2FPPB

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 127
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fppB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fppB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fppB03
3KAKA 4O7VA 3V4ZA 3AX6A 5JQWA 3MWEA 5BPHA 1JKJB 4O83A 4MA5A 1EZ1A 3MWEB 1JKJA 2GPSA 4XX0B 1IOVA 3HO8A 2V58A 5D8DA 4ZOLF 2ZDHA 5JQGF 1JLLA 1DV2A 3ORQA 4L1KA 4I55F 3WNZA 4MV1A 2FPPA 2R87A 3Q1KA 1JLLB 1EYZA 4YB8B 3ETHA 2DZDA 2FPPB 3U9TA 4EGQA 4O7TA 3TINA 4O4JF 2VR1A 1SCUB 1M6VA 5LXTF 3TQTA 4YJ2F 1VKZA 5CAEA 2CZGA 1SCUA 4M9UA 4O2BF 5HBRA 3I12A 2YRXA 4TUYF 3JRXA 4TV9F 2R6FA 2CSUA 3K3PA 4YAKB 3LP8A 1GSOA 4YAKA 4DLKA 3MWDB 2FP4B 1CQIB 3ORRA 3MWDA 3R5XA 2FP4A 1CQIA 2R7NA 5K2MA 4IZOA 3QFFA 4YAJB 2Z04A 1EHIA 1OBGA 4MV3A 1I7LA 4O2AF 5CA0F 4FFLA 2YS7A 1C30A 4O7ZA 4NYEA 4MV6A 4C5AA 3OUZA 3RV3A 3U54A 1GLVA 4FU0A 5C1OA 5I47A 2YV1A 5CAEB 4IIJF 1OBDA 2ZDQA 2YZNA 3K5IA 2FPGB 2YL2A 2YS6A 5J2UF 1OI7A 1M0WA 4I4TF 4O4IF 4O4HF 2YYAA 2FPGA 4FFOA 1KEEA 3LWBA 5HV6A 2J9GA 1BNCA 4FFRA 4O82A 1GSHA 5FNVF 2I87A 4EG0A 4IWYA 5JVDF 2YZLA 3AW8A 4YAJA 5JVLA 5H80A 2YWVA 1JDBB 3OUUA 3Q2OA 4MA0A 1DV1A 3V4SA 4DIMA 3NUAA 3UFXA 1Z2PX 2FPIA 4FFPA 2C00A 4ZHQF 3ETJA 2YZGA 2NUAA 4IWXA 5C1PA 3UFXB 3JZIA 2IP4A 2FPIB 1CQJA 1KJ9A 2GLTA 4FFNA 4MV4A 5EZYF 1CQJB 3JZFA 2XCLA 4O4LF 4EGJA 2I8CA 2DWCA 4ZQIA 2W6PA 4MV9A 4O84A 3R9RA 3R5HA 1CE8A 2W71A 4HNTA 1I7NA 4C5BA 3VMMA 3K5HA 3TIIA 4MAMA 1E4EA 2GPWA 2YV2A 2XD4A 2CNUA 1M0TA 2R7KA 3KALA 1E4EB 2W6ZA 5JH7F 2NU6B 3VA7A 2R7MA 5KX5F 2QF7A 2W6OA 3N6RA 2NU7A 3KAJA 3GLKA 1WR2A 4HQ6A 1ULZA 2W6NA 4QSHA 3R23A 1PX2A 2GQRA 4YBZA 3VOTA 5GONF 2NUAB 4O81A 4YBZB 2QK4A 3G8CA 1T36A 2YZMA 1W96A 3U9SA 4FGRA 5CA1F 4O7RA 3GIDA 1VBGA 2ZDGA 4E4TA 2PVPA 3HB9A 3JRWA 3MJFA 5DMXA 2W6MA 2I80A 4O86A 3WO1A 4O7SA 1A9XA 1IOWA 4XZ3B 4WBNF 3VPDA 4FFMA 2PBZA 4XYMB 4XZ3A 4XYLA 2R85A 3VPCA 5BMVF 5CB4F 4WD3A 2SCUA 1EUCB 1Z2OX 2NU6A 3SE7A 5LYJF 2V5AA 2SCUB 2W70A 2HGSA 3PFFA 4O7YA 2Z02A 2NU7B 1Z2NX 1DIKA 2VPQA 2HJWA 5KKNB 2FB9A 3R5FA 4YJ3F 4Y8VB 3DMYA 2P0AA 5IYZF 2CNQA 1KJQA 3VPBA 2DLNA 1KC7A 2OLSA 1VBHA 4Y8VA 3TW6A 1UC9A 1EUDB 2NU9B 1GGOA 2R84A 2R7LA 1KJIA 4ZI7F 2NU9A 5LA6F 2X0SA 2DIKA 4C5CA 4HNVA 2CNVA 2WYOA 2NU8B 1JDEA 3TIGA 1C3OA 3U55A 3E5NA 3RFCA 2NU8A 4O7NA 3G8DA 3KREA 1UC8A 4XYMA 4XYLB 3DF7A 4FE2A 3HBLA 4RZQA 1KBLA 2YW2A 2VQDA 4XX0A 1AUVA 1A48A 5C8YF 1EUCA 4HNUA 4HR7A 4IHJF 4O7WA 2R86A 3WO0A 1GSAA 3N8DA 1CS0A 4YB8A 4O7LA 4I50F 1B6RA 1KUTA 2YRWA 4TV8F 3RUPA 3BG5A 1KJ8A 2CQYA 1AUXA 5BPFA 5LOVF 2V59A 4MV7A 2GQSA 1W93A 1EUDA 2R82A 1KJJA 5HBRB 4ME6A 3RV4A 5LP6F 1PK8A 5J2TF 1B6SA 1BXRA 4MV8A 2W6QA 2PN1A
chains in the Genus database with same CATH superfamily
2QX9A 3WS7A 2V74B 4D0GA 2NXWA 2VDMB 4CV3A 2CSXA 5KFWA 5KFSA 3C7DB 4F2WA 4UPVA 2B4KA 5JUMA 2CEKA 2XUGA 2ZSIA 3MERA 5C7YA 2HU7A 5ITSA 3KWLA 2DFPA 1GDTA 2XYHA 5KYGA 3DE2X 1U9ZA 2IUTA 2XE6A 3UAXA 3FBTA 2QL6A 1OLSA 2OB1A 4UCWA 2G77B 4BS9A 4HJRA 4AO7A 4HUTA 4KLRA 4JC4A 5AO9A 3MCTA 3PD0A 4L8FA 3FKIA 3DV0A 3W5VA 3B51X 3C3DA 2R1ZA 4BAUA 4KR7A 3DS8A 2V58A 1IM5A 3FRIA 4M9SA 2W83A 2MSNA 4A91A 1PJBA 2G8LA 4K6NA 2GN0A 1P5HA 2N75A 3GAZA 3IQHX 4LTDA 4FI3F 2Q27A 2R87A 3R41A 4PZPA 4O8CA 1NC3A 5E9AA 3N58A 4CC5A 1NT2A 1YL6A 4ZVOA 7REQA 4O3PA 2PDAA 4GWGA 4DWJA 2Y9MB 4Y7CA 1YCHA 1SG9A 3UUGA 4J4BA 3L7BA 3QQPA 1E6UA 3WQHA 3FFXA 4FJ2A 4II2A 2O07A 2FSVA 1MTOA 4EQ5A 5K9ZA 3IDOA 2B2CA 4RF4A 4B4DA 1G8JA 3AGQA 4FLFA 1RLOA 2YJTD 3S0JA 4D42A 3IVMA 5JJIA 1J56A 4M37A 2EZTA 3FM9A 3RVRA 4OSPA 4O2BF 3O8RA 2I6UA 1A04A 2CXQA 1UFRA 1LI7A 1VB3A 2VNSA 4MINA 5AKXA 4EIWA 1AHNA 1J0CA 1WLSA 2Q5IA 2QN1A 1EHYA 4DIEA 1MJNA 4L9AA 5DHSA 5AI6A 2IYEA 2YOFA 4B34A 1LF0A 5BNZA 4HMQA 4YR7A 3BTUA 3BQNB 1CNEA 1MQAA 2Y76A 3M89A 1EVKA 4M87A 5BN3A 1G8HA 1KEEB 3BWXA 3E7PA 3DVLA 1L1FA 2I0FA 1G3UA 2GPJA 1L7NA 4AURA 1LTHR 2XBUA 3E4CA 1B23P 4OHUA 3AB7A 1FFWA 1WPQA 2DJIA 4I5IA 4D0NA 3OUTA 3S4YA 1SULA 4MGIR 5C8YB 3HCCA 4JP3A 3V8BA 3K71B 2W90A 4O4JB 1JDVA 2WTAA 3NRJA 4TTPA 4YQFA 2DPLA 3LWDA 4MKGA 5CH8A 4LYEA 4DBLE 3U4QB 2Z8YA 2OECA 1JJIA 3ESYA 4EG4A 1JQJC 4F4FA 2L18A 4CDGA 5HWSA 1XRJA 2G36A 2JB9A 5KHLB 5LDHA 3O3CA 2FRXA 4S2UA 4LS3A 5EY5B 3ZE8A 4IINA 3E6AA 3CTPA 1RC8A 2AFVA 1AMNA 4C3UA 4TSFD 4YAJB 2VHCA 1PP4A 1VCNA 1Z0ZA 1NG1A 1W75A 2RH8A 2XHZA 3OF5A 3QUAA 4EI2A 4Q4HB 5KT7A 1D9XA 3JVVA 2GUGA 2HU2A 1LLUA 2WRZA 4BE9A 4CM5A 1I7LA 2YASA 4NVRA 3LPNA 1Y6FA 4ZDJA 5KFEA 5AK3A 3UANA 3WMRA 1IVNA 2QVCA 1RJ9A 4RPKA 5FTLA 7MHTA 2IOQA 3OQVA 3ZCVA 1NSFA 4G84A 3DBOB 3GG2A 4DQUA 3QX3A 3M4IA 3OIWA 4ZZIA 4ZGGA 4JWKA 5HP4A 3L0YA 2LCFA 4GNRA 1OSNA 5D3QA 4PZ0A 2R60A 4G41A 2OFFA 2JGNA 1ZVMA 4IJWA 4QE3A 4ZI7B 5I5XA 3PGVA 5JOQA 4PFJA 4TL7A 5C53B 1VP3A 1FPMA 1YBVA 5I5GA 4YDQA 5F9HA 1HMPA 5IM5A 1QO9A 1V8FA 1WVGA 1X19A 5GV7A 5HCIA 4I2VA 4AL4A 1T3GA 3ZDEA 1AXGA 4G37A 4EB6A 4BBJA 3VI3B 5JFTA 4PPGA 4ARCA 2J45A 3FHLA 4TSFA 1XZHA 1NF2A 5JI2E 1QRUA 2EU8A 4ZZ3A 3AFIA 1HEIA 1MEJA 1V7CA 3A4MA 3D7MA 1YDFA 1N1GA 2F4NA 2R93G 2PLNA 3DUFB 3FRJA 4MSUA 