4UCVA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 95
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucvA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucvA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucvA02
4NXNB 1XDNA 4GKKB 1P16A 2Q2UA 4LH7A 2F4VB 4UCRA 4JYAB 4DR4B 3PN1A 2UXBB 5D1PA 4DV7B 4DR1B 4B3SB 4LF4B 4KHPB 3GJXB 4YY3B 4CC5A 1ZAUA 2VQFB 4JV5B 3KYHC 4LH6A 4B3RB 3W5OA 2HVSA 3BA9A 4UCTA 3GDEA 2UXDB 3RTXA 2ZM6B 3NC0B 5FPRA 4JI3B 4EEQA 1CKNB 3W1BA 4DV0B 2VQEB 4UCOA 4YHHB 4JI7B 3OTOB 4LFBB 4EFEA 4GKJB 1IBKB 3NBZB 1XNRB 4X62B 2HVRA 1J5EB 2E5LB 1FJGB 4JI8B 4AQYB 1B04A 4LF6B 4DR5B 3VNNA 1N33B 5D1OA 4EFBA 2VUGA 3SGIA 2Q2TA 4DV2B 4JI2B 4UFZA 3T1YB 4X64B 1S68A 4JI6B 4NXMB 3L2PA 3QWUA 1CKNA 3TY9A 2HVQA 5D1OB 5DISC 3TY8A 1HR0B 4PZ8A 1IBMB 2UUBB 5BR8B 4JI5B 4LF5B 4DRFA 4DUZB 1P8LA 1I94B 4UCSA 3BABA 3S24A 3W1GA 4LF7B 4DV3B 4LF9B 3UQ8A 4EQ5A 4UCUA 5FPOA 4X66B 4DV5B 3JSLA 4DR7B 4E6NA 4DR2B 2HHHB 2UUAB 3BA8A 1FVIA 4DUYB 1A0IA 1HNWB 4OX9B 1DGSA 4B3TB 1N32B 4PZ7A 4DR3B 2HIXA 3BAAA 3RR5A 1N36B 5LMUB 4GLXA 1XNQB 1TAEA 3NBYB 4K0KB 4DV6B 1XMQB 1CKMA 1X9NA 2CFMA 4UCVA 4TOIA 5LMNB 1XMOB 4JI4B 1N34B 1V9PA 4LF8B 3GB8B 4DV1B 1HNZB 4B3MB 2UXCB 4X65B 3TY5A 4JI0B 1XK5A 1HNXB 1CKOA 4LFAB 1IBLB 2UU9B 3T1HB 2OWOA 2UUCB 4PZ6A 1TA8A 2HIVA 4DR6B 4JI1B 1VS0A 3JSNA 4CC6A 5IWAB 4DV4B 4LFCB
chains in the Genus database with same CATH superfamily
2Q7DA 1H8HG 1T5EA 3D36C 4WFAV 4JI6H 2NU6B 2W6JG 1KBLA 3UT5B 4DW0A 2FPGB 3K9SA 2Q7GA 2X0SA 2DWCA 5DQGA 2X6BA 2X7RB 5LHGA 1WRVA 5KG6A 3V6HA 4JI1H 4O7TA 3B2EE 1K73W 4CHIA 2CDYA 2HG5C 2EIYA 4U6PA 4R7RA 2FTKA 2Y0IA 1V54B 5EZYB 2R86A 5GONA 4LNUA 1NTMH 4FFPA 4TUYB 4I4TF 2LFSA 1BCCH 2YIDA 1URFA 4X62H 3OR6C 5LOVA 2QWNB 3G6XA 2F66C 1AR1B 2Q4PA 3VNNA 4TV8A 5GTHZ 5BPFA 1Q8IA 4FBTA 5BMVB 1YIJV 2C2AA 5EK0A 5C8YF 5B1AC 3I12A 1BMFG 5J2UF 3N40P 5JUMA 3GV7B 3H4DA 1LUWA 3SE7A 4NXMB 1RJRA 4I55A 3QO7A 5KFEA 4A3LG 1VBHA 1S77D 2FLPA 2Q68A 1Y4MA 4J7ZA 4JXUA 4IL6Z 4J7JA 2QKAA 2COIA 3SYAA 4DV7O 2WLKA 4HBNA 1WP7A 2ZCEA 1YZBA 4B08A 5I5VA 4IHJB 1M57C 3OMAB 1GM7A 2JEGA 2P7TC 4ECZA 4UCUA 2XAJA 1THZA 4O2AA 4TT3G 4LF8O 3S3XA 3RB4A 1KJ9A 1PKXA 5EYPB 5KFAA 4XDKA 1RJQA 1NH2B 5ITZA 1XMQO 4ICGA 2C2EA 2DIKA 3ABMB 2A3QA 4O7YA 3JARB 4DR3B 1WA8A 2DABA 2R7KA 2QE7G 2R93G 1XNQB 5EWEA 1Y1WG 3FB8C 3THOA 3HOXG 4DAAA 3CRRA 5KT7A 4LF8B 4X89A 2CKZB 3K5MA 2YZMA 1KD1W 1KP2A 2XGQA 4HNTA 1GMGA 3HT5A 2ZIMA 2HVKC 1AI6A 1CEZA 4U7CA 3ABKB 4EB6A 4JI1B 4JI4O 4LFCO 3Q1KA 1E1RG 1XNQO 5F9LA 3WU2Z 4J9RA 2DLNA 2RCVA 4C5BA 2ASDA 1QLEB 5BMVA 2XT9A 4ZI7A 2C2DA 2AGQA 2OCHA 4LFBO 4ECSA 3SPCA 3GIPA 4O4JF 1HNXO 3PN1A 2CH7B 2QM8A 5IT9N 5EWFA 4OXSA 1D5NA 2CTWA 5CN0A 1SS3A 3ZRWA 4ZIBA 4DR6H 2IJHA 4IRCA 1CS0A 4O4JB 5L3GA 1KJQA 2YI8A 4K8XA 4QNHB 2CZGA 2YIBD 2B1IA 3CRQA 4JGSA 5B1AB 1XHXA 4TQDA 1E79G 2ADQB 2YEVB 2OH2A 1JPXA 1JLLB 2O57A 1IBKB 1WCMG 4JYBA 4X1IA 2RDJA 5DGIA 3RBZA 3CCVV 5LGTA 4DIMA 2E5LB 3JASA 3ZHRA 2B63G 2PMZA 1Y1VA 3T5LA 1IYDA 2BOCC 4JTAB 1N33B 4DL5A 5DM6V 2PMZE 3HKEA 5I5YA 4CE5A 1GN6A 5LA6B 3R5FA 3GIDA 4BR6A 1JA8A 1R3IC 1R9TA 2UUAH 1P49A 4K8ZA 4O4IB 1ZQ7A 4F4ZA 5C4XG 3TY9A 4F50A 4J11A 1R3LC 2GLTA 4DR7H 1K9MW 4ME6A 1M5IA 4EG0A 2UXBH 1SQGA 4O86A 4MV9A 1JQ0A 4X64O 3OAAG 2AZ0A 1OCOC 1TGOA 1JDBB 1BGWA 1MZBA 3PJSK 4MTEA 3K3PA 4UCSA 3BABA 4DRXA 4JYAO 2CE4A 2YRWA 1GYFA 3PR4A 4TSFG 2HJDA 3ASOC 4OPAA 1GK9A 3T9CA 1GLVA 4UUJC 2DAAA 3BA8A 1M56B 4LF5H 2CAZC 2XUMA 3MWMA 3ETHA 2F1MA 2PUSA 5K1XA 1BS3A 4RU9A 2BQRA 2VA2A 1AN7A 5FLXN 1V55B 3MHHC 5LA6F 5D5PA 2FK2A 1AJNA 3M8AA 4HZ3A 3TW6A 1X9NA 1KKCA 4CZZA 1YEWA 2Q69A 1SERA 4MTDA 2R8KA 3OEEG 5CA1B 3CSXA 4I4TA 1BXRA 2PGGA 3TXSA 5BYAA 3SPJA 5FNVB 4O7RA 2W57A 4QE7A 3N43B 4QWBA 5KT6A 4NTXA 3RGZA 4ABMA 1OWTA 1QQCA 2OCCC 2YSUB 3QNEA 1ORQC 5JVDF 4HAMA 4J9NA 2JA6A 4I4TB 4B3TH 3KHLA 1N32H 4UVAA 1TVKB 2R92G 2Y69B 4DV6O 1VQNV 4DV4B 4RAYA 1GM9A 4LFCB 2XC9A 3GIJA 2ARHA 3CQZA 2KSDA 1FXVA 3DTUB 3ZCCA 1Y1WA 5KHHA 1MOFA 5L9XA 4JYAB 1SCUB 4LF4B 3J7AU 2BOBC 3AW8A 5LP6C 1RM1B 1Q81W 1I94H 4O3PA 3CCQV 4LFBH 3IFXA 3ABTA 1LR1A 1VIBA 4FFKA 4O2BB 4Q4CA 1HR0H 4RNOA 2DYRB 3L74H 4YR2A 3N6RA 2O03A 4PJ0Z 1WSCA 1HW7A 2HLDG 1XNRB 2MK3A 3SPHA 4AQYB 4F6RB 2IBKA 4FK5C 2LQTA 4BWSC 3E89A 2K1EA 4K35A 3RYHA 3S3WA 1N34H 2QB5A 1L0NH 4UXNA 2JGUA 3EVKA 2W9CA 1A9XA 1OCCC 5EOYA 3T2MA 3PR5B 5H6RA 3FB6C 5B1OA 1W93A 4P9OA 4ED6A 3LP8A 2VR1A 5BR8B 4JI5B 2IM9A 2AZ2A 4X1IB 1XMQH 3JAKB 1HNWO 1EN6A 4LF8H 2W0XA 1QU7A 3HBLA 2ZM6O 3OSPA 4RUFA 5GW7A 3E8GA 1WR2A 2ZQMA 4B3RO 4GLWA 1RSOA 2DYSB 4O4JA 4H37A 4FM2A 3BQ1A 2JA7G 4B3RH 3L70H 1S5HC 1NT2B 3T54A 4P2ZA 3JATA 1YVWA 1PL4A 4PZ7A 2ZM6H 5KMGA 5LP6F 1IXBA 2GV9A 3QF7A 2PI4A 3ZRXA 1IZ3A 5KUMA 3T5JA 3CCEV 4K0KB 2EJ7A 2UU9H 4MV3A 1PM9A 2YYAA 5H9CA 4ZHQB 5LMNB 4DV5H 3SYOA 3QVNA 4JI7H 1EFRG 3N6XA 5C8YA 3FYEB 3K06A 5DLGA 4Q43A 1R73A 1PNKA 3JRWA 3K5HA 2YCHA 4GKJH 1SZXA 5LOVF 2XAQA 1QBZA 1TA8A 1XMOO 1UC9A 2E5LH 4O2BA 2V4QA 1EKFA 4DV1O 3CC2V 3MJFA 4JI7O 2C22A 5CBHA 1NTZH 1YJ9V 4NXNB 5LMNO 4ZOLF 4TQRA 3OD4A 4LH7A 2KSWA 3IG0A 1VBGA 2E3CA 4G27B 2EJ0A 3AYHB 4TQFA 4O7WA 2COJA 1KTAA 2N05A 1M1KW 2ASJA 1I6UA 1PD3A 1Z5VA 2P4VA 5KFPA 3TIGA 2BCCH 3RYCA 2GQSA 1P84F 3R5XA 1E4GT 3DGEA 4FU0A 4BY7G 1I1LA 4A3JG 1QR8A 3EFFK 5JVDA 3GTGA 2YICA 1IBLH 2FMAA 4O4LA 2BTOA 5BR8H 4EKWA 3B8MA 2UXBO 5IWAH 2EILC 3RV4A 1GTOA 4AI8A 4MVQA 5KFSA 3APOA 2CW7A 1PPJH 5L3DA 2CQYA 5LGNA 2Q9LA 2AQ4A 3TXQA 5IYZB 4JI8O 4KHPO 1NVPD 5D1OB 2Q6AA 3K5OA 1NR7A 5LP6B 2M7WA 3N2KA 3WWIA 4PA4A 5KFRA 4GX1A 1P8LA 3T9EA 5KUKA 1N8RW 3RGBA 1AJQA 1VF5B 5CBGA 4LF7B 3GIQA 3CHXA 3TINA 4JV1A 5JQGA 3CD6V 3JCUZ 5FPOA 4RWUA 4K0KO 5H5NA 1SRYA 2CTRA 4GKKH 3L73H 3T5KA 1I5XA 1JKJB 1HNWH 3HOWG 4ECYA 3SNOA 5L3FA 2HIXA 1P7GA 5BWXA 3U10A 4LNUB 5KFOA 1ZL8A 4YJ2A 1CKMA 2CFMA 3KCXA 1K4DC 3JRXA 5KFMA 4HN2A 4HYKA 4TOIA 2DOSA 1FJGO 1JX4A 1KC8W 4B3TO 1N32O 2ZDIC 2DJVA 3KZIZ 3T4ZA 5A2QW 3A0BZ 3TGUH 2VS0A 2XGPA 1ZL8B 1Y66A 2YRXA 3FB5C 3N27A 4O7VA 2IU3A 4UB8Z 5CA3A 5KFWA 3H3VH 4BBSG 3J81N 3QO8A 1VS0A 4UV8A 3BG5A 1VAJA 3KKYA 4A2AA 3JD1A 4JI3H 1YI2V 1WB7A 3NXSA 1XDNA 2V9WA 3KXYT 4YAJB 2Q5ZA 5K3WA 5EC1C 2P06A 3Q4HB 3OM3B 4AQYH 4PHZA 4O3NA 4YJ3F 4X65O 4A3IG 4ZOLB 4JUZA 4CMDA 5CA0B 3M9MB 5JH7A 3GDEA 3AG7A 3OT7A 3CB2A 4A93G 4UV9A 3ETDA 1QNMA 1F7YA 1JJOA 5EBWC 1HNZH 5KT2A 5GTIZ 1AUXA 4L1KA 2EIKC 2WTFA 1HNZO 3Q2OA 1VF6C 4PDLA 5JVDB 2JGDA 1XEQA 4BXXG 5KA6A 1QHTA 3EXAA 2W8KA 1P7BA 4GX2A 2R9RB 1JXLA 2P67A 3H0GG 2QTSA 3CS5A 2R85A 5EBMC 3HOUG 1BSMA 4IR1A 4RQEA 2Y0SE 1D2DA 3MWEA 4DR7O 2Q0AA 2V1DA 3QO5A 3VBBA 3M9NB 2OT5A 5CBFA 3QTCA 1S0OA 1VMGA 1TUEB 3ICXA 5I5SA 2XHBA 3ETJA 1S03G 3JARA 5BR8O 2W6OA 1R6NA 3OUZA 4JZGA 1CP9A 2ZJTA 2ZE6A 4YY3H 5IWAO 2WWWA 5L1KA 4ED2A 4LF4H 3CCUV 3H1HH 1N36O 1EKPA 3ABMC 2B5UA 1GGOA 2DPJA 4H0LB 3G8CA 3K0DA 1KC7A 2W9AA 2UUAO 2WB1A 3I55V 5KFCA 4F4XA 4CH4A 5CAEB 1FFXB 2P0AA 3RAXA 3ORQA 3LDEA 3N2GB 4NYKA 5EBLC 2H94A 3V4ZA 1TWGA 5CMUA 4RQFA 2Q0OC 2UU9O 5CM0A 4X64H 1FYJA 3NUAA 4U3JB 2E76B 1OZ0A 1HNWB 2XNDG 3U54A 1OCOB 4LCUC 4O7NA 5DQHA 4LSAA 4HNAB 5DGBA 3G80A 4I9QA 4LFAO 4I55B 1ZUQA 3NBYB 2ZDGA 2XAGA 2HGWA 1AI7A 3GTLA 1QVGU 3FAVA 5IP7G 1SQVH 4MTFA 2Z5UA 3GB8B 2AGPA 4FLVA 3PZPA 1XK5A 5DQIA 2DYRC 2RDCA 3DSQA 2ZKOA 5B1BC 1OHHG 1RSOB 3OTOO 2UUCB 1M6VA 2HIVA 2Z0AA 4QWCA 3ASNB 2LO1A 3MFIA 5AG2A 1EKVA 4BIUA 5IWAB 4N23A 2YIBA 5DGAA 3VOUA 1GH6A 2DMXA 1WPBA 1FXKC 2X6CA 2B63A 5C5JA 1H2MA 3IC9A 4J9ZB 4DUYH 1L8DA 3KAJA 2FP4B 3AG3B 5BWUA 1JX9A 2VQFB 2DW4A 1IBLO 4MV6A 4ECVA 1K1SA 1I94O 3BQ2A 5BWVA 2XOKG 1I5YA 1K34A 1KMIZ 5KHGA 4JI7B 2R8GA 1WCMA 3KHHA 3RYHB 5KX5F 5L3BA 4FLYA 2NU9B 2PI5A 4A3CG 3K3VA 1BT8A 2V4DA 3QZ8A 4JI8B 2F23A 2JS5A 4FLTA 3KAKA 4QGPA 2CW8A 4P30A 3WB0A 4OPHA 2YS8A 2IJKA 1CKNA 3CCSV 5BWRA 1M0WA 5FD5A 4I55F 2V7QG 5HFMA 4NR1A 5C1OA 4ECQA 2QF7A 4UB6Z 1RPOA 1R3JC 2R82A 4RB2C 2VWJA 