2YZMA

Structure of d-alanine:d-alanine ligase with substrate from thermus thermophilus hb8
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of D-Alanine:D-Alanine Ligase with substrate from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 83
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzmA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzmA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzmA01
4O7TA 3MJFA 4ME6A 4HNVA 5LOVF 1VBGA 2PBZA 2CQYA 1OBGA 3N6RA 1BXRA 5BPHA 3GLKA 5JVDF 3WNZA 1KJ8A 4O7LA 2PN1A 2W6ZA 2YL2A 4EAAA 2HGSA 5BMVF 4TV9F 2DLNA 4MV9A 1EZ1A 2W6PA 1C30A 2ZDQA 1BNCA 1JLLB 3RUPA 1KJJA 2YRXA 4O83A 1SCUB 4O84A 4TV8F 5CB4F 2DZDA 4O4JF 3VPBA 2I87A 2PVPA 4QSHA 2J9GA 4O4HF 5I47A 4Y8VB 1JDBB 1Z2PX 5KX5F 3U9TA 2V5AA 3BSSA 5C8YF 4MV4A 4FU0A 4MA0A 4IZOA 2YZMA 3R5HA 2FPGB 4EA8A 2YWVA 3VA7A 5JH7F 1I7LA 1EUCB 4FE2A 1A9XA 2VHEA 3TQTA 2NU8B 4O7RA 1C3OA 4FFMA 2NU7B 4YJ2F 4FFOA 1M0TA 4TUYF 3RV3A 5LYJF 4M9UA 2YZNA 2FB9A 3I12A 1EYZA 2SCUB 2QF7A 3BFPA 1KJ9A 2V58A 2XCLA 1AUVA 2R7MA 3OUZA 3BSWA 4YBZB 4O7ZA 3N8DA 1KBLA 1M6VA 4M9CA 2VPQA 4EGJA 2Z04A 1CQJB 2NUAB 3R9RA 4RZQA 4YAJB 4XX0B 2R85A 1KC7A 4O2AF 5KKNB 3GIDA 2FPPB 1KJIA 2CNQA 5IYZF 4GGMX 4HR7A 3KREA 3G8CA 1KUTA 2WYOA 4O7WA 3MWEA 1PK8A 2R87A 3RFCA 2DIKA 1EHIA 3VPCA 1W96A 2X0SA 3VMMA 3HBLA 2C00A 1OBDA 3AW8A 2YYAA 4I50F 3VPDA 4XZ3B 4O7NA 5JVLA 3Q2OA 2W70A 1DIKA 2GLTA 3JRWA 5JQGF 4EG0A 4IWXA 4MA5A 5K2MA 3K5HA 5GONF 3ORRA 3TIIA 2W71A 4NYEA 2R6FA 2GPSA 1W93A 5EZYF 3KAJA 5LP6F 2R7KA 1IOWA 4M98A 1UC9A 2I8CA 5HV6A 3G8DA 4DIMA 4C5CA 1E4EA 3MWDA 4I55F 3HO8A 4MV3A 3U55A 3VOTA 3U9SA 2R7LA 3NUAA 2FP4B 3JZFA 4M99A 1JDEA 3Q1KA 4ZQIA 2CZGA 2YZLA 2W6MA 1CE8A 2QK4A 3K5IA 3R5FA 5DMXA 3V4SA 4O82A 1I7NA 1GGOA 4IHJF 4MV8A 1Z2NX 4O4IF 1CQIB 2YRWA 4FFNA 2OLSA 2XD4A 4XYMB 5HBRB 4L1KA 2VR1A 1DV1A 1WR2A 2R86A 5LXTF 2W6OA 1DV2A 1UC8A 2YS7A 2NU9B 4O81A 1CS0A 3AX6A 1GSAA 4EGQA 4HQ6A 1PX2A 1AUXA 1GSOA 2CNUA 1VKZA 4DLKA 3LWBA 4ZHQF 2VQDA 4ZOLF 2IP4A 4YJ3F 3QFFA 1T36A 4MV7A 2V59A 3LP8A 5CA1F 4EA9A 4J6EA 5CAEB 4WBNF 4IWYA 2CNVA 2R84A 5BPFA 4YB8B 3TINA 1EUDB 1GLVA 2R7NA 1E4EB 5LA6F 4O7YA 4HNUA 3JRXA 5JQWA 3BSYA 3V4ZA 2GQRA 3UFXB 1KEEA 4EABA 3BG5A 2P0AA 2Z02A 3TIGA 3K3PA 2NU6B 1A48A 2YS6A 3TW6A 3R23A 2DWCA 5CA0F 3HB9A 4MV6A 4FFLA 3SE7A 3WO0A 3R5XA 2FPIB 3U54A 4FFRA 4O4LF 4YAKB 2R82A 5H80A 2ZDHA 3JZIA 1M0WA 2I80A 2NPOA 1Z2OX 1KJQA 4O7VA 3ETJA 4HNTA 3KAKA 4O86A 1ULZA 3DF7A 1IOVA 3WO1A 2ZDGA 2W6QA 4IIJF 3KALA 1B6SA 4FFPA 4EA7A 5J2UF 2HJWA 4WD3A 4FGRA 5J2TF 3ETHA 4XYLB 3OUUA 2YW2A 3ORQA 4E4TA 2GQSA 5D8DA 1VBHA 5C1OA 1B6RA 2GPWA 2W6NA 1JKJB 4I4TF 5FNVF 4C5AA 4ZI7F 4O2BF 2YZGA 4MV1A 3RV4A 3E5NA 4O7SA 5C1PA 4MAMA 4C5BA 1GSHA
chains in the Genus database with same CATH superfamily
2M1ZA 4MJ3A 2PBRA 4ME6A 3H84A 4XM1A 3JZAA 1VBGA 3B60A 3S6JA 3UWKA 4C29A 1EKVA 4JL6A 2B20A 1KEZA 3RFXA 4ECQA 1GRCA 4BN0A 5KC8A 3HJCA 2O2GA 2V3CC 2AE2A 1NQ5A 4DANA 3H0EA 3O8BA 1A5TA 1SBZA 5BPHA 1AB6A 3JSXA 5EEGA 3RYFA 4AECA 3UCEA 1DC8A 2XKJE 1U3WA 4LOKA 3RFUA 1DWUA 5DBHX 4QGGA 1CS0B 1U8UA 2VDUE 2NXCA 4BQPA 2KYRA 4RA6A 2B8NA 5ICSA 2CNWA 2FPUA 3C3XA 3C2QA 4HBZA 2JPDA 5BN5B 1YUBA 5CA1A 3HDTA 1QBKC 2LDBA 4G3XA 1UJ4A 4ZO9A 3EMVA 5AHKA 2J6TA 1LSOA 2YXPX 5EJ9A 1Y3CE 1AQUA 2A94A 1LRKA 3E05A 4TN1A 1ESMA 4A2WA 5DT9A 1O89A 2W98A 4HNSA 5DG7A 1O96A 4D9CA 1M3SA 4NCNA 5EMLA 2XRZA 2CSUA 1EK1A 1ZRMA 2ZYWX 4PNPA 3L82B 4DIBA 2OSVA 3WBJA 3PG5A 1PHPA 4C30A 2DLNA 1EJ6A 3K0CA 5ICCA 1UDBA 3TW8B 1IN6A 4PAOA 5DX0A 4JV2A 1C30A 2FH5B 3WGHA 3ZHQA 1NVEA 2Y1CA 4LYYA 4ZKEA 1TGYA 3EGEA 4GM1A 4J0IA 3Q9SA 2DAAA 3HVUA 2C35B 1Z7WA 3IR6A 1GIAA 5EJEA 1S0UA 1PZFA 3N7UA 3HR8A 2JARA 4DV4H 2EG5A 2OZLB 2OBFA 3TLJA 3AIKA 3HR7A 2ADMA 4MGEA 2HU5A 5ISMA 4PDBA 2W57A 4P8RA 2TS1A 4IQ0A 2NO5A 4R0MA 3F78A 5FOXA 1CUDA 2UKDA 3ZY3A 2GEFA 5GAJA 1LX7A 5E6SB 5J47A 2O5VA 3ILSA 1FZTA 4C2UA 4ZJZA 3UYKA 1QIFA 1WJGA 1KQOA 4TWJA 1I0LA 1MVOA 3I2KA 1V1JA 3PJDA 1FZQA 1KOGA 1OU0A 4QGAA 1ZJ4A 5G0SA 3U4AA 3KJEA 1DWOA 3LWNA 3LH5A 4I55B 3Q3VA 5FPKA 3DE7X 4DMRA 2PSDA 5LOVA 1CUHA 4LHZA 5DTQA 1T26A 2WFMA 4IH1A 1T8TA 2V1XA 2BMJA 3W5CA 2DSTA 1RPZA 2AN1A 5BSUA 1EBBA 3QF4B 4GVLA 1K3UB 1RI5A 4D81A 4ZEVA 5JQGB 1EDBA 5T6BA 3DL2A 3HYLA 5DHTA 2PL1A 3UKJA 1TAEA 4LVCA 4MTDA 1EE9A 3BTOA 4DGQA 4E5KA 4XZ3A 1LSJA 4F91B 4HVTA 1MABB 1VJTA 3IDQA 5IU6A 4HLUA 2BKAA 3FUXA 4BMYA 3D2AA 3TE7A 3C3PA 2JZCA 1PUXA 2AYZA 3T5PA 5ITVA 2FPKA 2NAPA 4FGSA 3WSVA 5JCOA 4B46A 1NG1A 2JJ2D 4HG2A 3R5KA 4X84A 1E3WB 3DMTC 5COQA 5EVJA 5JJLA 1XRRA 4BTLA 1BDMA 5CD1A 3PQ8A 4U0KA 2O2SA 4KQXA 2PGLA 1RHRA 1S9DA 2VPIA 4X90A 3WBFA 4I1YA 4OIMA 1OIXA 3JQ7A 1RLIA 1CJVC 1R0SA 2WNIA 4M9SA 4WV3A 3ZWVA 1PRYA 4CUZA 5JOQA 1FF9A 4WZAA 1GQSA 1JN0A 3UFXA 2QRHA 1UXGA 5CFRA 1OZ0A 4EHLA 4WJLA 4Q3CA 5JMOA 3I01A 4RWZA 1JJVA 5K0SA 4D57A 4CQMD 1NVVR 2COJA 2IY9A 3MA0A 4DL7A 4K6KA 1SBIA 5EPEA 5COBA 4DZTA 4NBUA 1KMNA 1TT5A 2DF8A 2O0JA 3N1UA 3TQFA 3UATA 1OWOA 4D8UA 4E46A 3O8RA 4P0QB 2IYSA 3EZ6A 5DXAA 2ZJ1A 5AW0A 3BFXA 1X7ZA 3VR3D 2AG5A 2PMZE 4FILA 4FX2A 4NG5A 