2FPPB

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 127
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fppB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fppB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fppB03
4MA5A 3RFCA 5CAEA 4O7ZA 2SCUB 3HO8A 4MV7A 3QFFA 1SCUB 3R5FA 1VBHA 2HJWA 5HV6A 4I50F 4YAKB 5C1OA 2W6PA 3N6RA 4IIJF 4MV8A 2R7KA 2NU9A 1KJIA 2FPPA 4O7RA 4YJ3F 5IYZF 3SE7A 2GPWA 4I4TF 3R5HA 2FPIA 2NU7B 1KEEA 2I8CA 2ZDHA 4DLKA 5LP6F 1KJ9A 4FFPA 2V5AA 1AUVA 1JKJA 2FPGA 4YB8A 3ETHA 4O4IF 3RV3A 4TUYF 4IWYA 2X0SA 5EZYF 5CB4F 5LOVF 4Y8VA 1W93A 2CNUA 2R6FA 1GGOA 2FP4B 2W70A 2C00A 2R82A 2V58A 1B6RA 4XYLB 4TV8F 3UFXB 5CA0F 2FB9A 1KBLA 3OUZA 5C8YF 1Z2NX 3GIDA 4C5BA 2R85A 4FFRA 4O7LA 4XX0A 1I7LA 4YAJA 3AW8A 4FGRA 2YYAA 1E4EB 4MV6A 4C5CA 2W71A 3WO0A 2SCUA 3BG5A 3VPCA 1SCUA 4YBZB 2QK4A 3MWEA 2YS7A 3HB9A 1CQJB 2GQSA 4XYMA 1W96A 4O7VA 2R84A 2YZNA 1WR2A 4EG0A 3TW6A 2NU6B 2YZLA 3MWDA 4YJ2F 1EUDB 1EUCB 5BPFA 5C1PA 3R5XA 4O81A 4RZQA 3TINA 4EGQA 1GSAA 5GONF 4O84A 2NU8B 2YZGA 2DIKA 1JDEA 2Z02A 2YS6A 5J2TF 4MAMA 2R7MA 2XD4A 2DLNA 2I80A 3R23A 1PX2A 1DIKA 1OI7A 5FNVF 3KAJA 4MV9A 1M6VA 1GSOA 3LP8A 4WBNF 4WD3A 2VPQA 4EGJA 4ZHQF 4TV9F 3V4SA 2HGSA 5D8DA 4IWXA 1KC7A 1JLLA 2CSUA 2YZMA 2Z04A 3ORQA 2PBZA 3KALA 3ORRA 3K5HA 1GLVA 2YV1A 2W6NA 4MV3A 1EYZA 3OUUA 3Q2OA 4O4HF 5JH7F 2OLSA 1UC9A 1AUXA 3K3PA 1EZ1A 4O2AF 4ZI7F 4YBZA 2J9GA 1CQIA 2XCLA 3AX6A 2W6OA 4FFOA 4XZ3A 4MV4A 2NU9B 2FPPB 2NU6A 1M0WA 3DMYA 2IP4A 4O4LF 5DMXA 2FPIB 1Z2OX 4IHJF 4HNUA 3V4ZA 4O2BF 1CE8A 3WNZA 5BMVF 2NU8A 4O86A 1M0TA 3MJFA 5K2MA 2GQRA 1JKJB 2FPGB 4YB8B 3TIGA 4FFNA 2R86A 4M9UA 4YAKA 2DZDA 5JVDF 2YV2A 4I55F 1DV2A 2YW2A 5LXTF 3G8DA 3I12A 5JVLA 1A9XA 1KJ8A 2NUAB 2NU7A 3LWBA 1IOVA 4O83A 4O82A 5HBRB 3DF7A 3R9RA 3ETJA 2PVPA 2CQYA 1DV1A 3VPDA 5KKNB 2YL2A 3JRWA 4L1KA 4QSHA 4ME6A 3TIIA 1PK8A 2ZDQA 3U54A 4FE2A 4O7YA 4YAJB 4E4TA 3JZFA 4O7NA 1T36A 4O7TA 3JRXA 2CZGA 1KUTA 3HBLA 1C30A 4FU0A 3MWEB 1VKZA 2QF7A 4IZOA 4XYMB 2FP4A 2DWCA 4XYLA 4MA0A 3NUAA 3UFXA 3MWDB 4HNTA 2YWVA 4O7WA 2R7LA 5LA6F 3WO1A 1GSHA 1BXRA 5J2UF 2W6MA 1E4EA 5CAEB 4HR7A 2I87A 5LYJF 4HNVA 3K5IA 3RV4A 5H80A 1CQJA 2ZDGA 4ZQIA 2VQDA 1B6SA 3RUPA 2GLTA 1IOWA 3VMMA 1KJQA 1UC8A 3PFFA 3U55A 1BNCA 2CNVA 2VR1A 1CS0A 1EUDA 1EUCA 2NUAA 4HQ6A 4O4JF 3VOTA 3N8DA 5HBRA 4FFMA 1EHIA 3U9TA 2YRXA 1JDBB 1JLLB 3U9SA 1ULZA 2GPSA 2R7NA 3KAKA 1Z2PX 3E5NA 4C5AA 2W6ZA 2P0AA 1KJJA 5KX5F 2WYOA 4Y8VB 3GLKA 1I7NA 3G8CA 1OBDA 2PN1A 5JQGF 4ZOLF 1VBGA 4DIMA 3VA7A 5I47A 1A48A 2CNQA 1CQIB 1OBGA 5JQWA 2W6QA 5CA1F 4XZ3B 3VPBA 2YRWA 3Q1KA 4NYEA 2R87A 3JZIA 3TQTA 1C3OA 4FFLA 4MV1A 5BPHA 4O7SA 3KREA 4XX0B 2V59A
chains in the Genus database with same CATH superfamily
3Q8QB 1T8TA 1IU9A 4PSUA 3UMYA 5A05A 3GVPA 2PEYA 4JZYA 4U02A 3SEQA 4IJUA 5EUQB 2DE0X 1LPSA 5CJ2A 1OBCA 3E3OA 3DZBA 1SXJE 4Z0TA 1XNHA 3GT0A 4BNTA 1GCUA 1IN1A 1DKPA 2TS1A 3TSZA 1JDJA 2V5AA 1AUVA 4GZ3A 4WAUA 2AC2A 3KUUA 3REFA 3QWHA 3WIUA 1Y8AA 1BA3A 4RGYA 4GOLD 1I10A 5FPQA 3EIXA 3RGWS 1MKYA 2F3QA 2ZUCA 4AX8A 1HG0A 1GA6A 1J22A 4YP7A 1VDMA 3EY4A 2JRCA 5COBA 1QG4A 1GNTA 2R25B 1R10A 1VJ5A 1A9QA 1K6IA 5HS4A 3DE4X 3LFTA 1PR4A 1GPWB 3QEBZ 5BQ5A 5CJJA 2GKSA 4BC1A 3WAJA 3WB0A 2QK4A 3PPIA 3FIJA 1PUJA 3K15A 4NCIA 4ZT2A 5BN3A 3NH6A 2YC2C 3A6ZA 3IUQA 1EFAA 3HGTA 3GC6A 5A2QW 5FOVA 2Z1DA 4FHEA 2EFJA 1N3YA 1O9GA 3TNLA 3MZ0A 3FDFA 4E5UA 4D8TA 3PHCA 3BFXA 2C98A 4GBJA 3VR6D 4XX1A 3RSGA 1NE7A 4Q3LA 4UBNA 1LVUA 4X62B 2X1MA 4XGNA 1FYEA 3R77A 3DVAB 3LC0A 1ZK1A 4LY6A 4RCNA 5DWVA 4X45A 2NUTB 1EXMA 4JGGA 2FG7C 1WUYA 3TFOA 3UBTA 3GLFE 1DLJA 1SWWA 4FDAA 5CH8A 3VV3A 3G9XA 3HE3A 1A4XA 2YC4C 4B87A 4C0JA 4ARZB 1GY8A 1EFLA 3KZCA 2Z4TA 3N2GB 3PWZA 3AQIA 3NVDA 4CLDA 3UK0A 3CE9A 3ZDAA 3PFWO 2DF8A 5ICSA 3WKBA 1JDUA 3DZDA 2FRDA 1CKNA 2C2YA 4FGKA 1XD9A 2MYNA 4CLEA 1JG6A 4BJHB 1M2OA 4U63A 1QQBA 5AM3A 5DTIA 2A58A 5TEVA 2G1KA 4EX6A 5IYBG 3MIIA 3GFSA 2BGJA 1EB8A 2E4WA 3TLYA 3I12A 2C8JA 3QBJA 3VJRA 5DF1A 4LUCA 4MHSA 3PDWA 1LU9A 5JBQA 3WLNA 5AXAA 3T4UA 5I5XA 3WMFA 2DUUA 1WZ2A 3LRPA 4OXYA 4JAVC 1FYDA 4MS1B 3UK7A 1O96A 5EEGA 4G1VA 1DBQA 2IOFK 3OPYA 1UOQA 3V1TC 5IBCA 1IY2A 2B1GA 3RTBA 1XCOA 5FR2A 2VHQA 2QPLA 4AKGA 4O4JB 2LWIA 4TZ6A 5D1OA 2W43A 4A2BA 4PVCA 1LK7A 3GHYA 4ZT5A 3CEHA 4DLSA 2WDTA 2Q5EA 4UCVA 1E4EA 4FNAA 1O5OA 3Q0EA 4HXGA 4IIEA 1NW9B 1H2XA 2I76A 1JQJC 3VR2A 4MTLA 4YLEA 1RACA 1AKUA 4EL0A 5E6UB 3FZYA 4J0IA 1ZUNA 4PFQA 1KMHB 4DMLA 1OBFO 2WQZA 3H2GA 2RDIA 3TECE 2KQUA 1W48A 2NV6A 3TRDA 1ESZA 3RS2A 4C03A 1NRXA 3FUWA 1NFRA 4R9SA 1E1LA 1YULA 1Z13A 4CEIB 2HXYA 3G2OA 2HA6A 1U3TA 1SK8A 3UIEA 1ZGBA 3DOOA 1K98A 2EFCB 2FZWA 3S2IA 1O0BA 3I04M 2FUG1 3MUOA 4MVJG 4YMGA 2W6QA 1O94D 3RVNA 2JJYA 3CRVA 3LT4A 1WTAA 1Z0JA 3W4JA 1S03G 1ZK4A 2K7ZA 4W5OA 4ECXA 4OV6B 4DV4B 5ES4B 1M7GA 2UUBH 3VQTA 2IU4A 1HURA 5JVDA 2SCUB 1LFDB 3GVCA 3I32A 1OHHA 4CLRB 5KJ6A 2VTBB 2IV7A 4IIJF 2W83A 2FPPA 4TWBA 2EKDA 3BVPA 3W4IA 2BC9A 4A27A 2PUCA 3AH8A 2CBXA 3GTJA 2RGGA 1B0ZA 1YMQA 2LKCA 3EPKA 5IUKC 5CD9A 3EFBA 4RB0A 1OWMA 1BIFA 