1ZA 1J7KA 1AT1A 2IJGX 1QS0B 2L0XA 1E2HA 2H4YA 4DR3H 5KAPA 4IWNA 2Y2VA 3I42A 5CXXA 1XZHA 1UPXA 4GMDA 2JEFA 3OSNA 3GMIA 1ACLA 2WJHA 5KAMA 3H84A 3W9SA 3WHPA 2ZETA 1GXSA 2VT6A 1J2JA 2XY4A 1II0A 2B83A 2VPTA 5JXGA 4UXHA 4YLGA 2ZP1A 3LCJA 2FP4A 4AQ7A 4D8YA 4C4SA 3R5SA 4YGXB 3J81A 3H0KA 4QU0A 4IXMA 4DJDC 2JJYA 3SPXA 1MGOA 1GXSB 1NQTA 4KN8A 1KQOA 4YJFA 4D5EA 1TF5A 2FP4B 5MFZA 1UDWA 3TRHA 3H9UA 5A5DA 4AO8A 1ESEA 4UE2A 4DL3A 1ISPA 1JT2A 2J08A 3PTLA 2P4SA 2FPRA 4HLQB 2YWGA 5CM2Z 3ESDA 3DAFA 1BMTA 2R0QC 2NU7A 2XTJA 1WQ1R 5TQ2B 4WY8A 4J0MA 2COKA 1VHTA 3NONA 1DTEA 2PNJA 4RSMA 3AVXA 4JUBA 3Q98A 4HXFB 4DLAA 4BNLA 1GUZA 1WG8A 1VFPA 1H66A 3WYCA 1Q92A 1YQGA 4TWJA 1EINA 4AF6A 2RGCA 3GGSA 4BGEA 4O7LA 5A4MS 3KPUA 2AOUA 1WXXA 4ZAVA 1FQWA 3PEFA 1XCOA 3ZI0A 3IL2A 3GEMA 3PO3G 3MT8A 4YDSA 5A71A 2WJWA 3ER9A 4IJMA 4RZHA 3W8RA 1J0AA 2Q4DA 3E22B 3WK5A 1JB1A 3FB1A 2BC9A 2AOUB 1BHQ1 4ZAGA 4Z4FA 3QWAA 2YVLA 3QM1A 2WF8A 2J09A 2ZB3A 4TOIA 2WIAA 4JI5B 2P68A 1U0SY 1ESNA 4C3VA 3ZCQA 2FQQA 3VR6A 2H16A 1FNCA 4JYMA 3A6JA 1ZICA 1JHPA 4BVGA 2PT7A 3PHBE 3KVVA 1BHO1 1Y7LA 4M76B 3TW6A 1VCIA 1E7MA 4TXNA 3NT2A 2ET6A 2EJ0A 3GVIA 1CZKA 2X0NA 4FSDA 4HZIA 4ENTA 1NXPA 3KZOA 1N32B 4ZU3A 1GPYA 4H6WA 1XRLA 1ZH6A 2O2IA 3SX4A 2YXLA 4O25A 5JXWA 5BWNA 2PNFA 3JARA 4AJOA 4DIBA 3OCXA 1E3JA 1PTJA 5JD6A 4DUGD 1HTWA 2B69A 4UTZA 3UGKA 2HK7A 1NIJA 2FSFA 1Q22A 7AT1A 2IDZA 1SQGA 2JHCA 1YR6A 4IMPA 2A0YA 1LS1A 1LW7A 4AS1A 3JARB 3WAJA 3B5EA 1L5MA 3HB5X 4IEFB 1EK1A 4HGPA 5A4KA 5TMDA 3OPMA 2GFHA 2MJLA 1WRVA 4DQVA 5B30A 1X1TA 2ID4A 2WSSA 1TTQB 2KJQA 4AMVA 4S1VA 1K6JA 1U7OA 4F3CA 3KWFA 3U4GA 3ME5A 4ZEMA 2ZR8A 3R75A 2FEPA 1WNTA 2I65A 3DTNA 4QATA 3WLQA 3GEEA 2XCQA 4WLVA 1Z4IA 2HT6A 1P7YA 4GR9A 3L8FA 2D1YA 5AI9A 5L3QA 4H7KA 4G26A 4BWGA 3F3YA 5J43A 2Y1LA 5LQRA 1T3HA 1USUA 2C0CA 4JI2H 2V55B 4RL4A 3V8QA 4TZKA 3DNFA 2RGBA 2B20A 4E5UA 1MHPA 3L6RA 1EUYA 3TMKA 1GN9A 3WYNA 1K68A 2WF6A 1E60A 4MUAA 3SXJA 1WNFA 1GGHA 5BW6B 1A4UA 1BE8A 2YFQA 2BY4A 1GEGA 3ZDFA 4COKA 3RFUA 1H2YA 2VDQB 1KDRA 3H0EA 2FWAA 2WINI 3SBOA 3TZEA 3A0RB 2YNMA 4B0OA 4UXJA 2YINC 4A27A 5CYPA 1VIVA 3Q6MA 4DVJA 3EXAA 4GP6A 2UXBB 1IE3A 5CYFA 4PXYA 3EQ8A 3DFMA 5EKSA 3VVMA 4PC7A 4JGBA 2E1RA 5LZ4A 1X94A 1HR0H 3VKHA 4IQ0A 5AJWA 1MX5A 4X63A 3JWIA 2HBRA 1XHLA 4AY6A 5FLMG 1YZNA 3PGJA 5KFBA 3BSWA 2EAUA 1DPGA 1KJ9A 4UREA 3QI7A 3DZCA 3Q0IA 1PD0A 4D02A 1M2HA 5IAAA 4U9HS 1KMCA 4ALJA 3BJMA 1C4OA 4Z1MD 2HB6A 3ECCA 1GZ3A 4TTQA 3ZVKA 4QIHA 2ZJFA 1X1QA 1GG2A 3IHTA 1FFXA 2WY2D 3FKIG 1M1NA 3WMXA 3KQQA 4P58A 2CT8A 2F00A 3MW8A 3EVBA 4IZOA 4U5QA 3W4KA 2CKZB 3TRIA 5T41A 1M0TA 4ZKDA 1FFXB 1FLNA 4JLKA 3NPMA 4DLUA 7ABPA 1HNWH 3QX9A 2ZGIA 1HA3A 3AR3A 1ZP6A 4MRRA 1OTYA 2FPIB 2XTNA 4GVXA 1CR6A 3FUXA 4U7TB 5AUPB 5KNBH 3SR3A 1SZDA 1UJMA 4R5HA 1UBCA 4GAEA 1HMYA 1E1LA 3PC6A 4ZRNA 4QXMA 2OB2A 2H63A 4DLNA 1Z6TA 4MK4A 5B3JC 2YWJA 2A6PA 2CUNA 1WKBA 2PU5A 4H6XA 4QC2A 3IAHA 1T4MA 2C4UA 2Z2IA 4IL5A 3PFIA 1U3TA 2DFVA 4EJSA 1ZI8A 2HTEA 5TIIA 2HEGA 3D81A 5E8RA 2B34A 5K05A 4M53A 1RYDA 3CEAA 2XIGA 3DPUA 3DTVD 1CQIA 2OV8A 4B7XA 3KXIA 4BP9A 1FC0A 2YHSA 3V8PA 1MJNA 4ZHQF 2WLTA 1WMSA 2DWPA 2JD0A 3WIOA 3BHMA 4R84A 4PZ9A 3DTGA 4DQLA 1AV7A 1CNMA 3ZWQA 1RXWA 1CETA 3TZ6A 5KNDD 1QHIA 1ATZA 2I4IA 3AM4A 1SC9A 1F51E 2BHNA 5BYBA 1Q2UA 2GAFA 2WU3A 3VTZA 4HUQA 4JI3B 3U26A 3MCTA 4O0MA 4Q9LA 1QZ3A 1XXHE 2H7VA 3I2YX 3T1TA 1VLQA 2D0PB 2VT3A 3R3SA 4XB6B 4PYOA 3S1LA 4ZANA 2OGZA 5P8WA 4HUQB 4XDHA 1H8HA 3AESA 4BMPB 1HE2A 1N6PA 1P5FA 2QKYA 5SY4A 1HK7A 4RJ2A 3Q40A 2XQGA 2MYNA 3L1KA 2XI4A 4G85A 3MR3A 1UFQA 2M9MA 2N47A 3PFKA 3FHJA 3VI4B 2JIMA 1P33A 2CCJA 3GNLA 2RHDA 1WF6A 2FXIA 1RU3A 2C82A 3ZNNA 2ZSUA 2QUKA 3C15C 4PSCA 4JLWA 2IHZA 1CY7A 3HRIA 3C3MA 1S2DA 3VZBA 3OCJA 2L17A 1LBQA 1BMQA 4X7PA 4CL2A 1ODTC 3QPVA 1SIUA 4TRNA 3SSOA 3KQUA 1FDTA 1NJ8A 1YQWA 1IOZA 3RWBA 2Q5EA 2DTEA 2R6DA 1E9DA 4RW0A 2PMEA 1P9RA 1TMGE 2EKDA 5H68A 2YZMA 4GS5A 1OUMA 2RGXA 3E9QA 2W58A 1TB4A 3E4CA 2AC2A 3B1YA 3RFFA 1LBTA 1EFAA 5KFPA 1ATIA 2AW5A 5K51A 4DDKA 4ZCMA 1UBHS 4DWWA 2Q4TA 4TSKA 3JWEA 5EOYA 2ZWPA 4UCUA 1XQWA 2XCIA 3FCYA 3KFXA 5KJCA 1SC3A 3EX7C 2J5BA 3HWX1 4DS3A 5EIBC 4XFKA 1BXKA 1J25A 1LCIA 3IOBA 2BFEB 2L2QA 1TVKA 3GCWA 4DCPA 1MX9A 4J9SA 1PR2A 1BXRB 3LY5A 4ISCA 1P4SA 3ANLA 3CZRA 1RLTA 1JZTA 2ZWMA 4ITVA 3GZTB 1BFDA 3RIYA 1NW7A 3BE4A 3A4TA 4F85A 4BNVA 1TVKB 4LHYA 3B53X 3KB1A 4AMBA 