4UCVA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 95
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucvA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucvA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucvA02
4X64B 4B3TB 1IBKB 2UUCB 1TA8A 1CKOA 1XDNA 4LH7A 4X66B 5BR8B 4PZ7A 1TAEA 4DUYB 4NXMB 4JI7B 2OWOA 4JYAB 3QWUA 4JI2B 3T1YB 4UCSA 1A0IA 2UU9B 3TY5A 2VQFB 4EQ5A 3BA8A 4DV6B 4UCVA 3NBYB 4X65B 4PZ8A 1CKMA 4GKJB 1J5EB 2VUGA 1VS0A 3RR5A 4LF7B 4AQYB 3BAAA 3NBZB 5IWAB 4LFCB 4UCUA 3TY8A 4E6NA 4DV2B 4LF9B 5LMUB 2HVRA 4LF4B 4GKKB 4DR6B 4B3MB 3GB8B 5D1OB 4X62B 1N33B 1HNZB 5D1OA 4DR2B 1HNXB 1DGSA 4EEQA 3BABA 1I94B 5D1PA 4JI6B 4LFAB 4DV7B 4DV4B 1HR0B 4DR7B 4DR5B 4DUZB 4OX9B 4NXNB 1IBMB 4UFZA 4DV3B 3PN1A 4JI4B 4JI8B 5FPRA 1N36B 4PZ6A 4B3SB 4YY3B 4JI1B 2UXDB 4YHHB 1FJGB 4DR4B 2Q2TA 3S24A 4UCRA 3NC0B 3L2PA 3T1HB 1V9PA 4UCTA 2ZM6B 1XK5A 4DV0B 4LFBB 2UXCB 1B04A 2VQEB 5FPOA 3GDEA 2F4VB 3SGIA 1XNRB 1ZAUA 4B3RB 4DRFA 4GLXA 3TY9A 3W1GA 1N32B 5DISC 4CC5A 4LF5B 3UQ8A 4CC6A 3BA9A 3JSNA 3JSLA 4LH6A 4DV1B 2HHHB 2E5LB 1HNWB 3KYHC 4LF6B 4DR1B 2UXBB 4EFBA 4JI5B 4JV5B 4LF8B 4KHPB 3W1BA 4K0KB 2UUBB 1CKNB 4JI0B 3VNNA 1XMQB 1P16A 1CKNA 4UCOA 2HIVA 3W5OA 2UUAB 3GJXB 1IBLB 2HIXA 1XMOB 4JI3B 4EFEA 2HVSA 2CFMA 1S68A 1X9NA 1FVIA 2HVQA 5LMNB 1XNQB 4TOIA 2Q2UA 4DV5B 1P8LA 3RTXA 3OTOB 4DR3B 1N34B
chains in the Genus database with same CATH superfamily
2HG5C 4H0LB 2R8JA 2BTOA 3EVKA 3B77A 1K5SA 5B3SB 4C5AA 1TAEA 4DUYO 1F7YA 4PA6A 1JVMA 1UFIA 2Y0PA 3HB9A 3T1YO 4J41A 4J10A 4LMYA 3UO3A 3LNNA 2CTRA 2XCLA 2R92A 3Q8SB 3OFNG 3M9OB 3E8GA 3E35A 3VPBA 1CS0A 5LL6b 1J5EO 1YCIA 4O4HA 3FKIA 1YF2A 4IHJB 4M0JA 5EIBC 4I55B 5J2UA 3ZEDA 3TK1A 3MR2A 3JCZA 2HVJC 1NBMG 3H01A 4ED7A 4U7NA 4DYLA 3N2KB 1M93A 3GB8B 4IIJF 4MTDA 1S9FA 5I5YA 5DGBA 4RB0A 1VQ7V 1FFXA 5EDWA 4UB6Z 3ABTA 1VQ9V 4QWAA 3AW8A 3A2FA 3JRWA 2HFEC 4WFFA 2VR1A 4IYHA 1U96A 2DPJA 3LDDA 4GX1A 4PELA 5L3EA 3ZHSA 3ETHA 3RN4A 2KKWA 2UVRA 4IT5A 4GT1A 4Q0YA 1KP2A 5KFDA 4DV3O 5CA3A 1GO3F 4Q8EA 1IXMA 1WPBA 1JJOA 5IYDO 4QE7A 5C8YA 1FXKB 1M90W 2UXDB 3GB7C 2YS8A 4DR2H 4NZOA 1AN7A 3ZMZA 1A3GA 3ORQA 3SYAA 2P22C 3CRCA 3GVMA 5EZYA 3RYIA 3FB5C 3CP1A 4FZ1A 4IL6Z 5LA6A 3UYYA 3DF7A 1VQ8V 2UXCO 4TQSA 4NXNH 4JUZA 2F4VO 3SGIA 5H9CA 4ICGA 1M0WA 3WO1A 1E79G 3GWOA 3WB1A 4JI1H 3K5OA 1JA8A 1D2DA 2NU9B 2W6JG 2DYSC 3RIZA 2HGXA 4DR1B 2ILMA 2XD4A 5DG9A 5KG5A 2WLLB 5KA5A 1H2MA 4CS3A 4KHPB 4K0KO 1YITV 1FFTB 4ECVA 3RV4A 2Q0AA 5LP6F 4F4LA 3ZIAG 2SCUB 4UCOA 4TUYB 3W5OA 1JQ0A 4PJ0Z 3JAKB 1IBLO 5KHIA 1XMOB 2HVSA 4GX2A 1FVIA 4CS2A 1KT8A 4I0XA 1WNSA 3T2MA 1E1QG 2N05A 3T1CA 4R50A 4F6EA 2P4KA 5I5TA 3H4DA 4X64B 3RGBA 2B1GA 3L75H 5BWRA 1MZBA 2V1DA 3M9MB 4B7KA 3BFRA 3HB3B 2X7RB 1L0NH 4NYKA 2F43G 2R7ZG 2DQ3A 2QWRB 2H94A 2YS6A 3N2GB 2C2EA 2DN9A 2VQFO 5IJ0B 1BNCA 5IYCO 2F66C 1WRVA 2EINC 2WAQA 1AP6A 1W59A 3I4MG 2ZKOA 1KMIZ 1JLLB 5BR8H 1V4YA 2B63G 1OCRB 3GIKA 4MTGA 1DV1A 4UCUA 3ABMB 1YEWA 4LFCB 4E6NA 3CS5A 4QJFB 2JJ1G 1FXVA 2X0SA 1Y1VA 3OSNA 2AHYA 2ZE6A 1UJWB 3STLC 2E3CA 1HNZO 1HNXO 3U54A 5KX5F 3AG4B 5KG0A 1I7LA 1K9MW 4KXRA 1I94B 2VQDA 4JI6B 3MR5A 1YHQV 4XDKA 3JD3A 4DR5O 2HVKC 5CN0A 1Z2OX 4MVMA 2VWJA 2AZ0A 1FAFA 4HR7A 1PKXA 3N42B 1ZQ7A 2EIMC 2COGA 1N36O 2EJ2A 4B3SO 3FD9A 3H20A 3P32A 4RQEA 1JXLA 4YHHB 1SF9A 1N0JA 5LP6A 4L1KA 5K2MA 3GTMA 4DR4O 2ETNA 4G3IA 2LGWA 4XBFA 3ZMTA 2QTOA 3KREA 4DR7H 2Z3YA 2YIDA 4FM1A 4BXXG 2ZXWB 1RP3B 3CCEV 5KKNB 3FX7A 1B04A 1N56A 4O4JB 1VQLV 2ADPA 4QE9A 4MV8A 5BPHA 3VQYA 1NR7A 3RBEA 2Z0AA 4O7WA 2QE7G 1Z2NX 3VOTA 3AX6A 3EPGA 5FL7G 4EBCA 3RAXA 5GONA 2HHHO 4DV1B 4QGPA 2DMXA 5DLFA 3D3IA 5IJ9B 2UXXA 1BMFG 4MW8A 4G27B 1R9TA 3K3WA 5CB4B 4MT8A 4C7UA 4O7VA 3CVZA 4HYKA 2UUBO 3THOA 1X59A 2IBZH 3MD0A 3GQCA 2BTQA 4WBNB 3IN5A 1CEZA 2UVUA 1GGOA 3HBLA 3D36C 4EFEA 3E8BA 1XUQA 4X89A 3UT5B 2E5LH 5KFJA 5I5VA 1AVMA 2JVDA 4LFCO 4FFBA 2FE3A 4ECSA 3CRAA 2QSAA 2IA6A 2UUCO 1T94A 4JV2A 5HFMA 4HQ6A 2NLJC 4ZHQF 4TQFA 5BPFA 1SESA 1VBGA 1G8MA 4NTXA 4QWDA 3CMAV 3TXQA 3CRRA 3ZRSA 4QIWF 1SQFA 2YDEA 5LMNH 4ED8A 4JYCA 4A2BA 2LW7A 4EQ5A 4O4HB 5KUMA 4CH6A 4Q6GA 2JEFA 3QFFA 1FKAH 5DG7A 5IT9W 4X65B 2VA3A 5J2UB 3AK3A 2QEXV 5DECA 2QKSA 2WLJA 2RCVA 4AQYB 4O81A 4FLWA 3AG1C 1K1SA 2JIZG 3C0FB 5L1JA 3VQVA 1DF5A 3OGIB 1XL4A 2EULA 1FFXB 2XIGA 1EM1A 4B3MB 4DL6A 5KG1A 4X62O 4A2AA 3HKEA 4A3EG 1N33O 3K0DA 5D1OA 4K8ZA 4K6NA 1KECA 3SDLA 3ABKB 3R9RA 2ZR3A 4JAUA 3L72H 3O9OA 2Q9LA 3PW2A 4Q4DA 4WFHA 2P90A 3K5NA 4EBEA 1Z5WA 1U97A 1WCMA 4TV8F 2KG7A 5F2VO 3TETA 5C8YB 1KEEA 4JI4B 3OUFA 2PVPA 1IOWA 5HV6A 1M0TA 2DQ0A 2JEJA 3CRMA 1I1MA 4O7RA 2CUGA 5EK0A 1FJGO 5EZYB 3RYIB 4WFBV 4XYMB 3ML0A 4M9UA 1CE8A 5LA6B 4ECZA 3L2PA 2B9ZA 3HT5A 3STZC 4J9RA 4LFBO 2WAQE 2VQEO 1GO3E 5FPOA 4CBCA 4I7ZB 2CGNA 4CKEA 4ZI7F 4F4YA 3ZN0A 5JVDF 4JI8H 4BAYA 5LBQA 3GTPA 4R7CA 1SETA 4ZHQA 4KL1A 1VARA 4YJ3F 3JSLA 3E5NA 2ZDGA 4R8UA 3TW6A 2C22A 4IR1A 5L1KA 2HJDA 2UXBO 4QIWA 3ASNB 3IFXA 2M7WA 3K08A 3WWJA 4DL2A 4FBUA 5IYCG 3BCCH 5H80A 4YIOA 2DYRB 2P5OA 2LP7A 1WH2A 1XNRH 2IJHA 2XASA 1Q3EA 1XMQB 4LF5H 4C5CA 1BZKA 1YSCA 3E22A 2Q69A 4ZBMA 5DLGA 1TWGA 1Q43A 4I0XB 2HIXA 5DN6G 3K5LA 3OAAG 1ZX3A 1PNKA 4DV5B 2V4DA 4DR3B 5J2TF 4EGJA 3T5KA 4WHXA 1GH6A 5B1AB 3E2EA 2QKCA 4TVIA 4JYAB 3APOA 5JQWA 1AR1B 3U9SA 1VKZA 1S0OA 5KT7A 3G8DA 4N21A 5CMUA 4G2KA 1EN6A 5CA0F 4TV8A 3OM3B 3UKMA 2VUMA 3DTFA 1JCHA 3X2QB 2HDKA 2CDYA 5KAIZ 1UC8A 4JYYA 3RVYA 5IWAB 4DV2B 2YZGA 3ZMVA 1EYZA 3T1YH 1Z2PX 1KJIA 1R6KA 1ZSPA 1I5XA 3OR6C 4FU0A 3T9CA 2Q67A 4ZI7A 1JJ2U 1EFRG 5JVDA 1EUDB 5IDJA 4RUAA 4UUJC 1J5EH 1PM9A 1H38A 1P49A 4YJ3A 4DV7O 3AEIA 4LFAB 1C3OA 2YL2A 4YR3A 1HR0O 5H5NA 1XHXA 1XI1A 1SQBH 5KFAA 5D5PA 3SPGA 5LP6B 1AR5A 4PZ6A 4MA0A 2YSUB 4TUYF 3PW5A 2Z02A 3G6VA 5FLXW 3HOZG 1B3QA 1NTKH 2ZINA 2FKXA 2RJZA 3KCXA 2Q2TA 4FMTA 3WFVA 3L71H 1XMQO 4JAAA 2ZM6B 2JGUA 3FAVA 1I1LA 5KT2A 3T54A 4K8XA 3RFCA 1V54B 4XDLA 3D8CA 4DV3H 4MVOA 3M7MX 2IU3A 5J2TA 3N6RA 1THZA 4B3RO 2V58A 4GLXA 2YI9A 5GONB 2C2AA 1TUBA 1PPJH 1FYJA 4DR3O 2CNUA 4RUEA 4MTOA 3KKYA 2HGSA 2IJKA 4BY1G 2COJA 4RZQA 2RDIA 3V4ZA 4CKBA 1HNWO 2GHYA 4LF6B 3G6XA 3WG7C 1Y67A 1S5JA 2UVVA 4EFBA 3CE2A 2P0AA 4UVCA 4JI5B 4JV5B 4LF8B 2UXCH 1JX9A 3ASOB 3B40A 5CA0A 2BTQB 3ETGA 2Z04A 4JI0B 3VNNA 2F4VH 2YU9A 4J11A 2FPPB 4O4IA 3V4SA 3K3PA 1M7JA 3SJCC 4CH4A 3PW4A 3RYHA 4FFBB 1X9NA 1KC7A 1QBZA 1XNQO 1SA0A 3RBZA 3RTXA 1R6TA 1SERA 4JTAB 1Y14B 4RAZA 1IBKO 1CKOA 4U6PA 4LH7A 4K0KH 4A3CG 4ED3A 2PGGA 5CE8A 1PV0A 3AG2B 3PZPA 3T5HA 2R8IA 1IBLH 4EEYA 2M05A 2UU9B 2EIYA 2ZQMA 4D7SA 5BXZA 5KFSA 4MV6A 2AGAA 3UO2A 1M57B 1OCZB 3U0GA 2QK4A 1RYRA 4GKJO 2VUGA 3RGZA 5KFEA 3SJBC 3M9NB 2W9CA 4A3GG 2BSKA 3PJSK 5EWFA 2AGQA 4YR0A 5FD5A 4LF9B 2ZR2A 1PL0A 4O4JF 4LF4B 3HKEB 4GKKO 3IC9A 4NKGB 2DWEC 5FLXN 2VQFH 1P84F 3KAJA 5D1OB 4E4EA 4XYLB 2WB1A 2R7NA 2ZM6O 3G80A 4FM9A 2W0FC 4UV9A 3OSPA 3U11A 2ZE7A 3T9BA 3SI8A 4DV4B 2GPSA 1NTMH 2KG7B 2ATLA 4IYIA 4NTYA 4QPKA 4DUZB 1Q8IA 5I5XA 2DW4A 4HN2A 2V59A 1GN3A 3PN1A 2R92G 4PDBA 3MR3A 4H44B 2QWOB 2HR3A 1HNZH 3HKBA 3KALA 1HNXH 4J9MA 2QF7A 3FKIG 1BT8A 5CAEB 3F8NA 3SYPA 4E2LA 4DR5H 2R82A 2ZDIC 4N23A 2CNQA 4DIMA 2IP4A 4ZHQB 2O57A 3LQSA 3W1GA 3Q1KA 1N36H 4B3SH 1I0HA 1SKVA 3MR6A 4R8UB 2RDCA 1VQPV 2Q7DA 4DR4H 4RB1A 3QTCA 2JEIA 3KYHC 1GTOA 1M56C 2EIKC 1US6A 3FMAA 5EC2C 2Y0SA 1BCCH 3OHAA 1VQOV 4JZGA 1XREA 3E22B 4MTEA 4CHIA 5JQGA 4TSFG 2NVXA 1MOFA 1L2ZA 2HHHH 1VF6A 4MTFA 4FGRA 2HLDG 2XUMA 4EKWA 5JJJB 5DQHA 2XGPA 1QU7A 5KFWA 4O4JA 1ZL8B 4A93G 1SCUB 2W57A 1T36A 1F51A 1ZLZA 2FL4A 1E1RG 1Q7YW 4LF9O 1F4MA 3ETJA 2UUBH 1SQQH 3I12A 2GPWA 4PZ7A 4FLVA 4JI7B 3JYCA 4JI2O 4J9ZB 2P67A 2QM4A 3IC7A 1G6UA 4PA7A 4TV8B 5KFIA 3CEBA 4LFCH 4MV7A 4DV6B 4O7SA 4PZ8A 2UUCH 3C3TA 3JAMW 5FR9A 5LA6F 1JPXA 5EYPA 4MA5A 2Q68A 2AZ2A 5E25A 3CCJV 4FFNA 4BBRG 3V6JA 2WLMA 2R93A 2VS0A 4BIUA 4ZI7B 1IYDA 4DR6B 3RB6A 5JVDB 2W7PA 4MVQA 