4UCVA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
total genus 95
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucvA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucvA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucvA02
3TY8A 2Q2TA 3L2PA 4DR2B 1CKNB 3S24A 4DV1B 3TY5A 3GB8B 1X9NA 4YY3B 4NXNB 3KYHC 1XDNA 4LF9B 3TY9A 1HNXB 5IWAB 4DV4B 2UUAB 2HVRA 3BABA 3BA9A 5FPRA 3JSLA 1N34B 5D1OB 2HVSA 1DGSA 1J5EB 4UCVA 4EQ5A 5LMNB 2HIVA 3GJXB 3RR5A 4X65B 1XMQB 4DR4B 1TAEA 3NBZB 2CFMA 1HR0B 4JI3B 4B3SB 4GKKB 4LF6B 4JI1B 4JYAB 2HIXA 1V9PA 4CC5A 2UU9B 4NXMB 4B3MB 4E6NA 4LH6A 1HNWB 4JI2B 3T1YB 4EFBA 1FVIA 4UCTA 3UQ8A 4X62B 4LF5B 3JSNA 4DV3B 3PN1A 1A0IA 2UXDB 4DR5B 4K0KB 2UUCB 4JV5B 3W1BA 5BR8B 4UCSA 3NC0B 4LH7A 2F4VB 1FJGB 4DUYB 4DV2B 4JI8B 1B04A 4DR7B 4LF4B 4X66B 5FPOA 4LF8B 4OX9B 3RTXA 3W1GA 2OWOA 4EEQA 1XNQB 4LFCB 2UXCB 1CKNA 2HVQA 3W5OA 1ZAUA 4X64B 2Q2UA 1I94B 3NBYB 4LFAB 4GLXA 3BAAA 4B3RB 1CKMA 5D1PA 4DV5B 1XMOB 4KHPB 2VQFB 4CC6A 4TOIA 4EFEA 5D1OA 1P16A 4LF7B 1XNRB 3GDEA 4JI4B 4PZ7A 3VNNA 4DUZB 4LFBB 3BA8A 4PZ6A 2UUBB 5LMUB 4JI5B 4DR6B 2VQEB 4DV0B 4JI7B 4DR1B 4DR3B 4DRFA 4B3TB 4UFZA 2ZM6B 4YHHB 1S68A 4JI0B 1IBMB 4UCRA 4DV6B 4JI6B 1HNZB 2E5LB 3OTOB 2UXBB 3QWUA 5DISC 4AQYB 1N32B 2HHHB 1IBKB 1CKOA 1N36B 4PZ8A 3T1HB 1XK5A 1IBLB 1TA8A 4GKJB 1VS0A 3SGIA 1N33B 4UCOA 4DV7B 1P8LA 4UCUA 2VUGA
chains in the Genus database with same CATH superfamily
4U6PA 5IYBO 3N6XA 3SJQC 1K3EA 4CE5A 2Y69B 4LC1A 3SYAA 3BJYA 1SA0A 3C90A 1BXRA 2UUBH 3K5NA 5IYZF 3ABKB 1OCRC 5KFTA 1BHAA 1MG1A 4DRXA 4K8ZA 4DV4B 3B4SA 2UUAB 5H6QA 4MT8A 1XL4A 4O2BF 3OMNB 4Q43A 3BABA 3BA9A 1H2GA 3CCQV 2FJZA 1RK5A 1XI1A 1C30A 2W6OA 3GQCA 4MTOA 1XNQO 4X65B 4J9LA 2DOSA 1F51A 1VQ7V 3NXSA 4EEYA 1VAJA 2GDSA 4XZ3B 3K5OA 4TUYB 3O9OA 4I4TB 4MSWC 3DXRB 3F8NA 2DN9A 1WB8A 3FKSG 4J0MA 4DV5O 3T1YB 2R82A 3STLC 4UCTA 4MV6A 2W6JG 4QW8A 3T1HO 3PW7A 4GKJO 3RFCA 1JDEA 5D8DA 4JI4O 5GONF 4LBEC 3ZN1A 5FJ8G 4QE7A 1LNQA 1ZETA 5LHHA 4FS2A 2Q4PA 3RAQA 4X66B 2R7ZG 2H8PC 2CGOA 4LCUC 4LF9O 2F1MA 2R9AA 3P3PA 4KFMA 3J7AK 1TWHA 5DQIA 1R6NA 4LFCB 5KFBA 3MWDA 1N32O 2GHYA 2HHHO 2DW4A 5KX5A 3KHGA 2JEXA 3AG4B 3T4DA 2PVPA 2KSWA 2VQFB 2J9GA 2XD4A 3T9CA 2FB5A 1EUDB 4TWKA 5LP6B 4BW9A 1GGOA 1GH6A 3WWHA 1OCZC 5IWAH 4DK1A 2MW2B 3A0HZ 4LFBB 3E83A 2R7MA 2ZDHA 1G2WA 4RB1A 4DV2H 1AJNA 2L35A 4ECQA 3ABMC 4K0KO 4PI0A 4Y8VB 1XQ8A 4Q20A 2P4KA 4I50B 4O2AA 2QM4A 4DV4O 4OX9H 4DV0B 4Q44A 3DC5A 1XDCA 3CB2A 4IWXA 4ED6A 2C2EA 5KFUA 1IOWA 2Q0OC 2ASLA 2G38A 4MTDA 3Q8SB 4X1YB 5LHGA 3W7WA 3CC7V 4OPHA 4JI6B 1BCCH 3CJHB 3ZRVA 2UVUA 3MWEA 3IFXA 1IBKB 2ZE6A 1UJWB 4PZ8A 3RIZA 5KT6A 2EJ2A 2UVWA 2ZE5A 2Q73A 3GIIA 3GIDA 4B08A 4K6NA 3TY8A 3RWRD 4GYCB 3QVNA 4KHPO 4DV1B 1PP9H 2WLMA 3GB8B 1QR9A 2NUAB 5DGBA 4DUZO 2YXHA 4EBCA 5LXTB 1I7LA 5LYJA 4X66O 1AP5A 3CCRV 4GUNA 2QWPB 2E2HA 1N34B 3JAKA 2CH7A 3QZ7A 5JVDA 1TWGA 3G8CA 4RZQA 4C5CA 4LFCO 1EZ1A 3KAJA 1KUQA 5CA0F 2JEFA 3NBZB 4ZHQA 1VQOV 2CFMA 4ECZA 4JI3B 4YAJB 4TUYF 4I4TF 4LF6B 3TQ1A 3WB1A 1M56C 1Q5OA 1HDJA 5KHGA 3GILA 3UYYA 5C1OA 3RB0A 4DR2H 4IZOA 1BQ0A 2EZOA 4ECTA 4JZ2A 2UUCB 4X1IB 2EINB 4UV8A 3WB0A 5DGAA 3WO0A 2CDYA 1MABG 1U96A 2X6BA 4PA9A 3VOTA 4DYLA 3VQYA 1YXBA 3QTCA 1MNGA 3VOUA 3HKEA 3GTQA 3CRQA 2RGVA 4YR0A 3W1GA 5FLMG 2W8KA 2ETNA 1XMQH 3C0FB 1DF5A 2P67A 2Z0AA 1PKXA 4JI6O 5I5YA 1FKAH 3Q4HA 1CKNA 3W5OA 4O81A 1Q90D 4JYYA 4O4HA 2CW8A 2FYUH 3SJCC 1JR9A 1WH2A 3S3WA 1M9NA 5EZYB 2W8LA 3CCJV 1RYRA 4A93G 1EFRG 2R7LA 5LP6F 5KUKA 1RJQA 2C28A 4B3MO 4LF7B 1S0VA 3QZ8A 3L73H 4GC6A 4DV1O 1RSOB 4CH6A 4DL3A 2UXNA 4H44B 4R7CA 2OIGA 4JI8H 3OUZA 4C2MA 4LP8A 2AW9A 3K59A 4JI5B 2VQEB 2EJRA 4Q8FA 1WA8B 4DR1B 5KFIA 1D5AA 1SERA 1N34O 3R23A 2XAQA 4A3EG 2C22A 2BQRA 1FJGO 4TM5A 2I80A 3AK1A 1QU7A 1HNZB 3T1CA 4MVZA 2ZT9B 4QW9A 4KXRA 2QWQB 4JI3O 4LF6O 4M9UA 1G4YB 2EIJC 4O7VA 3HOUG 2DYSB 1XL6A 4WBNB 5IJ0B 1MA1A 5GTHZ 5K1XA 3K79A 4RB3C 2W0XA 2ZGIA 2EULA 4BWAA 1XNRH 1QR8A 4B3RO 2Q2TA 3CE2A 4QJFB 2UUCO 3T7AA 3PR5B 1EKFA 4F4YA 4ZBMA 4RNMA 4U3JA 1Q43A 2P6JA 3D8CA 1GSAA 3R66A 4YY3B 2LQTA 2FP4B 5BZBA 3QO7A 4HYKA 2V7QG 2YEVA 2ZNIA 5LXTF 3JSLA 3HOWG 3SJBC 1K1QA 4UCVA 5KLVH 3AG1C 1TWAA 2FMAA 3DTUB 3WO1A 2GUZB 4A2AA 1OWTA 4RNNA 4DV5H 2C2DA 1PNLA 5DQHA 1GK9A 4M0JA 2LGQA 1HR0B 3VPDA 5E79Z 4IGGA 3T1HH 2DJVA 4MS2A 4YJ2B 2JA6G 4GKJH 4JI4H 1H2NA 2WLIB 2Y4TA 4LH6A 1HNWB 2YIDA 4BWSC 2ZCEA 4O4IA 3I4NG 1SQVH 4EBDA 