4UCVA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 95
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucvA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucvA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucvA02
3RR5A 3JSNA 2Q2UA 4YHHB 1CKOA 2UXCB 4B3TB 1HNXB 5D1OB 1J5EB 4K0KB 2VQEB 4EQ5A 2Q2TA 3TY9A 3BABA 1IBKB 2UUCB 4JI6B 4OX9B 3NBYB 1TA8A 4B3RB 4GKJB 4DUYB 2HHHB 4DR7B 1IBLB 1V9PA 1X9NA 4LF4B 4EFEA 1N36B 1XK5A 3L2PA 1CKMA 4X65B 4JI0B 2HIXA 1XDNA 4DUZB 4DV4B 5DISC 2HVSA 4GLXA 4X64B 3KYHC 1ZAUA 4PZ8A 3GB8B 4UCRA 1XNQB 1N34B 1HR0B 3W1BA 5LMNB 4KHPB 3OTOB 4UCUA 1A0IA 1N32B 1HNZB 3W5OA 4DV5B 4EFBA 3RTXA 2E5LB 4JI5B 2UUAB 4JYAB 4NXMB 1HNWB 3BA9A 2F4VB 2HIVA 5D1PA 5D1OA 3TY8A 2UXDB 5IWAB 5BR8B 3T1HB 1FVIA 4LF5B 5FPRA 4UFZA 1IBMB 4JI4B 5FPOA 3W1GA 4X62B 3PN1A 3GJXB 4DR3B 2OWOA 4TOIA 2UXBB 4DV1B 3BAAA 1S68A 4DV6B 4NXNB 4PZ6A 1XMOB 3GDEA 3TY5A 4JI8B 4DV3B 4UCVA 4DV7B 2ZM6B 4X66B 4UCSA 4LFAB 4CC6A 4DR6B 4AQYB 1FJGB 3S24A 3VNNA 4UCOA 3QWUA 3NBZB 4PZ7A 3NC0B 4LFBB 1P16A 4JI2B 2HVRA 4DR2B 1XNRB 4DR1B 4UCTA 4LF9B 2VUGA 4DR5B 1CKNB 3T1YB 4GKKB 4DRFA 4JI3B 4B3MB 4CC5A 3UQ8A 1TAEA 1P8LA 4E6NA 3BA8A 1VS0A 2VQFB 2UUBB 4LH7A 4JI1B 1B04A 4EEQA 1XMQB 4LF7B 4DR4B 4JI7B 1CKNA 4YY3B 4LH6A 2UU9B 4LF6B 2CFMA 2HVQA 4LFCB 5LMUB 4DV0B 4DV2B 3SGIA 1N33B 1DGSA 3JSLA 4B3SB 4JV5B 4LF8B 1I94B
chains in the Genus database with same CATH superfamily
3CC7V 2UVVA 2DN9A 3V6HA 2W6MA 3CRCA 1J5EB 1W0KG 3G67A 3ZN0A 2EJ2A 4EB6B 3MR2A 2Z02A 3K9SA 4HNAB 3SPIA 3JARA 4ECWA 2GQSA 1H2SB 2DABA 2EBOA 2ZIOA 2ATLA 2R86A 2C22A 3MFIA 4MA5A 1N32O 1V9PA 2Q5ZA 5DN6G 2GUZA 3T9EA 1VBGA 5KKNB 1RK6A 1WCMG 4EFEA 1N36B 3ZMSA 3L71H 2P5OA 4MV3A 4OGQB 3MAQA 3Q8QB 3A0RA 4IRDA 4DQNA 4J9OA 3HBLA 4LF5O 5JQWA 1XHXA 5I5VA 5LP6A 3H1IH 2EZPA 3L73H 3OTOB 1A0IA 4UV9A 2CW7A 3F8NA 1WB7A 2P22C 1Q86W 2F4VB 5BXZA 4GYCB 5BWTA 2AGPA 3R5XA 1SFOA 1L0LH 2YS8A 4F4XA 2EILC 4MA0A 3H1KH 1IXMA 2JRIA 4FLUA 2OTLV 2EJ0A 2FL4A 4C7UA 4QNHB 1NZ6A 3BACA 3TIGA 2QWPB 5KT2A 2FKLA 4J9PA 3J80N 4O4JB 4BXXG 2W70A 5KA5A 1SCUB 2R85A 4JI2O 4DR2O 2HG8A 1KTAA 4RAIA 5JH7A 2YI8A 4DR1O 1A3GA 2ATKC 2R8GA 3WWHA 5J2TB 4DV5H 3ASNC 5HFLA 3CS5A 5IYDO 4BWSC 1DF4A 4NXNO 4UCOA 3AK2A 2EIMC 4AHCA 1WPBA 3RYCB 5KFMA 4DV3O 5L1KA 1K5SA 2R7ZA 2DIKA 3PZPA 4H37A 2XUMA 2OYQA 4I9QA 2HR3A 5CA3A 4UCTA 2ZT9B 1D5AA 2RF4A 2YUAA 4IRCA 2QSAA 3T1YB 4HR7A 1OCCB 1TVKA 4PA9A 2AGAA 1XNRO 3MDSA 1Y1WA 3N44B 5L1JA 5CA0B 4F4WA 4E4TA 4O3OA 1I7LA 2WTFA 2UUBB 5KUKA 3HXLA 3KHGA 4A3KG 3J7AU 4HYOA 2CW8A 2WLJA 4NVPA 4O3QA 4YY3B 2W7PA 3D36C 2EIYA 3DTGA 4D7SA 4WFAV 2WAQE 4J9NA 1RPRA 3LDCA 5JUMA 2JGDA 4DW1A 4MW3A 1TWCA 3AG2B 2XAJA 1VQ4V 3JSNA 2LGWA 4JAVA 5GONA 4FIPC 3G6EV 4FLVA 4XBFA 1CKOA 2Z3YA 1I7FA 4FZ1A 1R3LC 3OUZA 2JA8G 2EJRA 2DPJA 2DWDC 3LUTB 1ZWIC 3BFRA 4B3SO 3NXSA 3W7WA 2ADPA 4TV8A 1IDSA 1JJOA 4EGJA 4YR0A 4DL2A 2DE0X 1XNQO 4FM9A 2HJFC 2C2RA 4ZI7F 3VPBA 4BIUA 1R73A 5DGHA 1SERA 2G38A 3KAJA 2CGNA 2UUCO 3HKEA 4O4LA 3AG1B 4PWQA 5A2QN 2UUAO 4FMTA 1DTOA 5JWPA 1W93A 3KHHA 2P67A 2JJ2G 3Q4HA 4IYIA 3T1HO 1KC7A 4JV5H 1L8DA 1SQXH 1OCRC 2Q7HA 4BIOA 1S97A 2Q0AA 1AN7A 3RB3A 4PDRA 5LXTB 1AR5A 1GM8A 1HNWH 3IAYA 4DRXA 2UXDB 3RN4A 1K8AW 2XT9A 2XCAA 1Y74B 4J9ZB 5EC1C 3UKMA 3L4KA 3DTUB 3WU2Z 2RMKB 5CA1B 1VQ9V 2FLPA 3EVKA 4X62B 2NU6B 2WSSG 5C1PA 5GTHZ 3CCEV 2JEXA 2OCCB 1TWAA 2NUAB 3SJCC 3BAAA 5IT9W 3TQ1A 4Q43A 3T9AA 1O9GA 2SCUB 2JEIA 4RUCA 2BR0A 2A9HA 3CQZA 4J9SA 2Z5UA 3GLKA 1M57B 4JI5H 2ASLA 3L70H 4RUAA 3CMAV 2IM9A 3OEEG 4PA7A 1Z2OX 2EIJB 4LFBB 3HB9A 4IRKA 2YI9A 4UVCA 4LFAO 3MWDA 1Q3EA 2CE4A 4JI4H 5LMUO 4LFCO 1Y14B 4BWAA 4A93G 4DRFA 4C5AA 4CC5A 5L3BA 1H2MA 2B5UA 3CCMV 5DLFA 3VBBA 4NZMA 3K58A 5EZYF 5FLMG 2QWNB 1M0WA 2AW9A 3U10A 1XMOH 2XTAA 3L9DA 1XMQB 4LF7B 5JVDB 3ZHSA 4H0LB 2FK3A 2I8CA 3AG2C 1EKVA 1MSWD 1R3IC 3R5FA 4G3IA 4JZGA 3VPDA 4BY7G 2ZGIA 3JD1A 2N74A 2W9AA 4L8JA 3TK1A 2MK3A 3JATB 1US6A 1SQQH 4IIJA 4FFNA 2LFSA 4O2AA 5J2TF 4YQWA 3OGIB 4OX9B 1L2ZA 1O9HA 5LA6A 3WO1A 5KS8A 5KT3A 2ETNA 3K5MA 3Q8RB 2HGXA 4ASUG 3M99B 1IBLB 3CXHF 4X89A 4JASA 2QGNA 1YXBA 2HGSA 5KFYA 4FGRA 5H2FZ 4DV0H 3FFQA 2IJIA 3FKSG 1N33H 3S3WA 3RBZA 5EZYA 5LL6Y 1TUBA 3ZHQA 3GB8B 4UUGA 2QWRB 1ROPA 2E75B 2FTKA 4M7EA 4UB8Z 2UXCH 1QHTA 4U7NA 1Y1VG 2ZR2A 2W6QA 4UB6Z 2GQRA 4FFOA 5L3DA 4NXMB 1HNWB 3OMAB 4DV6O 3W7TA 5LMNO 1EM1A 1MOFA 3ABKC 2ITCC 3U11A 3N2GA 2NVYA 5IWAH 1OBGA 4FS2A 2RN9A 3G4SV 5KFXA 2OCCC 3M9NB 4ECXA 2HP8A 1AJPA 3ETQA 3HB3B 3LSQA 1RK5A 1S68A 5GTIZ 1V55B 4MVZA 5CM0A 2VUMA 1HR0H 3OE7G 3CMEV 1M57C 3MR6A 4C5CA 4QSHA 1NR7A 3OHBA 3M4IA 3GTJA 4DR6B 2J6SA 3QFFA 2B1IA 2AHZA 2EIJC 3JAWA 4FFBA 4H13B 3HKZA 3HKCA 4DK0A 3NC0B 1M0TA 4JI1O 2GBOA 1JDBB 5I47A 1X4TA 3AG7A 2M05A 5J2UF 3N2KB 2HKOA 2PBZA 1OCOB 5EBLC 5EIBD 4K8ZA 4F6RB 5B3SB 4QWDA 1I94O 1NKDA 2NLJC 4LBEC 4RAYA 1P7BA 1VQNV 3CX5F 2R9AA 2UVWA 4GCZA 2DOSA 5K1PA 1RSOA 5C1OA 4I55F 4B3MO 3G8DA 5CA1F 1JPXA 1PNMA 4J7KA 4LF6H 3ZRXA 2P7TC 1G1XB 2QDOA 3H1JH 4HBNA 3CYOA 3JCUZ 5TISZ 2EULA 2Q2UA 1MG1A 1KUQA 2Q7DA 1IX9A 1JFFA 2DJVA 3IFXA 2NR5A 2GV9A 4EQ5A 1RJRA 3CHXA 3BABA 1PD3A 1FD9A 2WLIA 3FMAA 4O4IB 4K6NA 4RZRA 4DUYB 5BMVB 2JEGA 4Q4DA 4J9YB 1VQ5V 2Q8VA 1GN6A 5AG2A 3TCUA 5CB4A 1UNNC 4N21A 5B66Z 4O7SA 5L3CA 2GLTA 3OR7C 2E2IA 5LYJF 5C8YB 4DV2H 5BYBA 4LMYA 3KCXA 1DF5A 2H3OA 2ZD9A 4J7ZA 2WE6A 3FDSA 1E4FT 3CVZA 4A3BG 4ZHQA 4XX0B 1KEEA 1DIKA 1M4UA 5JVDF 5KFVA 2P4VA 4Q45A 5KFFA 5IYZA 1JJ2U 4EBCA 2CH7A 3QTCA 4PJ0Z 2R72A 5IWAB 2ZE5A 1M9NA 3F7VC 2JS3A 2HHHH 2W6PA 3ETJA 2R8IA 3E35A 3RB4A 1ZSPA 1M93A 3SPHA 5IJ0A 3K3VA 1BS3A 3JYCA 4QE9A 1GYFA 3CWBH 3AK3A 3E8FA 4TOIA 4U7CA 4U6PA 4JUZA 2DYSC 1N48A 4PZ6A 1BMFG 5ITZB 2YXLA 1F23A 4A3FG 4DR5O 3GQCA 2B1GA 4X66B 2VA2A 3H4BA 3EHBB 1HNZH 4CC6A 5KHKA 3S24A 3SE7A 4MTEA 2N05A 3K5HA 4FLYA 2VQFO 2DLNA 4DV7O 4CKBA 2IU3A 5T14A 4HYKA 1P16A 4O3PA 3JARB 3HT5A 5I5XA 1SESA 3CCLV 3WNZA 4LF9B 2PY5A 5B3SC 3E83A 1NVPB 5DMXA 4TT3G 3JASA 5KFUA 4DR3H 3LNMB 5JQGF 2WDTA 4JV5O 3J81W 2GUZB 4GKKH 5IJ9A 1T5EA 4DV1H 1E4EA 3QVNA 5E25A 1E79G 2YIAA 2IBZH 2WB1E 5CN0A 3BJYA 2ASDA 4EEQA 4JV2A 1EZJA 4MV6A 1JMKC 4LF6B 5LP6B 1SQPH 3PW7A 2QR4A 1BGYH 5HFMA 1GM7A 4TUYA 5DG9A 1FJGH 1RM1C 3ZS8C 5C5JA 2JA7G 4NZNA 1D2DA 4JF3A 2UXXA 4YJ3F 2Y0SA 4A2BA 1BNCA 3LWBA 2LW1A 3OTFA 3T9FA 5D5QA 5KFEA 3P32A 2EIKB 1XI1A 4B7KA 4YJ2F 2R84A 1P49A 2E74B 1W2BU 3L72H 4QE7A 5IYBO 2ZDIA 4PI0A 4FLZA 3U54A 5IY5B 3RW0A 1UPGA 2Q67A 4DLKA 3N27A 3U9TA 3ETDA 4EYIB 3JD3A 4QPKA 3G6XA 3RYFA 2NU8B 3V4ZA 4X65H 4B08A 1BJTA 1SKVA 3T9DA 5EWFA 1KKCA 1N34B 1I2KA 4NTWA 2WWWA 3HOUG 4KUMA 4FLTA 3K9AA 2PI5A 2R7MA 3AW8A 5IDJA 1LUWA 1B06A 1QLEC 3OD4A 3RYHA 1H2LA 2K9PA 3E8GA 4DO2A 4JYAH 4OPAA 4NR1A 3K06A 2W57A 1TVKB 5EIBC 2DQ0A 4UXNA 1ULZA 4MVOA 2D3OW 1HWYA 3JRXA 3GIPA 3PN1A 4DW0A 4KFMA 3MFHA 4U3JA 4WCEV 4O84A 5D8DA 4AYBE 4A3GG 1LR1A 3IJ4A 3OGCC 3E22A 4NXNB 2A3QA 2ZQMA 4ZOLA 2JGDB 2BQRA 4ZIBA 1C30A 2YSUB 4KP4A 4DV3B 4UCVA 1GN2A 3OTOH 5B1BC 4BR6A 3T7AA 4CS3A 1Z5WA 3CP1A 4UV8A 2HHFA 3AG3C 3NUAA 5F9NA 2P6JA 5BY1A 1DV2A 5C8YF 5KFPA 2QM7A 4FFLA 1K33A 2F4VH 4PV1B 1BGWA 4HN2A 1VF6A 2FB9A 3FAVB 2D2CB 3WG7C 2VS0A 4TWKA 1CXZB 4TV8B 4FFPA 4JI7O 2Q73A 4AQYO 2UU9O 3K3PA 1S10A 1MMMA 3HOYG 4GKKB 1H38A 1VQMV 2V4RA 1PKXA 3HKEB 5J9PC 4Z1VA 1TWFA 2COJA 1K7DA 1ZL8B 4QW9A 2BTOA 3ETEA 1SQFA 1RPOA 5DLGA 1BQZA 1K4CC 4CMFA 3HO8A 3J80W 3RAQA 5KX5F 4F6EA 3Q1KA 3ETGA 2LW7A 5KT5A 1KU9A 1M6VA 1GMGA 2QYZA 5LOVA 3CCSV 1XOUA 4B3SB 1KJJA 3ETHA 1GO3E 5KG2A 4RNOA 3QG5A 1AILA 4PA4A 1FKAO 1FAFA 3MHSC 5KHGA 4JAUA 3CPWU 3CRRA 1HNXH 4B3TH 3ZRWA 1FPOA 1Q43A 5KAFZ 2UUCB 4JI6B 4DUZO 1DAAA 3T1YH 4YHHO 2W9CA 1GGOA 3E8BA 5FLXN 4ME6A 3DTFA 4ECUA 1QR9A 2W9BB 4RQEA 1VARA 4RB2C 4NZOA 2DPIA 1FXKB 4CKCA 3N6RA 2DYRB 5DGBA 4MAMA 3RBDA 4X65B 3K04A 3R65A 1Q6HA 1U97A 2HVSA 1VBHA 3JD0A 4IHJA 1M1KW 5JCOC 1VQKV 3PR4A 2AXTZ 2HG5C 4FFKA 4WBNF 