2FPPB

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
total genus 127
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fppB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fppB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fppB03
1Z2NX 2YV1A 4MV7A 3JRXA 2YYAA 3QFFA 1DIKA 1CS0A 4M9UA 4FFLA 4MV8A 4XX0A 2CQYA 2GLTA 2R7KA 1EUDA 2NU7B 4C5CA 2FP4B 1EUCA 3ETJA 1I7LA 3R5FA 2YW2A 1KC7A 2FPGB 1CQJB 3Q2OA 4YJ2F 4FFOA 4TV9F 1VBGA 5CA1F 2R7NA 4O7ZA 2VPQA 3ORRA 4MV9A 2CNUA 5FNVF 4WD3A 4ME6A 4XYLB 4YJ3F 5IYZF 2QK4A 4XYMA 4O7NA 3TQTA 3ETHA 4O7YA 2YRXA 3MJFA 2C00A 1UC8A 4C5AA 4I55F 5JVLA 3HBLA 2CSUA 4ZI7F 2W6NA 2ZDHA 2WYOA 4O7VA 4MAMA 3MWDB 3K5HA 5C1OA 2CNQA 4I50F 1GGOA 2FPPA 1AUXA 4TUYF 3TIIA 2YS7A 1KUTA 1JLLB 4FE2A 1CQIA 1T36A 2VR1A 2NU6A 4MV3A 3WO1A 2W6MA 1SCUB 5BMVF 3TIGA 4IIJF 4EG0A 2W6QA 1E4EB 3TW6A 2YV2A 4HR7A 2R7LA 2HGSA 4Y8VB 5CB4F 5K2MA 3OUZA 5LA6F 1M0WA 1KJ8A 4DIMA 2CNVA 3NUAA 4YBZB 2PN1A 4NYEA 3LP8A 3WNZA 5D8DA 3VPDA 1JDBB 2DIKA 5HBRA 2V5AA 5LP6F 2XD4A 3GLKA 4HNUA 4O4LF 2J9GA 2ZDGA 2YRWA 4L1KA 4O4IF 4O2BF 3WO0A 3VA7A 3I12A 4WBNF 3VPCA 2NU8B 4IZOA 3N8DA 2FPIB 4YAJB 4YAKA 4FFRA 4O82A 2NU7A 2GPWA 3R23A 4O7TA 3MWEB 3U9TA 3AX6A 3KAJA 5BPFA 2YZLA 1KBLA 2R87A 1PX2A 3V4SA 4TV8F 2FPGA 1CQJA 5CAEB 2SCUB 1OBGA 4C5BA 1KEEA 2NUAB 5HV6A 5LYJF 2W6ZA 4HNVA 1EZ1A 4O83A 5KX5F 4EGQA 1GSAA 5GONF 2GQRA 4HQ6A 3DMYA 4YB8B 3UFXA 3RUPA 3RV3A 3HB9A 2NU9A 1C30A 4XX0B 1EUDB 3JZIA 4ZOLF 3MWDA 2YZGA 1VKZA 1EUCB 1UC9A 4IWXA 4IHJF 2VQDA 3TINA 3VPBA 1JKJA 3KREA 3KALA 3RFCA 4XYMB 1GSHA 3HO8A 5J2TF 2PVPA 1OI7A 5LOVF 1GLVA 1M6VA 2YWVA 4O7WA 4MA0A 1A48A 4MV4A 2OLSA 3SE7A 3U54A 1KJ9A 1M0TA 2FPPB 3JZFA 1WR2A 5J2UF 1CQIB 2GPSA 2DWCA 2Z02A 3Q1KA 5KKNB 2QF7A 2W6OA 2YZMA 3VOTA 4MV6A 3RV4A 2X0SA 2DLNA 1JDEA 3E5NA 4QSHA 2R84A 1AUVA 4XZ3A 3R5HA 4MV1A 2I8CA 1OBDA 4FGRA 2IP4A 2GQSA 3U55A 1EYZA 2YL2A 4O84A 4MA5A 4ZHQF 4ZQIA 2FP4A 4I4TF 1CE8A 3G8CA 1W96A 5HBRB 2HJWA 1BNCA 2CZGA 3DF7A 4FFNA 1B6SA 4XYLA 4YB8A 3GIDA 3ORQA 1IOVA 4FFMA 4O86A 2R6FA 3LWBA 4YAKB 3AW8A 1DV2A 5JH7F 2YZNA 5H80A 5BPHA 4O2AF 1BXRA 2Z04A 4DLKA 4HNTA 1DV1A 1JLLA 3N6RA 5CA0F 4FFPA 1EHIA 1SCUA 3JRWA 3OUUA 2W70A 2W71A 1B6RA 1ULZA 2XCLA 3UFXB 1E4EA 3R5XA 4IWYA 1KJQA 2NU9B 4FU0A 3BG5A 2ZDQA 5JQWA 4Y8VA 2I80A 2V58A 1PK8A 4RZQA 3U9SA 3K3PA 4O7RA 3G8DA 2R82A 4O4JF 2YS6A 4YBZA 2V59A 5JQGF 1I7NA 1KJJA 1JKJB 3KAKA 1Z2OX 5C8YF 2FB9A 2DZDA 1Z2PX 5JVDF 5I47A 2NU6B 2R85A 2W6PA 4O4HF 3V4ZA 1KJIA 5C1PA 1C3OA 4O7LA 4O7SA 4O81A 2P0AA 2I87A 5LXTF 3K5IA 3PFFA 2NU8A 4E4TA 1GSOA 2FPIA 4YAJA 2R7MA 3MWEA 5EZYF 1VBHA 2R86A 5CAEA 2SCUA 2PBZA 2NUAA 1W93A 1A9XA 3VMMA 5DMXA 3R9RA 1IOWA 4EGJA 4XZ3B
chains in the Genus database with same CATH superfamily
4KO1S 2V0NA 1CS0A 4O5OA 3PA8A 5CYOA 2D3TA 1NN3A 1U2TA 1KDYA 1HDXA 3AFHA 5ALKA 5HUQA 5TR9A 1NQXA 2DQYA 4W9MC 4ZWNA 2J32A 5DISB 5B1IA 4LRUA 5DYWA 4JUFA 3F78A 4ETMA 1OILA 1YZNA 4O7YA 2GJ4A 2Q2NA 3I37X 2R3SA 3HM9A 2L82A 2FR8C 2VUUA 3PGVA 5K8LA 5JVLA 1A8PA 3LG2A 1Q6YA 4R71A 4MIOA 3PNOA 4RLFA 2IYQA 3RAFC 1S2OA 3OJLA 2FR1A 1XRJA 5FPPA 3GXOA 1F6DA 4L78A 3KKKA 4KVZA 5CU7A 4MV3A 4TZKA 5LYYA 1P16A 2WV9A 3WLTA 3AUJB 6NULA 4G5OA 5SYMA 3FIJA 5E4FA 2IA6A 1CB7A 3IIIA 2WHPA 5LQUA 2O8DA 2B8JA 3PW5A 2FF7A 1XA0A 4LDNA 5T4BA 5BN3B 3TB6A 1NXVA 2OCLA 1LXCA 4LRQA 3JQ9C 4K46A 1YAHA 4DR4B 3QBVA 2JJ1D 1IBLH 1J49A 1NVDA 3QX8A 1P4JA 5DGCA 5JDCC 2QAGC 4RVOA 4XOIA 2A9QA 3IUBA 4G2NA 2B1IA 2BKEA 5D3ZA 1YE8A 3TSAA 1V1MB 1DPGA 1SOVA 4HYEA 1NW6A 1FDIA 1I24A 1ZESA 1ZCZA 3RVDA 1XCPA 3MJCA 4LXIA 3QA3E 2IQ5A 3EXIB 4FOSA 3AIKA 1NXWA 4FIDA 2ZR0A 3QBTA 3BAAA 4BRZA 1NX9A 2ZS8A 5CH5A 4RKYA 2WHEA 1EXDA 1FU7A 4UCXA 4D9IA 2ZI3A 2VDKB 3ZGVA 5LMUH 2OV8A 3BMCB 3G1UA 4L4UA 2UUOA 3TNDA 4BU0A 2CXQA 2VDVE 5F64A 3DS8A 4EGFA 1QFXA 1AE1A 2JFFA 4QE3A 3SKVA 3L7DA 4TL8A 4MVJE 4PYOA 4YMLA 3OM8A 4QPZA 4BTLA 3MPUA 5I9IA 3D4NA 1V5IA 3A04A 3ZHUA 1N8NA 3WQSB 4JUCA 2GSDA 2L19A 1JHUA 2XF2A 4XGQA 4PQRA 2QOEA 4AL4A 1G5QA 4PRYA 4ENUA 2WFLA 2YJ4A 2C2YA 1O57A 3WOVA 5LU8A 2HGZA 4IEFB 4ARIA 2CNDA 2VQEH 2OBMA 3VPGA 2GPSA 1KDRA 4L4SA 4ESHA 3H75A 4XIYA 5K0GA 2YHAA 4MV6A 3JQ7A 5CCEA 3E5NA 3UAGA 4BXOB 4C06A 3TLZA 2Q0HA 1XN1A 4MV1A 5GTDA 3RNLA 4HEA6 3CUYA 2R62A 3CKKA 1LK7A 1ZP6A 3JATA 2JATA 4X1OA 2X7JA 1CE8A 4ZZ2A 5T6MA 2BMDA 3PDIA 2GDZA 1P6XA 5F9NA 3BIOA 5LZ9A 2CCJA 4LJ5A 1L4LA 1U3WA 3K0KA 3R0QA 3U0BA 1UM8A 4GPAA 3F49S 1ORVA 4BKPA 4RA9A 4D4IA 3A05A 1U7XA 1X7WB 3I52A 4EF5A 5BVHA 2JBAB 4NJEA 2C4MA 1R0ZA 1B6RA 4PO1A 3OFJA 1ULZA 3ZEIA 4DLPA 5FFMA 5A3RA 4Q4CA 4HQNA 2PXAA 3BF7A 3VYWA 4CLDA 1R0BA 4G8BA 5CA1A 1WSWA 2COGA 1IAVA 3ITNA 2FU5C 5C4IA 3VO8A 1TZ2A 3AFIA 4WH0A 3J7AK 1Y6RA 2E4WA 1E3LA 2B82A 4J7AA 1YZKA 4M0MA 2IHKA 2A94A 3ZWYA 2XCPA 3D8HA 4MZDA 5E1DA 2C9OA 5JSYA 1JSLA 3TM4A 1UH5A 4QUAA 2HRRA 2R86A 1F8XA 2A9KA 1RYYA 2LDXA 2PMKA 1AV7A 1UPTA 3EA4A 1E58A 1TIKA 3L4BC 3UGQA 2ONYA 4WKOA 2C2DA 4AJOA 1OGYA 2PD3A 4TKZA 1U8EA 3I92A 9MHTA 4FX2A 2BDUA 1MLDA 3FWKA 3EASA 2H5LA 3H7AA 5C44G 4EG8A 4HX9A 1RYEA 1YB7A 4Y3UA 5F4BA 