3VPDA

Lysx from thermus thermophilus complexed with amp-pnp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
281
Chain Sequence
MLAILYDRIRPDERMLFERAEALGLPYKKVYVPALPMVLGERPEALEGVTVALERCVSQSRGLAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIGSWGRLLAKVTDRAAAEALLEHKEVLGGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRRSAHWITNTARGGQAENCPLTEEIARLSVGAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILRYAWEVARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ribosomal protein S6 modification protein
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 86
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 6.3.2.43: [Amino group carrier protein]--L-2-aminoadipate ligase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3vpdA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpdA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpdA01
4HNTA 4I55F 3G8DA 3BSYA 2R84A 2YRXA 4EABA 2NUAB 2PBZA 1DV2A 1BNCA 5LXTF 2XD4A 3K3PA 3JZIA 1CS0A 4IWXA 5C8YF 2YYAA 2YL2A 3RFCA 2FP4B 2W6NA 1AUXA 2YS6A 4EA9A 4XYMB 2ZDQA 5CAEB 4YAJB 2W70A 1GLVA 3WNZA 2W6QA 4MA5A 1JKJB 2FB9A 5CA1F 3HO8A 4XYLB 4ME6A 5DMXA 1C3OA 1SCUB 4I4TF 3MWDA 4IWYA 3OUUA 2FPGB 5EZYF 5BPFA 5C1PA 3VPBA 5BPHA 3BSSA 2VR1A 4O4HF 4XZ3B 1EZ1A 3UFXB 3Q2OA 2VHEA 4O4IF 2R82A 1KBLA 2DLNA 3JZFA 4YAKB 2R86A 2FPPB 4MV6A 1I7NA 1UC9A 1VKZA 3JRXA 5BMVF 1KJ9A 2V59A 4I50F 4ZHQF 3LWBA 3MJFA 1W96A 3N6RA 1UC8A 1WR2A 3R5FA 4HR7A 2YZGA 5D8DA 2P0AA 4XX0B 4EA8A 4MV4A 2OLSA 1B6SA 1PK8A 5JVLA 2V5AA 2R7LA 2DZDA 2I8CA 1GSAA 4EA7A 4YB8B 3K5IA 4YBZB 1E4EA 4MV7A 2VPQA 3WO0A 1JDBB 2W6MA 3AX6A 3ETHA 3RV4A 3G8CA 1ULZA 2Z04A 4YJ3F 2J9GA 4RZQA 4O2BF 4HNVA 5LA6F 3MWEA 2FPIB 5HV6A 4MV9A 5J2TF 2XCLA 3TINA 3BSWA 5KX5F 2GLTA 1EYZA 1VBGA 5CA0F 4Y8VB 3QFFA 2X0SA 4M99A 1JLLB 3TQTA 2VQDA 5K2MA 2NU6B 3HB9A 4O4LF 5JH7F 4MV3A 2I87A 3I12A 3ORRA 4HNUA 4M98A 5LYJF 3BG5A 1KEEA 2R7KA 1DV1A 2SCUB 2YS7A 3N8DA 1IOVA 1A9XA 3OUZA 4M9UA 3V4SA 4L1KA 2NU9B 2R87A 3R5XA 3R5HA 4DLKA 4J6EA 4E4TA 2NPOA 3VPCA 1JDEA 2R7MA 4FU0A 5KKNB 1T36A 1M6VA 5I47A 4O2AF 2W6OA 4ZOLF 4DIMA 1KJ8A 2R7NA 3HBLA 4ZI7F 3TW6A 5LOVF 1AUVA 1EUCB 4IZOA 5CB4F 5JVDF 1GSHA 3ORQA 1EHIA 5J2UF 1I7LA 2GPWA 2YZNA 3TIIA 1W93A 4WD3A 4MA0A 2ZDHA 1PX2A 4QSHA 3VMMA 4EG0A 2PN1A 3AW8A 3GIDA 5IYZF 3E5NA 5GONF 3RV3A 1KJQA 2NU8B 3VPDA 1E4EB 1CE8A 2DIKA 5C1OA 3K5HA 4MV8A 4WBNF 1VBHA 4MAMA 1EUDB 5H80A 1B6RA 2V58A 3LP8A 3BFPA 4C5AA 3RUPA 2QF7A 2NU7B 4MV1A 2GPSA 3V4ZA 4HQ6A 2R6FA 2HJWA 2C00A 1GGOA 2I80A 3WO1A 3VA7A 4TV8F 1BXRA 1KJIA 1C30A 2CQYA 4EAAA 4C5CA 5JQWA 2W6ZA 4C5BA 3GLKA 4ZQIA 1KC7A 2YZMA 4TUYF 3SE7A 1KJJA 2IP4A 1DIKA 2W71A 1GSOA 4TV9F 5LP6F 2YW2A 4IHJF 3R23A 4M9CA 1IOWA 2QK4A 4EGJA 2W6PA 3Q1KA 3U9TA 2PVPA 4EGQA 3JRWA 2R85A 4GGMX 3ETJA 3U9SA 2YRWA 3VOTA 2DWCA 5HBRB 2CZGA 4YJ2F 3TIGA 1CQIB 1CQJB 2ZDGA
chains in the Genus database with same CATH superfamily
4YACA 3RAQA 1YB6A 3FZYA 2Q2NA 2D0IA 3WWPA 5JAUA 2C20A 5EC8A 2L19A 2XH8A 3FFTA 1UM8A 2HLPA 4I9HA 2B4RO 2EW2A 4F9TA 1CUCA 3RHSA 4C3VA 1P81A 1U98A 3OT1A 1XNRB 2OD7A 1ML4A 1Z3CA 4XYLB 4ZAFA 4XDZA 2C1ZA 1U94A 3EF3A 5J5CA 3V9PA 3GPLA 1P45A 2LE0A 2RF4A 4B83A 3D3WB 1EU1A 4FFOA 5IH7A 4E2YA 1MAUA 3PDCA 1J7KA 3RQSA 1G8GA 1XD2A 1KAOA 1Y3CE 4X8HA 4NNJA 2F62A 3DL7A 1V71A 4UTVA 3D7MA 2FV8A 1Z4OA 5TQ0A 1RPAA 1I36A 5FWYA 3C7TA 5JR3A 1WEKA 3O5AA 3SK0A 2V8OA 5M2QA 2YHUA 3NHBA 3CMMA 1YQWA 4PXAA 1MMFB 3QBEA 3G59A 4OHUA 1V6CA 2ZIUB 3EODA 1NUQA 1HH4A 1UKYA 1Y8RA 5ALXA 4WFJA 1EKPA 4N7BA 5C3UA 5GP1A 4PANA 1T5DX 4YRCA 4B3FX 5F2NA 4EA8A 4ZJYA 3MMNA 1FTQA 5JVLA 3KVOA 4OQZA 4H4DA 1XJ0A 1HORA 3QW4B 2UXCB 1DVRA 1Z73A 1Y6RA 1FW6A 4MV7A 4WOKA 1WKVA 2AFHA 4GR5A 3WO0A 4U7DA 4BLPA 4CDMA 3GWGA 3QG5A 4G1MB 4N7JA 1U2SA 4TKUA 5CFLA 2ZBVA 1V9LA 1R0RE 4XIJA 1A0IA 1S97A 4MUYA 2DU8A 5IVHA 5ILOA 3AIOA 3Q3VA 4TLBA 2XB9A 1QQ7A 2OZVA 4R0NA 1W8IA 4M1TA 2ZYGA 1E4YA 1EVJA 4FJ2A 3EFHA 3M9XA 5IKMA 4AB1A 1ZK0A 2XSZD 2OFOA 3TQIA 4AVYA 3HKCB 1U7XA 4FFVA 4NPCA 3MJCA 4GHWA 2PT6A 1OYWA 1UK9A 4KE7A 1IPHA 4G25A 1MX3A 4MW5A 3ZXIA 5T41A 4JI0B 1PL8A 2AWNA 1KYVA 1OREA 2WSLA 4XIFA 4UATA 2O2YA 4UHEA 4BECA 1E1CA 3RB6A 2FCAA 1HT2E 4B81A 1N0WA 4PR3A 1DRJA 2YWEA 1A4XA 3RVRA 5BSHA 1U0RA 3MQ2A 4HLNA 3OQIB 3A9RA 3HSSA 2QPOA 4WI1A 2X86A 3FDZB 4QWAA 5LP6A 2PLNA 3I2IA 4JJZA 5GJWC 3HP1A 3KBBA 3PUJA 3ZHOA 5HDBB 1VKRA 4O4JB 3CZAA 3AJEA 4EW1A 3ONWA 1CEEA 1N6LA 2OAP1 1Y6FA 2A67A 2W2KB 2J59A 3REQB 2GK6A 1R18A 3AKDA 5IHPA 2ZJ5A 4KQKA 2WTXA 2X9NA 3W2TA 2OBFA 1QHGA 4XIGS 2PUGA 2R8ZA 2HDKA 4FE2A 1FNSA 2R6FA 4NU8X 3WDLA 3TQQA 2XVXA 2VYVD 4YMWA 5L51A 2WUEA 4M53A 3CCBA 4Z0HO 3ZHBA 5F9HA 3HJAA 1S8OA 2ZRHA 2N3ZA 4R8KA 3WVNA 1RRMA 1OASA 2DBVO 5KFBA 2FWBA 2OUKA 4EHDA 1S8NA 2CK3D 3W4JA 3B78A 2F9FA 3OTQA 1POWA 3QWBA 3H75A 2KJQA 1GL3A 1ENZA 1VPDA 5K6AA 3QE2A 3S68A 2ECKA 1SKUA 3AJ9A 4QBIA 1NMXA 2P1DA 2JA6A 1PV2A 4BNZA 4E11A 3DLCA 4QDTA 1ECGA 3PITA 4HOYA 3WLEA 4EQ6A 3G1UA 5TGTA 3Q9SA 3O74A 3DEFA 1FFHA 3EB9A 4DADA 3TBKA 1Y1KE 2WLSA 2QUKA 3WNCA 4A3GG 1SVMA 4QGGA 3FYUC 1FPMA 3PNVA 4RZ3A 1MEOA 2PQMA 3DLPX 5AW3A 1C3LA 4BVLA 4I50A 3WHIA 4JB2A 4CM4A 