2XNDG 4R50A 3JSNA 3PN1A 1JFFB 2RGRA 1ZL8A 3OSPA 4LF7O 4DL2A 2NR5A 2JDIG 5JJEB 4CHIA 5EWGA 5J2UA 3UM7A 4DIMA 1VQLV 2YWVA 4LF9H 3NC0B 1G1XB 2F4VB 3JRXA 4HNAB 2Y48A 3K58A 2W6NA 2B63A 1Q6HA 4JI5O 4TV9B 2VQEO 2HJDA 1QLEC 5KHKA 4O4JF 4LF8B 2HHHH 5KHIA 3T9BA 1N32H 1S76D 3RTXA 2DMXA 1BSMA 4GT1A 4I55A 5H80A 3T54A 5K3WA 4ZKIA 4RUAA 2XAHA 1HNZO 2ZIOA 3AK3A 1KJ9A 3B40A 2ZIMA 1M0WA 3GTPA 5EIBD 2QYZA 1BS3A 1KJ8A 5EZYF 3H0GA 4IRDA 4K0KH 4TOIA 4JI1O 4J42A 2UU9O 4DV4H 2R92G 3K0DA 2ITDC 3FMAA 4BW5A 2A9HA 1O9HA 1KBLA 2IM9A 3GV7B 3ETHA 2JA5A 4YY3O 2UUBB 5BWVA 4JV5O 3RYFB 3LMLA 3TINA 4ZIBA 1W2BU 3CRCA 1JQ0A 1ORQC 1NR1A 2R86A 3ZCCA 2BOBC 2LW7A 5GTIZ 4YJ3B 5I5VA 3LWBA 1I5YA 2Y0SA 4YAKB 4MVOA 3MHSC 3JATA 5EBWC 4AHCA 2UVRA 4KHPH 2B5UA 1XK5A 1WCMG 1VIBA 3G6EV 5KFCA 1HNWO 4UCOA 4J11A 3RJ0A 3RGBA 2CTQA 5BMVB 3N41B 4TQRA 2W7PA 4DUZH 3GIKA 4X66H 2W6ZA 5KFRA 1YTFD 1X9NA 2M6YA 2YYAA 2VQDA 1WP8A 3NUAA 3G6VA 2F4VO 2VPQA 2FK3A 5EYPA 1SCUB 5A9GA 1KJIA 2XGPA 1T94A 4KP4A 4QIWF 2FTKA 4LF8O 2OIEA 4I0XB 4IIJA 4YR2A 4B7KA 4FZ1A 2A06H 3ZMUA 2I87A 4J9SA 1VQ6V 2A3QA 3ZBHA 3SR2C 3M9OB 4JI0O 5L9XA 1SQQH 4YJ2F 1V9PA 4LSAA 1YITV 4FFNA 3RYIA 1XILA 2DYRC 5DGIA 5CR5A 5KG6A 5L1IA 2W9CB 4JZGA 2O03A 5KAIZ 2J6SA 4Z2WA 2DLNA 3OMAB 3J80N 1HP8A 1UFIA 2JVDA 4IHJB 4PD4F 5DQGA 2R8HA 2WLKA 4WFBV 4DV2B 4JI6H 3DSQA 4G27B 3ZRWB 5KT3A 1FXHA 1XBLA 3M8AA 1HWYA 2YSUB 4OX9B 4U7OA 3GIJA 4EEQA 4X1KB 3TIIA 2D2CB 3MFHA 3MFIA 3H9VA 3SPHA 3JD0A 3RW0A 4F4XA 2Q2UA 4B3MH 1NR7A 3CCUV 1GM7A 4PDVA 5DEDA 4X20A 4DV1H 1WSCA 2Q7HA 1Y6XA 3TW7A 1DLBA 3MR3A 3GLKA 4R6ZA 2EZPA 3DGEA 1QNMA 2W6PA 2C2RA 5C93A 1PNKA 5AG2A 3RBZA 3ASOB 5LOVB 5EC2C 1N34H 4FM9A 1BZKA 3A0RA 3E8FA 3ZJZA 1BNCA 1FJGH 5JQGB 4O7RA 1JPXA 3IN5A 4DR6B 3QFFA 4JAUA 3CXCU 1A48A 4K3AA 4JI3H 1SF9A 4H33A 4LF6H 1S97A 4DLKA 2ARHA 2PI5A 5DECA 3CSXA 4D7TA 2LGWA 4UCRA 5KUMA 4YJ3F 4PA4A 3G6BA 1I2LA 1L1FA 5KFNA 4PDLA 2Y0SE 3CEIA 2Q68A 4NTWA 1TWCA 1VEWA 2NNUA 2QDOA 1CKOA 5CBHA 5JQWA 3FAVB 5KG5A 4B3RH 2UUCH 1K7DA 2PTMA 2R93G 1KU9A 4ZOLB 3BFRA 2H94A 3MR5A 5BMVF 3L2PA 4DR2B 3ETJA 4BBRG 3UO3A 4HN2A 3K5IA 3QO8A 1YJNV 4NTXA 4Z1MG 2DIKA 1S0MA 3E22A 2VA3A 1Z2GA 3R5XA 4E2LA 4FFLA 2V1DA 5KFZA 4JV1A 3E5NA 1ENVA 5C44G 3K5LA 2WSSG 3GJXB 5D5QA 1XMQB 5IYCG 4MW3A 4PWQA 1S72V 5KFEA 4MV4A 3Q8RB 4FLWA 3WU2Z 1FXKC 1FXKA 4GC7A 1OCCB 1R3IC 1FVIA 1UPGA 1GTOA 2WLHA 3JD3A 1MZEA 5IYZA 1NTZH 3FKIA 2D3OW 3MJFA 1OBGA 4RU9A 3T5HA 4JI5H 4TT3G 3W1BA 4J9OA 2ZDQA 4IYHA 3N27A 1R3LC 5JWPA 1W0JG 1VQKV 4O2BA 1XREA 1Q6UA 4LH7A 4IHJF 4LMYA 4JI8B 4O7LA 4DR6O 4F6RA 1COWG 5FPOA 4CH4A 3A2FA 2HP8A 3K9SA 4FU0A 1DK1A 1FAFA 3OGCC 3PW0A 4RUEA 3DTGA 1Y1VG 1GYFA 1QQCA 4X88A 1KKDA 4XDKA 4JI1H 2UU9H 5LMNO 3KHHA 1AB3A 3I56V 5EWEA 2F43G 5KA6A 5KG1A 2NN4A 5GONA 1NH2D 3F7YC 2F95B 4YY3H 4J80A 2XGQA 4JV5H 5L3DA 5BR8H 1XNRB 3EVKA 3S3XA 3R9RA 2QM7A 2AGOA 5LOVF 2PBZA 1ZUQA 2CAZC 2EILB 1SRYA 5JQGF 5KFKA 1EZJA 2B1GA 2HVJC 3RGXA 1VP7A 1EBOA 4JI7B 2NU7B 3A0BZ 3TQTA 3CCEV 5KFDA 2V4RA 4FFBB 2O57A 2E5LB 4LF4O 3KHRA 3HKBA 4LR3A 1KC8W 4J7KA 5J2TB 4EYHB 4ECVA 2QTSA 1MOFA 2AXTZ 3T1HB 5EC1C 4GKJB 4PELA 3ZHTA 3LULA 1ROPA 3LP8A 4ZOLF 2COJA 4TQDA 4IRCA 2JJ1G 1KKCA 1ZTEA 1YSCA 2RN9A 5JH7B 4LF8H 5K2MA 1YF2A 4FGRA 3KG2A 1RM1B 1IDSA 4LF9B 3TY9A 1NQTA 1ZWIC 4PHZA 4RCNA 2VR1A 4JI8O 3KZIZ 3JALB 4JI0H 1EZVH 1J95A 4EB6B 3H1LH 3BEHA 2RJZA 1M4UA 4O4LA 3N42B 3ZHSA 2HKOA 2Q0AA 3RR5A 3B8NA 5B1BC 1SS3A 3T9EA 2EJ7A 4X8AA 4DR3O 3KXYT 1JX9A 3RB6A 3WWIA 3CHXA 3GV8B 5JCOA 4B3SB 3NR7A 3H3VH 3JD1A 2JA7G 2Y69C 3CCLV 2FLPA 1S3JA 3ABLB 2P7TC 2QR4A 4ED2A 2CW7A 2LW1A 2DQ3A 4ECWA 1OZ0A 4JTDB 4K0KB 4QWBA 1XNRO 4BIUA 3JASB 4ECRA 4DV7O 2RMKB 1JX4A 3OGIB 1T3NA 2E76B 1QVFU 3HOYG 1PPJH 3Q1KA 3T5KA 2ZE8A 5CA0A 5CBGA 4JI7O 2R7KA 3TGUH 2YZLA 2LP7A 4NLGA 1SA0B 2C2AA 3CX5F 4WFEA 2R8KA 2E5LO 2IH3C 1OCRB 5I5SA 1ZAUA 3UO2A 1S10A 3FX7A 1E4FT 5F2VO 4DRXB 3CC2V 1AILA 1QLNA 3SJAC 1GKFA 1WNSA 4A3GG 5C8YA 4KHPB 4NYEA 3MR2A 3ETEA 2YDEA 4TV8B 4A3LG 4I9WA 3JZIA 2PN1A 1IX9A 4F4ZA 2JS3A 4ED1A 2YL2A 4DUZB 4GZRB 3E89A 1GN4A 3U0ZA 4JYCA 1WRVA 3WG7C 3ZHRA 3ZHVA 4CKEA 4U7CA 3T4ZA 1P49A 4A3IG 4W4LA 2JA5G 5KT4A 4CH5A 2ABJA 3L74H 1Q82W 4O7ZA 3AG4C 3AW8A 3QWUA 5KHJA 5DISC 3OTFA 5J2TF 3OR7C 2XIGA 3ML0A 3H1HH 4MVSA 5LP6C 5LP6A 4B3SO 2QB5A 3BACA 2R6FA 2ZE7A 3D3QA 1BQZA 3PJSK 3BHPA 2IA6A 4ED0A 3L9DA 2PZSA 3GB7C 2CZGA 4LFAO 5CAEB 1H2MA 5K1PA 2YI8A 4MV8A 2P06A 2Q7DA 5JH7F 1R3KC 