2YZMA

Structure of d-alanine:d-alanine ligase with substrate from thermus thermophilus hb8
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-Alanine:D-Alanine Ligase with substrate from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 83
structure length 319
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzmA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yzmA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yzmA01
5JVLA 1B6RA 3VPCA 4XX0B 1DV2A 1GSAA 5JH7F 3MWEA 1M0TA 1VKZA 3AW8A 1DIKA 1IOVA 3E5NA 3JZFA 5CAEB 3ETJA 2XD4A 4TV8F 2VR1A 1W93A 1OBDA 4EGJA 5BPHA 5IYZF 2P0AA 4O4IF 3U9SA 4O82A 5EZYF 2W71A 3Q1KA 4FFLA 5FNVF 4YB8B 4YJ2F 4M9CA 4MV1A 4M98A 1A48A 3U55A 4IZOA 3VPDA 4I55F 3K5IA 5CB4F 4EAAA 4FFMA 2W6PA 3AX6A 3KREA 1I7NA 5LOVF 2R85A 1GLVA 4HNVA 3BSYA 2YL2A 5GONF 5JQGF 5DMXA 4MV8A 1UC9A 4C5AA 4O7WA 1IOWA 1B6SA 3BSSA 4EG0A 2GLTA 4QSHA 1CQIB 3Q2OA 3OUZA 4EABA 4I50F 3KALA 4FFPA 4O2BF 4O7SA 3JZIA 4FFRA 4YBZB 4MV7A 4FE2A 3WO0A 2QK4A 4FU0A 4C5CA 5LP6F 3JRXA 4O4HF 2YRXA 4ZHQF 3TIIA 1Z2OX 4GGMX 2NU6B 2R82A 3RV4A 3WO1A 5K2MA 1KJ9A 3UFXB 4J6EA 4O84A 2GPSA 4O86A 2YZMA 1E4EB 2X0SA 1GSHA 2YS7A 2YWVA 3GLKA 1JLLB 3R5HA 2GPWA 2CNQA 4YJ3F 3I12A 4O4JF 4HQ6A 4FGRA 1UC8A 5CA0F 2I87A 4WD3A 2R7LA 5LXTF 3JRWA 5J2TF 1Z2PX 1CE8A 1JDBB 2PN1A 4I4TF 2YZNA 4O7TA 3U54A 2W70A 4EGQA 5C1PA 3HO8A 3MWDA 2I80A 2CZGA 1C30A 4ZI7F 2W6NA 1GGOA 3BG5A 1WR2A 2IP4A 3VMMA 1CQJB 1AUVA 4IWXA 2PVPA 1KUTA 3LP8A 4RZQA 4C5BA 4O2AF 3U9TA 2DLNA 2CNVA 2V59A 2QF7A 3R5FA 1KJJA 1W96A 2HGSA 1M0WA 4MA5A 2W6QA 4HNTA 4Y8VB 1DV1A 5LA6F 4O7NA 3R5XA 2Z02A 2FPPB 3SE7A 1E4EA 4L1KA 4YAKB 2FPIB 3BSWA 4XZ3B 2NPOA 3N6RA 1KJ8A 4EA7A 2ZDGA 1VBGA 4ZOLF 2R86A 2VHEA 3K3PA 5KKNB 2YW2A 5HV6A 1PK8A 4O7VA 5KX5F 4M9UA 2FPGB 4ZQIA 1T36A 1EYZA 2C00A 1I7LA 4MV3A 3QFFA 4TUYF 2DWCA 5LYJF 1JKJB 2V5AA 2WYOA 4NYEA 1VBHA 2I8CA 4MV6A 1A9XA 5C1OA 5BPFA 4IHJF 4FFOA 4O7RA 4E4TA 1JDEA 2OLSA 2FB9A 2R7KA 2XCLA 4EA9A 4XYMB 4IWYA 2NUAB 2J9GA 5BMVF 4O81A 2NU7B 1AUXA 2R7MA 2V58A 1EZ1A 2FP4B 3VOTA 5JQWA 2GQSA 3RFCA 3WNZA 2YYAA 5JVDF 4MA0A 2R6FA 4O83A 4HR7A 4XYLB 1EHIA 5D8DA 2DIKA 4O7ZA 3HBLA 2CNUA 2SCUB 3ORQA 3GIDA 2W6MA 3VA7A 2NU8B 2ZDHA 2YZGA 3DF7A 1M6VA 1EUDB 5CA1F 1KEEA 3TQTA 3V4ZA 4DLKA 3TW6A 2W6ZA 3K5HA 1C3OA 2GQRA 1CS0A 2PBZA 3ORRA 4MV9A 3R9RA 5J2UF 3KAKA 5H80A 3ETHA 3G8DA 1SCUB 1ULZA 4MV4A 4YAJB 4EA8A 3TIGA 4ME6A 5I47A 4MAMA 2R84A 4WBNF 3HB9A 3RV3A 3G8CA 3N8DA 2HJWA 3MJFA 4TV9F 3R23A 4O4LF 2YRWA 4FFNA 5HBRB 3VPBA 1GSOA 1BXRA 3TINA 3BFPA 2R87A 2VQDA 1OBGA 5C8YF 2Z04A 1PX2A 1KJQA 1BNCA 2W6OA 4O7YA 1KJIA 4O7LA 2YZLA 4HNUA 2DZDA 2VPQA 3V4SA 3NUAA 3OUUA 4IIJF 1EUCB 2ZDQA 2NU9B 1Z2NX 3LWBA 2R7NA 2YS6A 4DIMA 3RUPA 2CQYA 3KAJA 1KBLA 4M99A 1KC7A
chains in the Genus database with same CATH superfamily
1O58A 3BGDA 2OVFA 3ZCRA 4R3WA 5H16A 4KSYA 3IP6A 1U1DA 4XPIB 4MR9B 4P32A 4TPKA 5JYDA 2JIRA 4KYIB 2WHXA 4RVGA 2Z5GA 2HYIC 1E4FT 1BGXT 2NAPA 1ZG3A 1PW5A 4OO3A 2IUTA 5ALIA 4ENRA 4QUBA 2WTUA 1NYQA 4BV8A 3HY6A 3NEPX 2FEOA 4KR7A 1FTQA 2AZMA 2E5WA 2B8WA 1QH0A 4BBAA 3UAWA 1VMKA 1FDUA 3LX5A 2KBFA 3KAPA 1OLXB 4EUNA 4EG1A 3BCHA 1ZVVA 3RC1A 4CZ2A 3R6LA 4RCYA 1DQSA 3ACCA 4IOKA 1Q5PA 2HMWA 1C3EA 1L0BA 1O75A 4KFUA 2HB6A 2JFHA 1K5PA 4Q3BA 3IERA 1SXJD 4J16A 3TAHA 2GSDA 1USUA 4DCSA 1MAVA 2O57A 1DJMA 1MFZA 5KCMA 1C1HA 4KXYA 1VJGA 1P75A 4BTLA 1D8AA 3GLSA 1FTSA 4LXIA 4QNNA 1K4KA 5EQTA 1N8NA 5IYBG 3GX1A 4ZZ2A 4P2BA 5LZ4A 3RS5A 2YHIB 5DM1A 5BN1A 4QULA 1L1QA 3ZVNA 2F1HA 4OUDB 4LF9B 3R41A 4R9SA 5ADVA 3COJA 2BR5A 3NGLA 4BO8A 1LTQA 3TLCA 2DPJA 3AF3A 4LF8B 4LC0A 1DUSA 4UNNA 5KFWA 5DGXA 4H1TA 4C4OA 4JEUA 4DWOA 1CTQA 1Z7WA 4JCOA 4PSUA 1ORHA 4FEYA 5BWVA 3Q88A 1EUQA 2UVDA 5I4CA 3SJ7A 4EECA 2Y1KA 4F96A 5T3YA 1BXGA 5JU6A 2JEFA 3QUSA 2E4AA 2QUHA 3FF1A 1PFWA 4P93A 2J6SA 5HWSA 3IAHA 4DN6A 3PKZA 1E8DA 4RYLA 3AP2A 1AX9A 4FGSA 2NTNA 1A2KC 4FUTA 3TTSA 3M4ZA 3RJ5A 1E1KA 1M67A 1VL8A 5DLGA 3BCSA 3SEQA 1BJRE 1PFGA 4BO6A 3UBTA 2JJ1A 2EKBA 4WXHA 2BR3A 4QODA 3JQAD 3VJLA 1HYBA 3O1IC 2BF4A 2QQEA 4D25A 4EEKA 2J07A 3AUSA 3G68A 2VZ0A 2OQRA 4F84A 2VYCA 1T9CA 5CCXA 2QTBA 1IYZA 3F7TA 5KVCA 4LV8B 1IJFA 4IIBA 3SQMA 2WUFA 2BZ1A 2YV1A 2D1YA 1C50A 1FDIA 1M6YA 1VLMA 5KOHB 3F6PA 3G9QA 2UXDH 1QIEA 3V2UA 3G1WA 3JATB 4FSDA 4OJQA 5EXDA 2VWHA 1SCNE 2R2GA 1MVLA 3MUOA 3TIXB 5BYBA 1PSZA 4TROA 1NAIA 3ORRA 3E81A 3IIKA 1M2VA 3RS2A 4R1MA 5ED4A 4RHEA 3HR8A 5DXAA 3L4BC 1N4AA 2HIGA 1C3XA 4NLLA 1QE0A 1VL2A 2WUDA 5DCLA 1T5LA 4O3NA 3ZHBA 2PUDA 4DJ5X 5JBIA 2YWBA 3DC2A 4Y6QA 2ENUA 2PUAA 1XMXA 4EL0A 3UA4A 2GZRA 5KFQA 1PNTA 2CCJA 3F6YA 3A9SA 1PX2A 1H22A 1YRQA 3DMYA 3SHTA 3MJRA 3GVHA 4C7KA 3MINB 1HE1C 4I1UA 5EINA 2FPOA 4DXAA 4MPJA 2O2SA 3Q7QA 4Q1VA 5DN6A 3LKBA 5J63A 3LQKA 2QZPA 4U8HA 4PZCA 3COSA 4LC9A 5KPDA 3A27A 3RNLA 3CEJA 1U7WA 4GH5A 1MO6A 5DYYA 3H04A 2NT4A 2IF0A 1BJKA 4A3JG 1G2PA 3S8MA 2COJA 4X66H 4HQNA 9ATCA 3UJ7A 1WG8A 4J0MA 5FQOA 3AJDA 4DUZB 3VPDA 1QV6A 3KOYA 3KOWA 2FN3A 2R4UA 2CV2A 3F6CA 3TK1A 3WYDA 2NU9A 1LNZA 1JKMA 5J9FA 2N1BA 4JEHA 2QL9A 1TM5E 1MEJA 4RIHA 4C5AA 1SCDA 