2FPPB

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 127
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fppB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fppB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fppB03
2YRXA 3WNZA 4MV7A 3R5XA 2DZDA 2YV1A 3GLKA 3R9RA 3NUAA 4IHJF 3AW8A 2XD4A 1B6RA 4IZOA 4DIMA 1EYZA 1M0WA 3G8DA 1UC9A 1I7LA 4MA0A 1KJ8A 2PVPA 4MAMA 5LOVF 2FB9A 1M6VA 4EGQA 2J9GA 4C5CA 1C3OA 4FGRA 4XYMA 4FFLA 3QFFA 1JLLA 4O7ZA 2HJWA 4I50F 5C8YF 4O4HF 5BPFA 4XX0B 3V4SA 3KAJA 2GPSA 1VKZA 2NU8B 2YS7A 3DF7A 5KX5F 2I8CA 3ORRA 2W71A 3TQTA 4FFPA 5D8DA 3KREA 3MJFA 2CZGA 4WD3A 3R5HA 4MV4A 3SE7A 3TW6A 5HBRA 5JVLA 3JZFA 2FPIB 3VPCA 2FP4A 3JRXA 2YZNA 3AX6A 3K3PA 3TINA 2OLSA 3KAKA 3LP8A 2YZLA 2IP4A 5HBRB 2W6PA 2R85A 3RUPA 1IOVA 3ORQA 2GQRA 3U54A 1KJQA 2I87A 2DLNA 4I55F 2R87A 2NUAA 3U9SA 1DIKA 2QF7A 3OUUA 4MV1A 3DMYA 2GLTA 4YAJB 2R6FA 3R5FA 1CQIA 2XCLA 1GSHA 2W6NA 2CNVA 5C1PA 1GLVA 2R7NA 4O82A 2W6OA 2CNQA 2YS6A 4I4TF 4TUYF 5BPHA 2VPQA 4O4JF 2PBZA 4MV3A 2W70A 2YYAA 3U55A 3RV4A 1KJIA 4EG0A 5LP6F 2Z02A 3E5NA 4MV9A 4FE2A 1SCUB 3K5HA 3U9TA 3HO8A 4C5BA 1KBLA 1AUVA 1BXRA 1EUDA 4FU0A 4YB8B 4XZ3B 1EUDB 3WO1A 1OI7A 1ULZA 5HV6A 2V5AA 2ZDHA 4ZQIA 2R82A 3N6RA 2V58A 5J2TF 4FFRA 2FPGB 4XYLB 5IYZF 4C5AA 2WYOA 3RFCA 5KKNB 2R86A 1EZ1A 2SCUA 2NU8A 4IWYA 2FP4B 4TV9F 1KEEA 1E4EB 4YJ3F 4HNVA 4YAKB 5DMXA 4Y8VB 3I12A 4ZI7F 5BMVF 4YB8A 2QK4A 1PK8A 4O7RA 2R7LA 5JVDF 1DV2A 1EUCB 2NU9B 4O2BF 1A9XA 4O7SA 3V4ZA 4M9UA 2X0SA 4NYEA 4XX0A 4O7NA 2YW2A 5C1OA 1EUCA 2NU9A 4ZHQF 1KC7A 3N8DA 5CA1F 1VBHA 4IWXA 3MWDB 2ZDGA 4O84A 1GGOA 3MWEB 3RV3A 4XYMB 3UFXB 4MA5A 4O4IF 4YAJA 3WO0A 2CSUA 3MWDA 4O7TA 2I80A 1CE8A 4O7VA 3VA7A 2YZMA 5GONF 3Q1KA 2YL2A 4Y8VA 1CQJB 4O7WA 4FFMA 2FPPB 1SCUA 5LYJF 4TV8F 4L1KA 4WBNF 4QSHA 1Z2PX 1GSOA 3TIIA 5CB4F 4RZQA 2R7KA 5H80A 2FPPA 3G8CA 1OBDA 5EZYF 1Z2NX 4YBZA 5FNVF 2W6MA 4MV8A 5JQWA 2GPWA 2W6QA 3MWEA 3KALA 2FPIA 1OBGA 3UFXA 4XYLA 4XZ3A 2NU7A 1A48A 2FPGA 4DLKA 4YJ2F 3Q2OA 3HBLA 4IIJF 3K5IA 1EHIA 5CAEB 4O7YA 4E4TA 1KUTA 2YRWA 4O81A 4ME6A 4MV6A 3JRWA 2CNUA 1JLLB 1I7NA 2P0AA 1Z2OX 2GQSA 3JZIA 1PX2A 1WR2A 4ZOLF 4YBZB 4EGJA 2R84A 1UC8A 2R7MA 4YAKA 2W6ZA 2V59A 5J2UF 4HR7A 3VOTA 4HNUA 3LWBA 2NU7B 1BNCA 4HQ6A 3PFFA 2Z04A 4O83A 1JKJA 4O2AF 5LXTF 1KJJA 1B6SA 3VPDA 2SCUB 3R23A 3BG5A 4FFNA 2VR1A 3GIDA 1M0TA 1C30A 2YWVA 3VMMA 1DV1A 2NUAB 1KJ9A 3ETHA 3TIGA 5K2MA 2NU6A 2ZDQA 1IOWA 1CQIB 3OUZA 1JDEA 1CQJA 3VPBA 4HNTA 2NU6B 1W93A 5I47A 1VBGA 5JQGF 2DIKA 2HGSA 2YZGA 2VQDA 2PN1A 1AUXA 3ETJA 1JKJB 2C00A 2DWCA 1E4EA 5CA0F 5JH7F 1T36A 4O86A 3HB9A 4FFOA 4O4LF 4O7LA 2CQYA 1CS0A 2YV2A 5LA6F 1JDBB 5CAEA 1W96A 1GSAA
chains in the Genus database with same CATH superfamily
4JU8A 3ZDXB 3C4JA 3TLMA 4CR8A 4QT4A 4KMOA 4EAQA 1JI0A 4RE5A 5FKJA 4N49A 2I66A 3NALA 4B4DA 3F3MA 4Q19A 3W5AA 3PCTA 3NUGA 5DCYA 3IO5A 3AB7A 3EEBA 3GO4A 2GWHA 3NHPA 4X5OA 3PQ2A 4JI5H 2WKRA 5BYBA 4IHJF 2FK7A 3C7AA 3PPWA 4DAAA 4LKOA 4G0YA 4ASUA 3W1GA 3H42B 5AJVB 2X14A 4XJVA 2QBYB 2ETVA 3TO5A 4BFXA 4PW0A 1COZA 4U6NA 3JQGB 1AQLA 1CD5A 2GZ2A 3AU8A 3GRRA 3HNPA 1Y1LA 3MCZA 1MJHA 2WAXA 3OJXA 4EIWA 5KTOA 3U44A 4GYJA 2MDTA 1UC9A 4O3RA 3HZHA 1DBVO 2ODBA 3T41A 3KKEA 1QDEA 4CEHB 1E2QA 4Z7NB 3L01A 3O03A 4BEVA 4DAOA 2R5NA 5CE8A 1TUGA 1QPGA 2RJOA 4OHMA 4B17A 1RK5A 3TD6A 2XODA 5KVSA 3WC4A 1WV1A 4A0SA 1CERA 3A1WA 3BQNB 2HREA 3A1DA 3D8BA 3LFTA 4LWOA 4OHKA 3ZGNA 2FDRA 2P9ZA 1YKSA 2DB3A 1E2MA 4JVMA 4RB2C 2C28A 4F7WA 1ZHFA 3LBNA 3RWOA 4OOEA 4CU2A 3KKZA 2G5TA 1P29A 5FLMG 4L85A 3OZAA 4KNVA 4XLZA 5TSDA 1G41A 4RV4A 5IF9A 1YZ3A 4KTTE 6YASA 3THSA 1Q57A 4FB4A 1AB5A 3UAWA 1PNTA 5IXSA 2C7OA 2H1IA 4CQMB 1J56A 1T9BA 1H1TA 1Z4OA 3GU3A 4ZOLA 5CT5A 4EUKA 3KFVA 1MO6A 4LF8H 1QHNA 4CF6A 2VNHA 1LTHR 4GAEA 5SICE 1V1MB 4NZYA 4CQMD 2DQSA 4BFSA 2OK7A 3LUDA 1UPXA 4EB6A 1L4BA 1MJGM 1YL5A 4KGXA 4E2WA 5I7SA 1SVIA 3RC7A 5JVLA 1YJXA 3KEGA 3LQFA 4XGNA 5C5CA 1O6FA 1HXHA 3BGSA 3MR5A 4HS4A 4X6UA 5KFIA 2HUNA 9LDTA 1RSZA 3RT9A 2HHCA 3TWOA 1IG3A 3UPDA 1RLIA 2QBYA 1DXQA 2AFHE 1OBVA 2C9YA 1L5LA 5A71A 3GZ4A 5AK3A 3VHRA 2WAMA 2BDUA 2D5CA 2QL7A 4F50A 1G8YA 2W58A 2YYZA 4OVKA 4FGKA 1RADA 2IXAA 4NE2A 2PKRA 5BNFA 3UHOA 3VR4A 2WB2A 2D2FA 5A0FA 5BSGA 4YP3A 3R76A 2F55A 2RH4A 4XD2A 2ZWVA 1N0IA 2Z43A 1ZAYA 3GJ0A 1YNSA 3OHSX 4A3BG 2VKQA 1LI4A 1M9NA 1U9YA 2DSTA 2ZQ5A 3CNHA 4MWBA 1NDQA 2JAHA 3GEEA 5FX2A 5LIRA 3ID6C 3WLNA 1PV1A 4M8NE 1H2AS 1O7JA 2I2BA 5CA1A 4KPYA 5AW4A 4OL0A 4R16A 2R87A 1BJTA 1T10A 1NOIA 1ZD2P 1G42A 2AQKA 2CVFA 2NUAA 3QVJA 4K26A 4KH0A 3RQIA 1DI0A 1XWFA 3S2IA 5IFLA 3DMYA 3S8EA 4QG7A 1S4MA 3WB1A 3E61A 2PUDA 5JRDS 5KCZA 2C1EA 2VNAA 1BN7A 2H48A 2UVVA 1C0EA 1IATA 1P1IA 2XRFA 4OX9B 4EWLA 3EDOA 2WJ6A 5AVZA 5E9WA 4GWGA 3M9WA 1VCHA 4CBVA 5FPPA 2J4FA 4RF4A 1BQ4A 5EP3A 4J0QA 4IR7A 1ZM4A 5GJCA 3TNYA 3ETLA 4FNMA 5HZKA 1K5PA 3OHAA 1NVVR 1V43A 1W73A 2Y27A 3F71A 3NCTA 4PLHA 4E46A 4DDVA 2IT1A 4ARIA 4X8OA 4AJOA 3OPMA 1GA1A 5L9XA 1PP4A 4I4TF 1W6UA 3RSSA 1NR1A 4FS1A 1I4EB 1K9SA 5FUWA 1EK0A 4KBFA 4Z4GA 3E22B 4O4JF 2PBZA 