2YZMA

Structure of d-alanine:d-alanine ligase with substrate from thermus thermophilus hb8
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-Alanine:D-Alanine Ligase with substrate from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 83
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzmA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzmA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzmA01
1C30A 2IP4A 3ETHA 3ETJA 4Y8VB 4XYLB 4O7ZA 3RUPA 1CE8A 1KJIA 2I8CA 4YBZB 1VBHA 5JQGF 1GSHA 3SE7A 4M99A 2V5AA 5I47A 3KAKA 4O86A 4C5AA 2YRXA 1IOVA 4M9CA 2R82A 1I7NA 2ZDHA 4J6EA 2R7LA 2W6PA 5D8DA 1EUCB 3HBLA 1KBLA 1EYZA 5J2UF 4HNTA 4YB8B 2VHEA 2GQRA 4MAMA 2FP4B 4TV9F 2Z02A 2W70A 1B6SA 4IWXA 3LP8A 2XCLA 3VPCA 1PK8A 3AW8A 3KALA 3ORQA 4FFLA 1EZ1A 4O7NA 1KUTA 4O2AF 4I50F 4FFOA 4O83A 4M9UA 1UC8A 3JZIA 3G8CA 3JRWA 4O7VA 2R85A 3K5HA 5KX5F 3KAJA 1CQIB 2NU9B 5JH7F 4EAAA 2YL2A 1W96A 2QF7A 5CAEB 4MV3A 4IHJF 5GONF 2X0SA 4WBNF 3WNZA 3BSSA 3N6RA 1E4EB 2PVPA 2ZDQA 3RFCA 1DV2A 4XZ3B 4MA0A 2W6ZA 3QFFA 5H80A 5LXTF 4C5BA 3Q1KA 1BNCA 1KJ8A 5C8YF 4FFPA 4QSHA 1OBGA 2HGSA 3U54A 4I55F 1UC9A 3V4SA 1Z2PX 3KREA 5BMVF 2YS7A 4MV9A 4HNVA 3JZFA 4O4IF 1M0TA 4FGRA 4MA5A 3MWDA 4FU0A 4O7SA 4RZQA 5JVLA 2R7MA 2I80A 4IIJF 2W6OA 2NU8B 5JVDF 3E5NA 1PX2A 1VBGA 4EGQA 2C00A 3TIIA 3VA7A 1ULZA 5LOVF 2OLSA 2FPPB 1JDEA 4IWYA 1CQJB 2YWVA 3GIDA 4ZI7F 2CNVA 1T36A 1KC7A 4L1KA 2YYAA 1Z2NX 2GPSA 2NU7B 2HJWA 3ORRA 4O81A 2DZDA 4YAJB 3U9TA 4O7YA 1Z2OX 4MV6A 4ME6A 4MV1A 5IYZF 4YJ3F 5HBRB 3BG5A 4EA7A 2NU6B 2J9GA 3RV4A 3VPBA 5J2TF 3N8DA 2NUAB 2DIKA 2VQDA 4WD3A 3AX6A 5EZYF 4FFRA 2SCUB 2YZNA 3R5FA 3NUAA 4HR7A 1I7LA 4MV4A 1W93A 1KJ9A 3R5XA 3I12A 4ZOLF 5JQWA 4O4LF 4MV8A 1BXRA 2CZGA 4TV8F 1GLVA 1DIKA 4HNUA 5LYJF 4O7TA 2R87A 3U55A 2R6FA 3VPDA 3UFXB 1AUXA 3VOTA 4HQ6A 4EA8A 1CS0A 2CQYA 2V59A 4O2BF 3RV3A 5K2MA 3BSYA 2Z04A 3MWEA 3TW6A 3R5HA 4EG0A 4O7LA 5CA0F 2CNUA 2PN1A 3HB9A 5CB4F 1KJJA 2GLTA 4O82A 1VKZA 2CNQA 2W6NA 2R7KA 1JDBB 4M98A 2YW2A 3U9SA 1IOWA 3BFPA 2VPQA 2I87A 1GSOA 2FPIB 3MJFA 4GGMX 5CA1F 2P0AA 1A48A 3K3PA 1KJQA 2V58A 5LP6F 4FFMA 1KEEA 1GGOA 3VMMA 4EGJA 3OUZA 1B6RA 2WYOA 4O7RA 5C1PA 1EUDB 3K5IA 2FPGB 2ZDGA 4DLKA 3WO1A 5FNVF 2PBZA 4IZOA 1GSAA 1DV1A 2W71A 2YZGA 2DWCA 4DIMA 5BPHA 1SCUB 4XYMB 4O84A 4NYEA 1WR2A 4TUYF 2YRWA 4ZHQF 2W6MA 4E4TA 3OUUA 3V4ZA 2R86A 2YS6A 2XD4A 5HV6A 4FFNA 1A9XA 2GQSA 3GLKA 4I4TF 1OBDA 2R84A 5LA6F 5KKNB 4O4HF 2YZLA 3TIGA 4YJ2F 4ZQIA 3DF7A 4O4JF 1E4EA 4YAKB 3Q2OA 4FE2A 1M0WA 5C1OA 3G8DA 3TQTA 2NPOA 1M6VA 4EA9A 3R23A 1C3OA 3TINA 1AUVA 5BPFA 3BSWA 5DMXA 4XX0B 2QK4A 3JRXA 1JKJB 2FB9A 4MV7A 3WO0A 2VR1A 2DLNA 2YZMA 4EABA 4O7WA 2R7NA 4C5CA 2W6QA 1EHIA 2GPWA 3R9RA 1JLLB 3LWBA 3HO8A
chains in the Genus database with same CATH superfamily
1WEKA 4GWLA 4HUJA 1NULA 3FMAA 4YACA 4QASA 1CQZA 2QN6A 1GV1A 2PZKA 3RUPA 1S8AA 2HRRA 1PGJA 4RL4A 3HB1A 1E2HA 3AHHA 1ZUNB 2NN3C 1KHHA 1NQOA 3CRVA 1ZSVA 3W3AA 4LOJA 1FF9A 4B33A 3GFTA 2CHUA 4XTRA 3QBVA 1Z5WA 2CVQA 3ZW8A 4HK4A 3DAAA 2EDAA 5AJVB 3K1AB 4GS5A 4QTXA 4H7DA 2QTVA 2SBTA 2XUJA 4A8JB 1DT3A 2C8KA 3KQYA 3LUHA 1P62B 3VYWA 3T54A 4O7VA 2R6CA 1VHJA 2EFDB 1KJWA 2CXTA 5AW3A 1XRMA 1XZDA 2W93A 4IGEA 1NY5A 1FMCA 2QRVA 1TEXA 3NDJA 2EFJA 4JT8A 5HZGA 5ICMA 4C0XA 1FRZA 4HY3A 3GFVA 1RPAA 5DSTA 2Q3LA 3A6HA 3QX3A 4ANFA 1U2EA 5MN6A 3TLBA 3INRA 4LHEA 3KD2A 5COBA 3W77A 2Z2YA 2C2HA 5IABA 3TRFA 2IU4A 5KFLA 4EM6A 2JCBA 4IZ6A 4GXTA 1QMGA 1WMAA 2V7TA 3CEMA 3LYAA 4WQMA 3HFSA 7ADHA 1QGUB 2ZJ0A 3VNNA 3KEQA 1ZI9A 3WB2A 1MXFA 2R9VA 2XZOA 5AKJA 3PW7A 4PC2A 3NHKA 3U1BA 5A02A 2ZAGA 3UG6A 1XZ8A 5DM0A 2OFWA 3NETA 3O38A 5BQ5A 4BCBA 5ADVA 3SDSA 4Y2UA 1DAPA 1C0LA 1PNQA 2JDID 5J2TF 1S1MA 4HUTA 3WJ7A 3S5JA 3X2EA 1UBFA 3T7KA 3HN6A 2IPMA 4DYHA 3ADOA 1XDNA 1UXHA 3PXBA 3H87A 4K9OA 5FHQA 4CM3A 4X63A 1W9HA 4YK7A 3FNRA 4FZ5A 2HF8A 2DPIA 2R8PA 1YULA 5G41A 1BE6A 1WTAA 3R3VA 4MDHA 2VL7A 2BMVA 1ZICA 1G64A 1K0UA 1Y7HA 4X65H 1AKEA 4OREX 3UYYA 3ZCXA 4YXWA 4HBZA 3RYHA 4EVSA 5F78A 3RFFA 1I8TA 2XCPA 3B2QA 3QU7A 1E5LA 3IQEA 2V9WA 3OHSX 4XOIA 3PX7A 3I9KA 4R9RA 3NC1C 5EJ4A 3IQFA 2W6NA 4LAFA 1KVUA 4Y6LA 2R5FA 3T0FA 2VIIA 4YAOA 2GBPA 3FF1A 4JI0B 1A9QA 4OH7A 3H5OA 3FCUB 1G8KA 3CLVA 2H9AA 2BP7B 3OT4A 5C4IA 4J1QA 1OFGA 5U4QA 2FPGB 4Z9BA 2JBAA 4BFVA 1UJ2A 3VYUB 1V5GA 2ASDA 3W06A 4Y6QA 2VP4A 4PQEA 3EZ9A 4J0JA 1UXKA 2VTBA 3LF2A 4DRYA 4CF4A 2XUGA 3H4MA 2PV0A 3CH5A 4XWWA 1CNMA 5CH5A 2A5GA 3M5CA 1MZBA 3IT2A 2VZ9A 4XCQA 4DL9A 3S8MA 1T0BA 3AG5A 5DX8A 3ZD7A 2BZGA 4HRAA 2H4FA 2V3VA 3WLIA 2VNJA 3PP8A 2NP6A 4TQ9A 3R9KA 2CXXA 3L8HA 1QV7A 5ECDA 2JIZA 2QQ5A 2XQKA 2PXAA 4FD2A 1OGIA 2ZYTX 4LDQA 4CF6A 2B25A 2R7ZG 1R9GA 4DV3H 1SU4A 5ALJA 2JIOA 3IERA 2AZMA 1S9HA 4DTIA 4NV0A 4KE6A 5CX1A 4UHJA 2EJ3A 1JXMA 2DGDA 4RTSA 1PV2A 1SWWA 4LHVA 1CQJA 4HWPA 3FVQA 4PANA 3A70A 3RLIA 3B20A 1IYZA 3BA1A 3WMWA 2FWBA 2QRQA 4I14A 1L7OA 4MGEA 2GCNA 1JAZA 4U7HA 4MHSA 1YB5A 3UV6A 1I0IA 4QJIA 4DVJA 4ROTA 4MUGA 1T9AA 3Q3CA 1U7TA 2OPBA 4CIVA 4GPEA 2O23A 4JJ4A 4IQ4A 4Q16A 4KCGA 1YZTA 3G5LA 5EPEA 1JI3A 3NAMA 2C7GA 5CLGA 