2MMGA 5TJHA 2G06A 1E60A 3BTSA 1GU0A 2GSWA 3ZXYA 1I0LA 3UJ6A 1FP7A 1UM9A 4MKRA 4R54A 4AIIA 4LZAA 1KBOA 2VDNB 1N48A 1X1SA 2BWJA 1W581 4PS1A 3QTLA 3D3JA 3ND8A 5AI9A 2C92A 1COZA 2P9HA 4DIFA 1ZETA 2QLFA 5FTWA 3DKPA 1QFJA 2Q5EA 3FTDA 4YUZA 4KMMA 4Z4IA 3L8HA 1OI7A 5CU7A 2H1VA 2ESRA 3R5JA 1VHLA 4BY9E 1Y34E 3B6EA 1KVQA 3HWSA 2IYTA 4OBWA 2YU9A 2DY1A 2H18A 3IAFA 1Y6ZA 3NETA 2Z30A 1WR2A 4U6SA 3ILHA 1NJ1A 3SKYA 4D5EA 4Q44A 2OHHA 3WGYA 2ES4A 4X8OA 1XZPA 1Z15A 3GU3A 2X1LA 3L02A 4M8LA 3QX3A 1QG4A 1D2EA 3LZDA 5DQGA 3DZ8A 4BLWA 1YRYE 2Y3IA 3QZUA 2JGKA 1JI0A 3K96A 2E18A 3SE7A 4EPTA 3DW1X 2ZM6H 3WJ7A 4FKMA 2XMSA 2JLYA 1QE3A 1BDHA 3ZNOA 4B0OA 1DDIA 3GT3A 2GHRA 1Y9JA 2HQ1A 1ECBA 4M53A 3F78A 4RZXA 3PEVA 3F46A 3P0IA 5EHNA 1CU1A 3DM9B 4PWZA 1FB5A 2IXGA 4FMBB 4ZDWA 2YJNA 2JZOA 2F59A 4ZOQI 4J4HA 1WUJS 2FB9A 3H5NA 4CM4A 1TM1E 2VJYA 5AW6A 3QYFA 5BVHA 2KSQA 1GPMA 5IZCC 3TKYA 3EUEA 2BBTA 1W19A 4P3YA 4Q4HB 4UTVA 1CF4A 4KQ9A 3THOA 4DANA 3MTJA 4WK4B 1IVYA 4DV2B 4E7PA 3HDJA 3M6WA 1ODFA 2FQ1A 1G7CA 1GPJA 1BFUA 3ETCA 2W42A 3CINA 1WULS 3IT3A 3PE6A 5E6SA 2XTZA 3TSYA 4QDOA 1SZPA 3BAZA 2NYAA 4TL9A 2IVZA 3KSUA 3W7BA 1CS0A 1EDDA 2WHPB 2RARA 2CHVA 3Q3HA 4QTTB 4J9QA 1R6XA 2EGGA 2FJZA 4Q9DA 1T6YA 2WWRA 2P3OA 5KNCD 4D4KA 1LS1A 4Q7EA 1BHO1 2GMWA 2YDXA 4WXEA 5I47A 3W8FA 2NX2A 2DFNA 2A5FA 3ZDDA 2AXPA 3KELA 1PFYA 3IRUA 2V4RA 3TMAA 4KHZA 2EX0A 3M89A 2FR0A 2DJIA 3EX7C 5DNVA 4M0LA 3KZMA 4DLXA 2QGZA 5JARA 2J5QA 4I7EA 3J80W 5E6RA 4AYBE 1PT7A 2QR5A 3V6MA 1R5JA 1D5WA 1Y4AE 2GCOB 3KYHC 2EGUA 2HZ7A 2VPYA 4HYEA 3ZBPA 3SDZA 5IRCD 3AEZA 3M2TA 1M9NA 5CGQB 1SU7A 3MT0A 1W46A 2DC1A 4N3NA 5C51B 3JAWB 4WFQA 3BGVA 2FLPA 3QMVA 1X13A 2I2CA 1LWNA 3WWCA 5CB4A 1DJLA 2CD7A 2P0AA 2DBYA 3DZDA 2O2XA 1QHSA 1XN4A 1LI5A 4WA7A 4HB3A 1QKJA 2GN2A 1LVGA 2BBOA 4J07A 4GLXA 3EBLA 3JYQA 4QT0A 2W37A 4BMZA 5TS3A 1AXGA 1OBVA 1HEIA 5AHXA 1II0A 2D5AA 3IURA 2PS1A 3PFKA 4OLAA 4HXYA 2HWXA 3T99A 3TEJA 2YFKA 1EK1A 4RVUA 1DFIA 3A70A 3EXEA 2DUJA 5I4BA 2FYTA 2COEA 5CA0A 2QRPA 3W3AH 2XR1A 2NU6B 1KSJA 2I78A 2YJZA 3IEMA 2QM3A 5L7YA 4X8HA 3NOXA 3I39X 4Y6LA 3TZBA 2ZYTX 3GL9A 3BWXA 5DTRA 2HMUA 4R2MA 1RSZA 1AG9A 2MYPA 2GAOA 5H3CA 1TQHA 1WXXA 2XE6A 3O3OB 1CP3A 1Y7LA 3F7MA 4RSGA 3I3OA 1A8UA 1YGYA 4B4VA 5L3QB 4HGNA 1SBCA 3G5LA 4XB2A 2RGNA 2F9MA 2BEKA 1Q7GA 1O89A 1KIAA 3DMFA 4G5OA 3NBUA 4OV6B 1XPUA 2X2PA 2YV3A 2H1OA 4MI6A 5JJBA 3KUKA 2DHEA 3GMDA 3OJXA 3I8XA 3TY8A 4B4DA 5JHGB 3CC8A 5FPSA 1W9HA 2JFVA 2P6MA 3PQFA 2CF6A 5FHRA 1G20B 2AZTA 3GR6A 3FHJA 3PO2G 4LUCA 3AWDA 4YQZA 2GUWA 1R0LA 3BH6A 4N6NA 1PJ4A 1CP2A 3UC5A 4QXAA 4QUAA 4QQKA 3W6UA 4TUYF 4JI6H 1QQ6A 5IEJA 3DJFA 2O2GA 1FZTA 1E6MA 2ONYA 2OV6A 3COYA 3G02A 1JLKA 5ECDA 1EQUA 4CL0A 2ONJA 1JEEA 4E4TA 3THXB 3NT2A 4BNFA 1E9RA 4PO8A 5IJZA 4GOND 2OCGA 3TR0A 3HV2A 4P6VF 5G0VA 1FVXA 3PL5A 5CA1A 2PGXA 4EJ2A 4A36A 1C0PA 2VKTA 1YR9A 2VUUA 3WAJA 3BJEA 4M0UA 1J0EA 1JEYA 4O7ZA 3EYYA 1ETUA 3M1IA 5L4NA 4HLDA 3Q8KA 3BOSA 3X1KA 3P0EA 2IF2A 4W82A 5IC5A 5IC4A 3FYUB 2ZREA 1UXJA 3OEED 1SU4A 2WOOA 3WB9A 2IKSA 5CXUA 4PGAA 2Q1SA 2LXNA 3ROKA 4F6RB 5E8JA 1H6AA 1SWWA 3PW5A 2F9FA 3H7AA 2K87A 4EO4A 1TWGA 1UBHS 2H1LA 1QHEA 5KC8A 1FDTA 2J4CA 3NHMA 5FJIA 2ZYSA 1EXWA 4E2WA 2YFYA 3FTFA 3GOQA 1DTSA 4M1WA 2ZG6A 3QBVA 2Y1FA 3VZRA 3Q41A 4FCVA 2HLNA 2PQ6A 1GN8A 4PC1A 1SBNE 3GJ3A 4DR6H 2QUJA 1DAIA 1HSZA 2F55A 2VRWA 1P9RA 5HZMA 4G8DA 2P9BA 2YVLA 1TCBA 4BNUA 4MW5A 4JUAA 4RGBA 1G0NA 2P4EA 1PGNA 1Q3TA 4NZNA 3NZEA 3T94A 3NCTA 4LDZA 1A97A 2I4OA 5H68A 4ZEVA 2V6BA 3ZHOA 5FULA 5TMEA 1S0NA 1Z75A 4G5HA 4C29A 4LXTA 1GU1A 3RK4A 1C9KA 5AUPB 1XRPA 1V1MA 5JC8A 3MTQA 4DCPA 2QOEA 4X6LA 1UK7A 4UHKA 3SSOA 1F3LA 3W05A 3NYRA 3CA8A 5JOQA 5A1JA 3GYBA 4B6SA 1MIOB 3I6BA 2DETA 1JP7A 4U39A 3C6QA 1O0CA 1YKGA 1KXJA 3T3EA 3MYYA 3P9XA 4NKRA 4GSKA 4ABTA 4EENA 3T1YH 2IYEA 5KYYA 1I4OA 4EUSA 4E33A 1JHZA 4N48A 1XYGA 2PBRA 1DG3A 1VLVA 4ZU1X 2P2YA 3G6XA 4MEJA 4E2FA 3R5HA 1IG0A 4LK3A 2CWWA 4KIGA 1YR1A 5KVVA 2WKWA 4O4JF 4YMUA 1UK9A 2OG1A 3PSHA 2WAYA 1K98A 1V37A 1TZMA 2UVPB 4HWTA 4Z4FA 2JJQA 4RBNA 2RH4A 1L4BA 3OCWA 3GJRA 3BCRA 3A0RB 3EXIA 1SD1A 4QQNA 1TJYA 4P80A 1AUVA 1ZA1A 1VB5A 1OE0A 2WKPA 3ZDQA 2Z9CA 1TJ5A 1Z18A 1MVNA 3N75A 2DKOA 3AFMA 3DSRA 2GJAA 2VPTA 4G9BA 5L45A 2O5RA 2M1XA 2CKMA 4CKYA 2NACA 3HCBA 1WEHA 2VLBA 3K2IA 1OAAA 1GXSB 2H6EA 4UTNA 1UDAA 3WRXC 3K3PA 3MFIA 3NHWA 4MVJF 4AWBA 2C96A 3KPUA 4M9UA 3BRWA 4ZCMA 4WFKA 4G0MA 3CPSA 3OLYA 5TJ9A 3DDSA 4QU5A 5EZQA 1MF7A 1ST2A 5C34B 4C3ZA 1SIUA 2EKDA 4FEEA 1A77A 5AM2A 2ZIUB 4LVNA 4EZEA 1DPFA 5KSWB 2ATLA 2ZYVX 4DPLA 1SEVA 4HAVA 4MRRA 2ZIZA 3F2IA 4R71A 2C5FA 4I1VA 2YHBA 4NCHA 5FOTA 3W6PA 1WXDA 4RNNA 2DBRA 2EFGA 3WKCA 1GCOA 2R7KA 2P4SA 5IW8A 2G36A 3IDZA 2BGWA 3F73A 1WR8A 2NXCA 3H8VA 3N6VA 3R7NA 4RUKA 2X5RA 5D2CA 4F0JA 2YIJA 1PZGA 4XCVA 5E7MA 3JWJA 3HJTA 2ZIEA 1TGVA 5CLLA 2M05A 1K0FA 1TF5A 1QU2A 2QP3A 2DIKA 5FTKA 3NKFA 4CF4A 1NXXA 1YJXA 4ETWA 5IUJC 3EF1A 4LW8A 4LSZA 4EYKA 4RKRA 4C21A 3ZWOA 4IJVA 5DW3A 3ZV5A 2AG1A 3I76A 4XWTA 3ZQKA 2E49A 2NAFA 4KQXA 5EZYB 2I7VA 2OPBA 1NVFA 4TL8A 3G8DA 3O8NA 5DGHA 1RZVA 1Q1BA 4O2RA 