3SHQA 3SJUA 4MR9A 1P9LA 3CF0A 4IDEA 5J4HA 4L5CA 1W0JA 1UC5B 2ZPAA 2IKQA 1FVHA 2GR9A 3VISA 2WSSD 3BHNA 4QXPA 5ALNA 1M72A 3C6BA 3BULA 2YYAA 3NFRA 3WK6A 3M6IA 2OENG 4EJMA 1GCGA 2NN3C 2ZFUA 3AOEC 4FFOA 1XYVA 2B30A 5I8ZA 2JAUA 1T29A 2CT8A 1FC0A 3STUA 1DIAA 2P9EA 3I8OA 3K53A 5M34A 4BLUA 4BWGA 1C50A 1KHHA 1T9GS 2V8OA 3V6LA 4DM4A 5IDVA 3X1YA 2RD2A 1J42A 1GSIA 3KOUA 4NDNE 7AT1A 2HA7A 3IUSA 5JZSA 2BOVA 2RHHA 5CFLA 3OECA 4N8EA 3PC8A 2AN5A 2GRUA 1U0SY 3ADDA 3HCDA 5G1OA 4TV8B 2ZJ0A 1JU4A 1F8XA 3O0DA 2FETA 4J16C 2W11A 3CX8A 2ZSBA 1QP8A 5EEHA 3MQFA 2BEJA 1TT7A 1C3JA 4GM0A 1Y8CA 1GGHA 1RLMA 1OW3B 2D5LA 2I2XB 2R11A 3A06A 4DPMA 1ZGJA 1JIJA 2R8JA 1ZVVA 3KBOA 3RWOA 3H11A 4KQKA 3JQFA 2LVBA 3ITDA 3UFBA 4DCPA 2BSQA 5HA5A 3KJZA 4AWXA 2OHVA 1ODFA 1FDOA 3FNQA 4RF5A 1R6TA 5DHRA 3RF6A 3DMGA 4N47A 1IQRA 2HH9A 5C5DA 3ILYA 1M66A 1IH8A 2V4UA 2IMWP 4I5FA 1BO6A 4AKTA 3HKBA 5ICEA 4DIMA 3WKEA 2O2DA 2OE2A 4H7PA 4P53A 4WXEA 1Y98A 4N39A 3WK9A 2HJRA 2W2LA 3OZTA 4NYIR 4ZQBA 3T3PB 2IYTA 3OLXA 3H7IA 3VHQA 5AVJA 2EBUA 1L8LA 2ORIA 3KR0A 3HMKA 4BKOA 2HVQA 4JV2A 2W57A 4DR2B 3NR2A 3WV5A 5H9WA 3SI8A 5DGAA 4LJAA 1RI2A 2VWQA 1U2PA 3AJAA 1ULHA 4DWVA 4ZDWA 4L72A 3TOSA 2W8LA 1A7UA 3CSDA 1FS5A 4FSHA 3ZCQA 1OQAA 3TG2A 3UKDA 2Y0PA 3PDHA 2R4QA 4UM7A 4LNUB 5BRAA 2P5TB 2IEAA 3K09C 2Q49A 3AJEA 2Q6TA 4PAOA 1ZBQA 2NV2B 2RK3A 4C4AA 1E77A 3CF4A 3DOJA 3R20A 1EZZA 2NVUA 3OKAA 3OPVA 4P2GA 1KQGA 3A1VA 1MLDA 3GDGA 1XTIA 4IUDS 1ZOIA 1CIVA 2QIOA 1ZH4A 2CVPA 3DTFA 2NXEA 3DT6A 1IUNA 3KB1A 2WF9A 4ILKA 5AW2A 3KQOA 5JPCA 4YAWA 2I3BA 1UBFA 2VH2A 3L02A 4JJKA 4DUPA 2PWBA 4UEKA 4BO8A 3KEOA 3N41B 4KBGA 2W6JD 3WVNA 4BOYA 4CL3A 3Q9LA 3WZLA 1N3IA 3U0BA 1XTVA 2BRUA 1HRKA 4MB0A 4D9CA 1Z0DA 2QHXA 2W71A 4FWIB 4Q9LA 5JV5A 4PFQA 1VKJA 5A02A 1KAQA 4HTFB 5DEOA 3SNOA 4UXIA 2GAFA 3DOIA 3WL4A 1IY8A 3ZVRA 2DFLA 2XCTB 2GPWA 5FLKA 2QROA 2DQZA 3EXFA 3QFCA 4HWTA 2G0TA 4LQ4A 4JLDA 3VDMA 5HIAA 1XWIA 4Q9DA 2VSXA 3R6WA 4ZIRB 4HRYA 4J1TC 4HFMA 2VCEA 2V7VA 4YN3A 5E1DA 2PH3A 2O5VA 5DCUA 1Q11A 1C9NA 4WNIA 1TO2E 3RVDA 5DWVA 5KX5F 1F2TA 3PQ8A 1H5QA 4RQAA 2GEJA 3LRTA 3S1AB 3WLJA 4AZ3B 1OFUA 1YCDA 4AW9A 1KFEB 2YFQA 1L4YA 2NVOA 5JFGA 4DUYB 4FJ0A 1EIWA 3LULA 4YP3A 4Y2GA 4ZKDA 4DAEA 1MRNA 4BL5A 1EXNA 5KDLA 3SBEA 1CSEE 3X44A 4BVAA 4OYYA 4A0GA 5KOJA 1ULZA 1P5ZB 4PCVA 3U3OA 2JLCA 3IEVA 1RRFA 3E84A 2R8HA 4OBWA 4QSHA 3FROA 3C8MA 3IRVA 1L4FA 4L2IB 4TOIA 2DSNA 3DA8A 5EIWA 2QVGA 1RRVA 3O83A 4Y2TA 1HV8A 1DEKA 1P73A 2VPYA 1QGED 1FTYA 4XUEA 5B36A 3CLRC 2LKCA 4XJSA 3TWOA 3K0FA 2AJBA 1OTHA 3D1LA 3LNTA 4PHCA 3BOSA 2AX4A 2VK1A 3GJYA 2I67A 2Y27A 4DUYH 4LRYA 4WLOA 4PRKA 2KHZA 4YV1A 1P9NA 3WRXA 2D1QA 3U9SA 1OIVA 2H8GA 1AZTA 4RFSB 5KS8A 1Y8QB 1XDBA 4N0QA 4YCBA 3JQGA 2DBQA 2WIFA 3KK0A 5BSUA 3GLFE 1RS0A 4GZLA 1J5XA 3W4JA 4BNKA 4O0MA 2PKQO 3IT1A 1IAQA 3CRMA 2PVPA 3BH6A 4YRQA 3GMTA 4IAJA 1QH1B 4TKLA 3UMFA 4PCLA 3LKZA 4RJTA 2HSWA 1FSFA 3L7DA 4HAWA 2GNAA 3D8TA 5CPFA 3G9QA 4KYVA 3WO1A 3MWJA 4NG4A 3KBBA 4CMDA 5HKKD 3TR0A 4W9MC 2Z2YA 3O93A 1UOPA 3RRFA 2FRVA 3IODA 3OEHD 3VPDA 1SQ6A 4GVXA 3BK2A 5BN5A 1SKYE 3LLMA 1BXZA 2H51A 3CF4G 3MOSA 4GMDA 3SJZA 3W9BA 3QW2A 3DKRA 3IDZA 3SEZA 2WWYA 2Z6VA 3GCGA 2HU5A 1X7XB 4DC0A 4ZT5A 4YT5A 2BMJA 3LA8A 3TX6A 4KN8A 3PO2G 1VHLA 4KQFA 3Q3EA 3A3OA 3ZX4A 1ECJA 3GW8A 3OLYA 3GVIA 4WD3A 5LYYA 3LVFO 4COOA 2I7VA 3IHTA 5CYGA 1S0OA 3OY2A 1KNQA 1XV5A 5AIBA 5MN4A 3GTQA 2IIQA 3ZLVA 3EF1A 1LFAA 4DV2H 3GFOA 2QAJA 5SYNA 3U3RA 4NEHB 4GXTA 5LYJF 1NBOA 2A1UA 2D62A 2Q2QA 1L6IA 2QSJA 2WTXA 3A0RB 3I2GA 1GUAA 4R8MA 1Q1BA 5DHUA 1LSJA 5BW4A 5LZ8A 3PA6A 2WNHA 3VZBA 3ZC3A 1OZGA 3QFTA 2OQVA 4GDFA 1HE4A 4H7KA 1HL7A 2Z02A 1IZ8A 1N2CE 2A5LA 1ZAKA 2H08A 3LP6A 4MW7A 2CKMA 1CR0A 2FY8A 1E1YA 1H4VB 1B43A 4I4TB 4F56A 3OP1A 2FMKA 2GK7A 2CJPA 5HF6A 2D13A 4MW2A 1ZM4A 3GGCA 2WF5A 2JAHA 3WWOA 2OAEA 3OOEA 3L79A 1NLMA 2R96A 1SR8A 3KQWA 3FPBA 4UNRA 5HUJA 3ZGLA 3DONA 3OEHA 4L5YA 1TWHA 2JDID 4I4LA 3LC7O 3DBRA 4I9NA 5HKKA 1PWXA 3RYCB 4NECA 6REQA 1BE6A 3L4BC 1P2TA 1QVWA 3F47A 1TVKA 1XQ6A 4FMDB 4YK7A 4A16A 4KUGA 1KOFA 1ZWLA 1OR8A 4QTTB 4Q9HA 5ALHA 4EY5A 3MT0A 4V0LA 1KDYA 3BBPA 2PVCA 4K9LA 2H4WA 1CPYA 5JDCA 1QE3A 3VGPA 2OM6A 2ONKA 4KIJA 1YB6A 3ZWOA 2H4FA 2DUJA 4KI7A 3OJEA 5CPBA 3GN2A 1WWKA 3E7XA 2C7GA 2FZGA 2NZWA 1BXGA 3D8SA 3WGGA 1QVZA 4J1QA 2O48X 1WOYA 3L6OO 1RQPA 4A82A 2O52A 1WHTB 2NP6A 4QQ8A 5ALOA 4G4IA 4JBXA 5I48A 1Q1GA 4CFZA 3U7FB 2AGQA 3KQHA 3RUIA 2JIBA 3WRVA 3E35A 4RYLA 4XTRA 3F90A 1C3OB 3WLEA 5EUQB 4IIDA 3C7CB 3EGDB 1ABBA 1IZYA 3EQ9A 4OJKA 3G5LA 5DYGA 4BO7A 4XQEA 5JBIA 2H0QA 1TYDE 3SE0A 5M7EA 1TZ2A 3EASA 4YA6A 4DA0A 3TZKA 4DV5H 3ANYB 3L07A 2RHBA 4QDJA 1YVRA 4G85A 1T5BA 1ND6A 4WL0A 4BFVA 3MLBA 2YJ4A 4D3XA 4HR7A 5EN4A 4X1KA 5HGXA 5FBZA 4AZ0A 5JD5A 4IHJF 1DAOA 3FSGD 4O3NA 3G8BA 4G63A 5GV8A 1REQA 3HCEA 2YWEA 4GWLA 2QM3A 2XDYA 4C07A 3B1FA 1G2IA 3OICA 4P7FA 3L0BA 3CEAA 1XCPA 3PJFA 5D3MA 4B45A 3I2IA 3PTZA 5HR5A 1B0ZA 3RABA 4I50F 2A1TR 2VT7A 4V2IA 4ZRMA 3T61A 3IVXA 2R8GA 4KREA 3HGTA 4IJQA 4F6RB 2O6LA 3IMFA 3PSAA 1PL6A 4DLYA 3RAJA 5M29A 3U17A 5T5QA 