3UK2A 1EIZA 2BM1A 1CKEA 4YJ3A 2ZSJA 4J0HA 2FE1A 2YYAA 3ICPA 3UVEA 4JI7H 5C46F 1G7TA 2Q9AA 3VYUB 4DREA 5A5FA 2Q1YA 4GC9A 5CYOA 5DLPA 3W5SA 3WRVA 4AY4A 2HA0A 1T9DA 1EX9A 1G7CA 4I3FA 1XTIA 3A14A 4IIEA 3E9CA 3ZU3A 4AMZA 3MBIA 4O4JA 5A3SA 4OQXA 5HWSA 4LXTA 1E8NA 3RU2A 2A67A 3K8QA 2QSJA 4X64H 4G4SO 4JNCA 4GGPA 3MWMA 1DGQA 2I2CA 5E2IA 3RRBA 5K09A 4QASA 4A8JC 2E21A 2GZDA 2YWDA 5I6DA 2ZUUA 5P8WA 2PJDA 2IS1A 4JD5A 4OLFA 3RTAA 5A0VA 2XI4A 2C2HA 3I6MA 1Z0UA 1N0VC 5D00A 4D9GA 5I3CA 2FR0A 2QTZA 3NBAA 1X7WB 4PYIA 3V7FA 1KNXA 1IK6A 3FBWA 2GRUA 1Q1EA 3M1AA 2I9KA 3DVSX 3JSNA 3MRSA 3DXYA 3Q9UA 3JAWB 4R7GA 4F5DA 1A3GA 1HTTA 1SCDA 4XZ3B 2WUDA 3IQZA 1Q50A 4YJHB 4E2YA 1FJHA 1OLSB 1DIGA 2B9VA 3JQBA 3WMXA 1YGYA 1R4NB 1KYXA 4WQMA 4X20A 3T6KA 3PITA 2WMOB 1P7PA 2C5LA 2EZTA 4BMXA 2ZYTX 4MDFA 5BWNA 4LQ4A 2VSXA 3H2YA 3BQMB 2IU4A 1K83A 1K2VN 1M76A 1MUUA 1MVOA 3K4QA 3CIOA 2LWIA 1FFAA 4UMEA 4I50B 5IMSA 4BIMA 2D7DA 3ZU2A 2O1XA 3DL4A 1I2MA 1LZKA 3W4KA 5KBYA 1Z34A 3NFYA 5EWMA 5IKOA 2WD7B 4BBRG 1VCMA 1QGUA 2I7XA 2OV3A 4IFEA 5E3HA 4HGPA 4RANA 1T0JB 1XTBA 5CPBA 5KFOA 4FDTA 4JELA 3GWZA 3DHEA 4QXAA 3MWLA 3CN7A 3FIUA 1P7CA 3CGWA 3HWRA 5EXEA 2H63A 2HGXA 1RYNA 3EDRA 1L7QA 4JUBA 1SMKA 4F3TA 4MLPA 3HVJA 2GA8A 3KHHA 3TY9A 1PT6A 2G1KA 1D9ZA 5JD6A 2O0HA 1G16A 2I67A 4IMRA 2P9CA 5LQNA 1IDOA 3L7KA 3W1EA 2FVYA 7REQA 1ZHQA 1Y9DA 3BYZA 3Q10A 3QJ5A 5B1IA 4G0NA 1F2TB 1TYBE 1XTUA 1PZNA 5TPWB 1EJBA 1IB6A 3ZIDA 1QG4A 3QU4A 4WKNA 1T3ZA 1IQRA 2Z9DA 3I0MA 4KZPA 4XLTA 5ALHA 4IZIA 5FA5A 1UL1X 1S8FA 2E82A 4WL0A 5BWLA 2WWVD 5LBIA 5CVUA 1GZ3A 1N57A 2VDKB 3Q2IA 1JEOA 2GM4A 2H7VA 2GN1A 3PQFA 4M2LA 4OHBA 2XLCA 1TKAA 1FNBA 4GLOA 2FFBA 3ZYZA 5AI0A 1CF4A 3E9MA 1XCGB 1MZBA 1Z74A 1P9NA 2W6IA 2X8WA 4W5QA 1YVPA 2MSCB 1ZYUA 2ENUA 3ND8A 1VZ2A 1MQ9A 2VT6A 4OI4A 3W3AH 1QO0D 2RGBA 3U7RA 3SXUA 2NUTB 2HY7A 1PWHA 2XITA 3BULA 1G7RA 4NZNA 2IKQA 2VOJA 3PR4A 3F97A 4YONB 3N2YA 2JFPA 3V2GA 5JSYA 3ZEAA 1JH9A 4D4GA 3ST7A 1XK5A 1A4UA 3PIDA 3R3VA 3N8DA 1SK9A 3UENA 2EG5A 4ZAGA 3ZDEA 4HQRA 4D81A 5T8KC 4XSVA 1KK3A 2HYIC 2JK0A 2D2IA 4BWYA 5JATA 1FJXA 2WNHA 3C1AA 1UIMA 2Y4RA 2QTTA 4IZHA 3IAEA 2H5JA 1KXZA 3C1TA 2JKVA 1ENYA 4DTIA 3ZE7A 5AW8A 3EEYA 2CBGA 2C9OA 3LQ1A 3RSFA 2I76A 2VHWA 1ZIPA 1BWRA 3I09A 4UASA 3LULA 2FX3A 4ZPJA 5LJIA 3OCZA 4WA7A 2HEIA 2MT9A 1LTQA 2GBLC 4WJKB 3KM0A 1L9XA 5CT6A 4UOZA 5ES3A 3U6BA 3K0FA 3WAJA 1A8QA 1RTTA 4IILA 5CLHA 5G0TA 2FRDA 3B1YA 3E81A 3G0OA 3U40A 4MHSA 3A9RA 1F2TA 4V03A 2N1BA 4QDOA 5EC8A 5LL6b 4MV0A 5KFYA 1FMLA 1BQEA 1JDSA 1V3VA 2C0PA 2OCPA 4CW7A 1XDGA 4F06A 1ZMTA 4GT1A 5EWJA 1TB4A 2ILVA 1OU4A 1X7ZA 2ZJ0A 3A2MA 5EIWA 4FT4A 1FQKA 3BRQA 2WAOA 3PIIA 4X9XA 3RG8A 4DR1B 4YI3A 2OG1A 4WBNF 2OGSA 4REQB 2CWWA 3ZJ5A 4QSHA 2CNLA 3IPRA 3WLIA 2NIPA 2E37A 3PD7A 3MRXA 2GK4A 3Q9NA 1TK2A 4UUQA 4MTEA 5DW3A 4DQNA 5DLGA 1WSDA 2FUEA 5DBEX 2BFBB 3CX4A 5FI1B 4A0RA 3WDLA 4ARBA 6PFKA 3AO0B 5EZYF 4D3DA 1CVIA 2BTQB 1JHXA 3FX2A 3TQSA 1T9GR 5CP8A 4A3EG 5AKYA 4DUYB 3ZWNA 1ECPA 2XUZA 4HDNB 3DM5A 1T2NA 3ZCUA 1ZI9A 3LCJA 3EXHB 3NRCA 3RVRA 2GEDA 4X97A 4F11A 4R0NA 1PL6A 4EFDA 1DBPA 4RHCA 2YHBA 3D1JA 5EMMA 4CMFA 1C5KA 3H05A 5DYTA 3FIJA 4CMIA 2AQ8A 1OBGA 1Z08A 1R16A 1Q12A 4FOOA 4XSGA 2XCSB 4C4PA 4YAGA 4KR2A 1L7AA 5KWIA 3NORA 1ZI6A 4M37A 5LQMA 2QTRA 1IY9A 3L0CA 1V16A 1YRLA 3LYUA 4P92A 5D87A 1A9RA 4GOND 3VC7A 4A8PA 2ZUDA 1JIVA 4QYXA 4BB9A 5CDSA 1G6OA 4EYOA 4C7VA 4DLKA 3K53A 2JPDA 1MH9A 1MRZA 1VBMA 1WSBA 3AHIA 3QVOA 1BIFA 1E1KA 4GVXA 2EP5A 4IR1A 4HYYA 3RRZA 3TM4A 3QUSA 3WL8A 2X9QA 4OXRA 2PZMA 4A2PA 3JASA 3QLVC 3VOBA 1VE3A 2WMYA 1Q14A 2BEWB 3LECA 4RQBA 1MVLA 2EX4A 5FP0A 3SU8A 3UB2A 5KG2A 4FW8A 3HOVG 2BH2A 5JAIA 3NDJA 3D4BA 2HDNB 1YR7A 2JFFA 3GDFA 4MQUA 4BKQA 3QBEA 4A3KG 4KB5A 1L6RA 2B99A 2CN1A 3KKKA 3MIZA 3RIEA 3RUEA 5AVKA 3ZZUA 5CYFA 5KFFA 3T7KA 2CHGA 3OA2A 1JLLB 2FQXA 2R93A 2B4YA 3OMXA 1TC2A 2JIZA 5C8YA 5HK9A 1WY5A 4X1KB 4NEQA 4R8MA 1MQ8B 1IJFA 2G40A 3I0NA 2AZ4A 1ZGGA 4HAYA 2WUFA 4HPJB 3ZUGA 1PDOA 1XMIA 2IL1A 2YIMA 4D0SA 5JJCA 3VDQA 1V8DA 4U2DA 1P62B 1GUAA 3L0SA 1Y1QA 4ARAA 5BNZA 3BWYA 4FJ1A 3QU7A 2CCGA 1YI1A 1GL3A 1CUIA 4B3SH 1QFZA 4HPWA 5JYDA 3F98A 2F8TA 3ROFA 1MIHA 2WAQE 1V7CA 2HT6A 1JALA 2AJBA 2GPJA 4A26A 2FW9A 3DFUA 1RWBA 1ZN9A 2BL4A 4A23A 5DX8A 2AN4A 2JAUA 3ZLUA 2IUEA 4QNRA 2PL3A 3I9OA 1GRRA 2A1HA 3AU9A 1GTMA 1ZM3A 2OKGA 2MJLA 2QR3A 1DIRA 3NH6A 4W9RA 2Q2VA 4V39A 1T1RA 3PR3A 1OV6A 1TF5A 4LN1A 3E9NA 2OTCA 3QVMA 5CD1A 4FYYA 3PW4A 3H1PA 1PYGA 3GROA 1R4MA 1RQXA 3H9UA 3KYBA 5BYAA 2Z1DA 4FXPA 2DC1A 5DB4A 3G0CA 3K9LA 1U5BB 3ZD8A 1Z5VA 4RWEA 5EZ5A 4RELA 5BR4A 3B2EA 3HK2A 3CLSD 5HGJA 1PL8A 2P2LA 4O2AF 4Q82A 3WFZA 4DQ0A 4URFA 3O6VA 3G2QA 5BN4B 4Q3BA 5ALPA 3EVBA 1IG0A 1M5UA 2AUNA 2PO5A 2VLBA 4KG7A 3R23A 2EZ8A 4UVGA 4YRDA 1D7AA 2PRIA 4CG2A 5KOIA 5GINE 3RE1A 4NMHA 4X92A 4D2IA 4ACAA 4D6YA 2B78A 4H1WA 3OPYI 1ZG3A 1CUZA 1NDUA 5FOVA 5TGDA 4PWYA 4YXWD 4V3BA 4LF9B 5AXDA 2YWVA 3G5AA 3I5UA 2CBZA 1Z82A 3LHKA 4YCLA 1UJBA 3RLIA 4BO9A 1QG6A 3G0IA 3R3WA 4X45A 3F3KA 1T91A 3R3XA 3CX8A 5MF6A 3AVXA 1LKZA 4UFZA 2QN6A 1ZLYA 