4ITRC 3MWEB 3DGFC 4JI6B 4MPPA 1I4TD 2O3QA 5T67A 1B04A 3HB9A 5FI1B 4BMDA 2NNWB 1OXKB 4H3HB 2FEWB 1CKEA 3PUKA 1CLEA 4BFYA 2XVZA 3EPGA 1YRBA 1KJYA 5KAMA 3QQPA 4I50B 3DG9A 4FLFA 4BMCA 2YVAA 4U7DA 3MGBA 2WFMA 2BOVA 1SUAA 2BPOA 2ZYRA 2X22A 2JLCA 2WPDD 4Z8XA 2Y27A 1KYVA 3EY9A 2ZBFA 4N12A 3K6KA 4OHVA 1VMAA 1AKUA 1I6LA 1OXXK 1SAYA 1FLDA 3H9JA 4B6PA 4D0NA 1K7EB 2HJSA 3BD8A 2OFXA 4X8MA 4R2JA 1S8NA 4C0AC 2VR1A 4X71A 2LNDA 2V4ZA 1RLIA 2HT1A 5DWVA 1A1SA 1E2QA 3WSVA 3KPVA 4JBLA 3MWJA 4UPVA 3GTKA 1A3CA 5IBQA 1A8HA 1JI3A 3U4HA 4GVXA 5L3VA 3OPXA 3FE2A 4URHA 3W3ZB 5LOVF 1J22A 2OAGA 3I5UA 4I14A 4ZODA 4O4HA 3BWYA 1VJDA 3HXMA 5D6NA 1TD1A 4DTCA 3V4FA 3ODPA 2DPMA 5CJPA 1TM3E 4O7SA 1XSEA 4L5AA 5KOJA 3RYCB 3DVSX 2CXHA 2ROQA 2DBZA 4QT4A 2F4VH 3SR0A 3DUFB 3CPHA 4WOCA 1VE3A 4P4UA 3EZYA 2XWQA 4IINA 5KTNA 2P1ZA 4OMUA 4JGIA 3GLFE 3EAFA 1PEAA 1F4PA 1QYCA 4XM1A 5LQUA 2WEKA 2QEQA 5CURA 1QYVA 1XWWA 3U19A 1T3HA 1HFWA 2EZTA 5ALVA 3VJMA 2PZEA 4ENWA 2C22A 2JIZD 2BSAA 4AICA 2I62A 1FPQA 1HFJA 4KE9A 3V1YA 1YASA 5I7WA 4HY3A 3JWPA 5IANA 4YAIA 1NI4B 3U13A 2PO7A 2ZYDA 3QLUC 2ZATA 3DFMA 1V71A 1WDTA 3HUUA 2NVWA 5DEIA 4FMCF 4XCQA 2OOKA 2JGEA 4MQMA 2HG8A 3WOHA 1MB4A 1AV7A 4R83A 1C4OA 3R75A 2OXFA 3BQ2A 1GDTA 5LA6F 4N3GA 3IUJA 4L08A 3C6BA 3A3KA 5M2QA 3HCAA 5G0UA 1NLYA 3LTEA 3VNRA 4MVYA 2FZEA 1X74A 5DV9A 2AGQA 3BXPA 3C16C 3AKZA 3ZPXA 5K2OA 2A86A 2JC3A 1VL0A 2PM8A 2HYDA 4PFSA 4J9LA 4P7FA 4IS2A 1U8FO 4AKHA 2RIPA 3ONNA 5KFUA 3WL6A 5DE3A 2W6JD 3KT3A 1WMAA 3ZGNA 5C5IA 5IHPA 1II8B 5EP4A 2CLHB 1J2RA 3UWSA 4J8PA 1W2HA 4YT2A 2JA1A 2G9UA 1W0JD 3VR3A 2OCYC 4LQ4A 1D2HA 3P19A 5FBHA 1M1YB 3DV0A 3UT0A 1JDUA 1PVOA 3GTPA 1FP4B 1NVDA 2REXB 1S1MA 3RS4A 1DZIA 4ZJPA 1WBDA 5C7OO 3EGDB 1I30A 3WGNA 1SU8A 3UJNA 2FPIA 2H17A 3KYJB 1U28A 3PC8A 3WNZA 3V6LA 1M2OA 4PZ6A 4PFJA 1YJ5A 4GSYA 2BFOA 3HBLA 2XCRB 5HJ2A 2PH3A 4E5MA 1GKLA 1QXSA 1NUUA 5AI8A 2IY7A 10MHA 3VA7A 2EFHB 3I8OA 3SHWA 3FTEA 1DDGA 2IQ5A 1VOTA 3G88A 4RV9A 4J6FA 2QZ9A 2VHZA 1S4QA 3GIQA 2QUZA 4MGZR 1KE1A 5JS2A 1V16B 1E8NA 4K9PA 1SCUB 4RE5A 2IIQA 3PITA 5MDHA 2D7JA 2Q29A 3QG1A 1GGKA 1YQDA 1XB2A 4LJRA 3TBFA 4DLRA 4RTPA 1Z73A 4DNXA 2CLFB 4DY4A 2H0AA 1XNHA 4D9CA 3KSZO 3C3JA 1CCWA 3PX3A 3VISA 4TKLA 3N58A 2VDWA 5K09A 4YWJA 1RXIA 4UTXA 4G1EB 4RD1A 1Z6ZA 1HMYA 4RCZA 3UJBA 4U00A 3U7FB 1WHSA 1N3YA 4QJ3A 3ZD6A 2FN9A 1ECFA 1YO6A 3SXPA 4A0RA 2W98A 4YCBA 3BGOS 3OO0A 2JS7A 4V0MA 5EZ5A 2VP5A 4Z1OA 3LL4A 4KAJA 4FMPA 4XX0B 2DUMA 1C7QA 1VE9A 4GZ5A 3ZCQA 2WAQE 3G0DA 3LH5A 3HRKA 3JWHA 4FT4A 4JOCA 4IFEA 2JFBA 1U2QA 2X7HA 1LBIA 1RKVA 3KBBA 4LDNA 1DEHA 1WLSA 3G82C 2F62A 2XZLA 3PR1A 1IPHA 3DMTC 3IKTA 3KHTA 3P32A 4HPWA 4TMZA 2X5JO 2J46A 2NVXA 1QHYA 3UW3A 1BS2A 3B38A 1V1RB 1KZ7B 2TECE 3IHWA 4AUMA 1K08A 1FJGB 2Y4OA 4FFPA 2MU1A 2FSIA 2P69A 2OKGA 3FIUA 4NZPA 2X8AA 1IJKA 4FYMA 3LXMA 3TIIA 1JB9A 4BASA 3U4CA 3T7JA 2DSTA 1YFJA 2PGNA 1GFIA 3K94A 1DAAA 5CGZA 5DEOA 4WHMA 3OKCA 3G8YA 2BTQB 4IHJB 5FA8A 3EZFA 4WD3A 1BMFD 1EVKA 1YVDA 4Z7JA 3SNKA 2ZAMA 1KZYC 1I7SB 4O7TA 1DKLA 2GZSA 4N9QA 2R9VA 3FUXA 2YOFA 3E3LA 2BQRA 1A7KA 5JTTA 3NBYB 3SDSA 3BG5A 2GESA 4IP0A 4YY3B 1Y9DA 1P91A 2ZSBA 1O94C 5BSGA 2JCSA 1V5FA 4DV7H 3FKIA 4MB6A 1G5RA 3R5FA 4OKSA 4LMBA 3ZWBA 4CC5A 2CMHA 2G9VA 1KF0A 2XRMA 2H5LA 1L4GA 3C3DA 2OB1A 1WXGA 4Y6SA 1W5FA 4B3TB 3D2AA 3EF3A 5L9XA 4DG9A 3DTVA 3GLGA 4LYYA 5I9TA 3EDMA 2F4VB 1MU0A 3VAYA 1TX4B 5GM1A 2P3SA 5CLQA 4LQLA 3QNMA 5A7HA 4HFRA 2PL3A 5BO5A 2O6LA 1OHHA 2Y92A 2AZXA 5J2UB 5F33A 4P0QB 3NRCA 4HLNA 3NIDB 4JLWA 2RH5A 1E64A 4FSHA 5EIOA 3GRYA 3MA0A 5KG3A 4B3CA 4LHZA 5CM9C 1WNTA 4CCSA 3DAPA 3LPAA 4J91A 5A4FS 2HA5A 4FGJA 4XYEA 4ZVMA 2XOKA 4WOBA 3CQ9A 2XTNA 1OT3A 1HT1E 1RMYA 1YBVA 1CUGA 2WILA 1L4HA 3TKLA 4NABA 1PZEA 5HF9A 4CXMA 2WJ6A 3I0MA 4RMHA 1MDBA 5F4BA 3AM4A 2IHUA 4NBUA 3L3BA 5L8VA 4NI5A 1Z68A 2ZCUA 3PU6A 4EDHA 3SIPA 5ARCA 4F1KA 3DYVA 1UKYA 2W4QA 1N0UA 4DDTA 4MTDA 4PRLA 1HEUA 2Q6OA 3PQEA 3NBQA 1R9NA 1O6ZA 2O1SA 4UTOA 2G5PA 5IFKA 4A3DG 1N78A 5G4KA 1VYVA 4LV6A 3KAKA 4KWTA 3GA0A 2J6UA 4YO8A 3OQIB 4QYSA 4PX2A 3DLBA 4RUCA 4AFNA 3OAAA 1CE8B 4P7KA 2DR0A 3DNPA 3VKWA 4PLHA 3Q2IA 5FI5A 3W8NA 1MKYA 2HL6A 2G8NA 4RV5A 3VH1A 3O4GA 5EIEA 2SKEA 5AJUA 5HBRB 3Q0IA 1RHMA 4DJFC 1WXEA 2I6UA 1NI3A 2VSOA 3T1VA 3H0GG 5JS1A 3OG9A 3DE1X 1FNCA 4EBCA 4OI4A 2KI5A 5H4GA 2DAPA 4OGFA 1KDPA 1SOUA 4R69A 1O6FA 3L0IB 5AP9A 5G1PA 5AJWA 2OP0A 2FLVA 4Z0TA 1FFYA 3RBDA 4EJSA 3IHTA 1DKRA 1UXIA 4O29A 2FEXA 3CW2A 1V3QE 1P0CA 2ZPAA 4IIYA 4W7HA 1EK2A 2O19A 5B4TA 821PA 2CLLB 2OWOA 1TB4A 3AJRA 2H0QA 3NUQA 1SCBA 3OZXA 3A36A 4LRTB 3L6BA 5CPFA 1OGIA 4KWEA 2JGDA 2Q49A 5DI3A 2QX7A 1O96A 2VAPA 2HHFB 5JTUA 3NT5A 3AEKA 3KB8A 1JXAA 3DL4A 4NEHB 3PFHA 1RAGA 1QX4A 4B4KA 1KP3A 3T6KA 3CR7A 4ZVLA 1G8SA 4Z3KA 1FFHA 5HIKA 2WDTA 2PGLA 4CLOA 1JR3E 4E5NA 4BO9A 1SVMA 1J21A 1SKMA 4FDTA 1W1WA 4KOEC 2QTFA 1H9AA 1O7JA 5KHLB 3SYRA 3OQBA 4ZCLA 3VX3A 1S2NA 4WWHA 5FLXW 4NE7A 3WB0A 2VT2A 2XCAA 3EF0A 3DBRA 4J9PA 2R82A 3NC4A 2HT6A 2VBCA 4D4GA 4WESA 4V0RA 1DAHA 1JG7A 4EELA 3B78A 2BJHA 3U3KA 4DRXA 4ZKDA 3HSKA 2ORVA 1JLLB 1ZD4A 4NBTA 4JQZA 