4XJTA 2FEAA 2PX3A 3B3JA 3DEFA 4IDDA 3U3MA 4X3OA 4TLMB 1XEWX 3M1IA 4IR1A 5BWOA 2FSSA 3VKVA 3Q2IA 1K7FB 1NY5A 1DC5A 2ENUA 2ZPUA 3E05A 2EGUA 2JEJA 1S4QA 1D2MA 2FJUA 4ME6A 3QX9A 2FGKA 4GGMX 2PT9A 1D2EA 1TXGA 3LTEA 4X85A 4EF4A 5GZ6A 5B7QA 4V1CA 5K2OA 1U3CA 5AXBA 5LZ5A 4B84A 4GBJA 4O3QA 3DGEC 4OHRA 4WECA 2WJHA 2Q9BA 2ZWMA 3GNLA 1WCMG 3KZOA 4D74A 5BN3B 2QLNA 4KQXA 1JEEA 1E2FA 2XIQA 2G08A 4NE9A 5A3QA 1D09A 1TK2A 2INGX 4UVEA 1RZUA 3VPHA 4R16A 3D6JA 4EG5A 2JBWA 1UFOA 4EUKA 2BCEA 1SUAA 1PL8A 1MB3A 2PXXA 3SK0A 3ZH9B 5HJEA 3AHGA 2NZ2A 3A6DA 4UPDA 3H1TA 2XB6A 3MXTA 2A0XA 1WQ3A 2YRFA 5JBNA 1Z83A 1TKBA 1QG6A 1EINA 1NP6A 2A9OA 2EFGA 2FZEA 5A4KA 3N2IA 1RBQA 1EAYA 3MWEB 4BB0A 1QF6A 3VZRA 2GN1A 3DLTA 5ARCA 2X40A 1W47A 4EY6A 1O87A 1R4MA 1R66A 3JVIA 2XPCA 3U39A 1T24A 4RULA 3RYIA 2B82A 1O9GA 1ZD4A 4NONA 4AY3A 2PLRA 3G17A 3O92A 1EVJA 1Z5WA 2O7QA 3FTFA 1L3BA 2R8PA 1ISRA 3NTXA 5AFSA 5DXFA 3AM1A 3C4VA 3AF0A 3AOEA 1M2NA 1XTKA 3FCSB 2QNBA 1OB5A 1HLPA 5FD5A 1UK8A 2XRMA 4KRGA 5HZKA 4Z2AA 1KI9A 1EAMA 5K0EA 1TZKA 1ZP6A 1XMXA 2WE6A 1UBLS 2HIHA 3MTJA 2O7RA 3QFRA 4KX5A 4DHEA 4ECXA 2A2ZA 4FOOA 1CZNA 4DF3A 3C3PA 3NO4A 1FX0A 4IG9A 5DGCA 3RJ9A 1P1JA 3W2HA 5IX8A 5JI3E 1I3MA 3AIMA 4PC1A 4QIWE 5TXGA 2R47A 1XZ8A 2DFNA 1U0GA 1NVGA 2E5FA 4HX2A 3W5UA 1S0MA 5J4YA 1NMQA 3SMQA 5IAKA 3UB4A 2JGJA 3DZIA 4WEOA 5DZSA 2QU7A 5G4KA 1WY5A 5DG7A 2ZYWX 3QZ8A 1KOJA 2OCDA 4CTOA 1SPBS 3D2CA 4JYMA 3ROXA 4PN3A 1NMSA 1FDWA 2AUMA 2DHEA 2TMKA 4BJ6A 3IB3A 1WJGA 1XTRA 1ZR4A 3K92A 5DNAA 1ZFNA 2VF7A 1PEAA 4WH0A 4BJHB 5E3JA 2QTNA 1NXQA 1T3LA 5I7VA 3G0GA 3T1YB 1PSZA 3F5MA 3ZY3A 3JSLA 1TCVA 4CTMA 4OG2A 3GVCA 4ZAZA 3OJLA 4RAZA 4JJ7A 4KE6A 4DR6B 1M2HA 1HY3A 2QUHA 3NVAA 1VJCA 1JSLA 2BIFA 3OLVA 3IMGA 1NXSA 2PIAA 2DB3A 4C7KA 2XMQA 1I33A 3GV7B 3AHCA 3KTAB 4CLOA 2EJBA 4Y2XA 1PZGA 3UV7A 1R0BA 3FRHA 4DCJA 2JFBA 1JLRA 4QWEA 5SZKB 4AIIA 4DIBA 2GZ3A 4IHKA 3IQXA 4EY3A 5U9CA 1CNFA 2JRCA 4N03A 3I2JA 4Z8XA 2XNJA 4ZYUA 3ORRA 1TAHA 1Z33A 1NTRA 3BHMA 3HOWG 3GXBA 4V0RA 2QR3A 2WBLC 3JALA 4I08A 1M8PA 1H6CA 4IBOA 4MUBA 1LGYA 3K5WA 2FW8A 3VYVA 5IT0A 4FMPA 3ZHCA 4UW9A 2R7NA 2VVTA 2EP5A 5AXDA 3E7WA 4E6EA 4HL6A 4YFVA 1FRNA 1R5NA 3N2KA 5D2CA 1AY0A 3GJSA 2DBYA 5JXHA 2X5OA 4BV9A 1SHZA 5B55A 3IQEA 2ZRPA 5C37A 4QO8A 4L9SA 3CW9A 2W9CB 4JH0A 1NKVA 1H4SA 1ZY2A 5L3QA 3IUYA 3P2KA 4L6IA 1T25A 4LI3X 1EHIA 2VYQA 1OBGA 3QM1A 4MV3A 1GP2A 1IOZA 2IE8A 2P9GA 1LS6A 2VG8A 3LBAA 3OX1A 3ZNOA 4E70A 5C3MA 4R9VA 1A7JA 4RKFA 1CQZA 5CYOA 4UCSA 1YJXA 3HG7A 1WIWA 2BZGA 3HA7A 1G1AA 3H4DA 5KWSA 2XMDA 1U1EA 1BFUA 2YVKA 3KLOA 1PFGA 2RKWA 4NYEA 4N1AA 2P2GA 2BGKA 1GAEO 4QUDA 3WWZA 2Z2XA 1KQNA 1TQ4A 5LQKA 1BIFA 1XJWA 1GO2A 2W6CX 3AILA 4HAZA 5EFOA 4RV5A 4HYYA 3AR5A 1X15A 1GLVA 4OGGA 3F0TA 1F9EA 5AJWA 3WIVA 3TEJA 3N0XA 3QG1A 3NGMA 2WU4A 3GRUA 4DJEC 4JASB 1ZGGA 2FPKA 4JT2A 4PF1A 3SZRA 2ZQYA 3JCZA 3K5IA 4MULA 4TRJA 3VZSA 2O3RA 5HK8A 4DV6B 2Q5FA 2C98A 2XNDD 1LKZA 2F67A 3O95A 4A4DA 3NMUF 3ILSA 4S12A 1OFHA 1Z25A 3PQ5A 4W99A 4WFIA 4CMAA 4QWBA 3FOCA 5BWLA 1FJXA 3LO5A 4GYKA 1EFDN 4UHCA 3GHYA 3OU6A 5ESWA 4U7DA 4LGCA 3C3MA 2G8NA 4E07A 4URZR 2ZYHA 2VATA 4LYFA 3CZPA 3B8HA 5A1JA 3D7SA 4MP6A 1FSZA 1PZNA 2GJ8A 3HJCA 3W4KA 1Z6QA 4BZWA 2VYCA 2XZOA 4O82A 4LXHA 4RZ2A 1V5GA 1UPTA 2BFBA 4JOQA 2X0KA 3N2EA 3PWKA 2AC7A 4UUPA 1TW2A 3A9UA 5LYJA 1U7ZA 2DOKA 4DCSA 2W2XA 1II8B 5E8RA 1P33A 5CLFA 1HG1A 1NBMD 1VYHA 2Z1DA 4I5GA 3O90A 3Q72A 5DW0A 3PI6A 2KM1A 1BA2A 3WNVA 2A9VA 4DDWA 5F52A 4J1SA 1X3SA 3MTIA 1YSCA 3UK7A 3TLCA 1YU9A 4MUHA 3G59A 1QB8A 3C3YA 1DKQA 5JCXA 3T5PA 4EO7A 3DJFA 3OM9A 1N6RA 1XU9A 2XWPA 3FVRA 5KINB 3IHLA 4QQKA 3UCFA 2H8KA 3PJGA 2FRDA 3X1JA 1C8KA 1W35A 2P6MA 3GT3A 3MIZA 5B58T 2CFMA 4L75A 1ISSA 1EFCA 4BO6A 2MU1A 2OR3A 2BQ3A 4W5OA 3D2BA 1WU8A 3SN6A 1KY2A 4YGYA 5JRDS 2HRRA 1D5CA 2RI1A 4JV1A 3MM4A 3O47A 3WB1A 4J1TA 2JEOA 5FBLB 3EZ9A 3H2JA 4U39A 3UOWA 3MJSA 2ZRHA 3QMWA 4FE3A 5CM0A 3D8RA 4QG7A 2OAGA 2YC2C 2WJVA 4Q4JA 4DIUA 4CIYA 3TBKA 4N82A 1GFZA 1RSZA 3JASB 2BKXA 3FGPA 1YZQA 5HS4A 4W5TA 2AOUA 4B4OA 3L1HA 4YJHB 1OJ7A 1EIZA 3ZCRA 1PRYA 1PNQA 1I6MA 1OWPA 2H7VA 3DD5A 3EGXA 3PG5A 4BC0A 4CU2A 4PTZA 2YBEA 1PS8A 1IQUA 1ECLA 3JQGB 4Q02A 4QL3A 3DBIA 4EHDA 3L8DA 3PIDA 4HB0A 1NN3A 1P1RA 4LV6A 2JLUA 2WB2A 2UVWA 1GG2A 5IPFA 1Z7BA 4IHQA 2P2ZA 3WX0A 4DANA 4EF5A 1UMBA 3W5AA 4J0QA 1D6MA 2Y2VA 3K9NA 4LDQA 3ZZUA 3TL3A 2C28A 3THSA 4P86A 1FW6A 1I4OA 3INYA 3FGZA 3SP1A 4LY0A 4NU5A 4K0KH 4W6QA 1HDRA 3ZWWA 3CR3C 4RM3A 4MV5A 4M9ZA 4B5LA 2CKZB 2WHRA 4BFUA 4IDNA 3TLZA 4GQBA 4AKEA 3K8QA 3VKGA 5CNIA 4BO9A 3X1ZA 1YJBA 2WUEA 2XF8A 2XUIA 2FWIA 5FOWA 3QOYA 5CDGA 3A58B 4LTNA 3W5OA 1SU6A 1N0VC 4A3LG 1R8YA 4X62B 1DJOA 1SKYB 4OB6A 5BMVA 4PSDA 2J59A 4JENA 3MHTA 1M0TA 1BX3A 1I51A 2J32A 3L1JA 3LY8A 4WVLA 2B3DA 2I6FA 2ZKLA 3R3YA 4OF4A 1DRUA 1A2BA 2V9PA 4ED2A 3F6BX 2JEZA 1WUJS 2GNPA 1W4BA 3VNNA 1DBPA 2QIPA 2ZCUA 5DIFA 1R0RE 4HN2A 1FU7A 2VH1A 2O7VA 3AZPA 3DQPA 4BASA 1CFZA 2CBXA 3IIIA 5ADUS 3EXHC 4QOEA 1Z34A 2PGIA 2QSUA 4EP1A 2VPSA 1PNVA 5BOSA 2B0CA 1EKVA 1VFPA 4I4TA 5FUQA 2AFHE 2PK3A 