2FPPB

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
393
structure length
393
Chain Sequence
b'MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
molecule tags Ligase
source organism Sus scrofa
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
total genus 127
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fppB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fppB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fppB03
4EGJA 3ORQA 2CSUA 2FPIB 1JDBB 4L1KA 4YB8A 1KJ9A 2J9GA 2HJWA 4ZQIA 4O7LA 1WR2A 3E5NA 2QK4A 4YBZB 3U55A 1I7LA 4FE2A 4O86A 3VA7A 3JRWA 1A48A 4HNUA 2YS6A 3ETHA 5J2TF 4FGRA 1BNCA 4XYLB 1DIKA 3V4ZA 1Z2OX 2W70A 3JZIA 3MWDB 1JKJA 2W6NA 5CA1F 3MWDA 4FFRA 4HNTA 3TIIA 3DMYA 4MV7A 1M6VA 3OUZA 1CQIB 2FPPB 4IHJF 2FPGA 5C8YF 3RUPA 4FFLA 1ULZA 3HO8A 3R5HA 4MA0A 3UFXA 4WBNF 4ZOLF 5DMXA 3GLKA 5D8DA 5BMVF 2YZGA 4XYMA 1Z2NX 4IIJF 4EGQA 2SCUB 3MJFA 4HQ6A 4Y8VA 3K3PA 4MV1A 4O4JF 3R23A 2R6FA 1KEEA 4O84A 1OI7A 4IWXA 3JZFA 1GSAA 2YWVA 2P0AA 2W6OA 3TQTA 2FP4B 5GONF 4MV9A 2GLTA 1C30A 2NU7B 1KJQA 3KREA 1W93A 4XZ3A 2DIKA 1UC8A 2FPIA 2GPWA 5KKNB 5JVDF 4IWYA 1IOWA 3G8CA 2W6PA 2ZDGA 5J2UF 3VPBA 1E4EB 3MWEB 4MV6A 3K5IA 1VKZA 4ZHQF 1KJJA 3ETJA 4O7VA 2GQRA 5C1OA 3R5FA 1AUVA 4MV8A 1C3OA 5JQGF 2I8CA 1Z2PX 1EYZA 1GGOA 4XX0A 5IYZF 1GSHA 4XYMB 1EZ1A 1M0TA 1KC7A 5CAEB 3LWBA 3RV4A 1CQJA 3VMMA 3QFFA 2NU9B 2W6MA 3U9TA 4I50F 3RFCA 4FFMA 2PVPA 2FPPA 2FP4A 1CE8A 2CNUA 3NUAA 4O81A 3AX6A 1I7NA 2CNQA 4XZ3B 2YS7A 2VPQA 5JVLA 2YV2A 4O83A 3ORRA 2HGSA 2NU6A 1M0WA 1EUCA 2W6QA 3HBLA 3SE7A 1JLLB 3Q2OA 2CQYA 2NU9A 4O7SA 4XYLA 3UFXB 4HNVA 5LXTF 2W6ZA 3GIDA 2YRXA 3I12A 2XD4A 5HBRA 3HB9A 2I80A 5CB4F 3VOTA 2R87A 4O2BF 1DV1A 2CZGA 4MAMA 5H80A 4O7NA 4ZI7F 2YZMA 4O7ZA 2OLSA 5LP6F 1KUTA 2NU7A 1VBHA 4O2AF 4YAJA 3JRXA 5JH7F 4RZQA 4QSHA 3WO1A 2X0SA 4MV4A 3KALA 3WO0A 2SCUA 1PX2A 2I87A 2XCLA 1JKJB 2R7KA 4C5CA 2QF7A 5HV6A 5K2MA 1E4EA 5I47A 2Z02A 1B6RA 2C00A 2R82A 4EG0A 2WYOA 4IZOA 3KAKA 2PN1A 1JDEA 4O4IF 1SCUA 3PFFA 4M9UA 5LOVF 3LP8A 3G8DA 3MWEA 3TIGA 2NU8B 3Q1KA 2ZDHA 2VQDA 2Z04A 2YW2A 2YYAA 2FPGB 4O7WA 1KBLA 4YJ2F 5CA0F 4C5BA 4FFNA 4O7YA 1UC9A 4HR7A 1W96A 1IOVA 3N8DA 1EHIA 4YAKA 1T36A 3RV3A 2NUAA 1B6SA 3WNZA 5JQWA 4O82A 2V59A 1DV2A 1PK8A 4YB8B 5KX5F 2GQSA 5LA6F 4TV8F 3VPCA 1AUXA 2W71A 4O4HF 2CNVA 4FFOA 2DZDA 2YL2A 2YZLA 2GPSA 2R7MA 1JLLA 4XX0B 2DLNA 1OBDA 4FU0A 1GSOA 2V5AA 3DF7A 2DWCA 5LYJF 2ZDQA 2FB9A 4WD3A 2R7NA 1CQJB 3R9RA 4FFPA 3V4SA 4O7TA 4MV3A 4MA5A 4Y8VB 1VBGA 3U9SA 1A9XA 3N6RA 1CQIA 3AW8A 4E4TA 4YBZA 4C5AA 3VPDA 2VR1A 2R84A 2IP4A 4ME6A 1EUDA 5CAEA 1EUDB 5EZYF 2YV1A 2R85A 1KJIA 4NYEA 4DIMA 5C1PA 4I4TF 1KJ8A 4TUYF 1GLVA 1SCUB 4TV9F 4YJ3F 5BPFA 5BPHA 1EUCB 2NU8A 4O7RA 4I55F 3K5HA 3BG5A 2PBZA 4DLKA 2V58A 5HBRB 3OUUA 1OBGA 2YRWA 3U54A 4YAJB 4O4LF 2NUAB 1CS0A 3TW6A 3KAJA 5FNVF 1BXRA 2YZNA 3TINA 2R86A 4YAKB 3R5XA 2NU6B 2R7LA
chains in the Genus database with same CATH superfamily
2H18A 4I3GA 3ORQA 1Y42X 1Z08A 1XNQH 2JD2A 3C8HA 3GNTA 3L05A 1G2OA 4O1IA 1C3EA 1DOAA 3ZQ4A 4F9FA 3L92A 3F6EX 3OLVA 3P7MA 4PXSA 5THXA 4NENB 1NNSA 2RG7A 1FZTA 2C5EA 4A3BG 1J1IA 1BRMA 1YOBA 3C0FB 3LDAA 2KQUA 3TRJA 4EF4A 4F4DA 4YR2A 3HJAA 4B46A 1WDLA 2Y99A 4ECXA 2GFQA 4EGFA 4ER3A 2PE5A 2D5AA 3IDFA 1X38A 5H4GA 4C4XA 3QWBA 3A1VA 4HMPA 2G04A 3NBUA 3PX3A 2TSYB 1HL7A 3LTNC 2E4VA 2JJ2D 1RAFA 2W0SA 2W0MA 1VIDA 3LWDA 3O1IC 3P2IA 4ZKDA 2NO9A 4DRYA 2OCYC 1X86B 4WESB 1WM1A 3BK2A 2JIZD 3OHBA 1V9SA 1FJ2A 1Y3HA 2CNLA 3ORYA 5C3MA 3KHRA 4O1MA 3COZA 1KH3A 1TL7C 4RVGA 5AKIA 3PDIB 4JI4B 4RUAA 1ZLYA 5B53A 1UP7A 3D6NB 3DPSA 5A5DA 3ZD6A 2C4MA 4MEJA 2YC2C 2H11A 2NXNA 2QBYA 4RYLA 1EVKA 1G55A 1PBTA 4G0NA 5LBTA 1CKOA 1KHHA 2F1KA 1O57A 1G38A 2X0NA 3MWDB 3OOHA 4QTZA 1NVBA 7MHTA 1CZOA 1O8BA 3TNDA 1JJIA 4ZIRA 1T2FA 4GOJA 5BV1A 3QWFA 1ZINA 2ESRA 5HX7A 2VAWA 2O2ZA 4LGMA 3JWEA 3EZ6A 4ND5A 1PZMA 5AI8A 2GYUA 4QICA 5JADA 3D8NA 4LJAA 5EE9A 4MKZA 5EIHA 5HGXA 4B7XA 1ILWA 4DR2B 2UUCB 4O8CA 1DQZA 5I48A 4OVKA 3W8EA 1W85A 5LLTA 2JHFA 3IKLA 4OFZA 1JZTA 3R5TA 3R0ZA 4R41A 4UBOA 1F2DA 4LZLA 4DANA 1L6IA 1RE1A 3UF0A 2N3ZA 5E1DA 5DGHA 4Q7QA 4YR3A 3K6KA 1J5XA 3Q12A 1VQ1A 5EGNA 1P19A 3K0SA 2IHNA 3BCUA 5FLXW 2OFOA 2V7PA 1GG8A 3HWSA 2AR0A 4YLEA 5A3VA 2EZTA 4AFNA 2O8DB 1G42A 1U0NA 1J00A 2FE1A 2FUG1 3O6VA 4KDEA 1EA7A 4NEQA 3KV1A 3TUJC 4DJFC 5AW8A 1EFPA 1RAGA 1S2NA 3RI3A 3BXHA 3PDCA 2GETA 2N1BA 2WTEA 4R51A 3AYHB 3E22B 4RO0A 1R8JA 5CH8A 1TYAE 3IKTA 1ST3A 3ETLA 2DR0A 4D0RA 2VRWA 4YLYA 2J0SA 1L5VA 3A1TA 3ZHXA 1OI3A 4EMSA 1JMVA 3GFGA 4DGQA 4BFVA 1Q1ZA 5I7AA 5FUMA 3JQ9A 3ZC3A 3LOUA 2QGFA 1LSOA 4IR9A 1ODSA 1Q83A 3JQRA 1VPTA 4WCDA 3WYAA 3ZTYA 4BB9A 5K8JB 1ECPA 3LCRA 3ND7A 3NWEA 4XB1A 1OAOC 2CXPA 1BGWA 4KXVA 3WWZA 4ALMA 1PT6A 4UPDA 1QCZA 3SK0A 2V3CC 4E5DA 1LBEA 1APBA 1L4YA 4HLQB 1DU4A 1NKTA 1NQOA 5KBYA 4QWWA 2WZDA 1HC7A 4DSAA 5F4ZA 2PBFA 3LCUA 4GLJA 1GU7A 2QDKA 4Z9BA 1JV2B 2QD5A 3OICA 4FYXA 2W4IA 1K0UA 1D6SA 2ZT7A 3HADA 3RUAA 4XSVA 3LUKA 1T43A 4B4KA 2R11A 4D0SA 2WE6A 4EWLA 1IZZA 2OV6A 3GQCA 5JO9A 3PR2B 4NYIR 2BGIA 2RK4A 1IQRA 