1U96A 1O75A 4HYOA 4X66H 3GTOA 1TVKA 2IJIA 1Y76B 1H2LA 3WG7C 4GKKO 4X66B 3BFRA 2R7LA 2M05A 2RGRA 3L75H 4L87A 3MAQA 1AUVA 1PL0A 1SQQH 5KT5A 2QA4V 4FLUA 4CS3A 3BCCH 5CA1A 1WB8A 2WAQA 1B3QA 4BW9A 3BAAA 4O2AF 4GLXA 5KG5A 3ZHVA 3ASNC 5J2TF 2BR0A 1RYRA 4PDVA 2A06H 4RAIA 2W8LA 2P4KA 3R65A 1N34B 1V54C 1QLNA 1CQIB 1HNZB 4YHHH 1IX9A 4ED1A 5KG2A 2VQEH 4ZOLA 2FB5A 5FL7G 3FKIG 4W4LA 1CKOA 4MV4A 1TUBB 1NTKH 3JYCA 2OWOA 3RF2A 2VQFH 4EGQA 2WLJA 4DV0H 4CC6A 4DV5O 1N56A 4CKCA 4G2KA 5IYCO 4IRKA 1RFYA 3V4SA 4O83A 5CA0A 2L6LA 4NVPA 3HOZG 4DRXB 4OX9H 2HDKA 2ZDQA 4K6NA 2KG7B 4DR1B 2EZOA 3ETQA 2AHYA 4ED7A 3JZFA 4B3RB 2WLLB 1U97A 4RNNA 4UCTA 3V6JA 1AR5A 1MA1A 2EIMB 3SPIA 4DV3O 3B8NA 2OTJV 2R7MA 4B3MO 3C3TA 2FK1A 5L1JA 2ZE5A 1K5SA 3LULA 4RB3C 3KG2A 2R7NA 4J9YB 4PDBA 1FFTB 4UCOA 3TK1A 1IBMO 2ZE7A 2UUBO 2FK3A 4B3MH 2G38A 3G71V 5IE9A 1GSAA 1VQ5V 1TWAA 2JRIA 4LF6O 3WNZA 2VQDA 4O4IA 1N48A 3GVMA 4Q44A 3Q8PB 2EIMC 2EZPA 5J2UA 3KREA 4ECXA 1AI5A 3BJYA 1QCEA 5K2MA 4X64B 1S68A 3F7VC 2DPIA 3JASB 4LP8A 3L2PA 1EZ1A 3QWUA 1YXBA 5LYJB 2AGAA 1FPOA 3ASOB 4FLXA 2RDIA 2R8IA 5JJNB 4KHPH 3JAMW 2DQ0A 2IU0A 5DLFA 3H9VA 4LF9O 2UXNA 4CKEA 1IOWA 2X6AA 1Q86W 1NZ6A 4CS4A 5KFGA 4DK0A 4ED3A 1G6UA 4FMTA 3AK3A 3RN4A 4ZI7B 4AILC 4JYCA 4LF5O 4PA3A 1SQFA 2R7ZG 2VWKA 5EDWA 1FXKB 5JCOC 5BZBA 2NVXA 2E74B 2R8HA 1ET0A 1GRJA 3HKDB 4XX0B 1ZHQA 5B66Z 3T9DA 4PDMA 4FM1A 5I47A 4FFRA 2P5OA 4Q8FA 1N36B 3FD9A 2QM7A 5KFXA 4PI2A 2NU8B 2GTAA 4MW3A 4UCVA 2JEFA 1KP3A 4QIWF 3W7UA 1K8AW 1T36A 5F9NA 3RYIB 4DV1B 2UXCB 2HGXA 4Q20A 2PYJA 3OFNG 3OHAA 2R6FA 1VQ7V 5IP9G 3CXHF 3RB6A 4LFAB 3C3SA 4Y8VB 2AXTZ 2OIEA 4NXMO 1AB3A 2QEXV 1BNCA 2ETNA 3F7YC 2MCTA 1FXKA 2ATLA 2H8PC 5CB4A 3JSNA 3PW0A 4DL2A 4A3EG 1FJGH 3JD3A 1Q6UA 5KFLA 3UO2A 4JI4H 4DR4H 4KP4A 3M9OB 4OGQB 2RMKB 3GV8B 4JAVA 4DR4B 4O4LF 2UXBB 2GUZB 1VF6A 1RYSA 4DV0O 4CC5A 4LH6A 3W5OA 2HVSA 3IJ4A 3RYFB 2XCLA 3LQSA 1GN4A 3JD2A 1BJTA 1SQXH 2PTMA 2NLJC 1XL4A 4EEQA 1L1FA 4YR0A 4MV1A 2WLMA 2J6SA 2X5RA 4AYBA 4J9QA 5DG8A 4BAYA 4RNMA 3NBZB 1UFIA 4DR6O 3RAQA 2A79B 3Q4HA 3JATB 5LOVB 1YTFB 4FJCC 2OLSA 2ZNJA 1EUCB 3VQYA 3HR0A 4DR5B 3ZS8C 1M90W 2ZIOA 2JEIA 4J10A 3KHRA 1V55C 4LMYA 3RJ0A 4O3RA 4DV2B 3TETA 2NUAB 4YJ2B 2FKLA 3HKCA 5EZYA 4IYHA 5EWGA 4BIZA 3T99A 3OTFA 3JAKA 2HVQA 5KFVA 1VP7A 3CRMA 5T14A 4GUNA 4IT5A 4MVZA 1S0VA 4YQWA 3SJAC 4X66O 2FLNA 4E2LA 3ABUA 4NB5A 3AEIA 3VQWA 4B7EA 3B40A 4IGGA 4DV3B 4LF9B 4FLZA 1H2NA 1EUDB 3T5HA 1DTOA 3G6VA 2W7PA 4MA5A 1FS0G 3WB1A 3RB0A 1N33H 1DF4A 4YY3O 4JAUA 3A0HZ 3B77A 4WBNB 2DWDC 2RN9A 3UT5A 4DR2B 1Y67A 2HHHB 4F6RA 4A3BG 3M99B 4ECRA 2FB9A 1KBHA 2XAHA 4EBEA 5FR9A 4Z1VA 4AHCA 4JI0O 1Q6HA 1YTFD 2J9GA 4YR3A 4X88A 1NBMG 1OCRB 4F4YA 1GM8A 3AG1B 1WLEA 1IYEA 3H01A 2DZDA 1M7JA 4LC1A 4I50A 3STLC 3N44B 5LXTB 3SYQA 4JI4B 2E5LO 3UFXB 1NR1A 4GKJO 4DR2O 1RP3B 2YS6A 3MR3A 2ITDC 1XNRH 4BY1G 1B06A 1AROP 3GV5B 4YXWG 1AVMA 1I3QA 5IYZA 1QVFU 2ZXWC 3ML0A 2GBOA 5KFUA 2JA8G 2VUMA 4GT1A 3RYCB 1NI8A 3NR7A 2W6NA 3FKIA 4KUMA 4O2BF 1GO3E 1GSHA 3OTOH 5CR5A 3B09A 1NS1A 4O4LB 1GAXA 4A3GG 1JMKC 1UC8A 4IIJF 3H1KH 3EYYA 2WLIA 3ZIAG 1BGYH 1VQ4V 1BQ0A 2V58A 4C7UA 3K5IA 1Z5WA 2I8CA 5LHIA 3AG4C 3CRAA 1AILA 5IYBO 5KFIA 1EZJA 1BL8A 1K3EA 3W7WA 2RGVA 5FPRA 1AI4A 3DXRA 2QWOB 4JI3B 5J2TA 1A32A 1CKNB 2XAFA 3CPWU 3SJCC 2E2IA 2KKWA 5JJJB 1NH2D 2W70A 4YHHB 2JIZG 2Q7EA 1RK5A 3J7AK 3CCMV 3T1HH 1I2KA 3V6KA 4K3AA 2OCCB 2JA7A 2HVRA 3GILA 1KYOF 3D36A 4ZHQF 1VQLV 3G6BA 2J6TA 3ZMZA 4J9LA 2Y69C 4GX0A 3TCUA 3OUUA 3H4BA 5FD6A 5FNVF 3SGIA 4X9QA 4O4HA 4LF9H 3MR6A 3LSSA 4DV2H 3F8NA 2UXDH 5IDJA 3E86A 5C93A 1JDEA 2UVRA 2JA5A 5JJEB 5B3SC 1HR0B 4RUAA 4PZ8A 3GLKA 4TVIA 1I50A 4DUZB 2EULA 1CPYA 4I7HA 3CCRV 3CC7V 5KFDA 4DUZH 1UPGA 4EQ5A 3CRCA 4ZBMA 1DV1A 4FFOA 4MTOA 4UUGA 4ED0A 4JTDB 1H38A 5LA6A 1N0JA 3ZRSA 3VPDA 4QIWE 1I1KA 5KG3A 5E25A 5GONF 4E6NA 1YHQV 3HB3B 3ZHQA 3E8FA 5LYJF 3R23A 1DGSA 5KT3A 1A0GA 1VQ8V 3GB7C 3H1LH 2JJ2G 3CJHA 1E4FT 1C30A 1K33A 3CE2A 2JVDA 1XMQB 5IYCG 5HV6A 3CP1A 4O4IF 4R50A 4DL7A 1XNQH 2AHZA 4IZOA 4MVUA 3H1JH 3TY5A 4NYEA 1RJPA 3RIZA 4KXRA 2PF4E 2LGWA 1IBLB 4J9OA 4MVOA 4O3QA 5IYBG 4MT8A 2YEVA 3WWJA 4H44B 3OUSA 3D3QA 4U3JA 4X20A 4O4HB 3G8DA 2VQFO 1XMOH 2P22C 1DIKA 3BQ0A 3J80N 1FFXA 1P16A 3CMAV 4YIOA 3A2FA 1OCCB 4HNAA 3L9DA 3R5HA 5D1PA 2LP7A 1VQMV 2QJ1A 1W0JG 1B6QA 3SYPA 1PNLA 2L35A 4DW1A 4I0XB 2YXYA 5CB4F 4RUCA 1TWFA 3QQMA 1A48A 4R6ZA 1KJIA 1JCHA 4NXNO 3H40A 1SKVA 4R7CA 1NKDA 1S5JA 4XZ3B 4CKBA 4O81A 4O4HF 3U9SA 2AU0A 2VRZA 2DWEC 2ZT9B 4GKJB 2EJ2A 2GSMB 2WYOA 3E5NA 5CA1F 1XUQA 2COGA 5A2QN 2W6PA 4QIWA 1VQPV 5KFJA 1B04A 2P6JA 2GHYA 3T9FA 4D7TA 5J2TB 1ZETA 4GCZA 3UM7A 4EFBA 2E2HA 3CYOA 2ABJA 4IWYA 1KEEA 4O2AB 4JI2B 1H8EG 4PA9A 2NN4A 3J81W 3GWOA 3T1HO 2HHHH 2CGOA 5L1LA 4ASUG 4C5CA 4LF4O 4Q0YA 4ED8A 2ZR2A 1Z2PX 2I87A 1VQOV 1JIHA 2D3OW 2VPQA 2YDEA 4FE2A 1SQBH 1NU1H 2JGDB 3E22A 3K79A 1Q82W 4NZMA 1D5AA 3K58A 4R8UA 5LXTA 4M7EA 4IIJA 5KS8A 4O3SA 1MMMA 4LWSA 1C3OA 4DL4A 2ZINA 3CWBH 2R93A 1YSCA 3OHBA 3DTGA 1S97A 2LJ2A 2QDOA 1I08A 4H13B 1M0TA 1ENVA 4IHJF 1FAFA 4JI5H 3Q8SB 2YZGA 1EBOA 1H2KA 4PD4F 4XBFA 4RUEA 4J9KA 5KG0A 1PNMA 3CEIA 4WBNA 1SYXB 4FIPC 3T1YO 3GIIA 3MFHA 2C28A 1TAEA 4PDRA 3SPGA 2QK4A 4K0KH 3C0FB 4RZRA 3T1YH 3ETGA 4D6TH 2UVUA 1OCZB 3E35A 4FM0A 1XMOB 5HNEA 1I0HA 2DYSC 1M93A 4IR9A 1N0NA 5J2UB 2PYLA 4D7SA 1EYZA 4CH6A 5BMVF 2WB1E 2WPDG 4RCNA 3T1HB 1O9HA 1O9GA 1WJZA 1EZVH 1EN5A 1R3KC 3JZ6A 5LBQA 3HKEB 2W6IG 5LMUO 1J95A 3VA7A 1Z2OX 4GKKB 5KAIZ 3I4MG 2AGOA 3GIMA 2R70A 5LGUA 1KJ8A 5DGHA 4NTYA 1MZFA 5CA0F 2VPSA 2OIGA 1ZTEA 1SZTA 4DYLA 3KYHC 3VPBA 4FLWA 2WE6A 4JI2O 2UXDB 2X0LA 3KALA 4O7ZA 4DLKA 4CS2A 3W1BA 2BTQB 4LWSB 4DR3O 2FLLA 4WFEA 4TV9A 4LFBB 2ZNIA 2C35B 3GTKA 3N2KB 5B1BB 2CK3G 4MV8A 2B1GA 2IW5A 3HO8A 1IBKH 5D5QA 3E22B 3PVXA 2ODTX 4A2BA 2GQRA 3WO1A 3ABKC 3OSNA 2Y4RA 3F5WC 3VQVA 4Z2WA 3MD0A 2HR3A 4YBZB 5D1OA 5I60A 2VUGA 5C3EG 2FPIB 1YDXA 4PA7A 3ZHSA 4JF3A 1NVPB 3RYFA 2PY5A 1SC5B 2FE3A 1OJHA 3HOYG 3MR2A 2WSSG 3X2QC 1J5EO 2GUZA 4DV7H 2EINC 4U3FH 2YXLA 3JZIA 5DEDA 1G1XB 4TWKA 1H2GA 4LF5B 4DR1O 2IMWP 3BHPA 4JV2A 5IJ9A 1Z2NX 4NTWA 3PO3G 2FL4A 2F4VO 5DG9A 1N36H 1N33O 3JCZA 1SA0B 4JV5H 3GTMA 5L3EA 1MNGA 1Y76A 1B6SA 3BPZA 4ZQIA 1G4YB 4NZOA 1WA8B 1V51A 2Y4TA 2RJZA 1S3JA 5H80A 3APQA 4DUYB 1A0IA 1EM1A 3RWRD 2R72A 2VUMG 4JV5O 3R66A 2Q7HA 3ZMSA 4O82A 4A3KG 2Y48A 2QSAA 5EYPA 3IC7A 4LF7H 5C8YB 5LMUB 1A3GA 1ROPA 4O7LA 4PA6A 3IAYA 5DAAA 3C90A 5B1NA 5KFKA 1COWG 4FBUA 4J42A 5KHIA 1I7NA 5KHJA 4LFCH 3CEBA 1SQPH 1Y74A 3G4SV 4EGJA 1K97A 5KAFZ 3HKDA 2IA6A 3AK2A 2YW2A 5KG7A 3D3IA 4X65B 2M6YA 2Q8VA 3K5NA 3TEKA 1WH2A 4J7KA 4MVMA 2R87A 5LMNH 3K9AA 4P9PA 5KFHA 2PBZA 4E4TA 4TUYA 5LYJA 4ZHQA 4QWAA 3I5DA 4MS2A 2QWRB 1PV0A 1KUQA 1DV2A 3BVOA 5H6QA 4ECUA 2ZR3A 5KT4A 1XQ8A 5KMGB 3B4SA 1R6KA 2DQ3A 4TV8B 1RPRA 3RV3A 2W9BB 2EIJC 1BHBA 4DV3H 3RBEA 4YJ3B 4UCRA 1HP8A 2IH1C 4NXNH 2A9HA 2HEPA 1B6RA 3GJXB 4U7NA 4FGRA 1X59A 3RB3A 4ETSA 1IOVA 3LNMB 2WAQE 2FKXA 3W7TA 1Q43A 5KFQA 3UYYA 3E2EA 3GWKC 3MWDA 1Y1VG 4JTCB 5IY5B 4MAMA 5JVLA 3PW4A 2WLLA 4I9WA 4QWEA 2NNUA 2UXCO 5L1IA 5H2FZ 3L72H 2CUGA 1XHZA 2EINB 3ZJZA 4ZKIA 2BSKA 3FMAA 3RVYA 2NR5A 4Z1MG 1JOYA 2W6QA 4EBDA 5F2VO 1G2WA 2R9AA 4IWXA 1FXHA 3CVZA 3K5LA 4O84A 2Q2TA 3I56V 4MSWC 1S10A 1Z2GA 2IBZH 5LL6Y 3U0ZA 1OCZC 3STZC 3H1IH 3E8HA 1YCIA 4AYBE 4B3SH 3T1CA 3TIIA 2KG7A 1K1QA 2GPWA 4WBNF 4B3SO 4CMFA 2XCPA 5DECA 3HKZE 3S24A 3W1GA 1DK1A 1IURA 2QYZA 1VARA 4JI8H 2YXHA 4QW9A 4ECWA 4C5AA 1W0KG 1OV9A 4I5SA 1YF2A 3HPLC 4X1YB 3W7XA 3KCYA 1FVIA 4B3TB 2JS3A 4DUZO 1YJWV 1N32B 3DAAA 4YJ2F 4APMA 5LL6b 1RK6A 2EX3A 3FX7A 3RR5A 4BBRG 1Q7YW 1XREA 1R6TA 1L2ZA 3ZN0A 1IXMA 2N04A 5EIBC 2V59A 3OMNB 5KA5A 4H33A 1GN2A 4B3MB 3LWBA 1TWCA 2YUAA 3P3PA 1Y6XA 2XTAA 3K3WA 1I1MA 1IDSA 4GC6A 3F5TA 3VPCA 4MA0A 2WAMA 3IN5A 2DN9A 2IH3C 2XD4A 3RFRA 5BWTA 4X1YA 4YAKB 2WA3A 4B7KA 3AG1C 1F51A 