4UCVA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 95
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucvA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucvA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucvA02
2UU9B 4DV4B 2OWOA 1XMOB 2HIVA 1HNWB 4DV1B 4PZ7A 5DISC 4JI6B 1P16A 2HHHB 1N34B 4DR1B 1XNRB 1FJGB 4DV7B 5D1OA 5LMUB 4DV5B 4OX9B 2VUGA 3L2PA 5FPOA 4UCOA 5D1OB 5FPRA 4JYAB 4JI3B 2Q2TA 4DV3B 4GLXA 3BA8A 4DR3B 4NXMB 3TY9A 3W1GA 4DV0B 4EQ5A 2VQEB 4AQYB 3RR5A 4E6NA 4DR5B 4DR2B 3BAAA 2UUCB 1CKMA 1CKOA 3BABA 4JV5B 4EEQA 4DUZB 4LFBB 4DV2B 1HNZB 4PZ8A 4X65B 4DV6B 4X66B 1J5EB 1TA8A 3GB8B 4LH6A 3W5OA 1ZAUA 1IBKB 2UXCB 5D1PA 2Q2UA 3S24A 3VNNA 4UFZA 4LF5B 4UCUA 2CFMA 4UCVA 4DR6B 3OTOB 1TAEA 4LF9B 5BR8B 4JI7B 1N36B 4JI5B 4JI8B 4EFEA 4YHHB 3NC0B 5IWAB 4B3SB 2ZM6B 2VQFB 1HR0B 4LF6B 2HVSA 3TY5A 1XMQB 3T1YB 2HIXA 3BA9A 4LFAB 1I94B 4LF7B 4LH7A 4TOIA 4JI1B 4DUYB 2F4VB 4JI0B 4LF4B 1A0IA 4NXNB 4CC5A 4B3MB 1S68A 4DR4B 3GJXB 1IBLB 4JI2B 3TY8A 1FVIA 3SGIA 3GDEA 3JSLA 1XNQB 4PZ6A 1B04A 3NBYB 1CKNB 1N32B 4K0KB 1XDNA 3JSNA 2UUBB 4B3TB 4GKKB 1CKNA 2HVQA 4DRFA 4UCTA 2UXDB 4EFBA 4LFCB 2UUAB 3KYHC 3T1HB 1IBMB 4GKJB 4CC6A 1VS0A 4JI4B 1N33B 3UQ8A 3QWUA 4UCSA 5LMNB 3PN1A 4KHPB 2HVRA 3W1BA 4X62B 1V9PA 4X64B 1HNXB 3NBZB 4LF8B 4UCRA 4B3RB 1P8LA 2UXBB 1X9NA 4DR7B 4YY3B 1DGSA 3RTXA 1XK5A 2E5LB
chains in the Genus database with same CATH superfamily
5LP6F 3OD4A 1WNSA 3U10A 1HNZO 5E25A 4X65O 2H3OA 3L75H 5EIBD 5KAIZ 1FS0G 2JGDA 3CEIA 5D1OA 3LWBA 1V54B 1CPYA 1R6TA 4ETSA 4DV4H 2IBKA 2YRXA 2FB5A 3SJAC 3Q8PB 3G6EV 1MA1A 4LP8A 3I5DA 4NXMB 3MR5A 2GUZB 3ZRSA 5DG8A 4O2BB 4O7RA 2UVVA 3M99B 4JI7H 1X59A 3HKCB 4PZ8A 2C2AA 3HOXG 4PDMA 3J7AK 4I0XB 1JR9A 4A93G 4U7CA 5LHHA 4UFZA 4ECWA 4LF5B 4EBDA 3C3TA 3MR6A 5IDJA 4TUYA 3VOTA 5KHIA 4DL3A 4P9OA 1THZA 2VOBA 2YWVA 1GH6A 4TV9B 4NZNA 1DAAA 3DTFA 2YRWA 2JEJA 3OUUA 4LMYA 3TGUH 2X0LA 3JD0A 1KJQA 1VQ9V 1Q6UA 1L8DA 1SEIA 3G6YA 3N2GB 2R9RB 1S5JA 5KG0A 3L71H 1VQPV 2ZDIA 5KG5A 4DV7H 3GTJA 3JD1A 3I4NG 4YIOA 1SQBH 4O4LF 4IRKA 1YTFB 4ECYA 2UXDH 4CH4A 3UO2A 4U7NA 3ASNC 5J2UB 4O4JA 2PZSA 2JA7G 3AG1B 3EYYA 3UYYA 1JX9A 4MTXA 3RWRD 2W6QA 3DXRB 2DOSA 2IU0A 3AYHB 1L0LH 3H01A 5I5WA 2YIBA 4J7KA 2JRIA 1E1RG 2QM4A 3JATB 4EB6B 4MW3A 3T1CA 3T9DA 1QVGU 1Y1VA 3K5IA 4LFCB 2Y4RA 5BZBA 5LOVA 2WSSG 3WG7C 4GX1A 5DAAA 5CA1F 5L1KA 3ZX6A 3FKIG 4DIMA 1VIBA 3E5NA 1VF6A 1S5LZ 2HLDG 4O3SA 1OBDA 2WAQA 3PW4A 3WB0A 5CN0A 1N32O 5I5YA 5BWVA 4ECVA 4KUMA 3R23A 2BE3A 3RYFB 5AG2A 2FJZA 3B2EE 4Z1MG 2KG7A 3A2FA 2WAMA 4YB8B 5KFLA 3F7VC 2VPSA 1PL0A 4PWQA 2CZGA 4JI7O 5EZYA 2YZNA 3V4ZA 2JJ1G 4A3EG 1EZJA 4JPRA 4JYAB 4MAMA 4X62O 1RJRA 3HOUG 4GLXA 2ZNJA 5KHHA 4O2BA 2L35A 2DQ0A 2OCCB 1EBOA 4QIWE 4ABMA 3GV8B 5IYCG 4FLVA 3GWKC 3D3QA 4FFRA 3N44B 4KHPH 1NKDA 1Q6IA 3A0RA 1NT2B 5HFLA 3STZC 5GONB 4DV2B 2YXHA 3WB2A 5LHGA 2J6UA 4MVZA 4FLZA 3JAKA 1XILA 4TUYB 4LFCH 2UXCB 2LGWA 4FM0A 3FAVA 1BL8A 1S97A 3T7AA 2JS3A 4MT8A 1L2ZA 2DE0X 4YJ2B 4LF9B 5BR8B 2XHBA 4J7ZA 1IXBA 1ZHSA 5IWAB 2XCAA 2RNBA 2UXDO 3UT5B 1XMQB 3TCUA 1ROPA 2K9PA 5C5JA 3OUFA 3ETGA 2WLKA 4QPKA 3OFNG 1B6SA 3W7TA 2EJ3A 2E2HA 2CK3G 3AX6A 2IW5A 1AILA 1AI6A 5DLGA 4O4JB 4LSXA 2WLLB 2PTMA 5KFPA 4MV3A 5CAEB 5CA1A 2QWNB 4LF9O 1OV9A 2OTJV 1VQ6V 2NVXA 3CJHA 3QQMA 3ABMB 5IYBO 5GTIZ 4GKKB 1FYJA 5CE8A 4G3IA 2Q6AA 2JA5A 1BHAA 1AJQA 3CCSV 3CCMV 3AG3B 4R50A 1YJ9V 2HHFA 1IBKH 2N05A 4LFAH 4PV1B 5FLXN 3L72H 2P22C 2R7KA 4Y8VB 1N32H 3UM7A 5KA5A 1HNXB 4I7ZB 1K7DA 4K3AA 1Q5OA 1IBLO 3NBZB 4B3RB 4HBNA 5D8DA 1I2KA 2JEGA 4A3JG 3RTXA 3T5JA 4MTFA 1ZL8A 2UVUA 5C44G 3A0BZ 1BE3H 4DV4B 4HYKA 2ODTX 3UZBA 2EINC 4NXMH 3OAAG 2QKCA 4X62H 5LGTA 4B7KA 1FD9A 2WWWA 3JD4A 1EYZA 4FPPA 3P3PA 5EZYB 5JVDA 1G2WA 1KB9F 4OX9B 3UFXB 2D3OW 4RAYA 4EEYA 1K9MW 4WFEA 5FPOA 4UCOA 4Q8FA 1EZVH 5K1XA 2Z04A 2AW9A 1K1QA 3ASOB 3BCCH 4DAAA 1JPXA 1FFXA 1YDXA 4LNUA 3WWHA 4ZBMA 3JD2A 2ZM6O 3CRRA 1I1KA 3QZ8A 4ECQA 1R3IC 1KP3A 3HKBA 2Q0OC 3KALA 5BYAA 3M9MB 3JAKB 2DN9A 4EGQA 1XMQH 1YF2A 5B1OA 4JI6O 1NI8A 1TA8A 2QYZA 3LUTB 1Y1WA 3FAVB 1M0TA 2XT9A 1K5SA 4HZ3A 5KLVH 4UCUA 5CBFA 4IAJA 3OMNB 4EYHB 2XAGA 4DL4A 5L1IA 4EBCA 2W9BA 5L1LA 5IT9W 2B63A 1VQ5V 2HVJC 3ZIAG 1VQKV 3T5LA 2YSUB 3B8NA 1QR8A 3CQZA 1D2DA 2WA4A 1K4CC 2UXCH 1FXKA 4DR2O 5FNVA 2XASA 2AU0A 2JIZG 3OMAB 1H2NA 2HVSA 1GSOA 1TVKA 4BW9A 4LF7B 1ZX3A 4M0JA 4BIZA 3CD6V 3R65A 3RBDA 2C28A 4O7ZA 4RUAA 3E22A 2R87A 1EUDB 4F4ZA 1YIJV 2JJ2G 3SGIA 3WB1A 3TXSA 3CJHB 5T14A 4IIJF 4ED2A 3NBYB 3G6VA 1W0KG 5ITZA 2YIDA 1AP5A 3E8FA 1P4RA 5KFUA 2BSKA 3N6XA 4HNAA 2HHFB 2DZDA 3AG7A 4EFBA 2M7WA 2Q7HA 5DQHA 4JI8H 4I4TA 3M9NB 3PW2A 2E76B 4G28B 4NXNH 4TSFG 2R7ZG 1SFOA 3RAXA 2Z5UA 5KFHA 3GVMA 2DWCA 2V4QA 1OCZC 5JJEB 3QNEA 2I80A 1V9PA 2J9GA 5DGHA 1M9NA 1OJHA 3CCQV 4QIWF 5DEDA 5KX5B 4NXMO 2NU6B 1R6KA 5IJ9A 1BQZA 1SKVA 1NVPB 4JI5H 1MABG 1XK5A 1QLNA 1O9GA 2PVPA 4QWCA 2ZIOA 4RWUA 5J9PC 4RQEA 1XEQA 4PA9A 4DUZO 1XMOB 5HV6A 4ECRA 4RNOA 1I7NA 1L0NH 4TQRA 4A2BA 2YZGA 3QF7A 5BMVA 5JVDB 4GKJH 2AHZA 2YXYA 3VBBA 4HNUA 4ECZA 2VA3A 1BGYH 5BWWA 1LUWA 2JA7A 2X6BA 1K97A 4O4LA 3GIJA 4CHIA 2VUGA 3RIZA 4DLKA 4WBNF 3P3NA 1Q3EA 4R8UA 2B9ZA 1FFXB 4JI6H 4NVPA 4TV8A 2XTAA 3PR5B 2JDIG 3JD3A 1WB8A 2EILB 1EZ1A 1QNMA 4E6NA 2UUCB 2J6SA 1CQJB 5IYCO 1YHQV 1CKOA 1K92A 1T36A 4CKBA 4HAMA 3L4JA 1HR0H 4YJ3F 3MHSC 1BS3A 5KT2A 3R5XA 1S3JA 3RBEA 1H2GA 4FFKA 3GB8B 4F4YA 3AW8A 1I0HA 2DMXA 4QWBA 2W6JG 4JAUA 4F4WA 4C5AA 2UVRA 2QB5A 2X5RA 3SPJA 5DQGA 4IR1A 3CC2V 1GK9A 1VP7A 2JK5C 1FXKB 3ZHRA 2PY5A 1IYDA 3GTQA 1WJZA 1GM9A 1GM8A 1ZQ7A 1KJJA 4DV5H 3TY5A 3GIMA 1Y6XA 2OT5A 2HIXA 4QJFA 3OGCC 4QW8A 1KMIZ 1ZSPA 4B3MB 3LQSA 4MV9A 5BXZA 1HW7A 2ASJA 3OE7G 5KFVA 3F7YC 1FPOA 5KUKA 1H2MA 3VQXA 3OTOO 2NU8B 1Y14B 3ML0A 4K8ZA 4HNAB 2JVDA 1N32B 5H5NA 3K9SA 3JSNA 2HR3A 2UUCH 1PM9A 2B5UA 4XDLA 2VS0A 4I4TB 1RPRA 2E2IA 1OZ0A 2GHYA 4U3FH 1ULZA 3VPDA 2ZXWB 3CCLV 1FXHA 4GKJB 1A0GA 5I60A 3FKIA 2W0FC 3UQ8A 5J2TB 1NS1A 5FD5A 4DQNA 1W2BU 1NJIW 2JA8G 2PF4E 3KCXA 2QA4V 4MA5A 3KKYA 4ZKIA 3SPHA 3ZHVA 2OTLV 5I5VA 1ZTEA 5KT7A 4GC6A 4O84A 5IP7G 2IMWP 1FJGH 4UB8Z 4E2LA 1PNMA 4FLWA 3N6RA 2VQEH 1EKFA 4J9YB 5DM6V 2HIVA 4DV2O 2CTRA 4DV1B 4ICGA 1HNZH 2XUMA 2HHHB 2JGDB 4P9PA 4F4LA 2UXCO 3W7WA 4LFCO 3SI8A 1Q43A 2OCCC 4CH6A 4DL5A 1WCMA 5KFOA 3WFVA 5KT4A 2I8CA 4FFMA 4B3MH 5KFBA 3JZFA 3FB6C 2GUZA 3I56V 1I5YA 3STLC 4DR7H 1P49A 1MNGA 4WBNA 1BSMA 1TUEB 1M57C 4DR5B 1XHZA 5JJNB 5FD6A 2ZGIA 2YL2A 4RAIA 2AXTZ 3PR4A 2Q68A 4TVIA 4CH3A 1N4CA 1VMGA 4O86A 1XOUA 1WPBA 4TV9A 3WU2Z 3K3VA 4E4TA 1KBLA 2CH7A 4NZMA 3GIKA 4BIUA 3EPGA 4UUGA 2LW7A 4A3IG 3T2MA 2ZE6A 4G2KA 2SCUB 3ZHQA 4EFEA 3R66A 1E4GT 4APMA 5C8YF 3JAMN 4GX5A 2WA3A 2VPQA 1WN7A 4YJ3B 4LCUC 3GIQA 4I4TF 2CTPA 5LGNA 2Q73A 4DL2A 5I5SA 4ME6A 5IE9A 2W71A 4A3LG 4DYLA 1HDJA 2R82A 4R6ZA 1S68A 2A0LA 3BY6A 1IBLB 3FYIB 2YZMA 3VQYA 2XCPA 2V4DA 1AI7A 4XDJA 1WRVA 2ZE7A 4OPAA 3BPZA 2PN1A 2FPPB 4MV4A 5A9GA 4FVMA 3SYQA 1JLLB 3I4MG 4EB6A 2EILC 4DRFA 1B33N 2HGSA 5KHKA 3DTGA 1M6VA 4YHHH 1N33B 1FJGO 3QWUA 5BYBA 5EK0A 2FLNA 4NB5A 1E4EB 3AG2B 1UFIA 1COWG 1K33A 2QK4A 5B3SC 2DYSB 2FKLA 1VAJA 1QVFU 2DQ3A 2Q5ZA 4P2ZA 1NVPD 1I50A 4K35A 1FKAO 1EM1A 2CTWA 4ECXA 4GKKO 5KT6A 4L87A 2DYRB 4ED0A 1S10A 2JEIA 4FFBA 3KAKA 1N34B 2YI8A 2EZPA 4FMTA 3JAWA 4NZOA 5B5EZ 4O81A 4ZI7A 5JQGA 4WBNB 1I1LA 1HNXO 2Q2TA 1TWFA 2FLPA 1M56C 4B3RO 2R8JA 4HNTA 1BGWA 2ABJA 1YEWA 2W6OA 5IJ0B 4O7YA 3U9SA 2R86A 2ASDA 3L4KA 1B3QA 4WFGA 3BABA 2PI5A 2FPGB 1NBMG 1RJPA 3RAQA 2BQ3A 2HP8A 2RGRA 4MS2A 2AGOA 2R93A 3HKZE 3ETEA 4GT1A 4C5BA 1N33H 2EIYA 4QPJA 1VQ8V 4CMFA 5GTHZ 4GC7A 4H0LB 2ZINA 4A3CG 4IHJF 3K58A 3QZ7A 1NR7A 1Y74B 1VKZA 4PA7A 3KHLA 3UT5A 4B3SB 1KTAA 2R7LA 3TXQA 4CS4A 1WSCA 3K5MA 3H20A 4O7VA 4ECSA 5LP6A 3RFRA 3D3IA 3H1HH 3OGIB 4GX2A 4HYOA 4DK1A 1EKPA 2A1HA 4QW9A 2W70A 1R6NA 4NYEA 4U7OA 1OCRB 5JQGF 1IX9A 1TUBB 5KFTA 5EDWA 