1Y4MA 3RV3A 4DL7A 5JJNB 4JI6H 2IW5A 3SPJA 4FPPA 2VPSA 4YJ3B 4EEQA 4GZRB 1BHBA 2ZCEA 4GC7A 4ZQIA 3T5LA 2RGVA 4A3LG 4HNTA 2FJZA 3LNMB 4YP3A 5KMGA 1N0NA 1L1FA 1WB7A 5B3SC 1B6RA 3QVNA 2R9AA 1BJTA 5KFFA 5IE9A 4OX9B 4ED6A 1IBMB 4UFZA 4RU9A 4TQRA 1NH2D 3T9DA 3H3VH 1DIKA 4X62H 4LSAA 4YY3B 3FB7C 1N33H 4RNNA 2A9HA 2Y48A 1RM1B 5L3GA 3FAVB 2BE3A 2OTLV 3MFIA 4F6RA 3T1HO 1V9PA 2CH7A 5J2TB 2XNDG 1S77D 2QR4A 1TUBB 2YUAA 2COIA 1Y1VG 5L3DA 3OMNB 2BQUA 2EILB 4RAYA 3MWDA 3VMMA 2UXNA 1DTOA 3MDSA 4MVRA 1FJGH 3JSNA 3RWRD 1Y6XA 3ZRXA 4J0MA 1KC8W 4BY7G 2RN9A 4ME6A 3H9VA 5CA0B 2WA3A 5E1AC 4LFBH 2ZNJA 4K3AA 2VQEH 1EUCB 4O4IB 4FLUA 3W1BA 3H40A 2J6TA 1V55B 2JRIA 3RYHB 2UUAO 2YWVA 5BMVF 1SA0B 1YXBA 4JI3B 2GTSA 1GSOA 1FS0G 1MSDA 3TGUH 3P3NA 5AG2A 3WB2A 1ZHSA 5B1NA 4DO2A 3MHSC 3N27A 3B8NA 3JAMN 2UXBH 2CK3G 5LOVA 3U0ZA 1N34O 5HBRB 2V4QA 1AI7A 1TA8A 5LYJA 1EKFA 4X66B 1GAXA 4X1IA 2DE0X 2K1EA 2L6LA 1E4FT 1KP3A 4NXMB 3ZBHA 3RF2A 4CH5A 5KFMA 3IG0A 3W7UA 4B08A 5JVLA 5A2QW 1KD1W 1JKJB 4IRKA 1EKPA 5B1BB 1EZVH 3ZN1A 4QW8A 2C2RA 3BA8A 4IGGA 3CJHA 2WLKA 4PV1B 2W9CB 4IRDA 4ECQA 2CZGA 4IZOA 3K9AA 4XX0B 2Y4TA 2BSKB 5BWXA 3BQ1A 2FB5A 3K9SA 3F7YC 3N8DA 1YTFD 1NTZH 2DAAA 1AR4A 4AHCA 4YY3O 5BZBA 5FLMG 5LMUB 4DL4A 1FXHA 3RYCA 5GONF 1Q90D 1BGYH 2W6PA 4DL5A 3S3WA 1SYXB 3JARA 2ITDC 2X5RA 3K58A 3PO3G 4GLWA 3DXRA 5JCOC 2NN4A 5KLVH 4LWSA 2C28A 3LSQA 2AW9A 5C4XG 3FKSG 3N44B 1KBHA 1XL6A 3R66A 5C93A 2XGQA 2EINB 3HKBB 3NGDA 5B5EZ 4RB3C 2OLSA 2UXDO 2A0LA 2X0LA 5LXTF 3KHGA 1LUWA 4HAMA 4JPRA 5BMVA 1IURA 3J80W 4DV7H 2Q6AA 1I1KA 1HR0H 4JXUA 1H8HG 4APMA 1MNGA 4DV0B 1UNNC 1O9HA 4YAKB 1AUXA 5CM0A 3TCUA 4I7HA 4TQDA 3DC5A 3QF7A 4DRFA 2W6MA 1N32B 5DISC 2FPGB 3OMAB 2YYAA 1DLBA 3VOUA 1UPGA 1IYEA 1K8AW 3RYFA 2XAHA 1FPOA 1B6QA 4BIOA 3LP8A 2CW8A 2YICA 3VQWA 5C1OA 4JTDB 5EIBD 3EYYA 1XMQH 4DR1O 4L87A 3Q8PB 1K92A 3CQZA 2ODMA 3QZ8A 2XTAA 4H37A 5IYZF 4KHPO 4WD3A 2EIMB 5JQGB 3RW0A 1IVSA 1WCMG 4B3RH 3RJ0A 4BIZA 5A2QN 4RQFA 1CKNA 4FS2A 2R85A 3LWBA 4DR3H 5BWTA 3BHPA 3ZHQA 1S97A 5K1XA 1XMOO 2OCCB 1HNWH 1VP7A 1G2WA 5DGIA 4RB2C 1ENVA 5GTIZ 3K79A 4BBSG 4X64O 2R7MA 3J81W 2ZXWC 4U3FH 3OGCC 1Z5VA 4MV1A 1DF4A 1XHZA 1ZWIC 2QTSA 2PYJA 4IWXA 4PA4A 1S3JA 4X20A 3I5DA 1XNQH 4A3JG 1K97A 2Q7EA 2PYLA 4RCNA 2Q8VA 5EYPB 1IBKH 2R8GA 1WAZA 2JGDA 2FKLA 2V7QG 4LF7B 4FVMA 5LXTA 3HKZA 4O2BF 4YQWA 3CC4V 1K1QA 4F4XA 3APQA 3L4JA 3JCUZ 3T4ZA 4QSHA 2ALZA 5D5QA 3IAYA 4O7ZA 4DR2B 1BXRA 3JATB 3J80N 3H0GA 4JV0A 3JALB 4GKJH 1LUVA 4UXNA 5EBWC 5KMGB 1I94O 4EGQA 3N40P 2WSSG 4JI6O 5GTHZ 2WLNA 2FPIB 1N32O 5CR5A 1H2KA 4O3SA 4NXNB 1HW7A 5C3EG 4GKKH 4DW1A 5IYZA 1WJZA 3RT3C 2R6FA 2ZM6H 3DC6A 2Y4RA 4JI1B 2QM7A 4YHHO 5KHHA 2GTAA 4TWKA 4A3IG 2VUMG 1M9NA 1YJWV 4EB6A 4F6RB 5KFPA 2CH7B 3Q8QB 3BPZA 4NB5A 2XCAA 2E74B 4DLKA 1XK5A 1NT2B 3GDEA 4GCZA 3CEIA 5T14A 4BW9A 2WYOA 1Q86W 1SS3A 3TY9A 5KT3A 2VPQA 5BWWA 2PI5A 5L1IA 4PA3A 4FIPC 3JASA 4DV1O 2YRXA 2Q7GA 2DABA 3ABKC 3KAKA 1BS3A 5KG6A 2NNUA 2ZE8A 3J81N 2EJRA 1COWG 1TGOA 3CCVV 2N04A 2GV9A 1WB8A 1W93A 1HWYA 3FFQA 4C5BA 2FK3A 2FK2A 1YIJV 1OWTA 2Y4UA 2W0XA 4O2BA 1D5AA 3QQMA 1BE3H 2LO1A 5LOVB 2HVQA 1URFA 1KJQA 4TOIA 4LF7O 1O75A 2YCHA 1AJQA 2I87A 5LYJB 4X1IB 4X88A 1UC9A 5BR8B 2R84A 2ZDIA 1Y74A 3QWUA 4J9PA 2KQXA 3NXSA 3R23A 5JUMA 3CCUV 2YI8A 5CBHA 3OHBA 3CJHB 2AQ4A 2KSWA 1SRYA 1MZFA 3L74H 2EZOA 4DRXA 2CKZB 5IY5C 4X65O 1W0JG 4LF9H 3ZX6A 3ASNC 4GX0A 1VS0A 3CX5F 3FDSA 2HEPA 4GUNA 4AQYO 3R5XA 3JZFA 2R70A 4JI2H 3E86A 1GSHA 1ZL8A 3RYCB 2QA4V 3SPIA 3JARB 4B3MO 2DOSA 2JEGA 4TV9B 2PY5A 1IX9A 3HKCA 2YW2A 3DXRB 3DAAA 2WPDG 4LWSB 2NR5A 1G4YB 3CB2A 3NR7A 2DJVA 3AK1A 3CXHF 4CS4A 5ITZA 1X4TA 5BY1A 4DR7B 2W6NA 5B1AC 4CZZA 3RBDA 5K3WA 1NS1A 4ZOLF 4O4IF 1S0NA 1CP9A 5KG3A 3MHHC 4IWYA 5EOYA 4ECXA 4JI4O 1BQ0A 3UZOA 1NKDA 1JX4A 5DGHA 1ZHQA 4FM0A 1M4UA 5BMVB 3T9FA 4KP4A 4U7CA 1SZXA 2E2HA 5KHKA 1TUEB 3X2QC 3VPDA 3TEKA 4JV1A 2A1HA 3R5HA 2Q5ZA 3OMIB 1NR1A 3JD0A 4FJCC 4WFAV 1K83A 2J6UA 4J7KA 3KHHA 2JEXA 3RYFB 2WWWA 4CC6A 4MTXA 4UB8Z 1M1KW 2PN1A 1PX2A 1W2BU 3OD4A 5JWPA 2E5LB 1KTAA 2ZDHA 3I4NG 3K06A 3RUPA 3RAQA 3T1HH 2WLHA 2QYZA 3ABLC 3A0HZ 5KFNA 4QWBA 1ZETA 2YZMA 3A0BZ 3SJQC 1CKNB 1ET0A 1NZ6A 4AYBA 1SFOA 2FMLA 1TVKB 4ECRA 5LP6C 4EYHB 3OT7A 4MAMA 5LMNB 4LR3A 2R87A 4EYIB 3PW7A 2CE4A 4DV5O 4JI7H 2LW1A 3G4SV 2BOCC 4RO2A 1WP8A 4OXSA 4B3TB 3KZIZ 4PA9A 1KJ8A 3LSSA 1BGWA 2R8HA 5IP7G 5FNVF 3LDEA 4YIPA 1ORQC 3RB3A 1LNQA 4JYAO 2AU0A 4LCUC 3K03A 4X20B 2UUAH 1H2LA 2OIGA 1OCOB 4G28B 2B5UA 3CC2V 1TWFA 2WTFA 2YIAA 3WG7B 1CXZB 2IM9A 1WSCA 1ZTEA 4ZOLA 2YC0A 3VPCA 2JGDB 3NBYB 1AJNA 1N34H 2W6QA 1SZTA 1QCEA 4ZKIA 3J7AK 5LXTB 4J80A 4FFOA 3ASOC 2DWCA 2HJFC 5IWAO 2V5AA 4DV2O 2WA4A 4FK5C 4J9NA 2XC9A 2Y69B 3ZCCA 5KG2A 2P6JA 1KB9F 1IXBA 1EN4A 2L35A 3ZS8C 2R7LA 2PZSA 3B4SA 3W7XA 1BQZA 3AG3C 3H1HH 4WF9V 5BWVA 2ASJA 1DGSA 1KUTA 3EFFK 2PMZA 2GBOA 3M99B 4YXWG 1RK5A 5DM6V 4LFAO 4O3OA 3LMLA 4PDRA 1VAJA 4YY3H 1GYFA 1I5YA 3QG5A 5IYZB 5KHGA 3ZMSA 5JQGF 2HP8A 4H13B 2N74A 4NLGA 3ETEA 4JI8B 1CPYA 2W7OA 2YZNA 4EB6B 4O7YA 1MA1A 4QIWE 4FLYA 3KHRA 2JDIG 1BHAA 1OCZC 5I47A 1AI6A 3N6XA 2R8KA 5H6QA 3K04A 5F9NA 2YIBD 3RB0A 1V51A 2V4RA 1EN5A 3K5MA 1P7GA 3D3QA 1VIBA 3RFRA 1JDBB 2CTPA 2J9GA 1PNMA 1R3KC 2JA7A 1YI2V 5K1PA 1XNRB 2R93G 4Q20A 3GIPA 5IYBO 4LF5B 3E89A 3UQ8A 3JASB 2GQSA 5FNVA 3JRXA 2NUAB 3BA9A 2FLNA 2UXDH 5BWUA 3EHBB 2KSDA 4LF6O 5I60A 1N8RW 4LNUA 5JCOA 3T5JA 3H1IH 3GWKC 4JI5O 4JV5O 3TXSA 4LF8O 5BYBA 4O7NA 5KFLA 5KFYA 4JI0O 1T3NA 1AI5A 2Q0OC 1P16A 4O2BB 4OPAA 3GV5B 2HIVA 1KUQA 3GJXB 1IDSA 2O03A 1QLEC 1KYOF 1WLEA 5KFXA 1VQ5V 2Q2UA 4DR1H 4F4ZA 2JS5A 5KFKA 3GIMA 1Y74B 3CC7V 4KHPH 3OUUA 1AILA 3HOXG 1K73W 3HOVG 1OV9A 2FP4B 4DUYB 2OCHA 5KFTA 1NU1H 1S5LZ 3T1YB 2IBKA 4QNHB 4TM5A 2CTWA 1XMOH 2UU9O 3K5HA 1M56B 4DRXB 3OUZA 4ABMA 2JA8G 2WLIA 1S76D 2H8PC 4X64H 1JFFA 3JAWA 1J5EB 4E4TA 3Q8RB 3RR5A 4KFMA 2A79B 3VBBA 4NYEA 1I7NA 1MSWD 4DK0A 1R1BA 3SJAC 4XDJA 3VQXA 4D7TA 1AUVA 1YTFB 4DXWA 4A5UB 2BQ3A 2G38A 2P4VA 2QGNA 4LF4O 4JTCB 3HKCB 5FJ8G 4RUFA 3SNOA 3E8FA 1OBDA 3BEHA 3CCMV 5KS8A 3CCRV 1OHHG 5L3CA 5ITZB 4O4LB 4FFMA 2EIJB 4KUMA 1WPXA 4X1YA 4DV4O 3MJFA 2QWNB 2A7WA 4DUZO 4O83A 2BR0A 1E4GT 3F5WC 4DV3B 4YR2A 1RYSA 4JGSA 2XOKG 3CPWU 2IJJA 1GM8A 4Y8VB 3CCSV 1OCCC 4F50A 3BRCA 5LOVF 1I94H 3D36A 1GSAA 3NC0B 5LYJF 1Q6IA 5DEDA 1QR8A 1N32H 4UCTA 1WN7A 4MV9A 5I5SA 2UXCB 3RB4A 2F4VB 3JATA 1EZJA 4O2AF 3JALA 4DAAA 4EG0A 4A3FG 3GV8B 4PD4F 4YHHH 4P2ZA 1KBLA 1WA8A 3Q2OA 2OTJV 2JA5A 1KU9A 5I5UA 5EWEA 3WWIA 2AHZA 3LSUA 1VQ6V 3E8HA 4U3JA 4J7ZA 3K3VA 1S0MA 5I5WA 4J9YB 2F23A 3KTMA 2CQYA 2W9AA 2QKAA 1GM7A 1H2NA 4K0KB 5H2FZ 4C2MA 2RGRA 4FLXA 3ZRVA 2PMZE 1HP8A 3EXAA 5KFCA 3GTKA 2C35B 1JDEA 3T9AA 1GN2A 2LJ2A 1IBLB 4DV1H 5KHJA 1RPRA 4L8JA 1RM1C 4TV9F 5KT4A 4ECUA 3PR4A 3OTOB 4O3QA 2W9BA 3L4KA 3HOWG 2ITCC 1KJJA 3BACA 3GTJA 3MWEA 3G6YA 4JI7O 4O3PA 4DW0A 5KFHA 2EILC 2EZPA 4OPHA 2XHBA 2WB1E 1E4EA 4ZOLB 2NU6B 4A3BG 1I2LA 1LR1A 3RVZA 2VQFB 3N43B 4LF7H 3TQ1A 1R3IC 4DV6O 3TW7A 1NI8A 1FXKC 4O3NA 1QR9A 1W96A 1QNMA 2CTQA 1GM9A 2GUZA 2XAGA 3CYOA 1V55C 1JR9A 2PI4A 4X9QA 5KFRA 4DR6O 3QO8A 4TT3G 5EC1C 5CBGA 3C90A 3I55V 4DQNA 4O2AA 3K5IA 1HNZB 4X65H 1PK8A 1HNXB 4A3KG 2JA6A 2DYSB 5IYBG 4R7RA 4AQYH 1EBOA 3AYHB 5L3FA 3H1JH 1Y76A 5JH7F 4FBTA 2C00A 4ED0A 4DR5B 2OIEA 1NVPD 1XEQA 4OX9O 4LC1A 1B33N 1AI4A 1IBMO 5L1LA 2GLTA 2F1MA 4B3MH 2ADQB 2DZDA 3ZHVA 1N36B 4B3SB 3W7SA 2UVWA 5B1BC 1FD9A 5E79Z 5LHIA 3JD4A 5LGUA 3AG7A 2Y0SE 4GX5A 5DG8A 1Y1WA 4DR4B 2FB9A 3UCSC 3HKDA 1Q81W 2R9RB 1MMMA 4FFLA 3U55A 2R72A 4IAJA 5KFBA 1NQTA 4O86A 2XAFA 4UUGA 3DGEA 3GIIA 4XZ3B 4TV9A 4J9OA 4PI2A 5FNVB 5KAFZ 4JI4H 1W0KG 2YIBA 5KA6A 4I5SA 1K7DA 3CSWA 3SPCA 3OTOO 1RFYA 4W4KA 1OBGA 2W71A 2KB1A 4QWEA 2V9WA 1BL8A 3H1KH 4IIJA 4LNUB 2HHHB 2BOBC 3H0GG 4J9KA 4J9LA 3WO0A 4A3DG 3OE7G 2FK1A 5DQGA 2PUSA 1SQPH 1AROP 3QO7A 3IJ4A 1XILA 3BJYA 3GTOA 1YJ9V 