2A0LA 5KX5B 3PFFA 2W9AA 2NU9B 4FMTA 3HOZG 1XDNA 3A8TA 5LBQA 3CMEV 1FS0G 4PBCA 1AR1B 4MW8A 2DWEC 4FBUA 4NYKA 1OCZB 1J5EB 4UVAA 3DTFA 3GIQA 3OTOH 1NS1A 4L8JA 4P30A 3CCSV 2GQRA 4O2AB 4B3MB 4FLTA 1Z5VA 2FE3A 1FXVA 1CP9A 5B1AB 1SZXA 4BXXG 4RAIA 4UB8Z 3MAQA 2Y4RA 4O7YA 1AN7A 2YU9A 3SPGA 2GTAA 3HO8A 2FB9A 2V58A 4APMA 4DR6H 2QGNA 1BT8A 1BHBA 3MR6A 5LXTA 5KFVA 2CTWA 4UCSA 2YW2A 1V55C 1HNXH 2IBKA 4FLXA 1Q86W 3LSSA 1Q6IA 1FJGB 3K3VA 1S0OA 3H20A 2IW5A 2R7NA 4FVMA 2XCLA 2GV9A 2Y0PA 3CS5A 5LMNH 1S5JA 3J80W 5E25A 3L75H 3OM3B 2UXCB 5DG7A 2HVQA 4EGQA 5DAAA 4NXMH 1TWFA 3ABUA 4A5UB 1IXMA 2R8IA 4J9QA 1MSWD 4B3RB 5LYJB 1AVMA 4FLVA 1V54B 1AI4A 3BG5A 1AI7A 4TV8F 2EINC 3U55A 3BQ2A 2BTQA 2GTSA 4WFFA 4JYBA 5JVDB 4A3CG 1M0TA 3MWMA 4PZ7A 4ZHQB 3PW4A 1E1QG 1NBMG 2M7WA 1OBDA 5H5NA 4O4JA 4PZ6A 3G4SV 4RUFA 2ITCC 1M56B 3RV4A 4LF4H 2ZD9A 3KCXA 2YC0A 1T36A 3SPCA 5A2QN 4FE2A 3N2KA 4O3SA 1YDXA 2IH1C 1J5EO 4YB8B 2PMZA 4EG0A 2AGPA 4FFPA 2P5OA 2B9ZA 1JOYA 2C35B 1N56A 2X7RB 4UVBA 3HKCB 1IZ3A 5KFAA 4YQWA 3HBLA 3HKEB 5ITZA 4LNUA 5L1JA 3FB7C 4Q45A 4RB2C 3BCCH 1FFXA 1Z5WA 3Q4HB 1CKNB 4I50F 3R65A 2F93B 1SC5B 1RJRA 1LUVA 3J81N 3K5MA 2HGXA 4YIOA 3LUTB 4DR3H 5JVLA 4GCZA 2ZM6H 3H1IH 4ZI7B 4ZQIA 1UNNC 3VQVA 4Q4DA 1L2ZA 4ECYA 2WTFA 3IAYA 3G80A 2UXCO 2WB1A 1N36H 1TAEA 4A2BA 5KMGA 3LNMB 4J9PA 1IBLH 3RF2A 4O2AF 4JI1B 3ORQA 2UU9B 4D7SA 4DV7H 4QJFA 4EFBA 2LJ2A 3UQ8A 5IYCO 4X62B 1E4EA 3THOA 2HGSA 2DPJA 3ETGA 5KFGA 5C4XG 4JV5B 5B3SC 2WLLB 4JI7H 1AJPA 1IYDA 2W6MA 5BR8B 3FKIG 4QIWA 1WP7A 1XOUA 3LSUA 4J7ZA 1O9GA 2PUSA 3FB8C 1KUTA 1R9TA 4DUYB 2CQYA 2E5LH 4PDBA 2XT9A 2GUZA 4H37A 1KP3A 2FKXA 3H1KH 5IT9N 1K5SA 1X59A 1B6RA 3N43B 3HR0A 3UKMA 3AG2C 3BRCA 4DV0H 3V6KA 4AI8A 4PDRA 4YJ2A 1M6VA 4U3JB 1B3QA 1P4RA 3JAWB 2CGNA 2AQ4A 1JXLA 3GTJA 1US6A 1NZ6A 2YEVB 4HQ6A 4ED8A 5LYJF 4HR7A 3OW2U 5C3EG 3RN4A 1SYXB 3BQ0A 3AG1B 5JUMA 2EIMB 2QM8A 3OE7G 5KFQA 3GTLA 5BY1A 1DTOA 4JAAA 5KFYA 2VPSA 3WWJA 1KJJA 1BGWA 5KFXA 3UZOA 5KFWA 1C3OA 2JGUA 2W9BB 1O75A 3T2MA 4AYBA 4B3SH 1F23A 1ZL8B 5L3BA 4B3TB 1KMIZ 2RQ6A 2K1EA 4JI0B 5CA3A 1SZTA 2PMZE 1Q81W 1D2DA 4LFAH 3TEKA 3GIMA 1YHQV 5B5EZ 3RFRA 1K5QA 3D3IA 4CKCA 4RUCA 1TA8A 2QA4V 4FFRA 4FBTA 1BGYH 4ABMA 4I55B 4X62O 3UT5B 2YICA 3TXQA 4RAYA 1F4MA 4FIPC 3K3WA 3RVZA 5BR8O 1PX2A 2HG8A 2JRIA 1K34A 3LQSA 1IOVA 3N2GA 1SFOA 4DUYO 4PA7A 4YJ3A 4ZI7F 5FPRA 1GLVA 3BQ1A 4GX1A 5CM0A 1D5NA 1PD3A 3NGDA 2WB1E 4WBNF 3EPIA 4R8UA 2Q6AA 2BTOA 1PL4A 3U10A 5LA6A 2BCCH 2EIKB 4G2KA 4DV6O 1CXZB 1VKZA 3HKDA 1TUEB 5T14A 2V4DA 3HB9A 4WFHA 4PI2A 3PW5A 3RAXA 4HNVA 3JATB 5LHIA 1VQPV 2PYLA 4I0XA 1ZLZA 4MV3A 1K33A 5BPHA 2Q7GA 3SDLA 2RDJA 4MTFA 2XUMA 3R5FA 3U0GA 1YCIA 3CMAV 4B3TO 1IURA 3M9NB 3EYYA 1RJPA 5IY5C 4PJ0Z 3KTMA 1RPRA 1TGOA 5L3GA 2Q9LA 1BL8A 5KFPA 1WB7A 4JV2A 1Y74A 5CN0A 1EYZA 2OCCB 3X2QB 5EYPB 1DAAA 3NBYB 4HNUA 2V9WA 5LGNA 2QEXV 2XHBA 1CKMA 2VOBA 1XMOB 4IIJB 2X5RA 2JGDA 4JUZA 4X89A 4XYMB 3ZS8C 5CA1A 2UXDH 5D1OA 2JJ2G 3APQA 3ZRSA 3RUPA 3ZRWA 4TV9F 1Y76A 1J5EH 1GMGA 1A9XA 1RPOA 1TVKA 4X1KA 3RYIB 2HJWA 2DE0X 4J9ZB 1KJQA 2A7WA 4AYBE 3KHLA 2HHFA 1NKDA 5CE8A 5B1OA 2IJIA 2P90A 1H38A 1EHIA 5I5XA 2E2IA 1I94H 4J41A 3OTOB 3V4SA 3IC9A 3OUSA 4AQYB 1K92A 2FPPB 5FR9A 5H9CA 1H2LA 4O86A 2ZDIC 3FDSA 3WNZA 2ZNJA 5KG3A 4ETSA 5KT5A 3HB3B 2DQ0A 1ULZA 2DWCA 4X64O 2R85A 4I55F 4UCUA 1M57B 5JQGA 5KG4A 3FB6C 5L3CA 3VMMA 5IJ9A 3TY5A 3OEHG 1ET0A 1R1BA 1TUBA 1FD9A 3QO5A 1WPBA 4X20B 3RB4A 1CPYA 1HNXB 4HZ3A 3JD2A 2AGAA 4MTEA 2I8CA 2UXCH 2KQXA 3G67A 2P4VA 4LWSA 1ZQ7A 5KG0A 4YP3A 5LMNB 4RO2A 4WF9V 1L0NH 3MDSA 4P9OA 1GAXA 2JEJA 1A3GA 3AG7A 4ZOLA 1GO3E 1YVWA 4GX2A 5BWUA 4JYAB 1VQNV 3H4BA 2M05A 4NXMB 4I7ZB 4FZ0A 1RP3B 1XMOO 4ED3A 1QHTA 2A79B 2RDIA 2IJHA 2JEGA 5JJJB 5CB4A 4RWUA 4DR5B 4WFGA 1UC8A 2FKLA 1OCOB 1JJOA 3JYCA 1H2SB 4LF4B 1I6UA 5C1PA 4N23A 4CS2A 1S5LZ 3ASNB 4F4LA 1NVPD 2X0SA 3G6XA 1BMFG 1M93A 4BY1G 4UXNA 4O3OA 5KFFA 1OCCC 2BSKB 4K35A 3OTOO 4ECSA 3DAAA 4AQYO 4GLXA 3APOA 3E22B 3IC7A 2WLNA 2Z5UA 1JVMA 2EX3A 2ZR2A 1KQSU 3K3PA 4MA5A 1S5HC 5KT2A 3GV5B 2RNBA 1KD1W 4IIJF 3RT3C 1M7JA 3LSQA 1S77D 4GKKO 5B1NA 1VQ5V 1K4CC 3QQMA 3HPLC 2YZNA 4MV9A 2XAGA 3CRRA 1VQ8V 2HJFC 2YS8A 4BIZA 2ATKC 4C5BA 3GTKA 3KREA 1HNXO 2VUMA 3JAMN 3I55V 3DF7A 1VF5B 2QJ1A 1OV9A 5IYZB 4DR3B 2KKWA 2ZM6B 2FK2A 3HT5A 1H8HG 2JIZG 1VQMV 1I1LA 4QWDA 3E8GA 5A2QW 2XCAA 2W70A 4X62H 1YZBA 4QWEA 2ASJA 1N36B 2IU3A 2KG7A 4JYAO 1VBGA 4ECXA 1IBLB 4NXMO 