2YZMA

Structure of d-alanine:d-alanine ligase with substrate from thermus thermophilus hb8
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
319
structure length
319
Chain Sequence
b'MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
molecule tags Ligase
source organism Thermus thermophilus
publication title Structure of D-Alanine:D-Alanine Ligase with substrate from Thermus thermophilus HB8
rcsb
total genus 83
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzmA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzmA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzmA01
3WO0A 4QSHA 2W6OA 2PBZA 1I7LA 2R86A 4O83A 1GSOA 5HBRB 2I8CA 3BSWA 3TW6A 5GONF 1IOWA 2VHEA 2FPGB 4ME6A 4XYMB 4IWXA 2YRWA 2VPQA 1EUDB 3R5FA 2C00A 4O84A 3RUPA 4E4TA 5C1PA 4MAMA 3Q1KA 3MJFA 1CE8A 1KJ8A 2YW2A 3G8CA 1M0TA 3RV3A 3Q2OA 3JZIA 5C1OA 4HNUA 3RFCA 2QK4A 3K3PA 2GPSA 4WD3A 2FP4B 3KREA 4L1KA 5JQGF 5KKNB 2GLTA 5JH7F 2CNVA 3OUZA 4J6EA 1B6RA 4MV1A 5BPFA 5LA6F 2QF7A 2CNQA 4O7TA 4O7VA 5D8DA 2W6QA 4O2AF 2NUAB 3BFPA 1EUCB 2YZGA 2YS7A 4FFOA 3R5XA 5HV6A 1KUTA 1EZ1A 4EG0A 3WO1A 1JDEA 1W93A 4I55F 4YJ2F 1M6VA 1KC7A 1I7NA 2GQRA 3E5NA 2ZDHA 2DIKA 4NYEA 3V4ZA 4EA7A 1ULZA 3G8DA 3ETHA 4HNTA 4FGRA 2HJWA 1GLVA 2X0SA 3I12A 4O2BF 2R7NA 5I47A 4M9UA 1BXRA 1GSHA 2XD4A 3QFFA 4C5AA 1KBLA 3ORQA 4O7RA 4YAKB 1PX2A 4O7WA 5BPHA 2YZNA 4Y8VB 3U9SA 2YZLA 4FFNA 1Z2PX 4ZI7F 3TIIA 4FE2A 4I4TF 2R7MA 4IIJF 4EA8A 2V5AA 3N6RA 4EGJA 2WYOA 4FFMA 3VPCA 5CA0F 4HR7A 1B6SA 2SCUB 1A48A 5H80A 2PN1A 5LXTF 4MV9A 2I80A 4RZQA 5J2UF 2W6MA 3HBLA 2YYAA 2P0AA 4TV8F 2NU7B 1E4EB 4HQ6A 4MV3A 5JQWA 1CS0A 3AW8A 2FB9A 3K5IA 3N8DA 4TUYF 1Z2NX 1E4EA 4M9CA 2FPPB 4O7NA 1KJIA 3VPBA 2DLNA 3R23A 1EHIA 3KALA 3HO8A 2YL2A 4XYLB 4MV8A 2NU6B 3VPDA 3BSSA 3KAJA 1KJJA 1JKJB 1M0WA 3V4SA 4TV9F 4M98A 3LP8A 2YZMA 5BMVF 4YAJB 4MV7A 3SE7A 1KJQA 5CB4F 2ZDQA 4FU0A 4GGMX 1W96A 1GSAA 1AUVA 4DIMA 3KAKA 3MWDA 1DIKA 1EYZA 2R7LA 1C3OA 3R5HA 2Z04A 1JDBB 2R82A 2J9GA 3RV4A 1T36A 4FFPA 2PVPA 2W71A 2VR1A 3WNZA 2W70A 4XZ3B 3TIGA 4O7SA 3NUAA 4C5CA 4IZOA 4O86A 4FFRA 2CQYA 4XX0B 1UC8A 2NPOA 5JVLA 1GGOA 5KX5F 4ZHQF 2OLSA 2YWVA 5K2MA 5DMXA 1C30A 4EGQA 1KJ9A 1OBDA 4O7LA 1BNCA 4O4LF 4HNVA 3R9RA 5JVDF 2HGSA 2GQSA 1SCUB 2YS6A 1IOVA 4YB8B 3VMMA 5LOVF 1VBGA 3UFXB 1A9XA 2I87A 4O7YA 2W6ZA 2R85A 1PK8A 2ZDGA 1AUXA 1WR2A 3JRWA 5IYZF 3TQTA 3U9TA 4IWYA 3JRXA 4EAAA 1VBHA 1CQIB 3TINA 4O4IF 5FNVF 1DV1A 2V58A 4WBNF 4ZOLF 2NU9B 2IP4A 4YBZB 2DWCA 1VKZA 4MA0A 5C8YF 3BG5A 5EZYF 3VOTA 3ORRA 4O82A 4IHJF 3JZFA 4EABA 5CAEB 4YJ3F 1KEEA 4O4HF 2R6FA 3K5HA 4C5BA 2XCLA 4MA5A 3HB9A 5LYJF 4EA9A 2FPIB 4O7ZA 1OBGA 1Z2OX 2W6NA 2YRXA 3GIDA 2R84A 3GLKA 3U55A 1JLLB 4I50F 2NU8B 2GPWA 1DV2A 2R7KA 4O4JF 2Z02A 5J2TF 3VA7A 3DF7A 4MV6A 4DLKA 3AX6A 2R87A 4ZQIA 3ETJA 4M99A 2W6PA 4MV4A 3MWEA 1UC9A 5LP6F 3OUUA 2CNUA 1CQJB 2V59A 3U54A 4O81A 3BSYA 4FFLA 2VQDA 2CZGA 3LWBA 5CA1F 2DZDA
chains in the Genus database with same CATH superfamily
3EXAA 5JNVA 1KNXA 5I9LA 4NXMH 3W06A 2X2PA 3AV3A 2P65A 4AXBA 1QU3A 3E1KA 2HPAA 1N56A 2HQOA 3QPAA 4Q6BA 4D3ZA 1I3MA 1QXSA 1Z5VA 2IHKA 1KRHA 5DWVA 5H7XA 5ER9A 4CETA 5KG5A 4ASUA 2HJVA 1IU9A 1N0WA 1PR5A 1G5IA 2CVFA 3LT0A 2F9FA 2ZR9A 2ZPAA 4U2GA 5DWQA 1QRTA 1HBJA 1IVNA 3MN1A 5CAEA 2ZIAA 3JQBC 3KD3A 1N6PA 1E32A 4MUIA 4NJMA 1OH6A 1IUPA 1QIDA 4RANA 5HCNA 3BHIA 3PXDA 5KTPA 1J0DA 1UBEA 4I1OA 1XVIA 4NRDA 1WY7A 3TR5A 2NTYC 2WV9A 3TI7A 2VLIA 3OQIA 4IX9A 1M5TA 1JV2B 2NZVG 2WWTA 1C2YA 1W34A 1Y9ZA 3KFVA 2N3ZA 4XW2A 4IIVA 5B57C 2APJA 3DHNA 3B3QA 3HEMA 3OCVA 1V51A 2ZYUX 4K9DA 4LC0A 5TVKA 4F50A 3D5QA 4A93G 3NGXA 2XUFA 4CG2A 3R6LA 3RNOA 3CNEA 3JS5A 1XHFA 1IVYA 4MUYA 2Z43A 3ROQA 2ZUVA 3GNSA 3PFHA 5EJ8A 3G2OA 2OFWA 2JH8A 2FPUA 3B6KA 4EHDA 3ZD6A 1JBQA 1YB6A 2N42A 3KR1A 3SN6A 5HUQA 2VDWA 2GBPA 1NLFA 4HYQA 1N5KA 1A5ZA 4IUYA 1GUDA 1QS0B 1Z7EA 2QQ5A 4FHCA 4B79A 3GJXC 3N87A 4DC0A 3ZU3A 4XE5A 1L5WA 4UD6A 4B3MB 3ICVA 4P86A 3C4VA 1AK2A 4EEYA 2GEBA 3JALB 4EVQA 3SQWA 3CNOA 5C5DA 4DSTA 1YVUA 3P9PA 3H84A 3KZXA 3AR2A 1W25A 3I8XA 2B4TO 4G1MB 3BMOA 3SZGA 4TT3D 3LCCA 4D4JA 5C5EA 3N6VA 3H04A 4G4IA 2VJKA 3LT5A 1YCHA 3PE6A 2PMEA 5K4AA 3C6KA 1NU6A 2HC9A 3U3JA 4AICA 2MYTA 2IY9A 5F7XA 5IDWA 3IERA 2ODQA 2BR0A 1U5CA 5SZIA 2ZRCA 1ISSA 4L7QA 3YASA 4E03A 1W87A 2J3QA 3HACA 4CKBB 4CEHA 3KJIA 4CPDA 4F4XA 1FDTA 1AQUA 2XT6A 3BQ2A 4D0LB 4G3XA 5PGMA 3HK2A 5T41A 4O7TA 3BABA 1P5FA 1R6BX 4QU8A 4NCIA 4GSYA 1NXOA 1V4NA 2ZG6A 2XYHA 1GARA 4A2CA 4N5NA 1TB4A 1RFLA 4UDOA 2M6LA 1VHWA 2HFKA 1AK1A 2UZAA 1X2BA 4FSHA 1PW5A 3LC0A 3WGTA 2WPDD 1U65A 1Y4AE 1FMCA 1M2HA 3ZI4A 2B0JA 4RD1A 2PUHA 1ES9A 4FR5A 4HLCA 4PHGA 3UCXA 2ZYVX 5EG5A 2QU7A 1IYDA 4MYRA 4LOAA 1ISPA 1J22A 1V1JA 2AC2A 2W0MA 4P08A 3D5EA 2OQRA 4WUVA 3BE5A 2C3UA 3SBDA 3UK7A 4A0GA 1NVVR 2ZWPA 3FKIG 3HQ4O 2EQBA 3M0EA 3KQOA 3RC9A 5IC4A 1G38A 1ZISA 4YDRA 2YHIB 4PWZA 1W93A 4PS0A 1C41A 1AS0A 5LL6b 1A95A 2WAMA 3NEYA 1ZI8A 5DI3A 2C7RA 3UXHA 5K0LA 1G3RA 2HV8A 3IQZA 4OHWA 2ZW9A 1TM3E 4M60A 3CINA 4RCYA 4UHCA 5A3VA 1XA4A 5ILQA 3VAYA 5IEJA 5AUPB 1UDAA 5I4KA 1D7AA 1IQPA 3OCCA 4NP6A 2DUUA 