1C8LA 3ST7A 4CCYA 3PHHA 3PW5A 4O7NA 4RPHA 4RDXA 1TLTA 4RIHA 2YJGA 4M9UA 1Y6FA 1ZINA 4XQCA 4NESA 2X23A 2P2YA 4W8HA 5FP0A 1NVUQ 3QLJA 3U3OA 2ZM6H 2AZXA 1H1LA 1WCIA 2BMWA 1HFWA 4ZJUA 4MVYA 3QOWA 4F4WA 1E2QA 3TUJC 3RFCA 4ARCA 4XIFA 4Q3CA 3CA8A 3FRHA 5G0VA 1B7GO 4NDNE 2BEJA 4QPCA 2F3UA 2YYYA 1T1IA 4WCFB 4WY5A 2HCRA 2ICAA 3W05A 3M6WA 4H35A 5H9VA 3GIQA 3DZKA 5CNIA 1FE8A 4WOBA 1PHPA 2M6LA 2WUVA 1TAHA 1FC0A 1OA0A 4HNAA 3KTAB 3ZCPA 1W2GA 3RRYA 3NNSA 4JKIA 4AJ2A 1NMYA 5HM6A 1NVMB 3FCCA 2ZITA 1Y8CA 1VL6A 2GHQA 4FYYA 1FP4A 5DT2A 2EKBA 4GRDA 3B60A 5JAPA 4NI5A 2HEIA 4JVMA 5TVKA 3WK6A 5DX0A 5DI3B 2VP6A 1OZGA 1T3LA 1U98A 3AF0A 5ERXA 4BFCA 1C9NA 5IYZF 2UXBB 1XPUA 5L9AA 4K9MA 3PDCA 2I2XB 2V3CC 5HTOA 1JHXA 3ZOKA 4YONB 2ODEA 4CBVA 4YTEA 3AW9A 3C7AA 4E4RA 4YHHH 3MZ0A 3LO8A 4L5CA 3X2SA 2GCPA 1EP9A 1Z4KA 1K1EA 3JPWA 4MJXA 3R5FA 1EUYA 4BN5A 5BR7A 2AG5A 5AOCA 1O96B 4IH9A 1VE9A 4FBTA 2X4IA 4DNXA 3AI1A 1U8AA 5EP1A 3IL2A 3IELA 1T1JA 2WZCA 3OWHA 4A3EG 1NC1A 2OD9A 4CLEA 1LDYA 4B2LA 1CU1A 3BXPA 2Z6VA 2ZYDA 4NPAA 3PN1A 1HSZA 3I64A 3JQAB 2QLJA 1NG1A 1O2DA 3VO9A 3ZJ4A 4OY3A 4MVJH 2VZEA 3EEBA 3CJQA 2FW1A 3VGPA 2BDTA 3WR5A 4Z7OB 1Z4IA 1L3CA 1VRVA 4TROA 3KQWA 5DDIP 1OV4A 4B80A 4BQSA 4BXOB 2QTGA 2WQ6A 4DQKA 1KPHA 2O2YA 3MWYW 2ZUDA 3KOOA 5D01A 1J0CA 5JNUA 3VC3A 3TQQA 3ANSA 4NMHA 2B7CA 4JCOA 1WO8A 1QO9A 2ZJAA 3AR7A 1C7IA 2QD4A 3T99A 4LIPD 2V6GA 5EWLA 3KKPA 3VPAA 4WECA 1QG6A 3JQEA 5C7YA 4H17A 1UK9A 3THYA 1BTOA 4EPWA 1YV9A 1B42A 3HB4X 2ZTUA 2ODAA 4IO1A 4L4SA 3O4RA 4N7JA 3AI3A 1J8QA 4IRXA 3EAGA 3MMNA 4KXMA 3V1TC 3M34A 3R6GA 4WDRA 3AUFA 2B3DA 3T9BA 3B78A 4EG3A 3E6AA 2IIQA 3Q8KA 1RXIA 2O59A 4DHWA 1NVBA 5CXXA 5CT9A 1XE3A 1EM6A 4BQNA 4N3NA 4TZ6A 2DHDA 3NYWA 4DV6H 2NSYA 1WW2A 3QLUC 4HJXA 3FLMA 3N43B 1HOXA 4FEAA 2ONJA 3CVYA 2DPHA 2J59A 3DYVA 3VU3A 2DFNA 3MCWA 4RVFA 2V5VA 4UM8B 1E2UA 3GIPA 1LKZA 3W1EA 4DVGA 2Q9UA 4ZQGA 3N2LA 3X1WA 4CWAA 4TMYA 3ZI7A 5TXGA 2V03A 3E1KA 3RODA 4F11A 4L5YA 5KYXB 4PYRA 1KXZA 1EUCB 5CTAA 3RVBA 4GZMA 5E6SA 5IAOA 2RGGA 3OM8A 1D8AA 3E70C 4MWSA 1XTRA 2JKVA 2QR2A 1QRDA 1P18A 5FPQA 4TX1A 5JHGB 3MWLA 4P8RA 4O2AF 1CPYA 1E7YA 1U3GA 3PNBA 1Y0BA 4KU4A 1L4HA 5JJCA 2PM8A 4O02B 1G21B 3UUFA 3H2SA 5JH7F 3LX4A 3UZBA 4LBZA 3S7TA 5IJXA 3OC0A 4PCVA 1KO4A 1L7MA 2QGZA 2IELA 3TNLA 1GA1A 3CW8X 4PVDA 1H6BA 5LBTA 3RBAA 4KK3A 4Q4JB 2Y1DA 4Z2YA 1E3MA 3NEPX 2J8ZA 1BD4A 1RQ7A 4R16A 4XASA 1KQOA 4JWKA 1XHEA 3AF2A 7MHTA 3RTDA 4AN4A 1TC2A 3K9FC 1GUFA 1VL2A 3RBDA 4PSCA 2G09A 5IAEA 4PGFA 2FPKA 4JJZA 1SA0A 3K8QA 4R40A 3RUHA 1Y42X 4EYOA 5TJHA 4O4HB 4L50A 5D7BA 4BKOA 2NGRA 2NSDA 4MARA 4BO1A 1AZLA 4B2PA 4DLWA 5IVIA 4O81A 4XD7A 1QZTA 3WNVA 5CFMA 2NZXA 1LBTA 4LYDA 1CY7A 3OM1A 3DOJA 1M1XB 3A1SA 2ZB7A 2GVZC 3A6JA 4I08A 5BY2A 1A1VA 5EIBD 1R50A 4XPZA 1J8MF 5C4MA 4N1AA 4F72A 3LQ4A 1EKVA 3K9NA 1MQSA 7REQB 3GLHB 2RI1A 3C3XA 1RJQA 2IUEA 1PJ8A 1XZBA 4X65B 3EDMA 2OP0A 3FOFC 1NPYA 2X6TA 2QRZA 2MR6A 2RDIA 1E3EA 3LQ1A 4YN3A 1T3SA 1XOIA 4F97A 1NM5C 2EIXA 2XDQB 2XWJI 2VT7A 1RHUA 4DZTA 1ZCFA 1E94E 2X0FA 3ANMA 3K6RA 4OHPA 5AM3A 1GPDG 4LF6H 4BX3A 2EHJA 1XAIA 1IOLA 3D0KA 1Q1AA 4CLOA 2R7KA 1JDUA 2IU0A 1U6IA 4RXMA 5KG2A 1XZMA 3B3AA 1C0EA 4WE3A 3I5XA 4GG1A 1ZI6A 2TYSB 1B8VA 1WG8A 1V11B 1BIFA 1VC2A 3P5BA 5GM1A 2WFZA 4AUKA 3D3KA 4LV6A 4NR0A 4DFDA 3MFIA 1DV1A 1N8TA 4DT1A 3EOBI 4V2UA 1SKQA 1GQYA 2NVOA 2WSIA 3SYKA 2QDXA 1V3UA 4US2R 1V5EA 3IT1A 2IU6A 3H20A 4LZPA 1SVLA 4UCVA 3MT7A 4JC8A 3TZLA 4J0IA 2JASA 2FW0A 2IYSA 4PC1A 1AXGA 1XUOA 3RCBA 2DR0A 4ZEVA 1X8LA 4O4JF 2M05A 3TD9A 3PCRB 4NU0A 1U1GA 1R0WA 1R0RE 3QHQA 2P2CA 3EY9A 1RI3A 4JI4H 2C5BA 3O2NA 3COPA 1YR8A 4DV3B 4ZI7B 3PL5A 2GAJA 4I1PA 1ISMA 5IDYA 2DY1A 3V97A 1KJYA 2ZRCA 3GEDA 4JOCA 2VJPA 1EBUA 1VGVA 1CRZA 4M8NE 4D4HA 4JT9A 5D5QA 1YDGA 2RHLA 2Q5JA 2JJ2D 1OR8A 3UAGA 4HZGA 1RMYA 3Q12A 3H1GA 1NONA 2GTHA 1M9NA 4K6KA 5TGDA 1OB2A 2WC1A 3GHYA 2JLSA 2X1VA 4YAFA 1EVJA 3MW8A 3LF1A 3NGXA 3S2IA 3RADC 2HIMA 2GRAA 3U1TA 4HQOA 1N1MA 4NFYA 1VLLA 5BSUA 3R7FA 2J5XA 5HHTA 4CEIA 4EO9A 2FG5A 1NQWA 2WA2A 1JBEA 2DHCA 3DT9A 3LW8A 1KDPA 4AKSA 1IZYA 3B52X 2B5WA 2FMHA 4UCOA 5AW4A 1GLGA 2V9PA 3MQ4A 4DR6H 4MW4A 1NVGA 4M1OA 1A0GA 2XGMA 2ZM6B 4RF5A 2R48A 2QQEA 1VB3A 5FA8A 1EGHA 5KWVA 4S0ZA 3NDRA 3M5PA 4FOLA 4IVNA 3CKKA 5B37A 1N3YA 3BF8A 1QTQA 1JTEA 3NYRA 4BGVA 1YJAA 4KE8A 1XV5A 2DUUA 1R12A 5IN4A 4DADA 2BI8A 3V8EA 4WACA 5JNWA 5G4KA 2W6ZA 1RACA 5EXEA 5EHZA 3LKDA 3TKYA 2J3MA 3H0EA 5C80A 4C06A 2OKCA 4ETMA 1LNZA 1N1EA 1QFSA 2JB9A 1YKSA 3GDFA 4M37A 2HPHA 4HQKA 2HWWA 2BKEA 2Q41A 2JFUA 3SEFA 4RH0A 4ZGBA 3RK1A 4TZTA 2PKWA 1G8SA 2VBGA 4F93B 1FP1D 3ED5A 5CJ2A 2COIA 3QVSA 1VJRA 1ZM3A 3M4NA 3VHXA 1RWXA 2H4ZA 4MRNA 2QX9A 221PA 3WGMA 4G8JA 1U2DC 3KSZO 5ADHA 4RM2A 4GX5A 2YNMD 3LYLA 5M5BA 1JHRA 1OTYA 3D59A 2IL1A 3P2KA 2GBLA 2AC2A 3DHEA 3L6OO 5IX8A 4YHHB 3H9BA 1AURA 2BM8A 4QOEA 3ETCA 5BR4A 1LPSA 5F23A 1N4AA 2XXAA 2TRSB 4AKGA 2FFJA 1TM2A 4R8UB 4COKA 4W5NA 4QPDA 3FY4A 3C45A 1CZOA 4CQLB 4ZXPA 3HK2A 3W8NA 2Q3FA 3V8PA 3G9TA 2WF5A 3CVXA 1D2AA 1PCXA 3SLKA 1DCMA 2KM1A 2OC4A 1A0IA 4QD3A 1FNCA 1P8AA 1NRWA 