5EJFA 2IZOA 3IESA 1JDVA 1DXYA 3T3NA 1DRWA 3LY8A 2AFRA 4K05A 2I7TA 4KDFA 1JJAA 1Y9ZA 1SEVA 4HR7A 3PPIA 5GONF 3WB1A 4LX0A 1FJHA 3UA3A 4GKBA 1QH1A 1G5PA 2NQTA 1UKZA 5KFGA 3RBZA 4Y6LA 2DT5A 5ALRA 3OSUA 5EXDA 5F5XA 2J0EA 4G1FA 1BH2A 5DSXA 1CKNA 2ORED 4UHEA 4L95C 821PA 5TJHA 3PUVA 3JPWA 1G8YA 3EF3A 3OQBA 3VZQA 4FZJA 2WAAA 3WDKA 3NC1C 4MYRA 3ZH2A 5AKIA 3FKQA 4CIYA 1W52X 3TW8B 3LP6A 3VJLA 3GQBB 4KFUA 3GI1A 4YUYA 1PJSA 2IUEA 4YRKA 1T5OA 2EG9A 1R8SA 3MWGA 2PDAA 5ICSA 3EG5A 3N0TA 1LRLA 1KKMA 2RARA 3GRUA 3VV2A 4AM8A 4MKFA 3DKIA 1P1HA 1I1HA 3PQ3A 4PO3X 3T1VA 1GA6A 2Y68A 1VPLA 3ASVA 1WPQA 1JALA 4A92A 4PG8A 5JCXA 1LK7A 4ZXPA 1PR4A 3RF7A 2GBIA 3AHHA 1YS6A 5A3JA 5DU2A 4JP1A 3MAGA 4YRDA 4LZZA 1ZN8A 2QAIA 4TTRA 2VYFA 1YSCA 8AT1A 4DL7A 2J5XA 1KYXA 4F3YA 4BNXA 1U04A 2HSZA 2FWPA 2VJQA 3NGDA 2VHQA 2D2EA 3Q72A 1FSPA 4ZCRA 2FU5C 4KQMA 4CF5A 4I9NA 1JKJA 4KQXA 1ZMRA 4U7DA 1V4YA 5I6DA 4BZWA 5BY2A 1VAJA 1R64A 4RNMA 1RT9A 4N5IX 1V43A 2M6SA 1EUCA 1YONA 2W2XA 3EWSA 1M34E 4L08A 2H6EA 3U49A 3UUWA 4FGKA 4OXNA 2W83A 3R09A 3DO6A 2COJA 3O3NB 1S03G 4FWBA 1IEQA 1MCZA 5HCIA 1L9KA 1W1UA 4AIIA 4MVJH 2NQ2C 1QF6A 5JMWA 1EUCB 5HZGA 5AIBA 4PHFA 2B94A 1T3ZA 3ZI4A 4I1OA 1Y7IA 4PLYA 2QU8A 1KBZA 2OLSA 1F4VA 2VFAA 2X41A 4OQEA 4BVJA 2HK8A 1Y8QB 5AMXA 4CIWA 1IRXA 5C1DA 1RYNA 4ARAA 4ARIA 5KBYA 1D4FA 3DFZA 2UYOA 4EI8A 1QNLA 4I14A 4N7BA 1ZUHA 3WL5A 1T9BA 1C7ZA 1JQLB 1ZRHA 2XYVA 3BQMB 5SZHB 3R3HA 1VOTA 3EE6A 1X39A 2JLSA 3PT5A 2RHMA 3ZDYB 2C5HA 2ZRCA 3HSYA 4E6PA 3NG1A 5DTRA 1A4XA 5J1TB 5DP2A 5A7GA 2NGRA 4LF4H 4UNPA 3NH6A 4KR0A 5HIAA 4OX9H 3WGTA 2HZBA 1H5NA 5HCUA 1RLMA 1C4KA 3W5AA 3HS3A 2H08A 5FPPA 3GT7A 3MRTA 2BKAA 1U1DA 3L7AA 1GHTA 2Y0SA 1LVGA 4Z86A 5FWYA 3D7SA 5LSAA 1E2GA 3ENQA 2QQ5A 1J0EA 2Z2JA 3DE4X 3UMCA 3X1WA 3G0OA 5G0TA 4XDGA 3PXXA 3F4BA 1W36D 3LG2A 1O75A 3UUEA 1Q2XA 4OQLA 4B3RB 3MMSA 2PWZA 1UOPA 5FWYB 4L6AA 5FNVA 4ZQCB 1NPYA 5A9RA 2VYCA 3HR7A 3K70B 3B3JA 4LWOA 4F45A 3VSEA 2F9LA 2ZBQA 3LT4A 3SLKA 1TM1E 2Y1GA 1YQUA 5CB4B 4NJEA 2SKDA 4YRGA 4YMGA 4I50A 5LMUB 4J0GA 5AVVA 3CG0A 3IGFA 1PQ4A 4CM6A 2QXTA 3ZPXA 4CQJA 4PHCA 2ZRGA 5LZ7A 2C8VA 3IQFA 1BQEA 1Q17A 4N0MA 4EA8A 3PWZA 4NPCA 4Y98A 2XF2A 421PA 3I01M 4R8KA 4ZVSA 4D2IA 2WNHA 1AZLA 1BOOA 3KKQA 3U0BA 3VHXB 4YCJA 2WHQA 2HQSA 4FDVA 1XU4A 2QTHA 4F1KA 4X3CA 5TS2A 1CY4A 4JOQA 1BG6A 2JC3A 1NASA 1A50B 3TW7A 2PV0A 3NIDB 5IYZA 1PWXA 4GPTA 1S1CA 1HQCA 2YQ4A 1AO0A 1F2UB 5AI5A 2DTXA 2ZWOA 1QM5A 3EW9A 4WFQA 4K1LA 2B4YA 2OWEA 1AHNA 1WUIS 2HMAA 3RTBA 1CY0A 5BWBA 1JHYA 3N2NA 2YH2A 2QTVB 1JFFA 2OHOA 4I1PA 1EBFA 5IUJC 2C9CA 2JLAA 5KVQA 4TV8A 2GZ3A 3WNQA 4UVIA 4YHHH 2C2OA 1OX5A 2I67A 1BRTA 3KFLA 4O7SA 3C45A 5F64A 4R2WA 1JHUA 3GPLA 3R6DA 4CDMA 1P1KA 2CB0A 1AKVA 1BH6A 3TL3A 1BDBA 5AUQA 4L2IB 4O3RA 2WUGA 4G1BA 5AM5A 5ALYA 1VP3A 2BF7A 3L0BA 5FFNA 4W1SA 2X8AA 5IRCD 2AG6A 5L40A 1J09A 3AV3A 2WA1A 3V8EA 2RB4A 1DAKA 1QFXA 3OY7A 4H0FA 4IJKA 4ZYZA 4FHFA 3GN1A 3GT0A 4FYXA 2ZIAA 3IUBA 3RDPA 1DRJA 1Z73A 4LCJA 1RPNA 1UFRA 3DBRA 3CONA 3U3KA 3WQQA 1SBYA 4Q3OA 1I6LA 3NTVA 1FUKA 1YR7A 3HYCA 1YS4A 1H2WA 4HWSA 4C14A 1ZAKA 3SJ7A 2CVOA 5IJ9A 5M3BA 1P0CA 1S97A 3E3NA 2NT3A 3OIUA 2AK2A 3VMFA 1IPEA 1IBMH 3U39A 1VRWA 3V34A 1N5JA 3IULA 4RF5A 2FW0A 1EK0A 1JU9A 1NBOA 5C4GB 4EY3A 4ZU1X 3PUXA 4NFYA 4P34A 2QEQA 5I4IA 5IJZA 4GBJA 3LCCA 4QWDA 3IDFA 1QQBA 1FCJA 4A3FG 4I8DA 1GLVA 4ZVNA 1LBIA 3GIMA 3FIJA 2YWVA 3K53A 4A6DA 3PFWO 3FVRA 4HNSA 4KK4A 2I1LA 3LAWA 4BVHA 1DX4A 3VR2D 1G3RA 3LO8A 5BWUA 2DSTA 4K6GA 1GNPA 3Q3JB 1QHXA 3EZGA 5CIWA 4O4JF 2VUIB 4OBWA 3JQAD 1NUPA 1MPTA 3QLTA 3VYTB 3W5UA 1D6NA 2CDRA 4PRLA 4GOMD 1RM5A 4OI4A 2FKLA 3B9RA 3MBIA 4GLLA 4FQ7A 5CT5A 3DUFB 3EOBI 1EDEA 4W5HA 1OFHA 3OU6A 2VKQA 3RR2A 5TGZA 1SZPA 2WAOA 1MV8A 4JQYA 2XKJE 4LDZA 4OYLA 5TS3A 4N5LA 2XMPA 3M2PA 3W90A 4KXWA 4B4KA 4J7UA 1A76A 4GLWA 2ZYAA 5CLIA 4X1YA 5EQDA 1ORTA 1GNRA 2V58A 3SYTA 3U9SA 5C3MA 4O5OA 2PT6A 2OBFA 2ZITA 5AK0A 3U0VA 1E0KA 1KRWA 3HJHA 4C6HA 3Q12A 3QBTA 3D8UA 1RWNA 4KBYA 5H82A 4X1YB 1NW9B 1C7IA 1Z7WA 1U7ZA 5FTKA 5E3JA 2DQKA 1QG6A 4N1AA 4BBJA 1RMQA 1YR3A 2F90A 3JQEA 2CLCX 3LPMA 3K2QA 2GBPA 3W1BA 3FYSA 2P9JA 2Q5OA 3JX9A 4E22A 3F98A 3EJ6A 3N43B 4K86A 1HE1C 3JSXA 4C5AA 4MW6A 3HOXG 4W7SA 2PMBA 4JI8H 1CXZA 1DJPA 2VAXA 2X0RA 3A06A 1SIOA 2W6NA 3UQ8A 5ALTA 1TF2A 2IZZA 4R9VA 3R7WA 2BP7A 2VH1A 4PV7A 2OENG 3IIMA 1UCFA 3H9JA 4XYLA 2CHQA 1Y3CE 2H3EA 