4CE5A 2D2CB 2HVKC 5CA1B 4F4XA 2IJIA 1CQIB 3ZMUA 4LFBH 2C2RA 2OIEA 3GB7C 1A3GA 4RCNA 4RB3C 4MTOA 4IHJB 3G71V 2YS6A 1XDNA 1DV2A 2UUBB 4FFPA 2DPIA 5LGUA 3CMAV 5DGBA 1CKNA 2PMZA 4LWSB 4FFNA 2M6YA 1KUQA 1S76D 2BCCH 3ORQA 1E4EA 3RB0A 2AGQA 4TQDA 4UCSA 1FFTB 5EYPA 4Z1VA 1CEZA 4FBTA 1JJOA 4DR4O 4B3TH 4GKKH 1ZL8B 4DR6H 1CS0A 5KMGB 1A48A 2QKSA 4AQYO 4FFLA 2CW7A 1R3JC 3QO7A 4K0KH 2BTQB 4LBEC 4TV8F 1JA8A 4J9KA 3OEEG 4QIWA 3L73H 4WCEV 4FFBB 3KAJA 1SQFA 1HNXH 3APQA 1WB7A 1F23A 5IP9G 4LF5O 4A3GG 5KKNB 5JQGB 3D36A 4WHXA 2YDEA 4YP3A 1SF9A 2E75B 1UNNC 4DV5B 2VQFH 4KP4A 3T9AA 3AG3C 1T3NA 4BBRG 1HNWH 4LNUB 5IJ0A 4DR3B 2YIAA 2HEPA 3HKBB 4JXUA 1C30A 4AQYB 2RF4A 3ABMC 2EJRA 2CQYA 4FZ0A 4IIJA 3BFRA 3I55V 5BR8H 3T9BA 3BQ1A 4X20A 3LNNA 3HBLA 3PW5A 1H2SB 1KJ8A 1G8MA 5D5PA 5KFXA 1ZAUA 4O7LA 1VQOV 4DR1H 1RSOB 5JUMA 2QWQB 1H2KA 3GIIA 4JTAB 4TV9F 4FLXA 3GLKA 4BW5A 4UCVA 1SC5B 3FD9A 1XL6A 1Y74A 1SCUB 3NC0B 2QGNA 3GTPA 1GKFA 5FNVB 4DR3O 1TWGA 1JOYA 2P06A 1URFA 4MV8A 5LYJF 3M9OB 3RYCB 5LP6B 3ASOC 4CH5A 2QEXV 2X7RB 4FM1A 5EOYA 4I50F 1TUBA 2O03A 3E22B 2HJFC 2XCLA 1SESA 1KYOF 3PW0A 4NXNB 3T9EA 4Q20A 1GRJA 1FVIA 4BWSC 3D36C 1RJQA 4UVBA 1S9FA 4IHJA 5ITZB 3T99A 1KQSU 3V6JA 1CE8A 2BSKB 2IH1C 5I47A 4LWSA 3ZMZA 2Z0AA 1Z5VA 2Q8VA 4C7UA 4A2AA 3OUSA 1TWAA 4I9QA 4B3RH 1O75A 4JYAH 4B08A 1XBLA 1KD1W 2UUAB 2MK3A 3RV3A 1IBMB 3K3WA 1SRYA 4R7CA 1EHIA 1A9XA 2MW2B 2ODMA 4O4IA 1WR2A 4JI2H 4NXNO 1KJIA 2HVRA 3ZMVA 3MD0A 2W7OA 1GAXA 3IN5A 4X64B 2V58A 3M7MX 3THOA 1KKDA 2OLSA 3BEHA 2BTQA 3ABTA 2JA5G 3KXYT 4LF7H 4QSHA 2R6FA 2C00A 5IYDO 2EJ0A 3T9FA 1GYFA 1FAFA 4UUJC 3VQWA 4AI8A 3JARA 2DIKA 5LHIA 2ZR3A 4FS1A 1JXLA 5JVDF 2WE6A 3CE2A 4LSAA 5KG7A 5JQWA 4PA4A 1BMFG 1IBMO 2YU9A 4GKJO 4AHCA 4DR1B 3TIGA 5CMUA 4R8UB 1AR1B 3U11A 4FLTA 3HB3B 1Z2NX 1S03G 5BR8O 3RUPA 5LA6B 1R9TA 1AR5A 4RUFA 3IJ4A 2QJ1A 4IIJB 2V7QG 2QM8A 4IRCA 3W1GA 1WPXA 1KUTA 3EXAA 3SPIA 3TQTA 3SR2C 1CKMA 3Q4HB 2HJWA 5EIBC 5JH7A 4BR6A 3OT7A 4RB1A 2GDSA 3ABKC 3OTFA 3ASNB 2F4VO 5BWTA 2UUAH 4DR3H 2QR4A 2RN9A 3VNNA 3Q8QB 5B1NA 2C2DA 5JWPA 2IBZH 1SQGA 1XMOH 5IYZF 5KG4A 5D5QA 1M4UA 3SPCA 1N36B 2CDYA 1PK8A 1H2LA 3RYCA 4CKCA 2UXBH 2RGVA 1UC9A 4B3TO 4DR4H 2UXNA 3ZEDA 1V4YA 3ETDA 2FTKA 3CB2A 2COIA 5KFZA 2DYRC 1RPOA 3Q1KA 3BA9A 3DAAA 4H44B 1YXBA 2F4VB 2UUBH 2A06H 3JCUZ 2XGQA 1VEWA 1KP2A 5L3CA 3GILA 4MVOA 4JZGA 2ATLA 4F50A 3IAYA 4BY1G 3AG2C 1N36O 2W7PA 5IWAH 3CMEV 5IYZA 2GQRA 3K0GA 4A3KG 1BCCH 2RQ6A 2GBOA 2EULA 4B3TB 1HNWO 3CS5A 1JJ2U 1SYXB 4LF8H 4IR9A 2JEXA 4O83A 5J2TA 3KYHC 5KG1A 4O4IB 2FYUH 1FXVA 2QE7G 4OX9O 1DK1A 4LF4O 2YZLA 3K59A 3U9TA 2BTOA 4PJ0Z 1JX4A 4CS3A 1YCIA 4UCRA 4J0MA 1P8LA 3LDEA 3OEHG 2UXXA 2GPSA 1MZEA 1JCHA 1HWYA 1DGSA 2CTQA 3JARB 4MV7A 3ZBHA 1Q6HA 3T4DA 2OWOA 1NU1H 4Q44A 1U96A 4HR7A 1G4YB 3N42B 5C3EG 2W9CA 4DV2H 2YCHA 1ZETA 1K83A 3F5WC 3HOYG 1BHBA 1AI4A 1F7YA 3RB4A 4TQFA 5B1AB 4BBSG 2AZ2A 3G8CA 1N33O 4DV7B 3RYHB 4J11A 3CCUV 2EIKB 5LMNO 3ZS8C 5KFJA 2R70A 4JI5O 3T1YH 1OCOB 2ATKC 4LF9H 5F9LA 1IXMA 3BA8A 1PD3A 3Q4HA 5LXTF 5EBLC 3K0DA 4B3SO 3P32A 2V1DA 1ZUQA 4EQ5A 4DR7O 4EGJA 2YIBD 4DR2B 4A3FG 1I3QA 2E5LO 4UV9A 4TT3G 4LFBB 4LFAO 2R84A 1T5EA 2CH7B 5BWXA 4JASA 1TWHA 3SJCC 2DYSC 4LF6H 4O3QA 1N34O 1A32A 3B8MA 4YR0A 5B3SB 2ZKOA 1P7GA 2P4VA 5TISZ 2COGA 3U55A 1WCMG 4ZOLF 4ZIBA 2V4RA 5KFYA 4DV3O 2F95B 4YJ3A 2P0AA 2UUBO 1PL4A 3RYIA 5JH7F 2EZOA 1M90W 3VQVA 1VQMV 4FE2A 1Y1VG 4JV0A 4DRXB 3WO0A 3L9DA 1OCOC 3T1HO 4DV6H 1J5EH 4TUYF 1AN7A 4RUCA 1D5NA 1GO3F 2QWPB 2QSAA 4LFAB 3X2QB 4LH7A 3G6XA 4EYIB 1V54C 4ED8A 1S72V 1UC8A 4KXRA 1W0JG 4DR5H 2W6NA 4DR4B 5LA6F 5KFCA 1R3LC 4R8CA 2R7ZA 4LF8O 4RB2C 2ALZA 3RGBA 1JVMA 5IYZB 3KREA 1S0OA 2LW1A 1XNQB 3CHXA 1B04A 4X9QA 4YJ2F 3HKZA 2W57A 2IU3A 5H9CA 3KTMA 4ZOLA 3ZN1A 4MTGA 2WDTA 4XDKA 2R8KA 5C8YB 2R9AA 2F23A 3K08A 1K34A 4J7JA 4HN2A 4P30A 1H8EG 1GTOA 3LNMB 2IJKA 1I94H 4LF5H 1VBHA 4I55F 4FS2A 2GTAA 4A3MG 4WF9V 3TINA 2Y0SE 4DV1H 3OTOH 2COJA 3AG4C 4JTCB 2EJ7A 4QE9A 1BQ0A 2AGAA 5KFWA 4YY3B 4WFAV 5LXTA 2R72A 2UUCO 1S5HC 4A3DG 3TEKA 1Y1WG 5JCOC 1E79G 4IWXA 1ET0A 1IOWA 5L3FA 4MVMA 4PZ7A 5DISC 5LMNH 3JZ6A 5E1AC 2XGPA 1ZHQA 2LO1A 1Y67A 2JEFA 3JAWB 4WFFA 3G80A 4ZI7B 3HOVG 3APOA 1XREA 1XNRB 1KC8W 3WWJA 1FXKC 2R8HA 5KFRA 2XD4A 4TWKA 3NR7A 3J81W 1I2LA 2ZNIA 2LFSA 3GTGA 1OCCB 3RR5A 2BR0A 3CSXA 3DC5A 3OSPA 2YC0A 4LF6O 4O4HF 5CB4B 1N36H 4J9LA 2ZDGA 4O4HA 5K3WA 1Z2PX 4X66B 4DUYO 2W8KA 3JRWA 1BXRA 4IRDA 1L1FA 4B3MO 5D1PA 2Q2UA 1XI1A 3CVZA 2QTOA 3VPBA 3H1LH 4Q6GA 2CFMA 1AI5A 2WLNA 5FJ8G 3OTOB 1SQXH 3LSUA 3ABKB 4C5CA 4ED3A 4LF4H 2E3CA 3O9OA 4JI3O 2EJ2A 5J2UF 4FLYA 5IT9N 3MWMA 3AEIA 3T54A 3PO3G 1ENVA 4JV5H 4Q8EA 2ZXWC 1AUVA 2W8LA 2JA6G 4YR2A 2NU7B 3ZRWB 4L8JA 3GTOA 4U3JB 2WLHA 3WWIA 2B1IA 4DUYB 5FLMG 5KFKA 1Q81W 4NTYA 4A5UB 4KHPO 1KKCA 3PW7A 3MR2A 1M93A 4XZ3B 1WA8A 5LL6b 1YZBA 3K06A 3GDEA 2Z3YA 4PI2A 4ZOLB 2EBOA 4ZHQA 1I5XA 5C8YA 3SDLA 1CKNB 1NQTA 4K0KB 3G4SV 1SQPH 4DV1O 4JF3A 4W4LA 3W7XA 3ZHSA 3DF7A 4NR1A 1KT8A 2AQ4A 1Q90D 3RVYA 3A8TA 4W4KA 5EYPB 3VOUA 3ZJZA 1VS0A 4JI4B 2R92G 1GSHA 5C1PA 4G27B 3LP8A 3HT5A 4KHPB 1DF5A 5KMGA 2ZM6H 2EX3A 3TJTA 2P6JA 4I55A 2LJ2A 2ZR2A 5LXTB 4CMDA 3UKMA 4BAYA 3FB5C 4O2AA 2LP7A 2W6IG 3AK3A 3LSSA 3C0FB 4DW1A 3VMMA 2QF7A 2OYQA 2E74B 2VR1A 4YIPA 5EBMC 3MDSA 5EBWC 4XBFA 1MSWD 2J6TA 4J9PA 2ZQMA 3E8BA 4I50B 2F4VH 4O4IF 3F5TA 2UUAO 3ABUA 5KG3A 1WAZA 4XX0B 5L1JA 3CYOA 4RNNA 4AILC 4ECTA 2LQTA 1JDBB 1EN5A 1AR4A 3LDDA 2YS8A 4LC1A 2HKOA 2IJHA 3HKDB 4NKGB 4K8XA 4X64O 3RN4A 1AROP 3E2EA 2QKAA 5B1BC 2UXBO 1NR1A 1QHTA 3W7SA 3MAQA 3OHBA 3SYOA 4QGPA 4X20B 1IZ3A 1AB3A 3GIPA 5C1OA 4JV5B 4MTDA 3CRQA 5KUMA 2VA2A 1VF7A 1WP8A 3O65A 4EEQA 2WPDG 2JA6A 4IYHA 4X89A 4ED1A 1RSOA 1YITV 3M8AA 4N23A 1EFRG 1JKJB 3V6HA 1DTOA 1VQLV 4R7RA 1B6RA 2YEVA 2FK3A 3ZCCA 2Q9LA 4DR1O 3VA7A 4O2AF 1YSCA 3V4SA 2EIMC 3ABLC 1TAEA 3UZOA 4I9WA 1XDCA 2DWDC 1R3KC 4JAAA 4X66H 1Z2OX 4RZQA 1OHHG 3ZRWA 3TW7A 1DV1A 4ECUA 3HKEB 2EINB 2AGPA 2WLIA 1SETA 1K73W 1AJPA 2F93B 5BPFA 1GLVA 1RM1C 4YR3A 2HGWA 5A2QN 3OMIB 2ARHA 1WA8B 4O7TA 4RU9A 4JI2B 2R93G 3J80N 4ZHQB 3HOWG 1ZWIC 2Y4TA 2ADPA 5KFSA 4Q45A 3ETHA 3KHGA 4X1KB 4PZ6A 3H0GA 1AJNA 2Q7EA 5BY1A 5L3BA 2UU9O 4NLGA 3FKSG 4YHHO 4X1IB 3BACA 1EKVA 2XAJA 3I12A 1S0VA 3SPGA 4JUZA 4NTXA 3W7UA 4YY3H 2VQDA 2ILMA 2GSMB 1I08A 1Q86W 4I55B 5C4XG 4EG0A 3E89A 3PN1A 4MV6A 4Z2WA 3PZPA 4JV1A 2EIMB 3ABLB 5KFIA 1CP9A 4N21A 4B3SH 4O3NA 2LFRA 4J9RA 2UU9B 2HGXA 4X1YA 4I50A 3MR3A 3RVZA 1HNWB 1X4TA 5JCOA 5BPHA 4JI3H 4JV2A 4NYKA 3TK1A 2Y69C 1P16A 2YYAA 3IC9A 2RDIA 1BZKA 2DWEC 4MVSA 4UVAA 4DL7A 1MG1A 3EFFK 2YXLA 5LA6A 5B1BB 4JI0H 4DR6O 5KFEA 5KFAA 3L2PA 2IJJA 3EVKA 2GTSA 4JI8O 4DV3B 1DF4A 4F6RB 1EN6A 3H3VH 4E4EA 3H4DA 1JDEA 1GN6A 5JH7B 3E86A 1G1XB 3OUZA 1QCEA 5CA0B 4PDRA 3CPWU 3EHBB 2PMZE 1TGOA 4QE7A 4O7SA 2WB1A 2QM7A 4D7SA 4UVCA 2PBZA 4JGSA 3S24A 4O82A 1OCCC 2ASLA 1W96A 3GTMA 4DV0H 1R73A 5DN6G 3C90A 3CRMA 3NGDA 4NTWA 4DV7O 1NH2B 4DR6B 2P67A 1M5IA 3RF2A 2PYLA 4JI7B 4BY7G 4JI5B 4OXSA 2WTFA 4JI8B 2Y48A 1Q82W 1N48A 4TQSA 1PV0A 5KS8A 4ED6A 2CAZC 5B66Z 1MSDA 4QWAA 2WLJA 4C2MA 2FL4A 5EWGA 4DW0A 2FMAA 5C93A 3GTKA 3ZMTA 1UPGA 3UCSC 2A3QA 3GWOA 2UVWA 1VQNV 4TOIA 4ZI7F 2ZDHA 4XYLB 1I7LA 5L9XA 3TY8A 4X1KA 4H13B 1SERA 4I5SA 4D7TA 1MZBA 1NTMH 5DLFA 4YY3O 1Y76A 4FLUA 2FPIB 4X1IA 3TQ1A 4FZ1A 2QTSA 3K9AA 2Q67A 3B4SA 4RNMA 2C22A 1SZXA 3OHAA 2HVQA 3LMLA 3KHRA 1RP3B 3G8DA 2R7NA 2UXDB 1SA0B 3T1HB 4BWAA 4U6PA 2XAFA 1XNRO 2ETNA 2V59A 5LMUO 4ZHQF 3QG5A 4DV5O 4DXWA 1LNQA 3Q2OA 2R7MA 4IYIA 2YUAA 3JCZA 1GMGA 1IDSA 3MWDA 3W1BA 3JRXA 4ED7A 4LF8B 1TWCA 3OSNA 1Q8IA 1PKXA 3OR7C 1X9NA 4GUNA 5BWUA 5DECA 1GM7A 2RDCA 4RAZA 4PDVA 4X1YB 1XNQO 5KFDA 5IYDG 3BHPA 2W9CB 2XIGA 3U54A 1DIKA 4RUEA 4Q43A 5DGIA 1C3OA 2YS7A 4X66O 2CNQA 1KJ9A 4UB6Z 3F8NA 2WLMA 4DUYH 3N27A 5KHGA 1BT8A 3RYHA 5KHJA 3LULA 2B63G 1XUQA 3RBZA 3JASA 2F43G 1B06A 4F6RA 2DABA 1IYEA 