4OHWA 4CN8A 4F8YA 4JXJA 1GFWA 2QWXA 2M1XA 2Y2VA 4WIAA 3OTOB 1Z83A 5AHWA 4QASA 3D1LA 4A0HA 4PFQA 4A8JA 2XUHA 2JA7G 5ALUA 4QAQA 4AC9A 2HF7A 2Y67A 3IV6A 3OKPA 4G5FA 1HDRA 2UXBH 5GZ6A 1KBLA 2QS9A 4NZMA 3GJ4A 4W8OA 1KAOA 3DVQX 4P4GA 4PLZA 3TG2A 8MHTA 1XELA 1ESNA 4F93B 4EGJA 1YAJA 1G2WA 4MR9B 3UHAA 1DAPA 1QHSA 2PX2A 1YCFA 3UUEA 4RETA 1O03A 4JUCA 3R9RA 5DM70 2DH5A 4UTRA 2D7CA 4HFMA 8ABPA 1TQ2A 5KNCD 1GITA 3CR7A 5MN6A 3UJDA 1ZMXA 3OAAA 4H1WA 2JAPA 3OPVA 4PZZA 2FWJA 5J4KA 1O5OA 2HIAA 2OKGA 2W58A 5ALNA 3KR1A 1PDWA 3LO8A 1I1KA 2P67A 5I3CA 1LX6A 2Q6VA 1RT9A 3J80A 4ETSA 2W22A 4Z7QB 3QNWA 2H1OA 2JLCA 3GJXC 2XWBF 1G21E 5K3DA 4JI3B 3DHWC 1YZGA 2EU8A 2C9MA 4RS4A 4G85A 3OT4A 2NP7A 3HVHA 1ZXBA 5KJ1A 4TT3D 3GD5A 4RSGA 5A3JA 3CWZA 3UJ6A 1Y3HA 4D98A 3MPOA 3BEOA 4M60A 4ZVRA 4YREA 2FLLA 1UWVA 4PX5A 1KRXA 1GGFA 1BOFA 4RC9A 4CVNA 3G5TA 2XZPA 1S7CA 5BSKA 4Z2AA 3DVRX 5C37A 1Z07A 4WESB 3BMNB 4RZIA 3WK8A 4YRZA 3HP1A 4AMBA 1G21B 1QR6A 2AX3A 3WJ1A 4EX6A 2B7CA 2ZBVA 2Q46A 5BUSA 5L7WA 2SNIE 5L4LA 3MR5A 1MB4A 4J7AA 4HDCA 2FVYA 1S2NA 4EY3A 5JBQA 1AMUA 3GLIE 4DADA 1T5SA 5ARDA 4G25A 5HOQA 3NONA 4EVIA 1TU4A 2EP5A 4JVNA 5C81A 3JRWA 2R25B 5FYQA 3CJQA 4IVQA 4LVOA 4D3FA 1L0BA 1RYFA 3ET5A 1GTG1 4BHTA 3EVZA 2IV2X 3TO5A 1SUCA 1D6MA 4BX3A 1XK7A 4DR3B 5BR8B 1E7RA 1SIUA 1BQEA 4QTTB 3CN9A 3GDGA 4DLZA 3LQSA 2PQMA 4NYEA 1Q77A 1P6QA 5CLJA 3GTPA 2OGZA 5DB4A 5JPCA 1X3SA 4LC0A 4AYWA 2WKQA 3D6AA 3GJQA 3CUTA 4OI2A 3UH1A 3HMQA 3D7LA 3RARA 1X8KA 4BQRA 1HDZA 1IZ7A 4CV0A 4KMRA 1S1CA 1O3YA 2PS0A 4GO1A 3TLBA 4BFUA 4JR0A 3IMFA 1OSNA 4ZI7B 4G36A 5BYBA 3ZR4B 4LFAB 1FDSA 3OOYA 3REQB 4JL5A 3O38A 3OY7A 3QKRA 4KBGA 1YVUA 4TS4A 3DR3A 3BKXA 4MRPA 4JA0A 3S2FA 2QENA 2H1FA 3GDOA 1T0BA 3QIAA 4IDHA 4HQRA 4NCBA 3INGA 4P2GA 1ZS9A 2IFTA 1NGSA 3CLHA 2BEVB 3BRQA 2XGGA 1UZLA 3Q7SA 1W0JA 4BJHB 5KMGB 2CZGA 2H1VA 1XZQA 2W4QA 4EHHA 5I4BA 1WMBA 3EC2A 2CLLB 1V9LA 3OE7D 1V4BA 2YX1A 1N6HA 1DP4A 1HDIA 3LKZA 3MC1A 2JANA 5G0WA 3UUWA 4X66B 1QSGA 1GQ2A 1GZVA 2AVNA 4Z4IA 4QL3A 1G9SA 2LWIA 2UZ0A 1FJGB 1SC3A 4MUMA 1NOIA 1NWCA 1E2LA 2DJ5A 3IQEA 1U2TA 2NW6A 2J6IA 4XJSA 4P5DA 2IHVA 3PX3A 2FKNA 3JPWA 1M1YE 2XUKA 4IP0A 3F4KA 5H81A 3RRZA 4CLOB 4Q44A 1O5TA 4DSUA 4EH1A 3K70D 3DLIA 1XWWA 1PWZA 2OCPA 1L2ZA 2IE8A 2XPCA 4FW8A 3X2SA 3CCFA 3U0VA 4EVSA 2B69A 4L5YA 3S1AB 3V8BA 1UJNA 3WNDA 2OCBA 1MOZA 5KFBA 3ZW7A 2YFKA 3FWHA 4JS0A 3TQRA 3HBNA 1W8DA 1JT9A 3TY5A 1SXJB 3JYLA 2O4CA 3ZIUA 1NXPA 3DBLB 3GB9A 2RC6A 3ABZA 2V8OA 3KPJA 3WRWA 4B8ZA 1L7NA 1J00A 2VBIA 1HE4A 3LXMA 4YVFA 4YRIA 1PEDA 2KBEA 3QE0A 3RKUA 1F3LA 1K7EB 1YB2A 5K0TA 5K5EA 4JITA 1XQVA 4PZCA 3HZOA 4PS1A 2BFNA 3FWYA 5DX1A 2BSQA 2G82A 4NOKA 4RLFA 5AW6A 1MB0A 1NW9B 3W3ZB 1PFWA 3SI8A 4AROA 2UXBB 2PUJA 2IBSA 2GHIA 3BJMA 2I7DA 5HM8A 3I2YX 3NBMA 4DQKA 1RYEA 4EMBA 1MIHA 3LWBA 3D7MA 4MVJG 4BBPA 1I2CA 5G4LA 2L19A 4OEHA 4ZN6A 2BZ0A 2VDNB 1N5IA 2CD9A 2Y77A 3RT7A 4U9UA 1V6AA 1J9ZA 1T0UA 1WULS 2B6HA 1U0OC 2Y1EA 3K8OE 4L6AA 2AA3A 3WNBA 3ZHOA 5C4IA 1XZAA 4Q9JA 4MGKR 2BI8A 2DE0X 1IM5A 2AC2A 2JFQA 3V2UA 2DABA 3W5HA 3QEAZ 3BMXA 3OQVA 4ETNA 1IULA 1VGQA 2TECE 5CA1F 2VWHA 1S2GA 3K20A 1XTRA 3HRHA 1TA4A 3KKPA 4DPLA 4I19A 3FYUC 2GHTA 4OJQA 2O0MA 3T9AA 3RVDA 5JJIA 1RYSA 4CG2A 1WF3A 2WF5A 2JJ8A 2PQ2A 4E5YA 2N3ZA 4CM9D 4RWEA 1Q22A 1TTQB 1N25A 2BZSA 1YE8A 3L8EA 1C50A 5T4FA 4R68A 5L1JA 2JFNA 4UOQA 3PSHA 1C14A 4A3KG 1OV4A 2ES4A 2P6OA 4WKPA 1AMNA 1GUZA 3JSNA 2XQVA 4E09A 5ADVA 2HCJB 3LQKA 3MWDB 3C3DA 3W3AH 3V7WA 2R8HA 3FYTA 4KX3A 2HT1A 1MX5A 2PFGA 2X3YA 3AMVA 3WNCA 2GQRA 2WU3A 2YFQA 3KHRA 4BVGA 3GH3A 3RVKA 3S55A 1VP9A 5KHLB 4LHWA 5L9AA 1NY6A 4GKJB 2FKAA 4KIWA 1WVMA 2JRCA 3GRYA 1TC2A 2NVBA 4IJ6A 3JARB 4KFSA 1V5IA 2Z6AA 3A25A 2PNFA 4MLZA 4LF7H 3N05A 4ZVNA 3HB9A 5A7HA 3CZ9A 2PUVA 5F64A 2GRUA 3T7DA 4DXDA 5IP9G 3JU3A 3HSYA 5CXUA 3RK4A 2XE8A 2X0FA 1I6UA 5MF6A 4MAFA 3D02A 5EA2A 2NGRA 2ZB7A 3MMNA 4QIWE 4YUAA 1T3LA 2HPZA 5EINA 3I0ZA 2MSLA 3HOXG 2PL5A 4MCAA 4R3NA 4DLYA 5HF8A 3NJ4A 5K0EA 2GPAA 2ZQZA 2Q8NA 4TL7A 3IVMA 3PHBE 3UHPA 4OFZA 3QVGB 5AVKA 2CFIA 1K97A 3FB4A 1AZSC 4ZP1A 1XA3A 3FVTA 4O7VA 1TQ4A 4B3SB 1TAGA 2VQ6A 2VTVA 5AICA 3TBKA 4G86A 3EGDA 1AKMA 1G20E 4MWSA 2XWPA 5TEWA 1GTZA 2RHOA 5EIEA 3X1WA 4QLBA 2A1TS 2IXAA 4QM7A 1LA2A 1X7WB 4G9BA 2QIOA 3MIIA 2AJTA 4X3CA 2CV1A 5I9TA 2XMDA 421PA 1ODLA 3W5AA 2RB5A 1AQ6A 5EMHA 1H0SA 1MOQA 4D9JA 1J23A 2ONKA 2XKBA 3M3PA 5AXAA 1YS4A 4PWYA 4G5QA 4N54A 1IHXA 3EDQA 4L5CA 4O4IA 4OL0A 2Y1WA 3L07A 7MDHA 2Q2QA 4CG1A 1UPFA 3LY8A 4MIKA 5FHQA 4MQ4A 4H7IA 1NBMA 1X1EA 3BPSA 4EQ5A 3EFEA 4Q4AA 1N8KA 2AMVA 4NI5A 3ZIDA 4AY5A 1W36D 3D4IA 3HN2A 3NHJA 3FXAA 4QHSA 3WB0A 1R3DA 1GPBA 3D6VA 3P0HA 3Q8WA 1JH8A 4R1SA 2BUBA 4BLQA 4BDSA 2Q1UA 1G2PA 2YNMA 3KLNA 4XASA 2BGWA 3JVUA 3NV9A 1W4LA 2FPPA 4JI7B 2X23A 3E27A 3ZJVA 3ZDAA 3ONVA 2CLSA 1E3QA 4LG1A 5KS8A 2QBYA 1Z06A 5IF9A 5KFYA 5DP1A 1B0UA 1ORRA 2QW8A 2GD6A 3H4VA 4TLEA 4W82A 5DLGA 4BEBA 2BUCA 4DAEA 5KYKA 3NDBB 1L7RA 1Q11A 5KFKA 5TY0A 2V4QA 3M4IA 2CDCA 1QO0D 5F9NA 4I4IA 1JKJB 2QT1A 1QB8A 4BB5A 4I4TF 4UM7A 3T4EA 2RKBA 3FDJA 4G24A 3Q8KA 1YL7A 4X92A 