3H2BA 3DYBA 2WJ3A 4PZ8A 3KCNA 4CMDA 4MTDA 5MDHA 2HLHA 1DUVG 4DV0B 3BGDA 3WBBA 4QQRA 1UBGA 3EXEB 1M6EX 3VC3A 3BQ2A 4BMOB 3CUSA 4URXR 4RKQA 1VLLA 4K6FA 1RYMA 4HLUC 3UJPA 4MV6A 3EGXA 3GFFA 1KI6A 2ZE7A 3WO0A 1M7HA 5D00A 5BNFA 2IYPA 2PUEA 5BWMA 5KFEA 4TLMB 2I7TA 2J1LA 4Q4AA 3W1EA 4ZHQB 3EFOA 2BHSA 2GETA 2KBFA 3RO7A 4XCVA 5K3OA 2E82A 5BT8A 3D6AA 3CLSD 3I72A 4I1PA 1E3SA 1KQFA 3IBTA 4P33A 4KFRA 2V7GA 1ICIA 1E1CA 3UGTA 1HDOA 4UFPA 4AM8A 2WILA 2J67A 3KQHA 4IJ5A 1ZKMA 3HY3A 4EMBA 4WLUA 3I73A 2Z95A 1V96A 2YYZA 3MUEA 2ZCUA 4ND3A 4KP7A 4YUXA 4A3SA 3V4RA 2VYNA 1LX6A 3KWFA 1ZM4A 1UKCA 2H1SA 2HA3A 4E03A 2QI9F 3M6UA 2VZEA 3RRMA 4LYAA 3RG2A 4YAOA 3T5CA 3HP1A 2A3NA 1KI7A 3IAFA 2YV1A 4GGMX 1AY0A 1AGNA 3BFJA 1ETHA 5JW6A 2IWRA 4GI7A 3V55A 1CP3A 3AINA 4WZBB 4L85A 2I6SA 3JAKB 4H35A 2C4MA 3TPFA 2EFDB 5HKOA 1Z4KA 2OBBA 2HQBA 3K09C 1ZSNA 3PPWA 1DBIA 2PFGA 5BMVF 1KETA 3OJ0A 3LY9A 3F78A 1DTWB 4NENA 5KNBA 2QZSA 4AWAA 3GLGE 1E2UA 2HD4A 1VE7A 4RUKA 5GADl 2ZSAA 1OZ0A 5JMOA 4LCBA 2VIIA 1G3QA 2YW9A 2CNWD 1YJXA 1Z8FA 5AK5A 1FS5A 5CIWA 3C4JA 1STOA 1AHIA 3SJ7A 1OI3A 2MSKA 4MWDA 1JE1A 4HEHA 4RQUA 1UFVA 1ODTC 2P11A 2ZWPA 3BAZA 2MSCB 2C7VA 2XSZA 3CX4A 3X44A 4EG1A 3PVXA 3NOVA 4HGYA 4ZAGA 1N2CE 3X43A 2NZJA 2B4AA 3QVUA 5KFHA 1GSHA 1JX4A 4GGPA 3VKHA 2KW5A 5CYPA 1ISJA 2PCLA 1QCDA 2VH5R 1LDBA 2I87A 2GRUA 1WLYA 1TCBA 2C2KA 3L5KA 5EJ4A 1VCIA 2AKYA 4FQ7A 3AIMA 1OXVA 2ZT5A 4K5QA 4WW0A 3A1TA 1NJ2A 2A1UA 1V45E 4RDCA 2LRHA 4QNRA 1CD5A 1P39A 2NAFA 4EPWA 1HI9A 2ZBQA 2V7TA 1I3KA 3L5OA 4MZXA 1OWTA 2AEFA 4XQ9A 2WUGA 1D2EA 3T0GA 5DCYA 3UQZA 2ETVA 2GEBA 1M6NA 2ZUVA 3SKVA 2BTEA 4G24A 4C0BA 1J0XO 3HHEA 4L22A 1DJPA 5DHTA 1WXQA 4IGFA 1PFKA 3A4VA 2J87A 5IH3A 4A92A 4ENVA 3L0DA 3KU1A 1ZIPA 1NOJA 3GA7A 3FGPA 3A9SA 3H84A 2HJHA 3PQ3A 3UEOA 1FDOA 4KITB 3M83A 4Q24A 2PGJA 4HUQA 2WUWE 1RRFA 1HE1C 2VAWA 2YWXA 3J80W 1CLEA 4TV8B 3JRNA 3CMMA 3C85A 5L95A 2H59A 5C7IO 5CFRA 2JI4A 4P98A 1XMVA 3C6BA 1L7QA 5FTJA 3SS7X 1I1QB 2I7VA 3ACCA 2QGNA 4B6EA 4KEAA 5AIBA 1Z38A 3S6JA 4QT4A 3VAZA 1Y7HA 2TRSB 3ZTWA 3IVAA 4PC6A 3STTA 4XUGB 2F3RA 3A0UA 2XNDA 4DV0H 2H31A 3MW8A 4A2CA 1XEWY 3QJGA 2YWEA 4WCFA 5LZ7A 3IE1A 4ZICA 1XTQA 3ADBA 4DIUA 3A4NA 1ZGJA 4P36A 1KEKA 5THQA 2DPIA 2BJVA 2ODWA 1XBTA 4R8UB 1A27A 1ST2A 3QHQA 4HC4A 1NVTA 2L42A 1TO2E 1LLQA 4Q1FA 2PDAA 3KT0A 4O8ZA 3OLYA 3Q5DA 1BA2A 4DIBA 4YR3A 4Y2HA 4F0JA 3JD4A 1LLUA 2CVZA 3KB6A 1YZLA 4BNZA 4JMLA 2V4QA 2HK6A 2WJIA 5HTOA 4MARA 1OFIA 3WWDA 3TRIA 4DUZH 4ED3A 1YRHA 3G5TA 4PIMA 5DOVA 4UULA 4Q12A 4Z7JA 2C31A 3EBLA 3BS4A 2EW1A 2G76A 3MGKA 1DTEA 3E8MA 1ORRA 4QDKA 1A8PA 2VH2A 3K16A 1V8BA 4N9WA 1TRKA 3OLXA 1VMEA 5D87A 4DLXA 5ALNA 1YA8A 4RY0A 4XWGA 4M60A 4GX2A 4CLHA 1KJZA 3S7TA 4EB0A 4J49A 5ITZA 3FTFA 3TQFA 4QUKA 4I4CA 2BIFA 4B3SB 4BO6A 1M0EA 2Q3BA 2XIQA 3PJFA 2HXGA 1RXWA 3OJWA 4OGWA 4LYGA 1GTL1 1H2YA 1NXOA 4ARSA 4HT3B 5ADWA 1EAYA 1CVIA 2HIAA 2JCXA 1Q19A 4ND6A 1BD3A 1PG2A 2V6JA 3T1NA 3RHFA 2Z30A 2IWHA 2C0CA 3UK6A 3ZY5A 5LXTF 3CZCA 5CR5A 3TH5A 1GPKA 1RAFA 5JCJD 3UJDA 2FR8C 1SKYB 3H99A 4H18A 1SPBS 2FVYA 5EWEA 1I0IA 5CXUA 2HJGA 3OD1A 2VDOB 2XQVA 2V6MA 4QNMA 2H1FA 4K86A 1M6HA 1NC1A 3SZMA 4R1UA 1XZNA 1LBSA 3FNBA 2QEQA 3T7SA 2VDQB 4UUNA 2JJQA 3SX4A 4X20A 1BU8A 1Z3IX 2ONCA 5F78A 3ZD8A 4IZOA 2D2IA 5K20A 3UNXA 4X1YA 1W46A 3MT7A 1ZN9A 1TC1A 4YACA 2VDJA 3IURA 1NVVR 2R7LA 1JT9A 3RJ0A 1VHLA 1PO7A 2AI2A 1L3IA 3C6MA 4I5FA 4ZGBA 4ALMA 4MVJD 4ZAYA 4ESHA 2ZANA 1JNYA 3QITA 1OC2A 1UF9A 1ZS9A 4WESA 4IV0A 4C2MA 4AJNA 2VXOA 3GH3A 4QRHA 1KRWA 1MHPA 3VOTA 4BVEA 3OOJA 4LTDA 2JIBA 4YONB 4QYXA 1P6QA 1VYHA 2F1JA 4LGYA 1EX6A 2BW0A 4HDNA 3TZKA 1Q2UA 1QZTA 1A9SA 3A32A 3EIHA 3ZUPA 1TK2A 2F9LA 3KYJB 5AESA 2PRIA 1HY3A 1IZZA 1XU4A 4RZUA 2OE2A 1EJ0A 4DCGA 3PQ2A 3AFGA 4GKVA 2H16A 3TEFA 5AVOA 3KHHA 1ZD3A 5C81A 4BLQA 3E7FA 2A0UA 3LVRE 3THXA 4MEJA 2WU0A 3GJ3A 1OXUA 4K9PA 3JZIA 4LQDA 7REQB 1CKNB 4MA5A 2AGOA 4DAAA 1Y37A 5B1IA 5L6LB 2A7XA 3PGXA 4KJZA 2Y8EA 2GBLA 3QVMA 4PWYA 4H1HA 3ZVMA 4YIKA 3MWFA 2I2FA 2AR9A 3C6QA 3S2GA 4EKDA 1Y3AA 1RHKA 3MJHA 5JLJA 4X41A 5NULA 4IRMA 3I6QA 1YDHA 3E81A 2XRMA 1LA2A 1U9IA 1Z4OA 3E3AA 1E69A 1J2YA 2AS0A 3HDYA 3BXOA 4JI3H 3OPYB 2QS9A 4FE7A 3NIFB 4Y2YA 4UBOA 3TVTA 3ZCRA 2ZLBA 4NICA 3PEVA 2UU9H 4LQCA 5HNKA 2BGNA 3NH9A 5KYXA 1JAZA 4MUYA 4QU5A 5ALKA 1JSLA 1E4EB 2Y2UA 3O8LA 2HDOA 5KKAA 3K9FC 3SDBA 5FPTA 1K86A 3ZJTA 5KFPA 4X24A 4S3MA 4KR0A 4XDYA 4ADSG 3PNMA 2NV0A 3BIJA 2BFDA 4GMXA 5C5CA 1ZUNB 1AHNA 3AOEA 4HGZA 3BH7A 1RRPA 5IC5A 3UHJA 1QLJA 3OPQA 4NOMA 2GN2A 1SVLA 3AFHA 2IP2A 3WTBA 4E6PA 3ONNA 3G7SA 3TNDA 1G8AA 3KVOA 4FEYA 1E3IA 1C3EA 1EDDA 1TAGA 1SK9A 3NV9A 4WBNF 3HA3A 3PFNA 2AB0A 3PUWA 4F4DA 4HZUA 2R4QA 1DBVO 1ULSA 4CMIB 4N01A 3V8MA 1NXPA 3UOWA 1BYUA 1Z5VA 5BWNA 4GLOA 4S04A 3QTLA 3U7QA 1SXIA 1L5HA 4DAOA 2IXDA 3V7WA 5JVDB 1GARA 3BXPA 3ADDA 3HBJA 4O2AF 1SBHA 3CE6A 5AH0A 4TT3D 3Q8PB 4KWIA 3GFOA 3ZN2A 1UOOA 2O2XA 3FRIA 3Q40A 2GAIA 2EU8A 4LC9A 2FPPB 2BZ1A 2HU5A 4GBMA 1L4FA 5H7XA 3LYLA 1N0IA 2FEXA 5LQUA 3HO6A 1Z4JA 2ZJ4A 5LQDA 3FUCA 3MJFA 2C58A 4P2GA 5C35A 4KFSA 2XRZA 