1G6Q1 2BFDB 1WM1A 4BMPB 2FLKA 2E4YA 1MNQA 4ND1A 4QTYA 3HNRA 3A05A 3RYHA 4MMZB 2JHAA 2VRNA 2OCBA 3GV5B 1XMQH 2DUUA 4NARA 3V42A 5EVCA 4F5EA 2QIOA 2WF7A 1NM5C 2I3BA 2F7SA 4BVJA 2YNMD 4ZV9A 2QTVB 3RSLA 4LDAA 4RZQA 1PO7A 1OLUB 1DUVG 3CMMA 3Q8WA 2H4FA 2GEUA 2W6QA 5FIUA 1UZAA 4NAHA 2R25B 2PZMA 3NBZB 1RXYA 1U04A 4PQYA 4BWFB 2VKQA 2AN1A 2Y1XA 4S1PA 5JLJA 1J39A 1XCLA 1S2DA 3WGOA 2ZRIA 1ZGBA 1N6OA 4YI3A 2WWIA 3X44A 1VKHA 1TCCA 1W44A 3A9UA 2J33A 3IPYA 3K20A 5IYDG 4ZGWA 3GB9A 3M6AA 3JQBC 4L95C 2OZLB 3DR5A 1E0DA 3G2HA 1JEQA 4OMFG 1EWKA 2A9PA 2WG2A 4UXIA 4MLPA 4H7IA 1FC0A 4G2NA 4MITA 3F97A 1GN9A 1ZGHA 1YJAA 4M9QA 4TV9B 4RULA 1XCGB 1BDMA 4B46A 1UR5A 1CRZA 5CX4A 3HDHA 3EQ6A 1GR1A 2YWFA 4BAGA 1UP6A 5LD2B 1OYOA 4DV7B 3D7RA 3VKFA 4TVKA 5JLAA 1MH9A 3B3JA 3U5ZB 3I5YA 4HH4A 1JKFA 4FOTA 3LMLA 2NQTA 2Y71A 2JIPA 5K0TA 2FUCA 5TB5A 4HFMA 4EJFA 1MO2A 3KEOA 3H5IA 1CNEA 1USVA 4JI0B 1YCHA 1CEEA 2WWGA 1KY3A 1AURA 4KQKA 2IHBA 1R4NA 1KZ4A 2E87A 2JVKA 5KNCH 3DYBA 1C7JA 3NVMB 4CF6A 3DL2A 2QMUA 4BX9A 4YP9A 1FU4A 5CT6A 3AFGA 2ZRBA 2IYOA 1RQPA 3CF0A 3KUCA 3UMFA 5FH9A 1FSGA 1IY0A 4V2IA 4WKGA 3WP1B 2DBQA 4IDQA 3KQQA 2RI1A 3KK0A 2AB0A 2VBIA 5DWDA 3L07A 2BEVA 3D6FA 3FHCB 1N3IA 1J0DA 4LFAB 1JKXA 5CJ2A 3C4JA 2YR0A 2NVUB 5FBLB 5B1EA 5K99A 5I9MA 5P21A 5AESA 4I55A 5E6UB 2ZS8A 5AUOB 3ORHA 2P0EA 4JBNA 4TQAA 1FFAA 2AYXA 2D2FA 4BJHB 3O9VA 1EDOA 3H1GA 4XSHA 4KC0A 5HUJA 1RQXA 4DFDA 1O5TA 2JLAA 2VHWA 4B3SB 3U55A 4WIAA 5G40A 3EFOB 2QPAA 4KIJA 5GPBA 4CVNA 2XTAA 4FFMA 4L74A 2AX3A 1UBUS 3HBAA 3AY0A 3ZBUA 5CDFE 3QKTA 3C14C 3QHAA 1JHDA 1PUIA 3GDEA 2O03A 1CJMA 3RF2A 3B5JA 2O3JA 1SXJE 3IQFA 2VJAA 3Q2KA 2R7AA 1XVAA 4BZZA 2G1PA 1T9BA 1HWYA 2IYNA 1M2JA 2BRUC 2HDKA 3ZH2A 3N0RA 3G2NA 2V3CC 4A3KG 4MB0A 4MRVA 5A05A 2QBYA 2DJ5A 2AWNA 2IE0A 3D8UA 1YOBA 1ORVA 3R74A 2QM7A 1S2OA 1JX4A 3A6FA 1FW6A 3CLSD 4X24A 4CMIB 3UBMA 3P0JA 4JOBA 2CZQA 1ZXLA 3KKZA 2QGFA 1FDVA 5EKDA 4X9XA 5AFSA 1Z35A 3EEBA 3FMVA 1J97A 3BE4A 4KI7A 4LYHA 3H05A 1TADA 3U44B 1OD6A 1SBZA 5BSMA 4DG5A 3IUPA 2Q5CA 5EJGA 4IIFA 2DX7A 1CNMA 2J9ZB 4FYVA 3L8ZA 1OZHA 1GTG1 1W85B 2RI0A 4IIGA 2ZTHA 4BXOB 4O3PA 4CYMA 1XU4A 2PX3A 2VUIB 2IEGA 3FI9A 1PL0A 2Q9BA 1BEUB 4OXXA 4CUZA 1UMCB 3FSGA 5K0SA 3T7AA 2RGYA 3BMXA 4P33A 2P2DA 3UQYS 5DF1A 4FS2A 3GRCA 1ND5A 4RD3A 3OHSX 3REQB 3N07A 5D5HA 3SC3A 1A9XA 2WY2D 1FRZA 5K6RA 3IODA 4NV3A 4B5LA 3HCCA 1TLFA 4GPAA 1ZJYA 2XDQB 4YRNA 3DZGA 1YCFA 5FPTA 1IJBA 2HA2A 1XMQB 3IKMB 2OCAA 1FVIA 1U81A 4YJDA 1RM5A 2CDRA 3KHHA 1AXRA 1QB7A 2AFIA 3RM3A 1GDHA 4ACBA 4ZCTA 1QCDA 4IIJB 4JMPA 1SZDA 1X94A 1RFLA 5IWAH 1RJDA 4NYMQ 4XWYA 3GFFA 2D1QA 4AY6A 3JSLA 1GTZA 2OK7A 3A2NA 4LF4H 3PNQA 4G8CA 1LX6A 3LSYA 2DLDA 2WUWE 3G2KA 4U1RA 1GRVA 3SBDA 1W36C 4JGGA 3R7BA 2NTYC 3BICA 2YWCA 4BNTA 1AQYA 4MV9A 4K28A 2VJCA 4G4SP 1NJ2A 2E21A 3U0BA 2ZWAA 1Z9BA 4MIKA 1UAAA 3U26A 4FQ8A 5DBGA 4CEJB 1Y3IA 3UNXA 2WJZB 2Q7OE 2GETA 4H6WA 2UXCH 2HMSA 4J9KA 4XYLA 2FMAA 2H4HA 4R6WA 3LQ1A 1GNVA 3QLEA 4AS1A 1FSPA 4E5YA 1EM6A 4MVXA 5C8YF 1CY8A 4Q6WA 4OJNA 5JH7A 4HEHA 1QRUA 3E9ZA 5IMSA 2UYYA 3V4SA 4QUHA 3RE1A 4X7PA 5LKRA 1O0SA 1VIYA 4BY7G 2VP2A 4O4IA 3LUCA 1N4DA 1TGYA 3CNQS 3JWIA 3JYPA 2Y0CA 3HXKA 1Y6QA 2P62A 3COWA 3REOA 5KFTA 3WZ2A 5AJZA 5E9QA 5LJLA 1DV2A 4J0FA 1BROA 3E0QA 3DULA 5CNKA 1ADJA 3JZFA 4L8GA 3RW9A 1KDTA 4NXNH 1Z7EA 3AERB 1XCJA 4AQDA 5IH3A 1T1EA 1XLTC 2B34A 2DUNA 3CGWA 4LAFA 3D4PA 3AF1A 3UO8B 1XXHB 2DKFA 1PWHA 2EP8A 3AKEA 4PTLA 2H31A 1I7NA 5BWWA 1PTJA 4TSFA 3ZYZA 5DHPA 3LTNC 3KZKA 2R6R1 2D74A 2H3EA 2EJTA 2H7CA 2HCTA 1F17A 3N7AA 3FMIA 1YUNA 3NBXX 3JX9A 1G21E 1NQUA 3C1OA 1U1IA 1T9ZA 2PUFA 5K5EA 4QRIA 3DOUA 2P90A 4PWYA 4W5NA 2CDAA 3RARA 2E1PA 4XYBA 3HH8A 5KFAA 4PICA 3ACBA 1XEAA 1KH1A 5L3SA 2GB4A 2Q07A 2PZLA 4RS3A 4QWWA 2ADFA 5KBYA 1ZW1A 2AUMA 3KRTA 3UMSA 4GGOA 1T1IA 5EESA 2XZOA 5AHRA 3OZEA 4QUKA 5J2TF 3JRNA 4D79A 1YVRA 3LDFA 1G5PA 3F96A 3K92A 4HTFA 4YR7A 3R77A 5JYEA 5COBA 3PQ3A 3GTOA 5BMOA 4ZPJA 2HSGA 2P67A 2GBFA 4ETMA 2RGUA 4IWXA 2YZKA 2YXLA 4Z4HA 1P81A 2GJSA 1FPMA 3PVXA 1FYWA 5DG8A 3C6XA 3TR5A 3RS3A 2JLZA 4PRKA 2PAAA 5JXHA 1PSDA 2Z2KA 3PXXA 1P39A 4IPTA 3GFSA 3ETLA 1LUAA 4W1PA 2AFRA 1GCGA 1RYZA 3TMKA 3VOSA 3ZVLA 1WSAA 4CCYA 2FPLA 5KWVA 2OHVA 3VO8A 2O1XA 4RFSB 2BGGA 3RFXA 2AMLA 2NVYA 4DMRA 3E9DA 3IV9A 4URFA 1NX9A 1M3SA 2ASJA 2PSDA 2H4ZA 4HC4A 1O97D 3NEJA 3ZCXA 2WICA 5EAIA 4FR5A 1ESDA 4G0ZA 1Y5MA 4P53A 3OZ7A 4CNBA 4OKNA 1Z5WA 4V0NA 5EHIA 3V1NA 3LBAA 1AQUA 2OORC 4YLGA 4M8KA 3OZRA 3CNNA 1EFRA 2WTMA 4OLBA 4ZQGA 2DYKA 5T6BA 5KJCA 3DCYA 4FT2A 1QIMA 4EBBA 4LWPA 4RANA 1JIXA 5A5VA 3QMMA 5AHKA 3FMFA 4QQ8A 2UXDB 3G0CA 3LW8A 1YU6A 2C2DA 4E14A 4QW9A 2ZTLA 3QPVA 2W6MA 1PBTA 1BDBA 1UC5B 1IQPA 4FE4A 1L3CA 1XXHE 4CRWB 2XCPA 1R0XA 1UINA 2Z6AA 2O59A 1QTRA 1OXTA 4NHEA 2LD4A 1CK4A 4JOSA 1BEEA 4EY4A 4YACA 2Z2ZA 5CVJA 3ZY2A 4CMEA 4X61A 3HU5A 1CQXA 3PNSA 3SD7A 4OHUA 4CTNA 1E1LA 3FOEC 4O2AB 3E82A 3PNPA 4JMLA 1NU8A 2OO3A 4DMCA 3ZLJA 1E2GA 1ZUWA 2R8XA 1GQRA 2Q0XA 3RGZA 1ODJA 2FWRA 3ESQA 4UNIA 4AY2A 2MSLA 3VRHA 4LNUB 3QEMA 3G2JA 5IT5A 3ZE7A 1RWOA 3PWSA 4TRJA 4YRQA 3EOZA 1T43A 