2YZMA

Structure of d-alanine:d-alanine ligase with substrate from thermus thermophilus hb8
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-Alanine:D-Alanine Ligase with substrate from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 83
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzmA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzmA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzmA01
2R85A 4O4IF 5JVLA 2XCLA 2YZLA 3TIIA 2NU6B 2W6ZA 2ZDGA 4FFLA 3R5HA 1UC9A 3DF7A 2CNUA 1GLVA 2R7KA 4YJ2F 4O7YA 1M6VA 3HO8A 2R82A 3R5XA 1EYZA 1BXRA 5J2UF 3N6RA 4FGRA 1CE8A 3WO1A 2VHEA 4IWYA 2WYOA 2PVPA 1T36A 2ZDQA 1E4EA 1B6RA 4ZI7F 4MV8A 2HGSA 3JRWA 2I8CA 4XYLB 4TUYF 1DV1A 5LA6F 1EUDB 3WO0A 2CZGA 4O7RA 1VBHA 4J6EA 2R84A 4O4JF 4O83A 3LWBA 3JZFA 2R7LA 3Q2OA 4M99A 3QFFA 3SE7A 5LOVF 1VKZA 4O4LF 4L1KA 1GSOA 1W93A 3Q1KA 1KJJA 5GONF 3U9TA 2YS7A 5KKNB 2OLSA 5FNVF 5CB4F 2DWCA 2DLNA 4HNVA 5BPFA 2YZNA 3LP8A 3AX6A 3NUAA 3KREA 4MV3A 4O7ZA 5C1PA 3G8CA 1W96A 4TV8F 3MWEA 3V4ZA 3KAJA 3VPDA 3KAKA 4MA5A 1EHIA 1C3OA 1M0TA 3VMMA 2XD4A 4YJ3F 5DMXA 4ZQIA 3HBLA 2CQYA 2GLTA 2V5AA 4XX0B 4M9CA 4EA7A 2GPSA 3U54A 4MV6A 4GGMX 2C00A 1JDEA 2GQSA 1JDBB 5HBRB 2FB9A 1UC8A 2V58A 1SCUB 1OBGA 3RFCA 5BMVF 2YW2A 4IWXA 5LXTF 1PK8A 2VR1A 2YZMA 3ETHA 3AW8A 3E5NA 5LYJF 1AUXA 4O81A 1Z2PX 2NU9B 2W70A 2DZDA 4FU0A 4DLKA 5LP6F 3G8DA 2ZDHA 4O84A 4IHJF 4ZOLF 3GIDA 1B6SA 5CA0F 4TV9F 1CS0A 5JH7F 1C30A 4MAMA 3R23A 2FPPB 4O7TA 5J2TF 1PX2A 4C5AA 3VOTA 4O4HF 4FFNA 4FFMA 2R87A 2YRXA 1JLLB 2P0AA 4HQ6A 2CNVA 2W6MA 5CAEB 4IZOA 4O2BF 2GPWA 3ETJA 1Z2NX 3MWDA 5H80A 3JRXA 1GSAA 4I50F 1IOWA 4YAJB 3OUZA 3BSWA 3RV3A 2FP4B 4NYEA 1Z2OX 1CQJB 4XYMB 3TQTA 4O7NA 1BNCA 4MV9A 4RZQA 2PBZA 2YYAA 4M9UA 5C8YF 5KX5F 4O82A 4WD3A 3K3PA 5HV6A 4FFOA 2FPGB 4EGJA 1IOVA 1EUCB 4DIMA 2R6FA 2R86A 3BSSA 2NU7B 3N8DA 1M0WA 2IP4A 3RUPA 3VPBA 3TIGA 5EZYF 2VQDA 4YB8B 4O7SA 2X0SA 3GLKA 2GQRA 2YRWA 2HJWA 1ULZA 4I55F 4ME6A 1A9XA 2W6NA 3U9SA 5JQGF 2W6OA 4EA8A 1KJ9A 4I4TF 4FFRA 4O86A 5I47A 4O7WA 4MA0A 3WNZA 2W71A 2YL2A 1OBDA 4Y8VB 4C5CA 4MV7A 4HR7A 3RV4A 4ZHQF 2R7MA 5BPHA 4EAAA 1E4EB 4YAKB 2QF7A 2NUAB 2VPQA 1KEEA 1KUTA 2SCUB 3VA7A 5D8DA 1KC7A 1EZ1A 2I87A 3V4SA 3TINA 5C1OA 1KBLA 3K5IA 2YS6A 2CNQA 4MV1A 4O7VA 4QSHA 3I12A 3MJFA 2W6QA 3ORRA 5IYZF 5CA1F 5JVDF 2W6PA 4M98A 4MV4A 2YWVA 2I80A 2NPOA 1VBGA 4FFPA 1JKJB 2DIKA 2R7NA 2YZGA 2Z02A 4EABA 2V59A 1KJQA 3HB9A 2QK4A 4XZ3B 3KALA 4O7LA 4EGQA 1AUVA 2NU8B 3R9RA 5JQWA 1GGOA 4HNUA 1I7NA 1DIKA 5K2MA 4HNTA 2PN1A 4WBNF 4FE2A 1GSHA 3UFXB 3R5FA 1KJIA 2Z04A 3JZIA 4EA9A 1KJ8A 3VPCA 4C5BA 1WR2A 4YBZB 3U55A 2J9GA 4IIJF 3TW6A 4E4TA 1DV2A 3BFPA 3BSYA 1CQIB 2FPIB 3K5HA 4O2AF 1A48A 1I7LA 3OUUA 4EG0A 3BG5A 3ORQA
chains in the Genus database with same CATH superfamily
4WNAA 5EIXA 4BV8A 4D1YA 4HATA 4KQXA 5J59A 1Q21A 1GPAA 4BN0A 2AW5A 1OZAA 1BROA 3B36A 3AILA 2HZ7A 3D6NB 1SHTX 5BN5A 2A92A 1XI2A 3WLLA 4PLPA 2QORA 3OIWA 4RDXA 1S2OA 3WE7A 5KYYA 4M1KA 3TUZC 1NJSA 2QIOA 1AGXA 2E4XA 1IEVA 1WIWA 5BR8H 1NRWA 5U1PA 4H7KA 2I7XA 4IJVA 5A06A 5AK3A 5KHAA 3B2EA 1PJRA 4XM2A 5IZCC 3RB6A 1O3YA 1PFKA 5DGDA 2HCFA 3C8MA 3ND9A 1BJTA 3ZK7A 5K3OA 5IDXA 3T9DA 4PTYA 4BY9E 1I2ZA 5J40A 1T2FA 3Q7PA 3HP4A 4EOGA 4UTZA 3PQ8A 2IY8A 1P45A 1KF0A 2FZCA 3ITDA 2IS6A 3D3WB 3P71T 1IYZA 3DFFA 3FYUB 4X95A 2CMFA 3PICA 1BMTA 1SN7A 4JUZA 1TW3A 3USES 1ZCJA 3DBLB 5LA6B 3TRKA 1OXSC 1AUXA 5CT4A 4KXFB 4O4JB 4BB9A 3IIKA 4DRFA 3ZE7A 2VKQA 2EBHX 2PSFA 4HWKA 1QQBA 4N12A 1STOA 5AW1A 3EZNA 1OFIA 1MORA 3I04M 3IDZA 1EFAA 1QYVA 1KQNA 4PCUA 3CKLA 3E4CA 3SVTA 2HEIA 1TEHA 4LHSA 4LN1A 1LLFA 1P0MA 4PIVA 5A2QA 4HS4A 3TOCA 4IQ8A 4RD4A 4J0KA 1QOQB 2CHVA 1D7OA 3BWYA 1XZJA 3PIIA 3TOZA 2JJ1D 3I9V1 4OLFA 1HURA 2X6QA 1KTIA 3T3IA 2XUDA 3IUJA 2FZWA 3EUEA 1O6CA 5IP7G 5NLLA 4KMRA 1FMFA 2PS1A 3K96A 3FGOA 1TJPB 1R9GA 2QR5A 3B20A 5KNCH 5EXXA 2XYGA 1OXKB 4DTCA 1CVLA 4NHOA 4D79A 2FPXA 4EZBA 3GV0A 3K0AA 1V5GA 5DGBA 4NY1A 2OV8A 3QTLA 2QY6A 1X19A 1LEHA 3BSFA 1EPUA 3IO3A 3A1UA 5AVZA 4HAZA 2AQKA 2ZWIA 4MPRA 4Z53A 1M34A 1LPBB 1UFVA 3RIGA 1GAWA 5K6AA 4D3XA 4MX8A 5I7SA 1C1XA 1XZPA 4GOKA 3GJ5A 1UBTS 5LU9A 3B89A 1ZI9A 5EXTA 2CCKA 4DQXA 2WAMA 3ZZTA 4OB7A 4JI6H 5KNDH 1P4RA 4E5YA 4OHOA 2HQ1A 4YRMA 4Q9KA 4PHFA 1LK5A 1B00A 4BGIA 2AMFA 4IW3B 1H2XA 5CNMA 1USUA 5DCUA 2IYQA 5A62A 1N2HA 4P7FA 3R9XA 4B6PA 4NONA 1ZNZA 5FL7D 2W9XA 4D9NA 2EGGA 1J5EH 2ONYA 4JXZA 4EY7A 5EY5B 3IODA 3O4RA 5KTTA 4MVJM 5BUQA 1U1DA 3BULA 3Q11A 3DOCA 4DLBA 2AMLA 2DQKA 2R8ZA 3R09A 1Y1VG 4PC7A 5DBOA 3B5IA 1CUEA 3ADPA 1X70A 3ZLUA 4L5JA 4EELA 2OC4A 5KSOA 3HJHA 3B9BA 5JXWA 1ZHQA 2Q9AA 4GMFA 1NVVR 1LLQA 3NDRA 1J0EA 1YC2A 1YVRA 4MQUA 1CZOA 5L8VA 2A1IA 1I1MA 4AB1A 2AG8A 2DFDA 3DZJA 2AI2A 4JOSA 1XMSA 2ZR7A 1DBSA 1S0UA 2D1TA 1B8OA 2IQIA 3UXHA 5AVKA 4CCYA 5H8WA 4X92A 1UK7A 1N6RA 3FPAA 1HETA 2GLUA 1SXJA 3PJGA 4FYHA 2VSOA 4L8WB 3CKMA 2ZJ7A 3TW8A 3NNDA 4Z9BA 1HDYA 1N33B 3RC3A 1AUPA 3D31A 4BMXA 5K0NA 4CM4B 2P6PA 1HGXA 4IV5A 3GV7B 1E9CA 2QQ0A 1KI8A 5IDQA 4ZU3A 1P0FA 1EUCA 3RB4A 3BZUA 5D1NA 3UW1A 2ZKIA 1CUYA 1W2HA 3WRWA 