4I4TF 4IRCA 3WU2Z 4WFGA 2UUBB 4RAIA 4HNUA 4B7EA 1Y66A 2C2DA 5KFVA 4AI8A 4NZNA 3CMEV 3SR2C 1OCRC 2I80A 1JIHA 3ABMC 2CW7A 3ABUA 2HG8A 3G6BA 2IH3C 2QWPB 2Q7HA 4JI3O 1ZUQA 1S0VA 1M6VA 3TIGA 3QZ7A 4CMFA 3G67A 2ZIMA 4HYOA 3BQ0A 2A06H 4IR9A 2F95B 3SYOA 2CNVA 1RSOA 2UUCB 1KKCA 4X66O 3AG4C 3TIIA 5C5JA 4NXMO 1R6NA 1S5HC 3DTGA 1Z2GA 2FLLA 3LUTB 3NUAA 1A0GA 5KFOA 5JH7A 4O3RA 2WLIB 5CA1F 2XAQA 1JFFB 1SQGA 3JAWB 3Q4HA 1Q5OA 2IMWP 2EJ0A 4DV5H 1CQJB 4UCVA 4PBCA 3MFHA 3JZIA 1GKFA 1TVKA 2IJIA 4RWUA 2ABJA 3JD1A 4PWQA 5KT5A 4ED2A 3J7AU 3GIDA 3KHLA 4JYAH 3PVXA 3MAQA 1RJQA 3BY6A 5LMUO 3OW2U 1VF6C 3G8CA 4AILC 2E75B 3WB0A 2OCCC 2JEUA 4LBEC 2JS3A 4X62B 4FLTA 4RZRA 1I50A 1S03G 4EBDA 1N33B 4X1YB 3BQ2A 1EHIA 1L8DA 2W70A 2BCCH 1HDJA 5IWAH 1ROPA 4DV2H 4X1KA 4PI0A 5EBMC 3ETDA 4YAJB 2HHFA 1J95A 1QVFU 3HXLA 4NVPA 4I4TA 1OZ0A 1D5NA 3H4BA 2RNBA 4ECWA 2W6IG 1FJGB 2YZLA 2QJ1A 3QO5A 2DWDC 4PDMA 2YEVB 3S24A 3SYCA 2WE6A 4LFAH 3RGXA 2IH1C 2ATKC 3OUSA 1F23A 3K0GA 4DV0O 4LFBB 1VQKV 2VQEB 3B8MA 1KQSU 1H2SB 1WA8B 4HNAA 2RDJA 1XQ8A 1K5QA 4UVBA 2R7ZA 4BWSC 3V6HA 4U3JB 3F5TA 3ZMUA 2WDTA 4Z1VA 4WFEA 1VF7A 1SEIA 2B1IA 1TWAA 4ED1A 1N4CA 5KX5A 3G6EV 2UXBB 3OR7C 5CA1A 4FFPA 3OEEG 4ECTA 2AGOA 3ZRWA 2B63A 3AG1B 3FB6C 5F9LA 4MV4A 4I50F 2XAJA 2R7KA 1VEWA 3KG2A 5LHHA 3V6KA 3QNEA 4J42A 3AK2A 3L70H 1ULZA 5HFLA 5KT6A 5IP9G 4B3TH 4I9QA 1VQ4V 5IYDG 1SQVH 3E83A 2W9BB 4LF6H 1VF5B 4A3MG 1K34A 1C30A 4JI5H 4JV5H 1Q6HA 4LF8H 2ZT9B 4O4LF 3FYEB 1VQMV 4O84A 5EBLC 4JI0H 3ICXA 1GK9A 3KXYT 4FS1A 1E4EB 5LHGA 2OH2A 2LQTA 3LDCA 4UCSA 2JK5C 5TISZ 4Q44A 2CAZC 3F7VC 1TWHA 4YJ2F 3OEHG 3M4IA 1AP5A 3ORRA 4FM2A 1R3LC 5C44G 2GUZB 3BAAA 5JJEB 5B1OA 4NR1A 1M5IA 4Q45A 2UU9H 1RJRA 3DTUB 4O2AB 2YRWA 4PHZA 3FB8C 1G1XB 4DK1A 4P9OA 1RPOA 3CCLV 1K4DC 4DR2O 2D3OW 1GN4A 4U7OA 3W7WA 3BABA 4RUCA 1Y76B 2Q73A 4UVAA 4DV7B 1HR0B 4CKCA 2RF4A 1IZ3A 2LFRA 4HZ3A 4NXNO 2VOBA 4LF4H 4GYCB 2DYRC 5LGTA 2OYQA 5IY5B 2M6YA 4JI1O 2F93B 3HKDB 4I50A 4JASA 1Q6UA 3A0RA 4IHJF 2W6ZA 3GIJA 3PR5B 1OJHA 4UCRA 4QWCA 2FLPA 4I55F 4DV4H 3GTLA 4BR6A 3HOYG 2X6BA 1KJ9A 3HPLC 1AJPA 2Z5UA 1YJNV 4DUZH 5IT9N 4ZIBA 4B3RB 4O4LA 4IIJB 2ZE5A 4CC5A 4NTWA 2YS7A 4LSXA 1A9XA 1EKVA 4LH6A 2ASLA 1IOVA 2EJ7A 3U10A 2HJWA 1HNWB 2JJ2G 4MW3A 2E2IA 1K4CC 3HR0A 2QDOA 3S3XA 1B06A 1XOUA 5KUKA 4FFRA 4YJ2A 5A9GA 4CE5A 2DIKA 3CHXA 2YXLA 2ZDQA 1DK1A 3EPIA 3UZBA 3GV7B 3BG5A 2MW2B 1QVGU 3T7AA 1GN6A 3JZ6A 3WWHA 4BW5A 1S68A 2AGPA 1XNQB 3CWBH 2DLNA 1RSOB 4DUYH 1P8LA 4P9PA 3I56V 2ZIOA 3HKZE 1N48A 2EBOA 3B09A 1MABG 1QQCA 3W7TA 1IBKB 1XDNA 2EJ3A 1MG1A 5BR8O 2JA7G 2YXHA 4K35A 2OWOA 2W8LA 1P4RA 4JZ2A 1YVWA 5JH7B 5BYAA 3BVOA 4H33A 1A0IA 3LULA 3PO2G 3Q4HB 3O65A 3TQTA 3TY5A 3P3PA 4GC6A 4ECYA 1PNLA 5LGNA 2ZGIA 3ABLB 4O7TA 2Y0IA 2R86A 4WCEV 1CKMA 4GKJB 3WNZA 5KFQA 1YZBA 1SC5B 4J9SA 3NBZB 3H1LH 3TY8A 2W6OA 4IHJA 1I6UA 4I55A 1A48A 3TINA 4GKKB 2RQ6A 5L9XA 1V54C 4FLZA 4Z2WA 4DV6H 3K59A 3N2KA 2NU7B 4UV8A 1SQXH 1KKDA 2QWQB 1O9GA 1VMGA 4X1KB 1QLNA 5KFZA 5EWGA 3GTGA 2HKOA 2HHFB 3DSQA 4DR7O 2RMKB 1RJPA 4I4TB 3CD6V 1VQNV 3L9DA 3SPHA 4DR6H 5J9PC 1OCOC 3SE7A 1DV2A 5FPRA 3UM7A 5CBFA 5B66Z 5H6RA 1GMGA 1YDXA 2GQRA 4O82A 2X6AA 1FXKA 1R3JC 4HBNA 5KFGA 1CQIB 2WAMA 3ZHRA 4MVUA 2NVYA 3G71V 4OX9H 2VRZA 4HNAB 3K57A 1IBMH 2Y69C 3AG3B 2I8CA 2K9PA 3GTQA 2Q4PA 3ZHTA 4Z1MG 2PBZA 4LP8A 3AG2C 5KX5B 1QHTA 2LGQA 5CA1B 2E5LO 3HOUG 1JMKC 3IGAC 4Q8FA 3N41B 3ZRWB 3ZJZA 1R73A 5GW7A 1NH2B 1M57C 1GLVA 4J9QA 2YXYA 3MWMA 2E76B 2FTKA 2WLLA 4M7EA 3JD2A 1P7BA 5LL6Y 4CH3A 2P7TC 3OTOH 2GSMB 4FE2A 1BSMA 2CFMA 2BQRA 3L73H 4TUYA 1WP7A 5LMNO 4YBZB 4R6ZA 2XT9A 3JAKA 2NU8B 2ZJTA 1K3EA 4PDVA 1FKAO 1H8EG 1DAAA 5DQIA 4I9WA 4MV3A 4B3TO 1XDCA 3A8TA 4ETSA 4JF3A 2J6SA 4MVZA 5KG4A 2P06A 2OT5A 2VWKA 2ZD9A 4JI2B 5DAAA 1PL4A 4DL3A 4JI3H 3T4DA 5HNEA 4JAVA 2D2CB 2JA5G 2FYUH 4PDLA 2XCPA 2ODTX 3GIQA 3OTFA 4J7JA 3B2EE 1AB3A 3N2GA 4W4LA 3CSXA 5IJ0A 5CB4F 1I7FA 3CRQA 4X66H 4MS2A 3PFFA 4CMDA 4NXMH 1S72V 4WBNF 1F4NA 3KCYA 2IU0A 1WR2A 1QLEB 2HVRA 2A3QA 4QW9A 3T9EA 2PTMA 4QJFA 4QPJA 4HNVA 3SYQA 1H2GA 3P30A 2FMAA 1B6SA 1Q82W 5KG7A 1I3QA 5DGAA 2MCTA 2EIKB 3C3SA 4NZMA 5D1PA 5KFUA 1A32A 4JYBA 4O7LA 1XBLA 3VA7A 2PF4E 4ASUG 1L0LH 1GRJA 5LMUH 3TJTA 4OGQB 1I08A 4Q43A 4JI8O 4I50B 3T99A 1S10A 5FD6A 4O4HF 1NVPB 2HGWA 3UFXB 2ARHA 2GDSA 5J2UF 5C1PA 1RK6A 1I2KA 4P30A 4BWAA 3T1HB 4AYBE 2VA2A 4FZ0A 4RNMA 2ZNIA 3GILA 3M8AA 1XNRO 1ZAUA 4LF5O 4D6TH 1PP9H 1TWCA 1K33A 4MVSA 3HO8A 2AXTZ 2JA6G 5DMXA 2W8KA 1EZ1A 3CXCU 2ASDA 4YJ2B 2H3OA 1MZEA 2EIJC 3ETQA 1JOYA 3ZHUA 4DV0H 4RNOA 5IJ9A 1NJIW 3GLKA 4FFKA 4MSWC 5D8DA 5L3BA 5C8YF 5CB4A 3PW0A 3CCQV 4X8AA 2YEVA 1OCCB 2LFSA 1PD3A 2UUAB 1VBHA 2EX3A 2QM8A 2R9IA 5EZYF 4YB8B 1Y1WG 4WBNA 1T5EA 2MK3A 2X6CA 4R8CA 3R65A 3R5FA 3U9TA 3FYIB 2CGOA 2DPIA 4Q4CA 3UT5A 1N34B 4F4WA 2QB5A
chains in the Genus database with same CATH topology
2F95B 1RSOA 2UUCB 2BTOA 1CKOA 4K0KH 4LH7A 5BR8B 1TAEA 2PGGA 3QWUA 1IBLH 4LMYA 2UU9B 3LNNA 2YI8A 5JH7A 2KSWA 4D7SA 1JFFB 1SQGA 3JAWB 1Q5OA 4DV5H 4UCVA 4DRXA 4LF9H 5LL6b 2VUGA 1TVKA 4O4HA 3RGZA 3SJBC 1VS0A 4IHJB 2HEPA 5EIBC 4I55B 5J2UA 3ZEDA 4JYAH 2R70A 4JI2H 5FD5A 3MAQA 4LF9B 3RYCB 4AILC 3HKEB 4LF4B 3N2KB 3JARB 1M93A 3GB8B 5D1OB 3KAJA 3WB0A 4FLTA 4MTDA 2VQFH 4X62B 4TV9B 2PY5A 4RB0A 1S03G 1FFXA 3HKCA 1N33B 4X1YB 4FM9A 1L8DA 3A2FA 3CB2A 3U11A 5IWAH 4CS4A 5ITZA 1X4TA 4DV4B 4DV2H 4DR7B 4X1KA 4PI0A 2KKWA 4DUZB 1Q8IA 4Q0YA 5EOYA 3HXLA 3PN1A 4NVPA 4PDBA 4I4TA 1WPBA 1JJOA 5C8YA 1ZHQA 3HKBA 2UXDB 3KALA 4DR2H 4FM0A 1M4UA 5BMVB 1HNXH 1FJGB 1AN7A 2QJ1A 5KHKA 3S24A 2P22C 3F8NA 4LFAH 2WE6A 5EZYA 3RYIA 3RGXA 5LA6A 4DR5H 3DF7A 4LFBB 2VQEB 4NXNH 3SGIA 4ZHQB 3W1GA 1H2SB 1N36H 4HNAA 3RYFB 1M0WA 4B3SH 1SKVA 1XQ8A 4CC6A 3WB1A 4BWSC 3K5OA 4JI1H 4U3JB 4DR4H 2WDTA 4RB1A 1SEIA 3QTCA 1VF7A 2E5LB 3KYHC 5KX5A 3RIZA 4DR1B 2UXBB 3FMAA 3T1HH 5CA1A 4CS3A 4KHPB 1CKNB 3E22B 2Q0AA 4MTEA 5JQGA 1TVKB 4UCOA 4TUYB 3W5OA 5LP6C 3JAKB 4B3TH 5KHIA 1XMOB 2HVSA 2HHHH 1L2ZA 4I9QA 1FVIA 4CS2A 5JJJB 5LMNB 4LF6H 4LR3A 4O4JA 1WNSA 4JI7H 2W57A 4JI5H 4JV5H 4LF8H 4X64B 3RGBA 4B3TB 1BGWA 2UUBH 1MZBA 4JI0H 3ICXA 3KXYT 4PZ7A 4FLVA 4JI7B 4X20B 2UUAH 4UCSA 2QM4A 1G6UA 3N2GB 2YIAA 4TV8B 2CAZC 2IM9A 5IJ0B 4ZOLA 2F66C 3M4IA 4LFCH 4MV7A 4DV6B 3NBYB 4FM2A 1N34H 4PZ8A 3J7AK 5LXTB 2UUCH 1KMIZ 3JAMW 5BR8H 5EYPA 3BAAA 4UCUA 4LFCB 1YEWA 4E6NA 5JJEB 1M5IA 3ZS8C 2UU9H 4ZI7B 2PZSA 4O2AB 4DR6B 4PHZA 5JVDB 4JI6H 4DK1A 5JJNB 2VPSA 2E3CA 4YJ3B 1DGSA 4EEQA 3BABA 1I94B 2ZCEA 2RGVA 4JI6B 4DV7B 5KMGA 3LMLA 1HR0B 4YY3H 1GYFA 3QG5A 5IYZB 5KHGA 2R9AA 1BJTA 4OX9B 1IBMB 1Z2OX 2VWJA 4UFZA 2VOBA 4GYCB 4LF4H 3N42B 4JI8B 2OYQA 3H20A 4X62H 4LSAA 4EB6B 4YY3B 1N33H 2F93B 3HKDB 4YHHB 4FLYA 4I50A 5LP6A 3N6XA 4UCRA 2YIBD 4DV4H 4F6RA 1V9PA 3K5MA 4FM1A 4DR7H 5J2TB 3RFRA 4DUZH 1B04A 1TUBB 4O4JB 5K1PA 1XNRB 4ZIBA 4B3RB 3VQYA 4O4LA 4IIJB 4CC5A 4LF5B 3UQ8A 3JASB 4RAYA 5FNVA 1Z2NX 4LSXA 3BA9A 2UXDH 5GONA 1FJGH 3JSNA 3RWRD 4LH6A 4DV1B 3U10A 1HNWB 4J0MA 5IJ9B 4LNUA 5JCOA 5CA0B 5CB4B 4YJ2A 3CVZA 2ZNJA 4LFBH 2VQEH 4O4IB 4FLUA 3W1BA 3THOA 3CHXA 2YXLA 1P16A 4O2BB 2BTQA 3RYHB 4WBNB 2HIVA 3GJXB 1SA0B 4JI3B 4EFEA 2O03A 1S68A 3UT5B 2E5LH 1ZHSA 3WB2A 1XNQB 2JVDA 2Q2UA 4DUYH 4DR1H 1P8LA 4FFBA 2FE3A 2UXBH 5LOVA 2ZIOA 3U0ZA 2JS5A 1IBKB 1QQCA 1TA8A 5LYJA 4KHPH 1XDNA 4X66B 4X1IA 4TQFA 4DUYB 1E4FT 4NXMB 2OWOA 3RF2A 5JH7B 4CH5A 3T1YB 1A0IA 3IG0A 4B08A 1XMOH 3TY5A 5A2QW 1SQFA 5LMNH 4DRXB 4A2BA 4EQ5A 3BA8A 4O4HB 4CH6A 4Q6GA 5IT9W 1FKAH 4X65B 4X64H 1JFFA 3JAWA 1CKMA 4GKJB 1J5EB 5J2UB 3RR5A 4AQYB 3NBZB 3TY8A 4FLWA 4DK0A 3SJAC 3VQXA 4D7TA 4IHJA 4AHCA 3C0FB 1I6UA 4I55A 3VQVA 5LMUB 4GKKB 1FFXB 2RQ6A 3HKCB 4B3MB 2XIGA 3RYCA 4FLZA 4A2AA 3HKEA 3K59A 3N2KA 1SYXB 4DV6H 3JARA 5D1OA 4K8ZA 5ITZB 4O4LB 3K58A 1O9GA 4X1KB 5JCOC 4X1YA 3DSQA 3N44B 3K5NA 1Z5WA 4I4TB 1E4GT 4DV3B 4DR6H 5C8YB 3HKBB 4JI4B 5FPRA 4RB3C 1M0TA 