1S2NA 5DTMA 2FZEA 4ECAA 4KG7A 1N33H 1P4GA 3ZOZA 1M83A 3G6XA 2W6CX 3KQPA 1CQXA 4GLLA 5ALRA 4D9CA 1BW9B 4MKXA 1HE4A 3UJ9A 4TXLA 5BWCA 4JV2A 2VDKB 3EG9A 4H1HA 4EY6A 3AIKA 4UW9A 1U1EA 3D4PA 3TLEA 4L0CA 4Q8EA 3LJKA 2IV2X 1N57A 1AD2A 3OIVA 3EQZA 3BE6A 3L7KA 4HX2A 1CV2A 4NYEA 1KZ1A 3QLTA 2OUKA 3IOEA 4DV5H 1YUBA 2VUHB 4AY2A 1KYZA 4P34A 3W9SA 1R0KA 4ZI2A 1Z4OA 2A88A 4J07A 1ZUD1 4A2QA 4R41A 1N6IA 4GMFA 5DN6D 3L1KA 1W4AA 2Q29A 4A2PA 4JEHA 4LGCA 5K6AC 2OXRA 1E4EA 4I4LA 5EP4A 3CJRA 4RSGA 4LGYA 4BLVA 4BNIA 2DQ4A 1N5JA 1YBMA 4O8CA 1NAHA 4AMGA 5IAKA 1SWVA 1EHYA 3SZGA 3BTOA 2D5IA 3A4VA 5E7IA 4DV6B 4LUCA 3L04A 2O2ZA 3WTCA 4HDRA 3R9RA 1JAXA 4HZUA 4BNGA 1K4MA 2JA2A 4MAAA 3V1YA 3FB1A 3NGLA 2GFIA 1B3RA 1QF6A 4XI9A 2WWTA 5A0VA 3NTRA 4G1FA 2Z4RA 1V3QE 2W2LA 4U4AA 2HJGA 1F6WA 5GVSA 4WKNA 1J2UA 4C89A 4KXWA 2OCLA 1QQ5A 5L6MB 1IOVA 3D5QA 5LQDA 1HE3A 4FC6A 5DXJA 3HCCA 1GADO 4NECA 2ZIVB 2VF2A 4Q05A 3FKQA 4QDZA 2WF6A 4E70A 4XXHA 1ESDA 3O9VA 2GNOA 3DNPA 4NIMA 1T3GA 2BZ1A 3UMMA 3UXYA 1U8FO 5B4VA 2W0MA 5FKJA 2VJMA 1CUWA 2I6TA 2A4KA 2E5WA 3GB8B 4Q9IA 3H1PA 1AE1A 3GD5A 1L8AA 2AHRA 4EK9A 3AR5A 1QM5A 1KI6B 1RVDA 5KU7A 3R76A 4OKIA 4JYPA 5EE5B 1YAHA 1NY6A 1ACMA 1XFAA 1KJZA 3GDWA 4MA0A 2Q1TA 3WIBA 3C3YA 3BXEA 4S12A 1Q0TA 3QW2A 3UAOA 4DLVA 2CNWA 3CV3A 1VRWA 1QS0B 2OCIA 2XZDA 4HS4A 2RGNA 3STYA 4O4IF 1RLIA 4PQFA 4JUDX 1T0HB 4IMPA 2AR9A 3ILYA 4ERNA 5EWEA 4XB6B 5KX5A 3RB8A 3FWNA 3UWOA 3TR0A 1KI8A 4LJKA 2PL5A 3N76A 1U9YA 2PZMA 1BFKA 5EQDA 5DW0A 1UXJA 2KBEA 3T1HB 2Q6LA 5KT7A 3C41J 3HXKA 1OFTA 1D2NA 4XYMA 3IX7A 2WMYA 2BYTA 3ZNNA 2ORWA 2BFPA 1OFHA 1JIIA 2P6MA 1Q74A 3ZE0B 1UP6A 3AK4A 4L0MA 3ML1A 2XTNA 3STWA 3L4JA 4L95C 3BM5A 2D74A 3C5CA 1L3BA 2C3UA 4M0UA 1AQUA 1XCGB 3TG2A 2A9KA 1YZUA 1FBNA 5DKFA 2C4TA 4TMKA 5ED0A 3OZTA 4BO2A 3IVRA 4UTNA 4QW8A 2QUIA 1JAHA 4MJ7A 1XVTA 3VYSB 5IPFA 4LF6B 2LTAA 4U8GA 1HYQA 2HGXA 1IG0A 3DE7X 3MXOA 4QFMA 2KQUA 1I2AA 4LVCA 2W9AA 2RBGA 2CFSA 2E5LH 1CY6A 3MB8A 5H9WA 3GGPA 3RK0A 5EUCA 5AUOB 5AKEA 1AY0A 1K1SA 4LF9H 1AOXA 3P0RA 5M7EA 2WM3A 1BCSA 3LFUA 2PGLA 5DNEA 5CVDA 3QOFA 3GO4A 4FHDA 2JLRA 3LE8A 5TIIA 2ECKA 1EZ4A 4ZOLA 4K9SA 1Y1SA 2B4TO 5F76A 3RREA 4ER0A 2P5UA 3RIXA 1BKYA 1UMKA 2ZE6A 3H75A 2J4CA 1T34A 2VHTA 1W0JD 3X3HA 3I05A 5DI9A 3QY9A 2YJTD 2R8IA 16PKA 3D8RA 1WLYA 5JSZA 4C21A 2IC5A 3K0SA 1ZONA 3LPCA 4XSVA 3G2LA 4KGZA 3P9YA 3QY0A 2ODBA 4TXMA 4JV5H 3A9SA 4PPQA 3QWUA 4PFSA 2I67A 2Z5VA 4JI4B 1RW4A 2Z83A 2UXDH 5FJ8G 1KH1A 1JFVA 1YBHA 2BE7A 1CUJA 4P92A 5M2QA 4LKOA 2GX6A 1EE2A 4O5AA 4A8HA 4RZ2A 2AX4A 2IYFA 4L02A 3H3XA 2WJ3A 4BNTA 1XEWY 1VLVA 2REQB 4TM8A 3GA0A 5KFGA 1V8DA 4MRAA 3DDNA 2Z30A 3LWBA 1HDRA 5KB3A 3AF5A 4OOFA 3GLGB 4OLBA 4YUZA 2AYYA 5JY1A 3H8WA 5F9FA 1ZMXA 1OB5A 1BROA 3RSSA 3D6HA 4B47A 4PGHA 4UNPA 3IBYA 1BS2A 2MR5A 4C4TA 3B38A 4QOGA 4AM8A 4IR7A 4LDJA 5I47A 4UTXA 5KTTA 5KYUB 4LFBH 1PKXA 5MFZA 2ZDHA 3ICVA 1PFQA 2B82A 1M1YE 1CYEA 3F5MA 3W2TA 4BLWA 1IUNA 1SZPA 1AX9A 3CRW1 3CNNA 4RZHA 4IX1A 3WL7A 4DR6B 2BCGY 2FZLA 1MO2A 2OSBA 4GGPA 1CDOA 2PSHA 3QVMA 1TC1A 3MA0A 4JGIA 1FVIA 3I6MA 13PKA 4PZUA 1RZRA 1P9WA 3TUIC 3OQ1A 3LHFA 5LZ7A 3MD0A 5IKPA 5K03A 1KKUA 2OKGA 4E5SA 3OKCA 2GRJA 2C2WA 3IRUA 3KSBC 1KFCB 1QCYA 4DGQA 2I7VA 3DONA 1UUFA 2AB0A 4OXKA 1ZPDA 1QHHB 4WCVA 3LP5A 2EVWX 3NHJA 2BFBB 2RHRA 3LUCA 4CR8A 3QP9A 3LPDA 4CKZA 3GUVA 2XPCA 4NBVA 3OD5A 2WHPA 1EFVA 3EWAA 3GPCA 3SKYA 4WNCA 5D6OA 2XLBA 4ZV4A 3VTAA 4CTKA 4H27A 3DTGA 5DGBA 3NKVA 5AK6A 3TKLA 2CXQA 1CEEA 3HBMA 1TDJA 1B73A 3M3DA 4D9KA 1AHIA 3DFUA 1WV1A 3KV1A 1T43A 3MMSA 3O9ZA 4CV1A 2QM8A 5LUBA 4CEJA 1E0DA 3H3FA 4P6VF 3OPYI 5A6VA 1KYWA 4GLOA 4ME6A 2D06A 3TZBA 4LHYA 3PRYA 2FP4A 3BMQB 3ESQA 5JEDA 5G1NA 3FCYA 1L8LA 1W30A 4OYRA 1M1UA 1UM9A 3UXMA 2Q3JA 3SXJA 1JDZA 4A0RA 2C28A 3MELA 5JALA 1J9EA 5FORA 1Y6JA 5KFZA 4IXTA 3EE6A 3CLKA 4E7OA 2PX4A 1BXGB 4QVGA 2HLPA 1LQUA 4CE6A 4G23A 4ECYA 4KQ9A 4AN0A 3DL4A 1NQ5A 4OQDA 5ANRB 1RLMA 3PPXA 3KUUA 1ZC4A 3FNBA 4IINA 2PJRA 2R62A 4ETNA 1GDDA 4YQWA 1OXTA 1ZIOA 2WICA 3EGXA 3FKJA 3RJ5A 2Q5HA 1E3WA 1R4MA 2PS0A 1O5TA 4BQOA 2D54A 3EDRA 3FI0A 1IHUA 2WOOA 4HVAA 3U4AA 5FD5A 1PJSA 3KYCA 3VMMA 2XWBF 2D4AA 1Z34A 1V4VA 3DDCA 1VJTA 3GRVA 2Y05A 4JLUA 5DMHA 1YB7A 4O4LB 4ZQHA 3B8EA 3VDQA 3ZE9A 1YS6A 2Q4DA 1UKEA 3M3PA 1LC0A 1SKYE 4NBLA 4LWQA 5LA6F 3IQWA 5BR8H 5CAEA 1P2DA 1SQ6A 1JPJA 3PXCX 4LRSB 1BFDA 4X6UA 1YVUA 2BGLA 3C3CA 3FNQA 1J90A 4K26A 2CLDX 2G8LA 5FDFA 2HXYA 4MEBA 3WL3A 2W0SA 4F4YA 1YB1A 4UU1A 1E2DA 4GOLD 3TMAA 4GXNA 3JRXA 1TA8A 5TMEA 3VR6D 5KFNA 4GOKA 4JA2A 3PXEA 1GL3A 1RAEA 3DOEA 1U5BA 5J2TB 1R8XA 4Z2AA 5ETJA 1RHJA 3U61B 3VDRA 5G2OA 3F8SA 3VNAA 4XVHA 4Q3DA 3UB3A 4YMLA 4A3JG 1A9PA 3MYYA 3RVPA 1DAOA 3E9ZA 1YDHA 1GKUB 2AC7A 1H85A 1AGNA 3RS5A 1I2LA 4OHRA 3DE5X 3OZ7A 2OHOA 3L8FA 4FS2A 4IUCS 5CUQA 2GCOB 3W5UA 5CXQA 2GASA 2VYVA 5LL6P 3I01M 3T7JA 2XF2A 2VHEA 3CUEF 3COVA 4OHOA 2SNIE 2DABA 5CEEA 1NWHA 1ODFA 1CZUA 4U2FA 3HEAA 4OB8A 3SX4A 3PVSA 2LCIA 4O83A 4AUMA 1JEAA 1D4ZA 1WZNA 4X7MA 3D54D 2JEOA 1A8IA 1KY3A 1E3QA 2PY6A 3HYNA 2Y4OA 3MBOA 4HVCA 2PMBA 1TAQA 4IHJF 1B2RA 1ZZGA 4AT1A 2C07A 