5KHKA 4FFBB 2V5AA 1DLBA 2R9IA 4YHHO 2VA3A 4I0XA 4XDLA 4QE9A 2BE3A 3SR2C 5JH7B 1DF5A 4X1KB 5D8DA 2ASLA 3E8BA 5I5XA 3OUFA 1WPXA 3X2QB 4DV7B 4KHPB 3PW2A 1HWYA 5KFZA 4RZQA 3A0RA 3U9TA 1H2SB 3FFQA 4CH3A 4TV8F 2YIAA 2EJRA 1S0NA 3MR5A 3ETEA 3WWHA 4QJFA 2ATKC 3NC0B 3AG2B 3K03A 2VOBA 4I50B 1E4EB 1S76D 4MTGA 4DV0B 2VQEB 4WFHA 1GN3A 3OTOB 3ZRVA 2UVWA 3RUPA 4EFEA 4FFMA 5FLXW 2K9PA 4TQSA 4YB8B 2A0LA 4PI0A 5JCOA 5DG7A 4X8AA 2BSKB 2UXXA 4A5UB 4MVRA 2C2RA 4F6EA 3HB9A 4LF6H 2PN1A 3O65A 3GTQA 3SJBC 1JR9A 2CGNA 2HVJC 2F4VH 3CJHB 1Q90D 3JAMN 3CSWA 2JDIG 2R84A 3RVZA 4RAZA 1WNSA 4MV7A 4DR1H 3J80W 3OE7G 5C1PA 3ZRWB 5JQWA 2ZGIA 4XYLB 1F23A 1I94B 3EPGA 1K4CC 3FAVB 3JAWA 4KL1A 2I80A 1FKAO 2HHHO 1PK8A 2YWVA 4LR3A 4M9UA 4A3MG 2JEJA 1KT8A 1LUVA 1Q3EA 3HKCB 4W4KA 2HJWA 3UQ8A 5JQGB 1BQZA 4J80A 3R9RA 3JSLA 1Q6IA 1WP8A 3ZMVA 3NGDA 3MDSA 1KJJA 3ZHUA 2KB1A 4WHXA 3DF7A 2DE0X 4BIOA 3UCSC 1XL6A 1Y74B 2YZNA 3N2GA 1XILA 2ILMA 3OGIB 4WF9V 5J9PC 4F4LA 3PW5A 2CTPA 1X4TA 4JPRA 4BWAA 4EB6B 4GZRB 3N8DA 2UUCO 2GTSA 4WFBV 2H3OA 2A1HA 2Y4UA 4JI0B 3JD0A 3BY6A 4EBCA 1VQKV 2QWPB 1K5QA 2HP8A 2LW1A 4FS2A 5IJ0B 3TJTA 4DR6B 4DUYO 3H20A 3H0GA 2W6MA 1V4YA 2PZSA 4DR5H 4NLGA 5KFTA 1JJ2U 5KLVH 5B5EZ 3O9OA 3AX6A 2XCAA 5IJ9B 4WD3A 4DV6H 3P3NA 1BZKA 3SYCA 5CB4B 3G6EV 3WO0A 3K0GA 4IHJA 1SA0A 1ULZA 1ZLZA 2Q73A 4QWDA 4JI1O 1W2BU 3JD4A 4B3SB 1IBMH 2UUBH 1ZAUA 4J9MA 2B9ZA 2W71A 4MW8A 3FB7C 2HFEC 3BA9A 5ITZB 3KHGA 5LMUH 2D2CB 1SESA 3RTXA 1SFOA 3BRCA 2CTQA 3WFVA 2CNUA 4JI2H 3CC4V 5I5TA 1Y14B 4WCEV 2UXCH 4IRDA 3OEHG 1N4CA 2FYUH 5KG1A 1QR9A 4DL6A 1L0LH 5IYDO 1WAZA 3RW0A 3E83A 3MHSC 2FJZA 3AG3C 5B3SB 1M4UA 2ZDHA 2Y0PA 1BE3H 1S72V 1FJGB 1PX2A 2JA6G 2BTQA 5JWPA 2PVPA 4LF6B 1GKFA 4ECTA 3GQCA 1HR0O 3Q8QB 2UXDO 3JALB 4DO2A 4YIPA 3QFFA 2WDTA 1K83A 1SF9A 4XDJA 2R7ZA 3VOTA 5HBRB 3OMIB 3GIKA 1T94A 5KFNA 3TY8A 1P4RA 4HNUA 3LSQA 5KFFA 1MSDA 3P30A 1I7FA 4G28B 1J5EH 4TV9B 4DRFA 2FMLA 3BEHA 2JK5C 5L3CA 2Y0SA 3DTFA 3DC6A 3LDCA 5GONB 4DQNA 1I2LA 2QGNA 5C44G 3CMEV 2BQ3A 4TV9F 3JAWB 4DR7B 1I7LA 4NZNA 4DV4O 4E4EA 1YJNV 2XIGA 5EC2C 1XDCA 3LDDA 2W0FC 1AJPA 2YL2A 4G3IA 3LMLA 5E1AC 5BWWA 1UNNC 3ZN1A 1HDJA 3M4IA 3N41B 3WG7B 4N21A 4QPKA 1AP5A 3JALA 4LSXA 4DV4H 2CNVA 2VQEO 3W7SA 2UVVA 4JI3O 5BYBA 5KX5B 5LP6A 1XBLA 3U11A 1HNXB 4FFNA 3VMMA 4LFAH 3UO3A 5EIBD 4DR2H 3L4KA 2Z3YA 3HKBB 1HNXH 1XNRO 2AW9A 2JA5G 3OGCC 4TUYF 1E4EA 5I5WA 2LW7A 3N42B 3ABLC 2Q2UA 3CCLV 2EJ3A 1VQ6V 2F4VB 3SI8A 1LNQA 4O7SA 1OBDA 2MW2B 2ZE8A 3LNNA 3P32A 4DR5O 3TQ1A 1B33N 4YY3B 4OX9O 2FPPB 3GTPA 2OYQA 5KFYA 1VF7A 3CX5F 3FDSA 2ITCC 3I4NG 4PV1B 4IIJB 3M7MX 4HR7A 3ZHTA 2ZM6B 1F4NA 2LGQA 4R8UB 2J6UA 1M57B 2P90A 4FZ1A 4BW5A 4R8CA 4J0MA 4FFBA 5HFLA 1ZWIC 1S0MA 1US6A 2Q67A 5CE8A 4QW8A 1K7DA 3ZEDA 5DMXA 4WFGA 1E1QG 4RB1A 1R1BA 3U0GA 2ZXWB 2RQ6A 2ALZA 1J5EB 4J9PA 1KECA 2N74A 3RYIA 4O3OA 2QKSA 4JV0A 4L8JA 2YI9A 3OR7C 2Z04A 5BXZA 4UFZA 2QTOA 4JI6B 1ZSPA 5IJ0A 4X62O 4DV2O 3Q8RB 3QG5A 1NJIW 3L71H 1FKAH 3T7AA 1GO3F 5LHHA 1GSOA 3ZBHA 5JQGF 2HKOA 2WA4A 4RB0A 3AG2C 2HHFA 4I7ZB 1NQTA 2Z02A 4EYIB 4UVCA 4X20B 1AP6A 4FM9A 4JI0H 5KKNB 2HG8A 4JYAH 2GPSA 2F43G 3RT3C 4DV5B 4A3DG 3TQTA 4JI5O 3KTMA 4F4WA 2EBOA 1OBGA 2UUCH 2NU7B 2R8JA 2BQUA 4GX5A 5KG4A 4FZ0A 4M0JA 2SCUB 1CE8A 2F95B 3LUTB 1IVSA 3PW7A 1JFFA 1MZEA 4Q4DA 3ZMUA 4IYIA 3AG4B 2WLHA 3RGXA 4A3FG 4YP3A 4NXMH 4DV6B 5IYZF 1EHIA 3G6YA 4EEYA 3GTJA 5DN6G 1KB9F 1VKZA 4TM5A 2RF4A 2EIJB 3HXLA 1MSWD 2EIKB 4NKGB 3FKSG 4Q45A 1UJWB 2YC0A 1MABG 3HOVG 4KFMA 3CCJV 5BPHA 3CXCU 4PZ6A 3RBDA 4I50F 1F4MA 4MTXA 2C00A 5EZYF 4HNVA 2W9CB 3WB2A 2HJFC 2JJ1G 4DR4O 1RM1C 2ODMA 2UU9B 1KKDA 2W9BA 2W7OA 1ZHSA 4GC7A 4RO2A 4QJFB 2YZLA 4Q8EA 5IY5C 3T9BA 5IT9W 3K04A 5IYDG 5FJ8G 4X65H 5TISZ 2NVYA 1JFFB 4DR3H 3G67A 4QPJA 2CH7A 5JH7F 3UZOA 1KU9A 4C2MA 1XOUA 4JASA 4DXWA 4AQYO 4JV5B 3L4JA 1WN7A 3D8CA 2A7WA 2YS7A 4YJ3A 2ZDIA 2E75B 2EILB 1BHAA 3K08A 4PBCA 1Q5OA 2HHFB 3A8TA 4FVMA 2V4RA 1ZX3A 3DC5A 2OTLV 4WFFA 1S5LZ 4J9SA 1G8MA 2IP4A 4DL3A 4PWQA 3K57A 4U7OA 1W96A 4JAAA 2W6ZA 1TUBA 3AK1A 4X62B 1TWHA 1SEIA 2XASA 2KQXA 4X1KA 2CNQA 1M56C 1N34O 1IBKO 5LXTF 1KUTA 3SJQC 2LFRA 3ABLB 1KQSU 4XYMB 3T1YB 3SDLA 2YU9A 1AR4A 4HQ6A 4J41A 3DXRB 4CH5A 5DISC 2R92A 2WLNA 2JEXA 4UVBA 4LBEC 2WLIB 1IBMB 2UUBB 5FNVA 1CXZB 1M9NA 2JEUA 5FLMG 2QM4A 3T4DA 1VEWA 3BACA 4IAJA 2RNBA 3EPIA 2QWQB 1OCRC 4CBCA 4GYCB 4ZI7F 1SETA 1W59A 1QLEC 3ZMTA 1S9FA 3IGAC 1JVMA 1VQ9V 3UZBA 4DK1A 2HGSA 2QR4A 3ZX6A 4JZ2A 2UUAB 3K59A 1K92A 1T3NA 3HKBA 3RFCA 4JYYA 4LF7O 1MG1A 2GDSA 4OX9B 4FFLA 1EN4A 3VQXA 1DAAA 3EHBB 4FS1A 4Q6GA 1XI1A 2IJJA 2F93B 1PP9H 4FPPA 3OW2U 5K1PA 3TW7A 3FYIB 1V9PA 3LSUA 3UKMA 4DV1H 3PO2G 3T9AA 4MVSA 2ZD9A 3HKZA 1FD9A 5E79Z 3U55A 2QKCA 4EYHB 5A9GA 3ORRA 4PELA 5I5UA 5KFBA 3QZ7A 1CQJB 5KX5A 5BY1A 2ADPA 3PFFA 1YITV 4QSHA 4JI6O
chains in the Genus database with same CATH topology
1XDNA 3KXYT 3SR2C 5JH7B 3OTOH 1T5EA 4JI6H 4O4LB 4X1KB 1JMKC 3EYYA 3UT5B 4AQYH 2Q7GA 4PHZA 4DV7B 4KHPB 4RZQA 1Z5WA 1H2SB 3FFQA 4ZOLB 4CH3A 4JI1H 2YIAA 3B2EE 5CA0B 5JH7A 3GDEA 3CB2A 4R7RA 3NC0B 2RGVA 5FPRA 4JI3B 1CKNB 5J2TA 5EZYB 2VOBA 1JJOA 4I50B 1HNZH 3SJCC 2KKWA 5JJJB 4DV0B 2VQEB 5GONA 4YHHB 3OTOB 4LNUA 2Q7EA 4TUYB 4EFEA 3J7AK 5FLXW 3T1HH 5JVDB 4X62H 1QHTA 2HVRA 4PI0A 5JCOA 5LOVA 2F66C 4LF6H 3VNNA 4TV8A 1Q8IA 5FD6A 5BMVB 3SGIA 4O4HA 3SJBC 3N40P 4DV2H 4LF9H 2Q0AA 3F8NA 2F4VH 4NXMB 4I55A 2UXDH 3QTCA 3ICXA 5JJEB 4RAZA 2XHBA 1WNSA 3JARA 4MV7A 1S03G 4DR1H 2ZJTA 1HR0B 4YY3H 3J80W 4PZ8A 4LF4H 4HBNA 4DUZB 1I94B 2ZCEA 4KL1A 4I7HA 3JAWA 4B08A 4LR3A 4IHJB 4DUZH 1Q3EA 3HKCB 3UQ8A 4EQ5A 4UCUA 4CH4A 5JQGB 1FFXB 4O2AA 3N2GB 5LA6A 5EYPB 3JSLA 4X64H 4E6NA 5ITZA 4U3JB 3DF7A 1HNWB 1DGSA 3JARB 4DR3B 4LSAA 4HNAB 3N2GA 4I9QA 4I55B 1XNQB 1E4FT 3NBYB 1X4TA 2JVDA 1XMQB 4BWAA 4EB6B 3THOA 1XNQH 4LF8B 3GB8B 4FLVA 3K5MA 3TY5A 4JI0B 1XK5A 3DSQA 3RIZA 1IBLB 2UUCB 2ZIMA 5IJ0B 2HIVA 4DR6B 3H20A 4EB6A 4U3JA 4JI1B 4X20A 4DR5H 2PZSA 5IWAB 4O4HB 2YIBA 5BMVA 2P22C 1XMOH 4ZI7A 1FFXA 1WPBA 5IJ9B 1P16A 4DV6H 5CB4B 3A2FA 4IHJA 1SA0A 4HNAA 3PN1A 4DUYH 1L8DA 5D1PA 3KAJA 4B3SB 1IBMH 2UUBH 2QJ1A 1ZAUA 2VQFB 4ZIBA 4DR6H 5ITZB 3BA9A 5LMUH 4O4JB 2YI8A 4K8XA 3RTXA 3BRCA 2YIBD 4JI2H 2UXCH 1XHXA 1SKVA 1S5JA 1KMIZ 4TQDA 5KHGA 4JI7B 3RYHB 4GKJB 1IBKB 2WYOA 4X1IA 4FLYA 3K3VA 1M4UA 2V4DA 2E5LB 3JASA 1FJGB 4JI8B 1B04A 2BTQA 2JS5A 4LF6B 4D7TA 4FLTA 5J2TB 1N33B 3KAKA 3HKEA 4EFBA 5LA6B 2CW8A 3JALB 3WB0A 4O2AB 4JI2B 2WDTA 3J81W 2HHHH 2UUAH 1P49A 4K8ZA 4O4IB 1CKNA 3TY9A 4Q0YA 4DR7H 1M0WA 3TY8A 1Z2PX 5FD5A 1M5IA 2UXBH 1SQGA 1I7FA 1J5EH 4MV9A 4TV9B 4DRFA 1TGOA 1MZBA 1BGWA 3E22A 4RB2C 2VWJA 4MTEA 1D5AA 3K58A 1O75A 4UCSA 3BABA 5LXTA 4M7EA 4X66H 4DRXA 1TVKA 4IIJA 5GONB 1GYFA 2ZINA 4X66B 3JAWB 4DR7B 2RGRA 1M0TA 2XIGA 3MAQA 3BA8A 4JI5H 4LF5H 2CAZC 3MWMA 4FLUA 2F1MA 2PUSA 4CS3A 5K1XA 5CA1A 3LMLA 4WBNA 1AN7A 1SYXB 4BW9A 3BAAA 3M4IA 3N41B 4GLXA 5D5PA 1TAEA 4K0KH 3C0FB 4LSXA 3JALA 1X9NA 4DV4H 3T1YH 1YEWA 4FM0A 1XMOB 4MTDA 1N34B 1M93A 5CA1B 3CSXA 5J2UB 4I4TA 1HNZB 2PYLA 2PGGA 4D7SA 4YHHH 4CH6A 5FNVB 5KX5B 2VQEH 5LP6A 3U11A 4ZOLA 1HNXB 2W57A 1CKOA 3N43B 4LFAH 1TUBB 3T1HB 3RF2A 5EIBD 2OWOA 1O9HA 1O9GA 3RGZA 3L4KA 1QQCA 4DR2H 2VQFH 3HKBB 1HNXH 4I4TB 4DV0H 4B3TH 4CC6A 1N32H 1TVKB 4DV4B 3N42B 4RAYA 4LFCB 3HKEB 1Z2OX 4GKKB 2Q2UA 5KHHA 5CA0A 2F4VB 4NVPA 2R70A 4DRXB 4JYAB 4OX9H 3LNNA 2VPSA 4DR1B 3ETQA 4LF4B 4YY3B 3KYHC 5LP6C 4B3RB 4FLWA 2OYQA 1VF7A 2WE6A 1I94H 4UCTA 4IIJB 2UXDB 4LFBH 3M7MX 2ZM6B 3KALA 4CS2A 4RB3C 4O2BB 3W1BA 2BTQB 4FFBA 4J0MA 1HR0H 4PDBA 4TV9A 4UCOA 2ZNIA 4LFBB 4B3MH 3N2KB 3ZEDA 2O03A 4RB1A 1HW7A 5D5QA 1IBKH 3E22B 1XNRB 4A2BA 2RQ6A 4O4IA 1J5EB 4AQYB 4F6RB 3RYIA 3VQVA 5J2UA 4BWSC 4L8JA 2YI9A 3RYHA 5D1OA 1N34H 2VUGA 4UFZA 3RYFA 4X64B 2PY5A 1S68A 4JI6B 3JASB 2FE3A 2JGUA 5IJ0A 3L2PA 3QWUA 5EOYA 5LYJB 4DV7H 4FLXA 3QG5A 2YXLA 5JJNB 4KHPH 5BR8B 4JI5B 