1N48A 4LHEA 4Q3NA 2G4VA 3VO9A 1OROA 1ZHOA 3PJFA 2XDWA 4GT1A 3U4QA 2UZAA 3GGCA 4FM9A 5BWMA 3R5SA 3KTAB 1WD7A 4R8SA 5EJ2A 2VCEA 1L9XA 1ISIA 2V7WA 3H1AA 5G1OA 4NXNB 4REQA 3K32A 2H2DA 3G8CA 2J3QA 3GJ3A 3B7GA 4AKSA 4EUEA 5LC1A 5B4UA 1HFKA 4AY6A 3I0NA 2D62A 1CKMA 3D6MA 3K1JA 1T4GA 3IUMA 1B6GA 2I4RA 5IP7G 4BVKA 3E9MA 4P7KA 1J5PA 5EHNA 3Q6IA 4NU6A 5AKJA 3QA3E 2Z1NA 2P9CA 4IIJA 4GYJA 4O3PA 4QEKA 4TTPA 3S2GA 5KNCH 1VXOA 1RYNA 4FEEA 2F4VH 3HCBA 3Q41A 4GI2A 2IV2X 4I1IA 4PGAA 5K01A 1LC0A 2LIPA 3H9CA 1AMOA 1YL6A 1BCRB 3CVZA 1Z73A 3BGDA 3WK8A 4KREA 3FZGA 2B78A 4JELA 4V03A 3TZKA 5JQGF 5SZIA 1QYVA 3BMCB 3FE2A 5T4BA 2X5NA 3K09C 5FUXA 4MAAA 5ALSA 1MRZA 3UKJA 5AHWA 2F4NA 5BR1A 1W6RA 2ZJOA 5CRIA 1GPNA 5K4GA 4BQIA 5F7XA 2PZGA 3NBAA 3C98A 1ABEA 2QTNA 2VUUA 3DTFA 4FEGA 1LLFA 4PLWA 1JYFA 3DBVO 3LO5A 2KLHA 2P6PA 3W3AH 5BN5A 1KC7A 4APMA 3W3AA 3DEZA 2UVWA 4MHOA 2BHNA 1G3IA 4HEQA 4OI4A 4QYXA 1FTWA 3PNQA 4I1UA 2V9ZA 4OHBA 4A6PA 4WXRA 1D4AA 4YS6A 1NZJA 2QJFA 4EUKA 3BICA 3O8OB 1OU0A 3B2NA 3P9KA 4W5JA 4LMAA 1CVIA 1AK9A 3T5TA 2MHCA 4Q7LA 5JO0A 5SV2A 2BMWA 3AJRA 3F74A 3B36A 4MVJI 1A3GA 3VR5H 1O03A 1RAHA 2BJVA 4MWGA 3TOCA 3OZFA 2MOKA 4E4RA 4F06A 4RSMA 3ITKA 3KB1A 1SHKA 2XMBA 3C85A 4DHEA 1CY4A 4MVJA 1VYVA 4HVLA 1IXYA 2ZIFA 4A3GG 2FI1A 4G0YA 1GZSA 4N5LA 1UKZA 3B1XA 3LUPA 2COGA 1AGPA 4LYEA 1QV7A 1XD2B 2PZ8A 1CQWA 4NMMA 4GL2A 1BC5A 3ZGNA 4ETMA 4XD7A 1I30A 2BFBA 1K8ZB 2OT3B 3KJZA 4FFBA 4BMXA 3UAVA 5KCZA 5CA1B 5D6NA 1NMYA 1SG6A 5JLAA 3ZLBA 4PQEA 4Y1GA 5A1TA 5JWOA 4DV1H 5DLQC 1U3WA 2EKDA 4EUSA 3ZWPA 4E14A 2AGQA 2Z08A 2OCGA 4JN6B 4XVHA 3TKAA 4AL4A 1U6KA 4YK7A 2D6FA 5BQ3A 4QC2A 4Z0PA 1I2BA 1XK6A 3LP6A 5G02A 4B3FX 1VL1A 3W5BA 4NCBA 2WKSA 2PH1A 5CNJA 4M7EA 2QU8A 5CXXA 5K0LA 3EPHA 2E5LH 1ZJZA 2PT9A 5ABPA 1N5LA 5LKAA 4L0QA 3M5CA 4CN8A 3MS7A 4ZJYA 2HA7A 4KQ1A 1T8RA 3IBTA 1EWRA 3FLAA 4ALIA 1WY7A 3JQCA 2P4SA 1VM6A 3HH8A 1RCUA 3KYDA 2W6ZA 1CY6A 4P5EA 4ZC8A 1Y1LA 4DR1B 3C87A 1QH1A 5F1YA 1T2VA 4AY5A 1CU1A 3MGBA 2CKDA 3AO0B 2F9MA 4IX1A 3CVWA 1JKFA 3HSKA 4AZTA 1M0SA 4C22A 4X6XA 2H1SA 3MAAC 2HCRA 2DFLA 2O52A 5IAJA 1CZLA 1AUQA 2Y1CA 5HCUA 3R7NA 1D2CA 3IVRA 1ISFA 2RGVA 2FN4A 3DLPX 4MR9A 1QQBA 1YK1A 4NHOA 4YAOA 5ALHA 4KAFA 3IOEA 4HSEA 4N8SA 3SEAA 1UC4B 2VEDA 4RPLA 2X5JO 5KWSA 1B14A 3C3JA 1XLTA 1P33A 2QMYA 5A9RA 1OX4B 4OX9Y 4V0NA 1U81A 1IY1A 3E7WA 2Q49A 2X2EA 4YYEA 4AW9A 2AN5A 4WEOA 1Z7EA 2C54A 3BH7A 4D80A 3RJ5A 2X0SA 4D45A 1IZ8A 5ALTA 3EGDB 1F8GA 1VL8A 1W49A 2NSHA 2EKQA 2YWJA 2ZYGA 3D7KA 13PKA 4FONA 3EWNA 3FYTA 3CUYA 5JYEA 2X8JB 4UREA 3HXMA 1E2QA 1E3SA 2FMKA 3NHKA 3QVUA 1DT3A 2XEDA 5LNK1 4EHJA 4DLNA 3TLXA 3K6SB 3H40A 4ECTA 4F8JA 1FDTA 4RAZA 2FF5A 3MGCA 4HFMA 4G36A 3AFOA 3JQ7A 4ZT4A 2H3EA 5FEMA 4JCCA 4ARSA 5BW4A 3O8QA 1ZCAA 2EVWX 3UZOA 3TQIA 2PMFA 1IUPA 2ZITA 3KAKA 3EVGA 3OURA 4FGKA 3PHJA 4HNRA 1KDYA 1RZUA 4B7CA 4YCCA 1QC5A 3GN1A 3CRNA 3L8YA 3D6VA 3T99A 1X7DA 1H1LB 1VKJA 4D81A 1AHNA 4BQNA 5JXIA 4NH0A 4CNBA 4B6EA 2FUCA 2N42A 2H1RA 4P4TA 1KWGA 3ZXYA 1LQUA 4KAAA 3KXLA 4IUCS 5EUBA 5LP6B 2RGXA 1K9VF 1VGQA 1T4BA 1WXWA 2CVPA 5IW8A 4MW2A 4ISBA 2Q50A 4KWIA 1I9CA 1V3TA 5FPPA 2A1HA 3OLQA 4V3BA 1UKCA 1L5HB 5H16A 2IZ6A 5KX5A 3R9XB 5G53C 1U8XX 2AFHE 4B5LA 4JOCA 1E2LA 1KBLA 4Q0YA 1LC3A 4MH0R 2QE7A 3ILHA 4AKIA 2PS3A 1SKMA 2QMUA 1GY8A 5AW0A 4OBXA 2HC9A 1W581 1MOSA 1K98A 1T4DA 4UNIA 2O1EA 4RTLA 2PA3A 4X94A 1RNLA 2KPOA 2GD1O 1S2MA 5DHQA 1T36B 1V1JA 2ZB4A 1A9SA 4B7AA 1SXJB 4NLLA 2UAGA 3ENKA 4ERNA 1FMLA 1VHJA 2G7MC 1MB3A 2JJ1A 4D5GA 2RC6A 5MDHA 4WOPA 3A4IA 2EP7A 4J9PA 2DH5A 2FPRA 4O2AA 2P7IA 3OBIA 1XFDA 3QVGB 3OF5A 2JKVA 3RRYA 1BCRA 4WNIA 2WHQA 4DNOA 5BSEA 1SM4A 3EF0A 2XT0A 3LPMA 2ZRHA 4WKOA 1M73E 3A1DA 2OBNA 4O1HA 3ZWNA 4GX1A 1YR9A 3P9RA 4CMHA 4RJIA 2P5YA 3GPBA 4A16A 3WTBA 1JIUA 3GL9A 4FI3F 4W5OA 4D4MA 2RI0A 2X0FA 1SBYA 2O0KA 2VDJA 5THQA 3FTPA 4QECA 3GEEA 2WMYA 3QQPA 2W71A 2XKJE 4Q93A 3UY4A 1T29A 4N0DA 3L8GA 2W2MA 2V6BA 3I30X 1IB0A 1C0IA 2C4UA 2IF0A 3T4UA 4Q9NA 1CIVA 3SXJA 4PHFA 3PZRA 1JLLA 5JEEA 4Z99A 1JBEA 3G85A 2BUAA 2RAFA 3UJHA 2HSZA 4NESA 1MQ8B 1JVSA 2HCTA 4D9CA 4M7PA 3VU9B 1P29A 4PN7A 4OAPA 1ISMA 1NA5A 3GLSA 1RJWA 4JI5B 4JI6H 2RHOA 4BN5A 2NV0A 3S1SA 1O58A 1RYYA 5CH3A 4AWXA 1NW5A 4WCFC 2W5UA 3DA8A 3NIGB 3OZIA 1B4DA 1WUYA 1AKMA 1YCDA 3C6ZA 3M9NB 1M8JA 4B33A 4DSZA 1GTG1 2QRJA 3VR3A 4EW6A 3QUSA 4WX2B 3AEZA 4UZFA 2GDZA 1VCNA 2J7KA 3NUZA 3P0EA 3DH0A 3HLKA 2ZRFA 3ONDA 1KI1A 2ZYUX 3M6WA 4K28A 4Y8VB 1J2RA 1EHYA 2FWBA 2QVXX 3U9SA 5L1IA 3A6GA 3BMCA 3PXEA 5KNBA 1A9XA 1DWUA 4IYJA 3BX1A 4RHTA 4UHHA 2PT7A 3LT5A 1Z4KA 2NYVA 4UTOA 3G2LA 2BFBB 1KY2A 4FFBB 4HS4A 4JLNA 3WR5A 4Q37A 5K09A 1J2EA 5HNEA 1UBCA 3EAGA 4CXMA 1YNOA 1XF9A 1SHZA 4G09A 3VPDA 5HCNA 1GGJA 5LYYA 1NVFA 1N8NA 2BL4A 3HWRA 3M4YA 4Q3CA 5TPWB 4UCSA 3VYUB 3ONEA 4D3DA 2BE9A 3R6TA 2PZFA 4FPXA 2O05A 5CAEA 1P2FA 3DOOA 5EZYF 3GDHA 2BGMA 1OXXK 4MUBA 4AJLA 2FMTA 1VL5A 3F6BX 3AL0C 4PRLA 3DBHB 3DUFB 3PNKA 1E5XA 3KTMA 2ZRIA 2WUWE 2WAMA 3QLVA 3N42B 1U1DA 4RE6A 5EIWA 3FF1A 2G9QA 2C2EA 2J0EA 4IG4A 4M49A 1BFDA 4BKRA 4EHLA 3PD1A 5FEUA 2PD4A 1R0BA 3VVMA 4C21A 