4ETSA 2AGOA 4WF9V 2QEXV 5D5PA 4O2BA 4DV4O 2E5LB 4EBDA 4JYAB 1S03G 4B7EA 1QU7A 1KP2A 3JALA 1MZBA 4CBCA 4LNUA 4TQSA 4X1IB 2FPPB 4MW8A 3DAAA 2YZGA 4LCUC 2B63G 3JZFA 3GTGA 4QGPA 5FL7G 1NBMG 3W1GA 5KFSA 3GTMA 4YIOA 1Q7YW 1AVMA 2UXBB 5KFZA 2M7WA 3EFFK 3GWKC 1UC8A 4QWCA 2FLNA 3SYCA 1K73W 5A2QW 2L6LA 3GDEA 4CS4A 3UT5A 3TY5A 1KT8A 4JI8H 4QIWE 4LFAB 1OZ0A 2AHYA 3PW0A 3C0FB 4A3CG 3MR3A 4IIJB 2XD4A 1SYXB 2V1DA 4O2AB 1VQPV 1OWTA 3R66A 4CH6A 4RB3C 2UXDH 2ZM6O 4TV9B 4DR4O 4F50A 3ASOB 4WHXA 4I50F 3ZIAG 4FU0A 3UFXB 4LSAA 3DXRA 1GSHA 1S0MA 4X62H 1CE8A 1CKNB 5LL6b 1H8HG 3AG4B 5IYCO 1KQSU 4JI3H 1A0GA 3OUSA 5EYPB 4J80A 1MABG 3KHRA 3M8AA 5DGIA 5EOYA 1NU1H 1F4MA 2BSKA 2OTJV 1TUBB 4WFBV 2ZR3A 1ZQ7A 3N43B 5FNVB 1N8RW 2R70A 2DW4A 1KYOF 2F43G 2CNUA 4DR7O 2Y48A 4LF8H 1KC8W 4LFBH 1Q82W 2ILMA 4B3TB 1HNXB 5KG0A 3ZHUA 2ODMA 4LF4O 5KG6A 3H0GA 3TY9A 4K0KH 2VQEH 2YCHA 2DQ3A 1KJ9A 3IG0A 4J10A 5FD5A 4A3LG 5H6RA 4G28B 4BAYA 1FXKC 4DL6A 4GKJH 4X1YA 4I50A 4X20A 4JXUA 5KHIA 4I5SA 2ZKOA 2QTOA 2QJ1A 4RB0A 1XMQH 2P06A 5BWXA 1WSCA 4LF7H 3JRWA 1E1QG 3E5NA 2FP4B 2CGOA 2YZMA 2W6OA 1RJQA 2FLLA 5BR8O 4GLXA 1P84F 3OMIB 4X64B 2RGVA 1W96A 3JAWB 2W6ZA 1JCHA 1YHQV 3W1BA 4Q8FA 3HKCB 1PNKA 3D3QA 4Z2WA 5LMNB 3QZ8A 4DR3O 2Q68A 4UVBA 4KHPH 2A79B 4MV4A 4A3IG 2R93G 3SPCA 3N40P 5KG4A 4OX9H 3EPIA 2Q6AA 5L9XA 2C2DA 1S5HC 5CBFA 3P30A 3O9OA 1GH6A 5KT6A 2HJWA 2WYOA 2AQ4A 3HKBB 1IBLH 4UFZA 5FPOA 4XDJA 4DXWA 3HKDA 3GJXB 1RSOB 1NT2B 3U55A 3TEKA 4A2AA 2GSMB 1MNGA 1PL4A 5F9LA 1N56A 1QVFU 5KFIA 4IWXA 1IBMO 3JAMW 4JI8B 1ET0A 2E76B 3K0GA 3G71V 3TW6A 1Q90D 3ORRA 2J9GA 4GLWA 5BZBA 4NXMH 3Q8SB 3PVXA 4O86A 3VPCA 5EK0A 2CTWA 3B77A 4IR9A 2BOCC 3ZMZA 2WLIB 2IH1C 4R8UB 1BHAA 4FVMA 4Q0YA 1SZTA 3AG4C 3ZEDA 4ED1A 4YBZB 2ARHA 1EFRG 5CB4B 2YXHA 4JI3B 4B3MB 5KAIZ 3SYPA 1T36A 4ZI7A 2YC0A 2DAAA 5BWWA 3K59A 1J5EO 1EUCB 3GV7B 4RO2A 4TQDA 4JAAA 5DECA 3IN5A 5C93A 3DC6A 4ZHQB 3R5HA 1JLLB 4DR6H 3JZ6A 1RFYA 1BCCH 5A9GA 4YB8B 2R82A 4LF8B 1S9FA 1AP5A 2RDIA 3BY6A 3KALA 3OW2U 2IH3C 2YWVA 1OCCC 2CH7B 2QF7A 1K4DC 4K0KB 2VQEB 2R92A 3GIJA 1N36O 1R9TA 3GB7C 4M9UA 1IXBA 4X1KB 2ZDHA 3GV5B 3K0DA 1XUQA 4FE2A 4RNNA 1Y67A 3D36A 4DL7A 5IJ0B 1IBKH 4Q4CA 4WFHA 4JGSA 3PR5B 4GKJB 2HGWA 2W6IG 2FMAA 3HOWG 4B3RH 4TV9F 2I80A 2RGRA 2CKZB 3GTKA 4X9QA 3UO3A 3CE2A 4EB6A 2QA4V 5BPFA 3EYYA 4HNAA 4O4JF 3AYHB 4R8CA 4F4ZA 4A5UB 2C2AA 3JAKB 3ZRVA 3ORQA 1ZHQA 2RDJA 3V4SA 3H3VH 5BWRA 2RJZA 3GTOA 4F4LA 2FMLA 1DLBA 2YICA 4KHPB 4QJFA 4JI0O 2XAFA 5KFDA 2PI4A 4JYBA 4TSFG 1P4RA 5FNVF 5KMGB 3BA9A 3STZC 1TWGA 3ML0A 2XGQA 3GVMA 2W8KA 3AG1C 5KFHA 1VIBA 4O7VA 4DUYH 2FKXA 4FLWA 2W8LA 4RUFA 2PF4E 2F1MA 5IJ9B 2ABJA 3RYIA 1KBLA 1J95A 2LJ2A 3IC7A 3MD0A 4MVQA 3L74H 1EN6A 4ED2A 3B4SA 5CE8A 2J6TA 5CA0F 2H8PC 1ZTEA 1WP8A 4OXSA 1K1SA 1YJNV 2JA5A 3LDDA 2JS5A 3KZIZ 4DV7B 3T1YO 3NR7A 1GO3F 4YR2A 3VNNA 3FKIA 4MV1A 3V6JA 2UUBO 1WP7A 2HVRA 3RVZA 3WFVA 5HBRB 2R7ZG 4YY3O 5J2TA 3T1CA 1NH2B 4RU9A 2VUGA 2R8JA 2C2EA 2HEPA 2LQTA 1I08A 5KFKA 4XZ3B 3LQSA 2JA6A 1PP9H 3RYCA 1I1MA 3F5WC 1PNLA 3RBEA 2QE7G 1XDCA 4E6NA 4PDMA 4ZKIA 1GTOA 3BA8A 1VS0A 1Y1WG 1R3KC 1B04A 2KG7B 4LH6A 5IT9N 5LGNA 2ZCEA 3GIDA 2HVQA 4X66H 5JVLA 2IBKA 1E1RG 3MHHC 2JIZG 1PV0A 1RYRA 5IYDG 3C90A 4BY1G 2B9ZA 5BWVA 4MTOA 1GSOA 5KT4A 3OSNA 3RB0A 3PFFA 1CS0A 2CNVA 4O82A 2EINB 4MTDA 3OUUA 5KG3A 4FLXA 1Q6IA 3FYEB 2Q2TA 2Z0AA 1T94A 1VF5B 4LF9H 4J11A 1IBKB 1ZLZA 5LXTF 4ABMA 1KJ8A 2L35A 4B3RB 3SJAC 5K2MA 2Y69B 4AILC 4ED3A 1SQVH 4LWSB 3E22B 3TIIA 4QPJA 4I4TB 4XYLB 4U3FH 3L2PA 2X6BA 1SA0B 2I87A 1VQ6V 3ABUA 4QIWF 1QR8A 4P30A 3PJSK 1KD1W 1O75A 5EWEA 4X62O 4I7HA 1QCEA 4FS1A 1GN4A 1K1QA 2Q9LA 5I5SA 1NVPD 1N32H 4IL6Z 2UVUA 1S5LZ 1F4NA 5D1OA 3TY8A 2MW2B 3ICXA 5J2UA 4DV5O 1THZA 4I0XA 4IYHA 5FD6A 4L87A 1VEWA 4O4HB 3RGXA 5DM6V 1Q5OA 1VMGA 5LXTA 5BWUA 3M9MB 2JEFA 4X8AA 2A7WA 4ED6A 2C28A 3O65A 2CK3G 2CAZC 2WPDG 1Y74A 3OEHG 1JX4A 2R7KA 3CEBA 2QKSA 4I55A 5LOVB 1WRVA 5CA1A 3ABMB 1SS3A 1N34H 3CCQV 2W6NA 2PYLA 5KFOA 1S0NA 4AQYB 3SDLA 3QWUA 1PX2A 2YEVB 5DQGA 4QWEA 1SC5B 3CRAA 2NNUA 1JVMA 2NU9B 2K1EA 3H1HH 1NS1A 3LSSA 3PW2A 1WA8B 4JI2H 4DR2H 1M56B 1V55C 3B09A 4DYLA 3OUFA 2FYUH 3H01A 5IE9A 1B33N 1GKFA 1RP3B 4MTXA 4NXNH 2X5RA 1V54B 3KREA 1CPYA 3RWRD 4IHJB 4DV3H 4JV1A 2R8HA 4PA6A 3LP8A 5LYJA 2QTSA 3VQYA 1GK9A 5HNEA 2CQYA 3Q2OA 3R23A 4XYMB 3DSQA 3X2QB 1OCOC 3RR5A 1IURA 2NN4A 4YHHB 4D6TH 4ECQA 4LNUB 4CKEA 2ZXWB 5JVDA 3DGEA 1KJIA 3LNNA 1JA8A 3E2EA 3TJTA 3I55V 2Y69C 1JXLA 3NBYB 1H8EG 5DQHA 3B8NA 1EKPA 4FFRA 3W7SA 1BHBA 1WCMA 3JATA 4MV8A 3DF7A 3B2EE 1X9NA 3PW5A 4A3JG 3FD9A 3CC4V 3KXYT 3RUPA 5LBQA 1HNWO 4DV4B 4I9WA 5DISC 5LGTA 1SQGA 4B3SH 4EBEA 3KYHC 2GTAA 3RB6A 4WFEA 2WAQA 2X7RB 1NJIW 5C44G 2QM4A 3AEIA 1XNQH 5FR9A 1G2WA 3BQ1A 2XAGA 1N32B 2JDIG 2HFEC 2YS7A 4H33A 2UUCH 4JI6H 3DXRB 3HR0A 2RNBA 5D1PA 2UUAH 1GN3A 2WLHA 4K35A 1I1KA 3BG5A 1FVIA 2Y4UA 4O7ZA 1MZFA 4LF5B 2O03A 1JQ0A 3OT7A 2IJHA 4JI5O 2R7LA 5JH7B 2Q0OC 3UM7A 3W7XA 1YTFB 3SPGA 2J6UA 5JQGA 2QKCA 5FLXW 5LHGA 2W71A 4MTGA 2V4QA 1AUVA 3ABMC 1F7YA 2CTQA 4JI4O 3AX6A 1KUTA 2ZNIA 1ORQC 5I5WA 2ZM6B 1I6UA 3RIZA 2OT5A 2VUMG 4UCSA 3SYQA 4I4TF 2DMXA 2F23A 1L1FA 2COIA 2E5LH 4A3EG 4O3NA 1W0JG 5EBWC 4YJ3A 2R87A 1XMOO 4ECYA 2WLNA 4YAJB 1CEZA 2IJJA 5F2VO 4RZQA 1VP7A 2AU0A 1M56C 1SF9A 4JI2B 4O83A 2PN1A 2F93B 4DR2B 2VRZA 1ZETA 1UFIA 3T2MA 4DR1B 4YJ2A 1YEWA 3VQXA 4FZ0A 2RDCA 3J7AK 3K5LA 4X20B 2LP7A 3CEIA 2UXBH 2WAMA 1TAEA 1V54C 1XL4A 4O4IF 1S0VA 5BMVF 4BBRG 3T5LA 3Q8PB 2AGQA 1OHHG 4R7RA 4X88A 4ZBMA 2UVRA 4O4HF 5GONB 3MJFA 4F6RA 4PA3A 1S72V 4LFAH 3H1LH 4EEYA 3X2QC 2GTSA 5EBMC 2CNQA 3UYYA 3VA7A 5LMUH 1XREA 4LFCH 2XHBA 1Y76A 4FBUA 1XNRB 3U0ZA 5BPHA 3VQVA 3G6BA 1AI4A 4A3DG 5HV6A 4PBCA 1A48A 1VF7A 4DV0O 3BEHA 4RCNA 1QBZA 1N33O 3KTMA 3G6VA 4O4LB 1VQOV 1COWG 4O7YA 2VOBA 3B40A 4IT5A 4ECSA 4FK5C 1AB3A 4O3SA 3RGZA 5FJ8G 2UXCO 5B1NA 5DAAA 5E79Z 5EC2C 5LP6C 2PYJA 3Q4HB 5KUMA 3K5NA 2YRWA 3C3TA 1CQIB 3CC2V 3FB8C 1BSMA 1XL6A 5E1AC 2YL2A 2YZLA 2EILB 1XK5A 1WNSA 5KG1A 4J9LA 5DQIA 1XDNA 2YDEA 4ECRA 5BMVA 5IWAO 5L3GA 5I60A 2EIKC 3K5OA 4GZRB 1EN4A 2EJ3A 4DK1A 1XNQB 4FM0A 4NYKA 4DL5A 2WA3A 4DRXB 2VR1A 2BOBC 2XAHA 3HKZE 4UCUA 2Q7EA 4MVSA 5C8YA 3R9RA 2UUAB 3LMLA 5IY5C 2HIVA 1HR0O 4MV7A 2X6CA 4MTFA 3ASNB 1G4YB 4JZ2A 2R9RB 3H9VA 2GDSA 3T1HB 2ZIMA 1XILA 3HOVG 2KSDA 1NTMH 2EIMB 4ED8A 2F66C 3F7YC 1WJZA 1IBMB 4UVAA 4LSXA 3P3PA 4DAAA 3WB0A 1V4YA 4X64H 3CCVV 2JEJA 5KX5A 2YS6A 4DV6H 5JJEB 3SR2C 2WLLA 2M6YA 5LMNH 5LP6F 1MZEA 1LUVA 3U9SA 2QWOB 3ZHVA 1NTKH 2COGA 2WA4A 5KA6A 5KFRA 1JKJB 2VQDA 4ECZA 3K03A 4HAMA 2W0XA 1AUXA 1K9MW 2VWJA 4BIZA 5L3FA 4J0MA 3L75H 4LF6O 3GWOA 4K8XA 3T5HA 2ITDC 2W6JG 3ABLB 4QWAA 2EJ7A 1EUDB 3F5TA 3KKYA 4RWUA 1XHZA 2YIBD 3PW4A 1YF2A 5BYAA 2R9IA 4E2LA 5CR5A 2FE3A 4PDBA 1DV1A 4O7RA 5JH7F 1G8MA 4CH4A 1VKZA 3VOUA 4YAKB 3A2FA 2HLDG 4JI1H 4G27B 2Z04A 2ZDQA 4LFCB 5LMUB 1I7NA 1V51A 4JPRA 4EYHB 3TGUH 4QJFB 1PL0A 4RUEA 2LGQA 1IZ3A 2N04A 3OHAA 2W7OA 1I3QA 1YJWV 2AZ0A 2BCCH 4WBNA 5LA6B 4GX0A 5LHHA 2KSWA 3RV4A 3RJ0A 1I94H 4YIPA 3THOA 4DV2O 3ABTA 5KHHA 5KG5A 1OCRB 3RYIB 4B3MH 1KECA 1IOWA 1AI5A 1KMIZ 1H2NA 2DWCA 1KP3A 4MVRA 1VQ7V 1N34O 5EZYB 1EZVH 3WWJA 4R7CA 3T4ZA 2NU7B 2V7QG 1YJ9V 3CRMA 5CBGA 4W4LA 3D8CA 2BTQA 1U96A 5L3EA 4JI0B 3I4NG 2HHHO 2F95B 1NI8A 4P9PA 3OR6C 5DEDA 3ZMTA 4DIMA 4BBSG 2ADQB 1TWHA 4Z1MG 4Y8VB 1URFA 4M0JA 1Z2GA 1JIHA 1Y1VA 5GONF 2OCHA 3N2GB 4EFBA 1YIJV 1BL8A 2XNDG 2QB5A 1GSAA 2IU0A 3SYAA 4RNMA 4K3AA 5I5UA 1Y6XA 4TV8F 1B3QA 4O7WA 1YVWA 5IYBG 2CTRA 2DYRC 5JCOA 3E8HA 1Y66A 1HNZO 1NTZH 3ZMUA 2LFRA 1WH2A 3LSUA 2OWOA 5LGUA 4O4LF 4YP3A 3SNOA 1QNMA 4J9QA 1GAXA 2X0SA 2C00A 4FFBB 4DV6B 3QO5A 1JR9A 5KT7A 1FFTB 1SETA 3UO2A 4GKKO 2IJKA 1B6QA 4DV1O 2FK2A 4GC6A 2Y0SE 2YRXA 1A9XA 4RQFA 3ZCCA 3VQWA 1AR4A 2PUSA 5B5EZ 4R50A 3QF7A 5C3EG 3ABLC 3U0GA 4TQRA 1AP6A 4NYEA 1SRYA 1FFXA 1S5JA 4GX5A 1FJGO 3SPJA 1FYJA 