1F3OA 3L4JA 4MHSA 5AJUA 3WWPA 1K1QA 2PR7A 2HLNA 1DOZA 3EWAA 4MYRA 3VVBA 3ZWDA 4MAMA 1A0OA 3QMWA 2C2HA 1ENPA 2ESRA 1ML4A 3AW9A 1I30A 3WB9A 1NVKA 4X85A 5EIBC 2LD4A 2L42A 2WJ6A 1RNLA 3OD5A 5TDHA 1KPHA 2CNWD 5BUCA 5CJPA 4RNMA 5L6LB 4GF5A 4TQ9A 1KXZA 1YGPA 2QX9A 3UHFA 1VIAA 3GTGA 3AF5A 4FLFA 4DQVA 4MIEA 2H3HA 3EPRA 1VLMA 4E31A 3JS5A 4FKMA 4DC0A 5DRYA 3HGMA 4FNAA 2V55B 1A98A 2Y1DA 3V34A 1RI4A 5AUOB 5K8IA 3HWX1 1C3VA 4HS9A 2HMSA 1D6SA 3GQBB 3DFIA 5EMNA 4FYXA 3MNFA 1UBCA 4J9KA 3IEKA 4KXQA 3TD2A 2IYLD 3C14C 4BASA 3BIWA 5CHEA 1Q21A 2IP1A 4JB0A 4WINA 1ONSA 2IX3A 4L5AA 3LQ2A 5KNDD 2HLHA 1EGMB 4BFYA 1T25A 2XJ9A 4EGSA 2FLWA 2GRJA 2YDXA 2PVCA 2O5CA 1UAGA 4UBLA 1M6EX 2H65A 1ZESA 2ZXFA 5BMVF 2GKGA 4HKTA 4DCNA 5G0TA 3CZQA 1CQPA 3BK1A 3QU5A 1E18A 4N0MA 1EZ1A 2Q5EA 4YJGB 4D99A 4K9KA 5KT6A 1S2DA 3K72B 4G37A 5I5UA 2J3JA 3AB8A 3SYNA 1E2KA 3VI4B 3T1TA 4XX0A 3AC0A 4J16C 5KFFA 3H1TA 1ECBA 2BF7A 4MYTA 4DL4A 1YZFA 3HZHA 2NIPA 2HC9A 1JDPA 1DWQA 4B7ZA 1UZUA 1VXRA 3M89A 5EXEA 3ZNNA 1QDLB 1EGVB 5L95A 4L76A 2ZS7A 1KSJA 2GD1O 2G4CA 1BU8A 1SQ0A 3I0MA 4KO3S 4RM2A 1PJQA 4DLLA 1A27A 1QTQA 3KX2A 2NX2A 3ADBA 4A3IG 1LH0A 1KP3A 3A32A 1KVTA 4IRCA 1X7DA 3D3WA 3INYA 4LRYA 3U3ZA 2EZ4A 1JJIA 1RCFA 3WKBA 2GI4A 2VP3A 4CKXA 3EZ2A 4HVAA 1QK5A 5A62A 1ZN2A 5I48A 3LQ1A 3FPBA 2GYYA 2BEJA 3PFCA 5JDCC 1X1TA 4K5QA 3KJXA 2AFIE 1O57A 4IHAA 2ZTUA 4YJ3B 2VP2A 3IMGA 2XVYA 1E7YA 3IUBA 4UQPA 4PZEA 4RK1A 3MYYA 5DQGA 3W2TA 5KX5F 1W5EA 3RSLA 1I13A 2EJ3A 3F7TA 3KYCB 1QRTA 2Q3DA 4JFAA 2EL7A 5IJ9A 3IB6A 3L0CA 1W2WB 4WX2B 3LLMA 3V8QA 4JOQA 4N6NA 2EJ0A 3IEPA 4OHZA 2IA5A 5CJJA 5DQIA 3SBXA 1J8QA 4X91A 4ZYUA 3UHJA 5BN1A 5DFAA 1DAMA 4CV1A 3MK31 2PMZA 4U4AA 5IBRA 3Q3JB 1TAQA 3J80W 3KQTA 4P7KA 3FOEC 2ODBA 3PGMA 3N0TA 1IJFA 4EA8A 1Z8NA 2A4KA 2F67A 3E03A 4G67A 1E8NA 5EKDA 2GYWA 3SXPA 4CF7A 4LE2A 5FTLA 2DHEA 4JJIA 1VSVA 1WABA 4M9XA 1TGVA 1A1SA 2V6MA 2FXVA 3RS5A 4HQKA 3SVZA 5LMNB 1SVNA 3I23A 1OFHA 5IBPA 5F1KA 5KOJA 3EGIA 4LQDA 1J09A 2WU8A 5J4VA 4PSVA 1DSSG 4E21A 3QEBZ 1M2HA 3NG1A 1DKUA 2C29D 4NFSA 4DT1A 4NBKA 1HE1C 4ZT2A 2PMFA 1KS2A 4H0CA 1G5PA 5GWXA 1EQUA 3Q9NA 3NKVA 1AM4D 2ZRQA 3WSTA 5FYDA 4WHXA 2WFLA 3GUYA 4P34A 4O6VA 3ROXA 3BAZA 3HPRA 4NICA 4IIYA 4KREA 2GM9A 3FDFA 3DAYA 2JI9A 1XCPA 1Y6RA 3WIUA 1DXHA 2O5RA 3EASA 6CHYA 5IAJA 5JTTA 4NMWA 2HZ7A 3R0VA 3RV3A 1WUTA 5ALHA 3UOAB 2MHCA 1JSRA 3DXYA 3PZRA 1ECLA 1BW9A 2OZVA 3IN5A 4YMVA 1LBIA 3TR6A 2JIOA 3BH6A 3GFBA 5JSZB 3BA6A 4P9NA 4QX6A 2NPFA 4B44A 3B1KA 1M1NA 3MLEA 3ZX4A 3WHPA 1YE3A 1VI5A 3KPVA 3MOGA 3HDYA 2A67A 2P9GA 4NZYA 5LR6A 2WYHA 5K8JB 1KDTA 5K4AA 3VFDA 3NLLA 2XCLA 4LXIA 1UPUA 3CB2A 3CHYA 2P5SA 3EHEA 4HXFB 1X77A 1ORDA 1N1DA 2BH9A 4ZOAA 5KFGA 4YAFA 3MWKA 2JB9A 2UZ1B 1BMTA 2G7ZA 3DZIA 4PO8A 2EFEB 1XWIA 2NADA 3JV7A 3OEWA 3ELYA 3R5TA 4DV6B 1U7PA 3FOZA 1IUPA 1SK9A 1N6IA 1H6BA 4KIUA 3ZJ4A 3H5NA 3MGAA 4MRMB 1ZHQA 2WSIA 4DKJA 4ZJPA 1MEEA 1ONBA 4CIBA 2CLMB 3CSUA 4I2VA 2H9YA 1B93A 2X9LA 4F06A 4CEIB 2E2WA 2V7VA 1T2EA 1YJQA 5EP2A 1R0ZA 1SCAA 1JEYB 3MHTA 2YMLA 4D9GA 1Q1NA 3WQRA 4EI7A 3KKQA 4YRPA 1SQSA 1K2WA 4M8KA 1M2VA 1X15A 1T6YA 4KKXB 5G3ZA 4DWOA 4N40A 3AGQA 1A7AA 1DZIA 2CHFA 5H02A 2IC5A 1DRWA 2IUTA 4ZEMA 4KUGA 1RW4A 4N47A 2O1EA 4JU8A 2W8BA 1KH1A 5TS3A 1OXVA 1J2YA 3R7SA 4BKRA 3MWEA 3EIWA 1P9LA 2O8EB 1ZUIA 2QQGA 2VF7A 2YDYA 4HXYA 1M8KA 1GQFA 2EV9A 2WHQA 4XYMA 9LDBA 4OLHA 2Z2ZA 3FJYA 4D0NA 4DF3A 2R8XA 3NDRA 3FKQA 4EPXA 1A4RA 5JALA 4D2IA 4DA6A 3QPCA 2P41A 1UF9A 3AL2A 1CRZA 4OYYA 5KCMA 3BMOB 4MITA 5BNZA 5C7IO 2QY9A 4U6NA 3SHVA 5TE9A 3HDVA 5ALZA 4LFBH 1RRGA 3B8EA 1AMOA 3PUHA 2ZRMA 3LI2A 2TMYA 3LPLA 4R6XA 3TR5A 2O8BB 2C1XA 3S24A 1GTMA 3PPIA 1BJKA 2W2KB 4ONEA 4Z9YA 3THYA 3EOZA 4YQZA 3TW7A 3TZEA 5I4KA 4FI3F 4RVOA 4MRVA 5EJFA 3TGPA 3CWQA 2ASJA 2JGIA 2ZR0A 3W5SA 3CS3A 4LQLA 3BTUA 4WW0A 2G06A 4TVIA 3DEKA 1M8JA 4OHUA 4JSYA 4UBIA 2C84A 3NBUA 5EPUA 3CRRA 3GGDA 4O8ZA 3A3KA 4FQ8A 3UJ7A 5CFMA 2C0CA 3HMKA 3O31A 3JASA 3DWEX 1BAPA 4ZQBA 3WYGA 3VYUB 4GOKA 1NZDA 2Y6VA 2CLKB 2IUSA 5ABPA 5B58C 1NQWA 1D7AA 2EIHA 4CF5A 4MYHA 3TRJA 2IPOA 5IDYA 4KW7A 2H2IA 2HA6A 3C6XA 2Z9DA 3MW8A 2RGCA 4PYOA 2Z4TA 3CLRC 3BX1A 4TZ6A 2R93A 1L3CA 4UCTA 2VHVA 3LTNC 2R7KA 3TTWA 2DEUA 5C4MA 6Q21A 5L53A 2WDZA 1E7SA 1IOWA 4CMFA 3S3TA 4IL5A 5FAXA 2ANCA 4UTNA 5HZHA 4WBNA 1OE0A 1W8IA 4QG3A 3P20A 3QVLA 5E9JA 3NFRA 4ZOQI 1AJEA 2CXUA 4Z0TA 1XR3A 3GCXA 3PS9A 1W73A 3TKYA 2EERA 1AA6A 1DKRA 1S02A 3G7NA 2FQWA 1SKMA 4LF5B 1FMFA 1YRLA 2G40A 2X2EA 3NHPA 4NENB 4ARSA 5LZ7A 5PNTA 1CEYA 4BNYA 5U9CA 2XB4A 1ZUD1 4HMOA 1GO3E 3LF1A 3ZKAA 3H5OA 1M8GA 3CKLA 4DV3H 1A7JA 1X9IA 3CT6A 4GI3A 2DPIA 4MTEA 3R0JA 3VH2A 3DBHB 2CVOA 2FN4A 3RRFA 4BV9A 3D31A 3EQ7A 5F3DA 3I1JA 4UZSA 4XWTA 1W5AA 2QM8A 1HEIA 3TL6A 1H6DA 5BR4A 1EQAA 3CRQA 1C9MA 4X94A 3VPFA 2Q8QA 4AJOA 4F11A 2XUDA 5DM60 2XGOA 5KJ6A 3K5IA 3G9XA 2UUBH 2VDQB 1UM8A 4MX8A 1LWOA 4B3MH 1LD3A 4O33A 2RGVA 4N5NA 2VRCA 3KOYA 3INNA 1YRHA 3QE3A 3A10A 4FW9A 1H42A 1ZH8A 4RESA 5JSKA 5IUNC 4TQUS 3L92A 2XGQA 2XUJA 4P33A 4ECWA 4BU0A 4LF6H 1Y1PA 2VF8A 1Z2NX 4I6GA 2N75A 3U2QA 5KQLA 4LDAA 5JADA 