4AJKA 1IULA 3W5IA 3IV7A 3FN4A 4P0QB 4DCVA 1AQIA 4R0NA 3PZRA 4GE0A 1UZMA 3AINA 4LF4H 1I4WA 3F9CA 3VO1A 4L0DA 2YS7A 2YR0A 1RMQA 3H11A 1IQPA 3IUPA 4GI5A 2AFHB 2OSVA 2DKFA 3U2QA 2JA5A 1GZHB 3LKBA 3O2QB 1BU5A 1M2VB 2ZS9A 3USCS 5T5QA 3TPCA 1USUA 3L0IB 1YKFA 1U2SA 3QQ5A 4EB6B 3IKVA 4ZGGA 4MHTA 4DCOA 3J81A 4J4TA 4PZZA 3EQ9A 2X4LA 2J9GA 3UGKA 2NADA 2NV2B 1YVRA 2B83A 2DEUA 4KMOA 1KQFA 4I2NA 2OGZA 4Q21A 2X3UA 5F3WB 3L0PA 4O08A 1QB7A 4JLWA 1IDOA 1QIDA 5JXGA 2IUFA 3AR8A 5BYBA 3T7CA 5B58T 3VZPA 1BEEA 1HDYA 5LR6A 2VHCA 3JYHA 5EKTA 1XTIA 4KIUA 3HCAA 5A71A 4ZC8A 4ZVQA 1IHYA 3AQ4A 4XH9B 4F6RA 3H5VA 3UFXB 2RAVA 3ONFA 3ZJYA 1R8SA 3RV3A 4LF9B 1TKRA 2FSSA 3FPLA 3IO3A 5AVQA 3KXYT 4AJLA 2R6JA 2BHTA 1ZD5A 1F5SA 4IIYA 1IOWA 1X1QA 2VWPA 4A3MG 1G20A 2HOQA 1ADYA 1KPIA 5AR1A 2OXIA 3I5UA 1Z5NA 5JDCC 3R0VA 1B6RA 1KSGA 4PG7A 4HX9A 1AH2A 1QKKA 2WAOA 3ZXXA 4JYZA 3P2EA 5F3RA 2W2TA 3KIPA 2ZVPX 1GSAA 1YCGA 4RY0A 4DG9A 3NDPA 2W2PA 1GA4A 2I5PO 5FB3A 4BJ1A 4JXXA 4BVJA 4JV5B 1TT5B 4Y2GA 2PX2A 1AF7A 2UXDB 2CXUA 1PS9A 5KFUA 2C2MA 4DJAA 5HZKA 3H17A 5LIPA 1PDVA 3L79A 4PXYA 1N3BA 2WIKA 3A9UA 3TK1A 2YXLA 4EHLA 1SBYA 3C39A 3HXLA 1QV9A 2ZTLA 1XVAA 3H9QA 1FX0B 3BWEA 2J0QA 4X93A 1R1DA 2P4QA 1E8MA 4BCDA 1X15A 5IYZB 3BZBA 1OD6A 1EWQA 3H5AA 2F1KA 3T0GA 4U2DA 3DAHA 2QT9A 5CLHA 1JHMA 2WJJA 2A4MA 1W4RA 4LFBB 2R4UA 2QJTA 1H0HA 3HKCB 3B5IA 1QH1A 2VDQB 3NHSA 3KQKA 5KFPA 2BFWA 2ZPTX 4CKXA 2ST1A 4V2IA 1BVRA 1A9ZA 6PFKA 2R7LA 3T5LA 3HKEA 3RSHA 1C9YA 2FKNA 3CIFA 4MR9A 3R8CA 5FWNA 4FDMA 5CG1A 4ZRDA 2CV2A 2KX7A 1Q2UA 3TD6A 3VJLA 4PEVA 4FT2A 1I24A 3EUFA 5I7UA 1D4OA 3W78A 4XR9A 1DOHA 3JWJA 3OQ6A 3FBGA 1NC3A 2I7DA 2YL2A 4EHBA 4HLDA 1HT1E 4FI3F 2O3JA 4NBRA 4FQ7A 4A2CA 1FUIA 1RM3A 4LF7H 1CKOA 3SJCA 4K9NA 3X1ZA 5JAUA 3BT7A 4IDNA 1H05A 3CRZA 1XK7A 4F7WA 1T35A 2YX1A 3WLKX 5IAGA 2RKOA 3M9WA 3KFVA 4J94A 3DVRX 1XKXA 1DDGA 3BQ9A 4BMZA 5B7GA 3Q8QB 2OQ2A 3F6RA 1FRQA 1DELA 5HPYB 2FEKA 3V4FA 2I03A 3C7DB 3HA2A 2GDZA 4RPKA 3D31A 1B2LA 1IVYA 2HSEA 5NLLA 3HU1A 3KFLA 4IYJA 5CNKA 1N6LA 3BCHA 4QNRA 4UNIA 3ZK9A 4BNZA 2VWGA 3H13A 2PTGA 5CIWA 2G82A 3R41A 4WINA 4OM8A 2F00A 1BWPA 2XT0A 1MJ5A 2C4WA 2W00A 4F5DA 3W90A 4ECZA 4Q1CA 3O03A 1PYDA 2UZ1A 2DR3A 4NWIA 2WPNA 1OH6A 4MQEA 4F45A 4R31A 3GNTA 1F2UA 3PVXA 1OXMA 3I1YA 2VHWA 1PG2A 2EATA 1CY8A 2I6UA 3QWAA 3RYIA 5BSRA 3UV7A 2P2LA 3R40A 5FLYA 4CJXA 4DDVA 1ZH6A 2G40A 3GUYA 1NLFA 2PT9A 5T4BA 3VPDA 2F1IA 2YQ4A 1AUXA 4P54A 5I7WA 4GD3Q 5H1YA 4BCCA 1L3IA 4KI0A 2R79A 2I2BA 1UBEA 4OBXA 2H7XA 3HABA 3MFQA 4P98A 3NXKA 3LGSA 4BMVA 4N7BA 4H6WA 1LC3A 1FS6A 3KZKA 4HOYA 4O2AB 3LBNA 3G8AA 4BIIA 3OHPA 1UEJA 4GNKA 4CKWB 4D4GA 2YIJA 5JH7B 1T0PA 4F04A 1V8BA 3BGOS 3I6ZA 2YCLA 3FMGA 5J1TB 3A9CA 2DWCA 1MVNA 1SBQA 4MYTA 4PONA 5AQEA 4NICA 3CNQS 5BR8B 1VLHA 2A30A 3RFTA 1Q57A 3FPEA 2EBFX 3ONVA 3N5CA 4YRDA 2C5SA 3I4MG 1EWVA 3HDGA 1YF3A 4Q9AA 2KMLA 2CF6A 4WBSA 4MWCA 1OBHA 2ZRNA 3VU9A 1WQ3A 3G85A 4F5ZA 4KGXA 2B8EA 3MGKA 4LNUB 2ADMA 5B30A 1AKQA 4DQUA 2FAXA 3FW1A 1S0NA 3NH6A 3IMGA 4C7XA 4D80A 4UVGA 3OIGA 3MILA 1IMJA 3PEEA 1KDZA 1E9AA 3TI9A 4EEYA 2FZGA 4I66A 3HP4A 5D6NA 1P5FA 5AW9A 3PR2B 4EFBA 1X8JA 3QWIA 5I3ZA 1AU9A 3W04A 1FNDA 1B0PA 1SHUX 4IDOA 2BGTA 1Z0IA 4C3UA 1M8JA 4QPJC 1IM8A 3TLJA 4ZVRA 3BHMA 2XIJA 1OWPA 1JILA 4V39A 2W6PA 3DAGA 1EYZA 3U4GA 5CR9A 2WSSD 2MMCA 1M7HA 4CCWA 2W70A 2C54A 3EFBA 2ROQA 4F4DA 4EFNA 5J59A 4MB6A 4L8GA 1YBFA 1I94B 4G5OA 4QIWE 1UC8A 4YP1A 4LGMA 2RD2A 1U65A 3RFUA 2O20A 4ILKA 3GVHA 4X90A 3LBHA 5K51A 2Y2VA 2E2HA 2WDTA 2BRUA 1M2EA 4KQHA 1E59A 1XD9A 1SU7A 3GNQA 5BUQA 4RTNA 1UIRA 1I7DA 4IRDA 4LF4B 3GTPA 3D6FA 1PE0A 2XMPA 1ODLA 2H5JA 3IS3A 4CMDA 2I6FA 3VBEA 4ZV9A 4LY6A 1S9DA 1I2MA 4GL2A 3CRNA 3AEUB 4NFHA 2I2DA 1IHOA 4QYMA 2GEKA 3WGKA 1GAXA 4OA8A 5K3OA 3HKZE 2AUTA 4GPZA 1NQAO 4NQRA 1NP6A 1XYYA 3JARB 2FMUA 3QE9Y 1BQ4A 4ZDJA 3FNFA 4A0HA 1FMLA 1F5NA 2PRJA 2QP3A 4O4JB 3I37X 1YXMA 4LXHA 3WISA 4M1ZA 5P8WA 4P0TA 3IOMA 4W5JA 3PD1A 1T2FA 3ZD9A 4B09A 2A86A 4QVIA 4EBDA 4J4BA 4EHDA 1GTL1 3VVBA 1QC5B 3MJSA 3HXTA 3FNHA 3PFIA 3CZQA 1T2DA 9ABPA 5A06A 5EP3A 1X80A 3E7DA 4L3OA 1UDCA 5BWUA 3NVDA 1XRPA 4JU8A 1IG3A 3A10A 4N03A 2CW5A 3T4EA 1KRHA 5I9SA 5EJ9A 1P4SA 5JDIA 3FYTA 4HAVA 4HNUA 1AS3A 1EFRA 3W6UA 1AGPA 2P2GA 2DSTA 2H65A 4HEA1 3HJNA 1SXPA 2JEFA 3ZE1B 2HHFA 1JMVA 1WB4A 2V7QD 5EUQB 4AJ4A 1U2ZA 4QJ4A 1GCIA 1XEAA 1FMJA 2ACWA 5JRDS 1CZLA 3O4IA 2W7OA 1NIPA 1CEXA 4KE7A 3TZEA 4TKVB 1DMSA 3N70A 2HK8A 2FLWA 3SI8A 2AR0A 3GRCA 2FRDA 1PFUA 2V9CA 4RANA 5K3WA 4NSNA 3EJWA 3B1YA 2MSDB 5BUSA 4R1QA 1VP9A 3RC9A 2H00A 2J9FA 4F7DA 3RG2A 5AJZA 1CP2A 2GK7A 1QNFA 4W5QA 5CLJA 3QFRA 4JX8A 3S1LA 4JXJA 4S35A 1UJ5A 1J6UA 3QF4A 2Q6VA 5DPMA 3JTEA 4ZK2A 4MQ6A 5FWAA 5BR1A 3IQHX 2XBLA 1QRTA 5BV2P 3L8GA 4TZ0A 3O74A 3FKSA 1HX7A 1FFBA 3N0XA 4TS4A 3EPIA 1GR0A 1XEWX 2JA5G 4AJNA 3NATA 5KMGB 5K8IA 1E58A 3S4YA 3OE7A 1AUVA 4P33A 1JDNA 5K8VA 1JIKA 4LMAA 4Q44A 5I9MA 2WF9A 5FBQB 2JVIA 1OJLA 2XBMA 4IQ0A 3H1TA 1I4EB 3K9GA 3EEYA 3UMJA 1GUAA 2VLIA 1E77A 4KN8A 3OOYA 4DKXA 4Q3LA 4DJJA 4Y6OA 3L46A 1ZOPA 1RJFA 1VG9B 3ETHA 3GT3A 4CQMB 3G6KA 