3BRCA 5EZYB 3RYIB 1I94H 5LA6B 3NC0B 5BMVA 4HBNA 3L2PA 3J80W 4DV7H 1N32H 1HR0H 4UCTA 1WN7A 4APMA 4DV0B 4MV9A 1O9HA 2UXCB 4OX9H 4HNAB 3K57A 5FPOA 1IBMH 2F4VB 4I7HA 3JATA 3JALA 3QF7A 4TQDA 4DRFA 4JI8H 1N32B 5DISC 4ZHQA 4KL1A 4YHHH 3RYFA 5KX5B 3JSLA 2CW8A 1KU9A 1QHTA 5CA1B 3VQWA 3K3VA 4U3JA 5EIBD 3EYYA 1XMQH 1JMKC 3N41B 2P5OA 4K0KB 1HNZH 5JQGB 1WH2A 3MWMA 1XNRH 2RGRA 4B3RH 4M7EA 3RJ0A 1Q3EA 4FLXA 1XMQB 4LF5H 1CKNA 4CH3A 3OTOH 4DR3H 3E22A 3BHPA 1Q43A 1IBLB 2HIXA 5K1XA 4DV1H 2CFMA 5KHJA 4TUYA 4L8JA 1HNWH 3JAKA 3K5LA 2ZJTA 4DV5B 4RB2C 3OTOB 2V4DA 4DR3B 3L4KA 4ETSA 3J81W 1Z5VA 2VWKA 1XHZA 4JYAB 2PYJA 4JI2B 2XHBA 4ZOLB 4JI3H 4X20A 2VQFB 1XNQH 3N43B 4LF7H 2Q7EA 3OTFA 3B2EE 3N2GA 4TV8A 2PYLA 3CSXA 5IJ0A 5EYPB 1I7FA 1IBKH 4X66H 4LF7B 4FVMA 5LXTA 5IWAB 4NXMH 4DV2B 3T1YH 1Z2PX 2HVRA 3L4JA 2PTMA 5D5QA 3IAYA 4ZI7A 4O2AA 4X65H 1HNZB 5JVDA 4DR2B 1HNXB 3JATB 4GKJH 1J5EH 3JALB 4R7RA 5KMGB 2MCTA 3N40P 4AQYH 5D1PA 1P49A 4YJ3A 4LFAB 1XHXA 4DR5B 5LMUH 1XI1A 4NXNB 1HW7A 5D5PA 4GKKH 2F1MA 4B3MH 5IYZA 4I50B 5LP6B 1N36B 4PZ6A 4B3SB 5FD6A 2ZM6H 4JI1B 5KHHA 5FLXW 2ZINA 2RJZA 4EB6A 4F6RB 4DR4B 2Q2TA 3BPZA 3HKDA 4IAJA 2R72A 4BWAA 2ZM6B 3T1HB 2JGUA 1XK5A 4TV9A 4K8XA 1NT2B 2ZNIA 4PI2A 3GDEA 4DV3H 5FNVB 3M7MX 5J2TA 4BW9A 1ZAUA 2WYOA 4GLXA 2YI9A 2YIBA 3TY9A 5GONB 4JI4H 1TUBA 4IIJA 2HGSA 4LNUB 3JASA 2HHHB 4RZQA 2Q7GA 4LF6B 3KAKA 4YJ2B 2PUSA 1S5JA 3ETQA 4EFBA 1TGOA 4JI5B 2GV9A 4JV5B 4LF8B 5IJ9A 4DV0H 2UXCH 5CA0A 2BTQB 2UUBB 2F4VH 4JI0B 3VNNA 5CB4A 3FFQA 4O4IA 3SR2C 2CW7A 3SJCC 4CH4A 2UUAB 2EX3A 4O2BA 1D5AA 2Q7HA 3RYHA 4FFBB 4WBNA 1T5EA 5LOVB 2HVQA 1X9NA 2ZIMA 1SA0A 4TOIA 1O75A 2YCHA 5LYJB 3RTXA 4RAZA 3UT5A 1N34B 4X1IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 B;  4B3T B;  1IBK B;  2UUC B;  1TA8 A;  1CKO A;  1XDN A;  4LH7 A;  4X66 B;  5BR8 B;  4PZ7 A;  1TAE A;  4DUY B;  4NXM B;  4JI7 B;  2OWO A;  4JYA B;  3QWU A;  4JI2 B;  3T1Y B;  4UCS A;  1A0I A;  2UU9 B;  3TY5 A;  2VQF B;  4EQ5 A;  3BA8 A;  4DV6 B;  4UCV A;  3NBY B;  4X65 B;  4PZ8 A;  1CKM A;  4GKJ B;  1J5E B;  2VUG A;  1VS0 A;  3RR5 A;  4LF7 B;  4AQY B;  3BAA A;  3NBZ B;  5IWA B;  4LFC B;  4UCU A;  3TY8 A;  4E6N A;  4DV2 B;  4LF9 B;  5LMU B;  2HVR A;  4LF4 B;  4GKK B;  4DR6 B;  4B3M B;  3GB8 B;  5D1O B;  4X62 B;  1N33 B;  1HNZ B;  5D1O A;  4DR2 B;  1HNX B;  1DGS A;  4EEQ A;  3BAB A;  1I94 B;  5D1P A;  4JI6 B;  4LFA B;  4DV7 B;  4DV4 B;  1HR0 B;  4DR7 B;  4DR5 B;  4DUZ B;  4OX9 B;  4NXN B;  1IBM B;  4UFZ A;  4DV3 B;  3PN1 A;  4JI4 B;  4JI8 B;  5FPR A;  1N36 B;  4PZ6 A;  4B3S B;  4YY3 B;  4JI1 B;  2UXD B;  4YHH B;  1FJG B;  4DR4 B;  2Q2T A;  3S24 A;  4UCR A;  3NC0 B;  3L2P A;  3T1H B;  1V9P A;  4UCT A;  2ZM6 B;  1XK5 A;  4DV0 B;  4LFB B;  2UXC B;  1B04 A;  2VQE B;  5FPO A;  3GDE A;  2F4V B;  3SGI A;  1XNR B;  1ZAU A;  4B3R B;  4DRF A;  4GLX A;  3TY9 A;  3W1G A;  1N32 B;  5DIS C;  4CC5 A;  4LF5 B;  3UQ8 A;  4CC6 A;  3BA9 A;  3JSN A;  3JSL A;  4LH6 A;  4DV1 B;  2HHH B;  2E5L B;  1HNW B;  3KYH C;  4LF6 B;  4DR1 B;  2UXB B;  4EFB A;  4JI5 B;  4JV5 B;  4LF8 B;  4KHP B;  3W1B A;  4K0K B;  2UUB B;  1CKN B;  4JI0 B;  3VNN A;  1XMQ B;  1P16 A;  1CKN A;  4UCO A;  2HIV A;  3W5O A;  2UUA B;  3GJX B;  1IBL B;  2HIX A;  1XMO B;  4JI3 B;  4EFE A;  2HVS A;  2CFM A;  1S68 A;  1X9N A;  1FVI A;  2HVQ A;  5LMN B;  1XNQ B;  4TOI A;  2Q2U A;  4DV5 B;  1P8L A;  3RTX A;  3OTO B;  4DR3 B;  1N34 B; 
#chains in the Genus database with same CATH topology
 2HG5 C;  4H0L B;  2R8J A;  2BTO A;  3EVK A;  3B77 A;  1K5S A;  5B3S B;  4C5A A;  1TAE A;  4DUY O;  1F7Y A;  4PA6 A;  1JVM A;  1UFI A;  2Y0P A;  3HB9 A;  3T1Y O;  4J41 A;  4J10 A;  4LMY A;  3UO3 A;  3LNN A;  2CTR A;  2XCL A;  2R92 A;  3Q8S B;  3OFN G;  3M9O B;  3E8G A;  3E35 A;  3VPB A;  1CS0 A;  5LL6 b;  1J5E O;  1YCI A;  4O4H A;  3FKI A;  1YF2 A;  4IHJ B;  4M0J A;  5EIB C;  4I55 B;  5J2U A;  3ZED A;  3TK1 A;  3MR2 A;  3JCZ A;  2HVJ C;  1NBM G;  3H01 A;  4ED7 A;  4U7N A;  4DYL A;  3N2K B;  1M93 A;  3GB8 B;  4IIJ F;  4MTD A;  1S9F A;  5I5Y A;  5DGB A;  4RB0 A;  1VQ7 V;  1FFX A;  5EDW A;  4UB6 Z;  3ABT A;  1VQ9 V;  4QWA A;  3AW8 A;  3A2F A;  3JRW A;  2HFE C;  4WFF A;  2VR1 A;  4IYH A;  1U96 A;  2DPJ A;  3LDD A;  4GX1 A;  4PEL A;  5L3E A;  3ZHS A;  3ETH A;  3RN4 A;  2KKW A;  2UVR A;  4IT5 A;  4GT1 A;  4Q0Y A;  1KP2 A;  5KFD A;  4DV3 O;  5CA3 A;  1GO3 F;  4Q8E A;  1IXM A;  1WPB A;  1JJO A;  5IYD O;  4QE7 A;  5C8Y A;  1FXK B;  1M90 W;  2UXD B;  3GB7 C;  2YS8 A;  4DR2 H;  4NZO A;  1AN7 A;  3ZMZ A;  1A3G A;  3ORQ A;  3SYA A;  2P22 C;  3CRC A;  3GVM A;  5EZY A;  3RYI A;  3FB5 C;  3CP1 A;  4FZ1 A;  4IL6 Z;  5LA6 A;  3UYY A;  3DF7 A;  1VQ8 V;  2UXC O;  4TQS A;  4NXN H;  4JUZ A;  2F4V O;  3SGI A;  5H9C A;  4ICG A;  1M0W A;  3WO1 A;  1E79 G;  3GWO A;  3WB1 A;  4JI1 H;  3K5O A;  1JA8 A;  1D2D A;  2NU9 B;  2W6J G;  2DYS C;  3RIZ A;  2HGX A;  4DR1 B;  2ILM A;  2XD4 A;  5DG9 A;  5KG5 A;  2WLL B;  5KA5 A;  1H2M A;  4CS3 A;  4KHP B;  4K0K O;  1YIT V;  1FFT B;  4ECV A;  3RV4 A;  2Q0A A;  5LP6 F;  4F4L A;  3ZIA G;  2SCU B;  4UCO A;  4TUY B;  3W5O A;  1JQ0 A;  4PJ0 Z;  3JAK B;  1IBL O;  5KHI A;  1XMO B;  2HVS A;  4GX2 A;  1FVI A;  4CS2 A;  1KT8 A;  4I0X A;  1WNS A;  3T2M A;  1E1Q G;  2N05 A;  3T1C A;  4R50 A;  4F6E A;  2P4K A;  5I5T A;  3H4D A;  4X64 B;  3RGB A;  2B1G A;  3L75 H;  5BWR A;  1MZB A;  2V1D A;  3M9M B;  4B7K A;  3BFR A;  3HB3 B;  2X7R B;  1L0N H;  4NYK A;  2F43 G;  2R7Z G;  2DQ3 A;  2QWR B;  2H94 A;  2YS6 A;  3N2G B;  2C2E A;  2DN9 A;  2VQF O;  5IJ0 B;  1BNC A;  5IYC O;  2F66 C;  1WRV A;  2EIN C;  2WAQ A;  1AP6 A;  1W59 A;  3I4M G;  2ZKO A;  1KMI Z;  1JLL B;  5BR8 H;  1V4Y A;  2B63 G;  1OCR B;  3GIK A;  4MTG A;  1DV1 A;  4UCU A;  3ABM B;  1YEW A;  4LFC B;  4E6N A;  3CS5 A;  4QJF B;  2JJ1 G;  1FXV A;  2X0S A;  1Y1V A;  3OSN A;  2AHY A;  2ZE6 A;  1UJW B;  3STL C;  2E3C A;  1HNZ O;  1HNX O;  3U54 A;  5KX5 F;  3AG4 B;  5KG0 A;  1I7L A;  1K9M W;  4KXR A;  1I94 B;  2VQD A;  4JI6 B;  3MR5 A;  1YHQ V;  4XDK A;  3JD3 A;  4DR5 O;  2HVK C;  5CN0 A;  1Z2O X;  4MVM A;  2VWJ A;  2AZ0 A;  1FAF A;  4HR7 A;  1PKX A;  3N42 B;  1ZQ7 A;  2EIM C;  2COG A;  1N36 O;  2EJ2 A;  4B3S O;  3FD9 A;  3H20 A;  3P32 A;  4RQE A;  1JXL A;  4YHH B;  1SF9 A;  1N0J A;  5LP6 A;  4L1K A;  5K2M A;  3GTM A;  4DR4 O;  2ETN A;  4G3I A;  2LGW A;  4XBF A;  3ZMT A;  2QTO A;  3KRE A;  4DR7 H;  2Z3Y A;  2YID A;  4FM1 A;  4BXX G;  2ZXW B;  1RP3 B;  3CCE V;  5KKN B;  3FX7 A;  1B04 A;  1N56 A;  4O4J B;  1VQL V;  2ADP A;  4QE9 A;  4MV8 A;  5BPH A;  3VQY A;  1NR7 A;  3RBE A;  2Z0A A;  4O7W A;  2QE7 G;  1Z2N X;  3VOT A;  3AX6 A;  3EPG A;  5FL7 G;  4EBC A;  3RAX A;  5GON A;  2HHH O;  4DV1 B;  4QGP A;  2DMX A;  5DLF A;  3D3I A;  5IJ9 B;  2UXX A;  1BMF G;  4MW8 A;  4G27 B;  1R9T A;  3K3W A;  5CB4 B;  4MT8 A;  4C7U A;  4O7V A;  3CVZ A;  4HYK A;  2UUB O;  3THO A;  1X59 A;  2IBZ H;  3MD0 A;  3GQC A;  2BTQ A;  4WBN B;  3IN5 A;  1CEZ A;  2UVU A;  1GGO A;  3HBL A;  3D36 C;  4EFE A;  3E8B A;  1XUQ A;  4X89 A;  3UT5 B;  2E5L H;  5KFJ A;  5I5V A;  1AVM A;  2JVD A;  4LFC O;  4FFB A;  2FE3 A;  4ECS A;  3CRA A;  2QSA A;  2IA6 A;  2UUC O;  1T94 A;  4JV2 A;  5HFM A;  4HQ6 A;  2NLJ C;  4ZHQ F;  4TQF A;  5BPF A;  1SES A;  1VBG A;  1G8M A;  4NTX A;  4QWD A;  3CMA V;  3TXQ A;  3CRR A;  3ZRS A;  4QIW F;  1SQF A;  2YDE A;  5LMN H;  4ED8 A;  4JYC A;  4A2B A;  2LW7 A;  4EQ5 A;  4O4H B;  5KUM A;  4CH6 A;  4Q6G A;  2JEF A;  3QFF A;  1FKA H;  5DG7 A;  5IT9 W;  4X65 B;  2VA3 A;  5J2U B;  3AK3 A;  2QEX V;  5DEC A;  2QKS A;  2WLJ A;  2RCV A;  4AQY B;  4O81 A;  4FLW A;  3AG1 C;  1K1S A;  2JIZ G;  3C0F B;  5L1J A;  3VQV A;  1DF5 A;  3OGI B;  1XL4 A;  2EUL A;  1FFX B;  2XIG A;  1EM1 A;  4B3M B;  4DL6 A;  5KG1 A;  4X62 O;  