4LF5B 3JAMW 1FKAH 3BHPA 2IM9A 5IJ9A 1Z2NX 1XMQH 4X1IB 4RB0A 1N36H 3JAKB 1SA0B 4JV5H 4CS4A 4LF8H 4X20B 4DK0A 4FM9A 1G6UA 4JI0H 3BPZA 4JYAH 4ZI7B 4DV5B 4AILC 1RSOA 1SQFA 2RJZA 4O4JA 2UUCH 2VWKA 5JCOC 4FM2A 4B3RH 4DUYB 1A0IA 1NT2B 2R72A 3RWRD 3JATA 1ZHQA 3HKDB 2Q7HA 4PZ7A 2F95B 5EYPA 2ZM6H 5KMGA 4FM1A 1JFFA 2GV9A 3QF7A 2P5OA 4LF7H 5C8YB 5LMUB 1N36B 3RGXA 4NXMH 4PI2A 4K0KB 4DV6B 3IAYA 2UU9H 4UCVA 5KHIA 5KHJA 4ZHQB 5LMNB 4LFCH 4DV5H 3HKDA 3RYIB 4DV1B 2UXCB 3HXLA 4JI7H 4X65B 2PYJA 3K5NA 1WH2A 3N6XA 5C8YA 5LMNH 4LFAB 2YCHA 4GKJH 4TUYA 5LYJA 4PZ6A 4ZHQA 1TA8A 3WB2A 2MCTA 5CB4A 3JSNA 4O2BA 2E5LH 1FJGH 2UU9B 1XQ8A 4JI4H 1ZHSA 5KMGB 4TV8B 4NXNB 4DR4H 4DV3H 5IT9W 4YJ3B 4LH7A 2KSWA 3IG0A 4X65H 4UCRA 2E3CA 4DR4B 4NXNH 1JFFB 2UXBB 4DR3H 4TQFA 2HEPA 3GJXB 1KU9A 4CC5A 4JV5B 3L4JA 4LH6A 4ETSA 1WN7A 3W5OA 2HVSA 3RYFB 4YJ3A 1Q43A 1I6UA 1BJTA 1Q5OA 2PTMA 4EEQA 1Z5VA 4FVMA 3RYCA 1E4GT 3K57A 5JVDA 3NBZB 1TUBA 1IBLH 1XHZA 4X62B 3JATB 3FMAA 5LOVB 1SEIA 4O4LA 4X1KA 2BTOA 5BR8H 2ZNJA 3VQYA 5IWAH 4DR5B 3ZS8C 2ZIOA 2R9AA 3CVZA 4LMYA 3K5LA 2Q2TA 2CW7A 4DV2B 3RJ0A 3T1YB 4YJ2B 3HKCA 5EZYA 5IYZB 3U0ZA 3OTFA 3JAKA 2HVQA 4CH5A 5D1OB 4B3SH 5DISC 3K5OA 1IBMB 5LP6B 2UUBB 3N2KA 5FNVA 3SJAC 1P8LA 3VQWA 2QM4A 4IAJA 3S24A 3W1GA 3RGBA 4LF7B 4DV3B 4LF9B 3CHXA 4FLZA 4JI8H 5JQGA 4GYCB 3WB1A 1N33H 5FPOA 4WBNB 4DK1A 2HGSA 3UT5A 4DR2B 2HHHB 2UUAB 4F6RA 4GKKH 3K59A 1FVIA 4X1YB 3HKBA 1HNWH 4OX9B 4B3TB 1N32B 5LL6b 4APMA 3VQXA 2HIXA 4AHCA 3U10A 2EX3A 4LNUB 3RR5A 4YJ2A 1CKMA 4Q6GA 1XI1A 1L2ZA 2F93B 5EIBC 2CFMA 4I50A 5K1PA 3N44B 5LXTB 4TOIA 4JI4B 1V9PA 5A2QW 4DV1H 4B3MB 1XNRH 5IYZA 3RFRA 4X1YA 3RYCB 5KX5A 1VS0A 5KHKA 4FFBB 4A2AA 4JI3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN B;  1XDN A;  4GKK B;  1P16 A;  2Q2U A;  4LH7 A;  2F4V B;  4UCR A;  4JYA B;  4DR4 B;  3PN1 A;  2UXB B;  5D1P A;  4DV7 B;  4DR1 B;  4B3S B;  4LF4 B;  4KHP B;  3GJX B;  4YY3 B;  4CC5 A;  1ZAU A;  2VQF B;  4JV5 B;  3KYH C;  4LH6 A;  4B3R B;  3W5O A;  2HVS A;  3BA9 A;  4UCT A;  3GDE A;  2UXD B;  3RTX A;  2ZM6 B;  3NC0 B;  5FPR A;  4JI3 B;  4EEQ A;  1CKN B;  3W1B A;  4DV0 B;  2VQE B;  4UCO A;  4YHH B;  4JI7 B;  3OTO B;  4LFB B;  4EFE A;  4GKJ B;  1IBK B;  3NBZ B;  1XNR B;  4X62 B;  2HVR A;  1J5E B;  2E5L B;  1FJG B;  4JI8 B;  4AQY B;  1B04 A;  4LF6 B;  4DR5 B;  3VNN A;  1N33 B;  5D1O A;  4EFB A;  2VUG A;  3SGI A;  2Q2T A;  4DV2 B;  4JI2 B;  4UFZ A;  3T1Y B;  4X64 B;  1S68 A;  4JI6 B;  4NXM B;  3L2P A;  3QWU A;  1CKN A;  3TY9 A;  2HVQ A;  5D1O B;  5DIS C;  3TY8 A;  1HR0 B;  4PZ8 A;  1IBM B;  2UUB B;  5BR8 B;  4JI5 B;  4LF5 B;  4DRF A;  4DUZ B;  1P8L A;  1I94 B;  4UCS A;  3BAB A;  3S24 A;  3W1G A;  4LF7 B;  4DV3 B;  4LF9 B;  3UQ8 A;  4EQ5 A;  4UCU A;  5FPO A;  4X66 B;  4DV5 B;  3JSL A;  4DR7 B;  4E6N A;  4DR2 B;  2HHH B;  2UUA B;  3BA8 A;  1FVI A;  4DUY B;  1A0I A;  1HNW B;  4OX9 B;  1DGS A;  4B3T B;  1N32 B;  4PZ7 A;  4DR3 B;  2HIX A;  3BAA A;  3RR5 A;  1N36 B;  5LMU B;  4GLX A;  1XNQ B;  1TAE A;  3NBY B;  4K0K B;  4DV6 B;  1XMQ B;  1CKM A;  1X9N A;  2CFM A;  4UCV A;  4TOI A;  5LMN B;  1XMO B;  4JI4 B;  1N34 B;  1V9P A;  4LF8 B;  3GB8 B;  4DV1 B;  1HNZ B;  4B3M B;  2UXC B;  4X65 B;  3TY5 A;  4JI0 B;  1XK5 A;  1HNX B;  1CKO A;  4LFA B;  1IBL B;  2UU9 B;  3T1H B;  2OWO A;  2UUC B;  4PZ6 A;  1TA8 A;  2HIV A;  4DR6 B;  4JI1 B;  1VS0 A;  3JSN A;  4CC6 A;  5IWA B;  4DV4 B;  4LFC B; 
#chains in the Genus database with same CATH topology
 2Q7D A;  1H8H G;  1T5E A;  3D36 C;  4WFA V;  4JI6 H;  2NU6 B;  2W6J G;  1KBL A;  3UT5 B;  4DW0 A;  2FPG B;  3K9S A;  2Q7G A;  2X0S A;  2DWC A;  5DQG A;  2X6B A;  2X7R B;  5LHG A;  1WRV A;  5KG6 A;  3V6H A;  4JI1 H;  4O7T A;  3B2E E;  1K73 W;  4CHI A;  2CDY A;  2HG5 C;  2EIY A;  4U6P A;  4R7R A;  2FTK A;  2Y0I A;  1V54 B;  5EZY B;  2R86 A;  5GON A;  4LNU A;  1NTM H;  4FFP A;  4TUY B;  4I4T F;  2LFS A;  1BCC H;  2YID A;  1URF A;  4X62 H;  3OR6 C;  5LOV A;  2QWN B;  3G6X A;  2F66 C;  1AR1 B;  2Q4P A;  3VNN A;  4TV8 A;  5GTH Z;  5BPF A;  1Q8I A;  4FBT A;  5BMV B;  1YIJ V;  2C2A A;  5EK0 A;  5C8Y F;  5B1A C;  3I12 A;  1BMF G;  5J2U F;  3N40 P;  5JUM A;  3GV7 B;  3H4D A;  1LUW A;  3SE7 A;  4NXM B;  1RJR A;  4I55 A;  3QO7 A;  5KFE A;  4A3L G;  1VBH A;  1S77 D;  2FLP A;  2Q68 A;  1Y4M A;  4J7Z A;  4JXU A;  4IL6 Z;  4J7J A;  2QKA A;  2COI A;  3SYA A;  4DV7 O;  2WLK A;  4HBN A;  1WP7 A;  2ZCE A;  1YZB A;  4B08 A;  5I5V A;  4IHJ B;  1M57 C;  3OMA B;  1GM7 A;  2JEG A;  2P7T C;  4ECZ A;  4UCU A;  2XAJ A;  1THZ A;  4O2A A;  4TT3 G;  4LF8 O;  3S3X A;  3RB4 A;  1KJ9 A;  1PKX A;  5EYP B;  5KFA A;  4XDK A;  1RJQ A;  1NH2 B;  5ITZ A;  1XMQ O;  4ICG A;  2C2E A;  2DIK A;  3ABM B;  2A3Q A;  4O7Y A;  3JAR B;  4DR3 B;  1WA8 A;  2DAB A;  2R7K A;  2QE7 G;  2R93 G;  1XNQ B;  5EWE A;  1Y1W G;  3FB8 C;  3THO A;  3HOX G;  4DAA A;  3CRR A;  5KT7 A;  4LF8 B;  4X89 A;  2CKZ B;  3K5M A;  2YZM A;  1KD1 W;  1KP2 A;  2XGQ A;  4HNT A;  1GMG A;  3HT5 A;  2ZIM A;  2HVK C;  1AI6 A;  1CEZ A;  4U7C A;  3ABK B;  4EB6 A;  4JI1 B;  4JI4 O;  4LFC O;  3Q1K A;  1E1R G;  1XNQ O;  5F9L A;  3WU2 Z;  4J9R A;  2DLN A;  2RCV A;  4C5B A;  2ASD A;  1QLE B;  5BMV A;  2XT9 A;  4ZI7 A;  2C2D A;  2AGQ A;  2OCH A;  4LFB O;  4ECS A;  3SPC A;  3GIP A;  4O4J F;  1HNX O;  3PN1 A;  2CH7 B;  2QM8 A;  5IT9 N;  5EWF A;  4OXS A;  1D5N A;  2CTW A;  5CN0 A;  1SS3 A;  3ZRW A;  4ZIB A;  4DR6 H;  2IJH A;  4IRC A;  1CS0 A;  4O4J B;  5L3G A;  1KJQ A;  2YI8 A;  4K8X A;  4QNH B;  2CZG A;  2YIB D;  2B1I A;  3CRQ A;  4JGS A;  5B1A B;  1XHX A;  4TQD A;  1E79 G;  2ADQ B;  2YEV B;  2OH2 A;  1JPX A;  1JLL B;  2O57 A;  1IBK B;  1WCM G;  4JYB A;  4X1I A;  2RDJ A;  5DGI A;  3RBZ A;  3CCV V;  5LGT A;  4DIM A;  2E5L B;  3JAS A;  3ZHR A;  2B63 G;  2PMZ A;  1Y1V A;  3T5L A;  1IYD A;  2BOC C;  4JTA B;  1N33 B;  4DL5 A;  5DM6 V;  2PMZ E;  3HKE A;  5I5Y A;  4CE5 A;  1GN6 A;  5LA6 B;  3R5F A;  3GID A;  4BR6 A;  1JA8 A;  1R3I C;  1R9T A;  2UUA H;  1P49 A;  4K8Z A;  4O4I B;  1ZQ7 A;  4F4Z A;  5C4X G;  3TY9 A;  4F50 A;  4J11 A;  1R3L C;  2GLT A;  4DR7 H;  1K9M W;  4ME6 A;  1M5I A;  4EG0 A;  2UXB H;  1SQG A;  4O86 A;  4MV9 A;  1JQ0 A;  4X64 O;  3OAA G;  2AZ0 A;  1OCO C;  1TGO A;  1JDB B;  1BGW A;  1MZB A;  3PJS K;  4MTE A;  3K3P A;  4UCS A;  3BAB A;  4DRX A;  4JYA O;  2CE4 A;  2YRW A;  1GYF A;  3PR4 A;  4TSF G;  2HJD A;  3ASO C;  4OPA A;  1GK9 A;  3T9C A;  1GLV A;  4UUJ C;  2DAA A;  3BA8 A;  1M56 B;  4LF5 H;  2CAZ C;  2XUM A;  3MWM A;  3ETH A;  2F1M A;  2PUS A;  5K1X A;  1BS3 A;  4RU9 A;  2BQR A;  2VA2 A;  1AN7 A;  5FLX N;  1V55 B;  3MHH C;  5LA6 F;  5D5P A;  2FK2 A;  1AJN A;  3M8A A;  4HZ3 A;  3TW6 A;  1X9N A;  1KKC A;  4CZZ A;  1YEW A;  2Q69 A;  1SER A;  4MTD A;  2R8K A;  3OEE G;  5CA1 B;  3CSX A;  4I4T A;  1BXR A;  2PGG A;  3TXS A;  5BYA A;  3SPJ A;  5FNV B;  4O7R A;  2W57 A;  4QE7 A;  3N43 B;  4QWB A;  5KT6 A;  4NTX A;  3RGZ A;  4ABM A;  1OWT A;  1QQC A;  2OCC C;  2YSU B;  3QNE A;  1ORQ C;  5JVD F;  4HAM A;  4J9N A;  2JA6 A;  4I4T B;  4B3T H;  3KHL A;  1N32 H;  4UVA A;  1TVK B;  2R92 G;  2Y69 B;  4DV6 O;  1VQN V;  4DV4 B;  4RAY A;  1GM9 A;  4LFC B;  2XC9 A;  3GIJ A;  2ARH A;  3CQZ A;  2KSD A;  1FXV A;  3DTU B;  3ZCC A;  1Y1W A;  5KHH A;  1MOF A;  5L9X A;  4JYA B;  1SCU B;  4LF4 B;  3J7A U;  2BOB C;  3AW8 A;  5LP6 C;  1RM1 B;  1Q81 W;  1I94 H;  4O3P A;  3CCQ V;  4LFB H;  3IFX A;  3ABT A;  1LR1 A;  1VIB A;  4FFK A;  4O2B B;  4Q4C A;  1HR0 H;  4RNO A;  2DYR B;  3L74 H;  4YR2 A;  3N6R A;  2O03 A;  4PJ0 Z;  1WSC A;  1HW7 A;  2HLD G;  1XNR B;  2MK3 A;  3SPH A;  4AQY B;  4F6R B;  2IBK A;  4FK5 C;  2LQT A;  4BWS C;  3E89 A;  2K1E A;  4K35 A;  3RYH A;  3S3W A;  1N34 H;  2QB5 A;  1L0N H;  4UXN A;  2JGU A;  3EVK A;  2W9C A;  1A9X A;  