4O4LB 1BRTA 4P6VF 3ZV4A 1RMTA 1Z07A 3RBVA 4WKNA 1IEXA 2IDZA 3SS9X 2AQKA 1WDKA 4NTZA 2LKDA 3KHUA 3E03A 2HBQA 1DC7A 3GJ7A 4HPXB 3TW0A 2G67A 2X23A 5I7SA 2C82A 1CQWA 3P5SA 4TVIA 1E63A 2P4HX 2BEWB 3A31A 3BXPA 3JVUA 3LUGA 3S1LA 3VAZA 3MYRA 4L28A 1NSTA 4A3FG 1ORVA 1NM5A 4GLXA 3DBRB 3IMKA 2RHRA 4OIFA 6REQB 2GWHA 3X43A 4I46A 2EKQA 1TVKB 4PGAA 2O8CA 5E38A 1Q1EA 5AICA 2H65A 7MDHA 2IXTA 4ZGWA 4XR9A 1CKNB 1YJQA 2VSYA 4MPJA 1KNXA 4D9NA 4F6LA 2BEUB 2WTEA 1AJEA 1XRNA 4WESB 1YUNA 1SO8A 1PQUA 5EWMA 1KI6A 1HT1E 1QVAA 5BNFA 1CYDA 3ZV7A 2EGGA 2EWWA 3R44A 4WGGA 2OCLA 1HL3A 3FVVA 1AN7A 3CXUA 1A7AA 1P77A 4O7SA 3F96A 1FJGH 1H2YA 1XZPA 4LXUA 5GJCA 2CFIA 3QXJA 5C3UA 1QH1A 1NBME 2W0SA 5IZ4A 1CULC 3CHYA 4MO9A 4MUJA 5K6RA 2F1OA 3LCUA 5CCEA 2GZHA 4BU0A 5INTA 4FFMA 4A0HA 5BWMA 2D59A 2WM8A 1XEFA 3ESZA 4JP1A 1D2GA 3UYKA 1UJ6A 5JW6A 1YNOA 3D8BA 1VTKA 1ZG3A 1T2CA 2HHHH 4P93A 3S2YA 1FMLA 3W5HA 2PLWA 2O03A 4RY2A 4MA4A 2R44A 4ZMSA 1Q5PA 2V55B 3CW2A 3Q5DA 5CCDA 4DAOA 1KAGA 2GZAA 2CHEA 3GUHA 3HABA 3MRXA 4MQ5A 4RWZA 2FX5A 5BN4B 5LZ7A 5IXYA 2IC5A 3GA7A 1B2LA 1W1UA 4MQEA 4W5HA 4AXXA 3A6PC 3DAAA 1E6MA 1SKAA 1KPIA 4F4ZA 3M6WA 3PUVA 4G0XA 2WT4A 4OXRA 5HIJA 2ECFA 2AD1A 3R75A 1NULA 1TO6A 4LGMA 3OZBA 1LRLA 4BECA 5ES3A 3PFFA 2B6HA 3V8EA 4BQOA 3FPKA 5HEKA 1K7XB 4H08A 1B1CA 2NU7B 1LJUA 2PX4A 3MTEA 2HPVA 4OIMA 1CJBA 2X77A 1T0BA 2R97A 2I1LA 1KARA 2B5WA 2WMYA 3KYBA 4G5RA 5DP1A 4WZAB 3WHLA 3O38A 4H18A 4YECA 2F8TA 4REQA 2P0AA 1SBYA 4F3TA 1XALA 4DABA 4I99A 3T0IA 3VPBA 2JHCA 2DLNA 3KIPA 4R1OA 5CDYA 4CCYA 5KTOA 4DVJA 4MRNA 3ZNPA 1JALA 3H20A 4ZYZA 3ZUPA 4W82A 4K6OA 1AVTA 3LT2A 1G7RA 5LMUH 4QGFA 3HCAA 1L8XA 1EFHA 1ZEMA 1E6WA 4HVAA 1KO1A 5JY1A 2P30A 2PSDA 5JHHB 3FOFC 1YA6A 2FR8A 4LOKA 4PQRA 2PFKA 1RCUA 2WMDA 3ZDRA 3EGOA 2I9KA 1QTNA 1TJ3A 1XSEA 4KACA 5LQMA 4R0VA 1DBWA 4RW0A 2Z43A 1W25A 4B9AA 1EK6A 1NLYA 1T5SA 2VTBA 5EZYB 2R5NA 2CJXA 2WYHA 1KZYC 3ETCA 5ALZA 4OQFA 4RAOA 4UOZA 1I2CA 3D4OA 3EOBI 2BFDA 1LBEA 4RY0A 3K8ZA 4DILA 5GIOE 3L7YA 3E5NA 2QY6A 4OHCA 5GMOA 2DP4E 2QNRA 4EKYA 1IN6A 1XEXA 4U7WA 4W5RA 1RPTA 2HBRA 2GXSA 4DV6H 3LX5A 3QE4A 4RV4A 4BO1A 1ZX1A 2BGJA 1L5MA 1F6DA 1WO8A 3AIKA 1NN5A 3DF7A 2VO1A 4MTCA 1FFSA 1VA5A 4HDKA 4I5DA 4RZQA 1NBWB 1KIAA 1VKRA 2YW2A 1S3SA 4LRSB 4WZBE 5ILQA 1S6YA 3VR5D 1WKVA 2HF7A 1S2DA 3Q41A 4WXRA 2W8BA 5BW5A 1CR4A 2P5YA 4R8KA 2PRKA 3JQ7A 1SXJE 3GLIB 4GBMA 5EE3A 4AF6A 1U6JA 3RFTA 1TU0A 2HFKA 4RMGA 1IMJA 1SC3A 1RKUA 4R1PA 3WDSA 2CE2X 4AZ0B 1V7ZA 3CGGA 3O21A 1XZAA 3HYSA 1U5AA 1ND5A 1JYFA 3P8ZA 1GA6A 2G9RA 2NTNA 4DS3A 1DARA 2JK0A 1IB6A 2I3DA 3W04A 4ARBA 2V45A 4O5AA 1HLGA 2PJZA 4FYJA 4HDMB 2XX3A 1DQPA 4QYMA 1O0CA 5JD3A 2OYCA 4QATA 1U0RA 4DJDC 4XRRA 5JWRA 1VSVA 2AZDA 1YS7A 2LDXA 4HRVA 2QL5A 4UFPA 1E7YA 3MW8A 3C5VA 4N7MA 4Y6SA 5NULA 3AHEA 4KR9A 3W6ZA 1R5OA 2IT1A 4OQQA 2GH1A 1G5HA 4N3AA 3IUNA 3DFMA 4C22A 3IV9A 1NASA 3OT5A 4DR1B 4LA4A 3GYGA 1L4NA 1ZLYA 3DH0A 4TYPA 1JZTA 4AY2A 3A1WA 5BWVA 4JEIA 1GTJ1 1LPAB 4TYNA 2WM2A 2VF5X 4DB2A 3IQZA 1SQSA 1MAHA 4HH0A 3EVDA 4ETMA 3WIOA 3K9WA 4O4IB 4DFDA 1YTUA 1YIOA 2QENA 5CFRA 1XNRB 2QM0A 4J0IA 4RO0A 4ETNA 5KFZA 2E2IA 2ATVA 4JYAH 3C0FB 2CCKA 1PYGA 3JQ9A 3BRSA 1XAGA 2WUWE 1U8ZA 2WIDA 10MHA 1K3UB 1H8HA 3WDLA 1L5LA 3I5XA 3KAKA 4XLLA 3WB0A 2OGUA 4QXQA 3CC8A 5TRTA 1Y1RA 2H1OA 1N9ZA 3PHJA 1CY2A 2AL7A 5JWOA 2RGXA 3EVAA 3W8RA 2WTUA 1V5IA 3BK1A 3O4RA 2AW5A 2O14A 5KFYA 2PZKA 3A7EA 4EG3A 5JIBA 3RGZA 5IFKA 1JAZA 1EZ1A 4UAUA 3GROA 3WIBA 3DV0B 3RR5A 1AQYA 2X0NA 2X9GA 5SZJA 4E88A 5KSYA 2DMRA 5BQOA 1N3YA 1S2GA 1JB9A 2SKEA 2OVFA 3L84A 3EMKA 1N2JA 4EFDA 1XHLA 4YDSA 1Z6YA 2OXIA 4EJSB 1U8XX 4ZZ1A 4ONEA 4QDTA 4J7CA 4BMSA 3O3NB 1ODKA 5BQPA 1F0YA 1JLLA 1K3TA 4CWAA 2HGZA 2PGOA 4CE6A 1ETHA 4CKYA 2X5JO 3C14C 2XZLA 4GR5A 2AE2A 1B33N 1S03G 4HEQA 3H3JA 5ALWA 4RAYA 2DPYA 3S2SA 1N5OX 2JI7A 2POQX 3M4XA 1KQOA 1EGMB 1VRCA 2WILA 1WTCA 1B04A 1E5LA 3NAZA 4QGSA 4TUYA 4UHBA 4WNAB 4Y2HA 2GAOA 3PS9A 1QH8B 2O1WA 3EDCA 4RJJA 3GTLA 3QNWA 3TIXB 4CEJA 4F1KA 1NHWA 3P0EA 2VQEB 3BBLA 1Y8RA 4KPGA 5AXAA 1RNLA 5HF9A 3RUCA 1OLUB 4JJ8A 1Z5ZA 4KLNA 4TRNA 1P2SA 2Q1WA 3RTGA 4R54A 1LW6E 4LRUA 2GBLA 5DLPA 3H9UA 1XNQH 2PWYA 3NOVA 4TPKA 1XPRA 4OX9Y 1VJ1A 2E4AA 4MVJH 1OAKA 4BMOB 1FYEA 4H6XA 2B36A 1UBTS 4R98A 4CRWB 3GTOA 2VHEA 1WCWA 3RANA 4GLFA 2QD3A 1IN4A 4DPLA 1RRCA 4Q7KA 3AEXA 3LMLA 2HMWA 4Z1OA 1ZETA 1ECBA 1LLQA 3ULKA 3VZQA 4R3NA 3PJEA 3RGGA 4DCMA 4R9RA 1OLXB 5IDXA 5GPBA 4YAKA 1MORA 2JPDA 2YQ5A 2QTAA 2YIVX 4DARA 3RSZA 1G1MA 1NW8A 3IVRA 5JEDA 3A4YA 1CQIB 3L1UA 3LT5A 3GLVA 4UC0A 4I3HA 4I1VA 4MGHA 3RU3A 2X15A 2G1JA 3FJOA 2QUKA 4NMXB 3GC6A 1OX6A 1DXHA 4LY9A 3R9KA 5IUKC 1N34B 2FCRA 4IO1A 1F38A 3Q3JB 4TMVA 5CNMA 3Q7SA 4IWNA 3PC4A 4IZOA 4TLAA 5G02A 1I1NA 2RBKA 4X84A 5UKDA 3B7GA 3KB8A 1C81A 2JIDA 4GGPA 4LZPA 4GQIA 3U5ZB 4WE3A 3F9RA 1IBKB 5SZIA 2D5BA 4IX1A 1WVMA 5EC8A 2CDBA 2NLOA 4NFSA 4FBMA 2UVPA 1H2FA 2VTVA 3WMGA 3TQIA 1W7AA 5BWRA 5EIEA 3UKOA 2WC1A 1MAAA 2QMHA 1PWHA 5BV0A 3K4PA 3MTQA 4H77A 3EC2A 1PW7A 4N8SA 2B1GA 2WI8A 3RBXA 4MI3A 5E3HA 3G0IA 2WF6A 3BRCA 2FSGA 4BEBA 