2OBXA 5KCZA 4EI2A 4NL4H 2Y0BA 3LLMA 5H1YA 3LXMA 3KKLA 1JF8A 3VHRA 2GYWA 2GN6A 4TZ0A 2JD0A 4WSOA 2P4QA 3D2CA 4X3CA 3DEYX 4NATA 1DEAA 4D99A 1TUBA 4LEIA 3ZW9A 2PRKA 3H2HA 5E25A 3PGJA 3V2UA 3QF4A 1RBQA 3WIBA 2J30A 5IJWA 1KI6B 1WOYA 2IZ6A 3PCRB 2JBHA 5CT6A 4M89A 3C6YA 4NZYA 2D2EA 1EZZA 4Q4AB 2ZIVB 2A8YA 1OYVA 2GVDC 2X8LA 1CS4C 5C3MA 4LJ9A 3U0VA 3F7TA 5JSUA 1NBME 4B82A 2PBFA 4BDSA 4EX7A 1GEGA 1RLJA 1EPUA 4UQOA 2B37A 1L1RA 2ZYRA 3HUTA 1VMIA 1ZICA 2CNVA 2RGVA 2IKSA 3OESA 2IV3A 3MCUA 3BWMA 2D7JA 1L5LA 1FVFA 2X22A 1SZDA 3W77A 2PS3A 3M81A 1T9ZA 2CJPA 3BA6A 3GNLA 1NZDA 1GQOA 4F5DA 4AQYB 2V74B 5KX5F 2RGYA 3PLAE 5KAMA 3KHTA 4A8JB 4D6XA 2D5BA 5K6RA 5EG5A 2F7SA 4ZK6A 3NHPA 3VA7A 2A5YB 4KVFA 1UK7A 1JVNA 5COAA 2HZBA 3DO5A 2WDPA 1TEHA 2CCJA 4OH1A 4K9KA 1KQGA 3SIWA 3LWDA 4OHBA 2H5EA 4PWQA 1SQ5A 1KC3A 1YRLA 1SC4A 2I55A 3RC9A 4NENB 2MU1A 3PC6A 5AVXA 1D4AA 4RPCA 1N6PA 3UV7A 4ZK2A 4NBNA 4B84A 5CA0B 4Y9UA 1VGVA 1MDBA 1BE6A 2QZZA 3ZVNA 4KXXA 4PLYA 4ARIA 4KPFC 3N8GA 1UBUS 2CFSA 4BBRG 3EPIA 3BQ1A 4O59O 1C0EA 3QE2A 1IRIA 1DAHA 1FLVA 2PMWB 3ROQA 4Y2QA 2WNIA 2IYTA 5K09A 1ATIA 3OZXA 1XTKA 3LCRA 4J9SA 2PMKA 4ZV4A 4PGAA 3GUZA 4CT4B 2ONKA 4RUAA 2QY9A 4LVNA 5LZ5A 1KGSA 3MWEA 1NASA 2RE8A 4GDMA 1J8MF 3JVUA 3NAGA 1BFKA 3F7OA 4JA0A 3VPSA 4YK7A 3UTDA 2A1UB 3WDSA 1EWQA 1XC7A 2FEOA 5BW8A 1IBLH 4B74A 2I65A 2UUPA 1IUPA 2C8LA 2IUSA 4M7RA 4YQZA 3RNOA 3I42A 3D3JA 4GMGA 1GO3E 4J9OA 4DA7A 1RIFA 2I2AA 4GWGA 5ALDA 3IOEA 1GL3A 1KAHA 4DSNA 1V1MA 4LF8H 1HEIA 4MUNA 5DG8A 2FPKA 1U0LA 5EESA 1O5IA 4RPJA 3U3XA 1W4RA 3P1JA 3RTGA 2Y1DA 2Q4BA 1O89A 4LYEA 1P5JA 3I83A 4PF1A 4HBZA 4N3BA 3D4BA 1RWQA 4ZVUA 2A9KA 2C5LA 1FXSA 1H9BA 1XQVA 2R66A 2JA1A 1XAJA 5HW0A 2WC1A 4NH4A 1EBUA 4B2PA 3EIOA 4P34A 1G7CA 4JFRA 3WNCA 2W9BB 3Q8RB 4HV4A 3QE3A 1WCV1 1FB5A 2PT7A 3TXAA 5K45A 4HUQB 4TTVA 5HP4A 1WV1A 4BB0A 2JG3A 1RW4A 3OF5A 3FN4A 1KDYA 3IOBA 1YZYA 1MAWA 4V03A 5HFJA 4FYYA 1KEPA 5A1TA 2R8ZA 3C3JA 1XHLA 1E59A 1U98A 4EW2A 4LZLA 3T7RA 1O95D 2WUEA 3NVAA 3FRHA 1G2OA 4X71A 5F3RA 5C0OE 3SDZA 4BKQA 4C2TA 3B89A 1CS0B 4MW4A 2W2XA 1QV7A 3ZTYA 3FNGA 4HWPA 2PZEA 3DV9A 3O95A 13PKA 2VO1A 1F8GA 4WCFB 2QL6A 3PJGA 1TYDE 3ZIAA 2G7MC 3TRFA 3OSZA 1U8TA 1UM8A 4ARZA 1UKVY 1CUFA 1Q57A 4TMFA 5J5VA 1E5QA 1YKFA 2O1XA 3DFMA 4XR9A 3NGDA 5EWMA 3RVJA 4CG2A 4B4KA 2QYZA 3H05A 2OUIA 2H06A 3PX2A 1JPJA 2H51A 3E35A 1JIHA 3F3KA 1J8VA 2OGUA 3S8EA 2J6IA 3T1HH 2Z2IA 4Q3CA 1IAVA 2GD6A 1Z7EA 1GPUA 3W5BA 2AG5A 3PNVA 1DINA 4AKIA 1I2AA 3H4MA 3PYXA 1TO6A 3KUKA 4B47A 3FLBA 5FWNA 4JUFA 5IANA 5CA1B 2XA9A 4F72A 4BQEA 4KUGA 1QUEA 4GE3A 3S8YA 3D6MA 5JEDA 4R40A 5AI0A 1LUAA 3P32A 4IQ0A 2EGHA 1YL6A 4MS1A 2VYVD 2P0AA 5JI3E 4HEA6 5J4LA 1TX4B 4ENUA 4AQYH 3OJEA 5CB8A 4PYIA 2C9BA 5FAXA 4O4JA 5HTKA 3T4EA 2HNAA 1KAGA 5ITZB 4AECA 4BBZA 2XHEA 2Z3VA 4RMJA 2H63A 1CUZA 3GEMA 5LD2C 1XKXA 2FSGA 4EZEA 2C20A 2PH7A 1NHWA 2JFNA 2J31A 4JEHA 4N12A 2JGKA 5T3YA 1NR7A 1VLQA 4WMLA 4HFMA 1E3EA 1NJ6A 4NK4A 2RBKA 4BGDA 3UPTA 3G2HA 2Z98A 4FQ8A 5A1JA 1MD9A 2QVGA 4GYJA 4F2HA 3G9UA 9ABPA 5DM2A 4RCVA 5C46F 2VP3A 1J56A 2Q46A 3B8EA 1HM5A 4JVSB 3OZIA 2J6BA 4MGIR 1JWLA 2IYUA 3ZHTA 2GS9A 4LJ6A 4CEIA 1Q0UA 5INTA 4EMSA 4ALIA 1XV5A 1LPBB 5IKEA 1W8IA 1JG4A 2F9MA 1K06A 2Y93A 1JALA 3DEAA 4LRXA 1UZMA 4HAWA 4RYLA 1U5BA 5LBUA 1ZI6A 4X8LA 3CIOA 2Q5JA 1O9HA 2R8PA 4PCLA 1OYOA 1H22A 4I6JA 3HP7A 2YHIB 1GTRA 4ILEA 2SCUA 2RKOA 1BGWA 1P1BA 3D7RA 3U3KA 2AI3A 4ES6A 5SZIA 4CLRA 2BTQA 4WESB 3S99A 4AS2A 2G09A 2G67A 1MPTA 4RV9A 5IX8A 3A8TA 1UODA 2FK8A 2IHVA 4O81A 4C88A 4LECA 1UDCA 4ZCTA 4IWNA 3EMKA 3KQQA 1PWHA 1YTLA 4HDNB 4V0ME 1GADO 3BEDA 1HTTA 1ODKA 4EW1A 2GKOA 4QBHA 5D86A 1E4FT 4G67A 2Z9DA 2R6HA 5JNWA 4GQBA 2HRBA 4XXHA 3BE6A 5L7WA 5DG7A 1S9HA 3QFTA 2QX9A 4O1MA 4DR2H 4Y2XA 4LTMA 3A04A 1E99A 4TS1A 5DCUA 2IHTA 2OO7A 3QI7A 1NMQA 2BKEA 1Y4AE 4HYTA 3BXHA 3TZQA 2EFGA 4K05A 1WUKS 2ZSBA 2EKBA 3JZAA 2OQVA 1P81A 4RVDA 2Q4RA 3AU8A 2YMLA 5GZ6A 1V8OA 1OH5A 4TS4A 2XTZA 1NX6A 2HIMA 2EJ0A 1Z2OX 1BFUA 1G8YA 2MMGA 1IIRA 3LQQA 6REQB 2PZLA 2ZTHA 3ET5A 5EQTA 3GLHB 2ATEA 3N3BC 1JZSA 3ZU2A 2ZE6A 2BELA 5KNDD 2Q5IA 1BRMA 4WVLA 3KV3O 2BLNA 4BNYA 2YW2A 4MQ6A 5CCXA 4R8LA 2BM0A 2VS1A 2VQFB 2YINC 1CVLA 4F3YA 1TB4A 4RH1A 4XOIA 1CY2A 1VGQA 3HM2A 5JD3A 3IO5A 2CVQA 1V1RA 121PA 2G83A 3N58A 4Q1BA 4YWHA 5IBRA 4KRXA 2JI9A 4K9MA 2B5VA 3RD5A 1S0NA 5EC8A 4TMZA 3R24A 3VZDA 3M9LA 2QF7A 1J2EA 2O54A 1ZOPA 3ZE2B 4WZBA 4A93G 4BXOA 1KR2A 4R3UC 2FMFA 3EEOA 2ANBA 4UM5A 4D0RA 4LH6A 5J43A 5FUYA 1QYCA 1QMPA 1B3BA 3EPRA 3RWMB 3WKDA 3LYUA 1G0OA 4NQZA 2B7BA 1NJ1A 2BDUA 1DTWA 1HYBA 2OG2A 3SJUA 3BK2A 3V8RA 3SAJA 3S44A 3A05A 1A72A 3RIZA 2X0DA 2ERYA 5KSWB 3DM9B 3VOAA 4NJEB 4S12A 5LQJA 1P9NA 4HTFB 5A5FA 4HZUB 1P0FA 4PG4A 3ZHZA 3EZ9A 5P8WA 2W5UA 3U7QB 2XDAA 4K9SA 4IFIA 1L5HB 2Z09A 3LSTA 1DLIA 3KWJA 4Y8VB 4K9DA 3SEZA 4ITRC 1R5JA 5CFOA 3CS3A 1XUOA 1O1YA 2XB4A 4YT2A 4HNSA 1ECGA 1V5IA 3D8UA 3SHTA 4GWKA 3TTWA 2PJUA 3DE5X 4PLGA 1CY6A 3O8RA 1YI8A 2BI4A 2XGPA 3B1KA 4BHTA 5FEUA 5CLFA 4LGVA 2HJWA 2OCBA 3KZVA 3QUTA 4I9NA 3UWKA 4WDRA 3UAZA 2ZBRA 