1AM4D 1U3DA 3V4ZA 1X1CA 4DV2H 3MEQA 1V43A 4TTAA 2C8KA 3MWJA 2CVPA 4G07A 3UH1A 3BFJA 1XROA 3RRYA 4TRMA 1PWXA 2B99A 3ACDA 4MV6A 4KSCA 4ZYTA 3EAFA 3F6YA 1UT8A 1CQIA 4HDAA 1DJLA 2FHPA 1KYXA 4ZCTA 4KAFA 1AH2A 3PGKA 5EWFA 4RCVA 4DY4A 3V00A 3EG5A 1EDDA 5LP6F 3BTSA 5JD3A 4LWZA 5E9WA 4QT4A 4PZ9A 5K3FB 1RMYA 2P78A 2X0NA 4YP7A 2QRVA 4C7JA 4DW8A 1N0WA 4QPPA 3W1GA 3TLZA 1B8NA 5AVQA 2YIMA 3SR3A 3G0IA 3F9IA 3WMRA 2AC2A 5SV2A 4IFEA 1OKKA 5CJPA 5B1IA 2PYZA 4C3VA 2V96A 4E30A 3H97A 4BVGA 1V45E 1GPJA 4K7JA 1AX9A 1NBEA 4EGJA 2ZS8A 4DCTA 1ZEJA 4FSDA 4A8JB 1K5DA 1OXXK 2XYQA 3TG2A 5ALLA 3FZNA 5KFCA 3NUZA 3T5LA 5B1HA 4LF9B 1CXZA 4FK8A 3F6CA 1KJ9A 2BI4A 1H0KA 1DBQA 4ZOQI 4H0NA 3AB3A 3IBSA 3J80A 4FI3F 5DLDA 4S35A 1D2RA 3ZDBA 4QFDA 4UXIA 3AOEA 2WVAA 4P82A 1D0SA 4K1LA 2ZSFA 4FMBB 2BQ3A 1O97D 3NHPA 5CDHA 3NGLA 2O5CA 4B4OA 2B1GA 1N36B 4IYRA 1T5LA 3IBGA 4TVKA 3WNCA 4DT1A 1M8FA 3P9KA 3G6KA 3Q98A 1UBLS 1HFKA 1OKKD 5FWAA 1QB7A 3M83A 3NV7A 4R3NA 4DV0H 2VHVA 2QTRA 4RD2A 3WWCA 1XZEA 3AVQA 4GVXA 4RB2C 4L6AA 3PLAE 2FFRA 1QP8A 4LF6H 1Y9AA 2NXWA 1BXKA 5T67A 3GZTB 1WHSA 3ZHXA 1XCMA 2AC7A 4JVSB 4R71A 1OGYA 2N1MA 4LZLA 2A35A 1WPXA 4YJ3A 3WSVA 3TL2A 4LCJA 4PLTA 2DM6A 4A10A 2JK1A 2XCUA 3QZ8A 3R74A 3DE2X 5D7BA 1SG6A 4WASA 5IMBA 1KGDA 2GH1A 2VDRB 4FYJA 3CS3A 1ECLA 2JG3A 1SVWA 3NIGB 3T7AA 4BEJA 1H9CA 3H1TA 4WZBB 2F62A 5AR1A 1CRLA 1E7QA 3OOJA 1Z88A 2YN2A 4NV3A 4MPDA 1EXWA 2FWAA 4MLDA 3EWIA 4NMXB 5KG0A 5JAHA 4CT0A 3VR5H 3HNRA 5TQJA 3GMIA 1KYYA 3GLGE 4FWBA 3IS3A 3IDSA 4X20B 5AHXA 1XVUA 4IINA 2Z9CA 4LF5H 2QPOA 2C29D 3UUGA 3OPYB 3THWB 4BLRA 3P9NA 1NW8A 4Q5IA 4G0QA 4YHHH 4KYVA 4KJZA 1GNPA 1NVDA 3KOWA 4INOA 3VNQA 5LBUA 4M9RA 3IMKA 1E2QA 2I9PA 4AF8A 3NNSA 4X62B 1IEXA 3S28A 3EEBA 3KLOA 4WSOA 1N5RA 3D0QA 2JA7G 2I8AA 2X6RA 5TXGA 1YCDA 3JQ7B 2HQRA 4ZICA 1V1RA 3LC1O 4CDMA 3IHKA 1MOPA 2QN6A 1BN7A 3DTYA 5FYDA 1DUVG 4EY4A 4ODIA 4W1RA 4YJ2B 1WXDA 4D9KA 3N2EA 1JZQA 3E84A 4WRRA 1N34B 5D2CA 1F51E 1JDBB 4YR2A 4IBOA 3FVTA 1V95A 2R8HA 1JIJA 2EFDB 1HTTA 3N76A 2GDZA 5E6UB 2X5RA 4Q34A 2O8EA 2CGEA 2R93A 1PX0A 4RYDA 3EW9A 3C3MA 1SVKA 4CI9A 4L22A 3ZXUB 3GDHA 1S01A 1ZIYA 4EY8A 3C3DA 1SXQA 3SQXA 1CZNA 4KMSA 4KW7A 3NW9A 3RYCB 3ZHQA 5A5DA 2YHBA 3CO5A 5TJ9A 2X8JB 4GP7A 3W04A 2UYHA 3SHVA 5G4KB 4YRNA 5JOQA 1Z29A 1NPDA 3OQBA 1GZ6A 1P9RA 3B6EA 1WP4A 3FPLA 3T1OA 1CQPA 4OHWA 3GLQA 1A3CA 1KZYC 4X54A 1ZK1A 2Q3BA 1J2UA 1TMGE 2VWPA 4UUGA 2FK2A 5K03A 4D45A 3CRVA 1O6ZA 5LQUA 2HMYB 3LV8A 2GZDA 4F06A 3E9MA 1OZ0A 2G9VA 3SIXA 3NHJA 1Z5WA 4FI3C 4HRYA 1VIDA 2OYRA 3TZQA 4FFRA 1VL5A 5KG1A 1WTAA 2ZAYA 4Y18A 1Q0LA 4BQEA 1HX7A 5FLKA 4PQYA 4I5IA 2XAAA 4RTQA 2VJKA 4BFTA 1U7PA 3AEYA 3AF6A 1SVMA 2VYVD 4N49A 3T1YB 3HA2A 1ODFA 5THKA 5EJEA 2VSNA 3BRWD 4DUPA 4RHEA 5FI5A 3FPJA 1SZPA 3MFHA 4TVOA 4D44A 1NQXA 5KDOA 1G66A 2PT6A 4QOEA 3G82C 3WLAA 4LPSA 3F4BA 4BX8A 4XGRA 2VQEB 3R5SA 3ER6A 2CLSA 3CR3C 3M82A 3GLRA 4NLLA 2OBBA 1K75A 3V2HA 3TJMA 1YI0A 2VP6A 4Y6LA 3VOAA 3AY7A 3M6WA 4KSYA 4ER5A 4IUDS 4JB0A 4R83A 5KWIA 1O9BA 4DMUB 2WF8A 5IM4A 4Q12A 2PN1A 4WBNF 3CUVA 1ZPDA 1CNMA 1OH5A 3RVPA 4C5BA 2V7QD 3GZJA 1PZNA 3AVUA 4E4TA 3ZXXA 3NHRA 3AEUB 4YV0A 1HFWA 4Q6BA 4DKJA 3NUGA 2YZLA 5KFHA 4H7HA 5FBHA 1ZJ4A 1ZVJA 4OU4A 1TVEA 3QVGB 2XECA 3U60B 5HQJA 4DCUA 5E8RA 5K8IA 4DMKA 5F7XA 4CLXA 3EWAA 2WAOA 2WJ4A 3H40A 4NENB 1UPXA 3ZGYA 1KOGA 2AZMA 3WLRA 1TWFA 1REQB 1ZGGA 1FU8A 3OEED 4WZ6A 1BX0A 5FHQA 3V2GA 2E2IA 4MV5A 1XHEA 1XF9A 3KDPA 1D1TA 1N92A 5A71A 4I1OA 3V8EA 1NKVA 2F3UA 4U6SA 3DVRX 4LW8A 5KX5A 3ECSA 5JBIA 3EC2A 5ILOA 3HKEA 4TYPA 5CGZA 1W94A 2P0EA 3BTVA 3R3YA 1XLVA 5BSMA 3B70A 2AKYA 2B1JA 4G2TA 3L79A 4JS0A 2YWEA 1M33A 1PO7A 3RODA 1VJ1A 1VOTA 5TPZD 4BZZA 3UV7A 4LYJA 5HWSA 4RTRA 3KREA 2AA3A 3MIIA 4QWAA 3M6MD 1K7EB 3UMVA 3QVSA 4ZMSA 1GPLA 3H2JA 4MWDA 5EXEA 4UARA 4PANA 2P2SA 3UV3A 3PR1A 4IEIA 4RNDB 1MB4A 2WJJA 3BK7A 1ZDMA 4BJ6A 1I33A 1I6WA 3F6BX 1TWAA 1M7JA 4JROA 4RMHA 3BS4A 1PS9A 2NO7A 1Q1EA 2B1QA 2X4GA 1RYEA 1CS0A 1ETUA 1C7IA 1YKSA 3LDUA 2ZB2A 2R96A 4HFJA 1GT91 1GZ3A 2ZI7A 1YA6A 4HDMB 3E82A 2HU2A 2C4MA 1AY0A 5NULA 3D4OA 4MGHA 3JSXA 1YJCA 4TS3A 3N3AC 1QHHB 5KKCA 2OHVA 3ROMA 1DCFA 2BGRA 1MGOA 3C4JA 1UKEA 1JVBA 5HV6A 4EHHA 4J1SA 2NV2B 4CTMA 3EFHA 2H5EA 2ZUFA 1LXCA 5AQ1A 4E4YA 1P0QA 2VZ9A 1DIGA 1KY3A 1UJ4A 3U3ZA 3L84A 1PKEA 1T3TA 4YT2A 2A7XA 5JALA 3F4LA 1GN9A 3SSOA 1XBTA 1QH8A 3EC1A 4FZ3A 2DT8A 4RSRA 5KJ6A 1JSXA 1I36A 1NNUA 4LXXA 4HDRA 4I9UA 1QXSA 2AB0A 4EWLA 3CMCO 2W71A 1OYWA 4PN7A 3OHPA 4IFTA 4OXXA 1PV2A 1BHQ1 1Z2AA 4MUEA 3TTXA 2ZR0A 2I6UA 1FPQA 4Y6PA 3V2IA 1UINA 3WJ7A 3BREA 2QNBA 2FLVA 1IFXA 4KYIB 1T5SA 1SBIA 4LVCA 1XTVA 2WJHA 2HBZA 1G5FA 1S03G 2ZOSA 2E82A 3IHWA 4EABA 5SICE 3HB9A 2PUTA 1RLTA 3HFSA 3OZEA 1KO5A 1N2CB 2ZB7A 3LHDA 4HRVA 4M0MA 1ND5A 2XTAA 4MAFA 4M7PA 4LJLA 5KFGA 3AQIA 4OHBA 5BWUA 5K3SA 1P8LA 5KFSA 5KFLA 1ZC3A 3EIUA 4IIJB 4P4SA 4P4LA 4LCBA 3GN1A 1AHHA 3R6WA 3JYPA 4EH1A 4E21A 2WFLB 4G5HA 4O4IB 2B8JA 3M6FA 3QUQA 4U5XA 5ISMA 2CXQA 4MICA 5B3JA 3PUZA 5BSGA 2P9TA 4DLXA 4OY3A 2AYYA 5DCYA 5JAZA 4J07A 1MENA 3D3WA 2A4MA 2WYUA 4Y0NA 2CJPA 3LY7A 