4R8SA 3T4PA 1FRZA 4X1IB 4X92A 3LHIA 3QOWA 1XZLA 2PGXA 4ALNA 4MTLA 3D54D 4MWCA 4YNBA 1MIOA 4RJIA 5JHGB 1U0OC 4YJHA 5A2QA 2UVQA 2JFGA 3OUZA 1SVMA 4MWSA 4TWJA 4RF3A 2FZLA 4V0ME 5SV2A 2XGGA 2WUVA 1THMA 5D5PA 3RAPR 1OBFO 5IVDA 1HORA 4EVIA 4X95A 1D07A 1G6HA 4TT3D 1OXTA 2E6KA 3FZEA 4MQUA 5A6SB 1AG9A 1JHPA 1GGFA 3TN7A 4HUQB 1RZ3A 5H1YA 3OKCA 4MRSA 5F2KA 2FPGB 3K30A 1MOQA 1U2SA 4P7JA 2BYTA 3D8NA 4ZI5A 2ZCJA 1AXRA 3EVCA 1U9YA 1UXHA 1UWCA 1L5FA 2AOVA 2VHXA 4EFMA 5C4GB 5JSQA 4YS6A 3HKDB 4YT8A 2K2WA 5BOVA 3L77A 3ZWMA 4V0OA 1O1YA 2ZGVA 5CIQA 2H3EA 2OV2A 2VJMA 3B5JA 3WWCA 3K1AB 4B43A 4DQVA 1RZRD 3Q2KA 1K8RA 2IL1A 3HP1A 5ALJA 2H1LA 2HIAA 3D3EA 3HCRA 1XQYA 2AEJA 3BIJA 3NGLA 4RPLA 5TS3A 3Q3HA 3H97A 4GX2A 1LDEA 3AL0C 2BVNA 4L0CA 3I04M 5EEGA 2EFCB 2IEBA 3WGKA 4F2DA 3EE6A 5BMVB 1FK8A 3GCZA 3ZG6A 2JD2A 2D1FA 4CLEA 4Z9YA 3OZEA 1N2GA 1YK0A 1W44A 4HVTA 4PLZA 4DLNA 1R64A 2G4VA 2B20A 1TVCA 4BZZA 3GRKA 4UJ3A 3TLMA 3G7NA 1Q22A 4FONA 2QTRA 3OF2A 4H6VA 3GTPA 2O1EA 7ABPA 2Y0SA 2XMBA 2H18A 2XRFA 3RVQA 3VMFA 4IXMA 5HXAA 2WDZA 2GWRA 3SNKA 3UPDA 3GRRA 1YMVA 2WIJA 1YMUA 4U00A 2JEYA 3TBFA 2TMDA 1IJFA 1CJCA 1HETA 2D00A 3H5NA 2GASA 3FY4A 1NI4B 4GC9A 3T7EA 4D79A 1I7QB 1QO7A 4A0QA 5E6RA 4ZU6X 2X5RA 1MCZA 4Y1RB 5JARA 1RWOA 1H5NA 3ZDQA 1Y7PA 5DH9A 3GUUA 3RJTA 2OLKA 5CHYA 4ZI7A 3CVOA 3GRFA 4Q7EA 4R2WA 3LUKA 2NUAA 4IRDA 3DTVD 2BDEA 3LOUA 5FOTA 5FKJA 4B8WA 4PN7A 3QF4B 3M9XA 3EVFA 1XJ5A 5CLQA 4B3TH 3CNOA 5DKFA 5BR7A 4HFJA 1NUAA 1S5PA 4X1YA 3N0TA 2ONJA 1N1EA 2FMHA 2GLTA 4UFNA 4MV4A 5TR9A 3RRJA 2Z08A 5C4IA 2DR0A 3KD3A 4AP5A 2XWJI 1DO8A 4QRHA 2O3UA 4CQMD 1U63A 2J85A 4FCCA 3RIZA 3ETNA 2J7PD 1T0PA 2Y2UA 1FZTA 3Q11A 4ZQCB 3KOXA 4PG7A 5A6VA 3CLRD 3CJTA 4NYMR 1FDUA 4DUGA 4TKUA 2AN1A 2W42A 2AC4A 2D8MA 4OOEA 4WADA 1NP7A 5FBKA 4M88A 4TKZA 3VR6D 5EWGA 2MHCA 1BEZA 1M7GA 2D8AA 2A0FA 3NEJA 4MB6A 4M1KA 4Q3NA 4BLOA 2Q3BA 3H65A 1T2NA 4IMJB 4LYGA 1TAUA 3D1JA 4F1JA 1E0KA 1WMDA 1F06A 3R9RA 2FHSA 5DK6A 4D4KA 4RK6A 5KNBD 1BQ4A 3H2HA 4EMBA 3PEVA 2FQXA 3M4JA 4ZVMA 4ZVUA 1PG0A 2ZS7A 4A8JB 2GB4A 1JMVA 1E3SA 3EEIA 3NORA 1TWCA 1MHPA 3RLFA 5FWNA 4XVHA 2FLLA 2GPTA 4KH0A 4IVQA 4NFHA 2BGNA 2XDWA 2AG8A 4UE3S 4LOIA 3DE3X 5DBGA 4DYDA 3S29A 4RCYA 4DLLA 4W9RA 2J4DA 1P5RA 3NJRA 3P2MA 5K7SA 5KKCA 5KFVA 2M6SA 3ICEA 3WLNA 3J81W 2YWHA 2NUBA 3CZAA 4IDFA 2NMVA 2VRCA 5I7RA 3N0WA 4TM5A 4QLOA 1T3ZA 2R92G 2PNJA 4UBNA 1S68A 4RXMA 1X7GA 4OQPA 4CV1A 3C2QA 3IO3A 4QVGA 2NU7A 3GFSA 5K8JB 4QTUB 1Y1SA 1XMJA 3EC1A 1QE5A 5IMBA 2AWNA 1R74A 3T7IA 5JDCC 2FSUA 1CUCA 421PA 3QFHA 4TMTA 2VDLB 4N3NA 2JAPA 5J4LA 5EHXA 4F9GA 3AKEA 2FDCA 2Y4OA 1GCAA 1TE2A 4OHPA 2Q0SA 4P0QB 3I6MA 2XUOA 2J0EA 5IC5A 3WL3A 4IG4A 4DDUA 2ADOA 1MT0A 2VP2A 1CKOA 4R5MA 4M99A 4QU8A 4DKXA 3NVMB 4PHHA 2YN2A 4OP3A 3GRPA 4S3MA 5HKLA 5TQVA 3T1TA 3R9WA 1K89A 3DHNA 1GN8A 2ETXA 1VE6A 2QXYA 2ZSFA 1ECFA 2AUNA 4FJ1A 2JEFA 4FVTA 3DB1A 3EIWA 4P92A 2P3SA 3QV1A 4OQMA 3PV0A 3IQGX 4V0MA 3NFYA 1WEHA 3D2AA 2ZZKA 1HQDA 3AR3A 1WD7A 2ZE5A 2JGDA 5IK2D 1VBGA 5AKIA 5K0SA 3KDAA 1PTKA 2WF7A 3MJEA 1C3LA 4CM6A 4TMZA 4LOHA 1PR3A 4S04A 4MKIA 1NR5A 4P5PA 3GJ5A 4AKGA 5DG8A 3FSRA 5CA1B 5JCOC 2BH2A 1T4CB 3PVZA 2Q7XA 2V5UA 2ZITA 3ZDFA 1A98A 2KYRA 2P2LA 3V8VA 4IDHA 4OXYA 3D31A 4RNMA 4WBNF 4KWHA 3AI7A 1W1IA 4LGVA 1D4AA 4AZVA 1DKUA 2NVBA 3OPXA 4GO1A 2C2WA 2PBZA 1A9XB 2GN6A 2A88A 2YV3A 4PZUA 1K6EA 2XMCA 5HG0A 4LGYA 2ASJA 4A0FA 3PX3A 5J3JA 3W8NA 2OC9A 2OG1A 1LVUA 3K20A 4Y6OA 4BGIA 4ZVPA 1YRHA 4B3MB 2IYUA 3NYQA 4XYGA 1WOMA 5DBOA 3O1LA 4G1FA 4CGYA 1OHHA 3BJYA 2SCUA 1E5DA 1NOKA 3QWHA 2ZJ7A 4KQ6A 4BE4A 4A1OA 1N78A 3LF1A 2CWDA 4PX2A 3ZXIA 3T0GA 2ASLA 3NH6A 2ID9A 4JOSA 3S1AA 1KDZA 4R51A 2OV1A 3GT7A 1X7YA 1ODTC 2IY7A 3BA6A 1MAWA 1PUJA 2BJVA 1X1AA 2GOYA 1KDOA 3PQDA 3FUVA 3N0VA 4MQEB 4QRIA 1CS0B 1NR7A 2V9WA 1JJAA 1DIKA 2IF0A 1EXDA 4ZTUB 4ZCIA 1OXXK 2QM8A 4LVNA 2C7BA 1N8SA 2J9RA 3OJXA 5PGMA 1VL5A 4IQ4A 3SJ7A 5JMTA 1TC2A 2ZRCA 3HI6A 4BMVA 2ZRBA 1UP4A 2WV9A 1ODIA 1BOOA 2ORYA 2QRKA 2PMZA 3R0IA 4HDMA 3MJHA 4IICA 1RYEA 1N8TA 4K9KA 4L4RA 4LWPA 4PW0A 3DDSA 4RKRA 5F2OA 3ST7A 5KNBH 3AUSA 1WUYA 3HUDA 3TZQA 3FMFA 3PFHA 3UJBA 2YWRA 1NA5A 2ALJA 2ZYTX 2ZYUX 1DBIA 1HDEA 1VECA 4WZAA 4BLSA 4BVBA 4B80A 3NZEA 5B6PA 1XDUA 2GEDA 4A3GG 4R9UC 1QIEA 1QSGA 3USCS 4JLWA 1T4BA 1VIDA 3N5CA 5KOHA 1QONA 4ENUA 2ZE7A 4Y9DA 1IVYA 5IW8A 2HO4A 3LLSA 1G3QA 2G0NA 2C2HA 2XDQB 4FYPA 1LNSA 4MEJA 4AUEA 3IMEA 2A33A 4QRDA 1T2FA 4H0FA 3QBDA 5NLLA 4INZA 1VMEA 1U2EA 1D0SA 2OXCA 1BXRB 1C0KA 2IX9A 5ALPA 2VT6A 2JANA 1N32H 1CX9B 1T9GR 2IE0A 2CDRA 3IBGA 3U9LA 3WLPA 3ZWAA 3BX1A 5BVHA 3A6LA 5CFPA 3CT4A 2CNVA 4UCFA 4IYJA 3RIEA 2JCGA 2QPLA 1TT5B 4NZMA 5IAJA 2B1RA 2WSSA 1NL3A 4KK4A 4NU8X 4MWTA 4MLZA 4D4GA 2G6BA 3LUCA 1EWYA 3PXEA 2QE7D 1JX4A 3HGQA 4AYTA 3PFNA 2I34A 3QKUA 4JA0A 4UEWA 4UNPA 2WFZA 2X8JB 1B0PA 4TSKA 5A4MS 3K9GA 3HFGA 1TQ2A 4A0SA 1L2TA 2OWDA 4G81A 4BMYA 4J9KA 4RACA 1XCBA 5KG6A 5CM9C 5JO9A 4M0PA 1KETA 1PV2A 1G4AE 1WXFA 2EFYA 2QN7A 3C15C 3FLEA 5THQA 1JMKC 3WADA 4Q0YA 3R0XA 2XA9A 2REQB 2XH8A 2HV9A 2BMFA 1MTZA 5BSTA 1PKXA 