2AMYA 2F90A 2OG2A 1OFUA 3KXIA 5DGDA 3LRTA 5CIYA 2H4YA 3ESCA 2OLSA 1L1QA 1Q3TA 1JQEA 5HBRB 1W87A 2CMHA 2GAAA 2OECA 2I66A 2WAMA 4F3RA 3JAMA 2O8FB 1N3IA 1P9RA 1E4FT 4UHEA 2IX9A 2QZZA 3C5HA 3PF9A 3U80A 1R8SA 3V00A 1O94A 3QPDA 5I6DA 4RJJA 1JU4A 2NG1A 2IH5A 1K88A 2BR3A 2Q5QA 1JG4A 1UBMS 4FJ0A 4G8DA 3H4IA 4QOFA 5GV8A 5ER9A 3PNQA 4P81A 5ALSA 3H11A 4FMDB 2XAAA 3AX6A 3EY9A 2QL5A 1SD2A 4MPDA 4BFCA 1NBWB 2IPAB 3ENNA 1PX2A 4BCCA 4CPDA 2ZLBA 3ZEIA 1WMEA 3ZJUA 3SY8A 2Q0HA 5DBOA 3T5HA 4J91A 1ORWA 4XPZA 4FOTA 3KVRA 2BFDA 3CNLA 3CW8X 4ZHQF 2GVDC 2QZJA 2HLPA 3N6XA 2WWXA 3E7FA 4D82A 4GI7A 1IWOA 3GAMA 4YLGA 1L5LA 4EB8A 2WP8J 4MGIR 3CQZA 4NECA 4J7UA 1S8NA 5LU9A 4E33A 1J99A 1D2CA 3V3KA 1WZUA 3GIJA 2QT9A 3HVKA 2X8JB 1VRWA 4Z4EA 4GP9A 1CPYA 4AX8A 4ZYWA 4R2JA 4C01A 5JAMA 2VK1A 1WETA 5H0IA 4UOEA 1Z4IA 1EFDN 1WS6A 1ZW6A 4DLPA 4LW8A 5L3VA 1ZYUA 2RE8A 1WE2A 4GXNA 3A2MA 621PA 1YKFA 4FEEA 1MTOA 1Q57A 2ZPAA 4W1RA 2HTEA 3F6BX 5JT1A 2QVLA 2GSWA 1XLWA 2GZMA 1RXWA 1TKCA 1GNSA 1QPZA 2R84A 3F6EX 5F78A 4U2GA 3OVMA 4D25A 4JT2A 3CT4A 3V6JA 5EJ4A 5AKYA 4PC7A 4XJXA 3U61B 3EXIB 4EBEA 1GZ3A 4JEIA 4PG7A 1RJ9A 5CYFA 1H2HA 1DFGA 3CIFA 1T36B 2G83A 5B64A 5KSWB 2IBKA 1JV2B 2JJMA 3NUGA 3NHLA 2VA3A 2KSQA 3K1AA 4JLAA 3EPLA 1TPYA 2AFHA 2QX6A 1X80B 3ICOA 4K9OA 2LCQA 4QJ4A 4R9RA 2HKIA 3SFVA 1Z4QA 1E4YA 2Q9AA 4E3WA 1EH5A 1YZUA 2W7TA 5JQWA 4URYR 1QF7A 3IJEB 4V39A 5CPFA 4DLXA 2CY0A 2Y9PB 2XT6A 3FR7A 1AXEA 1QPGA 2ORWA 1PG0A 2PQ0A 3TIGA 3UJBA 4DNXA 4YRFA 5ALOA 5AKLA 2ATCA 2GN6A 3C39A 2PYIA 1XAHA 2RBEA 1SOAA 3O91A 1RS0A 3C3EA 4H17A 4TMYA 3SEAA 4OP2A 3UEOA 5LDHA 1UAAA 4X54A 5E6RA 3QFSA 1VDZA 4RNNA 1W75A 1ILEA 2VT7A 3VDNB 3GIQA 3V8VA 4FBGA 4NPAA 3R7NA 4AO7A 5FTWA 3TZBA 3IAEA 5AI5A 4OYLA 4MV6A 1KYQA 1ML3A 2C5GA 4YJDA 3UOWA 1FRNA 1FQWA 3I8OA 3WO0A 1E62A 3H9QA 3LS2A 1SUIA 4GUDA 4WNIA 3TJZA 1BWRA 5JAUA 4KQCA 1NONA 1MO2A 1NXVA 3KQPA 5I60A 4X44A 5K8UA 2P9FA 5B4VA 1CY0A 1D9XA 3IQFA 3WXBA 3HOZG 3AHIA 3HUTA 4INPA 4J1TA 4IDNA 4B6FA 2FXIA 1FTSA 3CRZA 1KNQA 1YA8A 1SWWA 1Z2OX 3G5AA 3S27A 3TTVA 4CKCA 5J9FA 4BAGA 1M2OB 3AFMA 5NULA 3RB6A 2QQEA 2WYIA 3M6MD 4OHRA 4TKLA 5C5IA 3MCVA 4DLUA 1EUQA 3BDIA 2LR0A 3A2NA 1WXHA 4WKOA 2CSXA 1E0AA 5D3ZA 2ORVA 2WPDA 1EJBA 4QBFA 5E3JA 4Y7CA 1MQ9A 2PXHA 1WXIA 4OHVA 4FJ1A 4QNNA 4I7HA 1GYRA 2NACA 2DFDA 3BZUA 3GV7B 3N42B 2OHHA 2XH8A 3EXG1 3O1JC 3TD9A 2VA8A 1P5FA 2C5SA 1Q5PA 2Z9CA 4HUTA 3GP3A 3KFLA 5K9ZA 1WQ4A 4KZPA 4AY6A 4PG8A 3LCJA 1B6SA 3Q1LA 1WV1A 2G77B 2DCMA 4DCJA 4N6GA 1CZOA 2OT3B 1YFZA 3ESXA 1DT5A 3TNDA 1YZYA 2PU7A 2W2PA 4GZ5A 3JAKB 1LUAA 1UQTA 5IJWA 4YNBA 1L5HA 3IALA 1OZHA 1YH3A 4LHVA 1TFUA 4OFBA 1N0IA 1LPNA 3F8NA 1B74A 2I2WA 1L5OA 4GX0A 4V1CB 4DDUA 1Q44A 1FDIA 1UANA 4KQIA 1A4IA 5HDQA 5C31A 4MPJA 4RABA 3HTXA 5KT2A 4BNZA 4O1IA 5IJ0A 3ROTA 5L3QA 4ZVUA 4XWOA 5K0CA 2I4IA 4NBVA 1RKBA 1U7DA 1LPSA 1XKLA 2HNKA 1EHYA 2QTVB 3D3NA 1Y9ZA 4EG8A 4BB0A 2X8AA 3FKSD 1L4GA 3ZVMA 3TNYA 3IKJA 4TLBA 4OFXA 1BGVA 5LQCA 4CL3A 3P4YA 6ADHA 1D4ZA 4M9QA 1Z5PA 1U9CA 3VKGA 1B6RA 1QOQB 2VUIB 3ZQ4A 5INTA 1DJMA 4INZA 2IPLA 3E8MA 2ZSUA 4ZWNA 5HUHA 2AUTA 3L41A 1F0PA 221PA 3O7MA 4V3BA 1UZAA 2Q9BA 4N9QA 1FNDA 1NT4A 3ENWA 2CGEA 2OV8A 3H83A 1MH1A 2ZYGA 3FDIA 1QYIA 2NQTA 3IAM6 3RJTA 3E5NA 2GZHA 4I9NA 3UG6A 2QTNA 4DIOA 1DADA 1SPBS 3I72A 2CFSA 4IV8A 3S1LA 1VLJA 4KQMA 3HA7A 4C04A 4BGEA 4O7TA 4B83A 4HNVA 2Z6VA 3QXSA 4KVZA 1NLMA 3DCNA 1GPJA 4PYNA 3RG8A 2GBCA 2ACEA 1NR1A 4Q4LA 3KQWA 4DDTA 4YRLA 3I32A 2QN6A 1KXJA 3LLUA 1RWNA 3EIFA 2BM1A 4GX1A 2QSZA 4JJ4A 1HR0H 3ZLVA 3ADDA 1HV8A 1P29A 2CYAA 3AVQA 3FJ1A 2NZ2A 4OCZA 2GM3A 2VZ8A 2OHVA 3QVMA 2NU7A 4ILKA 1SZJG 2OM6A 2XEDA 3K71B 5HNKA 5JJKA 2WQ7A 1JKFA 2NYUA 3ZS9A 3C41J 4JP1A 4P4NA 3GRPA 5LLTA 4C4AA 4LGYA 3AEYA 4MW2A 2M6SA 4WSOA 2JCVA 4Y2XA 2VUTA 2MSWA 1YIAA 1DPFA 1U0TA 4KLZA 3RVMA 3OQBA 4RK7A 4AG3A 5BUZA 1TM4E 4KFCA 5C8DA 1YO6A 2CJWB 3PNPA 1C1DA 4IHJB 4EQ6B 1CF4A 2PN1A 4EAAA 3QG1A 4LMBA 1E89A 3U7EB 2B4RO 1SG9A 3GIKA 3IP1A 3NT5A 3G2MA 3P2MA 4WCFB 5G02A 2A92A 3L6OO 1G6OA 3ZBUA 4ALMA 2NUTA 2FK3A 3GUZA 4F2HA 5J4YA 4AIRA 4GMDA 4Z6KA 4N5IX 4X0EA 2JJ2A 4S2EA 5CCBA 4KXMA 4OB7A 1Y8ZA 4UCUA 3Q72A 4KWIA 3GLHB 1JNXX 2JEZA 1YRQA 3NTLA 3UXMA 3WKEA 4Q9KA 3G6XA 4GC5A 5GVSA 1ZGHA 4MDFA 5KU1A 2RK6A 3OQIA 4OHMA 2IV3A 1HNWH 4RE6A 2ACVA 5EKUA 1SB9A 3CINA 3KE8A 1LQUA 5H70A 3UAYA 3I9MA 5F2NA 2A1UA 2O3TA 2O48X 3QM1A 1KGSA 3QQPA 2J08A 2L18A 1NXWA 2WQZA 1ETUA 3CNNA 3F5SA 1XZDA 3Q3IA 1SH7A 3BHIA 3QPUA 2Q2TA 2BBOA 3Q9UA 5KSOA 2Y2UA 4HAXA 2J6BA 1PQWA 1WU8A 2P77A 4MCJA 5I7RA 1PJ3A 2XDQA 1J8MF 4UCOA 4J9MA 4W5HA 1ZOOA 2PVPA 1WLSA 2DRIA 2PCJA 4GM0A 3K70C 4X8OA 1R4MA 2HPVA 3K35A 4JODA 2PLAA 3EY4A 3SX2A 3ZWBA 3F6RA 3HKBB 4JMLA 5JAOA 1ZGJA 4JELA 2GRAA 3PFFA 3V4LA 4NXMB 3U9TA 2V5AA 4CE5A 3BE6A 4N18A 5FBWB 5GM1A 5B3JA 3H05A 1YMUA 1FKAH 4LPSA 2ISSD 5JYBA 1K2VN 1IYZA 3SR0A 4BNIA 3MT8A 4D5EA 2WHEA 1WP4A 5DTJA 5BV7A 1TA0A 3OZTA 5AT1A 5HM6A 4CR7A 1P75A 3QTBA 1UBLS 5JSZA 1O75A 1PW7A 1QGAA 3WFZA 4PGGA 4EZBA 2ZGVA 4Q18A 2Z83A 1A9SA 1D03A 4B5LA 3HCEA 1H4TA 5TARA 4KQHA 3VC7A 3H2IA 1SKBA 4XOUA 5DSXA 3RAJA 