4QTZA 1FYFA 4EG3A 3R0QA 2GWRA 5KFUA 4L9SA 3FYHA 4EGCB 1IONA 4OA5A 3K8ZA 1ORHA 1TUBB 4YMHA 3MT9A 4U7GA 2OR3A 4F3NA 3AC0A 4EUFA 1IHPA 1Y4SA 3QF4B 1GLGA 1VE6A 4FOSA 1LTQA 4OF4A 1TQDA 1PFGA 3LX6A 1TD1A 2R6FA 2JAQA 4NZPA 1IXRC 4RF4A 4ZYLA 1OLOA 3WS7A 1E2IA 2VBGA 1R8JA 2DH6A 3BZWA 2FHSA 4JLMA 2BKAA 2JEGA 3WBFA 5KHAA 2DWUA 2YYAA 2Q27A 1WG8A 2W9AA 2D62A 3KD2A 1SVIA 1KNQA 2DPMA 3KJZA 4P1ZA 3UMJA 2B9EA 1BEZA 1TPZA 2QMOA 1SIWA 1YGPA 3EGWA 3MCVA 2Q28A 4P0TA 3OTGA 5HK9A 1B0PA 2XZDA 1NQTA 1NC3A 2UYQA 5ILOA 5LNK1 2YVQA 4J4HA 1O8CA 1C7EA 2C9DA 1A82A 1P2UA 4E0BA 5AKEA 2IZ1A 3B1VA 1I3LA 2YQZA 1C1HA 4Y9SA 2FN9A 1E5LA 4LF5H 5JS7A 1TIPA 2UUAH 4MWBA 4QKQA 3PHJA 1YBFA 4PWZA 2C78A 4FHDA 2GBGA 3RWBA 1MVLA 5J4YA 3ZQ4A 3RH0A 1UC9A 3TSOA 1TZMA 4CCYB 3WGKA 3JD3A 4R8UA 4CEJB 3PTAA 4R1NA 1IEWA 4I3GA 1GG5A 3SN6A 1XYYA 1KKMA 4C78A 2XMCA 3TVDA 4FDUA 2AQIA 4BVHA 1I4TD 3MMNA 3ORSA 5EE3A 3BGVA 2J3IA 1WXHA 4UAUA 1IHXA 4EA8A 3EPPA 4M37A 4MKHA 3QYAA 2J6TA 4Y1GA 3DDUA 1N2GA 1B2RA 2OXFA 1SIBE 1FFXA 2ODBA 3EIQA 2RG1A 3VUFA 4X65H 3IS3A 5HGJA 2QN2A 3NHBA 5KPJA 4I1UA 2GUWA 3BAFA 3TR0A 3DT9A 2JFVA 4WUTA 4F85A 5ECDA 3UJ7A 4UC0A 3ELYA 2LCFA 5C8ZA 3MRTA 1YONA 3L0PA 4IQGA 3NFYA 3ORYA 3QF7A 3GGJA 4BJ3A 3BPSA 4EM6A 3GCXA 2ZJ2A 4R8SA 3CPSA 5TC4A 3MWEB 2XGGA 4ZFNA 3UAVA 5KUTA 6Q21A 3C39A 5HG0A 3LCVB 3CKMA 3I6MA 2FQXA 5EIAA 2EP7A 3PFIA 4YYEA 3NM4A 5AHXA 2E37A 5AVJA 2NVXA 6CHYA 4KSBA 3DM5A 1P16A 4G5YA 3HFGA 5CT8A 4CFZA 1NT4A 3RUEA 2R97A 2GLTA 3ENNA 1XTTA 3R6GA 3GAFA 1IY0A 4JDPA 1V1MB 4LWOA 5DI3A 5B7GA 1MX3A 1M1UA 4C05A 2IDJA 1NYQA 2QYSA 4ANFA 4LOJA 3I4NG 3KBOA 5D1NA 3D8NA 2R4TA 2VPYA 4BAGA 4Z4CA 3CTPA 4DRZA 3NXSA 3MS2A 2VP5A 5BUSA 2OM2A 5TIIA 2ZIAA 2I8AA 3RRZA 4NZNA 3V46A 3TIFA 3E6AA 5J5CA 3SYMA 4Z2YA 1AKYA 1YC5A 1J90A 1O5TA 2KM1A 3GBSA 4U2CA 4G25A 1W75A 4RXUA 5GMOA 2QIOA 1CJUC 4RESA 1ADBA 1AKRA 1Q1EA 2X19A 4YV2A 4EEZA 1LQTA 4I1RA 3WRXC 3COZA 3IMCA 5CLQA 5EXPA 1UEJA 2N1BA 4EAQA 3JSAA 1RQLA 1OFHA 5DX1A 5CXXA 5FXMA 4X44A 4MAFA 3CNHA 3HSKA 3IFSA 5JY6A 3X1KA 3VPFA 1ZVKA 3GG9A 2EERA 3RJTA 2ZDHA 3TK1A 4JCOA 2EIXA 2Y27A 3HGQA 3DC7A 4J4BA 4TOIA 3H7AA 3R6LA 1OPRA 3F2IA 3T5HA 1XTRA 2BCJQ 4GI2A 2X0SA 1TRHA 3F98A 3HUEA 2Z3ZA 4CR8A 1RDFA 3MCWA 2AI1A 4YO8A 4KOEC 5EWMB 2V3VA 2F62A 3I3SR 5F1PA 5ICGA 1PRYA 4E70A 3N7UA 4LSZA 2YR0A 2HXSA 7REQA 1K7XB 3BGIA 2DFTA 1OAOC 5KDOA 1UMBB 5JHGB 4LI0A 1N8TA 3MQFA 4URVR 1G5RA 2QOEA 4KYVA 3OKFA 3H1PA 4II3A 1YR8A 5DU2A 2QL7A 1VB5A 4KQIA 4OMFG 3RK1A 3B6IA 5BV1A 1THTA 4MJXA 3AR6A 2CXQA 1GT91 1PLKA 3NQ41 3LNTA 4TXNA 5BRNA 1KAQA 1BN6A 1CPYA 5EL0A 1JSXA 4W5QA 2UYHA 4B4VA 1L7PA 1A9OA 4ILKA 2PZAA 2O2IA 3U3MA 2ZI4A 1YVEI 4G8JA 3R09A 4JX9A 1ML3A 1Z4PX 2J5BA 4HATA 4P7FA 2Z2KA 3QLJA 3GX1A 4AMYA 3OZDA 2VJPA 3E22A 1ZD1A 1ZOLA 3CBQA 2IS1A 3WZ2A 2EL9A 3HCEA 3RT1A 2HEIA 5I4IA 1WAMA 1YCHA 3OTOB 1W0KD 1U2PA 2PGNA 3BEOA 4NZZA 3VYSB 3BWCA 1L2TA 4M8NE 3C7KA 2I2WA 2YY6A 3JPYA 3PZBA 4YYZA 2V96A 1MT3A 4D8VA 4UUQA 1X92A 4RTPA 4FGUA 4JLKA 4RHFA 2D5IA 5EVCA 1WS6A 2ORYA 1Y7LA 1Q3TA 3ZZ0A 3GDEA 3FI0A 4LMBA 2Y4NA 4CMIA 5JZVA 5FO0A 3LZ6A 3T9FA 2QQFA 1P1RA 1U5BB 3A9VA 5FCDA 1LWNA 1V11B 5JRDS 2QTLA 1H4TA 5F1KA 2REBA 5BR1A 4JYCA 3BCRA 2PKQP 3IDSA 2C29D 4XFJA 3OZRA 2BTQB 3BJEA 3G82C 2WFZA 4WY5A 2OCYC 3P2OA 4I1YA 1SULA 3ZZTA 3TG2A 5HKKD 3RKSA 4YT8A 5J2TA 1YRAA 1S4QA 1KEUA 4YMWA 4KSYA 4OJYA 4BO0A 2Q2NA 4DV6B 1ZQ9A 5LCXA 2BFWA 1E94E 2C9CA 4R1TA 2PWBA 3D6FA 1WOMA 5KU7A 3ZEIA 1X86B 5DGDA 3DV0B 4B0OA 4ALLA 3AJEA 3GV8B 4UUAA 5AQEA 3N8NA 2R5FA 1VOTA 4HCJA 3I3OA 2OORC 3HPQA 1UZAA 2GXAA 1A0OA 4N39A 3KP1A 2PY6A 2GRAA 5DGIA 3LT5A 3Q3JB 2WIKA 3SG0A 3KFXA 4HN9A 4AMGA 4I4TB 2MSNA 1A48A 2H1HA 3WGZA 1Y5IA 4UQLA 2YN4A 2R6R1 4UCTA 4IR1A 1XZEA 4G1MB 3PX3A 4MRNA 4EG4A 1S5PA 4R2MA 1ENOA 4KO3S 1TA4A 1XWWA 3EDRA 5HMLA 2AZMA 1R9JA 3G79A 3A9UA 5TMPA 5K6TA 2GM9A 4N0EA 1ZR2A 3SEFA 2XODA 1V8PA 4KR9A 2Z6UA 2G71A 4LH7A 1SC3A 2VJOA 4X62H 4WEOA 4GC9A 2R00A 1R7RA 3IUEA 4EHKA 1TKAA 1JR3D 2BFEA 1GYQA 3DZKA 4QIWA 4L4XA 3ZV7A 5CIYA 2WKWA 4KPEC 1V1RB 3T5GA 4GR5A 3COVA 4BX0A 1NNSA 2ZR8A 5F4BA 1PEAA 3SQXA 1J1ZA 4A8JA 2ZJ1A 4J9PA 3B3FA 2J3LA 2IS6A 1IZ9A 2AZ4A 4QAJA 3P45A 4BXOB 2J0VA 3NKLA 3HXLA 4JJGA 1LDMA 1PJZA 4KK4A 4B3IA 1B43A 3KEQA 5DX8A 4JYPA 2BFCA 4ZPJA 3COJA 3GA5A 1G4UR 1WZEA 5E1OA 5CCDA 4CFSA 1W0CA 3T7CA 4ISBA 4R6WA 3FFTA 4BE7B 4NYIQ 3P2YA 5CA0A 2PQ6A 1X7HA 2Z43A 3MJTA 1IAQA 1E9DA 4CRWB 4M1SA 2X0JA 2Z8ZA 4Q00A 5TJ9A 1TCCA 5A4AA 2DFLA 5KREA 5TX7A 2Z02A 2BF7A 1V6SA 4JSRA 1T9GR 3RAQA 4DIDA 3OM8A 3WGJA 4MCIA 3VJKA 2VC2B 4GH5A 3A1NA 4N7BA 2N46A 5D2CA 4DEYA 1ZYUA 4YI3A 2BUAA 4FR2A 2XLBA 1RKXA 1FMCA 4I5IA 2PZBA 3DDWA 4L75A 3JS5A 4JLOA 2QYTA 1VBMA 1N48A 5DIZA 3GARA 3I0ZA 4DDMA 1NXQA 4ND5A 1Z0IA 4YX9A 2C1XA 4KVAA 4CIXA 5JDCC 4AJ9A 3DDOA 1ESEA 2JLWA 3Q98A 4P8RA 3ZKAA 5HF9A 5AUOB 2VSFA 1G6KA 4BIIA 1RAHA 4A3BG 3I23A 3OTOH 1I0ZA 1P5HA 1YZHA 2GB4A 1FRVA 4M1WA 3HABA 2PL5A 4LDNA 2CBGA 4KNWA 5KFOA 3ZJ5A 3ZYCA 1FMJA 2WJYA 2XE8A 4RORA 1CDOA 4A0SA 5EE1A 1QP4A 4CU5A 4KO8A 1LTKA 4L9WA 4OOFA 1MB4A 3PEWA 3VPDA 