4B3SH 3CNHA 4KYUA 1WLYA 4FSDA 2XKJE 3J7TA 4XB2A 1P7YA 2ZRDA 5B2FA 1DVRA 1R3UA 1U0LA 3KHTA 3QHPA 1NWHA 3V9PA 2PQ6A 2Q4EA 3H1EA 2J1LA 4ZN6A 3N8DA 2H0RA 2PUFA 2QPAA 1NZDA 2EDAA 2FWNA 4B7UA 2JVJA 4N4AA 2IEYA 1ECPA 4CG3A 4O7LA 1J24A 3NAQA 1KUTA 2W2QA 3FKSA 3U31A 3A6HA 3VKWA 4TQSA 1E1CB 3MRSA 4Q1VA 2IUUA 4KNYA 5JNWA 4B6FA 2FZKA 4Q3BA 1JI0A 5HRAA 2J41A 1CUXA 1NW4A 2CQYA 1O57A 5EMKA 4BGVA 2ZR8A 4I1SA 5DLYA 2F17A 3BFXA 2V59A 1OLUA 1UOOA 2NZVG 3LXMA 2IDKA 3TKLA 3WL8A 1ORDA 1SHUX 1YQEA 3QXHA 4JEHA 4W63A 1EPUA 1Y5LA 4V1CB 3NBZB 1J99A 1JLHA 3OE1A 2AH5A 2CDAA 2CL6X 2YMPA 1M2KA 4YCAA 1W85B 4BMDA 2UVVA 3KL2A 3OTOB 3V2HA 4YWJA 2MINB 4YFYA 1U6KA 3MIIA 1M1NB 4KQ9A 3K0HA 3N8NA 1AHIA 4OD0A 1ZQ9A 2C7PA 3L0PA 5FFMA 5K0TA 2BTQB 3PW4A 2AK2A 2JLSA 3A7DA 3ZV5A 2Q3JA 4YHHH 3ESRA 1OX4A 3TLGB 4DL9A 3A4NA 3BEOA 1NVFA 4G89A 4O4IA 4AG3A 3T5KA 1TWAA 1KGSA 3LE8A 4LVCA 4B6RA 3M6MD 4TVOA 3RSCA 3KKEA 1Y4SA 2GBPA 5DU2A 4YR9A 4IPTA 1FJGB 5BQ3A 1W87A 1L1QA 2FOXA 5FWYB 2F62A 3LIIA 3P32A 4P36A 4Q19A 1P44A 4QFBA 1DIGA 1WHTA 1KQFA 1Z3CA 4RIFA 1SVOA 4RLFA 3BGIA 2QXUA 1KRHA 2ZIVB 1UZMA 4MA5A 5KQPA 3PQ3A 4TYQA 2Y1FA 2APJA 2VPXA 1BDJA 1W1WA 1QIIA 5KHAA 1ULSA 5BSRA 5I4CA 1LA2A 2J87A 3SC6A 3OCXA 4HXFB 1J5EB 3LFHA 3MFYA 3EXIA 2RC5A 4D56A 5GZ1A 2ACWA 2W48A 4K9MA 2WTFA 1PJRA 1LD3A 1JYSA 4NNPA 1MJFA 4KDRA 2P91A 5KVQA 4L6CA 1YRWA 4N5HX 5DCWA 3PXAA 4L4YA 4ABYA 3SWWA 3Q9NA 3HS3A 1JBEA 1PL7A 4UE2A 4EJSA 3TDMA 1X8LA 3MWKA 1C2YA 4ND5A 2PSFA 1REQB 3RK1A 4I1IA 4MR7B 4ALLA 4YMVA 1CUDA 4RNDB 2FPPA 4YHHB 2IH2A 3AKDA 4NATA 3DAOA 2CNWD 1JLLB 3QXCA 2FEWB 3EEOA 1AKQA 2CJYA 3L8MA 5AM5A 2BFAA 4EL5A 1SBNE 5HIKA 4JEMA 4JSYA 4L8LA 1ESMA 4XQ9A 2FEPA 3F1LA 3GJ8A 4Y6RA 3ZK7A 4F6RA 1FP6A 2ZAIA 5B7GA 3QEJA 1Y80A 3NANA 5IF3A 2OAP1 4ED6A 1OFIA 1CCWA 2I7TA 1JE1A 3FJYA 1WDWB 3TQTA 2IEZA 4BN0A 2VDWB 2OOKA 3UWOA 2EIYA 4DCOA 3LQKA 3BERA 4DT1B 2WLSA 2X0RA 2WTBA 2DTXA 2P11A 4GPZA 3T3GA 2ECKA 3RT7A 2Y4NA 4FW9A 3ASZA 4DSAA 4F4DA 4YP5A 5BWBA 2BP7B 3QENA 4XUDA 3YASA 1O94D 2P9TA 1DHTA 1QIFA 2HHJA 2OEPA 2V7WA 1WBJB 3KPVA 3LUBA 4JLNA 2QLLA 4OYHA 3GIKA 4DV1H 3DTVA 3FKJA 4C2BA 5K0LA 3BXXA 2P2DA 2ZT6A 3G2JA 5KFIA 1DIHA 4LXQA 4MPRA 5DMHA 2Z83A 2JIZD 4PZLA 4ZVLA 5I5SA 3LWNA 1FFXA 4JHXA 1H4TA 6LDHA 4GOLD 4NHOA 5DN9A 3ZDCA 1GFIA 1IWPB 4RGBA 2AFIA 2NUPA 1CY0A 2I6SA 3NKVA 4JBNA 1PE0A 1XG5A 4DIKA 3IQDB 1JR3D 3QVJA 5FNZA 4C0LA 4GL4A 2ZB7A 4MYUA 3L1VA 3LA6A 1I6UA 2Y1WA 2J6SA 1JIQA 3KSUA 3MSCA 4JJAA 4EZEA 1AO3A 1J23A 1C1XA 2WAQE 3I5UA 1JX6A 2RGRA 1ORHA 2JGFA 3PI7A 4TTIA 5F7ZA 1PX0A 2I4TA 3RYIB 4JXKA 4JC0A 1G21A 3S2FA 3WAGA 1CUFA 1IYDA 3CX6A 4R2LA 2G07A 1QNLA 3N5KA 4XVQA 1Z9BA 4XIYA 7GPBA 1OV4A 3R40A 2XRZA 4ZYLA 1Y6ZA 4HQKA 2CLIB 1I5RA 5EZQA 4OA8A 1RQLA 1BH6A 1ZSNA 3B1XA 5FP0A 1KZHA 5F3WB 1MOPA 3N74A 4HB3A 1NI4A 5D5QA 5IT9A 1X74A 4NCKA 2YIDA 2F3PA 3OMXA 3MWMA 4FDLA 3F8SA 2IXGA 1CF9A 1HYGA 2R6ZA 2VI5A 5LA6B 1SBCA 1ZGBA 1K9SA 1PFKA 3CWZA 3GYBA 4V3BA 3WZMA 2FJZA 3K9QO 1V0JA 1F8GA 2NXJA 2ZJZA 4IVRA 4LKRA 2OZEA 5PNTA 4DIOA 2VHUA 3MTDA 3PFWO 3I32A 3QF4A 2YWBA 2EBHX 4O63O 2GVNA 1CZRA 4LJ5A 3E9CA 4HWKA 1DO0A 4YUYA 5HOQA 4UKDA 3D59A 1E1MA 5KO2A 1BWRA 2KSWA 1XT6A 3H0EA 4A6EA 4WMLA 1A8HA 4U9IS 4M1EA 3GV5B 1C2TA 5FULA 5F2NA 3AKZA 1XTUA 1YHYA 1XL1A 1BZYA 2XT0A 3M49A 2GD2A 3OCJA 1DL5A 2A9QA 4KSBA 4OXIA 5DSXA 1PR4A 5KG4A 4CHTA 5BYJA 5DNWA 4Q3CA 1M0WA 3PVXA 3LUFA 5A6SA 4MRMB 2ZUWA 1AMOA 5F5NA 2IYFA 4JVSB 2ID4A 4N6NA 4Y98A 3NHBA 4CDRA 1M54A 4PC7A 3ZDBA 5TE9A 4JLSA 2IELA 4UDXX 1NVMB 1C14A 1KZ1A 2IP1A 5KJEA 1Y1PA 1VI2A 3RS3A 1SA0B 5BQXA 4PY2A 5JZVA 4E5KA 2WFMA 3WLAA 5GVSA 1P8JA 5IULC 1JXOA 4ZAVA 3ICWA 5I45A 1ZCJA 2Z2KA 4NCXA 1BG6A 4B3FX 4C6TB 2P3LA 4WCVA 1QWSA 3KHSA 1BWPA 1XTZA 1XZIA 4UUMA 1CUWA 2O6HA 3QVVA 4HEJA 4KWEA 3GD7A 1R18A 1S2LA 4ARVA 2FJ0A 2QGFA 1JHAA 2AXEA 2CDCA 3G2OA 3P7MA 4YJGB 3V8PA 3SC2A 5I6DA 4NS4A 1RMQA 1US8B 1TB4A 3B85A 3CURA 3HSKA 4IMRA 4D5EA 1VHJA 1WVIA 4TWIA 3SHFA 4FOSA 3GY0A 2ZKIA 4NBKA 3T9AA 1EDEA 1JEOA 1XD9A 3ROTA 3KUKA 2AW3A 3HZOA 4RL6A 1KBOA 5K3AA 3RUFA 3DLHA 3ONVA 4C20A 3U7JA 4WOJA 5FO1A 1JSZA 4X61A 2OPHA 2JCXA 3HEMA 4JLKA 4U63A 4YUZA 5ALGA 4RLQA 5KDOA 3IJEB 2NAFA 4BVHA 4YY3H 4ZANA 4CDNA 2EJ2A 3ZEIA 4KVFA 2O4CA 1TF2A 2FPIA 4JC8A 2JD1A 3BTVA 2B78A 2QZSA 3UGKA 3VU9A 4CKWB 1E9FA 3AESA 4ZHQF 3AUAA 1L5SA 2PZBA 4XYEA 1BN6A 1HNZB 1POXA 4JI0B 5C1PA 1R0KA 3GK3A 4I1RA 2JLVA 5KFQA 5HCNA 3UJPA 1T36B 2HAEA 2H59A 1MRSA 1BKSB 2W98A 3QVMA 5COQA 1GWNA 4NPHA 4EW1A 5BV2P 5TLSA 1TX4B 2WD8A 4FEEA 1BYIA 4CM7A 4WW0A 1YR3A 2GM5A 3LDUA 2M9MA 3NGXA 1TQ6A 1VPEA 3W3AA 1IBKH 2TSYB 4PBRA 3KU4A 3RSQA 3EBPA 3DKIA 3THRA 3V80A 3BDIA 2H4ZA 3DC2A 3D2LA 4Q4DA 3AHJA 3NBYC 3UT5A 2PO5A 1OA0A 1I4DD 3NW9A 4JB3A 4JGBA 5CP8A 3NOQA 2AOXA 2P5SA 2BI8A 1BD4A 2PH7A 2W6PA 3GD5A 1KJWA 4CMFA 2VQ3A 4P4GA 4Y1EA 5BYKA 3B70A 3LX4A 3Q6NA 4TKUB 5JDIC 1NDQA 3WGYA 3M5WA 1I2LA 1T6NA 1BJKA 4UHKA 1R0LA 2LIPA 3LD9A 2AXNA 2JHAA 1RQXA 2B98A 4HSGA 5FTJA 5IXJA 2ZUBA 3KXDA 4AJEA 5M2QA 2VQ6A 3RVLA 4LJSA 1VG1A 3K5HA 4WCFC 1O6GA 3EGIA 1Z18A 4F4HA 1C80A 4TQ9A 