3EODA 2O8DA 1OJ7A 3RJ9A 1AO0A 3Q1LA 1VKHA 4CQNA 5EL0A 1A98A 2AUMA 3JYLA 4MRRA 3X1MA 3DMPA 4AVYA 5TMPA 2WB2A 3AR9A 2ERCA 1O95A 5DM0A 4WI1A 3OMLA 5DZSA 1J56A 5CYFA 3UT5B 5CD1A 2PQ0A 3PJEA 3MLEA 1NDHA 4RS4A 4RA9A 5A3QA 3FBTA 2G8NA 1FB5A 3QY0A 2CVFA 2XQVA 3IBCA 1E0SA 3LK6A 3WYGA 3DOFA 5TQ0A 3U80A 4G0OA 1HDRA 1I3CA 1P17A 2IHUA 3UAXA 3ZS9A 5LP6C 4F2DA 1P0FA 4WEQA 3PQ7A 3OFKA 2IGBA 2H2AA 1WKVA 4ZZ0A 5HIJA 2BM1A 1DPFA 1DBIA 1RS0A 3L01A 3PLNA 3W8NA 4CM9D 4FHFA 4OQPA 1TKBA 4KX5A 5JD3A 4DLXA 3TG2A 1M6HA 1YKSA 2ONCA 1WVGA 1YDEA 3TR0A 4ETWA 2NUTB 2GDJA 1XNHA 2OILA 3NM4A 4ZO8A 1GRRA 3TW6A 2Q6LA 4H6XA 1BQ3A 1RTTA 5GM2A 5L9XA 4A8HA 3ZZ0A 4RKYA 5FNVF 3S2SA 1E64A 1EGVB 3FNEA 2VHCA 1ZM4A 4F3YA 1SWWA 4Q4LA 2V74B 2HWUA 2D5LA 3MLBA 4HDAA 3CX6A 2R7LA 4MIOA 3T9AA 2ZBQA 3OQ6A 4Y6PA 4RJKA 5B7NA 4O2RA 2LRHA 3P2JA 4MWCA 3OKFA 5K7SA 5C8YB 2WJYA 3ZKAA 5EJ9A 1RWMA 1YK0A 4L0DA 4PW0A 2Y2VA 4CM3A 2O2CA 2E87A 1FE8A 3QOWA 2J6SA 4X63A 1S2OA 2XTMA 1EXMA 1RRKA 4CCWA 4REQB 4K9RA 1PJ8A 2RGDA 4MWDA 4NH4A 3N8HA 3PK0A 2O8CA 1DRJA 2XCUA 2YZKA 3KJIA 3VX3A 2YVKA 3Q98A 4IS3A 1LEHA 3AVQA 3SQOA 1ISRA 3OO0A 1PR4A 2PS0A 3ZK7A 4ZOLB 4AP9A 1NR5A 3ESYA 1Z0DA 2REOA 4YBZB 1QTIA 1W88B 3UAZA 3ZCVA 1NM5C 1C7IA 4KBGA 1BE8A 3DQQA 2W4QA 3GTOA 3S1LA 1F3OA 3CT6A 2WWGA 2I1VB 1L0BA 1D5CA 3G68A 4H9GA 3DBRA 1NQWA 1OILA 4QG3A 1XZFA 3C41J 2P9GA 5KSYA 2ZI5A 3MELA 4HAWA 4DA8A 5JS8A 1BNCA 3NYRA 4J07A 5I3CA 1KETA 3KPWA 4EBCA 4LSZA 5FAXA 3PQ5A 2BT4A 3ZV6A 1VZ3A 1C8KA 2QTFA 2QY6A 2PUJA 1WXDA 4MMZB 3B5IA 3F6SA 1QG0A 2QZPA 4U9UA 3BC1A 2R66A 3VZBA 4B4WA 2ACEA 5CDYA 3M9OB 5UKDA 1TRKA 2O8FA 2P6NA 5ESDA 2FHPA 2YQ4A 4CDMA 1NBEA 4FYMA 4UBLA 3TQ1A 2XDQB 1XB2A 4DDTA 5T6BA 3T1QA 1F7UA 4HH3C 4NOKA 3W4KA 4FLFA 1YAHA 2DF8A 4Y98A 4LOAA 1DTWA 4TQGA 4D44A 4OXIA 4ZVMA 4AF8A 3ZU2A 4GLOA 5FOSA 3RIYA 4O2AB 5EQTA 3WX0A 1Z6AA 5KKAA 4WINA 5EWJB 3CWCA 1C8LA 4TMXA 4EYKA 3A3OA 2PL9A 1NPDA 1NU6A 2QPLA 1KYYA 4F8EA 1I3QA 3VH3A 4XCXA 4J75A 4QIHA 3GLKA 1QHEA 1T2UA 3EF1A 3EVDA 3R0QA 4XFKA 5H3CA 3P45A 1IBLH 3R7FA 4TX1A 2NYUA 1ECJA 4JGBA 2MR6A 2A9VA 3ZHZA 2NMVA 4EGQA 5DGTA 2HT1A 2XMQA 2FJPA 3KOUA 4EJSC 2YWGA 2IYUA 5JSQA 3EPRA 1NM5A 1AS2A 1EWTA 4QOFA 3STWA 1V9LA 4BO8A 3G02A 3JAWA 3PYXA 1FZQA 4AJJA 1CZNA 4L3WA 4WA8A 1KEEA 3KM0A 1LSSA 4UHJA 3V8RA 4E31A 1WHSA 3A1WA 5FL7D 3ZU4A 3QITA 2ZCUA 5JE8A 1OREA 1QF9A 1CUWA 1RIFA 3NNDA 2XA9A 4NBTA 2ZT6A 2P0AA 3OQOA 4RESA 1DMRA 3UCXA 1TK9A 3MTQA 2WA2A 1A9RA 1CS0B 3T9FA 4JC4A 4DR4H 2JZNA 3LT2A 4MUKA 5HRCA 2ZBRA 2V3WA 1U9IC 1UWLA 2REQA 2DFNA 2FN8A 1U9JA 3RWBA 2C1ZA 3QF7A 1KPHA 2QPOA 2PLFA 1G8FA 1NG9A 1QU3A 4ZVRA 3PEYA 3KYDB 3SHWA 2R25B 1UEXC 3A06A 4Y9UA 3ELUA 2JH3A 3K1AA 4FC6A 2C5HA 4WNAB 3KT6A 2H65A 1YKFA 3QJGA 3LWNA 1ZXBA 3DE6X 3PX2A 4P3OA 1DKMA 4PHTA 2WU3A 4ZOQI 4TMZA 4CKWA 3QSGA 1Y3FE 4NAUA 1FU8A 5ALXA 4DTIA 4NBUA 5KKNB 1WPXA 2IJGX 4UM9B 3WDKA 3O4JA 2FVYA 2HRDA 2R1VA 1RBYA 4P93A 3MR6A 1IMOA 4R9RA 4X41A 5L53A 1XQVA 2XOKA 1I14A 3JAKA 1DIGA 4TLAA 4YRNA 4DV5B 1YB2A 1CEEA 1R8SA 1AHPA 5EC8A 2LWIA 4FUTA 3RVRA 2XVMA 1J09A 2OO3A 3OZTA 3VO2A 3OM8A 4C89A 2BEVA 5HUQA 2QW1A 4Q82A 4KWTA 4RB3C 3LIPA 2FK7A 4ZHQF 3HE3A 4DCNA 4GWGA 3L7KA 3M4JA 5FUYA 5GVRA 3IT2A 3H3VH 3EC7A 1NI5A 5KSPA 2FZCA 1JI3A 1FDVA 1QH9A 3EIXA 1VSQA 4YACA 1UPXA 2QENA 4JLSA 3I58A 1OWTA 5ERYA 7REQB 1EKXA 4OKIA 4RA9B 3RS7A 1EK5A 1I51A 4KWCA 2NUBA 2I8CA 2ALJA 4IRXA 2ZSEA 4F3NA 2VF8A 3V55A 4X84A 1DAKA 1M7HA 1XDZA 4D42A 1JPNA 3KAPA 1UJMA 1Z4NA 2GPAA 1CDZA 5JR3A 2ZQ5A 3KSBC 5HKAA 1FFXA 3H4BA 1DJLA 5CFRA 5BOSB 2BGJA 1U4SA 2AEMA 2PRJA 3C7KA 3N87A 1JAZA 1P61B 2X41A 3H18A 1IK4A 1ZSNA 3L4SO 4IDGA 4KITB 5AVWA 2YYZA 3T95A 1H1LA 3T8YA 2AMVA 1P5JA 2X3YA 3AINA 1IPFA 2NU9B 1OBCA 1ZWLA 5ES3A 1QKKA 1L4LA 3A27A 1CLEA 2GKGA 2VWQA 2WJGA 1QSGA 1H8HA 2DFTA 2ZRDA 2Q4OA 3KEQA 3PHIA 3WLLA 4W9MC 4R9UC 5BW5A 1VHTA 3HVRA 2W2LD 1H66A 1M2KA 5I01A 3BJMA 2FLNA 1X3SA 3KU4A 4CT5A 4DDHA 1LPOA 1S3GA 3OCXA 5GMOA 4RYDA 5SICE 1JHVA 3WXMA 2XMCA 1LJUA 1NFQA 1JT9A 2I6GA 5DNUA 1EP3B 1HZZA 4NU8X 2HK7A 5H1YA 3ZLVA 5B7GA 5IULC 1PX0A 3U1TA 4PXYA 3ANXA 4BO0A 1KI3A 4IDQA 2CNQA 2FEPA 3FYHA 5FB3A 1QQTA 4L28A 4Q6BA 4RK1A 1YVUA 2F67A 2PG3A 4DIFA 1JYEA 2YS7A 4AF7A 1LDYA 1ZGAA 3AP3A 4FYWA 1P7ZA 5IYBG 1QIKA 1GM5A 3UHOA 2F1JA 3T3HA 4OI1A 2YNMC 3FPEA 3HCCA 5PNTA 3VHXB 4E5NA 2XGQA 2CK3A 1NF2A 2NTNA 3VYVA 2HG8A 5SY6A 4ZO6A 1XA3A 3DVSX 1PK9A 3JARA 3SE7A 2FSSA 5JCOC 4AQYB 3MPUA 2PMWB 2B5WA 4PGMA 2P6RA 5C32A 2MSWA 1KYQA 4XYLA 5B4TA 2FMHA 4D2IA 4B7ZA 1RC0A 5JD4A 1YR6A 2F90A 1BCSB 4PTLA 1P9OA 5ESWA 5TQ2B 1RP1A 4BY1G 2WM9B 2VDPB 3WJ1A 3GIDA 3I12A 2C7GA 4LXIA 4Z4IA 3WKDA 4EJSB 1D2NA 4F9EA 3LQSA 1DRVA 5LBIA 4LF8B 3PCRB 2PX5A 1PWYE 3PQCA 4D97A 3GV5B 1LI7A 1V45E 5DLYA 3NDIA 5E6RB 1YS6A 3HUDA 1YGPA 3IV7A 1GOTA 4ED8A 4F4HA 3I04A 3GGOA 4QJ5A 1NZDA 3TM5A 2MWMA 1JJFA 4LF6B 1NDUA 1XGKA 3A10A 5F5NA 4PC1A 5J5CA 5BSUA 3J81k 2IUUA 3ZW9A 1UOOA 5DF1A 3N2LA 1T2EA 3RS5A 3UO8B 3BQMB 4OQQA 5CBPB 2EX4A 3FYUB 3K0FB 1DWQA 4RFVA 4YRBA 1QYCA 1D1SA 5IAAA 2Z5GA 1SVLA 4H3SA 4UD2A 3D8RA 1YRQA 3IAHA 3M2TA 3SWWA 5EDWA 3W4IA 2FEWB 