3CLUD 2CNWA 1F2UB 1IJEA 1YS2X 1FFDA 4S24A 4EB3A 3TQ1A 5J3JA 1FRNA 4YK7A 2DIKA 4AURA 1CQZA 3RHZA 4DARA 4XA8A 1T0UA 4TVKA 5BXYA 2HCJB 3BMXA 3IBTA 3SFVA 3VR5D 4HNTA 3I2KA 3N8NA 3EFOB 3LLUA 4DREA 3OOWA 2B3TA 5IULC 1QX3A 2XVXA 1ZKMA 3WYDA 2A8YA 2VVTA 1U2DC 1LCIA 2TMYA 1N4AA 4AMZA 3C48A 2R66A 1IK6A 3N2LA 1YJBA 2VJLA 3HBMA 4M9UA 4JC0A 1YASA 4WNAA 5E4FA 5FL3A 3I2HA 5G0SA 2A33A 2O03A 1CY1A 1ZWKA 3T1NA 3WKBA 3ZHYA 4LK3A 4FHDA 3SIXA 4TL6A 2G09A 2WTMA 5AJUA 5IUKC 1MB9A 4OU4A 3EUWA 3M9MB 2GN0A 4FEEA 2X40A 4EL0A 3D4PA 4RU1A 5KG3A 4B3CA 4OL9A 4ARZA 1C29B 1PX2A 1JSLA 3N0XA 3BS4A 2POQX 2Q6OA 2FG7C 5BN1A 3H8SA 4MCHA 3O82A 2NZ8A 2BI8A 5E7QA 3ZV4A 5ICFA 2VF8A 3EPPA 1WUIS 2WF8A 3GU3A 4BQRA 1NMQA 2BW0A 1F7UA 3OHMA 2HRZA 1L9KA 4LN1A 4Q4DA 2IUYA 2QN3A 4ZVQA 4P4LA 3DO8A 2DFTA 2VHZA 1KIFA 1YI0A 3LYHA 5L45A 4JLJA 1IBKH 4CN8A 4LJ5A 4M1YA 4GC7A 1IVSA 1XNQB 1K4YA 1AKEA 4DJFC 3LO5A 4DDTA 1BDBA 3PFIA 3PEEA 5LBTA 1V45E 2AUMA 3KLMX 4BFXA 3U4CA 1Y6QA 2X4LA 2I6UA 5IXYA 3KQLA 2Z9CA 1AHNA 2G83A 5JEEA 2WAQA 4RCNA 2BKUA 4DJ5X 1ORIA 1QAMA 2WAAA 2GXAA 2VF7A 1PFGA 4IMRA 4L2IB 1QIHA 4OXNA 4YRMA 4UFZA 2NVWA 1DAPA 3LXUX 3PG5A 1J2EA 4QNMA 2HK6A 1LVGA 2O57A 4QT0A 2NGRA 2PRIA 4RA9B 1NAIA 3PC8C 1XZ8A 4PYOA 4PCAA 4E6EA 2Q4EA 2ZSUA 1ZUHA 2KBEA 1NBME 2JPDA 1Y8CA 5FA8A 2PGAA 2HGWA 1QCYA 3FXAA 3FYHA 4NYMR 5AIAA 4DEYA 1QP4A 1YUBA 5EIOA 1OXXK 1KZ7B 4Q24A 4NZYA 1I1MA 4ECXA 1LC0A 4NBSA 3RG8A 1LS6A 4FHEA 2I3AA 2PL5A 4I8XA 5DULA 2ZU0C 4D96A 2ZCJA 2W58A 2W2VA 3GLVA 3M4JA 2XR1A 5DN6D 5C3MA 4CQJA 1J8MF 1QPGA 2QD1A 4EZEA 3KNZA 4L78A 1MVLA 1BSVA 1S9FA 1QGYA 1ZH8A 2YVAA 3KJFA 4J0MA 3CUWA 1I80A 4MGYR 3N8DA 4TUYF 1ZSNA 3W1WA 3D4IA 2VOJA 3OECA 2GD1O 4Y1EA 4Y6GB 5AVOA 4NS4A 4AJNA 1QYDA 1WUTA 2J5BA 1U0OC 3ZWDA 3O6VA 5T6BA 4EG1A 1Z83A 3ED5A 4WK2B 2Y1CA 5FPTA 5C32A 3H87A 1V4BA 3OTIA 2CNDA 4X20A 2OBXA 2X8BA 2YY7A 1XJCA 2YICA 1U3FA 2DHRA 2ZVPX 3NHAA 4HBZA 3H3JA 2FSVC 4X91A 2HHFB 5DGDA 4KOEC 1G1MA 5C8DA 3PTAA 4DLNA 5BWCA 1ZH4A 3MGBA 1XEXB 2FHSA 1J70A 3QE4A 3H0GA 1UZLA 3BL8A 2OOSA 3QEAZ 6REQA 4KQ6A 2JHCA 1IG3A 3I01A 5F1OA 4AY2A 1UDCA 2BBSA 3B7GA 3GAAA 5DSTA 2FEWB 4DQXA 1D2GA 1G8FA 4AF8A 2L19A 4ENTA 4M98A 2BRUA 1DZ3A 1J07A 1KAEA 821PA 2YWJA 1H8HD 5AKGA 2BY4A 3D4NA 4O63O 5I9NA 2P0YA 4N18A 5DBFA 2RDJA 4R71A 3LL4A 5DVZA 3QUAA 4QGBA 1UK8A 1K5DA 3ER6A 3SHQA 2C7PA 3ILXA 1OUMA 4LY3A 3X1KA 3HB4X 3GUYA 4ID3A 3BIWA 1O57A 3T5HA 2X0NA 4JXKA 4W4TA 1VJTA 1M1YA 3MT7A 2H1LA 4J16C 4DDVA 4F86A 4OPMA 3OCUA 5AJVB 2CLIB 2ID7A 4TTPA 2Q7XA 2QTBA 2QRJA 1ZD4A 2QP9X 5J5VA 3RVLA 2Y4RA 4EIWA 1P9NA 3OT4A 3GFQA 2J9YB 3T94A 4ZCRA 1UMCA 1X8LA 3CRZA 3ZDCA 4JYBA 2OSVA 1V8PA 2Y92A 3JZ6A 1RP1A 2I34A 3ESYA 3G23A 4YX9A 4AKTA 3LUCA 1E2NA 2BHSA 2YJ4A 4G5FA 1T3NA 1E5DA 4NI5A 3ANYB 4P3NA 3WB2A 1W1UA 2XF8A 4ZDJA 1CYEA 3LAWA 4M0KA 2ZUFA 1UPTA 3DNPA 1VI5A 5EWJA 1QWOA 1UDBA 1R27A 2GBGA 4Q1CA 4K28A 5AW1A 3CVVA 4N76A 2AYZA 3UXEA 4YHHB 3HNOA 5KAMA 2DVMA 4BMCA 2AN4A 2QXTA 4XX1A 4AX8A 2CNOA 2FY8A 5J58A 5LMUB 4LOKA 1A4RA 1JFRA 3JZAA 4LXUA 4OI1A 5IVHA 2R96A 1SKMA 2CW5A 5EKSA 1VPWA 1P1IA 2RGGA 4CIVA 3KFXA 3V4OA 1X0XA 2A59A 4C0BA 4DEXA 1WQ1R 2WC1A 3I9LA 1X8XA 2Q8PA 4L0QA 4RIEA 3HDYA 5JVDA 1RRKA 2DGDA 3MIIA 2WJYA 2H16A 3FMGA 4X3CA 3GN1A 3NYWA 4FE3A 4ZO4A 3ZDQA 3RGZA 4ECSA 5A1JA 5M04A 2JLUA 1BEEA 2B2NA 1W36C 1XVUA 1RRMA 5B7GA 5L3RA 1T9BA 3GWGA 2Q2OA 3KHKA 1EFUA 3GD7A 3AETA 3LT2A 4PZEA 4LYHA 4R9UC 4W5HA 4WPGA 5F35A 3MSCA 2WI8A 4B5KA 1ECBA 2I33A 5C5IA 2CFMA 1LD3A 3K94A 4MVJA 5CT6A 5ALOA 1C30A 3T7RA 2ERXA 1YQDA 3PFBA 4B44A 1SMKA 3FWKA 1QOQB 1L7PA 2XNHA 3S44A 4EGFA 4QX6A 3PC6A 3DMYA 4FCVA 4JV0A 3TY8A 4Q7MB 4LF7H 3J81A 1TUEA 2NVUB 1WZEA 2AYXA 4FPXA 4F5DA 1ADJA 1FDWA 2AEMA 2IEZA 4RK1A 5AHWA 3LC2O 1JLSA 4YMTA 2R47A 5LZ2A 1YIAA 2QT9A 2WD9A 4US1R 5BT9A 2LRHA 4HDMA 2NIPA 4KIGA 3IKTA 4KREA 1LZKA 5U4XA 1NJFA 3GJQA 3HHPA 4OXYA 4PHCA 4R51A 3WQHA 3ZWOA 1L1QA 3GEMA 3HJCA 1M2JA 1UXOA 2ABWA 1XYYA 3AEKB 1GNVA 4JKOA 4RGYA 1YZLA 2C9YA 4IO1A 2F62A 4GMXA 1VPEA 4JOSA 2RGWA 3IBCA 4LMRA 4Y67A 4DKXA 1TKAA 3AF4A 2GTPA 1CUDA 3T3DA 1HEUA 4QRHA 4BB6A 2A5FA 1QO0A 2D62A 4DSZA 5JROA 1S9DA 1N9KA 1OU0A 1IONA 2GF9A 3D2CA 1Z12A 2FVXA 2W9XA 1P4JA 2IYYA 1E5QA 4G5OA 3I61A 2B9EA 3LWDA 2HBQA 4XLLA 3BX1A 3RH0A 4BJ5A 1JDZA 3F8WA 3V8QA 3NM4A 1MXHA 1CHDA 1IHDA 4Z9AA 4URFA 2RG7A 2RDIA 3OC0A 3T38A 1GPDG 1DCMA 1IB6A 4P7KA 3GMIA 2XNSA 2H1CA 3M4ZA 1RT9A 3A27A 3NX4A 3SAJA 4DMRA 1UJ6A 1XZIA 2A1UA 2B98A 1M2WA 3MWGA 2QN6A 1ACLA 4ZO7A 3V1UA 3DE1X 3MCUA 2XCUA 4IIXA 4G1UC 3E2MA 3R0ZA 2GZAA 3SIWA 4J16A 1TJYA 3E9YA 4ZXFA 3WX0A 4DA7A 5IAAA 3CF2A 2R8KA 2BGWA 2XB2A 1IY8A 1J9GA 4RMJA 4JI6H 2BKAA 2QQGA 1XLVA 2I9KA 1SCKA 2O4UX 4RTMA 3NB0A 1H2ZA 1YU9A 3LC7O 1ECLA 4Q93A 2QR3A 4QXAA 1S2IA 2WD7A 3TJZA 1QK5A 4AJ4A 3X0DA 3M6XA 3DBIA 1ZIDA 2HGZA 3C5WP 1YR6A 3ZE6A 1M5UA 1B14A 4WESB 2Q4BA 1KVQA 1YQQA 3CSWA 1ZJJA 1TK2A 1ZBQA 4JSRA 1ISMA 3BRSA 3QE3A 1MO2A 2BFFA 1ZAUA 3MIZA 1KJYA 1Y1TA 3CUSA 4FOOA 1F9EA 2HADA 4NAHA 2RAVA 2QWXA 1KPIA 4R9SA 2GOYA 1BIFA 5EZ6B 3VI3B 3H5VA 4RD3A 1KJNA 3LA8A 2A4KA 2QYTA 1OFUX 4BASA 1TMOA 1W75A 3HJAA 4JYPA 4QTTB 