3TE6A 1TQHA 1NVFA 1E66A 3OSNA 1EUCB 5IABA 4CEIA 2WWRA 2HWYA 3H9JA 1BE0A 1T0HB 1KAEA 3K15A 3LE8A 4BNDA 2ZITA 3AR7A 5A3RA 2A1IA 2GERA 3BA8A 2IU0A 2ZJAA 2CFOA 3G1TA 4DLVA 5C5CA 2QRUA 1YQWA 4JQYA 3NHYA 4CM4B 1FVHA 1G63A 1TM2A 4CYMA 1Q7RA 3F8TA 1JIJA 3N76A 2OESA 4HNGA 4FDLA 4ZQEA 2I76A 2BGKA 3CUSA 1K3TA 4JJ8A 1M34A 4CCYA 4YJFA 1OT3A 1I94B 4IH4A 2J46A 2WSLA 1T4BA 2KW5A 2I6GA 2UZ3A 4ZRDA 1JQDA 2P5TB 4RJLA 2BKEA 3P45A 5KWEA 3QW4B 1QP8A 1QBGA 2QF7A 2B92A 3VR5H 5A4AA 2FLKA 1E94E 4KRXA 3OBIA 1TUGA 2QIPA 3UXEA 3KQQA 4Q1DA 5IJ9B 3RBXA 4IDOA 1SC1A 1XLVA 3L49A 3DLCA 4QREA 5IH3A 1Y6GA 1QOPB 1DTWA 1JEQB 3I4LA 3MTEA 4YV1A 1UADA 4A0FA 5LB4A 5SZJA 1KZ4A 1Q3KA 2LKCA 3GPIA 1KK2A 2Q21A 1YFLA 2DUMA 1E3DA 3GT3A 4IGAA 1IXKA 2HT6A 3UK1A 5A9RA 4LF7B 4H77A 5BR1A 3RC7A 1HLDA 2FDCA 3O03A 2C3YA 1TU0A 1Y9AA 4B40A 4W6QA 3KEQA 1DI0A 3NOQA 5AVZA 3ZD8A 2IUUA 4NNOA 1YR8A 3ZX5A 4KJZA 3KOMA 2BL4A 1XMJA 1I9CA 1SEPA 1Z22A 4GGOA 3AQIA 4XVRA 3OF2A 3WGZA 2JLWA 3NO4A 3FCAA 5DNDA 4NXNB 1Y1RA 5ELXA 4KR9A 5EC8A 5K3WA 4H3VA 4D97A 3V1LA 3GV5B 1KTIA 1N6KA 3GJ5A 1NKSA 1Q1BA 3C6KA 2ZOSA 3QU9A 2FW0A 3Q0IA 2F62A 5CLFA 1V8DA 3I9FA 3KR2A 3MSXA 3F4LA 4J1TC 2YASA 4CM4A 5K4GA 2Z8ZA 3PE6A 1ORHA 1UMBA 3Q8XB 3RTGA 5CCEA 5CIWA 5D86A 1C5KA 2Z08A 3VR5A 4J9QA 4WXMA 1CX9B 5EWMA 5P21A 2DT5A 3TK1A 2N42A 3V2HA 2J87A 4Y9UA 4EFDA 3I2HA 3SVLA 3AEKA 1N57A 1FSSA 4R8SA 3DBIA 1TQ8A 3NNSA 3BF8A 1N5MA 3VTZA 2VHWA 5FOVA 1BDHA 3HZZA 2YOGA 3N2LA 1LJLA 1NMZA 1PT7A 1RYBA 5HTOA 3GP8A 4XJVA 3HBLA 5AK6A 2C00A 3I9V6 2GS9A 2ZUFA 2GKOA 4N3AA 1B4DA 1AGYA 1KDPA 2XECA 1UK6A 1N5KA 1FTWA 2I34A 2GNAA 1KK0A 2ZIXA 3WGGA 3WDSA 4FGUA 1UDRA 2ZR7A 5B1EA 5HJ7A 2MCFA 1TRKA 1MZBA 1JAHA 1TYZA 2VP9A 3O8CA 4GYKA 1NYQA 1DIKA 1BCRB 1DFIA 3DMGA 2JAHA 2RKOA 2V7XA 1JYFA 4GECA 4IG4A 5FFNA 1K7YA 1PT6A 5GJWC 3U44A 4EKGA 3EVEA 1S5PA 1KAQA 3G5UA 4LF8H 1N1EA 1UJMA 1C4OA 4IWXA 2A9FA 2YHBA 1N48A 2XC9A 1UEIA 4FR2A 5I9BA 3BWVA 5TB5A 4LK2A 4NE9A 3KQLA 3GTKA 1YA4A 4KOEC 4F7WA 4OQDA 4ZU1X 5LZ9A 2DFPA 5FR9A 2AQKA 3ZGLA 2FX3A 3EA5A 4KC0A 3ZCSA 2FN8A 4C21A 3KB6A 5LBIA 4GSYA 3H1GA 3UJAA 4NY1A 2BGMA 3FMFA 1KL7A 2BFBB 4QXQA 1BRTA 1XU9A 2C88A 3EG9B 3KL4A 3PIRA 3D81A 4GXRA 3B2QA 4Q1AA 4TV8B 4X1YB 2YV5A 5DT2A 3ZYZA 2WB1A 1CHDA 5B3LA 1GVNB 1TF7A 2A1UB 3W6ZA 4FCWA 4E3ZA 4YP3A 3DHNA 4A9AA 3ED5A 3RREA 1H2WA 5AUPB 1H8ED 3OQIB 4KXFB 2VZLA 4IDDA 3ISTA 4N01A 3DEAA 3QEMB 4NOLA 5B6IA 2WIFA 1SZCA 2FEPA 2YMMA 4AP6A 2JFBA 1CU1A 1S0MA 1NVDA 2J7KA 2NVOA 2NZJA 2PTHA 3IRUA 3QU2A 3SYKA 2J32A 3PFBA 2E4UA 3LQRA 4BBZA 4XM2A 4UAGA 2D59A 1FFGA 2W90A 3MCWA 4V0QA 1QS0A 3KEOA 4JV1A 4HS4A 2AK2A 3GTLA 3MFQA 5B53A 3TR0A 2IYUA 4AZWA 3EK2A 2AB0A 2IXDA 2W6MA 1OW3B 2GPNA 3MHPA 1ZUNB 3M3DA 4MGHA 1CUSA 3QVJA 3I5AA 3KTOA 3AVVA 1XVIA 1Z6TA 1XRLA 2SICE 3B8HA 1E1DA 1C3OB 4HRYA 2EKQA 1CNFA 5AW8A 1E6CA 2FLNA 2Q5OA 3DJYA 4RADA 3SQNA 4X64B 1PT5A 1NUPA 5A4MS 2Q3BA 4U1RA 2WVHA 4TTIA 2X86A 1JDUA 1T8YA 4WZBA 3UTCA 5IXYA 1QAMA 5JZVA 3P2IA 4ZYZA 1X7WA 2KX7A 3NHUA 4S2UA 1R6BX 2OTCA 4OJNA 5TMEA 4ZV4A 3H2ZA 1V9SA 2VBCA 3JQBA 3OH8A 2PLWA 1FW8A 3P5BA 4UNNA 1WA5A 3WZ2A 1IDOA 5HNEA 3R0QA 4MUBA 5JNUA 3EGDB 1AURA 1C3JA 2IGBA 4GDFA 3AWDA 1DMRA 2R86A 2VJCA 2ZYAA 5CM0A 5L1IA 4R41A 5DW3A 1KO5A 3B9BA 1DV2A 5HUQA 2AYYA 2FWPA 1OI2A 1CD5A 1CWUA 4JKIA 4C6HA 1GTL1 2Q2NA 1RLOA 4B4OA 4RY0A 5I7EA 1RAHA 1WCMA 1KY5A 1GN9A 2DWPA 2KMLA 2R79A 3HCFA 1JPVA 3A0RB 5JCOC 1GSAA 2J9FA 2YY6A 3Q8RB 1G18A 4JJFA 3ZBTA 1U3CA 2W9BA 1NMYA 2FSUA 3BGIA 3PXAA 3DPSA 4PTZA 3KQNA 1QJCA 4WZZA 4FD2A 5KFUA 4A6DA 2LDXA 4XYEA 2OC4A 3RM3A 2RJNA 1TD1A 5EJAA 4R9UC 1O4VA 3FWNA 2V9PA 1NHWA 2VHXA 5EIOA 2EL9A 2COKA 4OLFA 1S03G 3OIFA 4JXXA 2WINI 3THXA 3UZBA 1DBSA 1G8MA 4MV7A 4C4OA 5J23A 4M0EA 1L7AA 3HSKA 5DYYA 4MP8A 1NHGA 5FL7D 2Z8XA 3ZE8A 3M9OB 3KZVA 1JWBB 4ZMSA 5LUBA 1RKQA 3MWLA 1NF8A 1RK5A 2GFQA 3GNQA 2QE6A 5FULA 2CV2A 4R71A 3RHZA 3JAWB 2COUA 1QIEA 2CW5A 4B2YA 1NATA 4DDKA 5JNTA 4NBTA 5AP9A 1G7SA 3QLTA 5BPFA 4QGBA 4DR1H 3WIDA 1E6WA 3TQIA 4HUQA 1I5EA 1FDWA 1ZHSA 1XDDA 1YCGA 4BMDA 4B3MB 1RM0A 1YB1A 2QLTA 2MJLA 3GG9A 4FDMA 4J0CA 1SCUA 1GAJA 4RB2C 1CT9A 2IW3A 1U6KA 2RGGA 3BXPA 3FPJA 2RC5A 2H1HA 2W4IA 2JNWA 1PSWA 3DNFA 3H5WA 1DEAA 2PIDA 3ZXIA 5AVJA 2XRMA 1G59A 3COJA 4MLPA 3R0IA 3VR5D 4KVGA 3JD4A 4W7HA 3FH0A 5A4FS 4C3ZA 1RHQA 2CNNA 1IBRA 5A6SB 5FI5A 1N2HA 3RF2A 3OHBA 1OIVA 1SGWA 1VLZA 2VQFH 1SG6A 2C2OA 1HSOA 4HB4A 1MZVA 1K7XB 1PZMA 3KTAA 3OLYA 1KVUA 4BP9A 2ZI6A 3W2HA 3GD7A 4I1IA 1CTQA 2HM7A 4XQ0A 4I4LA 4HX9A 5BNFA 3X43A 3WWZA 2RDIA 4BUZA 1LBEA 2QAGC 1J8YF 3E9MA 4MQEA 2VTEA 3KQMA 5I3ZA 4RB3C 1FMCA 4D8YA 2CMKA 1IBCA 2C8LA 4NJMB 2DHRA 3M6IA 4LJ8A 1R88A 3MT7A 3KVVA 4Q3NA 5LMZA 5B4TA 4FFRA 4P7GA 2WG1A 1ECJA 4N5HX 4P53A 2E85A 2OPHA 3W6UA 4EITA 4GYYA 4KAAA 4ZICA 2G8NA 1TF2A 4OQLA 5EMMA 3AUAA 3U31A 3LX8A 2GILA 3KD2A 1MP0A 4PM4A 5G2OA 1UOPA 4L02A 1V47A 4NTZA 4S05A 4CDMA 2VLBA 2XR1A 5E6RB 1BVRA 3G1WA 4Q9LA 1SXJA 3CX3A 4P0PB 2XSZD 1VRVA 3FPFA 1HK7A 3C6ZA 4BKOA 3IAM1 3R6TA 3ZDFA 2E4VA 4N1AA 1EPUA 4ZAGA 1PFVA 2A88A 3IODA 4MVWA 1VA5A 2B1RA 1N2OA 2D5AA 2RH5A 3OWHA 