3ENKA 4RYDA 3B82A 4MWCA 1Z45A 1NQ5A 3B6ZA 5D5PA 1SG0A 3BULA 1U4NA 4BCBA 4PTZA 2Q3BA 1BO6A 5JCJA 2H7YA 2R66A 2FOLA 4OP1A 4Y98A 4ZYXA 4U7JA 1R5BA 1H4TA 1BH6A 2OC4A 4OFWA 2VT3A 1KC7A 1N2CA 5FYQA 1V35A 4F4ZA 3HI6A 4LF4B 3R6DA 1SEPA 1NN0A 1Q19A 3T9BA 1JWBB 3VBCA 1DLIA 2D5IA 5KFGA 4X66B 4MW0A 4ZAXA 2B2XA 1D03A 5TF4A 3GCXA 4V39A 3M49A 3MWKA 3ZU5A 2FWIA 4JQOA 3DLTA 1AK2A 3GB8B 1DWQA 1U94A 1HRDA 1AHPA 4TMWA 3INYA 4BJ6A 3PGXA 3SG0A 3DFFA 3G7NA 5JDCC 3JD3A 1P4GA 3EA5A 5JFTA 1SC9A 1G4AE 2GZDA 3Q3IA 4NESA 3C3AA 4JZYA 4BC0A 2CNBA 3U7JA 3O2NA 1TMOA 2OSVA 2R93A 3C7CB 4DV1H 3HBFA 4LZWA 4XFDA 2Y8EA 3P52A 4L3WA 3GLIE 3MM4A 1M6HA 1MRNA 1SIBE 3K73O 4B31A 3IDFA 2XPCA 2C95A 3AJ8A 3N28A 2CJYA 1IVSA 4RXTA 3HJGA 1E4VA 3ONVA 4MWTA 2AKAB 2Q3LA 4JP2A 1E6EA 1PGPA 2DM6A 3GP8A 5I7FA 3OZDA 1DTEA 2Y76A 2AD5A 4TZ6A 2FWPA 1TQ2A 1FL9A 3Q9NA 3F5DA 4M38A 1I9CA 4C22A 4NXNB 2PN1A 4RB3C 4RDXA 1WXIA 4EO7A 3SHOA 1EFDN 3CJTA 2YOHA 5B1HA 3PCTA 2VOBA 1XZLA 3MLAA 2VUGA 4P5DA 2VDQB 2R7ZA 1W1UA 3CNOA 5ALTA 3MJHA 2QAGB 3T5AA 2PE5A 3GQBA 5LMNH 5KDDA 4UMVA 1QPBA 2W2LA 2PKQP 2QF7A 1OT5A 4POOA 3RHTA 2CNWD 2EBWA 2ZM6B 1W88A 1DCMA 4G4JA 2FTKE 3QIVA 2ZJZA 1GJRA 5CXQA 2HH9A 4XZ3B 2JAUA 4FHGA 5FUBA 1F8XA 3RYFB 3K6SA 4P5EA 1PQ4A 3RHZA 2QL7A 2EIHA 4Y1RA 2C9OA 5IVPA 2PKEA 4TYMA 5ITZA 1M54A 3TBKA 2QJRA 1U9IC 1W0CA 2HD4A 1NC1A 4WH0A 4UQOA 1N36H 2H2AA 3EA4A 3BIJA 4FPXA 4TTVA 3OPQA 2XQJA 3R09A 2HADA 1IZYA 4OIMA 4M9RA 2PUEA 3B70A 2BZSA 2VYFA 4ESOA 1VG0B 2NYVA 1I3MA 4PCUA 1RJPA 4WI1A 1EINA 1ZD1A 4ZT4A 1PV2A 2RFLA 3IBGA 1O9GA 1X8LA 3JPYA 5C80A 2ZZKA 3LGXA 1QF6A 4DARA 2EKQA 3VAZA 4C07A 2G7ZA 3EH1A 5SICE 4WFIA 3PIRA 3AGPA 3QWAA 5DNUA 4WNAB 1MQ9A 3P9YA 4JY7A 4UQLA 2EZ9A 3I6YA 3FLBA 3PNBA 3MUNA 3UFBA 2Z4SA 3K5HA 4N1AA 5DYIA 3GJSA 4HL6A 3HC7A 3PQ7A 1ISFA 4Y7DA 5LDDC 3I4MG 4WLEA 1YS7A 1XTRA 5G1OA 4RVSA 1P61B 4CQLB 2CUZA 3IQHX 4C08A 3VDMA 2BONA 4LQDA 3RRMA 3FTPA 3MR6A 5TR9A 5EP3A 1QZTA 3DBHA 4L8LA 2X8WA 1P6QA 5NLLA 1RRGA 4XWWA 3NTUA 1MO4A 1BRTA 4A93G 5K8JB 4K9LA 3EZ2A 4OFBA 5IWCA 1QFZA 3ZVKA 3CEHA 2GHIA 2BKEA 3S99A 1QDUA 4CHIA 2Y9MB 1CKMA 2B63G 1LPSA 1PEKE 4C3VA 1G2QA 3RUPA 4DA8A 1YTUA 1BJTA 1FLAA 3RB8A 1ECPA 7GPBA 2XSZD 1GUDA 3R7DA 3GDWA 4XX1A 4ZCSA 4MLZA 1ZVMA 1Z12A 3MPOA 4ERXA 3AR8A 1A0OA 1C0EA 1URPA 2RD2A 1NVEA 1R4MB 5BW5A 1RR6A 2ZU0C 3RSFA 5IT9W 1YFZA 3HA3A 3WE7A 4DSNA 3ITDA 3WR5A 4K9KA 2A1UB 4CETA 2FUNB 4MDYA 1YQWA 5AMXA 3NNNA 4CUJA 1GLVA 5LDGA 3UJHA 2IYSA 4JDUA 3OSUA 3DFIA 3L05A 4MP6A 4ZEWA 1NN1A 2LWIA 3RUIA 4Y18A 4GRDA 1OWPA 3KALA 1FX1A 4F9GA 5HQ3A 5TY0A 5HBGA 4A15A 2C5SA 3X1XA 2X0EA 3ZGVA 3HYCA 4J9NA 3TAXA 3URKA 1X87A 1EUDA 1CIJA 1Z2OX 3EG9B 5ALDA 3GLFB 3AEYA 5AIAA 4KDFA 2CYAA 3LDUA 1TM2A 1COWA 5ICSA 3TCKA 1VE7A 2I1WA 3ULKA 1F0NA 4US1R 4GMGA 3TRKA 3ZIAA 4QIWA 4FCCA 1GZDA 4K6CA 2VBGA 1JVNA 1QGDA 1IHDA 3LHSA 4IKOA 4RZRA 2C9BA 1WCMA 1P0PA 2OGWA 4HUQA 4Q9IA 4WVFA 2X0KA 2QRQA 2R751 3C3MA 3TOCA 3R40A 1EPUA 2Q9UA 4H6VA 4BO2A 4C4ZA 4URXR 5ERXA 3KWMA 1R5NA 2AOTA 2QVZX 1J6UA 3MCTA 5K3OA 1UIRA 3FTQA 3DNMA 1OA1A 4M1ZA 3QWHA 2YHUA 3K6JA 3CV3A 3WQSB 4GWKA 4UC0A 4RZSA 2C8LA 5I45A 4AZ3B 4KVFA 2X0NA 4F2HA 3L46A 2ORIA 4RGQA 3LFTA 3L9WA 2I1QA 3LK6A 4TWRA 3GP5A 1XC7A 3H9BA 5T57A 4EA7A 2BGUA 4K9MA 1TTHA 4LIPD 2XB2A 4E13A 4JFRA 4OFXA 3STTA 1JSZA 4ZT3A 3QQMA 3WA7A 5H3HA 2O4UX 3PLAE 1ZH8A 5LZ2A 2ZVQX 2CHEA 2PUVA 3GK3A 4U2DA 4Q6BA 3MTBA 1P2BA 2HIMA 4UNSA 1N5JA 3B8HA 3DHNA 3AY7A 3KYDB 1ONNA 1J33A 2WIGA 3MT8A 2VHJA 5C8DA 2Q8NA 3H11A 3DKKA 2XGSA 1ZK3A 3RWBA 4CMKA 3D4BA 1PT8A 3DOIA 3NFYA 2HGXA 3QOYA 1AQIA 5FI3A 3SS7X 1E3EA 1W7AA 1UZNA 3A6HA 1L7XA 4X1KB 5LMNB 2PFSA 1JZTA 5JJ5A 4QPZA 2A9VA 4GLFA 1BXRB 1JKIA 4EMBA 4UXHA 3QE3A 4CM8B 5TARA 3KKOA 4EUHA 1DI0A 4RA9B 2ATXA 3G9UA 1Y8RB 4DC9A 5BSRA 3IHKA 1YE3A 2AJLI 2VA9A 3UPTA 3MJ4A 3UOAB 2HO5A 3GUCA 5FO0A 4EJ0A 5BUZA 3KZCA 2D5CA 2P6NA 4JBHA 3TCNA 5ECGC 3O93A 2B4KA 2OR3A 3E3AA 4HZUA 4R6XA 3L4EA 3IAUA 3BCUA 1AGPA 3DOCA 3BA9A 3S2IA 4JGBA 5ALMA 4PAMA 1N36B 4LN1A 3EDYA 4OB7A 4MCAA 1IUPA 3JQCA 3RFUA 3GEPA 3NTRA 3ETEA 4F4FA 3SGIA 3ASVA 4K6OA 5DRTA 3F74A 1QO0D 2OESA 2NTEA 2YRWA 4URZR 4Q3CA 2DPHA 1VSTA 4DR6B 1I33A 1YHNA 2IY8A 1VCOA 3GAAA 4DDWA 1SBHA 2IL1A 3C85A 2O54A 3QP9A 3V6JA 2V98A 3EPJA 3WBJA 5TQJA 1OCEA 2YS6A 3S40A 1KI4A 1E7QA 1JQ5A 3TIVA 4OJKA 1EJBA 3HOWG 4G1BA 2PTGA 1A72A 1HE8B 3EXFA 4TKVB 1ABBA 3PGJA 4C2MA 2Y66A 5TT1A 3WLEA 4UM9B 3HKCA 2HVSA 3NANA 1V9SA 3B2QA 5H83A 5SY6A 2EJVA 2HMAA 1PVVA 2D0IA 1FW8A 4M0FA 2HCRA 3SM9A 3DKRA 2BFMA 2IPMA 1X7YB 4I6JA 4L0DA 1ST3A 4Z4QA 3B2EA 1VQ1A 1U0SY 2A8YA 2AEJA 4L3VA 3W1VA 4RY9A 1TTTA 1G4HA 2YVQA 4OF4A 4EABA 3VFDA 3T1YB 2RAPA 3INGA 2R8BA 3KHUA 3CCBA 1JAZA 1XD8A 4M0EA 3AR3A 3KL4A 4UVHA 4ATNA 3GJ6A 1XTVA 1T8WA 1GLGA 2DU8A 1E1DA 2IODA 1TU3A 2TSYB 5DK4A 5KQSA 2NUPB 1NMEA 1X1BA 3LQRA 4MRMA 3IILA 1Y1WG 1AVTA 3VO9A 2O07A 3RYIA 1GWNA 3ZY3A 4CM7A 1FA9A 4LTDA 4TKZA 3WLJA 3AUXA 4AMVA 5KHOC 2M6LA 3SYNA 2W6NA 4A2CA 1ZJ5A 1IN6A 4QG3A 4ECUA 3IXLA 1CY2A 2V9ZA 5TSDA 4C78A 5DM60 2H1WA 1FSZA 3ZV4A 2AGPA 2V7EA 2FZ4A 1P2FA 3M3PA 1GV0A 2FZGA 5HZHA 1XTQA 