1E9RA 1SD1A 2P11A 4X8MA 3S1AB 3T0FA 2X1HA 1WBBA 5B3JC 2OP0A 3CXRA 2X2EA 3I6ZA 1K7XB 1ST2A 4WZAA 1MB3A 3L77A 1IOWA 4M7EA 3LT5A 3I6QA 5JSHA 4N48A 3H3JA 4KAFA 3S8MA 3BTOA 2AC7A 3EGDA 2O3UA 5I8ZA 2ECOA 1BQ3A 1ZXBA 3RSCA 3AFNA 3SYLA 4P35A 2VA3A 1OWOA 3QIAA 3N44B 1PFVA 4PCAA 4HNTA 2B8JA 2G17A 4IKPA 5KYXB 2O8FB 3IB3A 3E3LA 1AVTA 2VK2A 2PE5A 3DL0A 1RZUA 1TYZA 1XRQA 1ESEA 4HGZA 4WXEA 4E1AA 1I7DA 3P26A 3KLPX 1FDRA 1IBRA 4M0UA 2VNSA 3VYSB 2PN1A 3T9DA 1D1PA 1MX3A 1G66A 3BMNB 3KWFA 2QRVA 1Z68A 3AM5A 5CBKA 1SVNA 3V1YA 4WESA 2EJ0A 4ECQA 2A1TS 4X62H 3MK31 4XA8A 1TE2A 5AP9A 4PLCA 3SY8A 4LDZA 1I1LA 5CA0F 3VDNB 3H2SA 4MVJA 1UDWA 4MR9B 1OE0A 2Z8YM 5TARA 3TNDA 5BN4A 1YL7A 2FQQA 5BWOA 1ISGA 1ZD1A 1S8AA 2Q5IA 4NFSA 4C2TA 2VK1A 3DBRA 4MB0A 4EUHA 4Q3DA 2YV2A 5DBFA 2VUMA 3GJ8A 3O75A 3U39A 1M75A 2IYEA 4I5GA 1W34A 4JODA 2C99A 4WLNA 5CAEA 4H9GA 1MEOA 4QGHA 4A2BA 1XLTA 1XZGA 1T8SA 1VL6A 1KDRA 2R5WA 3FTNA 3MMSA 4GUAA 4ZOLB 1OASA 3HUUA 3TRJA 2O8CB 3PF8A 3ML1A 1JQBA 3ZYCA 1H4SA 4G65A 1BAPA 2IXTA 3N28A 1TCBA 1O6CA 1ZBQA 3G2PA 4CT4B 1NSFA 2HRBA 3IB6A 3HXLA 2I3GA 1FUYB 2W4QA 3V4PB 5EJ7A 1C8LA 1B4DA 2JIBA 4PO8A 2CE2X 1SUPA 2DFDA 3C6MA 4TTVA 4URUR 3RKRA 3EFOB 1JEYB 5I60A 2P40A 3JWPA 1GPAA 4BBJA 3CUUA 1S7GA 4X3CA 2V96A 2XY4A 1H8ED 1RWVA 4OXKA 4AYXA 5LBUA 5EWLA 4CLHA 1OT5A 4DIMA 2XSZD 3BH6A 3HKBB 1VS0A 1PR0A 4AO7A 3P9KA 1I4LD 4W6ZA 3VHLB 4QIWE 3INTA 3FNGA 4CHIA 5KFJA 3LYLA 4MA0A 3KB8A 2HF2A 4YN3A 1EJ0A 1ZGCA 4MJXA 4UUPA 4RPCA 1MKYA 4LJ6A 4RLQA 3WL4A 5ALVA 2XKKA 2XE7A 1AT1A 1D2NA 1JIQA 3SQXA 1LJLA 1ZC4A 3LDAA 5E4JA 2FK8A 5EJ2A 3AINA 3L40A 1MJFA 2J0UB 1TZBA 1BE6A 1GN9A 3DFFA 4CM1A 1LNQA 1PZMA 5KWSA 2PZLA 1HPLA 4RZRA 1TZ2A 3MMZA 4BIIA 1UZLA 4IMJB 1JPVA 2EWVA 1ZR4A 1XKQA 4ZIRB 5AHWA 2Q8QA 3KIPA 2GBGA 2YNMA 4X3OA 1NT4A 2P78A 4PO3X 4Q9HA 3OIGA 3QFCA 2FPXA 4B3IA 1NIJA 1TD9A 5ALRA 4LZLA 3U4GA 5DM60 1ZETA 3NEAA 4JENA 3GRUA 4GI5A 4NESA 4NX2A 2GX6A 4V3CA 4LBVA 4M83A 3G13A 1W44A 4CCYB 4EI2A 4Q37A 1NJ8A 1V95A 1D4OA 5I4CA 4WY2A 1UEXC 2JIQA 3P9YA 4J4BA 1YIOA 3NBUA 3HDJA 1QOPB 3PXBA 4ARUA 1AO0A 3L6OO 4YJGB 4CM4B 1SCBA 1NQ5A 3H9GA 2QD2A 5FDFA 3SD7A 5L51A 4B82A 3C3BA 1YH3A 1GGVA 2RDMA 2AKYA 4XW2A 1PD0A 2IP4A 5HBRB 2GF0A 2WU4A 3N6VA 3U81A 1IY2A 5IYZA 2J7KA 2JVJA 1S9FA 2YVUA 1HTBA 4TXMA 3TAUA 3R7WA 2QGFA 3OJWA 2HG8A 3PJDA 4V24A 4GXQA 2O3JA 4XTRA 3W1WA 1U5AA 1NVGA 2B21A 2NZJA 2YUTA 3MCUA 2E89A 3L5KA 3PB3A 4M0MA 1DHTA 1AX9A 1NR7A 3WBJA 3PTAA 1LI7A 4C7KA 3LUJA 2HBRA 5IASA 3QFRA 2DH5A 3LC7O 4F4WA 1HDRA 3HDHA 4L4YA 5DT2A 4ZI3A 2RB4A 4UUOA 1KI4A 2H4FA 2P5TB 1K8YB 3D3WB 3R5JA 4JC0A 5JCZA 1V35A 2HA2A 2X1VA 4QOJA 1P3Y1 4RJ2A 5EIBC 1VJDA 2AJTA 3TM5A 1RRKA 3A4YA 5C1PA 2HW8A 5LOVB 1LFDB 4WCFA 3HNOA 1I3OA 5KYYA 2D2VA 5F9NA 3SLKA 3V4OA 2J5RA 3CVZA 2V7TA 3MJVA 5LP6B 1UFOA 2P6UA 1Z8HA 3I4LA 2YICA 4C20A 1GPNA 4ND6A 2PRKA 2ZI7A 3MW8A 1EKXA 3FCAA 2OQ2A 4OI1A 3QE4A 1TCVA 5JWHA 4L57A 1NMXA 1NN1A 4KSCA 1GPKA 3UB4A 4AL4A 2D1SA 3L49A 5EUBA 2X13A 2ZTHA 3UANA 4YXWA 4RDHA 1H6DA 1NJFA 2WA1A 3BMXA 4B3HA 3V8QA 4YQWA 4RULA 2I2DA 3D6HA 4PGHA 5DWQA 5C4IA 4RNOA 1KJIA 3F96A 3UJPA 4C1NA 4OUDA 2CV1A 1GL9B 3F4BA 3Q3HA 3I42A 4L9RA 3B51X 3ZJYA 3QBTA 8LDHA 3VO8A 4XB6B 5AKXA 3RUDA 2OLKA 5A9RA 1NVWQ 3BGIA 4RXMA 4LOHA 3OAAD 4RCZA 4ZEOA 2VCYA 2RGNA 1FRZA 4C5BA 1EX6A 3ZE1B 3BGWA 3BCUA 5LA6B 1R8YA 4S2EA 4BMPB 4ODIA 1MBZA 2ERCA 3JD4A 3FNRA 3DAHA 3CLRD 4DLXA 3T7TA 4UULA 4B9AA 1EE9A 1Y6RA 5FB3A 1FFCA 3T5DA 4IEIA 3ICCA 3GYGA 5FFFA 1NUSA 1ENZA 3QYJA 4DM7A 2EERA 1I1NA 3EDQA 3VV3A 1FDTA 1G9TA 2OB2A 4DMKA 1G19A 4AO6A 1YVRA 4JYCA 3QPWA 1HEYA 5DISC 1NNUA 2WTMA 1TNDA 2YQ5A 4FKMA 4G1BA 4OV6B 2V3CC 5HK8A 1I51A 1QCDA 2C9ZA 5ALKA 1WU7A 2QQGA 1WV0A 5LU8A 1KVTA 5AMXA 5CDHA 2IBTA 4IO0A 2JW5A 4P81A 4J0FA 5FLKA 1K6JA 3CLUD 4MVJD 3VR6H 2NP7A 1IEWA 2X8BA 3KKQA 2JIOA 3W3AA 1GT91 2DPGA 4WXPA 2HB6A 3PUHA 5TS3A 1JEQB 1EMDA 2OV8A 3W7AA 3K16A 5LQDA 3V1TC 4IVNA 4MTDA 3BWBA 5A06A 3VZQA 3GK3A 2ZSIA 3HFJA 3ZVLA 1HRDA 3SX0A 3ZZTA 4JKIA 4AT1A 2IZOA 1Y3IA 5HKKA 1JX6A 4J91A 3I5YA 4MWEA 4NPAA 1PEDA 1ZH6A 2IY7A 4B9EA 4ZVRA 1VE6A 2FN7A 3GAFA 3GCXA 3N42B 5KFCA 1N2XA 2ZKIA 3O8BA 4B3MH 3KSUA 4LJ4A 4WOBA 1GNSA 4AO8A 1RFLA 3G1UA 2CZCA 4QOIA 2UUAB 2FEXA 3TDNA 4CCSA 3GDEA 2YVKA 4OK5A 1Q0TA 4DR7B 3IN5A 1X1QA 5D3KA 4FQ7A 5LZ7A 1QGED 3PKZA 4M8SA 3REFA 1XDBA 4CMKA 5C7OO 2BI8A 5FI5A 3TLXA 4CMEA 3IXMA 2VH1A 5KQSA 3IIKA 4F4IA 3ESZA 3PE3A 4K9PA 2RC6A 2XV1A 4BP1A 2X3UA 1J42A 2W8KA 2IYTA 4IX9A 2KE5A 3RJ9A 3WYAA 3S7ZA 5BQPA 5DHTA 5TQVA 1KIAA 3UWOA 5B6IA 1PR2A 3KT0A 2J5KA 4F46A 2CNDA 2ESRA 4MKRA 1EUCB 4RA6A 2A92A 1Y82A 1KAHA 2C31A 2JJ2A 1TECE 3GOQA 1JIXA 2VJOA 1E2GA 1LDBA 2HYDA 1GYPA 3L7YA 4M1WA 1Q0QA 4R2KA 4BQFA 3U7QB 3H3FA 3V4VB 4DGSA 2PX0A 4BLUA 4L4SA 1PZEA 2HT1A 2DWQA 4Y6QA 3LNCA 3B6KA 3FG9A 5JTTA 2HI0A 1JE1A 1A9QA 3Q7TA 2BELA 1J25A 5KO2A 1U1EA 5KDLA 3IJRA 3CJTA 3TL2A 2QMEA 3V1MA 5AVTA 3T99A 1MPTA 2JJ1A 3I6YA 4YMLA 1DC3A 1KC7A 3RRXA 4HDOB 1U0RA 4R8SA 2R8IA 3PE6A 4LF4H 2ZWAA 4TTSA 5KAMA 2NMVA 2PS3A 5JNSA 1EFDN 2FW1A 5I9MA 1CSEE 3AUUA 4NMWA 