4F85A 3OP1A 3AJ9A 2HF8A 4QJ5A 4EB8A 3FTDA 4L3VA 3FNQA 2PUBA 4GXNA 1UODA 3H2SA 2W37A 3G6KA 3SJBA 5C46F 1GTJ1 2GAAA 4C0SA 3IIMA 1O0CA 1NKSA 3GDEA 3O73A 1RKBA 4DZRA 1DCKA 2GZDA 2XUGA 4TV8A 4EO4A 4Y2HA 4JV1A 2H4YA 4DM3A 3VA7A 3OHBA 3MTAA 3RKRA 1FE8A 2QX8A 4MYSA 4OREX 2FQQA 3UUEA 1T1EA 2E2IA 4AUMA 3IP5A 2ONZA 3S8EA 3AVOA 2CD9A 5KFPA 3DL7A 3OWOA 4LV5B 1MO3A 1WDTA 9LDTA 1A76A 2MTBA 3SZUA 3UJPA 1L2ZA 4HZGA 2A9OA 3JD3A 5D3MA 2QX7A 1SK8A 1LX7A 3KL4A 1TTQB 3NH9A 1KPHA 1B6TA 2CLSA 1DLJA 2V1XA 3RS5A 4UBMA 3STTA 1AS3A 1IAVA 1IHOA 1CQJB 5FWYA 2DY1A 3BMQA 3EISA 1E4VA 2GN8A 3G88A 2W8LA 4RF2A 4JI4H 4WLVA 4F60A 4LJKA 2BHTA 4IQFA 4JVMA 4KTVE 5LQMA 1CK4A 5KFVA 5C8YB 2Z5LA 3RJZA 1TYDE 5TIIA 1J8FA 1VL8A 5A5VA 1YAHA 2QNIA 1XDSA 1PJCA 4B6GA 4E5VA 4F4ZA 2RH4A 4Y7CA 1TIBA 3HYTA 1SG0A 2UZ1B 4RLFA 4BNUA 3U1VA 5HSGA 3H17A 5CB4B 1TYAE 4NENA 4MUHA 3KELA 3MJRA 3WY9A 4A6XA 3B3AA 2FP3A 4TVIA 2FZGA 2H7CA 3AUXA 2FI1A 3MJEA 1GSOA 4B81A 7MHTA 4NZZA 1I36A 1PIWA 2QJOA 2C2WA 4QUEA 4QUDA 1FZQA 3CR3C 3LBFA 1TT5B 3MT8A 3O8NA 3OICA 3G13A 4KTTE 1ADGA 3FVTA 1XG5A 1PJ8A 2OFOA 4JB8A 4FJ0A 1A72A 3COVA 5CA0A 1E0DA 3HBFA 5JFOA 4V0NA 1ONBA 5CW1A 1LPOA 4DUGD 5KREA 1G21A 2A35A 2HMWA 1M2EA 3EXG1 1MVNA 3FZEA 5IWAB 1C8BA 3SICE 3ZWPA 1Q1AA 2UDPA 4GDFA 3IB6A 3NRCA 4KR3A 2JFFA 2FE4A 4FYKA 2SBTA 2XNCA 3OI7A 4MRPA 5CHEA 4TKUB 4EHBA 1R37A 3L77A 4EAQA 3CPHA 1VSTA 2YRFA 4MCIA 3W8NA 4RQBA 5HF9A 2C9BA 5J4VA 5LWHA 1CRWG 2IBSA 1RYRA 1RAHA 2DHDA 1IBMB 4H3HB 4NZOA 1MPXA 2BKLA 2FMHA 2GA8A 4CTNA 5KQPA 5FV4A 3CLTC 5K8VA 3HBJA 3KUDA 4DHEA 3GD5A 4EHKA 1CR2A 4Y8VA 4GZLA 4REQB 4AZ0A 2NSLA 3NBKA 1Z6PA 2J45A 3L8GA 4XJTA 1DDGA 4IH1A 2X5JO 3B78A 4D79A 3AFGA 3B6EA 2HMYB 5IBQA 1O8BA 3DF9A 4LVOA 4RH0A 1P3DA 2A58A 5FUQA 3V8PA 4Y18A 2IW3A 3RC8A 3VR2D 1JI3A 1FNNA 3HCOA 4QGHA 4K2HA 1O87A 1RYZA 5HIJA 1X9HA 1CUYA 1QOZA 2DEUA 2VSOA 3HO6A 3WYNA 3VO2A 5IHPA 2O9JA 2O50A 2ZI4A 3F1LA 5FA5A 3L9XA 3W8RA 2P9HA 1P8LA 2ZTLA 3LGSA 2ACVA 1L5LA 4BGIA 3EC7A 4LY9A 3SP1A 2VUSA 3D8TA 2EWVA 2PL9A 4WY2A 4OBBA 4GLWA 3CHYA 4ND1A 4EITA 3A4MA 5TGDA 3L1HA 1I1NA 1QGZA 1FOEB 3NYRA 4Q9NA 4RFVA 2XZLA 4TQ9A 3MOGA 3OAAD 3TDKA 3JPYA 5AW3A 1WD5A 1X1DA 3I3SR 3A4IA 5EOVA 2XYQA 4OHXA 1ZD8A 4JT4A 1TPYA 1E1CA 4FZJA 5KOJB 1V26A 2QT1A 3L8FA 2AOTB 2Y68A 1G8JA 4D3DA 3BHMA 2YS7A 1IAQA 2RGCA 1I3CA 4ND5A 3NATA 2UYQA 4YI5A 3AVVA 1X1AA 1SC1A 1TK3A 3I6QA 5AUNB 2QG4A 3RFFA 2OAEA 4CEIA 5KFGA 2Q5HA 1KK1A 4J03A 1K3TA 3EGVA 4HQLA 3WAGA 1XRRA 1UDRA 3WO1A 2JHPA 2J0SA 1O5TA 3RBAA 4AMGA 2P8JA 3A28A 2W2OA 3JVUA 3NBUA 4HI0E 2CDRA 3ET4A 4CMJA 2UXCB 1QO9A 3L82B 3W5HA 2G1AA 1BEUB 3PNLA 4RNCA 5FPQA 1S0NA 2HJGA 3G6XA 2HIXA 1KL7A 5TPZD 3GRYA 1T3SA 3UMSA 5CTAA 3L6DA 3GWZA 4U4AA 3O7WA 1LLFA 4WVLA 3TW7A 1ZVKA 4HYEA 5A9RA 2CVOA 4MRMA 3MFIA 3R77A 4KN9S 2HOQA 1A9OA 3E22A 2HSJA 3NUZA 3EDRA 3PUJA 5BO5A 1NYLA 3DZJA 1EDOA 4BPRA 4BP8A 3L0IB 3K70C 3ETHA 4MV0A 2IV2X 3RE1A 5LBIA 3EGEA 5COBA 2CLCX 4CZ2A 5LLDA 1QG0A 4B5LA 2DM6A 3U31A 1ZHHA 4JLWA 1L5RA 1PWHA 4M0JA 3DMNA 1E66A 3I9KA 2ZJ3A 2WHQA 2OBMA 2LXNA 4ED9A 5BQPA 2BF7A 1JFVA 1Z3CA 5JG7A 1CY2A 5ALGA 2RIRA 2QA5A 2KW5A 4TUYB 1K6IA 3GX1A 2GAIA 3HMKA 3RU2A 1ZK1A 3KHTA 3JQAA 5AJWA 1RXVA 2H1SA 3M5PA 3MELA 1OX6A 4KQXA 1BMFD 2G5TA 4JU8A 2IYRA 3RQSA 2Q99A 1YKSA 2RJOA 4XM1A 3NWJA 4YGYA 4BNXA 3PNKA 1TW3A 1MAVA 2IH5A 4ND6A 5AW0A 4Y6OA 5BPHA 4U39A 1E2IA 5AYVA 3EDCA 3BDVA 1VE1A 1MG0A 1Y6ZA 2OCDA 2QTNA 3EG9A 5CCEA 2JLYA 2X1HA 3HL0A 4LRTB 5EE5B 1UM9A 2FA9A 3KT3A 3OWHA 3ABOB 5D6OA 1JHVA 1PJAA 1PUXA 2L82A 2C57A 1OA1A 2NO0A 2OZEA 2XWQA 3PNPA 5YASA 4BNLA 3HR8A 5AO9A 5F1KA 3T5TA 4IG4A 2OQIA 4RWEA 4DFDA 3DO6A 4F3CA 4EYKA 4RNDB 5DLQC 2K7ZA 4LWOA 2IU0A 1I2MA 5L3SA 2JEYA 4YRGA 1E1LA 4HEA1 3UV3A 3UWSA 2G71A 2YZ2A 1C50A 4U6NA 2ZFUA 3OJLA 4WGGA 1WO8A 3GPBA 3SXUA 3WL6A 6CHYA 4V03A 1AQLA 4LBVA 4L16A 3Q2IA 2BDUA 1DQPA 4LH6A 3FVVA 4JENA 4BLWA 1QFYA 3L0PA 2C3MA 4EI8A 2E6UX 2P6OA 1XDNA 5KFWA 1YXMA 2YW9A 5LUAA 1P1JA 3VZPA 4XYMA 2OHFA 1DG9A 2ZBUA 4H6WA 3GARA 3L8MA 4XH9B 4P93A 2O7VA 4IFTA 4HMPA 5CDHA 3U6BA 2IF2A 4FS3A 3RB4A 1VZ3A 1GA4A 2HA2A 4UPEA 1JXOA 3AVXA 1RI4A 1U2ZA 3L0YA 2EGUA 1IH8A 4YMLA 1RC1A 2FWIA 2B4QA 4OK6A 4WN9A 4O5OA 5DMHA 5IJZA 5MGBA 3AINA 3DM5A 4Z1MD 2X9LA 3TX6A 2X8AA 4N48A 4TV8F 4YY3H 5H3CA 2NAPA 3KUUA 3C3JA 3HA3A 3GFTA 3SIPA 2HLPA 4WK6A 5CA1A 3OLQA 1U0SY 1QDEA 1M2OA 1RHRA 2B5OA 2C22A 1M2OB 1MO6A 2ZJFA 3BCHA 3HLYA 4PRYA 4DIOA 3OSZA 1WTAA 3NYIA 2ILTA 4LCJA 1E4EA 2GJ8A 5CBKA 3UAZA 4LXHA 1LF0A 3KWLA 2QAGA 3G8BA 3QF4B 4YBRA 1EP9A 4TV9A 5EXSA 1P16A 2OHJA 3QMPA 2DB3A 1Y1PA 3D6NB 5CNJA 2OR3A 1CQXA 7REQA 1RD4A 1VHLA 4LSXA 2B4RO 3SSOA 1GQOA 3EXHC 3HJUA 1KO8A 1OC4A 3IIKA 1P77A 3LY9A 1G8MA 3KFLA 4GRDA 5JFTA 3VNQA 2HEIA 2W0SA 1E2PA 3HP1A 1EJ6A 4X45A 2XMCA 4P1ZA 4R3WA 2G08A 5KMGA 3RSCA 4Z2AA 1W6RA 4MV8A 3CVUA 1GRQA 1A9TA 1SKAA 2YQ4A 5KWVA 3PHHA 4TVSA 3PFFA 2I6XA 3P9KA 3KU4A 5KT6A 1PT7A 1J5EH 4WOKA 2JLWA 5A2QW 2Z6AA 3W3AA 1TMGE 1VKOA 4ER5A 2G28A 4MW4A 1L8AA 4NCHA 2MDTA 1LV7A 5DYTA 2YUTA 1JLLA 1VMDA 4W99A 3SXUB 3TLKA 4IS2A 4GUDA 1KQ3A 4B6PA 1J09A 2AD1A 2AWNA 2PK3A 4R7ZA 1FSGA 1P29A 