4O7ZA 2JFGA 3WK4A 5F2NA 3W5BA 3TQIA 2ODQA 1M2OA 1IEWA 1R0SA 4DPMA 4YBZB 1ML4A 4PBCA 1XVLA 2JJMA 4BDTA 2H4HA 4R1SA 2CMKA 1WOMA 2PBLA 2YV5A 4IHAA 4LISA 1MW9X 1IUKA 4HFRA 3WHIA 4EPXA 5AJUA 2XCQA 1N2CA 2BFCB 4R6WA 4OQPA 3ZU2A 3VJMA 5I7HA 4W9MC 3GV5B 1J1ZA 2CFOA 1QO7A 1O7JA 3IE2A 1UJMA 2QNBA 4G0PA 1F2DA 1T4MA 3A36A 1QGYA 3GLIA 1DHTA 4N18A 1GAQA 3WRVA 2ODPA 3PYMA 1HL7A 3C24A 4ZD6A 1QCCA 4YI5A 4ZYYA 4N5NA 4TVIA 3R3YA 4RD6A 2QF7A 2C5FA 3LUBA 4BMYA 3I09A 3JWHA 3K4PA 1WMEA 4LF7B 4DPKA 3KBBA 1K4KA 3MMZA 2JLUA 2O4CA 1EFPA 3ZWQA 4GKJH 4OFBA 1Y3FE 2ONKA 4QUIA 3EXHA 2GT1A 4ARIA 3B53X 3CISA 1WB9A 4QBKA 4U3JA 2GZ3A 3TAUA 4WUTA 3FSRA 4HH0A 3OFVA 2ZU6A 3SJAA 5CU7A 3DHNA 1DX9A 3RF6A 2FNAA 3X1YA 4EY4A 5DQIA 3PFWO 4XIIA 1OI3A 3BKWA 2C42A 5JSHA 1ABFA 4Y2VA 1V1RB 3UUGA 2POCA 3AF3A 1F1JA 3B48A 5DBGA 1IXRC 4D9IA 2JVKA 1R2QA 4IDQA 2NU6B 4GYYA 1SOMA 3HSYA 1PZNA 2ZIAA 1F4VA 3DLIA 1DDIA 2WHQA 2NIPA 3HXMA 3RO7A 2C3MA 4ND8A 2VSFA 2UU9H 4UCUA 3SICE 5EJ5A 1HT3A 3WRXC 4A6PA 4F21A 1V5WA 4MMYB 1R5JA 2EJWA 3EWNA 5B7NA 2BV3A 3TW4A 3FMPB 4KAXA 3JQRA 3CZCA 4F1WA 3PYXA 3BZWA 3P27A 2AI3A 1LLUA 1NP7A 4X84A 5AW8A 5DHAA 4FOSA 4I4IA 4HQ6A 3N3AC 3DO8A 4JT2A 4IJWA 2WIGA 1K08A 2ZT6A 1GKYA 3AM3A 3OZGA 3HZZA 2VTDA 2Y9PB 1RYMA 3FDIA 1CJSA 2P2NA 4KN5A 1R6BX 5BWBA 4OLAA 3M9LA 2VCEA 1SVOA 2W6IA 4MKZA 4HB3A 4NBUA 1KMHA 1QIMA 4EIWA 4L28A 1WPGA 4D5GA 3GN1A 3WOVA 1HH4A 2J7KA 5AVZA 2W8BB 1JIXA 5AKYA 3MJ4A 2E3JA 4HN2A 3TQFA 5I60A 4RSMA 2VHYA 2HRQA 3LCJA 4MKHA 4AG6A 2X3FA 3PDUA 3AC0A 1Z7WA 3WYCA 3D6TB 2RG7A 2PLRA 3QHPA 3GMDA 4NOMA 1E7RA 4BBAA 4MYHA 4FFBB 5B4TA 2NO1A 1UMCB 1WSBA 1ODIA 1R6UA 4O4IB 2HMUA 4DJEC 1TMGE 5IT5A 3ONWA 3LFTA 4RULA 1EEHA 2QYOA 1A4IA 5JCZA 2HU7A 1E69A 2I3AA 3T1VA 3BSFA 3O4JA 4OP2A 4UMDA 2R8KA 2XCOA 4WNAB 1GTZA 3VSAA 4DHEA 5IAAA 1G8JA 1PFWA 3P0FA 3PPIA 3F2VA 4V1CA 4ZVVA 2WWVD 3IMKA 2F7SA 2FB9A 1PJLA 4TUYA 1JG3A 1U3TA 2C4KA 5KJFA 1AS0A 3FSGA 5THXA 4MGZR 4QWDA 3DBLB 2WKPA 4S05A 2E2IA 1F38A 1ZH2A 5BVHB 3MWMA 1KU0A 3C1TA 3H5LA 5HDQA 1H8ED 1W0KA 4DR1H 4LWOA 5DRTA 5CFRA 4FSHA 3IAM6 3DL7A 2RAFA 2RGWA 2R25B 1L4LA 3MRSA 3K6SA 5HNEA 5IP5A 3ZWCA 1XMVA 4E1AA 5AVRA 4YREA 4HMOA 4ZYXA 3I76A 4RJTA 1SCJA 4NMLA 3UMFA 4Q4LA 4MW0A 3T1YH 5FCDA 1QOZA 3OWOA 4HQFA 4BVKA 4YT4A 1F8YA 2ZWPA 2QLTA 4BE4A 4E3ZA 2QTBA 5JZSA 4BOYA 3F8NA 4PHTA 1D1QA 2PX5A 4E46A 2C1ZA 4BAZA 4HYTA 2NTNA 2PU7A 4DBLC 1E79A 2K5UA 4AJPA 2EX4A 2DYKA 5A9SB 4DS3A 5TB5A 1X1EA 2Y77A 3ENNA 5K09A 3SC2A 5KTMA 2YWJA 3A3PA 3PQ2A 1OT3A 2DCUA 3R6DA 2OLJA 4RTOA 3WG9A 3NBAA 1C1YA 2HHCA 2C57A 1ZOLA 1C29B 3C1UA 4L2IA 1Z2CA 2Y71A 1SXJB 2GYYA 1CHDA 2R8ZA 1W52X 2P1ZA 2FH5B 5FI5A 4UAUA 3KWJA 1X8XA 2W8ZA 1DBVO 1OXSC 2EL7A 2Y93A 1Y8AA 4B3XA 3NWPA 5EQTA 4WEOA 1ZC3A 1QOPB 1P73A 5I45A 3MWJA 4MROA 1XCJA 1Z6YA 4DUZH 3EZFA 1RM4A 2ZXFA 3NHYA 2P91A 2YFHA 4NZYA 3PXXA 4A92A 4NATA 1FDIA 3O94A 4BRZA 1Q0RA 4LTNA 2CEKA 2DBZA 2WB4A 4XM0A 3OU2A 1XVIA 4FIZA 4BFWA 4CM9A 1S2IA 5JQWA 2MINB 3QPAA 1AN9A 3WLRA 1C14A 1V8ZA 4NOLA 1JR3D 1HNNA 1NG9A 4YDRA 4IOLA 2REXB 1Y1TA 1IEXA 3NTLA 4KFUA 4A3LG 2C5HA 2QM7A 3V34A 3DVLA 3DVSX 1AVTA 3BAAA 1Z6XA 3FOAA 2IYWA 2RH5A 2Q8NA 1XAGA 3QYAA 1TWHA 5DGDA 1TW3A 3KPYA 4UEJA 1XWWA 5IYCG 4Q66C 4FSXA 3DZCA 2CXRA 3PNLA 5FYDA 3DTVD 3GF4A 1MGOA 2G6TA 2GYWA 3CPSA 1W6UA 3FH0A 2JIPA 3NVMB 4IHKA 2OFXA 4QOFA 5ICGA 4ZT3A 2RFLA 2WINI 2HFKA 4R71A 1MXHA 1IE3A 2KWIA 4MS3B 4L8VA 5GJVC 4RF3A 4JITA 3UJNA 1ZCAA 3D6UA 4QULA 3WIOA 4XOUA 4IXMA 4EW2A 1ONBA 4WLUA 1RAGA 3ZLTA 4AO8A 3EYYA 1L4KA 3VAZA 2G83A 4LHSA 1Y48E 3KU1A 3CKLA 4IEFB 1ZUWA 1EDZA 3ER9A 1J0BA 2CHQA 2VP0A 3NNDA 2J6IA 4A3CG 3QKSA 2IV3A 2OMEA 2C96A 5TE9A 4C6TB 2J0UB 1FSFA 1AC5A 1YR9A 2V6MA 2JZCA 1EU1A 2VPTA 3GV0A 3HCPA 1ZN8A 5FD6A 1F06A 3HMKA 3JD1A 2VHVA 3W6NA 1JKJB 2CW7A 3LY7A 3GDHA 4YH1A 1UDAA 4P7JA 4YMTA 4Q7QA 1Z75A 2VQ3A 3A4YA 4QTZA 5LWQA 4JY7A 3ED1A 3C8MA 2Z2IA 2DBQA 2IKQA 1SKAA 4ECUA 4YP3A 3JZ6A 1Q7EA 1KTAA 4NV1A 1J24A 4RFLA 3KJZA 3T6KA 3FOZA 1T8YA 3P9RA 1FK8A 3OT1B 4GPIB 4PYNA 2O2GA 3TCKA 2VNIA 4PO9A 3JYNA 4EMSA 1OFVA 3PR3A 1XWIA 3OEHD 3EIWA 3HBLA 1I51A 1LD3A 1KZGB 1Z63A 5F9HA 4HNTA 4CI9A 4DAAA 2VXBA 5J4VA 3RJZA 1WABA 2PZFA 4TTQA 4HDNB 1X19A 2A5YB 2XUOA 3ICOA 3CLHA 1M2NA 2Q5EA 4KWTA 3IMEA 4Y2JA 2O48X 5FYQA 3J81W 1VPLA 2XTJA 4EAAA 4C6HA 4OMUA 4GKJB 1FP6A 1KFKB 4G1VA 5D7NA 5K0LA 1VKHA 4FQ5A 4BVBA 1USVA 3AFOA 1XRSB 1JQLB 3H65A 1D2HA 2YOHA 1LUAA 2B78A 3OICA 1ZNZA 2BT4A 2R6R1 3ZX5A 1FTGA 3AY7A 1XCLA 1WF6A 1YT5A 3CLTC 4BDSA 5K01A 4TL7A 4MZDA 2P9TA 2BJVA 3HFJA 2IS2A 4QE3A 5HJ5A 1SVUA 2V1XA 1OH8A 5LA6B 3UKOA 2HY7A 4RLFA 3FPGA 1N8NA 1Q20A 3IPRA 1WP9A 3DFMA 3E0XA 1RYSA 4HAIA 4EA7A 1KY2A 3KR0A 5HFAA 1YMUA 3PD7A 1W9MA 2HMVA 1Z7EA 5KNBH 2QNIA 1JDTA 3FWYA 2I54A 2C9BA 1TAEA 1TLLA 2OAGA 3MLAA 5FEUA 2MMGA 5JZMA 4MW5A 3LCCA 2YN4A 1FY2A 1YHYA 2P3OA 2JEIA 1M6HA 4IVQA 1HFEL 1YVEI 2Q62A 4LSMA 2ABJA 3OEEA 3V7UA 2C7BA 5E2AA 4HDAA 1NQUA 1D0IA 5EPUA 5FWYA 1J2JA 1ZHFA 3PC8A 2Y99A 4JQYA 3KYJB 1Y3HA 4AZ3B 4D56A 1B1AA 3B70A 4YNBA 3C98A 2E21A 5CVVA 2A3NA 3BK1A 3QHAA 2BBTA 3CE6A 4HN9A 2WM9B 1GR1A 5LLTA 