5TEVA 1W5AA 4FDTA 4XWYA 5BVGB 1IN1A 5ILOA 2QD1A 3KSZO 2I5PO 3O2QB 3KP1A 4A27A 1RM0A 3BORA 3K4HA 4W9NC 4ZWNA 3W2EA 2VAVA 2ZAYA 1AHIA 3WIUA 2J9XB 1SUEA 4E7PA 4JUCA 4IIBA 1BQEA 2A5GA 2G67A 4IVNA 4ZRNA 3UOAB 4I81A 4JQZA 4L4UA 3W6ZA 4C20A 4ZTUB 3HDGA 3MJTA 2AKYA 2IUSA 5K2MA 3GP3A 4UVIA 1HNWB 4GFDA 1QX3A 3CH4B 3IUQA 2BR5A 4MINA 4YJHB 4QM7A 4B3SB 4KYUA 2Q9CA 3Q87B 1NKVA 1N56A 1PQUA 2JIOA 2RHGB 2XYVA 5CGQB 4GE0A 2WYOA 1WDMA 1OFIA 2WJVA 1N7JA 3NB0A 2UZ3A 4AWAA 3G0CA 5I7FA 1TMOA 1MW8X 4XYEA 3RPEA 4RVCA 1CETA 1CY0A 3GRCA 4B4VA 4QFDA 4P82A 4Q21A 3C7AA 4EITA 3CW2A 2H00A 3B7WA 5KVSA 1LBSA 4K6MA 3I73A 3AJEA 3F4LA 5H83A 3MZ0A 4Y2JA 1E3DA 1FFAA 2FSIA 2WG1A 4MVCA 4U39A 2OQVA 3TY9A 4EA7A 4B3GA 4BTVA 4IH1A 3A4MA 1V0JA 3TOXA 1JIHA 1VSBA 2VXYA 3OZ7A 4CKWB 1YAJA 5CM9C 3WJ2A 5DULA 3RGZA 4WAUA 2YW2A 4JQYA 3TAXA 1JFLA 3UK2A 4J3NA 5DNVA 4C7XA 5BN4A 1E3QA 2GZRA 2VHUA 3E2PA 4NR0A 4DV0H 1W30A 1H9AA 5K3DA 3BILA 2ODWA 3E70C 4JC8A 5IBPA 3FPKA 4I5IA 3GXBA 2O7QA 3KKNA 5KU7A 3ZS8A 2ZIUB 5G0TA 1VG9B 2VPPA 2HCBA 4B3TB 4FGWA 3BL5A 1LA2A 2Y1FA 1W96A 3HI4A 2WWWA 2CN1A 3ETNA 3FXAA 4XIJA 2FFRA 2Z5FA 1S0MA 1RI1A 2PKCA 3A6EA 2R2GA 1QV6A 4ZP1A 3CG4A 1QYRA 2NUTA 4PX2A 5KI6A 1PR3A 4QIWE 4MA4A 4PYOA 1UDRA 4DDUA 1MO3A 4FMCB 4NAVA 5LQCA 4KIGA 1PD1A 1UINA 3HFGA 2JLBA 4NNOA 1J0XO 4UEWA 4GKJH 4EB3A 4GMKA 4B2PA 1WNTA 2DQKA 3SBOA 3QQ5A 2LDXA 5I7EA 4J0CA 4R8UA 2BJWA 1WB9A 3ESXA 4QPPA 1E0AA 4IRMA 4MVJF 3QVMA 2R8OA 3AUTA 2FZWA 1U80A 2Q5FA 4KPUA 4B3MH 1USIA 5EZSA 4Q1CA 2G17A 2BKUA 4BGUA 4CU5A 4LSGA 2IZ0A 1EI9A 1AKQA 2YICA 3CZAA 2H7XA 3A2LA 3NKFA 3DFUA 3F5QA 1RWKA 3W5UA 4HV4A 3EGWA 1DZ3A 5A4IS 4YWHA 1W1IA 3AR8A 2DTXA 5IZCC 1K3TA 3GIKA 1HT0A 3AHFA 1U2ZA 3JD1A 2R7MA 1MH1A 1RWQA 4GLXA 2VKQA 2Z56A 3W6PA 1XVIA 5KX5B 1X7XA 4PG6A 3WJ7A 4BKMA 3S8EA 5T8KC 3VNSA 1SPXA 4C04A 2F59A 5BWCA 4M8SA 1Q3KA 5JMOA 1R15A 1IZ7A 4LHZA 2IMWP 3TSWA 3Q8KA 2I03A 2R96A 3IB3A 5LYJA 1OYWA 1K68A 1YUNA 1ZK0A 1N5DA 1W0JD 2OZPA 3B60A 3CWQA 3KVRA 3QEOA 4RSHA 4D9KA 4DILA 9GPBA 5DNYB 3GJ4A 3SYLA 2VUMG 2XE4A 3D3WB 4V0OA 5FH9A 4E46A 2C58A 3VZSA 4ODIA 1GPUA 4TM5A 4AP6A 2VXBA 1T9DA 3NW9A 1K1QA 2AW5A 4ZAVA 4GPEA 5K99A 1T5IA 4K87A 3R6WA 3T7DA 3TD6A 3C4VA 1QO0D 2WB4A 4M36A 3ESDA 1T9ZA 1KJYA 1PJSA 1MC8A 5J59A 1OY1A 3OF2A 5DSTA 1P80A 4XQGA 4IBOA 5JVDB 3VI4B 2OBFA 1CJCA 3HKCB 4XA8A 3HKEA 3NV9A 4LGCA 5ALFA 2OYCA 2YXLA 3AH8A 2I2DA 3DWGA 5GZ3A 4D4KA 2BFNA 1TK3A 1YR1A 3RTGA 4CF7A 5TGZA 3GUZA 2X3FA 4A8JA 4KXLA 4H1WA 3EQ8A 4N82A 4TLCA 5FR9A 1FFCA 3T5PA 2OAQ1 1AVTA 2FHSA 1XWIA 2ZB2A 3CB2A 2H1WA 3HUTA 3O74A 1KMQA 3HSYA 1FP4B 1G3UA 3DDHA 4LWOA 3KVOA 4Z54A 3N75A 4O6VA 3ITEA 4BLRA 2NZUG 4EB0A 1WULS 3DXFA 1XRSB 3AF4A 3UWKA 3LF2A 4HX9A 2PUBA 4ROSA 3UHJA 3LLSA 3CBGA 2XE6A 4WBSA 3AKDA 4B8YA 4RFSB 3D2BA 3BWYA 1WXFA 4QPNA 3H9UA 5ICFA 1K66A 1UK6A 3B1WA 4GXQA 4J9NA 4LE0A 3TW7A 1XR3A 3BJEA 1KI8A 2JHPA 4DUYB 2PBZA 1JBQA 4DLKA 1MIHA 2JARA 3N3AC 1X80A 1A97A 2GVZC 5DXJA 5AUNB 3EPLA 4XOUA 5IAGA 3TZBA 3U3JA 2HOQA 4Z8XA 1NATA 2HI0A 1GZ6A 2BFEB 3CRW1 3Q4GA 1FSSA 2W2TA 2X15A 4HQOA 5I4IA 4AJPA 3T5AA 4O0LA 2DSNA 4FXOA 2EBHX 1VJGA 4JYCA 4HYEA 5G0SA 1KOFA 3GJ6A 5ITWA 2AJLI 4AK9A 1Q92A 1N2ZA 4EJ6A 3A4VA 4L07A 3R0IA 1CS0A 2EARA 1YFZA 3E9DA 2J6IA 3FPHA 5B4VA 4TLBA 2GLXA 2IIQA 1TT5A 2ODEA 3ENVA 4R8MA 3UHAA 4CF4A 4DREA 4JXJA 5I7WA 3GFSA 4R5MA 3EEBA 3PQFA 4F1JA 2R86A 1CJKC 5SZKB 1NJFA 2NXCA 3G7UA 4GE3A 1GAEO 1KP3A 2OM2A 2YIJA 2ZTUA 4MPJA 4AUMA 4DDKA 5ADUS 5A02A 4DTCA 4U7DA 1XQ1A 1VB3A 1H8ED 2I91A 1EK0A 1NP3A 2E89A 1ESNA 4DABA 5L40A 2BLLA 4DADA 3ED5A 5FUVA 5DBIA 3C6YA 2ZIAA 4KNWA 3H4IA 3EFHA 4QYSA 2CFOA 4U7HA 1H3EA 3GRRA 2DFDA 2V3VA 3GRKA 1Z6XA 3QW2A 4R0VA 4HPWA 2FQWA 1I0ZA 4ABTA 3A4YA 4ZQIA 2H4ZA 3I8XA 5FD8A 1L1EA 3WBJA 4IWNA 3WKBA 2D2EA 2H6EA 2W7TA 3K0AB 4OQ4A 1MX9A 5LU8A 4UXIA 1H6CA 3SFTA 1M2HA 1RKQA 1AQIA 2Z1MA 3GMTA 4US0R 3ZHVA 2FV8A 4QQNA 2C7RA 4U7CA 1CJTC 1EDEA 1R8QA 3WQQA 2JA5A 5FBZA 5KWVA 4PQGA 4O86A 2PYIA 1RRCA 5HR5A 3RS2A 2ZIEA 2FQQA 3MNFA 1RXUA 2W9CA 2X0IA 2HF2A 4LJRA 4BV3A 2XSZA 4CE5A 1EKPA 2FWJA 3AUSA 1FLNA 3BFKA 3P71T 2GQ0A 3PEFA 4P84A 3E7DA 3QFHA 3W6NA 4LDZA 1CB0A 2R6HA 1CR6A 2OBXA 4O3OA 4Q9AA 4BRUA 4OQMA 3Q8LA 3PRHA 4GKAA 5LZ2A 2CFIA 4LN1A 1ID1A 4G0ZA 4O4JA 2XQJA 3WBKA 1QHYA 2GF2A 4YDSA 2I3DA 5M5BA 4NE7A 4X1YB 3THXB 1C2TA 3QWAA 5FQOA 1HURA 2C78A 1Z06A 4C0BA 4YV7A 2IYLD 2HCJB 4HNAB 4N8EA 5HNKA 1U94A 2HHJA 1G20B 1RZRA 1CQIB 4DYDA 2MSLA 4QGGA 2QD3A 2VLBA 4ZAXA 2IHZA 4ON9A 2VWHA 3Q2KA 1E3WB 5CLJA 1XP5A 2YHIA 3BSFA 2QL6A 1U7XA 3IA2A 2WJWA 2D2XA 3T7RA 1L7MA 4PC7A 3QUCA 4OHUA 2QW0X 4AKTA 2AI1A 1WMDA 3UUEA 2ZQZA 3OSPA 1A76A 1X7HA 3SDSA 3V48A 4ENQA 3E8MA 1NBMD 3TTSA 1PNOA 3LK7A 3I9V6 5EIXA 3R5HA 1SVSA 3I5YA 2YZ7A 1N8KA 4N65A 5SY9A 2VSQA 5TR9A 2ZE7A 3F2VA 1RWXA 3W2IA 3A2MA 3F8WA 3FCEA 4PRKA 4MCHA 2QTRA 1JZQA 1UKYA 1UJ4A 3JR7A 3Q7EA 5B57C 5J2UA 1V96A 2EJ2A 2IBKA 2X4DA 2XXAA 2G09A 5KDOA 4X97A 1VPWA 4G5SA 1KMMA 4NG4A 3W2FA 2IXTA 3O3NB 3SKYA 1K63A 1RRMA 2QAGC 3L9WA 4HGNA 2XNCA 3MJFA 4HRAA 4Q3LA 3GB9A 2W00A 1EK1A 5J47A 2AOXA 3H9QA 1PEAA 2D7DA 4HQ6A 4RKWA 