2QTCA 1EPUA 4GRAA 2XOKA 5H59A 3I5AA 5IK2D 1MAWA 2MCFA 1LSJA 1SUBA 4HQOA 1P80A 3QMWA 1PFYA 5EXPA 3RAFC 1HOXA 4JYPA 1XRNA 2IXBA 4HAYA 3IAUA 1HFEL 4FEYA 4IIHA 3RK1A 4Q34A 1DNPA 4E2XA 4EL0A 1YBVA 4Q1VA 4QOGA 1QUEA 2RBGA 5FA5A 4F8JA 1QK4A 4A3KG 2FW9A 1L7MA 4QL3A 3VBEA 3IQXA 1DQPA 1T2FA 3I73A 1P1RA 2OZLB 4X20A 3I09A 5DI9A 3GVPA 3SCZA 1GARA 1YC2A 3OA2A 1BWSA 1IAVA 2ATXA 1QZ3A 1NVKA 3TBFA 1VKZA 1W48A 3MTAA 3KEGA 1O87A 2BR4A 1YJXA 2YWDA 2X58A 3PR3A 4RTMA 4P5DA 5DRYA 2HF9A 2ZI9A 2JGMA 2SNIE 2ADOA 3H2GA 4X1KA 5DNAA 5G2OA 4L5AA 3CF4G 3M4YA 3L8HA 2EJVA 4BQEA 3OICA 5FLYA 1KSGA 3TLAA 3RBZA 1FFSA 3SXJA 2WFLA 4M0MA 3L6EA 1V6SA 1HDXA 4PC7A 1NRJB 3C5HA 3QOWA 4BAGA 1UXOA 1ULZA 4A10A 3V6MA 2HUPA 2C78A 4YQZA 3Q9NA 2QXUA 3ZE0B 2PKQO 5KOHB 3EMKA 3E7PA 4RLHA 2XODA 1GG8A 3C98A 1WCV1 2JD1A 5J4HA 4YDRA 3ANNA 5ECWA 4P81A 2VUIB 1NUUA 4PLWA 4CHIA 3ZV7A 3B6EA 5SV2A 1NI4A 4DR3B 5DBOA 3H13A 5FPQA 3ANYB 4EVRA 2IYXA 4Y1RA 5F3RA 1BE1A 3X1YA 4CT0A 4HDQB 2VSYA 5FI1B 2GAFA 4M9UA 16PKA 3RSFA 1QH0A 1N5KA 1D2AA 2JGEA 3BFJA 3RS9A 3H05A 2QBYB 4L4RA 1T3ZA 4YCDA 4TM8A 2AGQA 3PHIA 3L93A 1UJ5A 3FTFA 3FFWA 2RHDA 2CXUA 2PKEA 1H2EA 1VB3A 4F4UA 2GEFA 4UPVA 5TJ9A 4X66H 1WB5A 2ZUVA 4QHTA 1C7JA 1E6KA 4IJWA 3R7WB 2GCIA 4G8CA 1G9TA 1T5TA 3M5PA 1T8WA 3N87A 4P53A 4M1WA 1IM2A 2JLSA 4YY3B 3ZXUB 2CUKA 4WEQA 4OHFA 4CUJA 4KHZA 4ZI2A 2FTKE 1EVEA 1NF9A 3OKPA 4U2BA 4HB0A 1Y89A 4OXRA 4K9OA 1TECE 1TAGA 4HWSA 4FKBA 2HU2A 4Q3EA 1TF5A 4Y0NA 4G1BA 3FGNA 3FKSD 4B71A 5I5VA 1WQ4A 4C2TA 3AR3A 1OLUA 1FMTA 4FDUA 4X7PA 1IUPA 1JXAA 5TF0A 2MU1A 1Q91A 4D41A 1PFVA 2K7FA 1EG7A 2VRCD 3LPLA 3MFYA 5DSXA 3HJFA 3HMKA 5E1MA 3A1TA 1RDFA 3LQFA 4BB6A 4BBRG 4ZQHA 1PR5A 1XDBA 3IHTA 4WPGA 4LK2A 5A0FA 2WWYA 4EGQA 1A9XB 8OHMA 4RV9A 4YIHA 1T2DA 3V33A 3G6KA 1WF3A 3P26A 3AP3A 2IYNA 2WD8A 1TT7A 1A9SA 5JSYA 2FMFA 3QJYA 4LJYA 4PYIA 5C5DA 4EBFA 1L4BA 3PQ8A 4FSHA 1BN7A 4G63A 3TQFA 4GOLD 3VHQA 3IH5A 4H0FA 4BNJA 4EP1A 3R3SA 4RZRA 2DOKA 2JHCA 5K9ZA 4OL0A 3SX2A 1OI3A 3LLVA 3OF2A 1EDZA 2ZJBA 4OYLA 1D4FA 4J4BA 4MQLA 5AUNB 4HRXA 1XDGA 4L8YA 1QPBA 4BJ1A 3QUSA 4JLPA 3RFUA 4D4GA 1WW8A 2HGXA 4QA9A 4AG5A 1CF2O 1RBYA 4M87A 5ES4B 4YBRA 2VWHA 3B52X 4DMCA 1O03A 1V41E 1FK8A 5BSWA 3Q7EA 5G40A 2RH8A 4AO8A 1WWKA 4ZK6A 2QG6A 1SC9A 5CB6A 5LA6A 3JAMA 2XRZA 2Q3DA 2XCQA 3KD3A 4X1OA 5HFNA 2XB2A 3SWWA 1S4MA 2DY1A 4R9NA 3TWOA 1DBVO 5TGZA 4JITA 4K9DA 3NETA 2M1ZA 2JFOA 3SI7A 3WGMA 1A76A 5ICMA 2FW7A 3LXMA 4O02B 2BPOA 5JISA 4D0GA 1X8LA 4OMUA 5HQ3A 3A27A 3PWKA 3T5PA 1FFWA 5E3HA 5MFPA 2YMLA 1Z7EA 2PLFA 3U7QB 5LWQA 1L8XA 4KMSA 2IPXA 4D4JA 3EY9A 4F4CA 1ZI8A 5K8IA 3GJ8A 1IHYA 4RLSA 3O75A 4QIWE 2JW5A 4JJFA 3U7GA 1KZYC 1DC8A 2NSHA 1NBMD 2Y1EA 3PLRA 4Q39A 3V9AA 4IXTA 3JQAA 4BJHB 4NP6A 2AV6A 4AECA 4KXFB 4Q0YA 4O2AA 3KJZA 1KO8A 4YJ2A 3ND5A 4HZUA 4JFAA 2H7VA 4YR7A 1PJ4A 2EHJA 3WQQA 3HUDA 4P7BA 2XMPA 3M6XA 4H9GA 1C9DB 4ZZ0A 4HQFA 3GROA 7REQB 1Z2CA 4BLVA 4ZDKA 3A04A 4M1MA 3W5CA 2BUBA 1ZWLA 3FBWA 1N6HA 3W2EA 3AP1A 1QYRA 2UUCB 2F90A 4UNPA 5HJ5A 3DS8A 1AJEA 3RS3A 3BIFA 5KG5A 4E15A 3VR5A 3NHSA 3CKLA 3YASA 5D3QA 2PSHA 3DUWA 4J6EA 1JBQA 4U2FA 1JKXA 2HBZA 1RQNA 2ZVPX 2A0UA 4PZLA 2P4UA 1O94D 4UCQA 3UG6A 2DWPA 4GYJA 1EX1A 5AHXA 1XQVA 1G0OA 3E0QA 4TV9A 4F6RB 3KZNA 4E08A 2D5AA 1RQXA 4C0HA 4N3GA 1W6UA 2YXNA 5FNVA 3LOPA 3I6BA 1OWNA 2JA5A 1OF1A 1E5LA 3O2SB 2IW3A 5IYZF 4GSKA 3L43A 1RC0A 1WBJB 1XDDA 2UXDH 3KLMX 5ADHA 1KAEA 4WIAA 3B70A 2WSIA 1SXJD 1DKPA 1YU9A 4FFSA 5BWVA 2R25B 4FLMA 2YJ4A 3BFPA 1G8PA 1GYPA 5FWNA 1BE8A 4KHPB 1TJYA 5DIFA 1ESEA 3CPJB 3KQPA 4C3OB 3VJMA 3UKJA 4Q47A 4A5SA 5JCZA 1A0OA 4RPLA 1EXWA 1U1DA 3CRMA 4LSXA 2PYDA 2DETA 1A88A 1YF3A 3VVMA 4OH1A 1F17A 1JZTA 4JI8H 1XALA 4ND5A 3QVGA 4N5MA 2VH5R 1YZNA 1K8RA 2QG4A 2RCYA 4TGLA 1WXEA 5J58A 1UMKA 4MA4A 2FR0A 4LBVA 4QGHA 1W0JD 3L0IB 1BN6A 2Z8XA 2C31A 3WJAA 1F0NA 2BKXA 1NVVR 5CVVA 4ZALA 1VG0B 2BZ0A 3ZHSA 4FFBA 4E5KA 2GYWA 3NC0C 2V9PA 3BMNB 2NTYC 4RMJA 5KYUA 4ENSA 2QIPA 2H6EA 2VQFH 2A1TR 2Y2UA 3FX2A 1DHTA 5EOYA 4GLJA 5H83A 4RENA 4BZWA 1DAIA 1SVSA 4LBYA 1NNUA 1YZHA 2A86A 5KCMA 3WHLA 3KLNA 2IGTA 4FYIA 4PG7A 4HB2A 2ZAIA 5KT4A 3PENA 2I0FA 3NM4A 4Y3UA 2OV8A 1TUIA 3BD7A 2FJ0A 1KPHA 4RVUA 2WI8A 4HAXA 2OO5A 3P0HA 3WY9A 5IWCA 3EOAI 2ZT8A 3JWIA 3UFXB 3EXG1 4UQPA 2HIXA 5EWEA 1C30B 4NULA 5HKOA 3VH3A 4CKZA 3ZIUA 1KDRA 4BJ5A 3KTAA 1X3LA 3B2EA 3MJTA 3HWX1 4KXUA 1UMDA 4P38A 3U7JA 4LC0A 2HF2A 5DNEA 3RAEC 3GU3A 2ABJA 5EQFA 4UHCA 4DRFA 1V6AA 3V8VA 3MIIA 5P21A 3EXEB 3WZLA 2PUCA 5FRDA 4Q44A 3WMXA 3RK4A 1YR3A 1U3VA 3O03A 3JSLA 3G2MA 4BKRA 3P9QA 2BCEA 3JASB 2C35B 1NURA 1O9GA 1RQGA 2I34A 1ZUHA 1VS0A 2RGUA 1B1AA 1EXMA 2CFRA 1D6SA 5U1PA 1IHOA 4Y6PA 3FLMA 4BNKA 4GM4A 4CGZA 2HCTA 4K9QA 1YR2A 1JT2A 2CLFB 5FEUA 3TJMA 3Q8SB 3I61A 2FHSA 3TINA 3DMFA 1LBHA 4BP9A 3VR4D 1R0LA 3FNFA 4L02A 3PCTA 4V1CA 2QVGA 1YQTA 4Z86A 5CHEA 3I4FA 4WHXA 2GZ1A 4QPNA 4QOIA 3L49A 1RIFA 3HM9A 2CJXA 4A2WA 4ROTA 3DHWC 2GUGA 5AM4A 4MJ7A 1HUQA 3K09C 3ED5A 1H3FA 4QYIB 4N5HX 1M1NB 3SZ3A 2A58A 5AVQA 1JTFA 1ONBA 4N8EA 2AKEA 1LPSA 5ALRA 5FBZA 1WS6A 2BZGA 5ICFA 3W8FA 4FYMA 4ZMSA 4GEGA 2Q5EA 5DEOA 3MT7A 5MGNA 5HQJA 4HGRA 3CGGA 1IEVA 3D8BA 3T9FA 