3MINB 4N5DA 3O3CA 3O5AA 3DVSX 4YMSA 2IEBA 3SKYA 3JVIA 1TIPA 2B82A 2OQRA 4BNMA 5J2TA 2PUBA 2CDBA 4JJ4A 1KI1A 3EDMA 4LWPA 2IE8A 2VBGA 1OBOA 2EKZA 4FGRA 1Y89A 2ZRKA 2PUCA 4Y2YA 2HK6A 3T1HB 1JHDA 1WEKA 4C7MA 7GPBA 2IEZA 5T7BA 2QYTA 3P8ZA 1BTOA 4JX9A 3HP1A 3PQFA 5IAOA 1PZHA 4ZA2A 2IUSA 2D1RA 3FVQA 3H1AA 4F5EA 4ENWA 1NUAA 3UATA 3BXPA 5EE3A 3P26A 1V47A 3C7CB 3NXSA 1VKZA 4AK9A 3JQQA 1UEXC 3OTWA 5FLXW 3CH7A 3PT9A 5KREA 3TZBA 4KC0A 2X58A 5KNDA 1JAZA 4IRKA 1O8BA 1ULUA 4KNYA 3LX6A 1SVOA 3EHEA 4OQFA 3MTEA 3P4XA 1B14A 1V8PA 2PU7A 1P6QA 1VA4A 3L6RA 3TX6A 3HB0A 2Y1KA 1LRLA 5F1YA 4TN5A 5K9ZA 2R60A 3RBZA 1T3NA 4LK2A 4DDMA 3DVAA 3NHLA 3WDLA 3LQRA 4R2IA 5TY0A 1URPA 4LXGA 2HL6A 3NBKA 4IHJF 3RWBA 3CEJA 1G42A 3L07A 1C0KA 2ATIA 1VMAA 2IXDA 1N2JA 1M1XB 3GCGA 1P3DA 2AI3A 3SYTA 1V9LA 3MTGA 4FFMA 5CE8A 2YQ4A 3TTVA 1TRHA 1KNQA 2R6AA 3HE3A 4LJ8A 2D00A 2WB1E 4QOGA 1R4MB 1Z2OX 1F2TA 2FFAA 1AQYA 4X5OA 2H5JA 4LCEA 3O7WA 4QYMA 2EZ8A 2N9UA 2A58A 4YXWA 2H9IA 3OOSA 5EVCA 1TO1E 2PX0A 2WSSD 1DFHA 3PKZA 1OIXA 1RW4A 2BM8A 4MW9A 1H5QA 4IZIA 2FW9A 4AJ9A 1FDSA 3IL2A 5KFPA 3E23A 2IBSA 3MT0A 5BWNA 4WXHA 4WHXA 3M4IA 4LSWA 4LAFA 2N1BA 3VPHA 1GZVA 5FDFA 1IQPA 1OASA 5JLJA 5CDFE 1J20A 4BVJA 3SOPA 3I5UA 3ESZA 1G2PA 1U28C 4OIMA 2AOWA 4DDHA 2WEKA 3EXG2 2BBSA 4J1TA 2PSSA 4DCCA 2E3JA 1CFZA 4FLFA 5DLGA 4MROA 1PNVA 2J9RA 4TTIA 1DG9A 5TF4A 1D07A 5F7JA 3KZNA 5DHSA 5LWQA 2EZTA 1GRRA 4ESEA 1JH9A 3LHSA 9GPBA 4NJEA 2XOEA 3VYWA 3CLTD 2TMGA 3QPCA 5IC6A 2QM3A 4KFCA 4IJKA 1N75A 2O0KA 3VZPA 4ZAYA 2VP2A 5GINE 3L0ZA 1TCCA 1TKBA 4D41A 4DKXA 3EPGA 1N57A 5CFOA 4PY2A 2FEOA 2HVRA 2UDPA 1N3LA 4TKVB 5LQSA 4PNZA 5FHRA 4CLEA 3FUXA 5CM9C 4WH0A 3SXUB 5BV1A 4CDRA 4F21A 4L8FA 4W7HA 1U1EA 2I99A 1CRWG 3PSHA 4A3EG 1QHYA 3AUYA 5JW6A 4ZCLA 2QSUA 4MP3A 3OY7A 1G0NA 3OFSA 3QEKA 4UOEA 3WLHA 1ZCBA 2Q1SA 4RH3A 4B74A 3WYEA 3WWPA 4YUXA 1D1SA 1WCXA 5KCMA 3BRQA 2F6RA 1CKMA 3ZE8A 5LMNB 2NU6B 4I5FA 1PJLA 1RCFA 3KUKA 3QVUA 5HKKA 1K6MA 2QTBA 1U8CB 5LQMA 4RB0A 1XNRB 2B2NA 1GVNB 2CFRA 3HKBA 4MS1B 4CL8A 3GNQA 1U8ZA 3UHPA 4EHFA 2PL5A 4DAAA 4EFDA 2FLWA 4IDOA 4AZTA 3GVHA 3OZWA 2WHYA 3JRWA 5BWWA 3KE9A 3FPGA 3ADBA 5LOVB 1WXWA 4N0EA 2XUIA 4KWCA 4XJTA 2VDWB 2GYWA 4OUKX 3B3GA 1WDMA 2FNAA 4CW7A 3RUFA 5ADWA 3TXAA 3G2NA 4ZYWA 3IVXA 4MQ6A 5HEKA 3NTLA 1BE8A 1K6XA 3RTXA 3JYNA 3IA7A 3S8EA 1WA5A 1GCGA 3BICA 1DXHA 1W73A 5J58A 3NBXX 3A1FA 4A8JA 4OI0A 3DW1X 2IUEA 1LF0A 1W85A 1PYDA 1U63A 4QNRA 3HUFA 3KAKA 1VSVA 3BK1A 2PXCA 3OZBA 1P7YA 4ZYUA 4A3BG 2QTGA 3PW4A 1IC6A 3TW0A 1TEXA 4HEQA 3PTZA 2A67A 3THXB 3PW7A 5E9AA 3W7BA 3KUCA 3D4BA 2WF7A 3BIOA 3A6KA 3IXLA 4HWPA 1M7BA 2RGDA 3I9KA 2GFHA 5ELLA 1B41A 1DKRA 4XIGS 4RWEA 2YHIB 3W6PA 4E5DA 2FZ4A 5GIOE 4UNSA 4IP0A 1YNOA 1Z2PX 2AC4A 3VVMA 4KMMA 1KEEB 1HDEA 4EHJA 4ZALA 2HD4A 3U1TA 1X77A 4D0SA 4V2IA 4WT7A 4P98A 5CH8A 3CZQA 4II3A 3CISA 1T10A 2AXEA 1TXGA 2GPWA 4KUHA 4WGFA 3IHTA 2CNDA 1JFFA 5L7TA 2JKYA 1L7EA 2K6GA 4WLUA 1NUQA 1RXCA 3T5PA 3U5ZB 2ZWPA 3IKVA 3B8EA 3L6CA 3G6VA 3EXAA 3VR5A 4B7XA 3IRVA 4RCYA 3RYHB 4XD7D 3LPCA 1FXSA 3BSSA 3O74A 2E4ZA 2ZRMA 2P5SA 4FQ7A 4OKNA 5FOQA 3TJZA 2X5KO 1R15A 2R65A 2I1LA 3IYLW 2PKWA 3MPUA 2EG9A 1HNXB 3QVTA 4S04A 3I0ZA 2LNDA 4NI5A 4HJRA 1Q0SA 2HSDA 2RAPA 3IUEA 1FX0A 5CA0B 3K1AA 3LKBA 3P0FA 3H0GA 4U9UA 3I62A 1U0SY 4Y8VB 2FDXA 5EHGA 1U2RA 3M33A 1F8UA 4IVNA 1LC0A 1JHUA 2R6JA 4NOMA 2JA6G 4LJKA 1WO8A 4MTDA 4DPKA 5CLHA 3TLJA 2ZLBA 1CSEE 3ZGZA 1V6CA 5JZ9A 1KZHA 1JVSA 1J8FA 5EJ9A 1RXWA 1RJ9B 4IF6A 3DE5X 2HRZA 1U3FA 4LMYA 1CRQA 3TLGA 4KREA 1TT7A 4NYIR 2FG7C 1VYUA 2CXOA 2QK4A 3CEAA 4FKBA 2OGTA 2RBEA 3THWA 1B04A 5J1TB 2DPLA 3ETCA 3GRCA 5HFNA 3RVBA 3CPSA 3K31A 2CKDA 4JLDA 5HCIA 4FE2A 1HNNA 3PRKE 1CLEA 4YX9A 3GFOA 3WAGA 1DJMA 1QIKA 1XP8A 5GJWC 1PHRA 5LKRA 4CL0A 3LP6A 5F2EA 5FJIA 4UEKA 3ZDAA 3ANLA 3G02A 2C4UA 1KFCB 4ZDWA 1HYBA 3VAAA 1RWWA 3C15C 3EVAA 1TZBA 1R8YA 4IQFA 4FILA 3W3AD 3KL4A 4QWCA 1NXOA 3MR3A 3C6BA 1AQNA 1JQ5A 2AD5A 3VISA 2C7QA 2GN0A 4GX2A 5AJXA 3BACA 3BJYA 4NTZA 1P8AA 3VDQA 3LQFA 3DP7A 4Y1RB 1ZMXA 1A7AA 4E31A 4OK6A 2PZGA 5LU8A 3BL8A 3RFTA 1RWNA 1W0JA 3IE1A 4E6EA 4IKPA 4XQEA 4FSXA 4A15A 3UMSA 1BJKA 1WUTA 3FHLA 1RMQA 3C39A 3MNFA 1XK5A 1Q6YA 3PFIA 3GXOA 1T4GA 3EDYA 1Z56C 5KKNB 3Q8MA 4O08A 4D25A 2J9YB 1MO4A 3LP8A 3QBTA 2PT9A 5GOZA 4LISA 2H29A 2V0GA 3OD1A 4QTYA 4G26A 3EQ6A 1OJ7A 5KAMA 3IT1A 3ESDA 1DFGA 3LHFA 2Z1MA 3VU8A 3WQBA 4ZOBA 2AN3A 3MTQA 3C5EA 1JR3E 1PQWA 1ISRA 3WAJA 3J7TA 4INJA 4B82A 4YUZA 2IS4A 1KVQA 4BO1A 5KTOA 1SRQA 5IEJA 1FS5A 3IXQA 2NVUA 1OLSA 1C2TA 1PVDA 2VYFA 2YWFA 3NTVA 2UVVA 3ID6C 1MABB 2VJBA 4QTUB 2VHCA 3AUXA 3B1YA 3W2IA 1AQ6A 3NKFA 4Q19A 1SOMA 3HDQA 4OM8A 2V6BA 4MYSA 3ZQ6A 2BL4A 3ZLBA 1NF3A 2H4FA 1M2EA 4DEYA 1JVNA 2PGDA 4N18A 4IAJA 3FN4A 5JJKA 2Y1CA 3DUFB 4JT9A 4L78A 4ZCMA 1U0EA 3QV1A 4UOZA 1W0JD 3IAS1 1E1LA 2X0DA 2X9VA 1K5PA 1NY5A 3JWEA 5GONB 4DQUA 3UYLA 1HE4A 1JTEA 3V5NA 3LUGA 4UMFA 4J9LA 2OBXA 2VSXA 5DNWA 2AEMA 4QTTB 5DASA 3LKDA 5HF9A 1A5SB 2ZRDA 3DXZA 3AGPA 3LU1A 4RPGA 3KYDA 3EUWA 1QHXA 4KGXA 2RKOA 1GZ4A 1NTOA 2RHBA 4QXPA 2YHUA 5TGZA 4C78A 4YI3A 4OL0A 5C5EA 