5L3SB 4LYDA 4AP6A 2D06A 2XMQA 3P2OA 3BE4A 5EJ6A 1VPVA 2GILA 4O4LB 4AMBA 4XUDA 4LF4H 3ZWWA 4HYTA 3Q7QA 4DNPA 4MWTA 4LS3A 3EG9B 4ZRDA 1T9GR 1WS6A 4OOEA 4WW0A 1M74A 1REQA 2X9GA 5TLSA 3R44A 3PVXA 3MWDA 2Q1SA 3PBKA 3KDPA 1DIKA 4ZDKA 3RIXA 2R7LA 4MTDA 4Z0HO 1GPBA 1MN6A 1P31A 2PZJA 4BKQA 3WRVA 1E2QA 4OBXA 2QRQA 1NP6A 2BISA 1K1EA 2BHRA 2G82A 3OKFA 4QDXA 4FR2A 5JZMA 4OYRA 1A0OA 3IHWA 5BN5B 3UUWA 5E3HA 5LQAA 2ORED 3DWIA 5I7FA 3QP9A 3J80W 1N8TA 1P7WA 4M37A 4HADA 1W0KD 2BDTA 2O2CA 2Q5QA 5JMWA 4W7IA 4YQWA 4JIMA 4DR6B 3E61A 2AOXA 3BJYA 1NP3A 2HREA 2MJLA 2PD3A 4DY6A 3L84A 4ZAWA 5IAOA 1RKVA 1DXHA 3RRXA 3M5WA 2CXXA 2Z8XA 2KHZA 5BOSB 4CM6A 1N2HA 4AF7A 4KK4A 4B7AA 4E2XA 3ZWAA 2PMWB 4URVR 2YASA 5I01A 4YR0A 2E5LH 4PAWA 4U3JA 2P77A 4HWTA 5JANA 1NQAO 3CW2A 4Q18A 5FLKA 5IC5A 3I4MG 5EIAA 5E4YA 5K2MA 4TMZA 2AZXA 2WQ7A 1NC1A 5KFIA 4LF6H 1FLNA 1OYVA 3FIUA 3LULA 1E5VA 1CJTC 1OAKA 1ZGBA 3PENA 5F77A 3TOVA 1KEUA 1SD5A 3GEDA 4WADA 5AQ1A 1L4EA 3EZNA 4GR5A 2OG1A 5JH7B 3ACCA 3IVXA 3VISA 3GZNA 6ADHA 4E5MA 2XF2A 4DC9A 3UYYA 3O3CA 1EM8A 4HH1A 4Q4JB 3JAMA 3F5FA 3LNTA 3F4BA 4ODIA 4YP0A 1PFVA 2XKJE 2BFNA 1FPQA 2PQ0A 3KETA 3E7DA 5JVDF 5MHTA 1TEVA 1QF7A 2L0XA 5KFHA 1QGED 1A5AB 2GBLA 1C7FA 2JEZA 5CB8A 3RIYA 2HAEA 1CERA 1FTNA 4ZEWA 4TS4A 1KFKB 1ANKA 4FTWA 2F8LA 4MW6A 4DBZA 2COKA 3HKBA 4TRRA 4BX8A 2AG5A 1IXSB 1RR6A 2DWUA 1V1MB 4I1PA 1GZ7A 1MOQA 1MT0A 4FMCF 5SY4A 4COKA 1X1BA 1U5AA 2FP4A 2Z0MA 4G26A 4GMFA 2P2CA 3H4VA 1DRVA 3IT2A 4Q03A 2H1WA 1NKVA 4BNMA 2YIVX 1Y63A 4RZSA 4JBIA 4RTOA 4DV3B 3FYDA 1A2QA 1F4LA 5LU8A 1K4MA 3CKLA 1DXOA 3LPDA 1SOUA 3MXTA 4KZKA 2XADA 4DWVA 1L4NA 3H7IA 4D6PA 2JLCA 4OKNA 3E6AA 3R4VA 4BNDB 4L51A 4P4SB 2EFHB 4F46A 2LUOA 2WFLA 2GHQA 4ENPA 1MZPA 4F3TA 2W7PA 2VHWA 4HRXA 3M5CA 3GNLA 1U0EA 1TAUA 3LSYA 4DC1A 4RTNA 1XKQA 1WMAA 1ST3A 2MSCB 3EWSA 3ZE8A 4D6YA 3EEOA 1PL8A 2JFYA 3LPLA 2FAXA 2PFKA 1V16A 3F7NA 4RZUA 4P4NA 5KSPA 3LA6A 3W0LB 3ZDFA 4EYQA 1FZTA 3P0FA 1WEHA 2P2SA 3F3YA 2WDPA 1OXTA 4O2BB 3SC4A 1XPJA 2Q3DA 3HXKA 5BUQA 1Q6ZA 3FIJA 4OGFA 1S2DA 1N1EA 4HMOA 3ADBA 2FSGA 3H65A 3Q41A 1CPYA 2HCTA 2KBFA 3O1LA 3B3JA 2GH1A 3OZAA 3ZKWB 1Y81A 3JATA 5HJ7A 4JNKA 2CJWB 4C0WA 1C3OB 3ESZA 5I8PA 5IP5A 1FDIA 3U0GA 4MQMA 2KI5A 4MRNA 4NFSA 1J1IA 2HK8A 4ED0A 1E9SA 1UJCA 5ESDA 3UKOA 1YB4A 5H3LA 3NBYB 2BCJQ 2PUFA 4LF6B 2O8FA 1E3LA 4HRVA 5FI0B 3GA5A 2AFRA 4EGAA 4G0YA 4LYGA 1Y80A 2WV7A 4I2VA 1OI7A 3TUIC 4BWSC 5EHQA 2EZUA 1KEEA 2VJBA 1SIWA 4Q9AA 4RUAA 4HYYA 2Q5CA 1BO6A 3RRYA 3FTEA 4GBGA 2VJOA 4K9MA 5AVTA 1QOPB 1HDIA 4I4IA 2Z2KA 4ZALA 2H4FA 3U2QA 1BQEA 1KI2A 1M2GA 2N0SA 3PSHA 4M86A 4D8VA 4H7PA 4EEXA 5F9NA 3QW2A 1FYEA 3ANMA 4QECA 2K2WA 1KYXA 4ICIA 2CEKA 1YI1A 4LKRA 4WV3A 1O5IA 2E2WA 3KZKA 5C1IA 1QV6A 3FPCA 1Z2OX 2FK7A 1OIXA 2YRXA 2I6SA 3T3IA 4OUDA 1UANA 3V4VB 2J9FB 3QZ7A 1B76A 4JGBA 3GLKA 5IXSA 3MA0A 2VHYA 3HCBA 2X4DA 1QLWA 1XPUA 4Q1AA 2ZETA 3SZ3A 3WIBA 3KOWA 5K3AA 2DSTA 3BMQB 2QJRA 3HGMA 4EQ6A 2OCLA 1RRCA 1ND5A 4MO2A 4IIJB 3EQ9A 4Y98A 2XD9A 5FI5A 5F7JA 5JY1A 3TX2A 1Z0DA 3LKDA 4BVLA 4FVTA 4LXXA 5FX2A 1TZKA 3HM2A 3Q98A 1RIIA 4WCFB 5F9HA 3VTFA 4PSDA 4KN6A 3N8GA 2RGDA 4JT8A 2VWGA 3PUXA 4ZT7A 1G3IA 2ET6A 4I5IA 4TXNA 4P9NA 3KHRA 3TZKA 1Z45A 4UM8B 5DYGA 1LQ2A 3RAPR 1S4MA 2FN4A 3KEMA 4RM2A 4A0QA 4PAMA 3QOWA 1P7YA 4HQRA 2XYPA 3JWEA 4TT8A 3A9UA 4DDMA 3FUVA 1ZD2P 4LWZA 4OGWA 3G2HA 2KYRA 1DVRA 1NN5A 1ID1A 1EXVA 3CF6R 1FTQA 1XJQA 2ZUEA 4RKWA 5F5XA 3OTHA 2GK6A 2ECFA 4LEIA 4V0LA 3SJCA 2BD0A 5EUMA 5CA1F 2H2GA 3M4YA 1LJ8A 3G2PA 2NMVA 1Q3TA 3VR1A 1MBZA 1AKMA 2PSSA 2JD0A 4MIEA 2B63G 3EXG2 2JBAB 1XJWA 4R2IA 1LTHR 1LWOA 1SCIA 3AHDA 3FYUB 1PNQA 4PO1A 3WIVA 4L4UA 4JDPA 4CM3A 4QUKA 4YS6A 2JVJA 4B3RB 2J3DA 4DV5H 4G0UA 5HBRB 3UPDA 1COWD 1E1YA 2VYND 2I8CA 4M7RA 4R5MA 5JSUA 3BBPA 1C3VA 3O0TA 1G9XA 4TTTS 2P9CA 1NW6A 1JR4A 2NSHA 1GZVA 3EF3A 3IX7A 4UQOA 5DB4A 1W5AA 4GPIB 1V7ZA 2YHBA 1E61A 1W0CA 1BJKA 3E2IA 3HS3A 3ZI7A 5IM4F 4ABTA 2X15A 3DZDA 4X84A 4A3CG 1JDJA 2W98A 2R6CA 1EZZA 1JQAA 3D6UA 5LKAA 1SCDA 5KBYA 1U81A 1D4ZA 2HK7A 1YIOA 2HLDD 4UFNA 2BI4A 1V7PC 2OM2A 1CLEA 1NBMA 2CHQA 4Z4QA 1VECA 4Q7LA 3WHLA 1JH8A 2QG9A 1DARA 3OT1A 3RVJA 2I6FA 1ABEA 1NBWB 5PNTA 1IN5A 4F8YA 1TPZA 3TAHA 4WLFA 5J23A 4FMDF 3ETCA 4BQIA 4CM8A 1X1TA 2R79A 4P31A 5G2OA 2WHPA 2WU1A 1ITZA 2SHKA 4Y2XA 3R7WA 1YB1A 2OO5A 2QW8A 4JFRA 4UEOA 4WE3A 4E7OA 2M98A 5AI4A 1XCJA 1KYYA 1G3UA 2QTRA 3R0VA 4HDRA 2J6HA 2JA6G 3CO5A 4L9RA 4WLOA 2FF5A 3WYGA 3WLSA 2NUPB 3EIEA 3RYHA 1H85A 3E7WA 4A9AA 4EKYA 4XVUA 1XZGA 3D1JA 5LJLA 5C1OA 3C6YA 2BGMA 3H99A 4QARA 2ZK7A 2WJVA 1ZC3A 3ELYA 4XR9A 3OWXA 3T7EA 1G5QA 2I3BA 5C51B 2OXEA 4JQSA 4BVGA 1NMSA 5DT2A 4JP2A 3F2IA 2QK4A 1R9TA 2ZZNA 1GL9B 2A0YA 4DDUA 1R18A 3HZHA 1E99A 1W8DA 5KKNB 2VTEA 3QIVA 1WA5A 5AJYA 4KUGA 5D6NA 2O0HA 5A5GA 5FULA 3S29A 4Q3BA 3T0IA 3S2SA 4P35A 5I5GA 1XLTA 5B55A 1UPUA 2YVQA 3I4NG 1AK9A 3FDZA 3IA2A 3AEKA 4YQZA 1M3SA 1Q2UA 2IBMA 4OI0A 4G86A 4KQKA 5FBRB 4E5SA 1XCGB 1XDGA 1RJGA 3I5AA 4YMIA 1Z4PX 2CNQA 3HFGA 3MRSA 2X77A 1UOPA 4HGNA 1YHNA 1R8XA 1ZGCA 2JIOA 2LGJA 4QYMA 3T06B 4AJHA 3IS3A 4NESA 1T0HB 4DL2A 2HHHB 1H9BA 2IGBA 