4TS9A 2V7PA 2VZEA 4MPJA 1P18A 3LOUA 5JQGB 3EC2A 3IAFA 3MLBA 3OU6A 4KXNA 4UM9D 5AOAA 1FDSA 2GTHA 2YXDA 3S0JA 2BD0A 3K8YA 5CXXA 3GFBA 4K40A 3KPVA 3TZLA 4F84A 4UCRA 5D1OA 1ZH4A 1U0BB 3U4QA 1IK4A 4A3LG 1B2RA 4UUAA 4YJ3B 1JHQA 1B43A 1MC1A 2BR5A 1LS1A 4IUBS 4MJ7A 2IC5A 4DR4B 3VC2A 1CDZA 5GONF 2F2TA 3NAZA 1HKHA 3BN3A 4YPVA 4U2EA 1X1SA 4DSTA 4HNRA 4UEOA 2XKJE 3ELUA 4QIHA 5L1KA 2PD3A 1PF7E 2QLFA 3OM8A 3AIKA 3BXXA 4ETWA 1CRWG 2UXBH 1TDJA 1G60A 4O1MA 1VMAA 3V6JA 2BEWA 2KI5A 4Q0MA 4MUAA 3DTNA 5DE3A 4F9TA 3HXKA 4E07A 4L1KA 1L5FA 2DABA 2XA1A 1E6WA 3IR7A 5FWYA 1QC5B 3EMVA 3ABIA 2VDMB 1GCAA 3O94A 4HWKA 1YS4A 4CIDA 1WB9A 3K94A 1U8XX 4LSXA 4BNDA 4WOPA 5K2OA 4Q48A 3REQA 3LPLA 4S1TA 4EJSC 5JJ5A 2FPPA 2O5CA 3LAWA 1SUCA 1RABA 2BJWA 1T36B 2BONA 3S28A 5JEDA 1CYEA 3TZCA 3P1JA 2X0EA 4DDTA 2VCHA 1LRKA 4N0DA 3CONA 2ZREA 3DAPA 4KHPH 3WLEA 3M8KA 5IJWA 2D4HA 3G6KA 1XZAA 3T7IA 2NNWB 2FUG1 2HIGA 1Y6QA 3NPAA 4HQ0A 3NHJA 3KALA 1DKNA 3DG9A 1V9CA 2ADOA 1DJNA 1KH2A 3CU5A 3M4IA 1OZ0A 1YZTA 2ENWA 5DM4A 2E55A 1AGRA 2ZITA 1S0MA 1FSFA 1V4YA 2I6QA 1G5HA 2IPAB 4KL8S 4ZJYA 4QM6A 1YC2A 1SZJG 2FK2A 4NNOA 1X39A 5G1OA 5B1SA 1EQAA 2DFVA 1DINA 3AESB 5KFGA 1FXWF 2EEPA 2PBRA 2ZULA 3EAQA 3RSGA 4EJ6A 1E20A 2FSPA 4I9UA 4EGCB 4L8GA 4KQGA 4B32A 2JLZA 3DEAA 3AKZA 1VE9A 4M98A 2A9KA 3TMYA 1O54A 3AR2A 4U00A 1GNRA 2C78A 4R40A 2I2AA 3VKUA 5F64A 5L3QA 1Z5OA 4RYDA 4TYYA 2WDPA 2HJ9A 4PRKA 3T3MB 3CUKA 2YRWA 1Z6PA 1ZHSA 3AKEA 3K0CA 3T9CA 1IVNA 2PZEA 4JI3H 3GVPA 1XQYA 4DCMA 3IOMA 1SXJA 4ABTA 4URZR 3GIMA 2VHJA 3U1VA 1C0IA 1E8MA 1KZ7B 1TK3A 1B8PA 1TU0A 3TNFA 3ZGZA 1RHUA 2OO5C 4Z4CA 3REQB 5GIPE 2VG8A 5D86A 4Y2XA 4Y98A 5IWCA 4CKEA 4QW9A 1SUWA 2YNMC 4I19A 1QR2A 5CJ2A 4DSNA 3OQNA 3IEMA 3TDMA 2VBFA 1QO9A 3GF4A 4AQYH 1VKOA 3SS9X 4RADA 4R8UB 4FP9A 5DHQA 3F6RA 4FYMA 4BS9A 4ZT3A 1Q7EA 4WNIA 1LSOA 4YAKA 2JCSA 4D4KA 3H16A 4HDKA 3ZHZA 5KTSA 1UMCB 5BR7A 2QRPA 2EZUA 2VA9A 3CR8A 1JYSA 4KP7A 1JLRA 1MC8A 3IT3A 3IPAA 3HABA 5A2GA 3HCDA 4HR7A 3KXPA 3E5HA 3N5CA 1E79A 3RWBA 1FDVA 1E77A 1O5OA 1YIDA 3K8ZA 4HGQA 3PKJA 4UAUA 5KT2A 2FFQA 2XEXA 4N5IX 3WLHA 3PFFA 3QQ5A 1JBQA 1JU9A 1T1SA 1I1MA 1UZUA 3TLBA 4AWBA 4WBNA 3EPIA 3DMPA 1QTRA 5ITVA 1FYXA 1GM5A 1XWIA 1MX1A 1KOLA 5JSZA 3G02A 4KFRA 5K6AC 5FTKA 5BYKA 2PIDA 4C0WA 3I61A 4BBPA 2FLVA 4G1FA 3ROEA 3PJRA 2X0RA 3C14C 2ASLA 2LKCA 2Z4TA 2GAJA 2QU8A 3ICEA 3Q5EA 3SP1A 1K6MA 3MD9A 4J2OA 3K30A 4MYRA 5J63A 4C30A 3DKIA 4Y1FA 3AFIA 1CKNB 5KG4A 1Y1PA 2A9JA 4TV8B 4C14A 1SXJB 2IEBA 3O91A 5IP9G 1SU7A 3OE1A 4XPIA 3TB4A 2D6FA 1G0OA 4XM2A 2VT2A 3ENVA 4ZAFA 1E2KA 3OQIA 1E4YA 4PFSA 1RJ9A 2A8YA 3QMMA 1NUUA 2FP3A 3NNNA 4Q9NA 2WF5A 3FYHA 4KX3A 3L79A 1USUA 4BGDA 5ICMA 3CF4G 3GLRA 1UBEA 3NYIA 4ND3A 4N40A 2RHDA 4UAVA 1NF2A 3TRIA 4FZVA 2P4UA 3O92A 3WFJA 1PJBA 1V8PA 3GGCA 5C44G 2BFBA 4L0CA 4U9HS 3ZTTA 3DV9A 4TKMA 4AX4A 4ENPA 3D7NA 4HN4B 4EF4A 5FLEX 4DBLC 2OD9A 3MFIA 1ECGA 2IIBA 2ZIAA 1H0KA 4GG1A 3HJRA 4QTXA 3UT5A 3AC0A 1FMCA 4LJ9A 3OLYA 1VGQA 4GI2A 4HVTA 4M3NA 1VSTA 4YXFA 2DIKA 1F38A 3G7SA 3VAAA 4ESHA 4RTOA 4PHFA 1TQ8A 4RMNA 1FPMA 1M1ZA 2R62A 1EP1B 3CRVA 4L16A 1YR2A 2WFMA 4HXGA 4N5NA 3WKBA 2LXNA 2RB5A 4PCUA 5K0SA 1RWMA 1K9VF 2WJIA 4GRIA 5CVDA 4N0EA 3VKHA 3EUFA 1PEAA 2LNDA 3M9XA 5EI5A 5AXCA 5JUWA 5NLLA 1OC2A 3IAM1 4FHDA 3T5TA 2BJHA 1DPGA 5AH0A 4DA0A 5TNXA 1YFZA 5IM4A 4LY3A 4FOTA 3T3GA 2CEAA 2E7ZA 2O48X 2PGIA 1FP7A 1Z2AA 1Z4IA 4ZARA 1IBLB 1JG6A 2VAVA 1HDYA 2BEKA 1J8QA 2R751 3UMCA 2B92A 3ZNQA 3DWIA 3D8NA 1J5EH 1Z6ZA 3T0IA 4AN4A 4JUCA 4QBTA 1LXCA 4LY0A 1H2FA 3AEXA 1J22A 4QICA 1G20E 1P7WA 4M1OA 5ESXA 3R75A 2HNKA 3WTBA 4DT1A 2VZ8A 2DBYA 2ET6A 2Z9BA 3W06A 1EIWA 5BP7A 1ZSYA 2FI1A 3R9RA 1T0BA 3HHEA 3IO3A 4TKZA 3RC2A 1V9PA 3O7WA 4NQRA 4CQMA 2OH2A 2GEKA 2R11A 4IVRA 3NIWA 3GA5A 3A4LA 1HE5A 3VVMA 5CFOA 1PW7A 3L0PA 2XMRA 3GPDG 1IQ0A 1MO2A 2OCLA 4P22A 2HQ1A 4BBAA 3TYXA 2Q6IA 1NRXA 1GNPA 1UAYA 4HS9A 1V2GA 4AC9A 1TXGA 4YR0A 1Y9ZA 2WIFA 3DW1X 1EYZA 5B36A 3NV9A 5HZMA 2K7FA 2A7QA 5CA0B 2EJTA 3H3VH 1M1YB 3KRTA 1IBKH 1N2CE 2A5FA 1OBOA 3BD9A 2ZUFA 3IAAA 3RJZA 3E23A 2VNIA 4FOLA 2O2HA 2O7VA 3CINA 1IBCA 1KDPA 4C5CA 4HWTA 4LZAA 1VDMA 2FHSA 1I3CA 5A1TA 1P5HA 1JQAA 3JQGA 3QWIA 1PR9A 1RBYA 3BL8A 4TOIA 4MX8A 3MT8A 4BLQA 5HQTA 1FTSA 1K7FB 2BKUA 1UWCA 3CY6A 1KR5A 3VI3B 5BPFA 1P1JA 3KL4A 4UCTA 3WYDA 5CLQA 3PL5A 5DVZA 2WF6A 3N2KA 1T13A 4I4CA 2NXNA 3OESA 4E22A 4R7TA 4QUBA 4ZXPA 1HNZB 1U7DA 5FADA 1C41A 2R6JA 2QX4A 1RNLA 4IF4A 1XCBA 3AR8A 5JS2A 1A7KA 2E85A 4QDZA 4BNXA 1XE3A 1I2AA 5E9QA 1NW4A 2VF4X 2DFKB 3EIEA 1JXAA 1BU5A 5D85A 3T38A 5G3ZA 4XD7A 1CIPA 3CTPA 4U4AA 4MW5A 3EG9A 5ALJA 2C58A 1X7YB 2ZIZA 2WI8A 4D02A 1G4AE 3AFGA 3ZZ0A 4XRGA 3LFUA 3RGGA 4ZVMA 1H85A 2X4LA 2WBLC 3I2GA 1MENA 3B85A 2FPIB 1B41A 3C41J 3AJAA 3KYDB 4GM0A 2XQGA 3BABA 3KFXA 1AQUA 5CHEA 4D7AA 1T5DX 4PPQA 1OXTA 4DL9A 2IYUA 1XROA 5CNIA 1PV2A 1N75A 3ZKAA 4NAUA 2GZ1A 4NCIA 5A3QA 3SSOA 3G8BA 1IBMB 4IDQA 3CZCA 4I6EA 3VNUA 3A6EA 4G4JA 5FAKA 2BC9A 5L4NA 1A69A 2GKOA 1QK5A 3NT2A 1BOOA 2BUBA 2GK3A 5K0FA 3AY0A 3MB5A 2JJQA 3OOJA 1RPNA 3DE0X 4HGNA 3TTVA 