4EQZA 1OVMA 3G2PA 1XRSB 3I3OA 1Q1BA 2LIVA 2NNWB 4US1R 3KR0A 1S2MA 1T1JA 4LY6A 3PV0A 1P81A 1F1JA 4I50F 4Y2UA 1MAUA 4F4YA 4EBCA 2BP7B 4KL8S 3PB3A 4AUMA 3OTQA 2RAFA 2VYVD 2EGHA 3BB3A 4TTAA 4C04A 2WTUA 5LYJB 1T0IA 1UM9B 4BVAA 3GX1A 4B4OA 1TJ5A 5DQGA 4KSYA 4DLBA 3U09A 4CPDA 1PWEA 1UZMA 1JSRA 3JPYA 2XNDD 4L76A 1N77A 1GPBA 5KU1A 4JXZA 1V1MA 4CKYA 3UF0A 2B9EA 4YAWA 3WKEA 5A05A 3WGZA 1VL5A 2BKLA 1XZKA 3C3EA 4AP6A 2X0DA 2WSMA 4QYIA 1ZW6A 5ALQA 4Z3DA 1W46A 3TY9A 1ECPA 5IYZF 3A10A 3F3KA 3AUYA 4Z2YA 3JZ6A 3L49A 2GPSA 4TKLA 4WLUA 2UZ1A 4NX2A 2QRJA 3BH6A 2FMAA 4DR2H 4BNNA 5TR9A 3FDIA 1ZETA 3JR7A 3QVXA 4HAOA 4B6JA 2OFPA 3IR7A 3AM5A 1D4AA 2X8BA 4FZRA 2W2QA 3KAKA 4XEHA 2QSUA 2VNJA 3BCSA 4HYKA 2YU9A 3VXKA 3RASA 2PAFA 1Q1GA 3KLPX 4AMGA 4ZD6A 3KOUA 3VUFA 3ORYA 1RKQA 3WLKX 1QYXA 4XVUA 5ALLA 4F9TA 1VI5A 1XG5A 5CVEA 4Q6BA 1T3NA 3O8QA 1UOQA 3B52X 5EFZA 3H3VH 3IUNA 1U5AA 3N42B 1Z5GA 3LZCA 2X5XA 5JWOA 4RC9A 3QNUA 4EJMA 4DUZH 3VR5A 1CJCA 2O20A 2NAPA 5JANA 3ZE7A 1ILEA 5TGDA 4EYGA 3OE7A 2EERA 3OUUA 3SDBA 3A6EA 4J1NA 1R4MA 1NJSA 3ZD9A 4QVIA 3W0LB 3UAGA 5I9BA 1U2SA 2R97A 2NU8B 3L43A 2R8PA 2G17A 1QANA 1DADA 2HYDA 4M1ZA 3AP3A 2X8JB 2IPOA 4DT1B 2FGKA 5CLHA 3LMLA 3IUMA 3I6QA 1WXHA 2DWCA 4PICA 4TTSA 1FP2A 1E4EA 5JRZA 4CXMA 2AZ4A 3EZXA 5MGNA 2Z4RA 1UWVA 1N2GA 3EOAI 3OF3A 2GZMA 2QDXA 3CLRD 1N2CB 4BMXA 4M88A 4KXFB 4D9MA 3JRXA 1E9VA 5JY1A 4FBTA 3EPPA 1OT5A 3TLBA 3HU3A 1LFDB 2EGUA 4Q01A 1UQTA 2IKQA 4HNRA 1E4EB 5IVIA 3Q7IA 5BR8H 3AUTA 1R6AA 1OHHA 1F48A 3TSWA 3ZTWA 2FWRA 4MIKA 4HD8A 3OH8A 2P5SA 3QEMB 3BN3A 1QYCA 5IC5A 2P6OA 4C4ZA 1N2IA 4JI1H 4LRYA 2P3QA 4JAVC 4QBGB 1AV6A 3AHIA 2Z2YA 2I1VB 5K03A 3V1TC 3NANA 1KY3A 2ZWVA 1SELA 1RJDA 4EPXA 4LY3A 2C9DA 1J20A 4V0MA 2ZKIA 4PGHA 2GD1O 4PWQA 2X8WA 4G65A 4OATA 1ZEJA 5BNFA 3CVXA 4CM1A 3R5KA 3HCFA 2WWHA 4LE2A 1IVYA 3UPUA 1UMCA 4K81B 4YLYA 1D6SA 2R82A 2X23A 2PMZE 3ZZ1A 2BDEA 2DSNA 4KW7A 3HEBA 3S27A 4G5SA 4HRVA 1HLGA 4FMPA 4ZA2A 4ALLA 1XZQA 4JLUA 2E2IA 1UMCB 2R8XA 4U0KA 4D92A 3WLIA 4BXOA 5JTTA 3N5KA 4OI1A 2DBYA 1T5BA 4N5HX 3IEVA 2VNHA 4DEVA 1U7PA 3G1TA 1TJ3A 5EUQB 5DBHX 4TKZA 2XMZA 3HCDA 2DPGA 2H1OA 3VC3A 5I9TA 4HVAA 4QXRA 4DRYA 1NKVA 5KFQA 1RJWA 2DJIA 1VSVA 1H1DA 5HWSA 2FWBA 3S1AA 4K3UA 1JTEA 5AJHA 4QDKA 4CMGA 4CN8A 4A93G 2POQX 3MFHA 1KP9A 3DDUA 4NBLA 3V2HA 1SXJC 2DMRA 4ZDIA 5JZ9A 5DGBA 4L8FA 2DQYA 2NP6A 2ZCUA 4BBZA 3V1LA 4F93B 3R0JA 4Y2GA 1EPUA 3S1AB 5JAUA 4UQOA 4IXTA 3VZDA 4PRKA 1YFLA 4BQOA 2GCOB 5GZ6A 1R0ZA 1Q84A 2HA0A 3AEKA 3KP1A 5IJ0A 4IS3A 3DCJA 2I80A 1FFAA 2ATVA 4G24A 1FIUA 2GESA 4UU8A 2FHSA 1WZNA 1ZK2A 4ZV4A 1VPEA 2BPOA 1N5MA 4ETIA 3OCVA 2PZFA 2Z9BA 3R41A 3BRWD 2W0MA 3PVCA 4DL2A 1Z4QA 4DGSA 3TEFA 3X1KA 3KJNA 1G98A 1MOPA 5BN4A 5LA6F 1XRPA 2WVAA 1QQ5A 3KTAA 4EAQA 4PLTA 4EFMA 2V6MA 3WQHA 2P9TA 1P31A 1BGXT 4Y2XA 1R9JA 1R6DA 1WH2A 1Y1VA 3ZXUB 1B16A 2H9AA 1YVPA 2R6FA 5BN4B 3HYLA 3K4QA 4YP1A 3TNFA 4BX3A 3KTAB 2H51A 5GINE 2FSSA 1NVUQ 4G0MA 2CXOA 3IUJA 3T4XA 2PRKA 1XAHA 5CHYA 4F56A 2C59A 4F3RA 4RB2C 4I8IA 2LIPA 1JSXA 4AF7A 2O8FA 3I09A 2QZSA 2EJBA 1Y1RA 2QMQA 2X9LA 4F4HA 1ZO8A 3AZOA 4OJTA 4CR6A 3ER8A 3TMAA 4DIUA 5FJ8G 3FMAA 1LD3A 1X1CA 3FYTA 3T5BA 1WD5A 1SVMA 1HT0A 3ZS8A 5ECDA 4D44A 2WIGA 4DJJA 3PQEA 1OBOA 4F86A 5F3DA 1KWGA 4D97A 4OPMA 5B3JA 3VR3A 5B1EA 4DKJA 2QG6A 2MSLA 2W6MA 2ZBPA 1L1QA 2GS9A 3BJZA 3FTCA 4ZAWA 1FQKA 1G2OA 4QD3A 3U4DA 1G7RA 3HO1A 2EW1A 1SEIA 2NU6A 1I1NA 4YRMA 2JAXA 5EXEA 4CZ2A 4H2DA 3WGQA 4BO6A 4BASA 5EZ6B 1IHPA 1I3KA 1TO1E 1EQUA 1ABEA 3KE9A 4JWKA 4JYBA 5L9AA 3SK0A 4ECVA 4I7HA 1IHUA 4KLCA 4X71A 1JAXA 2NIPA 3V4OA 3THYA 2ZAMA 2KX7A 5G02A 1PSZA 4IGIA 3O9VA 3BWDD 2CNNA 1E6WA 2YMLA 1I94B 3KQLA 1BX3A 1UEIA 2GX6A 4ZCQA 4HLUC 1Q1ZA 2XGJA 4Z8YA 1B14A 621PA 6NULA 2Z5VA 4DL5A 3N05A 3V97A 5LBUA 3I4LA 4F4IA 3AR6A 1CZUA 2Q49A 1N2BA 2ZANA 3KYIB 1D4ZA 3UZBA 2R8KA 1QHYA 2IT1A 2V0CA 1UKCA 2OYSA 4LXXA 3C3CA 4ZARA 4JKYA 3RHTA 1Y8CA 4HN4B 2XEXA 4GL4A 3EHEA 4AXXA 5COAA 4C0LA 1P5HA 2XDYA 3AIKA 4I4NA 3FZQA 2BJWA 3ZLJA 5AWFC 5FBHA 5DX8A 5A4AA 2QRHA 2VP6A 4FOPA 1SBTA 2XTZA 5CB8A 1QE3A 2HF9A 3MSCA 1IJEA 2ZAOA 3A6HA 4DCSA 1C9DB 3ICOA 3S2ZA 1CERA 2VZLA 2CMFA 3NKFA 1R5BA 4IPTA 3VDQA 4BPRA 3OWOA 4H17A 2ZYWX 4MGZR 4QW9A 3RB0A 4GF5A 2MWMA 1MR3F 1XAGA 2CV2A 1J5EH 3WNCA 5AD1A 4FSHA 4F92B 3ZKWA 4ZOAA 1NKSA 2FSVC 4CMHA 3G89A 4JQCA 4LNUA 4G4JA 3SIRA 1EP2B 4ME6A 5EWLA 4ZAXA 1WULS 1CDDA 1NJ1A 