4UOQA 1IOZA 4D96A 5H68A 1EA5A 4M9SA 2BH2A 1VIDA 1U2DC 4DV4H 4B43A 3UHAA 4UTOA 3FTCA 2TSYB 4DV5B 3THRA 3IQZA 2W9BA 4CCAA 3D6NB 1SBCA 1JR4A 2B4TO 4Q9IA 5FTNA 4DYHA 4FGZA 2OCGA 1Y98A 2QI9C 3TW8B 4DYVA 4RPGA 4Q3EA 4TL9A 4UCFA 5LKAA 1MC4A 1Y6QA 3CRMA 2TMYA 4TN5A 1A4UA 4ZVVA 3K96A 1L4GA 5J47A 4RB3C 3ITEA 2AHOA 1PUXA 5TGZA 3DFIA 1RE0A 1T5OA 2I3DA 3JVDA 4GKKB 2NXWA 1IWBB 4Z86A 4OXIA 3GIMA 5L8VA 5AKZA 2EJCA 1XNQB 4URZR 3TLBA 5HK8A 2I1VB 1CS0A 4Q03A 4DM7A 2HK9A 1QVZA 1L5VA 3CEPB 4IEEA 6NULA 1KIFA 2H9IA 3AF6A 5FHQA 3I37X 4MW9A 3MMZA 1HF3A 5GM2A 1PLLA 1VG0B 3EIEA 4ENRA 1BMFA 5I6DA 3RABA 1VRCA 1V51A 4HMQA 1Z39A 2NZXA 2HFJA 4OHUA 4KHPB 1UBKS 3BX1A 4INAA 1EFKA 4LXXA 1NRJB 1X8XA 2YRWA 1D8TA 2PSJA 1N78A 2YVLA 3FNIA 4E30A 2QMYA 4J16A 1V5EA 4J2HA 2JEZA 2YX1A 5FBHA 1SO8A 3WSVA 4MMXB 1CUSA 1FFXB 5ECGC 5CA1A 1WDLA 2WE6A 3K9GA 2NXNA 1RXUA 4OJQA 5KFZA 2OGSA 4RSHA 3VI4B 2IXFA 5ADVA 3ICVA 4H4DA 2I91A 1SHZA 4CF7A 5K0FA 4QUAA 1NUHA 4MCHA 1Y7TA 5HKAA 4IX1A 2IHZA 4YPFA 3MJDA 3RQIA 2PUAA 1XQ1A 4UPVA 4TXLA 4NMXB 3GFGA 4C76A 5DWQA 2R1VB 3ZDEA 1J8YF 3ND5A 4G0ZA 1ZL2A 3U4QB 1NG9A 4KE9A 4MDHA 3WWHA 1EFUA 4DT1A 3F5QA 3JALB 1UXKA 1OV6A 3CB2A 3QVVA 4R5HA 5FQOA 4B44A 3WYDA 2ZRMA 5EIOA 4IJVA 1ZITA 3SDSA 3A4TA 2FRXA 5DI3B 1P7YA 1PFVA 1GG9A 3D7NA 3GRFA 4RETA 4KTTE 4HNAB 1CFZA 2FLPA 3V8NA 4LXHA 2NT3A 2AVDA 3WGQA 1E8DA 1EGVB 3VHQA 1TD9A 3KZXA 4Q3OA 4A0HA 3K70B 4C06A 3GCDA 2ASEA 4J9UE 3K73O 2Z6AA 1Q0SA 2IYZA 4KQMA 4O29A 1TVCA 2LIVA 2GK3A 3JZ6A 2IT1A 4QXRA 4LC0A 1TAUA 1YB1A 1LPNA 3RS4A 1OU0A 4AJPA 4Z1OA 4AP5A 4AYBA 3M34A 4JB2A 2FQWA 3R40A 1GU0A 5IMSA 3IIIA 2YHIA 2VT2A 2LGJA 3Q2OA 4QULA 4QOHA 3U7FB 3PR5B 1C0IA 2D06A 5T67A 3DGFC 4UHBA 3RK4A 1C0LA 2WWTA 1RM4A 3DEIA 1H93A 2BEVA 4TUYA 5CFNA 1T1JA 2J9FB 5LZ2A 1IBRA 3A6EA 3H87A 1KL7A 2ODQA 1L8QA 2RGBA 5CB4A 3BIXA 3K0AB 1VPTA 4BNKA 2HW8A 3QTBA 3IYLW 1T6NA 1X14A 4O25A 1W94A 3OLZA 1Y42X 5BN5B 1Q95A 2UVVA 2ZVQX 5BORA 5EFOA 2C35B 3M3DA 2H11A 2P0EA 4RVUA 2FSVC 3KJEA 1WVIA 5CDSA 3TWOA 3L07A 3OCVA 3GRZA 4WT7A 3A6DA 3KZKA 3OY7A 1MQ8B 5FRDA 3LFUA 3B3GA 1G8FA 3TE6A 2IU0A 1ZZGA 5LB4A 3O8CA 2W90A 4R2WA 2WT4A 4YQWA 3P94A 4MQUA 1T91A 3RUHA 3VO1A 1FFHA 5M3BA 6REQA 5DRTA 3LLSA 4HFRA 3KQSA 4F8YA 3GLHA 1YZVA 3RV4A 1PAUA 3OOHA 4MHOA 1FXWA 3E9YA 4MV5A 5AK0A 2GVZC 1XVTA 3ZBTA 3QVTA 3QFCA 3VZCA 5FUQA 4KXNA 4FYVA 1DG1G 3LGSA 2A3RA 3HSYA 4MPJA 1N5RA 1IPHA 2LDXA 2OBLA 3PFBA 2G25A 3CUWA 5AKGA 1T10A 4ZDJA 1IYEA 3CUTA 5B3KA 1TZ2A 3RREA 1YI1A 4HAIA 1N4DA 4O3FA 4KAAA 3E22B 1TEZA 1K8ZB 5T14A 3RKRA 3S70A 2H1OA 1S2DA 2OHGA 5H5JA 5DTJA 2BSAA 1E6WA 1XZQA 2PKXA 1DTSA 1LDEA 4Q8EA 2CBZA 3OT4A 2R87A 1NR1A 1RM0A 3R7AA 4WZZA 2EHDA 4IF4A 1TVMA 2CLHB 3MF4A 3R8XA 2ATLA 1XMSA 1ZJYA 1VE5A 4BNFA 4NYJQ 2ZTLA 2ODTX 3HDTA 3RWOA 1B23P 1BHQ1 2OP1A 2XXAA 3ACBA 4C4SA 1KK2A 1CHNA 4JV1A 4FFDA 4NJEA 1F06A 3C70A 4HTFA 1UBCA 1GNVA 3IMFA 3O1JC 2EQ5A 3RDPA 3D3QA 2ZWVA 2YU9A 4FBTA 1M8GA 3O2JA 2D2XA 4YJFB 2AKEA 2W6JD 1SEVA 1SUAA 4Y8VA 3GI1A 4MRAA 3DE2X 2IX9A 1U2TA 1NATA 3GB9A 3B20A 3LQ2A 4F92B 3X1DA 2I6UA 2A7QA 3U0GA 2RGRA 5MFZA 1NAIA 5J2TB 4UZSA 4XJXA 3CKYA 4B3SH 5FPKA 5IG2A 2JAOA 3UKOA 3BG5A 1WSAA 2FN7A 1U8ZA 1U04A 4Z8YA 1NRWA 3NHZA 4WACA 4UAGA 4HNGA 4RDHA 2HM7A 1JHAA 5HRUA 1FMFA 2M9MA 2C54A 1V4YA 1WO8A 4RKRA 3G17A 3LDAA 1D9ZA 1RC8A 4XYBA 3I5XA 4RV5A 2H8GA 4RAQA 1PU2A 2CT8A 5TQVA 1LSUA 4B6RA 1JDPA 1BXKA 1WP9A 4CG0A 1K7SN 1FLNA 3DOHA 3L9WA 4UU1A 2AC4A 4X6UA 1WSBA 4O3RA 2WF5A 4YT5A 3WL7A 5FPHA 3W5VA 1ND5A 1T6XA 3AL3A 1YB6A 4MVCA 3PGKA 1ULTA 4C7XA 4ZP1A 3C5CA 4RHTA 3NNSA 2GJAA 4RVCA 3W5OA 1IIBA 1M0WA 1E20A 2O8CB 5F52A 3FNHA 5CTAA 1YC2A 1Z8DA 2BFEB 3EZ7A 1VFPA 1COWA 4B6QA 3NVKI 2PUBA 3I9V6 1F38A 1ZCJA 2C3OA 1GITA 5HIKA 1C3LA 4D4KA 1GTVA 4HSEA 3G8DA 3G2MA 3FSGA 2K7FA 5ECYA 4YRDA 3DFFA 1KXZA 3CF0A 1H42A 1Q0QA 4KWTA 3LCUA 3UA4A 1EVKA 2XGSA 3RVOA 4TVIA 1NJFA 3O3NB 2BFCB 5IVDA 3UG7A 1JN0A 1XP8A 4CCYA 4BQRA 4CEJA 1NVXQ 4PO9A 4E09A 3ZWXA 1M5UA 5LVAA 2IPNA 2PA3A 4EFKA 3T7TA 4BJ5A 2YHBA 4HVCA 4ER5A 4D3ZA 1UPFA 5HILA 4KE8A 2WYHA 4RY8A 2KLBA 2JRLA 5FPSA 3B6ZA 4OL9A 2QD3A 4QDXA 2W8BA 4GWLA 2OLEA 3AEXA 2RHOA 4ZAVA 5B3LA 2VR1A 3IOYA 1SB9A 4XUDA 2XVYA 1ZCBA 4S1WA 2HPVA 1N8NA 2GFIA 3EVTA 1QIMA 4FZVA 1XGKA 1WJGA 3HPRA 4O4HA 3LOQA 1MTZA 5AM5A 5DE3A 3BQ9A 5HPYB 2YZKA 2W6ZA 2BI7A 3L2OB 1MNQA 1U2RA 1W0JA 4JQSA 4AUEA 4LF7B 1ESCA 3KYDA 3HN6A 3RIEA 2CUTA 1U7TA 2W2MA 3GTOA 1PCXA 3C24A 3FBTA 2FWRA 1Q3KA 1MO5A 3LH5A 4RK0A 5I5SA 4Q02A 2BLLA 4KQGA 4BCCA 4IFEA 5KYYB 5BN4B 5KFSA 1WMAA 4D7AA 2HCRA 3JWGA 3W1BA 4P7BA 4HLNA 1ESDA 2I62A 4UCUA 3T1QA 2A5LA 1RWWA 2FQQA 4FMBB 1H66A 4OI2A 2EVWX 2R92A 1A71A 1B4DA 2OA0A 3NEYA 2MYTA 2PXCA 4QUGA 4NAVA 2L18A 4GOXA 3P9KA 3QV1A 3WMWA 5K0EA 3AB7A 1G8KA 2PHZA 4DG9A 4I9HA 1SHKA 1OTHA 1KH2A 3RVPA 1XPOA 5B37A 2JCBA 4MVJM 2OWDA 5IAKA 5L40A 3JTEA 1K4KA 2JJMA 3OE7D 5JLAA 3DYIA 5JEEA 3O4HA 1E6LA 2FE1A 3I52A 1JKFA 2FUCA 4EG8A 2DPJA 3KSBC 2QM0A 1HLFA 4WOKA 2P40A 1QE5A 5KFDA 5L3QA 1F2UA 3CR3C 1W96A 1K8QA 2EZTA 2X58A 2R84A 3DO8A 1HGXA 4AI6A 1THGA 3K4HA 4ZZ0A 1P5RA 