3EGDB 4PYQA 4EFKA 4Y3UA 2YVAA 1FXWA 2F90A 4QTTB 4ZI5A 3V1UA 3OSZA 3LT4A 4EEYA 1KTVA 3HY6A 2XXBA 3DHWC 3MELA 2AX4A 4RS4A 3U5ZB 4IJ5A 1M3SA 3FROA 2I87A 1QM5A 3VR4H 3CPJB 2Y92A 3STXA 1UKZA 4TQ9A 1DIKA 2W2PA 1PFGA 3D0KA 5BQXA 1N33B 5K05A 1WXEA 1TWHA 1ZZEA 2VWHA 3HP4A 4RAZA 4LXHA 2D0OB 4QQKA 1BDIA 4ZCSA 1JDJA 1RQLA 1YQEA 2H4ZA 1CQIA 4YQZA 1WTCA 3FWKA 3DOJA 2QPTA 2CLDX 4I3GA 5BWXA 3IFSA 1BOFA 1CHNA 1H5UA 2A1IA 3M4YA 1X1TA 4TT3D 5EVCA 5REQB 3D8TA 3LK6A 4L5BA 5DN6D 3QVUA 3KYIB 2J3EA 2G82A 3D0RA 2FK1A 1KC3A 2WB1A 5HRCA 1KO7A 2R7NA 1RD4A 2WMNB 1DAHA 3HUEA 5FR9A 5JY6A 2OXTA 4JV2A 1Q6ZA 3X3HA 1HZZA 1O8CA 2JFUA 1GJRA 3QXSA 2VPQA 3AUFA 4BO4A 3JSLA 2D1YA 1RRVA 5EHIA 3ROGA 2ZZMA 1ILWA 1H5NA 3H8WA 4M22A 1XZLA 3NVMB 3NWPA 1GRVA 3O0TA 1CY2A 4K6KA 1OREA 3TZ6A 2FHPA 3U3ZA 3L8YA 1L4UA 1V7QA 1ULTA 4R2MA 1QP0A 1R9TA 1QRSA 1ZN7A 5LP6F 3H84A 5D6NA 5FPOA 2BM0A 3AI2A 3N0WA 1DARA 2VAPA 3WKEA 1BHQ1 1R1DA 2WVAA 2AG0A 3D3QA 1R0BA 1W4BA 1JV2B 4WERA 4NONA 5BRAA 1O0SA 2LCIA 4QWWA 2C82A 1IYDA 1NHGA 1EUDA 1LRLA 3QNUA 3FPHA 4BLTA 1VL8A 4BNYA 3AVVA 5LQKA 4BLOA 3FWNA 4KE8A 2IP1A 4TWRA 3QOXA 4JJZA 4MKGA 4W99A 1OIWA 3EPPA 3NVAA 2I1VB 3RF7A 4DJTA 4D79A 1AKTA 1DJMA 1W36B 2NPOA 1GPJA 4LECA 4MUNA 1G21B 4U7PB 3BOSA 1I0ZA 3JD2A 4ALLA 1A82A 1QANA 4YPOA 3PGJA 3PYLA 3VPSA 5DAAA 2EX1A 1YQUA 4UREA 3QE2A 2OCGA 3IT2A 2YZKA 4D8XA 5HV6A 1OGIA 3ICVA 4WKPA 4PZUA 1H4TA 1J09A 3DHNA 2WHXA 3AMVA 4H7JA 3ZWKA 2Q4TA 4X1IB 4F9EA 1GPYA 4IH9A 5DXJA 3FVQA 2QVZX 2V58A 4MCHA 3BMOB 3EQ8A 1V8FA 2FJ0A 3AK4A 2WTUA 3A4NA 3ELDA 2PKXA 4RY8A 1Y9EA 3PDJA 3V8MA 1I4WA 1F8GA 5ERXA 2ZR7A 2HNAA 3RFCA 2ZTSA 3BIOA 3PTZA 3AY6A 3M6VA 4J1QA 4R0VA 3TW8A 1Q7BA 3A0RB 1P81A 1SG6A 4BXXG 4TN5A 1KPIA 4MUKA 4TTTS 4F5YA 4O0LA 2NU8A 4DZZA 4ZCRA 4DIDA 4TV9F 5D1OB 4DV3H 3LRXA 5K0ZA 2PVCA 3Q3GE 3FVVA 4EGSA 4YJGA 4EJ0A 1V25A 1ZI8A 2JBHA 2JI7A 3BTVA 5H83A 4EQ5A 4HNVA 4GI7A 3DE7X 3GLHA 1Z0AA 4IHKA 4UU0A 3RYTC 3M6XA 2YWRA 1NATA 2B7BA 5DTMA 4QBGB 4MO9A 5FBHA 1N5RA 3FZQA 3HLKA 2FQWA 3RTEA 2ES4A 2Z8YA 3BORA 3CO0S 4J7CA 5IKMA 1USKA 4UPDA 1A9YA 2VP5A 4OXIA 2AMLA 3BTUA 3I8XA 1U1GA 3MOGA 4OJNA 3K0BA 4B6PA 3E4DA 4YCDA 3RJ0A 2Q5HA 5SYNA 5JVDF 4W8HA 4D3ZA 4D74A 2ZIEA 1T24A 4G26A 2OBBA 4E09A 2QTLA 5KSWB 3E5MA 2WTNA 1HDOA 2RI1A 1HT1E 2BDTA 3L7AA 2V7WA 3M4ZA 4EW3A 4ZYYA 1FVXA 1U0HC 1EA7A 2PRJA 3E8MA 3K9NA 3PP8A 3ZGOA 3DTGA 5BWTA 1WG8A 3N2GB 1A9PA 1I9CA 1L1RA 1XEXA 3AIOA 4ZCPA 1QQ6A 3WWDA 3AVTA 1ECFA 3ASUA 2P7IA 2XF2A 4GC7A 1Q92A 3ANNA 4F38A 5KEIA 1E3WB 2MINB 3FFTA 3Q3EA 4OQLA 4DQKA 1ETHA 1XA4A 2NXWA 4F3RA 3I2YX 1DRKA 3CUSA 4RZ2A 4YUXA 1NSTA 1LUAA 4F9GA 2HA7A 2KLHA 2E1PA 4U7WA 4WCFB 4ZGBA 5HZHA 3LDGA 4OBEA 3JAMW 1W0CA 2DT8A 2PM8A 5DYIA 5AW9A 1F8YA 2W9CB 3RS8A 3L9XA 4WT7A 4B0PA 3OX4A 1WMBA 1F1JA 4QKQA 2GO7A 3HCAA 2H06A 1T9KA 5DRTA 1A95A 1P5FA 5LMNB 3DA8A 2O8NA 3T4PA 4BO5A 3SGIA 4RD2A 5EL0A 3EIQA 2CSUA 2R1VB 2D0PB 4YCBA 1DIAA 2C1ZA 2HHAA 4HATA 4CIBA 3IDOA 3QXHA 1RE1A 5IHXA 3O4JA 1U94A 3L1JA 1JFTA 4HAUA 2HHLA 5JO0A 3QX3A 2DBZA 5JLJA 1T8TA 1IYEA 3NLLA 1Z9BA 4Y2PA 3VTAA 3ODGA 2GNOA 4Y8VA 4RTMA 4KR7A 4AQ7A 1UM9B 3HSYA 2TS1A 1QMPA 4EMUA 2ANCA 1M66A 1K1EA 4P4GA 3VAYA 5K45A 1W35A 3PD1A 2RD2A 1YE3A 4Z7JA 1KZYC 2CY0A 1C4WA 2NV6A 2X41A 3GD5A 3JQ8B 3OVMA 3ACDA 3KJXA 2OZVA 4DL3A 2G4CA 3BA8A 4L6IA 3WKAA 4AS3A 5K8LA 4XD7D 4K81B 2WOOA 2QG9A 4Q3OA 2XUDA 1L4GA 3AL2A 4BQPA 1VB3A 2H5LA 1N2OA 1ZA1A 1WDKA 1ZIDA 2ZB8A 2QVGA 3H87A 5EWJB 5C31A 4DJFC 4EABA 4ZJPA 1Q0LA 1Z2NX 4X95A 1HYHA 3D4IA 1NNEA 2H2HA 4KOAA 5IBQA 4ETIA 5L7TA 2XIJA 2JD1A 5ALZA 1FP1D 3PSAA 1A9TA 5FQNA 4UD6A 1RYHA 4CKXA 5DG8A 4PC6A 2DM6A 1YHNA 2GBFA 4G89A 1PR4A 1QHYA 5IN5A 3MOIA 2R7ZA 2VP3A 4XSHA 1EESA 3N8NA 5AVQA 3KSMA 1CETA 2ZRDA 4JLVA 1V41E 3FOCA 4OHUA 2ZTLA 2PX6A 5IS2A 2Q1WA 3SKVA 3B1WA 1GGJA 1SUAA 1PZFA 5BWRA 1WR8A 1A48A 1SAYA 2FPGA 3KEFA 3N0VA 4OQQA 3S24A 3BWCA 1LB1B 1KI9A 2QTBA 4QTYA 5LPNA 3IE1A 3LO5A 1GR0A 4XIGS 5T4HA 1QHHB 1FSGA 1P19A 3H9CA 1XMSA 3BSFA 4MVJE 3PU6A 1N1MA 4DC1A 2QAJA 3O2QB 3EWIA 4YAWA 3WJ1A 4TMYA 2JA2A 4HRAA 3M4XA 4QPNA 1T3NA 4HV4A 3AI7A 1HQKA 3UKOA 4AULA 2HCBA 1TT5A 1RAHA 1S2GA 3T1QA 3QVWA 2J3LA 2RK3A 4MUEA 5IT4A 4RHTA 3RGZA 3RJMA 3PEYA 2O8DA 4I7HA 2JBAA 3G0BA 3QKSB 3GJ3A 2YINC 4JVLA 4A2AA 4PY2A 4UEKA 4AMVA 3RADC 2HPVA 2WJWA 4JWKA 2AMJA 1N48A 4H77A 4L73A 2DVMA 4PPFA 4RM2A 4WVLA 3O3MB 3WWOA 2CNUA 3P32A 1B04A 2PG3A 3MINA 5A62A 2Q6TA 3LVRE 4OQDA 2Z2JA 4GQBA 4F4FA 3K0HA 1LSJA 4G2TA 1FYEA 3P0HA 4MVCA 4LZJA 4NP6A 4WGGA 3VUFA 7GPBA 3OQIB 4WSOA 1G5RA 1WZIA 1PX2A 4BFWA 5KYWB 3NJRA 4P1ZA 2CW8A 3I9NA 3LH5A 4W8OA 3SEQA 2IV2X 2PNFA 2CLHB 2AGQA 3GN1A 1N2CA 1Z22A 2EHDA 4HEA6 3ZE0B 2Y05A 1YTLA 4RU9A 2JVKA 5EIXA 1GAQA 2W8BA 1SIUA 2BP7A 4RABA 3CYFA 5HCIA 4BAUA 4U1RA 3FCYA 1EDEA 2W00A 4GX2A 4C2MA 4W5NA 1LBIA 1NFRA 2VYQA 3IHTA 3WNBA 4V1CI 4LH6A 4LNAA 4JYAB 3LIPA 1D7OA 1QWSA 3AR3A 2A0UA 5FPKA 2BV3A 5F9FA 1WMAA 2DEUA 2JGKA 2H7XA 1NURA 1OX5A 3MQ4A 5FUMA 5KFDA 1E3LA 1XNGA 1YB1A 2JKYA 2H51A 3PEEA 4O33A 3RS0A 2R6GA 2Q2OA 2CVQA 1T2EA 3GLVA 2QUJA 3CNLA 1YGPA 3NC4A 