3TW6A 3KCYA 1NH2B 1VS0A 3RYHA 1N33B 2NU6B 4O3QA 4DV7B 1JCHA 3CQZA 2EILC 3AG3B 4FFKA 4NVPA 4DUYH 1L8DA 4DR5O 3D36C 4H13B 2JEIA 1CQJB 1SKVA 1VMGA 5FNVB 4K8XA 1I2KA 3RV3A 4FFMA 2BOCC 3E8HA 2GBOA 3CPWU 4NXNB 3Q8PB 1AJQA 4DW1A 4FFBA 3GWOA 3J81W 1RFYA 1DGSA 4PA6A 2Z3YA 5J2TA 4EQ5A 2JS5A 4DV6H 3E86A 3E8BA 3CXHF 5LMUO 2Z04A 2Q5ZA 2E75B 2YUAA 2ZXWB 1BE3H 2OTLV 1AUXA 4YHHO 4FJCC 4QGPA 5FD5A 2HIXA 4JASA 3OD4A 1E79G 1KEEA 5JH7A 2QK4A 4DL4A 1XUQA 2BQUA 2J6TA 3HKBB 2FK1A 1G6UA 4QPJA 3TXSA 4EYIB 4B3TH 4MTXA 5IYDO 1I50A 4DL6A 3GIPA 4R8CA 1P7BA 3OEEG 3RYCA 4L87A 3Q8QB 2ADQB 3OT7A 4XDJA 2PYJA 4NZNA 2ZM6O 2OWOA 2ATLA 3EPGA 3H01A 4Q4CA 1EN5A 1I5XA 3JARB 5IT9W 4FM0A 3V4ZA 1N4CA 4M7EA 2YCHA 3ABLC 4BAYA 4LFAB 3ABKC 1N36O 4I7HA 2RDCA 1JLLB 1QBZA 1IBLO 2YRWA 3I12A 2XOKG 1N33O 2DWDC 4O4LB 1URFA 2IJJA 3JRWA 3K0GA 5H6RA 3SPJA 4KL1A 4QNHB 2EJ0A 2Z02A 3N40P 4CMDA 3V6HA 2DAAA 3U9SA 4MV7A 2CTPA 3VA7A 4LF5O 4E4EA 4TQFA 2R9RB 4DV3O 2YXYA 4NXNO 2B63G 1KECA 1PV0A 4TUYA 4I4TA 4G3IA 1AI6A 3DXRA 2X0LA 4DRFA 3EHBB 4UFZA 5KS8A 5L1KA 2IJKA 3L71H 2P22C 3HKZA 4DR7O 5BWTA 4X64H 2YI9A 3ZMZA 1RYSA 4TV8A 1SEIA 1WJZA 1FPOA 1YJWV 4O7NA 4Z1VA 5DMXA 3H0GG 5HBRB 5KKNB 5KFHA 5CA0B 2V4QA 1Y1WA 5BWRA 2NVYA 3SGIA 4AILC 2VRZA 2AZ0A 4YR3A 3TCUA 1ZX3A 1UC9A 4OGQB 2WLJA 4QWAA 1GN3A 5FNVF 5E1AC 4J9MA 4IRKA 3RGZA 2DPIA 3TK1A 5C8YB 4NR1A 4ME6A 4O7SA 4RZRA 1DIKA 2EJ3A 1I1KA 3H40A 1AI5A 1XMOH 5EK0A 1NI8A 2GPSA 4ECUA 1GSHA 3WG7B 2YZGA 1IBMO 1AR4A 2CKZB 3N44B 4E6NA 5KFJA 4YXWG 3T9DA 2ALZA 4I50A 2WE6A 3QG5A 4B7EA 2N74A 4X9QA 1A0IA 3LNNA 1QVGU 2UXDB 4DAAA 3RBEA 4A3MG 5D5PA 3WFVA 3N8DA 1MZBA 5HFLA 4X1YA 1GM8A 1VBHA 2X6AA 4O83A 3CJHA 2E3CA 2N04A 3B09A 4A3DG 4ED7A 4UB6Z 4AQYH 2SCUB 5DG9A 2GLTA 1KB9F 3ABMB 1CEZA 4DR4H 3AX6A 3L4JA 4RAZA 2ILMA 2UUAO 4G28B 1LUWA 4GKKH 5B1AC 1I94B 1XHXA 2YIAA 3SI8A 3QF7A 2Y0IA 1THZA 3RBDA 5HNEA 3BAAA 5FLXN 4X65O 3P30A 4GLWA 5D1PA 2HGWA 1R3JC 1FFTB 2R93A 1Q8IA 4O4LF 3B77A 3MD0A 3UFXB 3GDEA 4IAJA 3T1YO 2F66C 4QPKA 4QE9A 2HG5C 4NZMA 4RQFA 2NU8B 3CP1A 1B06A 3OAAG 4RB0A 4A3BG 1JA8A 1VARA 4P9PA 1ZSPA 2CE4A 3E2EA 4JYAH 1OHHG 4FLUA 4XDLA 1F7YA 3HKZE 2H3OA 4MVQA 2QWNB 2YZMA 3STZC 5DLGA 5L1LA 1V54C 4J9NA 2JA8G 1V55B 4XX0B 4EKWA 5BYBA 4EGJA 4X1IA 1K73W 1K1SA 3CSWA 3RB3A 3JAKB 1PL0A 4MA0A 4FM2A 4R7RA 2CH7B 4DR5H 1N0NA 5KT7A 1X4TA 4RQEA 2Q67A 3N6RA 2VUGA 2QKCA 3ABTA 5C5JA 2UXDO 1U97A 3U9TA 3L4KA 4BIOA 2VQFO 1EN4A 4GX5A 1W93A 1GSOA 2WA4A 2WDTA 4DL7A 1HW7A 1YEWA 5CBFA 2FL4A 1PM9A 2YRXA 5LMUH 3SYOA 3KYHC 5C8YF 3GTGA 3VBBA 2XTAA 4BBSG 1V4YA 2BTQB 1N8RW 1LR1A 4LFBO 4YHHH 3EXAA 5EZYA 2E74B 2QKAA 2X6CA 2QF7A 3GVMA 1SQGA 1SQPH 4FK5C 2W0FC 3ETDA 3W7TA 3PVXA 3HKCA 4JF3A 4MAMA 3F7VC 4C5AA 4O4JB 1AROP 4DV0O 1Y1VA 5JJNB 1RSOA 1I94O 1B6SA 1NJIW 1YI2V 2R9IA 5I5TA 1GN2A 2OT5A 3GWKC 3N2KB 4JI2B 3OUUA 3L72H 1IBKO 5KX5F 4O4HB 1WA8A 3O65A 2UVVA 5L3EA 1VQ4V 4Q6GA 4ZI7A 1W0KG 3W7UA 3M7MX 1I1MA 3T99A 4A3KG 2PF4E 5ITZB 4LNUB 4UUGA 2DYSC 2HFEC 2XC9A 3PW2A 5IJ0A 4WBNA 4J10A 5LL6Y 1FFXB 1SQFA 3PO3G 4O84A 1N33H 4UUJC 3LDCA 1NTMH 2CK3G 3OFNG 5IYDG 2PGGA 1M5IA 2A1HA 3ZMSA 2V59A 4LF5H 2W57A 5KFSA 3PZPA 2WLLA 3CCVV 1W96A 4DV3H 1F4NA 2WAMA 4NXNH 4CC6A 4CS3A 2ODTX 1GM9A 1SQBH 4FLYA 3LDEA 2EIJB 1WN7A 4UV9A 2CNQA 3SPIA 2COIA 2Q7EA 1AR5A 2JK5C 2N05A 5KMGB 1S9FA 1RK6A 1M1KW 4TVIA 2LFSA 3SYPA 1AP6A 3P3NA 5BWWA 4DR7H 4DQNA 2R8JA 2PI4A 4HBNA 1Y14B 3ZRXA 1E4EB 1Q7YW 2ZDGA 2WLIA 2OTJV 3JAWA 2VUMG 2Q69A 4MTGA 1XNQH 5B3SB 3JAMW 3ZMTA 4DV6B 1JFFA 4LSXA 4I5SA 2K9PA 4CMFA 2UXXA 3ZX6A 2UXBB 1DV2A 4TSFG 3TIGA 2B1IA 2EIMC 2KB1A 5IYBG 2OLSA 5JVDF 3SE7A 2JA7A 4HNAA 2ASDA 1W59A 3AG2B 1K97A 3L70H 4JI2O 2ZKOA 4JTCB 4OPAA 4TV9A 4CBCA 4ZHQF 3GTOA 2IBZH 1WLEA 2COGA 2WYOA 3UZBA 2AHZA 3IJ4A 2HDKA 3VPBA 4O4IB 3SYQA 2W9BA 4J9RA 2YS6A 4F4WA 1Z2PX 2OH2A 3ZN0A 2VS0A 2R70A 2R8GA 2RF4A 3VQXA 5J2UB 4PA3A 4O3RA 5B66Z 2BE3A 1ZHSA 2W7OA 1IXBA 1P84F 5KHHA 1IBMH 5BXZA 1JKJB 4O82A 5EIBC 1B6QA 4MV1A 1KYOF 2ZINA 4A3JG 3ZMVA 1QLEB 4DR1O 3UCSC 5IDJA 4EBEA 1WR2A 2KSDA 4JV0A 1Y67A 4JTAB 3UT5A 1DF4A 3M9MB 5KFMA 3RYFA 2W6IG 3ZEDA 4JXUA 3P32A 4DXWA 4O4HF 2MCTA 5EWFA 3IGAC 1I3QA 3OUFA 5J9PC 2GPWA 4IWYA 3T5JA 3ZIAG 4RNOA 2ZJTA 1T5EA 1ZHQA 3WB2A 4MVUA 3U54A 2OYQA 4J7JA 4KUMA 3RVYA 2R7ZA 1H8EG 2AU0A 2UUAH 3KKYA 3AK2A 2VA2A 1CS0A 5HV6A 2QTOA 4X65H 1Z2NX 4IR9A 3JZFA 1EKPA 2EIKC 4IT5A 5BMVA 3B2EE 2V5AA 3PO2G 2HVKC 3W7SA 1SESA 2UXBO 1VF7A 4L1KA 