4PHZA 3BQ0A 4GLWA 3QVNA 3SE7A 3GIDA 4EBEA 3T5KA 2CNUA 5CA0A 4MW8A 3NXSA 1GN3A 3BJYA 4IWYA 3CCJV 2C2EA 1KECA 4QNHB 2NU9B 1XQ8A 4AYBA 4DV6B 1J5EB 2KQXA 1I6UA 2BOBC 3K5NA 1EUCB 4LH6A 3W5OA 4MVQA 1VQ4V 1PNKA 3HKCA 1SZTA 4B7EA 1IBKB 3JZIA 4HNVA 5EWFA 4FBUA 2HFEC 2A79B 4PA6A 1MOFA 3H1IH 5EZYF 3TIIA 2G38A 3U0GA 1YVWA 4YQWA 3AK2A 2VRZA 2CUGA 4PDBA 3RYIB 3KHHA 4J42A 4K0KO 4OGQB 4RB0A 1K5QA 4GX0A 2V5AA 3CXHF 2H8PC 4DRXA 5F9NA 4J9QA 1M57B 2Y0IA 3VPCA 2ZM6B 2FP4B 2W6PA 5CA0F 1HR0B 1T94A 4LF6B 2WB1E 4FIPC 3T1YB 1G6UA 1BJTA 1WLEA 2CKZB 4DV6O 1J5EO 3GQCA 4JI1B 3OW2U 3MFHA 3N2GA 1S0MA 4Q4DA 2CNVA 3RB6A 2B1GA 1IBKO 4DR2H 3AG1C 2KSDA 1VARA 1Y76B 3HPLC 2JGUA 2O57A 2CGNA 2Q0AA 4X8AA 4O3PA 3DTUB 2NNUA 1IURA 1JIHA 3ZRVA 5J2UA 5DMXA 4O2BF 3K5HA 2BQUA 1EN4A 2IA6A 3HOZG 4MTEA 1JFFA 2Q4PA 3P30A 1HR0O 1Z5WA 4UCTA 1SQQH 1QQCA 4GCZA 5L3GA 4FM2A 2RCVA 3GV7B 1XNQH 1I94O 4LF7O 1F51A 2PGGA 3B40A 5KG2A 3CSWA 2VUMG 2A9HA 1US6A 2R85A 4K6NA 3DSQA 4M7EA 4FGRA 4PD4F 2Y69B 3CC4V 5KFFA 5EWEA 1PPJH 2UXBB 1NZ6A 4DV0O 2F66C 5DGAA 2NN4A 1WH2A 4M9UA 3UO3A 5JJJB 1XHXA 3CP1A 1M1KW 1OWTA 1SS3A 4IL6Z 3BQ2A 3QO5A 4ASUG 1K1SA 1RFYA 1E1QG 2ZT9B 4DK0A 1OCZB 2Q69A 3JASB 1Z2GA 2WAQE 3H1KH 3RYFA 3RFCA 1YTFD 5DG7A 2XAQA 2KG7B 5KX5F 1KBHA 5K2MA 4HQ6A 4J41A 3CCVV 3ICXA 2DLNA 4CKEA 3PJSK 1GSAA 5KFMA 4IGGA 3TY9A 4JAVA 4DV0B 1VBGA 1P7BA 2VQEB 2KB1A 4O3OA 5CB4A 4DL6A 4O4HB 3G6BA 4BXXG 4PBCA 3ZRXA 1SQVH 4DUZB 3K3PA 1HNZB 4X65B 3E8GA 1D5AA 3N40P 1DLBA 1H38A 1PX2A 5GONA 2ZD9A 2H94A 3RV4A 2JEUA 3CX5F 4PDLA 5KA6A 4RZRA 3Q8RB 3MFIA 4JI2O 2YW2A 2NR5A 3BRCA 3SYPA 5DQIA 3CWBH 1W93A 1QR9A 3K79A 3LSQA 4DO2A 3HR0A 2FK1A 3IC7A 1KEEA 2AHYA 1NTZH 1K3EA 5IY5B 4YHHB 2GQSA 2FK2A 2UU9H 4YJ2A 4FK5C 2F1MA 4WFBV 2GPWA 5H2FZ 3IGAC 3E35A 2XOKG 4U3JA 2VQFB 5CB4F 3BG5A 1IVSA 3BVOA 2NLJC 3K03A 1QU7A 5LL6Y 3K57A 2ZIMA 2HG8A 1IBMH 4JI0B 3U0ZA 4LF4B 4AQYH 2VWKA 4JZ2A 1VF5B 1M7JA 1Y4MA 2CW8A 2Y4UA 3HXLA 3FMAA 2VWJA 5CBHA 4DV3H 2OIGA 3JSLA 2ITCC 2WLLA 1JMKC 5K1PA 1V55C 1JFFB 4X88A 5KT5A 1Q7YW 2YICA 5L3EA 3PVXA 3ZMSA 2VQFO 2X6CA 5GW7A 2IP4A 4DUZH 2C35B 3QFFA 2FE3A 1BNCA 3RGZA 2EIJB 4FU0A 1O9HA 1OBGA 2AZ0A 1PNLA 4IT5A 2HG5C 3IG0A 4J9SA 3J7AU 2RMKB 3KG2A 5CM0A 2OH2A 4JI0O 3HB9A 5BMVF 5LMNB 1U97A 2HJDA 2PUSA 3SYCA 2FB9A 2NUAB 1RYSA 2BQRA 1LR1A 2OCHA 4J10A 4X62B 2N74A 4O2AB 2PYJA 5FL7G 1AUXA 3T9CA 2ADQB 4FM9A 4L1KA 1MMMA 4DR7B 2QDOA 2DW4A 2JS5A 3LDCA 3CCRV 2W6ZA 3NUAA 2CGOA 2E5LB 2CE4A 5HBRB 4D6TH 3R5HA 1K8AW 4JI4H 4LFBO 3AK1A 5FLXW 3FFQA 1KU9A 2P4KA 3TETA 2KKWA 4ZQIA 4YBZB 1QLEC 1HP8A 3MJFA 3HKDA 5KG6A 3DC6A 1RM1B 5JVLA 2K1EA 4YXWG 5IWAO 4O3RA 3E83A 3Q8SB 1CXZB 5FNVF 3N43B 2KSWA 3K5LA 2ZDQA 2W6MA 5H6QA 1AVMA 1R1BA 1XMQO 1E4FT 5KAFZ 3CCEV 4FFOA 5I5UA 2V9WA 1V51A 4PELA 5F2VO 4WD3A 3D8CA 3RGXA 2FLLA 2YEVB 2HHHO 5HNEA 2W9AA 4KL1A 4XYMB 2Y0SA 1B6QA 2YI9A 2Q7DA 2RJZA 1P84F 4JI1H 3ZHUA 3T1HH 3WO1A 4JYAO 3DGEA 3L70H 3WNZA 2W9BB 1QLEB 5BWRA 3GTLA 3HKEA 2WLIB 4DR5O 5KT3A 2BOCC 3N41B 2W0XA 4MSWC 3A0HZ 5KFQA 4I7HA 3IFXA 4J9ZB 3G67A 4AYBE 1XNRH 5EC2C 1TVKB 3N2KA 1KC7A 4EKWA 3GJXB 3SYAA 5HFMA 4CZZA 4KFMA 2DAAA 1S77D 4O4JF 1IOVA 4CS2A 3ETQA 3JALB 5LYJB 2E5LH 2IH3C 1N0JA 3SJBC 1ZLZA 3MHHC 5A2QW 2L6LA 4PI0A 3TW6A 2QWOB 2XNDG 4GZRB 5CBGA 3ETJA 4Q4CA 3J80W 5LP6C 2Z02A 2P90A 2ZJTA 1N34H 4YAKB 1GO3E 4CBCA 2R92A 5FR9A 3RJ0A 5H6RA 4LR3A 1NH2D 1F4MA 4JYYA 4RO2A 1K4DC 5CR5A 3QO8A 5KX5A 1S0NA 5CA3A 3J81N 3T5HA 5IJ9B 4J9MA 3FB8C 2MCTA 1UJWB 3C3SA 4JI6B 5GONF 4H37A 3OR6C 5L3DA 4JYCA 3ORRA 4IZOA 3JAMW 3H40A 4H33A 3AG4B 1H8HG 3R5FA 2VUMA 3JYCA 5BMVB 3V6KA 1FJGB 5LMUB 2ZE8A 4X65H 2FKXA 3K5OA 1LUVA 4QWEA 4O4LB 1IBLH 2QWRB 5D1OB 5FPRA 3B09A 4J9NA 4JI3B 4JYBA 1J95A 1ORQC 2FMLA 3BAAA 4TV8B 5LBQA 2ITDC 3RT3C 2GV9A 4O7WA 3FDSA 4DV4O 4RQFA 3CXCU 1N8RW 2A7WA 1I1MA 3H0GG 4JI1O 2RDJA 1WP7A 5J2TF 1RK6A 2PI4A 1N56A 2R8IA 2Q7GA 3KZIZ 2I87A 3H4BA 5I5XA 2P7TC 2ZCEA 4I0XA 1M56B 4X64H 4QWDA 3X2QC 2DPJA 4YAJB 2XC9A 4JTDB 4BIOA 4MVRA 3GV5B 4WFHA 4PA3A 3T4ZA 2X0SA 2R9IA 1VQ7V 5DG9A 2DJVA 5E79Z 1GN4A 1Y66A 3H1JH 1PP9H 2EIJC 4MVUA 4OX9H 4FJCC 5KFGA 2LGQA 2Y0PA 3L74H 3EPIA 1RYRA 1XL4A 4MA0A 3B77A 3N2KB 1GN2A 4JI4O 3PO2G 1JQ0A 3K04A 1I94B 3H9VA 3S3XA 3N8DA 1A0IA 5I5TA 5KFNA 1VF6C 2ZE5A 4CC5A 1V55B 2N04A 4OPHA 4QJFB 3SNOA 3RB3A 3PFFA 3FB7C 3FX7A 3OM3B 3QTCA 4Q0YA 1GGOA 4MV1A 3JALA 5LYJA 1RK5A 2WYOA 3SJQC 1YJWV 4O7NA 1M0WA 3CRAA 5IYBG 4J80A 4A3BG 1XMOO 1I7FA 1OCRC 1QBZA 4F6EA 1SA0A 3R9RA 3CEBA 1F4NA 3DXRA 4GYCB 3M4IA 5EC1C 1FKAH 1NTKH 2HDKA 4TM5A 2XAHA 3E8HA 3T1YO 2M05A 2EIKC 1YJNV 3ZHTA 3RW0A 3JATA 4CC6A 2X6AA 1YI2V 5B1AC 4UXNA 5IY5C 5LOVB 3CRCA 3KCYA 3CC7V 1W59A 3WG7B 3HO8A 3ZN0A 5LMUH 4J9OA 3MWEA 2HHHH 5LOVF 4UV8A 3FYEB 5H80A 2R8GA 1N0NA 2VQEO 2ZDIC 3S3WA 2GLTA 1AP6A 2NVYA 2P5OA 1MZFA 2IM9A 4JV5O
chains in the Genus database with same CATH topology
2XIGA 1WNSA 2OWOA 2HIVA 3U10A 4DV1B 3N42B 4DV2H 1HNZH 2YCHA 2VQEH 3F8NA 2HHHB 4DUYH 5KHGA 3RYHA 5KHJA 5EIBD 1Q43A 4TQFA 4CH6A 5D1OA 4DV7B 3JASA 3RYHB 4B3MH 4F6RA 4ETSA 3ZS8C 4DV4H 2R70A 3SJAC 3T1YH 4PHZA 4LF9H 3BA8A 4DR7H 1P49A 4NXMB 4WBNA 4EQ5A 5CA0A 2YIBD 4DR2B 4DR5B 4O2BB 1XHZA 5JJNB 5FD6A 4JI7H 4LFBB 3HKCB 4PZ8A 1XQ8A 4DV6B 1J5EB 1I6UA 3K5NA 4LH6A 4CH3A 1T5EA 3W5OA 3J7AK 3HKCA 1IBKB 4UFZA 3SJCC 4LF5B 1WPBA 4TV9A 3K3VA 4LF6H 4TUYA 5KHIA 2VOBA 4TV9B 4PDBA 3RYIB 4EFEA 4ZIBA 1E4GT 4RB0A 2F95B 4YJ3A 4LMYA 4APMA 4DRXA 3RYIA 1WN7A 3VQVA 2ZM6B 4YJ3B 1HR0B 1L8DA 4DRXB 4LF6B 1SEIA 3N2GB 3T1YB 4DV6H 1J5EH 1AN7A 1G6UA 1BJTA 1S5JA 4LFAB 4LH7A 4JI1B 3N2GA 4DV7H 4DR2H 4DR5H 1S68A 4DR4B 1IBLB 2JGUA 2UXDH 4CH4A 4RB2C 3VQYA 2Q0AA 2V4DA 5J2UB 3RGBA 5IYZB 4O4JA 1XNQB 3CHXA 1B04A 3BPZA 2PZSA 5J2UA 2W57A 3EYYA 3RWRD 4ZOLA 2WDTA 4FVMA 4EB6A 5C8YB 2R9AA 2YIBA 4MTEA 1JFFA 2QM4A 4DRFA 3JATB 1Z5WA 4EB6B 4UCTA 2HGSA 1QQCA 4LFCB 5KHKA 1I94H 5LOVA 4FM2A 4YHHH 4LF5H 1N33B 1XNQH 3QWUA 2PGGA 4DV1H 3OTOH 3DSQA 4M7EA 2UXBB 2F66C 1WH2A 4YY3B 5LXTA 3WB0A 2R72A 5JJJB 5JCOC 1XHXA 4PZ7A 5DISC 5LMNH 1ZHQA 4DK0A 3RYFB 3B2EE 3JAWB 3JASB 4FFBA 3KAKA 3A2FA 4ZI7B 3RYFA 1N34B 2YI8A 1XNRB 3JAWA 2VPSA 4ZI7A 5JQGA 5EZYA 4WBNB 4JYAB 3ICXA 2Q2TA 4GLXA 3J81W 2ZNJA 5KHHA 4O2BA 2ZNIA 3TY9A 1BGWA 4DV0B 2VQEB 1YEWA 3RR5A 5CB4A 3CSXA 5IJ0B 4O4HB 3L4KA 4FLVA 3BABA 3N44B 4KHPH 5CB4B 4DUZB 1NT2B 1N36H 5GONB 4DV2B 4O4HA 3WB2A 1HNZB 1Z2PX 4X65B 4X66B 1D5AA 4FLZA 3N40P 3JAKA 2RGRA 5GONA 4TUYB 4LFCH 2UXCB 5D1PA 2Q2UA 1XI1A 3CVZA 4FM0A 1N33H 3BRCA 4Q6GA 2CFMA 3OTOB 1L2ZA 4YJ2B 4LF9B 5BR8B 2ZINA 2XHBA 4LF4H 2E3CA 4YHHB 2UU9H 3K58A 4YJ2A 1ZHSA 4FLYA 5IWAB 3MWMA 2F1MA 3UT5A 4B3SB 4CS4A 4JV5H 3K5MA 4U3JA 2VQFB 3H20A 3UT5B 1XMQB 4L8JA 3K57A 5LP6A 3RFRA 4U3JB 4DK1A 2ZIMA 1IBMH 4DUYB 4JI0B 3U0ZA 1TUBB 4LF4B 4AQYH 2VWKA 5CA1B 2CW8A 4O4JB 3HXLA 4LSXA 3FMAA 1M93A 2PTMA 2VWJA 4DV3H 5LL6b 4LFBH 3GDEA 5CA1A 3JSLA 4PI2A 4ZOLB 4ZHQA 1JMKC 4RB3C 5K1PA 5C8YA 1CKNB 4IHJB 1JFFB 4K0KB 1XDNA 2UUBB 4GKKB 1CKNA 3DF7A 4DUZH 1IBKH 2FE3A 3RGZA 4LFAH 1O9HA 3IG0A 5EYPB 1VS0A 4JI4B 2P22C 4TQDA 4UCSA 5LMNB 1N32H 5EYPA 4KHPB 2PUSA 2ZM6H 5KMGA 2EX3A 1JJOA 4B3TH 4I55A 4X62B 1HNXB 3NBZB 2PYJA 1Q5OA 4O2AB 4GKKH 5LXTB 4FM9A 4DR6H 4B3RB 5KMGB 4HBNA 4DR7B 2CW7A 4O2AA 2JS5A 3RTXA 4K0KH 2BTQB 2E5LB 3C0FB 4JI4H 4DV4B 2OYQA 5FLXW 3FFQA 4FFBB 1KU9A 1SQFA 3KAJA 4NXMH 4X62H 4I50B 1HNXH 2F4VH 2KKWA 5JQGB 5EZYB 3HKDA 5JVDA 4AILC 4RAYA 4DV5B 4OX9B 2VQFH 5FPOA 3HKDB 4UCOA 4K8XA 1HNWH 5K1XA 4LNUB 5IJ0A 4DR3B 2YIAA 2HEPA 3HKBB 1QHTA 1FFXA 4LNUA 3MAQA 4AQYB 3N43B 4X20B 2KSWA 4IIJA 3K5LA 4MTDA 3HKBA 4JV5B 3KALA 3JAKB 1E4FT 5BR8H 1VF7A 4EEQA 4X20A 3LNNA 1XMQH 1TA8A 1H2SB 1RSOA 5D5PA 3RGXA 1M0TA 1ZAUA 4R7RA 4DR1H 4KL1A 4UCUA 4IAJA 4FLXA 4UCVA 2YI9A 1TAEA 2RJZA 4JI1H 5IT9W 3T1HH 3NC0B 4X66H 5FNVB 1Z2OX 4RZQA 3HKEA 2UXCH 3RYCB 5LP6B 5FNVA 4CH5A 3N41B 2HVSA 3HKEB 4FM1A 5EOYA 4I7HA 1TUBA 1TVKA 2O03A 