5TV2A 4TYYA 1AIPA 1I4DD 1LK5A 3OCCA 1XD8A 3NHMA 4JWTA 4MV1A 3PCXA 5TC4A 5IAKA 1ZUNA 3TR5A 1GDTA 4C78A 1E1KA 5AD1A 4YMSA 3PW4A 2FZ4A 3RIXA 4HGPA 2ZR7A 4GMFA 4EAAA 5J4KA 5L3QB 1N0VC 3QVWA 5FWYA 1DI0A 3C3YA 1EG7A 1MR3F 3EZ2A 1I4LD 1IBKH 1ZM3A 5KTRA 1FLAA 2NZVG 3DJYA 2C4KA 1E2MA 4IHAA 1OBFO 1YDFA 1UNNC 4LVUA 2YXNA 5BUZA 4MR9B 1RM5A 4BFTA 5F5LA 4PWYA 5GONF 3A32A 1V26A 1QFZA 1XAGA 1YCFA 2PKQO 4GMGA 5EFOA 4OXXA 2PGNA 3BXFA 3AIOA 5DV9A 2DJIA 3V6JA 3EDCA 4ED0A 1F2UA 3DMTC 3NYQA 3EGOA 2QAIA 3CISA 1ATIA 3BD9A 4K9SA 3IV9A 4EEYA 4BUZA 5JECA 4M1KA 5IM4A 3F5MA 5DSXA 5KYYA 1PEKE 2VJMA 1XMOB 3QE0A 3OPYA 4TTVA 3WLAA 1THMA 2GX6A 4BKPA 4C0KA 5CE8A 1XPUA 1VE3A 4MS1A 1ZK2A 3W1WA 2ZEJA 1CNMA 2F8MA 1E2NA 1Y3CE 2ZFUA 4IIVA 5DGDA 5DU2A 5JT1A 1U8EA 3GJ8A 2HSEA 4X8OA 1PZEA 2CMGA 2FMAA 1DBWA 2PH7A 4XCVA 1HLPA 1R88A 3VTKA 4WXPA 1N1MA 3A4LA 3CH5A 2O2EA 3SF0A 1QC5B 5I5EA 3RNLA 3EHEA 1G7SA 1GNPA 5ADHA 5JSFA 1KFEB 2QG4A 4LOKA 5IC5A 3HDJA 5IJ0A 2PRSA 1C0PA 1P44A 2RKWA 4DCPA 3ZPXA 2FA9A 4GQIA 3PLAE 4MV6A 5EIFA 4IIHA 1E3MA 4IICA 5FNVA 2BMDA 2I2BA 3AZOA 3G9QA 3O4RA 3OCUA 1Z6YA 1UBOS 4Q9JA 5DBEX 5D51S 3PHBE 3ETJA 5EP1A 3RRZA 4O7VA 1PGJA 5E9QA 2WUGA 2ZIZA 3HBNA 4L5BA 4RAOA 4HAUA 4GR9A 2DWPA 5JUMA 2I2CA 2YDXA 3PUVA 2O0JA 1IN7A 1G1AA 1ZZGA 2P4QA 1MGPA 4Q1VA 4Z1MA 4UQPA 4CUKA 2BGUA 1RPJA 3AYXB 5CG2A 5KOYA 1IM8A 1R4AA 3OZCA 1YTUA 3RU7A 2IXEA 3KEOA 1IXZA 4BV8A 4TTQA 4MAFA 3QLTA 2X42A 2XMRA 4QDJA 2F1IA 3G6WA 1MB2A 2QJRA 1HNZH 5DTEA 1A27A 1QGDA 3LCCA 4JJZA 5E6UB 1IXKA 3UJNA 3R9XA 4NZNA 4D3FA 1OJLA 2C2HA 2GN8A 2INGX 4HFJA 5C31A 4OQNA 3I28A 1MZVA 1NXPA 1GIAA 2WLSA 2JIZA 5DH9A 5LR6A 1Y1WA 3TSAA 3HKZA 4LXUA 4ZICA 3DKVA 1WLSA 2X9NA 3DWFA 2ZUTA 1YZGA 5TQJA 4AULA 2C77A 2UUAH 4TYPA 2ZM6B 1Z8HA 1U9YA 4QLAA 2GERA 2G1UA 4M37A 2GRAA 4A1OA 3ICPA 2WIBA 3CZCA 3HKCA 3UYKA 5A9SB 3OPXA 4BE7B 1QFXA 3KZVA 3DWIA 4P53A 4LG1A 4Z7OB 2BFCB 2JA7A 3IPYA 3BXEA 5B30A 3ZWYA 3B89A 4RCVA 3KL2A 4EVQA 4D9IA 3T5MA 1FS5A 1M2EA 3GVXA 4UASA 3ER8A 3GEPA 3O8QB 2GZMA 3JQEA 3IAUA 5JLJA 2A5YB 2IWRA 2C2WA 3PD0A 4LC1A 5ITSA 2JFQA 2M1ZA 3N0VA 3RTXA 2C2XA 3W1EA 3OFNA 1K08A 5H5JA 3WS7A 4PO3X 5FTMA 3RG2A 3DTYA 3PQ4A 5H3LA 1DARA 4C3ZA 3OCZA 4KXMA 4LF9B 2WSLA 3QSYA 4F4UA 2AC4A 3FUUA 4LY0A 2GJ8A 4D7AA 3DNMA 4IS2A 4LV8B 1H93A 2F3QA 2WJ6A 4E03A 4EYQA 5A4DA 1ZG3A 1ZD4A 3TI9A 3O90A 1DKUA 1U8YA 1E2KA 3F3MA 2CMKA 5ALMA 5JANA 1NNEA 1UK8A 3ACCA 2O57A 3DONA 4M1MA 4YHHH 2CQYA 1G0OA 4U3JA 2JAHA 1N9ZA 1OBOA 3U5TA 2Y1EA 2VP9A 3AESB 3BPSA 3SLRA 1I3LA 2OXCA 2QXUA 3D8BA 1V35A 1HE8B 1HETA 5AXAA 9LDBA 1JHOA 3I4NG 2XD4A 2X86A 3R3VA 5I5TA 2NPIA 3PL1A 3HB9A 2ENUA 2AK2A 4D0LB 4XLZA 4YUAA 1A96A 2ZGIA 1MO6A 1VHWA 2DTDA 1LF5A 3LXMA 3NT5A 5BSTA 2IKQA 5BSKA 5I6DA 4J9RA 1DG9A 2R4UA 4YAFA 4POOA 4CLHA 4MAMA 2RJOA 1PVDA 2VPIA 1LI4A 5ESRA 2SNIE 1S02A 4NABA 4P86A 5H80A 1FQOA 1MVOA 3EYWA 5HF8A 1WL8A 2RBEA 3LECA 3I39X 3RF6A 4Q8FA 5LDHA 1QP7A 4GMDA 1N0HA 4OHWA 5KFNA 1Q17A 2PS9A 2IODA 2YWRA 1LY1A 2OK8A 3QUAA 1E1MA 1M2JA 1XX6A 1X15A 2QN7A 3DCNA 5E3JA 4C1BA 5HQ3A 1ZD3A 4BWSC 1N6NA 1XU4A 3HB7A 4GXNA 5D7NA 1B2RA 5BQOA 1NQVA 3LBYA 3ZWKA 1Z33A 3VR4A 2J31A 3IDSA 4A3LG 4DWWA 1GDHA 1TYEB 1EZ4A 1RPNA 1SU7A 3EC2A 5L1LA 1U3GA 1BVUA 1DUSA 1KMIY 2BKVA 2KX7A 3H5TA 3OTOH 3NYIA 3OOSA 5CX1A 3F3YA 4ZPXA 3E9RA 2JCBA 4NCJA 5F73A 2C2RA 3PT5A 3VX4A 1VGRA 1JR3D 1U0EA 1Y5LA 4YRAA 4RHFA 2E7ZA 3WGOA 3N2GA 5IWAH 4NULA 1SKUA 4BE4A 1UMCA 4ZYYA 1C3XA 4PM4A 2CVOA 5F33A 4EZIA 1L7NA 5K05A 4YP0A 1DP4A 1FFSA 1U31A 5EY5B 5IT4A 5B6JA 3K0EA 4OLFA 4IUYA 4OFWA 4GIBA 2HVSA 4QT4A 2TS1A 1M5TA 3A2NA 5DTRA 3KZMA 1GPBA 1EVQA 2O2JA 1E6KA 1P3JA 1ICIA 2EEZA 4LOLA 1OIXA 4TXLA 3SYKA 4MDFA 4CM8A 1SWVA 4IVPA 2C42A 2UV8A 4JSRA 3CF4G 4MPDA 4GKKH 4WZBA 2R2AA 4JLPA 4LF5B 4EJ2A 3L18A 1BGVA 1JFRA 1Q2UA 4MGZR 3I9JA 4D4JA 4DSNA 1C1XB 2WD7A 4K9QA 3ZXSA 4YMIA 1GAWA 3I9OA 4P2BA 3A58B 1YXMA 1T6NA 1U1FA 3SC3A 2WWIA 3A1SA 2Z9CA 4YR0A 5A03A 1WJGA 3KC2A 1IZ0A 2D7JA 1VMIA 4KI0A 2Z57A 3ZKWA 2HB6A 2YYAA 4KIJA 1TECE 3QELA 2QTLA 1OGIA 4KLAA 1EIZA 2XDQA 4O7WA 4MQBA 1WD5A 5DHPA 5HF6A 3STYA 4IOJA 1K8XB 4YJ2F 5CA0F 4BRSA 5JMTA 2J6BA 3IVCA 4FKBA 2ZOSA 4QARA 3VDXA 4LF4B 3WYFA 4XVCA 3VPHA 3JYOA 4RL4A 4RK5A 4UCVA 3DBLB 3TLAA 4BQSA 4TVKA 1H2AS 3MEQA 4DW8A 3PS9A 4UUGA 2RCYA 2ZCVA 3EARA 4NZYA 4PO9A 2LCIA 5F77A 5FP0A 2AXPA 3FA2A 1LV8A 4WCVA 4DNFA 1UMBA 2HBRA 4IFEA 4UBIA 7AT1A 5C52B 2CJWA 4I4NA 2IYQA 2YWDA 4LF7H 2HTFA 4KGZA 3PPIA 4LS3A 1XVLA 5F4BA 2AJBA 3VTZA 1W47A 1G8AA 2Z3ZA 3JQPA 2O8CB 2K7FA 4ZFNA 3SXUA 1GAXA 4YJ2A 5A0FA 4BPRA 2I2XB 5KJCA 5B37A 4EBFA 3L0IB 5AM1A 4R1MA 5JW6A 4P54A 1RQ2A 1WW3A 4HF7A 4XVQA 3VOAA 3EPJA 5FI3A 5C1DA 2UVRA 4IJKA 3OJ0A 2X1VA 4C14A 2PWZA 1N75A 2ZJYA 2ZRAA 2WUFA 5LA6F 1ONNA 1NU8A 3PR5B 2V1XA 3I6YA 3ORHA 3GH1A 4LRWA 5REQA 3V80A 4JV1A 4IEEA 3MT8A 1L5KA 1FMCA 3IMCA 4UHKA 4E13A 2MYTA 2JBWA 2XE8A 3AF3A 1XL1A 2WOOA 3T6KA 3N39C 4NNPA 1RPAA 3RR2A 3JWGA 1Y4DE 2WJJA 2NZ8A 1PFWA 1F20A 1B8OA 1KZ4A 1RXEA 2GZ1A 5C0OE 4C4AA 3FSRA 4WLVA 4FU0A 4C6TB 1EH5A 1G19A 1BYUA 2DECA 3ANLA 1U9ZA 1WXIA 3WOHA 2GM3A 1HNZB 3Q0IA 2OQRA 