2XBLA 2FJPA 2JRLA 3DKPA 2RHJA 3TIIA 4D99A 2WSSA 3JYQA 5T8KC 3NZEA 1S3GA 1Z5ZA 4KRFA 3PTAA 4QSMA 2QTNA 1DJQA 3F74A 4RSRA 4FB5A 3ESQA 2CV1A 1Z08A 3W7BA 2BFBA 1HKUA 4RLQA 3HZOA 1LJ8A 2BM9A 3LC7O 3T61A 2QF7A 1JE1A 5A0TA 1ZN8A 1LDNA 5KYWB 4JVOA 2I80A 3C6KA 3PC8C 1Y6JA 4QD3A 1JR6A 5HWSA 3PJDA 4YQYA 1JE0A 3VRHA 4M1SA 1N32H 1ZUD1 1VLZA 4F2HA 4EG6A 1Q12A 2ZANA 5T67A 3LY5A 1MABB 1IWBB 1F8YA 4CIWA 4QXQA 1Q95A 4JVLA 2IELA 5FKJA 1B8OA 3GRVA 2I6SA 4BO6A 1AKNA 2HC9A 2V4ZA 5F9LA 4Q4JB 1T5HX 1JI0A 1XNGA 4DQNA 3DTVA 3VX3A 2OK8A 3BXZA 4OREX 4W4TA 4LF6H 3FOCA 2DKNA 2NQ2C 1C0LA 3G8DA 5BWLA 1C3EA 1Y3DE 4TZ6A 1NUSA 4U2CA 5FV7A 2I91A 5KKAA 1QZXA 2F9MA 2OQRA 3QEJA 3FTNA 5HNEA 4H17A 2BRUC 1JR4A 3NLLA 3R0XA 2OT3B 4KIWA 3UENA 5BN4B 2DF8A 2H9IA 2GVNA 1Z33A 4GPEA 4LFCH 3K5WA 5HCIA 4TLEA 1W1WA 2R6HA 2QXTA 2JCGA 4KPUA 1D2HA 4F2DA 2B37A 4Q1DA 4P3YA 3ER9A 3WNDA 4Y2HA 2OL4A 4NBRA 1E8DA 1RK5A 4HNAB 5JE8A 4PNZA 2RE8A 3AW9A 1D6MA 1UK7A 3PGXA 2JGFA 3BA1A 5KG6A 3V1TC 1W30A 5CVJA 2D8AA 3GFPA 4M1YA 4M22A 2WR8A 3IXLA 1WXXA 3OO0A 1UKZA 3IUSA 2ZSBA 1TMGE 5K0TA 1YVUA 3DLBA 3T3PB 5WRFA 1AG9A 2P77A 1A27A 1IMOA 1IG3A 3UJDA 3CH7A 5IABA 5FPPA 2PMCA 4EFBA 2IEAA 3OAAD 3KAJA 1DWQA 3WWIA 4JOSA 2WAQA 4JP1A 1V96A 2Z5LA 3HL4A 2R2GA 4FGJA 4AQYH 3D8HA 621PA 1IWPB 1WXFA 1DJMA 2SICE 4NIMA 1B04A 1GIAA 4RX1A 4D0SA 2RARA 3FYCA 1JA0A 2FWJA 3U4IA 3NBFA 4NCIA 2II6A 5ELXA 4JHXA 4ZQFA 1OBGA 8ATCA 1L5WA 3FSGA 1KI2A 1NOJA 3JY6A 1B8VA 3AK4A 3LBAA 4S2UA 2FSPA 3GTJA 3CUYA 4HWTA 4HQ0A 2V6GA 3JQGB 1GVHA 2WKQA 1A1VA 4BV3A 1N3IA 5K3FA 4XUCA 1JLKA 4NONA 3F73A 1FYVA 3SEAA 4HNUA 3RT1A 4KQHA 4US2R 2VHUA 2FMAA 3MUFA 3HJHA 5CW1A 2E37A 3O8LA 2XHEA 4L8LA 2GPTA 3VKVA 3W8RA 3BGVA 4II2A 2GGSA 4WFQA 1R0CA 1NV8A 4BLOA 4CIXA 5A0VA 3L6OO 1HWYA 3DM5A 4XASA 4ASUA 1X80B 5P8WA 4M9RA 3R5XA 1NZDA 4XDGA 4Z0NA 2GJ9A 3WJ1A 1C1YA 2XCIA 5AKKA 2C0PA 4Z1MD 1KYTA 2BI7A 4GKAA 5ALTA 4YMUA 3THOA 4EDHA 5LOVF 4MMYB 4C0QC 3EHEA 3WADA 5AVXA 3LRPA 1R6UA 1DPGA 2XNCA 1FDUA 1G18A 1ISPA 3TMYA 5KBYA 1SXJC 4NQZA 5C34B 1GGVA 1KE1A 4YREA 3LGXA 2Q46A 3PIIA 3PLNA 3HJGA 2CB9A 1M2NA 5DBEX 4ARCA 1WZEA 1JP7A 1L8LA 4JLNA 5HIKA 1XRJA 3SMVA 3IKMB 4M49A 3A1UA 4MUGA 3PDJA 2ZYUX 4J7CA 1QVAA 3B1KA 3PFBA 4RA6A 4XPIA 2X6QA 4UZFA 2Q5IA 5UKDA 1JTVA 2WIJA 2JI6A 4RJLA 3ZQ6A 1EAYA 3OHMA 4NDZA 1ZAYA 2HQBA 2P5YA 2Q0SA 1QU2A 4YAOA 3A3KA 3MFQA 5DX8A 1K5HA 3R7DA 4X3CA 1FDTA 4B7XA 4PLGA 1H9AA 4BP3A 3TLMA 2AXQA 3PHLA 2JLRA 4WN9B 2BGNA 2AX3A 4FK8A 3KZVA 3KSBC 1EUQA 1MEJA 2BEWA 2DAPA 3G7NA 2ZB7A 4BXXG 3F67A 5AJYA 2RCNA 3DFFA 4JX9A 3MA0A 1H2FA 3PSAA 4M7PA 4B3HA 3AZPA 3K9LA 1FJ2A 5DIZA 1UMCB 4G67A 3UA3A 2Y8EA 3PYMA 2PWAA 1Q16A 5JZMA 1JLSA 1UT5A 4HGQA 1VOTA 3WIBA 4O25A 4RB2C 4GSYA 4RM3A 1CKOA 5DQIA 4UARA 5ALJA 4TN5A 2WTBA 5IUKC 1TEZA 3TH5A 5CVEA 3KX2A 4QU8A 3H3JA 3S2EA 4PC1A 4YH1A 3EYAA 5KFHA 4Z4EA 1F0PA 2Z1DA 3A25A 4BP1A 4AROA 2NO5A 4YXWA 1QG0A 2GYYA 2RONA 1DB3A 4R0VA 4QG7A 3G68A 3I2GA 1UIMA 5FORA 2IHKA 1XZ8A 2B63G 4HTFA 3T9CA 1U2GA 4FW9A 2RJ3A 2PRKA 3I2HA 4BB0A 3HDQA 4ECAA 2MJLA 4QPZA 2UZAA 1V9SA 2NZVG 1LS6A 2OLEA 1X7XA 3QYPA 4HGYA 4GC6A 1Q5PA 1XJWA 5BV1A 5IBRA 1H8EA 4KYTA 5JTTA 3F4BA 5LQNA 2C0QA 5BW6B 3QY0A 3LUJA 2C7QA 3DWGA 3I01M 3E6AA 1MIOA 3WJ2A 3TVDA 3IG0A 4FC7A 4I3FA 1DIAA 3OSNA 5B58T 4QARA 2E89A 4LJLA 1Z37A 4MAAA 2I9KA 1O95A 2FMTA 5M3BA 1YCFA 5BQFA 5DXJA 4N1AA 2HXYA 4ECEA 4DCVA 4C0LA 3P7MA 1L5QA 2WP0A 1JU9A 4O7LA 4IJQA 4U7TB 1YQEA 5CH3A 3BMOA 3L5KA 1BHO1 4I2VA 5CIWA 3DNMA 2C8JA 3PDIB 2M2IA 2Z2IA 3R6TA 2B20A 2LKDA 2O05A 1P72A 1PJ2A 3LQ1A 4FMDF 3MJ4A 2VSNA 5DV9A 4ND4A 5F5LA 3O3OB 1DZ3A 1IYDA 3PE4A 3WV5A 4QLOA 1AZWA 3HPRA 2ECQA 1Q0UA 4MV5A 4D3YA 3F6PA 3LVFO 1BO6A 1Q1NA 1VL8A 5LB4A 3H5TA 1U63A 2NNWB 4LV5B 5IYZA 1QDUA 1EQAA 4KK4A 4ZHSA 1ISGA 1H23A 1SOWA 2Z43A 1FTYA 3LL7A 2P62A 1T5SA 3QA3E 2P1RA 4PIMA 1BHSA 4RF3A 1JHAA 2ZCJA 2WJ3A 4X6UA 3OKCA 3B1YA 3W5HA 3HJNA 1Q50A 4IDPA 3FTCA 1QWSA 5I4KA 4D0LB 3Q7PA 4YRKA 1J8VA 4FU0A 4CQMD 1EVIA 2OHHA 3OWXA 1IN1A 1MQ9A 4BFSA 3O8OA 2XE8A 3SFTA 1PGNA 2G5TA 4KNVA 4M0EA 3AONB 4Q3NA 3UT5B 2DJIA 1LVHA 4QU9A 3D2LA 1HDIA 3C24A 4RJTA 4G5YA 4OF4A 3V8RA 1G1AA 3E5HA 3G0IA 4CUZA 2C1XA 4J0EA 2ZRKA 1M72A 1D7OA 1VMKA 1WG8A 2WWWA 3IELA 3L7MA 4KQ6A 4LZWA 5E4YA 1S7GA 1KNQA 4FFWA 1UT6A 5F4ZA 2Y66A 3PIRA 4MHSA 1G5RA 1S7CA 3TL3A 4BVAA 4QYSA 1GGOA 4TLAA 1QB8A 1VTKA 2C7VA 4TV8F 2WG1A 1EFVB 1OV4A 4X45A 1GRVA 2NZJA 2F1HA 1H3NA 3LX6A 3C5WP 3OCWA 1JXQA 4OVKA 3U49A 3JWHA 5COAA 1U2DC 1Y5LA 4XI9A 3SE7A 2HMAA 2W98A 4DSOA 2WLTA 1KMHB 4QYWA 4M9CA 2H63A 3I0NA 4UTPA 4LMAA 5A6SB 3C8HA 3KFXA 2IF0A 1BD3A 2FX2A 1ZJ6A 2PUTA 3EOBI 1HI9A 4CCSA 3OQNA 1ODTC 2ZJAA 5IEBA 3DP7A 3GXOA 2YICA 1SUEA 4ZO6A 3WB2A 1CEXA 4P3XA 2AOWA 4ZANA 2RG7A 2F4VH 3OFND 1SNYA 2QD4A 2H2GA 2XMQA 4J1TA 4WNAA 4GM0A 2ZOSA 1O6ZA 4W8HA 3UTDA 5KQGA 2H0QA 2FN7A 5CAEA 3AFOA 1KYQA 4N3CA 1TLTA 2ERYA 2XGGA 3ZWMA 4LSWA 3R9RA 2BBTA 1OVGA 2VP2A 1R12A 1L7NA 5AW4A 3DMHA 2VK1A 2OLJA 1SXHA 2OP1A 5BY2A 3OCVA 1K9SA 4ZGBA 4ZZ1A 1TQHA 3UQYS 2EVWX 1T0UA 2BFDA 1AHPA 5L3QA 1N7HA 2BQ3A 1Y1VA 1JEJA 4LRQA 2EGUA 2PS3A 1H6DA 4MKIA 3ZVRA 1FRQA 2PH1A 1XTKA 3JQCA 1W59A 3Q3JB 