3C6BA 1VMIA 4LG1A 1SUIA 4PTYA 4RETA 2FUNB 421PA 4ZV4A 3L1VA 2OHIA 2BFCB 4M22A 1UKAA 3OIUA 4KQIA 1CDEA 5DNWA 1CD5A 3AF5A 5GJCA 4E5PA 5ALSA 4H0FA 2AMVA 1VHTA 2ZUBA 2XYRA 5F78A 4I6GA 4WTOA 1OC2A 3P96A 1V2GA 4HDNB 1WMFA 1EFHA 2WLSA 1V6AA 2GRJA 2XQIA 3IQIX 1WHTB 3PC3A 2VRWA 4BP1A 1ZH0A 3E35A 5JCJA 1KDPA 3FD8A 1JAYA 1NRWA 4JNCA 4PGHA 3QUTA 4O3MA 2I5PO 3QBDA 1XTPA 2FOIA 3PR3A 3RSLA 1RBQA 1T1GA 3C8ZA 3ZHUA 1IK4A 5D3ZA 1LNQA 3IEIA 1EAYA 3JYQA 1PU2A 5ERXA 4N5MA 1IN7A 3DDSA 1U0FA 5CB6A 6ABPA 1JEDA 1E8MA 1UJ5A 3KQVA 1HZZA 1LSUA 4KPGA 1IBLB 2BFCA 3P9SA 3FLAA 4Y1RB 4HTFB 2ZYRA 4Z9YA 5K6AC 3V4ZA 4PSAA 4AO7A 3BZBA 3H2JA 3OM0A 3ZZUA 4B48A 5A9SB 2O4CA 3FDXA 4Q3AA 2C0PA 3DMPA 2VP9A 4C21A 1GPH1 1UXJA 3PVCA 2H4ZA 5E95A 3NMUF 2C88A 3FKIA 5FBWB 1ZNYA 3DEZA 1UXGA 2QMEA 3FTNA 5JAIA 1W8IA 1NW8A 3F46A 1SD2A 4R1TA 2JGRA 4LXYA 4KR9A 2D2VA 1T8RA 2PZEA 3JQ8A 4RCZA 2FK2A 4KO1S 3WZMA 3LYLA 5IVPA 4I19A 4AIIA 4FSXA 2O05A 3WAJA 4WQMA 3LMLA 3OIYA 2JA5A 3WYFA 4O7RA 2W22A 4TTJA 2LPMA 2H11A 3L7JA 3E48A 2Q8NA 5LOVA 3WLFA 1P2SA 2AFIB 2IZZA 1ZX1A 2F9MA 3L7OA 1D6SA 2QRHA 3R4CA 3H16A 4KK3A 4P81A 2AHOA 3PCXA 1HE1C 2FV8A 1SOAA 4FFBA 4YYZA 3BPSA 4NPAA 3SM9A 1OLSB 5H59A 2PKQP 2ZJ6A 4J0EA 5EHXA 2HPHA 1NNLA 4UU0A 3ECSA 4BUJA 4W1PA 1NWHA 1O0BA 2D1FA 5JTTA 3EG5A 1FVXA 4IRCA 3HA7A 4OATA 4F8EA 4HJXA 4EW3A 4PSUA 1XQVA 4TZ0A 4PG6A 2WKWA 2UUOA 2XKAA 3KSMA 3M2PA 2PNJA 4ZI7B 3K53A 1ACJA 3SJ7A 5K09A 3WP1B 4K86A 2YWBA 1H65A 1IOLA 3V80A 4DT1B 5F2KA 5T4FA 1E63A 2A9FA 3OIGA 2BCGY 1T4DA 4JI0H 1N0VC 1Z82A 4NCNA 1X7GA 4F04A 4M1ZA 5JYDA 2DG2A 1L1FA 4BTVA 4ILEA 3ROFA 2AR7A 3C74A 4F3NA 3BZWA 5CCXA 4DBLE 5B36A 5JCZA 4E4YA 4HR7A 1CNEA 4M0LA 3KOXA 1XEXA 1AURA 2WDTA 3DBLB 4I9GA 3CNBA 4KRYA 4YECA 4CQMD 2B1GA 4FB5A 1YHYA 4J29A 3LPAA 1P72A 4XYEA 2E89A 3CB4A 3TNDA 4TLMB 3ZC3A 4D3YA 4J8PA 1MJ5A 2WZBA 4CODB 4W5TA 2VP3A 1JH9A 3IHKA 1KDVA 3ZZNA 1KH3A 1XF9A 2BGTA 3AEQA 3OTQA 4NICA 2V6JA 3N8KA 3V6LA 1Z6GA 2F9LA 1EFAA 1IMJA 4XCVA 2IH2A 1RSZA 1PX0A 4I1VA 4BNFA 3TLAA 5HTKA 4RA6B 3ZLVA 1UNNC 4HQ6A 1T5SA 2L18A 2LR0A 3JYLA 7AT1A 1TQ6A 2I2BA 4EJSA 2JBAA 5JNLA 4WXMA 5CIQA 1DO8A 4BDTA 5KWEA 4QFBA 1RPAA 1O5OA 1PWYE 1XP8A 2AJCA 4KGXA 4NG5A 3ZQ6A 1MB2A 2I76A 1GFSA 5GVRA 5A5DA 2WWGA 3QH4A 2IHUA 1FU7A 2YOGA 3K5WA 1H8EA 2PL3A 3DE7X 3GG9A 4S1NA 1L5GB 4AQ7A 2YR0A 1U94A 2QUKA 4Q9IA 3GG2A 3IP6A 3UHFA 1P7ZA 3FFWA 4EHIA 1PFQA 2E1PA 4XIJA 3H40A 2MOKA 3VKGA 1O94D 3IJEB 5E0OA 2G0AA 2JIBA 1J2JA 1C4KA 3S8YA 3U7IA 1CB7A 1XXHA 4HDQB 1EHIA 2EGHA 3EPHA 3RF7A 5BWNA 4OOFA 3TRDA 4RA9A 3E9DA 1Z6ZA 1NNI1 2R6DA 3G2JA 3P4YA 3CLVA 4CJXA 3GLGB 2PO7A 2C5HA 4HWOA 3WLAA 4GKKB 4LFBH 3USZA 2P78A 1EA5A 4FXPA 4GLBA 3A1UA 3GY0A 4G01B 3RS9A 1E98A 4MDHA 1NR5A 4L22A 4PG4A 4RPCA 4G37A 5I4CA 1XN4A 2CE7A 2SICE 3R0XA 2ZSBA 2PJZA 5CT4A 3G1UA 5AM1A 1SJ9A 2CK3D 1EK5A 1OXBB 3A1FA 1PJTA 1QHFA 2PGXA 3GLHE 3O4FA 3QVGB 1XWIA 4ZTBA 4CG0A 1H4SA 1D0SA 1DFGA 2FSSA 4KVGA 1AS2A 4KXNA 3E70C 1FP1D 4ESVA 4B40A 2PRJA 2XUQA 3QX7A 3NAZA 4UPVA 3OY2A 5CITA 3TMAA 1PTJA 1DUIA 2VRBA 1GRVA 4EFMA 3NHMA 4PGAA 2I2WA 3EWAA 5IEBA 3ZZMA 1PQPA 1P9WA 1WNFA 2WU0A 3EGDA 4XUGB 5L3QB 2GN4A 4R83A 2NTEA 4IKOA 4RV9A 2LDBA 1XFDA 4YJDA 1JHDA 2A2ZA 5DO9A 4D0NA 1TLTA 3IALA 3R7FA 4DCSA 2IYTA 4U63A 5A2QA 4CF7A 1OBVA 2OXFA 4ARZB 2AEEA 3KHHA 4DLBA 1JIIA 5TT0A 1NI4A 2C8KA 4RPGA 5IP7G 1MD9A 3FPKA 4HATA 4QEKA 3NG1A 1KQNA 4J0JA 5A02A 4KDFA 1SXJD 4U2DA 3WMGA 5KHOC 3UGKA 5LQNA 5JEDA 3IUPA 2QTTA 2WJPA 1QONA 1TUBA 1QC5B 2IUSA 3DTGA 3DD1A 3RB8A 4KE7A 5LNK1 4WNAB 3GJRA 1Y1LA 2JHAA 2Z04A 3WWJA 1KVRA 3R5JA 4EYGA 3HOXG 1OTYA 4NK4A 1NONA 3GK3A 4Q4CA 1MAWA 2PVPA 2BELA 4PC3A 1I1OA 1Y4DE 5FO1A 4CLXA 3G6VA 1RYBA 4RCVA 4RENA 3S2ZA 4QW8A 3MWYW 4XZ3B 1EHYA 4FNOA 4RMNA 4HAYA 4M3NA 3V2GA 4ERNA 3UUGA 3M3HA 4DR6H 5H9VA 5LP6A 4C7MA 5FBVB 3QY0A 5K4GA 2DFPA 3O2QB 4O86A 2QZZA 4Q3KA 1VPTA 5LQRA 3ZW9A 2WJAA 3UG7A 2WWRA 2FEKA 1R6AA 1GGOA 1BCSA 2GM5A 3K7EA 1FU8A 4IVNA 4Y2JA 5JNUA 1BE6A 1YTUA 1XYVA 5G0TA 4TQUS 3U3DA 2OLSA 4BMZA 1HZZC 1VLHA 1SC3A 3FMVA 4R81A 1M0SA 3JTEA 3MYYA 3UAGA 3EXIA 3SEZA 4OJNA 4BVKA 3K3VA 1I32A 3FA2A 1P81A 4B3HA 3RB0A 5KKAA 4DUYB 1YNOA 1NW7A 2JCYA 3N53A 4ZQGA 1RVDA 3N2GB 4WIAA 4WOPA 3P5SA 4PYKA 5BNZA 1L4KA 2HWXA 2VQSA 4XDYA 3ILHA 4E30A 3TB4A 4KJXA 3QF7A 2IUTA 1TO2E 1QVVA 2ZTHA 1RKUA 1Z25A 2AXNA 2BSXA 3PLNA 3WYEA 5IT5A 2O2EA 5E9QA 3PB3A 5ULLA 4ZEMA 1CNFA 2ZROA 5HKOA 3CVWA 2XE6A 2CGEA 5IS2A 2R0QC 2EBUA 1JVSA 4MUJA 4JROA 5CHYA 5CH3A 3VKVA 3ZU4A 2M9MA 5KOHB 3COZA 3AERA 1WZCA 2C7BA 4UNNA 1RBMA 5TMDA 1HYQA 3RD5A 4M0MA 3RJ0A 5KNDH 2BQRA 4ITRC 2H1VA 4BRZA 3I5UA 4PWQA 3CVYA 1VJ1A 4YB8B 1J9ZA 2FTKE 4IINA 1YCDA 4CEHB 3L02A 3R3UA 4HAVA 4KE8A 4PW0A 3RRMA 4Q4JA 4BKOA 4B17A 1QYWA 3UKDA 4V0QA 5T67A 5KFFA 2MMCA 3PHGA 4LDAA 3AVTA 2PXHA 4NHOA 5BV2P 4NG4A 3N39C 1JNYA 4BU1A 4E12A 2FK3A 3RVOA 3T1QA 4Y6PA 1BKSB 1Z6YA 3OA0A 4HVAA 3DJYA 5ILGA 2EJ2A 1A97A 1I0IA 1KFBB 2X4IA 1P2VA 2NO4A 4BEBA 5CG2A 3LRTA 1L9XA 5J2TB 3KHUA 2AX4A 4YI3A 5TNXA 2Q3MA 3FPBA 3TCXB 1QSGA 1BD4A 5IN4A 3WGNA 1JE1A 4BGVA 3VH1A 3OQJA 4KYUA 4MUXA 1N7IA 8AT1A 3NAMA 1OAAA 4IJKA 4PNZA 