5E1OA 2ALZA 4KDEA 2P91A 3D02A 3NIBA 5K8VA 1T4DA 4ZQGA 3GTJA 1X0XA 1Z2DA 5ESRA 4G1VA 2XVXA 3ZKWB 4AJLA 3CSSA 3SNHA 2A5LA 5DYTA 1W48A 4FIZA 5FO1A 4B79A 1CCWA 3KQKA 2PTHA 2XA2A 2HBYA 1FE8A 1ECBA 2BFCA 4GDFA 1N4DA 2CCGA 2V98A 4WECA 1EK5A 4MITA 3OPQA 1YC5A 5IDWA 3CEJA 5IEBA 1GLNA 3N8KA 3WNZA 3NC0B 5IKMA 4YJFB 1J1ZA 3PHGA 1JZQA 1M2EA 4POAA 4PNPA 1BWPA 5GP1A 3D5TA 2ZTSA 1J9ZA 2ZYDA 2SICE 1N9GA 4DZRA 1XNGA 2IEAA 2DKNA 1CB7A 2WAXA 1NMXA 3AM3A 5AK6A 2NU7B 3BD8A 2F67A 3I0MA 1KZGB 4LZAA 4A8JC 5A0VA 5G1OA 3G79A 1KC3A 1LDGA 4BRWA 1KJNA 3HV0A 1CUWA 1XJWA 4BCCA 1VBMA 1G0NA 4JT8A 3GB9A 4R2XA 4LV6A 1O0BA 2ZAYA 1DWQA 2X3FA 4E5VA 1B6RA 2OKGA 1H4SA 3LPLA 1D3AA 5FKJA 3IT2A 1CZLA 1FMTA 2R62A 4AFNA 1ZOPA 1S9FA 3U9LA 2NO7A 2VP5A 3RB3A 1SHZA 2UZ3A 1C7EA 5F2OA 1GZUA 4ZHQA 1RM3A 3C6YA 5JJCA 4UTNA 1E7WA 3G2QA 4FNMA 4EY5A 3H6GA 4C29A 2OQVA 3V4PB 4ZEVA 3BORA 4RZ3A 4JVOA 4L4UA 5TNXA 1H6DA 3FIUA 1EX9A 3U3RA 2IYOA 1NN3A 4EWLA 4RFVA 4ZHQB 1PEAA 3UWSA 1QBGA 1QLWA 4XVRA 3C7CB 1O89A 3LP5A 3CO0S 4ZZ0A 5U1PA 4GKVA 4RTRA 1AB6A 2P0EA 3KQWA 3QOXA 1U8ZA 3K3VA 4WL0A 3EPHA 3NEJA 3QVJA 4DV5H 3B3GA 4TT3D 1N2ZA 2C2WA 4OX9Y 1LH0A 2AWOA 1U2ZA 1VYHA 1KDTA 2EZ4A 1JA9A 3C3JA 2N3ZA 4BB6A 3CLHA 4WXEA 1RHRA 3TVYA 2GZHA 2WVGA 4KZKA 3QXHA 2DKOA 5A4DA 5AW6A 3HJNA 4RF4A 2PZ8A 4ER7A 4KMMA 3F47A 2H9IA 3OUZA 5EN4A 4MINA 2IH2A 1Q6ZA 1AQUA 2HGWA 1QRDA 2Q4RA 5K20A 2FZKA 3M6XA 4KIFA 4B6QA 1C0IA 4ZDWA 4BTVA 1YI1A 1L8XA 4JYCA 4EMUA 1DGQA 4BE4A 3PEWA 3WGKA 2FW6A 4J3JA 4I3GA 1MX1A 2C3PA 3GXBA 3O8NA 2N1MA 3MBKA 3ZCUA 3F0TA 2I34A 2JVIA 3H2KA 1BDMA 3TL6A 4ENVA 3PC7A 1J1IA 3MINA 4RCNA 3HY3A 3SQMA 2SKEA 3QXJA 3JCZA 1FK8A 3KT8A 3FWNA 1D5WA 3ZZTA 4XDYA 4KIUA 5AVUA 2QYTA 5L3QB 1ORWA 1EFDN 3UOGA 1ZFNA 2Q46A 1XF9A 4MX8A 3QH4A 4B8YA 3E9RA 3OQJA 5KJ6A 4PC6A 1U8XX 4RVOA 5THXA 4CCSA 2KSQA 1AIPA 4R9UC 4Z7QB 1JIUA 5CD1A 4I1SA 1AA6A 2G1JA 4MI6A 3ND6A 1E0SA 5DLGA 2VNKA 2NO5A 2ST1A 1Z5UA 4UJ3A 1IWBB 2XVZA 3TQRA 2XAUA 1RXEA 4BVFA 5KFUA 4R1TA 4CUKA 1JHDA 4IGKA 3MJVA 2ZRMA 4DGQA 1T1EA 5GONA 3WSWA 1CIJA 1E63A 4YRSA 4MWTA 5COBA 4IFIA 2XVAA 1GFIA 3PKZA 3ZNQA 2O3TA 2R8GA 1FBNA 3KTFA 1G9SA 3EZFA 3L7OA 2IVZA 2X40A 4GP7A 2WDZA 2BGGA 4K0RA 2ZULA 3LQSA 1O9BA 5K8JB 2PYDA 2CJWA 4P53A 2Q3BA 3LQFA 1CUJA 3KREA 5B53A 3HADA 3PF8A 1R5NA 3N76A 3OIFA 5GJVC 1TVMA 1XKTA 2WYOA 2CJWB 1X13A 2ZYRA 4HC4A 2LRHA 2YVAA 3I2KA 2QLTA 1QO9A 2I4NA 1XXLA 3DJFA 2X77A 4C0KA 1M1NB 3OO1A 4KR3A 5IH7A 1U1CA 3NVDA 3G7NA 3TJMA 2UZIR 2PX3A 4OM7A 3MXOA 1BN6A 1H42A 4P83A 4BY7G 4M83A 3ZJ5A 2Q5QA 3GCGA 4B6SA 4HADA 1C29B 4R54A 1EFLA 4IGAA 5HKAA 1QGUA 2W8ZA 4HT3B 4MRPA 2HWUA 4QGFA 2WYUA 3UHPA 4X64H 4F06A 3X43A 1CRPA 2EF1A 2H29A 4NYJR 1W4LA 1EHIA 3ZYCA 2FJPA 4FXOA 4BZZA 3PNOA 1ZINA 3HUUA 4YCDA 1QGUB 2ZG6A 3RJ5A 4EX7A 5CT9A 1DHTA 1NJ6A 3MLBA 3RBVA 1YDGA 3U4QA 3HN6A 2P41A 3CUEF 4EJSB 2ADFA 1F4PA 4LAFA 1JZSA 1IH8A 3FTEA 5DYWA 1IXYA 1V3TA 3IT0A 4DLRA 1E66A 3JZFA 5EGNA 1IPHA 2GTHA 2PKXA 3REQA 4QUJA 1OXBB 4ECYA 4ZDKA 1O7JA 4UEWA 3W5OA 1FS6A 4XLZA 1CQIB 2D5AA 2HRBA 1YB1A 5FTNA 3KUXA 5FLXA 1XDWA 2CXRA 5EIXA 1XMJA 2FN7A 3LBIA 5KNCA 3V1UA 1ISFA 3T95A 3CKLA 1O9GA 1W1WA 4DR4B 1LK5A 1MUUA 4HAVA 1WO8A 3QGMA 4J8PA 2DFLA 3NIWA 3ZIUA 4RHFA 4TM8A 4PPYA 4BY9E 5FAXA 2CVQA 3LBYA 2VPXA 1FUEA 4YMSA 1IZ0A 3IX7A 4MRNA 5K2OA 1KS9A 3P2JA 5L6LB 3NHJA 3U37A 4OJKA 2WZCA 5J4KA 1NVFA 3BZUA 4D1YA 1RABA 3RC8A 1YZLA 5C1PA 2JIZA 3AESB 1HQDA 1VCNA 2HT1A 3K2EA 4NQRA 1GNSA 4K46A 5A02A 4WBXC 4KGDA 1SR8A 4PX9A 4LF7H 3F1LA 1OZFA 1HM5A 1EHCA 4TUYF 4YCLA 4ZYVA 4UJ5A 5EE3A 3GWGA 4LMYA 2XWQA 4IOKA 4RXTA 1QCZA 4Y67A 2Q28A 1QX3A 4J6EA 4S04A 4M7WA 2C2GA 2MINA 2P8JA 3I2HA 3ZZ0A 4EA6A 1Y1TA 2IPNA 2OGUA 3KL2A 2QX4A 4IM7A 3HJRA 5LQDA 4F4DA 4HXYA 4MRAA 3R7BA 2DPMA 1NSTA 2FMKA 3A9UA 2ZJ6A 4Y6RA 2O1SA 3WIUA 3L6BA 3Q8MA 2P6MA 1K89A 1UK9A 1OX6A 2VT2A 3EH1A 3DTTA 5JBQA 4LH7A 2OAEA 1FQJA 3PL5A 4EFEA 1ZNXA 5FUQA 4R8LA 4O5AA 1J90A 4A2PA 3C8UA 3A9VA 3L0SA 3MUNA 5AKLA 3DHNA 3T7IA 1XRNA 4RF2A 4LSXA 5H5JA 1J22A 4WY5A 4GECA 1OWPA 2CUZA 1YRLA 4IGEA 1KY5A 4EB8A 1RM0A 2P3OA 3WGYA 1QV6A 5F9LA 1N3BA 1MX3A 4RJIA 3F5QA 4RVFA 2JHPA 4EKYA 4UAUA 4WHMA 3SP1A 1B33N 5C31A 3IURA 3HM9A 4J29A 1XNQH 4L28A 4RS4A 1JAIA 4LJSA 2D4AA 1EIZA 3TQIA 1RAIA 1Z5NA 3C7AA 4HQRA 4YRPA 5J47A 4RE5A 4RMHA 2WTEA 5BSWA 1SKYE 2B3TA 4GMGA 3FHTA 3WLLA 1P16A 1U80A 1OXMA 3E9EA 4NENA 1QIJA 5F23A 1QH1B 4I1RA 