2JEUA 2ZE8A 2PMZE 2IW5A 2OIGA 4DR5H 3WB2A 3FB7C 3OSPA 3FAVA 1HDJA 1VAJA 2IMWP 3IGAC 2JK5C 1P8LA 4MVUA 1H2GA 5CBHA 3EPGA 3GILA 4JI1B 2VQFH 5JJJB 2HJDA 4DV7H 1JFFB 2FJZA 4JI6O 3CJHA 4P2ZA 4MVMA 2KB1A 2X0LA 3ASOC 4CS2A 1ZL8A 1S76D 1I1LA 3K79A 1KKDA 1S0OA 1I94B 3TETA 5DGAA 3CCRV 3BCCH 4CE5A 5D1OB 4XDLA 2CTPA 2XCPA 4X65O 5J2UB 5IP7G 4I0XB 3T4DA 3SJBC 1ZX3A 5B1AB 2HDKA 5KHJA 4I55B 2E5LO 4O7NA 4JYAO 4ED7A 2XASA 4QW8A 3ABKB 2WB1A 5C4XG 5GW7A 2RQ6A 3G80A 4IZOA 1W59A 5IYZB 3BPZA 4NTYA 3CCUV 1YCIA 2PVPA 2V4DA 1UC9A 2W9BA 1FXKA 4FM2A 4DL4A 2ZINA 1NH2D 4DV5B 1GLVA 3W5OA 2UXBO 4C2MA 3HOZG 4IIJF 4O2AF 1A32A 3AK1A 3QO7A 3RGBA 2A06H 5LA6F 4IWYA 3OTOO 1FXHA 4H44B 1VQ8V 1F51A 3QZ7A 4PDLA 2OLSA 4I7ZB 2QKAA 3ZHRA 4J9RA 2OIEA 3D3IA 3H40A 2F4VO 4XDKA 3I5DA 5JJNB 4X1IA 1X59A 4U7OA 3MWMA 5LYJB 1RJPA 4J9MA 1XQ8A 2X6AA 4CMDA 1XBLA 1EKFA 2R7NA 1VQLV 1S77D 4FFMA 3T5KA 1K83A 3KAKA 2ZJTA 4FBTA 3JASB 5EWGA 3STLC 1JX9A 4F4YA 1WLEA 1B6SA 1E4EB 4A3MG 3ZHTA 1K92A 2P4KA 4DR5B 1BQ0A 1YSCA 3UQ8A 4TUYB 5KFWA 4GC7A 4TV9A 4WFFA 4B3TO 1HNXO 1AJQA 2VQFB 3K57A 2IA6A 2HVKC 2KKWA 3I4MG 4AYBA 4LR3A 4TM5A 4O4JA 1CKNA 1M5IA 4UUJC 3TQTA 3CRQA 1Z2PX 1K97A 4JI7H 3HOXG 2JA7A 1R1BA 3JAMN 4AQYH 2UU9H 3I56V 1CQJB 1ENVA 3JSLA 5EYPA 4JV5B 1QVGU 2V5AA 3GTQA 3OM3B 3APOA 3TXQA 1M90W 3MWEA 1C3OA 5DG8A 4MSWC 4HNUA 2VPSA 1OCZB 1GM9A 5FNVA 4GX1A 5B1AC 3H0GG 3WWIA 3RYFB 4X64O 5JQGB 5IYCG 4LC1A 3ZJZA 2O57A 5L1IA 3BQ2A 4PDVA 1IYDA 1FKAH 1WAZA 4RAZA 1CKMA 5CA0A 4BW9A 2HIXA 3T99A 1YITV 1BT8A 3N8DA 3RYHB 1IOVA 3LDEA 1Q81W 4DUZH 1ZAUA 5KFJA 2YU9A 1CP9A 1OJHA 2DWEC 1UJWB 4YJ3B 3UZOA 4N23A 2FK1A 3N42B 4O81A 4YHHH 1AI6A 1N4CA 3M9OB 3RT3C 1Z5VA 4MS2A 2DYSB 4JI5B 3JZIA 1D5NA 2YIBA 2KQXA 4YJ2B 3ZX6A 3TINA 3VOTA 2Q69A 4U3JB 3CCJV 4JI8O 2VWKA 1FS0G 1TUEB 4OPHA 3E86A 4ICGA 4JI4B 4ZOLB 3RVYA 4HNTA 5CB4F 2MCTA 2ZNJA 1R6KA 4EGQA 3CXCU 5I5TA 2UXDO 2P90A 3W7UA 3UZBA 3OMNB 5K3WA 2HHFB 4DV4H 3HKBA 5H9CA 4FM1A 3A0BZ 1IYEA 2XC9A 1XMOB 1I5XA 1YDXA 3RFRA 3K3WA 1Y76B 1YI2V 2ZE7A 4ZHQF 1YZBA 2CZGA 3A8TA 1N0NA 4YXWG 1AI7A 4JI3O 3SYOA 1M7JA 5IYZF 3L4JA 4GT1A 1OBDA 5H6QA 2VPQA 1AJNA 5IP9G 4LF5H 1RM1B 3OAAG 1I2LA 3JD2A 1BE3H 5L1LA 3K08A 3N41B 1EZ1A 1S3JA 1R6TA 3OFNG 2Y0PA 2Y4RA 1K3EA 3RV3A 2ASJA 1PK8A 4LF8O 4LFBO 2WLKA 2EZOA 1QQCA 3T9BA 3GV8B 3KG2A 4NTXA 3WB1A 4R8UA 4K0KO 1Q8IA 2VQEO 1E4GT 5H5NA 4JI7B 1FXVA 2ZM6H 3FX7A 2CFMA 2UU9B 2YIDA 4CHIA 4DR4H 4ED0A 4DV0B 4J42A 1H2KA 3ZRWB 1BXRA 3KCYA 3GTLA 2P0AA 1N33B 1DGSA 4GKJO 2ZDIC 4QIWA 3CSXA 2AZ2A 1XMQO 1JDEA 4LF7O 2W9CB 2IP4A 1OCZC 3A0HZ 2UXCB 2DZDA 5I5YA 4DR1H 2RCVA 3RFCA 2Q7GA 4GUNA 1WN7A 4Q20A 1YTFD 2V59A 4O7LA 2R92G 2E2HA 3N6XA 4WFGA 1I0HA 3JD4A 1AR1B 2BE3A 1TA8A 1SZXA 2H94A 1QLEB 3BHPA 4KHPO 4J9KA 2R6FA 2R8KA 2LO1A 1XEQA 3QO8A 4P9OA 3QNEA 1EHIA 3VMMA 4DR7H 4X1KA 2OH2A 1EYZA 4OX9O 5KX5B 4PHZA 1NQTA 2WLLB 1KB9F 4CH5A 4LF4H 4O2BB 2EINC 3T54A 4DUZB 2YXYA 4HQ6A 4TUYF 1IBLO 3RF2A 1XNRH 3JALB 4JTDB 1BZKA 1HR0B 1SQBH 4MV9A 3JAKA 4Q6GA 3S3XA 4R6ZA 1RYSA 4FPPA 1P7GA 5B1BB 2Q4PA 3K5IA 1K34A 4QWBA 2B63A 4LP8A 3AG3B 2E3CA 5FPRA 1Z2NX 3TW7A 5BR8H 4J7JA 4NXMO 3UT5B 3WG7B 5KMGA 2BQUA 3PO3G 4WD3A 3NGDA 1VF6C 4NLGA 1MA1A 3T9CA 1Q6UA 4WBNB 2JGUA 2JA5G 3KHLA 3GIQA 1Y4MA 1WPXA 4TQFA 2VA3A 1JOYA 5KLVH 1B6RA 2Y0IA 3NBZB 2QM8A 4L1KA 3ZMVA 3FKIG 4PELA 3GIIA 4IR1A 3T1HH 4DR6O 5KFGA 1IBMH 2FPIB 2BSKB 2GPWA 3QQMA 1EBOA 1ZUQA 3I12A 2PTMA 5KFTA 2JA6G 3T5JA 2A0LA 2PMZA 2BTQB 2W0FC 5LHIA 1R6NA 4LH7A 3M7MX 4IAJA 2QK4A 4DR4B 2XOKG 4ZOLF 2YYAA 1T3NA 5K1XA 1IBKO 4HNVA 3SJQC 5H80A 2XGPA 4DV2B 4B3RO 2V58A 3ZRSA 1DK1A 4APMA 1N0JA 3CB2A 4GX2A 3G8CA 2KG7A 4TVIA 1R3JC 3BVOA 2JJ1G 1I5YA 4KXRA 2HVJC 4I50B 4X1YB 1J5EH 2GHYA 1PM9A 4D7TA 4NB5A 4Q8EA 3ZN1A 1ZHSA 4ECVA 3N2KA 2HHHB 4DR7B 3SI8A 3RAXA 3P3NA 3ZBHA 5KFAA 4JYCA 2ODTX 2FB5A 4LF4B 2YW2A 2C35B 1I50A 3MR5A 3H4DA 3V6KA 3APQA 3B8MA 4O3RA 4CH3A 5CAEB 4DUYO 1N36H 5KG7A 5KFCA 3G6YA 5DG7A 3GIMA 2ZXWC 5LOVF 4PZ8A 1HW7A 4UCRA 2ZE6A 4LWSA 1WR2A 1G6UA 4I4TA 4AI8A 2JVDA 2R93A 1HNZB 3RTXA 1KBHA 5KFLA 1SA0A 3HKDB 1FFXB 1QLNA 3FB6C 1MSDA 4PI2A 4NKGB 3E89A 1SEIA 4BW5A 1AROP 3GTPA 1GRJA 5BR8B 1IVSA 1HP8A 2Y4TA 2GPSA 5KFNA 5B1OA 3J81N 3JCZA 3DC5A 4DR3B 3TXSA 4O4IA 1EN5A 4JI0H 2BQ3A 4JV0A 3FYIB 4DV1B 3CJHB 2V9WA 1LNQA 3HPLC 4O4HA 4IGGA 4IHJF 4DL3A 5EDWA 4EKWA 4ZQIA 3WO0A 4JYYA 3LULA 2EX3A 2A1HA 4Q44A 1PPJH 4JTCB 2CUGA 5CMUA 4O2BF 1FJGB 2ALZA 4YR3A 4KL1A 3CD6V 4FJCC 4PZ7A 4ZI7B 3IC9A 4X66O 4HZ3A 5KFQA 3CSWA 1NR1A 4EG0A 4G2KA 4CZZA 1K5QA 1TGOA 4JTAB 2YZNA 3GIKA 2QWQB 2PGGA 2XIGA 2WLMA 3H20A 3C3SA 2YEVA 2ZDGA 2PZSA 3UCSC 4PD4F 4MT8A 2CDYA 1L0NH 4LF9O 4RB1A 1WA8A 1WB8A 3PO2G 2NVXA 2UXNA 2UUBH 4W4KA 3BQ0A 4C5BA 3FB5C 4O7TA 1KJQA 3BRCA 4YY3H 3SGIA 2XAQA 2XCLA 5KFBA 5ITZA 2FPGB 3EXAA 4ECTA 4E4EA 1OV9A 4J41A
chains in the Genus database with same CATH topology
4A2BA 4MTDA 5D1OB 4FLXA 1J5EB 2Q2TA 3OTFA 5D5QA 4LF9H 1XI1A 5J2UB 4EB6B 1IBKB 1P49A 3SJBC 4HNAB 3JARA 4B3RB 1H2SB 3SJAC 2ZIOA 4PI0A 4FLZA 5KHJA 4AILC 1V9PA 3E22B 4I55B 4I4TB 4EFEA 1N36B 3RYFA 3L2PA 2P5OA 2RQ6A 3MAQA 1SA0B 5IYZB 4X65H 3BPZA 4B08A 2V4DA 1BJTA 1SKVA 1XHXA 1N34B 5LP6A 1O75A 4FLTA 4I7HA 4FM2A 3OTOB 1A0IA 2CW7A 2ZINA 3W5OA 4DV5B 3F8NA 1N32H 2P22C 3RYHA 2F4VB 4GYCB 3RGBA 5D1OA 4JYAH 3TY8A 3ICXA 2W57A 1TVKB 5EIBC 5J2UA 4FLUA 5FD6A 4O4HB 3RGXA 3PN1A 1Q5OA 5LXTA 5JJNB 4O4JB 4X1IA 3MWMA 4U3JA 5LYJB 2CAZC 1XQ8A 3E22A 4NXNB 4I55A 5JH7A 5LOVB 2YI8A 5CA1A 4ZOLA 1N34H 4ZIBA 4DV3B 4UCVA 3OTOH 5J2TB 4CS3A 2PYLA 1Z5WA 3KAKA 4BWSC 4DV5H 4AQYB 2ZJTA 4UCOA 3JASB 4AHCA 3QWUA 2F4VH 1WPBA 1BGWA 3RYCB 4TV8B 2OYQA 4I9QA 4JI2H 4UCTA 4DR2H 1D5AA 4DR5B 3T1YB 4GKKB 1TVKA 3HKEB 3UQ8A 4TUYB 4TV9A 3N44B 2BTOA 5CA0B 1SQFA 4NXNH 2VQFB 2UUBB 3K57A 2KKWA 3HXLA 3J80W 3RWRD 4LR3A 2CW8A 4IHJB 4NVPA 4O4JA 1CKNA 4DV3H 1M5IA 4YY3B 5LYJA 1KU9A 1Z2PX 4JI7H 3VQYA 4D7SA 4AQYH 2UU9H 5LOVA 3JSLA 5EYPA 4B3SB 3DSQA 4JV5B 3QG5A 3RR5A 3JSNA 4FLVA 5GONA 4YHHB 1CKOA 4LNUB 1I7FA 5JVDA 5KHGA 2VPSA 4B3TH 1HNXH 5FNVA 3LNNA 1Q43A 2UUCB 4JI6B 3T1YH 3RYFB 4TV8A 3NBYB 1JJOA 5JQGB 4FM9A 3JATA 3DF7A 3KAJA 4RB2C 3B2EE 3HKEA 4O4LA 1X9NA 3KXYT 1FKAH 4RAZA 1CKMA 4X65B 5CA0A 4BW9A 2HIXA 4DV4B 5DISC 2HVSA 3RYHB 1SQGA 4B3SH 4JV5H 4IHJA 3KYHC 1ZAUA 4DUZH 5JCOC 1L8DA 3N42B 4YJ3B 2QM4A 4YHHH 2Q7HA 4ETSA 1XNQH 5D5PA 2Q0AA 1Z5VA 1N32B 4O2BA 1AN7A 2E5LB 4JI5B 2YIBA 4JYAB 2UUCH 4JI6H 4YJ2B 1S03G 5LXTB 5D1PA 3JALA 2UUAH 1MZBA 1HNWH 4LNUA 4X1IB 3IAYA 4DRXA 2UXDB 4U3JB 1FVIA 4LF5B 2VWKA 2O03A 3L4KA 5JH7B 5CA1B 4JI4B 4ZOLB 3W1GA 4X62B 5JQGA 2MCTA 2ZNJA 5FLXW 2UXBB 3SJCC 3BAAA 4DV4H 5IT9W 5A2QW 3HKBA 1O9GA 4FM1A 1XMOB 3GDEA 3RFRA 4CS4A 3UT5A 3TY5A 2ZNIA 2ZM6B 1I6UA 3RIZA 4JI8H 4UCSA 4LFAB 2E5LH 4JI5H 3C0FB 2IM9A 4IIJB 4YJ3A 1SYXB 4O2AB 3L4JA 4CH6A 4RZQA 4RB3C 2UXDH 1Z2OX 4LFBB 4JI2B 2YI9A 4TV9B 4LF5H 2F93B 4DR2B 4DR1B 1Q3EA 4YJ2A 4LSAA 3N41B 4JI4H 1YEWA 3VQXA 4X62H 4BWAA 3J7AK 3K5LA 1CKNB 4X20B 5LL6b 4DRFA 4CC5A 2UXBH 4JI3H 1TAEA 1QQCA 3K58A 5EYPB 1M0WA 3WB1A 4R7RA 1Q8IA 3U10A 1E4GT 1XMOH 5EOYA 1XMQB 5GONB 4LF7B 4JI7B 1TUBB 2ZM6H 2CFMA 2UU9B 5JVDB 4DR4H 4F6RA 3N43B 4DV0B 4LFAH 5FNVB 2R70A 5LMUH 1N33B 1DGSA 4LFCH 2XHBA 3CSXA 1XNRB 3U0ZA 3VQVA 4LF8H 4LFBH 2UXCB 4B3TB 1HNXB 4L8JA 1VF7A 4DR1H 3JATB 4IIJA 3TY9A 2Q7GA 2VQEH 1WN7A 4O2AA 4O4LB 2YCHA 4K0KH 3IG0A 3N6XA 2VOBA 4OX9B 5FD5A 1L2ZA 1O9HA 5LA6A 3RGZA 1TA8A 3K5MA 5LP6C 2PYJA 3K5NA 3BHPA 4GKJH 4X1YA 4I50A 1IBLB 4X20A 5KHIA 4DR7H 4RB0A 1XMQH 2QJ1A 4X1KA 4LF7H 5KX5B 2HGSA 4PHZA 1XK5A 1WNSA 4CH5A 4DV0H 3FFQA 4O2BB 4LF4H 1XDNA 4DUZB 1N33H 5BMVA 5EZYA 4GLXA 3RF2A 4X64B 2RGVA 1XNRH 3K5OA 1TUBA 3JALB 3GB8B 4DK1A 3JAWB 1XNQB 4FM0A 1HR0B 3W1BA 4DRXB 4MV9A 4M7EA 2UXCH 3HKCB 5LMNB 1QHTA 4UCUA 2Q7EA 3JAKA 4KHPH 4Q6GA 5C8YA 2UUAB 3LMLA 4NXMB 1HNWB 3N40P 4OX9H 2HIVA 4MV7A 3T1HB 2ZIMA 2E3CA 3U11A 2WYOA 5FPRA 1Z2NX 