4AS2A 1CVLA 3LLVA 2P9QA 4JGGA 4JVOA 4LI3X 4P80A 2QNIA 4TS4A 4CLOA 5J3JA 2WP8J 1T5IA 3TOXA 2X58A 3EXIB 4Q39A 3DKRA 4ENWA 2P3QA 3N8HA 3AJ8A 3GFQA 3BXFA 4N7JA 2ACVA 2IGBA 2BQ3A 2P41A 5AI8A 1TJPB 4QUHA 3U4QB 1C9MA 2BE7A 2ZJ2A 3D3EA 3TUZC 4R1LA 3FTFA 4DIKA 1Y63A 5BV0A 4G8BA 4HSEA 5BSVA 2WIAA 5G1NA 5HVNA 1B0ZA 5DTRA 4E5YA 1I10A 1XR3A 3PJFA 1U5BA 1W1IA 4OGLA 4UM8B 5EG5A 1ULHA 4XEHA 5EPEA 2QA5A 1IM2A 4EX7A 4OMFG 4QRDA 4LTDA 1KARA 4I36A 3STTA 3ESCA 4DUGA 4KXFB 4DT1B 4QOSA 5DLEA 1A1VA 4S1NA 4M99A 4HVAA 4DC0A 4OXNA 4YMGA 2NU6A 2VS1A 2F3SA 3CRQA 2O05A 4O5AA 1YS6A 2BMAA 2Q2NA 5FEMA 3NVDA 5GVRA 5KOJA 3WRXC 3OUZA 5I4KA 4P4SB 3GJRA 3OFKA 3L02A 1CY8A 2EJCA 1FL9A 3Q87B 2ZI4A 2K6GA 3RC8A 1RPZA 1EUYA 4EL0A 4IXTA 3UWSA 3GRFA 1JR2A 1NFQA 1W93A 3H83A 4NF2A 1ZK4A 5AJWA 2CL6X 3NIBA 3RBVA 3W79A 3KLNA 4JC5A 4S04A 1CUYA 2DETA 1ISPA 5BSKA 4RUAA 3ZX5A 4B3XA 2HGSA 2OV2A 4JI5B 4YRCA 5AVVA 4X44A 3SBDA 3K2IA 3VKWA 3L1IA 4DA6A 2OECA 3LHFA 3C98A 3BHNA 1QS0A 1A5SB 3RTCA 1UBTS 5DH9A 1BYIA 1H2XA 1RQ7A 2Z5LA 1PAUA 1I6KA 5EIOA 4DSAA 5C4MA 4WACA 4EG3A 5JH7F 4KXUA 4O86A 5JXGA 3TZBA 4RAOA 1GYFA 1JQLB 5GIOE 3HB9A 2AXNA 5A5GA 1TQDA 4O4LF 4GOOD 3RIGA 4DR5B 1EVLA 1RVDA 4K88A 4LRTB 4OHFA 1VG8A 1B6TA 5A4MS 2C2EA 2YFKA 3DBLB 4O2BB 4AICA 5HG0A 2NTJA 5F35A 2X7JA 1PGQA 2XNDA 2DU8A 3MR6A 2GTPA 3R20A 5FBQB 1HDGO 4GECA 1ZK2A 3OCXA 1Z37A 5D01A 4KE6A 1Q1AA 1GTJ1 2Q62A 3TD9A 2W48A 4B87A 8ADHA 9ABPA 3UGTA 4IM7A 5CCXA 3G6XA 2WWWA 3FMVA 1XT6A 3KQVA 2J45A 4J3FA 1LLDA 3U48A 2GNPA 2AQHA 3L05A 3IURA 4JKOA 2YV1A 5K4AA 3EZLA 3BCRA 1CP2A 2E4VA 1PHRA 3TZEA 4UOQA 3H20A 2CNBA 1NW9B 2GD0A 1RZRD 1I3NA 2LDBA 1ZUNB 2XD4A 2ZRAA 4R2IA 3OECA 5DYGA 2AYZA 2QUZA 3A31A 5IH3A 4CCWA 3EQ9A 2PFGA 1EXNA 2Y4OA 3U3RA 1C3OB 3HN2A 2J3JA 1XXLA 3D6JA 2I55A 2X7XA 4O4LB 2DPIA 3RYHA 3ILVA 2Y1LA 3UMFA 1VHQA 4LJ5A 5B2EA 4MPRA 3UJ7A 5LVAA 5LJLA 2A58A 3GEHA 3IIEA 1ADCA 1WO8A 5CW1A 2RHLA 3GFFA 4MKXA 2VP9A 1YK0A 1GUBA 2OCIA 1A3CA 1JHMA 2OM6A 2O1WA 2VDQB 3B3GA 3IP3A 4FCCA 1WVMA 1Y3FE 2WSYB 3JS5A 4RL6A 4KOEC 3G2KA 4Z49A 3VR6D 5CB0A 4F96A 1XWWA 2I71A 3S2GA 1IIRA 3QRWA 4J7AA 4KLAA 4LMRA 4Q9LA 1NY6A 4M8KA 2BRUA 1MX9A 5EUQB 3X0DA 4AF8A 4UE2A 3W5OA 2AOTB 4RB3C 4BKMA 2JI8A 2HMAA 3AHGA 5JY1A 1OYWA 3M5WA 4DMFA 4XPZA 4L15A 3FNIA 5T7BA 4CDGA 2NUTA 2GB4A 3NS7A 3U7IA 5JRZA 1MB2A 4DWWA 1NLFA 3TPCA 4XARA 3DD1A 1OLUB 1CUXA 1MF7A 4D4LA 3I64A 5E4TA 4EHIA 2DFLA 1A2OA 3QJYA 4UVIA 4W4TA 2RHHA 1VSQA 4JWTA 3H9BA 2W8LA 4FMBB 1SQSA 4OMCA 2I9PA 3EVDA 1CDEA 1E6MA 3M1IA 4NEGA 5IRCD 1LJ8A 3U4DA 4UBKA 4UXJA 821PA 4GQAA 5THXA 1GL7A 2WFLA 3N7TA 4RD1A 4QHYA 5HM8A 3R5HA 3F5SA 1CUAA 2AHRA 4G0OA 1FP4A 2Z3ZA 2B3TA 5FJJA 2DTEA 4DR3B 1RMQA 4M7PA 2D1QA 2WQ6A 5KDOA 3THYB 2EXXA 3ANSA 2PSSA 3DE2X 3N75A 3G49A 3ZGYA 2DP4E 6CHYA 3P2YA 2R4TA 1D2EA 1L0BA 1PFQA 4KE9A 3EDYA 5DYWA 2KBFA 5EJFA 4F6RB 1PEKE 2VDJA 3FKSA 4MNTA 2OUKA 5EHQA 2WD8A 1R37A 2OAQ1 3AI1A 5C7LO 2QW1A 5KTKA 2I4LA 3RK0A 1HETA 2E0IA 2H4XA 5IT9W 4PX9A 5FF9A 2YXPX 2N42A 2ZVQX 1W88B 2M6KA 3WSTA 2A59A 5IPFA 4G1MB 3F0TA 2EJ2A 1M1YE 4LTMA 1TPZA 1D4ZA 1XG5A 3NAQA 4OJMX 3WX0A 2D4AA 2Q6LA 1K75A 4EY8A 1UM8A 3MTGA 2PSEA 3ULKA 3KVYA 5FTMA 3F8WA 3ZBPA 3S8YA 4X1YB 4P32A 3L1VA 3TKAA 1X1DA 4UUBA 3UGQA 1ELOA 3C0FB 3B3JA 3FTDA 1CZNA 3BFJA 3WYGA 1MG5A 3AEKB 3LXMA 4CL8A 2GPYA 3A25A 3PFBA 3N59A 2AMFA 5H82A 3CB4A 3IT1A 3KOYA 1LPNA 5E9AA 4WUTA 5EUMA 5EJ4A 1SYXB 1XMPA 2OFWA 3FLMA 4H08A 3TN7A 5AKEA 4PICA 4LOLA 1UWKA 3DLBA 1L7OA 2CDNA 1QFYA 3JATA 2HWYA 1QB8A 5BSHA 1HR0H 3IOEA 3LY9A 1V7PC 1CIJA 1M7JA 1EDOA 2VZ9A 2W0MA 4MV3A 1ORVA 4IYJA 3OE7D 4BWVA 2XRZA 3PC4A 2ZUVA 3HLYA 5COQA 1E9BA 1H3NA 2GPAA 2O2YA 2OILA 4ARZA 4B7UA 3RV4A 1JDNA 4AKTA 1G18A 1U9JA 1H0HA 1LWNA 1SKYE 2RBKA 3BWXA 4Y2RA 3M6FA 3Q2KA 4JLKA 3T9AA 5CFNA 2QMOA 3RTXA 3H9JA 3HZRA 2CLSA 2BZSA 1ZOLA 3K71B 1UJNA 4ARSA 3N8KA 4KBGA 3HPQA 4AZ0A 4NBWA 3BD7A 1M2JA 1G6HA 2QVXX 4DR2H 2LCFA 4TZ6A 3TLCA 3SVZA 4RQUA 2QYHA 3K9BA 1O75A 1AXEA 3UNXA 5A4AA 3HVIA 3MGAA 4PCLA 5AVRA 1C50A 4HYKA 1F0PA 1X1RA 3NNDA 4X63A 4BB6A 5C7IO 1NT2A 3H6GA 1K3TA 1TI7A 4F2GA 3VISA 1HT2E 2Q0SA 4MINA 2O5RA 4GBED 7ADHA 4LSAA 4MAFA 5IJ0A 1QH0A 4D9MA 4F93B 1LBSA 3AEKA 1YZGA 4C05A 5KYKA 1X1EA 1MT3A 1THMA 2JJ2D 2V55B 3FSJX 4EO9A 1UEJA 2NSLA 3DOIA 5LQCA 2W4MA 2BGIA 4DR5H 1Y34E 3NHMA 4TN1A 4EMSA 1RMYA 1JPJA 4RPHA 4XDGA 5TIIA 2CFSA 4YACA 1Q21A 3EA5A 5ESDA 5FO0A 4YHHB 4J9QA 4NBSA 1E3WA 2BEVB 3U7JA 4KITB 4ER6A 3N0TA 4RVFA 4XQGA 3C8ZA 1DAMA 3NHSA 2ZXUA 4J0MA 1HFEL 5EESA 4H4EA 2RJ3A 4ZKEA 1TWGA 2PL9A 2W93A 4CQNA 3PF9A 1PQPA 2PEYA 1QJ4A 3OTWA 4KH1A 2J0SA 2B20A 3EQ2A 1X8LA 1K7CA 2GM5A 4UAGA 2FMXA 4GP9A 2CV2A 3H40A 1QF9A 1FNMA 2ZYWX 2FW8A 5DI3B 1O97D 2ZAGA 3EGXA 4YR7A 1KRXA 1CE8B 4BVLA 1EXMA 3IXLA 5SY9A 1BXGB 1X87A 2MCTA 4G0XA 4L4ZA 4TRRA 4BKPA 2DR0A 2GEFA 3ZW8A 1V1RB 5L4SA 2HTFA 2CLIB 2ZE8A 1GXSB 3RVSA 3K0CC 3IBCA 5DSZA 3FKIA 1JR3A 3FTCA 3IELA 4PRZA 4LZPA 4Y9DA 3COSA 1EHCA 7MDHA 1EFVA 4O7RA 2OGTA 4RACA 3ZWOA 3R8XA 1GUDA 1NBME 2P2DA 3I92A 5EZ6B 1ZEJA 2PX2A 2V4MA 1LLUA 5E6UA 4E30A 1DV2A 3FOZA 5DHUA 