4CQMD 5IEJA 2UAGA 4C0QC 3GLUA 2DY0A 3OT5A 1CKNB 5LD2B 1OA0A 3AY6A 4IINA 4E33A 2C29D 3GEGA 3RPEA 4Q3AA 4NENB 3M82A 3WWJA 2P9FA 3EA4A 5JCJA 1ZIPA 4Z49A 4WK0B 1HXHA 2CHUA 1CY1A 1B3BA 3THRA 2ESRA 2CVFA 2JGAA 4C78A 3D0QA 2VPSA 2JFPA 4IRDA 5E4JA 1XPJA 4F8EA 2KPOA 2REOA 3DZDA 3UT5A 2XGQA 5ALGA 4ZQHA 2DT8A 3PA6A 1R27A 3NRJA 2QUZA 3RW9A 3BWXA 1GIAA 5EJ6A 1A95A 2YJ3A 1JG2A 4QTYA 5THQA 2Q2VA 3GPCA 1C9KA 4K87A 3L41A 3O92A 4MKXA 1R6TA 4N5DA 2OCGA 4FDAA 4BEWA 4K9PA 3SEFA 2HSGA 1OH7A 3VH4A 1DQPA 2FLVA 3D8TA 2R68A 3OX4A 2LCIA 1LF0A 3LFUA 4WNIA 1J06A 3DFFA 4OAPA 1PR3A 5ARDA 5FDFA 5C5DA 4KFRA 4E3ZA 4KX3A 2HWYA 2D8MA 5B1YA 2XF8A 4JCOA 2C8KA 4I19A 1SCAA 1SM4A 4GI7A 2PAAA 1YL5A 1XUOA 3TLAA 1JKJB 3A31A 5A9SA 3GW8A 5ICCA 4G2NA 2JIRA 3AQ4A 1MO2A 3QEKA 2R44A 3QWFA 3WLAA 1K8QA 1AUPA 4LY9A 4CYMA 1P0FA 1Z0KA 2R11A 5DF1A 2NYVA 4XOIA 2VF8A 5LMNH 4O4JA 4FSXA 3A1SA 2NADA 4M9RA 4QJBA 5DN9A 1PO7A 1H4VB 2X0IA 4I5GA 1NX6A 2AC4A 1Y7TA 3DMFA 3U13A 2WOJA 2XKAA 2RKWA 5KOIA 2C2ZA 3KHTA 1TADA 2DHRA 1YS1X 5I4CA 4EGSA 1DEOA 3E3AA 2YJ4A 4UVGA 4ER5A 3HVJA 4F4UA 2YRWA 3V4VB 1B0PA 4IR9A 1DO0A 5BWMA 2EL7A 3PUJA 2ZRNA 2HA7A 3DV9A 1X70A 2P1DA 1VPVA 2I4MA 2J3KA 4R68A 3Q41A 1NVWQ 2AL7A 5C44G 4AO7A 1E9FA 1Y5MA 1U6IA 2W6IA 3QQMA 1VGRA 3MR6A 5LUAA 4BJ1A 1DIBA 5FBKA 2QTMA 2ZYGA 3TZBA 5KFAA 1VJCA 1OAOC 1XZ8A 3D6UA 3MWMA 4MV9A 4UHFA 4N7RA 1II8A 2BGUA 3IP6A 3RYTC 3PJEA 1E9RA 3G6VA 2QN1A 1YIDA 1Y1QA 1JLHA 1K6EA 1R0XA 3H05A 2WV9A 1SB9A 1FJGB 1VC2A 3AJ8A 4JK3A 2HJHA 4IG9A 3WTBA 1II8B 4F38A 4RZQA 2J3DA 1USGA 1E77A 1TU0A 3W5HA 3R1IA 5HS6A 1XL1A 2ONJA 4KV7A 4GP9A 1MABA 3R0IA 1HUQA 4BGUA 3KXLA 4DZTA 3OZTA 4J4BA 1E18A 1W0KA 1N0WA 1IG0A 5CYOA 1S0NA 2G40A 5FNVB 1J2RA 5L6MB 3CUSA 1IZYA 1MT0A 5LC1A 3OEED 2PWAA 1QQ7A 3JZAA 4LDPA 1ZHOA 1MABB 1PW7A 1P1RA 1E2KA 4BECA 2F3QA 4Q7KA 5EHNA 4R1LA 4NJEB 3EW7A 5JHGB 4RJJA 3AQIA 2LKDA 3VNQA 2IS2A 3WZ2A 4I50B 4HNVA 5C1OA 4YR9A 2O8VA 3BACA 4FBGA 3GIDA 2CXNA 3AEYA 5D1HA 4D0NA 2X19A 4YRQA 4KWCA 3UCXA 3RJ0A 2RDMA 2WK1A 4DMLA 1V7QA 3R24A 1U2QA 3ZH9B 4C21A 2QZ9A 1NVBA 1FRQA 3NWEA 2D5LA 2ZE7A 3PCXA 3GA0A 2IMWP 1R0WA 4NCJA 4PCVA 3FPBA 5JMOA 2J33A 4E4YA 2PX2A 3O4IA 1V8OA 3ZXYA 5GPBA 1TAGA 2Q1YA 4INAA 5IYZB 1XNRB 2H2WA 1TYBE 4D8WA 3VPCA 2B9VA 1G4UR 5BWRA 3OPYA 4RNNA 5FHQA 1GDHA 4GQIA 4D99A 2YFKA 3O83A 1JFFB 1WF3A 4ON9A 3QUCA 1KJJA 4D3YA 4TV8B 4CBVA 1M5UA 3QWIA 1SXJA 5TARA 2OR3A 1ZKDA 1HNZH 2J1LA 4RSGA 4WZZA 3D0OA 3OPYB 4EUNA 1CY8A 2JASA 4EI9A 4ZOCA 1IN4A 1KVTA 2Y9PB 1I3OA 3E58A 5FIUA 1VE9A 1MENA 2ZE8A 2QM8A 4ZOQI 4X7BA 1H2AS 1PNQA 1SKUA 5JD5A 1SXJB 3RVRA 1YUBA 3QW2A 2I03A 2QL9A 2I29A 1XPRA 4UNSA 3ZIAD 1KJQA 1XP5A 1VL1A 1AQIA 2NN3C 3AW8A 2J6IA 2GUGA 3SEQA 4RNDB 4DR7B 4JBXA 4IXNA 4N9WA 3RH0A 2X4GA 2YVUA 1MW9X 3NTXA 4PGFA 2I6UA 1CP2A 4YDRA 1YIOA 5CE8A 1QJ4A 5IJAA 4MGHA 3DBRB 1EGQA 1SVOA 4KOEC 2AUTA 4PN3A 4AN1A 1KQFA 5IJ9B 5L1IA 2BV3A 1XU9A 1R0SA 2QM7A 3K6SA 4H7EA 3H0GA 3T15A 1S2GA 2V7WA 5I7WA 5DGCA 3WGUA 3Q2IA 2YYYA 2Q21A 2AMVA 2DJ5A 1QRSA 4ETWA 1A71A 1MFPA 5KPDA 2I8LA 3EIOA 3NHRA 4FFLA 5LXTF 2NX2A 4RSHA 1N3YA 3LKBA 4UAVA 4RF3A 4C3ZA 1DFIA 4V3BA 2QW1A 2Q3HA 1V3QE 1UJ5A 4EUHA 1VMIA 2JJMA 3DWEX 2CHFA 2MSWA 4HFNA 1V9CA 4FHGA 3NH9A 1X8JA 2Y76A 2BEUA 3JQ8A 4KUGA 2YC2C 1RZUA 2EVWX 4JX8A 7ADHA 2GBGA 5A0FA 1KMIY 4YMUA 3UHAA 3V9PA 2VF2A 1RZRA 4EGCB 4V03A 5JPCA 3W4JA 2JDID 2JARA 1SULA 1L7VC 3H20A 4XIGS 5B5SA 3I34X 5H70A 4GGMX 1JB9A 3NJ8A 1V2HE 4RTLA 3MCVA 1IUPA 1NE7A 4YY3H 1DAAA 3E3LA 3PGKA 2QJOA 3F7NA 1I1LA 3OX3A 2QBYA 1IQRA 4K6FA 1TRKA 3ANSA 5I7RA 4ZYYA 4G56A 5CEJA 3I0NA 4XCXA 5CM0A 2CSUA 2YW9A 1BGVA 5ENDA 3E82A 2ZSFA 4IH1A 1U0OC 2E5LB 4KO8A 4YUAA 3D0RA 2R7KA 1ULTA 1JGTA 3ZHVA 1IWOA 4WESA 4FNGA 5E9WA 2WIKA 4JLPA 3S7ZA 2OCXA 1B7GO 2HFKA 2OP1A 4FYPA 1ENOA 2QMEA 3KLBA 3EDYA 4FMBB 1YACA 1S89A 4LC1A 5KFJA 3CNLA 1KEEA 2IK8A 5D1OA 4TS1A 4QQ8A 2V7PA 5DYYA 2PMWB 2PQ6A 2QD4A 1QGDA 4H4CA 3RTEA 3VNRA 1WSBA 4OD0A 5BSEA 3DE6X 3HGQA 2ZXEA 4DMGA 4OHRA 1HDEA 5F7OA 1R5JA 1F2DA 3V4SA 4HB0A 4IRKA 1KEEB 3O84A 3HGTA 4HLUA 1H2EA 5CW1A 4BFTA 2G1KA 4EG7A 1XYGA 2P9YA 4X1IA 1WU8A 2A67A 3DDOA 3C3BA 2P6UA 3H4DA 2QIOA 4H1VA 3MTJA 5GIPE 4QGGA 4EYQA 2Q27A 2B1GA 3R7WB 1HI9A 2O3RA 4XYLB 3VBCA 3QLJA 3OQ6A 1UJ4A 3P9CA 1QHGA 1G8KA 4X1IB 4PZ6A 3F73A 1H65A 2GH1A 8ADHA 1HFWA 5BYJA 2D2FA 1HZZC 2E2HA 4GXTA 5DN6A 1B42A 4FM9A 1PU2A 3QPBA 1AF4A 5E1MA 2IEBA 