2CNNA 1W0CA 3ZTWA 4CCYB 4L73A 2BCJQ 1YCHA 4D0NA 4DS3A 1ENYA 2R1VB 5IWAH 3GEGA 3KE8A 1HLPA 1Y1RA 5E95A 4H7JA 1ZN2A 2ROQA 1U9ZA 2HIMA 1KQGA 3ZUPA 1QH1B 3VZDA 2GHRA 4YREA 2HNBA 3FYUC 4MPTA 4C3ZA 2OBXA 1ORIA 1CVIA 2ZLBA 1GNVA 2FHSA 3OG9A 221PA 1P1HA 1PSDA 4UE2A 2BKUA 1MOZA 5G40A 3O73A 1K5GA 3CJRA 3DDCA 3MLAA 2P6NA 4TYWA 3SZMA 3BGWA 4PG7A 4LIPD 4ED2A 1ZGZA 4O3MA 1PQWA 1NU8A 3H8SA 3HDTA 1ML3A 2EZ9A 3PQFA 2MIIA 1ZH4A 2C8LA 1J09A 2IZ7A 3FIUA 2WLSA 2ZIVB 2BR5A 3FMGA 2FFHA 3LCVB 3UK0A 3HADA 4C4PA 3PWSA 3UJ8A 2QY9A 3LKDA 2ZJ8A 4NYJR 4ZZ1A 1X13A 5T64A 1OLXA 2PL5A 1OZAA 1ZUNB 2FX3A 2Q45A 3LA8A 2JFPA 3ZY4A 3PXEA 2LWIA 1PJSA 5E6UA 4LFAB 1INLA 1LDMA 4E30A 3UCEA 1Q3TA 4F9EA 5A9RA 3UTDA 1Z56C 3HB1A 2G3YA 3K6SA 4EFLA 2A59A 1SC9A 2XF8A 3DUWA 3OQMA 3I6MA 2G04A 3EXHB 1V7PC 3IUJA 1QV7A 4A6EA 3OFKA 1BVUA 4V0RA 1IPFA 4MV4A 4LJRA 4GPIB 3TE7A 4Z53A 3KB1A 4RNMA 2BTQA 3U48A 4QTXA 3UAZA 4DR6B 4BYGA 3KFXA 3JQ8B 3LRPA 2QF7A 4X1YB 4S1TA 3L9WA 3LT4A 2ZPAA 4JS0A 4CI9A 3G68A 1GTZA 3DLAA 3ZLJA 3NTRA 3DZDA 1PR2A 4YV1A 3NTUA 3KSDO 4PBSA 4J29A 2VAVA 2C2MA 1S2LA 4PZ9A 1GPNA 1K98A 5CDYA 2XNDD 4X64B 1JIXA 3OMXA 3SJCA 2OD2A 2WJAA 1SXPA 2MSWA 4HDRA 1S2GA 2IS6A 1VJTA 5BQPA 4NI5A 2HBZA 1J0BA 3LUHA 3NEYA 1UPXA 2A7QA 5EE9A 3RVPA 4U9IS 3KSUA 3L6BA 1BE0A 2OECA 1T9ZA 4CTMA 1HEYA 3C6KA 3KQTA 4BTVA 2X40A 5ES4B 1Z17A 3O38A 5L7WA 1LBHA 2GEBA 4BCDA 2WWYA 5ES3A 4MIKA 1ZK3A 1I51A 2OORA 2EKQA 1VJ0A 4KWCA 1MTOA 5EIHA 1DIBA 2VRWA 1M73E 2QJWA 3HDQA 5DP2A 1OAAA 2V58A 5AVZA 4Z9FA 2OQRA 3K3PA 1FYVA 5IKMA 4Y0AA 4HQRA 5D1NA 2V7UA 3LC1O 3LTNC 1TM7E 3QOYA 4PZ8A 1RD4A 3PTZA 5LZ4A 5D5QA 4YQFA 2RHMA 2J0SA 4O81A 5IT9A 1UBUS 2P9EA 2UUCB 4D9MA 3U4DA 1RRVA 2I7VA 4NCIA 4DLNA 2UZ1A 1WMAA 2ZSDA 5CX1A 5A4MS 1PJRA 3KZ1E 2FTKE 3VU0A 4FLEA 4JQSA 3UUFA 1VI2A 1Q16A 2YV1A 2CVPA 2ZSBA 4IJ6A 1YTUA 4D97A 3SYTA 4C0XA 4WKNA 1Z25A 1I7PA 2C99A 4XOUA 4CLXA 1WR8A 2Q3HA 2Q6TA 1XRMA 2F1IA 3AKYA 4PAMA 1GUDA 1CQJB 3LNCA 1W2WB 1UK6A 5A71A 4OL9A 1RAFA 2BEUB 5CDFE 4OU5A 3GLFB 3D7KA 4I46A 1X80B 4YROA 3UJBA 4K8RB 2B0JA 2EJVA 3L77A 4F93B 4RKWA 4FJ1A 3NOXA 1YQDA 1VMIA 2X2FA 2C2GA 5CR5A 1EFKA 3D8SA 1JFLA 3L8GA 3FVWA 3AJEA 3WGGA 4ECVA 1VPDA 3UMBA 3P7MA 2PH3A 1WV0A 1BTOA 2PGAA 3DG9A 3CJTA 4BP8A 3PI7A 4XD7D 3H04A 3WC4A 2R8ZA 3ZXUB 1JA0A 5E38A 4B3RH 3DNFA 1EP2B 4RVHA 3KB8A 2FUG1 5GMOA 2C77A 4JFRA 4YV0A 3CEHA 1Y7IA 1IC6A 1N75A 3G0IA 3KOOA 3LU1A 3THSA 5JPIA 1YACA 1EH5A 3BCSA 2W7OA 3VZBA 2BMJA 3O5AA 3I12A 4N0DA 2UUBH 4XIIA 1FNBA 1M7HA 4IDOA 1Z08A 3BJIC 1UPCA 1B2LA 2C7RA 4AB1A 1BMFD 3WGKA 5DYTA 4MVCA 3UF0A 4ETWA 5E7MA 1MGPA 2QUHA 3OPYB 4WPGA 4MIEA 2ZR9A 5FUQA 3ME5A 1GT6A 2VQEB 2WM3A 4KYIB 1YZFA 4EPYA 3TK1A 2KQUA 1CR2A 1X9GA 2UVDA 3ADCA 1YOBA 1GNLA 1TLLA 4MCIA 1Z62A 2ZRQA 1ZM3A 5JS1A 3NIWA 4O2RA 1OI7A 1KIAA 4WY8A 3V4RA 2X8LA 3U81A 3H2ZA 4FGZA 4PBRA 5LBIA 4ED9A 2BEJA 1YCFA 1V9CA 3WV4A 2I91A 2H2GA 2RAPA 3KQNA 3HA3A 2PX8A 4Y18A 2YWXA 5LDGA 4XR9A 3D2CA 4QZVA 2HDNB 1E79D 3C45A 4IGEA 3WJ1A 3HN7A 2QUAA 3V4VB 4DV6B 4EFEA 3RIGA 2YY5A 3RYHB 1X39A 1KXJA 3E48A 2P65A 1YR9A 5JMTA 1QHYA 2PYIA 3NORA 2P7HA 4PIPA 4DNFA 4JJIA 5FQNA 5KFOA 4YR0A 3N0RA 5FX2A 1UDWA 4P83A 1C1XA 4UHFA 2K4MA 3RT7A 4FFNA 5K01A 2Q5IA 2VT2A 3Q88A 4PF1A 1HZZC 3FTQA 3EEYA 3BSFA 4INZA 3ZU4A 5JTTA 4KO3S 3BE6A 1TM3E 2VXOA 3PO2G 3V8NA 1BXGA 3QVWA 1YGPA 5FL7A 4MQ4A 4MI3A 2FQ1A 1MEOA 1JLLA 2HXYA 3FWHA 2JAOA 3OUUA 4ZXPA 2QI9F 2AL7A 2XCLA 2HADA 3U1BA 4RMHA 2BD0A 4ED6A 2BDTA 2W6JA 3O4VA 4L3VA 3GV8B 4F5WA 2AKEA 2NGRA 1RAAA 2Q4EA 3K4HA 4LHSA 5AKJA 2DUJA 1F2TA 3WRYC 2K5UA 5TMEA 4ERNA 1FQKA 3MOSA 5GONB 3OPQA 3INGA 2FLKA 4K9RA 4M3NA 3RU9A 4MMXB 1FXSA 1C3OA 3AXTA 4MGZR 4Z2AA 3MLBA 3IOYA 1YU6A 2PMZE 1EFPB 3RUFA 5EIBC 3W2IA 2X86A 1XTBA 1VL0A 5C1DA 1CUBA 1T0IA 4E08A 2CJPA 1ONBA 1JFFB 4KIUA 1QR6A 1XQWA 3HG7A 4O4HA 1PS8A 5LC1A 1SIBE 3RB3A 5IRCD 1FA9A 3V6MA 5DLQC 3F9CA 3W4KA 4CQMA 5IWAB 4XUGB 5TVKA 4MAFA 2AD1A 2H5IA 5SYAA 1QDEA 2HPHA 2XB4A 3Q2OA 1YWGO 3L0CA 1VBGA 4B3HA 3VH4A 3ZWPA 3EQ9A 2RHOA 1ZMTA 4WZBB 1F1JA 3BFPA 5SZHB 4ZRNA 3P2JA 2EFEB 3R41A 2R1TA 2A8YA 2EKPA 5U4XA 2C96A 4NU5A 3NAQA 1ZGHA 3QLTA 1O0SA 5HF5A 3K2QA 2I71A 3ONFA 1EBUA 2JBHA 2Y2VA 3L7YA 2DVMA 1E6LA 4L3WA 4NFYA 4JI5H 1GAQA 4JU9A 4NH0A 4Q8EA 3V7FA 2JFQA 2HT1A 3OKAA 5JISA 1B0AA 3AUKA 5IU6A 2W0SA 3DAHA 3X1ZA 2UYYA 2WUFA 3V4FA 4P80A 2WD8A 3ND9A 3N41B 1XVVA 3W04A 1LDYA 3V1UA 3A70A 5LQRA 5ALRA 1TGVA 1OBFO 3R5KA 4D4MA 2CHUA 1GL9B 2Q0QA 2GN8A 3QFCA 2GBCA 1CJUC 3LIIA 3W3AA 5AXDA 3HTXA 5ERGB 3B1JA 1N36H 1FDOA 3IMCA 4FDMA 1M0SA 1VKNA 1SJ9A 4ZFNA 2BKAA 4CTOA 1P72A 1MQ8B 4LDZA 3RVMA 1T4DA 3UBTA 3W34A 4X6YA 2HV9A 3PC2A 4OOFA 4IUBS 2P7IA 2VJBA 4D2IA 4NH4A 4R68A 5CPFA 4RCYA 1VYHA 1U02A 3GTMA 1OY1A 2DCUA 1DOHA 4QHTA 5GV7A 1STOA 2LZ0A 2ZUTA 4B3MH 4BWVA 1EKXA 1S89A 4N7JA 4BBPA 3FUWA 2HI0A 4K26A 3MBKA 1EUZA 5JTUA 1GLGA 5FI0B 2WSSA 3OMWA 4TKUA 4B46A 5KYKA 1B0ZA 1IUOA 4HNGA 2DTEA 5J2UF 4J9MA 3NETA 2OZKA 4HQOA 1X70A 2I9KA 4KPUB 2ETXA 3SQWA 1T24A 4BLWA 3VKGA 3OZFA 5EPUA 3KKOA 3IHTA 1ML4A 1M2VB 5BYJA 4PYIA 2W2MA 1ELOA 4N3NA 3REQA 