3S2GA 5EPEA 2Y8EA 3X1KA 2P9CA 2BFAA 2R1TB 4QTZA 4A3DG 1KERA 1RQ7A 5DCWA 2HJWA 4F1WA 3GLIB 2YWGA 1ORDA 1FSZA 4PXYA 4RUCA 1X1EA 3ILHA 3R7FA 3BA6A 3DEAA 2IA5A 2RGCA 1XTZA 1ENYA 3AEUA 1T2EA 2IKSA 3UWKA 5TLSA 2IU3A 2JZNA 4MI3A 5CFRA 1FNCA 4TT8A 1OR8A 1B3RA 3VTAA 4PHGA 3T5MA 3WLMA 1XQYA 1RXVA 4O33A 3U4DA 3EVZA 1BIFA 3AM4A 4R1QA 4LXYA 2C04A 4I9GA 4HWGA 3A6GA 4F4HA 4TKLA 1KQPA 5AVTA 4BRWA 5BV8A 1W59A 3UAVA 3EG9B 4ZV9A 1KC7A 4P35A 4BBJA 2NP7A 3BD6A 1YCGA 4H3HB 2YJTD 4Q9JA 1AQLA 1ZNWA 5IUKC 1JLLA 4MV4A 3ROFA 5J63A 1G7RA 1VBGA 1V3TA 2LE0A 5FPQA 2H4WA 4QD3A 1XQ1A 4UE3S 4U4AA 3N6VA 2PBRA 3L8FA 4AN1A 3K0EA 5EVJA 3LIPA 3OCCA 4PYJA 2J09A 4R2XA 1GFIA 4PZ0A 1XJQA 4GBMA 4B2PA 2NQ2C 2G77B 4HL6A 3LQ1A 4TV8A 5DM4A 1F60A 4H77A 6NULA 2JJ1A 1ZXLA 2A3NA 2ET6A 1PU2A 2HNKA 1GU0A 1W29A 3IB6A 1P80A 5CT9A 4PQEA 2HHJA 3EEOA 1SKBA 4JQYA 3G2IA 1RZ3A 4ZHQB 3WGOA 4ECUA 1ZA2A 5GZ1A 5LYJA 4EFMA 3QGMA 1PKXA 5LDGA 2BSQA 4GR4A 3OHAA 5BWBA 4P22A 1WRBA 4AQ7A 3T12A 4EHIA 3V4RA 4OP1A 4WCDA 1NG9A 2Y2VA 2AQ8A 1XIVA 3ZHVA 5JTTA 2PUJA 2X7JA 4S2EA 2IV7A 4LBZA 3W1VA 2L82A 5DEIA 1N6LA 1ZM3A 3QMMA 2Y99A 4G2NA 1NYQA 4YNBA 1T0BA 3N2ZB 4TVIA 4ETMA 2ZBVA 2ZYRA 3LOUA 1BH2A 4TL6A 3ICQB 1F6WA 2BFBB 3A3KA 1TYZA 2WE7A 2PD6A 1IZYA 4RD6A 1T3SA 4HDMA 1NW5A 1BVHA 1QLJA 2GWHA 5EMKA 4B7ZA 1XLTC 2H1CA 3U37A 1U1FA 4UUQA 1FFDA 3OP1A 2JFBA 4RD3A 3VZSA 5A0FA 2MIIA 3D2BA 3TTUA 1OFTA 4D9CA 1AVTA 5FUBA 5EIWA 4I2VA 4HRAA 2OV6A 4CKEB 3KKZA 4N5IX 1EJ6A 1KAGA 5FL7A 3ZEAA 2GF2A 1A97A 3O2NA 1QM5A 2II6A 1ABFA 9ABPA 4GBED 3NFRA 3IVMA 4ZEXA 4I5GA 3KRTA 2XMZA 1YWGO 2PFSA 4PS0A 1RPTA 3AI7A 2OKGA 2XMQA 4TYYA 1LC3A 2O1XA 4UBLA 4UCWA 4ZU6X 1L5WA 2OE2A 1JDEA 5HBRB 1Z4LA 1JB1A 1I2BA 2JGFA 5GVSA 4JGIA 5BOSB 3W05A 3R40A 5E4JA 4QX6A 3OO1A 1VFPA 3MTJA 4ZZIA 2R8EA 1MV5A 3IO5A 3I39X 2IYOA 3TMKA 2HA5A 5HG0A 3HHEA 4CLDA 3R4VA 5DYIA 1L8XA 1J00A 4L27A 2OZLA 1U7ZA 3L02A 4IZOA 3L7KA 3I73A 3LQKA 4CKCB 4INAA 3HV0A 3Q10A 2BAGA 3LL7A 4NPCA 3VKVA 3UB3A 1B15A 3T7EA 3L8HA 1NW9B 1L9XA 2IQ5A 5LMCA 4E5MA 1XD2B 4HV4A 3CZAA 1RYMA 2CE7A 5C34B 1P0PA 2B3TA 4DCSA 2EKLA 3F5SA 1CZUA 3WYDA 1ZBDA 4XWWA 3NKVA 2C2DA 1CLUA 1F2VA 1T2CA 4S1OA 4K87A 3BIXA 4AJKA 1SKAA 5C7OO 1QNLA 4O7SA 4PPGA 4PBSA 4IIJA 3B1JA 4BFXA 4F4WA 1QSGA 2DJIA 2WHQA 1N3YA 4O4IA 3BZBA 1IAQA 3WP0A 1Y34E 1N6KA 3VO1A 2BFCB 1IY8A 2YASA 2JIDA 4Q16A 3E9QA 5IHXA 2X76A 2GBCA 4J43A 2Q46A 2Q9UA 5GJCA 4Y9UA 2RGXA 1PG0A 1QWSA 5A4AA 3QFTA 2BTQB 2V0NA 4LFAB 2YMPA 3NYRA 3VSDA 1LQ2A 1I30A 1KOFA 4KWEA 1DI0A 1MUUA 3DUWA 2QF7A 2LD4A 3VTKA 2DWUA 3NBMA 1Y4AE 2YJGA 4QW9A 1Z0JA 3PWTA 5C8YB 3ORRA 5CA1F 3H75A 4S12A 3RJMA 3MUNA 2OLKA 3RCBA 1FFGA 3GBVA 1JXQA 2WU8A 2V54A 3K9QO 1F3OA 3HN6A 4H7EA 4MB0A 3JSAA 1VL8A 4ZZ2A 1FJXA 5IZ4A 2OFWA 5FWYA 2XXAB 1M66A 1T5BA 1RZRD 3VNVA 3NYWA 2C0QA 1X0VA 4FDVA 3R0ZA 1P1IA 2CLEB 5ES3A 2XCQA 3D9QX 4DMGA 3PR3A 1XWFA 2XQFA 3Q12A 4CNQA 4JITA 1RTKA 3QITA 3U7IA 3CLKA 1JA9A 2WIJA 4BFVA 4D74A 4EYKA 1CVRA 1SZJG 2ODNA 4Q24A 1WCYA 3LNTA 1N5DA 3H7AA 2XQKA 1ZHFA 3CRQA 2GGSA 4GC5A 5KVAA 3AB8A 2PEYA 2I4LA 1SMKA 3PE3A 4AXXA 3SX2A 4OI1A 2L69A 4KCGA 3OAAD 4DBLC 1TECE 2V4RA 3WO1A 3INRA 4U6NA 4U8HA 3KK0A 2NP6A 1VPLA 4GL2A 3AQ4A 2NW6A 4RB3C 2AN5A 4XWAA 1WXXA 4BZPA 1N33H 3RTAA 2FZ5A 3RDPA 3UK6A 3KQVA 3WKCA 4JH0A 3IOBA 1JR2A 4M76B 1OOEA 2QVGA 3DOHA 3EGXA 1JBEA 1KEKA 4RA6B 5FR9A 2JKZA 3RB0A 1II8A 1ZM2A 2B8WA 4ZAXA 3D6UA 1XMOB 2OLSA 5CYPA 2DKOA 2V5UA 1MGPA 2IWHA 4MV3A 5C5DA 2HEGA 2WTBA 4QYXA 3ISTA 2ZIEA 1NJ8A 3GAAA 3UO8B 2R7ZA 1IIBA 3RVMA 1CW2B 1SOVA 4ERNA 4EQ5A 1WB5A 1VJGA 3AUJB 2KM1A 3SBEA 1GVHA 1JQAA 8OHMA 5FKJA 1ZICA 2WFAA 5I3ZA 3VR4D 5L4SA 1L5KA 2Q8NA 1ZMTA 4JT8A 1OCEA 1I4EB 5B7GA 3JR3A 4O81A 4UBKA 4FU0A 4KQWA 1NQUA 4DV6B 2Y93A 3RBVA 5DSXA 3JQGB 5FBKA 3HO6A 3NLLA 4PM4A 3KPJA 4MVJD 4PO1A 4A0GA 1UCFA 2O8CB 2QMHA 3W5JA 1DNPA 3HV2A 1IJBA 5KTRA 1JJ7A 4O2BF 4G81A 4GMXA 3B1KA 1PEAA 3WK5A 4B47A 5AUOB 3DLBA 5CLQA 4OYHA 4BO5A 3F5FA 1T8PA 2O2YA 2IZ7A 3HCNA 4KNVA 5TQ0A 1A0OA 3AJAA 3H9QA 3BA8A 1E2LA 3CBGA 5CCDA 4DA8A 4LF9H 3FSGD 1FMTA 1RC1A 3KQKA 2NO4A 4Q48A 3Q0IA 2I2AA 3FRJA 3D8UA 3FZQA 2A9OA 3WGLA 4RUKA 4C3UA 3I5XA 2MMCA 2WJZB 5DM70 1Z17A 1SOAA 4ILEA 3T7SA 3OJWA 1LCIA 2FFBA 4RJKA 4ARIA 2VJDA 5EIBC 2VTEA 3BCUA 1KRWA 1XEFA 2GJKA 1V5FA 2JGAA 1LBSA 2OSVA 4WCFC 1U90A 4O86A 5JJBA 2WAXA 1CR1A 2P67A 1A2OA 2V4ZA 2X0FA 2QIPA 3UWSA 1EA5A 1ZN9A 4PAQA 3D0RA 2VJQA 3EY4A 1EP2B 2XZLA 4ARSA 2YY7A 4HYKA 3A3NA 2D6FA 1L1RA 2C3PA 1N7JA 1H69A 1DWOA 4YRAA 2XZTA 4N1AA 2RI0A 5CT5A 5FEMA 3QBVA 3VA7A 3V4FA 1AOXA 4OA5A 3LMLA 1K6JA 4MPTA 3WSTA 1ISFA 3TI9A 4DIBA 5LOVA 4PX9A 3LPNA 5JEDA 1P5ZB 1XNQB 4J9RA 1SXPA 3KSZO 3QFHA 3SC3A 1XK6A 1I3QA 2MSDB 4IDBA 1QIJA 2WABA 4AECA 1PYGA 2ID8A 3JQBA 4HUQA 3L1KA 4QDTA 3AV3A 4A5SA 4LRXA 2ID9A 1G18A 3LKVA 3ZY6A 2OGZA 4GDMA 5BN3A 4RZIA 1FW6A 4M0CA 4C7VA 4A91A 1AUQA 5EWEA 4O2RA 4YACA 2CC2A 1X8KA 1DQSA 2V7EA 1W2GA 3OLCX 1DO0A 1TF7A 1U99A 2FG5A 4KXXA 1CZRA 3TQOA 2E9SA 5IP5A 1UXKA 1ZMBA 3RREA 1CCWA 4GLBA 2GPYA 2CXHA 4ZOLA 2FSVA 1WNTA 2OILA 2YHIA 1UL1X 3LX4A 3HY4A 2NZXA 2VYVA 1C50A 1G64A 