3RVKA 4DTIA 2C97A 5BOSA 3AIOA 1TUIA 4DWJA 5ADWA 3DLBA 1U1EA 3V8VA 4J9PA 5LD2B 4M21A 3LHDA 3SS7X 5DQIA 4IVRA 1R9NA 2V58A 1WXEA 3RRBA 4FUTA 1Y9JA 3DQPA 1TKRA 3DBRA 3NHYA 1O6FA 2HRDA 2PGLA 1NPDA 3KWMA 1PR1A 1I6WA 1BFDA 1ZP6A 5TRTA 1GZHB 3ZNOA 2R2GA 3OQ1A 3EZFA 5JD5A 5CM0A 1ZMBA 3EOZA 3OO1A 2CYAA 1A2KC 1BXZA 2C04A 3OQIB 2WJGA 4URXR 3GTOA 1JLHA 4JZYA 1VIVA 4BO7A 1I5OA 7MDHA 4LBZA 5IARA 1GYFA 3C3WA 4CF6A 1FPMA 1OTHA 2ATVA 2CC2A 1I7DA 2DPGA 4NJMB 2XAAA 3TNFA 2ZJ7A 3QHAA 3U48A 5AK0A 4B4OA 2JZOA 2RC6A 1PJLA 1D09A 2O0LA 1KMNA 4IHAA 3EGXB 1N7GA 5JJKA 4HD8A 1PR2A 4UTOA 1PKXA 3CCFA 2HIVA 1XFAA 1TD9A 3M49A 4MA5A 1JAHA 4UM9D 1ZGHA 1A7AA 1PLKA 3L7IA 4BY7G 3E9CA 5KS2A 5GIOE 4EA9A 3UMVA 2BOVA 2FPIB 3OQ6A 1RKXA 3M81A 4WLNA 4FYVA 4YAJA 2W6NA 4DQ0A 2WAYA 2P2YA 1KPGA 1LK5A 3GIDA 2R84A 1SUEA 1X86B 1MT3A 2C99A 1NE7A 2EHDA 2G1UA 3EQ2A 3FBGA 5J40A 1FFXB 1RTKA 3MBKA 4XJXA 3URKA 3AY3A 4YRPA 1KQGA 1RBYA 5E9AA 2OC4A 1H2XA 1AGYA 2VBIA 2W2TA 4WOCA 1O97D 2I2CA 4DIBA 1WB6A 3GGGA 3HCWA 4QHSA 2VQ6A 2WHEA 4R9RA 4RK0A 5D3KA 1ISGA 5EE0A 1IZ7A 4C7KA 3EF1A 1QZZA 3FCEA 2TSYB 4GOLD 3OIFA 4BQEA 3W1EA 4KWTA 3GP5A 4A5OA 5CU7A 1VB3A 1R6XA 3LH5A 3JVVA 4TKVB 2XRFA 3PWZA 2AJDA 4L6IA 1N92A 4M1WA 4M99A 1NSYA 3GRKA 3WYAA 4E7PA 5AM3A 5JIBA 1UC9A 1G8HA 4PGGA 2ON6A 5LP6F 1AZWA 1QHNA 1ZRSA 2GPBA 4QLOA 5EE9A 1KE2A 1DCFA 3WYBA 5IH3A 2Q5FA 3FPSA 2E4WA 4GT1A 1W4ZA 4DL6A 3AHIA 5CG1A 1NLMA 1RWBA 1U7WA 3KR0A 2RGYA 3ZXXA 3ZS9A 4FMBB 5C1DA 2O5EA 3MWMA 3BSYA 5FP0A 3ZD9A 1E3EA 4LOLA 1E79D 3FFTA 3K6JA 4DMHA 5JSQA 2O8NA 2C0QA 3OD5A 5KCZA 3IUSA 1ISRA 1TKBA 1QU2A 3OLCX 2HKIA 3DZHA 4DDWA 5EZYB 2X9QA 1P4GA 1W44A 3MPUA 2DPYA 4LY0A 1D2HA 4NBRA 5B1DA 1ET0A 3SSAA 3V8EA 2PH7A 3V2IA 4MB6A 2R86A 1S2MA 4XAQA 5IU6A 4C07A 4M53A 5DRTA 3QJYA 4N3GA 3H4DA 5EEHA 3WJAA 2ZUCA 1YC2A 1K08A 3OFSA 4R6WA 4CHGA 3HUDA 2SECE 3T5KA 2WG1A 3UA3A 1EDDA 1VRCA 3GZJA 3V48A 4BN5A 4V1CI 3OLXA 4A4DA 2Q4TA 4BC0A 5I7UA 1PYDA 4FOSA 4XYMB 1E1RA 2HM7A 2C54A 2VDLB 2JI8A 4J3JA 4MQFB 3ZHVA 4QQFA 2GI4A 3GXOA 4N5DA 5F64A 5A3JA 2ZB8A 1KBQA 4DADA 5ALWA 2CKDA 1BWRA 2DFVA 4HWSA 4Q48A 4YCJA 4ENVA 3J80A 4S3MA 2ZE8A 5JRJA 1NT4A 1H6AA 1YE5A 2AYYA 3LVRE 4B8WA 5FLXA 2BYTA 4MPPA 4BWYA 1EGMB 3Q8KA 3KP1A 1RJQA 3TMKA 1IBMH 2ZYIA 4YMHA 3BK7A 3O3OB 2ZBQA 5T64A 3I9FA 5HK9A 1NBEA 1AGXA 2WT9A 4WHXA 4YLGA 4XWKA 3BK1A 3L8CA 4X8MA 1UBRS 1HC7A 2WUGA 5E1BA 1YULA 2A1HA 3BWMA 3FB1A 2W4MA 1NV8A 2IXAA 1CKMA 2PPVA 3B51X 2CKMA 3B48A 4FWIB 1KVTA 2QIPA 4OQFA 2XA2A 3DFZA 1VBFA 2ICAA 3GPDG 2AMFA 4TRNA 1ZGGA 1IEXA 1R4NA 2GRAA 4F2GA 1HDGO 4YRJA 2F55A 3EUAA 3R7NA 1Z0JA 3ICQB 4KSBA 2PY6A 4MRVA 1NQTA 3RGGA 5JHGB 1VB5A 4B8YA 5K3WA 5A0VA 2OG2A 3CGGA 4Q4AB 3FPFA 5I9BA 2LE0A 3K3PA 2IYZA 3HY6A 2J41A 3K32A 1ZNQO 4PZLA 1V9PA 4FBGA 4JQOA 5CLIA 5EPUA 3SNKA 3UWKA 2X3FA 4ALKA 2UVWA 2FWBA 2H59A 3CSUA 3KDAA 3O5AA 4L3OA 1EDZA 4OAQA 3T3PB 1PHPA 4JVLA 4C2MA 1SUBA 3THWA 3TDMA 5BUZA 2Q07A 3H4BA 4CIDA 3EDOA 4TWZA 2BRUC 2EFGA 1WCMA 1P8AA 2VNIA 3H9JA 1R5OA 1G42A 1Z35A 3ZGYA 4EOGA 3HJBA 1JGTA 2JGLA 5JU6A 3DFMA 2MR6A 4L6AA 2G8LA 3ZIDA 1A98A 3TSYA 1OZHA 3TL3A 1XN1A 4HGYA 2R8IA 1Z0ZA 2QPOA 3GQVA 4HEJA 4O2AF 4QOHA 1TZMA 1X1RA 2FCRA 3Q5DA 2GRUA 3BFPA 3B9RA 2PT9A 4XD2A 5GGYA 3PTZA 4YUXA 1KYVA 4KUHA 3Q7SA 2IDKA 4K6GA 5EKTA 5AKZA 4AECA 2QORA 1SBCA 2E21A 3ZLTA 4ZCIA 2R8YA 3FYTA 3MS4A 3RASA 4UE3S 4AZSA 5B58T 5A4FS 4Y0VA 1XZEA 1WXXA 4PM4A 3QFRA 1WL8A 3QBEA 4YT5A 4P0QB 3LP6A 4FMCB 3QTBA 3KCQA 4KXMA 1E8DA 1G18A 2CXRA 2FSFA 2ZIZA 2NACA 1KS9A 3LMKA 4Q4HB 1NG1A 1PZEA 1RTTA 4QWDA 1X15A 2OB1A 3F3KA 1BGWA 2AUNA 4HF7A 3E3LA 3Q7IA 3UUFA 4ZGWA 4UUMA 3TY9A 5HZGA 1KAMA 3NTRA 3TBKA 5ES4B 3ND9A 3TSWA 2IXGA 3C3BA 5DBIA 1JEQA 4ZOLA 1ESDA 2FYTA 2H4XA 3Q0EA 3WTBA 2F7SA 4JY7A 3H0KA 3IA7A 5CK4A 4AJ9A 4EG7A 1ZIPA 3O21A 1Z75A 5KFNA 3T9CA 3D02A 3RARA 5EFOA 1V8OA 3FWNA 1C1DB 4IDEA 1KA9H 5F7OA 2RHBA 1ZL2A 1HQCA 4EBCA 2DTXA 3PE3A 3UJ3X 1Z8NA 1UAYA 2Y0EA 1A0IA 1EDBA 3VU1A 4CN9A 4R8RA 1CLUA 3BTUA 2C1EA 3GRAA 4A16A 4L4RA 3E5HA 1ZCAA 4V39A 3C2QA 5EP1A 4M8SA 4O2BF 1N6KA 1N4DA 1T36B 1HI9A 1K6MA 3HV0A 2AC4A 3CLRD 3ZEAA 2IPXA 4U7DA 3E9NA 5I47A 1T6XA 4BS9A 2WDZA 1TA8A 3GLRA 3BWXA 1VE3A 3OBBA 3GIWA 2PYZA 2C3YA 2WU8A 3CN7A 1PEYA 4MW7A 1NLUA 4Y6QA 5EP4A 3WK5A 4CLDA 9GPBA 4X66B 3QFFA 4HX5A 3JR3A 1RQNA 3I92A 4BNWA 1GTZA 2GNPA 2I7DA 2VYFA 4GX2A 1U3GA 1BMDA 3DVQX 2DUJA 4IY1A 3CX3A 4OGKA 1Y1VG 4UBJA 5KWJA 4BGUA 4S2EA 1BMTA 5EQDA 3QWAA 1CUCA 3TOSA 1FRZA 5DXFA 1IHYA 3DCNA 1B00A 1KK0A 1QR2A 2ZPUA 3C7AA 3E8MA 5EXEA 3WFIA 5H8WA 4YFYA 2HSWA 2F3PA 1N9GB 1IZYA 5JMPA 1EH5A 3L7KA 3TBFA 4KR2A 5GY7A 3R7BA 3ANTA 5I5TA 2OD9A 3IPXA 3STWA 4REQA 1Y3IA 4XTRA 1GGNA 1SHJA 1U8TA 1WIWA 2G9QA 1QIIA 2JRCA 3FVQA 1PJ2A 1IY9A 4A3LG 2RHLA 3KPYA 1EG7A 1WULS 1BVRA 3E1GA 4IAOA 1IWBB 4BLPA 4K9RA 1G60A 3MTEA 1ZMRA 1RYHA 2NTVA 2VHJA 3Q3IA 2YCHA 4RKYA 4YP3A 1Z62A 3S8MA 5AI0A 4YJ2A 1TQ4A 5HCUA 3HU2A 2P3SA 2R7MA 1WV0A 2NXJA 3IFSA 2VWPA 3S55A 3OIDA 2V5AA 4EA8A 1U8XX 2DOKA 3HCFA 4FK8A 4IBOA 2GHIA 2WRZA 1HE2A 3FSEA 4LE0A 4XRRA 4FX2A 4P3YA 2ZTSA 1PN3A 3JYOA 4FZRA 4HLUA 4LWPA 4PLGA 1B1CA 1J21A 3RC3A 