4M3NA 1OWMA 1RTKA 2CBGA 1P8LA 4OPMA 4JEIA 5COBA 4RJIA 3JZFA 4LPSA 4PG6A 2H1LA 5CBKA 3WWCA 1W4BA 4QQRA 4US0R 1KQNA 4CCYA 2IIPA 3C7CB 4OCZA 5KNCA 2DPMA 3VC7A 3QH4A 3H83A 1NJFA 3P9PA 4QDJA 3CXRA 4INZA 1N7JA 3RROA 3RCBA 2Y1CA 1DU4A 4IDCA 2HGWA 1VBKA 1M0WA 3HI4A 1YCGA 1ZK4A 3O4RA 3FCCA 4HR7A 2ZWIA 4NJMB 2H1WA 1NKVA 4RMIA 3TQOA 4AMBA 5DHAA 3Q8WA 2OLSA 5I51A 4AZWA 2Y67A 2VHJA 3B1FA 3W6NA 2J45A 3PDHA 3QELA 1FDRA 3C70A 3GFTA 3VPSA 5J1SB 3NS7A 2VPQA 2HW8A 1PLJA 1CY8A 3QA9A 4S04A 1M2EA 4AF6A 3RV4A 2JCSA 4GGPA 2QE7A 4HH4A 4XUGB 4ZYLA 2WYOA 3LYUA 3SX4A 2X5XA 4Y7DA 3RD5A 3RRZA 1YR7A 1AKMA 1V3QE 2NVBA 3GQVA 4OK5A 2B2CA 4IHQA 5KX5F 1LPAB 5FA6A 2C2XA 1S9DA 2A7XA 4YT8A 4BRSA 1NOKA 2YASA 1OHHA 1GAJA 4Z0PA 4D92A 2KWIA 3ZHVA 4PZYA 1ZI6A 3N2EA 3C6QA 3HKEB 3IVGA 3N75A 1NPDA 3G2OA 1YDGA 4D1YA 1PTJA 1KI9A 2B2NA 2X0EA 2ARKA 5EY5B 3TW8B 4ZARA 4EPVA 1DIGA 2CD7A 3HCDA 3OWHA 5AVKA 4KFUA 2XNSA 2HWWA 5LQJA 3E4CA 3CPHA 1JJFA 1RZ3A 1XO1A 1ZVKA 4PICA 3ANSA 4CN8A 4IZOA 3DW1X 3MSXA 1GCUA 3PHBE 1TWGA 1KH1A 3DF7A 4B6PA 2WSBA 4YJFA 3QU4A 4QWWA 5NULA 3TAXA 3A4IA 3DH0A 4LZLA 4EG8A 1UDWA 1XMJA 3QITA 3V8MA 2IV7A 4EB6B 2QUHA 3T3HA 4KN5A 4MKRA 4D25A 1WXGA 3K31A 3S2UA 2GASA 1ZS9A 1CR2A 5HX7A 3IPRA 2YQ5A 4OO3A 1ZBQA 2V45A 3L9XA 3T38A 3S2FA 3EZLA 4JUCA 4DR6H 1Y1LA 3KZOA 3O93A 2HLDA 1JIQA 4EAQA 4HN2A 4JR0A 4BLRA 2O3RA 2JPDA 2J3KA 2Q1TA 1G9XA 5BYAA 3SXUB 4AC9A 4I6GA 1CIJA 3HN6A 1H05A 3PW4A 1J2RA 2IHVA 4G4SO 2W90A 5HFJA 3A31A 4IHAA 5C7LO 4UBOA 2G8NA 4XFKA 6AT1A 4ZO4A 3QKSB 1L5HA 3PL1A 1ADFA 4U7PB 4CL2A 3VOBA 1NFRA 1GL9B 5FFFA 1WNFA 3UMCA 2W6IA 1RIIA 2ZUEA 3OIWA 2RKWA 3NTRA 1TT5B 4DLZA 1DEOA 4M6WB 3ZLUA 4HLCA 5FLKA 3EGOA 3BAZA 2PVSA 1OA1A 1UC5B 4E1AA 2QKYA 3PPIA 2OKGA 3QLEA 1EWKA 3BORA 4MYCA 3KVYA 5C1BA 1H6CA 3BZWA 1HK7A 1SVLA 4TT3D 2J87A 2CCGA 3BBPA 3NV9A 1NRWA 2WY2D 2VJMA 1JBEA 1LRJA 3I34X 3OQ6A 1M2HA 5JALA 3OZEA 3IEVA 1KAQA 2C2YA 2ZUSA 3WLAA 4Q4AA 1NVWQ 5C44G 1KGDA 1DQRA 2PR2A 3PPYA 4PSCA 5KOJB 3VJRA 2QUJA 3LW8A 3FHOA 4KJXA 1GKUB 3IE1A 3BK2A 2GKGA 4PNPA 2CKZB 1ORHA 4KO1S 3FUWA 1Z9BA 4N82A 4G5HA 5LQUA 4Q48A 4PNHA 1G5IA 4RNOA 3W04A 5H9WA 4K0KB 4DRXB 5DT9A 2XECA 2ILVA 3E0XA 1YASA 4TKVB 3RUHA 2R5FA 1U7OA 3ZDQA 3GA5A 1IUKA 4N3BA 1BZYA 4L8FA 4JU8A 1CR1A 5F9FA 4MCJA 2G70A 4MTDA 1U7ZA 3I9OA 4EKYA 1LB1B 3NYQA 2NUPB 3MERA 4MWSA 4ZCPA 2CEAA 4HS4A 4PRZA 5DASA 4BZXA 4J3FA 3FTQA 5K3SA 3TNLA 3IOCA 5FA8A 1ZOIA 1LX6A 4EX6A 5G0TA 4YR2A 5THXA 1AV6A 3FBGA 2NMVA 1FTNA 5IXYA 4JV1A 2ZBGA 1DXOA 3VR4H 5LLDA 4BO0A 2IZ7A 1GPH1 4EB3A 3USCS 4DMLA 5AUPB 3B85A 3F78A 1TKAA 4BPRA 5LOVA 2RHHA 1IZ0A 5I5XA 3EUFA 1ODLA 2JHFA 4IVNA 2IBTA 4BFZA 2NVWA 2GR9A 1KE2A 4GLXA 5EJMA 1BMTA 1QH8B 4M99A 4OI1A 3H42B 2X15A 4BO3A 4H16A 5DOZA 1HLDA 1KIAA 1H4SA 5HILA 3DAOA 3K0FB 1DV1A 1KY5A 1WUIS 4W1SA 1VCOA 4GMHA 3NBUA 4CLOA 1OB5A 2GK7A 5FI3A 4P3PA 3U7RA 1E1NA 3ET4A 3RT7A 4R2KA 1JR3E 3I64A 4S1TA 4HEA6 3U3KA 4CDNA 4QYXA 8GPBA 2HRCA 4L4XA 2KSWA 2BY4A 4EG1A 1XA0A 1CXZA 3GAZA 2IYAA 4OM8A 2CCJA 3AVVA 5KKNB 5I47A 2DM6A 1W4ZA 1DMSA 4YJHA 3KCQA 3OFSA 3T3DA 1JECA 4RB1A 3UMYA 3V8NA 4YMVA 2IKSA 2JZCA 3DWFA 3OJFA 4WL0A 4BNHA 4UM9B 3L7AA 4C76A 2FZVA 1E0SA 4R41A 4E21A 1QVVA 1LQTA 3GCGA 4NCBA 3HB4X 2Y0CA 3TB6A 4E88A 5BXYA 4JJAA 1EGAA 3DPSA 2MSKA 4YMTA 4X91A 3P0EA 5CXUA 1OAOA 2ST1A 3LP8A 4AX8A 1XV5A 1EBBA 1TYBE 4C89A 1VPLA 4FZ5A 4RTOA 2E4YA 5AKEA 4TWJA 3CU5A 4K9RA 1P74A 1J22A 2YN0A 4C5CA 3MOIA 3T5CA 4DNXA 5EUCA 1DT5A 4ECUA 2CNLA 4YWHA 2AQHA 1PDWA 3I04M 1I1QB 3J80W 3LQKA 5IDXA 4IFBA 1P4HA 2FZKA 2W6PA 4O7TA 2DHEA 2FXIA 1YAJA 3I4CA 1L1QA 3IOBA 2QUBA 1OWPA 4LIPD 2J7PA 3AHJA 3OJLA 1ZM7A 5DHFA 2FFHA 1KKUA 2OYCA 1BMQA 1DCMA 1R15A 2OBMA 3G17A 4RTJA 2I1LA 2J0UA 4YIKA 4JP3A 5AUOB 2PGAA 2QZ4A 4YBZA 3TPCA 5ARCA 1XKLA 3OJOA 4RKQA 1OKKD 3WR5A 2VLIA 2P2LA 1BYUA 3VSDA 5FNZA 4F04A 3RJ5A 3ZX5A 1ZGZA 2NXCA 2W6NA 4ZVUA 4O59O 4MVYA 3KHLA 4U0KA 4J9UE 5EMLA 2ZJZA 2CDAA 2HNKA 3C1UA 1NXWA 1X70A 5FV4A 4KQWA 1HYBA 1RLTA 3EMVA 1BRTA 2CSUA 3OMWA 5CGQB 3DPUA 4YFVA 4BMVA 1A8QA 2GM4A 3BSSA 1SUPA 4DY6A 1O0BA 3UC9A 4LBWA 4M1ZA 4D97A 3I4LA 1P91A 3OTOH 4EJMA 3BJEA 4LNHA 4RK1A 2WUWE 4DY4A 4O7ZA 3UEOA 4W1RA 3O2JA 1H1DA 4WDRA 3ZC3A 3EIHA 4DJFC 3D31A 3QBTA 2VPXA 1G6HA 1MOQA 1HRKA 4QATA 3QTBA 2R8PA 3K20A 1XZHA 5AQ1A 1LWOA 2I33A 1FJGH 2FWMX 1UANA 2QJRA 3IT1A 4TYMA 1C4KA 5KKCA 4TL9A 3K9WA 3RI3A 3AHGA 5CIYA 5BORA 4NZ9A 1GQFA 3B51X 2HVQA 3MXOA 3UNXA 4TZKA 3X43A 1KO1A 1UPBA 4EFEA 3T54A 1WVMA 2LXNA 1AMOA 1YRWA 1E9DA 2ILTA 3QWAA 3KEQA 2W2NA 4OYYA 4J94A 1OX4B 1U90A 3V3KA 5KTMA 4XWKA 2ZBDA 2RDMA 3LWDA 4YJ3F 4AJ9A 1RWWA 4YRLA 2E9SA 2IQIA 4UCWA 3P94A 3MWEA 1OI4A 4OJNA 2JFGA 1PW7A 1Z26A 4IVPA 4ARUA 4EI9A 1QAMA 3LV8A 5TDHA 1IZYA 3JARA 2I6FA 2G5PA 3WGQA 1C0PA 3O8QB 3PEEA 2X8AA 5IJ0B 1YZLA 3DWIA 5HIAA 1ULUA 4TL6A 2F67A 3RSZA 2PFSA 1ULAA 4AULA 2GO7A 2ZLBA 3OZGA 1ACLA 5LKRA 2FLLA 4TV8A 3FSRA 3ZVMA 5EXXA 4WY8A 1L6RA 5FL3A 1VMIA 2AI2A 4UVIA 4UMDA 3F4KA 3X2FA 1GTMA 4RS4A 4E1BA 1GO3E 4C2UA 3H0GA 3FCOA 3F5SA 5IG2A 2XUQA 3TQ1A 3UHOA 4UAJA 5K3DA 4O7RA 3LLCA 4CKXA 3H2ZA 1NJ6A 3LHSA 3ZY6A 4MR9A 2VP3A 4UHKA 4O33A 2CKMA 4HDNA 2OC9A 1FTWA 5A5VA 3KTDA 