4WLVA 1T2NA 4QARA 2C57A 3BRWA 1UMDA 5JZSA 3GPIA 3TZ6A 4H7IA 2Z3WA 4CM8B 3NH6A 1FFAA 3D7RA 3MJDA 3KP1A 1J33A 1GNVA 2CJWB 4GOLD 3WO0A 4N3CA 1OB2A 1T0JB 4OQPA 4E0BA 4FOLA 3PUWA 3M34A 3P2OA 4QUGA 3WWZA 3GLTA 1QO7A 3J81A 4X62H 1P91A 1HT2E 1GPMA 2ZRJA 2VQFB 4CHIA 5EMLA 5I5GA 1FNSA 2OZKA 2PS9A 4X8OA 1PFGA 1PP4A 1DADA 1PLJA 3RYHA 5M7EA 2D13A 4A3KG 3WI7A 4BMDA 2WIDA 5HZHA 1C14A 1MP0A 5AI9A 4RPLA 3AVXA 1INLA 4BX2A 4ZQHA 3OLVA 1N34H 3ZS9A 1AB5A 1LQTA 2G63A 3OU2A 3JU3A 3UKJA 1DC6A 3T54A 4WW0A 2V7QA 5FFNA 1EXVA 1XMQB 3RUCA 1YU6A 3WLOA 4TGLA 4WVLA 1J42A 3FCEA 2VYNA 1FW8A 1RBMA 4NG5A 1DBVO 3H3XA 2JLSA 2JVIA 3DSRA 5CTJA 3MJ4A 5SZJA 2H4YA 1JWLA 5C3MA 4M9ZA 3HHPA 1CR0A 3STXA 3VX3A 2LDBA 5DQHA 1U80A 1BQEA 1K4MA 4XM1A 2PQMA 1M1YE 1YS7A 4WNIA 1I3NA 3TIFA 1KC1A 4XUEA 3OEEA 2W0SA 1U2EA 2I2DA 3SP1A 3K32A 1RJ9A 4UJ5A 3GEGA 5MGNA 1U7WA 5AK4A 2VUTA 3WL6A 1UBCA 4UHBA 2IMWP 2D7CA 2POQX 1L7PA 4DL4A 4BMZA 1QZXA 4K0KB 1SFRA 1KMHA 4Y2VA 3G8BA 2FRVA 1NBHA 1R4NA 5IUJC 4TMKA 3JD2A 3AR9A 1U2PA 5AK0A 4Q1VA 4KBYA 2H59A 5TPZA 3PLNA 5KFVA 1KO7A 3KSMA 4C05A 2RHWA 1ZZEA 1PF7E 8AT1A 1LFDB 1VJ5A 3T1YH 1BCRA 4HNHA 5JYBA 3RFFA 4Y67A 4C0WA 1SIBE 4RENA 2VYND 3TS1A 2J3MA 1NVAA 1B1AA 4CMEC 2VWGA 5FO0A 1JDZA 2VK4A 3JQ8B 3T5TA 3GBPA 3B7GA 4AJLA 3W0LB 3TGWA 2OO5A 1EX6A 4GM4A 3ISVA 4ZJPA 3H8SA 2NZ2A 1MAVA 3ROKA 4G24A 2CFOA 4XEHA 1OB5A 2CL6X 2IYRA 1BAPA 4Q3DA 1EVKA 2OAQ1 2B4KA 2A3RA 3DHVA 1E61A 2QU8A 3AUUA 2UZ1B 3B1VA 4KUEA 2JNWA 1Z47A 2NPOA 2HNBA 3THYA 3IVGA 5KMGA 2W7PA 2BM9A 3O1JC 3IERA 2WRZA 4OTZA 1RZVA 3RTBA 1GQYA 1J07A 2KQUA 2O5EA 1QTQA 3F6SA 5COQA 3NHZA 3TMYA 4BKQA 1Y6QA 1ECGA 5A05A 3PFGA 3IH5A 1U5CA 2H3HA 2W9CA 4G3IA 2Q0XA 3ZZMA 4QPJC 4FNOA 1TF2A 3K72B 4NH4A 1E18A 1JU4A 3H0EA 1IN5A 1U94A 4HYYA 2UUOA 2FR1A 3NIDB 3Q3EA 3NTXA 4URXR 2FLNA 1C1YA 2DVMA 3ZQJA 2MMGA 4UOQA 2FPIB 3KXYT 3C5CA 1SIWA 1NX9A 3FFTA 4L15A 4L8VA 3V34A 3W2GA 2ZQ5A 4FE4A 4IGIA 3GDEA 3IPXA 3QLTA 3FY4A 3UPTA 5J2UF 3T41A 3V6LA 4OB8A 1HYGA 1RK5A 3ETNA 4PF1A 3QG5A 4HAUA 2W8BB 3RF7A 4YT4A 1W36B 1B42A 5CDUA 3T8YA 3H3VH 3UCEA 4RM2A 3CWZA 1QUEA 3KQOA 2BQRA 1JFRA 4OFWA 3WYBA 3M7IA 3VC2A 3QU4A 3SICE 1DGSA 4ETSA 1LDEA 4ECWA 4IJUA 3J7AC 2O23A 5JS1A 4JB8A 2Z08A 4M49A 1D4ZA 5EQDA 1E20A 3ZCSA 3NHBA 1GQSA 3DPIA 2IEGA 5K05A 3RYFA 3Q0EA 3WWHA 1BZYA 2CVOA 1TB4A 2BKAA 3PZRA 3KKPA 4LX8A 2R1TA 1G55A 3KAJA 2HIMA 4BFLA 3VPDA 3UHFA 3EXIA 3QU7A 2ZB4A 2IP2A 4LY9A 4FYMA 4FHDA 3RJ0A 4JDUA 1AO0A 2FK3A 4F45A 3DZDA 3S6JA 3BK2A 1TFRA 1JXAA 2C07A 4AM8A 4EHLA 2GKOA 1I01A 3UENA 3K6KA 2L18A 4HXFB 5J4YA 1TNDA 1A0GA 3ZH9B 5GGXA 3F5MA 2ZCUA 1KJWA 2O5VA 1Z16A 5I7WA 1DIOB 3NNNA 3EPKA 5FBWB 3RHSA 2P1DA 3LY9A 4D42A 2DFKB 4RIGA 3KSBC 1LX6A 4RPHA 3QXSA 4C6HA 1NXWA 3QF4B 3N41B 4HEHA 1GY8A 1P74A 3EA4A 2JFNA 3EG9A 2QLFA 3NASA 3L18A 4B46A 2XNCA 3C3YA 4EA6A 2XQJA 1OBFO 1P2BA 1J5XA 4WDQA 2NQ8A 1GTVA 5MN6A 2JD1A 1LS6A 1E5DA 4A8TA 1O0SA 4OX9B 2QSYA 5EJ2A 4DADA 1Z4OA 3AMVA 1TL7C 4EY5A 2GM5A 2X0JA 1Q2XA 1XXHB 5G0SA 5HIMA 2A5GA 1QLWA 2EEPA 2RARA 5L9AA 1UDAA 1YKFA 2HA2A 1HDCA 1OJLA 1VSBA 4FOOA 1NVBA 3QPDA 1OTXA 3A1DA 5CVEA 1IQ0A 3JQ9A 3P5SA 1HI9A 4K9DA 2PNJA 4MARA 1NU6A 3IQDB 2W6NA 1DAGA 3FZGA 4JC4A 1O5TA 4EJSB 3KAQA 4L7VA 5FI1B 3EXHB 3DWIA 1SCBA 2C2KA 5JY1A 2X0RA 2XMSA 3HMKA 3VHQA 2GA9A 2WYVA 4QT0A 3FYUA 1G7SA 2B21A 3OUTA 5BWTA 1NLMA 4KQMA 2WWGA 3UK0A 6ABPA 1RHJA 4EO9A 2CCJA 1QWOA 2R00C 1OFUX 4WK6A 5IDVA 3DBLA 4J0IA 5LA6A 5KVCA 1VSQA 3UYKA 2ZVDA 4O4JA 4P7JA 2R0QC 3TY5A 4MK4A 3L8YA 3TSCA 3VYVA 1GDHA 4PYNA 5FV7A 3GO4A 2EFHB 1XJWA 3W9YA 2JDID 1YHZA 1PSZA 4Q3NA 5A4IS 4I99A 4FE7A 3GAMA 4EPXA 4RH1A 1PK7A 1TCVA 4HI0E 4EEYA 2DERA 1UDBA 1FDRA 2FWIA 2XY4A 2WSSA 1S68A 1SVUA 1DAAA 3GHYA 4LSZA 3OP4A 1N1DA 3TOXA 4Q7MB 5H9VA 4JP8A 4ZZ0A 5C7IO 1UWLA 4ITUA 3U61B 2RHLA 4N0PA 5B64A 5CDGA 2V74B 3W1BA 1KMQA 4MUYA 4XGIA 5JS8A 2FWPA 2KMLA 2GVNA 4H4EA 1QHGA 2ZSKA 1CEXA 3I6YA 2FETA 1M2WA 2R1VB 5TMBA 2FKNA 1LF5A 4BO7A 4S0ZA 3R5HA 2RI1A 3M3HA 5HBRA 3T1HH 2VEDA 4DTIA 1FQWA 2B3DA 3G9ZA 4TM5A 4WKPA 4DVJA 5KT3A 3H65A 1XNHA 2CLLB 2VAMA 3LS2A 3A7DA 2L2QA 3DL7A 3I9MA 3IEMA 3R3ZA 1HMPA 2HDHA 2OYCA 1L8LA 3ZWCA 1GAJA 1C4KA 2C95A 4QREA 1IY0A 2Y2UA 3KJGA 2OFOA 3D1LA 1OAOA 4KWIA 2HWWA 4ND8B 4D97A 1ZEMA 2O0HA 1TZKA 5EEGA 3B12A 2QENA 5JPCA 3BH0A 2PGIA 3T1VA 2PRKA 2EFJA 1B43A 1LVUA 4EAQA 4HGOA 2QUBA 5F12A 4BNNA 2R68A 4CJXA 4NFHA 3VV2A 1GPH1 3MD9A 3GJSA 4ED2A 1RYHA 4IIHA 4R84A 2WOJA 1HA3A 4F04A 3RAPR 4AX4A 4JQZA 3PV0A 3VR4H 1TK9A 2M6SA 3IKTA 3QE9Y 5FH9A 4U9IS 1QX3A 1SR8A 2P11A 5JSUA 3BWVA 1WXIA 1ZJJA 1RE0A 4R5MA 1FK8A 1E96A 4O59O 1EFVB 4C21A 4EY3A 1SUDA 5KSYA 5LXTF 1V7ZA 2QX6A 4CLOB 3ZE1B 3L5OA 3G0BA 3K0CC 2CLMB 4RTLA 3PGLA 2XGOA 3TL6A 2UVWA 2CXUA 2OTCA 5ERGB 3U3OA 3UXMA 1EK6A 5REQB 3KB6A 2PK3A 4EZEA 1H2HA 1MIOB 2AFIB 4H4CA 3TVDA 4FR0A 3TQHA 2XF8A 5A3SA 2BMFA 5JARA 2GJ4A 4D4JA 4W1QA 1MAAA 1XL0A 5EJAA 4V0LA 1ZYUA 4UW9A 5ALXA 1LBEA 1R0KA 3FNEA 2GEUA 3KR0A 4KQIA 2A9KA 5KFNA 2XXAA 2IUTA 4GPZA 4CM4A 5FPSA 1DKQA 4IM7A 2J1LA 3U3MA 3FNGA 3VKUA 4BATA 4DQDA 4NCHA 3FTQA 1NI5A 1WKVA 3QVJA 5I9TA 1PGNA 