2NVXA 2HRZA 1AXRA 3K70C 2JZCA 3FRJA 1E3TA 1JKFA 4H7HA 1SBZA 3L1UA 4GXTA 4ALNA 3N76A 4RFSB 3KDPA 4ND4A 3UJCA 4A0HA 4QEKA 4FZRA 1OVMA 4PSKA 2BHTA 2V7QA 2G6BA 4HMOA 3SSNA 4IH1A 3U19A 2DPMA 4BVBA 2R92G 2XVZA 3RFXA 2ONJA 2BR4A 4O7NA 4OPMA 3FI9A 5I5YA 2GD6A 4JP8A 3J80W 1EUCA 2CC2A 3VTKA 2JIPA 3QLEA 5TQJA 3ZDQA 3OKFA 4W8GA 2ZRNA 5DHFA 2Q45A 4GOLD 4BX0A 3KKLA 2EIHA 5FULA 5H7XA 4MRNA 2IOHA 1SKMA 5AR1A 2GZSA 4JI6B 4O84A 4MVJI 2IRWA 3P94A 2EKLA 1G59A 1ZOOA 1TGYA 2F43A 4ZMBA 3TTYA 1HNNA 3O21A 1HF3A 5I5XA 2AGPA 4RDXA 4EPXA 2QTMA 4QO8A 2JAQA 1QLHA 4UJ5A 1G38A 3KQMA 4MPDA 1ZNYA 1WCYA 5GZ1A 1Z7BA 3L4BA 3RUFA 4LISA 1FS6A 5IWAH 5F7JA 4JEHA 2DR3A 3HCWA 3MSXA 1VL1A 1CE8A 3VA7A 1YOVA 1GPMA 4WFJA 4IHJA 4NS4A 2FV8A 1Q91A 5JQGA 4HNAA 5C53B 3GLGB 2P5UA 1D4FA 1DIHA 2CKZB 4CLRB 4PLYA 2PCJA 4RB0A 2XCOA 3UXHA 1T8WA 3DFIA 1XZCA 2GRJA 2R2GA 4F4HA 3MTBA 1OAOC 4BDTA 1R9MA 1RQNA 2QV0A 4FX2A 4QQ8A 3W05A 1L1FA 4PNZA 4YT4A 1R6DA 2DAPA 4PGGA 1XX6A 2IGTA 2FZ5A 4MICA 1TT5B 1TYEB 3UCEA 3KAQA 1SPBS 4IIYA 5MFZA 3T5PA 4LYYA 2OWEA 5DP2A 4IDCA 3EFEA 4BO7A 3LI2A 4EHNA 1I6WA 1TTQB 3AHFA 3DMTC 4TSRA 1K97A 4AWXA 4RK1A 2QTWB 3IPCA 3MQ2A 4QULA 5PGMA 3AKYA 4ALMA 4E3ZA 2PT9A 2VJAA 2WYWA 4NBUA 5BUCA 3G8CA 1IVSA 1OXXK 2BJVA 4KSBA 1VMEA 3NV7A 4MS4B 3NHYA 2JZNA 5IVDA 3ENKA 2Q5LA 3H6KA 3LHSA 4KRYA 4QELA 4TMKA 1TQ4A 2WC1A 2QZZA 3SJAA 3ZY4A 4EOGA 4PN7A 2J85A 5CFPA 4R2LA 2IY9A 3OD1A 3VYWA 3SM9A 3KHSA 4CTNA 5IYDG 4J9UE 3T3NA 3KKNA 1WPRA 2ZPAA 3LBAA 4JH0A 5HGXA 3TSZA 3OQVA 3VC1A 2WE7A 3QEAZ 4MR8A 4MRVA 3UH0A 1M1UA 1W59A 1XOIA 2HCRA 3BZBA 1A7UA 1XDSA 3DQPA 3LMKA 4E51A 1D09A 4JLNA 4GSLA 4XZ3A 2WP0A 1OLSA 2YXLA 2P3LA 2QM0A 1G3UA 2AJDA 2OV6A 4JV5H 4EECA 1T9HA 2G1PA 2XOKD 2CK3D 3NDBB 1BWQA 1GUYA 5FD8A 4KVAA 1J0EA 5IYBG 2GJ8A 1Z0JA 2JI6A 2JEYA 2ODAA 2IOFA 4CC6A 1WUTA 2QYSA 4WN3A 4X91A 5L3ZA 1OA0A 1T29A 1XJCA 3AESA 3H65A 1BMFD 3DVQX 1CQWA 4PQFA 1JHUA 3U49A 2QNRA 1BX1A 1DT3A 3EWSA 4RVGA 1U8TA 5FXMA 1K1QA 3EZFA 4WJLA 5KYTA 3O8LA 2HSZA 4MS3A 5G41A 4NMMA 5E1DA 2PKCA 4C7MA 2ASDA 1Z7WA 4FLMA 1AH2A 3DEJA 1OTXA 1JDPA 2QW0X 2VAMA 1O58A 5C5JA 3UUEA 4J0IA 4RY0A 4WY5A 3AF6A 4JX9A 3OZWA 2B1JA 2JAPA 2FGJA 1DJOA 2ZANA 2DWOA 4HQOA 1PTJA 3OZIA 3CBGA 1QH1A 1K66A 1S9DA 2HC9A 3SYMA 4TMVA 3IEIA 1M8FA 4J9MA 3P9SA 1JB1A 1V9SA 3DO6A 4PZPA 5JARA 2CXOA 4B6OA 4K05A 2W6ZA 1QVWA 3LK7A 1USVA 3LQRA 4IP0A 4UBMA 3L82B 3VUEA 3WJ2A 3P2JA 3CRZA 5H4HA 1B33N 1H6BA 4QUGA 3QYFA 2YHUA 1UP6A 1T5LA 1JJIA 1WY7A 1Y7TA 3WGKA 4EL5A 2VQFB 4FONA 1K08A 2ZSKA 3NBFA 2QAGA 5K0GA 1PU2A 4KJXA 1N8NA 1Z12A 4M36A 3ZHOA 4KYTA 4GUDA 5J47A 4ZVPA 2L0XA 3GLTA 4UKDA 4YV1A 4JI8H 5HF6A 3ADBA 2CBXA 1UWVA 1Y98A 4PYNA 1AY0A 4ID9A 3AY7A 2OO3A 3LUBA 2QY6A 1HNXB 3VJLA 5EWGA 4MYCA 3WXBA 4GVLA 3RUAA 3JR7A 2XSZA 3WR5A 3WVNA 1U3TA 4GZLA 4JYMA 2W98A 3AFOA 4LDPA 2O8BB 5F2NA 4LRSB 5EE0A 3SX4A 2CVZA 2WF7A 3TXYA 3GFPA 4AWAA 3ECAA 2V7UA 3KZXA 1WXHA 2P68A 2Q99A 3FPGA 4RHFA 1TA8A 1OX4B 2X5JO 2E48A 3MVEA 2ATIA 4KQ2A 4LJAA 1KY3A 4B3JA 4CL0A 2VR1A 3GIDA 1U2GC 2X0KA 3P0FA 1Z63A 4TTPA 5JJKA 2HPZA 1O96B 1ODKA 1TQ2A 2YXNA 4QNMA 1GKLA 2H00A 1J90A 1V1MA 1KDVA 5KFKA 3Q7PA 3OZGA 1RI2A 1DJLA 3EW9A 4A2CA 1OYOA 4AJNA 4E33A 1HQDA 3FB1A 3VKGA 2FN4A 1NBEA 3KJZA 3PYXA 4WADA 5EKUA 4ZO9A 1NI4B 2GBCA 3H4DA 2RGUA 3GUYA 4XASA 1XLUA 4DLYA 3QWAA 4G56A 4CIYA 3EXHC 3PX7A 3LE8A 1R0KA 1P39A 2JCGA 1T3SA 3PC8C 2YY7A 2IYNA 3JWJA 3ROMA 5I4BA 1T6ZA 2O7SA 3EF3A 2HLPA 4G5XA 1J23A 1Z88A 1XLVA 2DBQA 5EDWA 2J5BA 1EVKA 3ILSA 3ZZNA 5LQRA 1N7IA 1ZKMA 4KE7A 4BMNA 1NA5A 4PAMA 4QQFA 2A9FA 1NVDA 3ZK7A 4ZCLA 4EUFA 2J0QA 1NXWA 3RGWS 1JFLA 2IODA 2DJ5A 4CM3A 1Z28A 2ERYA 1QP4A 4F4YA 1MEJA 3L7JA 3VZSA 1F5NA 2CL5A 5J43A 1SHUX 3OOEA 3VMFA 3UZBA 1TO1E 4M53A 2ODPA 2JJ1D 2A30A 4R8LA 2NXEA 3IEPA 5LB2A 3HA3A 4JFRA 4DDHA 1YZLA 3ESBA 2Z1NA 2YXBA 5JS7A 4HLUC 3NM4A 3EG5A 3X43A 5AKKA 2EC5A 3IUPA 1Y4AE 1RI5A 2YCLA 3GGOA 3INGA 1HSOA 1BHSA 5DYNA 1G8FA 1P4GA 3R8CA 1JS1X 2VCEA 1U6IA 4GR4A 2XTZA 5D1HA 2JHFA 3GA0A 4RPKA 5AHRA 5ICGA 4DA4A 4WXRA 2H1CA 3H5AA 3K35A 1YRBA 3QA3E 4G5SA 4YLGA 3UUFA 5AVSA 3WL5A 1MRSA 3GDWA 3OTQA 4UHHA 2XUJA 1M6NA 2HN9A 1IEXA 2QZPA 3I6BA 4DV6B 4UHEA 1TKCA 1IAVA 3I2JA 3N7UA 2JAXA 3RRJA 4W7HA 4DMLA 2B2CA 3OIFA 3WZ2A 1Z0DA 3LQQA 2I78A 3U0GA 4QWEA 1X9GA 2I99A 2YIJA 4ZO4A 4KFSA 2PVSA 3L8CA 4B76A 5IN4A 5JZOA 2Z6UA 3BE8A 3VZBA 4XJSA 3G7UA 4FKBA 1GTRA 4TQSA 4Q4CA 1YKFA 3UZUA 4EKYA 1E6KA 3OCYA 1L7VC 2DUNA 5SZJA 3VNNA 5JNUA 3KDAA 4PPYA 3QEOA 4IQ8A 4II3A 2EKZA 2VQ6A 2I7TA 4N82A 3E48A 1R5BA 2Y93A 1SHKA 3NYWA 1EDZA 3K1AB 3M6AA 4GRAA 4OKNA 2DULA 2ZB2A 4WECA 5BSEA 2JH3A 2JA7G 1M0WA 1M7GA 2ONCA 3PC6A 2OGWA 4JBWA 1N2CB 1OKKD 1X1AA 3C6BA 3D5EA 3FWHA 1C7IA 1OIVA 3QHQA 5E1MA 3S4YA 1R0LA 3HO1A 3TZQA 1E3QA 1VE7A 2PQ6A 3T35A 3EK2A 5FBVB 2PXCA 4KIJA 1V5WA 1ZVVA 1WKVA 3PX2A 5D2CA 1HSZA 4G63A 2HF9A 5KNDH 3KPJA 2BMWA 4FJ2A 3TY8A 1JLLA 1FF9A 3DCJA 3FGPA 3KVOA 3OQBA 5KNBA 2FEMA 5C8YF 1FRVA 1XQXA 3IP1A 4O8ZA 1VECA 5DULA 4GKKH 2B63A 2RGEA 3ZS8A 4XX0B 4ND8B 4HLCA 1JEEA 1YB5A 4FCWA 5BW8A 3KAJA 1BEZA 3QEMA 3MJDA 