3HEMA 1I1NA 2YWHA 5HCUA 2WKQA 4WERA 1SK8A 4HNTA 3GNQA 3W5DA 3ECCA 4YT4A 4RTNA 4LSWA 1XWIA 2LDXA 3LVQE 1PGQA 3P9RA 1XCPA 2Q6TA 2K7ZA 3TSWA 1LLFA 3PW2A 3A0UA 2WWYA 2PKYX 2ADMA 5ETJA 4BLQA 4GOOD 5J1TB 1T5DX 2VTBA 3IXQA 1DBRA 4E5UA 3J81W 1GEEA 1AN7A 3IIEA 4UDXX 5YASA 1LCIA 2AT1A 3KJZA 3LZCA 4ZGGA 3CHYA 4K9SA 1JE1A 2FMTA 5I7RA 5JNTA 2PMZE 3D6MA 1Z5PA 3E0XA 1E4YA 1YDFA 2QN3A 1JFFB 2XUAA 4MX8A 1Q0PA 4YJGB 5T41A 1P2DA 1VLQA 1AKVA 2UVQA 1JSRA 3C1UA 1JPJA 4FBTA 1Q44A 2ODQA 3MJTA 3G8AA 2GPTA 5ENVA 1SG6A 3KVYA 3JWEA 3NHZA 1G6HA 1GRNA 2RDMA 1ECJA 3RLIA 1PAUA 1MUUA 2DTXA 1UQRA 4PYOA 5BSKA 3MR3A 5EUQB 1TJ4A 1SZCA 2XOEA 3KPJA 2AC7A 3V4ZA 2FRDA 4ZQBA 1GAWA 4ZRDA 5FO1A 3VXKA 3M9NB 1XN1A 2P6OA 1JBQA 2L17A 3VH2A 5BNFA 2I6XA 3C3PA 4CW7A 2P7IA 1H2RS 3HFJA 1FXWA 4DIOA 3KDAA 2EC5A 5F9FA 4BFWA 1WS6A 4ARZA 2JFZA 2VF2A 1GTRA 4GBMA 2VK4A 2IWRA 1USGA 1LSSA 1PL7A 2OH2A 5HUHA 4MKZA 5C52B 4R8VA 4RS4A 4EX7A 5CE8A 1R37A 4UHBA 2O3UA 1SVIA 5DWQA 1OXBB 4NDNE 4XEHA 4O2BB 4C7BA 3OE7A 1BNCA 4ND8A 4O7YA 3W7VA 1PG2A 1FDSA 4H15A 4YAUA 3MD0A 3CF2A 5EWJB 3RQSA 4A91A 5F9LA 1NKTA 2CW7A 5BVGA 4BNDA 621PA 3THWB 4BFXA 3EGXB 4TTPA 2POQX 3OPNA 3FYCA 1WPQA 1MHTA 4RIGA 4D9JA 4CG2A 3C45A 5EXTA 1E4GT 3M34A 4IMPA 2HX1A 4D56A 2CKDA 3P0RA 4JT9A 1PWXA 4LZZA 4X3PA 2DHRA 2X0DA 3PENA 4M54A 3O4IA 3MAAC 4ZD6A 2BUBA 3DLCA 4KFSA 1XA4A 4N7BA 4E46A 2PXCA 3QZ8A 2A78A 4LJSA 4MR7A 2W6PA 5DYGA 4WLOA 2ID9A 4BN4A 2OV2A 5EWMA 4JFAA 1YS1X 5LP6A 3GIIA 1TI7A 4YGXB 4W5WA 2FJ0A 3UHJA 3SX2A 3FCEA 2PSEA 3TXXA 4PPYA 3ND6A 3KKQA 4PSAA 2VF8A 3G1UA 3H1BA 4ARCA 4X00A 2BZ0A 1VE6A 4ZDIA 1B93A 4IZIA 3HMQA 5H59A 2AH5A 2G80A 2RK3A 3BXOA 3Q8XB 4O5AA 2X9GA 3QVJA 4HVTA 1TF2A 1VBFA 2Q99A 1EP2B 4IXNA 2DH5A 1FYVA 2QRKA 3ZJ4A 3HDTA 3EIEA 2CE2X 3BK7A 2P2SA 3GT0A 3L5KA 1QNLA 1E2PA 1N8KA 4EFLA 1KS9A 3HR7A 3QFCA 5FOVA 3HQ4O 5K8UA 3B20A 4ZVTA 4KQWA 4MUIA 5KT3A 4AKIA 2L0XA 4XVUA 2H57A 2IOQA 4I4TF 5IVKA 3HDVA 1UPAA 3U54A 1QP8A 3JAMA 3ELWA 3ZDEA 4IR7A 1XLVA 1UKEA 1T35A 2ASLA 1JR2A 1A4XA 5JBQA 4DMLA 3KR1A 4IIVA 2ONZA 4QJIA 3QKSA 4CDNA 1SO8A 3SSNA 4AMYA 3FOBA 3VTFA 4FKBA 5HVNA 4I1IA 2JBHA 1L1FA 2HBQA 1NBWB 2YFQA 3Q6NA 4BMVA 4ZTZB 4FOLA 4LI0A 1T9GS 1CRQA 1Q50A 4PYJA 3IBSA 3HEAA 2OA0A 4FMDF 2ZXFA 4FR0A 2QRJA 4ZDKA 2B2CA 3KTDA 4DM4A 1HPLA 4B6EA 5HQJA 1I6WA 1Z0UA 1AQNA 3IE0A 4H59A 4L16A 5CVVA 4FYJA 1JR4A 3AVVA 4A3MG 3TI9A 4PZDA 2JLSA 3PP8A 3RNOA 4ZC1A 1BN6A 1NP3A 2PMDA 3Q6IA 3HP4A 3LUFA 5B4UA 5BWTA 4K9RA 5JR3A 2PJRA 1B16A 2V6JA 4QA9A 5E9JA 1NUPA 4LFBH 2XUHA 5EEHA 3LUPA 4KUEA 3ZWAA 4FFVA 3J81k 3LLVA 4EY8A 2F2TA 4OOFA 1E2KA 1PGOA 2MOKA 2XYHA 2UVRA 4EUKA 3LQSA 4B3BA 3N2GB 4LXUA 1T3LA 2FZKA 4QXOA 1K9SA 4J0KA 2JH8A 3LO8A 4MDEA 5AK6A 1Q6ZA 3EUFA 3EC7A 4PIVA 3ZV3A 1U2SA 3TGPA 3DF7A 4CEIB 2I91A 1VIMA 3LULA 1L4UA 1X70A 3R3XA 5IKPA 3M1AA 4HQLA 3PBKA 4YJHA 3JQDA 2AK3A 2RHHA 3BRCA 4XOUA 1UF9A 4M87A 1IBRA 1MO5A 1N0HA 5IP7G 3NTQA 3UANA 2RJNA 1KVUA 4OBBA 4MHSA 1QTNA 3CJRA 2VSQA 4KE6A 4ECAA 2R84A 4KCGA 3GMTA 3K1AA 1I3CA 3U7GA 3CH4B 2G09A 1AGNA 1KHTA 3PNVA 2Q7XA 1ARZA 1EXDA 4F9TA 1OV4A 1GSOA 3PDIA 2F3RA 1R8QA 2XWSA 1VB3A 5B58T 1VMDA 4RVDA 1F06A 1JEAA 4Q39A 2RK4A 3HYRA 4E0BA 2ODEA 2AW3A 3NCHA 4ZN6A 4QYIA 2ZLBA 5DPMA 5SV2A 4IDOA 4LHSA 4YJ2A 3CSSA 3FCSB 4C4YA 3K1ZA 1KP2A 3OLCX 3N2LA 2C35B 2WDPA 1DGSA 3GLUA 3CS3A 5AJXA 3OPYI 4ERNA 1A76A 5F73A 4X85A 2W2VA 4D3SA 4JH0A 4J2HA 2XUKA 2GXSA 1DKQA 5JY6A 3RIEA 5F78A 5AH0A 3KUDA 5GWXA 1DAGA 2FGJA 4QJ4A 4L8VA 2RGCA 4ZI3A 5GJVC 1DADA 3I2YX 5C18A 1EG2A 3DEHA 2JZNA 4Q19A 4YP7A 4HB4A 3RSHA 8LDHA 1Q7TA 1I1QB 4GQIA 1AQLA 1QMGA 2XLCA 5JAUA 4NBWA 3WC4A 1SXJB 4IGFA 2C5LA 4D41A 8ADHA 3CX4A 4TQUS 5ESRA 1K7XB 3BX1A 3R7WA 1FTNA 1KSGA 3AVUA 2OZEA 3CKYA 3EA0A 3M1LA 5EFOA 3RVLA 2WQZA 4XTRA 4HQ6A 1TOAA 5KJFA 4HOYA 3VI3B 5FOUA 4CIDA 3H8SA 2J5BA 5DT9A 1RPAA 2BUAA 3WLMA 3HO8A 1CHNA 3IEUA 1BQ3A 3TBHA 2WZDA 5JATA 5AK4A 1NNUA 4AIRA 3FFTA 3V7YA 3K0FB 3VQTA 2JAHA 4PAOA 1R50A 2ZFUA 3AEUA 5C53B 2Z1DA 1TEZA 3PC4A 3FDFA 3V46A 4H4EA 2ZR0A 1J24A 4K05A 4BWSC 4RU9A 4ALIA 2QN6A 1OASA 4FYYA 1GG9A 2W8KA 1P7PA 5AW1A 5M29A 3MWYW 4L1KA 1C7EA 5MHTA 3VKVA 5TQ0B 4Y2TA 2O8CA 3T9AA 3OM0A 5JXGA 4G07A 4KSCA 1KFKB 4ZOLF 1B0PA 2B83A 4B81A 2JI8A 1O4WA 4PC3A 2BT4A 1H1LB 3NV9A 3HG7A 5BN3A 1QPGA 4NENA 4EI2A 3VTKA 2Z0MA 3CH7A 3QLUA 3WNCA 3BQ0A 4J9OA 4IGKA 4B80A 3SXUA 1JL3A 4I4CA 3G89A 1HX7A 3H5TA 1NJSA 1ZVQA 4ER7A 4NBVA 4GR5A 3N3AC 4KMSA 1JQBA 3V33A 2Z58A 1RKQA 4HYYA 2WSMA 3TY9A 1MORA 3JQAB 5BXYA 5BMVF 3E3OA 3P2MA 5ALLA 3HBJA 2R7MA 2CYCA 5KYKA 4GYKA 1U0HC 1EFVA 4JN6B 1K6XA 3DA8A 3X2FA 4C0HA 1NTRA 2ZSAA 1T3ZA 5KO2A 3R3WA 3H13A 2ZGVA 3CG4A 2V65A 3QBTA 3L7DA 1QZZA 4II2A 5LXTB 1NKVA 3FPGA 3D59A 1RI5A 4G67A 2ZBDA 1B42A 2WJVA 5ALJA 4TLEA 4A2QA 4NPCA 1KE2A 3UXMA 4EEXA 2XW6A 4FEGA 4EUFA 1Q16A 4H7DA 3D3KA 2ZR8A 4M88A 4NX2A 2Q4RA 3RJTA 1ADGA 4K1XA 3ND7A 4YV0A 3SCZA 4JXXA 1PP4A 1KOFA 4YREA 2AKEA 3AI3A 1IZ9A 4Z0HO 3LQFA 2V7BA 1U90A 4WLFA 1FVHA 3OCJA 3AB8A 3RT1A 4GX5A 3G0OA 3BGSA 4MQEA 4BJ1A 3V1MA 4C7OA 1XX6A 3BWCA 5ALGA 1QQTA 4M89A 1GNLA 1UZMA 2AHRA 3HCDA 1NLMA 