2F93B 4BW9A 4LF7B 3E22B 1XNRH 1TVKB 3N2KA 4NXNB 3GJXB 3E22A 4JI2B 1FVIA 4ZHQB 4BWSC 3SGIA 3WB1A 4IHJA 5ITZB 4X1KB 4PZ6A 4CS2A 3ETQA 2Q7EA 3NBYB 5ITZA 3JALB 5LYJB 2E5LH 4X1IB 3N6XA 1Z5VA 4HNAA 4A2AA 3SJBC 4I9QA 5A2QW 4B3RH 1O75A 4PI0A 4JYAH 4B08A 4YY3H 4EFBA 2UUAB 2Q7HA 3J80W 4JI8H 5LP6C 1IBMB 4I4TA 4NXNH 4I55B 2ZJTA 1N34H 4O4IA 4JI2H 3PN1A 2HVRA 5JJEB 3RJ0A 1V9PA 4X64B 3M7MX 3THOA 4LR3A 5KX5B 2BTQA 3KXYT 5IJ9A 1SKVA 4LF7H 4B3SH 4JI5H 1XK5A 5KX5A 1O9GA 2UU9B 2ZIOA 5IJ9B 1GYFA 3VQWA 1XMOB 3JARA 4I50A 4X1YA 2MCTA 1HNWB 1X4TA 5JCOA 4JI6B 4JI3H 1P16A 3JAMW 4A2BA 3QF7A 5BMVA 2WE6A 5JVDB 4LSAA 4GKJH 2YXLA 4AHCA 5BMVB 4O4LA 5LA6A 4DR1B 1FJGB 4JI0H 3U11A 5LMUB 4FLTA 1Z2NX 2VUGA 3RIZA 1S03G 3L2PA 4X65H 3K5OA 1IBLH 4O4LB 1Q3EA 5LA6B 5D1OB 5FPRA 1FFXB 4JI3B 4JI6H 4DV3B 4NVPA 4TV8A 4F6RB 2QJ1A 4IIJB 3W1GA 5JH7B 4E6NA 3BAAA 4TV8B 3SR2C 2UUCB 1CKMA 3L4JA 1CKOA 2GV9A 5EIBC 5JH7A 1HR0H 5CA0B 4RB1A 1TGOA 3OTFA 3GB8B 2Q7GA 4D7SA 2UUAH 4DR3H 3S24A 3VNNA 4DV0H 2ZCEA 1SQGA 4X64H 1XMOH 5D5QA 1M4UA 4DR6B 1M5IA 3RF2A 2PYLA 4JI7B 1N36B 4JI5B 4JI8B 2PY5A 3RYCA 2UXBH 2RGVA 2CAZC 4DR4H 3ZEDA 3CB2A 4DV5H 4OX9H 3TY5A 2HIXA 3N2KB 3BA9A 1I94B 4TOIA 2F4VB 2UUBH 1A0IA 1KMIZ 4CC5A 4B3MB 4MV9A 1HW7A 3TY8A 4X1KA 3QTCA 4D7TA 1MZBA 4Q0YA 3VQXA 3IAYA 3JALA 5LYJA 4FLUA 2WYOA 4X1IA 4K8ZA 4HNAB 2JVDA 1M0WA 1N32B 5IWAH 5IYZA 1I7FA 2RQ6A 3JSNA 4B3TB 1SA0A 2UUCH 2HVQA 1SYXB 3LMLA 4LF8H 4GYCB 4I4TB 3M4IA 2UXDB 1SA0B 5J2TA 1FKAH 3KYHC 3T1HB 4BWAA 4O4IB 4GKJB 4CC6A 3JATA 3UQ8A 5J2TB 3QG5A 5FD5A 5LOVB 3K59A 5LMUH 3W1BA 2HHHH 2BTOA 4CS3A 4LF8B 4UCRA 4J0MA 1Q8IA 1P8LA 1X9NA 4RAZA 1DGSA 3JARB 4X1YB 2P5OA 1FJGH 4FLWA 4MV7A 2IM9A 3BHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 B;  4DV4 B;  2OWO A;  1XMO B;  2HIV A;  1HNW B;  4DV1 B;  4PZ7 A;  5DIS C;  4JI6 B;  1P16 A;  2HHH B;  1N34 B;  4DR1 B;  1XNR B;  1FJG B;  4DV7 B;  5D1O A;  5LMU B;  4DV5 B;  4OX9 B;  2VUG A;  3L2P A;  5FPO A;  4UCO A;  5D1O B;  5FPR A;  4JYA B;  4JI3 B;  2Q2T A;  4DV3 B;  4GLX A;  3BA8 A;  4DR3 B;  4NXM B;  3TY9 A;  3W1G A;  4DV0 B;  4EQ5 A;  2VQE B;  4AQY B;  3RR5 A;  4E6N A;  4DR5 B;  4DR2 B;  3BAA A;  2UUC B;  1CKM A;  1CKO A;  3BAB A;  4JV5 B;  4EEQ A;  4DUZ B;  4LFB B;  4DV2 B;  1HNZ B;  4PZ8 A;  4X65 B;  4DV6 B;  4X66 B;  1J5E B;  1TA8 A;  3GB8 B;  4LH6 A;  3W5O A;  1ZAU A;  1IBK B;  2UXC B;  5D1P A;  2Q2U A;  3S24 A;  3VNN A;  4UFZ A;  4LF5 B;  4UCU A;  2CFM A;  4UCV A;  4DR6 B;  3OTO B;  1TAE A;  4LF9 B;  5BR8 B;  4JI7 B;  1N36 B;  4JI5 B;  4JI8 B;  4EFE A;  4YHH B;  3NC0 B;  5IWA B;  4B3S B;  2ZM6 B;  2VQF B;  1HR0 B;  4LF6 B;  2HVS A;  3TY5 A;  1XMQ B;  3T1Y B;  2HIX A;  3BA9 A;  4LFA B;  1I94 B;  4LF7 B;  4LH7 A;  4TOI A;  4JI1 B;  4DUY B;  2F4V B;  4JI0 B;  4LF4 B;  1A0I A;  4NXN B;  4CC5 A;  4B3M B;  1S68 A;  4DR4 B;  3GJX B;  1IBL B;  4JI2 B;  3TY8 A;  1FVI A;  3SGI A;  3GDE A;  3JSL A;  1XNQ B;  4PZ6 A;  1B04 A;  3NBY B;  1CKN B;  1N32 B;  4K0K B;  1XDN A;  3JSN A;  2UUB B;  4B3T B;  4GKK B;  1CKN A;  2HVQ A;  4DRF A;  4UCT A;  2UXD B;  4EFB A;  4LFC B;  2UUA B;  3KYH C;  3T1H B;  1IBM B;  4GKJ B;  4CC6 A;  1VS0 A;  4JI4 B;  1N33 B;  3UQ8 A;  3QWU A;  4UCS A;  5LMN B;  3PN1 A;  4KHP B;  2HVR A;  3W1B A;  4X62 B;  1V9P A;  4X64 B;  1HNX B;  3NBZ B;  4LF8 B;  4UCR A;  4B3R B;  1P8L A;  2UXB B;  1X9N A;  4DR7 B;  4YY3 B;  1DGS A;  3RTX A;  1XK5 A;  2E5L B; 
#chains in the Genus database with same CATH topology
 5LP6 F;  3OD4 A;  1WNS A;  3U10 A;  1HNZ O;  5E25 A;  4X65 O;  2H3O A;  3L75 H;  5EIB D;  5KAI Z;  1FS0 G;  2JGD A;  3CEI A;  5D1O A;  3LWB A;  1V54 B;  1CPY A;  1R6T A;  4ETS A;  4DV4 H;  2IBK A;  2YRX A;  2FB5 A;  3SJA C;  3Q8P B;  3G6E V;  1MA1 A;  4LP8 A;  3I5D A;  4NXM B;  3MR5 A;  2GUZ B;  3ZRS A;  5DG8 A;  4O2B B;  4O7R A;  2UVV A;  3M99 B;  4JI7 H;  1X59 A;  3HKC B;  4PZ8 A;  2C2A A;  3HOX G;  4PDM A;  3J7A K;  4I0X B;  1JR9 A;  4A93 G;  4U7C A;  5LHH A;  4UFZ A;  4ECW A;  4LF5 B;  4EBD A;  3C3T A;  3MR6 A;  5IDJ A;  4TUY A;  3VOT A;  5KHI A;  4DL3 A;  4P9O A;  1THZ A;  2VOB A;  2YWV A;  1GH6 A;  4TV9 B;  4NZN A;  1DAA A;  3DTF A;  2YRW A;  2JEJ A;  3OUU A;  4LMY A;  3TGU H;  2X0L A;  3JD0 A;  1KJQ A;  1VQ9 V;  1Q6U A;  1L8D A;  1SEI A;  3G6Y A;  3N2G B;  2R9R B;  1S5J A;  5KG0 A;  3L71 H;  1VQP V;  2ZDI A;  5KG5 A;  4DV7 H;  3GTJ A;  3JD1 A;  3I4N G;  4YIO A;  1SQB H;  4O4L F;  4IRK A;  1YTF B;  4ECY A;  2UXD H;  4CH4 A;  3UO2 A;  4U7N A;  3ASN C;  5J2U B;  4O4J A;  2PZS A;  2JA7 G;  3AG1 B;  3EYY A;  3UYY A;  1JX9 A;  4MTX A;  3RWR D;  2W6Q A;  3DXR B;  2DOS A;  2IU0 A;  3AYH B;  1L0L H;  3H01 A;  5I5W A;  2YIB A;  4J7K A;  2JRI A;  1E1R G;  2QM4 A;  3JAT B;  4EB6 B;  4MW3 A;  3T1C A;  3T9D A;  1QVG U;  1Y1V A;  3K5I A;  4LFC B;  2Y4R A;  5BZB A;  5LOV A;  2WSS G;  3WG7 C;  4GX1 A;  5DAA A;  5CA1 F;  5L1K A;  3ZX6 A;  3FKI G;  4DIM A;  1VIB A;  3E5N A;  1VF6 A;  1S5L Z;  2HLD G;  4O3S A;  1OBD A;  2WAQ A;  3PW4 A;  3WB0 A;  5CN0 A;  1N32 O;  5I5Y A;  5BWV A;  4ECV A;  4KUM A;  3R23 A;  2BE3 A;  3RYF B;  5AG2 A;  2FJZ A;  3B2E E;  4Z1M G;  2KG7 A;  3A2F A;  2WAM A;  4YB8 B;  5KFL A;  3F7V C;  2VPS A;  1PL0 A;  4PWQ A;  2CZG A;  4JI7 O;  5EZY A;  2YZN A;  3V4Z A;  2JJ1 G;  4A3E G;  1EZJ A;  4JPR A;  4JYA B;  4MAM A;  4X62 O;  1RJR A;  3HOU G;  4GLX A;  2ZNJ A;  5KHH A;  4O2B A;  2L35 A;  2DQ0 A;  2OCC B;  1EBO A;  4QIW E;  4ABM A;  3GV8 B;  5IYC G;  4FLV A;  3GWK C;  3D3Q A;  4FFR A;  3N44 B;  4KHP H;  1NKD A;  1Q6I A;  3A0R A;  1NT2 B;  5HFL A;  3STZ C;  5GON B;  4DV2 B;  2YXH A;  3WB2 A;  5LHG A;  2J6U A;  4MVZ A;  4FLZ A;  3JAK A;  1XIL A;  4TUY B;  4LFC H;  2UXC B;  2LGW A;  4FM0 A;  3FAV A;  1BL8 A;  1S97 A;  3T7A A;  2JS3 A;  4MT8 A;  1L2Z A;  2DE0 X;  4YJ2 B;  4LF9 B;  5BR8 B;  2XHB A;  4J7Z A;  1IXB A;  1ZHS A;  5IWA B;  2XCA A;  2RNB A;  2UXD O;  3UT5 B;  1XMQ B;  3TCU A;  1ROP A;  2K9P A;  5C5J A;  3OUF A;  3ETG A;  2WLK A;  4QPK A;  3OFN G;  1B6S A;  3W7T A;  2EJ3 A;  2E2H A;  2CK3 G;  3AX6 A;  2IW5 A;  1AIL A;  1AI6 A;  5DLG A;  4O4J B;  4LSX A;  2WLL B;  2PTM A;  5KFP A;  4MV3 A;  5CAE B;  5CA1 A;  2QWN B;  4LF9 O;  1OV9 A;  2OTJ V;  1VQ6 V;  2NVX A;  3CJH A;  3QQM A;  3ABM B;  5IYB O;  5GTI Z;  4GKK B;  1FYJ A;  5CE8 A;  4G3I A;  2Q6A A;  2JA5 A;  1BHA A;  1AJQ A;  3CCS V;  3CCM V;  3AG3 B;  4R50 A;  1YJ9 V;  2HHF A;  1IBK H;  2N05 A;  4LFA H;  4PV1 B;  5FLX N;  3L72 H;  2P22 C;  2R7K A;  4Y8V B;  1N32 H;  3UM7 A;  5KA5 A;  1HNX B;  4I7Z B;  1K7D A;  4K3A A;  1Q5O A;  1IBL O;  3NBZ B;  4B3R B;  4HBN A;  5D8D A;  1I2K A;  2JEG A;  4A3J G;  3RTX A;  3T5J A;  4MTF A;  1ZL8 A;  2UVU A;  5C44 G;  3A0B Z;  1BE3 H;  4DV4 B;  4HYK A;  2ODT X;  3UZB A;  2EIN C;  4NXM H;  3OAA G;  2QKC A;  4X62 H;  5LGT A;  4B7K A;  1FD9 A;  2WWW A;  3JD4 A;  1EYZ A;  4FPP A;  3P3P A;  5EZY B;  5JVD A;  1G2W A;  1KB9 F;  4OX9 B;  3UFX B;  2D3O W;  4RAY A;  4EEY A;  1K9M W;  4WFE A;  5FPO A;  4UCO A;  4Q8F A;  1EZV H;  5K1X A;  2Z04 A;  2AW9 A;  1K1Q A;  3ASO B;  3BCC H;  4DAA A;  1JPX A;  1FFX A;  1YDX A;  4LNU A;  3WWH A;  4ZBM A;  3JD2 A;  2ZM6 O;  3CRR A;  1I1K A;  3QZ8 A;  4ECQ A;  1R3I C;  1KP3 A;  3HKB A;  2Q0O C;  3KAL A;  5BYA A;  3M9M B;  3JAK B;  2DN9 A;  4EGQ A;  1XMQ H;  1YF2 A;  5B1O A;  4JI6 O;  1NI8 A;  1TA8 A;  2QYZ A;  3LUT B;  1Y1W A;  3FAV B;  1M0T A;  2XT9 A;  1K5S A;  4HZ3 A;  5KLV H;  4UCU A;  5CBF A;  4IAJ A;  3OMN B;  4EYH B;  2XAG A;  4DL4 A;  5L1I A;  4EBC A;  2W9B A;  5L1L A;  5IT9 W;  2B63 A;  1VQ5 V;  2HVJ C;  3ZIA G;  1VQK V;  3T5L A;  2YSU B;  3B8N A;  1QR8 A;  3CQZ A;  1D2D A;  2WA4 A;  1K4C C;  2UXC H;  1FXK A;  4DR2 O;  5FNV A;  2XAS A;  2AU0 A;  2JIZ G;  3OMA B;  1H2N A;  2HVS A;  1GSO A;  1TVK A;  