4LMPA 3S2UA 3R74A 4JC8A 1P4AA 4CUZA 2Z2YA 3ZNPA 3WWEA 1YJBA 2J6CA 1IEQA 3MAGA 4KGDA 2ZTVA 3FCOA 1XYVA 2WG1A 3A36A 4P4LA 4RPLA 1I14A 4FZJA 5LWQA 3LXXA 1QP7A 4X85A 2F8SA 4BFYA 1Z36A 4CKBB 3EW7A 1OC4A 2CZQA 5FFMA 2WLTA 3PKIA 2AC2A 4G37A 1XCMA 3V6KA 5I9SA 4ZXFA 1ODIA 5DN6A 4CV2A 3EBOA 1IUKA 4WVFA 4HX5A 2ZR9A 1ATZA 4J75A 4N03A 1XK7A 3OETA 3GAAA 1V1JA 3JZFA 2FPWA 3DTVD 2RH9B 1UPFA 2VF5X 1WCIB 1J8DA 2XUFA 2ZJAA 3IERA 5AKHA 5LYYA 5BUQA 5JAUA 5FOWA 1P2GA 1Z2DA 5L9AA 1GQQA 3AW9A 1ZKDA 5CFLA 3AX6A 1CK4A 1UKBA 4HB2A 2VNKA 2BQRA 3C2QA 2QLNA 4GX1A 3F49S 3DE4X 3LP8A 5KCMA 2V97A 1E2DA 1RKQA 3QPVA 1XDZA 4OG2A 3SS7X 3JYQA 3T4UA 3UT0A 3ETCA 2PA3A 2VJKA 3QITA 4FWBA 1AHNA 4EHHA 1E2FA 5F7OA 3MILA 2DT5A 5JR3A 3X1YA 3U54A 3KOUA 3AHEA 4BV2A 4JL5A 1U1FA 4GP7A 5E6RB 1B76A 2I6FA 3DT8A 3UHJA 1JNXX 4NH0A 2XOEA 4FZ3A 3IPXA 2VDRB 3GFTA 2J87A 5B4VA 4JEMA 3I9KA 3MHPA 4OJYA 2EEZA 4CM5A 5JXWA 1JXMA 5JFGA 4KV7A 3NNSA 1P9OA 1ZNXA 3RS5A 1QFJA 1YC5A 2AG8A 2JLRA 3HXTA 4PFJA 1WQ4A 3J7AK 3PO2G 2Z08A 4E6PA 4Z51A 4ECUA 2YWHA 2WLSA 2CLLB 3TF5A 1VHTA 4WUVA 2LPMA 2OWDA 3D54D 4I4IA 1GZ5A 1AURA 5TMEA 4NQZA 4YRZA 2OC9A 3MUEA 5IWAB 2XXJA 4NCBA 3QLJA 5BV2P 3OQPA 5KFEA 3F9IA 1N9GB 1ONNA 1TEHA 2CHQA 2P7HA 3OT1A 1VP3A 4L5CA 3Q8KA 1KU0A 4GF5A 2Q46A 1X7DA 4YUZA 1LU9A 1AF7A 1R6BX 4R83A 1Y42X 3NAMA 4AZWA 3IV6A 3MJEA 4L27A 4DCOA 1B23P 1O03A 1VXOA 3EULA 3JVIA 4KPFC 4YJKA 4GLWA 3DFZA 2GILA 2V9WA 2E6KA 4IDAA 1JLHA 2JARA 4MV9A 1Z0KA 2BLNA 1U1CA 1PVVA 1KIFA 1KO8A 2IYQA 2PSJA 1XUOA 2JLCA 3BD6A 3LW7A 3SJBA 1K92A 2E18A 4S1WA 3RD5A 3ZHXA 3CZ9A 4FLFA 2QQ0A 1O95D 3M1LA 4NG5A 4ZMSA 4OQFA 2COJA 3NG1A 1N77A 5KYNA 4TTQA 3ME5A 4J29A 5KJ6A 2GXAA 3WWIA 4CEHA 4HNQA 4A93G 1LVHA 3ZHSA 2IWRA 4D6PA 2V4RA 1SB8A 1C7JA 2R96A 3BAFA 2Q7OE 1ZQ9A 5IH7A 1VYUA 2QE7D 4GR5A 4N39A 4KQIA 1C7QA 3CUTA 3V34A 4KGVA 2BZ1A 6ADHA 2QM8A 3P71T 1ZIYA 3DEIA 1J8MF 1U28C 2C4TA 1BEEA 1DCKA 3GRZA 4UTOA 4D57A 1HYGA 2XCTB 4MUJA 2HU5A 1XRNA 3PXGA 4HXYA 1EUDB 3IQDB 4LV8B 4S2UA 4ZHSA 2EKBA 5T8KA 1IN4A 1DX4A 1X80B 4A3CG 2IDKA 2VZ0A 5IAEA 3PDIA 1DC5A 1H9BA 1O08A 3H5TA 3OOHA 5A9SA 1O2DA 4Q9IA 1KETA 3I5MA 1T4DA 1IPEA 1REQA 5F5LA 3W78A 1E4GT 2B30A 3N6RA 1I94H 3RDPA 4EMBA 1KMHB 3ZWMA 5IXJA 4OGWA 2GZRA 1YMUA 4P3NA 2ZLBA 3V9PA 1IXSB 3CNOA 2CNWA 4OFBA 1D2CA 4FE3A 3ZQUA 4RV5A 2C2ZA 3LY5A 1PYOA 4LG1A 4IJWA 4W5WA 2UUAH 4C5AA 1N34H 1Q1QA 1U4SA 3TQHA 5BUZA 4GPD1 5DLDA 1EKVA 4Z2YA 2WHYA 4R9RA 2QYOA 1KMCA 3G68A 5FBRB 1PVOA 2WTFA 3CIFA 4MWTA 1DO2A 4ED7A 4PAQA 4GMGA 4PX2A 3AVUA 3OPQA 3NHBA 3MWYW 4NDNE 3ICWA 3UY4A 4IBOA 2PLNA 4P2BA 2BUAA 3KSDO 4DY4A 4DC9A 1OTYA 4RK4A 4Q4HB 1SCNE 2ZUWA 1E2EA 1UADA 5I5TA 1ZIOA 2CEKA 3Q98A 5EGNA 2JFXA 2UUCH 1S01A 2B8NA 1RJ9B 1YFKA 1IHUA 1E9AA 7ABPA 4CMGA 4NAHA 3VR2A 4X66H 3DV0A 4BECA 4YUVA 2VTKA 4ZZ1A 3C3DA 1LK7A 1R10A 3FW1A 3L7NA 3GYBA 4Q44A 4J0JA 4WFQA 5BW6B 1ENPA 2PUCA 1R8SA 4B34A 1A9XA 4O7SA 2J4CA 3TD2A 2CB0A 4IG9A 1AN7A 4E21A 2HMWA 1GHTA 1SVSA 3GCWA 3OZBA 4HLNA 3F8SA 1JDTA 4WEQA 1B0AA 3KXDA 2JH9A 3O1JC 2EL9A 1AIPA 5LZ4A 2YW2A 3G9TA 2G67A 4AKEA 2QG6A 3OKCA 4GL4A 1WF3A 3HP1A 5F23A 2J6HA 3GB8B 3KJQA 2HRCA 3N43B 1D8AA 2P6PA 3CLKA 3DZGA 1Z39A 4FIZA 3NO4A 4Q93A 1QHIA 3CH4B 1GO3E 4B3DA 1LNZA 4ENUA 5IU6A 4J9VA 1CX9B 4JU9A 1W36D 5AJZA 3S70A 2XUGA 3LS2A 4IW3B 4JX8A 4NBNA 2FPOA 2P77A 5DSTA 4DBZA 2WRZA 1ZX1A 4PU0A 3CLSC 1GL6A 3B9RA 4YRJA 1RJDA 1LA2A 5HOEA 2VUGA 4LHYA 4ETSA 3ZDBA 5JANA 3WO0A 3T5CA 2RHBA 2QZ4A 2R8ZA 1N34B 3JAKB 4O7VA 1XP5A 3SFZA 4J1TA 4D0LB 2PQMA 3DZIA 1U3GA 5KVVA 3ILYA 1EWYA 5C3MA 2VUMG 2BSAA 1TIKA 1L7NA 2Q1XA 3B7WA 2GHTA 2H2WA 3Q72A 3IKLA 1TM1E 1UWLA 3RNOA 3W2EA 5B4TA 4JJ8A 3SKXA 1UXJA 1CQJB 1CR4A 1E5DA 1QIKA 4O7WA 2PWAA 4QBFA 3IUEA 4RVOA 2A5LA 3E84A 4G8DA 2MMCA 5KSPA 1IBLH 2F3UA 3AUAA 5FUXA 5JNRA 1VL2A 1EAMA 5AM1A 5KFAA 1ULSA 2HNBA 3ED5A 3KQHA 4KQEA 4BQIA 4AUEA 3ZJTA 3ISTA 1XAGA 2R6AA 4EBDA 2QN8A 4FMDF 5PNTA 1K6XA 1E2HA 4YYZA 1MAUA 3UC5A 1XL1A 4Z0HO 1IHPA 1YRHA 4LDNA 4EENA 4URVR 1RHQA 1NUAA 1XZEA 1VBKA 4FBMA 4RF3A 2XUKA 3ILHA 3H1GA 1JI3A 1UK7A 2PZ8A 3NAGA 2BKEA 1GA4A 3W5IA 5JSKA 5C3UA 2QVLA 5B1DA 1NP3A 2VBGA 4MV8A 3HB1A 3TS1A 1WZCA 3IVGA 5IJ0B 4HFRA 5KPJA 4PC7A 1UBJS 4AJIA 3IPLA 3EXG1 3QX8A 4I50A 3LWDA 2TMYA 2XYHA 2QWXA 2E5WA 3B38A 4PYMA 1DC6A 2BQUA 4YO7A 1K3FA 1T9GS 3OWXA 3DJFA 3BJEA 3OUTA 4HG2A 3E3MA 1TAHA 5JPCA 2WJPA 4L3VA 1P0MA 1L4HA 5EY5B 4EEZA 2IA5A 2WSIA 5L3SB 2ZXFA 1TUIA 4GXRA 5A0TA 2Y4NA 5B7QA 4R6XA 3GJ5A 3QU2A 2NZ2A 2DYKA 4RPIA 1H94A 1Q19A 1RCTE 1ZU5A 2AUMA 2JD2A 3AUTA 3GELA 1BKSB 4IFBA 4IUDS 4IRXA 1FNDA 1C80A 4KIGA 5KVAA 1TLTA 4RNCA 5HRUA 1X0VA 2ONZA 1Z8DA 4A8HA 2WW8A 5KFWA 1JR4A 3WGJA 4BYMA 1IJKA 1RLJA 5ADWA 4MI1A 3TIFA 4Y1GA 2C7GA 4E4TA 3E7XA 1UP4A 2P62A 4J0DA 3U26A 2X7HA 3QGMA 4KACA 1FJ2A 5GZ6A 3V8PA 4YRIA 4EY4A 5K99A 3A6LA 4IIUA 2JATA 4FS8A 1QKJA 2CF5A 4ECWA 4QT0A 3WIEA 3A28A 4D9IA 2B5OA 2JFHA 4QU5A 3M2TA 4QUDA 4U0KA 1IHOA 2QM3A 4GOXA 5L6LB 4Z53A 1B26A 4B8ZA 3IQHX 4HKTA 2GQSA 5B4UA 5F1OA 1EWKA 3GIPA 3VH3A 4IQGA 5IEBA 3AP3A 4FI3F 2BEUA 1Q77A 3LA6A 2UXCH 3SQWA 5F33