5NLLA 1TZKA 2BCJQ 3TLZA 5LL6P 4F4HA 5IZCC 5L1KA 3F1KA 2HT6A 2FG5A 4HNRA 4BGVA 3SQXA 1NN3A 2ODWA 1WB4A 6CHYA 5CG2A 2FW0A 4Z53A 1R4NB 1HNXH 1DQSA 2FMXA 1YBHA 2GBLA 2PVCA 1KRHA 1Z0SA 1OX6A 3W3AD 5JWOA 5DEIA 2AF4C 2X19A 1EXNA 2PV0A 3LCUA 3UJNA 2R8YA 3GUUA 3WYCA 3CVXA 3FPLA 2PR7A 4Y9UA 4OOFA 3WLRA 1KYXA 2ZQYA 2FUCA 2Q50A 2KQUA 4DQVA 1BROA 4ESVA 2C54A 3GV5B 4HLUA 4QEZA 1I4EB 2UYHA 2X8LA 4LI0A 1KWKA 1JR3A 4PZDA 5EZYB 4Q7EA 2HCRA 3TQSA 4NAUA 3PEFA 4DPMA 4M4SA 2BTQB 4IIBA 4V38A 4ZCTA 2VPIA 1VKNA 2JBAB 4Q8FA 5E2IA 2CL7X 1RVV1 2WKPA 2G63A 2PNJA 4EX7A 4MYSA 4OB8A 4EYIB 2RMKA 1Z4KA 5LP1A 4YAJB 3MM4A 3IDQA 1G19A 1SQGA 1I1OA 1ZJ4A 4HXEB 5CHYA 4D2IA 1JX6A 4MAFA 2JAOA 3CRNA 3CW8X 4JEMA 4JI4B 4HNHA 4QXOA 2XKBA 4GOJA 5FJJA 4KTTE 1G6KA 3GNTA 3RGGA 5K4GA 3AF2A 4DV2H 3GTMA 3AGQA 1RAAA 3AF1A 4QO7A 4CUKA 4DB2A 1M6WA 5DLGA 2PUAA 4EBBA 3PI7A 5CBPB 4BFUA 1P9LA 2ID8A 1G55A 1ZESA 1IY1A 1RYBA 1YZQA 3BQ9A 3TY8A 4FGWA 5KX5A 3QJGA 4ZAGA 3IP9A 3VR3D 1L4FA 1SBCA 1YT5A 1NSYA 5CM9C 1GQYA 3SXPA 3ZCRA 4GKJH 4MB2A 1U1IA 2CV0A 2IXFA 5EWLB 1KXJA 2UYOA 4JQOA 2C5FA 1KARA 3I4MG 1QKJA 4D6YA 2NZUG 4OTZA 4PIVA 2X77A 4ZZIA 1T9GS 1RYZA 4LQ4A 1PQ4A 2IOYA 4A6XA 2PIAA 3W6OA 1ZUWA 5A9RA 1PJBA 4CEJB 1OZGA 3R3UA 5BUQA 3ZNPA 5KFDA 1QO0A 2PLWA 1JDBB 4W9NC 2BGRA 3C6MA 1F8FA 1GKKA 3MTQA 3DVSX 1I0ZA 4E6PA 2HYDA 3QLVA 3H8SA 3VO2A 4OFZA 3SS7X 3WK4A 4CV1A 2C4KA 1RZVA 4K0RA 5GIPE 3BSWA 2AOUA 4RF4A 3C5EA 1A5ZA 4OQXA 3OLVA 5K2MA 4KH1A 1JX4A 1XAHA 2W9BA 2PL9A 2JASA 2UYGA 3H1GA 1I14A 2ZJ4A 4DCOA 1BCSB 5JSFA 1BXGB 4GKKH 3PNLA 3IAM6 1NYTA 5AVYA 3GZNA 3I9FA 3RFTA 1JZSA 1PNRA 4I8IA 3NANA 5FQNA 4A5OA 4GOXA 4P0TA 2WIKA 1I1NA 1J23A 1FYWA 3AG5A 2VDPB 3UAOA 4MI3A 5HS6A 2DY0A 2CHFA 2J3JA 4P8RA 4M0DA 1I2BA 2WWGA 3NBYC 1TMYA 3JV7A 1O7JA 1QGAA 1DJPA 1JEYB 3WKCA 2HU5A 3V80A 1V51A 2UZ3A 5F3DA 1LDBA 3QKUA 1JKJA 3JD2A 1L4KA 1QVRA 2XF8A 3ICQB 4QJ4A 2WDPA 5B53A 3NM6B 4FHCA 4D9JA 4M7OA 1Q1BA 4PZCA 2R1TB 4D42A 4RYDA 1XL1A 2IHBA 1AKVA 1ZVMA 1XZAA 3ND9A 4AMGA 1Z82A 2YV2A 2B21A 4GI7A 1J42A 2X7HA 1GNRA 3BCUA 3ILVA 5A4DA 3QFHA 4PSVA 2Z2YA 2Y93A 3PFKA 5DM2A 4RD1A 4BGDA 4CV2A 2PT9A 4CMHA 3D4NA 2QG9A 1NXXA 3A4LA 1IMJA 1U6JA 4CL3A 4DC9A 3DMNA 4BATA 3PQ7A 3QU7A 4KMOA 1OY1A 5ERGB 1RQ7A 4DAOA 2RGRA 3QOXA 3HOVG 1G8YA 5IULC 1KR2A 3RFVA 2HTFA 3ZY3A 3QQMA 4B0OA 3UMBA 1YE5A 1XLTA 1DIBA 2GARA 3IKTA 5BR4A 1L1RA 5DHPA 3M2TA 4DLXA 2C82A 3H9CA 4F3TA 2O57A 4V2IA 3UCFA 2UVPB 2ZUUA 3H5LA 5MN4A 2CHGA 3L40A 1HRDA 5BWTA 4BGEA 5E6SA 1W2HA 4UBNA 3H86A 1UZAA 3SQWA 1C3JA 4XGQA 4OMDA 3IVMA 3JQEA 1XCJA 4NTZA 1H1TA 1U4OA 2A1UA 3C7AA 1TAEA 2Z30A 3GLFB 3VTFA 1R9NA 4AN4A 3B48A 5B7PA 2RG1A 1ZU5A 4N5DA 2HA0A 2QJTA 3GJ6A 4YPVA 4TTPA 2CZQA 2WQ6A 3T1HB 3L77A 1P31A 5L9XA 1E3WA 2ODAA 1EFTA 2IEDA 3L0DA 3JRXA 2P3OA 5HP4A 3COJA 3SPXA 2AJ8A 4A93G 3MCVA 2IY8A 4WNIA 1K6XA 3TEJA 4YK7A 4MQEA 2W93A 1UBCA 4ZEXA 4AWAA 1T6YA 2B0CA 2BKLA 3FF1A 3H4DA 3PD7A 1G41A 1GKIA 3EGDB 1VA5A 1Z4MA 2GFHA 2CNWD 4EHKA 2ZI7A 3GJ4A 3QX3A 1OFGA 2JFVA 2Q6VA 4EUHA 2GK3A 2Q9CA 1ZICA 4QIWA 5TEWA 4J43A 4WLOA 2K87A 2GH1A 4FSXA 8LDHA 4G56A 4IDFA 3I92A 1GZVA 4F84A 4EBEA 3QPCA 4F96A 1QLWA 2C42A 4MNTA 3OP1A 2OB1A 5E8RA 1B14A 5E2BA 1F38A 3HY3A 2ZRMA 2SKEA 4KUGA 1BAPA 2H2WA 2QRLA 1TXGA 3TOSA 3C3CA 4LMBA 2ZXEA 1ZIDA 3VH1A 1HNZH 1XDUA 1A2KC 1G7RA 4D3FA 3M9MB 2NLOA 2VPSA 2OZPA 2RFLA 4CF5A 4QOEA 2GO1A 2VSQA 4O8CA 1CD5A 2PO7A 1TFRA 3HN2A 3QFRA 4UNSA 2XRMA 3K1TA 4YUYA 3RB0A 1MX5A 1HFWA 5DN6D 4UHBA 3L1KA 4B40A 1ZNWA 3M6UA 3RYTC 1PGOA 3HRHA 3QMVA 4EGCB 4RNMA 1G3IA 4X93A 4O4LB 1EFLA 2GFIA 3CX8A 2N1MA 1T1EA 1JIHA 4D82A 4QEDA 5DX0A 5CB4F 2X1HA 5DPMA 3SN6A 1J2YA 4BQRA 3DMPA 3Q0TA 3SP1A 5ALIA 2O20A 3TOZA 4LGYA 1UPAA 1ZCZA 5AXDA 3AYZB 4KC0A 1XZLA 3GRZA 3VU3A 5CYGA 3WP1B 4BQNA 5JHGB 3LZCA 5TIIA 3HRIA 1NQUA 1RMTA 2M6KA 3ZVLA 4B3RB 4X0EA 3ZDZB 1XAJA 3CE9A 2HJWA 1G7CA 1E1LA 5DCWA 3LQSA 3H1BA 1PLLA 3NHWA 3JQRA 3MW8A 1ZUNB 2HBYA 3CZMA 5DTIA 3N6XA 2NO6A 4OH7A 4C5BA 2I76A 4RY9A 2J7KA 4ND8A 5REQB 1I6KA 1HDRA 1GGEA 3MTIA 3BJRA 4QQNA 3B1XA 1FKAH 1OT5A 3EXIA 2O0KA 4BX3A 3U9TA 1E1MA 4EG5A 1ABBA 2ORED 3EZ6A 5C4XG 3GYGA 4U7CA 2BGWA 1XZGA 4MGIR 4CR6A 3PFWO 2X9GA 3GFQA 1BX3A 2OCBA 1PZNA 4ZT6A 5CLHA 3L05A 2ZBUA 1Z0ZA 3LK7A 2TMGA 1QRAA 2PYIA 2EC5A 4XXHA 4N65A 5JQGB 2Q4DA 4JS0A 1N8KA 3HR8A 2GD0A 5G0VA 1OIVA 1QGED 2DWUA 3KYDA 4Z7NB 1B8UA 1H9CA 2O8EA 3HTXA 1NFFA 3E8MA 4RZIA 1EP9A 2WAYA 1BIFA 2Y71A 4AN1A 3OLCX 3WNZA 4ZVQA 3DUFA 4IUCS 1WVIA 5H1YA 1T9ZA 2IUFA 1SCUB 1U8ZA 5DISB 4WESB 4AIRA 1QR2A 1M2JA 4NXMB 2WM9B 3M82A 1P1KA 1SUSA 1NKTA 4NCXA 3B7WA 4RUKA 1SUDA 1G9SA 2HHCA 1S10A 2H57A 1K92A 4COOA 4YJ3A 2FXVA 2G4LA 4CG1A 1Z8NA 2I4IA 2NU9A 3FZGA 5K3OA 3JAWA 4JBLA 1W2GA 1K2VN 5LWHA 3CW2A 2Z4RA 2Q8NA 1VHWA 3LWBA 1Y9AA 2ZAYA 4FN5A 2ZKLA 5BN5A 4RE5A 3N86A 1EFRA 1MOSA 5LSAA 5A5GA 2EZ8A 5LUAA 2H2HA 1P1JA 1N2BA 3K2IA 4FB4A 3EFBA 5BNZA 2J6IA 3D8SA 3VNSA 3T15A 4TTRA 4CE5A 1UFQA 5DQGA 1P61B 1G8AA 3AB7A 1JHRA 2NO4A 1FS4A 4KLZA 2HHFB 1RVDA 5EJ7A 3DBHB 5HZGA 3HUEA 1AUQA 4AUKA 3VSBA 4IRXA 2DR0A 2QSJA 1K6EA 2WG2A 4ND3A 3KKOA 1M2FA 2JH3A 3NP7A 1W19A 5AXBA 2JGKA 1KETA 1XP5A 4WZZA 2C83A 3NWJA 