3GAZA 1EGVB 3VHQA 1SZDA 3ZXXA 3B1YA 4J9SA 1FOEB 2OMKA 4WLNA 4JJKA 4ZQIA 1XMQB 2BI7A 1D07A 2DH6A 5KREA 4CETA 3GLUA 2QG4A 1NURA 2VOEA 1D2GA 2QG9A 5D01A 2IX3A 2ZTVA 3C3JA 5HQ3B 1V5WA 3Q11A 3HKEB 4PSKA 5IT0A 5FBLB 4L4YA 1PQUA 4DMFA 5CVVA 2RHWA 1FLDA 1L5YA 1OTHA 4XEHA 2QZPA 3C0FB 2QMQA 5E6RA 3UH0A 5EWFA 3TJZA 4PRLA 1R8YA 1OI4A 2ZIXA 1SUCA 1QJCA 5BW4A 1II0A 1MRZA 4OH7A 2XGMA 3VNUA 1R5BA 2I80A 4PVDA 2XJ4A 4TQAA 4XAQA 3N8IA 5CLFA 1UQUA 3OZIA 2QB5A 1DAFA 1K6IA 1J8FA 3EMDA 2OZVA 3QBDA 2GCGA 3IQZA 1IDOA 1KI6B 2DX7A 2J5XA 4GVPA 2OBBA 4P3PA 2V7WA 2BGNA 3LV8A 2X0RA 8LDHA 4WGGA 4NQRA 3OOWA 5F9MA 2VYVD 3KTOA 3STXA 4E88A 2ZS9A 1Z16A 5JVDA 3ND6A 4NNPA 2P69A 3L4JA 2QTFA 4L50A 3KDAA 1RQ2A 4LF4B 1Y8ZA 1QTQA 4N7BA 4E33A 2VJPA 3DMFA 2IOFA 5DTEA 2GZ3A 4M9UA 1KZ4A 2GLTA 1PT6A 4W1QA 1TGYA 4PR0A 3KU4A 2QTBA 4LTMA 1ZOLA 4HFNA 3ETJA 1KP2A 2H0QA 3IB6A 4FFOA 4MS4B 2AFIB 4O7ZA 1EFVA 3U49A 3ZNOA 4P6VF 4B3RB 3OUTA 2WYVA 4BX8A 2IYTA 2AJ8A 3KTMA 2W2XA 2AFRA 3UH1A 3DBOB 2H1LA 3B82A 3DC2A 5LZ2A 4KH1A 2C84A 3RHTA 3BL6A 3TSCA 1DP4A 4FZ3A 3H8WA 3OQ1A 5FXMA 4BJHB 3FYCA 5C8VA 5EJAA 4ZEXA 1VG9B 5IYZA 2YQ4A 1JEDA 2ISCA 4L4RA 4OYHA 1Z22A 5TGTA 2XNKA 4OHPA 4ZGBA 4BO7A 3FPSA 5FLYA 2DYKA 5CB8A 3DTTA 2FFBA 1YRQA 1O5OA 1EKFA 2BHLA 3RAXA 2BTOA 5AFSA 5HF6A 3HH8A 4L9WA 4R81A 3TE6A 1MEJA 5L3SA 3H20A 1VBKA 2V6GA 1UDRA 3VA7A 4GP9A 1WEHA 3JQBA 3ZVKA 2OV4A 4F5DA 3LOQA 4XARA 3PDCA 1N25A 2XBUA 4KHPH 5LCXA 1CVRA 2ZRHA 1V95A 1JIUA 1ST2A 1UINA 4X61A 3BWVA 2JK0A 3SMVA 4H7KA 5AI6A 4U0JA 2YW9A 3L8CA 2WBLC 4O83A 3SSMA 3PW0A 1HE1C 3WBKA 2YXPX 3I2FA 3V42A 2IXGA 4BBSG 2Q8NA 3KVVA 2AZMA 3OEED 1LBSA 3PU6A 3BD9A 4GLLA 2XQIA 2XUGA 1HDIA 1R0CA 1ZNYA 4IRMA 5T5QA 3C1OA 3ASZA 2CBXA 3GLHA 1ECBA 3LHKA 1XPUA 4BXXG 1WDWB 2VHJA 4INPA 3IUYA 4O5AA 3EULA 6LDHA 1CY4A 3RGWS 1Y33E 3GIIA 5FPTA 3RVKA 3X1WA 3I9LA 1Y4UA 2DY0A 3U7QB 1RC0A 3IKJA 2Q41A 2XJ9A 1JU4A 3SMQA 3JWGA 1RQPA 2YY6A 4ZKEA 3ELYA 1R18A 2BDEA 3OY2A 5I01A 1JHPA 3PYLA 4RCZA 2ZBPA 3ML1A 2YWEA 1DZIA 1IOZA 1U2EA 5SY6A 2V7QD 2BUBA 2R9VA 2NYAA 1YI8A 5IYCG 3FG9A 2P9YA 2ODEA 4JYPA 3MTAA 3HBNA 1HY3A 4DCOA 2VBFA 1CIVA 1AG9A 2O54A 3ST7A 4U9UA 2PTGA 1YONA 4ZHQA 1N9KA 5JH7F 4RJKA 4DBZA 3RLIA 1RTKA 3UB3A 3CISA 3PFWO 2OD7A 2E1RA 2E3JA 3B8HA 2NUPB 4UVEA 3B9QA 1X1BA 5FP0A 1DJOA 3H6KA 2QDKA 4M2LA 5L8VA 3NUGA 3OJEA 4UEOA 3HKDA 2ZJYA 1NVEA 1Q22A 1CP3A 1WUKS 5K9ZA 4GO1A 1P7PA 1VP9A 1F0KA 3DEKA 2BR4A 3LQFA 4RK6A 5HF8A 4I5DA 1Z5PA 4GKVA 2B8TA 5EJ4A 1SBZA 4QIWE 2ZQ5A 1UM9A 1V4VA 1T43A 4AKIA 3KQKA 5FO0A 1BS1A 5HDQA 1VLZA 3PLNA 4R1PA 2P1RA 4OGKA 2WB1A 1P5HA 2GPBA 3ETGA 1PUXA 5CK4A 1E2GA 3P9QA 3JZDA 3SS8A 1NU6A 3BGDA 3F6SA 3IQGX 1D1QA 1BCSB 5A05A 2AXEA 2MT9A 5AM1A 4RXMA 4D96A 4G6ZA 3WWJA 1V7CA 2FP4B 4JI5B 1Q1AA 2ODAA 2JIOA 4KRXA 3U9LA 3BMQB 1TYEB 4DR4H 2OK8A 2QSZA 3PUKA 8ABPA 5K1ZA 4XYLB 2Z57A 1WHTA 4ZQFA 4ENQA 3O2SB 1GNRA 4F9TA 2DPXA 2FJZA 3AXSA 4GOKA 4EG1A 1WJGA 1UAGA 3LPMA 1B43A 5KFLA 1P75A 4DFDA 1L5ZA 4U7FA 2CY0A 4A3BG 4W9NA 1MAHA 2J9XB 2YX1A 4DC1A 2P77A 3FPEA 3P9PA 3QKTA 2PGNA 1J8VA 4TRNA 1R4AA 4TXJA 5IFKA 4ZIRA 2R7LA 4DN6A 2I66A 1N36B 3DVLA 2P5TB 2QX6A 4MVJG 4ZK6A 3I58A 3ILSA 4BB9A 3SHVA 5FBHA 2BGKA 4TUYA 1LC3A 1FJHA 1SQ6A 1R6XA 4K1XA 2BEWB 4WESA 4PIMA 2UVRA 2VPYA 3TY8A 4CEHA 5DQHA 2J85A 4TX1A 1SXJA 4JJ4A 3AEUB 1RJ9B 4O4LF 3K9HA 3MD0A 4AJPA 1Q7TA 1UK9A 4PGMA 3LD9A 4RORA 3WISA 2ZTHA 2QPTA 5EINA 3EDYA 2WNIA 3UWMA 5KINB 1Z6ZA 1P2SA 4M0PA 3TTWA 3VU9B 3RAQA 3VTFA 3G59A 1JXQA 3ENKA 3O3NB 3BHNA 2VP0A 5IF3A 4MNTA 1WCMG 3DZGA 4OB6A 5FLKA 1CJBA 3ZZMA 5G4KB 3AUXA 4D0SA 1CF9A 5KOJA 4TV8A 2CLMB 4XXHA 2CSXA 5HW0A 3DTFA 1Q1NA 4BATA 2P9CA 1X1SA 2XT0A 2QNBA 3I5XA 4DYVA 4MYUA 5HZGA 2RAUA 4H17A 2GRUA 5DN6D 2W9CA 4QUKA 1CRLA 1RQNA 1N2SA 4FFDA 2JLZA 3VPSA 4RKRA 4H1UA 3CSUA 3E70C 3EYAA 1FBTA 1ISPA 4NY1A 3AEQA 4NPHA 4L5AA 2Q5OA 5A7GA 2XDYA 5AK0A 3H6GA 4BO6A 1CJVC 5BWXA 3L1IA 2QV7A 3MGAA 5HKOA 5LZ7A 4JP8A 5I5UA 2Q3DA 3OEHA 1WW8A 1GPJA 2X1LA 3TY5A 5DCLA 4G09A 5LNK6 4DV4H 4H16A 4TPKA 4EEQA 3TTXA 1NVVQ 3TMYA 2MCFA 4R1OA 5CXXA 4QJ4A 5CM9C 2VNIA 5KT5A 1Q44A 1GZVA 4GR4A 3BVPA 3TN7A 4GE3A 3K0CA 1GR0A 1O9HA 1OAOC 3QJ5A 2ZRNA 3EGOA 5DHUA 3ICPA 2GQ0A 5EUQB 2YVKA 2JK1A 1JG4A 3VHXA 3LK6A 2VA3A 4EVRA 4MDHA 4HQLA 2PKQO 1E9DA 3KSBC 2PX5A 4RJLA 1IK4A 3PEUA 1HTTA 3D7NA 3TW8A 2INGX 3B70A 4F8JA 5JNTA 4C04A 1L4EA 2YHSA 3AF3A 3IJ5A 3S68A 3DTVD 3HY4A 4MIYA 4EKYA 4C0KA 2Z3ZA 1N2CE 3A9VA 2PKYX 1D4AA 1GTG1 3D8UA 4I36A 1T6ZA 3WLLA 5DKFA 1I10A 2C22A 1FFWA 5F1YA 4RK0A 3SDBA 2A0YA 5HMLA 3UK2A 4CM9D 1CIPA 3IAAA 4GC7A 3E61A 2FPIA 2VF8A 1OH8A 3D4LA 3TSYA 1RS0A 3CNBA 3OIDA 3M34A 1V71A 4AN0A 4HUQA 4DG5A 2FP3A 1Z0FA 4YRJA 1Z45A 3EDOA 1TM2A 1JB1A 3GGOA 3V55A 2D2VA 5AH0A 3EZ6A 4EABA 4HGOA 1ND5A 1DQSA 4GYYA 4TROA 4GX0A 5DZSA 5AXAA 1KU0A 4C4ZA 5EKUA 4F3TA 2RIPA 4EY6A 1ACMA 2NU7B 1ISIA 5T6BA 1PGQA 4PLGA 5IVKA 4LYHA 3QPVA 3VU1A 4WOPA 3SYKA 2CDRA 3COSA 4WLVA 1ODFA 4YJ3F 1Y8QB 3HYCA 3LBFA 1L1RA 3BWCA 2OZLA 1DTWA 4JD5A 3ZY2A 3IAEA 2HMTA 1P9OA 4V38A 1HR0B 2FMTA 3T52A 4BL5A 3MCUA 3NBKA 3PNMA 2NVUA 2C2ZA 