3HKBB 3N2GA 5IWAH 5BR8H 2F66C 1IBLH 4UFZA 1IBMB 5FPOA 3UT5B 5KMGA 3HKDA 3GJXB 1NT2B 4LSXA 4A2AA 3ETQA 3WB0A 1S68A 4X64H 3JAMW 5KX5A 4DV6H 1HR0H 5JJEB 3SR2C 4JI8B 4WBNB 2JGUA 5LMNH 3M4IA 4DR6B 4TQFA 4NXMH 3JAWA 4FFBA 3NBZB 3HKCA 4DK0A 3NC0B 1M0TA 3T1HH 2VWJA 4J0MA 1X4TA 4FVMA 4K8XA 4Q0YA 1IBMH 3N2KB 3ZEDA 5EIBD 5CB4B 4JI3B 4B3MB 4K8ZA 2PTMA 4F6RB 1XHZA 2YIBD 4ZI7A 4RAYA 2BTQB 2R9AA 2FE3A 3K59A 4PDBA 4LH7A 5K1PA 3M7MX 1RSOA 4TQDA 4IAJA 4DR4B 4CH4A 5K1XA 3A2FA 4ZHQB 4JI1H 4LFCB 5LMUB 4DR6H 4LF6H 4DV2B 4APMA 4HBNA 4LF8B 4WBNA 5LA6B 3CB2A 3KALA 2KSWA 2Q2UA 3RJ0A 1I94H 1JFFA 4K0KB 2VQEB 4EQ5A 2GV9A 3CHXA 4I50B 4X1YB 3THOA 1J5EH 5KHHA 3BABA 4X1KB 4D7TA 3RYIB 4B3MH 5IJ0B 1IBKH 1KMIZ 3FMAA 4GKJB 1ZHSA 4O4IB 4DUYB 5BMVB 3N2KA 5EZYB 2HHHB 4DR7B 4B3RH 2RGRA 5CB4A 4EB6A 4LF4B 3EYYA 4HNAA 2BTQA 3JAKB 4CH3A 4JI0B 1ZHQA 1N36H 5C8YB 4DV2H 2F95B 4LMYA 2RJZA 4PZ8A 2WE6A 1E4FT 1HW7A 4UCRA 3CVZA 4ZHQA 1G6UA 4KHPB 4I4TA 1M4UA 2JVDA 3N2GB 1HNZB 3RTXA 4EFBA 1SA0A 5IYZA 3HKDB 1FFXB 5KMGB 3BA9A 4PI2A 3QTCA 1SEIA 2R72A 5IWAB 5BR8B 4DUYH 4FLWA 5JCOA 5IJ9B 2HHHH 2F1MA 3RYIA 1M93A 5IJ0A 3K3VA 4DR3B 1WH2A 1GYFA 2OWOA 4O4IA 4TOIA 4JI0H 4DV1B 4FFBB 4DV6B 4PZ6A 4O4HA 5ITZB 2YXLA 2JS5A 4DV7B 4X66B 1HNZH 2EX3A 4CC6A 5KHKA 1FJGB 3S24A 3VNNA 4MTEA 4KL1A 4FLYA 4PZ7A 3VQWA 2PUSA 4ZI7B 3QF7A 1P16A 2HVRA 3JARB 1TGOA 5J2TA 1FFXA 1S5JA 4LF9B 2PY5A 2PGGA 2XIGA 2VUGA 3H20A 4DR3H 3JASA 2HEPA 3RYCA 2WDTA 4DR5H 3WB2A 3J81W 4GKKH 5IJ9A 2PZSA 1T5EA 4DV1H 1P8LA 4E6NA 3BA8A 1VS0A 2YIAA 4RB1A 4JI1B 1B04A 4EEQA 2VQFH 2UUBH 5JJJB 4DV7H 1JMKC 1JFFB 4LH6A 4LF6B 4X66H 2ZCEA 5LP6B 2HVQA 3BRCA 4YY3H 4TUYA 3SGIA 4CS2A 3ZS8C 1FJGH 5ITZA 1I94B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RR5 A;  3JSN A;  2Q2U A;  4YHH B;  1CKO A;  2UXC B;  4B3T B;  1HNX B;  5D1O B;  1J5E B;  4K0K B;  2VQE B;  4EQ5 A;  2Q2T A;  3TY9 A;  3BAB A;  1IBK B;  2UUC B;  4JI6 B;  4OX9 B;  3NBY B;  1TA8 A;  4B3R B;  4GKJ B;  4DUY B;  2HHH B;  4DR7 B;  1IBL B;  1V9P A;  1X9N A;  4LF4 B;  4EFE A;  1N36 B;  1XK5 A;  3L2P A;  1CKM A;  4X65 B;  4JI0 B;  2HIX A;  1XDN A;  4DUZ B;  4DV4 B;  5DIS C;  2HVS A;  4GLX A;  4X64 B;  3KYH C;  1ZAU A;  4PZ8 A;  3GB8 B;  4UCR A;  1XNQ B;  1N34 B;  1HR0 B;  3W1B A;  5LMN B;  4KHP B;  3OTO B;  4UCU A;  1A0I A;  1N32 B;  1HNZ B;  3W5O A;  4DV5 B;  4EFB A;  3RTX A;  2E5L B;  4JI5 B;  2UUA B;  4JYA B;  4NXM B;  1HNW B;  3BA9 A;  2F4V B;  2HIV A;  5D1P A;  5D1O A;  3TY8 A;  2UXD B;  5IWA B;  5BR8 B;  3T1H B;  1FVI A;  4LF5 B;  5FPR A;  4UFZ A;  1IBM B;  4JI4 B;  5FPO A;  3W1G A;  4X62 B;  3PN1 A;  3GJX B;  4DR3 B;  2OWO A;  4TOI A;  2UXB B;  4DV1 B;  3BAA A;  1S68 A;  4DV6 B;  4NXN B;  4PZ6 A;  1XMO B;  3GDE A;  3TY5 A;  4JI8 B;  4DV3 B;  4UCV A;  4DV7 B;  2ZM6 B;  4X66 B;  4UCS A;  4LFA B;  4CC6 A;  4DR6 B;  4AQY B;  1FJG B;  3S24 A;  3VNN A;  4UCO A;  3QWU A;  3NBZ B;  4PZ7 A;  3NC0 B;  4LFB B;  1P16 A;  4JI2 B;  2HVR A;  4DR2 B;  1XNR B;  4DR1 B;  4UCT A;  4LF9 B;  2VUG A;  4DR5 B;  1CKN B;  3T1Y B;  4GKK B;  4DRF A;  4JI3 B;  4B3M B;  4CC5 A;  3UQ8 A;  1TAE A;  1P8L A;  4E6N A;  3BA8 A;  1VS0 A;  2VQF B;  2UUB B;  4LH7 A;  4JI1 B;  1B04 A;  4EEQ A;  1XMQ B;  4LF7 B;  4DR4 B;  4JI7 B;  1CKN A;  4YY3 B;  4LH6 A;  2UU9 B;  4LF6 B;  2CFM A;  2HVQ A;  4LFC B;  5LMU B;  4DV0 B;  4DV2 B;  3SGI A;  1N33 B;  1DGS A;  3JSL A;  4B3S B;  4JV5 B;  4LF8 B;  1I94 B; 
#chains in the Genus database with same CATH topology
 3CC7 V;  2UVV A;  2DN9 A;  3V6H A;  2W6M A;  3CRC A;  1J5E B;  1W0K G;  3G67 A;  3ZN0 A;  2EJ2 A;  4EB6 B;  3MR2 A;  2Z02 A;  3K9S A;  4HNA B;  3SPI A;  3JAR A;  4ECW A;  2GQS A;  1H2S B;  2DAB A;  2EBO A;  2ZIO A;  2ATL A;  2R86 A;  2C22 A;  3MFI A;  4MA5 A;  1N32 O;  1V9P A;  2Q5Z A;  5DN6 G;  2GUZ A;  3T9E A;  1VBG A;  5KKN B;  1RK6 A;  1WCM G;  4EFE A;  1N36 B;  3ZMS A;  3L71 H;  2P5O A;  4MV3 A;  4OGQ B;  3MAQ A;  3Q8Q B;  3A0R A;  4IRD A;  4DQN A;  4J9O A;  3HBL A;  4LF5 O;  5JQW A;  1XHX A;  5I5V A;  5LP6 A;  3H1I H;  2EZP A;  3L73 H;  3OTO B;  1A0I A;  4UV9 A;  2CW7 A;  3F8N A;  1WB7 A;  2P22 C;  1Q86 W;  2F4V B;  5BXZ A;  4GYC B;  5BWT A;  2AGP A;  3R5X A;  1SFO A;  1L0L H;  2YS8 A;  4F4X A;  2EIL C;  4MA0 A;  3H1K H;  1IXM A;  2JRI A;  4FLU A;  2OTL V;  2EJ0 A;  2FL4 A;  4C7U A;  4QNH B;  1NZ6 A;  3BAC A;  3TIG A;  2QWP B;  5KT2 A;  2FKL A;  4J9P A;  3J80 N;  4O4J B;  4BXX G;  2W70 A;  5KA5 A;  1SCU B;  2R85 A;  4JI2 O;  4DR2 O;  2HG8 A;  1KTA A;  4RAI A;  5JH7 A;  2YI8 A;  4DR1 O;  1A3G A;  2ATK C;  2R8G A;  3WWH A;  5J2T B;  4DV5 H;  3ASN C;  5HFL A;  3CS5 A;  5IYD O;  4BWS C;  1DF4 A;  4NXN O;  4UCO A;  3AK2 A;  2EIM C;  4AHC A;  1WPB A;  3RYC B;  5KFM A;  4DV3 O;  5L1K A;  1K5S A;  2R7Z A;  2DIK A;  3PZP A;  4H37 A;  2XUM A;  2OYQ A;  4I9Q A;  2HR3 A;  5CA3 A;  4UCT A;  2ZT9 B;  1D5A A;  2RF4 A;  2YUA A;  4IRC A;  2QSA A;  3T1Y B;  4HR7 A;  1OCC B;  1TVK A;  4PA9 A;  2AGA A;  1XNR O;  3MDS A;  1Y1W A;  3N44 B;  5L1J A;  5CA0 B;  4F4W A;  4E4T A;  4O3O A;  1I7L A;  2WTF A;  2UUB B;  5KUK A;  3HXL A;  3KHG A;  4A3K G;  3J7A U;  4HYO A;  2CW8 A;  2WLJ A;  4NVP A;  4O3Q A;  4YY3 B;  2W7P A;  3D36 C;  2EIY A;  3DTG A;  4D7S A;  4WFA V;  2WAQ E;  4J9N A;  1RPR A;  3LDC A;  5JUM A;  2JGD A;  4DW1 A;  4MW3 A;  1TWC A;  3AG2 B;  2XAJ A;  1VQ4 V;  3JSN A;  2LGW A;  4JAV A;  5GON A;  4FIP C;  3G6E V;  4FLV A;  4XBF A;  1CKO A;  2Z3Y A;  1I7F A;  4FZ1 A;  1R3L C;  3OUZ A;  2JA8 G;  2EJR A;  2DPJ A;  2DWD C;  3LUT B;  1ZWI C;  3BFR A;  4B3S O;  3NXS A;  3W7W A;  2ADP A;  4TV8 A;  1IDS A;  1JJO A;  4EGJ A;  4YR0 A;  4DL2 A;  2DE0 X;  1XNQ O;  4FM9 A;  2HJF C;  2C2R A;  4ZI7 F;  3VPB A;  4BIU A;  1R73 A;  5DGH A;  1SER A;  2G38 A;  3KAJ A;  2CGN A;  2UUC O;  3HKE A;  4O4L A;  3AG1 B;  4PWQ A;  5A2Q N;  2UUA O;  4FMT A;  1DTO A;  5JWP A;  1W93 A;  3KHH A;  2P67 A;  2JJ2 G;  3Q4H A;  4IYI A;  3T1H O;  1KC7 A;  4JV5 H;  1L8D A;  1SQX H;  1OCR C;  2Q7H A;  4BIO A;  1S97 A;  2Q0A A;  1AN7 A;  3RB3 A;  4PDR A;  5LXT B;  1AR5 A;  1GM8 A;  1HNW H;  3IAY A;  4DRX A;  2UXD B;  3RN4 A;  1K8A W;  2XT9 A;  2XCA A;  1Y74 B;  4J9Z B;  5EC1 C;  3UKM A;  3L4K A;  3DTU B;  3WU2 Z;  2RMK B;  5CA1 B;  1VQ9 V;  2FLP A;  3EVK A;  4X62 B;  2NU6 B;  2WSS G;  5C1P A;  5GTH Z;  3CCE V;  2JEX A;  2OCC B;  1TWA A;  2NUA B;  3SJC C;  3BAA A;  5IT9 W;  3TQ1 A;  4Q43 A;  3T9A A;  1O9G A;  2SCU B;  2JEI A;  4RUC A;  2BR0 A;  2A9H A;  3CQZ A;  4J9S A;  2Z5U A;  3GLK A;  1M57 B;  4JI5 H;  2ASL A;  3L70 H;  4RUA A;  3CMA V;  2IM9 A;  3OEE G;  4PA7 A;  1Z2O X;  2EIJ B;  4LFB B;  3HB9 A;  4IRK A;  2YI9 A;  4UVC A;  4LFA O;  3MWD A;  1Q3E A;  2CE4 A;  4JI4 H;  5LMU O;  4LFC O;  1Y14 B;  4BWA A;  4A93 G;  4DRF A;  4C5A A;  4CC5 A;  5L3B A;  1H2M A;  2B5U A;  3CCM V;  5DLF A;  3VBB A;  4NZM A;  3K58 A;  5EZY F;  5FLM G;  2QWN B;  1M0W A;  2AW9 A;  3U10 A;  1XMO H;  2XTA A;  3L9D A;  1XMQ B;  4LF7 B;  5JVD B;  3ZHS A;  4H0L B;  2FK3 A;  2I8C A;  3AG2 C;  1EKV A;  1MSW D;  1R3I C;  3R5F A;  4G3I A;  4JZG A;  3VPD A;  4BY7 G;  2ZGI A;  3JD1 A;  2N74 A;  2W9A A;  4L8J A;  3TK1 A;  2MK3 A;  3JAT B;  1US6 A;  1SQQ H;  4IIJ A;  4FFN A;  2LFS A;  4O2A A;  5J2T F;  4YQW A;  3OGI B;  4OX9 B;  1L2Z A;  1O9H A;  5LA6 A;  3WO1 A;  5KS8 A;  5KT3 A;  2ETN A;  3K5M A;  3Q8R B;  2HGX A;  4ASU G;  3M99 B;  1IBL B;  3CXH F;  4X89 A;  4JAS A;  2QGN A;  1YXB A;  2HGS A;  5KFY A;  4FGR A;  5H2F Z;  4DV0 H;  3FFQ A;  2IJI A;  3FKS G;  1N33 H;  3S3W A;  3RBZ A;  5EZY A;  5LL6 Y;  1TUB A;  3ZHQ A;  3GB8 B;  4UUG A;  2QWR B;  1ROP A;  2E75 B;  2FTK A;  4M7E A;  4UB8 Z;  2UXC H;  1QHT A;  4U7N A;  1Y1V G;  2ZR2 A;  2W6Q A;  4UB6 Z;  2GQR A;  4FFO A;  5L3D A;  4NXM B;  1HNW B;  3OMA B;  4DV6 O;  