4ZCQA 5JNLA 4A8JA 3R8FA 1M33A 3EZLA 3L6UA 2VPZA 3ADKA 1PU2A 5SZHB 4P7KA 4PVDA 4JB0A 5DSTA 5E7IA 4GLWA 3T7KA 2ECPA 2WWFA 4MVCA 3ZVLA 4FB5A 2PEZA 2WVAA 4KB5A 2J3HA 4ZEXA 2GZRA 4YR2A 4A3MG 1TYZA 3E5MA 4E2XA 4GM1A 4YLEA 3RYFA 5JYBA 1GZSA 1QCYA 3UIEA 1QLWA 3PRHA 3OTGA 4CL0A 4J9PA 3C87A 1ZXLA 5A9RA 1K98A 2BSXA 3S6JA 1EGHA 1VIYA 4KOEC 1K27A 1CUZA 1RI1A 4RL4A 4CL2A 4DMCA 4ZT2A 4M0JA 1ZUWA 4W7SA 1B42A 2Q6VA 2ZRNA 5CB4B 4E21A 1IK6A 2Z8ZA 2CHFA 2DQSA 3L0IB 3W8DA 3ECCA 2NUTB 4TXHA 3N28A 3TE7A 2ID7A 2JJ8A 1ZGHA 2Q8NA 4HYEA 3U49A 3FAKA 5DBIA 1WPGA 2GYYA 3L7AA 4UBLA 5JCOA 4B8YA 1BEUB 3PLNA 3SLRA 2X76A 3JASA 2XBLA 1HZJA 4URYR 3TD9A 1JILA 4JI1B 621PA 3ZJVA 3DEAA 4ISBA 1DJLA 1QFYA 5CX4A 5KFTA 2P9BA 4X9XA 5LUAA 4PPFA 4DR2H 3ENKA 4X91A 3IVAA 4EYGA 3Q6MA 1A8SA 3LV8A 1LSUA 3LT0A 1RBZA 1KJNA 3KWJA 4LOLA 4MVYA 5EWLA 5C4MA 4TWAA 1DT5A 3MTGA 4B85A 4WY8A 2EWMA 2JJQA 3D3NA 1DKMA 1WCYA 2C5SA 2GA9A 3KWMA 5DMXA 4I6EA 3QSYA 3BDAA 2H1IA 2DE0X 1H1DA 2OGZA 1ZJZA 3FFBA 3GZJA 3HZHA 4J91A 4QLBA 4ZYVA 1P9RA 2MMCA 3D3WB 4PC3A 3ZW8A 1VOTA 4RF2A 4U6PA 1DZ3A 1GGEA 3OJCA 2NYVA 1RADA 4M46A 1L5OA 3K0SA 1XXHB 3MJDA 2F3SA 3S8EA 1O95A 4UXJA 3DWGA 5CE8A 2Q7OE 5L3VA 4NICA 2WWXA 4OFBA 5BMVF 3K1ZA 4FFBA 2O2HA 1EB9A 1G5QA 5CB4F 4DR1H 2J09A 5E1OA 1YJ8A 1ZUHA 2Q5EA 3HEAA 3RNLA 3WWEA 3UMYA 1AUOA 1T9KA 5T8KA 5D87A 4ESOA 2VJBA 5AVTA 5J58A 3RG8A 4KXLA 2GGSA 3K0CA 1XUOA 4DBLC 3EYWA 3I6ZA 4N7BA 4JJEA 3PNSA 4NF2A 3JYLA 1WUHS 5CX1A 4LY6A 4BO0A 4FFWA 1JPUA 4S1TA 3S2GA 1TLFA 1S9HA 3ZU4A 1MZPA 1KAMA 4DMGA 1DOHA 3B6MA 1UJ2A 3CS3A 2IXBA 4JYZA 3ANXA 3K73O 2HBZA 5H82A 2BZSA 3FYUA 3K2IA 3TQOA 2W22A 3B2NA 5C1DA 3IKTA 2JLXA 4HGPA 5JMOA 3CCFA 1S0NA 4JV0A 1JBQA 1V7QA 4ACAA 4GUDA 2FK3A 3QTBA 2VTKA 4IH9A 1BYUA 2GVDC 4PLCA 4YP7A 2VXYA 4AN0A 1G66A 4IUCS 3Q3GE 2OA0A 1WPXA 2B6NA 2VK4A 4CDMA 4JI7H 2XMZA 1UC9A 2FPLA 4NV0A 4FQ8A 5FA6A 3TTUA 3W6NA 1P5JA 2PXCA 1P4RA 4GM4A 4US1R 1O03A 1V8ZA 2ZJ4A 4CODB 2O8CB 3BXEA 5EJGA 3UCXA 1VIAA 4KXFB 5D1HA 1H6BA 2JLQA 1I1HA 2Y0EA 3P0FA 1SCAA 2R1VB 4NMMA 3BJZA 1TU4A 4RY9A 2CBGA 1SOMA 3TLGA 1V26A 2P0EA 4PSAA 3E2MA 1J8DA 4OTZA 4X45A 5EWMB 2WJAA 1MO4A 5LQSA 2HRCA 1S9FA 4JX9A 4CCWA 4G2NA 2CHUA 1GLNA 1NG9A 1TZBA 1JDEA 3JD3A 4MGEA 1K0UA 1GQSA 1CZLA 5BNIA 3U55A 1DE0A 3EIOA 4HDAA 1Z5PA 2Q3DA 3H2BA 2CZQA 2YVLA 1T13A 2ZB4A 3DBHA 1SD5A 4ZPXA 4Z1MD 4O7NA 3KKMA 1K0FA 5LPNA 2ZUCA 1E4FT 3EFBA 1H1LA 1ISJA 4RA9B 4XYMA 4XYLB 1ENOA 1XQXA 3W5SA 1Y33E 3IS3A 3PJDA 3N40P 1MO3A 2UXDH 4Y0VA 5KFRA 4O02B 1G7CA 3DM9B 4DN6A 4UMEA 2B3TA 2Z8YM 1CHDA 2ZM6H 3QYFA 3D5TA 4QGAA 4CW7A 2A59A 1J9EA 2VHQA 4PLHA 1X8KA 5B4TA 1B74A 3W5JA 1QGOA 4TWRA 1AT1A 3SYRA 3MT7A 3ORSA 3T4EA 3AERB 4QG3A 4P4UA 4RVHA 2O20A 3ACBA 2NM0A 3OTIA 3BN3A 5LLDA 1DO2A 4U7CA 1FRQA 4I19A 5DLEA 2J0UA 3HKZE 1GSAA 3PL5A 5KX5A 3CNBA 4KCGA 2O54A 3DR3A 4YB8A 4H60A 1GGMA 3H3VH 2B5VA 4C4YA 1A9YA 3R5KA 2V1XA 5B37A 3REQB 5C5IA 4D82A 3RUDA 3BACA 1V5WA 3TOXA 2GLXA 2P7IA 5FL7A 1Z6PA 1GDHA 4M7WA 3R7WA 4D1YA 4TTAA 2YTZA 1IHYA 4JP5A 1AF4A 1JXMA 3BFPA 3UN1A 4REQB 1DCKA 2YY7A 3KJXA 4HP8A 4R2XA 4PYRA 1PJ3A 3N6VA 5L3ZA 1E2IA 2ECOA 5LOVF 4GKKB 3LFTA 3ED5A 3I73A 3TTVA 2JW5A 3HYNA 2GYVA 3KJNA 1D1PA 3PUHA 4YJKA 4DT1A 1EUDA 5L1IA 3SVZA 3FOZA 2ZRKA 4QW9A 1QGUA 1SG6A 3H5TA 4UZSA 5LB4A 4CF5A 4IZIA 3QKRB 1DUIA 1YK1A 3I52A 1ANKA 3PRJA 4QUEA 5DNDA 1WDTA 5H3CA 3L8EA 1T0JB 4BFYA 3N3AC 3OHPA 2VHVA 1UL1X 2A30A 2W4QA 3KYHC 3FUXA 3VU3A 3KE9A 4AJNA 2G09A 3OLWA 4YY3B 5H83A 2I71A 1L5RA 3CLKA 4XI9A 1DAFA 2Q0HA 5LQJA 2BKVA 3RIGA 3JAMA 5JAQA 2XRYA 1E0JA 3D7RA 1U7PA 1YBAA 1XZNA 1NQWA 1MW9X 1OZ0A 2YZ7A 3SU8A 5D3ZA 4NU0A 4DSTA 1UDRA 2W6JA 3TM5A 4YRKA 2BFDB 5IRCD 2FCAA 2JGEA 4YCJA 2O50A 4X0EA 4Z9XA 4URVR 4IKOA 5JD6A 1XEXB 1GILA 2ZTMA 3JQEA 3I2KA 4V3CA 5J5CA 1JJVA 3G0OA 1I2KA 2ZWAA 3FKQA 2LP4Y 4F9TA 5JJ5A 3CNQS 1IJKA 5ITWA 5HGJA 1JKJA 4FN4A 2J08A 2EEZA 4X97A 3WQBA 4CKZA 3RUEA 2GCGA 3NLLA 4ENWA 3CWQA 5KAPA 4JXUA 5EINA 3CZ5A 4LEIA 5FRDA 3SQLA 1GPMA 3QQMA 1P9OA 3PXCX 4IXNA 3ZU2A 1VLVA 1NKTA 1MJHA 1SPXA 2F48A 2HGWA 2OFWA 2ZJOA 3EFOB 3R6LA 1DV2A 5C7OO 4PG5A 5JYCA 3VH2A 1N3BA 2V7PA 3LYAA 5HTKA 2BE9A 2XV1A 3O6VA 5KU1A 1TMYA 5CITA 4MK4A 3EN0A 2GSDA 3K6KA 4LC9A 1FVXA 3NHMA 5CTJA 3WFJA 2V0GA 4JLUA 3R7BA 1EGVB 2R6R1 1WSAA 1N4AA 5T6MA 2HUPA 4C0AC 3OIFA 1IXYA 4A73A 3R74A 4HBZA 1ONBA 3MCUA 1EK1A 3RWBA 4UHDA 4WXPA 2C9CA 3IPRA 1NN0A 2Z58A 5FBWB 1ZK2A 1NX6A 5EUBA 3PIRA 1Y37A 2YVQA 2HT6A 5B64A 1O96A 4HYTA 2YHAA 4F4UA 1OOEA 1FMCA 1KI1A 1DQZA 1JBKA 5DTQA 3AXTA 1VZ3A 5CYFA 4HKTA 5FL3A 2CZGA 1JFVA 1NFFA 1DMSA 1DKNA 2QTTA 4WN9B 1I10A 2C31A 4PZ9A 1XRLA 1YB5A 5IKPA 2BGGA 1E99A 5A3SA 1X1EA 2C2RA 1XZQA 3NVKI 5LD2C 1GPYA 1Z68A 4X8HA 3ERCA 3JRXA 3IDAA 2GBLC 4MRMA 2CXHA 4Q0MA 1WBBA 4M0DA 3NCHA 1ZVQA 2C99A 1EM8A 1OLXA 3LZCA 3DTGA 2B4TO 2H29A 2OILA 3C4JA 4P31A 1KEPA 2ZYSA 4YAKB 4Q1FA 3AUUA 5GZ3A 1OB2A 3LQ1A 3GRVA 3TKYA 3PW7A 3I23A 2IJGX 3A28A 1SEPA 1TNDA 2LCIA 2QUJA 3MN1A 5FTWA 3R7AA 4YXWD 5KQGA 4C6SA 3S81A 1QKIA 1EFAA 1JAYA 1WNTA 1TQ8A 4EEXA 3NBAA 3ROKA 1JG2A 4WERA 1I32A 1ULTA 