4XVRA 4MR8B 4OQLA 3AR2A 4ZT7A 3KZ1E 2PZ8A 3E3AA 2PMZE 3OCJA 5JCJD 4KEAA 4Q43A 2AOXA 2DTXA 4Z9XA 3N0TA 1ADFA 2YL2A 4IDPA 2ATVA 4XW2A 3K8QA 3I9LA 4IOKA 1G5IA 3JQEA 4YV1A 3NH9A 3H9GA 4BKUA 5T14A 1M2FA 4IF4A 3SG0A 4YLYA 3DLHA 4L5CA 5K3FA 4XVQA 4L6IA 2VHXA 3OE5A 3ZXSA 4MUAA 2ZKLA 4US1R 4UFZA 2EIHA 4A92A 1FDOA 3KNZA 3G1TA 3JQPA 4NYMR 1JMYA 4YRJA 3DE4X 1YDGA 3PN1A 4J2HA 4OJYA 3EQZA 5BY2A 2YUTA 2JF0A 3NC0C 1PW5A 2WSLA 5K0LA 4RZ2A 1SY7A 1Y9ZA 2NU8B 3IOEA 1JFTA 1QF7A 4XD7A 2RGNC 3ZHUA 4Q39A 3GFVA 1IAVA 3QJYA 1Y6FA 4FEEA 4HZUB 3B8HA 3OOYA 3BFKA 3I2FA 4BE4A 3U7QB 1XNRH 4DJTA 1L4EA 4ZTZB 1W1WA 5KYGA 4QUJA 5JXHA 2H6EA 2X2FA 3VI4B 5AHWA 7YASA 3ZDQA 4IHQA 5JYEA 3OZSA 2P9JA 2XR1A 2Q1XA 3HR7A 5BO5A 1AURA 1P44A 2PUHA 4UDOA 1JJFA 1Z4PX 1B6RA 1XX6A 1XC7A 2R6DA 5L3QB 3RTCA 1RPZA 4KXNA 1PQUA 2GYYA 4F4XA 4KX3A 4E51A 3F49S 1U4NA 1VMDA 2AZTA 5HKLA 3WQRA 1JIXA 1NV8A 3OFJA 4C6RA 3T9AA 2A4KA 1IHDA 1TU4A 2BFDB 5LIPA 2MU1A 4ARVA 5F2NA 2A9PA 5FCDA 3N28A 4ZGBA 4Z3DA 1P5JA 3HWX1 1E6MA 2CFIA 1KBOA 5JJCA 3HFJA 1ZH6A 4PIMA 2FQXA 3GGGA 3S55A 4UNNA 7ABPA 4BN4A 4UHCA 3U16A 4EFLA 4P3NA 3K92A 1C7RA 4MKFA 4E2WA 1XWIA 1PS8A 3RIZA 1BDHA 3BMOB 2F9MA 4CC6A 2JJ2D 2D5CA 5FBZA 4RL4A 1RWMA 3K9CA 1D1QA 1RLOA 3W3AA 3ZK9A 4WZBA 1FDUA 2ZDHA 4YP9A 2O5RA 4NJMB 4WJKB 5J47A 5H1YA 4KQHA 2Y0SA 3A7EA 4BKMA 3UK1A 1QFXA 5LWHA 2X13A 5MDHA 1NQWA 1QF9A 3EXFB 4EEKA 5CAEB 2R44A 2ADMA 4OP3A 2HHHB 5JI2E 5K09A 1CT9A 4HVLA 2W6ID 2EKQA 3VAZA 3RBAA 4ZTBA 1HZJA 4X20A 1CFJA 4O7NA 1MBZA 4COKA 1OXMA 4E1VA 5BUSA 3IVRA 1YUBA 2A9QA 3CBQA 1NBME 4QDXA 2GPBA 3G9UA 2FPKA 4YWJA 5I8PA 3OPYA 3BIFA 5JNRA 2C0PA 1F9AA 1AKMA 3F5DA 5LBTA 1HNXH 1NKSA 2H2FA 2AUTA 1QH1B 3SQDA 3VPBA 5DQIA 4GP9A 2NPFA 3UT6A 1AN0A 2YH2A 2Y1WA 4E3ZA 4IDNA 1KZ1A 2RGGA 1RJFA 2AGOA 4I55F 3MYYA 3U3RA 3FUVA 4ND3A 2C3OA 2G3YA 4LQ4A 1THTA 4KKXB 1ZHSA 3JQ7A 2P9QA 1R3DA 1KQOA 1FP4B 3UXEA 1YB1A 4KN6A 1A2QA 1FVOA 3QNMA 1I1OA 4YJ2A 3GLFB 2DPYA 5AH0A 4BWFB 3DCYA 2YJ3A 1X14A 2Y1OA 4ALNA 5E6UA 3X1MA 3OQVA 1TAEA 3KOUA 1YZLA 3E9NA 1V6AA 2VT3A 5I5SA 4RZ3A 1G1MA 2ZWVA 2IFTA 3X1JA 1Y37A 3DFZA 3I4MG 1H8ED 4ARZB 4RPIA 1T0PA 1WB6A 3RYCA 1MQ9A 3D43A 3DV0B 1WBBA 3AZPA 5DXAA 2X8JA 2WQ7A 1FJGB 4XIIA 2VP5A 3H4BA 5G4KA 1QE0A 2QN7A 3R1IA 4WERA 2FGJA 3IOYA 1P33A 3PZBA 4Q9NA 1SA0B 3DAPA 3T4PA 1KZ7B 5EMMA 1QIHA 1X7WB 2BCGY 3FD8A 4V0MA 4REMA 2DWQA 5BXYA 4XGNA 5A4MS 3UMCA 4FGZA 1NW7A 1OY1A 3L6OO 3QW4B 4LZOA 2EIXA 4BJ5A 4MJXA 1KP9A 1YR1A 5JDCC 4NE2A 4NF2A 4DQNA 3QX7A 2R7KA 1SC1A 2GYVA 2WD8A 4X1KB 5DTJA 1G5QA 4HB3A 1N32B 4QQNA 1JHAA 4PX3A 1XZNA 1Y4DE 4NBKA 4TS9A 4B31A 1ESDA 4DBLE 1XSEA 1U0JA 1PJAA 4TUYF 1LS1A 2UYOA 3FTDA 3M0EA 1NFRA 2X4IA 2IDJA 3ICWA 4KVZA 3UMBA 3BBLA 2YTZA 4NBWA 4G5XA 1L4BA 3I30X 4QTXA 4NCJA 2GEKA 3L7IA 4TTRA 3UB4A 4RK1A 5HPYB 4CV2A 5AWFC 1SHLA 1UZUA 2RD2A 3MR5A 3LZ6A 3LUKA 1OVGA 3NPMA 3PDHA 2EGHA 3RSLA 1M76A 4ZHSA 3RASA 1BWSA 1E2GA 2AFHE 3KB2A 4URVR 2UVPB 3INGA 5I4KA 3SNOA 1Y4UA 1JEQB 4AZ0B 1E2BA 3SR4A 1J99A 2NACA 4ETNA 3DEKA 3CEMA 3GL9A 1LLUA 3IHLA 1UJNA 4EQZA 3SQOA 1FC0A 4LZZA 2CLCX 1MHPA 2IHZA 4HUTA 4EL0A 4H08A 2O2DA 3G17A 5BSRA 2FPMA 3EPHA 1O03A 3B85A 2JJMA 1MNQA 4Q1FA 1UP6A 2IF0A 3DE1X 5CEEA 2QU7A 2WPDD 3AKYA 3ENKA 3KLPX 3CV3A 3JQ8A 5AHKA 2O48X 4EG4A 4LC9A 4ZVNA 3QVGA 4N5MA 5LBIA 5U4QA 2Q49A 3RC7A 2AWOA 2IOFA 2RH9B 4NENA 2X22A 2C03A 1P5HA 1XPUA 3VJKA 2GKGA 2J7PD 3DE0X 1REQA 3CNEA 2XLBA 3G2JA 1ZHOA 2VDKB 3LT0A 3MAJA 2RGWA 4X65B 2YIVX 2UZ1A 3LF2A 4WESB 5TB5A 2OBLA 4F85A 1QK3A 3OFND 2CFMA 3KEGA 3JW8A 4TKUB 5FR2A 2UXBB 4KMOA 2C4NA 4RV4A 4JC5A 4OHMA 1HEIA 4HAWA 3KVVA 3SJZA 4G8BA 3P9XA 3T6KA 4RE5A 4X84A 4QBIA 2PRYA 2WT8A 2P7HA 4U3JB 2XUKA 2VCEA 3HKCB 2FLKA 3SQNA 3EVGA 3W2FA 1A9OA 1YRQA 3GUYA 2WV7A 3HVUA 1I9GA 1XELA 1FVFA 3MB5A 1DOAA 3H2BA 2EX0A 3DEJA 2E4YA 3O26A 4F6RB 1OYYA 2IPMA 1X92A 4Q3KA 1Y48E 2OXIA 3B9QA 1VI6A 4F4CA 2PGOA 2XTZA 1JPVA 2FPIA 1NATA 2CY0A 3EXEB 5C8XA 4TXLA 2FWNA 3BE5A 2OQIA 3K35A 5BR1A 5FJ8G 1W5FA 5FPOA 1OBCA 1F8YA 5SYAA 4K2AA 1GA4A 4QA9A 2IKQA 5DTIA 4DR1B 2B25A 1ZM7A 2AJCA 1JAYA 5D8DA 3JZ6A 4MW7A 4QRDA 1P7ZA 2UXDB 4QHTA 4F46A 3NAQA 4M0JA 1THZA 2VPPA 5A02A 2IUFA 2HQSA 2D2FA 3M9WA 3QZ7A 4KQ6A 3PEVA 2B63A 3H83A 4JLJA 3SCZA 3RNOA 1QHHA 5I3CA 3HLTA 3DXYA 2KBFA 5K3BA 3AY0A 3D5QA 3WGZA 1R3UA 2HI0A 1HR0B 2QLTA 3LULA 4AJEA 1KVRA 1IHYA 3IAAA 4OMUA 1KY4A 2W2VA 2G4VA 3QU5A 3P9ZA 4DZRA 1QS0B 4YYEA 2AMYA 4IL5A 4DRYA 1KZ9A 1RSZA 3A6PC 3A3YA 1CKEA 1PFVA 2OORC 5D1PA 5CT6A 2VP9A 3WLQA 5EHXA 3K5HA 2DH5A 2I6TA 4KQ2A 1G21B 3HOWG 1WE2A 4X7RA 4QOFA 1NNI1 4AF7A 4B34A 2VO1A 3N0VA 5B12A 2VCYA 4K5QA 4TT3D 4O7YA 1GCUA 3HU1A 4I9NA 2DHEA 4B75A 1VGQA 1M67A 2H18A 5CITA 3W5VA 1W36D 4UEQA 3GVCA 1OUMA 3LT5A 4LRYA 4R1PA 2NTJA 2WU1A 3LVQE 3KWLA 5IT0A 3AM3A 3Q6IA 4RKFA 3OZCA 1EAYA 2J46A 2QTZA 2FMUA 3R24A 5EYPB 3U49A 4WJLA 2P6NA 1EFCA 4BNIA 2NVYA 1V9CA 3MR6A 4X24A 3TCXB 1Y8RB 3W90A 4HY3A 4AZVA 1L7DA 1Q1ZA 1IXRC 3DT8A 2OBNA 4TS1A 1K8QA 3AR3A 1N2CA 2I55A 4BUCA 5G3YA 3UT5B 4J9MA 4HBGA 3T5GA 1RZRA 1DDGA 3CRRA 2HMWA 2YV5A 4MVYA 4M55A 1ZOLA 3TLCA 3AW9A 1ECJA 4BZXA 