3W7T A;  5LMN O;  1EM1 A;  1MOF A;  3ABK C;  2ITC C;  3U11 A;  3N2G A;  2NVY A;  5IWA H;  1OBG A;  4FS2 A;  2RN9 A;  3G4S V;  5KFX A;  2OCC C;  3M9N B;  4ECX A;  2HP8 A;  1AJP A;  3ETQ A;  3HB3 B;  3LSQ A;  1RK5 A;  1S68 A;  5GTI Z;  1V55 B;  4MVZ A;  5CM0 A;  2VUM A;  1HR0 H;  3OE7 G;  3CME V;  1M57 C;  3MR6 A;  4C5C A;  4QSH A;  1NR7 A;  3OHB A;  3M4I A;  3GTJ A;  4DR6 B;  2J6S A;  3QFF A;  2B1I A;  2AHZ A;  2EIJ C;  3JAW A;  4FFB A;  4H13 B;  3HKZ A;  3HKC A;  4DK0 A;  3NC0 B;  1M0T A;  4JI1 O;  2GBO A;  1JDB B;  5I47 A;  1X4T A;  3AG7 A;  2M05 A;  5J2U F;  3N2K B;  2HKO A;  2PBZ A;  1OCO B;  5EBL C;  5EIB D;  4K8Z A;  4F6R B;  5B3S B;  4QWD A;  1I94 O;  1NKD A;  2NLJ C;  4LBE C;  4RAY A;  1P7B A;  1VQN V;  3CX5 F;  2R9A A;  2UVW A;  4GCZ A;  2DOS A;  5K1P A;  1RSO A;  5C1O A;  4I55 F;  4B3M O;  3G8D A;  5CA1 F;  1JPX A;  1PNM A;  4J7K A;  4LF6 H;  3ZRX A;  2P7T C;  1G1X B;  2QDO A;  3H1J H;  4HBN A;  3CYO A;  3JCU Z;  5TIS Z;  2EUL A;  2Q2U A;  1MG1 A;  1KUQ A;  2Q7D A;  1IX9 A;  1JFF A;  2DJV A;  3IFX A;  2NR5 A;  2GV9 A;  4EQ5 A;  1RJR A;  3CHX A;  3BAB A;  1PD3 A;  1FD9 A;  2WLI A;  3FMA A;  4O4I B;  4K6N A;  4RZR A;  4DUY B;  5BMV B;  2JEG A;  4Q4D A;  4J9Y B;  1VQ5 V;  2Q8V A;  1GN6 A;  5AG2 A;  3TCU A;  5CB4 A;  1UNN C;  4N21 A;  5B66 Z;  4O7S A;  5L3C A;  2GLT A;  3OR7 C;  2E2I A;  5LYJ F;  5C8Y B;  4DV2 H;  5BYB A;  4LMY A;  3KCX A;  1DF5 A;  2H3O A;  2ZD9 A;  4J7Z A;  2WE6 A;  3FDS A;  1E4F T;  3CVZ A;  4A3B G;  4ZHQ A;  4XX0 B;  1KEE A;  1DIK A;  1M4U A;  5JVD F;  5KFV A;  2P4V A;  4Q45 A;  5KFF A;  5IYZ A;  1JJ2 U;  4EBC A;  2CH7 A;  3QTC A;  4PJ0 Z;  2R72 A;  5IWA B;  2ZE5 A;  1M9N A;  3F7V C;  2JS3 A;  2HHH H;  2W6P A;  3ETJ A;  2R8I A;  3E35 A;  3RB4 A;  1ZSP A;  1M93 A;  3SPH A;  5IJ0 A;  3K3V A;  1BS3 A;  3JYC A;  4QE9 A;  1GYF A;  3CWB H;  3AK3 A;  3E8F A;  4TOI A;  4U7C A;  4U6P A;  4JUZ A;  2DYS C;  1N48 A;  4PZ6 A;  1BMF G;  5ITZ B;  2YXL A;  1F23 A;  4A3F G;  4DR5 O;  3GQC A;  2B1G A;  4X66 B;  2VA2 A;  3H4B A;  3EHB B;  1HNZ H;  4CC6 A;  5KHK A;  3S24 A;  3SE7 A;  4MTE A;  2N05 A;  3K5H A;  4FLY A;  2VQF O;  2DLN A;  4DV7 O;  4CKB A;  2IU3 A;  5T14 A;  4HYK A;  1P16 A;  4O3P A;  3JAR B;  3HT5 A;  5I5X A;  1SES A;  3CCL V;  3WNZ A;  4LF9 B;  2PY5 A;  5B3S C;  3E83 A;  1NVP B;  5DMX A;  4TT3 G;  3JAS A;  5KFU A;  4DR3 H;  3LNM B;  5JQG F;  2WDT A;  4JV5 O;  3J81 W;  2GUZ B;  4GKK H;  5IJ9 A;  1T5E A;  4DV1 H;  1E4E A;  3QVN A;  5E25 A;  1E79 G;  2YIA A;  2IBZ H;  2WB1 E;  5CN0 A;  3BJY A;  2ASD A;  4EEQ A;  4JV2 A;  1EZJ A;  4MV6 A;  1JMK C;  4LF6 B;  5LP6 B;  1SQP H;  3PW7 A;  2QR4 A;  1BGY H;  5HFM A;  1GM7 A;  4TUY A;  5DG9 A;  1FJG H;  1RM1 C;  3ZS8 C;  5C5J A;  2JA7 G;  4NZN A;  1D2D A;  4JF3 A;  2UXX A;  4YJ3 F;  2Y0S A;  4A2B A;  1BNC A;  3LWB A;  2LW1 A;  3OTF A;  3T9F A;  5D5Q A;  5KFE A;  3P32 A;  2EIK B;  1XI1 A;  4B7K A;  4YJ2 F;  2R84 A;  1P49 A;  2E74 B;  1W2B U;  3L72 H;  4QE7 A;  5IYB O;  2ZDI A;  4PI0 A;  4FLZ A;  3U54 A;  5IY5 B;  3RW0 A;  1UPG A;  2Q67 A;  4DLK A;  3N27 A;  3U9T A;  3ETD A;  4EYI B;  3JD3 A;  4QPK A;  3G6X A;  3RYF A;  2NU8 B;  3V4Z A;  4X65 H;  4B08 A;  1BJT A;  1SKV A;  3T9D A;  5EWF A;  1KKC A;  1N34 B;  1I2K A;  4NTW A;  2WWW A;  3HOU G;  4KUM A;  4FLT A;  3K9A A;  2PI5 A;  2R7M A;  3AW8 A;  5IDJ A;  1LUW A;  1B06 A;  1QLE C;  3OD4 A;  3RYH A;  1H2L A;  2K9P A;  3E8G A;  4DO2 A;  4JYA H;  4OPA A;  4NR1 A;  3K06 A;  2W57 A;  1TVK B;  5EIB C;  2DQ0 A;  4UXN A;  1ULZ A;  4MVO A;  2D3O W;  1HWY A;  3JRX A;  3GIP A;  3PN1 A;  4DW0 A;  4KFM A;  3MFH A;  4U3J A;  4WCE V;  4O84 A;  5D8D A;  4AYB E;  4A3G G;  1LR1 A;  3IJ4 A;  3OGC C;  3E22 A;  4NXN B;  2A3Q A;  2ZQM A;  4ZOL A;  2JGD B;  2BQR A;  4ZIB A;  1C30 A;  2YSU B;  4KP4 A;  4DV3 B;  4UCV A;  1GN2 A;  3OTO H;  5B1B C;  4BR6 A;  3T7A A;  4CS3 A;  1Z5W A;  3CP1 A;  4UV8 A;  2HHF A;  3AG3 C;  3NUA A;  5F9N A;  2P6J A;  5BY1 A;  1DV2 A;  5C8Y F;  5KFP A;  2QM7 A;  4FFL A;  1K33 A;  2F4V H;  4PV1 B;  1BGW A;  4HN2 A;  1VF6 A;  2FB9 A;  3FAV B;  2D2C B;  3WG7 C;  2VS0 A;  4TWK A;  1CXZ B;  4TV8 B;  4FFP A;  4JI7 O;  2Q73 A;  4AQY O;  2UU9 O;  3K3P A;  1S10 A;  1MMM A;  3HOY G;  4GKK B;  1H38 A;  1VQM V;  2V4R A;  1PKX A;  3HKE B;  5J9P C;  4Z1V A;  1TWF A;  2COJ A;  1K7D A;  1ZL8 B;  4QW9 A;  2BTO A;  3ETE A;  1SQF A;  1RPO A;  5DLG A;  1BQZ A;  1K4C C;  4CMF A;  3HO8 A;  3J80 W;  3RAQ A;  5KX5 F;  4F6E A;  3Q1K A;  3ETG A;  2LW7 A;  5KT5 A;  1KU9 A;  1M6V A;  1GMG A;  2QYZ A;  5LOV A;  3CCS V;  1XOU A;  4B3S B;  1KJJ A;  3ETH A;  1GO3 E;  5KG2 A;  4RNO A;  3QG5 A;  1AIL A;  4PA4 A;  1FKA O;  1FAF A;  3MHS C;  5KHG A;  4JAU A;  3CPW U;  3CRR A;  1HNX H;  4B3T H;  3ZRW A;  1FPO A;  1Q43 A;  5KAF Z;  2UUC B;  4JI6 B;  4DUZ O;  1DAA A;  3T1Y H;  4YHH O;  2W9C A;  1GGO A;  3E8B A;  5FLX N;  4ME6 A;  3DTF A;  4ECU A;  1QR9 A;  2W9B B;  4RQE A;  1VAR A;  4RB2 C;  4NZO A;  2DPI A;  1FXK B;  4CKC A;  3N6R A;  2DYR B;  5DGB A;  4MAM A;  3RBD A;  4X65 B;  3K04 A;  3R65 A;  1Q6H A;  1U97 A;  2HVS A;  1VBH A;  3JD0 A;  4IHJ A;  1M1K W;  5JCO C;  1VQK V;  3PR4 A;  2AXT Z;  2HG5 C;  4FFK A;  4WBN F;  4ETS A;  2AGO A;  4WF9 V;  2QEX V;  5D5P A;  4O2B A;  4DV4 O;  2E5L B;  4EBD A;  4JYA B;  1S03 G;  4B7E A;  1QU7 A;  1KP2 A;  3JAL A;  1MZB A;  4CBC A;  4LNU A;  4TQS A;  4X1I B;  2FPP B;  4MW8 A;  3DAA A;  2YZG A;  4LCU C;  2B63 G;  3JZF A;  3GTG A;  4QGP A;  5FL7 G;  1NBM G;  3W1G A;  5KFS A;  3GTM A;  4YIO A;  1Q7Y W;  1AVM A;  2UXB B;  5KFZ A;  2M7W A;  3EFF K;  3GWK C;  1UC8 A;  4QWC A;  2FLN A;  3SYC A;  1K73 W;  5A2Q W;  2L6L A;  3GDE A;  4CS4 A;  3UT5 A;  3TY5 A;  1KT8 A;  4JI8 H;  4QIW E;  4LFA B;  1OZ0 A;  2AHY A;  3PW0 A;  3C0F B;  4A3C G;  3MR3 A;  4IIJ B;  2XD4 A;  1SYX B;  2V1D A;  4O2A B;  1VQP V;  1OWT A;  3R66 A;  4CH6 A;  4RB3 C;  2UXD H;  2ZM6 O;  4TV9 B;  4DR4 O;  4F50 A;  3ASO B;  4WHX A;  4I50 F;  3ZIA G;  4FU0 A;  3UFX B;  4LSA A;  3DXR A;  1GSH A;  1S0M A;  4X62 H;  1CE8 A;  1CKN B;  5LL6 b;  1H8H G;  3AG4 B;  5IYC O;  1KQS U;  4JI3 H;  1A0G A;  3OUS A;  5EYP B;  4J80 A;  1MAB G;  3KHR A;  3M8A A;  5DGI A;  5EOY A;  1NU1 H;  1F4M A;  2BSK A;  2OTJ V;  1TUB B;  4WFB V;  2ZR3 A;  1ZQ7 A;  3N43 B;  5FNV B;  1N8R W;  2R70 A;  2DW4 A;  1KYO F;  2F43 G;  2CNU A;  4DR7 O;  2Y48 A;  4LF8 H;  1KC8 W;  4LFB H;  1Q82 W;  2ILM A;  4B3T B;  1HNX B;  5KG0 A;  3ZHU A;  2ODM A;  4LF4 O;  5KG6 A;  3H0G A;  3TY9 A;  4K0K H;  2VQE H;  2YCH A;  2DQ3 A;  1KJ9 A;  3IG0 A;  4J10 A;  5FD5 A;  4A3L G;  5H6R A;  4G28 B;  4BAY A;  1FXK C;  4DL6 A;  4GKJ H;  4X1Y A;  4I50 A;  4X20 A;  4JXU A;  5KHI A;  4I5S A;  2ZKO A;  2QTO A;  2QJ1 A;  4RB0 A;  1XMQ H;  2P06 A;  5BWX A;  1WSC A;  4LF7 H;  3JRW A;  1E1Q G;  3E5N A;  2FP4 B;  2CGO A;  2YZM A;  2W6O A;  1RJQ A;  2FLL A;  5BR8 O;  4GLX A;  1P84 F;  3OMI B;  4X64 B;  2RGV A;  1W96 A;  3JAW B;  2W6Z A;  1JCH A;  1YHQ V;  3W1B A;  4Q8F A;  3HKC B;  1PNK A;  3D3Q A;  4Z2W A;  5LMN B;  3QZ8 A;  4DR3 O;  2Q68 A;  4UVB A;  4KHP H;  2A79 B;  4MV4 A;  4A3I G;  2R93 G;  3SPC A;  3N40 P;  5KG4 A;  4OX9 H;  3EPI A;  2Q6A A;  5L9X A;  2C2D A;  1S5H C;  5CBF A;  3P30 A;  3O9O A;  1GH6 A;  5KT6 A;  2HJW A;  2WYO A;  2AQ4 A;  3HKB B;  1IBL H;  4UFZ A;  5FPO A;  4XDJ A;  4DXW A;  3HKD A;  3GJX B;  1RSO B;  1NT2 B;  3U55 A;  3TEK A;  4A2A A;  2GSM B;  1MNG A;  1PL4 A;  5F9L A;  1N56 A;  1QVF U;  5KFI A;  4IWX A;  1IBM O;  3JAM W;  4JI8 B;  1ET0 A;  2E76 B;  3K0G A;  3G71 V;  3TW6 A;  1Q90 D;  3ORR A;  2J9G A;  4GLW A;  5BZB A;  4NXM H;  3Q8S B;  3PVX A;  4O86 A;  3VPC A;  5EK0 A;  2CTW A;  3B77 A;  4IR9 A;  2BOC C;  3ZMZ A;  2WLI B;  2IH1 C;  4R8U B;  1BHA A;  