1OCC C;  5EOY A;  3T2M A;  3PR5 B;  5H6R A;  3FB6 C;  5B1O A;  1W93 A;  4P9O A;  4ED6 A;  3LP8 A;  2VR1 A;  5BR8 B;  4JI5 B;  2IM9 A;  2AZ2 A;  4X1I B;  1XMQ H;  3JAK B;  1HNW O;  1EN6 A;  4LF8 H;  2W0X A;  1QU7 A;  3HBL A;  2ZM6 O;  3OSP A;  4RUF A;  5GW7 A;  3E8G A;  1WR2 A;  2ZQM A;  4B3R O;  4GLW A;  1RSO A;  2DYS B;  4O4J A;  4H37 A;  4FM2 A;  3BQ1 A;  2JA7 G;  4B3R H;  3L70 H;  1S5H C;  1NT2 B;  3T54 A;  4P2Z A;  3JAT A;  1YVW A;  1PL4 A;  4PZ7 A;  2ZM6 H;  5KMG A;  5LP6 F;  1IXB A;  2GV9 A;  3QF7 A;  2PI4 A;  3ZRX A;  1IZ3 A;  5KUM A;  3T5J A;  3CCE V;  4K0K B;  2EJ7 A;  2UU9 H;  4MV3 A;  1PM9 A;  2YYA A;  5H9C A;  4ZHQ B;  5LMN B;  4DV5 H;  3SYO A;  3QVN A;  4JI7 H;  1EFR G;  3N6X A;  5C8Y A;  3FYE B;  3K06 A;  5DLG A;  4Q43 A;  1R73 A;  1PNK A;  3JRW A;  3K5H A;  2YCH A;  4GKJ H;  1SZX A;  5LOV F;  2XAQ A;  1QBZ A;  1TA8 A;  1XMO O;  1UC9 A;  2E5L H;  4O2B A;  2V4Q A;  1EKF A;  4DV1 O;  3CC2 V;  3MJF A;  4JI7 O;  2C22 A;  5CBH A;  1NTZ H;  1YJ9 V;  4NXN B;  5LMN O;  4ZOL F;  4TQR A;  3OD4 A;  4LH7 A;  2KSW A;  3IG0 A;  1VBG A;  2E3C A;  4G27 B;  2EJ0 A;  3AYH B;  4TQF A;  4O7W A;  2COJ A;  1KTA A;  2N05 A;  1M1K W;  2ASJ A;  1I6U A;  1PD3 A;  1Z5V A;  2P4V A;  5KFP A;  3TIG A;  2BCC H;  3RYC A;  2GQS A;  1P84 F;  3R5X A;  1E4G T;  3DGE A;  4FU0 A;  4BY7 G;  1I1L A;  4A3J G;  1QR8 A;  3EFF K;  5JVD A;  3GTG A;  2YIC A;  1IBL H;  2FMA A;  4O4L A;  2BTO A;  5BR8 H;  4EKW A;  3B8M A;  2UXB O;  5IWA H;  2EIL C;  3RV4 A;  1GTO A;  4AI8 A;  4MVQ A;  5KFS A;  3APO A;  2CW7 A;  1PPJ H;  5L3D A;  2CQY A;  5LGN A;  2Q9L A;  2AQ4 A;  3TXQ A;  5IYZ B;  4JI8 O;  4KHP O;  1NVP D;  5D1O B;  2Q6A A;  3K5O A;  1NR7 A;  5LP6 B;  2M7W A;  3N2K A;  3WWI A;  4PA4 A;  5KFR A;  4GX1 A;  1P8L A;  3T9E A;  5KUK A;  1N8R W;  3RGB A;  1AJQ A;  1VF5 B;  5CBG A;  4LF7 B;  3GIQ A;  3CHX A;  3TIN A;  4JV1 A;  5JQG A;  3CD6 V;  3JCU Z;  5FPO A;  4RWU A;  4K0K O;  5H5N A;  1SRY A;  2CTR A;  4GKK H;  3L73 H;  3T5K A;  1I5X A;  1JKJ B;  1HNW H;  3HOW G;  4ECY A;  3SNO A;  5L3F A;  2HIX A;  1P7G A;  5BWX A;  3U10 A;  4LNU B;  5KFO A;  1ZL8 A;  4YJ2 A;  1CKM A;  2CFM A;  3KCX A;  1K4D C;  3JRX A;  5KFM A;  4HN2 A;  4HYK A;  4TOI A;  2DOS A;  1FJG O;  1JX4 A;  1KC8 W;  4B3T O;  1N32 O;  2ZDI C;  2DJV A;  3KZI Z;  3T4Z A;  5A2Q W;  3A0B Z;  3TGU H;  2VS0 A;  2XGP A;  1ZL8 B;  1Y66 A;  2YRX A;  3FB5 C;  3N27 A;  4O7V A;  2IU3 A;  4UB8 Z;  5CA3 A;  5KFW A;  3H3V H;  4BBS G;  3J81 N;  3QO8 A;  1VS0 A;  4UV8 A;  3BG5 A;  1VAJ A;  3KKY A;  4A2A A;  3JD1 A;  4JI3 H;  1YI2 V;  1WB7 A;  3NXS A;  1XDN A;  2V9W A;  3KXY T;  4YAJ B;  2Q5Z A;  5K3W A;  5EC1 C;  2P06 A;  3Q4H B;  3OM3 B;  4AQY H;  4PHZ A;  4O3N A;  4YJ3 F;  4X65 O;  4A3I G;  4ZOL B;  4JUZ A;  4CMD A;  5CA0 B;  3M9M B;  5JH7 A;  3GDE A;  3AG7 A;  3OT7 A;  3CB2 A;  4A93 G;  4UV9 A;  3ETD A;  1QNM A;  1F7Y A;  1JJO A;  5EBW C;  1HNZ H;  5KT2 A;  5GTI Z;  1AUX A;  4L1K A;  2EIK C;  2WTF A;  1HNZ O;  3Q2O A;  1VF6 C;  4PDL A;  5JVD B;  2JGD A;  1XEQ A;  4BXX G;  5KA6 A;  1QHT A;  3EXA A;  2W8K A;  1P7B A;  4GX2 A;  2R9R B;  1JXL A;  2P67 A;  3H0G G;  2QTS A;  3CS5 A;  2R85 A;  5EBM C;  3HOU G;  1BSM A;  4IR1 A;  4RQE A;  2Y0S E;  1D2D A;  3MWE A;  4DR7 O;  2Q0A A;  2V1D A;  3QO5 A;  3VBB A;  3M9N B;  2OT5 A;  5CBF A;  3QTC A;  1S0O A;  1VMG A;  1TUE B;  3ICX A;  5I5S A;  2XHB A;  3ETJ A;  1S03 G;  3JAR A;  5BR8 O;  2W6O A;  1R6N A;  3OUZ A;  4JZG A;  1CP9 A;  2ZJT A;  2ZE6 A;  4YY3 H;  5IWA O;  2WWW A;  5L1K A;  4ED2 A;  4LF4 H;  3CCU V;  3H1H H;  1N36 O;  1EKP A;  3ABM C;  2B5U A;  1GGO A;  2DPJ A;  4H0L B;  3G8C A;  3K0D A;  1KC7 A;  2W9A A;  2UUA O;  2WB1 A;  3I55 V;  5KFC A;  4F4X A;  4CH4 A;  5CAE B;  1FFX B;  2P0A A;  3RAX A;  3ORQ A;  3LDE A;  3N2G B;  4NYK A;  5EBL C;  2H94 A;  3V4Z A;  1TWG A;  5CMU A;  4RQF A;  2Q0O C;  2UU9 O;  5CM0 A;  4X64 H;  1FYJ A;  3NUA A;  4U3J B;  2E76 B;  1OZ0 A;  1HNW B;  2XND G;  3U54 A;  1OCO B;  4LCU C;  4O7N A;  5DQH A;  4LSA A;  4HNA B;  5DGB A;  3G80 A;  4I9Q A;  4LFA O;  4I55 B;  1ZUQ A;  3NBY B;  2ZDG A;  2XAG A;  2HGW A;  1AI7 A;  3GTL A;  1QVG U;  3FAV A;  5IP7 G;  1SQV H;  4MTF A;  2Z5U A;  3GB8 B;  2AGP A;  4FLV A;  3PZP A;  1XK5 A;  5DQI A;  2DYR C;  2RDC A;  3DSQ A;  2ZKO A;  5B1B C;  1OHH G;  1RSO B;  3OTO O;  2UUC B;  1M6V A;  2HIV A;  2Z0A A;  4QWC A;  3ASN B;  2LO1 A;  3MFI A;  5AG2 A;  1EKV A;  4BIU A;  5IWA B;  4N23 A;  2YIB A;  5DGA A;  3VOU A;  1GH6 A;  2DMX A;  1WPB A;  1FXK C;  2X6C A;  2B63 A;  5C5J A;  1H2M A;  3IC9 A;  4J9Z B;  4DUY H;  1L8D A;  3KAJ A;  2FP4 B;  3AG3 B;  5BWU A;  1JX9 A;  2VQF B;  2DW4 A;  1IBL O;  4MV6 A;  4ECV A;  1K1S A;  1I94 O;  3BQ2 A;  5BWV A;  2XOK G;  1I5Y A;  1K34 A;  1KMI Z;  5KHG A;  4JI7 B;  2R8G A;  1WCM A;  3KHH A;  3RYH B;  5KX5 F;  5L3B A;  4FLY A;  2NU9 B;  2PI5 A;  4A3C G;  3K3V A;  1BT8 A;  2V4D A;  3QZ8 A;  4JI8 B;  2F23 A;  2JS5 A;  4FLT A;  3KAK A;  4QGP A;  2CW8 A;  4P30 A;  3WB0 A;  4OPH A;  2YS8 A;  2IJK A;  1CKN A;  3CCS V;  5BWR A;  1M0W A;  5FD5 A;  4I55 F;  2V7Q G;  5HFM A;  4NR1 A;  5C1O A;  4ECQ A;  2QF7 A;  4UB6 Z;  1RPO A;  1R3J C;  2R82 A;  4RB2 C;  2VWJ A;  1U96 A;  1O75 A;  4HYO A;  4X66 H;  3GTO A;  1TVK A;  2IJI A;  1Y76 B;  1H2L A;  3WG7 C;  4GKK O;  4X66 B;  3BFR A;  2R7L A;  2M05 A;  2RGR A;  3L75 H;  4L87 A;  3MAQ A;  1AUV A;  1PL0 A;  1SQQ H;  5KT5 A;  2QA4 V;  4FLU A;  4CS3 A;  3BCC H;  5CA1 A;  1WB8 A;  2WAQ A;  1B3Q A;  4BW9 A;  3BAA A;  4O2A F;  4GLX A;  5KG5 A;  3ZHV A;  3ASN C;  5J2T F;  2BR0 A;  1RYR A;  4PDV A;  2A06 H;  4RAI A;  2W8L A;  2P4K A;  3R65 A;  1N34 B;  1V54 C;  1QLN A;  1CQI B;  1HNZ B;  4YHH H;  1IX9 A;  4ED1 A;  5KG2 A;  2VQE H;  4ZOL A;  2FB5 A;  5FL7 G;  3FKI G;  4W4L A;  1CKO A;  4MV4 A;  1TUB B;  1NTK H;  3JYC A;  2OWO A;  3RF2 A;  2VQF H;  4EGQ A;  2WLJ A;  4DV0 H;  4CC6 A;  4DV5 O;  1N56 A;  4CKC A;  4G2K A;  5IYC O;  4IRK A;  1RFY A;  3V4S A;  4O83 A;  5CA0 A;  2L6L A;  4NVP A;  3HOZ G;  4DRX B;  4OX9 H;  2HDK A;  2ZDQ A;  4K6N A;  2KG7 B;  4DR1 B;  2EZO A;  3ETQ A;  2AHY A;  4ED7 A;  3JZF A;  4B3R B;  2WLL B;  1U97 A;  4RNN A;  4UCT A;  3V6J A;  1AR5 A;  1MA1 A;  2EIM B;  3SPI A;  4DV3 O;  3B8N A;  2OTJ V;  2R7M A;  4B3M O;  3C3T A;  2FK1 A;  5L1J A;  2ZE5 A;  1K5S A;  3LUL A;  4RB3 C;  3KG2 A;  2R7N A;  4J9Y B;  4PDB A;  1FFT B;  4UCO A;  3TK1 A;  1IBM O;  2ZE7 A;  2UUB O;  2FK3 A;  4B3M H;  2G38 A;  3G71 V;  5IE9 A;  1GSA A;  1VQ5 V;  1TWA A;  2JRI A;  4LF6 O;  3WNZ A;  2VQD A;  4O4I A;  1N48 A;  3GVM A;  4Q44 A;  3Q8P B;  2EIM C;  2EZP A;  5J2U A;  3KRE A;  4ECX A;  1AI5 A;  3BJY A;  1QCE A;  5K2M A;  4X64 B;  1S68 A;  3F7V C;  2DPI A;  3JAS B;  4LP8 A;  3L2P A;  1EZ1 A;  3QWU A;  1YXB A;  5LYJ B;  2AGA A;  1FPO A;  3ASO B;  4FLX A;  2RDI A;  2R8I A;  5JJN B;  4KHP H;  3JAM W;  2DQ0 A;  2IU0 A;  5DLF A;  3H9V A;  4LF9 O;  2UXN A;  4CKE A;  1IOW A;  2X6A A;  1Q86 W;  1NZ6 A;  4CS4 A;  5KFG A;  4DK0 A;  4ED3 A;  1G6U A;  4FMT A;  3AK3 A;  3RN4 A;  4ZI7 B;  4AIL C;  4JYC A;  4LF5 O;  4PA3 A;  1SQF A;  2R7Z G;  2VWK A;  5EDW A;  1FXK B;  5JCO C;  5BZB A;  2NVX A;  2E74 B;  2R8H A;  1ET0 A;  1GRJ A;  3HKD B;  4XX0 B;  1ZHQ A;  5B66 Z;  3T9D A;  4PDM A;  4FM1 A;  5I47 A;  4FFR A;  2P5O A;  4Q8F A;  1N36 B;  3FD9 A;  2QM7 A;  5KFX A;  4PI2 A;  2NU8 B;  2GTA A;  4MW3 A;  4UCV A;  2JEF A;  1KP3 A;  4QIW F;  3W7U A;  1K8A W;  1T36 A;  5F9N A;  3RYI B;  4DV1 B;  2UXC B;  2HGX A;  4Q20 A;  2PYJ A;  3OFN G;  3OHA A;  2R6F A;  1VQ7 V;  5IP9 G;  3CXH F;  3RB6 A;  4LFA B;  3C3S A;  4Y8V B;  2AXT Z;  2OIE A;  4NXM O;  1AB3 A;  2QEX V;  1BNC A;  2ETN A;  3F7Y C;  2MCT A;  1FXK A;  2ATL A;  2H8P C;  5CB4 A;  3JSN A;  3PW0 