3KE9A 3MUNA 1B6TA 3FPAA 1MX9A 3ON5A 4XFDA 1D09A 1WDKA 4LCEA 4BPRA 1D5CA 2XUPA 5BURA 4BPBA 2OGWA 3OKFA 1K5PA 3CQ9A 2QT0A 3R3XA 5I01A 1JDBB 5HP4A 3RRZA 4RVNA 1SURA 4DOMA 1HKUA 4YRNA 3ESZA 5AM4A 4DYDA 1NJ1A 3K0AB 1RIIA 2PE5A 4WAUA 2VH5R 4D8UA 3RJ0A 1T8UA 2QYTA 4R81A 2OZLA 4DLLA 3I30X 3ZY3A 1NNSA 5EWJB 3MTEA 1OF1A 4IHJB 3HC7A 3V8MA 1N2BA 5C8DA 3Q8RB 4GPBA 4GZ3A 4O84A 2FDCA 2IHZA 4DR7H 3O73A 1OXUA 1UXOA 4QICA 3KRTA 5I48A 1EEXB 1E7WA 3VPFA 3H3VH 2BSXA 2NVYA 5CX4A 3IKTA 4U2CA 3RAEC 3T3EA 4LMRA 4OYLA 1LBIA 3E2MA 4PLTA 1QMPA 4Y2RA 3SR4A 2O54A 4KDFA 3KEFA 2EX0A 3U1VA 3MINA 3LY5A 3MERA 1TKCA 5A5VA 1Q1BA 1FUEA 3VC7A 3C6YA 3BAFA 1G5QA 1G7TA 3EXG2 5DHPA 1V47A 2L18A 1EAMA 2J5QA 1DQYA 5T57A 5E1DA 4DR1B 4Q1DA 3V2GA 2VC2B 1SZDA 4H7JA 1QYIA 4ER5A 5CFNA 3R5JA 2OXCA 1ENPA 5DNVA 3KCQA 1M2JA 3BD6A 2BC9A 2JIRA 3I52A 3T3PB 3ZVLA 5IWCA 1QAQA 1AHPA 5CT6A 1EP3B 3MGGA 5HBRA 5KYTA 2GJAA 1IEQA 4LWZA 3ZS8A 3ZDRA 1CT9A 2WE8A 4WN9B 4GKAA 5I5YA 1K3TA 3W7BA 3OJCA 5L3QA 1IY2A 1QE3A 4KQ6A 5IBQA 5CM9C 1CUGA 1BN7A 2H7VA 3O3MB 3LS2A 2IQIA 4ARVA 3KDPA 2C3YA 1KYQA 1JXQA 1MJHA 4OF4A 3UAXA 2NU9B 1Y9AA 4OVKA 2ESRA 4I5GA 1SHKA 4DA9A 5A4IS 2EOAA 1Z8HA 4HTFA 4MUIA 3T4PA 1EX6A 3J80A 2F43A 4RL6A 4Y2HA 1DO0A 5DHSA 2H7YA 1SZCA 4LZJA 4MWEA 1R15A 3AKCA 2FWMX 1VDZA 3L18A 3BZUA 4M88A 4F6CA 1UPUA 2OCDA 1JSZA 1NXSA 1N33B 1AKRA 4BY1G 4PZ9A 4BNKA 2VJLA 3CVVA 3SWWA 3CJTA 2E4XA 3ENVA 1GNTA 2RCYA 4OBWA 3SQDA 3BERA 5J9FA 2X8WA 3V4VB 2WB2A 3IQXA 4U8HA 4JV0A 1TCUA 2ZR8A 4ZQEA 2Y1XA 5JO9A 2PT7A 3OO0A 3SXUA 1Z2NX 2FGJA 3U31A 1E1CA 2NU7B 2HRBA 4B2YA 2GAOA 3Q1LA 3F71A 3TQOA 3U80A 2D6FA 1E0KA 5CCEA 4DV5B 3BD7A 4JHXA 5C8YA 4OOEA 3IJPA 3TY9A 1WUTA 2A78A 2WD7A 3JAKA 2V3WA 2Y1GA 5IBCA 2H29A 4JD5A 2JLWA 3RVRA 1PI3A 3AB3A 1TQDA 2B69A 3AX6A 2QTRA 1Z74A 5FPSA 1GZ6A 4YASA 2W9BB 5LQAA 1WP4A 2AEMA 1RHQA 2JH9A 1G8PA 3VH2A 3PC2A 3QSGA 3FUUA 1SVSA 1ZX1A 2EFYA 4D2IA 4QNNA 4ZWNA 3ICQB 3LDFA 4OQMA 1V6SA 2H63A 3QU9A 2WY2D 4M7WA 1QG4A 2R6FA 1YNSA 3GROA 2N46A 3HGMA 3JZAA 4QNMA 1FDOA 2A5DA 4RA9A 3PD0A 4Y9RA 1GTSA 4IKPA 4D02A 4Y8VA 3PFCA 2O0LA 5EFOA 1X7WB 4AJIA 4WK4B 2C98A 4B44A 4N41A 5GY7A 3TQRA 1MX5A 3E3NA 4IILA 1C7JA 2QHXA 4CFYA 4QDXA 5JAHA 2Z8XA 2Z3WA 3R7WA 2YIDA 5HILA 2P35A 2Q2WA 1EG2A 1YZLA 4X8MA 1SQFA 3ISTA 4WT7A 1DAFA 2EG5A 5F3DA 3K5IA 1U7WA 3FAZA 1BMQA 4Z9FA 4EG4A 1W4CA 1O08A 2X0KA 1RR6A 3NHMA 2WABA 2CHGA 5M29A 5K45A 4REOA 2CT8A 1T4GA 4A2BA 4TOIA 1NR7A 1VL1A 3OVMA 5JAIA 4RGVA 1WCXA 4YJ2F 2F8LA 2XE7A 3U81A 5AESA 4ZAZA 2FUCA 4OI0A 1PL8A 4UM7A 2IS6A 2QTLA 1HNZH 1M73E 1O5OA 3CXRA 4UE3S 1L5GB 2CCGA 3H5RA 2QK4A 4ISBA 4Z4HA 4XWTA 4CV3A 2X2OA 3ORFA 1QH0A 4DWWA 3IUBA 4U7DA 2PH5A 5IBRA 2MCFA 3PBKA 3OZAA 3ZXIA 2JGJA 2XKJE 3P45A 3WL6A 5CDSA 2B8NA 1DOAA 2ZWIA 2OBLA 2ZJTA 4YROA 5LJLA 5BWRA 1Z38A 5CURA 2H31A 4HNHA 2RAUA 5F7JA 4FMBB 4KQXA 1MNAA 1TXGA 4IFIA 3UJBA 5BSWA 5FWXB 2YUTA 5KC9A 1OX4A 5AKZA 2QAIA 3MUOA 1YZVA 4FTWA 2HBQA 3CSUA 1HTTA 3PI6A 2CJFA 3RRMA 3LSYA 3TR6A 2Y3IA 5FLMG 4W6ZA 1RYHA 3ZZNA 3FWKA 4HDMA 4DUGD 3NYQA 4Y67A 4Q45A 1DIHA 1OT5A 2HJ9A 2FSFA 1SD5A 3KB6A 4WZAB 3SX0A 4YQZA 4F38A 5HIAA 4JVLA 1WPXA 1W96A 1HQKA 1ULHA 4KR0A 2BEVB 5ALPA 2HVRA 3HZOA 2WUGA 4KX5A 5CLFA 3LI2A 1GQQA 4ZZ3A 1H2BA 2L17A 3DDWA 3C5EA 1SFOA 2E5LB 2B4AA 4JJKA 3KHUA 3AWIA 5KU1A 3GCWA 4L74A 4KKVA 3ETGA 3RU9A 4KREA 2R5WA 1V45E 3G2HA 1ZMTA 4PO3X 4JH0A 5EMLA 4A26A 4MW2A 3NAQA 3CEPB 3BXOA 1K4YA 2X77A 3C3DA 4PXAA 3T06B 3HM2A 3A1WA 4Z1MD 3SF0A 4OKSA 1RXEA 1TMOA 2COEA 2WG0A 2V74B 5REQB 5LZ2A 1OLXA 3N28A 3BULA 2HMYB 1QE5A 1T4CA 5EJFA 3DXYA 4P93A 5CFOA 4HWTA 4IS2A 4CKEB 3N87A 2GPJA 1GGEA 3BUSA 1CXZA 4UDXX 1P1RA 2WJWA 1TVEA 4C4PA 3QVTA 1ID8A 4X1IB 2AMVA 2XR1A 3DM5A 3ELDA 3WYNA 1U0LA 1CUZA 1XALA 2XRFA 5I7AA 2PIAA 2Y4NA 4OAOA 4V38A 3G3EA 2PGXA 5T4EA 3ODPA 1YL5A 1CDZA 4TV8F 5CVCA 2D7DA 4NU8X 1TQ8A 2A6PA 3WA7A 3HN2A 2J9XB 1JG4A 2X5JO 4O0MA 4RTMA 5BN5A 1IIBA 3GJXC 3BFVA 3K2QA 1GPBA 1RC8A 4IFBA 2M2IA 1XTTA 1WLSA 1AQNA 3GNSA 4B81A 1H22A 1G17A 5KDOA 5H82A 2VPZA 3VKHA 5IYDG 4KJZA 3UOAB 3P2JA 4YB8A 4DR7B 1YZ3A 4LZNA 3UPUA 2QNRA 1TM4E 1TWGA 1IMOA 5C4GB 5HIKA 4R5MA 1P80A 4XUGB 1MX3A 2PT5A 2Y1EA 3HOWG 4F1JA 2BFMA 1N9KA 2JLXA 2NP7A 3OJOA 5K0BA 1W2HA 1XYGA 4A3IG 3OPMA 4P38A 1KAQA 5I8ZA 2O3QA 3OECA 1X7XB 1RYRA 1E63A 2O8DB 3H6GA 2FW6A 5FAKA 4Y18A 1ZWLA 1XMXA 3HH8A 1UBTS 4XWOA 3V9AA 2OO3A 1JFRA 2QD1A 4G0UA 4BP3A 4R68A 1E3JA 5A0TA 3AP3A 3B3QA 1MRZA 3O47A 1SBIA 2MJLA 3H8VA 1U8TA 2XQJA 3EVEA 1N2XA 2AVNA 2ATVA 5KHLB 1WCV1 5THKA 4DEYA 4DSAA 4M89A 1E2GA 5G0WA 2BL4A 1SVKA 5CFQA 1PD1A 2G5CA 4J4HA 3B13B 1L7XA 5HYVA 3CX4A 4X62H 3EFOB 2HREA 4F3KA 1D2EA 1OPRA 4D6PA 4UNRA 2XNCA 2CZCA 4AQYH 2HI0A 1KDYA 2PWYA 2BPOA 3H8JA 3RABA 5HK8A 1GYRA 2XIGA 4KXVA 3KDAA 4R9UC 2O7SA 2GBLC 3TLMA 3FPFA 2IBMA 4JK3A 4FD3A 2WQZA 2MSLA 3G0CA 2O6HA 4LC0A 2XCLA 1Q16A 4GWGA 3UT6A 1GLNA 1MEOA 4UC0A 4DLYA 4R2WA 4I9UA 3ZZUA 5AVOA 4CIXA 2C2XA 4DY6A 5E7QA 1Q1GA 4GEKA 1FDWA 3KAJA 3ZWPA 2G5PA 3EUWA 5JZVA 1T5BA 3H8SA 1RRPA 3WGQA 4L15A 1DEXA 4CNQA 3FDJA 1WCWA 2P69A 1W47A 3SHTA 2DERA 2GSWA 5KOJA 3G88A 