4A2A A;  3HKE A;  4A3E G;  1N33 O;  3K0D A;  5D1O A;  4K8Z A;  4K6N A;  1KEC A;  3SDL A;  3ABK B;  3R9R A;  2ZR3 A;  4JAU A;  3L72 H;  3O9O A;  2Q9L A;  3PW2 A;  4Q4D A;  4WFH A;  2P90 A;  3K5N A;  4EBE A;  1Z5W A;  1U97 A;  1WCM A;  4TV8 F;  2KG7 A;  5F2V O;  3TET A;  5C8Y B;  1KEE A;  4JI4 B;  3OUF A;  2PVP A;  1IOW A;  5HV6 A;  1M0T A;  2DQ0 A;  2JEJ A;  3CRM A;  1I1M A;  4O7R A;  2CUG A;  5EK0 A;  1FJG O;  5EZY B;  3RYI B;  4WFB V;  4XYM B;  3ML0 A;  4M9U A;  1CE8 A;  5LA6 B;  4ECZ A;  3L2P A;  2B9Z A;  3HT5 A;  3STZ C;  4J9R A;  4LFB O;  2WAQ E;  2VQE O;  1GO3 E;  5FPO A;  4CBC A;  4I7Z B;  2CGN A;  4CKE A;  4ZI7 F;  4F4Y A;  3ZN0 A;  5JVD F;  4JI8 H;  4BAY A;  5LBQ A;  3GTP A;  4R7C A;  1SET A;  4ZHQ A;  4KL1 A;  1VAR A;  4YJ3 F;  3JSL A;  3E5N A;  2ZDG A;  4R8U A;  3TW6 A;  2C22 A;  4IR1 A;  5L1K A;  2HJD A;  2UXB O;  4QIW A;  3ASN B;  3IFX A;  2M7W A;  3K08 A;  3WWJ A;  4DL2 A;  4FBU A;  5IYC G;  3BCC H;  5H80 A;  4YIO A;  2DYR B;  2P5O A;  2LP7 A;  1WH2 A;  1XNR H;  2IJH A;  2XAS A;  1Q3E A;  1XMQ B;  4LF5 H;  4C5C A;  1BZK A;  1YSC A;  3E22 A;  2Q69 A;  4ZBM A;  5DLG A;  1TWG A;  1Q43 A;  4I0X B;  2HIX A;  5DN6 G;  3K5L A;  3OAA G;  1ZX3 A;  1PNK A;  4DV5 B;  2V4D A;  4DR3 B;  5J2T F;  4EGJ A;  3T5K A;  4WHX A;  1GH6 A;  5B1A B;  3E2E A;  2QKC A;  4TVI A;  4JYA B;  3APO A;  5JQW A;  1AR1 B;  3U9S A;  1VKZ A;  1S0O A;  5KT7 A;  3G8D A;  4N21 A;  5CMU A;  4G2K A;  1EN6 A;  5CA0 F;  4TV8 A;  3OM3 B;  3UKM A;  2VUM A;  3DTF A;  1JCH A;  3X2Q B;  2HDK A;  2CDY A;  5KAI Z;  1UC8 A;  4JYY A;  3RVY A;  5IWA B;  4DV2 B;  2YZG A;  3ZMV A;  1EYZ A;  3T1Y H;  1Z2P X;  1KJI A;  1R6K A;  1ZSP A;  1I5X A;  3OR6 C;  4FU0 A;  3T9C A;  2Q67 A;  4ZI7 A;  1JJ2 U;  1EFR G;  5JVD A;  1EUD B;  5IDJ A;  4RUA A;  4UUJ C;  1J5E H;  1PM9 A;  1H38 A;  1P49 A;  4YJ3 A;  4DV7 O;  3AEI A;  4LFA B;  1C3O A;  2YL2 A;  4YR3 A;  1HR0 O;  5H5N A;  1XHX A;  1XI1 A;  1SQB H;  5KFA A;  5D5P A;  3SPG A;  5LP6 B;  1AR5 A;  4PZ6 A;  4MA0 A;  2YSU B;  4TUY F;  3PW5 A;  2Z02 A;  3G6V A;  5FLX W;  3HOZ G;  1B3Q A;  1NTK H;  2ZIN A;  2FKX A;  2RJZ A;  3KCX A;  2Q2T A;  4FMT A;  3WFV A;  3L71 H;  1XMQ O;  4JAA A;  2ZM6 B;  2JGU A;  3FAV A;  1I1L A;  5KT2 A;  3T54 A;  4K8X A;  3RFC A;  1V54 B;  4XDL A;  3D8C A;  4DV3 H;  4MVO A;  3M7M X;  2IU3 A;  5J2T A;  3N6R A;  1THZ A;  4B3R O;  2V58 A;  4GLX A;  2YI9 A;  5GON B;  2C2A A;  1TUB A;  1PPJ H;  1FYJ A;  4DR3 O;  2CNU A;  4RUE A;  4MTO A;  3KKY A;  2HGS A;  2IJK A;  4BY1 G;  2COJ A;  4RZQ A;  2RDI A;  3V4Z A;  4CKB A;  1HNW O;  2GHY A;  4LF6 B;  3G6X A;  3WG7 C;  1Y67 A;  1S5J A;  2UVV A;  4EFB A;  3CE2 A;  2P0A A;  4UVC A;  4JI5 B;  4JV5 B;  4LF8 B;  2UXC H;  1JX9 A;  3ASO B;  3B40 A;  5CA0 A;  2BTQ B;  3ETG A;  2Z04 A;  4JI0 B;  3VNN A;  2F4V H;  2YU9 A;  4J11 A;  2FPP B;  4O4I A;  3V4S A;  3K3P A;  1M7J A;  3SJC C;  4CH4 A;  3PW4 A;  3RYH A;  4FFB B;  1X9N A;  1KC7 A;  1QBZ A;  1XNQ O;  1SA0 A;  3RBZ A;  3RTX A;  1R6T A;  1SER A;  4JTA B;  1Y14 B;  4RAZ A;  1IBK O;  1CKO A;  4U6P A;  4LH7 A;  4K0K H;  4A3C G;  4ED3 A;  2PGG A;  5CE8 A;  1PV0 A;  3AG2 B;  3PZP A;  3T5H A;  2R8I A;  1IBL H;  4EEY A;  2M05 A;  2UU9 B;  2EIY A;  2ZQM A;  4D7S A;  5BXZ A;  5KFS A;  4MV6 A;  2AGA A;  3UO2 A;  1M57 B;  1OCZ B;  3U0G A;  2QK4 A;  1RYR A;  4GKJ O;  2VUG A;  3RGZ A;  5KFE A;  3SJB C;  3M9N B;  2W9C A;  4A3G G;  2BSK A;  3PJS K;  5EWF A;  2AGQ A;  4YR0 A;  5FD5 A;  4LF9 B;  2ZR2 A;  1PL0 A;  4O4J F;  4LF4 B;  3HKE B;  4GKK O;  3IC9 A;  4NKG B;  2DWE C;  5FLX N;  2VQF H;  1P84 F;  3KAJ A;  5D1O B;  4E4E A;  4XYL B;  2WB1 A;  2R7N A;  2ZM6 O;  3G80 A;  4FM9 A;  2W0F C;  4UV9 A;  3OSP A;  3U11 A;  2ZE7 A;  3T9B A;  3SI8 A;  4DV4 B;  2GPS A;  1NTM H;  2KG7 B;  2ATL A;  4IYI A;  4NTY A;  4QPK A;  4DUZ B;  1Q8I A;  5I5X A;  2DW4 A;  4HN2 A;  2V59 A;  1GN3 A;  3PN1 A;  2R92 G;  4PDB A;  3MR3 A;  4H44 B;  2QWO B;  2HR3 A;  1HNZ H;  3HKB A;  3KAL A;  1HNX H;  4J9M A;  2QF7 A;  3FKI G;  1BT8 A;  5CAE B;  3F8N A;  3SYP A;  4E2L A;  4DR5 H;  2R82 A;  2ZDI C;  4N23 A;  2CNQ A;  4DIM A;  2IP4 A;  4ZHQ B;  2O57 A;  3LQS A;  3W1G A;  3Q1K A;  1N36 H;  4B3S H;  1I0H A;  1SKV A;  3MR6 A;  4R8U B;  2RDC A;  1VQP V;  2Q7D A;  4DR4 H;  4RB1 A;  3QTC A;  2JEI A;  3KYH C;  1GTO A;  1M56 C;  2EIK C;  1US6 A;  3FMA A;  5EC2 C;  2Y0S A;  1BCC H;  3OHA A;  1VQO V;  4JZG A;  1XRE A;  3E22 B;  4MTE A;  4CHI A;  5JQG A;  4TSF G;  2NVX A;  1MOF A;  1L2Z A;  2HHH H;  1VF6 A;  4MTF A;  4FGR A;  2HLD G;  2XUM A;  4EKW A;  5JJJ B;  5DQH A;  2XGP A;  1QU7 A;  5KFW A;  4O4J A;  1ZL8 B;  4A93 G;  1SCU B;  2W57 A;  1T36 A;  1F51 A;  1ZLZ A;  2FL4 A;  1E1R G;  1Q7Y W;  4LF9 O;  1F4M A;  3ETJ A;  2UUB H;  1SQQ H;  3I12 A;  2GPW A;  4PZ7 A;  4FLV A;  4JI7 B;  3JYC A;  4JI2 O;  4J9Z B;  2P67 A;  2QM4 A;  3IC7 A;  1G6U A;  4PA7 A;  4TV8 B;  5KFI A;  3CEB A;  4LFC H;  4MV7 A;  4DV6 B;  4O7S A;  4PZ8 A;  2UUC H;  3C3T A;  3JAM W;  5FR9 A;  5LA6 F;  1JPX A;  5EYP A;  4MA5 A;  2Q68 A;  2AZ2 A;  5E25 A;  3CCJ V;  4FFN A;  4BBR G;  3V6J A;  2WLM A;  2R93 A;  2VS0 A;  4BIU A;  4ZI7 B;  1IYD A;  4DR6 B;  3RB6 A;  5JVD B;  2W7P A;  4MVQ A;  1Y4M A;  3RV3 A;  4DL7 A;  5JJN B;  4JI6 H;  2IW5 A;  3SPJ A;  4FPP A;  2VPS A;  4YJ3 B;  4EEQ A;  4GZR B;  1BHB A;  2ZCE A;  4GC7 A;  4ZQI A;  3T5L A;  2RGV A;  4A3L G;  4HNT A;  2FJZ A;  3LNM B;  4YP3 A;  5KMG A;  1N0N A;  1L1F A;  1WB7 A;  5B3S C;  1B6R A;  3QVN A;  2R9A A;  1BJT A;  5KFF A;  5IE9 A;  4OX9 B;  4ED6 A;  1IBM B;  4UFZ A;  4RU9 A;  4TQR A;  1NH2 D;  3T9D A;  3H3V H;  1DIK A;  4X62 H;  4LSA A;  4YY3 B;  3FB7 C;  1N33 H;  4RNN A;  2A9H A;  2Y48 A;  1RM1 B;  5L3G A;  3FAV B;  2BE3 A;  2OTL V;  3MFI A;  4F6R A;  3T1H O;  1V9P A;  2CH7 A;  5J2T B;  2XND G;  1S77 D;  2QR4 A;  1TUB B;  2YUA A;  2COI A;  1Y1V G;  5L3D A;  3OMN B;  2BQU A;  2EIL B;  4RAY A;  3MWD A;  3VMM A;  2UXN A;  1DTO A;  3MDS A;  4MVR A;  1FJG H;  3JSN A;  3RWR D;  1Y6X A;  3ZRX A;  4J0M A;  1KC8 W;  4BY7 G;  2RN9 A;  4ME6 A;  3H9V A;  5CA0 B;  2WA3 A;  5E1A C;  4LFB H;  2ZNJ A;  4K3A A;  2VQE H;  1EUC B;  4O4I B;  4FLU A;  3W1B A;  3H40 A;  2J6T A;  1V55 B;  2JRI A;  3RYH B;  2UUA O;  2YWV A;  5BMV F;  1SA0 B;  1YXB A;  4JI3 B;  2GTS A;  1GSO A;  1FS0 G;  1MSD A;  3TGU H;  3P3N A;  5AG2 A;  3WB2 A;  1ZHS A;  5B1N A;  4DO2 A;  3MHS C;  3N27 A;  3B8N A;  3JAM N;  2UXB H;  2CK3 G;  5LOV A;  3U0Z A;  1N34 O;  5HBR B;  2V4Q A;  1AI7 A;  1TA8 A;  5LYJ A;  1EKF A;  4X66 B;  1GAX A;  4X1I A;  2DE0 X;  2K1E A;  2L6L A;  1E4F T;  1KP3 A;  4NXM B;  3ZBH A;  3RF2 A;  4CH5 A;  5KFM A;  3IG0 A;  3W7U A;  4B08 A;  5JVL A;  5A2Q W;  1KD1 W;  1JKJ B;  4IRK A;  1EKP A;  5B1B B;  1EZV H;  3ZN1 A;  4QW8 A;  2C2R A;  3BA8 A;  4IGG A;  3CJH A;  2WLK A;  4PV1 B;  2W9C B;  4IRD A;  4ECQ A;  2CZG A;  4IZO A;  3K9A A;  4XX0 B;  2Y4T A;  2BSK B;  5BWX A;  3BQ1 A;  2FB5 A;  3K9S A;  3F7Y C;  3N8D A;  1YTF D;  1NTZ H;  2DAA A;  1AR4 A;  4AHC A;  4YY3 O;  5BZB A;  5FLM G;  5LMU B;  4DL4 A;  1FXH A;  3RYC A;  5GON F;  1Q90 D;  1BGY H;  2W6P A;  4DL5 A;  3S3W A;  1SYX B;  3JAR A;  2ITD C;  2X5R A;  3K58 A;  3PO3 G;  4GLW A;  3DXR A;  5JCO C;  2NN4 A;  5KLV H;  4LWS A;  2C28 A;  3LSQ A;  2AW9 A;  5C4X G;  3FKS G;  3N44 B;  1KBH A;  1XL6 A;  3R66 A;  5C93 A;  2XGQ A;  2EIN B;  3HKB B;  3NGD A;  5B5E Z;  4RB3 C;  2OLS A;  2UXD O;  2A0L A;  2X0L A;  5LXT F;  3KHG A;  1LUW A;  4HAM A;  4JPR A;  5BMV A;  1IUR A;  3J80 W;  4DV7 H;  2Q6A A;  1I1K A;  1HR0 H;  4JXU A;  1H8H G;  4APM A;  1MNG A;  4DV0 B;  1UNN C;  1O9H A;  4YAK B;  1AUX A;  5CM0 A;  3TCU A;  4I7H A;  4TQD A;  3DC5 A;  3QF7 A;  4DRF A;  2W6M A;  1N32 B;  5DIS C;  2FPG B;  3OMA B;  2YYA