2I9KA 3KQHA 2YX1A 3UKJA 5EMNA 4JJZA 3MR5A 3QKWA 1TIPA 3WJ1A 1SY7A 2HWYA 1M34A 4K3VA 1F4LA 2OLJA 1IY2A 1KY5A 4J7CA 1WO8A 5T4BA 1LDYA 3OBBA 4EMTA 1YDHA 3ETDA 4H7HA 1Q3KA 2IEBA 1YUBA 1EKPA 3AW8A 2GM5A 4Q7KA 2CEAA 1KO4A 1NYLA 2QUBA 2D6FA 4E12A 4UXJA 3LT4A 2EF1A 1F4VA 1ZYUA 4P7JA 2ZUCA 4OH7A 4CIXA 2EKPA 3PNMA 3OU6A 3PDWA 5LQMA 3W6ZA 5JVDB 4TMVA 3Q5DA 1NJ8A 1H2WA 3PUJA 2WSYB 5ALZA 3L18A 1SA0A 4MAFA 3PXEA 2OBNA 4YJKA 5IDYA 4B6QA 1E6UA 3OTWA 3SZRA 3SVZA 4JYPA 3DKVA 5J5VA 4FBGA 5DNCA 4ZZ1A 2J0SA 1G21B 4KN6A 4M1OA 1KDYA 2CL7X 1P29A 4PS0A 1ZICA 2HLDD 1H2YA 3D3NA 4PAGA 3R7LA 1EGMB 2ZW9A 1AKMA 2MIIA 4MYHA 4Y9TA 1ZINA 1L5MA 1KJ9A 3ILXA 4JLSA 5CVEA 4JB0A 2P5SA 3Q5GA 2CNQA 1KARA 2VT7A 4PRYA 3K4QA 2ZT8A 3CONA 5F2KA 1TZCA 1C8BA 1DE0A 2BE9A 4X6YA 1QOPB 3SLKA 2IV2X 3DMTA 3D4IA 2PRYA 1YS2X 2H2FA 3B48A 3FJYA 5HRAA 4TT8A 5FR1A 3VR6A 2FWBA 3F90A 4OXIA 3VNUA 1VP3A 1IWPB 4TS3A 3JSXA 5AKYA 1AS0A 1KUTA 4K9DA 1ICIA 3G79A 2VCHA 4Q66C 3WKDA 1P2VA 4XJXA 1R4ZA 2CZCA 1SOVA 5DULA 2W6CX 1DIGA 1U3WA 4CGZA 2ZZMA 1JN0A 1NRXA 3GGCA 1OLSA 1KI6A 2KS6A 4RJ2A 2VSFA 3VR2A 3VZQA 2C20A 2B4RO 1ZIYA 2HIAA 1IONA 4ZU6X 3A28A 1O95C 1N34H 1VSVA 1WW3A 4IJ6A 1LZLA 2WE6A 2O8EB 3PXUA 4W99A 4DSTA 2R79A 2BP7A 2WYOA 2C2KA 3KO8A 3QE9Y 3C8DA 3W0LB 3HJBA 3AYZB 5IK2A 4GLWA 4DTIA 5CT8A 1L5HA 3VM6A 4HGOA 5KFCA 4HDRB 2AC2A 4GC9A 4TKUB 2YCLA 3GG2A 4G5SA 5A0TA 4TXNA 4GKAA 2VF7A 1T6NA 5I7VA 1KKMA 3KAQA 3OOEA 5L53A 1OFVA 3OZIA 4XLTA 1H8HD 3CR3C 3EMBA 2ODWA 3QVXA 3HBMA 5IZ4A 2H51A 3NC0B 4AX4A 1MVOA 2EP5A 1YBHA 4MYRA 1JE0A 5B2FA 3E9YA 5G41A 4G1UC 2GA8A 2C4KA 5CM2Z 2ZOSA 3NM6B 1TFUA 2NYRA 5KVSA 1W0KA 1GA4A 2JIBA 3AWIA 1Y5NA 4QOFA 3AM5A 4JJGA 3HN6A 2HWWA 3OEWA 4Q7JB 1C3OA 1TRHA 4JA0A 1HOTA 1ZY2A 1UWKA 4JX8A 4MRNA 4YH1A 2ZIAA 1OYYA 2R97A 2ZIWB 4OLFA 1F5SA 1GUFA 3P26A 1Z6PA 3IMGA 5CXSA 2VQ3A 4CFZA 1LW6E 3ZV6A 2OO7A 1E9VA 4YHBA 5BOVA 1ZKMA 4HYQA 4CMAA 5L4SA 8ABPA 4PXAA 2B4QA 3Q5EA 3IO5A 3H4VA 1U7XA 4QDUA 1MX5A 4HAYA 3JTMA 1PE0A 4BNLA 1GGHA 5IBCA 2C42A 1Q15A 1XIVA 2Z04A 3OTIA 4DV6H 4PV7A 4HNUA 1AXEA 1N2EA 1NZJA 1EUCB 3AINA 1G6KA 4G5QA 3MFHA 4MPRA 1HDOA 3SMQA 2VATA 4B4OA 4NONA 2Q8QA 4RM2A 1UNNC 2EERA 5KSOA 4I9GA 2QB5A 3H4TA 3OQMA 2PSHA 3LP6A 3QE4A 1KDRA 1KVRA 3QKIA 3FYUC 4Q16A 4EKYA 2PPLA 4PPNA 4S24A 4YT5A 3U1VA 4A1OA 3Q1KA 3UK6A 5FPPA 4RTJA 3R3JA 3PB3A 1R64A 2A0UA 3OJFA 4DUYH 3I4NG 4ALKA 2V1UA 1JSLA 4M98A 2WT8A 2H5EA 2YIVX 4PDBA 2HC9A 4HAWA 5AKLA 4JUZA 1Q2XA 1MX3A 5CM0A 3NW9A 2WM9B 3DTFA 4QWMA 5A9SA 1N3BA 3M9XA 3PCRB 5E3IA 1GG5A 4HQRA 1OIXA 1ZHFA 2BAGA 4HDAA 2AQIA 4EVRA 4R8KA 2X6RA 1BDIA 1C41A 4AX8A 3R0QA 5FOWA 3WGIA 3AKDA 4CBVA 2WVHA 2G04A 4AXBA 4XJSA 5AJHA 3GJXB 3W90A 1EWRA 2P78A 1V5IA 1Y3DE 1FF9A 2WE8A 2JCGA 3GLIB 1E9FA 2PKCA 1MTZA 4FU0A 3EW7A 2DMRA 4W1SA 1GVHA 3EUAA 3RGGA 4KN5A 4NS1A 4EFBA 1R0SA 2R6CA 2YBEA 5J4KA 1JX6A 4HMQA 1NVXQ 2FY8A 5BP7A 1VHTA 5AI0A 3HOVG 3FLMA 1D2AA 1GSHA 1J09A 1KYTA 2UYCA 4DUGD 4B6RA 5DHQA 4DSZA 1J2YA 1UJMA 4UHEA 2P8JA 4AVYA 4Z3OA 2XMZA 4KODA 3U3JA 1XTBA 3WWIA 4OHPA 3S1AA 5B58C 1WU8A 1XYYA 4B40A 2YC4C 4W1QA 4BQEA 4V0LA 1REQB 5C4IA 5AUNB 2ZKLA 2GVZC 1ZH6A 4NMWA 3UF0A 4QM7A 1NJGA 3T5JA 1I3QA 1IEWA 3L7BA 2J6CA 2ZUWA 2AV6A 4RO0A 3GEBA 1WCYA 3H0EA 2QI9C 2KLHA 2PFKA 4CIWA 3IHLA 4FW9A 1RWWA 4L2IB 1X1CA 4UUPA 4F4HA 3F0TA 2JGMA 4WTOA 3OHBA 1WVIA 3L4JA 2FSFA 4TYQA 1AA6A 5HRUA 2WPNA 4EQ6B 1WZIA 3N2KB 2G3YA 3P9PA 4TSKA 2P30A 3BH7A 3D3WA 2YASA 4FYHA 2LBPA 2O0LA 3ZHQA 2CDNA 2PGOA 5BOSA 2QNRA 4ECXA 4LNHA 1D4OA 3OLVA 1HDCA 1QAQA 4IOLA 1IBSA 1R6BX 4FFBA 4YUWA 5HK9A 2C97A 4M1KA 4OGKA 4PF1A 4HN2A 4M1MA 4ZPXA 3H2JA 3E3MA 4XRRA 4HQ0A 1W49A 1C1DA 4C0XA 4FEAA 4DABA 4W9MC 1LPBB 4E4YA 4M49A 1GGJA 2QORA 2IUEA 2MHCA 1PZHA 1BYIA 2R6ZA 1E77A 3P2KA 3TLMA 5LQNA 4NMHA 1DKMA 1Y1TA 1YHYA 1JF8A 1I1KA 1YZYA 1I2BA 4YAOA 1Q21A 1TJPB 3KQPA 4OREX 1X7WB 5IWAB 3QEBZ 5TPWA 2GTHA 3E58A 3IRVA 4YAGA 1HDGO 3IAEA 3WWDA 1ZR4A 5ES4B 3OE4A 4DKXA 1PIWA 3AF6A 4H08A 4DKJA 5K20A 1UPUA 4CM6A 1PJLA 1Z7BA 4G0NA 4WDQA 4LWQA 1BVHA 4PZZA 1Z28A 1ZM7A 1JH9A 1C7IA 2BN4A 4B35A 4MRAA 2CVFA 2OZPA 1SGWA 2VJQA 1V7CA 1SUPA 1TWFA 2IPXA 2IBTA 1K0UA 4OHBA 2UXCB 2X4IA 2OUIA 4F9FA 3W5SA 4FS1A 4HFJA 1VYHA 1EDBA 1Y89A 3TG8A 2OM6A 4U63A 2DOKA 1XVTA 2BGRA 2Q5OA 3PZPA 4P92A 5F76A 4GPEA 1OKKA 2NG1A 5FLMG 3WMFA 1XQXA 4LHYA 3DL7A 4RETA 3ON5A 4TV8A 1CLUA 3KFVA 4HB2A 5H5JA 4HUJA 3M3DA 2CFIA 2PJZA 3SNHA 1N0VC 5AKKA 4TQGA 1BN7A 1GA1A 2GCPA 2FEKA 3HXOA 2PMBA 1S5PA 4YUVA 4PVDA 1N2XA 5CAEB 2DRIA 3ZHRA 1T36B 3K0HA 2E7ZA 2WB1A 4ECSA 2BHTA 3JQ8B 2GEFA 5A03A 1T0BA 5DLFA 4MINA 2YYYA 3GNSA 3QQ5A 3MILA 3UQ8A 5SZKB 4WFJA 5DGBA 4DNOA 1XDSA 5K6AC 2J9XB 2ZUDA 3H4BA 1G17A 2CXRA 5CB4F 3MTEA 3VPFA 4AL4A 4PN7A 2PLAA 3UT5B 5A6SA 3O7MA 4GXQA 3FZQA 1RYSA 1AKEA 1PNRA 2VF5X 2ET6A 2A58A 1H4VB 1H05A 1HTTA 3T5CA 3BSSA 2V3WA 3ZU2A 3ZY4A 3W77A 1A9RA 5IDXA 5JJCA 1Y8QB 4B82A 1H3NA 5C3UA 4DV6B 4B84A 2MR6A 1M7JA 3OZUA 2IYPA 4F50A 4ZYYA 2WLSA 5KYWB 1X9HA 2LCQA 4YP3A 1DHRA 3WRWA 3F9IA 5KX5B 2W43A 5JMTA 5BRJA 4BEBA 2JATA 5K2MA 3STHA 2JFOA 1QG6A 3WMWA 3A11A 4H18A 5LYJB 4YRFA 4S2UA 