4X64B 3N2GB 5KG2A 1KTAA 2W71A 3VPCA 3T1YH 3T9AA 1JMKC 5IP9G 1S0NA 5BPFA 3FD9A 4GX0A 1HR0O 4BR6A 1BJTA 4QIWE 1YTFB 4O7TA 1CE8A 2GSMB 1NT2B 4U3FH 4R8UB 3FFQA 4CZZA 3M4IA 3BA8A 4YIPA 5LA6B 3K5HA 2BQ3A 4XYLB 4J9YB 4W4KA 2YXLA 3HKDB 2HR3A 3K08A 5EBLC 3TJTA 4J9KA 3J7AU 2OCCC 3X2QC 2YS7A 2F23A 4OXSA 1S68A 3FYIB 1SETA 4LFCH 4DO2A 3K9AA 2CNVA 4QWCA 4A3FG 2XCPA 2L6LA 2ZQMA 4FFOA 1KC7A 5DN6G 5EBMC 1AUVA 2LO1A 2W9CA 3VQWA 2VQFH 2WPDG 2WAQA 1KT8A 4IHJA 3CYOA 3G71V 1P8LA 1N0JA 5KFLA 5IY5B 4YBZB 1Y1WG 1EUCB 2EIYA 4LFBH 1Y74B 5BWXA 3S24A 3HOXG 4O4IF 2MK3A 1MZFA 3K03A 4O3NA 3LDDA 2DYRB 4CS4A 4DK0A 2CNUA 4NKGB 4UVCA 2YIBA 3K06A 2XAFA 5IWAB 1R6KA 2JGDB 5J2UF 1A32A 5LL6b 2R87A 4TQSA 5CA1B 3KALA 4MVRA 3JZ6A 5D1OB 2HVSA 2FMLA 3K57A 4IL6Z 2UUBO 4H0LB 2JEUA 4HAMA 2WA3A 3K04A 2W6QA 2ZDIA 4DR4B 1Y76B 1GRJA 2DZDA 1YJ9V 5EDWA 1IBKH 4MVMA 3ASOC 1TVKB 3F5TA 5LOVA 4GKKB 1YIJV 2NVXA 2YIBD 1M57C 5GW7A 4CC5A 4FM1A 1MMMA 2HHFB 2QE7G 4O7WA 1Y66A 4WFAV 1QCEA 2ADPA 2VWKA 5IP7G 3ZHUA 2QWRB 3DC6A 3F5WC 3Q2OA 1H2KA 5EOYA 4Q0YA 3CRAA 3OHBA 5DM6V 2ZR3A 3OMIB 1B04A 3FAVA 4P2ZA 4XBFA 3ETQA 3IG0A 4D6TH 3MHHC 3CEBA 5IJ9B 5FL7G 3KAKA 1TUBB 1Z2OX 3ICXA 2EBOA 2Q8VA 4F6EA 1JDBB 1WAZA 4CKBA 3CC4V 4LWSB 3AYHB 1Q3EA 3U11A 4DL5A 2IMWP 1KP2A 1OCOC 2DABA 5KAFZ 4HNTA 2CUGA 4EFEA 3SNOA 4CH3A 3CCMV 5FLXW 4IYIA 1I7FA 4BY7G 3H4DA 3VNNA 4IR1A 1E4GT 1GO3F 3FYEB 4ICGA 5LA6F 2AGQA 2FPIB 4F50A 3ASNC 5LGUA 5KFOA 3CRMA 3EFFK 5LMUB 1EKVA 5IWAO 3I4MG 4I9QA 5CB4B 2BSKA 1IVSA 5DLFA 1PK8A 1NVPB 4YHHB 4DW0A 4DV2O 3B8MA 4JI2H 3CWBH 4DR4O 4C7UA 4HYOA 4OX9O 4ASUG 3BVOA 2XAJA 5FD6A 1EN6A 3AEIA 2WAQE 1K83A 2AHYA 5BYAA 2QSAA 1VQ9V 1XHZA 3T9FA 4LF7H 1E1RG 3M99B 1FXKB 3W7XA 2IP4A 3HOVG 5I5UA 1PNMA 3BPZA 1K4DC 1SQXH 1XEQA 1K9MW 2QWOB 5IE9A 5DGHA 2FLLA 3E35A 2VQEH 2GQSA 4NZOA 2P0AA 4DR1H 1I0HA 2ODMA 4O2BB 2HVRA 5CA1F 4JAVA 4Q8EA 1P7GA 1NTKH 5KA5A 1HNZH 1I08A 1CQIB 2HIVA 3GTMA 1JIHA 4E4TA 3G8DA 4F6RB 2JA6A 1JJ2U 1A0GA 3FB5C 3OR6C 3OHAA 3CVZA 3AG3C 5F9LA 1G8MA 5KG7A 1L0LH 2VWJA 3D36A 5I60A 4LF5B 5FNVA 2J6UA 3SYCA 3BY6A 1MSDA 4DV3B 1FYJA 4NB5A 4WHXA 2R84A 2AZ2A 5GONB 3ZHQA 1WPXA 5H2FZ 5TISZ 1I7NA 1B33N 4N21A 3H1JH 1Y4MA 1IYEA 2KG7B 3C3TA 2HLDG 1K8AW 5L3FA 4DR2O 3HXLA 3RYHB 2UXBH 3JCUZ 4DR7B 3G6YA 4PDMA 2ZXWC 5F9NA 5I47A 4PV1B 1R6TA 1XNQB 3I5DA 1NU1H 3OSNA 4WCEV 1HR0H 2XASA 2OCHA 4QSHA 2FPGB 5I5WA 4WD3A 2R72A 3T5LA 1HNWH 1EM1A 1RM1C 1XMQO 4DV5B 2R92A 4FS1A 3TETA 4JGSA 1DV1A 2CTRA 1FKAO 2WWWA 3JALA 1R73A 4EB6A 1P16A 2BR0A 2C00A 5CMUA 4JI4B 3PR4A 4JPRA 1V51A 1GN6A 2F4VH 2NLJC 2PY5A 3R5HA 3C3SA 2IU0A 3CD6V 1VF6C 2RCVA 1VF6A 3JARA 1M90W 3QNEA 4FPPA 5CB4F 5DG8A 4U7NA 2Y4UA 2FLNA 1KBHA 4FLZA 1IBMB 3V6JA 3ORRA 3JD4A 1WCMA 5LGTA 1OJHA 2HHHB 1N32B 3JCZA 1N48A 3JASA 1S03G 3RYCB 5HFMA 4NTYA 4O3PA 5B1BB 2QKSA 5JCOC 2LFRA 2HEPA
chains in the Genus database with same CATH topology
3UT5B 3N6XA 3L2PA 4DR2B 1SA0A 3L4KA 4RAYA 2UUBH 3K5NA 2WDTA 1HW7A 1YEWA 5LMUH 3KYHC 3N2GA 4DRXA 4K8ZA 4DV4B 3E22A 2BTQB 2UUAB 4YJ3A 4YHHH 3BABA 3BA9A 5EZYA 5FPRA 1SQGA 1XI1A 3K5LA 3HKCA 3GJXB 5D5QA 4X65B 4O4JB 1XMQB 3K5OA 5JJNB 1RSOA 4TUYB 4I4TB 2BTOA 3U10A 5LA6A 4FLWA 3F8NA 3N2KB 4J0MA 4JI2B 3T1YB 1FVIA 3HKDA 4UCTA 5IYZA 4O4HB 2V4DA 4JI5H 4PI2A 3W1BA 3JATB 4O2BA 4Q6GA 2PYLA 4ZI7A 4LH7A 3M7MX 2Q7GA 4LMYA 4JI8B 5ITZB 4LNUB 4F6RA 4X66B 5FPOA 4CH4A 3A2FA 5IJ0A 4WBNA 1SQFA 1FFXB 3EYYA 2F1MA 2R9AA 3J7AK 1TGOA 1GYFA 4LFCB 1N33H 1QQCA 4JI1H 2UU9H 5EYPB 3NBYB 2PGGA 1M5IA 5KX5A 2XHBA 1CKMA 4LF5H 2VOBA 2W57A 1XMOB 4IIJB 5GONA 2KSWA 2VQFB 4DV3H 2F95B 4YY3H 4NXNH 2UXDH 3ZS8C 4BW9A 4CC6A 4CS3A 5CA1A 5LP6B 4FLYA 4JV5H 5IWAH 5D1OA 4DK1A 5BR8H 1XNRB 1WN7A 2Q7EA 5KMGB 4LFBB 1J5EH 2CAZC 4RB1A 4DV2H 4DR7H 4X1KA 1TVKA 3RYIB 1XQ8A 4PI0A 4I50B 4HBNA 2QM4A 4O2AA 3RGXA 4OX9H 4DV0B 4JI7B 3JAWA 3CB2A 1XNQH 3JAMW 4MTDA 4X1YB 4DV6B 1JFFA 4FFBB 4JI6B 4LSXA 2E5LB 1I94H 3OTOB 3HKBA 4LR3A 2UXBB 4AQYB 5J2TB 1IBKB 4PZ8A 3RIZA 3T1HB 2ZNJA 4ETSA 4GKJB 4HNAA 4TV9A 4UCUA 4B08A 4TQDA 5JQGA 2WYOA 3TY8A 3RWRD 4GYCB 5JH7B 4DV1B 4O4IB 4LF8H 5IJ9A 3TY5A 3GB8B 1TUBA 1Z2PX 1WPBA 4X20B 4LF9B 3TY9A 2R70A 1HNXB 4PHZA 3VQXA 5J2UB 4MTEA 2UXCH 5LXTB 3JALB 5LYJA 1ZHSA 4JI0H 5KHHA 1N34B 4EB6B 1IBMH 2RJZA 3JAKA 5EIBC 1M4UA 4O4LA 5LMNB 3N42B 3RR5A 2Q0AA 2ZINA 5JVDA 4RZQA 3KAJA 3KXYT 3NBZB 4ZHQA 3CHXA 2CFMA 4ZOLA 5JCOA 4JI3B 4B3SB 4LF6B 4JYAB 3WB1A 3UT5A 4NXMB 1Q5OA 1QHTA 3RYFA 