A;  1DLB A;  3VOU A;  1UPG A;  1IYE A;  1K8A W;  3RYF A;  2XAH A;  1FPO A;  1B6Q A;  4BIO A;  3LP8 A;  2CW8 A;  2YIC A;  3VQW A;  5C1O A;  4JTD B;  5EIB D;  3EYY A;  1XMQ H;  4DR1 O;  4L87 A;  3Q8P B;  1K92 A;  3CQZ A;  2ODM A;  3QZ8 A;  2XTA A;  4H37 A;  5IYZ F;  4KHP O;  4WD3 A;  2EIM B;  5JQG B;  3RW0 A;  1IVS A;  1WCM G;  4B3R H;  3RJ0 A;  4BIZ A;  5A2Q N;  4RQF A;  1CKN A;  4FS2 A;  2R85 A;  3LWB A;  4DR3 H;  5BWT A;  3BHP A;  3ZHQ A;  1S97 A;  5K1X A;  1XMO O;  2OCC B;  1HNW H;  1VP7 A;  1G2W A;  5DGI A;  4RB2 C;  1ENV A;  5GTI Z;  3K79 A;  4BBS G;  4X64 O;  2R7M A;  3J81 W;  2ZXW C;  4U3F H;  3OGC C;  1Z5V A;  4MV1 A;  1DF4 A;  1XHZ A;  1ZWI C;  2QTS A;  2PYJ A;  4IWX A;  4PA4 A;  1S3J A;  4X20 A;  3I5D A;  1XNQ H;  4A3J G;  1K97 A;  2Q7E A;  2PYL A;  4RCN A;  2Q8V A;  5EYP B;  1IBK H;  2R8G A;  1WAZ A;  2JGD A;  2FKL A;  2V7Q G;  4LF7 B;  4FVM A;  5LXT A;  3HKZ A;  4O2B F;  4YQW A;  3CC4 V;  1K1Q A;  4F4X A;  3APQ A;  3L4J A;  3JCU Z;  3T4Z A;  4QSH A;  2ALZ A;  5D5Q A;  3IAY A;  4O7Z A;  4DR2 B;  1BXR A;  3JAT B;  3J80 N;  3H0G A;  4JV0 A;  3JAL B;  4GKJ H;  1LUV A;  4UXN A;  5EBW C;  5KMG B;  1I94 O;  4EGQ A;  3N40 P;  2WSS G;  4JI6 O;  5GTH Z;  2WLN A;  2FPI B;  1N32 O;  5CR5 A;  1H2K A;  4O3S A;  4NXN B;  1HW7 A;  5C3E G;  4GKK H;  4DW1 A;  5IYZ A;  1WJZ A;  3RT3 C;  2R6F A;  2ZM6 H;  3DC6 A;  2Y4R A;  4JI1 B;  2QM7 A;  4YHH O;  5KHH A;  2GTA A;  4TWK A;  4A3I G;  2VUM G;  1M9N A;  1YJW V;  4EB6 A;  4F6R B;  5KFP A;  2CH7 B;  3Q8Q B;  3BPZ A;  4NB5 A;  2XCA A;  2E74 B;  4DLK A;  1XK5 A;  1NT2 B;  3GDE A;  4GCZ A;  3CEI A;  5T14 A;  4BW9 A;  2WYO A;  1Q86 W;  1SS3 A;  3TY9 A;  5KT3 A;  2VPQ A;  5BWW A;  2PI5 A;  5L1I A;  4PA3 A;  4FIP C;  3JAS A;  4DV1 O;  2YRX A;  2Q7G A;  2DAB A;  3ABK C;  3KAK A;  1BS3 A;  5KG6 A;  2NNU A;  2ZE8 A;  3J81 N;  2EJR A;  1COW G;  1TGO A;  3CCV V;  2N04 A;  2GV9 A;  1WB8 A;  1W93 A;  1HWY A;  3FFQ A;  4C5B A;  2FK3 A;  2FK2 A;  1YIJ V;  1OWT A;  2Y4U A;  2W0X A;  4O2B A;  1D5A A;  3QQM A;  1BE3 H;  2LO1 A;  5LOV B;  2HVQ A;  1URF A;  1KJQ A;  4TOI A;  4LF7 O;  1O75 A;  2YCH A;  1AJQ A;  2I87 A;  5LYJ B;  4X1I B;  4X88 A;  1UC9 A;  5BR8 B;  2R84 A;  2ZDI A;  1Y74 A;  3QWU A;  4J9P A;  2KQX A;  3NXS A;  3R23 A;  5JUM A;  3CCU V;  2YI8 A;  5CBH A;  3OHB A;  3CJH B;  2AQ4 A;  2KSW A;  1SRY A;  1MZF A;  3L74 H;  2EZO A;  4DRX A;  2CKZ B;  5IY5 C;  4X65 O;  1W0J G;  4LF9 H;  3ZX6 A;  3ASN C;  4GX0 A;  1VS0 A;  3CX5 F;  3FDS A;  2HEP A;  4GUN A;  4AQY O;  3R5X A;  3JZF A;  2R70 A;  4JI2 H;  3E86 A;  1GSH A;  1ZL8 A;  3RYC B;  2QA4 V;  3SPI A;  3JAR B;  4B3M O;  2DOS A;  2JEG A;  4TV9 B;  2PY5 A;  1IX9 A;  3HKC A;  2YW2 A;  3DXR B;  3DAA A;  2WPD G;  4LWS B;  2NR5 A;  1G4Y B;  3CB2 A;  3NR7 A;  2DJV A;  3AK1 A;  3CXH F;  4CS4 A;  5ITZ A;  1X4T A;  5BY1 A;  4DR7 B;  2W6N A;  5B1A C;  4CZZ A;  3RBD A;  5K3W A;  1NS1 A;  4ZOL F;  4O4I F;  1S0N A;  1CP9 A;  5KG3 A;  3MHH C;  4IWY A;  5EOY A;  4ECX A;  4JI4 O;  1BQ0 A;  3UZO A;  1NKD A;  1JX4 A;  5DGH A;  1ZHQ A;  4FM0 A;  1M4U A;  5BMV B;  3T9F A;  4KP4 A;  4U7C A;  1SZX A;  2E2H A;  5KHK A;  1TUE B;  3X2Q C;  3VPD A;  3TEK A;  4JV1 A;  2A1H A;  3R5H A;  2Q5Z A;  3OMI B;  1NR1 A;  3JD0 A;  4FJC C;  4WFA V;  1K83 A;  2J6U A;  4J7K A;  3KHH A;  2JEX A;  3RYF B;  2WWW A;  4CC6 A;  4MTX A;  4UB8 Z;  1M1K W;  2PN1 A;  1PX2 A;  1W2B U;  3OD4 A;  5JWP A;  2E5L B;  1KTA A;  2ZDH A;  3I4N G;  3K06 A;  3RUP A;  3RAQ A;  3T1H H;  2WLH A;  2QYZ A;  3ABL C;  3A0H Z;  5KFN A;  4QWB A;  1ZET A;  2YZM A;  3A0B Z;  3SJQ C;  1CKN B;  1ET0 A;  1NZ6 A;  4AYB A;  1SFO A;  2FML A;  1TVK B;  4ECR A;  5LP6 C;  4EYH B;  3OT7 A;  4MAM A;  5LMN B;  4LR3 A;  2R87 A;  4EYI B;  3PW7 A;  2CE4 A;  4DV5 O;  4JI7 H;  2LW1 A;  3G4S V;  2BOC C;  4RO2 A;  1WP8 A;  4OXS A;  4B3T B;  3KZI Z;  4PA9 A;  1KJ8 A;  3LSS A;  1BGW A;  2R8H A;  5IP7 G;  5FNV F;  3LDE A;  4YIP A;  1ORQ C;  3RB3 A;  1LNQ A;  4JYA O;  2AU0 A;  4LCU C;  3K03 A;  4X20 B;  2UUA H;  1H2L A;  2OIG A;  1OCO B;  4G28 B;  2B5U A;  3CC2 V;  1TWF A;  2WTF A;  2YIA A;  3WG7 B;  1CXZ B;  2IM9 A;  1WSC A;  1ZTE A;  4ZOL A;  2YC0 A;  3VPC A;  2JGD B;  3NBY B;  1AJN A;  1N34 H;  2W6Q A;  1SZT A;  1QCE A;  4ZKI A;  3J7A K;  5LXT B;  4J80 A;  4FFO A;  3ASO C;  2DWC A;  2HJF C;  5IWA O;  2V5A A;  4DV2 O;  2WA4 A;  4FK5 C;  4J9N A;  2XC9 A;  2Y69 B;  3ZCC A;  5KG2 A;  2P6J A;  1KB9 F;  1IXB A;  1EN4 A;  2L35 A;  3ZS8 C;  2R7L A;  2PZS A;  3B4S A;  3W7X A;  1BQZ A;  3AG3 C;  3H1H H;  4WF9 V;  5BWV A;  2ASJ A;  1DGS A;  1KUT A;  3EFF K;  2PMZ A;  2GBO A;  3M99 B;  4YXW G;  1RK5 A;  5DM6 V;  4LFA O;  4O3O A;  3LML A;  4PDR A;  1VAJ A;  4YY3 H;  1GYF A;  1I5Y A;  3QG5 A;  5IYZ B;  5KHG A;  3ZMS A;  5JQG F;  2HP8 A;  4H13 B;  2N74 A;  4NLG A;  3ETE A;  4JI8 B;  1CPY A;  2W7O A;  2YZN A;  4EB6 B;  4O7Y A;  1MA1 A;  4QIW E;  4FLY A;  3KHR A;  2JDI G;  1BHA A;  1OCZ C;  5I47 A;  1AI6 A;  3N6X A;  2R8K A;  5H6Q A;  3K04 A;  5F9N A;  2YIB D;  3RB0 A;  1V51 A;  2V4R A;  1EN5 A;  3K5M A;  1P7G A;  3D3Q A;  1VIB A;  3RFR A;  1JDB B;  2CTP A;  2J9G A;  1PNM A;  1R3K C;  2JA7 A;  1YI2 V;  5K1P A;  1XNR B;  2R93 G;  4Q20 A;  3GIP A;  5IYB O;  4LF5 B;  3E89 A;  3UQ8 A;  3JAS B;  2GQS A;  5FNV A;  3JRX A;  2NUA B;  3BA9 A;  2FLN A;  2UXD H;  5BWU A;  3EHB B;  2KSD A;  4LF6 O;  5I60 A;  1N8R W;  4LNU A;  5JCO A;  3T5J A;  3H1I H;  3GWK C;  4JI5 O;  4JV5 O;  3TXS A;  4LF8 O;  5BYB A;  4O7N A;  5KFL A;  5KFY A;  4JI0 O;  1T3N A;  1AI5 A;  2Q0O C;  1P16 A;  4O2B B;  4OPA A;  3GV5 B;  2HIV A;  1KUQ A;  3GJX B;  1IDS A;  2O03 A;  1QLE C;  1KYO F;  1WLE A;  5KFX A;  1VQ5 V;  2Q2U A;  4DR1 H;  4F4Z A;  2JS5 A;  5KFK A;  3GIM A;  1Y74 B;  3CC7 V;  4KHP H;  3OUU A;  1AIL A;  3HOX G;  1K73 W;  3HOV G;  1OV9 A;  2FP4 B;  4DUY B;  2OCH A;  5KFT A;  1NU1 H;  1S5L Z;  3T1Y B;  2IBK A;  4QNH B;  4TM5 A;  2CTW A;  1XMO H;  2UU9 O;  3K5H A;  1M56 B;  4DRX B;  3OUZ A;  4ABM A;  2JA8 G;  2WLI A;  1S76 D;  2H8P C;  4X64 H;  1JFF A;  3JAW A;  1J5E B;  4E4T A;  3Q8R B;  3RR5 A;  4KFM A;  2A79 B;  3VBB A;  4NYE A;  1I7N A;  1MSW D;  4DK0 A;  1R1B A;  3SJA C;  4XDJ A;  3VQX A;  4D7T A;  1AUV A;  1YTF B;  4DXW A;  4A5U B;  2BQ3 A;  2G38 A;  2P4V A;  2QGN A;  4LF4 O;  4JTC B;  3HKC B;  5FJ8 G;  4RUF A;  3SNO A;  3E8F A;  1OBD A;  3BEH A;  3CCM V;  5KS8 A;  3CCR V;  1OHH G;  5L3C A;  5ITZ B;  4O4L B;  4FFM A;  2EIJ B;  4KUM A;  1WPX A;  4X1Y A;  4DV4 O;  3MJF A;  2QWN B;  2A7W A;  4DUZ O;  4O83 A;  2BR0 A;  1E4G T;  3F5W C;  4DV3 B;  4YR2 A;  1RYS A;  4JGS A;  2XOK G;  3CPW U;  2IJJ A;  1GM8 A;  4Y8V B;  3CCS V;  1OCC C;  4F50 A;  3BRC A;  5LOV F;  1I94 H;  3D36 A;  1GSA A;  3NC0 B;  5LYJ F;  1Q6I A;  5DED A;  1QR8 A;  1N32 H;  4UCT A;  1WN7 A;  4MV9 A;  5I5S A;  2UXC B;  3RB4 A;  2F4V B;  3JAT A;  1EZJ A;  4O2A F;  3JAL A;  4DAA A;  4EG0 A;  4A3F G;  3GV8 B;  4PD4 F;  4YHH H;  4P2Z A;  1KBL A;  1WA8 A;  3Q2O A;  2OTJ V;  2JA5 A;  1KU9 A;  5I5U A;  5EWE A;  3WWI A;  2AHZ A;  3LSU A;  1VQ6 V;  3E8H A;  4U3J A;  4J7Z A;  3K3V A;  1S0M A;  5I5W A;  4J9Y B;  2F23 A;  3KTM A;  2CQY A;  2W9A A;  2QKA A;  1GM7 A;  1H2N A;  4K0K B;  5H2F Z;  4C2M A;  2RGR A;  4FLX A;  3ZRV A;  2PMZ E;  1HP8 A;  3EXA A;  5KFC A;  3GTK A;  2C35 B;  1JDE A;  3T9A A;  1GN2 A;  2LJ2 A;  1IBL B;  4DV1 H;  5KHJ A;  1RPR A;  4L8J A;  1RM1 C;  4TV9 F;  5KT4 A;  4ECU A;  3PR4 A;  3OTO B;  4O3Q A;  2W9B A;  3L4K A;  3HOW G;  2ITC C;  1KJJ A;  3BAC A;  3GTJ A;  3MWE A;  3G6Y A;  4JI7 O;  4O3P A;  4DW0 A;  5KFH A;  2EIL C;  2EZP A;  4OPH A;  2XHB A;  2WB1 E;  1E4E A;  4ZOL B;  2NU6 B;  4A3B G;  1I2L A;  1LR1 A;  3RVZ A;  2VQF B;  3N43 B;  4LF7 H;  3TQ1 A;  1R3I