4BW9 A;  4LF7 B;  1ZX3 A;  4M0J A;  4BIZ A;  3CD6 V;  3R65 A;  3RBD A;  2C28 A;  4O7Z A;  4RUA A;  3E22 A;  2R87 A;  1EUD B;  4F4Z A;  1YIJ V;  2JJ2 G;  3SGI A;  3WB1 A;  3TXS A;  3CJH B;  5T14 A;  4IIJ F;  4ED2 A;  3NBY B;  3G6V A;  1W0K G;  5ITZ A;  2YID A;  1AP5 A;  3E8F A;  1P4R A;  5KFU A;  2BSK A;  3N6X A;  4HNA A;  2HHF B;  2DZD A;  3AG7 A;  4EFB A;  2M7W A;  2Q7H A;  5DQH A;  4JI8 H;  4I4T A;  3M9N B;  3PW2 A;  2E76 B;  4G28 B;  4NXN H;  4TSF G;  2R7Z G;  1SFO A;  3RAX A;  2Z5U A;  5KFH A;  3GVM A;  2DWC A;  2V4Q A;  1OCZ C;  5JJE B;  3QNE A;  2I80 A;  1V9P A;  2J9G A;  5DGH A;  1M9N A;  1OJH A;  3CCQ V;  4QIW F;  5DED A;  5KX5 B;  4NXM O;  2NU6 B;  1R6K A;  5IJ9 A;  1BQZ A;  1SKV A;  1NVP B;  4JI5 H;  1MAB G;  1XK5 A;  1QLN A;  1O9G A;  2PVP A;  4QWC A;  2ZIO A;  4RWU A;  5J9P C;  4RQE A;  1XEQ A;  4PA9 A;  4DUZ O;  1XMO B;  5HV6 A;  4ECR A;  4RNO A;  1I7N A;  1L0N H;  4TQR A;  4A2B A;  2YZG A;  3QF7 A;  5BMV A;  5JVD B;  4GKJ H;  2AHZ A;  2YXY A;  3VBB A;  4HNU A;  4ECZ A;  2VA3 A;  1BGY H;  5BWW A;  1LUW A;  2JA7 A;  2X6B A;  1K97 A;  4O4L A;  3GIJ A;  4CHI A;  2VUG A;  3RIZ A;  4DLK A;  4WBN F;  3P3N A;  1Q3E A;  4R8U A;  2B9Z A;  1FFX B;  4JI6 H;  4NVP A;  4TV8 A;  2XTA A;  3PR5 B;  2JDI G;  3JD3 A;  1WB8 A;  2EIL B;  1EZ1 A;  1QNM A;  4E6N A;  2UUC B;  2J6S A;  1CQJ B;  5IYC O;  1YHQ V;  1CKO A;  1K92 A;  1T36 A;  4CKB A;  4HAM A;  3L4J A;  1HR0 H;  4YJ3 F;  3MHS C;  1BS3 A;  5KT2 A;  3R5X A;  1S3J A;  3RBE A;  1H2G A;  4FFK A;  3GB8 B;  4F4Y A;  3AW8 A;  1I0H A;  2DMX A;  4QWB A;  2W6J G;  4JAU A;  4F4W A;  4C5A A;  2UVR A;  2QB5 A;  2X5R A;  3SPJ A;  5DQG A;  4IR1 A;  3CC2 V;  1GK9 A;  1VP7 A;  2JK5 C;  1FXK B;  3ZHR A;  2PY5 A;  1IYD A;  3GTQ A;  1WJZ A;  1GM9 A;  1GM8 A;  1ZQ7 A;  1KJJ A;  4DV5 H;  3TY5 A;  3GIM A;  1Y6X A;  2OT5 A;  2HIX A;  4QJF A;  3OGC C;  4QW8 A;  1KMI Z;  1ZSP A;  4B3M B;  3LQS A;  4MV9 A;  5BXZ A;  1HW7 A;  2ASJ A;  3OE7 G;  5KFV A;  3F7Y C;  1FPO A;  5KUK A;  1H2M A;  3VQX A;  3OTO O;  2NU8 B;  1Y14 B;  3ML0 A;  4K8Z A;  4HNA B;  2JVD A;  1N32 B;  5H5N A;  3K9S A;  3JSN A;  2HR3 A;  2UUC H;  1PM9 A;  2B5U A;  4XDL A;  2VS0 A;  4I4T B;  1RPR A;  2E2I A;  1OZ0 A;  2GHY A;  4U3F H;  1ULZ A;  3VPD A;  2ZXW B;  3CCL V;  1FXH A;  4GKJ B;  1A0G A;  5I60 A;  3FKI A;  2W0F C;  3UQ8 A;  5J2T B;  1NS1 A;  5FD5 A;  4DQN A;  1W2B U;  1NJI W;  2JA8 G;  2PF4 E;  3KCX A;  2QA4 V;  4MA5 A;  3KKY A;  4ZKI A;  3SPH A;  3ZHV A;  2OTL V;  5I5V A;  1ZTE A;  5KT7 A;  4GC6 A;  4O84 A;  5IP7 G;  2IMW P;  1FJG H;  4UB8 Z;  4E2L A;  1PNM A;  4FLW A;  3N6R A;  2VQE H;  1EKF A;  4J9Y B;  5DM6 V;  2HIV A;  4DV2 O;  2CTR A;  4DV1 B;  4ICG A;  1HNZ H;  2XUM A;  2HHH B;  2JGD B;  4P9P A;  4F4L A;  2UXC O;  3W7W A;  4LFC O;  3SI8 A;  1Q43 A;  2OCC C;  4CH6 A;  4DL5 A;  1WCM A;  5KFO A;  3WFV A;  5KT4 A;  2I8C A;  4FFM A;  4B3M H;  5KFB A;  3JZF A;  3FB6 C;  2GUZ A;  3I56 V;  1I5Y A;  3STL C;  4DR7 H;  1P49 A;  1MNG A;  4WBN A;  1BSM A;  1TUE B;  1M57 C;  4DR5 B;  1XHZ A;  5JJN B;  5FD6 A;  2ZGI A;  2YL2 A;  4RAI A;  2AXT Z;  3PR4 A;  2Q68 A;  4TVI A;  4CH3 A;  1N4C A;  1VMG A;  4O86 A;  1XOU A;  1WPB A;  4TV9 A;  3WU2 Z;  3K3V A;  4E4T A;  1KBL A;  2CH7 A;  4NZM A;  3GIK A;  4BIU A;  3EPG A;  4UUG A;  2LW7 A;  4A3I G;  3T2M A;  2ZE6 A;  4G2K A;  2SCU B;  3ZHQ A;  4EFE A;  3R66 A;  1E4G T;  4APM A;  5C8Y F;  3JAM N;  4GX5 A;  2WA3 A;  2VPQ A;  1WN7 A;  4YJ3 B;  4LCU C;  3GIQ A;  4I4T F;  2CTP A;  5LGN A;  2Q73 A;  4DL2 A;  5I5S A;  4ME6 A;  5IE9 A;  2W71 A;  4A3L G;  4DYL A;  1HDJ A;  2R82 A;  4R6Z A;  1S68 A;  2A0L A;  3BY6 A;  1IBL B;  3FYI B;  2YZM A;  3VQY A;  2XCP A;  2V4D A;  1AI7 A;  4XDJ A;  1WRV A;  2ZE7 A;  4OPA A;  3BPZ A;  2PN1 A;  2FPP B;  4MV4 A;  5A9G A;  4FVM A;  3SYQ A;  1JLL B;  3I4M G;  4EB6 A;  2EIL C;  4DRF A;  1B33 N;  2HGS A;  5KHK A;  3DTG A;  1M6V A;  4YHH H;  1N33 B;  1FJG O;  3QWU A;  5BYB A;  5EK0 A;  2FLN A;  4NB5 A;  1E4E B;  3AG2 B;  1UFI A;  1COW G;  1K33 A;  2QK4 A;  5B3S C;  2DYS B;  2FKL A;  1VAJ A;  1QVF U;  2DQ3 A;  2Q5Z A;  4P2Z A;  1NVP D;  1I50 A;  4K35 A;  1FKA O;  1EM1 A;  2CTW A;  4ECX A;  4GKK O;  5KT6 A;  4L87 A;  2DYR B;  4ED0 A;  1S10 A;  2JEI A;  4FFB A;  3KAK A;  1N34 B;  2YI8 A;  2EZP A;  4FMT A;  3JAW A;  4NZO A;  5B5E Z;  4O81 A;  4ZI7 A;  5JQG A;  4WBN B;  1I1L A;  1HNX O;  2Q2T A;  1TWF A;  2FLP A;  1M56 C;  4B3R O;  2R8J A;  4HNT A;  1BGW A;  2ABJ A;  1YEW A;  2W6O A;  5IJ0 B;  4O7Y A;  3U9S A;  2R86 A;  2ASD A;  3L4K A;  1B3Q A;  4WFG A;  3BAB A;  2PI5 A;  2FPG B;  1NBM G;  1RJP A;  3RAQ A;  2BQ3 A;  2HP8 A;  2RGR A;  4MS2 A;  2AGO A;  2R93 A;  3HKZ E;  3ETE A;  4GT1 A;  4C5B A;  1N33 H;  2EIY A;  4QPJ A;  1VQ8 V;  4CMF A;  5GTH Z;  4GC7 A;  4H0L B;  2ZIN A;  4A3C G;  4IHJ F;  3K58 A;  3QZ7 A;  1NR7 A;  1Y74 B;  1VKZ A;  4PA7 A;  3KHL A;  3UT5 A;  4B3S B;  1KTA A;  2R7L A;  3TXQ A;  4CS4 A;  1WSC A;  3K5M A;  3H20 A;  4O7V A;  4ECS A;  5LP6 A;  3RFR A;  3D3I A;  3H1H H;  3OGI B;  4GX2 A;  4HYO A;  4DK1 A;  1EKP A;  2A1H A;  4QW9 A;  2W70 A;  1R6N A;  4NYE A;  4U7O A;  1OCR B;  5JQG F;  1IX9 A;  1TUB B;  5KFT A;  5EDW A;  4CE5 A;  2D2C B;  2HVK C;  5CA1 B;  4F4X A;  2IJI A;  1CQI B;  3ZMU A;  4LFB H;  2C2R A;  2OIE A;  3GB7 C;  1A3G A;  4RCN A;  4RB3 C;  4MTO A;  4IHJ B;  3G71 V;  2YS6 A;  1XDN A;  1DV2 A;  2UUB B;  4FFP A;  2DPI A;  5LGU A;  3CMA V;  5DGB A;  1CKN A;  2PMZ A;  4LWS B;  4FFN A;  2M6Y A;  1KUQ A;  1S76 D;  2BCC H;  3ORQ A;  1E4E A;  3RB0 A;  2AGQ A;  4TQD A;  4UCS A;  1FFT B;  5EYP A;  4Z1V A;  1CEZ A;  4FBT A;  1JJO A;  4DR4 O;  4B3T H;  4GKK H;  1ZL8 B;  4DR6 H;  1CS0 A;  5KMG B;  1A48 A;  2QKS A;  4AQY O;  4FFL A;  2CW7 A;  1R3J C;  3QO7 A;  4K0K H;  2BTQ B;  4LBE C;  4TV8 F;  1JA8 A;  4J9K A;  3OEE G;  4QIW A;  3L73 H;  4WCE V;  4FFB B;  3KAJ A;  1SQF A;  1HNX H;  3APQ A;  1WB7 A;  1F23 A;  5IP9 G;  4LF5 O;  4A3G G;  5KKN B;  5JQG B;  3D36 A;  4WHX A;  2YDE A;  4YP3 A;  1SF9 A;  2E75 B;  1UNN C;  4DV5 B;  2VQF H;  4KP4 A;  3T9A A;  3AG3 C;  1T3N A;  4BBR G;  1HNW H;  4LNU B;  5IJ0 A;  4DR3 B;  2YIA A;  2HEP A;  3HKB B;  4JXU A;  1C30 A;  4AQY B;  2RF4 A;  3ABM C;  2EJR A;  2CQY A;  4FZ0 A;  4IIJ A;  3BFR A;  3I55 V;  5BR8 H;  3T9B A;  3BQ1 A;  4X20 A;  3LNN A;  3HBL A;  3PW5 A;  1H2S B;  1KJ8 A;  1G8M A;  5D5P A;  5KFX A;  1ZAU A;  4O7L A;  1VQO V;  4DR1 H;  1RSO B;  5JUM A;  2QWQ B;  1H2K A;  3GII A;  4JTA B;  4TV9 F;  4FLX A;  3GLK A;  4BW5 A;  4UCV A;  1SC5 B;  3FD9 A;  1XL6 A;  1Y74 A;  1SCU B;  3NC0 B;  2QGN A;  3GTP A;  1GKF A;  5FNV B;  4DR3 O;  1TWG A;  1JOY A;  2P06 A;  1URF A;  4MV8 A;  5LYJ F;  3M9O B;  3RYC B;  5LP6 B;  3ASO C;  4CH5 A;  2QEX V;  2X7R B;  4FM1 A;  5EOY A;  4I50 F;  1TUB A;  2O03 A;  3E22 B;  2HJF C;  2XCL A;  1SES A;  1KYO F;  3PW0 A;  4NXN B;  3T9E A;  4Q20 A;  1GRJ A;  1FVI A;  4BWS C;  3D36 C;  1RJQ A;  4UVB A;  1S9F A;  4IHJ A;  5ITZ B;  3T99 A;  1KQS U;  3V6J A;  1CE8 A;  2BSK B;  2IH1 C;  5I47 A;  4LWS A;  3ZMZ A;  2Z0A A;  1Z5V A;  2Q8V A;  4C7U A;  4A2A A;  3OUS A;  1TWA A;  4I9Q A;  4B3R H;  1O75 A;  4JYA H;  4B08 A;  1XBL A;  1KD1 W;  2UUA B;  2MK3 A;  3RV3 A;  1IBM B;  3K3W A;  1SRY A;  4R7C A;  1EHI A;  1A9X A;  2MW2 B;  2ODM A;  4O4I A;  1WR2 A;  4JI2 H;  4NXN O;  1KJI A;  2HVR A;  3ZMV A;  3MD0 A;  2W7O A;  1GAX A;  3IN5 A;  4X64 B;  2V58 A;  3M7M X;  3THO A;  1KKD A;  2OLS A;  3BEH A;  2BTQ A;  3ABT A;  2JA5 G;  3KXY T;  4LF7 H;  4QSH A;  2R6F A;  2C00 A;  5IYD O;  2EJ0 A;  3T9F A;  1GYF A;  1FAF A;  4UUJ C;  3VQW A;  4AI8 A;  3JAR A;  2DIK A;  5LHI A;  2ZR3 A;  4FS1 A;  1JXL A;  5JVD F;  2WE6 A;  3CE2 A;  4LSA A;  5KG7 A;  5JQW A;  4PA4 A;  1BMF G;  1IBM