3DUFA 3REOA 5H70A 4N47A 2MYPA 1JSZA 3DE1X 1TIPA 3BXGA 2VCEA 1ZXBA 3NDRA 2Y0SE 2RMKA 3CH7A 1HYBA 2GK3A 4NF2A 1FSZA 2WHRA 3FJ1A 4FDTA 4TXLA 2CNVA 121PA 3B5EA 1U0JA 1CKNA 2EZTA 1J9GA 4IGKA 2WSBA 3MJDA 2GXQA 1VDMA 3FMPB 4YRDA 3B1XA 2RFLA 1FTGA 4FYWA 5LBTA 1F8GA 3F98A 3KKQA 2C9DA 4L1KA 1CKOA 2OUKA 5J4HA 2HRZA 3P0IA 3R3YA 3LW7A 2BZ1A 1S2NA 2ARKA 5FUMA 2QTTA 2CDAA 4GX5A 3RC1A 3KKPA 2W6ZA 3WLIA 4I7HA 3PHCA 4DR6H 1TKRA 5AP9A 1G3RA 3G5LA 1ENPA 4FKZA 2WJ4A 1SNYA 2NU9A 5TC4A 4S24A 4NZZA 4LRWA 3GAFA 4IY1A 4J4TA 4DV2B 4AVYA 4M0UA 3UAYA 1HZJA 1K7CA 1BX0A 1DRWA 4M76B 3W6NA 3KKEA 4C4OA 1GSHA 1NKSA 2E55A 5LJIA 2X8JB 1YZ3A 4J16A 5EJ9A 2GJAA 1S3GA 4E1AA 1JXMA 1NOJA 4RY0A 1PR6A 1BKSB 3HXTA 1XNGA 5KTKA 2CGEA 2RHRA 4PO3X 1KEVA 3ZKWA 1LI7A 2DFKB 3PGA1 4OMFG 4ZJYA 3GOQA 4LN1A 4MQBA 3RV4A 4Y2SA 2DLNA 2WJJA 2COUA 4EQ6A 4UULA 3L79A 1P17A 4CKWB 3NZEA 4DM7A 1QS0B 2IBSA 3Q8LA 3V7NA 3UT0A 4EYQA 2ZUUA 1KYYA 3MQ4A 1VFNA 2ZUFA 4DV1B 2IHTA 4JBHA 2W4IA 1G6Q1 3DTYA 2BRUA 3DF7A 3KUDA 2EFDB 5BUCA 2J45A 5KDLA 2BBWA 1KC3A 1WDTA 4KOEC 1BS9A 7AT1A 1TA0A 3AP1A 2JIBA 5HOQA 1NXTA 4D82A 1G2OA 2UUCH 1RU3A 5A6SA 4RTPA 4CQLA 4DXHA 2O8EA 2VKTA 1HK7A 2YN0A 4V0KA 3M4XA 3VNQA 1Y9ZA 3L1JA 5FD8A 3ROFA 1C8LA 2JZOA 1E1CB 4ZVKA 1MFZA 4KITB 4EM6A 3WK5A 4FR0A 2Z58A 3F73A 4B5LA 2JI8A 1RJDA 1NF2A 4CUKA 2NQTA 2LR0A 1Z6PA 3L04A 4MI6A 1C80A 3DLBA 3E9RA 1C8VB 1CQXA 1Y48E 2OG1A 2XUPA 1YT5A 2WJ6A 4N4AA 3N76A 2MOKA 2OG2A 1X9IA 4DCNA 5EWMB 3USZA 4A3GG 5KYYB 4ND5A 3X2FA 1A5TA 1Y3DE 3RSCA 3LC0A 3UUGA 1OREA 4HPXB 3K5WA 5EP3A 4QBFA 5AQEA 3VOAA 1MUUA 5CJJA 2Y0DA 3T5GA 2XAUA 3IVAA 4OYLA 3BL8A 1XK7A 4XX0A 2PBFA 3GLVA 3IPXA 1RYBA 3O4FA 1NRWA 3HKCA 3I3SR 2NTJA 4KXWA 4Q4DA 4Z4CA 3AGQA 1DX6A 5JECA 2P0EA 2OLKA 5B2FA 1THTA 5KSZA 1CUSA 4DTCA 4PYJA 2XRYA 3NHLA 1UP6A 1JEAA 3ILYA 4U39A 2Z8YM 4AW9A 3CONA 1BXRB 3AKDA 2CLIB 1ZC3A 1NQAO 4PZUA 1NBWB 3CBGA 1WY5A 4X6UA 4QM7A 2OWEA 4D9JA 3FZYA 1XHLA 2XE7A 5C5DA 4KVGA 3WBFA 4H4CA 4IR7A 4JSYA 1KTAA 1PL8A 2HC9A 2NM0A 3W0LB 3L92A 4RMNA 3TYXA 4NEQA 4QXOA 2Q3MA 1DKUA 1E3DA 1AF4A 4EG4A 3WICA 2JEJA 1N3YA 1B16A 1VE3A 5ALTA 4LDJA 1GG9A 3N2YA 5DDIP 3WYNA 1F38A 1MR3F 1UWLA 2QNIA 3AHEA 1QAMA 2XVYA 4AS3A 4BVGA 5E4YA 4FD2A 3A6PC 2QL5A 1OH5A 2REQB 2YZLA 3DXFA 1YCGA 4R2LA 1APBA 2XODA 4OTZA 3IE0A 3GUYA 4CMEC 3A31A 3BD7A 3GW8A 2GJSA 4LZWA 3BQ0A 3OZTA 2Z56A 4F4IA 2NVWA 4LZLA 3RUPA 2XWBF 4W5WA 1C30A 1QQTA 4G25A 1VIVA 2BQUA 1THMA 1R88A 2FEXA 1W94A 2YZGA 3U7JA 1ECCA 4DV6H 3ROZA 1L8QA 3NPAA 2QUBA 1MVOA 3GJSA 1G5FA 1H23A 3KLBA 3AUAA 2CXXA 4WNYA 3K2EA 4DLSA 4I3GA 3DDWA 1N2ZA 1A97A 5THXA 1Y7HA 3OD5A 1UBGA 4RF4A 2AOUA 4R1LA 3Q12A 3COJA 2IEIA 1E2EA 1AX9A 1JG6A 4DV4B 5B7GA 4QT4A 1A1VA 3H1TA 3SE7A 2BMVA 1ZFNA 2N1BA 2V4RA 1E92A 1JH9A 1WCV1 4UFPA 1J8QA 2ILTA 5CFZA 3K6RA 4JASB 3ZU6A 5HNKA 3GNSA 1U2SA 4BZZA 3QW4B 1KR2A 4XSHA 2GPAA 1E2FA 4UBMA 4PC6A 5IP9G 1DO8A 4GL2A 3ZLVA 3RHSA 3RYCB 3NGDA 1V1JA 3TEJA 1H6AA 3GGSA 3I61A 4MPJA 3LHIA 4OGGA 1KOLA 2FUEA 3HYLA 1GQYA 4HS9A 3O7WA 4EVIA 1IL0A 5DGBA 2QBYB 2VDRB 3O94A 3QPUA 2XCQA 4RJTA 1UBEA 3SF8B 3D6MA 2E87A 3ZE1B 3LQRA 3WY9A 1NR5A 5G4LA 4Y1FA 1HDGO 3CR8A 3KBOA 1COWA 4QC2A 3RARA 2C94A 5PNTA 3QZUA 4JYCA 3S2YA 4BNNA 1IHXA 5FI3A 4IFTA 3R3ZA 5BOSB 4A3CG 1KQNA 4QTZA 4B2LA 3O8LA 4O7RA 5HDBB 1QUEA 3WXBA 3H18A 2V59A 1U31A 2HF7A 4UTZA 4ARVA 4V1CI 1JKJB 2CV2A 3HJCA 5C8YF 5CA0A 4QOGA 2G70A 3QE3A 4QXMA 1PIWA 3WIBA 1XQXA 3WMXA 5EERA 5KNCA 5D7NA 2YDXA 3TFOA 3P8ZA 4IHJB 4GDFA 4GBED 3WGJA 3DE2X 3RYIB 1C8KA 1T2NA 2PSJA 4JR0A 5C7LO 3QEBZ 4LBZA 3W9UA 3GQBB 4EBEA 1VI6A 3VNRA 4LJAA 1X7ZA 2VI5A 3LYUA 3A28A 5LA6B 4G41A 1I6MA 1QQ6A 3ROPA 3D1VA 4Q3AA 4R84A 4FDUA 3MWJA 4MKXA 4HRXA 4JKYA 5E4JA 2YN4A 2ODBA 3UNXA 4TMVA 4YDSA 3STTA 1GZ3A 4KXMA 5AXBA 3T1TA 3L84A 3ANTA 1RM4A 2OXTA 4WOCA 4MQLA 1BIFA 4ZTBA 3CWCA 3LX8A 3MWDB 3P2OA 2BFCA 2R5FA 3EN0A 4LNAA 1GPAA 1PN3A 1E3SA 5TT0A 5KPDA 3VU3A 1GZ7A 3ZD7A 4PCLA 3BN3A 2W6MA 3G2JA 1VCMA 4BQQA 3LPNA 1MIOB 2AK2A 3WK4A 4AKHA 2RKWA 1EXWA 2Y4RA 4ZOQI 4PZ6A 4ZVPA 3IOBA 2XDAA 4JODA 4EKNB 4RANA 3R6WA 5AICA 2Q3CA 1XZPA 4O2AB 4DMUB 2H4JA 3LUPA 4Q4JA 1P0CA 1EJ2A 3FPLA 3QUBA 1FL9A 2OAGA 1X8LA 3EXEB 1WO8A 4FZJA 1JE0A 3O31A 5BUQA 2WF7A 5E4TA 3HGTA 5I5TA 3ICOA 2XCUA 4EY5A 4BQOA 4MB2A 3TDKA 1SOWA 4JL6A 1U9IA 4PQGA 3EK2A 5K2OA 3A25A 1BA3A 5DSTA 1G5PA 3RF2A 4JLSA 4RD0A 1EZZA 2WD7B 2FHPA 2JEIA 2AMVA 3BQNB 1N9ZA 4JJEA 1ZMXA 2Q21A 1T1IA 2QEQA 4PYMA 2C5EA 2J46A 1LPNA 4R54A 1LEHA 4P08A 3NC1C 3HZHA 2D0DA 4ZEMA 4OMCA 4IJWA 2BOVA 1LGYA 2VTKA 1N6OA 1XMQH 2FPMA 1JA9A 3BPSA 3HO8A 3E4DA 3UUWA 2HA6A 4M8NE 3KYHC 1LBIA 1PZGA 4GOXA 1A82A 3T41A 1T8SA 3T95A 2WTEA 1SHKA 1YBFA 1CJMA 2HDWA 3FKSA 2A92A 4YMHA 4UATA 4JWTA 2EW8A 1KMCA 2YV3A 1ISFA 3MFQA 3VXKA 3MOIA 1QO9A 3HCRA 4UHHA 2VTBA 2GBGA 3NBAA 2X0SA 2F4VB 5EG5A 4QECA 2WF6A 1U6KA 4E5MA 3DJFA 5JEDA 1Z47A 4LV6A 4QYMA 4MWGA 3UYLA 1EWYA 3JZAA 3AVUA 4KV7A 4QJIA 2Q2WA 1NMXA 4OA8A 1DXHA 5F1KA 3OQ6A 3GILA 1YR8A 1JZSA 2Z9CA 4RB1A 3UB2A 2EF1A 4M0JA 2I6UA 2HL6A 4HVTA 1O0CA 3OSUA 1DZ3A 4MKRA 2IEZA 4Q4HB 3UZUA 