4FVM A;  4Q0Y A;  1SZT A;  3AG4 C;  3ZED A;  4ED1 A;  4YBZ B;  2ARH A;  1EFR G;  5CB4 B;  2YXH A;  4JI3 B;  4B3M B;  5KAI Z;  3SYP A;  1T36 A;  4ZI7 A;  2YC0 A;  2DAA A;  5BWW A;  3K59 A;  1J5E O;  1EUC B;  3GV7 B;  4RO2 A;  4TQD A;  4JAA A;  5DEC A;  3IN5 A;  5C93 A;  3DC6 A;  4ZHQ B;  3R5H A;  1JLL B;  4DR6 H;  3JZ6 A;  1RFY A;  1BCC H;  5A9G A;  4YB8 B;  2R82 A;  4LF8 B;  1S9F A;  1AP5 A;  2RDI A;  3BY6 A;  3KAL A;  3OW2 U;  2IH3 C;  2YWV A;  1OCC C;  2CH7 B;  2QF7 A;  1K4D C;  4K0K B;  2VQE B;  2R92 A;  3GIJ A;  1N36 O;  1R9T A;  3GB7 C;  4M9U A;  1IXB A;  4X1K B;  2ZDH A;  3GV5 B;  3K0D A;  1XUQ A;  4FE2 A;  4RNN A;  1Y67 A;  3D36 A;  4DL7 A;  5IJ0 B;  1IBK H;  4Q4C A;  4WFH A;  4JGS A;  3PR5 B;  4GKJ B;  2HGW A;  2W6I G;  2FMA A;  3HOW G;  4B3R H;  4TV9 F;  2I80 A;  2RGR A;  2CKZ B;  3GTK A;  4X9Q A;  3UO3 A;  3CE2 A;  4EB6 A;  2QA4 V;  5BPF A;  3EYY A;  4HNA A;  4O4J F;  3AYH B;  4R8C A;  4F4Z A;  4A5U B;  2C2A A;  3JAK B;  3ZRV A;  3ORQ A;  1ZHQ A;  2RDJ A;  3V4S A;  3H3V H;  5BWR A;  2RJZ A;  3GTO A;  4F4L A;  2FML A;  1DLB A;  2YIC A;  4KHP B;  4QJF A;  4JI0 O;  2XAF A;  5KFD A;  2PI4 A;  4JYB A;  4TSF G;  1P4R A;  5FNV F;  5KMG B;  3BA9 A;  3STZ C;  1TWG A;  3ML0 A;  2XGQ A;  3GVM A;  2W8K A;  3AG1 C;  5KFH A;  1VIB A;  4O7V A;  4DUY H;  2FKX A;  4FLW A;  2W8L A;  4RUF A;  2PF4 E;  2F1M A;  5IJ9 B;  2ABJ A;  3RYI A;  1KBL A;  1J95 A;  2LJ2 A;  3IC7 A;  3MD0 A;  4MVQ A;  3L74 H;  1EN6 A;  4ED2 A;  3B4S A;  5CE8 A;  2J6T A;  5CA0 F;  2H8P C;  1ZTE A;  1WP8 A;  4OXS A;  1K1S A;  1YJN V;  2JA5 A;  3LDD A;  2JS5 A;  3KZI Z;  4DV7 B;  3T1Y O;  3NR7 A;  1GO3 F;  4YR2 A;  3VNN A;  3FKI A;  4MV1 A;  3V6J A;  2UUB O;  1WP7 A;  2HVR A;  3RVZ A;  3WFV A;  5HBR B;  2R7Z G;  4YY3 O;  5J2T A;  3T1C A;  1NH2 B;  4RU9 A;  2VUG A;  2R8J A;  2C2E A;  2HEP A;  2LQT A;  1I08 A;  5KFK A;  4XZ3 B;  3LQS A;  2JA6 A;  1PP9 H;  3RYC A;  1I1M A;  3F5W C;  1PNL A;  3RBE A;  2QE7 G;  1XDC A;  4E6N A;  4PDM A;  4ZKI A;  1GTO A;  3BA8 A;  1VS0 A;  1Y1W G;  1R3K C;  1B04 A;  2KG7 B;  4LH6 A;  5IT9 N;  5LGN A;  2ZCE A;  3GID A;  2HVQ A;  4X66 H;  5JVL A;  2IBK A;  1E1R G;  3MHH C;  2JIZ G;  1PV0 A;  1RYR A;  5IYD G;  3C90 A;  4BY1 G;  2B9Z A;  5BWV A;  4MTO A;  1GSO A;  5KT4 A;  3OSN A;  3RB0 A;  3PFF A;  1CS0 A;  2CNV A;  4O82 A;  2EIN B;  4MTD A;  3OUU A;  5KG3 A;  4FLX A;  1Q6I A;  3FYE B;  2Q2T A;  2Z0A A;  1T94 A;  1VF5 B;  4LF9 H;  4J11 A;  1IBK B;  1ZLZ A;  5LXT F;  4ABM A;  1KJ8 A;  2L35 A;  4B3R B;  3SJA C;  5K2M A;  2Y69 B;  4AIL C;  4ED3 A;  1SQV H;  4LWS B;  3E22 B;  3TII A;  4QPJ A;  4I4T B;  4XYL B;  4U3F H;  3L2P A;  2X6B A;  1SA0 B;  2I87 A;  1VQ6 V;  3ABU A;  4QIW F;  1QR8 A;  4P30 A;  3PJS K;  1KD1 W;  1O75 A;  5EWE A;  4X62 O;  4I7H A;  1QCE A;  4FS1 A;  1GN4 A;  1K1Q A;  2Q9L A;  5I5S A;  1NVP D;  1N32 H;  4IL6 Z;  2UVU A;  1S5L Z;  1F4N A;  5D1O A;  3TY8 A;  2MW2 B;  3ICX A;  5J2U A;  4DV5 O;  1THZ A;  4I0X A;  4IYH A;  5FD6 A;  4L87 A;  1VEW A;  4O4H B;  3RGX A;  5DM6 V;  1Q5O A;  1VMG A;  5LXT A;  5BWU A;  3M9M B;  2JEF A;  4X8A A;  2A7W A;  4ED6 A;  2C28 A;  3O65 A;  2CK3 G;  2CAZ C;  2WPD G;  1Y74 A;  3OEH G;  1JX4 A;  2R7K A;  3CEB A;  2QKS A;  4I55 A;  5LOV B;  1WRV A;  5CA1 A;  3ABM B;  1SS3 A;  1N34 H;  3CCQ V;  2W6N A;  2PYL A;  5KFO A;  1S0N A;  4AQY B;  3SDL A;  3QWU A;  1PX2 A;  2YEV B;  5DQG A;  4QWE A;  1SC5 B;  3CRA A;  2NNU A;  1JVM A;  2NU9 B;  2K1E A;  3H1H H;  1NS1 A;  3LSS A;  3PW2 A;  1WA8 B;  4JI2 H;  4DR2 H;  1M56 B;  1V55 C;  3B09 A;  4DYL A;  3OUF A;  2FYU H;  3H01 A;  5IE9 A;  1B33 N;  1GKF A;  1RP3 B;  4MTX A;  4NXN H;  2X5R A;  1V54 B;  3KRE A;  1CPY A;  3RWR D;  4IHJ B;  4DV3 H;  4JV1 A;  2R8H A;  4PA6 A;  3LP8 A;  5LYJ A;  2QTS A;  3VQY A;  1GK9 A;  5HNE A;  2CQY A;  3Q2O A;  3R23 A;  4XYM B;  3DSQ A;  3X2Q B;  1OCO C;  3RR5 A;  1IUR A;  2NN4 A;  4YHH B;  4D6T H;  4ECQ A;  4LNU B;  4CKE A;  2ZXW B;  5JVD A;  3DGE A;  1KJI A;  3LNN A;  1JA8 A;  3E2E A;  3TJT A;  3I55 V;  2Y69 C;  1JXL A;  3NBY B;  1H8E G;  5DQH A;  3B8N A;  1EKP A;  4FFR A;  3W7S A;  1BHB A;  1WCM A;  3JAT A;  4MV8 A;  3DF7 A;  3B2E E;  1X9N A;  3PW5 A;  4A3J G;  3FD9 A;  3CC4 V;  3KXY T;  3RUP A;  5LBQ A;  1HNW O;  4DV4 B;  4I9W A;  5DIS C;  5LGT A;  1SQG A;  4B3S H;  4EBE A;  3KYH C;  2GTA A;  3RB6 A;  4WFE A;  2WAQ A;  2X7R B;  1NJI W;  5C44 G;  2QM4 A;  3AEI A;  1XNQ H;  5FR9 A;  1G2W A;  3BQ1 A;  2XAG A;  1N32 B;  2JDI G;  2HFE C;  2YS7 A;  4H33 A;  2UUC H;  4JI6 H;  3DXR B;  3HR0 A;  2RNB A;  5D1P A;  2UUA H;  1GN3 A;  2WLH A;  4K35 A;  1I1K A;  3BG5 A;  1FVI A;  2Y4U A;  4O7Z A;  1MZF A;  4LF5 B;  2O03 A;  1JQ0 A;  3OT7 A;  2IJH A;  4JI5 O;  2R7L A;  5JH7 B;  2Q0O C;  3UM7 A;  3W7X A;  1YTF B;  3SPG A;  2J6U A;  5JQG A;  2QKC A;  5FLX W;  5LHG A;  2W71 A;  4MTG A;  2V4Q A;  1AUV A;  3ABM C;  1F7Y A;  2CTQ A;  4JI4 O;  3AX6 A;  1KUT A;  2ZNI A;  1ORQ C;  5I5W A;  2ZM6 B;  1I6U A;  3RIZ A;  2OT5 A;  2VUM G;  4UCS A;  3SYQ A;  4I4T F;  2DMX A;  2F23 A;  1L1F A;  2COI A;  2E5L H;  4A3E G;  4O3N A;  1W0J G;  5EBW C;  4YJ3 A;  2R87 A;  1XMO O;  4ECY A;  2WLN A;  4YAJ B;  1CEZ A;  2IJJ A;  5F2V O;  4RZQ A;  1VP7 A;  2AU0 A;  1M56 C;  1SF9 A;  4JI2 B;  4O83 A;  2PN1 A;  2F93 B;  4DR2 B;  2VRZ A;  1ZET A;  1UFI A;  3T2M A;  4DR1 B;  4YJ2 A;  1YEW A;  3VQX A;  4FZ0 A;  2RDC A;  3J7A K;  3K5L A;  4X20 B;  2LP7 A;  3CEI A;  2UXB H;  2WAM A;  1TAE A;  1V54 C;  1XL4 A;  4O4I F;  1S0V A;  5BMV F;  4BBR G;  3T5L A;  3Q8P B;  2AGQ A;  1OHH G;  4R7R A;  4X88 A;  4ZBM A;  2UVR A;  4O4H F;  5GON B;  3MJF A;  4F6R A;  4PA3 A;  1S72 V;  4LFA H;  3H1L H;  4EEY A;  3X2Q C;  2GTS A;  5EBM C;  2CNQ A;  3UYY A;  3VA7 A;  5LMU H;  1XRE A;  4LFC H;  2XHB A;  1Y76 A;  4FBU A;  1XNR B;  3U0Z A;  5BPH A;  3VQV A;  3G6B A;  1AI4 A;  4A3D G;  5HV6 A;  4PBC A;  1A48 A;  1VF7 A;  4DV0 O;  3BEH A;  4RCN A;  1QBZ A;  1N33 O;  3KTM A;  3G6V A;  4O4L B;  1VQO V;  1COW G;  4O7Y A;  2VOB A;  3B40 A;  4IT5 A;  4ECS A;  4FK5 C;  1AB3 A;  4O3S A;  3RGZ A;  5FJ8 G;  2UXC O;  5B1N A;  5DAA A;  5E79 Z;  5EC2 C;  5LP6 C;  2PYJ A;  3Q4H B;  5KUM A;  3K5N A;  2YRW A;  3C3T A;  1CQI B;  3CC2 V;  3FB8 C;  1BSM A;  1XL6 A;  5E1A C;  2YL2 A;  2YZL A;  2EIL B;  1XK5 A;  1WNS A;  5KG1 A;  4J9L A;  5DQI A;  1XDN A;  2YDE A;  4ECR A;  5BMV A;  5IWA O;  5L3G A;  5I60 A;  2EIK C;  3K5O A;  4GZR B;  1EN4 A;  2EJ3 A;  4DK1 A;  1XNQ B;  4FM0 A;  4NYK A;  4DL5 A;  2WA3 A;  4DRX B;  2VR1 A;  2BOB C;  2XAH A;  3HKZ E;  4UCU A;  2Q7E A;  4MVS A;  5C8Y A;  3R9R A;  2UUA B;  3LML A;  5IY5 C;  2HIV A;  1HR0 O;  4MV7 A;  2X6C A;  4MTF A;  3ASN B;  1G4Y B;  4JZ2 A;  2R9R B;  3H9V A;  2GDS A;  3T1H B;  2ZIM A;  1XIL A;  3HOV G;  2KSD A;  1NTM H;  2EIM B;  4ED8 A;  2F66 C;  3F7Y C;  1WJZ A;  1IBM B;  4UVA A;  4LSX A;  3P3P A;  4DAA A;  3WB0 A;  1V4Y A;  4X64 H;  3CCV V;  2JEJ A;  5KX5 A;  2YS6 A;  4DV6 H;  5JJE B;  3SR2 C;  2WLL A;  2M6Y A;  5LMN H;  5LP6 F;  1MZE A;  1LUV A;  3U9S A;  2QWO B;  3ZHV A;  1NTK H;  2COG A;  2WA4 A;  5KA6 A;  5KFR A;  1JKJ B;  2VQD A;  4ECZ A;  3K03 A;  4HAM A;  2W0X A;  1AUX A;  1K9M W;  2VWJ A;  4BIZ A;  5L3F A;  4J0M A;  3L75 H;  4LF6 O;  3GWO A;  4K8X A;  3T5H A;  2ITD C;  2W6J G;  3ABL B;  4QWA A;  2EJ7 A;  1EUD B;  3F5T A;  3KKY A;  4RWU A;  1XHZ A;  2YIB D;  3PW4 A;  1YF2 A;  5BYA A;  2R9I A;  4E2L A;  5CR5 A;  2FE3 A;  4PDB A;  1DV1 A;  4O7R A;  5JH7 F;  1G8M A;  4CH4 A;  1VKZ A;  3VOU A;  4YAK B;  3A2F A;  2HLD G;  4JI1 H;  4G27 B;  2Z04 A;  2ZDQ A;  4LFC B;  5LMU B;  1I7N A;  1V51 A;  4JPR A;  4EYH B;  3TGU H;  4QJF B;  1PL0 A;  4RUE A;  2LGQ A;  1IZ3 A;  2N04 A;  3OHA A;  2W7O A;  1I3Q A;  1YJW V;  2AZ0 A;  2BCC