O;  2YU9 A;  4GKJ O;  4AHC A;  4DR1 B;  3TIG A;  5CMU A;  4R8U B;  1AR1 B;  3U11 A;  4FLT A;  3HB3 B;  1Z2N X;  1S03 G;  5BR8 O;  3RUP A;  5LA6 B;  1R9T A;  1AR5 A;  4RUF A;  3IJ4 A;  2QJ1 A;  4IIJ B;  2V7Q G;  2QM8 A;  4IRC A;  3W1G A;  1WPX A;  1KUT A;  3EXA A;  3SPI A;  3TQT A;  3SR2 C;  1CKM A;  3Q4H B;  2HJW A;  5EIB C;  5JH7 A;  4BR6 A;  3OT7 A;  4RB1 A;  2GDS A;  3ABK C;  3OTF A;  3ASN B;  2F4V O;  5BWT A;  2UUA H;  4DR3 H;  2QR4 A;  2RN9 A;  3VNN A;  3Q8Q B;  5B1N A;  2C2D A;  5JWP A;  2IBZ H;  1SQG A;  1XMO H;  5IYZ F;  5KG4 A;  5D5Q A;  1M4U A;  3SPC A;  1N36 B;  2CDY A;  1PK8 A;  1H2L A;  3RYC A;  4CKC A;  2UXB H;  2RGV A;  1UC9 A;  4B3T O;  4DR4 H;  2UXN A;  3ZED A;  1V4Y A;  3ETD A;  2FTK A;  3CB2 A;  2COI A;  5KFZ A;  2DYR C;  1RPO A;  3Q1K A;  3BA9 A;  3DAA A;  4H44 B;  1YXB A;  2F4V B;  2UUB H;  2A06 H;  3JCU Z;  2XGQ A;  1VEW A;  1KP2 A;  5L3C A;  3GIL A;  4MVO A;  4JZG A;  2ATL A;  4F50 A;  3IAY A;  4BY1 G;  3AG2 C;  1N36 O;  2W7P A;  5IWA H;  3CME V;  5IYZ A;  2GQR A;  3K0G A;  4A3K G;  1BCC H;  2RQ6 A;  2GBO A;  2EUL A;  4B3T B;  1HNW O;  3CS5 A;  1JJ2 U;  1SYX B;  4LF8 H;  4IR9 A;  2JEX A;  4O83 A;  5J2T A;  3KYH C;  5KG1 A;  4O4I B;  2FYU H;  1FXV A;  2QE7 G;  4OX9 O;  1DK1 A;  4LF4 O;  2YZL A;  3K59 A;  3U9T A;  2BTO A;  4PJ0 Z;  1JX4 A;  4CS3 A;  1YCI A;  4UCR A;  4J0M A;  1P8L A;  3LDE A;  3OEH G;  2UXX A;  2GPS A;  1MZE A;  1JCH A;  1HWY A;  1DGS A;  2CTQ A;  3JAR B;  4MV7 A;  3ZBH A;  1Q6H A;  3T4D A;  2OWO A;  1NU1 H;  4Q44 A;  1U96 A;  4HR7 A;  1G4Y B;  3N42 B;  5C3E G;  2W9C A;  4DV2 H;  2YCH A;  1ZET A;  1K83 A;  3F5W C;  3HOY G;  1BHB A;  1AI4 A;  1F7Y A;  3RB4 A;  4TQF A;  5B1A B;  4BBS G;  2AZ2 A;  3G8C A;  1N33 O;  4DV7 B;  3RYH B;  4J11 A;  3CCU V;  2EIK B;  5LMN O;  3ZS8 C;  5KFJ A;  2R70 A;  4JI5 O;  3T1Y H;  1OCO B;  2ATK C;  4LF9 H;  5F9L A;  1IXM A;  3BA8 A;  1PD3 A;  3Q4H A;  5LXT F;  5EBL C;  3K0D A;  4B3S O;  3P32 A;  2V1D A;  1ZUQ A;  4EQ5 A;  4DR7 O;  4EGJ A;  2YIB D;  4DR2 B;  4A3F G;  1I3Q A;  2E5L O;  4UV9 A;  4TT3 G;  4LFB B;  4LFA O;  2R84 A;  1T5E A;  2CH7 B;  5BWX A;  4JAS A;  1TWH A;  3SJC C;  2DYS C;  4LF6 H;  4O3Q A;  1N34 O;  1A32 A;  3B8M A;  4YR0 A;  5B3S B;  2ZKO A;  1P7G A;  2P4V A;  5TIS Z;  2COG A;  3U55 A;  1WCM G;  4ZOL F;  4ZIB A;  2V4R A;  5KFY A;  4DV3 O;  2F95 B;  4YJ3 A;  2P0A A;  2UUB O;  1PL4 A;  3RYI A;  5JH7 F;  2EZO A;  1M90 W;  3VQV A;  1VQM V;  4FE2 A;  1Y1V G;  4JV0 A;  4DRX B;  3WO0 A;  3L9D A;  1OCO C;  3T1H O;  4DV6 H;  1J5E H;  4TUY F;  1AN7 A;  4RUC A;  1D5N A;  1GO3 F;  2QWP B;  2QSA A;  4LFA B;  3X2Q B;  4LH7 A;  3G6X A;  4EYI B;  1V54 C;  4ED8 A;  1S72 V;  1UC8 A;  4KXR A;  1W0J G;  4DR5 H;  2W6N A;  4DR4 B;  5LA6 F;  5KFC A;  1R3L C;  4R8C A;  2R7Z A;  4LF8 O;  4RB2 C;  2ALZ A;  3RGB A;  1JVM A;  5IYZ B;  3KRE A;  1S0O A;  2LW1 A;  1XNQ B;  3CHX A;  1B04 A;  4X9Q A;  4YJ2 F;  3HKZ A;  2W57 A;  2IU3 A;  5H9C A;  3KTM A;  4ZOL A;  3ZN1 A;  4MTG A;  2WDT A;  4XDK A;  2R8K A;  5C8Y B;  2R9A A;  2F23 A;  3K08 A;  1K34 A;  4J7J A;  4HN2 A;  4P30 A;  1H8E G;  1GTO A;  3LNM B;  2IJK A;  1I94 H;  4LF5 H;  1VBH A;  4I55 F;  4FS2 A;  2GTA A;  4A3M G;  4WF9 V;  3TIN A;  2Y0S E;  4DV1 H;  3OTO H;  2COJ A;  3AG4 C;  4JTC B;  2EJ7 A;  4QE9 A;  1BQ0 A;  2AGA A;  5KFW A;  4YY3 B;  4WFA V;  5LXT A;  2R72 A;  2UUC O;  1S5H C;  4A3D G;  3TEK A;  1Y1W G;  5JCO C;  1E79 G;  4IWX A;  1ET0 A;  1IOW A;  5L3F A;  4MVM A;  4PZ7 A;  5DIS C;  5LMN H;  3JZ6 A;  5E1A C;  2XGP A;  1ZHQ A;  2LO1 A;  1Y67 A;  2JEF A;  3JAW B;  4WFF A;  3G80 A;  4ZI7 B;  3HOV G;  3APO A;  1XRE A;  1XNR B;  1KC8 W;  3WWJ A;  1FXK C;  2R8H A;  5KFR A;  2XD4 A;  4TWK A;  3NR7 A;  3J81 W;  1I2L A;  2ZNI A;  2LFS A;  3GTG A;  1OCC B;  3RR5 A;  2BR0 A;  3CSX A;  3DC5 A;  3OSP A;  2YC0 A;  4LF6 O;  4O4H F;  5CB4 B;  1N36 H;  4J9L A;  2ZDG A;  4O4H A;  5K3W A;  1Z2P X;  4X66 B;  4DUY O;  2W8K A;  3JRW A;  1BXR A;  4IRD A;  1L1F A;  4B3M O;  5D1P A;  2Q2U A;  1XI1 A;  3CVZ A;  2QTO A;  3VPB A;  3H1L H;  4Q6G A;  2CFM A;  1AI5 A;  2WLN A;  5FJ8 G;  3OTO B;  1SQX H;  3LSU A;  3ABK B;  4C5C A;  4ED3 A;  4LF4 H;  2E3C A;  3O9O A;  4JI3 O;  2EJ2 A;  5J2U F;  4FLY A;  5IT9 N;  3MWM A;  3AEI A;  3T54 A;  3PO3 G;  1ENV A;  4JV5 H;  4Q8E A;  2ZXW C;  1AUV A;  2W8L A;  2JA6 G;  4YR2 A;  2NU7 B;  3ZRW B;  4L8J A;  3GTO A;  4U3J B;  2WLH A;  3WWI A;  2B1I A;  4DUY B;  5FLM G;  5KFK A;  1Q81 W;  4NTY A;  4A5U B;  4KHP O;  1KKC A;  3PW7 A;  3MR2 A;  1M93 A;  4XZ3 B;  1WA8 A;  5LL6 b;  1YZB A;  3K06 A;  3GDE A;  2Z3Y A;  4PI2 A;  4ZOL B;  2EBO A;  4ZHQ A;  1I5X A;  5C8Y A;  3SDL A;  1CKN B;  1NQT A;  4K0K B;  3G4S V;  1SQP H;  4DV1 O;  4JF3 A;  4W4L A;  3W7X A;  3ZHS A;  3DF7 A;  4NR1 A;  1KT8 A;  2AQ4 A;  1Q90 D;  3RVY A;  3A8T A;  4W4K A;  5EYP B;  3VOU A;  3ZJZ A;  1VS0 A;  4JI4 B;  2R92 G;  1GSH A;  5C1P A;  4G27 B;  3LP8 A;  3HT5 A;  4KHP B;  1DF5 A;  5KMG A;  2ZM6 H;  2EX3 A;  3TJT A;  2P6J A;  4I55 A;  2LJ2 A;  2ZR2 A;  5LXT B;  4CMD A;  3UKM A;  4BAY A;  3FB5 C;  4O2A A;  2LP7 A;  2W6I G;  3AK3 A;  3LSS A;  3C0F B;  4DW1 A;  3VMM A;  2QF7 A;  2OYQ A;  2E74 B;  2VR1 A;  4YIP A;  5EBM C;  3MDS A;  5EBW C;  4XBF A;  1MSW D;  2J6T A;  4J9P A;  2ZQM A;  3E8B A;  4I50 B;  2F4V H;  4O4I F;  3F5T A;  2UUA O;  3ABU A;  5KG3 A;  1WAZ A;  4XX0 B;  5L1J A;  3CYO A;  4RNN A;  4AIL C;  4ECT A;  2LQT A;  1JDB B;  1EN5 A;  1AR4 A;  3LDD A;  2YS8 A;  4LC1 A;  2HKO A;  2IJH A;  3HKD B;  4NKG B;  4K8X A;  4X64 O;  3RN4 A;  1ARO P;  3E2E A;  2QKA A;  5B1B C;  2UXB O;  1NR1 A;  1QHT A;  3W7S A;  3MAQ A;  3OHB A;  3SYO A;  4QGP A;  4X20 B;  1IZ3 A;  1AB3 A;  3GIP A;  5C1O A;  4JV5 B;  4MTD A;  3CRQ A;  5KUM A;  2VA2 A;  1VF7 A;  1WP8 A;  3O65 A;  4EEQ A;  2WPD G;  2JA6 A;  4IYH A;  4X89 A;  4ED1 A;  1RSO A;  1YIT V;  3M8A A;  4N23 A;  1EFR G;  1JKJ B;  3V6H A;  1DTO A;  1VQL V;  4R7R A;  1B6R A;  2YEV A;  2FK3 A;  3ZCC A;  2Q9L A;  4DR1 O;  3VA7 A;  4O2A F;  1YSC A;  3V4S A;  2EIM C;  3ABL C;  1TAE A;  3UZO A;  4I9W A;  1XDC A;  2DWD C;  1R3K C;  4JAA A;  4X66 H;  1Z2O X;  4RZQ A;  1OHH G;  3ZRW A;  3TW7 A;  1DV1 A;  4ECU A;  3HKE B;  2EIN B;  2AGP A;  2WLI A;  1SET A;  1K73 W;  1AJP A;  2F93 B;  5BPF A;  1GLV A;  1RM1 C;  4YR3 A;  2HGW A;  5A2Q N;  3OMI B;  2ARH A;  1WA8 B;  4O7T A;  4RU9 A;  4JI2 B;  2R93 G;  3J80 N;  4ZHQ B;  3HOW G;  1ZWI C;  2Y4T A;  2ADP A;  5KFS A;  4Q45 A;  3ETH A;  3KHG A;  4X1K B;  4PZ6 A;  3H0G A;  1AJN A;  2Q7E A;  5BY1 A;  5L3B A;  2UU9 O;  4NLG A;  3FKS G;  4YHH O;  4X1I B;  3BAC A;  1EKV A;  2XAJ A;  3I12 A;  1S0V A;  3SPG A;  4JUZ A;  4NTX A;  3W7U A;  4YY3 H;  2VQD A;  2ILM A;  2GSM B;  1I08 A;  1Q86 W;  4I55 B;  5C4X G;  4EG0 A;  3E89 A;  3PN1 A;  4MV6 A;  4Z2W A;  3PZP A;  4JV1 A;  2EIM B;  3ABL B;  5KFI A;  1CP9 A;  4N21 A;  4B3S H;  4O3N A;  2LFR A;  4J9R A;  2UU9 B;  2HGX A;  4X1Y A;  4I50 A;  3MR3 A;  3RVZ A;  1HNW B;  1X4T A;  5JCO A;  5BPH A;  4JI3 H;  4JV2 A;  4NYK A;  3TK1 A;  2Y69 C;  1P16 A;  2YYA A;  3IC9 A;  2RDI A;  1BZK A;  2DWE C;  4MVS A;  4UVA A;  4DL7 A;  1MG1 A;  3EFF K;  2YXL A;  5LA6 A;  5B1B B;  4JI0 H;  4DR6 O;  5KFE A;  5KFA A;  3L2P A;  2IJJ A;  3EVK A;  2GTS A;  4JI8 O;  4DV3 B;  1DF4 A;  4F6R B;  1EN6 A;  3H3V H;  4E4E A;  3H4D A;  1JDE A;  1GN6 A;  5JH7 B;  3E86 A;  1G1X B;  3OUZ A;  1QCE A;  5CA0 B;  4PDR A;  3CPW U;  3EHB B;  2PMZ E;  1TGO A;  4QE7 A;  4O7S A;  2WB1 A;  2QM7 A;  4D7S A;  4UVC A;  2PBZ A;  4JGS A;  3S24 A;  4O82 A;  1OCC C;  2ASL A;  1W96 A;  3GTM A;  4DV0 H;  1R73 A;  5DN6 G;  3C90 A;  3CRM A;  3NGD A;  4NTW A;  4DV7 O;  1NH2 B;  4DR6 B;  2P67 A;  1M5I A;  3RF2 A;  2PYL A;  4JI7 B;  4BY7 G;  4JI5 