4EYQA 1MGPA 1XEWY 1P29A 3B1WA 5CA0F 3ANMA 4PSUA 3ZWPA 1DX4A 1ZRSA 1PVVA 1MTZA 2C22A 5JEEA 4R8UB 5D84A 2JEZA 3U16A 3L1HA 5JBQA 3SHWA 1E2KA 1WTAA 4YYZA 1N4DA 1S0MA 3MBIA 1T13A 5KS2A 1C8KA 1C1XB 2WB2A 4HDSA 1K4MA 1NVFA 1ZVQA 1QIMA 1QUFA 1Z56C 3GLRA 1CP3A 1DUIA 1AC5A 1KK1A 5A5FA 1D2EA 5EZ5A 5FPHA 5JUMA 1PDVA 3IT2A 1WMDA 3OT5A 3NATA 3IR5A 4D3ZA 4B3TH 3LBNA 2C8VA 3AI2A 2JIZD 1XPRA 2VEOA 2IYUA 1CRWG 2QL7A 3GV7B 3TTUA 3GN1A 3TGLA 4BY9E 4CG0A 1ACJA 5JSHA 2J3MA 1M6HA 2JGIA 3ZGYA 4L0DA 4QHSA 1YXMA 3A6ZA 3DOUA 3RV3A 4M7EA 2P7IA 1IAQA 1VL1A 2W37A 1Y4AE 4ZA2A 3ASVA 4Y1GA 5DM70 3ESXA 2HK8A 2O50A 4NPHA 2YVAA 4TWZA 1VMEA 3OE7A 3OM0A 4YFYA 3JALB 1TQ2A 4RTRA 1DX6A 4ZVMA 1V8ZA 3LLSA 4HC4A 3B82A 5LKAA 2DPGA 3TZQA 4YCLA 3L6DA 3C3YA 1K3FA 2YXPX 1NR5A 1V5WA 3IBSA 3E9RA 1O0SA 5H3CA 2CB0A 3NT4A 3D0QA 4E5YA 2J08A 4L28A 3GVCA 1TX4B 1E5VA 3K71B 3L02A 2Q4TA 2FW1A 4HYYA 1YR1A 4B3IA 2EW8A 5DTQA 1ZHFA 2YRWA 4B6FA 4Y30A 2BEVB 4PG8A 2E2WA 1ZIYA 4CMDA 5CT4A 1L7EA 1N5RA 1E7MA 3GH1A 5KNDA 4M0UA 4FDLA 2P7HA 1U5CA 2BFPA 3TKYA 5LQMA 5B5SA 3NTUA 4A3FG 1E2IA 3DOEA 4WMLA 3ZHYA 2QA5A 1XDWA 1H2BA 4A0RA 1GTRA 3Q87B 3A06A 5ALVA 3WL7A 3RFCA 2F4NA 4B3MB 3DBLA 2VS1A 3R24A 4KXQA 1FFXA 1FRZA 1F51E 2Y6UA 1E77A 2B1JA 2C7RA 3ABQB 4OHVA 3UJ9A 4ZOCA 3F6SA 3ORHA 4L8GA 2Q41A 1V11B 2JLAA 2AN4A 5AK3A 5I5WA 2P2DA 5AIAA 2JKYA 4UJ5A 2VXYA 4J0CA 4RCZA 4DFDA 2OSVA 2O8CA 2P8SA 3OETA 1U8XX 2EBFX 2SCUA 3L04A 4BNWA 4UTOA 1V5GA 5FJ8G 2BWJA 3FWYA 4F4YA 4ML3A 4X62H 1WABA 3L7KA 4PGGA 3THWA 3H0CA 2X0NA 2IWRA 3L6BA 4X6LA 1FYEA 4Y9TA 5I9IA 2ZWVA 3DWEX 3BRSA 1K7YA 1JUDA 3AB8A 3H4VA 3WLIA 2UVQA 1M1ZA 1NLZA 3PC7A 2M98A 4E4RA 1T2EA 5JS6A 3U6KA 5B4UA 4WLVA 5KI6A 4GF5A 1WR2A 4B3JA 4REOA 3O4FA 2Z83A 3KPVA 4R71A 1STOA 2VYNA 5EE5B 1XCBA 4B7AA 3VR2D 4EKGA 2P5UA 4EPRA 2FMHA 1XVAA 4YRIA 1NONA 4UU1A 5KCZA 3FVVA 2R7AA 4HNGA 3WG9A 3CISA 1RZUA 1Y48E 3F49S 2WQZA 4YC7A 4LC1A 4MWEA 4D9CA 1KZ9A 1RACA 4FUQA 2I03A 3PXAA 5HS4A 1L7QA 4GLLA 3RS7A 5EP3A 2QN3A 3C16C 3HA5A 1DFIA 3MXTA 2O14A 3U1BA 3ZCXA 5MN6A 5KFXA 4OV6B 4O8ZA 3VOAA 2C5HA 2REBA 4ZQGA 1PU2A 3WHPA 1ONOA 2G06A 5HUHA 4JI1H 1YB5A 3WQBA 2FEAA 3SBOA 3DYVA 2TYSB 1QQ5A 1E2GA 2AOXA 2GN2A 1RYFA 1Q14A 3JCZA 5CPBA 1XNQB 3BEDA 1G21B 1KAGA 2Y4RA 1LBTA 4WERA 1YB4A 3CLVA 4JXJA 3COZA 2R93A 4A82A 1NBME 2OG1A 3AEYA 3EBOA 2W4QA 2ONCA 2ASVA 3PICA 1QU3A 2BH9A 3V00A 1PJ8A 5IK2A 3C41J 5B7QA 1NU6A 5EFZA 2PFKA 2R7NA 4B74A 2R9VA 2P1ZA 4C4AA 1VL0A 3C0KA 3WMRA 4G4GA 4UCVA 1SBZA 1T9AA 4ANFA 2Q28A 2PM8A 1KGSA 2GF0A 5CUQA 4HGZA 1RJDA 1SR8A 2LCFA 1QPGA 4CTKA 4J0KA 3UT6A 3RSHA 5BWBA 4R3NA 6ABPA 3GEGA 2IDKA 1PE0A 3DTNA 5JFTA 1E64A 2D0OB 1PG2A 1E6LA 4DE5A 3W3AH 1DARA 3UJ8A 3ROZA 4MAMA 4ZZ3A 4QXPA 3RVOA 2RHWA 2VJPA 1RXVA 1JIIA 4B3SB 2B8EA 3TRFA 3U61B 3OQMA 2G9VA 1X0VA 3G2LA 1IRIA 4B2IA 2B92A 4H1TA 1M7GA 3OJ0A 5ITZA 4X63A 4BMZA 1RAIA 2BEKA 3EQZA 4DA9A 3ACCA 3AVWA 1KDPA 2HK9A 1NQWA 4KAFA 1WP4A 1XYYA 2PMEA 4JB0A 1C1DB 3IKJA 5JY6A 3FWPA 3CSDA 1LUAA 2QTGA 4B2YA 2ZT7A 4EPWA 4DWVA 1SVKA 3ETJA 4IXWA 4ER7A 2HIAA 4I99A 5HBRB 4F7WA 1N2HA 2CZGA 1E2EA 1SXJE 2ZAMA 3KHRA 3RS5A 2XLCA 3BZBA 3Q8QB 1A2BA 5DVZA 1B93A 4TTTS 1ULHA 4I55F 2BN4A 5TMPA 5FWAA 4KRYA 5BYBA 1N5IA 1BDMA 1SKBA 2AB0A 5LXTF 4QPJC 3HDTA 2HCBA 2Z9DA 5K3BA 3OO1A 1NDUA 1DUSA 5DM1A 3ADBA 4C0BA 2PMFA 2G9QA 1A77A 2XA2A 3DVAA 4TWBA 1LLFA 3ORSA 2WYIA 1L7BA 4BNLA 3M33A 3B9RA 3FLEA 3DZFA 3EDQA 3IAS6 4C0WA 2IBMA 5K45A 3H11B 2PRZA 1Y81A 4OL9A 4I4TF 4J0HA 2JAUA 1DINA 1DEHA 2AVDA 1RBQA 3CFYA 4JBWA 3P2EA 5CNMA 4XD2A 5E8JA 1SU4A 1XWFA 4FHFA 1O5OA 1UBHS 4EUKA 3JR3A 4ODIA 4GPAA 2AC2A 9LDBA 5LD2B 1WCIA 1XTIA 3CUTA 4RFLA 3THYA 1S8AA 3MWJA 5G3YA 2NV0A 4M8NE 5KIAA 2WWTA 3KTFA 4ALIA 3G6YA 5EIEA 3IQDB 3FFAA 1G6Q1 3P71T 1KEZA 4DT1B 1UOOA 5BMVF 3SQDA 4EECA 2AR9A 4YR3A 1VSTA 5ELMA 1G5PA 3M9WA 5CEFA 3D3NA 3AG6A 4YP5A 2PD6A 4RIHA 5CH5A 1Y1SA 3GJSA 4MB0A 4JBYA 3OZUA 1XTVA 2GN1A 1KPGA 2E5LB 3IXQA 1YOVA 1N2CE 3GX1A 4DR1B 5AW8A 4DEVA 2IHYA 5ALZA 3DBIA 4II7A 1YJ5A 5C46F 5FX2A 1BS2A 5LZ5A 5CB4A 2VRCA 5HV6A 4PPQA 3F2VA 1Y7PA 1RXWA 2OGUA 3TR5A 1IJEA 2SECE 4Y8VB 2EDAA 5AM1A 4BNMA 3D3KA 3GAFA 2Q3LA 3FPSA 2PZGA 2CE7A 4LKRA 2DAAA 3AIIA 3D5EA 2DWOA 1JQ5A 4K6FA 4M98A 4RPJA 3IE2A 2EV9A 4ZC1A 1K6JA 1Y1TA 4BTLA 1XE3A 3ZNNA 3PR2B 4BBPA 5F5XA 4Q3KA 5DSTA 3BF7A 1JDSA 1VLJA 2QUAA 3A6JA 4P3NA 1NBWB 2X0KA 4DLTA 4BEVA 4ZCIA 4UPDA 2XT0A 2B98A 4XWWA 2RBKA 3GI1A 1E2UA 1L5OA 3FSJX 2Z5VA 2XMCA 5YASA 4H27A 4HVTA 5GGXA 4HNQA 4C7XA 1ZY2A 4UU0A 2ZROA 3CUUA 1MUUA 4GWKA 3ZGNA 3HKDB 5C2JB 4CF7A 1SA0A 1IE3A 1ESCA 4GOMD 3TGWA 3M6MD 4MWCA 5F7OA 2ZRJA 1C9NA 1RAFA 1RM0A 4KR6A 5JC1A 2ALZA 3P2JA 4DQKA 1AVTA 5AI0A 1TTTA 4M0KA 5C1OA 4P4SB 2FGJA 1HE2A 3BJIC 3IV7A 2ZTHA 4OQDA 1Y9DA 1N75A 2PGOA 4MUXA 3FNRA 4LXXA 4MW7A 2C4HA 2G07A 3CVOA 1G3QA 3SF8B 3BMCB 1NHGA 1G8HA 4I1OA 1CQZA 3AEKA 3QFCA 4MB6A 2BI8A 5IAEA 3L7NA 4IOLA 2IUUA 3GG2A 1J8DA 3WOVA 1V25A 1ZEMA 3R7AA 4DIFA 3ZGXA 4FONA 5L40A 1VG8A 1O08A 1KEEB 3I9V6 2COKA 4WCFA 4DCSA 4DCMA 4DKJA 3SFVA 3CSSA 2O8FA 5HUJA 2R85A 1NNI1 1PUJA 4DIEA 1N33B 3BXFA 4E33A 3NNDA 1R9GA 1EKFA 1EP1B 3KL4A 2ZRBA 3S1AB 3QEAZ 5FTMA 2HF8A 1ZOLA 