2BKEA 3ZOZA 5A5EA 1PZGA 5H80A 4MWOA 4JGGA 3VR6D 4PGFA 3D7SA 3RNLA 4C6TB 4UAUA 5DNEA 3D8NA 3F7TA 3ZV7A 3ZW8A 3K72B 1I7QB 3DC7A 4CG3A 1EXWA 1HXHA 3P9CA 1FFGA 4WCVA 3TE7A 2VJMA 4RVGA 3UHOA 4I8IA 3FNHA 4N7RA 1Q17A 2C9CA 5FUWA 4BVEA 3OPYA 2X8LA 4UHEA 5DHRA 1KOFA 4GX5A 1OSNA 5TF0A 3TGWA 4F11A 4UTPA 5EIEA 2YMQA 1KMHB 3NIWA 3WK8A 3DXZA 1FUIA 1ZJYA 3CONA 1D4FA 1KOGA 5JS2A 1KC1A 3HWWA 3WLKX 2ZS8A 1NFFA 5EP2A 2D4AA 3JVDA 1NDUA 3HCRA 5ECWA 4YP9A 3QNMA 4BQFA 1BYIA 3A1CA 4HQKA 3JQ6A 3BXZA 4CMHA 3DR3A 4HVTA 4K8OA 3P0EA 1Z07A 3CRMA 3IT1A 1SXIA 4PLPA 4BVAA 4E3ZA 1CUXA 4N82A 3T5JA 4FW8A 3RROA 1WMDA 3FE2A 5JZOA 3K0AB 3CRVA 3NVDA 2QD2A 4LSWA 2VJMB 5FIUA 3K31A 2Z8ZA 4O3SA 3BJMA 1Z5PA 1K06A 3DTVD 2IZOA 3G2MA 1GQFA 1YJCA 1QE3A 2RIPA 4D7AA 5BN4A 1GTL1 3DT6A 3NS7A 5IMBA 1MG5A 3JD2A 5H81A 2V7TA 2YWGA 3WLIA 2OOKA 1IL0A 1CUEA 2A9RA 3EMVA 3ZQ4A 2ABJA 4R1MA 2CWDA 1VAJA 2IC5A 4BFSA 2GUWA 4ZU1X 1QRDA 2HA4A 4S2UA 3QLVC 4YUWA 2IUEA 1K7FB 1ZLYA 1U3TA 3ANLA 3QIAA 5LPNA 1MTOA 2O8DA 3ZVMA 2QHXA 1T2FA 1JMVA 3DOJA 3G0HA 1W19A 4KFCA 4URZR 3AGQA 1Z8HA 2W2LA 3C4QA 2ZPTX 3LDHA 4FMDB 2JJ2A 5EWMA 1OYYA 5FJJA 2HJ9A 1OT3A 3CBGA 1ZEJA 4ZWNA 1SXJE 1W2WB 4AT1A 3ZOKA 4HUTA 2JFHA 3V6HA 1NNSA 2NNWB 1GR0A 1I51A 3CKYA 5KDLA 1U11A 3QLTA 4YJGA 1Y89A 2ZDQA 4FU0A 2DPJA 1UWKA 2BMJA 1K8RA 1TWGA 1KZ9A 2ZIUB 1QPZA 3AW9A 4I36A 4NEGA 1C80A 4WKPA 2Y4NA 2P9TA 1O1YA 5KT3A 1I14A 1N9GA 2C96A 3E81A 3EGXA 3GNQA 2PTGA 3M33A 4DIMA 3PWTA 3TRJA 4M9RA 3PDUA 5BWLA 1AMOA 1FJGB 3FZGA 4UFOA 4RB3C 1WSWA 3KPVA 4X93A 4DQUA 1P7PA 4WESA 1JFFA 2VA3A 1PTKA 4IXNA 2XAUA 3DC2A 2WJ4A 2WWWA 4RZRA 1R0BA 1WBBA 3I37X 5TMEA 4M7OA 1QHGA 1G63A 4X7RA 5LLSA 2UXBB 3TAUA 2I4LA 5DISC 2Z08A 2AVDA 3FNFA 3K2BA 5GMOA 3FGOA 4B4DA 3MS7A 1N5MA 3NHFA 3SZRA 4YV7A 1I1LA 5LWQA 1XTRA 4JSYA 3GBPA 3I6YA 3PN1A 3GNTA 4Z0NA 3WL7A 1TF7A 4FFPA 4AZVA 2JEIA 4XGQA 5LA6B 2VR1A 3K05A 1OKKD 2V8OA 1Y0BA 4I9NA 4LHYA 3CVJA 4UNIA 3S2IA 4FWTA 3CR7A 3VJKA 3ZIAD 5CFMA 4JB3A 3RJ9A 4ESEA 5BSRA 1K88A 3NUAA 1YBAA 4W6QA 1O94C 2ENUA 2I4TA 4YP7A 4J1TC 2A1UB 1W5EA 4DR4H 1C1DA 1I4TD 1LLCA 1SB9A 2XIJA 4ZI5A 3RTDA 1DEOA 2QMYA 4PZ6A 2Q2QA 2IA5A 4YT2A 2BP7A 5ALDA 4DL7A 3AH8A 1ZCFA 5LDGA 1T9CA 3CRNA 2IYXA 1TLFA 3ENNA 3EAQA 5DMXA 1FBTA 3H2KA 5JSKA 2OL4A 1WDWB 3F9IA 5EMNA 2Q5EA 1WP9A 3S7TA 4CTMA 3D81A 1KJ9A 2HY7A 3JQAD 1TW2A 1WXQA 4RVNA 5CURA 3CH7A 1KF0A 1OBDA 4G81A 4IMIB 8ADHA 4L95C 5BV8A 5HG0A 3LQSA 2CVQA 3W6ZA 1E96A 3ZK9A 4KQGA 4YONB 3QXGA 3GFFA 3SGIA 3D2AA 4LXTA 1SVOA 3ZVNA 1NN1A 4YAUA 2UXDB 3C1AA 1NMYA 2ZB2A 1DFHA 4Q01A 4HDMB 1NM5C 2GQSA 1NPYA 1KDYA 2PWYA 2AK2A 1G55A 3X2FA 4LBYA 3UO8B 3EX7C 4IJ5A 1YFKA 5E6RA 5K3CA 1XHEA 5KTRA 3GDFA 1Q3KA 1UMDA 5FWXB 2EG5A 3BSFA 4ETMA 5CE8A 4NU6A 4TLBA 1TIKA 4DZZA 4GW3A 3AMVA 4ZIRB 4C7VA 3TXXA 3FPGA 1X8JA 5B30A 1W94A 1NWCA 2J07A 4GBJA 5AXBA 1JHMA 3IRVA 3A25A 4R54A 3LQ4A 1G8SA 1M1UA 1OJ7A 3NOQA 5C3UA 3RSQA 3EVTA 4DLZA 1C30B 4YQFA 2NZWA 4BUZA 4BOYA 4EUFA 5GOZA 2JLVA 4Q4AA 1HDOA 5AVXA 1VL6A 3UMFA 3MILA 1UKYA 4EMUA 3BKWA 2PH3A 4DL5A 3IXQA 3DMDA 4G09A 3A1DA 2XMGA 3L7LA 3TTVA 1KK2A 3BD9A 3I6BA 3NHPA 4BX3A 1KAOA 3ND7A 5DYNA 4CDNA 1P9LA 4GPZA 5CX1A 2GASA 2HTEA 4ZZ2A 3TINA 3VV3A 5IDXA 1ZETA 3G7UA 4RK5A 2EQ5A 3EQZA 5LP6B 4XZ3A 5G1NA 3IUEA 4CLEA 4IIYA 3HU5A 2PMZE 2VSFA 1SVNA 2BI7A 4ZHQB 1FVFA 2B8EA 2WTAA 1N2CE 2I1WA 2VQFH 1A82A 1AXEA 2BZ0A 3AT1A 1BCRB 3HVIA 1G8KA 3KPWA 1SG9A 3G7NA 1UP6A 3HUTA 1PJZA 3QKUA 4Q1BA 3WGLA 1R8YA 5EUCA 1J7KA 1JIKA 2PKQO 3DOIA 3FF4A 3TD9A 2BE7A 3TTUA 2HNAA 5AIBA 5FEUA 5ICSA 4XFKA 2I3ZA 5KWSA 3PW0A 4CMKA 3F8TA 3M6FA 1P1KA 3NKFA 1N33H 1QB8A 2FSUA 4ZFNA 2J59A 2XCIA 1NI4B 3SHFA 4DVGA 2HMTA 3ORRA 1CUUA 5D5QA 5AP9A 3S70A 3TLXA 5ANRB 5AW4A 5DEOA 4EABA 3JY6A 1JDUA 2WE7A 3HN6A 4KLAA 3ZV5A 1EWYA 1UMCB 1PVVA 2OTCA 3BBLA 2XCLA 2VYVD 4QDJA 2G9RA 4CE6A 5LSAA 1A8UA 1U0HC 3BFJA 1Y7LA 4GKVA 1W36B 1SOMA 2CW8A 2JIZD 1E62A 1M73E 4M2LA 4PZ9A 3EQ8A 1KI6B 2E7ZA 4UKDA 2BFEB 2PMDA 1FJHA 4E5UA 1ESMA 4IJWA 4TZTA 1K63A 2VDJA 4MKRA 3GIMA 1B8UA 1ZIXA 1W5TA 4RMHA 1UFKA 1E2LA 2J9RA 4B74A 1JQLB 2HWYA 1XVVA 2IOQA 4NCKA 5DW0A 2YY5A 4MUFA 3EW7A 3F4KA 3UC9A 4I4TB 4EBFA 1OGJA 3GUCA 1E2FA 5JR3A 4XWAA 4EKNB 3HOUG 2QE6A 5IYBG 4RNOA 4J90A 4BCDA 2ECOA 3ERCA 1EE2A 2Q0QA 4RYDA 1QVWA 3DF7A 3FSRA 3BSWA 4CF4A 1KMQA 2ZKLA 4OH7A 1NF2A 2OV2A 5EN4A 5EJAA 4N0QA 5COQA 2WHYA 1W59A 1RLJA 3FKJA 3ZCVA 4D9EA 3UPUA 1HNXB 1K9VF 4JJ6A 3X43A 5K6RA 5DTQA 1UJ4A 4D8YA 4PU0A 3O75A 1DXQA 2W8BB 5JSFA 1MP0A 4LF5H 1V3VA 2C07A 4UXJA 5JAMA 2YXPX 1UADA 1TJ3A 1E2DA 5KYYB 1EVIA 2WIDA 1Q57A 3IDQA 2O52A 3WL8A 5ARBA 5CVUA 4FBLA 4B43A 3FMIA 3BDIA 5AH0A 3KSRA 3ZCXA 3GTJA 3BRQA 3KOYA 1LBIA 3IMGA 4J3NA 4EY3A 2YV5A 2Z30A 5FUMA 3IAHA 2E5WA 3WQRA 4B45A 5CGQB 1CUHA 4HG2A 2A67A 3NNSA 1NMXA 1NPTO 5T57A 1WSBA 4PGMA 4X6XA 5U4QA 1DLIA 3URMA 4X7PA 2H4HA 3WBFA 3Q12A 1SEVA 4RELA 4W63A 5CB0A 1FMFA 4F38A 4E09A 3LUBA 1XMVA 4QWAA 4OMUA 1PZHA 2XQJA 4QSHA 2QYZA 3CZQA 3K4QA 3O38A 3K5PA 3R40A 1WF6A 1NJ8A 1EFKA 2OEPA 2QVGA 3FRJA 4JLMA 4C4XA 4CNQA 3KB6A 4LRWA 2DHCA 4YNBA 3ZJ4A 4WECA 4ETIA 4Z49A 3L92A 1IBLH 4XCQA 3U4HA 1U2EA 1E2MA 