5JYBA 3D3NA 4H1UA 1JFRA 3G0DA 3IUEA 3RRFA 4Z99A 3UHOA 1QYVA 1ZH8A 1GSOA 4L6CA 3CWCA 2GYVA 4OYYA 4UVDA 5J59A 2C3OA 3OZBA 5DNEA 3SFZA 3RYIA 4REOA 3FI9A 2FMTA 3EY9A 4EHDA 4X66H 3AF6A 3UT0A 5IVDA 3UW3A 1A9OA 1V1MB 2HF2A 5EUCA 4JXKA 1Z7GA 2X3YA 1UAYA 1PEYA 5KFOA 4JJ4A 4QELA 2Y6UA 4QYIB 5K6AC 4L3VA 5LA6A 1ZGBA 1Q7EA 2FSVA 1VBGA 1QJCA 4QUKA 3QI2A 2FX3A 1XP8A 2Q6LA 3B1KA 3GH3A 3AR4A 4XIFA 1UPUA 1R3DA 3FBGA 2UZ1B 4QTZA 3TIVA 2I1QA 1SUFA 5LA6B 5DGXA 5K2MA 3PJGA 3FYCA 3ZG6A 1BS2A 4KLRA 2LR0A 3O90A 1F5SA 5IDVA 4TL9A 3SF8A 5DM2A 4FKMA 3VNUA 4YMIA 2HHJA 3B3AA 2BHLA 3QVSA 5ALVA 2Z8YA 4XR9A 3M3HA 5IKPA 1F5NA 4KGZA 1Z29A 3H86A 4MGIR 4P98A 4ED2A 1EI9A 1QO0D 5KS8A 3ZOKA 2KLHA 3RAEC 1HLPA 1HTTA 3O8QB 5HDBB 1I4TD 3CQZA 2WJAA 3PEEA 3PNMA 1WA5A 1TWFA 2XMBA 2B7BA 4RB0A 3I9MA 1LX7A 4FX5A 1AQNA 3L4KA 4BMSA 3F46A 3QNWA 4KSBA 3ACBA 5CM9C 1LVHA 2I4LA 2LV8A 4IIJA 2PJDA 3L7CA 5T64A 3H0CA 2J32A 2J07A 4GGOA 1YE5A 3R3UA 2R1VA 1PLJA 3C3AA 5K0BA 4AP9A 1GNVA 4H31A 4R8SA 1L7XA 2P2GA 1R4MB 5JS2A 2YZNA 1RTTA 1OFGA 4DBLC 4N0PA 1PJ4A 4OBBA 3A6LA 1MW8X 1KRXA 2JJQA 4XR4A 1ULUA 1OH6A 3AI1A 3QG1A 4RTPA 1IJFA 3SX0A 3FR8A 1GUAA 1T6NA 1XTIA 5LL6P 2PUDA 1NZFA 1IHXA 1NW3A 1GPDG 4QOHA 4R9NA 3GP5A 1S1MA 1YOBA 2PPLA 4O63O 2CNLA 2ZROA 3GJ6A 3RAPR 2Z09A 5EESA 2AH5A 3EWNA 4NPHA 4XUDA 1QE0A 3UAWA 1FSSA 5C8YA 2QTWB 4U39A 2D06A 1JAZA 3ESBA 5EP2A 3P9KA 1SC1A 3PO2G 3ZJTA 4INZA 1P2GA 3QITA 5CLJA 2YMMA 3K20A 2KBEA 3JQCA 5H8WA 1E7QA 1KAMA 2PXCA 2QS9A 1JH9A 1G7TA 5BPFA 5GZ1A 1H6AA 3N40P 2G09A 2QRZA 4OP1A 1J2UA 4QZVA 4ZZ3A 3K72B 1QORA 4LF6H 4MZDA 2R8ZA 1M6EX 1JEJA 4YMVA 4HJRA 3G5UA 4FS2A 2NO4A 2G6BA 1ZD8A 5KFNA 3UH0A 2AGOA 4Q4JA 5AHKA 4Y2QA 2OLJA 2GAAA 1R0BA 5ILOA 2B78A 4L4ZA 2VH5R 1I4WA 3D6HA 4PYLA 3V80A 3HYNA 4WY2A 2KW5A 1O77A 3DD5A 4DLWA 2AD5A 5D7NA 2FQWA 2J6BA 2WT4A 4RPLA 4C2MA 2XIQA 4J91A 2R7LA 2ZUSA 1T9GS 4LXQA 3BH7A 3FWKA 3ZDRA 1UQRA 5L7WA 4OHCA 4BXOB 1OKKD 1U6JA 1JHXA 2A5YB 2QRMA 4X62B 3CKYA 3RAFC 4E88A 3W6UA 2ZTUA 3LIIA 1UWLA 3AOEC 1ZGCA 2DPJA 4DREA 4YAGA 1JQBA 4PPQA 2FF7A 2FLPA 2Z6QA 3D64A 3MPOA 2QVZX 3MJFA 1RWBA 3DMDA 1Z2AA 2OO5C 2HRQA 3CVZA 3CTPA 2BTQA 3EDQA 2WJ3A 3ONWA 4BBPA 3DVLA 1F8YA 4CQLA 3PFCA 1S4QA 4QJ4A 4ZGBA 3WMWA 2I1WA 1E96A 3VDNB 1X42A 1U8UA 1UZUA 2IHNA 4NVRA 4ZO4A 4B6OA 1OWTA 1JQDA 3ANTA 4HZUA 5JD3A 2AG1A 1XJCA 2PGNA 3MJCA 2W42A 3R76A 5LIRA 2WWWA 3YASA 4EPVA 4FD3A 1X14A 5LLSA 3SSNA 5BRJA 4XIJA 1Z0UA 2ZJ8A 5LKAA 2AD1A 3A1TA 1EVEA 3AEKB 5IJ0B 3TTYA 1E4YA 3L0YA 4Q1AA 3E15A 1HOXA 4DV2H 5FI3A 2IYLD 1MPXA 5ADHA 4M0DA 1WZUA 4G0QA 5DOZA 4K9OA 1BIFA 4ZVLA 3EIQA 4INOA 2DVMA 1I6MA 4CMBA 1RPZA 1OLOA 2ZI7A 4ZVOA 3T7JA 4MSUA 1JAYA 4FS1A 1FMLA 2I2CA 4V1CA 2B37A 3TBKA 2FEKA 4U7FA 3DOEA 4QOIA 3FRJA 1CRZA 1W1IA 3MUEA 3DZJA 1G6HA 1JIHA 4JLDA 3HBLA 5A03A 4RH0A 3JAMA 1TQ6A 3OQHA 1MB0A 2IZ7A 4FVTA 4V1CB 1JIJA 1SURA 4WZBE 4JOCA 4F71A 4R16A 3ENWA 4JP5A 4NYMQ 2F43A 2VJDA 2VAWA 4AQYB 1J23A 4PR0A 3GAMA 3TI9A 1W96A 5H9WA 1XMSA 3N59A 3O4GA 2Q7XA 3L4SO 2BGIA 4KEAA 4TL8A 1Y4AE 1QVVA 1YXMA 3SHTA 4M0EA 4OQNA 3RROA 2YY7A 1A0OA 2O8FB 5UKDA 5DLQC 5EMHA 3G23A 1L7MA 1PG5A 4HPXB 1WB5A 3FTQA 3CLUD 1E69A 1DJMA 3M9LA 4JNCA 1VJ1A 3C24A 4IIJF 3K5PA 3I6YA 3S44A 1MQ8B 1RZ3A 1K4KA 1SK9A 1BYUA 3IBCA 2BFFA 4D6YA 2JLXA 5DH9A 1L4GA 1KTAA 4MA5A 1G18A 2HJVA 1SC4A 4KFTA 3RVNA 3MGCA 3KVYA 5LU8A 1KK3A 1B93A 5IDXA 1T35A 3QKIA 3MTBA 2A0UA 3NBZC 3TKLA 1W0JA 3CSUA 3MUFA 3BEOA 4B32A 3PFHA 3PIRA 4TZTA 2KBFA 4HGQA 1QHNA 2VBFA 2PBZA 1JDNA 3WRWA 4ZQFA 5DK6A 1DBSA 2NU6B 1KK1A 1T9AA 3BWYA 3IIIA 4NEGA 2VWGA 3B1VA 2A0XA 1SBNE 1GVNB 4G6ZA 1VSUA 4W6QA 4RABA 2WSYB 4IW3B 4OQPA 3THYB 2RCYA 3KE8A 5C8YF 5J5VA 2XQVA 2OFXA 4N49A 3QEAZ 4LGVA 2NVUA 3UXMA 3ZD7A 3NBKA 4MW1A 1OH5A 1K1EA 4XWTA 3AUXA 1ZVMA 4B81A 1MQ9A 1FDIA 4XEUA 4XYMA 4I1IA 2JANA 1GYRA 1TUEA 4CV2A 3T9EA 1QYIA 2Q5HA 4GMFA 2DUNA 2YV1A 4JKOA 4JUCA 4G86A 4RS3A 4RMGA 3TK1A 4Y0NA 2XBMA 4HG2A 2JI6A 3TSOA 4JI5H 1P9OA 4DG9A 5LWQA 1D8AA 2BGNA 4A15A 2BGLA 2XUJA 1ZN2A 3LQ4A 1A8HA 1JECA 2OBXA 1KBOA 1NRXA 4AU1A 4DAAA 2QY9A 2ZJZA 4PN7A 1GGOA 2RHTA 2Z8ZA 3EY4A 4KO4S 1KVSA 2UUBB 4MCIA 4M36A 2FB9A 1BWRA 3KHUA 4JSTA 3HJBA 4DQKA 4O4HA 4QQNA 5KFRA 3GLGA 3VDXA 2CE7A 2OXRA 4JIGA 1TU4A 4UAGA 4HSGA 2G82A 5EXTA 4E4RA 2BELA 4J3NA 3VU1A 4AG5A 3P5BA 2AOXA 5HVNA 1U0LA 4LE1A 3U1VA 1OU4A 3LO5A 4WKCA 3B5JA 5HGXA 5G53C 4M54A 1M7JA 3X1ZA 2Y4OA 4R83A 