1GPUA 4F4WA 3MGCA 3HLTA 1VDZA 5AM3A 1UBUS 3AR9A 3JVVA 2BHLA 2C29D 1SIUA 2BONA 2HB6A 2WYHA 4PYJA 5KTRA 4RD4A 5IDYA 3PDUA 3RUEA 3PKJA 5GOTA 4QUBA 1OYYA 1EVLA 4DJDC 3WRWA 4AW9A 4TMFA 1T9KA 3AVUA 1NPTO 4UBJA 1JDPA 5JEDA 2FQXA 1SC4A 3EEOA 2VUMA 3MWKA 4QLBA 3DDOA 3VZSA 2GBCA 4NE7A 4K6KA 1RHRA 3L2OB 1ORWA 3N07A 1E8MA 1R27A 2WEKA 1BXRB 4ZN6A 1O94A 5D51S 3DE3X 3ZYZA 1XXHB 4YAKB 4X5OA 4IEIA 1P5ZB 3LI2A 4FIDA 2GN6A 3SY8A 2IEZA 5CA0A 2JNWA 4Q24A 1Y63A 5IJAA 1VHJA 2R6R1 2AHRA 3NIDB 4RD2A 3G6VA 2JA2A 3ZTYA 3T1YB 2YUTA 2R1VB 2X6TA 1K7XB 3AUJB 1RQ2A 1M73E 4J16C 1DLIA 1SVOA 1X1RA 5KT3A 1CY6A 4RMHA 5KDLA 4YQFA 3ESZA 3QHQA 4D8TA 2FZEA 3VDNB 4ABYA 4NPAA 1N6IA 3RVSA 3W5BA 2JLXA 2YBDA 2IYFA 2HMYB 2PQ0A 3DJYA 2AR0A 3L8FA 4KL8S 1KZ7B 5JXGA 3GFSA 1S1MA 1OXSC 1PHPA 5K09A 3OQBA 2H1OA 2RHGB 3SF0A 3EW9A 4PFKA 4HDMA 4YQWA 2H00A 4NOLA 4D46A 1JG3A 3U3ZA 3PXEA 1W0JA 1C3XA 4QGSA 1ZOOA 2Q7OE 3GJ3A 2R4UA 3IALA 3DE4X 1ADJA 1J2JA 2AN9A 4R1SA 4PDBA 5IBQA 2WIBA 2IIBA 2HVRA 2GTHA 1ZD3A 1URPA 4OUDA 3Q6IA 1L5LA 1NDHA 1NJ8A 3ZD9A 5T4FA 1N9ZA 3NRCA 5JT1A 2VZEA 1I5OA 5HBGA 1UBEA 3QPWA 4DVJA 1B43A 3RTGA 4JI5H 2FAXA 4WW0A 4PO8A 2OFPA 5JVDF 5FYQA 1D4ZA 1E4FT 3ANTA 1CZRA 4MVJG 2WIFA 1PD1A 3WV4A 1W581 3SJZA 3TG8A 5ALWA 3EG9A 2SBTA 3FOBA 1N2CA 4X61A 2IBKA 2VDUE 4BQSA 1PO7A 2VC2B 4NS1A 2K4MA 4UBKA 4K3VA 3FTEA 1XK5A 5DLYA 3VU9B 4MWTA 2Z9CA 2WNIA 3SSNA 2O0MA 3MFHA 4UHJA 3EW7A 4L16A 3UYYA 3GEDA 5L9AA 3CKMA 4LFAH 2B4TO 2CDNA 2C9CA 4BP8A 5ICGA 3MB8A 2FR8C 2PSJA 4TUYF 2BEUB 4M8LA 4BNTA 2WT8A 1SOUA 3NALA 1ZBDA 3ZE1B 4JQSA 3E23A 3A6EA 3E9MA 1Z0DA 2VT2A 1XKQA 1P6XA 4UVEA 1Z2DA 1RXIA 1XTZA 4R3WA 4P0QB 1II8A 2VYCA 5EIXA 3OPVA 3U7IA 1BC5A 1Z6PA 4IQ0A 3QWHA 4XX0A 2BFAA 4RPHA 4TLMB 4IH4A 4EMBA 2Y1KA 3DZBA 2ZYDA 3KK0A 1QF6A 4YB8A 1V1MB 1YB1A 5DB4A 1DOHA 4YCSA 5IJWA 2GF9A 2QY9A 5AW9A 3OZVA 1ND6A 1WBBA 2JA7A 2EBWA 1KKLA 3OECA 2AC4A 2B0JA 3CB4A 2W70A 4MWZA 1SBIA 4H7DA 4ZEVA 1KKMA 4MUIA 3RIHA 1TJ5A 5DJ5A 1DI0A 2INGX 3NTOA 4G5GA 4RMNA 1X7DA 3ZKWA 3E7WA 3KUXA 2XT6A 4DV0B 1MZVA 3TD2A 5BPFA 2DBZA 1HR0H 4OHYA 5TPZD 3QXJA 1GP2A 3QPDA 1AKRA 2CLDX 4Q4CA 4NEGA 2FFBA 5BVHA 2ADMA 1V5FA 3KWMA 3VDQA 2KW5A 2LTAA 1DKQA 3VJLA 1DG9A 2P11A 2R66A 3SC4A 1NM5A 4JCCA 1VRVA 3HDYA 3GLGB 2IDZA 4ENPA 4HI0E 1ZRNA 3JQ6A 3BHMA 2C2WA 2ZS7A 5EWMB 3HU1A 4EGAA 1KSJA 4PFJA 5AK4A 1V1JA 4N0MA 4NNPA 1C9MA 4E51A 2BIFA 3NG1A 4IMIB 3LVRE 2Q7XA 1SB8A 3HCNA 1Q3KA 5JSQA 4HV4A 3O0DA 3PW2A 2FWNA 2O8BA 4NYMR 2QRQA 4N49A 3JPYA 3KKPA 1N56A 2J9FA 3TQHA 1VLHA 4DIDA 1I01A 1XU9A 4UDOA 3N42B 3B8EA 4LNUA 3PXGA 1N34H 1QBKC 1U1FA 1T8PA 1KI8A 1FSFA 4KWCA 1AGPA 5AJHA 1T4CA 2AN5A 2FFQA 1UBNA 1WHSB 4O2BF 1AUOA 3TEKA 1VXOA 1U31A 3KHSA 5CPFA 3JS5A 4CU2A 3QEMA 1TVKB 3KIPA 3T06B 1MB2A 2ZSAA 3N7UA 3A3NA 1VJ1A 5DW0A 4NESA 4NX2A 2XZLA 3HCOA 1T5OA 4H7JA 1ES9A 2DH5A 4C6SA 4HGNA 1Z0IA 3TTXA 5KYTA 1BEEA 4NZMA 2X4IA 3JQFA 1EP3B 1EBFA 5AR1A 4O3FA 2QZZA 2RSLA 3BB1A 1T8SA 4MJLA 2RIPA 3F3YA 1F14A 5KWSA 2XTZA 4NMLA 4BIMA 4PIPA 3ROQA 3UQZA 2ZB3A 2EFJA 5JG7A 5AW7A 4H4EA 4F46A 4WHMA 1NE2A 2V7VA 1SCJA 4YMSA 3K53A 4KGDA 3AY6A 5C8ZA 3E27A 2HF7A 4YAIA 5LYJB 1R9TA 3QKTA 4GT1A 3L0CA 1WJGA 2YMQA 2AYXA 3MJEA 2FWPA 4M83A 4IDBA 1UQRA 1R8SA 3DAYA 1PT6A 1EWYA 2O19A 4J4HA 1UEJA 1M7BA 3OX2A 1ZAKA 1SVIA 3ZE7A 2VA9A 5K4AA 3I8OA 3BL8A 2V6JA 3SJBA 4LOKA 3EVAA 4I55A 2HL6A 1SQ5A 4HAUA 4XVHA 1A96A 2OHVA 2C00A 2VFAA 2FF5A 4IIJB 5LXTA 4TLCA 1XFAA 4FE7A 5SZJA 1JQDA 1L7RA 5JAIA 3F6RA 4LFBH 2FLVA 1WCYA 3RVKA 3W3ZB 1KI6A 3PNPA 3ZLBA 4LX8A 3QY9A 4Q05A 3M49A 4QTUB 2CV2A 4IIDA 1NAHA 1G4UR 1UP4A 4IBOA 4I4TA 4CLRA 1SIBE 7AT1A 4ARZA 1JH9A 3BWYA 1VI6A 3IIEA 4LDNA 4G0XA 3OU2A 3FZEA 3SZLA 4CI0B 1KJZA 4AZ3B 1JH8A 3A4VA 3LPNA 3RADC 3IKVA 3RO7A 4MI1A 1ML3A 2FPXA 4X7RA 5I4BA 4WXMA 5J59A 2OGTA 1SM4A 2OECA 4WKOA 4KWHA 4MVJI 3RYCB 4EABA 3FYSA 5L3VA 2QTVA 5EKXA 2XAUA 4CEHB 5BMVA 3V4FA 2VG8A 1DO8A 4IMPA 4TL8A 1YNSA 3FXAA 3RS0A 1GN9A 4ECXA 1G3UA 3ORFA 1MVLA 1WM1A 1EM6A 4JSTA 4NFHA 4ZVTA 4TQSA 1WCMA 3ST7A 1YJBA 3UHFA 5DFAA 3QVVA 1YL7A 3K4PA 4DABA 5LQAA 4M60A 3MWLA 2ZJ0A 3Q3EA 4MARA 1TZBA 4P4UA 4ON9A 2UYQA 1KBLA 4UCSA 2ONKA 3N5KA 4L72A 5SZIA 3GIQA 4A8JA 4DLSA 2NUTA 4WN3A 3T4PA 3GWZA 1O9BA 3LXRA 4CTMA 4UVGA 2GN0A 4P3OA 1YHYA 5K8TA 5IN5A 1FP2A 2P91A 3H2BA 4ESHA 3VTKA 3K9QO 1JS1X 2CEKA 3RB3A 1AH2A 5JJCA 3CSUA 2HJHA 4JP5A 3TDMA 3L1JA 4IS3A 3GUCA 4EVQA 1X86B 3TL2A 2C59A 2HPVA 2NP7A 4QO8A 2ZUWA 1IM5A 2RK6A 1A4RA 3V6KA 1A9PA 4ENVA 3CZ4A 1V16A 5D2CA 1UBSB 5JYEA 4ZHQB 1ZM9A 1ZSNA 3JZDA 4J0JA 1LNZA 3ENVA 1D1QA 2P27A 3VSEA 4KRGA 4NOJA 1VKOA 3K8QA 2TS1A 3HVRA 3OCUA 4M54A 3OD1A 3E84A 4TMXA 1K8ZB 4Y18A 2BFFB 2Z02A 2IL1A 2FRVA 2AJLI 3SICE 2I7DA 5EJ2A 2OVBA 4LVOA 4UUOA 3NQ41 3I9MA 3NH6A 4PHGA 4TMTA 1EM8A 1L5FA 4ZVRA 3EPLA 4JKOA 1XZFA 4KDFA 2FU5C 3MCZA 1K7FB 3PNYA 3VQTA 1AU9A 4EB8A 3IBYA 3I1FA 3PVZA 3OPQA 3R44A 4IUDS 3L0YA 3O7MA 3JATA 1LF5A 3MAAC 4C4SA 5DM4A 5BWCA 4B9AA 4FS1A 4MITA 1Z7GA 2FP3A 1KHHA 2VQSA 2ZVQX 2OYRA 2P9FA 2HRBA 2ORWA 4BO9A 5LBTA 5I9MA 2X2PA 2W57A 3C3KA 4LY6A 3GH3A 1KT8A 1CE8A 5EKTA 4F60A 3NOVA 1GVNB 2C3UA 3VBCA 4CM6A 3T3EA 1TQ6A 2O8DA 5HKKD 4XVQA 3B9QA 