4KN8A 2XAAA 1IJKA 2P1ZA 3O7WA 1NT2A 5F1OA 5FULA 3JQGB 4WVFA 3HA2A 4GLWA 1NMSA 1UZUA 3R7WA 2XNDD 5KG7A 1N1GA 3LHSA 1USGA 2R7NA 4IYRA 1YL7A 4J7XA 4ZYXA 3OIGA 3RTAA 4BP9A 3OIUA 4PRZA 4DKJA 1VYUA 3S1AB 3VH1A 4F4FA 2PL3A 4FFPA 2ENWA 3I6IA 3D31A 2QIOA 1KDPA 1LK7A 3AOEA 2ASEA 3FDZB 1O89A 4O4JB 3ZVRA 3ETCA 4KR0A 4YAGA 3OHAA 1EDZA 1YB5A 4J2OA 4JOQA 2OHHA 1V8PA 2EG5A 1V48A 1NX6A 3A8TA 1RVV1 4ZK2A 1AA6A 1IN8A 2OFPA 3WRYA 1CQIA 3PRKE 4U2KA 1GGFA 2P2SA 1EQ2A 4CM1A 4LRSB 4YBZA 3KTOA 4N5IX 5JI3E 2VR1A 4MQEA 3G6KA 3G2IA 3GIJA 4EKYA 2P9HA 1U11A 1G8GA 4JJ4A 3TGLA 3CO0S 2OLKA 4CPDA 4P81A 5IVHA 4S1WA 2FSHA 2WIGA 1OXBB 1EUDB 3F9RA 4R7ZA 3WVNA 3ZW7A 3HOYG 4ZV9A 3ZHOA 3IHTA 4Z1OA 5EHXA 2CUZA 2DUNA 3ENZA 5EE1A 5CHEA 1UEIA 1YZTA 2GAIA 3L7YA 3F1LA 3PUZA 2HIGA 2EQBA 1Y8QB 2FOLA 3BGOS 1N2IA 4FZ5A 3SHOA 3T3PB 1TAUA 1JTEA 3PHLA 1HGXA 3HV0A 5ALPA 3WGTA 3OLZA 3JWJA 4IZIA 4EQ6B 5CHYA 2GBLA 4NK4A 1RMQA 3BA1A 1GTSA 3NUQA 4G5XA 1WMSA 1SQ5A 4R1PA 3F7TA 2C31A 2V6IA 3IAAA 3KEMA 3IHKA 1OT5A 4PYKA 3C5EA 2ZB3A 4PYMA 2JIRA 1EBFA 5INTA 4A0RA 1HK7A 5BOSA 3ER9A 3PXUA 5KJ6A 1SIWA 2EIYA 5JALA 1TTPB 4C43A 3KLBA 4KBYA 2XXBA 5KFBA 1U0RA 3DNFA 3FOCA 4Y2TA 1X1RA 1T8TA 3LYAA 2ZRGA 4POAA 3EJWA 1JHZA 1E2DA 3D2LA 1NXVA 5DPMA 1Z3IX 1PWZA 2WABA 4QNNA 5DGAA 2J7PD 4UHDA 2QTZA 1XVUA 3RVSA 3FR7A 1VJ1A 5ALUA 1I8TA 3TW8B 1ID8A 4PQRA 1KGSA 1L5RA 2AWNA 2D06A 2L2QA 3CLUD 3FSEA 4B6RA 5KHLB 5I9LA 3EVBA 2O7NA 1T24A 4IMPA 5HKKD 3WRYC 1AZTA 4KO1S 5CW1A 4M6WA 2QTCA 3GWZA 3KYIB 1H2EA 1O87A 3R5XA 5KREA 2CNDA 3RBXA 1UM8A 3AR3A 3O0DA 2XIQA 5CLFA 1ZIOA 3NAMA 4DNQA 2JGFA 3W5CA 4TV9B 4YJ3B 3TIXB 3U0VA 2PM8A 5COBA 4H27A 4DC9A 1VKRA 3SQXA 5JAUA 2O8BA 5JDIC 4WKPA 3GARA 2EJ3A 3GMSA 1D09A 4RGYA 3D6JA 2GJKA 1AOXA 3H7IA 4LGVA 1EP2B 3DBOB 4NXMB 1MLDA 1PFQA 2J6UA 2R3SA 4G1VA 3ID6C 3LVFO 2UVUA 2OD7A 1P62B 2R79A 2W7PA 1J8YF 1E2EA 5KNCD 5LB2A 1A8HA 1ZDMA 1NVUQ 5AWFC 4RZ2A 2IY9A 3EPGA 5KCMA 1PIWA 1XTTA 2YJGA 4UJ3A 4LYJA 5C1IA 4LA4A 4DIOA 4ETIA 1PWXA 1QOPB 2MYUA 4DRXB 5IFKA 2IDJA 4LZJA 5K0EA 4WY8A 2JCXA 3M1AA 1KQPA 2MT9A 1Q3HA 1XDSA 4N3BA 4QT0A 4GLLA 4J1SA 5I9MA 5AVKA 1CDOA 5KU1A 4DL2A 1F17A 3ROMA 4O59O 4X20B 3WRXC 2GAFA 2I3ZA 1JQ3A 2XTJA 5J2TF 1SFRA 1GU1A 1Y5IA 3LY8A 1W36C 3BACA 4ED1A 1C3OB 3V4ZA 1MN6A 3IT3A 4O63O 5ALOA 4A2PA 1MFZA 3JALA 5HQ3B 4IFIA 2FJ0A 1EK6A 3C16C 3RTBA 1UBUS 5EJ5A 3A9CA 5CFPA 2O48X 3U3XA 2FPPB 3M6XA 4AXXA 1XTIA 2QN8A 3I2HA 3QM1A 2W58A 4E6NA 1AUPA 5BVHA 3ND6A 5CGZA 3WBFA 3IO3A 2H4XA 1AMNA 5IN5A 2PZLA 4WOJA 1JZSA 2IXGA 4NMHA 4QELA 1XPRA 2VWGA 2P4HX 2HJRA 4RZIA 4TS9A 3O03A 5HRUA 1MAAA 1U2SA 1I2KA 2V9WA 2WT9A 4OJNA 3IP6A 4CM7A 2AMLA 4J8PA 3I3SR 3PBKA 3BA8A 1P2UA 1F8UA 2GASA 4M0DA 3RYHA 4B75A 5FDFA 5LZ9A 5GGXA 2EFHB 2EJUA 3BRQA 3QJYA 4QVIA 1D0VA 2P6OA 2V6FA 4WESA 2VQ6A 2QQEA 1M2VB 3QXSA 4M3NA 2A58A 4WBNF 5HILA 3GTGA 1GA6A 1FQKA 2ZBDA 1GGMA 2OCAA 1KU0A 1QVZA 2CFTA 3CNOA 3V97A 5CYOA 1G6KA 3EK2A 4L78A 3OM0A 4L72A 3DDSA 4Q3DA 4X95A 3I01M 3GUUA 4DMLA 1M8FA 2WMDA 3B85A 3FAKA 1LU9A 1QHSA 3R44A 1PN3A 1VIAA 3FNHA 4KQWA 4B43A 5I51A 2VRBA 3O95A 3PT9A 4JLJA 1KF0A 2QLBA 3K9BA 3PPWA 3WWIA 3HKDB 5EI5A 4O4JF 2OGUA 3P26A 4C4TA 1NSFA 1EFDN 4FCTA 1MP0A 1ZGZA 3DWEX 4U7FA 5JPDA 3EW7A 3K6SA 4DA4A 3FDXA 4IWXA 3ANSA 2P4EA 4P1ZA 2O7RA 4N7MA 4MVWA 1ULBA 2H5JA 3DB2A 5FO0A 4ML3A 5BN5B 3B9PA 3NWPA 3ZE2B 4HQLA 1OAKA 4MUHA 3T7AA 1USWA 2ECFA 2ZRJA 5BUSA 2VOJA 5FWNA 5BSWA 2NNLD 4MO2A 5G4KB 4H59A 3VPSA 3KSAC 4I1PA 3IEVA 3QBVA 1I01A 1HZJA 2VA2A 3EGIA 4QEZA 1ADCA 2KWIA 2RH5A 5HZMA 1NYRA 3K5WA 1NV9A 3A3KA 4AQ7A 4Q39A 4GKKB 4J4HA 1P4GA 1YZHA 1E2UA 1M1ZA 3UJ6A 3AGPA 1JHUA 2ZS7A 3MAJA 1TA9A 2ASLA 4AS1A 2CLIB 1J0DA 1UZAA 3Q15C 4OXKA 4KIWA 3WWYA 4HB3A 3GO4A 1RKVA 4CTKA 3B6JA 1C1DB 4E0BA 3B5EA 4OL9A 4W5RA 1YI8A 3KUXA 5G3ZA 4RMHA 2COUA 4ZODA 2ACVA 1UBGA 5AM3A 1VL0A 2CEKA 3NATA 2VZ0A 2P2YA 1EFTA 1RQ7A 1GZVA 3IJ5A 1F14A 5IC6A 2NM0A 4Q7EA 5KTMA 2NZXA 4JXUA 1SBQA 3E9EA 4FEYA 4G5YA 4UFOA 4BTLA 1L7DA 3DD1A 3FETA 3F78A 4HEHA 4L6IA 4Q6WA 5D86A 3U3ZA 4UULA 1DKNA 1XCLA 3NRCA 4J94A 4H6PA 1L4GA 3GLIA 4DLRA 2D1RA 1JFSA 1B04A 1SB8A 4X64H 1ZI8A 4U9IS 5F2EA 5FWXA 5J2UF 3T7TA 1K86A 3UT6A 2J6TA 4QUIA 4YJHA 1F4LA 4DCJA 3RRJA 3PZBA 3DE5X 2R93G 3LFUA 4OCZA 4PX3A 5EOVA 2H92A 4F72A 2IH5A 5C18A 1THTA 4P34A 3T0IA 4LYAA 3LLVA 3VC3A 5C37A 3QYJA 4F2PA 4R7RA 1KS2A 4FQ8A 3IXMA 1KA9H 1TUBB 1XXHA 4F60A 4MV8A 4ZARA 3JD3A 1PI3A 2FZEA 4B09A 4QLOA 1UDAA 1XRLA 2DQYA 1XBTA 1T13A 2LKDA 4TLLB 4MO9A 3JVDA 4EFBA 4FDUA 5AUPB 3MA0A 1E6EA 3EPPA 1W1WA 4UMEA 4UBJA 3KQYA 1JB1A 4H1TA 4WFKA 3AERB 3VJKA 3ZN2A 4UOQA 1XAIA 3V4OA 3GCDA 3EVZA 3FDZA 3WI7A 1S4QA 3WK5A 5GZ1A 4DGSA 1M0TA 1I3NA 3UKDA 3SR3A 4NEHB 5D3MB 1P5FA 5LP6A 4N54A 4KN9S 2WM8A 4R8VA 2XZDA 3M3DA 3R8XA 3JAWB 3PCTA 3EFBA 3QU5A 2H63A 2WTAA 3GN2A 4QOSA 4ZDJA 3QFFA 1EXNA 3F6YA 2NO4A 4UU0A 2WSSD 4JI7B 2ZUDA 1BEEA 4TZTA 2QVCA 4YHHB 3U44A 5FOQA 2XADA 2OV8A 2ZSKA 2JGLA 1G8PA 2BY4A 1L4EA 1B73A 3LL7A 4F5DA 4KHPH 2GFIA 4O4HB 4WKBA 1V43A 2C20A 4M98A 1FY2A 5EWMA 5ALJA 5JWHA 1H6DA 5KTSA 1KJNA 3FKSD 4KIFA 3MWLA 2QR2A 5REQB 2FP4A 