3GLGB 1ZNYA 3FMFA 4UTXA 5D6OA 4C01A 1M9NA 3BQ9A 2BQUA 4LNUB 1VIYA 2KWIA 5AXDA 5EWLB 4ITUA 5GY7A 2BL4A 3UVEA 2V45A 2VWQA 3HUFA 6ABPA 4KWTA 3CLSC 3BXOA 3CUUA 4YAUA 3MT7A 1KR2A 3BD9A 4MUEA 5KQRA 4HWRA 2QLLA 2WB1A 1O08A 2HCRA 2ZBRA 3A9SA 3I9OA 3NDJA 1VZ3A 2DU8A 1WCXA 4MVCA 2BFCB 3K0EA 3IAM1 4P80A 4IVQA 2HJGA 3I30X 4EEQA 2F2TA 4RD4A 3SC6A 2H1FA 1GZ5A 2V5UA 5I4KA 1TNDA 1K7XB 1WCIA 2O4UX 3FNEA 4MVJI 4MUJA 5FOVA 3LT1A 4IO0A 1Y82A 3WAGA 3V8BA 4BQEA 3NHSA 3KZ1E 1TT7A 1NMSA 5DLEA 2I9PA 4MWSA 3F7OA 4LYJA 4NXNB 2XBUA 1N9GB 3U62A 1WCIB 2Z9CA 3VSCA 4EAAA 2W4QA 3ABZA 4MUYA 5KTMA 4KK3A 3BFJA 4WXRA 1SNYA 1G20E 4HDMA 1DDOA 1KI8A 1DX9A 2UKDA 3QENA 3MGGA 1PJ8A 1P1JA 2UXBH 4WERA 1Y7HA 3G7SA 2TS1A 1BX1A 2SBTA 3DC2A 4HDMB 1F1BA 4IZ6A 2OYCA 5JJBA 3LXRA 5JATA 4BV3A 4MCJA 1M0EA 1Y6RA 2QQ0A 1S02A 3I9LA 4E32A 5HIJA 1JFLA 4LA4A 1C1YA 5LQCA 2JCVA 5L9XA 4II3A 3EC2A 3OZSA 4BFXA 5IPFA 2XSZA 2XVMA 5HE8A 1SAYA 4FEGA 5T7BA 2BF4A 4ZZ1A 1M8GA 2GARA 2IUTA 2O2YA 2GILA 3A9RA 2OUKA 1EE9A 1U1FA 1CRQA 4MW2A 4X65B 2DIKA 1SVIA 1FF9A 3ZE8A 3WV5A 4U7HA 5FI0B 1E3IA 4UATA 3P4UA 3PQ8A 1PWZA 1MVNA 2YXDA 2NLOA 3QKUA 2F17A 2ZRAA 3A7EA 3NBAA 1L4KA 2WWGA 2OK8A 1ECGA 4W9NC 2O2HA 5ICFA 1UXHA 4NABA 3BULA 1VHJA 4TUYA 1RKUA 1SBZA 5GVRA 4X61A 4FE4A 1JJ7A 4XM2A 5KSYA 1GRCA 5K0LA 2I62A 3HKZE 2BRUC 3C5CA 2X5JO 4FHCA 3USES 1F6DA 3NOQA 2VRBA 4TUYB 3BE8A 5LPNA 2P2DA 4IQFA 4PRZA 1R9MA 5ITWA 3KELA 4ECUA 1T5IA 2AJ8A 3D3KA 3HMQA 2EZTA 3ZV4A 1C3EA 3OEWA 3L0OA 3K9GA 3UHJA 2XEDA 1WTAA 5KT5A 3W5CA 1H2FA 1JFVA 1BTOA 1ESCA 4J9KA 3VM6A 2PZEA 3U4AA 4EMBA 3HXKA 3EG9A 1YD7A 2CCKA 2A1TR 2O5VA 4C4TA 4KI7A 1S2NA 3LT2A 5EINA 4CMAA 5F98A 4NBUA 4C7BA 3R7NA 2XITA 2F1KA 2AOWA 1Z83A 1JIIA 1DC8A 2PJZA 4G0PA 3MINB 4N6GA 1S10A 4NV3A 2PSFA 4ZZ2A 1Y4DE 3EG9B 4WPGA 6ADHA 4YGYA 2Q1TA 3E23A 5IUNC 3WK9A 2G36A 1U7DA 2I3GA 3DKKA 5KZMB 2VLBA 4WFKA 3CSWA 3ABSB 3RABA 1TFRA 5HUJA 1VBFA 3G2MA 4RPGA 4ZAFA 4RV5A 3WMRA 1ZH0A 1AB5A 2WSBA 4F4FA 5CAEA 3B6JA 1YDFA 1DT3A 4KRXA 4A16A 4JI3H 3IKVA 1OAOA 2BFOA 3ETLA 5JIBA 1H3FA 2IW1A 4IICA 2K87A 1I80A 3D59A 1EP1B 3L02A 2WEKA 4E1BA 4YMTA 4XGIA 2C4WA 1K8RA 2JG3A 3BFKA 1NC1A 5CAEB 2Q3LA 3V1KA 1VE7A 3LQQA 4C2BA 2DWUA 4QUGA 2GN0A 2FZLA 1HDIA 4QYXA 3PPWA 5KT6A 2YIMA 4O4HF 5GONB 2D74A 2ZSHA 3AJRA 4L0CA 2QE7A 1LF5A 3MM4A 3V7YA 1FNBA 3X1YA 1XI2A 4L4YA 3DXZA 4YP7A 2V65A 4LFAB 3CT4A 3TPCA 2MIIA 2IX9A 2PBLA 3E4DA 4Y2VA 3I8OA 4LSWA 1B6GA 2GBFA 2UYYA 5ALNA 3OLWA 4XTRA 3K9HA 3OQOA 1XTUA 1WU7A 1G19A 4PQYA 1OILA 5DNWA 1LTKA 3JRWA 3N8HA 2WKQA 1K63A 1WAMA 3FMOB 3JAWA 4JHLA 2MDTA 1YR9A 1XEWX 4TMVA 3QE0A 2R48A 3ADPA 2R7MA 3UNXA 3EPGA 2Q0HA 4LRWA 1J8VA 3QVMA 5J2TF 2BH2A 5IP5A 4YR3A 3ZCRA 1S8NA 1FXUA 3JAWB 1XFDA 2WAQE 4JH0A 1X7WA 1M2WA 3EYWA 3TFWA 4KXMA 1Z5PA 3GIPA 2C98A 1Z7BA 4DLVA 1G41A 3D5QA 1HOTA 2AG8A 5L1KA 3QE2A 4TVKA 2A94A 4DNFA 4JV1A 4PX2A 6REQA 4P3NA 1U3CA 1WB9A 1MTZA 7MDHA 3KDPA 1XT6A 1TKBA 2E4YA 1X7WB 4J9RA 3U7IA 1I2BA 1QU2A 2TMDA 1QWSA 3K9LA 3AF5A 2WP8J 4K26A 1EVYA 1DL5A 1EP3B 1O5OA 3G6YA 1T43A 1YJBA 4A03A 3TTSA 1MIOA 1O0CA 4CMFA 3FLEA 1B74A 3QHPA 3U4QB 3S2GA 1Q7GA 2AKEA 5T8KC 1ONPA 2HU7A 4LW8A 4O3QA 1SOUA 3D6VA 3A05A 4MQUA 2IUSA 1GL9B 4Q4LA 1L0BA 4L8WB 4BAUA 3ZD6A 4PGAA 1YQQA 3C16C 1JDJA 4RM2A 3PDUA 3REQB 1N0UA 1A9SA 2XUAA 3OJFA 4EB3A 3DL4A 3Q9NA 4Q1EA 3CVYA 5ARBA 2DF8A 2E48A 1N8NA 1Z4MA 3LTNC 4LRUA 3HL4A 2D6FA 2ERXA 2VJKA 4A8PA 2UXDB 4MIOA 1D9XA 3CNHA 4WEOA 4G25A 4PO1A 5FPSA 3T5GA 3WX0A 5LZ8A 4UNRA 2QA5A 2IZ0A 1Z13A 4RK5A 4G5GA 2A2ZA 1ZISA 1L4FA 3R3JA 1H93A 1P4RA 1DIKA 3KV1A 5J2UA 3KXKA 3A70A 1IMOA 1WZIA 4MW9A 3HCNA 5JZSA 3EGCA 1N6RA 1O87A 1XDNA 4TXLA 2BONA 3P9IA 1RXYA 4BLQA 1KIMA 1OLUA 4FT4A 3PPXA 2C00A 3PIIA 1WV0A 1IYEA 2QF7A 3R6WA 2J9RA 3VV3A 5EXPA 1A3GA 4A0SA 2HJRA 1SCIA 2LBPA 1LDMA 4JI0H 2PD3A 3COWA 4NC9A 4RM3A 4IIEA 1ZJJA 1WW8A 4TMFA 4M0KA 5D85A 4YTEA 3OQPA 5HF5A 4Q3KA 2MINB 2EX4A 2J7PA 1DQRA 8LDHA 2WDTA 1OYWA 3O3CA 1FFDA 2F4NA 3EZ9A 3CPSA 3CA8A 1PW5A 1MB4A 4OV6B 4OLHA 4WBNF 5HRUA 2YWDA 1QPZA 2J67A 4YP0A 2VCYA 1REQA 4NE2A 4M8KA 5F5NA 3N8IA 1PFQA 4W5JA 1MZPA 4KODA 1O97C 3DM5A 4E6NA 3CF4A 4TMTA 2AEJA 1WSWA 4EW3A 3DZ8A 3HP1A 4JKIA 4IUYA 1RWOA 2JJ1A 2B1JA 2WQ6A 3QP9A 4N4AA 1YZVA 3RWOA 1WWKA 1UM8A 4LN1A 9ABPA 3DGEC 2WOOA 4I8XA 4PPFA 2HNBA 4K7JA 1H0KA 1X86B 1I01A 2H2FA 4F3KA 2Q5FA 3GROA 2OXIA 3T3MB 3OOJA 3CZ9A 1R10A 4H18A 1HURA 4B33A 