B;  4OXS A;  2WTF A;  4JI8 B;  2Y48 A;  1Q82 W;  1N48 A;  4TQS A;  1PV0 A;  5KS8 A;  4ED6 A;  2CAZ C;  5B66 Z;  1MSD A;  4QWA A;  2WLJ A;  4C2M A;  2FL4 A;  5EWG A;  4DW0 A;  2FMA A;  5C93 A;  3GTK A;  3ZMT A;  1UPG A;  3UCS C;  2A3Q A;  3GWO A;  2UVW A;  1VQN V;  4TOI A;  4ZI7 F;  2ZDH A;  4XYL B;  1I7L A;  5L9X A;  3TY8 A;  4X1K A;  4H13 B;  1SER A;  4I5S A;  4D7T A;  1MZB A;  1NTM H;  5DLF A;  4YY3 O;  1Y76 A;  4FLU A;  2FPI B;  4X1I A;  3TQ1 A;  4FZ1 A;  2QTS A;  3K9A A;  2Q67 A;  3B4S A;  4RNM A;  2C22 A;  1SZX A;  3OHA A;  2HVQ A;  3LML A;  3KHR A;  1RP3 B;  3G8D A;  2R7N A;  2UXD B;  1SA0 B;  3T1H B;  4BWA A;  4U6P A;  2XAF A;  1XNR O;  2ETN A;  2V59 A;  5LMU O;  4ZHQ F;  3QG5 A;  4DV5 O;  4DXW A;  1LNQ A;  3Q2O A;  2R7M A;  4IYI A;  2YUA A;  3JCZ A;  1GMG A;  1IDS A;  3MWD A;  3W1B A;  3JRX A;  4ED7 A;  4LF8 B;  1TWC A;  3OSN A;  1Q8I A;  1PKX A;  3OR7 C;  1X9N A;  4GUN A;  5BWU A;  5DEC A;  1GM7 A;  2RDC A;  4RAZ A;  4PDV A;  4X1Y B;  1XNQ O;  5KFD A;  5IYD G;  3BHP A;  2W9C B;  2XIG A;  3U54 A;  1DIK A;  4RUE A;  4Q43 A;  5DGI A;  1C3O A;  2YS7 A;  4X66 O;  2CNQ A;  1KJ9 A;  4UB6 Z;  3F8N A;  2WLM A;  4DUY H;  3N27 A;  5KHG A;  1BT8 A;  3RYH A;  5KHJ A;  3LUL A;  2B63 G;  1XUQ A;  3RBZ A;  3JAS A;  2F43 G;  1B06 A;  4F6R A;  2DAB A;  1IYE A;  4PHZ A;  3BQ0 A;  4GLW A;  3QVN A;  3SE7 A;  3GID A;  4EBE A;  3T5K A;  2CNU A;  5CA0 A;  4MW8 A;  3NXS A;  1GN3 A;  3BJY A;  4IWY A;  3CCJ V;  2C2E A;  1KEC A;  4QNH B;  2NU9 B;  1XQ8 A;  4AYB A;  4DV6 B;  1J5E B;  2KQX A;  1I6U A;  2BOB C;  3K5N A;  1EUC B;  4LH6 A;  3W5O A;  4MVQ A;  1VQ4 V;  1PNK A;  3HKC A;  1SZT A;  4B7E A;  1IBK B;  3JZI A;  4HNV A;  5EWF A;  4FBU A;  2HFE C;  2A79 B;  4PA6 A;  1MOF A;  3H1I H;  5EZY F;  3TII A;  2G38 A;  3U0G A;  1YVW A;  4YQW A;  3AK2 A;  2VRZ A;  2CUG A;  4PDB A;  3RYI B;  3KHH A;  4J42 A;  4K0K O;  4OGQ B;  4RB0 A;  1K5Q A;  4GX0 A;  2V5A A;  3CXH F;  2H8P C;  4DRX A;  5F9N A;  4J9Q A;  1M57 B;  2Y0I A;  3VPC A;  2ZM6 B;  2FP4 B;  2W6P A;  5CA0 F;  1HR0 B;  1T94 A;  4LF6 B;  2WB1 E;  4FIP C;  3T1Y B;  1G6U A;  1BJT A;  1WLE A;  2CKZ B;  4DV6 O;  1J5E O;  3GQC A;  4JI1 B;  3OW2 U;  3MFH A;  3N2G A;  1S0M A;  4Q4D A;  2CNV A;  3RB6 A;  2B1G A;  1IBK O;  4DR2 H;  3AG1 C;  2KSD A;  1VAR A;  1Y76 B;  3HPL C;  2JGU A;  2O57 A;  2CGN A;  2Q0A A;  4X8A A;  4O3P A;  3DTU B;  2NNU A;  1IUR A;  1JIH A;  3ZRV A;  5J2U A;  5DMX A;  4O2B F;  3K5H A;  2BQU A;  1EN4 A;  2IA6 A;  3HOZ G;  4MTE A;  1JFF A;  2Q4P A;  3P30 A;  1HR0 O;  1Z5W A;  4UCT A;  1SQQ H;  1QQC A;  4GCZ A;  5L3G A;  4FM2 A;  2RCV A;  3GV7 B;  1XNQ H;  1I94 O;  4LF7 O;  1F51 A;  2PGG A;  3B40 A;  5KG2 A;  3CSW A;  2VUM G;  2A9H A;  1US6 A;  2R85 A;  4K6N A;  3DSQ A;  4M7E A;  4FGR A;  4PD4 F;  2Y69 B;  3CC4 V;  5KFF A;  5EWE A;  1PPJ H;  2UXB B;  1NZ6 A;  4DV0 O;  2F66 C;  5DGA A;  2NN4 A;  1WH2 A;  4M9U A;  3UO3 A;  5JJJ B;  1XHX A;  3CP1 A;  1M1K W;  1OWT A;  1SS3 A;  4IL6 Z;  3BQ2 A;  3QO5 A;  4ASU G;  1K1S A;  1RFY A;  1E1Q G;  2ZT9 B;  4DK0 A;  1OCZ B;  2Q69 A;  3JAS B;  1Z2G A;  2WAQ E;  3H1K H;  3RYF A;  3RFC A;  1YTF D;  5DG7 A;  2XAQ A;  2KG7 B;  5KX5 F;  1KBH A;  5K2M A;  4HQ6 A;  4J41 A;  3CCV V;  3ICX A;  2DLN A;  4CKE A;  3PJS K;  1GSA A;  5KFM A;  4IGG A;  3TY9 A;  4JAV A;  4DV0 B;  1VBG A;  1P7B A;  2VQE B;  2KB1 A;  4O3O A;  5CB4 A;  4DL6 A;  4O4H B;  3G6B A;  4BXX G;  4PBC A;  3ZRX A;  1SQV H;  4DUZ B;  3K3P A;  1HNZ B;  4X65 B;  3E8G A;  1D5A A;  3N40 P;  1DLB A;  1H38 A;  1PX2 A;  5GON A;  2ZD9 A;  2H94 A;  3RV4 A;  2JEU A;  3CX5 F;  4PDL A;  5KA6 A;  4RZR A;  3Q8R B;  3MFI A;  4JI2 O;  2YW2 A;  2NR5 A;  3BRC A;  3SYP A;  5DQI A;  3CWB H;  1W93 A;  1QR9 A;  3K79 A;  3LSQ A;  4DO2 A;  3HR0 A;  2FK1 A;  3IC7 A;  1KEE A;  2AHY A;  1NTZ H;  1K3E A;  5IY5 B;  4YHH B;  2GQS A;  2FK2 A;  2UU9 H;  4YJ2 A;  4FK5 C;  2F1M A;  4WFB V;  2GPW A;  5H2F Z;  3IGA C;  3E35 A;  2XOK G;  4U3J A;  2VQF B;  5CB4 F;  3BG5 A;  1IVS A;  3BVO A;  2NLJ C;  3K03 A;  1QU7 A;  5LL6 Y;  3K57 A;  2ZIM A;  2HG8 A;  1IBM H;  4JI0 B;  3U0Z A;  4LF4 B;  4AQY H;  2VWK A;  4JZ2 A;  1VF5 B;  1M7J A;  1Y4M A;  2CW8 A;  2Y4U A;  3HXL A;  3FMA A;  2VWJ A;  5CBH A;  4DV3 H;  2OIG A;  3JSL A;  2ITC C;  2WLL A;  1JMK C;  5K1P A;  1V55 C;  1JFF B;  4X88 A;  5KT5 A;  1Q7Y W;  2YIC A;  5L3E A;  3PVX A;  3ZMS A;  2VQF O;  2X6C A;  5GW7 A;  2IP4 A;  4DUZ H;  2C35 B;  3QFF A;  2FE3 A;  1BNC A;  3RGZ A;  2EIJ B;  4FU0 A;  1O9H A;  1OBG A;  2AZ0 A;  1PNL A;  4IT5 A;  2HG5 C;  3IG0 A;  4J9S A;  3J7A U;  2RMK B;  3KG2 A;  5CM0 A;  2OH2 A;  4JI0 O;  3HB9 A;  5BMV F;  5LMN B;  1U97 A;  2HJD A;  2PUS A;  3SYC A;  2FB9 A;  2NUA B;  1RYS A;  2BQR A;  1LR1 A;  2OCH A;  4J10 A;  4X62 B;  2N74 A;  4O2A B;  2PYJ A;  5FL7 G;  1AUX A;  3T9C A;  2ADQ B;  4FM9 A;  4L1K A;  1MMM A;  4DR7 B;  2QDO A;  2DW4 A;  2JS5 A;  3LDC A;  3CCR V;  2W6Z A;  3NUA A;  2CGO A;  2E5L B;  2CE4 A;  5HBR B;  4D6T H;  3R5H A;  1K8A W;  4JI4 H;  4LFB O;  3AK1 A;  5FLX W;  3FFQ A;  1KU9 A;  2P4K A;  3TET A;  2KKW A;  4ZQI A;  4YBZ B;  1QLE C;  1HP8 A;  3MJF A;  3HKD A;  5KG6 A;  3DC6 A;  1RM1 B;  5JVL A;  2K1E A;  4YXW G;  5IWA O;  4O3R A;  3E83 A;  3Q8S B;  1CXZ B;  5FNV F;  3N43 B;  2KSW A;  3K5L A;  2ZDQ A;  2W6M A;  5H6Q A;  1AVM A;  1R1B A;  1XMQ O;  1E4F T;  5KAF Z;  3CCE V;  4FFO A;  5I5U A;  2V9W A;  1V51 A;  4PEL A;  5F2V O;  4WD3 A;  3D8C A;  3RGX A;  2FLL A;  2YEV B;  2HHH O;  5HNE A;  2W9A A;  4KL1 A;  4XYM B;  2Y0S A;  1B6Q A;  2YI9 A;  2Q7D A;  2RJZ A;  1P84 F;  4JI1 H;  3ZHU A;  3T1H H;  3WO1 A;  4JYA O;  3DGE A;  3L70 H;  3WNZ A;  2W9B B;  1QLE B;  5BWR A;  3GTL A;  3HKE A;  2WLI B;  4DR5 O;  5KT3 A;  2BOC C;  3N41 B;  2W0X A;  4MSW C;  3A0H Z;  5KFQ A;  4I7H A;  3IFX A;  4J9Z B;  3G67 A;  4AYB E;  1XNR H;  5EC2 C;  1TVK B;  3N2K A;  1KC7 A;  4EKW A;  3GJX B;  3SYA A;  5HFM A;  4CZZ A;  4KFM A;  2DAA A;  1S77 D;  4O4J F;  1IOV A;  4CS2 A;  3ETQ A;  3JAL B;  5LYJ B;  2E5L H;  2IH3 C;  1N0J A;  3SJB C;  1ZLZ A;  3MHH C;  5A2Q W;  2L6L A;  4PI0 A;  3TW6 A;  2QWO B;  2XND G;  4GZR B;  5CBG A;  3ETJ A;  4Q4C A;  3J80 W;  5LP6 C;  2Z02 A;  2P90 A;  2ZJT A;  1N34 H;  4YAK B;  1GO3 E;  4CBC A;  2R92 A;  5FR9 A;  3RJ0 A;  5H6R A;  4LR3 A;  1NH2 D;  1F4M A;  4JYY A;  4RO2 A;  1K4D C;  5CR5 A;  3QO8 A;  5KX5 A;  1S0N A;  5CA3 A;  3J81 N;  3T5H A;  5IJ9 B;  4J9M A;  3FB8 C;  2MCT A;  1UJW B;  3C3S A;  4JI6 B;  5GON F;  4H37 A;  3OR6 C;  5L3D A;  4JYC A;  3ORR A;  4IZO A;  3JAM W;  3H40 A;  4H33 A;  3AG4 B;  1H8H G;  3R5F A;  2VUM A;  3JYC A;  5BMV B;  3V6K A;  1FJG B;  5LMU B;  2ZE8 A;  4X65 H;  2FKX A;  3K5O A;  1LUV A;  4QWE A;  4O4L B;  1IBL H;  2QWR B;  5D1O B;  5FPR A;  3B09 A;  4J9N A;  4JI3 B;  4JYB A;  1J95 A;  1ORQ C;  2FML A;  3BAA A;  4TV8 B;  5LBQ A;  2ITD C;  3RT3 C;  2GV9 A;  4O7W A;  3FDS A;  4DV4 O;  4RQF A;  3CXC U;  1N8R W;  2A7W A;  1I1M A;  3H0G G;  4JI1 O;  2RDJ A;  1WP7 A;  5J2T F;  1RK6 A;  2PI4 A;  1N56 A;  2R8I A;  2Q7G A;  3KZI Z;  2I87 A;  3H4B A;  5I5X A;  2P7T C;  2ZCE A;  4I0X A;  1M56 B;  4X64 H;  4QWD A;  3X2Q C;  2DPJ A;  4YAJ B;  2XC9 A;  4JTD B;  4BIO A;  4MVR A;  3GV5 B;  4WFH A;  4PA3 A;  3T4Z A;  2X0S A;  2R9I A;  1VQ7 V;  5DG9 A;  2DJV A;  5E79 Z;  1GN4 A;  1Y66 A;  3H1J H;  1PP9 H;  2EIJ C;  4MVU A;  4OX9 H;  4FJC C;  5KFG A;  2LGQ A;  2Y0P A;  3L74 H;  3EPI A;  1RYR A;  1XL4 A;  4MA0 A;  3B77 A;  3N2K B;  1GN2 A;  4JI4 O;  3PO2 G;  1JQ0 A;  3K04 A;  1I94 B;  3H9V A;  3S3X A;  3N8D A;  1A0I A;  5I5T A;  5KFN A;  1VF6 C;  2ZE5 A;  4CC5 A;  1V55 B;  2N04 A;  4OPH A;  4QJF B;  3SNO A;  3RB3 A;  3PFF A;  3FB7 C;  3FX7 A;  3OM3 B;  3QTC A;  4Q0Y A;  1GGO A;  4MV1 A;  3JAL A;  5LYJ A;  1RK5 A;  2WYO A;  3SJQ C;  1YJW V;  4O7N A;  1M0W A;  3CRA A;  5IYB G;  4J80 A;  4A3B G;  1XMO O;  1I7F A;  1OCR C;  1QBZ A;  4F6E A;  1SA0 A;  3R9R A;  3CEB A;  1F4N A;  3DXR A;  4GYC B;  3M4I A;  5EC1 C;  1FKA H;  1NTK H;  2HDK A;  4TM5 A;  2XAH A;  3E8H A;  3T1Y O;  2M05 A;  2EIK C;  1YJN V;  3ZHT A;  3RW0 A;  3JAT A;  4CC6 A;  2X6A A;  1YI2 V;  5B1A C;  4UXN A;  5IY5 C;  5LOV B;  3CRC A;  3KCY A;  3CC7 V;  1W59 A;  3WG7 B;  3HO8 A;  3ZN0 A;  5LMU H;  4J9O A;  3MWE A;  2HHH H;  5LOV F;  4UV8 A;  3FYE B;  5H80 A;  2R8G A;  1N0N A;  2VQE O;  2ZDI C;  3S3W A;  2GLT A;  1AP6 A;  2NVY A;  2P5O A;  1MZF A;  2IM9 A;  4JV5 O; 