5I7HA 5CA0F 4LDJA 2XA2A 1T8RA 1S9FA 1YD7A 2AN9A 1IY1A 3MFYA 2E4UA 3UMJA 4WLUA 4RPCA 5JV5A 3MWDA 2C2YA 1QP7A 2XF8A 4N0MA 3MGCA 2JFWA 1KA9H 4NIMA 5B3JC 4YXWA 4DUYB 2B99A 4JSTA 4KP7A 3ZWCA 4BO4A 3BJZA 1JALA 5F9MA 1YA6A 4DL4A 4F3KA 4ARBA 4B6OA 1IN7A 4TVIA 4Z0PA 5T4HA 5IULC 3HGQA 4XD7D 2GK7A 1PZFA 1O6BA 3PTLA 4BMSA 3TKAA 3BT7A 4Z7OB 1E2HA 2XH8A 3V3TA 4MGYR 3KXIA 4PU0A 4PZAA 2XHZA 4GI3A 3GFQA 3FPBA 1NY6A 3RROA 4D6YA 3KVRA 3H2HA 2DPIA 1CERA 4UUNA 3KTAB 5F1KA 2VQ6A 2I8CA 5IDVA 2C0QA 2CV0A 2Y05A 1U4OA 2R6AA 5JNLA 3UMGA 1WQ3A 1IC6A 1T5IA 5KFKA 4EB8A 2ZRNA 2QMYA 4DV4H 1U0TA 2Q2WA 5EYPB 1DGQA 2GD1O 3QXJA 4RKQA 4W9RA 4JI8H 3DHYA 3RUAA 3CF4G 2PH7A 3CUVA 5U1PA 4EYQA 1D9XA 4BC1A 4E1BA 5AM1A 2PLNA 3JQRA 4G81A 2BMFA 2WWFA 3I1IA 3SR3A 1EEHA 4Q3KA 2ECKA 3TZKA 1JDZA 3WNVA 3C7AA 3L4BA 5CA1F 5KMGA 3WICA 5LQKA 3M6XA 3JARB 4HWSA 2Y2UA 2GERA 3FWHA 4ASUA 4D8TA 4DLTA 2PNFA 1HDXA 2FE3A 4EYOA 2WAAA 1PWZA 2OBBA 2PFGA 2QQ0A 3M6IA 2O52A 4NNPA 3UHFA 5D3QA 1G3RA 2H5JA 1RJ9A 4P08A 5FCDA 4G89A 1NLUA 4P9NA 1E7SA 4WN9B 1NR5A 3FWYA 5EWGA 1ATZA 4YWHA 3VNVA 2QU8A 4YEDA 2GYUA 1YV9A 2ISQA 2I6FA 1HXHA 4RESA 3OTOH 4P3OA 3WXMA 1ZK1A 4GKVA 3MQ2A 4E32A 1KK0A 2EQBA 1Y42X 1PJRA 1PR6A 2C82A 3GPBA 4RJKA 3MBKA 1WBJB 1EJ2A 3P8ZA 1KORA 2VYQA 2AG6A 1QO9A 5AT1A 5AXCA 4C14A 3KFXA 5GVSA 5J4YA 5HEKA 4YXFA 3H1EA 3SC6A 1TCVA 4AMZA 4LFCH 1H2XA 3TFOA 1J5EH 5JRZA 4XXHA 5JROA 5EOYA 4RKWA 3KLPX 4IGIA 3WWHA 3N40P 4MGIR 3ETJA 3VU3A 2V03A 1KMIY 5B3LA 1EEXB 1R8XA 4OBEA 3L1JA 2WTFA 1H8ED 1U1FA 2B1QA 2NGRA 1QH9A 4ECTA 4AULA 4EPRA 3N0VA 2B7CA 2TMKA 4MV5A 5LUBA 4PG4A 2J5KA 4PXSA 3NASA 4H17A 2HUPA 4YR3A 2UZIR 1NV8A 1SOAA 1ORRA 5JEDA 5AM0A 4DV1B 1TVKA 1JIHA 5IASA 5SYMA 2PJDA 1HDEA 1JH8A 4DDMA 5B7NA 1TD9A 4R8RA 3C8ZA 1A2QA 1FFXB 1XELA 2ZAGA 2ZR7A 4KXNA 2VP4A 1U0RA 1A9SA 3C0KA 1RAEA 2QRLA 1CJCA 3DWGA 3B6IA 3L92A 2Q9AA 3UWMA 1Y3HA 4LPKA 1R3UA 1Y80A 1AKWA 4F12A 2MSEB 4EG5A 4KYTA 1U98A 5DOZA 4I8IA 3T5KA 3EIFA 4J6EA 1XLTA 1E4EB 4MVJH 4FN4A 4RF4A 2DFKB 3PJFA 3F5FA 1TIKA 2ZB3A 4XVQA 3LY8A 4D42A 1H3EA 3T0GA 2B8EA 5C1PA 2EXXA 4YVFA 1FVFA 4CG3A 2R5NA 3F6RA 3P45A 4FB4A 3O21A 5F1YA 2Y6VA 5BSWA 2CLOB 1NR1A 4OIFA 4HEJA 2ZVDA 1EA5A 1OFHA 2R62A 4RF2A 5KYXB 3W2IA 1L7AA 4QSMA 2XNDA 1C8VB 4DLPA 3K0AB 3E18A 5EKXA 2BEWB 3LX6A 3AMVA 2W5UA 1XZQA 4I5IA 3L6CA 3E27A 4RJTA 2QTAA 3EXHB 4D9IA 2AMJA 3ZTTA 4JBIA 1ODLA 1OJ7A 3TZLA 3ZHYA 4KNWA 1RBZA 3TVTA 4IH9A 4JL8A 2C99A 5DHSA 2PWPA 2XNCA 2VK1A 3RS0A 5JD3A 4RLFA 121PA 4RTMA 1G6OA 1BWSA 2NOAA 5BV0A 1A4UA 5IZCA 3M6MD 4BVGA 2A0KA 4DMMA 3NVDA 1XFAA 4O08A 3B1FA 4B5KA 4ZGBA 2QJWA 3GARA 3EZGA 2AVDA 3D81A 2CW8A 1M1NA 2X15A 4MS3B 3NBYC 5DNYB 1PWYE 2NZVG 1ZESA 3ZW7A 1XQ9A 2A9RA 4XUGB 4AUEA 2GA9A 2XTMA 4HR7A 1M2WA 1J2JA 4IV5A 4P4NA 4YDHB 2XIGA 1RI2A 3L0OA 2V4UA 3G6WA 4GOXA 3WFIA 4JBXA 4BO3A 4YAEA 2BFNA 1NC3A 2HPAA 4CTKA 1R27A 3IELA 5ALFA 3TQTA 2FG5A 4WJKB 4M86A 2R92G 3QXSA 2P9EA 1E2NA 1UP7A 3CUYA 5M5BA 1YL6A 1UBRS 5EE1A 1RZRA 5B53A 1GTMA 4EQ5A 4MQFB 2OO5C 2YMPA 3KJQA 2JJ2D 2VYNA 4YAJB 1H65A 1T2DA 3ESAA 4PYRA 5DH9A 4A6DA 4N7MA 3F2VA 3AHHA 2BEUB 1DRWA 1AJEA 4DQUA 5AVUA 2QLBA 2UZ0A 4INAA 2Y6UA 1IULA 3HKBA 2CVQA 3T4EA 3O2SB 2JBAB 1D04A 2IOFK 1L8XA 3L7LA 4Q4AA 1EM8A 1RXCA 2B4AA 5TVGA 4DAOA 3E22B 5AW4A 2VZEA 1TECE 2QXUA 2EDAA 3ZGOA 4FDMA 3EZ6A 4OQMA 1Z2EA 3R24A 3SYMA 4RADA 4L4YA 1DAPA 1BMTA 3UG6A 5HTOA 4A0GA 3DT6A 4EGFA 3BE5A 5LJIA 3ZVMA 4G9EA 4EI7A 4OVKA 1MPXA 2MSCB 4QX6A 1ZD2P 1XPJA 4UJ5A 4NCIA 4RNMA 1KK2A 3H8JA 1HDYA 3RG8A 3GFTA 1JBKA 1FQKA 1YULA 4GU5A 1A5TA 3DEFA 3OHMA 1JIQA 4NJEA 4WA8A 1PJAA 3PHHA 3FAZA 2D5LA 1VG1A 3JWGA 3WY9A 1ULBA 1BSVA 3BXZA 3AX6A 4HLUC 2ZUTA 3QNWA 2ZTUA 3FNGA 2PQ2A 4KHPH 2XMPA 4KQJA 3ZDAA 3IXMA 2IELA 4UUAA 5CX1B 3CLRC 3CM0A 3TS1A 4CLHA 4OL0A 2H1CA 5JNSA 2ICAA 3E35A 4O1HA 3C2QA 1VA5A 4O4HF 1WXWA 2W6ID 4Y9SA 2AF3C 3DV9A 3UAOA 2V9WA 1QR6A 2ZE5A 5KEIA 4LFCB 3OPMA 3W04A 2HV8A 1J5EB 5LN1A 4KQMA 3JVEA 4EIWA 3T95A 2FPKA 2C3MA 2FK2A 4QZVA 3HKDB 3RBXA 4ZAFA 2P9YA 3RTAA 4YYZA 3QWFA 1Z13A 1JB1A 1HNWH 1N1MA 4GP7A 1BTOA 3NWEA 5FV7A 5JDCA 5BYAA 1XZ8A 3ZCPA 4X20B 3NTLA 1K86A 2ANBA 1AD2A 1ENYA 4K0RA 2F3SA 1N57A 3C0FB 1TPYA 4HGZA 3WGVA 4M1YA 4WCFC 4NULA 4IILA 1I1OA 3CPEA 4EHIA 5KFNA 3I4FA 1IEQA 1XDWA 1FXUA 1K8XB 4JU9A 1XYVA 2X7JA 4JNCA 3M6VA 1LRKA 3G2MA 1P18A 2ZJ7A 3U3DA 1TAEA 1AA9A 1EBFA 1F0KA 1J2TA 2AEFA 5K8CA 1AUPA 1BW9A 3IQEA 5AKGA 1F6DA 4CG0A 4B8YA 1E1QD 4QO7A 2CJWB 2JANA 3FVTA 4ND3A 2IMWP 2ZIFA 1HO3A 1XOIA 3DWEX 1ODSA 3SF8A 2XITA 1V1JA 4HGQA 2CY0A 3V32A 5HE9A 1P74A 2J0UA 3S44A 3EZLA 4M0PA 1HYEA 4L78A 1GCIA 4EB6B 2Z5LA 1Q0ZA 1GPH1 1AUXA 2P6UA 2G08A 4HPXB 4S35A 4U02A 5MN5A 2GLUA 1XAJA 3RC9A 5AQ1A 1OTYA 2VRBA 3DTGA 3BUSA 3CLUD 1V9PA 3OH8A 3I01A 1YB6A 1XTSA 4GMFA 1Q7RA 2XMGA 4CKXA 1N2JA 2XBMA 3PGLA 3GIDA 2ZM5A 2ZDHA 4QGHA 3NBZC 4J0HA 4A9AA 1IIBA 2XQIA 1U8EA 3ZV7A 1RRFA 1U02A 3TQIA 3PR5B 2PHZA 1KZHA 2N1MA 2QMZA 4QNMA 4N5LA 1AH2A 4O4LA 1GG2A 1UPTA 4LRWA 3H1AA 1T91A 1RPJA 1JECA 4NK4A 2X2OA 4Y2QA 1ZH0A 4ME6A 1Z74A 4D9BA 2R8OA 3IX7A 3CYFA 1QC5A 3C5VA 5GAJA 4JYMA 2VDRB 1SUCA 2AI1A