5KHGA 3ZEDA 2CW7A 2MCTA 5JJJB 5CB4A 4DR2H 4DR5B 4K0KB 2UUCB 2ZJTA 1T5EA 1ZHQA 4X1IB 3WB2A 3JASB 3WB0A 2OYQA 1JJOA 3VQYA 2UUAH 3QTCA 1H2SB 4LF4B 1I6UA 3HKEA 5CA0A 4CS2A 2RGVA 3W1GA 4X65H 1Z2NX 1XMQH 1SA0B 3C0FB 1M93A 5BMVA 3B2EE 1FKAH 1CKNA 1VF7A 1ZAUA 4X64B 3W5OA 1E4FT 3N2GB 4DRXB 4GLXA 4O4HA 3E22B 2CW8A 3SJCC 3SJAC 2EX3A 3T1YH 1WNSA 1WH2A 5C8YA 1JMKC 5EZYB 4KHPB 4TV8B 1BJTA 4LF7B 1NT2B 4MV9A 3FFQA 4DUZB 3M4IA 4CH6A 3BA8A 5LA6B 3U0ZA 4JI8H 3K59A 2YXLA 3DF7A 4JI5B 3HKDB 2QJ1A 2VQEB 1P49A 5IYZB 4DR1B 4DR3B 2KKWA 1D5AA 2ZM6B 4CH5A 1S68A 4LFCH 5A2QW 1HNZB 4X62H 3QWUA 5KHJA 5DISC 3OTFA 2XIGA 5LP6C 1N36B 5LP6A 1IBLB 3VQWA 2VQFH 3BHPA 5K1XA 5IJ0B 4IHJA 4WBNB 2PZSA 3RYHA 1VS0A 1N33B 4RB3C 4DV7B 1P8LA 4BWAA 1XNRH 4NVPA 4DUYH 5K1PA 1L8DA 2Q2TA 2YI8A 4LFBH 3S24A 1SKVA 5FNVB 4U3JA 4K8XA 1Q43A 5KX5B 4YY3B 4NXNB 4CS4A 1XDNA 4DK0A 2YIBA 5IWAB 4DV0H 2ZNIA 5LL6b 4FFBA 5CA1B 3KALA 3J81W 3JSLA 5D1OB 2HVSA 1DGSA 3SJBC 3K57A 4UCVA 5J2TA 1J5EB 2JS5A 4EQ5A 4DV6H 3OTOH 4A2AA 4DV5H 4L8JA 4DR4B 1IBKH 1HR0B 3T1HH 1TVKB 5LOVA 4GKKB 4GKJH 4O2AB 2YIBD 4YJ2B 2HIXA 5FD5A 4JI4H 4CC5A 4FM1A 4B3MB 4FLTA 1Z5VA 4LH6A 1HNWB 2FE3A 4BWSC 5JH7A 2ZCEA 4O4IA 3MAQA 1AN7A 3JSNA 3PN1A 1JFFB 2RGRA 4APMA 3HKBB 4DR6H 2VWKA 1G6UA 5JJEB 5J2UA 5LXTA 4B3TH 5EOYA 4LF9H 4Q0YA 4UCSA 1HNXH 3NC0B 2F4VB 4FLXA 4HNAB 1FJGB 3K3VA 3K58A 3RYCA 1B04A 3H20A 4TV9B 4FVMA 5KHKA 3ETQA 2GV9A 2HHHH 4LF8B 1N32H 5KHIA 5LMNH 3IG0A 2PYJA 1S5JA 3RTXA 3J80W 2OWOA 4I55A 5IJ9B 3JARB 5IT9W 4FM0A 3KAKA 1TUBB 2UXCB 2ZIOA 4M7EA 1Z2OX 2HVQA 2YCHA 3ICXA 4LFAB 4NXMH 2ZIMA 1M0WA 5EIBD 4I7HA 4B3RB 5LYJB 4FLVA 1Q3EA 3U11A 2BTQA 4O4LB 4K0KH 4TOIA 5JVDB 4KL1A 4EFEA 4CH3A 5FLXW 1M0TA 3N40P 4DV4H 1I7FA 3MWMA 4PZ7A 3FMAA 4ZHQB 3VNNA 4MV7A 1O9HA 2IM9A 1E4GT 4O4JA 4TQFA 4PZ6A 2UUBB 4LF4H 4TUYA 4I4TA 5LMUB 3RYFB 3LMLA 4I9QA 5CB4B 4ZIBA 3N2KA 4DRFA 4UFZA 4YHHB 2P22C 4JI2H 4YJ3B 4X64H 2P5OA 2YI9A 4TV8A 1SEIA 3JATA 3HKCB 4AHCA 4KHPH 1XK5A 5FD6A 3HKEB 5CA0B 3SGIA 4AILC 4UCOA 4LNUA 5ITZA 1XHZA 3RGBA 3RJ0A 4LF7H 4RB2C 5BMVB 3N41B 4DUZH 1FFXA 1Z5WA 1CKNB 4X66H 2F93B 3BPZA 1X9NA 3RGZA 5C8YB 3K5MA 2VQEH 5EYPA 4DR1H 4DR3H 4O2BB 2HVRA 2ZM6H 4ZI7B 4IIJA 3VQVA 1L2ZA 1HNZH 2HIVA 1XMOH 3IAYA 4F6RB 1N36H 1TAEA 4A2BA 5KMGA 3SR2C 1IBLH 3CVZA 3RF2A 4JI1B 1V9PA 2UU9B 4LSAA 3N44B 2VWJA 4E6NA 4D7SA 4DV7H 3RYIA 4EFBA 4I50A 2WE6A 3QG5A 3UQ8A 5FNVA 4X62B 4LF5B 3THOA 4DV3B 1A0IA 2HGSA 3LNNA 2UXDB 5D5PA 4JV5B 5GONB 1MZBA 4JI7H 4X1YA 5BR8B 2O03A 2E3CA 1O9GA 2PUSA 2JVDA 3HXLA 4IHJB 4JI6H 3RYHB 4DUYB 4DV2B 2E5LH 4PDBA 3DSQA 2UXBH 4DR7B 4AQYH 3N43B 4OX9B 3BRCA 4EEQA 4X1KB 4DR4H 4YJ2A 3L4JA 1XNQB 4U3JB 4RAZA 1HR0H 4GKKH 3JAWB 2Q2UA 1I94B 1XHXA 2YIAA 4B3MH 3QF7A 2R72A 1HNWH 3BAAA 4X20A 4DV1H 5D1PA 4DV5B 2Q7HA 1SYXB 1Q8IA 3JALA 4EB6A 1P16A 3GDEA 4JI4B 4IAJA 2VPSA 2F66C 5LOVB 1BGWA 4FM9A 1N34H 2F4VH 1FJGH 5JQGB 2PY5A 2JGUA 4RB0A 4DR6B 3JARA 1O75A 4JI3H 4B3SH 4B3TB 4LF6H 1KMIZ 2RQ6A 4JYAH 4FLUA 4JI0B 4FLZA 3CSXA 4D7TA 1IBMB 4UCRA 4LFAH 4X1IA 2HHHB 1N32B 1S03G 3JASA 1CKOA 3JAKB 3RFRA 4R7RA 3RYCB 4FM2A 4DR5H 4B3RH 2UUCH 1TA8A 2PTMA 1X4TA 5JCOC 2HEPA 1KU9A 4ZOLB 4I55B 2VUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TY8 A;  2Q2T A;  3L2P A;  4DR2 B;  1CKN B;  3S24 A;  4DV1 B;  3TY5 A;  3GB8 B;  1X9N A;  4YY3 B;  4NXN B;  3KYH C;  1XDN A;  4LF9 B;  3TY9 A;  1HNX B;  5IWA B;  4DV4 B;  2UUA B;  2HVR A;  3BAB A;  3BA9 A;  5FPR A;  3JSL A;  1N34 B;  5D1O B;  2HVS A;  1DGS A;  1J5E B;  4UCV A;  4EQ5 A;  5LMN B;  2HIV A;  3GJX B;  3RR5 A;  4X65 B;  1XMQ B;  4DR4 B;  1TAE A;  3NBZ B;  2CFM A;  1HR0 B;  4JI3 B;  4B3S B;  4GKK B;  4LF6 B;  4JI1 B;  4JYA B;  2HIX A;  1V9P A;  4CC5 A;  2UU9 B;  4NXM B;  4B3M B;  4E6N A;  4LH6 A;  1HNW B;  4JI2 B;  3T1Y B;  4EFB A;  1FVI A;  4UCT A;  3UQ8 A;  4X62 B;  4LF5 B;  3JSN A;  4DV3 B;  3PN1 A;  1A0I A;  2UXD B;  4DR5 B;  4K0K B;  2UUC B;  4JV5 B;  3W1B A;  5BR8 B;  4UCS A;  3NC0 B;  4LH7 A;  2F4V B;  1FJG B;  4DUY B;  4DV2 B;  4JI8 B;  1B04 A;  4DR7 B;  4LF4 B;  4X66 B;  5FPO A;  4LF8 B;  4OX9 B;  3RTX A;  3W1G A;  2OWO A;  4EEQ A;  1XNQ B;  4LFC B;  2UXC B;  1CKN A;  2HVQ A;  3W5O A;  1ZAU A;  4X64 B;  2Q2U A;  1I94 B;  3NBY B;  4LFA B;  4GLX A;  3BAA A;  4B3R B;  1CKM A;  5D1P A;  4DV5 B;  1XMO B;  4KHP B;  2VQF B;  4CC6 A;  4TOI A;  4EFE A;  5D1O A;  1P16 A;  4LF7 B;  1XNR B;  3GDE A;  4JI4 B;  4PZ7 A;  3VNN A;  4DUZ B;  4LFB B;  3BA8 A;  4PZ6 A;  2UUB B;  5LMU B;  4JI5 B;  4DR6 B;  2VQE B;  4DV0 B;  4JI7 B;  4DR1 B;  4DR3 B;  4DRF A;  4B3T B;  4UFZ A;  2ZM6 B;  4YHH B;  1S68 A;  4JI0 B;  1IBM B;  4UCR A;  4DV6 B;  4JI6 B;  1HNZ B;  2E5L B;  3OTO B;  2UXB B;  3QWU A;  5DIS C;  4AQY B;  1N32 B;  2HHH B;  1IBK B;  1CKO A;  1N36 B;  4PZ8 A;  3T1H B;  1XK5 A;  1IBL B;  1TA8 A;  4GKJ B;  1VS0 A;  3SGI A;  1N33 B;  4UCO A;  4DV7 B;  1P8L A;  4UCU A;  2VUG A; 