1VYUA 2G80A 4BBRG 1IN8A 4HZUA 3TH5A 3SQXA 3GLHA 4KQGA 3KFLA 3CUUA 4NG5A 3RKSA 3UQZA 2H2HA 1ODCA 3SYKA 4AZSA 5CH5A 2V9CA 2HT1A 1JKFA 3SGLA 5L6LB 5JSUA 3DCJA 1F2DA 1HFKA 1IG3A 1B8VA 5I3CA 3THXB 2HSEA 2ZTSA 5P8WA 4W5NA 1W48A 2RGAA 3I9V1 4YI5A 3F74A 5HILA 3SX0A 1NNEA 2MTBA 3K3VA 4JI6H 4LF7B 4Z54A 1DAMA 2YN0A 3SYNA 1E18A 2RF4A 1VL0A 2JI4A 3AUFA 4IV5A 3AONB 3UB3A 2OD2A 3EH2A 5LZ4A 1EE2A 3RE1A 2XUFA 3QVWA 1G21B 4GBGA 4RIGA 1L8QA 3LPLA 4ZV7A 4ZVSA 1GU7A 1FQJA 4N49A 4ZOLA 1P1FA 3BD7A 3TY8A 4Q4HA 2R6AA 2HADA 1ZEJA 2O2CA 4OJNA 4OHWA 3T52A 3IUMA 2VYNA 3WFIA 5BNWA 3IKMB 3ECSA 1D4FA 3N0RA 5IVPA 4PNPA 2QMQA 3VU9B 3TUZC 1NMZA 2PL3A 3BD9A 5FJIA 4DDKA 5LZ9A 4C5AA 1I24A 5EWEA 1HEYA 3PBKA 4B09A 3CH7A 1KXJA 1X1TA 4JITA 3IRUA 3PQ7A 1B7GO 1YR7A 2DUWA 2MYNA 1JEQA 2IBMA 2UXCB 1E20A 4MRVA 1VSBA 2ZBPA 3E8XA 2PTHA 4DL5A 1SHLA 4US2R 3AR2A 4M0KA 3GT4A 2Q4DA 2MOKA 3UKJA 5KOIA 1AD2A 1EG2A 2FEXA 5K0BA 2GBIA 4GPBA 3SZ3A 2X4GA 2ENWA 5CFZA 4K3UA 2JH9A 1GYFA 2I99A 2DQ4A 1M74A 2WSLA 1WDLA 2OZPA 2LIVA 5FTNA 3TMYA 5BSFA 1A50B 2G1UA 4RVSA 1J97A 2GTIA 4IJMA 5EE0A 5H68A 1G98A 1TVEA 2VJOA 2QZPA 1ODJA 4QUAA 1SNYA 4TT8A 3I01A 1O5IA 3GHHA 1T2UA 3K1TA 3PYLA 1VRVA 4CFYA 3JR7A 3M83A 3FNHA 3TQCA 4E12A 2G5GX 3STXA 2O3TA 4RD3A 1Z28A 1SA0A 4U7PB 2PJDA 3L6CA 5C5JA 3RTAA 1R7RA 1WZUA 4PC6A 1J4AA 1NBHA 4ZPJA 2CUZA 3RAQA 3GBPA 3H5VA 3HDQA 2Z0MA 4DMMA 4M3NA 2DFVA 5LFAA 5MFZA 1QP7A 4TYYA 2J9ZB 3N7UA 2FFHA 4Z99A 3P45A 1E4GT 4L5IA 4MI6A 5KG1A 3DOEA 4ANFA 1QZ3A 2Z9DA 2V3CC 1J21A 1APBA 2C61A 2QRQA 2F4VH 4CU5A 1CRPA 3FUWA 2I4IA 2AOWA 3NXSA 4E0BA 1NTOA 2BT4A 2ASVA 1YI8A 1X87A 2JZOA 3KZNA 2PMEA 2FG7C 3TL2A 3VR0A 4KE9A 1EU1A 2EJ0A 3S55A 3ZU3A 2Q1XA 4QPZA 2I2BA 3VNUA 1CUIA 3OUUA 1NI5A 2JZCA 3PR1A 3WA6A 4J75A 4IJUA 5DLDA 5EJ5A 5K05A 1QPGA 3V4SA 4N76A 3BSYA 3KUXA 1PQ4A 2RHLA 2V96A 3KZXA 3NV9A 5B2EA 1DAPA 2QT1A 1SUIA 1Z45A 1GRQA 2PL9A 4LDAA 3ZD9A 4IP0A 1MQ9A 1XWWA 4CT4B 4ZO4A 1N56A 1F1BA 4O6VA 4PSVA 4MDEA 3L7JA 3KYJB 1EQ2A 2Y0BA 1P80A 2ZYRA 4FEGA 4TVBA 3TRFA 5BT9A 1TECE 6ADHA 3VYUB 4HWSA 2GARA 2FPIB 1M1XB 3IAFA 1YIDA 3AESB 3D4LA 3G5AA 3OMLA 5LD2B 3L1IA 2RH4A 4X6YA 4RLSA 4P82A 1IBMB 4E1VA 1J20A 4RU9A 4XSGA 4EBBA 4C3VA 3AY7A 2JDIA 1SRRA 2JA8G 1H4QA 2DXIA 1PYOA 3CINA 3G2IA 4O4LF 4IOLA 1JHOA 3R0VA 4B3IA 4KXUA 1INLA 1K8QA 1Q17A 4A3IG 3ITEA 3OTHA 1FYWA 4Q9IA 1DAAA 1EJ0A 1DOZA 4MV9A 1K86A 1M2GA 2C1EA 2CL0X 2MYTA 1WB6A 1SUWA 3B1KA 3IT2A 3OOYA 5G1PA 2VJKA 1GNLA 4RK7A 4Q9KA 3GLFB 2RE8A 1T6BY 1I3LA 5KYYB 4TTQA 4DCNA 1U0BB 2Z5GA 1DGSA 2OSBA 1TW3A 4HNTA 4EFBA 3OM8A 3AR7A 4QOIA 5EJ4A 2UZ1A 3CLTD 4R1LA 4HVLA 1E1NA 5E0OA 4MAMA 3H2SA 2XD4A 2X7XA 3R3UA 1R2QA 3X2EA 1CZOA 2QWXA 4QO7A 1TJ5A 1N33B 1U3WA 3D4NA 4FDVA 5JAHA 1M6HA 2NZJA 3BL8A 5AKJA 4WN3A 3WOVA 4QYWA 5BXYA 4LXTA 4DV7B 3AEKB 1AS2A 3CF6R 5IJAA 2ZAOA 3E4DA 3V6KA 3I0ZA 4JOCA 2MSKA 2ZI4A 3BB1A 2HKIA 4I6GA 3S2IA 3OC6A 4DR7B 3EXEA 4QM7A 3HCNA 1XTSA 4IY1A 4OMFG 3R77A 4IO0A 3ZHTA 3Q8QB 1MC8A 3JYOA 4C0HA 4BIIA 1V35A 1YNSA 3T5MA 1VJDA 4HDNB 4NCIA 2FMAA 4GU5A 1W49A 3TXAA 1K06A 3FAZA 3UV3A 4PZZA 1ESNA 3EUWA 4DA6A 4XSVA 2IZZA 1A9SA 4KYIB 5EYPB 2PUBA 4IX9A 2GQRA 2WEKA 2ZYGA 4U7JA 1E9EA 2XKAA 4A3BG 4K2HA 4QEKA 2F3UA 4XGQA 1KWKA 3RG2A 3R7FA 5CCXA 2QTWB 3RQIA 3PFBA 4MVXA 4F38A 5ERXA 4I1PA 3HOXG 1FP7A 5AKYA 3MD0A 2FDXA 3HR8A 5AT1A 4DGQA 1JKXA 1GPKA 5EVJA 3K0FB 4U2BA 2J0SA 2XGQA 3GLGE 3D3JA 3QG5A 3C5WP 4QODA 2AI3A 4EFEA 4KGVA 5IT4A 3THYB 4Q01A 4D0SA 2Q2TA 2UXBB 4E22A 2AJDA 2CKDA 5ED4A 1GD1O 1QGDA 3BXOA 3QH4A 4E4TA 4FYHA 1OI4A 3BL5A 1N36B 1YD7A 2Q7DA 1SVKA 5ALQA 2GM4A 4ZJYA 1AC5A 1QK5A 2ZWPA 4BE7B 1NLUA 1BH2A 3I4FA 1A9XA 1Z26A 3A25A 2VDPB 1E3WA 1YFZA 3LCCA 1FFYA 4MYCA 1HDIA 5G1NA 4YXWA 4BNIA 1YQ9A 3MG9A 4AU1A 3ABQB 1GNSA 3WL6A 4I2NA 4RTSA 3G7SA 4V02A 2E18A 5FPTA 3MK31 4I1OA 1ZO8A 2EC5A 1F2VA 2IZ7A 1P0IA 2CVOA 3OY7A 4OH1A 4PLWA 3IILA 3RB4A 5E4YA 2PGLA 4FXOA 1BAPA 5EKUA 5IJ9A 1QO0A 1T2AA 4B40A 1U5CA 1FNBA 2J0QA 4NHEA 1XXHA 5JPIA 2OAQ1 2PQ0A 3DCIA 5B7NA 4C7OA 5I8PA 2RJ3A 2QVZX 2V4ZA 2YFKA 3OWOA 1IM2A 1LI4A 1MABB 4TTRA 3ZJYA 4F2GA 1M7BA 2XVZA 4ATNA 5FEUA 4M6WA 1J22A 1S89A 3V1TC 3JXEA 1EEHA 1NV9A 1Y9JA 1A8PA 2BGTA 4CIDA 5TQJA 2B92A 3N39C 2DPMA 2G4LA 2RGYA 3S8YA 2W70A 3LOQA 1UAAA 3P27A 2BUBA 4RK0A 4UUQA 1U2GA 4H0NA 1KAOA 2Z3VA 4G0MA 4RK5A 1SXHA 4AJHA 2YIMA 3A37A 5JH7B 3U16A 1HQYE 5EG5A 2H52A 1NVVQ 3VU8A 4YCCA 3BRWD 1A1SA 1GQRA 2B7BA 3E53A 2HJWA 2WB1E 1ZN9A 2FGJA 2I1WA 1GLGA 3LPMA 4RQTA 4U6QA 5AHXA 4YONB 3TQFA 2GYWA 1MV8A 3NDIA 5DYNA 4YJ3F 2QSYA 2YFYA 1JJ7A 2XWQA 3PXXA 2K7ZA 3DEJA 3QNUA 1I4WA 1JH8A 3BYZA 2I2CA 2Q5CA 1SXJD 5DJ5A 4IR7A 4FM9A 1L5WA 3IUJA 3KOZA 2CFRA 3AIIA 4F3NA 5TVGA 1OXSC 2AXQA 1IPEA 5DX8A 2QQGA 4H0CA 4TRRA 1DC8A 4ZYTA 3P4XA 4B2PA 1YE5A 3HXQA 4CMCA 2JD0A 3VYTB 4MICA 3WB2A 4DG5A 1S8AA 2IYLD 4K87A 1LVHA 1OAOA 2HJ9A 3DVRX 3T38A 4BQRA 4P9NA 3E7DA 3IX7A 3ONEA 1ICEA 3INNA 4LDZA 4ZEWA 4DCCA 2JGDB 5IUJC 5GWXA 2HDHA 3LHFA 1AZSC 4L5AA 4FZ3A 3QF7A 2NO5A 4ZO9A 1CYEA 1VKOA 1EVLA 5IAGA 2JKVA 5J59A 5FQOA 1Z0KA 4I3GA 4LYJA 1QU2A 1KEZA 1EWRA 1T4C