3ICEA 3GEIA 3OZFA 3P96A 3SP1A 2SKCA 4UD6A 4RF4A 2AFHB 1T9HA 1RWKA 4I4CA 5SZIA 3KVOA 4I81A 2WILA 1V9PA 4LE1A 4NFYA 2FSFA 1RJ9B 3PITA 3NVDA 4R3WA 4D9MA 4KQJA 1WMSA 1D2NA 3IUYA 1GUBA 2ZSBA 3BL8A 4FOSA 3I2FA 3I2JA 3BAFA 2IK8A 5FD5A 1G9XA 4DSNA 3LL4A 3UAVA 3VI3B 2FMTA 3AUSA 1NIPA 2HHLA 2RHWA 4FGRA 2HUPA 2JRLA 3TZKA 4PV7A 3L0YA 3BFVA 1IG0A 3TZCA 1VG0B 2G72A 2X15A 3A3YA 4L9WA 1IEXA 4TQRA 3Q6MA 1YMVA 3CMCO 4Q3EA 4XYLB 5E6UA 4R9NA 3Q3HA 4BNGA 4DJTA 3UBMA 2ARKA 1AHPA 3L8FA 1VSTA 5GZ3A 1LBSA 4W5OA 1ZAKA 3OMWA 2YCLA 3PUKA 4HO1X 2VNAA 4K9SA 5C4GB 5DBFA 4E30A 2PUTA 2G5PA 3PPVA 1PGNA 3EDMA 4QYIB 1X87A 3RB3A 1L8LA 5EUCA 2O3QA 3AK4A 3U4QB 1E2BA 3TOZA 4Q03A 2QP4A 1ORTA 4HMPA 2VK4A 1MF7A 1E2FA 1FRQA 5EDWA 4M1MA 3MN1A 5I45A 4QULA 3NGXA 1I50A 3QWBA 4WN9B 1X1BA 3H11B 5AH0A 3A9RA 5JUMA 2GA9A 4XGNA 3PC7A 2O1XA 3QHAA 3I39X 1LRLA 3NP7A 4J1SA 3SHQA 3UMRA 3VTKA 4C5BA 1CDDA 1COZA 1H66A 1NN1A 2CCGA 2XOKA 3PC2A 1IY8A 3AF3A 3MJFA 4KO2S 4C2AA 4ER7A 2BFCB 2ZE7A 4PHGA 1LK7A 1QHNA 3DAHA 1ENZA 4P7BA 1QGZA 4U7HA 2GBLC 3EXFB 4I1UA 3RC9A 3E7PA 3ITKA 1H4QA 2VUSA 4HB2A 5CA0A 3OX3A 3I58A 3T12A 4F8JA 2EGGA 2D7JA 1T6NA 4ED0A 2OFWA 1O0CA 5M29A 1U8EA 3BQMB 1XVLA 2ZATA 3EIXA 1V16A 4UHDA 2F3RA 2G08A 3IE0A 4P3OA 4PFKA 1NJGA 4UU0A 1XA0A 3NHRA 4C7XA 1U2QA 1MENA 4A3JG 2WJZB 1MHPA 2C1ZA 3M81A 5G1OA 4X65H 1U8XX 2LCFA 5AKEA 1P3DA 1ZICA 2C95A 1R0CA 2QDXA 2XGJA 2BMFA 3PFIA 1KS9A 4IJWA 1A3GA 3CLSD 1U4SA 2MINB 4L8GA 4Q3AA 3BABA 4KSBA 2F1HA 2W6ZA 2O2IA 4HGPA 2BFEB 1E7WA 2C77A 2CVFA 3ZI4A 2FEMA 3KZXA 5C44G 2JA7A 3BC1A 3IS3A 2ZJFA 1Z2CA 1HC7A 3O73A 3RBEA 2JS7A 2APJA 2PTGA 4TV9F 3BD8A 3ODPA 4HSEA 3KXLA 4XLTA 3SS9X 3ZU6A 4TKUB 2PY6A 4D3SA 1GAEO 4G1BA 4GE0A 5DHUA 4RB0A 3NJ8A 3DDCA 4BZZA 1QCZA 2JFZA 4F12A 2A30A 2G17A 1NMXA 4PZPA 5FAKA 3AEQA 3B36A 3LECA 4PG5A 4FC7A 4BO1A 1U1IA 4MWGA 4E14A 4GEKA 4EUEA 2HJSA 3IJRA 1RJRA 2GCGA 4BVFA 3CUEF 3RUDA 3DD1A 2YRXA 4O3PA 1BEEA 2ZUBA 1EFUA 4ESVA 1FRZA 4B47A 4LJRA 4TV8F 3OZSA 1ZIDA 2FGKA 2QN9A 5HFNA 2FAXA 2WJPA 4J6FA 1XMPA 3NOVA 4HATA 2Q1WA 4M21A 3VPBA 1HYHA 1MU0A 1SCKA 4LX0A 1YRBA 3V8PA 3QWUA 2ATVA 3TWOA 2J9GA 5KT7A 3PQFA 1SULA 4QUDA 2UU9B 1GU7A 5EQJB 4IILA 2PT5A 1YJAA 4GM4A 5LP6C 3HY6A 1C3LA 1EFVB 1GZ6A 1JDBB 3D8NA 1OC2A 1CERA 2VPSA 2DVMA 5AR1A 1QQ5A 1XMOB 1G66A 2F1KA 1AQJA 4Y9RA 4E2YA 2YWJA 4RXUA 4E2ZA 3GLIA 3IQWA 3H5LA 1N0WA 2XW6A 3JQBC 3WMRA 3G17A 4HK4A 4RK6A 4EGCB 2ZE5A 2YW9A 1YD7A 2VN8A 3NM6B 3P9QA 3PEFA 3T3EA 5TT0A 2FZGA 3PO3G 2WUDA 3KB1A 3PHCA 2YZMA 1JYEA 1RM4A 1RQLA 2C7BA 3HDJA 3PUIA 4TTQA 4ZOEA 3S2IA 4UNRA 5JRJA 2IU4A 2Y1OA 4P5PA 1ENYA 5E7QA 1NA5A 1EB8A 1NBEA 5LZ5A 4EA6A 1VHDA 1TMOA 3JQEA 4TMKA 3TS1A 1D0IA 4C4XA 5AW4A 1FSFA 1BHO1 1ZCZA 3BMOA 3GZTB 3E23A 4LBYA 4RBNA 5FUYA 5EHZA 4OIFA 1M7JA 4TZKA 4X66H 3IDFA 1ZUWA 4RAQA 3SG0A 3G2OA 1GO2A 3N87A 4KMSA 3DZBA 1E2GA 3DVLA 2WHYA 4B34A 4RTRA 1KBZA 5A4IS 1TFRA 2GHQA 1Q20A 2J3IA 4WASA 2ZVPX 5F73A 3LF2A 3OM8A 4GGPA 1SXJE 1KEEB 3TBFA 2X6TA 5DNWA 4EELA 1P45A 4GLLA 3TLXA 2FSIA 1SFRA 3IJPA 1U0BB 1YBVA 2WIBA 5KTPA 2GK4A 4YRRA 4YJ2F 1SBYA 1OTXA 5P8WA 1GKLA 4Q47A 1JE1A 2HMUA 4MI6A 4TKZA 1M2VB 4FFOA 2VNSA 3DOJA 1RAIA 3N7TA 1NFQA 1IK4A 3FOWA 1W30A 1U1GA 2IXBA 3ZE2B 4G5XA 4EOGA 4GLOA 1JEYA 2B63A 2PSHA 3GEEA 3IQDB 3WQQA 1U1FA 2JBAA 4PQFA 2AOWA 2GUGA 3C3YA 3TMKA 4PINA 2ZBPA 1UPBA 1F2TA 3VKWA 2C9DA 1CZKA 1GPMA 2O05A 3IVAA 1EFKA 1XZGA 5CDYA 1E9DA 16PKA 2PMKA 5JQGA 3FFTA 2F4VB 4UAVA 4N7RA 5AMXA 2ZRCA 5JS2A 2NYRA 4B09A 4C3OB 1Z2DA 4UHFA 1IBMB 1UDAA 5A06A 2BE9A 2VP4A 3C3MA 2GXQA 1AGNA 1WZCA 1XTVA 2MDTA 3I6ZA 1MIOA 1VQ1A 2J4DA 5ENDA 1W4ZA 2GBPA 2QVGA 1G3RA 1EFLA 4I55A 1XYVA 2O9JA 3M2PA 4P54A 3L6BA 2AE1A 1U2SA 3JX9A 1J97A 5J63A 2PX0A 4Y6PA 1H93A 1WDTA 5CB4A 1BDIA 4LOLA 1KIAA 4YAJB 1P7ZA 1K8QA 3PFWO 3QLVC 4BVBA 4EY4A 5LKRA 3P71T 1CG6A 2FOLA 2QTMA 3IA7A 1L7MA 4HRVA 5KT5A 4ZU6X 4ZZ2A 2VWGA 2RARA 4ECYA 1NXOA 4Y98A 3SBEA 2LNDA 5I51A 1FNCA 1T34A 4YRBA 1PGOA 1NVTA 1Q83A 2ECFA 3AFHA 3P9ZA 1E2IA 2WAQE 1T2CA 2WTUA 5FO0A 1AGPA 2PGAA 4TWRA 5TQ2B 4OU4A 1DEKA 2HO4A 1BQ4A 1QPBA 2D2EA 5AW5A 1Y1TA 1YR3A 2V97A 1WUHS 2IOFK 3KJIA 4MMZB 3LC7O 5FJIA 3SC3A 1U2ZA 3WGYA 1PX0A 4AULA 2VXBA 5DYTA 1VDMA 4MUHA 4E5UA 2BTEA 3ANNA 5HIKA 3L1JA 4R8RA 4PHHA 1XAGA 1KZ6A 5F9HA 4CGYA 1JJFA 4B7CA 4E5VA 2NYAA 5TNXA 5I5EA 2ZRJA 1PR2A 4ABYA 3TRKA 3GZNB 1B7GO 3CLRD 1K68A 3GLUA 1QFSA 5CX4A 2O4UX 1C1YA 1AKEA 1IVNA 1SXGA 4OAPA 2IELA 1MAWA 3UYYA 2GPYA 2BYTA 3FUCA 3F49S 1ZVQA 2ST1A 3A27A 3ZIAA 4JR1A 1IVYA 1OYYA 3ITNA 3MQ2A 3A05A 4B43A 1XTSA 1Y4DE 3VPDA 4IIVA 4PYRA 5JVLA 5EZ6B 5I7WA 4UD2A 2W70A 1LFAA 1EX9A 3FKIA 1NQXA 1WD7A 2QW1A 3NBXX 5EKSA 4W4TA 3GWZA 5DCWA 3E61A 3GJYA 3LVRE 1F5SA 1JIXA 1SCJA 4MVJM 3PC4A 5JD5A 2B6NA 1YTUA 3QNUA 2OCDA 1GNTA 5MFZA 5IT0A 3STYA 1A95A 3TGLA 1PZHA 2AGQA 1EFRA 2R6ZA 4FBLA 1XJQA 3L06A 3CO5A 4U6PA 3HY4A 1UK8A 3N75A 1BTOA 5HMMA 5BWLA 2A9VA 1OZFA 2M9MA 4YJ3A 4FUQA 3VU3A 1C9DB 1GZ7A 1L5YA 4MKZA 4A0SA 4JLVA 1N1MA 2GPSA 2G5TA 4RFSB 3V8MA 4IW3B 1HE8B 2Q07A 2V74B 3DBRA 3IP6A 5EOVA 4RNOA 1X8LA 2WMDA 4JL8A 3PDIA 5JASA 3TKLA 1TUIA 1GGKA 