H;  4WBN A;  5LA6 B;  4GX0 A;  5LHH A;  2KSW A;  3RV4 A;  3RJ0 A;  1I94 H;  4YIP A;  3THO A;  4DV2 O;  3ABT A;  5KHH A;  5KG5 A;  1OCR B;  3RYI B;  4B3M H;  1KEC A;  1IOW A;  1AI5 A;  1KMI Z;  1H2N A;  2DWC A;  1KP3 A;  4MVR A;  1VQ7 V;  1N34 O;  5EZY B;  1EZV H;  3WWJ A;  4R7C A;  3T4Z A;  2NU7 B;  2V7Q G;  1YJ9 V;  3CRM A;  5CBG A;  4W4L A;  3D8C A;  2BTQ A;  1U96 A;  5L3E A;  4JI0 B;  3I4N G;  2HHH O;  2F95 B;  1NI8 A;  4P9P A;  3OR6 C;  5DED A;  3ZMT A;  4DIM A;  4BBS G;  2ADQ B;  1TWH A;  4Z1M G;  4Y8V B;  1URF A;  4M0J A;  1Z2G A;  1JIH A;  1Y1V A;  5GON F;  2OCH A;  3N2G B;  4EFB A;  1YIJ V;  1BL8 A;  2XND G;  2QB5 A;  1GSA A;  2IU0 A;  3SYA A;  4RNM A;  4K3A A;  5I5U A;  1Y6X A;  4TV8 F;  1B3Q A;  4O7W A;  1YVW A;  5IYB G;  2CTR A;  2DYR C;  5JCO A;  3E8H A;  1Y66 A;  1HNZ O;  1NTZ H;  3ZMU A;  2LFR A;  1WH2 A;  3LSU A;  2OWO A;  5LGU A;  4O4L F;  4YP3 A;  3SNO A;  1QNM A;  4J9Q A;  1GAX A;  2X0S A;  2C00 A;  4FFB B;  4DV6 B;  3QO5 A;  1JR9 A;  5KT7 A;  1FFT B;  1SET A;  3UO2 A;  4GKK O;  2IJK A;  1B6Q A;  4DV1 O;  2FK2 A;  4GC6 A;  2Y0S E;  2YRX A;  1A9X A;  4RQF A;  3ZCC A;  3VQW A;  1AR4 A;  2PUS A;  5B5E Z;  4R50 A;  3QF7 A;  5C3E G;  3ABL C;  3U0G A;  4TQR A;  1AP6 A;  4NYE A;  1SRY A;  1FFX A;  1S5J A;  4GX5 A;  1FJG O;  3SPJ A;  1FYJ A;  2JEU A;  2ZE8 A;  2PMZ E;  2IW5 A;  2OIG A;  4DR5 H;  3WB2 A;  3FB7 C;  3OSP A;  3FAV A;  1HDJ A;  1VAJ A;  2IMW P;  3IGA C;  2JK5 C;  1P8L A;  4MVU A;  1H2G A;  5CBH A;  3EPG A;  3GIL A;  4JI1 B;  2VQF H;  5JJJ B;  2HJD A;  4DV7 H;  1JFF B;  2FJZ A;  4JI6 O;  3CJH A;  4P2Z A;  4MVM A;  2KB1 A;  2X0L A;  3ASO C;  4CS2 A;  1ZL8 A;  1S76 D;  1I1L A;  3K79 A;  1KKD A;  1S0O A;  1I94 B;  3TET A;  5DGA A;  3CCR V;  3BCC H;  4CE5 A;  5D1O B;  4XDL A;  2CTP A;  2XCP A;  4X65 O;  5J2U B;  5IP7 G;  4I0X B;  3T4D A;  3SJB C;  1ZX3 A;  5B1A B;  2HDK A;  5KHJ A;  4I55 B;  2E5L O;  4O7N A;  4JYA O;  4ED7 A;  2XAS A;  4QW8 A;  3ABK B;  2WB1 A;  5C4X G;  5GW7 A;  2RQ6 A;  3G80 A;  4IZO A;  1W59 A;  5IYZ B;  3BPZ A;  4NTY A;  3CCU V;  1YCI A;  2PVP A;  2V4D A;  1UC9 A;  2W9B A;  1FXK A;  4FM2 A;  4DL4 A;  2ZIN A;  1NH2 D;  4DV5 B;  1GLV A;  3W5O A;  2UXB O;  4C2M A;  3HOZ G;  4IIJ F;  4O2A F;  1A32 A;  3AK1 A;  3QO7 A;  3RGB A;  2A06 H;  5LA6 F;  4IWY A;  3OTO O;  1FXH A;  4H44 B;  1VQ8 V;  1F51 A;  3QZ7 A;  4PDL A;  2OLS A;  4I7Z B;  2QKA A;  3ZHR A;  4J9R A;  2OIE A;  3D3I A;  3H40 A;  2F4V O;  4XDK A;  3I5D A;  5JJN B;  4X1I A;  1X59 A;  4U7O A;  3MWM A;  5LYJ B;  1RJP A;  4J9M A;  1XQ8 A;  2X6A A;  4CMD A;  1XBL A;  1EKF A;  2R7N A;  1VQL V;  1S77 D;  4FFM A;  3T5K A;  1K83 A;  3KAK A;  2ZJT A;  4FBT A;  3JAS B;  5EWG A;  3STL C;  1JX9 A;  4F4Y A;  1WLE A;  1B6S A;  1E4E B;  4A3M G;  3ZHT A;  1K92 A;  2P4K A;  4DR5 B;  1BQ0 A;  1YSC A;  3UQ8 A;  4TUY B;  5KFW A;  4GC7 A;  4TV9 A;  4WFF A;  4B3T O;  1HNX O;  1AJQ A;  2VQF B;  3K57 A;  2IA6 A;  2HVK C;  2KKW A;  3I4M G;  4AYB A;  4LR3 A;  4TM5 A;  4O4J A;  1CKN A;  1M5I A;  4UUJ C;  3TQT A;  3CRQ A;  1Z2P X;  1K97 A;  4JI7 H;  3HOX G;  2JA7 A;  1R1B A;  3JAM N;  4AQY H;  2UU9 H;  3I56 V;  1CQJ B;  1ENV A;  3JSL A;  5EYP A;  4JV5 B;  1QVG U;  2V5A A;  3GTQ A;  3OM3 B;  3APO A;  3TXQ A;  1M90 W;  3MWE A;  1C3O A;  5DG8 A;  4MSW C;  4HNU A;  2VPS A;  1OCZ B;  1GM9 A;  5FNV A;  4GX1 A;  5B1A C;  3H0G G;  3WWI A;  3RYF B;  4X64 O;  5JQG B;  5IYC G;  4LC1 A;  3ZJZ A;  2O57 A;  5L1I A;  3BQ2 A;  4PDV A;  1IYD A;  1FKA H;  1WAZ A;  4RAZ A;  1CKM A;  5CA0 A;  4BW9 A;  2HIX A;  3T99 A;  1YIT V;  1BT8 A;  3N8D A;  3RYH B;  1IOV A;  3LDE A;  1Q81 W;  4DUZ H;  1ZAU A;  5KFJ A;  2YU9 A;  1CP9 A;  1OJH A;  2DWE C;  1UJW B;  4YJ3 B;  3UZO A;  4N23 A;  2FK1 A;  3N42 B;  4O81 A;  4YHH H;  1AI6 A;  1N4C A;  3M9O B;  3RT3 C;  1Z5V A;  4MS2 A;  2DYS B;  4JI5 B;  3JZI A;  1D5N A;  2YIB A;  2KQX A;  4YJ2 B;  3ZX6 A;  3TIN A;  3VOT A;  2Q69 A;  4U3J B;  3CCJ V;  4JI8 O;  2VWK A;  1FS0 G;  1TUE B;  4OPH A;  3E86 A;  4ICG A;  4JI4 B;  4ZOL B;  3RVY A;  4HNT A;  5CB4 F;  2MCT A;  2ZNJ A;  1R6K A;  4EGQ A;  3CXC U;  5I5T A;  2UXD O;  2P90 A;  3W7U A;  3UZB A;  3OMN B;  5K3W A;  2HHF B;  4DV4 H;  3HKB A;  5H9C A;  4FM1 A;  3A0B Z;  1IYE A;  2XC9 A;  1XMO B;  1I5X A;  1YDX A;  3RFR A;  3K3W A;  1Y76 B;  1YI2 V;  2ZE7 A;  4ZHQ F;  1YZB A;  2CZG A;  3A8T A;  1N0N A;  4YXW G;  1AI7 A;  4JI3 O;  3SYO A;  1M7J A;  5IYZ F;  3L4J A;  4GT1 A;  1OBD A;  5H6Q A;  2VPQ A;  1AJN A;  5IP9 G;  4LF5 H;  1RM1 B;  3OAA G;  1I2L A;  3JD2 A;  1BE3 H;  5L1L A;  3K08 A;  3N41 B;  1EZ1 A;  1S3J A;  1R6T A;  3OFN G;  2Y0P A;  2Y4R A;  1K3E A;  3RV3 A;  2ASJ A;  1PK8 A;  4LF8 O;  4LFB O;  2WLK A;  2EZO A;  1QQC A;  3T9B A;  3GV8 B;  3KG2 A;  4NTX A;  3WB1 A;  4R8U A;  4K0K O;  1Q8I A;  2VQE O;  1E4G T;  5H5N A;  4JI7 B;  1FXV A;  2ZM6 H;  3FX7 A;  2CFM A;  2UU9 B;  2YID A;  4CHI A;  4DR4 H;  4ED0 A;  4DV0 B;  4J42 A;  1H2K A;  3ZRW B;  1BXR A;  3KCY A;  3GTL A;  2P0A A;  1N33 B;  1DGS A;  4GKJ O;  2ZDI C;  4QIW A;  3CSX A;  2AZ2 A;  1XMQ O;  1JDE A;  4LF7 O;  2W9C B;  2IP4 A;  1OCZ C;  3A0H Z;  2UXC B;  2DZD A;  5I5Y A;  4DR1 H;  2RCV A;  3RFC A;  2Q7G A;  4GUN A;  1WN7 A;  4Q20 A;  1YTF D;  2V59 A;  4O7L A;  2R92 G;  2E2H A;  3N6X A;  4WFG A;  1I0H A;  3JD4 A;  1AR1 B;  2BE3 A;  1TA8 A;  1SZX A;  2H94 A;  1QLE B;  3BHP A;  4KHP O;  4J9K A;  2R6F A;  2R8K A;  2LO1 A;  1XEQ A;  3QO8 A;  4P9O A;  3QNE A;  1EHI A;  3VMM A;  4DR7 H;  4X1K A;  2OH2 A;  1EYZ A;  4OX9 O;  5KX5 B;  4PHZ A;  1NQT A;  2WLL B;  1KB9 F;  4CH5 A;  4LF4 H;  4O2B B;  2EIN C;  3T54 A;  4DUZ B;  2YXY A;  4HQ6 A;  4TUY F;  1IBL O;  3RF2 A;  1XNR H;  3JAL B;  4JTD B;  1BZK A;  1HR0 B;  1SQB H;  4MV9 A;  3JAK A;  4Q6G A;  3S3X A;  4R6Z A;  1RYS A;  4FPP A;  1P7G A;  5B1B B;  2Q4P A;  3K5I A;  1K34 A;  4QWB A;  2B63 A;  4LP8 A;  3AG3 B;  2E3C A;  5FPR A;  1Z2N X;  3TW7 A;  5BR8 H;  4J7J A;  4NXM O;  3UT5 B;  3WG7 B;  5KMG A;  2BQU A;  3PO3 G;  4WD3 A;  3NGD A;  1VF6 C;  4NLG A;  1MA1 A;  3T9C A;  1Q6U A;  4WBN B;  2JGU A;  2JA5 G;  3KHL A;  3GIQ A;  1Y4M A;  1WPX A;  4TQF A;  2VA3 A;  1JOY A;  5KLV H;  1B6R A;  2Y0I A;  3NBZ B;  2QM8 A;  4L1K A;  3ZMV A;  3FKI G;  4PEL A;  3GII A;  4IR1 A;  3T1H H;  4DR6 O;  5KFG A;  1IBM H;  2FPI B;  2BSK B;  2GPW A;  3QQM A;  1EBO A;  1ZUQ A;  3I12 A;  2PTM A;  5KFT A;  2JA6 G;  3T5J A;  2A0L A;  2PMZ A;  2BTQ B;  2W0F C;  5LHI A;  1R6N A;  4LH7 A;  3M7M X;  4IAJ A;  2QK4 A;  4DR4 B;  2XOK G;  4ZOL F;  2YYA A;  1T3N A;  5K1X A;  1IBK O;  4HNV A;  3SJQ C;  5H80 A;  2XGP A;  4DV2 B;  4B3R O;  2V58 A;  3ZRS A;  1DK1 A;  4APM A;  1N0J A;  3CB2 A;  4GX2 A;  3G8C A;  2KG7 A;  4TVI A;  1R3J C;  3BVO A;  2JJ1 G;  1I5Y A;  4KXR A;  2HVJ C;  4I50 B;  4X1Y B;  1J5E H;  2GHY A;  1PM9 A;  4D7T A;  4NB5 A;  4Q8E A;  3ZN1 A;  1ZHS A;  4ECV A;  3N2K A;  2HHH B;  4DR7 B;  3SI8 A;  3RAX A;  3P3N A;  3ZBH A;  5KFA A;  4JYC A;  2ODT X;  2FB5 A;  4LF4 B;  2YW2 A;  2C35 B;  1I50 A;  3MR5 A;  3H4D A;  3V6K A;  3APQ A;  3B8M A;  4O3R A;  4CH3 A;  5CAE B;  4DUY O;  1N36 H;  5KG7 A;  5KFC A;  3G6Y A;  5DG7 A;  3GIM A;  2ZXW C;  5LOV F;  4PZ8 A;  1HW7 A;  4UCR A;  2ZE6 A;  4LWS A;  1WR2 A;  1G6U A;  4I4T A;  4AI8 A;  2JVD A;  2R93 A;  1HNZ B;  3RTX A;  1KBH A;  5KFL A;  1SA0 A;  3HKD B;  1FFX B;  1QLN A;  3FB6 C;  1MSD A;  4PI2 A;  4NKG B;  3E89 A;  1SEI A;  4BW5 A;  1ARO P;  3GTP A;  1GRJ A;  5BR8 B;  1IVS A;  1HP8 A;  2Y4T A;  2GPS A;  5KFN A;  5B1O A;  3J81 N;  3JCZ A;  3DC5 A;  4DR3 B;  3TXS A;  4O4I A;  1EN5 A;  4JI0 H;  2BQ3 A;  4JV0 A;  3FYI B;  4DV1 B;  3CJH B;  2V9W A;  1LNQ A;  3HPL C;  4O4H A;  4IGG A;  4IHJ F;  4DL3 A;  5EDW A;  4EKW A;  4ZQI A;  3WO0 A;  4JYY A;  3LUL A;  2EX3 A;  2A1H A;  4Q44 A;  1PPJ H;  4JTC B;  2CUG A;  5CMU A;  4O2B F;  1FJG B;  2ALZ A;  4YR3 A;  4KL1 A;  3CD6 V;  4FJC C;  4PZ7 A;  4ZI7 B;  3IC9 A;  4X66 O;  4HZ3 A;  5KFQ A;  3CSW A;  1NR1 A;  4EG0 A;  4G2K A;  4CZZ A;  1K5Q A;  1TGO A;  4JTA B;  2YZN A;  3GIK A;  2QWQ B;  2PGG A;  2XIG A;  2WLM A;  3H20 A;  3C3S A;  2YEV A;  2ZDG A;  2PZS A;  3UCS C;  4PD4 F;  4MT8 A;  2CDY A;  1L0N H;  4LF9 O;  4RB1 A;  1WA8 A;  1WB8 A;  3PO2 G;  2NVX A;  2UXN A;  2UUB H;  4W4K A;  3BQ0 A;  4C5B A;  3FB5 C;  4O7T A;  1KJQ A;  3BRC A;  4YY3 H;  3SGI A;  2XAQ A;  2XCL A;  5KFB A;  5ITZ A;  2FPG B;  3EXA A;  4ECT A;  4E4E A;  1OV9 A;  4J41 A; 