2GO7A 2HQOA 2V7UA 1U7ZA 1UBHS 4AFNA 3GD5A 5HOEA 3ZUGA 2J32A 4ZVRA 3KKNA 1HDRA 4X6LA 1PX2A 1SQ0A 1KIMA 2JLAA 4FXPA 2BRUC 5HYVA 1T5SA 4UJ3A 3J81k 3NATA 3CO0S 3NBAA 1RKQA 1GRCA 3KB8A 1I3MA 2CCKA 3GT7A 4DMRA 4IRKA 4XM1A 1QDUA 1S96A 1XD8A 4S0XA 1XLUA 3C3KA 1UMBA 1Q22A 2UDPA 3QPCA 3I2YX 1G3MA 2A33A 3WIVA 2AG1A 1DCTA 3LBHA 3S4YA 1VG1A 3WC4A 2WT9A 4GP9A 4MV4A 5DOZA 4XOUA 2B94A 3ZDYB 1GQFA 2OY0A 3I30X 3DB2A 2HT1A 4G2TA 4OA8A 3B3JA 3H1FA 4AN1A 1YE5A 5JCOA 3FJOA 1QIIA 4DWWA 3I6IA 1OXTA 3PC4A 1BU5A 1G21E 1JG1A 3ILSA 1YF3A 3WA6A 3GN2A 4MRSA 4MGHA 4E6EA 1ADJA 4GLFA 1L7BA 4PCVA 2AFHA 2P41A 1K5DA 3D1JA 3DH0A 1GL7A 4ZA2A 1NX9A 4LPKA 4QWCA 1S3IA 2X40A 2Y67A 3SR3A 1VMDA 3AW9A 3JRWA 4DNFA 1DIAA 2FMUA 1K5HA 4ME6A 3PQFA 4DT1B 2AYYA 2W4IA 3PFCA 4JJKA 5CFLA 4PPQA 2CHUA 3UH1A 1ZC3A 3F6CA 1U0SY 3BACA 2WHEA 4E5MA 4G4IA 4V39A 4XQ0A 3DJFA 3HBLA 4WIAA 4W8HA 3CZRA 4QW8A 1QQAA 4UOZA 2Y0SE 2VDMB 4HLCA 5KNBH 3GDGA 4YUYA 1Y1WA 1RE1A 3W7AA 2M6RA 5CXSA 4JBHA 1DDGA 3TOSA 1NVMB 4O2RA 2AMVA 4ODIA 4G5FA 2BMAA 9ATCA 2JI6A 2F4VB 5ALXA 3ZNOA 3EA5A 4LMRA 5C9ZA 3IJPA 4ECUA 2HDNB 5TF4A 3CWCA 4LIPD 2QRJA 3DMPA 1QBGA 4B46A 5K8VA 2RD2A 4RTLA 2ZAGA 4RCYA 4QAQA 3OHBA 2VNKA 4AYTA 3ZY2A 1DFHA 5DTEA 4EABA 1WTCA 3Q41A 3WSTA 4PAOA 2YXEA 1YT5A 4AL4A 4FIDA 3AMVA 3QBEA 4TQUS 3UKJA 2E4AA 1CF2O 1G8PA 5T6MA 1V11A 4K8RB 4EKEA 1KJJA 1W5TA 4D9NA 2ZR0A 5KDLA 4K9LA 1UXHA 2XBMA 1GFIA 1U2EA 5T4HA 2XKJE 2V9ZA 1DBRA 3DDNA 1E79D 3OM0A 1HNZB 3NC0B 1VSBA 2N47A 2E9SA 2H5LA 4U2GA 4Y6PA 3BT7A 2BEVB 2HOQA 4S1NA 1WHTA 4TUYB 2CDBA 1E3TA 2GZ2A 2ZUWA 2YIMA 2EKPA 1A9TA 5CB4B 3MR3A 2O14A 3O74A 4IG9A 3UANA 3HB0A 3PQ5A 4EYKA 3SNKA 3DV0A 4KQ9A 3ODGA 5D6OA 2ZRFA 3ZNQA 1DG9A 1DAFA 2IDZA 1SQSA 3L4BC 1PN3A 4NI5A 3Q9SA 4LV6A 2C4TA 3RV3A 3WLMA 4Q34A 4DMUB 3H75A 2QORA 1IMOA 2PUTA 3O9MA 3C3PA 4OMCA 3PQ7A 2C5SA 4I4TA 5F35A 3ZWNA 4AS3A 3ZE8A 1IY8A 1QK3A 3RTDA 4HUTA 1M1YE 2N1MA 3CA8A 1JX6A 4ZQCB 3D5EA 5JSKA 2W48A 2OO5C 2I8LA 2OQRA 5EP3A 2D1RA 4RANA 1BW9A 3Q3CA 4UTRA 4E5DA 2VP9A 4Q05A 3FNFA 1JR6A 4FGSA 1EJ6A 3FCSB 4F4JA 1RYYA 4R7TA 4ED1A 3DBIA 2PMCA 1GSAA 3COPA 3CG4A 3QEMB 1SCAA 4B3RB 1WCIA 2ORED 3MGGA 1QTNA 2VSYA 5KQGA 3CZAA 4FYIA 3MJRA 3QYFA 2RMKA 3C3CA 1XU9A 2JF0A 3EB9A 1GSOA 5EGSA 1QNFA 1NMXA 2PX5A 4LI3X 2ZEJA 3CGWA 2H00A 3IPCA 2X5OA 3STHA 1JDVA 4AYXA 2SECE 4TN1A 5GJBA 3RUIA 1SB8A 4CNBA 1GHTA 5BNZA 2OLSA 4D41A 1JI3A 2B8NA 5HCNA 4L15A 4ZRDA 4DNPA 4OQPA 4BVFA 1S02A 4CKYA 4LYJA 4F93B 4AJLA 2XXAB 1Z8HA 1SWVA 4JX8A 1RXCA 4FYHA 2JBAB 1GYFA 1CUUA 1N2IA 4OI1A 1NDHA 4LRUA 1XF9A 1TNDA 2CD7A 3HACA 2VEOA 4TWZA 1P2BA 5BSRA 2Q1SA 2GEUA 5FI0B 3L0CA 4L4ZA 4YN3A 1H8EA 1FSGA 3K6JA 4R8RA 3KT3A 1NLYA 3EGVA 2KSWA 4BNIA 3ZWMA 4EYOA 3HCDA 4JXUA 4JI2B 4C20A 4MWZA 4JBYA 2RHTA 1SBYA 4NCHA 1H4SA 4HJXA 3RBXA 1QRTA 2CZGA 3TF5A 2VWQA 1OXSC 4MVJE 2QLNA 1L7VC 4PBRA 3DW1X 4A6XA 3F47A 5FTMA 5FBKA 1GTJ1 1NI5A 2PAFA 3NYQA 5LA6F 5FBWB 2AU0A 1MABB 2ZB2A 1U8CB 4BNMA 4CM8A 2ZXEA 5IT4A 5TSDA 1ONBA 1N5LA 1A97A 3T9CA 2FKLA 3G85A 3HNRA 1KEWA 2E85A 1H5UA 3G1WA 1AKNA 4BU0A 5JYBA 4ZU6X 1GGFA 2J48A 3L1IA 1EFRA 2CLCX 1I14A 2ID4A 2FN8A 4V1CB 1HOTA 4I14A 4XEUA 2J07A 1ULZA 3KKOA 5F7ZA 3OPVA 3NBUA 4EJMA 3LFHA 4BO7A 2HA7A 3IP6A 4KBFA 4EKYA 1YVPA 3O8OA 1Y3FE 5KB3A 3HCCA 1SQGA 5IK2D 4MVWA 2COGA 1IVSA 4FK8A 2UVPB 5I9IA 3TJZA 3A2KA 1T34A 3IR6A 1X1BA 5HRCA 3CR7A 1IEXA 4I6GA 4QBFA 3GEBA 3B3QA 1U8YA 1FP2A 3TW8A 1EM8A 3W9BA 2BV3A 4MB6A 3K0CC 2F1KA 4NBSA 5L51A 5BVGA 1XJCA 1PL7A 3M5CA 3FHLA 4IEIA 2JGEA 2J3QA 3CSDA 3C43A 2RI0A 1ZCAA 1GDDA 3PXCX 3GLQA 2W42A 1QHIA 3PJEA 4RABA 2W2TA 2SKEA 1VG9B 2FCRA 3ZDRA 3BCUA 1CX9B 3K0EA 5JSYA 3IDOA 3G9TA 1X9IA 5JJKA 3VR4A 2EWVA 3O3MB 1H5QA 3ZNNA 2CJWB 1SC9A 3NEPX 4OHVA 3R7BA 3RVBA 5EMJA 1SU6A 4IFBA 1MJGM 3CH7A 4E5VA 4KAXA 4YRLA 2WIJA 4XVCA 2XWPA 1OGYA 4C5BA 4DBZA 1F9EA 5HWSA 4BVBA 1NVVQ 3FKIA 3CEAA 3A6KA 5DTQA 2F3TA 5EFZA 2W8BB 2XWSA 4XYMA 3GIJA 4DTCA 1Z0DA 4QEKA 1OD6A 4O2LA 3VR3D 5H02A 1DWPA 4EL5A 3K4PA 2VQFH 1XRRA 4UTPA 1XD2B 3FVQA 4ONEA 2VK8A 3S2SA 2K4MA 3HCOA 5EVJA 3BK7A 4NMLA 3HUFA 4O4HB 4J8PA 4PQRA 4UNPA 2X23A 3V34A 3JWHA 1R18A 3L8EA 4UQPA 1W59A 1S6YA 5THXA 3FDSA 3KYDB 5CDHA 1GR0A 2R1VA 2JJ1A 2H29A 5BWUA 2RK3A 3TJMA 1AMOA 1KVUA 1OC4A 1GTSA 4JQZA 4ZO9A 3B6JA 1N2JA 3U4QA 2EJWA 5FI3A 1D4ZA 3EJWA 3JALA 4Q43A 4EJSA 1SOUA 1ICEA 1XTJA 2BUBA 4IW3B 3EVEA 4ETWA 5EI5A 3T3HA 4E4RA 4QXAA 3O4RA 2GM3A 1NL3A 1YRBA 3WJAA 3RJMA 4UPDA 4AYWA 5CK4A 1H1TA 2J4DA 2DUMA 4LRQA 3AUUA 3U6BA 3SS8A 1PYDA 4HNAA 4KWEA 5GAJA 3GVHA 4NU5A 3SBEA 2O4CA 5LQMA 3E2IA 1TA8A 4YAKA 3KDAA 1SPXA 1ISRA 3U6KA 1YDFA 1BDJA 2PLFA 4WECA 5ERYA 1NR5A 2BFPA 4DADA 2IELA 2VT3A 1U1CA 5BWWA 2KE5A 4TQ9A 3RKUA 2FOLA 3UOGA 1D1TA 4KQCA 4FMDF 4ERXA 3JR3A 1Y4DE 5BUZA 4HH0A 2V3CC 4LHEA 5IVHA 5L3QB 1F2UB 1TCAA 2CB9A 5A5GA 1L5GB 2HPHA 2M1ZA 4MA0A 4ECSA 4BEVA 3RK0A 3FBWA 3D5TA 1SN7A 1W49A 2JLVA 2AFIE 4HR7A 2J9FA 1QCZA 5ITVA 3KTOA 1X9NA 2Q3FA 3EGOA 3K0AA 4A3KG 2NG1A 5DYGA 2FH5B 1PFQA 1TJ5A 4P81A 2FDXA 4W1PA 1FFEA 4INJA 4OU5A 5BN5A 1IHOA 2AUTA 2A4MA 1BVHA 3O83A 3R74A 