3C1AA 3DTYA 2JEYA 3GFFA 2F1IA 3WOHA 3ZW8A 2V9ZA 3KQSA 4BO0A 4OQEA 4BBAA 2CLDX 2O3UA 2LZ0A 2AOTB 4OP1A 3NT2A 4D9KA 5DGXA 2QE7A 1EIZA 3ANMA 2QGNA 2J09A 3FROA 1J2UA 1W35A 4TXHA 4B74A 5F4ZA 4BFXA 4JV0A 3E1SA 4QYMA 4OOFA 3OPYI 2QYZA 4S1OA 1A96A 3S2YA 4DHWA 3IERA 4MP3A 3IAS6 1L4FA 3U55A 2E55A 2GCPA 3GW8A 3Q10A 3TGWA 1BMFD 2Y0PA 2JVJA 4RHFA 4N82A 3PTLA 4EDFA 5AW1A 2A86A 2ZULA 1JDEA 3V7FA 1YONA 4XM0A 2NO4A 3QK7A 5JDIA 1CULC 3BQNB 3BQ0A 4R2HA 5IM5A 2VQFB 3CGGA 2R0QC 3K9HA 1FVOA 5F7ZA 2VVTA 3U3XA 3IP8A 5B2FA 3AM4A 4Y9DA 1RYDA 4EUFA 1GG5A 4K3VA 4CJXA 1YCDA 4Z1MD 1X39A 2QK4A 2QG4A 4Y1RB 1Z4NA 3WYEA 4CI9A 2KLHA 2ZRPA 4EYIB 3E6AA 1NUSA 1HZZC 2G4LA 4BCDA 3DTVD 1W0KA 3A6JA 2NO9A 4I1SA 1AZLA 1RBQA 1EFHA 3MRSA 1QKIA 4XRRA 3VUEA 4BNHA 2PH3A 1N3LA 3GROA 1QYXA 2A59A 3NXSA 3GY0A 2Z43A 4GRIA 4A1FA 2XY4A 1Z9BA 1ZISA 4FWTA 2CB9A 2EJCA 4LYHA 2O3SA 3J7AK 5HR5A 5EFZA 2WVAA 4R7GA 3PC3A 4C7MA 2E1PA 3BWMA 5AXDA 3GJSA 3MJRA 3QVVA 4NFLA 1J8DA 2ZYSA 2E4AA 3CXRA 5IHXA 3HUFA 4JA2A 4M88A 2MR5A 1PFYA 1YVRA 1NJ1A 1RBMA 3L8GA 5EP3A 1UC8A 2C83A 4O8CA 2NU9B 2IYOA 1AXRA 2X8BA 4EYGA 4R83A 5LMUH 1Z15A 3RFVA 1Y8RB 3AQ4A 5DOZA 2IBTA 5L3ZA 4ZXFA 3BQ1A 3DWFA 3F74A 3NAGA 2R7ZG 1NBMD 3OHSX 1V95A 3C8MA 3KZOA 5CVUA 1S0NA 5FFFA 1JKJA 3BHMA 5H83A 3OHAA 1OX4A 2WM9B 4M7OA 2GN1A 3LT1A 4DRXA 1N34H 5FV7A 4CRWB 3WKAA 1QKKA 2ECOA 2W6CX 4H9GA 2PUCA 5EVCA 3OE1A 4ND3A 4WL0A 3T61A 5BSVA 2ZVQX 4ZOLF 2IKSA 5IS2A 3ZWPA 1KC3A 2XEXA 1COWA 4BATA 1ZFNA 3WIOA 1S9FA 2EYUA 3GV8B 2YVQA 3OZRA 2QYTA 2AKEA 3CVJA 3DQQA 1PBTA 4BNKA 1CUEA 4I2NA 4OH7A 2XIQA 2ABJA 4CDGA 3G7SA 4JI5H 4K6MA 1G6KA 4UPEA 3MLAA 3OU6A 2BC9A 4IICA 4RD3A 1Y7HA 3R6LA 4ER0A 2WE6A 1OXMA 5F9MA 3WKCA 5B30A 1KMMA 2Q3HA 4KO1S 4KDEA 1UBJS 2DG2A 3AHJA 1IXYA 2I4MA 2OCIA 4CEJA 1IJEA 1JR3D 1XQYA 3HKCB 3ESZA 4GYWA 4N0QA 4ISBA 4O3OA 1U99A 4GLJA 4KSYA 2WSSA 3ES9A 3KV3O 3P1JA 3C3CA 1XJCA 4JDUA 3CJTA 2PFKA 1KMHA 2EZ8A 5EE1A 1RXIA 1THZA 2ZTVA 2HVSA 3DOFA 1R10A 2ZRIA 2ID9A 3LXXA 3DYVA 5HHTA 5IC4A 4WE3A 1FC0A 2J9YB 5IWAH 3AIMA 1A5AB 4V1CI 3ICQB 2IS4A 1GNLA 1V7ZA 1QIKA 1R00A 2XGPA 1NBIA 4AS3A 1SCDA 2FWAA 4DCVA 5IKPA 3HP7A 2V3VA 1DS6A 3FUWA 1BJRE 5E4JA 3TW6A 2WUFA 3W2FA 4OG2A 1A77A 3I62A 2Y66A 3KB2A 3NH9A 4B76A 1KJWA 4WKCA 3PLAE 1E1QD 4X1KB 2WOJA 4L4UA 2J3QA 3E9DA 2E7ZA 3FGNA 3L84A 5H4HA 3RABA 3GMIA 4KYTA 2H4WA 1LW6E 3EVFA 3L7OA 2C2RA 3G85A 1U9YA 1ABEA 4PLHA 1KNXA 1JI3A 5AUNB 2R6GA 2EFGA 5G40A 3DLAA 2QMUA 5FR1A 2WFZA 3JQGA 3PENA 1NM5A 2C2WA 1P8LA 1N92A 4MWBA 3TY9A 1QYVA 4EUSA 1P91A 2V5UA 1P1JA 2D06A 1SYXB 3BFJA 1Z7GA 4LH7A 3FNRA 1ST2A 2G36A 3O90A 4FFVA 4MVJH 4CTKA 4GP6A 4RXMA 3R9XB 3ETJA 1U0NA 3PJRA 4L22A 5KCZA 2IOFA 2ZI7A 4ARZA 4GE3A 3KSAC 3E15A 4MYDA 3BD9A 4L8LA 4LFBB 1XU4A 3CNQS 2G1UA 3DDUA 3KU1A 2F1JA 3G49A 3UO8B 4LTDA 2A0UA 3H2BA 4C20A 3HSSA 2JH8A 2WAQA 5F52A 1VLVA 3OEHA 3WR5A 5JAPA 4QWEA 3WO1A 2X2OA 3DTGA 1N8SA 1XP8A 3OJ0A 3KEMA 3QEKA 1CP2A 3ESQA 3S8MA 5DNYB 2N9UA 4EA7A 1YHYA 4ZVQA 1LDGA 1TK9A 2PH7A 2R4UA 2VRBA 3Q40A 4H08A 4Q7MB 4RNCA 3ICVA 2ZSJA 2JIMA 1EXNA 4L8VA 4RZSA 5L1LA 3SNOA 5GV7A 1KETA 1PFKA 2C42A 4DUYH 5D87A 2DU8A 3DXZA 3LBNA 5E4TA 4ZA2A 1TLLA 5F3WB 4IJMA 1ZP6A 2GPJA 1XZBA 2V6JA 2Y0SA 4JJKA 4US0R 5BN3B 4H0NA 4KYVA 5BOSA 2H92A 4JWKA 3ETHA 1HEUA 1S3IA 2NSDA 3CF2A 3EE6A 3RVBA 1AS3A 3ZWNA 4CMJA 3NC0C 5KG4A 1QXSA 2GCIA 4LBWA 3B3AA 3IOYA 2YV2A 1LPOA 1Z6GA 3L6EA 4IY1A 4KPEC 1A9QA 3I04A 3FKJA 1P4JA 5D1NA 3FUUA 3T4PA 2JIDA 4RZ2A 4ER3A 3ZWYA 3CW9A 4JBNA 1ZJ6A 2Y4NA 3O6VA 2FPRA 4FHDA 4TROA 4LJ6A 1SBHA 3BUSA 4R8LA 1JG7A 4DAAA 3AV0B 5J5CA 1I6MA 3X1ZA 4BRUA 5CH8A 3VGJA 1ZVMA 3R3JA 3P9RA 4OTZA 2AUMA 1J0EA 3BB3A 4A8JC 1J22A 4PN3A 2HZBA 1W36C 3N8GA 2BI7A 2JLBA 1HZJA 3BMCB 3PGA1 3K2IA 3GGOA 3NC1C 3QEOA 4X71A 2OA0A 3VJMA 2X14A 1I4TD 1EFRD 3ANSA 3K1TA 4F5ZA 4EY7A 1M1YA 1OGYA 3BK2A 2QVYX 2BEWA 2XDAA 4M1ZA 2OO7A 5FD8A 3WDKA 1BJTA 1YB6A 2VS1A 1P8AA 3ZQ6A 1RAGA 3B3FA 1JHUA 2FN3A 3U7RA 4OSPA 5K8VA 3O9ZA 1Z38A 3P0EA 2X41A 3U40A 1GQOA 3T5BA 4U2BA 2UVQA 3OLWA 2JF0A 1YBFA 1RWWA 4YCNA 2RD2A 4DUYB 5KFQA 4ZVTA 1WKVA 4CLOA 4QBHA 1BXGA 1THMA 3M1YA 4M9RA 1KGDA 2FW6A 4M1TA 4APMA 6LDHA 2P7IA 4ID3A 1Q19A 3ZHBA 4GLFA 1VKNA 4C03A 4H7KA 3LULA 1TM5E 4KQ2A 4A3SA 2PT6A 2RHHA 3SICE 3GJZA 3HRKA 3VJKA 4YP7A 2LE0A 1AK1A 4IJVA 4U7TB 3ZU2A 2JA5A 2R6AA 4ARIA 2X0NA 2PKYX 4JQZA 4ILEA 5LIPA 4GUAA 2VP5A 1R5NA 4EPYA 4IFIA 5MGBA 1YIDA 4U7DA 3OJWA 2C03A 5CBPA 3L7LA 2RSLA 1V4YA 5KMGA 1K4MA 1K6MA 1ZD4A 1Z7EA 3GLVA 4IHQA 5B7GA 3ORHA 3NIGB 4EJSA 1A8HA 4ESEA 4CEHA 3B3JA 5TVKA 5KNDA 1E20A 2WDTA 1FDVA 1LBHA 4GPAA 3SR4A 2CMFA 2XIJA 3CR8A 3UZUA 2IZ6A 2RHBA 4JSRA 4ARVA 1JLLB 1RADA 4PCVA 1DC4A 2XMCA 5KVVA 3IDSA 3MFYA 3F47A 1UJ6A 3REQA 4UUNA 1NNUA 4RF3A 4R05A 2B4TO 1TT7A 1JSLA 1E5DA 3NRCA 3UJHA 1P1BA 3NDJA 1AGRA 1ZN7A 2TMGA 4QUKA 4EG1A 1C8VB 5HJ2A 3SQOA 2PWAA 3ESDA 3GF4A 3LUKA 4NOJA 3ZHRA 4C7OB 3VYTB 4MUXA 4YUWA 4M0FA 1GZ4A 4U9IS 3ZPXA 3N39C 4JI3H 4KQEA 5AI4A 5TIIA 3B9RA 2JFYA 1CKOA 3E3OA 4Y0VA 2DPHA 3RC2A 5FJJA 4ZCPA 4HDOB 1C7IA 4JP3A 6REQB 1H3FA 3G82C 3HFGA 3TTUA 1Y3AA 1YZ3A 2P4EA 3O1IC 4GG1A 