4Q1DA 2H1FA 4F4YA 4AMVA 1DKMA 5LFAA 2C2WA 5HJ7A 2PUCA 3DD5A 4EHJA 1TVMA 4JT9A 4TM5A 3WR5A 2XEDA 4DCTA 4IINA 3GAAA 4LF4H 1YS9A 3TAHA 2QYSA 1UUFA 4QL3A 4HBGA 1RWKA 1Q1QA 1FZQA 2FMHA 2PGIA 1XTRA 4DCMA 3RKSA 4F04A 4ER5A 3KOYA 3P9YA 2WDZA 1ZM2A 2R8OA 1XZFA 2HA3A 1ZS9A 2WMDA 2ZBFA 1UT6A 4GP6A 3RBVA 4CMHA 1Q21A 1NLMA 2C7QA 5DHTA 1T9GS 5TPZA 1IJKA 2JB9A 4PG4A 3NOVA 4IG4A 5JROA 4K9KA 3QVJA 4ZCLA 1MQ9A 1POWA 1S3SA 3V00A 2PRYA 3R77A 1II8A 1DC6A 1P8LA 1AO0A 1SPBS 4LKOA 4IOKA 3QVGB 4MW6A 2C4NA 4X90A 2FWRA 4J1NA 1T5IA 4OSPA 1ESDA 4EKDA 1O7JA 1QB8A 4M60A 3NHZA 2OM6A 5LXTA 3BXHA 5L9XA 4XGNA 1NW3A 3ENVA 4XEUA 4G0MA 4CEIB 3QFFA 3RR5A 2WY2D 3O3CA 5EJGA 3WYFA 2PX6A 1KF0A 1N33B 1TTTA 1DAIA 3FPKA 4CV2A 1P2VA 2HA7A 1F1BA 2V5VA 3GJ6A 2ZWAA 4NZMA 1E6UA 2D0OB 3CA8A 4DJ5X 2H0RA 3VI3B 3O8NA 1GYPA 2IYFA 3LF2A 4AUEA 2X58A 1XAGA 4XTRA 3O93A 2J67A 3DDNA 4PZ0A 3TZKA 4H0FA 3BJEA 2GK4A 2FOLA 1L5HB 1T2EA 2O8CA 4TZ6A 1SG0A 5D84A 1W36C 1G7RA 1SWVA 4QARA 2YYYA 3O75A 3CUTA 4BVJA 2D5LA 3TZBA 2QL7A 3KXKA 3WMFA 2E4ZA 3A9UA 3WLQA 3R74A 3S2FA 5IXSA 3B3QA 2HT6A 2R4TA 4YBRA 1WPQA 4RPLA 2W6JD 4QOFA 1GEGA 1JILA 4HH4A 4D3ZA 3WSVA 1CC1S 2VL7A 3MINA 3VC7A 4YJHA 3ECAA 2EJ0A 2HNAA 5DBOA 5LSAA 4PINA 4UOEA 1UFOA 1Z4IA 2A35A 4CEJA 1X1QA 3FCXA 4YAKA 2OWDA 2GYYA 2PUGA 1Q0RA 2G82A 3MWEB 3NUQA 1S7GA 5L3VA 1GAEO 1SC3A 4ZYLA 1UWCA 1J5EB 1W4BA 2DULA 2X23A 1UZNA 3V32A 2RF4A 4F2DA 4S1OA 1JDZA 4ZOLF 4ZGGA 1IH8A 4RYDA 3UJHA 4EPWA 2VP4A 3T54A 4PZLA 1KQOA 2W2NA 1US8B 2V5UA 1E2PA 5JFTA 3QXJA 1J0DA 2FLVA 4JYMA 2WWRA 2OUIA 1PR3A 4D9GA 4LCJA 4CQMD 1LSSA 1AB5A 4JBIA 5EWLA 5SY9A 4ZO4A 4X3CA 1L7VC 5BN1A 1U3DA 1GN9A 1Y98A 4KQ1A 3V48A 1VM6A 2RGCA 3OQVA 5MDHA 4Z8XA 3NU1A 3GT4A 3PL1A 1CQIB 3TFQA 1FVOA 1NN5A 2AVDA 1GPKA 3UJAA 4C01A 5GM1A 1AKVA 3E5HA 3UK1A 4YPFA 5KQMA 3DCNA 1PU2A 2FMFA 5BR8B 2Q1WA 1GAJA 2YQ5A 3M2PA 3W7AA 3QVLA 1X1CA 4JL5A 2GD1O 4BWSC 1K7XB 2RB5A 1FRVA 5EYPA 3R5TA 4DBVO 3W2FA 4MA5A 2GX6A 3KQVA 2GB4A 4KQWA 2NT4A 1JJBA 1H8EA 1U8TA 1OPRA 1ZOPA 1B6SA 3GQCA 1P2FA 3KAQA 3NALA 3PQCA 3HKBA 1T0UA 3W5UA 4L8FA 1DKLA 3OP1A 2WDTA 4D43A 3ZIAD 4BV8A 1XGKA 1C7EA 1E2DA 5H80A 4EECA 4YUZA 5I4KA 5DI3B 1Y4DE 4FHEA 5CW1A 5I48A 5L3QA 3PGKA 4DL3A 3HWRA 3VNNA 2QLTA 3CT6A 4M99A 2X7HA 2ACVA 3HBMA 2ZUDA 4OREX 3W3AD 1LWNA 4TQSA 2JFGA 3WGIA 3FYSA 3BQ2A 1CD5A 2P5UA 2FDRA 1TMOA 1WMFA 4AJEA 1W49A 1E8MA 2MINA 1RYFA 2FRXA 5AJXA 2DF8A 3UTCA 1NW7A 1PE0A 5KX5B 4TLCA 3MJVA 5DLPA 4UXIA 3EVFA 2FUG6 4LNUA 4QO8A 4TS3A 4QVGA 1G20A 2IYUA 1V6CA 4YDRA 5IH7A 4GLWA 1QGUB 2IPOA 4J7XA 7ADHA 4HTFB 2CMKA 1Z0IA 1GAWA 2DKFA 3TOVA 2QRGA 1UBNA 1HNWB 1WB4A 1O6GA 3E18A 4TKLA 1XEWX 2AXNA 1WCIA 3F67A 2QTWB 4OQPA 1UPUA 4D57A 4QBGB 1LS6A 5E7QA 1Y4SA 1C9JA 3TLBA 4J90A 2A9OA 4Q15A 3ZI0A 4FW8A 4LBVA 2E82A 3P97A 1JNYA 3M33A 2XCRB 3FNFA 2RE8A 4RNOA 2VP9A 4HLCA 3PC8C 2DJIA 2VJCA 3V1NA 2R11A 2QPOA 4ODIA 3BXXA 1DU4A 3OCWA 3DMDA 3FUUA 3PNQA 2JGDB 3SZLA 1OJLA 4IMJB 2ZDHA 2JCGA 3SGIA 3BRWA 4IOLA 3EXFA 4ZI2A 3WTBA 5A6VA 1NATA 2FPPA 2ZIUB 3WX0A 4L7VA 1YQ9A 4D8YA 1FFAA 2ATIA 1ZOOA 4EATA 1S1MA 3BE4A 1WQ4A 1OCEA 4NBRA 3PDUA 4HZIA 2DT8A 1D6MA 1OX6A 2W22A 5BSUA 4KQ6A 1Y3HA 1MG0A 1JNXX 4IHQA 4B44A 1JPNA 2VDWB 5BRJA 1ZBDA 3FKQA 3LULA 1GCOA 1QOPB 1ZK2A 1RWXA 1GZSA 3O7MA 5KYUB 3KLNA 1GIAA 2QL6A 2KSWA 4RV4A 2SKEA 4FFRA 5CHEA 3H1EA 1LK5A 3TNLA 3OF3A 3WNQA 4ED0A 2Y0BA 5JSKA 1AQJA 2LGJA 2P67A 3ZZUA 4BRWA 1M8GA 2Z43A 4KUGA 4EJ2A 1PJZA 5DM4A 3QOFA 2XZDA 5DG7A 2HGXA 2FSHA 4H3SA 4RQBA 5D6OA 4DSNA 1N1GA 1HE8B 3C8ZA 2J30A 2OC4A 3P9NA 3VPBA 6YASA 1U2RA 1SURA 2JG3A 3G2LA 1A5SB 3BHJA 2VF2A 1H69A 2M32A 2VK2A 4WCDA 3ZZ1A 4A03A 5JAHA 1P5RA 5AR1A 4PWZA 1TU3A 3D5EA 1VLQA 1GY8A 1Q7BA 5TRTA 5AW4A 3OQOA 3O6VA 4G5FA 1TZCA 1VSUA 3F74A 4H1WA 3DAYA 1JTFA 1J20A 5AKGA 4UPEA 2HJHA 3IBSA 2OZEA 3GVPA 4UBNA 1NZDA 1A5ZA 4TLBA 3ZTTA 1Z2DA 2XWPA 2XRFA 1W96A 5HBRB 1RWQA 5HKKA 1NLUA 4BO3A 4UKDA 2F90A 3SJUA 4GE0A 5HEKA 4N8DA 3FRIA 4PAQA 2YICA 1MC5A 2PZJA 2J9FB 4YRLA 4G3IA 3WB9A 4KDRA 2JGRA 4G0PA 1U2GC 3O3OB 1P31A 4QW8A 3KWLA 5BWLA 5I4BA 3DE6X 1VPWA 1IXRC 1FJGH 3CUKA 5K0FA 4OHXA 4FNMA 4FBUA 4EYKA 1E7QA 3OOSA 3O8BA 3B6KA 4OIMA 2CJXA 1FRNA 5CDGA 3WLAA 3TQIA 3IP9A 4ANFA 2PH7A 4RZQA 1TZKA 3AGPA 2NZUG 3CG4A 4OK6A 4DT1B 1FP4B 3LLUA 3CN9A 4P5EA 3F7OA 3HVIA 2R85A 2YZKA 1DUSA 2ZYIA 3WYDA 2AE1A 1D4OA 4FMPA 3BIXA 3TPCA 4DL9A 2ZUWA 1W73A 1HR0H 3K1ZA 4E4RA 3EVDA 3WB2A 1DHRA 2JGLA 3S99A 2ISQA 2WVHA 4IJKA 4ZEOA 4CN8A 3UWKA 3QELB 1N6HA 4LOAA 5KYTA 3F9IA 3EW9A 1Z13A 4JQZA 2QSUA 2O06A 2RGNC 3GCGA 1QOZA 2IL1A 2XMZA 2LXNA 2Y67A 3UXEA 1GRCA 1CRWG 3IXLA 5B1HA 2FE4A 4BLVA 4JQYA 4G3XA 4MUBA 1H2ZA 1QX3A 2FMIA 3PC7A 2HWWA 2WP8J 1WBBA 4CLOB 4PFSA 3IT1A 2QVXX 5AW2A 4X6XA 5LQNA 1S0OA 4YR3A 1EHYA 4YDHB 3QVKA 4M9QA 4NMWA 3EVCA 4N0PA 1KY2A 2VDOB 2F1JA 1U1GA 5A04A 3KOWA 4I1SA 4FINA 2K87A 2NXNA 4F60A 4EFKA 3Q7EA 1L1EA 3OY7A 4J75A 3FPFA 3RTBA 3N8HA 4NHOA 4O02B 2CLSA 2A57A 4AG6A 2ZXEA 4I9NA 1Y1VG 4DV2H 3K72B 2FSUA 1WXDA 4G4IA 1P0QA 2IXEA 1CUGA 3QUQA 2ZR8A 2I22A 2A67A 3JYPA 2GETA 1V4BA 3QLVA 1F4VA 4IZIA 4BEWA 