3G0DA 3DEYX 1N77A 3QXGA 3SFTA 3V55A 2BIFA 4FMDF 3RRJA 3CZRA 4Q05A 5EOYA 5EZQA 2OPBA 2WFLA 1IPFA 1ORTA 1Q1BA 2DRIA 2YWCA 3O8RA 3EXHA 3WLIA 2YU9A 5TMDA 5BYAA 4PGGA 1MX5A 4Q4DA 3Q88A 3K4QA 4J1NA 3MRTA 3MINA 5EXDA 2B37A 3ZU3A 3ESBA 3KIPA 2QTHA 1F4VA 1ZM9A 3GVIA 3GA0A 1UAYA 4YN3A 3I3SR 3B3FA 3KR2A 2OAEA 3R8FA 3OAAA 2JB9A 3PUVA 1O0BA 5AI4A 3CT6A 3WMGA 4BFZA 3FMAA 2ALZA 4ENRA 2WAQE 4TYQA 3N42B 2GBPA 3ZDDA 4TMZA 2O57A 3FNHA 2ZS9A 1E9FA 4RFSB 4C01A 1AZSC 2CSUA 3ABIA 3F6RA 3QWHA 1EVIA 3V42A 2QT1A 4INZA 4FGJA 4WLEA 2NU7B 1JXLA 4X97A 3FKIA 3SX0A 4Y2JA 4ZCIA 3V1TC 3FYTA 4HADA 4M1YA 3WP1B 4DA0A 5IHPA 2E4VA 3QE3A 4NATA 5ED0A 3LIIA 8GPBA 3K3VA 2XJ9A 1T9GS 1Z6PA 3P32A 2AE1A 3ASVA 3QKRB 3RPEA 1YH3A 3WRXC 3COWA 4JJAA 4MHTA 1ZN2A 3I6BA 4MJ7A 3MG9A 4Z54A 1S7CA 5BVGB 1YTUA 3VR4A 4PQRA 1IRXA 4GLXA 2W6JD 4RADA 1Q74A 2C3YA 1P72A 1R8JA 4WCVA 2NZYA 4TMXA 1Y8ZA 1NNLA 3ISJA 2Q5IA 4M1QA 4CCSA 1NM5A 3R41A 2QAJA 1RYRA 1TAHA 2IYWA 5IBPA 3IUPA 4MVJA 3I12A 2J41A 5IAEA 3I9OA 1J7JA 2WJIA 1RIFA 4JIMA 4BN5A 4JP3A 4N6GA 1XYGA 1TKCA 4BV3A 1KJQA 1TC1A 3BXFA 3PYMA 5I5XA 1KH2A 1R4MA 3R7DA 3RVDA 2XA9A 1AUVA 2ZSIA 4B76A 1Z74A 3EW7A 1DWUA 1H6CA 4WKOA 3RTDA 5LLTA 1RCUA 3TSAA 4B4KA 2H9YA 2J9FB 2C5LA 1GSHA 4FYKA 1U0FA 3FSGA 1UK9A 3LRTA 4LJ6A 2NAFA 3QUTA 4DNFA 2WMNB 1BHO1 3IPCA 4XR9A 4NIMA 4P83A 3GGPA 4JUBA 4YV2A 3KXIA 4LHWA 4H7DA 1J5PA 3RAFC 1KK2A 4JK3A 4UBMA 2DPGA 4KFTA 1QFZA 1GFWA 3E2IA 4UVHA 3OLYA 4ZVRA 3NWPA 5KDLA 2QQEA 4P31A 2QL7A 4QLOA 1I0ZA 1R6XA 3DF7A 4Y0VA 3VU9B 3HO1A 5A7FA 3QU2A 2QRGA 2EFGA 1IXZA 1KK1A 1TLFA 1CUZA 2ZANA 3QKWA 4I36A 4KBFA 1ZVMA 3WQSB 1MFZA 3LTNC 5KO2A 4TQSA 2GZMA 5REQA 1MJGM 4RMNA 4RQAA 4F2GA 2ZPUA 2AG5A 4HX5A 1XMOH 1RFGE 1Z26A 5JC1A 2WJVA 3EEIA 5ICEA 3LOQA 4O4LF 3NS7A 3IG0A 4AURA 3SM9A 3CWCA 1YZKA 3PUXA 5J4KA 2GAIA 2AGQA 4HT3B 3QI2A 2P69A 3DOOA 4C87A 1O94C 4HNVA 1BOOA 1MTZA 2I34A 4TKVA 4L9WA 4Z9FA 1TPYA 4OFXA 4C7OB 3IIIA 3LQ4A 2VJOA 1UXGA 3SXUA 2BHNA 1JWAB 3WHKA 2PSDA 3GLHE 1EGVB 5KT5A 3CCCA 2JHGA 2YJ4A 1MPXA 1JALA 3T7CA 3TPCA 1UDWA 4MW4A 3JYLA 4K9SA 4AJ4A 1U1GA 3LQYA 2A9FA 2NXNA 3ON5A 3JARB 1I50A 4MR8A 2XZDA 4JEUA 2AXNA 1PRYA 4DV6H 3M1AA 4JQOA 4YRTA 2ZJ5A 5BMVF 1ODSA 1FUYB 1CUSA 3PR2B 3BXOA 1N36H 3C3XA 2NU6A 4K6FA 4R7GA 3OZFA 3RGWS 3TSZA 2OHGA 2AJDA 1PR3A 5CK4A 4UBIA 2CW8A 1VI2A 5J4HA 4MUKA 4MS1A 4QAJA 2QMUA 3H3FA 1CUJA 4K9LA 2HVSA 2QY9A 3S40A 3ZWQA 1QO9A 2FEAA 3UQYS 3DC7A 3ZWNA 3EBLA 4K6CA 2FR8A 1E5TA 1ZAUA 2Z6AA 5AM4A 4CMIB 1FFXB 4FUTA 1M9NA 3VR0A 3ER8A 5KHOC 2VDWA 5CIQA 3WG9A 2V7UA 2Y6UA 2IHBA 4OLHA 3ZWOA 1Z7EA 3DD5A 2AF3C 2NU8A 4M0DA 3OQMA 3MLEA 4QEDA 2G5TA 1G41A 2V3CC 3UICA 1XCJA 1DEAA 1YR6A 2C7BA 1X7YB 2IXGA 3T1TA 4UMVA 4HZUA 3GJ3A 5JO0A 3I01M 1RI5A 3W3AH 1A8SA 1OU0A 4W9RA 3SLKA 2PBFA 2RK3A 2FTKE 3ELYA 3VYTB 3OPNA 1E9EA 4N0QA 4UVDA 1Y81A 1VKOA 1O8CA 1ZRHA 5J3JA 1ID8A 4AMVA 1YFJA 1NURA 1YBHA 2J6UA 3THXA 3CLSC 3MRXA 1V35A 4MA0A 2F43B 3P2EA 4GGOA 3CM0A 3KKEA 4Q7JB 2KYRA 3STWA 1T36B 4HAIA 2IY9A 1N6OA 1XNQH 4UQPA 5LC1A 3WK7A 1KEEA 1E3IA 3GYBA 1HH4A 3R76A 1G20B 1AU9A 1SB9A 4J1QA 3I64A 5HK9A 4OHVA 2QS9A 3SOZA 1KO8A 2ZZNA 2AIRA 1DB3A 2DIKA 1W4RA 1C8KA 5FUMA 1BWPA 1E9SA 1PW7A 4JENA 1IYEA 3AVVA 4IOLA 3G0OA 3RAXA 4N0DA 4GPAA 3QKSB 4QEZA 3R9RA 3I32A 1RJGA 1MJHA 2OCGA 1NDQA 1Z39A 4LZJA 3QNUA 2GB4A 2TMKA 2XVAA 2HDOA 4O3OA 3CVUA 2G6TA 4A93G 1NJFA 1NKTA 4CCWA 3F3KA 3NIBA 3NBUA 2J3EA 4D46A 3WWJA 1JEAA 2XD9A 3E1GA 1QCCA 4UAVA 3GB9A 4XVHA 1NVTA 3ORQA 4YJDA 2WB2A 1EWQA 2PA3A 5C51B 4BP1A 1NVEA 3RGZA 3BMOA 1NVUQ 1VB5A 2HSZA 1XRNA 5CA0A 1JYEA 1CUHA 5E2AA 1ODKA 4I7EA 3K70C 4L8GA 5F33A 1SUFA 1E4YA 4Y8VA 1YA8A 1PAUA 3JZAA 3SXJA 2WYOA 2ISSD 3K6JA 1EDOA 5DXFA 5ALSA 5AVXA 1K4KA 4LYDA 1GOTA 2BGKA 4L0CA 4P36A 1UKAA 3JD3A 2O4CA 3S27A 2VQFH 1D6MA 5CAEA 1EVZA 3UN1A 5AW5A 3DLIA 2AMJA 1VG1A 3JZFA 3IB3A 2OCIA 1P8JA 2O05A 3H1BA 2BKXA 1ST3A 1IUNA 4RDHA 2GEBA 4KIJA 1ZQ7A 2QUIA 4UKDA 2Q5HA 4EMSA 2QOEA 3LYAA 1JMVA 4DC9A 1GZ7A 5KQRA 3VNNA 3KVYA 5F9FA 4RJTA 1XMQH 1PWEA 4Y2UA 5B6JA 1JU3A 2CE2X 4P38A 1Z4NA 2CWWA 2A78A 3REQB 3VMMA 1L3IA 1EFPB 4R1LA 13PKA 3TEFA 3GVPA 3HL0A 5C7YA 3PPIA 4IH9A 5GQSA 1HQYE 3JQDA 3Q7EA 3HA5A 3PO3G 4TL8A 1NN5A 1QHEA 5T4HA 3EARA 2P1ZA 3KZOA 5DI9A 2AS0A 4ECSA 2I2BA 3FFXA 3V1LA 3TLEA 2O9JA 3GC6A 1CRPA 2C2XA 3GLFA 3ETHA 4BQQA 2FSIA 1LD3A 1YF3A 4P32A 3Q7QA 2HLHA 2W70A 1FLNA 4G41A 2KSQA 1UBUS 2Q50A 4ZREA 2VQEH 5EGSA 3AB7A 2ZVPX 4CDGA 4ENUA 3C3WA 3PXBA 4GMDA 3TEJA 4B3GA 3INNA 2A0KA 2P0AA 4LE0A 3BWEA 1WUHS 4EI9A 4Y1RA 2V8BA 4DDWA 4K0KH 1HZZA 1G5HA 1EG2A 1NN3A 3CUWA 1EXDA 4M36A 2G09A 4FD3A 1CUCA 4CUJA 4GEGA 5DN6D 2H7YA 4CETA 3GQVA 3TVYA 4J9UE 3HWSA 3K4PA 4XGKA 2JH9A 4ECAA 2HXGA 2BM0A 3RSGA 4YCCA 1NMQA 1Z06A 4UHHA 3TQ1A 1YS4A 3PFFA 2OAP1 1SOWA 5HS6A 1ZS9A 3A9RA 3QE0A 1R5BA 1TK3A 3TYXA 2Y4RA 3FPHA 3IT0A 3ZOZA 4TV9B 1TIKA 1P2GA 4B84A 3ZGLA 1R6DA 2OO3A 4XB1A 3EOBI 1NF9A 3PT5A 4N01A 1VMEA 4Q3BA 1MABA 4CM3A 2XCPA 1GR0A 1DAFA 4OHKA 3BAZA 5B1EA 5AKJA 5JR3A 2Y4NA 3KX2A 5TIIA 1ARZA 2AR9A 1EMDA 1T29A 3OF2A 4L6CA 1BQ3A 3R0XA 3KJXA 1A0IA 3DUFA 2IV3A 2Z58A 2AN9A 2WYIA 