#chains in the Genus database with same CATH homology
 2XIG A;  1WNS A;  2OWO A;  2HIV A;  3U10 A;  4DV1 B;  3N42 B;  4DV2 H;  1HNZ H;  2YCH A;  2VQE H;  3F8N A;  2HHH B;  4DUY H;  5KHG A;  3RYH A;  5KHJ A;  5EIB D;  1Q43 A;  4TQF A;  4CH6 A;  5D1O A;  4DV7 B;  3JAS A;  3RYH B;  4B3M H;  4F6R A;  4ETS A;  3ZS8 C;  4DV4 H;  2R70 A;  3SJA C;  3T1Y H;  4PHZ A;  4LF9 H;  3BA8 A;  4DR7 H;  1P49 A;  4NXM B;  4WBN A;  4EQ5 A;  5CA0 A;  2YIB D;  4DR2 B;  4DR5 B;  4O2B B;  1XHZ A;  5JJN B;  5FD6 A;  4JI7 H;  4LFB B;  3HKC B;  4PZ8 A;  1XQ8 A;  4DV6 B;  1J5E B;  1I6U A;  3K5N A;  4LH6 A;  4CH3 A;  1T5E A;  3W5O A;  3J7A K;  3HKC A;  1IBK B;  4UFZ A;  3SJC C;  4LF5 B;  1WPB A;  4TV9 A;  3K3V A;  4LF6 H;  4TUY A;  5KHI A;  2VOB A;  4TV9 B;  4PDB A;  3RYI B;  4EFE A;  4ZIB A;  1E4G T;  4RB0 A;  2F95 B;  4YJ3 A;  4LMY A;  4APM A;  4DRX A;  3RYI A;  1WN7 A;  3VQV A;  2ZM6 B;  4YJ3 B;  1HR0 B;  1L8D A;  4DRX B;  4LF6 B;  1SEI A;  3N2G B;  3T1Y B;  4DV6 H;  1J5E H;  1AN7 A;  1G6U A;  1BJT A;  1S5J A;  4LFA B;  4LH7 A;  4JI1 B;  3N2G A;  4DV7 H;  4DR2 H;  4DR5 H;  1S68 A;  4DR4 B;  1IBL B;  2JGU A;  2UXD H;  4CH4 A;  4RB2 C;  3VQY A;  2Q0A A;  2V4D A;  5J2U B;  3RGB A;  5IYZ B;  4O4J A;  1XNQ B;  3CHX A;  1B04 A;  3BPZ A;  2PZS A;  5J2U A;  2W57 A;  3EYY A;  3RWR D;  4ZOL A;  2WDT A;  4FVM A;  4EB6 A;  5C8Y B;  2R9A A;  2YIB A;  4MTE A;  1JFF A;  2QM4 A;  4DRF A;  3JAT B;  1Z5W A;  4EB6 B;  4UCT A;  2HGS A;  1QQC A;  4LFC B;  5KHK A;  1I94 H;  5LOV A;  4FM2 A;  4YHH H;  4LF5 H;  1N33 B;  1XNQ H;  3QWU A;  2PGG A;  4DV1 H;  3OTO H;  3DSQ A;  4M7E A;  2UXB B;  2F66 C;  1WH2 A;  4YY3 B;  5LXT A;  3WB0 A;  2R72 A;  5JJJ B;  5JCO C;  1XHX A;  4PZ7 A;  5DIS C;  5LMN H;  1ZHQ A;  4DK0 A;  3RYF B;  3B2E E;  3JAW B;  3JAS B;  4FFB A;  3KAK A;  3A2F A;  4ZI7 B;  3RYF A;  1N34 B;  2YI8 A;  1XNR B;  3JAW A;  2VPS A;  4ZI7 A;  5JQG A;  5EZY A;  4WBN B;  4JYA B;  3ICX A;  2Q2T A;  4GLX A;  3J81 W;  2ZNJ A;  5KHH A;  4O2B A;  2ZNI A;  3TY9 A;  1BGW A;  4DV0 B;  2VQE B;  1YEW A;  3RR5 A;  5CB4 A;  3CSX A;  5IJ0 B;  4O4H B;  3L4K A;  4FLV A;  3BAB A;  3N44 B;  4KHP H;  5CB4 B;  4DUZ B;  1NT2 B;  1N36 H;  5GON B;  4DV2 B;  4O4H A;  3WB2 A;  1HNZ B;  1Z2P X;  4X65 B;  4X66 B;  1D5A A;  4FLZ A;  3N40 P;  3JAK A;  2RGR A;  5GON A;  4TUY B;  4LFC H;  2UXC B;  5D1P A;  2Q2U A;  1XI1 A;  3CVZ A;  4FM0 A;  1N33 H;  3BRC A;  4Q6G A;  2CFM A;  3OTO B;  1L2Z A;  4YJ2 B;  4LF9 B;  5BR8 B;  2ZIN A;  2XHB A;  4LF4 H;  2E3C A;  4YHH B;  2UU9 H;  3K58 A;  4YJ2 A;  1ZHS A;  4FLY A;  5IWA B;  3MWM A;  2F1M A;  3UT5 A;  4B3S B;  4CS4 A;  4JV5 H;  3K5M A;  4U3J A;  2VQF B;  3H20 A;  3UT5 B;  1XMQ B;  4L8J A;  3K57 A;  5LP6 A;  3RFR A;  4U3J B;  4DK1 A;  2ZIM A;  1IBM H;  4DUY B;  4JI0 B;  3U0Z A;  1TUB B;  4LF4 B;  4AQY H;  2VWK A;  5CA1 B;  2CW8 A;  4O4J B;  3HXL A;  4LSX A;  3FMA A;  1M93 A;  2PTM A;  2VWJ A;  4DV3 H;  5LL6 b;  4LFB H;  3GDE A;  5CA1 A;  3JSL A;  4PI2 A;  4ZOL B;  4ZHQ A;  1JMK C;  4RB3 C;  5K1P A;  5C8Y A;  1CKN B;  4IHJ B;  1JFF B;  4K0K B;  1XDN A;  2UUB B;  4GKK B;  1CKN A;  3DF7 A;  4DUZ H;  1IBK H;  2FE3 A;  3RGZ A;  4LFA H;  1O9H A;  3IG0 A;  5EYP B;  1VS0 A;  4JI4 B;  2P22 C;  4TQD A;  4UCS A;  5LMN B;  1N32 H;  5EYP A;  4KHP B;  2PUS A;  2ZM6 H;  5KMG A;  2EX3 A;  1JJO A;  4B3T H;  4I55 A;  4X62 B;  1HNX B;  3NBZ B;  2PYJ A;  1Q5O A;  4O2A B;  4GKK H;  5LXT B;  4FM9 A;  4DR6 H;  4B3R B;  5KMG B;  4HBN A;  4DR7 B;  2CW7 A;  4O2A A;  2JS5 A;  3RTX A;  4K0K H;  2BTQ B;  2E5L B;  3C0F B;  4JI4 H;  4DV4 B;  2OYQ A;  5FLX W;  3FFQ A;  4FFB B;  1KU9 A;  1SQF A;  3KAJ A;  4NXM H;  4X62 H;  4I50 B;  1HNX H;  2F4V H;  2KKW A;  5JQG B;  5EZY B;  3HKD A;  5JVD A;  4AIL C;  4RAY A;  4DV5 B;  4OX9 B;  2VQF H;  5FPO A;  3HKD B;  4UCO A;  4K8X A;  1HNW H;  5K1X A;  4LNU B;  5IJ0 A;  4DR3 B;  2YIA A;  2HEP A;  3HKB B;  1QHT A;  1FFX A;  4LNU A;  3MAQ A;  4AQY B;  3N43 B;  4X20 B;  2KSW A;  4IIJ A;  3K5L A;  4MTD A;  3HKB A;  4JV5 B;  3KAL A;  3JAK B;  1E4F T;  5BR8 H;  1VF7 A;  4EEQ A;  4X20 A;  3LNN A;  1XMQ H;  1TA8 A;  1H2S B;  1RSO A;  5D5P A;  3RGX A;  1M0T A;  1ZAU A;  4R7R A;  4DR1 H;  4KL1 A;  4UCU A;  4IAJ A;  4FLX A;  4UCV A;  2YI9 A;  1TAE A;  2RJZ A;  4JI1 H;  5IT9 W;  3T1H H;  3NC0 B;  4X66 H;  5FNV B;  1Z2O X;  4RZQ A;  3HKE A;  2UXC H;  3RYC B;  5LP6 B;  5FNV A;  4CH5 A;  3N41 B;  2HVS A;  3HKE B;  4FM1 A;  5EOY A;  4I7H A;  1TUB A;  1TVK A;  2O03 A;  2F93 B;  4BW9 A;  4LF7 B;  3E22 B;  1XNR H;  1TVK B;  3N2K A;  4NXN B;  3GJX B;  3E22 A;  4JI2 B;  1FVI A;  4ZHQ B;  4BWS C;  3SGI A;  3WB1 A;  4IHJ A;  5ITZ B;  4X1K B;  4PZ6 A;  4CS2 A;  3ETQ A;  2Q7E A;  3NBY B;  5ITZ A;  3JAL B;  5LYJ B;  2E5L H;  4X1I B;  3N6X A;  1Z5V A;  4HNA A;  4A2A A;  3SJB C;  4I9Q A;  5A2Q W;  4B3R H;  1O75 A;  4PI0 A;  4JYA H;  4B08 A;  4YY3 H;  4EFB A;  2UUA B;  2Q7H A;  3J80 W;  4JI8 H;  5LP6 C;  1IBM B;  4I4T A;  4NXN H;  4I55 B;  2ZJT A;  1N34 H;  4O4I A;  4JI2 H;  3PN1 A;  2HVR A;  5JJE B;  3RJ0 A;  1V9P A;  4X64 B;  3M7M X;  3THO A;  4LR3 A;  5KX5 B;  2BTQ A;  3KXY T;  5IJ9 A;  1SKV A;  4LF7 H;  4B3S H;  4JI5 H;  1XK5 A;  5KX5 A;  1O9G A;  2UU9 B;  2ZIO A;  5IJ9 B;  1GYF A;  3VQW A;  1XMO B;  3JAR A;  4I50 A;  4X1Y A;  2MCT A;  1HNW B;  1X4T A;  5JCO A;  4JI6 B;  4JI3 H;  1P16 A;  3JAM W;  4A2B A;  3QF7 A;  5BMV A;  2WE6 A;  5JVD B;  4LSA A;  4GKJ H;  2YXL A;  4AHC A;  5BMV B;  4O4L A;  5LA6 A;  4DR1 B;  1FJG B;  4JI0 H;  3U11 A;  5LMU B;  4FLT A;  1Z2N X;  2VUG A;  3RIZ A;  1S03 G;  3L2P A;  4X65 H;  3K5O A;  1IBL H;  4O4L B;  1Q3E A;  5LA6 B;  5D1O B;  5FPR A;  1FFX B;  4JI3 B;  4JI6 H;  4DV3 B;  4NVP A;  4TV8 A;  4F6R B;  2QJ1 A;  4IIJ B;  3W1G A;  5JH7 B;  4E6N A;  3BAA A;  4TV8 B;  3SR2 C;  2UUC B;  1CKM A;  3L4J A;  1CKO A;  2GV9 A;  5EIB C;  5JH7 A;  1HR0 H;  5CA0 B;  4RB1 A;  1TGO A;  3OTF A;  3GB8 B;  2Q7G A;  4D7S A;  2UUA H;  4DR3 H;  3S24 A;  3VNN A;  4DV0 H;  2ZCE A;  1SQG A;  4X64 H;  1XMO H;  5D5Q A;  1M4U A;  4DR6 B;  1M5I A;  3RF2 A;  2PYL A;  4JI7 B;  1N36 B;  4JI5 B;  4JI8 B;  2PY5 A;  3RYC A;  2UXB H;  2RGV A;  2CAZ C;  4DR4 H;  3ZED A;  3CB2 A;  4DV5 H;  4OX9 H;  3TY5 A;  2HIX A;  3N2K B;  3BA9 A;  1I94 B;  4TOI A;  2F4V B;  2UUB H;  1A0I A;  1KMI Z;  4CC5 A;  4B3M B;  4MV9 A;  1HW7 A;  3TY8 A;  4X1K A;  3QTC A;  4D7T A;  1MZB A;  4Q0Y A;  3VQX A;  3IAY A;  3JAL A;  5LYJ A;  4FLU A;  2WYO A;  4X1I A;  4K8Z A;  4HNA B;  2JVD A;  1M0W A;  1N32 B;  5IWA H;  5IYZ A;  1I7F A;  2RQ6 A;  3JSN A;  4B3T B;  1SA0 A;  2UUC H;  2HVQ A;  1SYX B;  3LML A;  4LF8 H;  4GYC B;  4I4T B;  3M4I A;  2UXD B;  1SA0 B;  5J2T A;  1FKA H;  3KYH C;  3T1H B;  4BWA A;  4O4I B;  4GKJ B;  4CC6 A;  3JAT A;  3UQ8 A;  5J2T B;  3QG5 A;  5FD5 A;  5LOV B;  3K59 A;  5LMU H;  3W1B A;  2HHH H;  2BTO A;  4CS3 A;  4LF8 B;  4UCR A;  4J0M A;  1Q8I A;  1P8L A;  1X9N A;  4RAZ A;  1DGS A;  3JAR B;  4X1Y B;  2P5O A;  1FJG H;  4FLW A;  4MV7 A;  2IM9 A;  3BHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...