C;  4DV6 O;  3TW7 A;  1NI8 A;  1FXK C;  4O3N A;  1QR9 A;  1W96 A;  1QNM A;  2CTQ A;  1GM9 A;  2GUZ A;  2XAG A;  3CYO A;  1V55 C;  1JR9 A;  2PI4 A;  4X9Q A;  5KFR A;  4DR6 O;  3QO8 A;  4TT3 G;  5EC1 C;  5CBG A;  3C90 A;  3I55 V;  4DQN A;  4O2A A;  3K5I A;  1HNZ B;  4X65 H;  1PK8 A;  1HNX B;  4A3K G;  2JA6 A;  2DYS B;  5IYB G;  4R7R A;  4AQY H;  1EBO A;  3AYH B;  5L3F A;  3H1J H;  1Y76 A;  5JH7 F;  4FBT A;  2C00 A;  4ED0 A;  4DR5 B;  2OIE A;  1NVP D;  1XEQ A;  4OX9 O;  4LC1 A;  1B33 N;  1AI4 A;  1IBM O;  5L1L A;  2GLT A;  2F1M A;  4B3M H;  2ADQ B;  2DZD A;  3ZHV A;  1N36 B;  4B3S B;  3W7S A;  2UVW A;  5B1B C;  1FD9 A;  5E79 Z;  5LHI A;  3JD4 A;  5LGU A;  3AG7 A;  2Y0S E;  4GX5 A;  5DG8 A;  1Y1W A;  4DR4 B;  2FB9 A;  3UCS C;  3HKD A;  1Q81 W;  2R9R B;  1MMM A;  4FFL A;  3U55 A;  2R72 A;  4IAJ A;  5KFB A;  1NQT A;  4O86 A;  2XAF A;  4UUG A;  3DGE A;  3GII A;  4XZ3 B;  4TV9 A;  4J9O A;  4PI2 A;  5FNV B;  5KAF Z;  4JI4 H;  1W0K G;  2YIB A;  5KA6 A;  4I5S A;  1K7D A;  3CSW A;  3SPC A;  3OTO O;  1RFY A;  4W4K A;  1OBG A;  2W71 A;  2KB1 A;  4QWE A;  2V9W A;  1BL8 A;  3H1K H;  4IIJ A;  4LNU B;  2HHH B;  2BOB C;  3H0G G;  4J9K A;  4J9L A;  3WO0 A;  4A3D G;  3OE7 G;  2FK1 A;  5DQG A;  2PUS A;  1SQP H;  1ARO P;  3QO7 A;  3IJ4 A;  1XIL A;  3BJY A;  3GTO A;  1YJ9 V;  4I4T F;  4IRC A;  3WU2 Z;  4WFG A;  2UUB B;  4RAI A;  4HNU A;  4B7E A;  1Y66 A;  2C2D A;  5KFV A;  4AI8 A;  4NZN A;  3CME V;  3SR2 C;  1OCR C;  2I80 A;  1JIH A;  3ABM C;  2CW7 A;  3ABU A;  2HG8 A;  3G6B A;  2IH3 C;  2QWP B;  2Q7H A;  4JI3 O;  1ZUQ A;  1S0V A;  1M6V A;  3TIG A;  3QZ7 A;  4CMF A;  3G67 A;  2ZIM A;  4HYO A;  3BQ0 A;  2A06 H;  4IR9 A;  2F95 B;  3SYO A;  2CNV A;  1RSO A;  2UUC B;  1KKC A;  4X66 O;  3AG4 C;  3TII A;  5C5J A;  4NXM O;  1R6N A;  1S5H C;  3DTG A;  1Z2G A;  2FLL A;  3LUT B;  3NUA A;  1A0G A;  5KFO A;  5JH7 A;  4O3R A;  2WLI B;  5CA1 F;  2XAQ A;  1JFF B;  1SQG A;  3JAW B;  3Q4H A;  1Q5O A;  2IMW P;  2EJ0 A;  4DV5 H;  1CQJ B;  4UCV A;  4PBC A;  3MFH A;  3JZI A;  1GKF A;  1TVK A;  2IJI A;  4RWU A;  2ABJ A;  3JD1 A;  4PWQ A;  5KT5 A;  4ED2 A;  3J7A U;  3GID A;  3KHL A;  4JYA H;  3PVX A;  3MAQ A;  1RJQ A;  3BY6 A;  5LMU O;  3OW2 U;  1VF6 C;  3G8C A;  4AIL C;  2E75 B;  3WB0 A;  2OCC C;  2JEU A;  4LBE C;  2JS3 A;  4X62 B;  4FLT A;  4RZR A;  1I50 A;  1S03 G;  4EBD A;  1N33 B;  4X1Y B;  3BQ2 A;  1EHI A;  1L8D A;  2W70 A;  2BCC H;  1HDJ A;  5IWA H;  1ROP A;  4DV2 H;  4X1K A;  4PI0 A;  5EBM C;  3ETD A;  4YAJ B;  2HHF A;  1J95 A;  1QVF U;  3HXL A;  4NVP A;  4I4T A;  1OZ0 A;  1D5N A;  3H4B A;  2RNB A;  4ECW A;  2W6I G;  1FJG B;  2YZL A;  2QJ1 A;  3QO5 A;  2DWD C;  4PDM A;  2YEV B;  3S24 A;  3SYC A;  2WE6 A;  4LFA H;  3RGX A;  2IH1 C;  2ATK C;  3OUS A;  1F23 A;  3K0G A;  4DV0 O;  4LFB B;  1VQK V;  2VQE B;  3B8M A;  1KQS U;  1H2S B;  1WA8 B;  4HNA A;  2RDJ A;  1XQ8 A;  1K5Q A;  4UVB A;  2R7Z A;  4BWS C;  3V6H A;  4U3J B;  3F5T A;  3ZMU A;  2WDT A;  4Z1V A;  4WFE A;  1VF7 A;  1SEI A;  2B1I A;  1TWA A;  4ED1 A;  1N4C A;  5KX5 A;  3G6E V;  2UXB B;  3OR7 C;  5CA1 A;  4FFP A;  3OEE G;  4ECT A;  2AGO A;  3ZRW A;  2B63 A;  3AG1 B;  3FB6 C;  5F9L A;  4MV4 A;  4I50 F;  2XAJ A;  2R7K A;  1VEW A;  3KG2 A;  5LHH A;  3V6K A;  3QNE A;  4J42 A;  3AK2 A;  3L70 H;  1ULZ A;  5HFL A;  5KT6 A;  5IP9 G;  4B3T H;  4I9Q A;  1VQ4 V;  5IYD G;  1SQV H;  3E83 A;  2W9B B;  4LF6 H;  1VF5 B;  4A3M G;  1K34 A;  1C30 A;  4JI5 H;  4JV5 H;  1Q6H A;  4LF8 H;  2ZT9 B;  4O4L F;  3FYE B;  1VQM V;  4O84 A;  5EBL C;  4JI0 H;  3ICX A;  1GK9 A;  3KXY T;  4FS1 A;  1E4E B;  5LHG A;  2OH2 A;  2LQT A;  3LDC A;  4UCS A;  2JK5 C;  5TIS Z;  4Q44 A;  2CAZ C;  3F7V C;  1TWH A;  4YJ2 F;  3OEH G;  3M4I A;  1AP5 A;  3ORR A;  4FM2 A;  1R3L C;  5C44 G;  2GUZ B;  3BAA A;  5JJE B;  5B1O A;  4NR1 A;  1M5I A;  4Q45 A;  2UU9 H;  1RJR A;  3DTU B;  4O2A B;  2YRW A;  4PHZ A;  3FB8 C;  1G1X B;  4DK1 A;  4P9O A;  1RPO A;  3CCL V;  1K4D C;  4DR2 O;  2D3O W;  1GN4 A;  4U7O A;  3W7W A;  3BAB A;  4RUC A;  1Y76 B;  2Q73 A;  4UVA A;  4DV7 B;  1HR0 B;  4CKC A;  2RF4 A;  1IZ3 A;  2LFR A;  4HZ3 A;  4NXN O;  2VOB A;  4LF4 H;  4GYC B;  2DYR C;  5LGT A;  2OYQ A;  5IY5 B;  2M6Y A;  4JI1 O;  2F93 B;  3HKD B;  4I50 A;  4JAS A;  1Q6U A;  3A0R A;  4IHJ F;  2W6Z A;  3GIJ A;  3PR5 B;  1OJH A;  4UCR A;  4QWC A;  2FLP A;  4I55 F;  4DV4 H;  3GTL A;  4BR6 A;  3HOY G;  2X6B A;  1KJ9 A;  3HPL C;  1AJP A;  2Z5U A;  1YJN V;  4DUZ H;  5IT9 N;  4ZIB A;  4B3R B;  4O4L A;  4IIJ B;  2ZE5 A;  4CC5 A;  4NTW A;  2YS7 A;  4LSX A;  1A9X A;  1EKV A;  4LH6 A;  2ASL A;  1IOV A;  2EJ7 A;  3U10 A;  2HJW A;  1HNW B;  2JJ2 G;  4MW3 A;  2E2I A;  1K4C C;  3HR0 A;  2QDO A;  3S3X A;  1B06 A;  1XOU A;  5KUK A;  4FFR A;  4YJ2 A;  5A9G A;  4CE5 A;  2DIK A;  3CHX A;  2YXL A;  2ZDQ A;  1DK1 A;  3EPI A;  3UZB A;  3GV7 B;  3BG5 A;  2MW2 B;  1QVG U;  3T7A A;  1GN6 A;  3JZ6 A;  3WWH A;  4BW5 A;  1S68 A;  2AGP A;  1XNQ B;  3CWB H;  2DLN A;  1RSO B;  4DUY H;  1P8L A;  4P9P A;  3I56 V;  2ZIO A;  3HKZ E;  1N48 A;  2EBO A;  3B09 A;  1MAB G;  1QQC A;  3W7T A;  1IBK B;  1XDN A;  2EJ3 A;  1MG1 A;  5BR8 O;  2JA7 G;  2YXH A;  4K35 A;  2OWO A;  2W8L A;  1P4R A;  4JZ2 A;  1YVW A;  5JH7 B;  5BYA A;  3BVO A;  4H33 A;  1A0I A;  3LUL A;  3PO2 G;  3Q4H B;  3O65 A;  3TQT A;  3TY5 A;  3P3P A;  4GC6 A;  4ECY A;  1PNL A;  5LGN A;  2ZGI A;  3ABL B;  4O7T A;  2Y0I A;  2R86 A;  4WCE V;  1CKM A;  4GKJ B;  3WNZ A;  5KFQ A;  1YZB A;  1SC5 B;  4J9S A;  3NBZ B;  3H1L H;  3TY8 A;  2W6O A;  4IHJ A;  1I6U A;  4I55 A;  1A48 A;  3TIN A;  4GKK B;  2RQ6 A;  5L9X A;  1V54 C;  4FLZ A;  4Z2W A;  4DV6 H;  3K59 A;  3N2K A;  2NU7 B;  4UV8 A;  1SQX H;  1KKD A;  2QWQ B;  1O9G A;  1VMG A;  4X1K B;  1QLN A;  5KFZ A;  5EWG A;  3GTG A;  2HKO A;  2HHF B;  3DSQ A;  4DR7 O;  2RMK B;  1RJP A;  4I4T B;  3CD6 V;  1VQN V;  3L9D A;  3SPH A;  4DR6 H;  5J9P C;  1OCO C;  3SE7 A;  1DV2 A;  5FPR A;  3UM7 A;  5CBF A;  5B66 Z;  5H6R A;  1GMG A;  1YDX A;  2GQR A;  4O82 A;  2X6A A;  1FXK A;  1R3J C;  4HBN A;  5KFG A;  1CQI B;  2WAM A;  3ZHR A;  4MVU A;  2NVY A;  3G71 V;  4OX9 H;  2VRZ A;  4HNA B;  3K57 A;  1IBM H;  2Y69 C;  3AG3 B;  2I8C A;  2K9P A;  3GTQ A;  2Q4P A;  3ZHT A;  4Z1M G;  2PBZ A;  4LP8 A;  3AG2 C;  5KX5 B;  1QHT A;  2LGQ A;  5CA1 B;  2E5L O;  3HOU G;  1JMK C;  3IGA C;  4Q8F A;  3N41 B;  3ZRW B;  3ZJZ A;  1R73 A;  5GW7 A;  1NH2 B;  1M57 C;  1GLV A;  4J9Q A;  2YXY A;  3MWM A;  2E76 B;  2FTK A;  2WLL A;  4M7E A;  3JD2 A;  1P7B A;  5LL6 Y;  4CH3 A;  2P7T C;  3OTO H;  2GSM B;  4FE2 A;  1BSM A;  2CFM A;  2BQR A;  3L73 H;  4TUY A;  1WP7 A;  5LMN O;  4YBZ B;  4R6Z A;  2XT9 A;  3JAK A;  2NU8 B;  2ZJT A;  1K3E A;  4PDV A;  1FKA O;  1H8E G;  1DAA A;  5DQI A;  4I9W A;  4MV3 A;  4B3T O;  1XDC A;  3A8T A;  4ETS A;  4JF3 A;  2J6S A;  4MVZ A;  5KG4 A;  2P06 A;  2OT5 A;  2VWK A;  2ZD9 A;  4JI2 B;  5DAA A;  1PL4 A;  4DL3 A;  4JI3 H;  3T4D A;  5HNE A;  4JAV A;  2D2C B;  2JA5 G;  2FYU H;  4PDL A;  2XCP A;  2ODT X;  3GIQ A;  3OTF A;  4J7J A;  3B2E E;  1AB3 A;  3N2G A;  4W4L A;  3CSX A;  5IJ0 A;  5CB4 F;  1I7F A;  3CRQ A;  4X66 H;  4MS2 A;  3PFF A;  4CMD A;  4NXM H;  1S72 V;  4WBN F;  1F4N A;  3KCY A;  2IU0 A;  1WR2 A;  1QLE B;  2HVR A;  2A3Q A;  4QW9 A;  3T9E A;  2PTM A;  4QJF A;  4QPJ A;  4HNV A;  3SYQ A;  1H2G A;  3P30 A;  2FMA A;  1B6S A;  1Q82 W;  5KG7 A;  1I3Q A;  5DGA A;  2MCT A;  2EIK B;  3C3S A;  4NZM A;  5D1P A;  5KFU A;  1A32 A;  4JYB A;  4O7L A;  1XBL A;  3VA7 A;  2PF4 E;  4ASU G;  1L0L H;  1GRJ A;  5LMU H;  3TJT A;  4OGQ B;  1I08 A;  4Q43 A;  4JI8 O;  4I50 B;  3T99 A;  1S10 A;  5FD6 A;  4O4H F;  1NVP B;  2HGW A;  3UFX B;  2ARH A;  2GDS A;  5J2U F;  5C1P A;  1RK6 A;  1I2K A;  4P30 A;  4BWA A;  3T1H B;  4AYB E;  2VA2 A;  4FZ0 A;  4RNM A;  2ZNI A;  3GIL A;  3M8A A;  1XNR O;  1ZAU A;  4LF5 O;  4D6T H;  1PP9 H;  1TWC A;  1K33 A;  4MVS A;  3HO8 A;  2AXT Z;  2JA6 G;  5DMX A;  2W8K A;  1EZ1 A;  3CXC U;  2ASD A;  4YJ2 B;  2H3O A;  1MZE A;  2EIJ C;  3ETQ A;  1JOY A;  3ZHU A;  4DV0 H;  4RNO A;  5IJ9 A;  1NJI W;  3GLK A;  4FFK A;  4MSW C;  5D8D A;  5L3B A;  5C8Y F;  5CB4 A;  3PW0 A;  3CCQ V;  4X8A A;  2YEV A;  1OCC B;  2LFS A;  1PD3 A;  2UUA B;  1VBH A;  2EX3 A;  2QM8 A;  2R9I A;  5EZY F;  4YB8 B;  1Y1W G;  4WBN A;  1T5E A;  2MK3 A;  2X6C A;  4R8C A;  3R65 A;  3R5F A;  3U9T A;  3FYI B;  2CGO A;  2DPI A;  4Q4C A;  3UT5 A;  1N34 B;  4F4W A;  2QB5 A; 