#chains in the Genus database with same CATH homology
 4A2B A;  4MTD A;  5D1O B;  4FLX A;  1J5E B;  2Q2T A;  3OTF A;  5D5Q A;  4LF9 H;  1XI1 A;  5J2U B;  4EB6 B;  1IBK B;  1P49 A;  3SJB C;  4HNA B;  3JAR A;  4B3R B;  1H2S B;  3SJA C;  2ZIO A;  4PI0 A;  4FLZ A;  5KHJ A;  4AIL C;  1V9P A;  3E22 B;  4I55 B;  4I4T B;  4EFE A;  1N36 B;  3RYF A;  3L2P A;  2P5O A;  2RQ6 A;  3MAQ A;  1SA0 B;  5IYZ B;  4X65 H;  3BPZ A;  4B08 A;  2V4D A;  1BJT A;  1SKV A;  1XHX A;  1N34 B;  5LP6 A;  1O75 A;  4FLT A;  4I7H A;  4FM2 A;  3OTO B;  1A0I A;  2CW7 A;  2ZIN A;  3W5O A;  4DV5 B;  3F8N A;  1N32 H;  2P22 C;  3RYH A;  2F4V B;  4GYC B;  3RGB A;  5D1O A;  4JYA H;  3TY8 A;  3ICX A;  2W57 A;  1TVK B;  5EIB C;  5J2U A;  4FLU A;  5FD6 A;  4O4H B;  3RGX A;  3PN1 A;  1Q5O A;  5LXT A;  5JJN B;  4O4J B;  4X1I A;  3MWM A;  4U3J A;  5LYJ B;  2CAZ C;  1XQ8 A;  3E22 A;  4NXN B;  4I55 A;  5JH7 A;  5LOV B;  2YI8 A;  5CA1 A;  4ZOL A;  1N34 H;  4ZIB A;  4DV3 B;  4UCV A;  3OTO H;  5J2T B;  4CS3 A;  2PYL A;  1Z5W A;  3KAK A;  4BWS C;  4DV5 H;  4AQY B;  2ZJT A;  4UCO A;  3JAS B;  4AHC A;  3QWU A;  2F4V H;  1WPB A;  1BGW A;  3RYC B;  4TV8 B;  2OYQ A;  4I9Q A;  4JI2 H;  4UCT A;  4DR2 H;  1D5A A;  4DR5 B;  3T1Y B;  4GKK B;  1TVK A;  3HKE B;  3UQ8 A;  4TUY B;  4TV9 A;  3N44 B;  2BTO A;  5CA0 B;  1SQF A;  4NXN H;  2VQF B;  2UUB B;  3K57 A;  2KKW A;  3HXL A;  3J80 W;  3RWR D;  4LR3 A;  2CW8 A;  4IHJ B;  4NVP A;  4O4J A;  1CKN A;  4DV3 H;  1M5I A;  4YY3 B;  5LYJ A;  1KU9 A;  1Z2P X;  4JI7 H;  3VQY A;  4D7S A;  4AQY H;  2UU9 H;  5LOV A;  3JSL A;  5EYP A;  4B3S B;  3DSQ A;  4JV5 B;  3QG5 A;  3RR5 A;  3JSN A;  4FLV A;  5GON A;  4YHH B;  1CKO A;  4LNU B;  1I7F A;  5JVD A;  5KHG A;  2VPS A;  4B3T H;  1HNX H;  5FNV A;  3LNN A;  1Q43 A;  2UUC B;  4JI6 B;  3T1Y H;  3RYF B;  4TV8 A;  3NBY B;  1JJO A;  5JQG B;  4FM9 A;  3JAT A;  3DF7 A;  3KAJ A;  4RB2 C;  3B2E E;  3HKE A;  4O4L A;  1X9N A;  3KXY T;  1FKA H;  4RAZ A;  1CKM A;  4X65 B;  5CA0 A;  4BW9 A;  2HIX A;  4DV4 B;  5DIS C;  2HVS A;  3RYH B;  1SQG A;  4B3S H;  4JV5 H;  4IHJ A;  3KYH C;  1ZAU A;  4DUZ H;  5JCO C;  1L8D A;  3N42 B;  4YJ3 B;  2QM4 A;  4YHH H;  2Q7H A;  4ETS A;  1XNQ H;  5D5P A;  2Q0A A;  1Z5V A;  1N32 B;  4O2B A;  1AN7 A;  2E5L B;  4JI5 B;  2YIB A;  4JYA B;  2UUC H;  4JI6 H;  4YJ2 B;  1S03 G;  5LXT B;  5D1P A;  3JAL A;  2UUA H;  1MZB A;  1HNW H;  4LNU A;  4X1I B;  3IAY A;  4DRX A;  2UXD B;  4U3J B;  1FVI A;  4LF5 B;  2VWK A;  2O03 A;  3L4K A;  5JH7 B;  5CA1 B;  4JI4 B;  4ZOL B;  3W1G A;  4X62 B;  5JQG A;  2MCT A;  2ZNJ A;  5FLX W;  2UXB B;  3SJC C;  3BAA A;  4DV4 H;  5IT9 W;  5A2Q W;  3HKB A;  1O9G A;  4FM1 A;  1XMO B;  3GDE A;  3RFR A;  4CS4 A;  3UT5 A;  3TY5 A;  2ZNI A;  2ZM6 B;  1I6U A;  3RIZ A;  4JI8 H;  4UCS A;  4LFA B;  2E5L H;  4JI5 H;  3C0F B;  2IM9 A;  4IIJ B;  4YJ3 A;  1SYX B;  4O2A B;  3L4J A;  4CH6 A;  4RZQ A;  4RB3 C;  2UXD H;  1Z2O X;  4LFB B;  4JI2 B;  2YI9 A;  4TV9 B;  4LF5 H;  2F93 B;  4DR2 B;  4DR1 B;  1Q3E A;  4YJ2 A;  4LSA A;  3N41 B;  4JI4 H;  1YEW A;  3VQX A;  4X62 H;  4BWA A;  3J7A K;  3K5L A;  1CKN B;  4X20 B;  5LL6 b;  4DRF A;  4CC5 A;  2UXB H;  4JI3 H;  1TAE A;  1QQC A;  3K58 A;  5EYP B;  1M0W A;  3WB1 A;  4R7R A;  1Q8I A;  3U10 A;  1E4G T;  1XMO H;  5EOY A;  1XMQ B;  5GON B;  4LF7 B;  4JI7 B;  1TUB B;  2ZM6 H;  2CFM A;  2UU9 B;  5JVD B;  4DR4 H;  4F6R A;  3N43 B;  4DV0 B;  4LFA H;  5FNV B;  2R70 A;  5LMU H;  1N33 B;  1DGS A;  4LFC H;  2XHB A;  3CSX A;  1XNR B;  3U0Z A;  3VQV A;  4LF8 H;  4LFB H;  2UXC B;  4B3T B;  1HNX B;  4L8J A;  1VF7 A;  4DR1 H;  3JAT B;  4IIJ A;  3TY9 A;  2Q7G A;  2VQE H;  1WN7 A;  4O2A A;  4O4L B;  2YCH A;  4K0K H;  3IG0 A;  3N6X A;  2VOB A;  4OX9 B;  5FD5 A;  1L2Z A;  1O9H A;  5LA6 A;  3RGZ A;  1TA8 A;  3K5M A;  5LP6 C;  2PYJ A;  3K5N A;  3BHP A;  4GKJ H;  4X1Y A;  4I50 A;  1IBL B;  4X20 A;  5KHI A;  4DR7 H;  4RB0 A;  1XMQ H;  2QJ1 A;  4X1K A;  4LF7 H;  5KX5 B;  2HGS A;  4PHZ A;  1XK5 A;  1WNS A;  4CH5 A;  4DV0 H;  3FFQ A;  4O2B B;  4LF4 H;  1XDN A;  4DUZ B;  1N33 H;  5BMV A;  5EZY A;  4GLX A;  3RF2 A;  4X64 B;  2RGV A;  1XNR H;  3K5O A;  1TUB A;  3JAL B;  3GB8 B;  4DK1 A;  3JAW B;  1XNQ B;  4FM0 A;  1HR0 B;  3W1B A;  4DRX B;  4MV9 A;  4M7E A;  2UXC H;  3HKC B;  5LMN B;  1QHT A;  4UCU A;  2Q7E A;  3JAK A;  4KHP H;  4Q6G A;  5C8Y A;  2UUA B;  3LML A;  4NXM B;  1HNW B;  3N40 P;  4OX9 H;  2HIV A;  4MV7 A;  3T1H B;  2ZIM A;  2E3C A;  3U11 A;  2WYO A;  5FPR A;  1Z2N X;  3HKB B;  3N2G A;  5IWA H;  5BR8 H;  2F66 C;  1IBL H;  4UFZ A;  1IBM B;  5FPO A;  3UT5 B;  5KMG A;  3HKD A;  3GJX B;  1NT2 B;  4LSX A;  4A2A A;  3ETQ A;  3WB0 A;  1S68 A;  4X64 H;  3JAM W;  5KX5 A;  4DV6 H;  1HR0 H;  5JJE B;  3SR2 C;  4JI8 B;  4WBN B;  2JGU A;  5LMN H;  3M4I A;  4DR6 B;  4TQF A;  4NXM H;  3JAW A;  4FFB A;  3NBZ B;  3HKC A;  4DK0 A;  3NC0 B;  1M0T A;  3T1H H;  2VWJ A;  4J0M A;  1X4T A;  4FVM A;  4K8X A;  4Q0Y A;  1IBM H;  3N2K B;  3ZED A;  5EIB D;  5CB4 B;  4JI3 B;  4B3M B;  4K8Z A;  2PTM A;  4F6R B;  1XHZ A;  2YIB D;  4ZI7 A;  4RAY A;  2BTQ B;  2R9A A;  2FE3 A;  3K59 A;  4PDB A;  4LH7 A;  5K1P A;  3M7M X;  1RSO A;  4TQD A;  4IAJ A;  4DR4 B;  4CH4 A;  5K1X A;  3A2F A;  4ZHQ B;  4JI1 H;  4LFC B;  5LMU B;  4DR6 H;  4LF6 H;  4DV2 B;  4APM A;  4HBN A;  4LF8 B;  4WBN A;  5LA6 B;  3CB2 A;  3KAL A;  2KSW A;  2Q2U A;  3RJ0 A;  1I94 H;  1JFF A;  4K0K B;  2VQE B;  4EQ5 A;  2GV9 A;  3CHX A;  4I50 B;  4X1Y B;  3THO A;  1J5E H;  5KHH A;  3BAB A;  4X1K B;  4D7T A;  3RYI B;  4B3M H;  5IJ0 B;  1IBK H;  1KMI Z;  3FMA A;  4GKJ B;  1ZHS A;  4O4I B;  4DUY B;  5BMV B;  3N2K A;  5EZY B;  2HHH B;  4DR7 B;  4B3R H;  2RGR A;  5CB4 A;  4EB6 A;  4LF4 B;  3EYY A;  4HNA A;  2BTQ A;  3JAK B;  4CH3 A;  4JI0 B;  1ZHQ A;  1N36 H;  5C8Y B;  4DV2 H;  2F95 B;  4LMY A;  2RJZ A;  4PZ8 A;  2WE6 A;  1E4F T;  1HW7 A;  4UCR A;  3CVZ A;  4ZHQ A;  1G6U A;  4KHP B;  4I4T A;  1M4U A;  2JVD A;  3N2G B;  1HNZ B;  3RTX A;  4EFB A;  1SA0 A;  5IYZ A;  3HKD B;  1FFX B;  5KMG B;  3BA9 A;  4PI2 A;  3QTC A;  1SEI A;  2R72 A;  5IWA B;  5BR8 B;  4DUY H;  4FLW A;  5JCO A;  5IJ9 B;  2HHH H;  2F1M A;  3RYI A;  1M93 A;  5IJ0 A;  3K3V A;  4DR3 B;  1WH2 A;  1GYF A;  2OWO A;  4O4I A;  4TOI A;  4JI0 H;  4DV1 B;  4FFB B;  4DV6 B;  4PZ6 A;  4O4H A;  5ITZ B;  2YXL A;  2JS5 A;  4DV7 B;  4X66 B;  1HNZ H;  2EX3 A;  4CC6 A;  5KHK A;  1FJG B;  3S24 A;  3VNN A;  4MTE A;  4KL1 A;  4FLY A;  4PZ7 A;  3VQW A;  2PUS A;  4ZI7 B;  3QF7 A;  1P16 A;  2HVR A;  3JAR B;  1TGO A;  5J2T A;  1FFX A;  1S5J A;  4LF9 B;  2PY5 A;  2PGG A;  2XIG A;  2VUG A;  3H20 A;  4DR3 H;  3JAS A;  2HEP A;  3RYC A;  2WDT A;  4DR5 H;  3WB2 A;  3J81 W;  4GKK H;  5IJ9 A;  2PZS A;  1T5E A;  4DV1 H;  1P8L A;  4E6N A;  3BA8 A;  1VS0 A;  2YIA A;  4RB1 A;  4JI1 B;  1B04 A;  4EEQ A;  2VQF H;  2UUB H;  5JJJ B;  4DV7 H;  1JMK C;  1JFF B;  4LH6 A;  4LF6 B;  4X66 H;  2ZCE A;  5LP6 B;  2HVQ A;  3BRC A;  4YY3 H;  4TUY A;  3SGI A;  4CS2 A;  3ZS8 C;  1FJG H;  5ITZ A;  1I94 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...