3ZXYA 2WV7A 2BEKA 4DLNA 4KPUA 3UIEA 3A04A 2R1ZA 3WMRA 1JHQA 3I1JA 1UCFA 4RFSB 3AUUA 1VPTA 4QECA 3WXMA 4LCJA 2NZVG 3Q7TA 1Q22A 5IARA 3UJPA 2R7MA 1ZJ6A 5L53A 4CPDA 2RHHA 3ZVMA 1JKXA 1L4EA 5G1PA 1SUWA 2A7QA 3DKPA 2FUEA 3T4XA 1NBMD 2WTBA 4UVEA 1ZCJA 2OZPA 3DKIA 4ZO6A 3EVAA 1MQ9A 1WBBA 3DOFA 4M8KA 1DG1G 4J0EA 2TECE 3U09A 2YIVX 1JR3E 4EI8A 5I4CA 4MV6A 3PITA 3GXOA 1P7PA 3MC1A 1CVLA 1KZ9A 4PLYA 1YS7A 2AEJA 2ZIGA 1RI1A 3TJZA 4LYFA 4KV9A 1XU9A 2GZDA 5E9JA 2Y0EA 2BQ3A 1SN7A 2IYLD 1C0PA 1YSCA 1GFIA 3FZEA 3UHPA 3QEBZ 3SZUA 1GZUA 3RS9A 3EC1A 3OMXA 5FBHA 1XEXA 4L6CA 4TVKA 2NTJA 4N5HX 3UJCA 5JLAA 3M4JA 5K0FA 1R5NA 2LZ0A 3Q10A 4BFLA 2Y9MB 2ERYA 4BO9A 3W1WA 5BXQC 1OXKB 1XU4A 4TLLB 5MGBA 1A2BA 2RGVA 1WZEA 1K7XB 2XZPA 2V59A 3SNOA 4V02A 2EIYA 3D02A 1T2EA 3OIYA 3RW9A 3NEYA 3QVXA 3AILA 4DLSA 4JNKA 1Y3IA 2BFDA 5HA5A 5AW1A 4J3FA 2CSUA 1PG5A 1NMSA 2G1PA 1US8A 3KLMX 3OI7A 5C35A 1AQ6A 1CJTC 3PRHA 3A32A 4YAJA 1X38A 3S1AA 2I91A 1I0LA 4OSPA 4WLFA 2MYTA 4O7RA 1Z8FA 3EDQA 3A1TA 5TQ2B 2FZWA 2PGIA 4AMZA 1Z6PA 4C2BA 3KSAC 3SIRA 4UDNA 4ENWA 2QE6A 4B0OA 1YB6A 4MRMA 3K2EA 1GY8A 3VV3A 1N6KA 2BBOA 3BWVA 3R0QA 1UBJS 5E8RA 2HIAA 1Z12A 3LK7A 4M0CA 5GPBA 4AZSA 1LVUA 3ZE2B 1HNZB 2XE8A 4DG5A 1CUXA 1UDWA 1U5CA 1UXIA 3VHQA 4IF4A 2BBSA 5J23A 3HZHA 2RJ3A 1MABA 4EA6A 3M4YA 1N6PA 2FQXA 4EH1A 1JB1A 2VKTA 2RGNC 2DLNA 1PZEA 8ABPA 3N2GB 4AMUA 2GEBA 4K81B 4P1ZA 5IM5A 4IH4A 3CNLA 5BWMA 2VDVE 4PZLA 1W8IA 4O29A 5EKUA 4FONA 2ZQ5A 2JHGA 3RSOA 5KZMB 4MIEA 2AU0A 1RLOA 2GPAA 4TQSA 3I6QA 3LHSA 3UK0A 1L7PA 2PSSA 2PXXA 3ANXA 2HYDA 2ZWAA 2XCTB 3WLAA 5CVTA 4QDOA 1ZQ9A 5SZIA 2OXEA 3VHLB 2GBCA 1OZHA 4G01B 4GECA 3OLVA 3I4LA 2ONZA 2ZIXB 3KQLA 2C92A 1NUHA 1ZSNA 1CUHA 4FHGA 4GICA 1QP4A 2OCPA 5K0NA 1E2EA 4G0MA 3UJAA 5HQ3B 2Z56A 3PQ3A 5K4AA 6Q21A 1ST2A 4WXMA 4RSHA 4KR7A 4J3NA 4X3OA 4EHKA 1XQXA 2C95A 2AH5A 4BV2A 2UYHA 4MQFB 4JI7H 3FAKA 5AXAA 1LSUA 4KJXA 1NDHA 2IY7A 3MF4A 1POXA 3M49A 4XZ3B 4K5QA 3LLMA 3KVOA 1NW5A 1IWOA 3RIGA 4JQCA 3T95A 4XVQA 2XZTA 5K0GA 3TGWA 4AG3A 2J0VA 3GRYA 1ZRNA 2O8EB 5AKLA 1XWFA 3HXOA 5KDDA 2IEBA 1G5FA 1SK9A 4RIEA 4RHTA 3F1LA 2CUKA 4L76A 4QT4A 3R7AA 3DMYA 4HB0A 1P0CA 3SLGA 1A4XA 3AHFA 2VUMG 1C7ZA 3IR5A 3OP1A 4JLAA 3C8UA 2J6SA 3VZDA 2AEFA 3R3WA 5A4FS 5AFSA 1YMVA 4AECA 4DUPA 1PT6A 4F3NA 3HCFA 1A88A 2HZ7A 1R6AA 1J49A 8OHMA 3F5FA 3CH4B 4LOAA 3KZCA 2BEUB 4TRJA 1AK9A 3LA6A 3WBKA 1JJFA 1IXYA 1MDFA 4CRWB 4C20A 1X0VA 4BKUA 2QN3A 1V4NA 4MS4B 5CYGA 3TEJA 1EKPA 3QPBA 3QQMA 5KOHA 4IL5A 3FROA 4YXWD 1GTG1 4YAWA 1Y6ZA 4AUNA 2H1RA 3NOVA 3IQIX 2QRUA 1P31A 3PJRA 2J6CA 4MDEA 1K8RA 1Z4PX 2QVYX 4UE2A 5CLLA 2PUFA 3DAOA 3KTDA 1A8QA 1NYRA 3BMCA 4JB2A 4P2BA 4CR6A 4E1BA 2LNDA 3PJDA 2FPSA 4QDTA 3BCRA 3CLTD 4B3TH 2D2IA 5B7PA 5SY4A 1B6GA 3W8RA 4LJ9A 5IKMA 4K0KH 2FN9A 3PPWA 4BE7B 1NNUA 2ZFUA 2VJKA 4J9VA 1X87A 4J0HA 1TQHA 3O4HA 4K3UA 3KLBA 5A4DA 1WHTB 3MTIA 2VF4X 4H7IA 2JH3A 4IGAA 3DCNA 1Z0UA 4N54A 3N74A 3BA9A 1C2YA 3DR5A 1V7PC 1P2TA 5DISB 2BMDA 3USES 2J48A 3C5WP 4P3KA 1BJKA 1GGOA 3JYPA 4G5RA 3N6VA 1E1RA 5D1OA 1CKNA 3A4NA 3RT7A 3T7EA 1CQPA 5LYJA 5JXWA 2JJ8A 5IP7G 4KGDA 3P9ZA 3F8WA 2G9NA 2BFFB 4L75A 3RWBA 1FFAA 4J0CA 3RTXA 1SB9A 2JAQA 4AWAA 2R86A 4N47A 4FBUA 5KHOC 3TL3A 5A9TA 3OAAA 2JIZD 1I3NA 4R51A 3W1BA 1SBCA 2OM6A 3G2QA 3DVQX 5TPZD 5TQ0B 4U2GA 5AKKA 4LE0A 4OI2A 4KZKA 2V8OA 1ULBA 5IFLA 1XRRA 3UNXA 5FOWA 3KB2A 3KOUA 2Y27A 1QV6A 2HADA 3JW8A 3WGLA 3TTSA 3MAJA 2BH9A 2LD4A 5JD4A 2O8FA 4D3SA 4RTPA 2LRHA 4WXYB 2QPLA 1RFGE 2I4NA 4AROA 1V16A 4EG1A 2ZLBA 2FY8A 4NENB 3VR3D 3NC0C 1TO2E 1YTLA 3CMMA 4FYJA 4X62B 3SQWA 3DMDA 1I1QB 3LQKA 3GP3A 4Z51A 1NVKA 4RA6B 2RH9B 3BRSA 1ENZA 4X44A 2JIQA 1X9IA 1MX1A 3MCVA 5LQCA 4PLZA 2R8RA 4XGKA 2D4HA 3BRWA 1WL8A 2R6DA 4TM7A 1UODA 1P2FA 3D81A 1CLUA 2FSPA 4B85A 3QXCA 3HYTA 3ULKA 2AYXA 3VR5H 5DBEX 1PEYA 2JD0A 4G26A 3RIMA 4NLLA 4I50F 1W88B 2AF4C 1KOFA 1H0SA 4B48A 5CB6A 3RS2A 1Z0DA 5EHNA 4L73A 2IDMA 2EWWA 4HG2A 4M8LA 5BP7A 5AM5A 3DOHA 1PR1A 4RDIA 2VBCA 3NT2A 4B6OA 5AW0A 2F4VH 1NI3A 1F3LA 4DV7H 2YWBA 2WI8A 4DLZA 1O9BA 1K5GA 4NAHA 5IJ9B 4JUZA 3GTGA 1N1GA 3T7SA 1HGXA 1TZMA 2GZAA 4OXNA 2BVNA 1M1NA 4KQWA 1PNVA 1V5FA 1ORVA 1P1CA 1I2ZA 5HM8A 4FLMA 4GM4A 3MBKA 4CV2A 3IPLA 3PRJA 5JSUA 3NTQA 1R64A 2ZANA 3I4NG 3GHHA 1XZHA 5LYYA 6GPBA 4RADA 3TE7A 3P9QA 2PR7A 5KI6A 4A36A 2PD4A 4WZBB 3CZ4A 4X7RA 4L1KA 2XSZD 1KEEB 1RAFA 2Z1MA 2ZJYA 3X1KA 4FPXA 4D4MA 5ALQA 2FGKA 2F3QA 1T1SA 3DEHA 2VQEH 1RQNA 3ZWMA 4EBEA 3IA7A 4ZZ1A 3QEAZ 1G8HA 1TJYA 4ITVA 1WMFA 1R7RA 5ECYA 4NBWA 3ASYA 1PR6A 5I4BA 5EIXA 2OH2A 1VQ1A 3R2JA 3C8ZA 3GLTA 2QVZX 4BNMA 2CFMA 4TMVA 1C2TA 2OV3A 4ACAA 4EFLA 1SQGA 3P0IA 2BM9A 3R7DA 3LQRA 4LECA 5EE9A 4BQIA 2JKZA 1NLZA 2GN4A 4FOPA 1WZUA 3SY8A 2KBFA 2RB5A 1KYXA 3EXIA 3GYBA 1UMBA 5THQA 4K05A 4HYQA 3S6JA 3GLFE 1BA3A 4U39A 4L85A 4Q93A 1ATZA 2CLSA 2EW8A 1IHPA 3D8TA 4WKBA 1P1KA 2CNQA 1NE7A 3TTYA 3RGGA 3HN7A 2VXCA 4YRPA 1GSOA 4F4UA 3UZOA 4I1SA 2FPIB 1XXHA 3CQZA 3E1GA 1OWOA 1U0JA 5F7OA 2CLLB 3QMPA 3W9BA 3NO4A 4EF5A 2RDMA 1PW7A 3U56A 2L69A 2VRCA 3ZHXA 2VK1A 4CFZA 5GIOE 4MI9A 3L1JA 3SLRA 1CDEA 3B85A 2B0JA 