3SQDA 2IHTA 5TMPA 1VE9A 3F49S 1CR4A 3X2EA 4H77A 4NR0A 2OO5C 4F72A 2BPOA 1QCCA 4BLVA 2JGAA 1LH0A 2O7SA 2I6QA 3OIVA 3VM6A 4YR7A 3ZWQA 6GPBA 3OLVA 1Z33A 1ZHOA 1BX1A 4DV1B 1O0SA 4IWXA 3P26A 3R3VA 1E5XA 4NVRA 1XEFA 1M6EX 4C7OB 1PV1A 4ZC1A 2UVUA 1F1BA 4R1LA 2VPQA 1N3YA 1VGRA 4V1CA 4AKHA 2ASEA 1NLZA 2QVZX 4O84A 5I7HA 1X13A 3L2PA 4E15A 2GFIA 5AI8A 4DSAA 4YHHH 5DGBA 3X1DA 3OZVA 4JP8A 4D45A 2Z09A 2ZRFA 4D4KA 1IXRC 4GAEA 1L3CA 1GV1A 1OFVA 3CY6A 3I45A 3A0UA 1XCBA 5AM0A 4NLLA 4G5XA 3CUKA 3HO1A 2OCBA 1N3BA 2OSBA 1O03A 1RWOA 4ZQHA 1JLKA 1YQEA 5EPEA 2BZ1A 3FGNA 3QG5A 3D7RA 5IHXA 4HWKA 2QENA 2QI9C 3WLTA 3E4DA 4BEWA 3V1KA 2FJ0A 2RI0A 5D3QA 4GC5A 3R9WA 2ZI6A 2VCHA 5EVJA 3IUNA 4BB9A 3K71B 1BDHA 3TPFA 1XRMA 3L0SA 1FTSA 2JD1A 1D04A 5IASA 4MGKR 1EESA 4DWWA 1SBIA 2FSVA 4WKBA 4EB0A 3EIOA 2A0WA 3EUEA 3OEHA 2IE8A 2A1IA 4YPFA 1GQRA 1QORA 3EH2A 3KTOA 1A8HA 4Y1GA 3KREA 2Q5LA 1L7NA 3RYTC 2UUCB 3CYFA 4LRSB 4X1KA 4QIWE 1V6SA 1CF2O 1NLYA 2NYVA 4GOOD 4PX3A 1YCGA 5LN1A 1J2UA 1KTVA 3JQ8B 3KG2A 5LYJA 4JI1H 3RSFA 3S3TA 3VZRA 3AB3A 4QODA 1Q83A 1CUZA 4F12A 4A3JG 5BPFA 4MV1A 3PO2G 2IU6A 3STXA 5AESA 3VDNB 1QGDA 2GK4A 4R69A 2CB0A 4G9GA 1JTEA 2FU5C 2QRZA 2WKPA 1U7HA 5I5WA 3ABQB 4IL5A 2IZ6A 3T7JA 4O7VA 2XCTB 3V00A 3MTIA 5C4XG 4UDXX 4ZYYA 1Z5NA 3EZ6A 4JQCA 1J7JA 1UBFA 1SU8A 2BR3A 3CG0A 2D2FA 4K46A 2GYUA 1C7RA 1EUCB 1XROA 4DANA 4UASA 5G1PA 4TX1A 2J8ZA 1FQKA 3RODA 5E1OA 3U37A 4Y1RA 4QVIA 1F1JA 1B43A 3RS2A 1F2UA 1P5ZB 2VTDA 3KTDA 5ICMA 1M1NB 2GYVA 2H5EA 1KE1A 3VHXB 4DJDC 4HEHA 3IUMA 1U3DA 2Z1DA 1PKEA 3CRQA 1WVMA 2WSSD 4QJBA 1N2BA 2C98A 2GCPA 1VCOA 5ALTA 4BX9A 4PWYA 4CM9A 4ZJZA 2ADOA 2QD5A 5NLLA 1XTVA 3O9MA 3MJCA 4KMRA 2YHIA 5F5LA 1KC7A 1LNSA 3Q5GA 2CNLA 1C14A 5EMLA 1XTTA 3DZIA 1JECA 5DXJA 5KNBD 3N0TA 3NTLA 4RDXA 5ALPA 3DBHA 4KNVA 1V5GA 1CCWA 2B1IA 3NC1C 5DLPA 5GJVC 4FC7A 1FP6A 1XTQA 3IEVA 4MI9A 4FCCA 1SZCA 5DTMA 3UJHA 10MHA 3DLTA 3G8DA 2FLWA 3GPCA 3GVPA 4DG9A 3G59A 3PE4A 5CGZA 2C2ZA 3IPLA 2XXAA 1KDTA 4JHLA 1GL6A 1NIJA 4OMDA 2LKDA 4D9NA 3TR0A 2OV4A 2HHLA 2IGTA 3UAWA 4S04A 3VQTA 4APMA 1H94A 3GRFA 3GAMA 1Z16A 3K15A 4TKMA 4UEKA 4RBNA 1G8AA 3F0TA 4XD7D 3ASUA 1F17A 4A82A 1GSHA 2CDCA 1QC5A 2J31A 3SYKA 4DLVA 1K89A 1MJHA 3FCXA 2P27A 3L1KA 2PFGA 3QE0A 3A9TA 3UT5A 4CEJA 3EGIA 5K0JA 3BMOB 4O3PA 4EATA 5JXGA 1U3UA 2RHMA 4ZJUA 5JXWA 1W85A 2RHJA 3GUUA 5DCLA 4O7WA 1A69A 5D1NA 1A8QA 2ZBDA 3I83A 5DCUA 3NC0B 2ZJ5A 3OOJA 2H1OA 3TPZA 2O59A 2VBGA 3JALA 3S5UA 4ED1A 1X92A 3D0QA 3O95A 4W6ZA 2VPXA 2CXQA 3U60B 1NY5A 4CMIB 1RQ2A 3H3FA 2WLTA 4I81A 4YDSA 2NUPA 1CVIA 5C5CA 2PEYA 4KDRA 5EIWA 1RZUA 5H0IA 3K2QA 1WZUA 1GTSA 4P8RA 4UXIA 1I6LA 5JNWA 3VJRA 4DV0H 4AG5A 4ER7A 4FFNA 121PA 4I66A 3ETEA 1SVSA 3ABZA 4KEAA 5AKLA 4F92B 3QKRA 1AZTA 2JI7A 5TARA 4M8KA 3ASYA 4DCOA 3BB3A 2UAGA 3WNDA 2ZAOA 4OHRA 1O54A 1GY8A 2WMYA 2UUBB 3V1NA 2RCYA 4FE2A 3H19A 3IESA 3KXIA 4IIJF 2I2AA 1I33A 4KKVA 1Y3DE 5FFNA 3ZDDA 4OFBA 1PDWA 3B89A 4QWCA 1N8SA 2H4JA 2VOEA 4DR7H 2KWIA 3HUEA 1ZCBA 3BCSA 5CA0F 2J85A 1E9DA 2ZYTX 1Q74A 1AKWA 3WK4A 1A48A 4KXYA 4AZTA 2VJPA 2WIJA 2V6IA 1EVJA 1OFUA 4FI3C 4AWAA 1GVHA 4E2WA 4U7PB 4OSOA 2WVJA 2RK4A 4OHMA 2CLLB 1RIFA 2R4QA 4UMFA 3ES9A 2ADMA 5BWWA 4L8WB 2XTMA 3VZDA 5CEFA 2OCYC 1XCPA 2JFOA 1GQ2A 3W2TA 5ALRA 4B85A 4MV3A 5DBHX 3WL5A 4EDFA 3E15A 5KNBH 1BROA 4X1IA 4JBNA 4KX3A 3CZCA 3IIJA 1TZJA 1VI2A 4HDKB 1IM2A 3F7MA 4EJSB 1Y1QA 5DOZA 1E2HA 2OB2A 3ML1A 5H3HA 1DKRA 4F97A 5CLFA 2OO3A 4KHZA 1JEYA 2Z8YA 3ENKA 1UKCA 2P2LA 1YKGA 1TO1E 3DW3X 1HOTA 2PZ8A 2JZNA 3AEQB 3QVJA 4GMHA 4BFWA 2C4KA 1ZCZA 1QGUB 3GLSA 2VTVA 2OPBA 3GJZA 4RO0A 1SPXA 4F3KA 5KNCH 3VPBA 2C35B 1MENA 2COEA 5GZ1A 1T8UA 2HCBA 5BWRA 3IUQA 3DLIA 2VDUE 1FF9A 2YL2A 2OLKA 2XLBA 3A31A 4ZCSA 4EJ2A 1MEEA 1PCXA 4DCCA 1JWAB 1X7HA 1X80A 2JKVA 2QVBA 3IAS1 3RSHA 3KAJA 3GMDA 4JN6B 4CMAA 4DV0B 2IY8A 4C1BA 1JALA 3ROGA 4GQIA 3RK1A 1Y1RA 1N77A 5G53C 3T7CA 5BSMA 4NMWA 1UWLA 1R5BA 4HGOA 3QXXA 4PANA 3VPXA 3FHJA 1T4GA 5FLXW 4YMSA 1DJQA 1EIZA 1HE5A 1KH1A 1OASA 1KO4A 2JAXA 5BMVF 1LBSA 2MWMA 2PX0A 2WMDA 3A3OA 3PQ4A 4R40A 4F2PA 4IUDS 1FS5A 3UJAA 3C3CA 4R1SA 4X41A 3M6MD 1XVLA 3ZU2A 4TSKA 3MJDA 3ASZA 4NH0A 4OCZA 3R7DA 4GMKA 3LUPA 1E3WB 2GERA 2YNMD 2BEUB 3DT8A 4GPTA 3OE4A 3MB8A 3CXRA 1ML4A 4FFBB 4U00A 1GPWB 2OGSA 1EKXA 4IM7A 4A2QA 4ZPJA 4K87A 3H13A 3KCNA 5GONB 3IT0A 5E9WA 4BFZA 3HC7A 4CYMA 5LOVB 4UNPA 4PY2A 5A05A 2RONA 1WCV1 5TPWB 3ER8A 3M1IA 4NBTA 1DRKA 2IE0A 5IAEA 3AY7A 3PJFA 4UCSA 4P7BA 5F3WB 3R41A 4DLXA 4HGQA 3VVBA 4PX2A 2PCJA 2CVZA 1CEXA 3H86A 1MJFA 4XSGA 5DYYA 3ZV6A 5JBIA 1JDBB 2R82A 3M3DA 2RGNA 3MEQA 4QBFA 3DEYX 3U61B 5CLQA 1HZJA 4R4JA 3FOZA 1N5IA 3COJA 1SVMA 1WMSA 4EEKA 1XQ9A 4QHTA 2DTEA 2W6JD 4NAUA 3UIEA 2RGUA 3FCOA 5JECA 3R24A 2ERCA 1DHTA 2FSPA 1TCCA 3A3KA 2Q2UA 2J46A 6AT1A 4YO7A 1NF9A 2YFQA 3P0HA 2EKLA 2CCGA 1Z5UA 2V5VA 1F2DA 4LVCA 3R8CA 3VR2A 3DFFA 3QGMA 2CXSA 4GLFA 3QOFA 2DTDA 3U4QB 3WJ7A 2Q9UA 4P2GA 1W581 4XQ0A 1SVWA 2PKCA 1WHTA 3LF2A 3PL1A 4L08A 2NXEA 2WWYA 1LPBB 4INZA 3A9RA 1VYHA 5DSZA 4BZPA 4CUKA 2BGGA 3HMQA 5KFUA 1X2EA 2JJQA 1C8KA 2VSQA 2YTZA 3JQBA 3WOVA 4BQNA 3SC2A 2JFQA