4DMCA 4YAIA 3TG2A 1TYAE 4AWBA 1Z68A 2HA5A 5HM8A 2QV0A 3F5DA 5LQKA 4YECA 3LZ6A 5JXIA 3TEFA 3NCHA 3MR5A 4LWQA 1I4EB 1G3IA 4B4DA 4I8DA 1RIIA 5D2CA 1VXRA 1UJ2A 3MFYA 3KJFA 2VHQA 1PBTA 3UHPA 5FR2A 3OPXA 3RS8A 4MDEA 1ZMRA 3OFND 3D6UA 1EUCB 2VJQA 4OI1A 2X0DA 1ISJA 1VOTA 2UZ4A 3SVLA 2HGWA 4DV1H 5JCOA 4EO7A 4IF6A 3K0AB 3T9EA 5CBPB 3AESB 3DGEC 4J1SA 2C4KA 3HFGA 4F92B 4V3CA 2HA0A 4NONA 1RXSA 2R00C 4JH0A 3VNBA 3OEYA 3SYNA 4ZAFA 4FWTA 3GIPA 4OX9Y 1NOIA 1XZQA 2OSVA 1CQZA 2ALZA 2HA4A 1IN5A 4LTDA 2WZBA 4I55B 4Z0PA 1X19A 1K4KA 1MF7A 3A6LA 3SICE 3LZDA 4KO8A 4RD3A 3NVAA 3EZLA 2X5XA 5K7SA 3P2EA 2FLPA 2QJFA 5KTNA 2EKLA 5L4NA 3ITEA 3M5PA 2GWHA 1U8YA 5KNBD 1UBHS 1Y3CE 2XUZA 4G89A 3JAKA 5CB4B 2ZFUA 4GECA 3HJGA 1H5UA 3ET4A 1EK0A 5KG5A 3L0OA 4E1BA 3SQMA 4PS1A 2IP2A 4POOA 4C20A 1SXJD 4JX9A 2O0HA 5LP6B 4GW3A 4JB3A 2NYRA 2BGRA 2DWUA 3I2JA 2ZAGA 1UPFA 4IJUA 1HMPA 1PCXA 2GEVA 5LL6P 3K09C 4F4WA 3E8MA 4DG8A 1P61B 4DJTA 4YY3B 1EHIA 1E2IA 3FF1A 2DRIA 1J23A 2PX4A 2VHYA 2YMPA 4A2CA 4X54A 3GL9A 2HJGA 1KZ7B 4RZHA 5HZMA 4C2MA 1Y0BA 2I1LA 2B0CA 4ER3A 5KYWB 1LTHR 2FMXA 5C4XG 1AQ6A 2WJYA 5IAGA 1T3TA 3F3KA 4QYSA 2W6PA 1U3CA 3THYB 3T3HA 2Y1DA 1SU6A 1GTJ1 2G9UA 3IVGA 1NTOA 3QYPA 1YMVA 2W2LA 4OXXA 1G7CA 2R93A 3CLSD 3M89A 3Q7QA 3PZPA 5BSTA 4RA6A 3M1IA 1XMOB 1NYLA 2VUSA 4KR3A 1UXIA 1QORA 4HH3C 3DLHA 3HVUA 4IQGA 3R7LA 2OBFA 4IWNA 5LVAA 3IEKA 4ZVUA 5JAZA 1SKMA 5DBHX 3FCUB 1ESCA 4CIWA 5KTRA 3GFQA 2JFBA 3WGMA 3HNPA 3EXHC 1E2BA 1BWSA 1U8ZA 3WGNA 3TZHA 3VPFA 4B09A 3HCWA 1FNNA 5AJTA 5JRDS 2H7YA 1F0NA 4JKOA 2G36A 2YRXA 3HSSA 2AQ8A 2XI4A 1QQBA 4OHMA 1T26A 3KTDA 3K7EA 3EWNA 4TLEA 4EMUA 3IUSA 1H4TA 5D51S 3ROMA 1PJBA 1WQ3A 3NEAA 5LUAA 1G2QA 2XOXA 5CCDA 2CJWB 1CJSA 3EIWA 2WV7A 4CKCB 5A3QA 4HR7A 3GJ0A 4UVDA 3LHFA 4F4CA 1EGQA 4X7PA 4JI7B 4DIMA 3KVOA 4PHHA 1D2RA 3IRVA 4OM7A 4EA9A 2O4CA 3CQ9A 3A26A 2BI4A 3ESAA 3DOFA 1L7XA 3OZSA 2W11A 4TT3A 4AY3A 1FF9A 2DU8A 4HRYA 3OCZA 2VNKA 1WVIA 5EUCA 4XASA 4YMTA 1CYDA 3HHEA 2R6JA 5CLJA 3RAGA 2NSDA 1PNTA 3ANYB 3KEQA 3Q2IA 1B33N 1A4UA 2C0QA 3YASA 1MPXA 4G1EB 4XFJA 1QHFA 4X3PA 5KJ1A 5CM2Z 1MXHA 1EZ1A 3P19A 2CF6A 4LCEA 4OQEA 4TXHA 4F45A 2F3QA 2I33A 2XKBA 1PWZA 1RPTA 1V7QA 3OWHA 2F64A 1CCWA 3C43A 1RK5A 4D02A 3RVLA 3S81A 1RRPA 5EMHA 4U02A 5MN5A 2OCYC 5LL6b 1KDTA 2ZVQX 1IN7A 5ICMA 5KFZA 1B1AA 3NATA 2YJTD 4RX1A 1JBQA 3ZHRA 3BB1A 3HR4A 4U2GA 4KXFB 4FEAA 2BQ3A 3EIFA 2DKNA 2BMFA 2IEAA 2EBFX 5KWIA 2EJBA 4QWAA 4W5TA 3TR6A 4QQKA 3E82A 4C7OB 3VOTA 4ZU3A 1KJWA 2P9GA 2C4TA 3D54D 3QVSA 3EMVA 2OO5A 5K09A 1XFAA 5K0SA 1H93A 3L1KA 5KYVA 2IKQA 4P86A 4G0NA 3PEWA 1FJGB 5DNYB 3A1SA 2PS9A 1W0JD 3KKLA 1CY0A 1V8FA 1JQAA 5B30A 1SCDA 4YRZA 4R1QA 3AM4A 5I7VA 4IYRA 4B6FA 3FZEA 4F3KA 4DZZA 4DPMA 1W34A 5ALWA 1UXKA 4MWTA 1NHGA 3SDSA 3AEZA 5ALEA 3C5EA 3QKSB 3EEQA 2CL7X 3K32A 1T10A 4BHTA 4WXHA 1SCBA 5TPWA 5L51A 4Z99A 3I34X 1FX0B 2FJ0A 2Z0MA 4NBWA 2ASLA 1ANKA 3E2PA 4DLWA 4EI7A 3EEBA 2ZB2A 1WE2A 3K31A 2IPLA 3KHTA 3D6JA 1NJ1A 1TKBA 2I76A 5C51B 3EFEA 2ZDQA 4ZKDA 2MJLA 1N1DA 2VDMB 2PKXA 3AHFA 2OLEA 4GMHA 4K9QA 2FSVA 2HU8A 3KAKA 3K35A 2ZYHA 1VGVA 4XVUA 2O3RA 3TPZA 4BJ6A 5BSEA 2OGTA 1NFQA 2BW0A 4Q21A 4FHDA 3U13A 3B3GA 3GRVA 5DIFA 4RULA 2KM1A 1JEYA 4UTNA 2H8GA 2WMNB 4ZCMA 3VBCA 5JR3A 5JPDA 3INNA 4MA4A 1VBHA 4HGQA 1IN1A 2PTHA 3A7DA 2HMVA 4BP1A 4C4XA 2R6ZA 1KBZA 1LZKA 5CHYA 4BQSA 4OLAA 3SIRA 4V0MA 3RU2A 1Y81A 1IOWA 4CFZA 3BRSA 1XLTA 1TK9A 2J4DA 4P4NA 1SCAA 2FN3A 1MJGA 3E9ZA 1GDHA 2FCAA 4FB4A 5HQTA 1YJQA 1FRFS 2VJAA 1DQYA 4RZ2A 1KC7A 5CDHA 2NACA 4CMJA 1EHCA 1V11B 3GRCA 1NJ8A 2XAAA 3WNBA 2V97A 4B79A 4C89A 4J2HA 4DDWA 1UJNA 1JLMA 1JYSA 1GA6A 4DUPA 2HB6A 1RYZA 3MZ0A 2NVYA 3T5BA 3MB8A 4N6OA 3AFOA 1JHYA 2EQBA 3D7SA 4WNIA 4NFHA 1J4AA 3HKZA 2YS7A 4XJVA 1E66A 1EFUA 2GVDC 3EFBA 3KQPA 3H5TA 3LDAA 4Y1RB 3ADKA 4WDQA 2I4RA 2JI6A 3QKRB 3PW7A 1J07A 4M83A 3VYUB 4K6NA 1R5NA 2QLLA 4UE6A 1P0FA 2KI5A 4NYEA 1KYXA 4RW0A 2C2RA 4P3KA 4BN0A 4LHYA 3WYAA 4Q24A 2X76A 4HNAB 4ZCTA 2A5LA 2A9RA 4AMYA 5KVAA 3ZE9A 1DIAA 3FVVA 1YHYA 4FYXA 3ASUA 5KFSA 2ZBRA 3LI2A 5KWSA 1T6YA 1EWTA 2QRUA 3WWIA 4FHCA 5BPFA 1KMQA 4DR7H 2UUAB 4E5VA 1PVDA 3UA4A 2RD2A 5K20A 3ZV5A 4MWBA 4DIBA 4RVFA 1QFMA 2ZBGA 1UMCB 4TQGA 2JA5A 3U19A 1NKVA 3O9ZA 5T4EA 1DDOA 1NQ5A 5J23A 3VM6A 2F4VH 3EHEA 1A0GA 5JLJA 4Q37A 1EM8A 3H0GA 4OQQA 2WIBA 4MR9B 2BGWA 3KT0A 1M7JA 3GZ4A 3QTTA 4GM4A 3H7IA 3H16A 4QRIA 2FPXA 2OCKA 3M9OB 2QMYA 3KEOA 4J0MA 2JFHA 3L07A 4A3MG 4IEIA 2DPHA 1JDPA 3IILA 4ZOBA 4ETIA 5EXXA 5REQB 2YWVA 5F4ZA 3GP8A 1T8RA 1IG3A 2RGVA 5J43A 4JI1B 4RPCA 2XMRA 2FW1A 2WJIA 1ZGJA 1DRVA 2VQ3A 1HDEA 2WAQE 3IP6A 1UOOA 2Q62A 2BM8A 2EW1A 3ZW7A 4CG3A 2I6TA 1QYDA 4FYKA 3V80A 4DRFA 3PF9A 5JBQA 4HWTA 1I1KA 5KFDA 3WXMA 3K0HA 4NMLA 3PHLA 4KBYA 3T3DA 2D2FA 2B9EA 3U4MA 1HDOA 4BPRA 4HLUA 1QGOA 4KR6A 4JKIA 3DAAA 1BW9B 1GGKA 1QLWA 5CFRA 2C07A 4GMKA 2VHXA 3BF8A 3MTDA 2WB4A 3CE9A 3W5OA 1XTIA 1OD6A 4CXMA 1QNLA 4KKVA 1WMEA 3STUA 1GUAA 3NEJA 4G2TA 1S01A 4EL5A 2JH9A 3DB1A 5BPHA 1LX7A 1PQ4A 5J1SB 1TRKA 1MA0A 1OFUX 3LLVA 2KE5A 3TGLA 4MJ7A 1O1YA 2VTDA 1VHWA 3ZG6A 