1Q91A 4RL6A 2I54A 1XMSA 5AICA 4U6QA 1OWLA 4MVJM 4P3NA 4KR9A 3UB2A 1ADBA 1FTGA 3MRTA 4OSPA 2WY2D 3R7SA 3ZVNA 3AX6A 1QGED 2PU7A 1ZK4A 2TMGA 2VTKA 2W2NA 1FRFS 1U3UA 3N2KB 1E3LA 4GGPA 4I4LA 5FJIA 3OE1A 4Y0VA 5EG5A 1E1LA 2WSYB 3K1AB 5KYXB 3SKVA 5HKKA 2QIPA 2WWRA 2YJ6A 4B0OA 4Z4QA 5JVLA 1SEIA 1Z2AA 2NO5A 3FWZA 3H05A 5L3ZA 2QGNA 1DAGA 2P11A 4HHEA 2ZZKA 4PX9A 3WK9A 2B99A 2OCLA 3WLOA 1S0NA 1DCMA 4V2IA 1XMVA 4IDPA 2I2FA 4YR9A 1V11A 2CDBA 3HVIA 5CT9A 3AHDA 2VCHA 2J85A 1H9CA 4RZRA 4GD3Q 4JC0A 4PF1A 1O0CA 1L4NA 2R1VB 4WY5A 3TD2A 3TMKA 3SS7X 2GEUA 5DBGA 3Q2OA 2HQOA 3F47A 4LDNA 1L1RA 1AN9A 1R6TA 2EJCA 1Z4MA 1THZA 2ZIXB 4MJXA 3M1IA 2ID7A 4TQ9A 5JARA 1JDVA 1ZXLA 1JAHA 2K2QB 1D9XA 1NX9A 1JEQB 1P5RA 2BFPA 1WXQA 2O3JA 3GR6A 3IAM1 2GCEA 1GZHB 2OEPA 4GOOD 4PZ9A 3MWMA 2R8EA 4MXDA 2FE3A 1XCMA 2O3TA 1UXKA 4MS4B 2CHQA 4IDBA 1L5GB 4AJ9A 1M74A 2JI4A 5JJLA 4WBNB 2V97A 4C4ZA 5JVDA 4X65B 2CXTA 1OA1A 2HFJA 4ZMSA 4Y2SA 2XUQA 3U4QB 5FPRA 3K4PA 3SLKA 3K9CA 4PPYA 3QW4B 4ABYA 4B3SH 2PFSA 1JQEA 4UCOA 3I53A 4L6CA 3HY4A 4XFDA 4BKUA 1CR4A 4OXNA 2A88A 4GM0A 5LP6F 5IK2A 4LQDA 4D8VA 3TVYA 5K3OA 4JL8A 3GV0A 4PLYA 3OPYI 1T0UA 2NO7A 3EAFA 3J80A 1FPMA 1U2DA 2C3OA 3I92A 3GHYA 3UGJA 2ZM5A 4J0DA 1YRBA 2C07A 3GLGB 1ZUWA 3HBMA 1KC1A 3PFNA 1I7DA 3NXKA 4P7BA 2I87A 2QYSA 1X80B 4TS1A 2BVNA 1N6RA 1TJ5A 4D9EA 5EP2A 4RB1A 1L4MA 1YMUA 4OHKA 4TMYA 2A3RA 3TAHA 1WHTA 1A7AA 4CODB 4QW9A 2W2QA 1A1SA 2YWHA 1Z2DA 2P0YA 4R5HA 1JH8A 2FZVA 3BWMA 3D81A 3DFMA 2PS1A 2QRVA 4HX5A 3JWIA 1RC1A 1SUSA 2ZATA 1S2LA 3GPDG 3FNRA 3N07A 2AN3A 1B0ZA 4TZKA 4QDKA 2FEMA 3HDHA 4QYTA 1FEZA 4WKNA 3RVMA 4JZYA 3SYMA 3AKZA 4BFSA 3O3OB 4BLSA 4BVJA 4G1MB 2AWOA 5C53B 3LXUX 5LOVF 1UBFA 5EVJA 4W1PA 2ISSD 4G07A 4UE6A 5I7SA 2AFIB 1EBBA 2HF7A 3B6MA 4MHSA 2NU8B 4HNAA 3IKVA 2NTEA 2IS4A 1V9PA 2RHWA 4L5CA 1T2NA 2HMVA 3DOHA 2VQDA 1AC5A 3AR4A 4XPIA 4UCXA 4OYYA 3EVEA 3RSCA 3G2NA 3FWPA 2COIA 1NAHA 2W7OA 3IG0A 1TYDE 4PZYA 5K3BA 2CNOA 3ZH2A 2GPJA 1E0JA 1JDJA 4F21A 2WIFA 4Q47A 3QV2A 2HGXA 1KZ9A 3IPCA 3Q6MA 4K7JA 1UBTS 4KN6A 3UANA 1JXQA 3MTDA 2HHLA 4BUCA 4LV6A 3OO1A 1NOIA 1DRKA 1UAYA 1WF3A 2A5LA 1KTAA 2H1CA 1E20A 2YJ4A 1V8FA 3FMIA 3JS5A 3TCXB 3HL4A 4Z8YA 2PZMA 3TRKA 3TZCA 2H51A 3DLIA 3ORSA 2WB1E 2MYNA 2OC9A 3HCRA 1IHXA 1YQGA 4R1OA 5DISB 1S2GA 5BNZA 5F98A 4Y30A 4I5GA 2VK1A 3N0WA 4MB6A 1UFQA 5KFRA 5F64A 1EVZA 3B3JA 2OYSA 2H29A 1LRJA 4OO3A 3UQ8A 3O8LA 3WLQA 1GN8A 2BEJA 3EW9A 4REOA 4NU0A 4YBRA 4CJXA 5KT7A 3O38A 1V6AA 4OHVA 5T3UA 4BY9E 5HOQA 2VPWA 1GTZA 2GA8A 2AX3A 1Q50A 2YH2A 3WIVA 3TEKA 2IXAA 4DLAA 1Z4OA 5BMVB 4CV0A 5FLEX 5DM4A 4CE6A 3WGJA 1DDIA 1MVNA 1SVOA 2NG1A 3PFBA 3PR4A 4JQOA 4WKCA 3IULA 4K8RB 1ZCZA 4Q3EA 4RORA 3J81A 3QBEA 4DQDA 3P2MA 1BN7A 4WWHA 4J29A 5TVGA 5KC8A 4O4HF 4IM7A 2Z8ZA 4K0RA 4L4SA 2DWUA 4C29A 4FFOA 1F0KA 1N9GB 2BEWB 1K4YA 2YZ2A 4Q4AA 3ZV7A 4YCSA 5AW1A 1HSOA 2IU4A 1JSXA 4AMVA 1NVGA 3C1UA 2YV3A 4HZIA 1NW6A 4NDZA 5B1IA 2PT5A 1ZOSA 3Q9SA 3L0ZA 1NPYA 2FW1A 4FEAA 4DL9A 4FQ5A 4PAMA 5B3JC 1FS4A 3GLIB 2GTIA 2JAPA 4BWVA 3GLGE 3DF7A 2DWCA 5LJIA 2PH5A 1BWSA 2ID4A 3DXZA 1WKBA 1G2IA 3FMFA 1QDLB 3B8HA 1G5TA 1NKSA 4KL8S 1KIFA 5HQJA 1LGYA 5KAPA 4QKQA 1Q7CA 1X9HA 3LQYA 3ZY5A 3DOEA 1Z4QA 2OK7A 4EY5A 1IXSB 5E7IA 2O1SA 4WNCA 5T64A 1WQ3A 3OI7A 3RTDA 3UCEA 2G80A 1NRWA 1PJ3A 5LWQA 1MABB 2DHCA 5LMUH 2XR1A 3BBLA 4WMLA 4AD8A 5IDWA 1MX1A 2PKEA 1TYZA 1U28A 1XEAA 1IOZA 1Y8RB 4G1UC 2XH8A 3A1UA 1NW9B 4JLDA 4P36A 2EEPA 1OLSA 3G7NA 4H31A 3W2HA 4D8WA 4LE2A 4HTFA 4U2EA 4K8OA 4KQHA 1QQ7A 3UK6A 4AZWA 2ROQA 4HT3B 3P96A 1UWCA 2GEVA 5K0GA 2Y0CA 3O47A 1FJXA 3IOYA 2OTCA 4V1CA 5KNDA 3I23A 1GQRA 3AW8A 1Z16A 1KU6A 3GVHA 3PHGA 3PL5A 5LZ4A 1X8XA 4P3KA 5EEHA 1XLWA 3PO2G 2X0EA 5EMHA 1AA9A 1ZVVA 2WV9A 4I1RA 1VG1A 5FNVB 2C5LA 2QLLA 3DZBA 1ZC4A 3BIFA 4JBLA 2PNFA 4M21A 3BSWA 3LZ6A 3L06A 2XQFA 2G5CA 3L3BA 4M53A 4TL9A 2IXBA 3A3YA 3NLLA 3RYHB 2VQEB 4F97A 1DGSA 2R1UA 4ZCQA 3S2YA 3PQ2A 4F4XA 2A67A 4TUYF 2YFHA 2IKSA 3I1FA 3M6MD 1PTJC 4GDFA 4B44A 3VU9A 4W63A 1QIGA 4P4UA 3SVTA 5JHHB 4EEQA 2B4KA 1UUFA 1EUCB 5KS8A 3D4LA 4MWTA 2BUCA 2YFKA 5IC4A 2VBCA 1P9WA 2JGIA 3OTQA 1S9FA 1H6BA 2JVIA 2VDVE 4NQRA 1JALA 2Z4RA 2JZCA 4F7WA 1A8PA 1SBIA 2RF4A 3MWJA 4W7HA 1GPAA 1VBKA 2NQ8A 3TSOA 1II9A 1TAEA 1FX0A 3U4DA 1ZH4A 1M2OB 3LQFA 4YECA 4CFSA 3VPFA 4DPMA 2KSWA 2VF4X 1YZYA 2XWBF 3N2KA 4B40A 5FAKA 3C48A 1HT1E 2C57A 1OHHA 4L08A 4BBZA 3M4IA 1UAAA 1N6LA 3I1IA 3G6VA 1AHHA 1Y1VG 2ABWA 3EXG2 4H7EA 4L9RA 3HN2A 4Y2XA 1CLUA 3FKJA 2B1RA 2WKWA 4KUHA 4NAHA 2QV0A 3TLKA 4NWIA 1M83A 4ZANA 4AG5A 2CJPA 1DEAA 2FGKA 3A31A 4B17A 2EZ8A 2VDWB 2HLDA 4JROA 3WQRA 2H08A 5DTIA 2HPHA 4TT3A 4LJYA 1MO5A 2Q1UA 2H2IA 5H9WA 3SKXA 2AYXA 3FI9A 3MMNA 1V8OA 1HG1A 5ELMA 1FPQA 2ZG6A 3AY0A 1BXRA 3ET5A 1PK7A 3I9MA 4EUFA 4YAKB 5AQEA 5IABA 3HUEA 1ZIPA 1Q22A 3OQIB 3PGVA 3IIEA 4UW9A 4H7JA 3EXHC 2CBXA 3IURA 4RF2A 5JHGB 2Y6VA 4KQ6A 1PV4A 1R4MA 1VHLA 3ASZA 3AVOA 2I78A 3T1YH 2IDKA 2Y2UA 1VJDA 5JXHA 2BFWA 4JL6A 4N40A 8AT1A 3COYA 4WXEA 1DOHA 2Y1WA 4CLOA 3HJCA 1M10A 2WUEA 4MVJG 2QRVB 3QNMA 1XZNA 2IPXA 5BUQA 1I5OA 2V65A 3H2HA 1UADA 2GCNA 1QUFA 