1HEYA 2BEWB 4PYRA 3LGAA 1HQKA 1PBTA 5GONA 2YV3A 5EZYB 3OSPA 3L7AA 3VR1A 3E5MA 1V71A 2ZPTX 1VJ0A 4OXIA 2ZTHA 2Y67A 5FNZA 3G2OA 5FULA 3FCUB 1XG5A 2RH5A 4HQKA 4QDUA 3AM1A 5JQGB 5LD2B 1Z68A 5CIWA 1IY9A 1MVNA 4LE1A 5BSUA 3A1CA 3DDHA 1PYOA 4WXPA 4E5PA 1QIEA 1NPYA 2X19A 3GA5A 2YR0A 5T4FA 4TKZA 2XODA 1XZGA 3WBBA 1I7QB 4TKMA 1RC0A 4G1UC 3D02A 3ICVA 2IDKA 4XPZA 3GLIA 1JP7A 4RAQA 3OUUA 2AWNA 4ENVA 1SQSA 4QOIA 4MQLA 3NDBB 1B93A 2Q7XA 3HM9A 3BJZA 3O3OB 3A9VA 2REQB 1TTTA 4S1VA 2O6HA 4GPBA 3FJ1A 4DPMA 2ZYUX 3CT4A 1N5LA 1X0XA 1XR3A 2W00A 2NQTA 3N70A 1Y8CA 3ME5A 2HGSA 1JNYA 1T6YA 5DYNA 2O3RA 3OZUA 7ADHA 1S4MA 5L1IA 4U6PA 1HOTA 1Y8AA 2EW8A 3OQOA 3SEZA 2ZXUA 2C97A 4QJ3A 4XA8A 2BJWA 421PA 3TSOA 1L1QA 2XB2A 3AHFA 4RK6A 2PXHA 2VEOA 2JDIA 4BECA 4EKIA 1JKMA 2GNAA 1W25A 1XUOA 3NT2A 3AI3A 2YZNA 5JSFA 4G85A 2Q2QA 4H6PA 2KHZA 1Q11A 4RFLA 2XIJA 4U3JA 1OIWA 5LB4A 4X90A 3PZPA 4L74A 3TZKA 1ABEA 2D1QA 5EQFA 2XWQA 2DT5A 5FUXA 4QC2A 2NSDA 3I2IA 4KQFA 4B3SB 3V1MA 1FY2A 3F9RA 4R2KA 2WZDA 3D4PA 5WRFA 2PL9A 3LC0A 1K98A 3C5WP 4GMHA 1K83A 4AJOA 4ZHQA 4MXDA 2P4HX 3NVAA 5T6MA 3G79A 3CZ5A 1NMSA 3TQIA 4MWCA 3QLUA 1U7TA 4QIWE 3C7TA 1QQ5A 4R1TA 1ADYA 1T4BA 1K1QA 5K8CA 3AHHA 3R23A 3NWBA 4F9EA 1RKQA 5IKPA 4PG4A 4OX9H 1BE0A 1XU4A 4FBUA 5H16A 4DG5A 3GROA 4UD2A 1RHMA 2EKDA 4LG1A 4EVSA 1QTNA 3LWDA 4RTNA 1MDFA 2BFBA 1MEJA 4UU1A 3CRZA 2IOFK 4UCUA 4X60A 1LSJA 3MTDA 3A1WA 4IFBA 1KAEA 4YS6A 1V3UA 1NXXA 3RU9A 4P3YA 3N40P 3A9WA 3S7TA 2R86A 1U2GC 3E61A 1YFLA 4UAJA 3RR5A 3I58A 5BW6B 3CVZA 3RTGA 3QIAA 2TMDA 2WTUA 4CKEA 3OEYA 1CHNA 5LSAA 2HSWA 1Q22A 1XZHA 3GNTA 1PWHA 1QS0A 3PVSA 3AF0A 4WINA 4GS5A 4YMIA 1PR5A 3TY8A 5DGIA 4B71A 4DLAA 3I5AA 2X2EA 4PZLA 1F48A 1KE2A 3OCYA 4N41A 4XWOA 3G5UA 4MCIA 2C5AA 4PZEA 2YWBA 4QQRA 4AUMA 4D56A 4G1EB 4P93A 1OMOA 1JR6A 1XAHA 4LH7A 3N2LA 5BOSA 1UH5A 1E2EA 5KOYA 5I9SA 2ZUVA 2ZE6A 1HC7A 2FG6C 3Q1LA 3CZCA 3GD5A 1ZI8A 2HG8A 2C9MA 1J0DA 2OHXA 2NG1A 1E77A 4XIFA 1R6VA 1BKSB 4LGMA 4CKCA 3OTIA 1JLKA 4A3IG 1BH6A 3E03A 6YASA 4M7RA 1IXKA 3AR8A 5HGJA 4OPMA 5EKXA 2GYUA 2GJAA 1OD6A 4ARAA 2FGKA 1W19A 1MW8X 3ZIAD 2H06A 5T57A 1XD2A 2G07A 2RB4A 4E94A 3WLSA 3T7TA 4D96A 3MERA 4MZDA 5IJ9B 1JAIA 1KJIA 3PS9A 1UXIA 3UC5A 1FVHA 3JWPA 4F1KA 3KPWA 3VM6A 2Z9BA 2ZWMA 4C4OA 3UMMA 3LSTA 3L77A 2OXRA 3NG1A 2C5SA 1QIIA 1Q0ZA 1IN4A 5HVNA 5JCJA 2BFCA 1RJQA 4AC9A 4UEJA 1K68A 4OBBA 3G23A 5C1DA 4MVJH 1WPGA 5EL0A 1C30B 2PGNA 4FMCF 3TIXB 5DAAA 2VUMG 2VTDA 4MWZA 4Q45A 2BTQA 3F98A 3WRVA 1M2JA 4GI2A 4C14A 4U2BA 4F9FA 1SCKA 2PUEA 3MS7A 3OWHA 1P9WA 3QW2A 2OWDA 4OK3A 1V11B 4JEMA 2IIQA 3WYNA 3UQ8A 3CNNA 3T4UA 5C8YA 2GESA 3X1ZA 2HF8A 1PL6A 2QMQA 3TR6A 4YIKA 3SGLA 1GAQA 3PNOA 2BR5A 4F38A 3K1JA 5GAJA 4RJJA 1TTPB 1PUJA 1T91A 4YUYA 3BFXA 2FN8A 4H9GA 2G04A 1V51A 3QIVA 2OCKA 1BDMA 4FGKA 5K4AA 1GNLA 1RQRA 2NXCA 1HLGA 3WB1A 1DFIA 2H5IA 3L4KA 1NF8A 2R8IA 1O2DA 1XZLA 1IYDA 3ZV5A 5JMWA 2ZYHA 3LXUX 3O4VA 4TWAA 1PR1A 4TSKA 5L40A 2QSZA 1TW2A 2ZYDA 4GXRA 1JMKC 1ANKA 3UTCA 3GK3A 2Q3FA 3N2GB 5K8UA 1Z8HA 5BORA 3PDWA 4WV3A 4GOJA 4FLEA 4CYMA 3CXUA 2C77A 1PJZA 3ZQ4A 2GZAA 2HHCA 4YAIA 3C85A 2J08A 3STUA 3ZCPA 3EWSA 5JIBA 4DR7B 1IMOA 1CULC 1RJWA 1CG6A 3LHKA 5IM5A 5IH3A 3E70C 4KR7A 1Q17A 3WKAA 2J3IA 2QQGA 1XZQA 3MVEA 2ZGVA 2UYGA 4OEHA 4NU0A 3WDMA 4UNRA 3FGPA 1MT0A 4J16A 3S81A 1ZJWA 2PFGA 4GKBA 1Z6AA 1ZLYA 4UHJA 1IZ0A 5DFAA 4NCKA 3C87A 2O2EA 4QHYA 1GPDG 4YA6A 2G0AA 2JFQA 1BNCA 4KXYA 4ML3A 4AYWA 1P60A 4UQOA 2C1ZA 3KZCA 1N2ZA 3W8EA 1YGPA 4RA6A 4MDYA 1M75A 3HKZA 5LJIA 1PGOA 4TSRA 3WA7A 4UXJA 4CUZA 2BCJQ 1P61B 1BC5A 2EC5A 2FZEA 3E8SA 2IXBA 4WDRA 1XCPA 4QPDA 1CVIA 2XVMA 5LMNH 3A04A 2O3QA 4EA8A 4TL9A 3DE6X 3QXHA 5L95A 4LMBA 4M7EA 3LLCA 4DR3B 3HYCA 2D62A 5DT2A 4TWJA 1WCV1 4C5CA 3FCYA 3C3CA 1G8MA 2JJ2A 3ZE0B 1TK2A 2QGZA 5ES4B 3QRWA 4YAKB 5AM1A 4E46A 3PPVA 1N5MA 3FB1A 4MVXA 3VZQA 5KTNA 1VXRA 3JQGA 4FGUA 3ZBQA 5EP2A 1EG7A 3DFKA 4NDZA 2QW8A 2Y9MB 5B5SA 3DM5A 1XCGB 3PQ5A 3OOWA 2D7DA 4IIBA 3W06A 2O8CA 2I0FA 4U2FA 3THOA 5A0TA 1TO2E 3MMSA 1U4OA 3H4TA 3RJ9A 4N3BA 2XA2A 2FWBA 1EUZA 3OZTA 3GRRA 4MNTA 1Y1RA 2W6IA 3O8QB 4NBRA 4LGVA 1J0BA 1LVGA 5DNAA 4NS1A 5JUMA 4GGPA 4CBVA 3RAGA 1BFKA 4KE8A 1GU1A 4ITVA 4BUZA 3QVOA 1BYUA 2I29A 1OWTA 3FOAA 3C6ZA 4DR5B 3OCVA 4G36A 1LDYA 4P34A 3I5YA 5KNLA 2IYSA 3CG4A 4B4WA 1JG2A 3CUYA 1XZBA 3GG9A 5GVRA 5B6IA 2HV8A 2E4WA 1DL5A 3G9XA 1M2HA 4LOIA 3ZCRA 2CNUA 4UPEA 2EG5A 3I05A 3N75A 5HKAA 3MFQA 3ILYA 3PL5A 1VL1A 1ILEA 5AI0A 1FJ2A 4MRNA 5DNVA 3CLUD 1D9XA 2C4KA 5GPBA 1IDOA 1KPGA 2Y92A 3DMNA 4TTPA 3NETA 4H31A 2VDPB 4XQ0A 1OI2A 2F3PA 1JI3A 3D6VA 3BWCA 4NPHA 1P4SA 4LV5B 4XVCA 2ZBQA 1HEUA 3IOCA 4LQDA 2AK3A 5CW1A 1CEQA 1NE7A 1A5ZA 1VMIA 3NJRA 2IU0A 2O14A 4CMIA 1FFXA 4W8HA 3EDRA 4ZI3A 3TOSA 3T38A 5SZKB 1H8EA 1KFKB 3R75A 4GOMD 1C3EA 1UJMA 4HDNB 5AXBA 3UVEA 5FPKA 5EWLB 4B45A 1KMIY 2ODBA 4QXAA 5B36A 5B7QA 1A5TA 2JHAA 2EIYA 1ZCFA 1XN1A 3CVWA 2YVKA 2PHZA 4EJMA 2IYAA 1EK1A 1JX6A 4H18A 3VPAA 5H59A 1KU6A 4KV7A 5SZIA 3WRYA 3ZQUA 3ANMA 1CDOA 1Z6ZA 3RQSA 5EFZA 3JZMA 1WSCA 1UZMA 1QHSA 5TQ2B 1XJ0A 1NJ5A 4K6MA 1Y6GA 2FEPA 3BYZA