2Z95A 1WSDA 4CF4A 1CR0A 1F14A 3UW3A 1Q1BA 3FOBA 2W2OA 1XB2A 8OHMA 2R5WA 2QLFA 3AEYA 5DM60 2QMOA 3JAWB 4RAZA 1N33H 1ZGCA 5BVGB 2A30A 4FI3C 4K9MA 1U7DA 3WAKA 3H9UA 4P54A 2IA5A 2RGAA 4M1MA 4YUYA 5JMWA 4AICA 4UCFA 2YJ3A 3O8OA 1HO3A 3QPWA 2FY8A 2MSCB 4F71A 4L16A 4RM3A 1D09A 2G76A 1UJMA 3TSWA 1XJ0A 3AY0A 4QXPA 1J5XA 1GTVA 4NYJQ 3WKAA 3A6HA 4ICIA 3AVWA 5KU1A 5AOBA 4AZ0A 2HCJB 2XCIA 3C8MA 1Z2NX 3ZCXA 3LT5A 3O2JA 5KQSA 2BFDB 3ZDEA 2AB0A 3V8VA 3VR0A 3HOXG 3MD9A 4X7RA 4JLDA 1ZD4A 2JD0A 1QDUA 3SVZA 4BE4A 1H0HA 3JVEA 3F2IA 5ALOA 3R3HA 1PWHA 2XX3A 4MRNA 5PGMA 2XKAA 3O4GA 1FSSA 4LYJA 1JYFA 3TX2A 3RRZA 1XDDA 2ZYVX 2XV1A 1ZM4A 1LS1A 4L27A 1GARA 4ONEA 1J90A 4HQFA 1JEEA 1SA0B 1QZUA 4Y2PA 2B35A 3ROQA 5F9HA 1BE1A 3OBBA 1K75A 2H08A 4AZTA 4IOJA 3NRCA 3U26A 3KV3O 2H4XA 2ERYA 4W7IA 1VGRA 3BEDA 1J5EH 5E25A 3D8TA 4M36A 1NVGA 1OBVA 3O82A 3THOA 3ASYA 1Q0HA 2A9PA 1K63A 4CKXA 3KHRA 4KQIA 2E18A 1I6UA 3ERCA 4C29A 3JQGB 1FVIA 2FQYA 2H48A 2QN9A 2JCXA 4P4SA 2X5RA 3F4LA 3PKIA 2WJVA 1VCNA 2D59A 2CCGA 4HF7A 5JRZA 1EMDA 1KMHB 4RH0A 3RPEA 3ZBUA 3TTSA 1RQGA 4NBVA 1V2GA 4I7EA 1G66A 2XTNA 1KAQA 3ZQJA 2K2WA 3WRVA 2ZIZA 2Z1NA 2JAHA 1W5EA 1MB0A 5KNCD 3VAZA 3JQAB 2GSWA 3AY3A 4YT8A 4M8KA 2BR0A 4EYEA 4P4TA 1FUUA 3ZWVA 1ZVMA 4R01A 5I5YA 4EBBA 5BR8H 3S1AB 1XHFA 3FBWA 2W43A 3SIPA 1BWQA 1TF7A 3AILA 2O9JA 1QZTA 2AN4A 4M1ZA 5TXGA 2UAGA 4YR2A 1TO2E 5LUBA 2I62A 1QIMA 3HDVA 3R24A 1XEXB 4YAGA 1X0VA 5B1YA 4JR2A 3VISA 1JMVA 4GLFA 3L8FA 1CSEE 3DQQA 1X86B 3RJ9A 1N2OA 2W6OA 2IMWP 1M34A 4EFDA 1M1YE 2HCFA 1XZKA 2JAQA 3JW8A 4P7GA 1UOQA 3TS1A 1KO1A 1QHNA 1KFCB 5KFVA 1J56A 5FAXA 1SAYA 4WV3A 4Z54A 2QENA 2XQVA 5JZBA 3KUKA 3DO6A 4HGZA 4KN5A 1KPHA 2HXGA 2OPBA 1X8KA 1U0LA 3GIDA 4MR8B 4BAUA 2F3TA 3R0XA 3UJCA 1L9XA 3I2HA 3N2NA 5L7YA 1M2HA 3I9OA 3PIRA 4X45A 2JKZA 1HNWH 2VQSA 3LX6A 1Z26A 1BROA 2V9PA 1DOZA 3OIUA 2NVOA 4ZICA 1SCUA 5LN1A 1U7TA 2FZVA 3GD7A 3I39X 3RQSA 5IM4F 3E3AA 3IQHX 3LFUA 4TTSA 3DR5A 1QQ7A 4EG7A 5GOZA 2UVPB 2NYUA 2BFFB 3VR6A 1LQUA 4YJFB 3K9QO 1NT4A 1O94A 4KMSA 4D1YA 3OCUA 3RB0A 2Q9BA 2C4WA 3SVTA 2FF5A 2H3EA 4CODB 2PWYA 5BWNA 4B3IA 1GQSA 4Z9XA 1QQ5A 4IS3A 4IRUB 1IYDA 2A1TS 5K99A 1FY2A 3SKXA 3T7IA 2ENUA 3G23A 4LZOA 1G2WA 2OBYA 4Y2RA 3FLBA 4QIHA 2CB9A 4LXUA 1DAMA 1NDUA 3ULKA 3CX7A 5AOVA 4S1PA 1VHQA 3QE2A 4MV7A 1CHNA 4U1RA 1M8KA 3WMWA 1LLUA 1HQKA 3HOVG 5BQOA 4M1OA 4KR2A 2Y0EA 2CKDA 2VWPA 4HYTA 3S2UA 1FZTA 3W8NA 2B6HA 5AM5A 3ZEAA 4D4JA 1N6NA 1WKVA 4O4IA 2G7MC 1DJMA 4G9GA 5AVKA 3E7PA 4NX2A 1OB2A 2PL1A 3EVEA 2X7XA 2BFPA 5ELMA 2KMLA 4ZI7F 1OZ0A 2FPLA 1OLSA 2XMQA 1K0UA 3QVXA 3TJMA 3OCVA 3D6FA 4PNHA 5JPCA 1IEXA 4U7DA 3QI7A 1VSQA 3TIIA 1RWWA 5IJ9B 3CF2A 1USWA 3GFFA 3WO1A 1SVUA 3U3DA 1JEOA 1PEDA 3LYLA 2A1UA 2SBTA 1EEXB 4DR7B 2PKEA 3HRKA 2OCBA 4RIHA 1DGQA 4GBMA 4AYBA 4HZUB 3KDSE 4F2GA 3ENZA 5FPHA 1UEXC 4OHVA 2XYPA 1NVWQ 3B1FA 4D8TA 2DY1A 5BYAA 2Q6VA 2WRZA 4C7JA 4HMPA 3Q6NA 4RD1A 3LP5A 4B48A 3UQYS 2WJPA 1WBJB 4JIGA 5KDOA 2YXLA 1N6PA 1C8BA 1PFQA 3LGAA 3R23A 4LF8B 4ARSA 4FOPA 4O3RA 3LVQE 5TPZD 2OM2A 1HSZA 2CL5A 3B3JA 4YRGA 5KTMA 3SG0A 4ZJUA 4AKEA 1G8GA 2BKVA 2BL4A 1L7NA 4ZMRA 1UKAA 3SXUA 2ZUSA 3WOHA 1PO7A 1X7HA 3IV7A 2C1ZA 2GBIA 2LCQA 3GHHA 2QJTA 5TQ0A 3O3MB 1E18A 2BFNA 1RYNA 4FCVA 4ATNA 6AT1A 6REQA 2P2DA 3ZW8A 4L0QA 4LK3A 1NN1A 1HG0A 4FDLA 2EG5A 2W6IA 4YXWA 3CVXA 1QYCA 3WGTA 1XE3A 2X22A 2EW2A 5FQOA 5KFUA 4CL2A 3F7TA 2ZETA 1BQEA 2G9ZA 1GT91 4KAAA 2HSZA 2WI8A 2VT7A 1K3UB 2V9CA 2PUJA 4IDBA 1QWSA 4CIYA 4YI3A 3OCYA 5M7EA 4DJDC 4QHYA 2XA1A 5ENZA 1XDZA 4PC2A 3THWA 4WXYB 4FR5A 4KZKA 1M1XB 5BMOA 4PRKA 1ISRA 3LLSA 4FS8A 3FJYA 3ZBQA 4R7GA 5AKIA 4L07A 1Y1QA 1CG6A 4MVJH 5K3SA 3V4PB 3M1YA 1PFKA 1WVGA 1QYXA 4MGHA 3SE0A 2D1FA 3W1GA 4RTSA 5LQJA 3PGLA 2ZUVA 4W5QA 1B23P 1X38A 1E94E 3E81A 5EVJA 3DBHB 4JBNA 4LF5B 2HPAA 4B80A 1JXAA 3PR5B 2VRBA 4RESA 1ZKDA 4DSAA 1UT5A 3O9MA 1ZJJA 4Z7JA 5I3ZA 2ZVPX 1XXLA 1XDSA 3B60A 2DLDA 1IOLA 1DEKA 4UD2A 1M67A 3AQIA 1YVPA 1MX1A 1XTVA 4B5KA 1T3HA 2O7QA 2Y76A 2PVCA 3GP3A 3CMMA 2R8EA 5JXWA 2EJ2A 3HFJA 1GZ5A 1DEHA 1EG2A 3RVBA 5AIAA 5FL7D 5KFNA 1Y14B 3OIFA 4TWIA 4F38A 3W1BA 3M4JA 2HWUA 2OR3A 1KEUA 2ZI4A 4QODA 3CQZA 3VVMA 3JVVA 3ELDA 3OT5A 2TMYA 3FWNA 1ZNZA 1A96A 4NJMB 2Y1LA 1Q12A 1L1FA 1WUHS 2G72A 5EFOA 3VKUA 4UBKA 2ZE6A 1I7QB 3CNHA 2XUOA 4FKBA 5FI1B 5TSDA 3TLGB 1IVNA 2GM4A 5B7QA 5T14A 2VZ9A 4K9SA 3QU7A 4Z3DA 4PZ7A 4BUJA 4ARZA 4YCMA 4UZFA 4DLBA 4V2UA 4EW2A 1FJXA 2BGTA 3IXMA 2BMWA 3ONNA 3ZLBA 5DYIA 4AYTA 3TW7A 1XTUA 3MJ4A 3DTNA 1PYOA 1I2MA 4ECAA 4NOMA 3AVVA 4LWPA 2R97A 3LPAA 4XA8A 2XBLA 2JGJA 4IKOA 1J6UA 2J5KA 1H8ED 1I4WA 1RJFA 1TZJA 2G0TA 2JJ2A 2QROA 3HT5A 3HU5A 1U2ZA 2CNQA 1X0XA 1SVWA 5IT4A 2DFTA 1B73A 4WI1A 4IVNA 3JD3A 4CU2A 1KL7A 2IZ5A 3CRVA 1U0FA 4Z3OA 4JVLA 2CFMA 2C58A 4GLJA 4H7EA 1AV6A 1XRSB 5E7JA 3CZ9A 1PZEA 5KNDA 5FOVA 2PRIA 1I80A 3DWEX 2BN4A 4Q00A 4BASA 1N2CB 3EOAI 3Q9SA 3EUWA 5CEFA 3RIZA 4QREA 4I4IA 4J0QA 4F5ZA 1UOEA 3Q7SA 3RUHA 5B6IA 1JDVA 3C5WP 1L5GB 4J0IA 4CL3A 1YUMA 4LHVA 4PLYA 2AW3A 4XX1A 1VHJA 4KGZA 2GA9A 3EE6A 1WP4A 2NXCA 3GH1A 4B9EA 