#chains in the Genus database with same CATH homology
 2F95 B;  1RSO A;  2UUC B;  2BTO A;  1CKO A;  4K0K H;  4LH7 A;  5BR8 B;  1TAE A;  2PGG A;  3QWU A;  1IBL H;  4LMY A;  2UU9 B;  3LNN A;  2YI8 A;  5JH7 A;  2KSW A;  4D7S A;  1JFF B;  1SQG A;  3JAW B;  1Q5O A;  4DV5 H;  4UCV A;  4DRX A;  4LF9 H;  5LL6 b;  2VUG A;  1TVK A;  4O4H A;  3RGZ A;  3SJB C;  1VS0 A;  4IHJ B;  2HEP A;  5EIB C;  4I55 B;  5J2U A;  3ZED A;  4JYA H;  2R70 A;  4JI2 H;  5FD5 A;  3MAQ A;  4LF9 B;  3RYC B;  4AIL C;  3HKE B;  4LF4 B;  3N2K B;  3JAR B;  1M93 A;  3GB8 B;  5D1O B;  3KAJ A;  3WB0 A;  4FLT A;  4MTD A;  2VQF H;  4X62 B;  4TV9 B;  2PY5 A;  4RB0 A;  1S03 G;  1FFX A;  3HKC A;  1N33 B;  4X1Y B;  4FM9 A;  1L8D A;  3A2F A;  3CB2 A;  3U11 A;  5IWA H;  4CS4 A;  5ITZ A;  1X4T A;  4DV4 B;  4DV2 H;  4DR7 B;  4X1K A;  4PI0 A;  2KKW A;  4DUZ B;  1Q8I A;  4Q0Y A;  5EOY A;  3HXL A;  3PN1 A;  4NVP A;  4PDB A;  4I4T A;  1WPB A;  1JJO A;  5C8Y A;  1ZHQ A;  3HKB A;  2UXD B;  3KAL A;  4DR2 H;  4FM0 A;  1M4U A;  5BMV B;  1HNX H;  1FJG B;  1AN7 A;  2QJ1 A;  5KHK A;  3S24 A;  2P22 C;  3F8N A;  4LFA H;  2WE6 A;  5EZY A;  3RYI A;  3RGX A;  5LA6 A;  4DR5 H;  3DF7 A;  4LFB B;  2VQE B;  4NXN H;  3SGI A;  4ZHQ B;  3W1G A;  1H2S B;  1N36 H;  4HNA A;  3RYF B;  1M0W A;  4B3S H;  1SKV A;  1XQ8 A;  4CC6 A;  3WB1 A;  4BWS C;  3K5O A;  4JI1 H;  4U3J B;  4DR4 H;  2WDT A;  4RB1 A;  1SEI A;  3QTC A;  1VF7 A;  2E5L B;  3KYH C;  5KX5 A;  3RIZ A;  4DR1 B;  2UXB B;  3FMA A;  3T1H H;  5CA1 A;  4CS3 A;  4KHP B;  1CKN B;  3E22 B;  2Q0A A;  4MTE A;  5JQG A;  1TVK B;  4UCO A;  4TUY B;  3W5O A;  5LP6 C;  3JAK B;  4B3T H;  5KHI A;  1XMO B;  2HVS A;  2HHH H;  1L2Z A;  4I9Q A;  1FVI A;  4CS2 A;  5JJJ B;  5LMN B;  4LF6 H;  4LR3 A;  4O4J A;  1WNS A;  4JI7 H;  2W57 A;  4JI5 H;  4JV5 H;  4LF8 H;  4X64 B;  3RGB A;  4B3T B;  1BGW A;  2UUB H;  1MZB A;  4JI0 H;  3ICX A;  3KXY T;  4PZ7 A;  4FLV A;  4JI7 B;  4X20 B;  2UUA H;  4UCS A;  2QM4 A;  1G6U A;  3N2G B;  2YIA A;  4TV8 B;  2CAZ C;  2IM9 A;  5IJ0 B;  4ZOL A;  2F66 C;  3M4I A;  4LFC H;  4MV7 A;  4DV6 B;  3NBY B;  4FM2 A;  1N34 H;  4PZ8 A;  3J7A K;  5LXT B;  2UUC H;  1KMI Z;  3JAM W;  5BR8 H;  5EYP A;  3BAA A;  4UCU A;  4LFC B;  1YEW A;  4E6N A;  5JJE B;  1M5I A;  3ZS8 C;  2UU9 H;  4ZI7 B;  2PZS A;  4O2A B;  4DR6 B;  4PHZ A;  5JVD B;  4JI6 H;  4DK1 A;  5JJN B;  2VPS A;  2E3C A;  4YJ3 B;  1DGS A;  4EEQ A;  3BAB A;  1I94 B;  2ZCE A;  2RGV A;  4JI6 B;  4DV7 B;  5KMG A;  3LML A;  1HR0 B;  4YY3 H;  1GYF A;  3QG5 A;  5IYZ B;  5KHG A;  2R9A A;  1BJT A;  4OX9 B;  1IBM B;  1Z2O X;  2VWJ A;  4UFZ A;  2VOB A;  4GYC B;  4LF4 H;  3N42 B;  4JI8 B;  2OYQ A;  3H20 A;  4X62 H;  4LSA A;  4EB6 B;  4YY3 B;  1N33 H;  2F93 B;  3HKD B;  4YHH B;  4FLY A;  4I50 A;  5LP6 A;  3N6X A;  4UCR A;  2YIB D;  4DV4 H;  4F6R A;  1V9P A;  3K5M A;  4FM1 A;  4DR7 H;  5J2T B;  3RFR A;  4DUZ H;  1B04 A;  1TUB B;  4O4J B;  5K1P A;  1XNR B;  4ZIB A;  4B3R B;  3VQY A;  4O4L A;  4IIJ B;  4CC5 A;  4LF5 B;  3UQ8 A;  3JAS B;  4RAY A;  5FNV A;  1Z2N X;  4LSX A;  3BA9 A;  2UXD H;  5GON A;  1FJG H;  3JSN A;  3RWR D;  4LH6 A;  4DV1 B;  3U10 A;  1HNW B;  4J0M A;  5IJ9 B;  4LNU A;  5JCO A;  5CA0 B;  5CB4 B;  4YJ2 A;  3CVZ A;  2ZNJ A;  4LFB H;  2VQE H;  4O4I B;  4FLU A;  3W1B A;  3THO A;  3CHX A;  2YXL A;  1P16 A;  4O2B B;  2BTQ A;  3RYH B;  4WBN B;  2HIV A;  3GJX B;  1SA0 B;  4JI3 B;  4EFE A;  2O03 A;  1S68 A;  3UT5 B;  2E5L H;  1ZHS A;  3WB2 A;  1XNQ B;  2JVD A;  2Q2U A;  4DUY H;  4DR1 H;  1P8L A;  4FFB A;  2FE3 A;  2UXB H;  5LOV A;  2ZIO A;  3U0Z A;  2JS5 A;  1IBK B;  1QQC A;  1TA8 A;  5LYJ A;  4KHP H;  1XDN A;  4X66 B;  4X1I A;  4TQF A;  4DUY B;  1E4F T;  4NXM B;  2OWO A;  3RF2 A;  5JH7 B;  4CH5 A;  3T1Y B;  1A0I A;  3IG0 A;  4B08 A;  1XMO H;  3TY5 A;  5A2Q W;  1SQF A;  5LMN H;  4DRX B;  4A2B A;  4EQ5 A;  3BA8 A;  4O4H B;  4CH6 A;  4Q6G A;  5IT9 W;  1FKA H;  4X65 B;  4X64 H;  1JFF A;  3JAW A;  1CKM A;  4GKJ B;  1J5E B;  5J2U B;  3RR5 A;  4AQY B;  3NBZ B;  3TY8 A;  4FLW A;  4DK0 A;  3SJA C;  3VQX A;  4D7T A;  4IHJ A;  4AHC A;  3C0F B;  1I6U A;  4I55 A;  3VQV A;  5LMU B;  4GKK B;  1FFX B;  2RQ6 A;  3HKC B;  4B3M B;  2XIG A;  3RYC A;  4FLZ A;  4A2A A;  3HKE A;  3K59 A;  3N2K A;  1SYX B;  4DV6 H;  3JAR A;  5D1O A;  4K8Z A;  5ITZ B;  4O4L B;  3K58 A;  1O9G A;  4X1K B;  5JCO C;  4X1Y A;  3DSQ A;  3N44 B;  3K5N A;  1Z5W A;  4I4T B;  1E4G T;  4DV3 B;  4DR6 H;  5C8Y B;  3HKB B;  4JI4 B;  5FPR A;  4RB3 C;  1M0T A;  3BRC A;  5EZY B;  3RYI B;  1I94 H;  5LA6 B;  3NC0 B;  5BMV A;  4HBN A;  3L2P A;  3J80 W;  4DV7 H;  1N32 H;  1HR0 H;  4UCT A;  1WN7 A;  4APM A;  4DV0 B;  4MV9 A;  1O9H A;  2UXC B;  4OX9 H;  4HNA B;  3K57 A;  5FPO A;  1IBM H;  2F4V B;  4I7H A;  3JAT A;  3JAL A;  3QF7 A;  4TQD A;  4DRF A;  4JI8 H;  1N32 B;  5DIS C;  4ZHQ A;  4KL1 A;  4YHH H;  3RYF A;  5KX5 B;  3JSL A;  2CW8 A;  1KU9 A;  1QHT A;  5CA1 B;  3VQW A;  3K3V A;  4U3J A;  5EIB D;  3EYY A;  1XMQ H;  1JMK C;  3N41 B;  2P5O A;  4K0K B;  1HNZ H;  5JQG B;  1WH2 A;  3MWM A;  1XNR H;  2RGR A;  4B3R H;  4M7E A;  3RJ0 A;  1Q3E A;  4FLX A;  1XMQ B;  4LF5 H;  1CKN A;  4CH3 A;  3OTO H;  4DR3 H;  3E22 A;  3BHP A;  1Q43 A;  1IBL B;  2HIX A;  5K1X A;  4DV1 H;  2CFM A;  5KHJ A;  4TUY A;  4L8J A;  1HNW H;  3JAK A;  3K5L A;  2ZJT A;  4DV5 B;  4RB2 C;  3OTO B;  2V4D A;  4DR3 B;  3L4K A;  4ETS A;  3J81 W;  1Z5V A;  2VWK A;  1XHZ A;  4JYA B;  2PYJ A;  4JI2 B;  2XHB A;  4ZOL B;  4JI3 H;  4X20 A;  2VQF B;  1XNQ H;  3N43 B;  4LF7 H;  2Q7E A;  3OTF A;  3B2E E;  3N2G A;  4TV8 A;  2PYL A;  3CSX A;  5IJ0 A;  5EYP B;  1I7F A;  1IBK H;  4X66 H;  4LF7 B;  4FVM A;  5LXT A;  5IWA B;  4NXM H;  4DV2 B;  3T1Y H;  1Z2P X;  2HVR A;  3L4J A;  2PTM A;  5D5Q A;  3IAY A;  4ZI7 A;  4O2A A;  4X65 H;  1HNZ B;  5JVD A;  4DR2 B;  1HNX B;  3JAT B;  4GKJ H;  1J5E H;  3JAL B;  4R7R A;  5KMG B;  2MCT A;  3N40 P;  4AQY H;  5D1P A;  1P49 A;  4YJ3 A;  4LFA B;  1XHX A;  4DR5 B;  5LMU H;  1XI1 A;  4NXN B;  1HW7 A;  5D5P A;  4GKK H;  2F1M A;  4B3M H;  5IYZ A;  4I50 B;  5LP6 B;  1N36 B;  4PZ6 A;  4B3S B;  5FD6 A;  2ZM6 H;  4JI1 B;  5KHH A;  5FLX W;  2ZIN A;  2RJZ A;  4EB6 A;  4F6R B;  4DR4 B;  2Q2T A;  3BPZ A;  3HKD A;  4IAJ A;  2R72 A;  4BWA A;  2ZM6 B;  3T1H B;  2JGU A;  1XK5 A;  4TV9 A;  4K8X A;  1NT2 B;  2ZNI A;  4PI2 A;  3GDE A;  4DV3 H;  5FNV B;  3M7M X;  5J2T A;  4BW9 A;  1ZAU A;  2WYO A;  4GLX A;  2YI9 A;  2YIB A;  3TY9 A;  5GON B;  4JI4 H;  1TUB A;  4IIJ A;  2HGS A;  4LNU B;  3JAS A;  2HHH B;  4RZQ A;  2Q7G A;  4LF6 B;  3KAK A;  4YJ2 B;  2PUS A;  1S5J A;  3ETQ A;  4EFB A;  1TGO A;  4JI5 B;  2GV9 A;  4JV5 B;  4LF8 B;  5IJ9 A;  4DV0 H;  2UXC H;  5CA0 A;  2BTQ B;  2UUB B;  2F4V H;  4JI0 B;  3VNN A;  5CB4 A;  3FFQ A;  4O4I A;  3SR2 C;  2CW7 A;  3SJC C;  4CH4 A;  2UUA B;  2EX3 A;  4O2B A;  1D5A A;  2Q7H A;  3RYH A;  4FFB B;  4WBN A;  1T5E A;  5LOV B;  2HVQ A;  1X9N A;  2ZIM A;  1SA0 A;  4TOI A;  1O75 A;  2YCH A;  5LYJ B;  3RTX A;  4RAZ A;  3UT5 A;  1N34 B;  4X1I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...