4NY1A 2JEZA 3FHJA 4DREA 2FUNB 1MOPA 3L0ZA 4H7FA 2R44A 1HG1A 1SRQA 2OD2A 1EDBA 1UBHS 4Z49A 5DE3A 3PXUA 4H1VA 1LK0A 1R00A 4UUPA 1TYAE 3D5TA 4NYIQ 3G2JA 1EJ6A 3MB5A 4Q01A 4YGYA 3HE3A 3U6BA 5FHRA 4K0RA 5JBIA 4C03A 1V1MA 3K70C 3OZBA 2VK8A 1FNMA 2FZKA 2ZIUB 4MJ3A 1XQWA 1YDEA 2BGNA 1SY7A 4KRFA 4CTMA 2A0UA 4ZOAA 5LQUA 3PEWA 1HZZA 1QF9A 4QOIA 2P4UA 4YR0A 4JYCA 3HJHA 5C9ZA 3M6AA 4ZT5A 4C7VA 2B3TA 5J5AA 4HH4A 4QTUB 3QGMA 4RS4A 4CLRB 4RTLA 3SFZA 1SEPA 3DL0A 3KOYA 4GOXA 1Q92A 4RESA 2FLVA 2V5AA 1ZGCA 1K7YA 3X1MA 4OH1A 1X39A 1TAGA 3TYXA 2R82A 5D85A 2IP1A 4NCIA 2B7LA 3NBYC 4BWFB 4URXR 5ULLA 4DM7A 2ASLA 4EMTA 3C3WA 1DC3A 3KV3O 1NBOA 4EITA 3N7TA 3WWDA 3QE4A 2VQFH 1MHPA 4JI7B 2ZRJA 4RPIA 1VCIA 1HRKA 1H1TA 5JWRA 1P6UA 3S99A 4PF1A 3BBLA 3DZBA 3GLRA 5JQGA 2K87A 4D81A 1UPTA 3AEQA 4GH5A 5JADA 2PUDA 2G1UA 1DQZA 3MLEA 1U8UA 4DL5A 4BNFA 3D1VA 1J00A 1XTVA 4B5KA 3ZR4B 3KQSA 5BXYA 3ROFA 1A50B 2OMKA 4HD8A 4IZHA 3AUTA 1DQNA 2P8JA 2XA9A 2HD4A 4RVDA 4JGGA 1UWLA 3KKMA 4XD7D 4QDJA 1ZK1A 1QE0A 1IBMH 3WNCA 4IIFA 1HE1C 5IF3A 2AXPA 2N1MA 3NU1A 4J3JA 3BIOA 1ESCA 2M1ZA 4WBNA 1VLZA 2BZSA 5F5LA 3V8BA 2ZM5A 3M1LA 4QWBA 4DCMA 4LYAA 1K8YB 2R68A 3RS4A 4YJDA 2CJPA 3CLRC 4PNZA 2Q5CA 1ECJA 3HB0A 2IIPA 3L02A 1AZWA 4G2TA 5EI5A 1E4VA 3DDUA 4ERXA 2Z5FA 4OK3A 1T9DA 2PUJA 3BQNB 4M9SA 3WFZA 2CDRA 2B20A 4ZALA 1OU0A 2P4HX 3I2IA 5H81A 4PFJA 3PK0A 5HCUA 4O2RA 1SUIA 3DHVA 1QGDA 2YWGA 3I12A 3CH7A 3SZOA 3B1JA 3AUXA 3UH1A 4OEHA 1YASA 4B3TB 1BJTA 1BXRA 4YVFA 2HFJA 4K0KB 1UPXA 2ZUBA 2P3LA 2QORA 2Z5GA 3M6XA 4QQRA 2ALZA 1NSTA 3K0HA 2A5JA 2FYTA 2PUHA 1ZK4A 4RLQA 1Y1KE 1ZMOA 4E5VA 3C3AA 1DBQA 4EKYA 2EJUA 3OTIA 3F7MA 3LC1O 4L8YA 5L95A 5D3MB 4UUBA 5TR9A 1T4BA 2OAQ1 1JSLA 4MCIA 4OKNA 1GVHA 1RP1A 2YHBA 3TW8B 1UINA 1QO0A 1U7HA 2IV7A 5ITZA 4IAJA 3ZXSA 3E9CA 5JMPA 2JCGA 1GZ4A 1E8NA 1YIDA 5CA1F 1XMSA 5KNCD 3UGJA 2NUBA 4XUCA 3IBTA 1I7PA 1UPCA 1IBKH 1L7NA 1XMPA 1W1UA 4LBVA 2OY0A 3LIPA 4LTDA 1NFRA 3L77A 2CXPA 3IKLA 3GAZA 4CN8A 3THXB 3IOYA 4NZNA 4KR6A 5IXSA 1SOVA 1YB4A 1ODKA 4UMFA 1DDOA 3Q6MA 4RXTA 3REQB 4Z7QB 4WZ6A 4GBJA 3NJ8A 2UAGA 1D8TA 2EC5A 1FFXB 3P26A 3D3EA 3W5AA 3VOSA 1ZR4A 5I9IA 3U4MA 1GCAA 1ZHSA 4R2MA 3M81A 2X3YA 4RV5A 4IMRA 1GITA 1WMDA 2B34A 2NSJA 5CPFA 1IWBB 3G8DA 3UBMA 4R1LA 1XLWA 3BIWA 3P1JA 3HY6A 4JZKA 5ABPA 3ACCA 3GIWA 4BQQA 4RYLA 3W5SA 1RM0A 3UJ8A 4ZQFA 2BMJA 2QRLA 2EZTA 1K88A 2OORA 4IXDA 1VE7A 4J0GA 3LRXA 3EPGA 1P8LA 2Z4TA 1G5HA 5LMCA 1X1DA 2F3SA 3DTNA 1ONNA 3EMVA 4PNEA 1U63A 1MRSA 2I7CA 2PMEA 4BN4A 1T5HX 5E6UA 3T5BA 2IYTA 3LKVA 3AJAA 4ARSA 3Q4GA 4IFTA 1VCNA 1MFPA 4UUNA 2PSFA 4UHFA 2AD5A 1T2CA 5EWMB 3WB0A 3AVYA 2HK6A 4QG3A 1UJCA 1DJLA 4XDYA 3GEEA 1J7KA 4BQRA 2L42A 3VNBA 2IEZA 2J3JA 1ONPA 4JB8A 2H1WA 2HT1A 1BYIA 5SY6A 3QVGA 4F84A 2UU9B 5K0SA 1OI4A 4HPJB 4RZ3A 1V9LA 3DDSA 5AJYA 4FFOA 1AV7A 4YJGA 3EXEA 3U44A 5B1DA 2IPLA 4IF6A 2SICE 2F4VB 4UCFA 4DZZA 4QA9A 3MMPA 4GGOA 4DV7B 1NBME 2XV1A 2OV4A 2CV0A 2ZSKA 4ZICA 2IVFA 3SE0A 4OJMX 3TOZA 2WF7A 4DILA 3H5NA 3K0FA 4M8IA 1N36H 2MOKA 4XIJA 3DP9A 3L82B 1KTVA 1XF1A 5GVRA 5K8TA 5E2BA 2HTFA 2QIPA 2VBIA 3MWEB 5AJTA 4KAJA 3ZC3A 5J3JA 1A77A 2WHEA 4L07A 1GPWB 5KFIA 2Q3EA 1HYHA 2AWNA 3C6QA 5HIJA 3QJ5A 2ZSFA 1LPAB 1I33A 4OB7A 4DBLE 3WNBA 3EZ6A 3IAUA 3K9BA 3GIDA 1N34H 1BS9A 3F5DA 4YJ2B 4KO4S 3CVUA 3EBLA 2VQEB 1DIGA 2JLBA 1I30A 3PWTA 3U5ZB 2CL6X 1YNOA 3IAHA 2WYIA 1CUDA 4EKEA 2PWBA 3DPIA 4RB2C 1NJ2A 2O0MA 3A9RA 2IYYA 1ICEA 3IEVA 3EK2A 2NVBA 3AUKA 2JS7A 2NUAB 2DQYA 4LH7A 2DAPA 1V4BA 3ONEA 4ZFNA 1LA2A 2QVGA 3U3XA 3BD9A 4OUKX 5EMNA 3OPYB 1L7RA 3EX7C 3PUZA 1H2ZA 1N5DA 2PVSA 3HDJA 4MRPA 4YCNA 4RH3A 5JXIA 1NNEA 1XTZA 3KL2A 5AK4A 5HTKA 4S1PA 3RF7A 3TOSA 1KKMA 4EFMA 4NCBA 1NASA 4IS3A 4ZU3A 2PPLA 5H83A 4FWIB 2ZGVA 2UDPA 4UFNA 2BH2A 1NXQA 4CGYA 1TD9A 4X97A 2KSWA 2JGDB 1THTA 2Q1XA 4HPWA 2NO0A 1O6FA 4IY1A 3A6DA 1IN1A 1ZJZA 2O8NA 4NU5A 4EY3A 3CZRA 3VISA 4LJ7A 3U0VA 1IZZA 5KAMA 1NVDA 3IULA 1L6RA 3WDLA 1A8UA 3I45A 1R5BA 3I73A 3LUKA 1URPA 1Z26A 3PO2G 3TFOA 3N7AA 2WHXA 3PT9A 4CW7A 4C43A 4HRYA 3B3FA 1YA8A 2DUMA 2CVZA 5DOVA 3K8ZA 3UT5A 3FTFA 1EX1A 3LULA 2WJGA 2FOIA 3ZWXA 2HR1A 1CVIA 3T1YB 1SCKA 2YHIB 1Q0PA 3PCTA 3RS7A 4RM3A 2ZETA 2UZ4A 2XB8A 4XWGA 1XCMA 4J9SA 4M7EA 3VM6A 2PNJA 5K3AA 1JVBA 1TECE 3MTBA 1LRJA 2DM6A 4H77A 1H5NA 2BRUC 2BIFA 1CTQA 4M53A 5E1BA 3O8OA 4GPD1 4HUQA 1VCOA 1YHNA 4BY9E 2LR0A 3EMBA 2V4QA 3JVEA 3WOHA 3NVAA 4C6SA 2NQ2C 4UULA 3FRJA 1JQAA 3RC7A 4MV7A 4OGGA 1GNVA 4QLAA 2W2LD 3EIHA 2XJ9A 3KZOA 2C3OA 4F2PA 2NYRA 4ZZ2A 2I4RA 1U90A 3OETA 5KFFA 3WWEA 5CGQB 2NO7A 3QUTA 4I4NA 3LA8A 1F2TA 3E22A 5E4TA 3L9XA 1FTNA 4PAQA 4ZCPA 3TW7A 2OG2A 4E13A 4ZVNA 5AI6A 5C3UA 5KS2A 4YAIA 1PWZA 3G9ZA 4AFNA 3LVQE 1KBQA 3FCOA 5CVUA 1HYBA 4TV8B 2CFTA 2YBEA 4EWLA 4GRIA 1ZLYA 2AN3A 4R1PA 4DUZB 4IMIB 5DNYB 3RYCB 2VQFB 4MAMA 2PGAA 5JECA 3GWGA 3E9DA 1R18A 4CCSA 2CBGA 3PRKE 4ZT2A 1RXVA 3VGJA 4M8SA 4ZI5A 3T5KA 1GAJA 2GYUA 1D04A 3MS2A 1Y1LA 2J41A 4IMJB 4K2AA 3G2OA 3RRXA 5JPCA 3VR4H 5JDIC 1K83A 4W7IA 2CNWD 4QVKA 3NOQA 3BABA 3ER6A 3HNPA 2ORED 1DOZA 1CKMA 1IEVA 1E5TA 4B3RH 2EQAA 2AW5A 3I4FA