A;  4DL2 A;  4A3E G;  1FJG H;  3JD3 A;  1Q6U A;  5KFL A;  3UO2 A;  4JI4 H;  4DR4 H;  4KP4 A;  3M9O B;  4OGQ B;  2RMK B;  3GV8 B;  4JAV A;  4DR4 B;  4O4L F;  2UXB B;  2GUZ B;  1VF6 A;  1RYS A;  4DV0 O;  4CC5 A;  4LH6 A;  3W5O A;  2HVS A;  3IJ4 A;  3RYF B;  2XCL A;  3LQS A;  1GN4 A;  3JD2 A;  1BJT A;  1SQX H;  2PTM A;  2NLJ C;  1XL4 A;  4EEQ A;  1L1F A;  4YR0 A;  4MV1 A;  2WLM A;  2J6S A;  2X5R A;  4AYB A;  4J9Q A;  5DG8 A;  4BAY A;  4RNM A;  3NBZ B;  1UFI A;  4DR6 O;  3RAQ A;  2A79 B;  3Q4H A;  3JAT B;  5LOV B;  1YTF B;  4FJC C;  2OLS A;  2ZNJ A;  1EUC B;  3VQY A;  3HR0 A;  4DR5 B;  3ZS8 C;  1M90 W;  2ZIO A;  2JEI A;  4J10 A;  3KHR A;  1V55 C;  4LMY A;  3RJ0 A;  4O3R A;  4DV2 B;  3TET A;  2NUA B;  4YJ2 B;  2FKL A;  3HKC A;  5EZY A;  4IYH A;  5EWG A;  4BIZ A;  3T99 A;  3OTF A;  3JAK A;  2HVQ A;  5KFV A;  1VP7 A;  3CRM A;  5T14 A;  4GUN A;  4IT5 A;  4MVZ A;  1S0V A;  4YQW A;  3SJA C;  4X66 O;  2FLN A;  4E2L A;  3ABU A;  4NB5 A;  3AEI A;  3VQW A;  4B7E A;  3B40 A;  4IGG A;  4DV3 B;  4LF9 B;  4FLZ A;  1H2N A;  1EUD B;  3T5H A;  1DTO A;  3G6V A;  2W7P A;  4MA5 A;  1FS0 G;  3WB1 A;  3RB0 A;  1N33 H;  1DF4 A;  4YY3 O;  4JAU A;  3A0H Z;  3B77 A;  4WBN B;  2DWD C;  2RN9 A;  3UT5 A;  4DR2 B;  1Y67 A;  2HHH B;  4F6R A;  4A3B G;  3M99 B;  4ECR A;  2FB9 A;  1KBH A;  2XAH A;  4EBE A;  5FR9 A;  4Z1V A;  4AHC A;  4JI0 O;  1Q6H A;  1YTF D;  2J9G A;  4YR3 A;  4X88 A;  1NBM G;  1OCR B;  4F4Y A;  1GM8 A;  3AG1 B;  1WLE A;  1IYE A;  3H01 A;  2DZD A;  1M7J A;  4LC1 A;  4I50 A;  3STL C;  3N44 B;  5LXT B;  3SYQ A;  4JI4 B;  2E5L O;  3UFX B;  1NR1 A;  4GKJ O;  4DR2 O;  1RP3 B;  2YS6 A;  3MR3 A;  2ITD C;  1XNR H;  4BY1 G;  1B06 A;  1ARO P;  3GV5 B;  4YXW G;  1AVM A;  1I3Q A;  5IYZ A;  1QVF U;  2ZXW C;  3ML0 A;  2GBO A;  5KFU A;  2JA8 G;  2VUM A;  4GT1 A;  3RYC B;  1NI8 A;  3NR7 A;  2W6N A;  3FKI A;  4KUM A;  4O2B F;  1GO3 E;  1GSH A;  3OTO H;  5CR5 A;  3B09 A;  1NS1 A;  4O4L B;  1GAX A;  4A3G G;  1JMK C;  1UC8 A;  4IIJ F;  3H1K H;  3EYY A;  2WLI A;  3ZIA G;  1BGY H;  1VQ4 V;  1BQ0 A;  2V58 A;  4C7U A;  3K5I A;  1Z5W A;  2I8C A;  5LHI A;  3AG4 C;  3CRA A;  1AIL A;  5IYB O;  5KFI A;  1EZJ A;  1BL8 A;  1K3E A;  3W7W A;  2RGV A;  5FPR A;  1AI4 A;  3DXR A;  2QWO B;  4JI3 B;  5J2T A;  1A32 A;  1CKN B;  2XAF A;  3CPW U;  3SJC C;  2E2I A;  2KKW A;  5JJJ B;  1NH2 D;  2W70 A;  4YHH B;  2JIZ G;  2Q7E A;  1RK5 A;  3J7A K;  3CCM V;  3T1H H;  1I2K A;  3V6K A;  4K3A A;  2OCC B;  2JA7 A;  2HVR A;  3GIL A;  1KYO F;  3D36 A;  4ZHQ F;  1VQL V;  3G6B A;  2J6T A;  3ZMZ A;  4J9L A;  2Y69 C;  4GX0 A;  3TCU A;  3OUU A;  3H4B A;  5FD6 A;  5FNV F;  3SGI A;  4X9Q A;  4O4H A;  4LF9 H;  3MR6 A;  3LSS A;  4DV2 H;  3F8N A;  2UXD H;  5IDJ A;  3E86 A;  5C93 A;  1JDE A;  2UVR A;  2JA5 A;  5JJE B;  5B3S C;  1HR0 B;  4RUA A;  4PZ8 A;  3GLK A;  4TVI A;  1I50 A;  4DUZ B;  2EUL A;  1CPY A;  4I7H A;  3CCR V;  3CC7 V;  5KFD A;  4DUZ H;  1UPG A;  4EQ5 A;  3CRC A;  4ZBM A;  1DV1 A;  4FFO A;  4MTO A;  4UUG A;  4ED0 A;  4JTD B;  1H38 A;  5LA6 A;  1N0J A;  3ZRS A;  3VPD A;  4QIW E;  1I1K A;  5KG3 A;  5E25 A;  5GON F;  4E6N A;  1YHQ V;  3HB3 B;  3ZHQ A;  3E8F A;  5LYJ F;  3R23 A;  1DGS A;  5KT3 A;  1A0G A;  1VQ8 V;  3GB7 C;  3H1L H;  2JJ2 G;  3CJH A;  1E4F T;  1C30 A;  1K33 A;  3CE2 A;  2JVD A;  1XMQ B;  5IYC G;  5HV6 A;  3CP1 A;  4O4I F;  4R50 A;  4DL7 A;  1XNQ H;  2AHZ A;  4IZO A;  4MVU A;  3H1J H;  3TY5 A;  4NYE A;  1RJP A;  3RIZ A;  4KXR A;  2PF4 E;  2LGW A;  1IBL B;  4J9O A;  4MVO A;  4O3Q A;  5IYB G;  4MT8 A;  2YEV A;  3WWJ A;  4H44 B;  3OUS A;  3D3Q A;  4U3J A;  4X20 A;  4O4H B;  3G8D A;  2VQF O;  1XMO H;  2P22 C;  1DIK A;  3BQ0 A;  3J80 N;  1FFX A;  1P16 A;  3CMA V;  4YIO A;  3A2F A;  1OCC B;  4HNA A;  3L9D A;  3R5H A;  5D1P A;  2LP7 A;  1VQM V;  2QJ1 A;  1W0J G;  1B6Q A;  3SYP A;  1PNL A;  2L35 A;  4DW1 A;  4I0X B;  2YXY A;  5CB4 F;  4RUC A;  1TWF A;  3QQM A;  1A48 A;  4R6Z A;  1KJI A;  1JCH A;  4NXN O;  3H40 A;  1SKV A;  4R7C A;  1NKD A;  1S5J A;  4XZ3 B;  4CKB A;  4O81 A;  4O4H F;  3U9S A;  2AU0 A;  2VRZ A;  2DWE C;  2ZT9 B;  4GKJ B;  2EJ2 A;  2GSM B;  2WYO A;  3E5N A;  5CA1 F;  1XUQ A;  2COG A;  5A2Q N;  2W6P A;  4QIW A;  1VQP V;  5KFJ A;  1B04 A;  2P6J A;  2GHY A;  3T9F A;  4D7T A;  5J2T B;  1ZET A;  4GCZ A;  3UM7 A;  4EFB A;  2E2H A;  3CYO A;  2ABJ A;  4IWY A;  1KEE A;  4O2A B;  4JI2 B;  1H8E G;  4PA9 A;  2NN4 A;  3J81 W;  3GWO A;  3T1H O;  2HHH H;  2CGO A;  5L1L A;  4ASU G;  4C5C A;  4LF4 O;  4Q0Y A;  4ED8 A;  2ZR2 A;  1Z2P X;  2I87 A;  1VQO V;  1JIH A;  2D3O W;  2VPQ A;  2YDE A;  4FE2 A;  1SQB H;  1NU1 H;  2JGD B;  3E22 A;  3K79 A;  1Q82 W;  4NZM A;  1D5A A;  3K58 A;  4R8U A;  5LXT A;  4M7E A;  4IIJ A;  5KS8 A;  4O3S A;  1MMM A;  4LWS A;  1C3O A;  4DL4 A;  2ZIN A;  3CWB H;  2R93 A;  1YSC A;  3OHB A;  3DTG A;  1S97 A;  2LJ2 A;  2QDO A;  1I08 A;  4H13 B;  1M0T A;  1ENV A;  4IHJ F;  1FAF A;  4JI5 H;  3Q8S B;  2YZG A;  1EBO A;  1H2K A;  4PD4 F;  4XBF A;  4RUE A;  4J9K A;  5KG0 A;  1PNM A;  3CEI A;  4WBN A;  1SYX B;  4FIP C;  3T1Y O;  3GII A;  3MFH A;  2C28 A;  1TAE A;  4PDR A;  3SPG A;  2QK4 A;  4K0K H;  3C0F B;  4RZR A;  3T1Y H;  3ETG A;  4D6T H;  2UVU A;  1OCZ B;  3E35 A;  4FM0 A;  1XMO B;  5HNE A;  1I0H A;  2DYS C;  1M93 A;  4IR9 A;  1N0N A;  5J2U B;  2PYL A;  4D7S A;  1EYZ A;  4CH6 A;  5BMV F;  2WB1 E;  2WPD G;  4RCN A;  3T1H B;  1O9H A;  1O9G A;  1WJZ A;  1EZV H;  1EN5 A;  1R3K C;  3JZ6 A;  5LBQ A;  3HKE B;  2W6I G;  5LMU O;  1J95 A;  3VA7 A;  1Z2O X;  4GKK B;  5KAI Z;  3I4M G;  2AGO A;  3GIM A;  2R70 A;  5LGU A;  1KJ8 A;  5DGH A;  4NTY A;  1MZF A;  5CA0 F;  2VPS A;  2OIG A;  1ZTE A;  1SZT A;  4DYL A;  3KYH C;  3VPB A;  4FLW A;  2WE6 A;  4JI2 O;  2UXD B;  2X0L A;  3KAL A;  4O7Z A;  4DLK A;  4CS2 A;  3W1B A;  2BTQ B;  4LWS B;  4DR3 O;  2FLL A;  4WFE A;  4TV9 A;  4LFB B;  2ZNI A;  2C35 B;  3GTK A;  3N2K B;  5B1B B;  2CK3 G;  4MV8 A;  2B1G A;  2IW5 A;  3HO8 A;  1IBK H;  5D5Q A;  3E22 B;  3PVX A;  2ODT X;  4A2B A;  2GQR A;  3WO1 A;  3ABK C;  3OSN A;  2Y4R A;  3F5W C;  3VQV A;  4Z2W A;  3MD0 A;  2HR3 A;  4YBZ B;  5D1O A;  5I60 A;  2VUG A;  5C3E G;  2FPI B;  1YDX A;  4PA7 A;  3ZHS A;  4JF3 A;  1NVP B;  3RYF A;  2PY5 A;  1SC5 B;  2FE3 A;  1OJH A;  3HOY G;  3MR2 A;  2WSS G;  3X2Q C;  1J5E O;  2GUZ A;  4DV7 H;  2EIN C;  4U3F H;  2YXL A;  3JZI A;  5DED A;  1G1X B;  4TWK A;  1H2G A;  4LF5 B;  4DR1 O;  2IMW P;  3BHP A;  4JV2 A;  5IJ9 A;  1Z2N X;  4NTW A;  3PO3 G;  2FL4 A;  2F4V O;  5DG9 A;  1N36 H;  1N33 O;  3JCZ A;  1SA0 B;  4JV5 H;  3GTM A;  5L3E A;  1MNG A;  1Y76 A;  1B6S A;  3BPZ A;  4ZQI A;  1G4Y B;  4NZO A;  1WA8 B;  1V51 A;  2Y4T A;  2RJZ A;  1S3J A;  5H80 A;  3APQ A;  4DUY B;  1A0I A;  1EM1 A;  3RWR D;  2R72 A;  2VUM G;  4JV5 O;  3R66 A;  2Q7H A;  3ZMS A;  4O82 A;  4A3K G;  2Y48 A;  2QSA A;  5EYP A;  3IC7 A;  4LF7 H;  5C8Y B;  5LMU B;  1A3G A;  1ROP A;  4O7L A;  4PA6 A;  3IAY A;  5DAA A;  3C90 A;  5B1N A;  5KFK A;  1COW G;  4FBU A;  4J42 A;  5KHI A;  1I7N A;  5KHJ A;  4LFC H;  3CEB A;  1SQP H;  1Y74 A;  3G4S V;  4EGJ A;  1K97 A;  5KAF Z;  3HKD A;  2IA6 A;  3AK2 A;  2YW2 A;  5KG7 A;  3D3I A;  4X65 B;  2M6Y A;  2Q8V A;  3K5N A;  3TEK A;  1WH2 A;  4J7K A;  4MVM A;  2R87 A;  5LMN H;  3K9A A;  4P9P A;  5KFH A;  2PBZ A;  4E4T A;  4TUY A;  5LYJ A;  4ZHQ A;  4QWA A;  3I5D A;  4MS2 A;  2QWR B;  1PV0 A;  1KUQ A;  1DV2 A;  3BVO A;  5H6Q A;  4ECU A;  2ZR3 A;  5KT4 A;  1XQ8 A;  5KMG B;  3B4S A;  1R6K A;  2DQ3 A;  4TV8 B;  1RPR A;  3RV3 A;  2W9B B;  2EIJ C;  1BHB A;  4DV3 H;  3RBE A;  4YJ3 B;  4UCR A;  1HP8 A;  2IH1 C;  4NXN H;  2A9H A;  2HEP A;  1B6R A;  3GJX B;  4U7N A;  4FGR A;  1X59 A;  3RB3 A;  4ETS A;  1IOV A;  3LNM B;  2WAQ E;  2FKX A;  3W7T