3D6TB 3C0KA 1RAIA 1WHSB 3FHJA 4AY3A 4CKYA 2C9DA 4IGKA 1EA5A 1GNQA 2BSAA 3NC1C 4QUGA 4FZRA 3TBFA 4J0JA 1JVNA 2LCQA 4CQMA 3GC6A 5JCJD 3U60B 2NT4A 2X7XA 3FHCB 4R3NA 4DAAA 2D8AA 3RO7A 2Q3BA 1OC4A 4TUYA 3R7BA 5E1MA 5A5VA 2QBYB 1PQWA 3MS2A 5IUJC 3GLGA 5KNDD 1LDGA 1T0IA 1X42A 2ZSBA 1F7VA 4PSVA 1W9HA 4IH4A 2PD6A 3D6AA 4BJ3A 4LFBH 4OX9H 4B47A 3QEBZ 1S8NA 1JFVA 1N2CB 4WLOA 4GI5A 4XXHA 3HUUA 3MRSA 4IMRA 4ZTBA 1M6VA 1WXXA 2JA1A 3SEQA 4BNDB 1YI1A 4E2ZA 2Q5EA 4FD2A 2AI3A 3MJEA 2W8LA 3KZXA 4KQGA 3ZWVA 4J0MA 3NIBA 5JJCA 4QASA 3ZJTA 2XGGA 5G3YA 1XDWA 1DRUA 1EE9A 2HU7A 3OLWA 1N6OA 4IAOA 1DAEA 1J8MF 2YR0A 2O8VA 4OV6B 1SCDA 2C94A 4M9SA 3OLXA 3I6BA 1V5FA 1EGQA 4OJMX 3AHCA 2I7DA 3AR7A 3C24A 4YUWA 1DXYA 5DAAA 1SPBS 5T57A 3B12A 1N0IA 3OIWA 5BP7A 4BXXG 2GBPA 4ZOLF 4UC0A 2Q6OA 1XYYA 4L0MA 4JV5H 5KQRA 3E9NA 4BVEA 4US2R 2M32A 4K05A 3QZ7A 4HQKA 1Z6PA 1T1GA 3L2OB 3UH1A 5CT6A 2F1OA 4F8YA 3FZNA 1CQZA 4YMGA 3T1YB 2AG6A 5EP3A 2HSWA 1ZL2A 2Z58A 5DNDA 2FLPA 1DDOA 2YMPA 3D64A 4MCJA 4BP8A 5A6SB 4P4SA 3EBOA 3WL6A 2RHCA 1WBBA 1P5ZB 1Y1VA 5U4QA 1A04A 1Y7IA 1N9GA 3ZV4A 4YAUA 2GN4A 1QANA 2GFHA 1FKAH 3IE2A 3KKLA 4WN9B 5EXPA 3OEED 4F71A 5AOBA 2NVBA 1FVOA 1O94C 4QUBA 5ER9A 4M1TA 5C4IA 4DLSA 1SXJD 3A9RA 3HA3A 4I6EA 2HHAA 1MB9A 2HK8A 1ZQ9A 2JK1A 1FYFA 4M1ZA 3NOQA 3BIOA 5JBQA 1KMNA 5AKHA 3I4LA 1YS2X 4DY6A 3P0JA 3HQ4O 5HUJA 1RCTE 3S40A 4H6VA 2VJKA 1FMJA 1M72A 2XUDA 1AZLA 1XHLA 1GPWB 4M9XA 2OXTA 2AV6A 2ECOA 1G6OA 3HR8A 4GX0A 4J7CA 4QBTA 1VPEA 2HMSA 5BSRA 2CYCA 2VI5A 3EZ7A 4IJWA 3NHFA 4H3VA 4OLHA 2ZU0C 4PGFA 3RC9A 4EG4A 2JPDA 1K5PA 2YJ3A 1ZVJA 4G3XA 1VG8A 3FMGA 4ESVA 2IHKA 2ORWA 3RT9A 5HDQA 2V0GA 4D9BA 3OQBA 521PA 3HOZG 2FX2A 5JNWA 3DLHA 2BBTA 4ZZIA 3KZKA 1K6MA 2ZJ7A 1TQDA 5C8VA 4S04A 4UBNA 1BOOA 1XTKA 2C9ZA 3CKMA 1OIWA 4I46A 1SOMA 4JYMA 2J3LA 2XQGA 3ZI7A 5BUCA 3MTAA 2DBZA 2QAGA 3EZYA 4TZ0A 3N2GB 1TM2A 4ZAFA 1ECCA 2COEA 3PNBA 4GRAA 4ZVQA 3E1SA 4BZXA 1EIWA 3PFIA 3G5MA 3RC1A 1EVIA 1WMBA 2CHEA 5AP9A 3V8PA 3JSLA 3BXOA 1H1DA 4MYRA 3NNNA 5FFMA 2Y93A 3ECCA 2P65A 1HR0H 1JWLA 1BXGB 5DHAA 4ENUA 1NW4A 3WGKA 1XK7A 1N5MA 2QX8A 3IQFA 4MVXA 1KHTA 5KFKA 1CF2O 3NHPA 5EPUA 1AQYA 4FSHA 3ZTTA 3HEBA 5GADl 4KR7A 2LD4A 4MB2A 2NT3A 4D46A 4ECRA 4XH9B 4XAQA 2PYZA 5FOVA 4KXWA 1ITZA 4ZALA 5CCEA 1G2WA 2C97A 4XWGA 2B36A 4N7JA 16PKA 1KY4A 1RLIA 1J22A 3RLFA 1C0KA 3RU3A 1UPFA 2DPHA 1FNCA 2O19A 4MYSA 5KT4A 1TMGE 2B8NA 2HXGA 3BIWA 4KQCA 2YMQA 1TTQB 5CLLA 2I55A 4S12A 3V2HA 2JFYA 4IG9A 4I8DA 2Y76A 4L76A 4MROA 4E5UA 1CQJA 1CS4C 3IQXA 2AMJA 2HK6A 4ZMBA 3FPFA 4URZR 1R0LA 2B1GA 3UENA 3DBLA 1WPRA 5IJWA 5GIOE 4GVXA 3WQSB 1BXRB 4MLPA 1UT5A 3VZRA 4ITRC 5JYDA 1ULSA 3E48A 1DJPA 4G6ZA 4JDUA 1IYEA 4JV5B 4MRVA 4A36A 2WMOB 1J1ZA 1A4IA 1RBQA 3H8VA 3ONVA 1EJ0A 4FFMA 2K87A 4OH7A 4IR1A 3S4YA 2L19A 4OBBA 4PXAA 4PY2A 4OM7A 5FD5A 1DELA 1T5HX 1URPA 1W44A 2BSXA 2DKNA 3FCUB 2Y1KA 3BTOA 4M87A 5HCIA 5IANA 2Z6QA 2WYUA 3M82A 4O8ZA 4K26A 1U3FA 3CT4A 3NUAA 1PTKA 3MJVA 4M7WA 5CLHA 4A9AA 5TS2A 3ASYA 4YXWD 1KAQA 1Y9EA 4YAWA 4KAXA 4PHGA 4A3IG 1QIFA 4J90A 4PS0A 4KWEA 3EOZA 4KKVA 3T34A 2AR7A 4R71A 1KORA 4Y2RA 4N76A 4S05A 3DZFA 5L3SA 4KRFA 1Z45A 3WL4A 2VPQA 1N3BA 1RMTA 1KEEB 1ZOPA 2C3PA 2IEYA 2B94A 2D1QA 3A7EA 3K2IA 3LBIA 4OUKX 4ZO4A 2BGTA 3RB4A 1S2DA 2GEKA 3PKZA 1PGOA 4JJEA 1U0TA 1TZMA 2HJSA 3PDIA 4QBFA 2VA8A 3LI2A 1K7CA 3SQNA 3U4HA 3VKUA 1WTAA 4TYQA 3RUEA 4V0SA 2GUWA 5IBQA 2OFWA 3PUIA 5TX7A 4LZWA 1Z68A 1OGJA 3W3ZB 2QV7A 2VNHA 1ZH2A 5EFZA 3KJHA 4M55A 3QVSA 3U3KA 1TWAA 4F56A 5JZMA 1PUXA 4DRFA 4R98A 3MTJA 3JPWA 2PUCA 5LXTF 4J03A 4IJQA 4YNBA 4MR8A 3RLIA 3FKSA 3E9YA 2XMSA 4NJEB 4ARZB 4N0QA 2C4VA 1W2HA 3TZLA 1RJRA 4NI5A 2A9JA 5EHIA 1UXGA 2NZJA 3PJDA 4Q1FA 1J2TA 4XE5A 4ZPJA 5BN4B 1MDFA 4NG5A 4Y2QA 2G1JA 4S0ZA 2Q8PA 1GQYA 2FOIA 3KR0A 3V4LA 2WAXA 3EYAA 2I71A 3L8MA 2RH9B 1X13A 4N5DA 3CW8X 4XR9A 4R3WA 3RRMA 3NS7A 2GGSA 4J9SA 1OLUB 4XM0A 4C6HA 3HABA 4HLUA 4RY8A 1A4XA 2OLSA 2KYRA 4R0MA 2AOTA 3ZH9B 3FG9A 4CKZA 1U02A 2BMJA 2H3HA 3BE6A 3IJRA 4Q3KA 2ZBEA 1YBHA 3SIWA 3SZOA 4NECA 2AX4A 2C4WA 1B1AA 2BZ1A 4WACA 4HDCA 1NVTA 4YJ3A 1Z29A 5CLQA 1SIOA 5KPDA 2YUIA 1E92A 3GH3A 1X1CA 3HGTA 3Q8RB 2MU1A 3MOIA 1MQ9A 3KALA 1ODIA 5L1JA 1OWOA 2F48A 2IF2A 2SCUA 3L0OA 3MQFA 4R84A 2OHIA 4X3PA 4J1QA 1JSLA 1O95C 5IVIA 1JG2A 1QPZA 5A6SA 3DKKA 4B6QA 1JVBA 1THGA 2BE7A 3AL2A 5IUKC 3KQTA 4CQMB 2JB9A 2DUWA 3E3AA 1T10A 3IBSA 4CMCA 5EKUA 3WYNA 3CX8A 4KFCA 3UJBA 1DKLA 1MPXA 3FW1A 4IF4A 2Q41A 2JFZA 4GOXA 5FLKA 1MF7A 2NYRA 3S6JA 1JLSA 1P81A 2OECA 4PVDA 3DOIA 5HV6A 3WL7A 1ADYA 3IR5A 2CXHA 4I14A 4PU0A 1U7HA 5ADVA 1DPGA 3G1WA 2WWTA 3N74A 1B6RA 4EHNA 2SECE 3YASA 3CR8A 4N3GA 3NTXA 5DN9A 5E6RA 4DOMA 1E9RA 4CEHA 5E3HA 2JJYA 5ICCA 1PS8A 1O96B 2MYPA 3OIVA 1JA9A 1MJNA 4X61A 2P3SA 3FKQA 5CYPA 3O5AA 4PFJA 2CLCX 4Z0TA 1M6EX 3ZCQA 2FDCA 2Q7OE 3TQOA 2P9TA 1ZBQA 2WU4A 4FS3A 5JMWA 4MYDA 4HUJA 1VIYA 3G79A 3FR8A 1BZYA 2XQKA 4R6XA 5JS2A 4FB4A 3C6MA 4N7RA 5FPHA 3TIGA 1Q15A 2XNSA 5CK5A 3VBEA 1Z5GA 1CRZA 3GXOA 1MJFA 4YAIA 1GPH1 1G8YA 4CMEA 2C4TA 3PGA1 1KSJA 1SU4A 4G2TA 4EA8A 1WZNA 4Y2YA 5L95A 1AV7A 2HA6A