3AYHB 2ABWA 1JG1A 3PBKA 2GKGA 3LC1O 1EDBA 2IU4A 4NS4A 2C94A 2NZJA 5GWXA 4BLSA 3VYWA 3EWAA 1QK5A 2EDAA 2B8JA 3T38A 3U4HA 5FF9A 1LV7A 5DG7A 5JZOA 3GFFA 3WIVA 1DV1A 3IAXA 4HFJA 5JYDA 4BMCA 4OEHA 1IM8A 1NLMA 3B36A 4BGVA 5KC9A 3FNRA 3WQSB 1IY8A 3Q15C 4N5NA 4R9RA 5KFZA 4KPEC 1WMBA 4LH6A 1P72A 5BVGA 3ITNA 3Q3HA 3IPAA 2HMVA 3NORA 2OV4A 1ZOIA 1AK1A 4F5YA 3PP8A 1GVHA 4UVHA 1PNTA 5KG3A 2QK4A 4EBDA 3Q3CA 4M1SA 1KR5A 4D9NA 2NUPA 1AZSC 5EJIA 3CU5A 1OIXA 4Z0HO 4GLBA 1YKFA 3L0CA 5DI3A 1WR8A 3VR4H 4L1KA 2WUVA 3W8DA 3H2GA 3O0TA 1U8CB 2WU4A 2PQMA 4UZSA 2IXFA 4PDBA 4DG8A 1XV5A 1HZZA 3O31A 5BV8A 4QJ5A 3UWOA 3PXCX 3HXQA 5EOVA 3WO0A 4K9LA 3CR3C 4HUJA 1ZD2P 2VO1A 3SSAA 1X2EA 2GPBA 121PA 1IULA 3UT5B 1U8EA 1D7OA 3IDAA 1KERA 3HP4A 1M1XB 3ED5A 1IK4A 1OAAA 3RC1A 2QU7A 2ACKA 4RU9A 2PS3A 4ED9A 3QOWA 3D1JA 4KPFC 4ND3A 5LMUH 4OQZA 3GAAA 3EIFA 3LUBA 4LFBB 3C6BA 3TM5A 2VHVA 3ADBA 3W5SA 5K6AA 3L1JA 3ELBA 3P4YA 1PYGA 5ESDA 3QU2A 4CKEA 4BP3A 2BI4A 4C06A 1O4VA 1A9YA 3WYGA 3BSFA 3GMSA 1EG2A 3GFPA 2EIYA 3ZZMA 1ZLXA 3CX6A 1OR8A 1O58A 3AL0C 1Q7RA 3EZ7A 3AONB 1SVNA 4NZPA 4U4AA 3OUTA 1C9MA 5IT0A 5LXTA 1TZJA 2W6OA 3ZJVA 1RACA 1ZCBA 1ZMTA 1WDWB 1GY8A 2KS6A 1YZGA 5A9SB 3NLLA 1BKSB 3VISA 2ZT6A 4DV0B 2D3WA 1TM4E 4W6ZA 3I04A 1VIAA 5K0SA 5LXTB 1M6HA 4O4JB 1FFYA 3H83A 2B4TO 3MN1A 1DC4A 3EVCA 2IBSA 3COPA 4XWYA 4X00A 4HDNA 4UCWA 4ZVRA 1KA9H 2P78A 1SXIA 4OHFA 5FTLA 3GARA 3FDXA 4UFZA 4BMNA 4F4XA 2FFAA 3P0EA 1IBKB 4GC7A 1ESDA 3MSXA 1DMRA 3PQFA 4G07A 4Q19A 4JLJA 4E5DA 1VL8A 2JGRA 4HDNB 5H16A 2O7VA 4EZIA 4IIFA 3G9QA 5J2UF 4KTVE 3WNVA 5BRNA 2TSYB 2VTEA 5KC8A 1V47A 3KSUA 1XMVA 2IYWA 2OZKA 2H7XA 5DTJA 4JC8A 1TIKA 1P2DA 2VXOA 2QRUA 1HG1A 1OGJA 3EJWA 2XT6A 2ZOSA 2NZ2A 2D0DA 3I6IA 3NXKA 3CINA 4BMDA 2HDHA 2ZU0C 4AJ4A 4M9XA 5GV7A 2WHRA 5CNIA 1MAHA 3AETA 1L4EA 3I1JA 1Z07A 3TLMA 4PG7A 2D54A 3OZXA 2WKWA 1T1RA 1VZ2A 3IEUA 5HV6A 2WFZA 4YB8A 4F21A 2QD3A 4WNYA 1B8PA 5JG7A 4I5EA 4HWTA 1PFGA 1YDMA 2NPFA 1V3VA 2A3RA 3OBIA 4UHKA 4A2QA 1Q7CA 5DMXA 4X8HA 1FUUA 4UUNA 2O5EA 4FTWA 4N12A 3L77A 2R4UA 3TRDA 1YH3A 1QWOA 1T6ZA 2QRPA 2PRYA 2DCMA 4ED0A 3OU2A 2V7QA 5JAZA 3DDNA 2XH8A 3GQVA 4E94A 3LC0A 2ANCA 3T3HA 1NF9A 3WICA 3KJGA 2H1CA 3NHWA 4MW5A 3WYAA 1FYDA 1N2OA 1CUHA 4L5CA 1LPPA 1RLJA 5IT9W 4B09A 4L16A 3KSDO 2AF4C 2WJVA 1XK7A 1ZNQO 3EARA 1E0JA 2XQIA 1UXJA 1J0DA 4JEIA 5BSFA 3PGMA 3ORFA 4M9SA 2AEEA 1IRIA 4QQFA 4LNAA 4S1NA 1PNVA 3I62A 3G2NA 3DMTC 4AQDA 1JXOA 1RJRA 4CI9A 2BEJA 1RPAA 4L50A 2LWIA 5C46F 4FGWA 1EXVA 3NHBA 1JXAA 2YICA 4J76A 3NB0A 4YAKA 3AHDA 3HDJA 1XZJA 2J6CA 3G8AA 2Z3ZA 1RE1A 3AVYA 4KN5A 1XZDA 4BNWA 3EUEA 2DBQA 4R6WA 2AIRA 4AVYA 3IVAA 1P0QA 3P2MA 2CEAA 4OHPA 1YK0A 5GGYA 4QPPA 4YAKB 1ZOLA 3WE7A 1PGQA 3AOEA 1TA0A 4H7JA 3OTIA 3E6AA 4M1WA 1YMVA 4DRXA 2DHCA 1WCWA 3UMBA 2XBLA 3LDAA 4LFCB 3OF5A 3SSMA 1T6XA 4EQ6A 1QIDA 1A5ZA 5JMPA 4JYAB 3TE7A 4KXQA 1XQ6A 1EXDA 1B41A 4RD1A 4LGMA 5BOSA 1X6VA 3L0DA 1GCGA 3SX2A 3BXGA 3T12A 2A9KA 3Q3GE 3A1EA 3LKZA 1L5LA 2Q4EA 2Q7OE 3PD0A 4EQ6B 2WPDD 1NYRA 1NVVQ 2WWYA 3FYHA 4K9QA 1ND6A 4ZVPA 5BOSB 3QWUA 1IZ8A 4KNVA 4G1CA 1JPVA 4OBEA 2BUCA 1RAEA 4ZI5A 3DEIA 3EYAA 1I32A 2YV3A 4UFOA 3M33A 2P90A 1M1YA 1M74A 2PXHA 1E1RD 1MDBA 4D9FA 2H2AA 4H08A 5KYKA 3T9AA 2QP3A 2OBLA 4ZFNA 4GVLA 4IDFA 4B34A 3TLJA 4C87A 2R7AA 3OZCA 5CH3A 3SJUA 1ZJ4A 2MSKA 2NWQA 1RI4A 5K4GA 1IIRA 3I8SA 2WYWA 5ES3A 1X1DA 1FFHA 3QU4A 1PS8A 2ZZMA 5C5JA 4UBLA 1NM5C 2NU9A 2HCFA 3NO4A 3HU1A 4AZWA 1YOVA 1TU3A 5DYIA 2C9OA 3OMLA 1Y5LA 3PZBA 3K6SB 2YYAA 5C1IA 4TLEA 2ZS7A 1NL3A 4AKGA 4B3JA 1JWBB 5DASA 1IOWA 3WR5A 2XZDA 4IYRA 4ECWA 4BFLA 2XCRB 1Z8FA 3F6CA 4QIWA 2NU9B 2NVOA 2C5AA 4EA9A 2ZYTX 4OP2A 3AUUA 4TS3A 2PFGA 2JGMA 2RHGB 1AXEA 3F4LA 1C14A 4FS8A 4MICA 4JQOA 4FFWA 4ARCA 1W34A 2Q4BA 3DS8A 2D2IA 2BEUB 3JQ8B 3AEZA 2J0UA 3PCRB 2YRXA 4TX1A 4V0QA 2VOJA 1DCKA 1GU7A 3GLVA 5CXUA 1KP3A 3BMXA 1HT3A 4Q7EA 3BIJA 3K0FA 3RKSA 3HU5A 1Y37A 1GL7A 2HCBA 2A35A 1DRUA 1TLTA 5JS1A 5AVYA 2J0UB 4IJ5A 2OWOA 3UZUA 3IMCA 4ID9A 4G0WA 3A6KA 3MTAA 4ZCIA 4HEA1 4YACA 3DDCA 3OBBA 3JD4A 1B23P 3OD5A 4NOMA 3BCRA 2ZXUA 5KU7A 2QBYB 3NTOA 3N2LA 1VCHA 1ANKA 2PGJA 2PM8A 5IHXA 3BQNB 3GLQA 1RC0A 4P3YA 1Z12A 1XEXA 3FG9A 4JHXA 4K6MA 3J81W 4YALA 4I6GA 4WESB 3UWMA 2FPGA 3DBVO 2X14A 2HREA 1II9A 1G5IA 2XWPA 5LFAA 3ROEA 3CF0A 5GM2A 1CTQA 4DV1H 1XEXB 2B5VA 1GRQA 4BGDA 5D1OB 4PYMA 4TSFA 4S24A 2VPYA 4EABA 5I9LA 2C2RA