1BHSA 5AVSA 3R9XA 4Y2HA 4EB6B 2Q6IA 3DOJA 1WLSA 4HWKA 3V1LA 4Y1GA 4KTTE 1AHNA 4L8YA 3CPEA 4FFWA 2QJRA 1JHMA 4IXMA 3WE7A 3E9MA 2N9UA 2IH4A 2RGUA 1GUZA 4Y0NA 4PLZA 1M2OB 2W2VA 3IAS1 3PC6A 2Q2VA 4MINA 1R6TA 3KT6A 2IUFA 5AHKA 1B3RA 4RUKA 3UA3A 1RBYA 2Y1WA 3S27A 5CNJA 2GZ1A 2P6PA 2JFOA 4NHEA 1QVZA 2DGDA 1O87A 2OGWA 1JPJA 2AGVA 5IKXA 2NUTA 5IZCA 4M55A 1ZK4A 5B37A 4ZYYA 1LLFA 5G2OA 3M6MD 2RHLA 1XL0A 2Y3IA 4K81B 3VTZA 4YI5A 1UZMA 1YC2A 3WDKA 5IASA 2IYSA 3L0IB 4KWEA 4YY3H 1KSFX 1ULHA 2QVZX 1M1NA 4B83A 3NC0B 2H9IA 4F4XA 2RGRA 3AF5A 4EY4A 2FJUA 4BQEA 3KXYT 4EITA 1R9NA 2F3SA 1QKIA 5J2UA 2G5GX 5BSWA 4C0HA 2O7SA 1N2GA 4YAWA 2XNHA 3ZNNA 1OUMA 1T3LA 3LA6A 1NVAA 2WSSD 4Z3KA 4GKJH 1GCIA 4JL8A 3CU5A 5BQ3A 1UFQA 1EWQA 2OFFA 3C0KA 3KU1A 1PS0A 3FROA 1P2UA 3SXJA 4JLMA 2AKAB 1ZVJA 2OQ2A 3BILA 2OFOA 3NMUF 1YE3A 4US2R 3KVYA 5JSZA 1XMOH 4PGFA 2V1UA 4KAJA 3GEMA 3KHSA 1QF9A 3D7RA 1GQQA 1LNZA 2ES4A 1W9HA 5I9BA 3DMTA 4TV9B 4Q44A 2W9AA 1NVKA 1CZHA 1Y63A 3NOOA 2HUPA 1HFJA 4W99A 1WMSA 4U9HS 1M8JA 1GZ6A 3PFBA 5JDIC 1LLDA 2B7CA 3W9SA 4GXRA 2PJUA 1FFDA 1U90A 5B36A 1VL6A 1YOVB 3IUQA 4BMVA 5ED0A 1MO2A 3PW2A 3DZHA 1T6NA 4RENA 3R9RA 1H2HA 3QSYA 1RC1A 3GJ8A 1OXXK 1L7QA 2EX1A 1VLMA 5FWNA 1DC3A 3BBLA 2VH5R 4ARUA 3EIQA 1EUDA 4RVUA 1M10A 4B3TH 4GI5A 1NT2A 1RLUA 3HVKA 4JI7H 1H4QA 3FI0A 1ODIA 4PZZA 2X8AA 2CEKA 5FA5A 1HQCA 3OHAA 1UKEA 4O7NA 1YK1A 4DBLE 4ED8A 1ZOSA 3IEUA 1OT3A 5HKKD 2ZTSA 1E3TA 4KDCA 4Z0HO 1PYGA 2RH9B 3NHSA 4M7EA 1E5XA 2PAAA 4EO4A 3JY6A 2G4CA 3OM9A 4B4OA 3JQFA 1NI3A 4ZJPA 4EMTA 5I9TA 1VJ5A 2HGSA 1XD2A 4LF7H 5KFXA 2J7PA 1E63A 2QRVA 4QWEA 2DHRA 2XZPA 1DKRA 4XGIA 3LBAA 4QQRA 2PRSA 2FH5B 10MHA 2C2HA 1T5DX 1Q1GA 2JGMA 4RFSA 3K1AB 3NM5A 3JZ6A 2CLEB 5JSHA 5DISC 2QRMA 4M1WA 4FFBB 2IS2A 4LH7A 5ANRB 1YRYE 4ND8B 1MJ5A 1GYRA 3EPPA 2XQKA 1UJ5A 1KVSA 1TT7A 4I3FA 3COPA 1YXMA 4XRRA 3X1YA 4PQYA 1E1NA 2D74A 4D42A 3BABA 3GTKA 2O6LA 3EGVA 1FP6A 3F46A 2ZE5A 1GU1A 4GG1A 5IYDG 2OKCA 4R3WA 2PT5A 3GIQA 3M3HA 4P82A 4REQB 3T5TA 5D1OB 4JI0B 1BFDA 1N9GA 2VHEA 5J2TF 1NVMB 3BK2A 3RBZA 1ZNWA 2GPTA 2WSMA 2O7RA 3K96A 3AOEA 2DMRA 2PFSA 4RGYA 1IPEA 2HREA 2C5FA 1G2IA 2X3YA 4DIEA 3BXZA 1FS6A 4IMRA 4ID3A 1RXUA 1E1LA 4JUZA 3TRIA 4YH1A 3ISJA 1UP4A 2NZXA 1P7YA 4QW9A 2P9QA 4YCBA 3CR3C 3OT4A 5KKNB 2TS1A 4RDIA 2V6BA 3FYDA 4ENTA 7GPBA 1ISHA 1TEVA 3LFHA 4Q1CA 2WSLA 2R47A 3G6VA 1NMEA 4AUMA 4H60A 3KZNA 3HBFA 4AI6A 1SQ5A 4AQ7A 2MSKA 4A7PA 4IXDA 1TEZA 4EUNA 1WPGA 4OPMA 2ORED 1GDDA 2C2XA 4MW7A 4I1YA 2C2BA 4FK8A 3GA5A 3HQ4O 4RTMA 2W57A 1IOVA 4L2IB 3C6XA 5EKSA 4P9NA 1YJXA 3OP4A 1BYIA 4CU5A 5JAMA 4LKRA 1Z3CA 3K0FA 1U3GA 1YAJA 4EH1A 4ID9A 1IBCA 1EUYA 3UJNA 2Z04A 1TUBB 2FA9A 1QONA 3COZA 3E2IA 1B8OA 2BMEA 1OIXA 4H18A 1NNI1 4EG3A 3FSGA 5B64A 2MU1A 4A6DA 1AKNA 3P9XA 4UAGA 3BIFA 3GBSA 1SH7A 2QQ0A 3L01A 4PGGA 2HA2A 1W30A 4BP3A 2YFYA 5JH7A 1NPYA 4FS2A 3SC4A 3KKMA 3FDFA 4O4JF 3KLPX 1NNEA 3AR9A 3IBTA 3K94A 4JLNA 1DQPA 2XE8A 3ZHTA 4YAOA 3T9CA 2C0PA 1K4MA 2JJYA 3Q9NA 3EF1A 4O1HA 4XLZA 2GHIA 3WYBA 4MRSA 1QFYA 5JRJA 4KHZA 5E3HA 1VMDA 3IP7A 1UQTA 4NKRA 2QG6A 3AG5A 4ZYWA 1C50A 3UJDA 1ADBA 1KEKA 1JWAB 3QNWA 3LQ4A 1LW6E 5M3BA 1VMAA 2CLLB 4TKMA 1Z73A 2C1EA 1FQJA 3WIOA 3IE2A 3P5SA 1RJWA 5D5HA 2GZDA 2W2QA 4W8OA 4FR2A 3GFPA 2EXXA 4NICA 4DNQA 4A8TA 2OY0A 4HX5A 2AFHA 4OBWA 1I7LA 4P34A 3R5SA 1Y7TA 1BJTA 3GLSA 1WHSB 3PIDA 1ETHA 3CW2A 1WU8A 1JHVA 2AEMA 3F6RA 4MUIA 4LC9A 2WM2A 3DFKA 2PZ8A 3QITA 2ZYUX 5EHGA 4UNSA 1IZZA 4MS3B 4QGFA 3VPXA 2CDBA 1EP3B 1JP7A 2IITA 4LMAA 1QRTA 3GT3A 2UUAH 1T2VA 4NEGA 4YN3A 4AMBA 4DDUA 1H2WA 4LDRA 1Y1PA 3T7CA 5HE8A 1UKYA 1E4EB 5M2QA 2YV2A 1V0JA 1G5TA 3CNQS 3T7RA 4UCUA 5GIPE 1NAHA 1IPHA 2HQBA 1BVRA 2D7JA 1X8XA 4JJGA 3A9WA 3K6JA 1MC8A 1NBEA 2C0CA 3S24A 1K4YA 4NCXA 4LRSB 1BQ3A 3GLKA 2MHCA 2XQGA 4DY6A 4KQGA 4QQNA 3OPYI 4AMZA 1Y6JA 4ZP1A 2LPMA 4QUIA 5AQ1A 3CYFA 3CWZA 3I04M 3CRMA 1T9AA 1HE4A 1QIDA 3OA2A 4HWRA 2ZWIA 5BOVA 4JI1H 3WV5A 2YWJA 3PF8A 2VPZA 3AUYA 2ZSEA 4JYZA 4O4LA 1VJDA 3L2OB 2Z3VA 1A4RA 3RROA 2B69A 5K3FB 2EEPA 4AJKA 2X4IA 5IBRA 1Z2EA 3FOCA 1J70A 1H1LA 3I01A 1UC9A 2VRNA 3N8KA 4II7A 3L7JA 4B0PA 1FP1D 2B20A 1J1IA 2FEWB 1Q7EA 3WFZA 3G9XA 3F47A 1K86A 1TM4E 4LMPA 2NN3C 1F0PA 1QPBA 1WZNA 5GP1A 4KYUA 2EWWA 3G79A 3G9TA 5SZKB 3NBFA 2EZUA 3U3XA 4NK4A 3UVEA 2V7PA 4Z0NA 1XG5A 1RJRA 2H2FA 3MEQA 3I2KA 4XVQA 3O1HB 5D3QA 4XLTA 4GKJB 4PM4A 2OCPA 1UMDA 4N7MA 2O03A 4RVSA 1Y4ZA 5FNVB 5CB0A 1MGOA 1MVLA 1HRKA 3LQKA 2WMOB 2O8BB 3U3OA 1QK4A 3IKLA 1SC6A 4URXR 1W44A 4Q34A 4Y9UA 2JI7A 3U31A 3KT8A 1CEYA 5CUQA 2MCTA 4HDAA 1XTZA 3GF4A 1NBMA 1A2KC 4HDNA 3JALA 4N5DA 1YQEA 3UKOA 3ANNA 3QEMA 4UQOA 1CY6A 4I66A 2O07A 2ZJ2A 4OJMX 2ANBA 1EVEA 4TT3D 3K20A 4QTUB 2JF0A 4BLTA 4KRFA 3GLIA 4K05A 1QH0A 5EXTA 3ZE8A 5ALIA 5K0TA 2JD2A 3IH5A 1OLUB 3OEHD 4GX1A 3V4OA 5JS8A 4I9FA 2AN5A 4EL0A 1ITZA 1JV2B 2JFXA 3EFOA 4EY7A 1VRWA 3E7XA 3KFLA 1W52X 3ZYCA 3BUSA 2W98A 4YBZA 1U5BA 5KO2A 1WDMA 3QH4A 1HE5A 3VNAA 2XCOA 3FB4A 1IBKB 1GGMA 2AV6A 4B3TB 2GF2A 3DL7A 3KQSA 3VNSA 3G3EA 1EK6A 3DOOA 2Q6OA 2B99A 3MGCA 3PGMA 3MB5A 4YXFA 4FE7A