4RA9B 4NQRA 2OHVA 1NRIA 3CLTC 3GF4A 3ILXA 4EEXA 3QNUA 4G56A 4YEDA 4OQNA 1CZLA 4UUOA 4CWAA 3GLKA 2J9ZB 3BTSA 3RAGA 2CNDA 4ARVA 1A7UA 3KHGA 1R5OA 4RZXA 2X4IA 2X7HA 1FSZA 4WERA 4DSUA 3S3TA 3MTIA 1C3OA 4MV1A 4YAFA 1DQZA 4HYKA 1R6AA 3F67A 3P4YA 1KY3A 1OYYA 3LCCA 3VTZA 1KQ3A 3L7KA 3QU5A 4MUFA 4LC1A 2X76A 1XEAA 2WWHA 3QV2A 2F00A 2RK4A 1RZRA 3SWWA 2AFHB 2LPMA 2FPRA 2P7IA 6YASA 1Z25A 3W5JA 4R7ZA 2GZ1A 4GVPA 5ADHA 1YR9A 2AXEA 4MW6A 3L77A 3TN7A 4FBLA 2Y1EA 4BIMA 1H9AA 3SJBA 4QYMA 3OP4A 4M9CA 4RZRA 1QGAA 4GHWA 1HDZA 3LZDA 3T9EA 1GPNA 2WV9A 3JQAA 2JEOA 5B3JA 2ZUUA 1WEHA 1HDIA 2GLUA 4PZLA 2EX0A 1B6RA 1U0BB 5FOWA 1JHOA 2P5UA 2OV8A 1TA0A 2XGQA 3OI7A 4R68A 2AG8A 4CU2A 1MQSA 2BHLA 5J23A 5CVDA 1HZZC 1G6Q1 1T4DA 2K2QB 3M4ZA 1AT1A 2V0GA 2XCTB 3IODA 4R2XA 3O0DA 4N3NA 3RRBA 4Z9XA 1S2MA 4TROA 1TC2A 1Y7IA 2CVHA 2BHNA 2NZ2A 1DC7A 2ADMA 4D80A 1HSOA 2VF7A 2YQ5A 4PLZA 1UBRS 2AJLI 1AQLA 4XPZA 1Z6TA 2AOVA 1TI7A 3VHXB 1FLAA 1I3OA 4KXFB 4YJFA 4WE3A 4JP8A 2X6RA 4BPRA 2Q99A 3CV3A 4GR4A 1X70A 4D6YA 2HG8A 2WAMA 3YASA 3N87A 5E2IA 2C4KA 2A1HA 3C8UA 2C5AA 4BLPA 9LDBA 5HXAA 3BM5A 3TSYA 1WHTB 2G28A 2VI5A 2P9ZA 1XQ9A 2OENG 4MWGA 1O57A 5IAJA 4KR6A 5IKPA 1B8VA 4RTKA 4P9NA 4MP6A 4F4XA 3T3PB 1T4MA 2P3SA 1B8OA 1E3WB 3M6IA 3PNYA 2H1WA 1FVXA 3QQ5A 3R75A 3E82A 3H2JA 2OO3A 3I4LA 3BJYA 3PD0A 2EIYA 1CDEA 4GPIB 2GCPA 2GQRA 1MW9X 3HV0A 1SUPA 3QZUA 1AA9A 4KFUA 1RKBA 4J9RA 1D2MA 2XOXA 4TSFD 3I2FA 1DRJA 3GJSA 3IAS1 5LP1A 2PCJA 4PHHA 2DJIA 2PO5A 3W5IA 3JSLA 1A0IA 1JJ7A 5F9FA 5LLTA 4O0MA 1DV1A 2QL9A 2RKBA 2D8MA 3C4QA 3Q12A 1RR6A 3OUTA 1YL5A 4A5SA 3R5SA 2C59A 5ANRB 5FLXW 3OAAD 2UZ1B 3NAMA 2XUQA 2EZ9A 4AAYA 3H9QA 1BS1A 1BW9B 3MT0A 4GFDA 2ZRQA 4EVSA 4M1TA 2GM5A 4UBLA 5FI5A 2O8CA 2XJ9A 2VJLA 2RAPA 3GEPA 4M9QA 3KOMA 4JOCA 2G06A 1NAHA 2W8LA 1WCIB 1LNQA 2XE6A 1WF6A 5CM8B 1J99A 1JSCA 2AN9A 4EPTA 4X8HA 4EYIB 3KUXA 2P9EA 5HZKA 2AUNA 2Z6VA 2OL4A 4LZAA 4R2IA 3V80A 4DCJA 3IEKA 4NCBA 4YDRA 4G5GA 4ZCSA 3OJCA 2QT1A 5EP1A 1HG1A 4GOJA 3ZWOA 2VTKA 4TQSA 1PSZA 3GQBB 2I1WA 2OC9A 3G2JA 4E07A 1HQYE 1L4HA 5JCXA 1IFXA 2C9OA 4K1XA 4B3FX 2EYQA 1DC8A 3IAM6 1VZ2A 1I7NA 3ZLVA 3B2NA 3GDFA 1EMDA 3MRXA 1G38A 4IIDA 5DBOA 3L8ZA 4GZLA 5JRZA 2B9VA 2F3PA 1PZNA 4N54A 5H4HA 2YHUA 2HMSA 3O4FA 2W2KA 5K8TA 1FIUA 4GRAA 3HOZG 1NXXA 1Z5GA 1G5FA 4K46A 5FWDA 2JGMA 4O7ZA 3N3AC 2KS6A 3PPYA 4ETNA 4APMA 3M9XA 3ZD7A 2ZTUA 2PE5A 3HFJA 1E3JA 3OETA 1CNMA 5E1DA 1JFSA 4IVQA 5KVSA 1EESA 1WUJS 3VC2A 3EHEA 3IXLA 3PDCA 4XGQA 4HVLA 5IT9A 2JGLA 4WGFA 4L6AA 2AXQA 1ZNWA 3U17A 4CKEA 4NBLA 1EH5A 1QHSA 5IFLA 3OZ7A 2JNWA 3TNFA 3CFYA 4DJFC 3IDZA 5HQTA 4A16A 5EA2A 3GDOA 2RGAA 4KIFA 5E95A 3DHYA 5IN4A 5KYYA 5BN4A 4CM8B 4TQAA 3GLFB 2PJRA 3QPUA 4NCKA 3CZ4A 3D7KA 5EJ7A 4HF7A 1P4JA 3VNRA 2ZE8A 2IF2A 1OT5A 2PUHA 2PK3A 4GZ5A 1YUBA 4KE6A 4DARA 3KEMA 1XPJA 4TM8A 1QYIA 2ZW9A 3W2GA 2Q07A 5CEJA 1H1LB 1EZ4A 3S5UA 2HHHB 1SUCA 4QJ3A 2C2WA 1P1IA 3AHGA 4KWHA 1NXVA 3O8OB 3KXIA 4E6NA 5C4IA 1PG5A 4K6CA 3D0OA 2XR1A 3GV7B 2GEDA 5D8DA 3R4VA 1NJ5A 1H8HA 4GOMD 3E9DA 5CP8A 2RBEA 4OAOA 3CF4A 3GJ8A 1EM8B 5I8WA 4JJAA 4XB1A 1E9SA 4FFSA 1E8MA 4KIUA 4ZVMA 4B3GA 4B79A 4DV6H 5DGBA 1AO3A 5DLPA 5I7OA 5BVGB 4M4SA 2QE7D 4RBNA 1ZUIA 4C2AA 4AJ1A 1Q14A 3LC1O 3C98A 3L7MA 2P5YA 5TT0A 1C7IA 3KLPX 2RGUA 3GN1A 1Y33E 4A7PA 4YRFA 5G1PA 4QPPA 4M9RA 1CEEA 2DB3A 4L16A 2E4YA 3T3DA 3U7GA 1LFAA 3SQOA 3LQKA 2UV8A 1K6MA 2X3FA 4HXYA 4D57A 3EDYA 5I4BA 3LUCA 4EJFA 5IULC 5KOYA 2HADA 3FKJA 1QX4A 3M2TA 3GBVA 1JQ3A 1GZDA 3G88A 4LQ4A 4M7WA 4IPTA 3CSSA 1V95A 3T52A 2Q1XA 2RGEA 1X7ZB 5BWCA 2ID9A 2WM2A 4INZA 4HQLA 4IJWA 5E4YA 4Q9JA 1QFMA 5ICMA 3HVJA 3N40P 4OU4A 4XYMB 1YQ9A 3ZGXA 3O8QA 1ZM3A 3FPEA 3KQVA 4ZYYA 2UVWA 4KPGA 4FTWA 5E9QA 3L4JA 1E2QA 2ZBEA 4ALNA 1N6NA 3D8TA 3W5SA 2G40A 3W6NA 3R5JA 1RLMA 1F3OA 3WK6A 1Z34A 4UNSA 1PSDA 3VXKA 4L7QA 4R71A 2XWBF 4N41A 4O4JF 4ZYZA 1L3CA 3HR8A 2O7QA 3E84A 1VJ0A 2GK7A 2PD6A 4TLAA 1ZD8A 4RSGA 3ZC3A 4QPCA 1B73A 2GJSA 4D97A 4FYWA 4FHCA 4ZPXA 4KVGA 1T3LA 4S0ZA 4RC9A 4B35A 3ZWVA 3FRJA 3DBHB 4EJSB 4AF8A 2GN0A 4P83A 2WYOA 4BVAA 1QZ3A 2QRUA 3QVOA 3A14A 2QMEA 2ZRIA 3N2EA 5F7XA 3HT5A 3CH5A 5ALTA 2XB9A 3QU7A 4BRWA 3RIXA 4AQ7A 5JISA 3OQNA 5DBGA 1L7OA 3EZXA 4Q9HA 5FTKA 3UICA 3D6TB 5B6IA 2Z83A 4W5JA 2NVYA 4EFNA 4X1IA 3Q11A 4BV3A 2QBYB 1V35A 3ZI7A 3D2AA 2JIQA 3URKA 4YAKB 1ML4A 3HKDB 1US8B 4Y2VA 3DHWC 2PFSA 4WBSA 2OCDA 3W6OA 1FNDA 3PHBE 3WWJA 1QDEA 5IT0A 1J20A 5FPRA 4Z9YA 4C7OA 3FR8A 1T4GA 2QTAA 1RJRA 1ZETA 2IZZA 4E51A 2PWZA 2Z2XA 1T3GA 4KYUA 3R3HA 3A6FA 1P60A 2G1UA 2KSQA 3GUHA 4U00A 2FFJA 1DPFA 4D3YA 3ASZA 3KC2A 5KFAA 3CJQA 3DZHA 2YN2A 3FAZA 4X7RA 1YU6A 2FWJA 3QIVA 4NMWA 4RKWA 5IWCA 2XGMA 3DLTA 1DCMA 2FJPA 4J7AA 1H5NA 3TLJA 5GY7A 3U7IA 5DNDA 4YMVA 1ZJ4A 2OILA 3LP6A 5AI8A 2DFPA 2WTAA 4ZVSA 4EZBA 2NPFA 2EJ3A 5CYGA 3FOZA 4RK4A 5GVSA 3OIUA 4L27A 5IAGA 4DMHA 1NN5A 3OD5A 3SK0A 3K3VA 1C2YA 4JV0A 3V8QA 1XNJA 4LHXA 2N3ZA 3SGIA 4I08A 1YB5A 1EIZA 1ADFA 2XZLA 1DZ3A 1GYPA 1E92A 1V8FA 4BTEA 1KYQA 4DCMA 3IQEA 4KIWA 4C7MA 2XUPA 4FWTA 2PSEA 3SQLA 4RFSB 4J0CA 3N8HA 4DV5H 3CLRC 