3BYZA 2XCTB 2NVYA 4QNMA 5HIMA 1WUYA 4ZMRA 1WDMA 2GZRA 4J0FA 3Q2KA 5JPCA 1R8JA 3VISA 5L1LA 3UYLA 1TWAA 1ZU4A 2ZRAA 4B34A 4P7FA 3FMFA 4DG9A 2ZM5A 3GC6A 3GJ7A 4P4TA 1K27A 2FGKA 3WRYC 1R4MB 2Y4OA 5JIBA 4IR7A 1LBQA 3NHMA 4XEHA 1FRFS 3EEQA 2W83A 5FPOA 4GDMA 1K1EA 4NFYA 2ORIA 2FSGA 1W88A 1IEXA 4FP9A 5KNBD 4L3WA 2A5JA 2AG8A 4L75A 1TPYA 3SNHA 4ZK2A 3FOAA 3KBOA 3JQPA 4RTSA 3TGPA 5D7NA 4QM6A 3RVMA 2R6DA 4YV0A 4JI6B 4G5RA 3GVXA 4ZDIA 1PS9A 3ZZUA 4QDXA 2JFZA 2VXOA 5FP0A 4GYYA 4PCLA 3ABOB 4RWZA 5F9MA 4TYPA 4XRRA 5C8YF 3AR4A 1P44A 3BRWA 4EA6A 2C2HA 2WF5A 3V2HA 1E2MA 4DM7A 1AUXA 4GBMA 1NXSA 5JSZB 1ZNQO 2XQKA 4NCKA 2WJZB 1JEOA 1TCBA 4G0UA 5CB0A 3KQWA 1JQKA 2E48A 3J7AK 2AOTB 5T14A 2COIA 4J2OA 3KD2A 4YRZA 1U02A 2JI9A 3FM9A 2FFJA 3K0CC 2V65A 3KKZA 2OD9A 1PJLA 4LE0A 1KFKB 2XB6A 4C08A 4YAUA 5I5YA 1A5BB 3PRYA 4YAEA 2X7XA 5JNVA 4CQMA 2IEBA 2ZWMA 3W5JA 2XNJA 3X1DA 3E9EA 2UXBB 3ABZA 4HAZA 4KBFA 1Q92A 2ZRDA 3ITDA 3KOOA 1U9JA 1Z15A 2ZJFA 3Q7IA 5HK8A 3OEHD 2ZUFA 4RSHA 1PX0A 1S89A 3WGNA 3V2UA 2XWSA 5D3MA 4WKGA 4JK3A 2G67A 3G6WA 3T3NA 4KZKA 2Z8YM 3OU7A 2IHUA 3AP2A 1R16A 5DWDA 1CB7A 2JIPA 4WTOA 2AZMA 4JD5A 1NW8A 3FYUA 1ZUIA 1GITA 2FSFA 4QUHA 4F5DA 2F00A 1XMPA 3B12A 5JJKA 2BHNA 1IRXA 1JHOA 3W1BA 3WA7A 4IUBS 2HGSA 5IXSA 1AHIA 4GR9A 3JQ7B 4ENUA 2YV3A 4Q7KA 5E4TA 9MHTA 4WLEA 4W6QA 1JKMA 1D9XA 1OTXA 2OXRA 2HMWA 5FTJA 2YVUA 3IOYA 5AVTA 4DV3H 1X1CA 3DFZA 5L7WA 4P1ZA 4E12A 5G1NA 1H2ZA 4LJAA 2A9RA 2C92A 4CMAA 4FYHA 2DKOA 5FI5A 5JVDA 4GLFA 3HDHA 3T7TA 4QG3A 4N12A 4JVMA 4HSEA 1JQEA 3HYRA 4D8XA 4BFWA 3KPWA 5FUQA 1PW5A 2JI8A 4PVDA 2XAAA 3DL0A 3IRUA 4K40A 4EFDA 2VTEA 2FX5A 3AVPA 3MFIA 4O7VA 4M55A 3UAWA 3OFNA 1GZ3A 1NA5A 2H1RA 4X41A 3T35A 3ZWCA 1L5SA 4PFQA 3TR6A 1NY5A 3TUJC 3A37A 2BDUA 3S44A 4N01A 2C8KA 1JEQB 3TNYA 1SB9A 1LJLA 3IYLW 4BKPA 5J63A 3RRMA 3VDRA 3I6IA 4AO6A 1Y8QB 1B7GO 1PWYE 3LOQA 2NZXA 5T3UA 1LFDB 2JGDA 4TUYA 3RH0A 3J80A 4MUBA 1G5HA 5ABPA 1YQQA 2WVGA 5H02A 1M2VA 2CZCA 2EKLA 2G1AA 4G5FA 7ADHA 3UIEA 3C3WA 3RSGA 4GOOD 5BV0A 3DL2A 1I7LA 4WV3A 4O63O 4PN3A 4MQMA 4LYDA 1FVIA 1B26A 1EX9A 5KQMA 1VKHA 3M8KA 3UWPA 1UM9A 1ZD5A 4AURA 1LZLA 2W2MA 3JYNA 4C1BA 1FP4B 4DS3A 3UMGA 2FDRA 3JAKA 1OFIA 4IGIA 3S2GA 4E7PA 2O7RA 5BQXA 1P8AA 3T1OA 3MILA 2CW7A 4S0XA 3ZNQA 3GAMA 5MGBA 1LWNA 3IUEA 3SNKA 5FPTA 5K8UA 2VQEB 5BT8A 1GZ4A 1DS6A 3SVLA 1ENPA 2I65A 3LXXA 1L4YA 1PL6A 2GXUA 2IP1A 5EL0A 2GTPA 3JD4A 2ZSDA 4TKZA 4FVTA 2FN3A 1QP7A 4EVIA 1DC3A 1H8HD 3QVOA 4BB9A 5AT1A 3WLKX 5AMXA 2I7VA 3I76A 4Y98A 1O2DA 3Q8XB 1G16A 4IMRA 3FHCB 2WTNA 2O54A 3EQ9A 4C7OA 4ZO7A 4ZVKA 2PHZA 3H0KA 2DPHA 4JJ7A 3GEHA 3N41B 2GWRA 1MRZA 4GOKA 3I53A 2C97A 4P2GA 4P2BA 1YSCA 4DDKA 3QBDA 4LCEA 3E4DA 4LZZA 4NBKA 1T24A 4F86A 3A0RB 3SC2B 2CMKA 1ADBA 2AXPA 3V4RA 2FPIA 3EVNA 1SURA 1UFVA 1SC1A 4EZBA 2Z09A 4QRIA 3PQ4A 4X90A 5JZBA 1WHTA 1ZETA 4ME6A 1NBHA 2ZJOA 1G38A 3U26A 1JI3A 1JKFA 3KQKA 1QQTA 3F3SA 2JHGA 1WAMA 1KK0A 3T99A 4R9VA 4JI3H 3N8KA 3NGDA 10MHA 1PR3A 3SSOA 5H4GA 4EH1A 3CLTD 3E9DA 4O2BA 3KHHA 3ICPA 2YY6A 4B4OA 4R2HA 3AWIA 4XX1A 2TECE 4UE6A 4Z0TA 2XZOA 3BQ0A 1ZNYA 2WJHA 1MAAA 1XNHA 4DUZB 4NYJQ 4D0NA 2HIHA 3UFBA 4QNRA 4UUQA 1YONA 4WLNA 5KJCA 1Z4NA 2R4TA 2GHTA 1J09A 3L7LA 1NN0A 1UMBA 4DGSA 1G2OA 3SG0A 3OOJA 3ZW7A 2GS9A 3UV7A 4WK6A 4HAIA 2GD1O 3V7FA 2FDCA 1ODKA 4A0SA 4N0DA 3PCRB 2Q4EA 2C2OA 1Z8FA 3GPCA 2DFDA 1D0SA 2EJCA 5EE0A 4GUDA 1NQTA 3EGIA 3NVKI 1A7AA 4MP8A 3ZK8A 3VNNA 4N39A 5JBNA 1JA1A 5L3ZA 3JWJA 1FBNA 3GQBA 4G8DA 2EWVA 1B41A 1JXOA 4BNDA 3QFFA 3M6IA 1RW4A 3JVEA 2OH2A 1NXTA 4RAQA 3CLKA 1U2PA 4BBAA 4W8GA 3K0AB 4DUYH 1P4JA 2SKDA 3I3OA 4OG2A 2CXOA 1FTGA 1QTRA 3B38A 3W7VA 4AS2A 2X6RA 3AF6A 1XAGA 1AN0A 5EAIA 3U7HB 5L1JA 1E6EA 2OORC 4B6EA 3UOAB 3IULA 1VE9A 3WKDA 3R74A 4MX8A 1CUFA 4TQGA 4PCUA 2QSUA 5ULLA 1UPTA 3UPUA 1LS1A 3WMFA 4KXWA 2OP0A 3LZDA 4G1UC 4LWOA 1MTOA 1TCUA 3QUAA 1ZR2A 3QIVA 2Z56A 2CXTA 3QOFA 3GPBA 1RM5A 3D7KA 4NH4A 1IDOA 3AETB 4QAJA 3TQCA 3L1VA 1Z4IA 1HDZA 1O89A 1PEAA 1RBMA 3KVRA 4RUAA 2QMOA 3K6SA 5FIUA 5AK6A 3KT6A 3PEVA 2XSZA 2DB3A 3FCXA 3LYAA 1AXGA 1IBMB 2VJNA 1TO1E 5BSMA 1I4TD 3R3ZA 1XKTA 4PQEA 3MN1A 5AKIA 2FSSA 4K46A 3MINB 3QKRA 4G2NA 2GTIA 3JVUA 4LS3A 2E49A 3GCDA 4A2PA 3LPAA 2JH9A 2H7CA 2A9QA 4Q3CA 1I80A 3DM9B 4KIUA 1SBHA 3KJEA 1G8SA 2OILA 2R68A 2RK3A 2CF5A 3KYJB 3N0XA 1K98A 3UWMA 2CLOB 4MHTA 1QGYA 2V0GA 3UPTA 2W8ZA 4GYKA 3I9LA 3OURA 3QE4A 3STUA 2KE5A 1EHYA 2OGSA 2GEUA 2B61A 3OPYA 3IAS1 3BMQB 2JIBA 1SH7A 4UMVA 3IS3A 1S96A 5CDHA 1ILWA 5JCXA 4KMRA 3N9IA 4NFLA 4E94A 5JMPA 5EYPA 3DFMA 4HXYA 3JW8A 4EG7A 2ZDGA 1SD5A 2RGAA 5DNWA 5DDIP 2OFFA 3IDSA 2CXXA 3VVLA 1QS0B 4JI7B 2BGIA 3VH4A 1LPPA 4AL4A 3ENZA 1JHQA 3JZIA 2JJ1D 2WMYA 2VYVA 2WJ6A 4R81A 5LBUA 3HR7A 6PFKA 4ZVNA 2XIGA 4YVFA 3WC4A 3FR7A 4Z7OB 1WDTA 4ZCRA 1NUTA 5ICSA 2ZZKA 4KOAA 2CK3A 1E92A 4MRNA 1VB5A 2CUNA 3BMXA 1RPJA 4V0QA 5AI8A 3BD6A 4DXAA 3QVXA 5E6RA 4DNQA 1M5UA 3AQIA 5SYAA 4RDCA 4W9MC 2FPMA 4LOHA 4DIKA 2KM1A 2NT3A 1HX7A 2RC6A 1QHHA 3HEMA 3ADCA 2VJQA 1HBJA 4AJ4A 3A0UA 2WTUA 3GRUA 4M46A 3KQQA 4M21A 4AG6A 1N5MA 2B6NA 1OLSA 3L46A 3FMVA 3RC9A 2RH4A 3ZV5A 1ODIA 1ZGCA 2BM0A 1XZQA 2ZZNA 3M4NA 3KJQA 3MB5A