#chains in the Genus database with same CATH topology
 4U6P A;  5IYB O;  3N6X A;  3SJQ C;  1K3E A;  4CE5 A;  2Y69 B;  4LC1 A;  3SYA A;  3BJY A;  1SA0 A;  3C90 A;  1BXR A;  2UUB H;  3K5N A;  5IYZ F;  3ABK B;  1OCR C;  5KFT A;  1BHA A;  1MG1 A;  4DRX A;  4K8Z A;  4DV4 B;  3B4S A;  2UUA B;  5H6Q A;  4MT8 A;  1XL4 A;  4O2B F;  3OMN B;  4Q43 A;  3BAB A;  3BA9 A;  1H2G A;  3CCQ V;  2FJZ A;  1RK5 A;  1XI1 A;  1C30 A;  2W6O A;  3GQC A;  4MTO A;  1XNQ O;  4X65 B;  4J9L A;  2DOS A;  1F51 A;  1VQ7 V;  3NXS A;  4EEY A;  1VAJ A;  2GDS A;  4XZ3 B;  3K5O A;  4TUY B;  3O9O A;  4I4T B;  4MSW C;  3DXR B;  3F8N A;  2DN9 A;  1WB8 A;  3FKS G;  4J0M A;  4DV5 O;  3T1Y B;  2R82 A;  3STL C;  4UCT A;  4MV6 A;  2W6J G;  4QW8 A;  3T1H O;  3PW7 A;  4GKJ O;  3RFC A;  1JDE A;  5D8D A;  4JI4 O;  5GON F;  4LBE C;  3ZN1 A;  5FJ8 G;  4QE7 A;  1LNQ A;  1ZET A;  5LHH A;  4FS2 A;  2Q4P A;  3RAQ A;  4X66 B;  2R7Z G;  2H8P C;  2CGO A;  4LCU C;  4LF9 O;  2F1M A;  2R9A A;  3P3P A;  4KFM A;  3J7A K;  1TWH A;  5DQI A;  1R6N A;  4LFC B;  5KFB A;  3MWD A;  1N32 O;  2GHY A;  2HHH O;  2DW4 A;  5KX5 A;  3KHG A;  2JEX A;  3AG4 B;  3T4D A;  2PVP A;  2KSW A;  2VQF B;  2J9G A;  2XD4 A;  3T9C A;  2FB5 A;  1EUD B;  4TWK A;  5LP6 B;  4BW9 A;  1GGO A;  1GH6 A;  3WWH A;  1OCZ C;  5IWA H;  4DK1 A;  2MW2 B;  3A0H Z;  4LFB B;  3E83 A;  2R7M A;  2ZDH A;  1G2W A;  4RB1 A;  4DV2 H;  1AJN A;  2L35 A;  4ECQ A;  3ABM C;  4K0K O;  4PI0 A;  4Y8V B;  1XQ8 A;  4Q20 A;  2P4K A;  4I50 B;  4O2A A;  2QM4 A;  4DV4 O;  4OX9 H;  4DV0 B;  4Q44 A;  3DC5 A;  1XDC A;  3CB2 A;  4IWX A;  4ED6 A;  2C2E A;  5KFU A;  1IOW A;  2Q0O C;  2ASL A;  2G38 A;  4MTD A;  3Q8S B;  4X1Y B;  5LHG A;  3W7W A;  3CC7 V;  4OPH A;  4JI6 B;  1BCC H;  3CJH B;  3ZRV A;  2UVU A;  3MWE A;  3IFX A;  1IBK B;  2ZE6 A;  1UJW B;  4PZ8 A;  3RIZ A;  5KT6 A;  2EJ2 A;  2UVW A;  2ZE5 A;  2Q73 A;  3GII A;  3GID A;  4B08 A;  4K6N A;  3TY8 A;  3RWR D;  4GYC B;  3QVN A;  4KHP O;  4DV1 B;  1PP9 H;  2WLM A;  3GB8 B;  1QR9 A;  2NUA B;  5DGB A;  4DUZ O;  2YXH A;  4EBC A;  5LXT B;  1I7L A;  5LYJ A;  4X66 O;  1AP5 A;  3CCR V;  4GUN A;  2QWP B;  2E2H A;  1N34 B;  3JAK A;  2CH7 A;  3QZ7 A;  5JVD A;  1TWG A;  3G8C A;  4RZQ A;  4C5C A;  4LFC O;  1EZ1 A;  3KAJ A;  1KUQ A;  5CA0 F;  2JEF A;  3NBZ B;  4ZHQ A;  1VQO V;  2CFM A;  4ECZ A;  4JI3 B;  4YAJ B;  4TUY F;  4I4T F;  4LF6 B;  3TQ1 A;  3WB1 A;  1M56 C;  1Q5O A;  1HDJ A;  5KHG A;  3GIL A;  3UYY A;  5C1O A;  3RB0 A;  4DR2 H;  4IZO A;  1BQ0 A;  2EZO A;  4ECT A;  4JZ2 A;  2UUC B;  4X1I B;  2EIN B;  4UV8 A;  3WB0 A;  5DGA A;  3WO0 A;  2CDY A;  1MAB G;  1U96 A;  2X6B A;  4PA9 A;  3VOT A;  4DYL A;  3VQY A;  1YXB A;  3QTC A;  1MNG A;  3VOU A;  3HKE A;  3GTQ A;  3CRQ A;  2RGV A;  4YR0 A;  3W1G A;  5FLM G;  2W8K A;  2ETN A;  1XMQ H;  3C0F B;  1DF5 A;  2P67 A;  2Z0A A;  1PKX A;  4JI6 O;  5I5Y A;  1FKA H;  3Q4H A;  1CKN A;  3W5O A;  4O81 A;  1Q90 D;  4JYY A;  4O4H A;  2CW8 A;  2FYU H;  3SJC C;  1JR9 A;  1WH2 A;  3S3W A;  1M9N A;  5EZY B;  2W8L A;  3CCJ V;  1RYR A;  4A93 G;  1EFR G;  2R7L A;  5LP6 F;  5KUK A;  1RJQ A;  2C28 A;  4B3M O;  4LF7 B;  1S0V A;  3QZ8 A;  3L73 H;  4GC6 A;  4DV1 O;  1RSO B;  4CH6 A;  4DL3 A;  2UXN A;  4H44 B;  4R7C A;  2OIG A;  4JI8 H;  3OUZ A;  4C2M A;  4LP8 A;  2AW9 A;  3K59 A;  4JI5 B;  2VQE B;  2EJR A;  4Q8F A;  1WA8 B;  4DR1 B;  5KFI A;  1D5A A;  1SER A;  1N34 O;  3R23 A;  2XAQ A;  4A3E G;  2C22 A;  2BQR A;  1FJG O;  4TM5 A;  2I80 A;  3AK1 A;  1QU7 A;  1HNZ B;  3T1C A;  4MVZ A;  2ZT9 B;  4QW9 A;  4KXR A;  2QWQ B;  4JI3 O;  4LF6 O;  4M9U A;  1G4Y B;  2EIJ C;  4O7V A;  3HOU G;  2DYS B;  1XL6 A;  4WBN B;  5IJ0 B;  1MA1 A;  5GTH Z;  5K1X A;  3K79 A;  4RB3 C;  2W0X A;  2ZGI A;  2EUL A;  4BWA A;  1XNR H;  1QR8 A;  4B3R O;  2Q2T A;  3CE2 A;  4QJF B;  2UUC O;  3T7A A;  3PR5 B;  1EKF A;  4F4Y A;  4ZBM A;  4RNM