4ZHQF 1U02A 4K40A 2VPWA 3GLGB 2O0JA 3KQKA 3LVFO 1C3OB 2FFAA 3CNBA 1Y89A 4EUSA 3VZSA 3NEAA 1ZK2A 3C2QA 2P69A 2YVKA 1CDDA 3ASYA 3SQDA 3PUYA 3KVYA 3LYHA 2Y1GA 4GKKH 3FOFC 1BS9A 4WK4B 3IAXA 4IIFA 5FA6A 1XNQH 4JBLA 3NANA 3V33A 3R3ZA 2QYOA 3VV2A 3QEMA 4YAWA 3KKKA 2Z56A 2X5NA 2X0NA 1V39A 1O77A 1PE0A 3HDQA 4EUHA 2XQIA 2HEGA 3P2MA 2R11A 1PGQA 1HDEA 2J7PD 2LVBA 3VR4H 3JQAB 1USUA 4IS2A 1YJQA 5ERGB 4KHPH 2GHQA 5DG9A 1HLDA 3G2IA 3GL9A 4GL2A 1KYWA 3F4BA 3MUNA 1AKQA 2REOA 1CHDA 3B9RA 4B85A 2MMCA 2QZ4A 1EVJA 3MLBA 3RLFA 1K4YA 2VT7A 2YZ2A 4CG3A 3NETA 2ZT8A 4MEAA 2ZYDA 3BXXA 4FGLA 4ECAA 1T2UA 2NPOA 1GKIA 3DE0X 2WNSA 2FP4A 4C3UA 1MR3F 2HTEA 5LZ9A 5DW0A 2P35A 2XNHA 4AY2A 5DLDA 2J6CA 1N2OA 4FT2A 4O7WA 2JBAA 3CF2A 2FV8A 1R9NA 4YV1A 4XLLA 3PDJA 1F2DA 4RVGA 4ZAXA 4Q1CA 2DMRA 5BSMA 5DV9A 4MLDA 2BBOA 1I4LD 2CJXA 2XYQA 3TOXA 4D9HA 3WICA 2ZSFA 3PIIA 3N8DA 2H5IA 2O3SA 2IXAA 5M5BA 5C5DA 1TMKA 1YZTA 3KAQA 821PA 1MIOB 3OF3A 1C4KA 2EHJA 4HDCA 3EYAA 3DCIA 4X66B 4PSDA 3PNPA 2C04A 2H3HA 5LJIA 3R9IA 4CYMA 4UE6A 2RJOA 2JAPA 4NDZA 4Q4CA 2AZTA 4DG8A 1WXIA 4UHEA 4OREX 3VPBA 2AA3A 4C4XA 4Y6RA 1MFPA 4XLTA 4JI6B 1MABA 4A2PA 1II9A 1E1QA 4P4GA 4DWOA 4FGJA 2VUIB 3DEZA 3QFFA 1DB3A 1R0ZA 3AIKA 5HV6A 3GILA 2G4LA 3RFVA 1DKUA 4P54A 3EEBA 3COSA 1SURA 4BFLA 2NTYC 3H5WA 3I5UA 4OTZA 4YIHA 1HQCA 3GCWA 4NNJA 4V1CA 3QNMA 1ORIA 1XKTA 1CFJA 2XYHA 5K3SA 4JR0A 3TXYA 3FD8A 5CPBA 4AUNA 1H6AA 4HDRA 1GGMA 4I1OA 3DONA 3EE6A 4W9MC 2JEIA 5IM5A 3QX9A 3GPBA 2AZXA 3KOUA 2PMBA 4M0MA 1XJQA 3EEIA 4RE6A 4EFDA 2REQB 3FYTA 3IPRA 2UVPA 5JAQA 1VSVA 3JYNA 3SSAA 4TWAA 4TV8F 1AUQA 3UXMA 4D9IA 2FB9A 1KU6A 4OQMA 1RLIA 4RD0A 4IH1A 5DLYA 4BMSA 4YXWA 3SM3A 1PQWA 2Y6UA 3H2YA 3PUJA 4DLAA 4PC1A 3K71B 3HKEA 4KN9S 2X7XA 1D7OA 4LBWA 2GQSA 4IIBA 4FINA 2DJ5A 4GXNA 4TRRA 3IJ5A 5DNUA 4I4IA 2YRFA 3DZ8A 3PQEA 1KFBB 3H19A 3C14C 1Q1ZA 2F6RA 3A4IA 1QM5A 4RMNA 1I7QB 1A95A 5JH7B 3C8ZA 1JP7A 1U9CA 3C97A 3UB3A 4JUAA 4TTTS 4OGLA 2UUOA 2A88A 3O31A 3KKQA 1WRBA 1LTHR 3Q9LA 1NONA 1PL0A 1ECCA 2CJWA 2QR3A 5KT4A 3IEXA 2D0IA 4H15A 2OZEA 4ZEOA 4F71A 2W2KB 4GMHA 1W1WA 1Z9BA 3D4NA 4YC7A 1Q21A 1CY1A 2MT9A 3FVTA 3W2HA 3HYRA 1T1SA 4L74A 3CPEA 3PENA 1YHYA 2YWCA 1DAKA 2ZJZA 5JD5A 1V25A 5AXCA 3C1UA 1YAHA 1XD2A 2L69A 2IYNA 5AVTA 2B61A 2V7WA 1XTPA 2Q4EA 3TMAA 2FZ5A 3SSOA 4J2TA 4K9QA 2VZLA 4CE5A 4CKEB 2FK1A 4YGYA 4P3PA 4WOCA 4AW9A 4NDAA 1E7WA 1FY2A 2PKRA 3NTQA 3ZK8A 4PX2A 621PA 1FJGB 4P2BA 1UXIA 3DOCA 2BE7A 1N6RA 4ZTZB 1VM6A 1ZH8A 4TM5A 4NE2A 4BO4A 2FI1A 4OQZA 4OXNA 4ENWA 4RXTA 4DJAA 3D8RA 1R00A 4WK2B 3LCJA 1QMGA 4HN2A 2JIPA 1G6OA 2FKNA 2GCEA 5BR4A 3TLKA 4IJKA 2QP4A 5BYJA 4BLOA 5FDFA 2IBTA 3ZS9A 1N5KA 2JA8G 2ZTSA 4XQGA 3R3WA 2RGNC 3D6UA 4JR2A 2J09A 4WKBA 5H80A 2X0RA 4PINA 2ZREA 4H3HB 4U6QA 1QV6A 3BAAA 2HJVA 4HDKA 1MVOA 5FOTA 2ZYUX 4PX5A 4D8XA 1LZKA 4KR3A 4WXMA 3ZK9A 4XDHA 2MSWA 1VPDA 4F4HA 1X94A 2UVDA 3QGMA 5B55A 1XLWA 1VL6A 1N34B 1PJ8A 3AKCA 3T3IA 3VHLB 1B8UA 3M4XA 3IV9A 4EY4A 1V5GA 3A1SA 4PPNA 2QTWB 3GQCA 2ORWA 4CLXA 1K66A 1C3XA 3F7MA 3LQRA 2G8LA 4YV0A 3L6DA 2VWGA 2VBFA 3B7GA 5TS3A 3DV2A 1UJ2A 4ZYTA 2AFRA 2IRWA 2O8EB 5IVPA 3N6VA 4H59A 2QLTA 3PRJA 1JR3E 4F06A 1B26A 4NSNA 1VLVA 3MFQA 2B8WA 1ZUHA 1XTSA 3RS5A 1YCGA 2ZPUA 1U8EA 4XDZA 4RA9A 4AF6A 2D00A 5H70A 4R9RA 1RPNA 4DIFA 1ECJA 3ZV5A 5A5EA 2JASA 4BFYA 4FEGA 3EEQA 4G5XA 3UVEA 1ISPA 1GAWA 1KYTA 4KRGA 3OTIA 3QY0A 4KL8S 1G8MA 3R9KA 3ADOA 3O8QB 3OM9A 1CF4A 1Q44A 4LJRA 4JQCA 1Z4QA 4KMRA 5EXDA 2FSPA 3KR9A 3QXXA 2R85A 4C22A 3X1WA 4B6JA 2ZSHA 3VR0A 3D2LA 3CKKA 3ZDXB 5MF6A 1LDYA 4D02A 2YWFA 3GYBA 1KE2A 4DG5A 4H0CA 5JSHA 3NP9A 2JFHA 2H57A 3OZVA 3PI7A 3I61A 1U99A 4G0YA 4M7PA 4PQGA 2X5XA 1P1JA 1MB2A 1HDXA 4FR0A 4U7WA 3A31A 5BWRA 4MMYB 5FFMA 4L6CA 2NN3C 4MRPA 3UWMA 5E7JA 3RSHA 3LHDA 1Z6ZA 3OPMA 4PSAA 1ZNQO 5CDTA 1UOEA 2I4IA 1T2EA 4M0EA 2FMIA 2ZRNA 2XD9A 3KL2A 5JYDA 3WYGA 4OYLA 1PFUA 3EZ6A 2P67A 1R12A 3KHSA 1V4BA 1N57A 2C5GA 3MEQA 1U63A 5TV2A 3A37A 4CR6A 4F86A 3D7SA 2EKQA 1H9CA 1X8JA 1NVAA 3KSRA 3ZR4B 1FU8A 4X1IB 1L4EA 4BV8A 3W8FA 1N7HA 4TM7A 2B1QA 4LXQA 4I0WB 3CQ9A 3N0RA 4KAFA 2OAQ1 3MWJA 5FYDA 2X2OA 1WCMA 4F50A 1IG3A 4PM4A 4BP3A 4G8BA 4PZYA 4BGIA 4RVFA 2Q9CA 3R0ZA 1V4VA 3HU2A 4C7OB 2FJZA 3VHXA 4Q01A 1DQSA 2VRWA 2JLUA 4A03A 5JVDF 1ZVMA 2EFHB 3IQIX 4E5SA 3W8RA 5F2NA 3L1UA 4J0DA 1W4ZA 5HUHA 4ROTA 5CT4A 3ZE7A 4LF7H 2KB0A 3R9RA 5IABA 1W76A 3CCFA 1FJGH 2WTFA 5PGMA 4EY3A 4LJYA 4NYMR 1DOHA 4O7TA 4O7NA 5EZSA 1K1QA 2CN1A 3OT5A 2ONJA 2XX3A 5K05A 5C8XA 3ZVKA 1PSWA 3LY5A 3H5VA 3HLYA 1WZNA 4FU0A 4L4RA 1QO0D 1JT2A 5CM0A 4RJIA 5AM0A 4CGYA 2FW6A 1EFPA 1VYUA 4XYLA 4LSAA 1E3WA 4RX1A 5I9LA 1XQYA 2FRDC 4QRIA 4JSYA 5ARCA 1VMAA 5F5LA 2GF9A 3G13A 3E53A 2PL9A 4CKBB 5DN6D 4LXUA 1S2NA 3B5IA 3BD9A 4DBLC 1OFUA 1SVKA 4QDTA 3WL6A 5BSKA 5AW2A 3CVZA 1TYZA 2ZJ0A 3W5UA 3FF4A 5SV2A 1JHXA 5AW8A 1J2JA 3EJ6A 5LFAA 2R3SA 4UHKA 5DX0A 4JL8A 1DVRA 5EKUA 3SMQA 2UZ1A 3E18A 5AK6A 3KPWA 1PQYA 4Z0PA 1VCHA 2BMJA 3S0JA 1X9HA 2XZOA 1N0VC 2IITA 3ZCXA 3AI7A 2Y2VA 5KTSA 3WIOA 2QL5A 1CJTC 1MXFA 4W7SA 4TRJA 4AO8A 1SZPA 1PZHA 2ZTMA