A;  1Q43 A;  5KFQ A;  3UYY A;  3E2E A;  3GWK C;  3MWD A;  1Y1V G;  4JTC B;  5IY5 B;  4MAM A;  5JVL A;  3PW4 A;  2WLL A;  4I9W A;  4QWE A;  2NNU A;  2UXC O;  5L1I A;  5H2F Z;  3L72 H;  2CUG A;  1XHZ A;  2EIN B;  3ZJZ A;  4ZKI A;  2BSK A;  3FMA A;  3RVY A;  2NR5 A;  4Z1M G;  1JOY A;  2W6Q A;  4EBD A;  5F2V O;  1G2W A;  2R9A A;  4IWX A;  1FXH A;  3CVZ A;  3K5L A;  4O84 A;  2Q2T A;  3I56 V;  4MSW C;  1S10 A;  1Z2G A;  2IBZ H;  5LL6 Y;  3U0Z A;  1OCZ C;  3STZ C;  3H1I H;  3E8H A;  1YCI A;  4AYB E;  4B3S H;  3T1C A;  3TII A;  2KG7 A;  1K1Q A;  2GPW A;  4WBN F;  4B3S O;  4CMF A;  2XCP A;  5DEC A;  3HKZ E;  3S24 A;  3W1G A;  1DK1 A;  1IUR A;  2QYZ A;  1VAR A;  4JI8 H;  2YXH A;  4QW9 A;  4ECW A;  4C5A A;  1W0K G;  1OV9 A;  4I5S A;  1YF2 A;  3HPL C;  4X1Y B;  3W7X A;  3KCY A;  1FVI A;  4B3T B;  2JS3 A;  4DUZ O;  1YJW V;  1N32 B;  3DAA A;  4YJ2 F;  4APM A;  5LL6 b;  1RK6 A;  2EX3 A;  3FX7 A;  3RR5 A;  4BBR G;  1Q7Y W;  1XRE A;  1R6T A;  1L2Z A;  3ZN0 A;  1IXM A;  2N04 A;  5EIB C;  2V59 A;  3OMN B;  5KA5 A;  4H33 A;  1GN2 A;  4B3M B;  3LWB A;  1TWC A;  2YUA A;  3P3P A;  1Y6X A;  2XTA A;  3K3W A;  1I1M A;  1IDS A;  4GC6 A;  3F5T A;  3VPC A;  4MA0 A;  2WAM A;  3IN5 A;  2DN9 A;  2IH3 C;  2XD4 A;  3RFR A;  5BWT A;  4X1Y A;  4YAK B;  2WA3 A;  4B7K A;  3AG1 C;  1F51 A;  5KHK A;  4FFB B;  2V5A A;  1DLB A;  2R9I A;  4YHH O;  2VA3 A;  4I0X A;  4XDL A;  4QE9 A;  2BE3 A;  3SR2 C;  5JH7 B;  1DF5 A;  4X1K B;  5D8D A;  2ASL A;  3E8B A;  5I5X A;  3OUF A;  1WPX A;  3X2Q B;  4DV7 B;  4KHP B;  3PW2 A;  1HWY A;  5KFZ A;  4RZQ A;  3A0R A;  3U9T A;  1H2S B;  3FFQ A;  4CH3 A;  4TV8 F;  2YIA A;  2EJR A;  1S0N A;  3MR5 A;  3ETE A;  3WWH A;  4QJF A;  2ATK C;  3NC0 B;  3AG2 B;  3K03 A;  2VOB A;  4I50 B;  1E4E B;  1S76 D;  4MTG A;  4DV0 B;  2VQE B;  4WFH A;  1GN3 A;  3OTO B;  3ZRV A;  2UVW A;  3RUP A;  4EFE A;  4FFM A;  5FLX W;  2K9P A;  4TQS A;  4YB8 B;  2A0L A;  4PI0 A;  5JCO A;  5DG7 A;  4X8A A;  2BSK B;  2UXX A;  4A5U B;  4MVR A;  2C2R A;  4F6E A;  3HB9 A;  4LF6 H;  2PN1 A;  3O65 A;  3GTQ A;  3SJB C;  1JR9 A;  2CGN A;  2HVJ C;  2F4V H;  3CJH B;  1Q90 D;  3JAM N;  3CSW A;  2JDI G;  2R84 A;  3RVZ A;  4RAZ A;  1WNS A;  4MV7 A;  4DR1 H;  3J80 W;  3OE7 G;  5C1P A;  3ZRW B;  5JQW A;  2ZGI A;  4XYL B;  1F23 A;  1I94 B;  3EPG A;  1K4C C;  3FAV B;  3JAW A;  4KL1 A;  2I80 A;  1FKA O;  2HHH O;  1PK8 A;  2YWV A;  4LR3 A;  4M9U A;  4A3M G;  2JEJ A;  1KT8 A;  1LUV A;  1Q3E A;  3HKC B;  4W4K A;  2HJW A;  3UQ8 A;  5JQG B;  1BQZ A;  4J80 A;  3R9R A;  3JSL A;  1Q6I A;  1WP8 A;  3ZMV A;  3NGD A;  3MDS A;  1KJJ A;  3ZHU A;  2KB1 A;  4WHX A;  3DF7 A;  2DE0 X;  4BIO A;  3UCS C;  1XL6 A;  1Y74 B;  2YZN A;  3N2G A;  1XIL A;  2ILM A;  3OGI B;  4WF9 V;  5J9P C;  4F4L A;  3PW5 A;  2CTP A;  1X4T A;  4JPR A;  4BWA A;  4EB6 B;  4GZR B;  3N8D A;  2UUC O;  2GTS A;  4WFB V;  2H3O A;  2A1H A;  2Y4U A;  4JI0 B;  3JD0 A;  3BY6 A;  4EBC A;  1VQK V;  2QWP B;  1K5Q A;  2HP8 A;  2LW1 A;  4FS2 A;  5IJ0 B;  3TJT A;  4DR6 B;  4DUY O;  3H20 A;  3H0G A;  2W6M A;  1V4Y A;  2PZS A;  4DR5 H;  4NLG A;  5KFT A;  1JJ2 U;  5KLV H;  5B5E Z;  3O9O A;  3AX6 A;  2XCA A;  5IJ9 B;  4WD3 A;  4DV6 H;  3P3N A;  1BZK A;  3SYC A;  5CB4 B;  3G6E V;  3WO0 A;  3K0G A;  4IHJ A;  1SA0 A;  1ULZ A;  1ZLZ A;  2Q73 A;  4QWD A;  4JI1 O;  1W2B U;  3JD4 A;  4B3S B;  1IBM H;  2UUB H;  1ZAU A;  4J9M A;  2B9Z A;  2W71 A;  4MW8 A;  3FB7 C;  2HFE C;  3BA9 A;  5ITZ B;  3KHG A;  5LMU H;  2D2C B;  1SES A;  3RTX A;  1SFO A;  3BRC A;  2CTQ A;  3WFV A;  2CNU A;  4JI2 H;  3CC4 V;  5I5T A;  1Y14 B;  4WCE V;  2UXC H;  4IRD A;  3OEH G;  1N4C A;  2FYU H;  5KG1 A;  1QR9 A;  4DL6 A;  1L0L H;  5IYD O;  1WAZ A;  3RW0 A;  3E83 A;  3MHS C;  2FJZ A;  3AG3 C;  5B3S B;  1M4U A;  2ZDH A;  2Y0P A;  1BE3 H;  1S72 V;  1FJG B;  1PX2 A;  2JA6 G;  2BTQ A;  5JWP A;  2PVP A;  4LF6 B;  1GKF A;  4ECT A;  3GQC A;  1HR0 O;  3Q8Q B;  2UXD O;  3JAL B;  4DO2 A;  4YIP A;  3QFF A;  2WDT A;  1K83 A;  1SF9 A;  4XDJ A;  2R7Z A;  3VOT A;  5HBR B;  3OMI B;  3GIK A;  1T94 A;  5KFN A;  3TY8 A;  1P4R A;  4HNU A;  3LSQ A;  5KFF A;  1MSD A;  3P30 A;  1I7F A;  4G28 B;  1J5E H;  4TV9 B;  4DRF A;  2FML A;  3BEH A;  2JK5 C;  5L3C A;  2Y0S A;  3DTF A;  3DC6 A;  3LDC A;  5GON B;  4DQN A;  1I2L A;  2QGN A;  5C44 G;  3CME V;  2BQ3 A;  4TV9 F;  3JAW B;  4DR7 B;  1I7L A;  4NZN A;  4DV4 O;  4E4E A;  1YJN V;  2XIG A;  5EC2 C;  1XDC A;  3LDD A;  2W0F C;  1AJP A;  2YL2 A;  4G3I A;  3LML A;  5E1A C;  5BWW A;  1UNN C;  3ZN1 A;  1HDJ A;  3M4I A;  3N41 B;  3WG7 B;  4N21 A;  4QPK A;  1AP5 A;  3JAL A;  4LSX A;  4DV4 H;  2CNV A;  2VQE O;  3W7S A;  2UVV A;  4JI3 O;  5BYB A;  5KX5 B;  5LP6 A;  1XBL A;  3U11 A;  1HNX B;  4FFN A;  3VMM A;  4LFA H;  3UO3 A;  5EIB D;  4DR2 H;  3L4K A;  2Z3Y A;  3HKB B;  1HNX H;  1XNR O;  2AW9 A;  2JA5 G;  3OGC C;  4TUY F;  1E4E A;  5I5W A;  2LW7 A;  3N42 B;  3ABL C;  2Q2U A;  3CCL V;  2EJ3 A;  1VQ6 V;  2F4V B;  3SI8 A;  1LNQ A;  4O7S A;  1OBD A;  2MW2 B;  2ZE8 A;  3LNN A;  3P32 A;  4DR5 O;  3TQ1 A;  1B33 N;  4YY3 B;  4OX9 O;  2FPP B;  3GTP A;  2OYQ A;  5KFY A;  1VF7 A;  3CX5 F;  3FDS A;  2ITC C;  3I4N G;  4PV1 B;  4IIJ B;  3M7M X;  4HR7 A;  3ZHT A;  2ZM6 B;  1F4N A;  2LGQ A;  4R8U B;  2J6U A;  1M57 B;  2P90 A;  4FZ1 A;  4BW5 A;  4R8C A;  4J0M A;  4FFB A;  5HFL A;  1ZWI C;  1S0M A;  1US6 A;  2Q67 A;  5CE8 A;  4QW8 A;  1K7D A;  3ZED A;  5DMX A;  4WFG A;  1E1Q G;  4RB1 A;  1R1B A;  3U0G A;  2ZXW B;  2RQ6 A;  2ALZ A;  1J5E B;  4J9P A;  1KEC A;  2N74 A;  3RYI A;  4O3O A;  2QKS A;  4JV0 A;  4L8J A;  2YI9 A;  3OR7 C;  2Z04 A;  5BXZ A;  4UFZ A;  2QTO A;  4JI6 B;  1ZSP A;  5IJ0 A;  4X62 O;  4DV2 O;  3Q8R B;  3QG5 A;  1NJI W;  3L71 H;  1FKA H;  3T7A A;  1GO3 F;  5LHH A;  1GSO A;  3ZBH A;  5JQG F;  2HKO A;  2WA4 A;  4RB0 A;  3AG2 C;  2HHF A;  4I7Z B;  1NQT A;  2Z02 A;  4EYI B;  4UVC A;  4X20 B;  1AP6 A;  4FM9 A;  4JI0 H;  5KKN B;  2HG8 A;  4JYA H;  2GPS A;  2F43 G;  3RT3 C;  4DV5 B;  4A3D G;  3TQT A;  4JI5 O;  3KTM A;  4F4W A;  2EBO A;  1OBG A;  2UUC H;  2NU7 B;  2R8J A;  2BQU A;  4GX5 A;  5KG4 A;  4FZ0 A;  4M0J A;  2SCU B;  1CE8 A;  2F95 B;  3LUT B;  1IVS A;  3PW7 A;  1JFF A;  1MZE A;  4Q4D A;  3ZMU A;  4IYI A;  3AG4 B;  2WLH A;  3RGX A;  4A3F G;  4YP3 A;  4NXM H;  4DV6 B;  5IYZ F;  1EHI A;  3G6Y A;  4EEY A;  3GTJ A;  5DN6 G;  1KB9 F;  1VKZ A;  4TM5 A;  2RF4 A;  2EIJ B;  3HXL A;  1MSW D;  2EIK B;  4NKG B;  3FKS G;  4Q45 A;  1UJW B;  2YC0 A;  1MAB G;  3HOV G;  4KFM A;  3CCJ V;  5BPH A;  3CXC U;  4PZ6 A;  3RBD A;  4I50 F;  1F4M A;  4MTX A;  2C00 A;  5EZY F;  4HNV A;  2W9C B;  3WB2 A;  2HJF C;  2JJ1 G;  4DR4 O;  1RM1 C;  2ODM A;  2UU9 B;  1KKD A;  2W9B A;  2W7O A;  1ZHS A;  4GC7 A;  4RO2 A;  4QJF B;  2YZL A;  4Q8E A;  5IY5 C;  3T9B A;  5IT9 W;  3K04 A;  5IYD G;  5FJ8 G;  4X65 H;  5TIS Z;  2NVY A;  1JFF B;  4DR3 H;  3G67 A;  4QPJ A;  2CH7 A;  5JH7 F;  3UZO A;  1KU9 A;  4C2M A;  1XOU A;  4JAS A;  4DXW A;  4AQY O;  4JV5 B;  3L4J A;  1WN7 A;  3D8C A;  2A7W A;  2YS7 A;  4YJ3 A;  2ZDI A;  2E75 B;  2EIL B;  1BHA A;  3K08 A;  4PBC A;  1Q5O A;  2HHF B;  3A8T A;  4FVM A;  2V4R A;  1ZX3 A;  3DC5 A;  2OTL V;  4WFF A;  1S5L Z;  4J9S A;  1G8M A;  2IP4 A;  4DL3 A;  4PWQ A;  3K57 A;  4U7O A;  1W96 A;  4JAA A;  2W6Z A;  1TUB A;  3AK1 A;  4X62 B;  1TWH A;  1SEI A;  2XAS A;  2KQX A;  4X1K A;  2CNQ A;  1M56 C;  1N34 O;  1IBK O;  5LXT F;  1KUT A;  3SJQ C;  2LFR A;  3ABL B;  1KQS U;  4XYM B;  3T1Y B;  3SDL A;  2YU9 A;  1AR4 A;  4HQ6 A;  4J41 A;  3DXR B;  4CH5 A;  5DIS C;  2R92 A;  2WLN A;  2JEX A;  4UVB A;  4LBE C;  2WLI B;  1IBM B;  2UUB B;  5FNV A;  1CXZ B;  1M9N A;  2JEU A;  5FLM G;  2QM4 A;  3T4D A;  1VEW A;  3BAC A;  4IAJ A;  2RNB A;  3EPI A;  2QWQ B;  1OCR C;  4CBC A;  4GYC B;  4ZI7 F;  1SET A;  1W59 A;  1QLE C;  3ZMT A;  1S9F A;  3IGA C;  1JVM A;  1VQ9 V;  3UZB A;  4DK1 A;  2HGS A;  2QR4 A;  3ZX6 A;  4JZ2 A;  2UUA B;  3K59 A;  1K92 A;  1T3N A;  3HKB A;  3RFC A;  4JYY A;  4LF7 O;  1MG1 A;  2GDS A;  4OX9 B;  4FFL A;  1EN4 A;  3VQX A;  1DAA A;  3EHB B;  4FS1 A;  4Q6G A;  1XI1 A;  2IJJ A;  2F93 B;  1PP9 H;  4FPP A;  3OW2 U;  5K1P A;  3TW7 A;  3FYI B;  1V9P A;  3LSU A;  3UKM A;  4DV1 H;  3PO2 G;  3T9A A;  4MVS A;  2ZD9 A;  3HKZ A;  1FD9 A;  5E79 Z;  3U55 A;  2QKC A;  4EYH B;  5A9G A;  3ORR A;  4PEL A;  5I5U A;  5KFB A;  3QZ7 A;  1CQJ B;  5KX5 A;  5BY1 A;  2ADP A;  3PFF A;  1YIT V;  4QSH A;  4JI6 O; 