4XLZA 4Y0NA 4AL4A 3FSGA 1K08A 1M5UA 3ELUA 4IS3A 2C7PA 3FY4A 1AUQA 4L08A 3VPSA 3ZDZB 4WLUA 4IMRA 2GZ1A 4R2XA 1KK1A 2WWFA 4YQWA 4R01A 5CNIA 4ZT3A 2OD2A 4EMUA 2VT6A 1OZGA 2X8WA 4QTXA 1JVSA 3N0WA 4ML3A 5C8YF 1J0XO 3FOBA 2BHLA 3LSYA 3PEEA 3OOJA 2BW0A 2CXPA 4DLSA 2O0KA 2AQHA 2P9JA 1FFXB 2CXOA 3BHNA 2FG5A 4O4LB 3GFRA 3GIIA 1PAUA 1EESA 2Z30A 3NTOA 4KWEA 5EJGA 4FNOA 4HEJA 2F55A 3DDHA 4CL0A 3DLBA 4TL8A 2NWQA 3OCZA 1G21A 3CUYA 1C9NA 4YTEA 1WSAA 3H97A 5EQTA 1V39A 4AZ0B 5JXHA 1OAAA 3U56A 2B35A 4LOHA 1Y3FE 3JWJA 4WESA 4YDHB 3RBAA 3H5IA 2NTEA 3IURA 4J0MA 3L1HA 3CF0A 3JZMA 1E5XA 4YONB 2JBWA 5BY2A 1L7BA 1P62B 1RHJA 3B1VA 3CH7A 4S3MA 1NF9A 3ZHYA 2PZGA 2OG1A 3MERA 1ZK3A 3QVKA 4K9QA 2GM4A 2Y4OA 1SBCA 5A02A 5JDIC 1P18A 1MB2A 3THWB 3ZEAA 1N5DA 1MRZA 1RAFA 2ZCUA 1A71A 3PQEA 1T43A 4BP1A 4TYWA 4E32A 3ELBA 4ESHA 2ATXA 2F9MA 3BMQA 3L9XA 3LDHA 1RTTA 3RUIA 4ZKDA 1H1LB 2F64A 5IUKC 3GPDG 4PLGA 2G6TA 1IYDA 3WISA 5GTDA 2R6DA 4N5LA 4XUCA 1DNPA 2Z95A 3JYHA 4FFMA 2QT0A 3OP1A 4IVRA 1WCXA 5CLLA 4A1OA 4BO6A 4BWFB 5HXAA 2HAEA 2O07A 2V7BA 1SU7A 3SM9A 1RZRD 2J33A 3P0RA 2A6PA 1W5TA 4I7EA 3QLJA 2BR5A 4LF9H 1J8FA 4I50A 1QK3A 3OX4A 1R4NB 3A4NA 5D1OA 4RVUA 4FYPA 1E1KA 1YS7A 4F1JA 2V7TA 5JHHB 3PICA 1OXKB 4H3KB 5REQB 5CEJA 1IBKH 1A8UA 1WEHA 5JJ5A 3A6PC 4M8IA 2O52A 5J2UB 5K3FA 3G2QA 1XAJA 3DLHA 3BA1A 5JAHA 4KTTE 2WM2A 1WXDA 3OF3A 4A8TA 1Z3CA 3TNLA 3DWIA 1T3SA 5FPOA 2G0TA 1F2UB 2QTTA 3QQ5A 3LMKA 3QX8A 2IUEA 4ZHSA 3RIXA 2E6UX 4HCJA 3FFBA 2G76A 4ABTA 4U39A 3DHVA 2O2YA 4FHGA 4KGXA 3UAXA 2NZUG 2IHYA 3PGKA 2OK7A 4N6OA 4CWAA 1PZEA 1U7WA 5U1PA 3ADPA 4NCXA 1IC6A 4R1TA 1PD1A 3TB4A 4TYNA 1ZETA 1ZINA 4FYMA 1DARA 2H11A 2K7ZA 2IYRA 4NBWA 3SXUA 4LYEA 3BRCA 3GXBA 4HHEA 3H86A 4HH4A 4ZXPA 3FIJA 2CNBA 4BMXA 1ZNXA 2R85A 1IOZA 4W7SA 1HL3A 1WB4A 1ZOIA 3MJSA 3QE4A 4ITUA 3VZSA 4B2PA 3PWSA 1MBZA 3A04A 4TPKA 1U7XA 2ZWOA 3BKWA 3LDAA 2QI9F 2YZ2A 1KMQA 1ULSA 2ISCA 3IILA 2D4HA 1T35A 3DPUA 3GX1A 5K0LA 1REQA 1JHOA 4J1QA 2GAFA 3G59A 3GFVA 2HMVA 4IIEA 2NUBA 3OI7A 4RCYA 2NZXA 3TOXA 4ZCMA 3AL0C 1GG9A 1FFYA 2WKPA 3Q11A 3CVVA 3IBGA 1E79A 2NSJA 4M86A 3CPSA 5IDXA 3M4NA 5JAZA 1LF5A 1T9AA 3VGPA 4X93A 1XVAA 3D2BA 3W3AA 4YP0A 2V3WA 1GT91 1U0SY 1ZN9A 5F5LA 4MPTA 4QO7A 3RKSA 4BWVA 2OGSA 1MZPA 3W0LB 5AQEA 4FGWA 5BW5A 3N41B 1PUIA 3KJFA 4ZD6A 1RJQA 4S04A 1E3EA 1N2BA 2X7JA 5I5GA 3K9WA 3DAOA 1J70A 1YL6A 1R6AA 2NLOA 4XZ3B 1X38A 3L4BC 2NVUB 4DA0A 4PIPA 3VC3A 2FHPA 3KPYA 4RVGA 4AZ3B 5D7BA 5BVGA 1RJFA 4QW9A 1N34B 1NFRA 1HF3A 1RZUA 2VCHA 1F2VA 3OZGA 4QQRA 2FPXA 1B16A 5EIWA 2QORA 2CE7A 4MQFA 5IKXA 3PD1A 5JQGF 4QODA 4NEHB 5DM4A 1NJFA 1V3UA 1H3EA 4XB1A 4F60A 4JXZA 2G25A 4DDHA 2TRSB 1VHLA 5KTMA 4RZXA 3SE0A 4HL6A 4YDRA 5KINB 1FDRA 1NN3A 3SF0A 2FOIA 4DQLA 2EEZA 3BXEA 4HYYA 2ZJ5A 3DJFA 3TQQA 4COOA 4PC3A 4L16A 4ZRMA 3COSA 3EXHC 1RAAA 2YWBA 2W8KA 4FEGA 1NV8A 1VRCA 1DG9A 3BJRA 2JHPA 3PKIA 1YT5A 1SA0A 1KAMA 1KRWA 3U1TA 4BLSA 5B6PA 4DB2A 2R8KA 1SN7A 1U31A 3EGWA 4X3PA 1OH8A 3VR2A 3MS2A 2XMZA 1CR6A 4BX0A 2HWKA 4J29A 3TZLA 1VPLA 2B1GA 4A6PA 5FTNA 2IYVA 3WA6A 2PAAA 3Q6NA 1OLUB 1V3TA 4RKRA 1I0ZA 1HZZA 2ET6A 3FTCA 3HH8A 3JATA 3L2OB 1K0UA 4LBZA 3AU8A 2LIPA 1E5VA 1TQ6A 1XBTA 2FWNA 2R1VA 3A6HA 3IBCA 4GBMA 4ZDWA 2O8VA 3WLRA 5IKMA 3K2QA 1C30B 1JVBA 2YV1A 4GBED 4Y0AA 5AI6A 4BIIA 1STOA 3KETA 5AI9A 3DTFA 1II8B 1CZRA 1FNBA 2AK3A 2BGLA 4NZOA 2EKDA 2GTPA 1VKHA 2Q2VA 3CTPA 3NEJA 3LKVA 3NBQA 5JRZA 1QRSA 3CH5A 4XWKA 2VUGA 1FPMA 1WRBA 2HA3A 4AF6A 1W1UA 1DWPA 2BE7A 4OKIA 4EL5A 3NP9A 2HXYA 4WTOA 1QNLA 3QXXA 4C0LA 3ZV6A 1Q92A 1YDMA 2H0RA 4GVPA 4M0CA 3RE1A 4XRGA 1ADGA 1C41A 1JLLA 4TQSA 4BTVA 1JIIA 1KZ1A 5IDQA 5JYDA 5BV2P 3STTA 2HJHA 2R6JA 4KDCA 3KIPA 2Q4EA 1UKCA 4FUTA 3B9QA 3KLMX 3L0DA 5BQPA 4CEHB 5BN5A 5LD2C 5JMPA 5AVYA 4Y9SA 4NXMH 4NU5A 2PRZA 3NTRA 3T1YH 3HXPA 4O4IF 4MVJE 3ABSB 2XE4A 2OP0A 2B5OA 5FL7A 2CL0X 3DOCA 3AILA 3RYFB 2AH5A 1FFCA 1TIKA 2UUPA 4KLAA 5EHXA 4YDSA 1FTQA 4US2R 4J76A 3ECSA 1DLIA 3K5WA 4CM6A 5FUWA 3E70C 1B8PA 3AXSA 4DLNA 3N2GA 1Q7EA 4JBWA 2A7QA 4NCKA 4FIDA 3SZRA 1LPAB 4B71A 1A9XB 1UWCA 3IPRA 1JKXA 4IOLA 4CTMA 3MRTA 3WGNA 3P52A 4QDKA 3ZI0A 1J2EA 5B7NA 3D4OA 3DOOA 1CRQA 4H6VA 4D9BA 4GR9A 3JZ6A 1GCGA 3TRIA 1KYVA 1SXIA 1B2LA 1FNMA 5DLFA 3FYUA 3VU0A 4CR8A 1XL0A 2J4CA 4KVFA 1GSOA 1XTPA 3KWLA 4XVQA 2RDMA 3KKNA 2ZP1A 3UB4A 3MM4A 3T3IA 1ZH6A 3BWEA 4AQDA 4R2LA 1CUBA 4H31A 2ADFA 3RYHA 4BEWA 5FUVA 1GAXA 5FPPA 3LYUA 1SHKA 4IWNA 2DHDA 3KYIB 4YRJA 5SYNA 5KSYA 4PS0A 4Q5IA 2WK1A 1GQYA 3E8XA 4AKSA 4BPRA 2BISA 1OH5A 2GO7A 1SVMA 2VQSA 4TXJA 2FSPA 5KFJA 3OPQA 2V98A 4REOA 5EUMA 3RJ5A 4E51A 4MHTA 2RGAA 3V55A 4AYTA 5JVDA 1B04A 1LRJA 2YY7A 1LNZA 4WADA 2QV7A 3AHGA 1Q91A 1YQDA 2J3EA 1D3AA 3B1XA 1H9AA 4FONA 4XGKA 4ERNA 1W88A 2E2IA 3JWGA 2HR1A 4CUJA 1ACJA 1KC1A 2DKNA 4BVEA 5L9XA 4Q6BA 1NPDA 5DWVA 1W46A 3UV6A 3UGTA 5I7UA 4DN6A 4ZYTA 1L5GB 3RKRA 1KSFX 4ZIRA 1PE0A 1FXWF 4ND6A 5CFQA 4WJKB 5EOYA 2A57A 3QOFA 3VHLB 1CR1A 1M8PA 2GN4A 1EUDB 2WD7A 3C1TA 1JXMA 4G26A 1HQCA 4MRSA 4PF1A 2A35A 1WZEA 3FHTA 1AKTA 2EDCA 5JI2E 1LU9A 3LCRA 1ONNA 5BN3A 2FDXA 1W76A 4JJ6A 4WY8A