#chains in the Genus database with same CATH homology
 1XDN A;  3KXY T;  3SR2 C;  5JH7 B;  3OTO H;  1T5E A;  4JI6 H;  4O4L B;  4X1K B;  1JMK C;  3EYY A;  3UT5 B;  4AQY H;  2Q7G A;  4PHZ A;  4DV7 B;  4KHP B;  4RZQ A;  1Z5W A;  1H2S B;  3FFQ A;  4ZOL B;  4CH3 A;  4JI1 H;  2YIA A;  3B2E E;  5CA0 B;  5JH7 A;  3GDE A;  3CB2 A;  4R7R A;  3NC0 B;  2RGV A;  5FPR A;  4JI3 B;  1CKN B;  5J2T A;  5EZY B;  2VOB A;  1JJO A;  4I50 B;  1HNZ H;  3SJC C;  2KKW A;  5JJJ B;  4DV0 B;  2VQE B;  5GON A;  4YHH B;  3OTO B;  4LNU A;  2Q7E A;  4TUY B;  4EFE A;  3J7A K;  5FLX W;  3T1H H;  5JVD B;  4X62 H;  1QHT A;  2HVR A;  4PI0 A;  5JCO A;  5LOV A;  2F66 C;  4LF6 H;  3VNN A;  4TV8 A;  1Q8I A;  5FD6 A;  5BMV B;  3SGI A;  4O4H A;  3SJB C;  3N40 P;  4DV2 H;  4LF9 H;  2Q0A A;  3F8N A;  2F4V H;  4NXM B;  4I55 A;  2UXD H;  3QTC A;  3ICX A;  5JJE B;  4RAZ A;  2XHB A;  1WNS A;  3JAR A;  4MV7 A;  1S03 G;  4DR1 H;  2ZJT A;  1HR0 B;  4YY3 H;  3J80 W;  4PZ8 A;  4LF4 H;  4HBN A;  4DUZ B;  1I94 B;  2ZCE A;  4KL1 A;  4I7H A;  3JAW A;  4B08 A;  4LR3 A;  4IHJ B;  4DUZ H;  1Q3E A;  3HKC B;  3UQ8 A;  4EQ5 A;  4UCU A;  4CH4 A;  5JQG B;  1FFX B;  4O2A A;  3N2G B;  5LA6 A;  5EYP B;  3JSL A;  4X64 H;  4E6N A;  5ITZ A;  4U3J B;  3DF7 A;  1HNW B;  1DGS A;  3JAR B;  4DR3 B;  4LSA A;  4HNA B;  3N2G A;  4I9Q A;  4I55 B;  1XNQ B;  1E4F T;  3NBY B;  1X4T A;  2JVD A;  1XMQ B;  4BWA A;  4EB6 B;  3THO A;  1XNQ H;  4LF8 B;  3GB8 B;  4FLV A;  3K5M A;  3TY5 A;  4JI0 B;  1XK5 A;  3DSQ A;  3RIZ A;  1IBL B;  2UUC B;  2ZIM A;  5IJ0 B;  2HIV A;  4DR6 B;  3H20 A;  4EB6 A;  4U3J A;  4JI1 B;  4X20 A;  4DR5 H;  2PZS A;  5IWA B;  4O4H B;  2YIB A;  5BMV A;  2P22 C;  1XMO H;  4ZI7 A;  1FFX A;  1WPB A;  5IJ9 B;  1P16 A;  4DV6 H;  5CB4 B;  3A2F A;  4IHJ A;  1SA0 A;  4HNA A;  3PN1 A;  4DUY H;  1L8D A;  5D1P A;  3KAJ A;  4B3S B;  1IBM H;  2UUB H;  2QJ1 A;  1ZAU A;  2VQF B;  4ZIB A;  4DR6 H;  5ITZ B;  3BA9 A;  5LMU H;  4O4J B;  2YI8 A;  4K8X A;  3RTX A;  3BRC A;  2YIB D;  4JI2 H;  2UXC H;  1XHX A;  1SKV A;  1S5J A;  1KMI Z;  4TQD A;  5KHG A;  4JI7 B;  3RYH B;  4GKJ B;  1IBK B;  2WYO A;  4X1I A;  4FLY A;  3K3V A;  1M4U A;  2V4D A;  2E5L B;  3JAS A;  1FJG B;  4JI8 B;  1B04 A;  2BTQ A;  2JS5 A;  4LF6 B;  4D7T A;  4FLT A;  5J2T B;  1N33 B;  3KAK A;  3HKE A;  4EFB A;  5LA6 B;  2CW8 A;  3JAL B;  3WB0 A;  4O2A B;  4JI2 B;  2WDT A;  3J81 W;  2HHH H;  2UUA H;  1P49 A;  4K8Z A;  4O4I B;  1CKN A;  3TY9 A;  4Q0Y A;  4DR7 H;  1M0W A;  3TY8 A;  1Z2P X;  5FD5 A;  1M5I A;  2UXB H;  1SQG A;  1I7F A;  1J5E H;  4MV9 A;  4TV9 B;  4DRF A;  1TGO A;  1MZB A;  1BGW A;  3E22 A;  4RB2 C;  2VWJ A;  4MTE A;  1D5A A;  3K58 A;  1O75 A;  4UCS A;  3BAB A;  5LXT A;  4M7E A;  4X66 H;  4DRX A;  1TVK A;  4IIJ A;  5GON B;  1GYF A;  2ZIN A;  4X66 B;  3JAW B;  4DR7 B;  2RGR A;  1M0T A;  2XIG A;  3MAQ A;  3BA8 A;  4JI5 H;  4LF5 H;  2CAZ C;  3MWM A;  4FLU A;  2F1M A;  2PUS A;  4CS3 A;  5K1X A;  5CA1 A;  3LML A;  4WBN A;  1AN7 A;  1SYX B;  4BW9 A;  3BAA A;  3M4I A;  3N41 B;  4GLX A;  5D5P A;  1TAE A;  4K0K H;  3C0F B;  4LSX A;  3JAL A;  1X9N A;  4DV4 H;  3T1Y H;  1YEW A;  4FM0 A;  1XMO B;  4MTD A;  1N34 B;  1M93 A;  5CA1 B;  3CSX A;  5J2U B;  4I4T A;  1HNZ B;  2PYL A;  2PGG A;  4D7S A;  4YHH H;  4CH6 A;  5FNV B;  5KX5 B;  2VQE H;  5LP6 A;  3U11 A;  4ZOL A;  1HNX B;  2W57 A;  1CKO A;  3N43 B;  4LFA H;  1TUB B;  3T1H B;  3RF2 A;  5EIB D;  2OWO A;  1O9H A;  1O9G A;  3RGZ A;  3L4K A;  1QQC A;  4DR2 H;  2VQF H;  3HKB B;  1HNX H;  4I4T B;  4DV0 H;  4B3T H;  4CC6 A;  1N32 H;  1TVK B;  4DV4 B;  3N42 B;  4RAY A;  4LFC B;  3HKE B;  1Z2O X;  4GKK B;  2Q2U A;  5KHH A;  5CA0 A;  2F4V B;  4NVP A;  2R70 A;  4DRX B;  4JYA B;  4OX9 H;  3LNN A;  2VPS A;  4DR1 B;  3ETQ A;  4LF4 B;  4YY3 B;  3KYH C;  5LP6 C;  4B3R B;  4FLW A;  2OYQ A;  1VF7 A;  2WE6 A;  1I94 H;  4UCT A;  4IIJ B;  2UXD B;  4LFB H;  3M7M X;  2ZM6 B;  3KAL A;  4CS2 A;  4RB3 C;  4O2B B;  3W1B A;  2BTQ B;  4FFB A;  4J0M A;  1HR0 H;  4PDB A;  4TV9 A;  4UCO A;  2ZNI A;  4LFB B;  4B3M H;  3N2K B;  3ZED A;  2O03 A;  4RB1 A;  1HW7 A;  5D5Q A;  1IBK H;  3E22 B;  1XNR B;  4A2B A;  2RQ6 A;  4O4I A;  1J5E B;  4AQY B;  4F6R B;  3RYI A;  3VQV A;  5J2U A;  4BWS C;  4L8J A;  2YI9 A;  3RYH A;  5D1O A;  1N34 H;  2VUG A;  4UFZ A;  3RYF A;  4X64 B;  2PY5 A;  1S68 A;  4JI6 B;  3JAS B;  2FE3 A;  2JGU A;  5IJ0 A;  3L2P A;  3QWU A;  5EOY A;  5LYJ B;  4DV7 H;  4FLX A;  3QG5 A;  2YXL A;  5JJN B;  4KHP H;  5BR8 B;  4JI5 B;  4LF5 B;  3JAM W;  1FKA H;  3BHP A;  2IM9 A;  5IJ9 A;  1Z2N X;  1XMQ H;  4X1I B;  4RB0 A;  1N36 H;  3JAK B;  1SA0 B;  4JV5 H;  4CS4 A;  4LF8 H;  4X20 B;  4DK0 A;  4FM9 A;  1G6U A;  4JI0 H;  3BPZ A;  4JYA H;  4ZI7 B;  4DV5 B;  4AIL C;  1RSO A;  1SQF A;  2RJZ A;  4O4J A;  2UUC H;  2VWK A;  5JCO C;  4FM2 A;  4B3R H;  4DUY B;  1A0I A;  1NT2 B;  2R72 A;  3RWR D;  3JAT A;  1ZHQ A;  3HKD B;  2Q7H A;  4PZ7 A;  2F95 B;  5EYP A;  2ZM6 H;  5KMG A;  4FM1 A;  1JFF A;  2GV9 A;  3QF7 A;  2P5O A;  4LF7 H;  5C8Y B;  5LMU B;  1N36 B;  3RGX A;  4NXM H;  4PI2 A;  4K0K B;  4DV6 B;  3IAY A;  2UU9 H;  4UCV A;  5KHI A;  5KHJ A;  4ZHQ B;  5LMN B;  4LFC H;  4DV5 H;  3HKD A;  3RYI B;  4DV1 B;  2UXC B;  3HXL A;  4JI7 H;  4X65 B;  2PYJ A;  3K5N A;  1WH2 A;  3N6X A;  5C8Y A;  5LMN H;  4LFA B;  2YCH A;  4GKJ H;  4TUY A;  5LYJ A;  4PZ6 A;  4ZHQ A;  1TA8 A;  3WB2 A;  2MCT A;  5CB4 A;  3JSN A;  4O2B A;  2E5L H;  1FJG H;  2UU9 B;  1XQ8 A;  4JI4 H;  1ZHS A;  5KMG B;  4TV8 B;  4NXN B;  4DR4 H;  4DV3 H;  5IT9 W;  4YJ3 B;  4LH7 A;  2KSW A;  3IG0 A;  4X65 H;  4UCR A;  2E3C A;  4DR4 B;  4NXN H;  1JFF B;  2UXB B;  4DR3 H;  4TQF A;  2HEP A;  3GJX B;  1KU9 A;  4CC5 A;  4JV5 B;  3L4J A;  4LH6 A;  4ETS A;  1WN7 A;  3W5O A;  2HVS A;  3RYF B;  4YJ3 A;  1Q43 A;  1I6U A;  1BJT A;  1Q5O A;  2PTM A;  4EEQ A;  1Z5V A;  4FVM A;  3RYC A;  1E4G T;  3K57 A;  5JVD A;  3NBZ B;  1TUB A;  1IBL H;  1XHZ A;  4X62 B;  3JAT B;  3FMA A;  5LOV B;  1SEI A;  4O4L A;  4X1K A;  2BTO A;  5BR8 H;  2ZNJ A;  3VQY A;  5IWA H;  4DR5 B;  3ZS8 C;  2ZIO A;  2R9A A;  3CVZ A;  4LMY A;  3K5L A;  2Q2T A;  2CW7 A;  4DV2 B;  3RJ0 A;  3T1Y B;  4YJ2 B;  3HKC A;  5EZY A;  5IYZ B;  3U0Z A;  3OTF A;  3JAK A;  2HVQ A;  4CH5 A;  5D1O B;  4B3S H;  5DIS C;  3K5O A;  1IBM B;  5LP6 B;  2UUB B;  3N2K A;  5FNV A;  3SJA C;  1P8L A;  3VQW A;  2QM4 A;  4IAJ A;  3S24 A;  3W1G A;  3RGB A;  4LF7 B;  4DV3 B;  4LF9 B;  3CHX A;  4FLZ A;  4JI8 H;  5JQG A;  4GYC B;  3WB1 A;  1N33 H;  5FPO A;  4WBN B;  4DK1 A;  2HGS A;  3UT5 A;  4DR2 B;  2HHH B;  2UUA B;  4F6R A;  4GKK H;  3K59 A;  1FVI A;  4X1Y B;  3HKB A;  1HNW H;  4OX9 B;  4B3T B;  1N32 B;  5LL6 b;  4APM A;  3VQX A;  2HIX A;  4AHC A;  3U10 A;  2EX3 A;  4LNU B;  3RR5 A;  4YJ2 A;  1CKM A;  4Q6G A;  1XI1 A;  1L2Z A;  2F93 B;  5EIB C;  2CFM A;  4I50 A;  5K1P A;  3N44 B;  5LXT B;  4TOI A;  4JI4 B;  1V9P A;  5A2Q W;  4DV1 H;  4B3M B;  1XNR H;  5IYZ A;  3RFR A;  4X1Y A;  3RYC B;  5KX5 A;  1VS0 A;  5KHK A;  4FFB B;  4A2A A;  4JI3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...