A;  4U3J A;  1Q43 A;  2P6J A;  3D8C A;  1GSA A;  3R66 A;  4YY3 B;  2LQT A;  2FP4 B;  5BZB A;  3QO7 A;  4HYK A;  2V7Q G;  2YEV A;  2ZNI A;  5LXT F;  3JSL A;  3HOW G;  3SJB C;  1K1Q A;  4UCV A;  5KLV H;  3AG1 C;  1TWA A;  2FMA A;  3DTU B;  3WO1 A;  2GUZ B;  4A2A A;  1OWT A;  4RNN A;  4DV5 H;  2C2D A;  1PNL A;  5DQH A;  1GK9 A;  4M0J A;  2LGQ A;  1HR0 B;  3VPD A;  5E79 Z;  4IGG A;  3T1H H;  2DJV A;  4MS2 A;  4YJ2 B;  2JA6 G;  4GKJ H;  4JI4 H;  1H2N A;  2WLI B;  2Y4T A;  4LH6 A;  1HNW B;  2YID A;  4BWS C;  2ZCE A;  4O4I A;  3I4N G;  1SQV H;  4EBD A;  2XND G;  4R50 A;  3JSN A;  3PN1 A;  1JFF B;  2RGR A;  1ZL8 A;  3OSP A;  4LF7 O;  4DL2 A;  2NR5 A;  2JDI G;  5JJE B;  4CHI A;  5EWG A;  5J2U A;  3UM7 A;  4DIM A;  1VQL V;  2YWV A;  4LF9 H;  3NC0 B;  1G1X B;  2F4V B;  3JRX A;  4HNA B;  2Y48 A;  3K58 A;  2W6N A;  2B63 A;  1Q6H A;  4JI5 O;  4TV9 B;  2VQE O;  2HJD A;  1QLE C;  5KHK A;  4O4J F;  4LF8 B;  2HHH H;  5KHI A;  3T9B A;  1N32 H;  1S76 D;  3RTX A;  2DMX A;  1BSM A;  4GT1 A;  4I55 A;  5H80 A;  3T54 A;  5K3W A;  4ZKI A;  4RUA A;  2XAH A;  1HNZ O;  2ZIO A;  3AK3 A;  1KJ9 A;  3B40 A;  2ZIM A;  1M0W A;  3GTP A;  5EIB D;  2QYZ A;  1BS3 A;  1KJ8 A;  5EZY F;  3H0G A;  4IRD A;  4K0K H;  4TOI A;  4JI1 O;  4J42 A;  2UU9 O;  4DV4 H;  2R92 G;  3K0D A;  2ITD C;  3FMA A;  4BW5 A;  2A9H A;  1O9H A;  1KBL A;  2IM9 A;  3GV7 B;  3ETH A;  2JA5 A;  4YY3 O;  2UUB B;  5BWV A;  4JV5 O;  3RYF B;  3LML A;  3TIN A;  4ZIB A;  1W2B U;  3CRC A;  1JQ0 A;  1ORQ C;  1NR1 A;  2R86 A;  3ZCC A;  2BOB C;  2LW7 A;  5GTI Z;  4YJ3 B;  5I5V A;  3LWB A;  1I5Y A;  2Y0S A;  4YAK B;  4MVO A;  3MHS C;  3JAT A;  5EBW C;  4AHC A;  2UVR A;  4KHP H;  2B5U A;  1XK5 A;  1WCM G;  1VIB A;  3G6E V;  5KFC A;  1HNW O;  4UCO A;  4J11 A;  3RJ0 A;  3RGB A;  2CTQ A;  5BMV B;  3N41 B;  4TQR A;  2W7P A;  4DUZ H;  3GIK A;  4X66 H;  2W6Z A;  5KFR A;  1YTF D;  1X9N A;  2M6Y A;  2YYA A;  2VQD A;  1WP8 A;  3NUA A;  3G6V A;  2F4V O;  2VPQ A;  2FK3 A;  5EYP A;  1SCU B;  5A9G A;  1KJI A;  2XGP A;  1T94 A;  4KP4 A;  4QIW F;  2FTK A;  4LF8 O;  2OIE A;  4I0X B;  4IIJ A;  4YR2 A;  4B7K A;  4FZ1 A;  2A06 H;  3ZMU A;  2I87 A;  4J9S A;  1VQ6 V;  2A3Q A;  3ZBH A;  3SR2 C;  3M9O B;  4JI0 O;  5L9X A;  1SQQ H;  4YJ2 F;  1V9P A;  4LSA A;  1YIT V;  4FFN A;  3RYI A;  1XIL A;  2DYR C;  5DGI A;  5CR5 A;  5KG6 A;  5L1I A;  2W9C B;  4JZG A;  2O03 A;  5KAI Z;  2J6S A;  4Z2W A;  2DLN A;  3OMA B;  3J80 N;  1HP8 A;  1UFI A;  2JVD A;  4IHJ B;  4PD4 F;  5DQG A;  2R8H A;  2WLK A;  4WFB V;  4DV2 B;  4JI6 H;  3DSQ A;  4G27 B;  3ZRW B;  5KT3 A;  1FXH A;  1XBL A;  3M8A A;  1HWY A;  2YSU B;  4OX9 B;  4U7O A;  3GIJ A;  4EEQ A;  4X1K B;  3TII A;  2D2C B;  3MFH A;  3MFI A;  3H9V A;  3SPH A;  3JD0 A;  3RW0 A;  4F4X A;  2Q2U A;  4B3M H;  1NR7 A;  3CCU V;  1GM7 A;  4PDV A;  5DED A;  4X20 A;  4DV1 H;  1WSC A;  2Q7H A;  1Y6X A;  3TW7 A;  1DLB A;  3MR3 A;  3GLK A;  4R6Z A;  2EZP A;  3DGE A;  1QNM A;  2W6P A;  2C2R A;  5C93 A;  1PNK A;  5AG2 A;  3RBZ A;  3ASO B;  5LOV B;  5EC2 C;  1N34 H;  4FM9 A;  1BZK A;  3A0R A;  3E8F A;  3ZJZ A;  1BNC A;  1FJG H;  5JQG B;  4O7R A;  1JPX A;  3IN5 A;  4DR6 B;  3QFF A;  4JAU A;  3CXC U;  1A48 A;  4K3A A;  4JI3 H;  1SF9 A;  4H33 A;  4LF6 H;  1S97 A;  4DLK A;  2ARH A;  2PI5 A;  5DEC A;  3CSX A;  4D7T A;  2LGW A;  4UCR A;  5KUM A;  4YJ3 F;  4PA4 A;  3G6B A;  1I2L A;  1L1F A;  5KFN A;  4PDL A;  2Y0S E;  3CEI A;  2Q68 A;  4NTW A;  1TWC A;  1VEW A;  2NNU A;  2QDO A;  1CKO A;  5CBH A;  5JQW A;  3FAV B;  5KG5 A;  4B3R H;  2UUC H;  1K7D A;  2PTM A;  2R93 G;  1KU9 A;  4ZOL B;  3BFR A;  2H94 A;  3MR5 A;  5BMV F;  3L2P A;  4DR2 B;  3ETJ A;  4BBR G;  3UO3 A;  4HN2 A;  3K5I A;  3QO8 A;  1YJN V;  4NTX A;  4Z1M G;  2DIK A;  1S0M A;  3E22 A;  2VA3 A;  1Z2G A;  3R5X A;  4E2L A;  4FFL A;  2V1D A;  5KFZ A;  4JV1 A;  3E5N A;  1ENV A;  5C44 G;  3K5L A;  2WSS G;  3GJX B;  5D5Q A;  1XMQ B;  5IYC G;  4MW3 A;  4PWQ A;  1S72 V;  5KFE A;  4MV4 A;  3Q8R B;  4FLW A;  3WU2 Z;  1FXK C;  1FXK A;  4GC7 A;  1OCC B;  1R3I C;  1FVI A;  1UPG A;  1GTO A;  2WLH A;  3JD3 A;  1MZE A;  5IYZ A;  1NTZ H;  3FKI A;  2D3O W;  3MJF A;  1OBG A;  4RU9 A;  3T5H A;  4JI5 H;  4TT3 G;  3W1B A;  4J9O A;  2ZDQ A;  4IYH A;  3N27 A;  1R3L C;  5JWP A;  1W0J G;  1VQK V;  4O2B A;  1XRE A;  1Q6U A;  4LH7 A;  4IHJ F;  4LMY A;  4JI8 B;  4O7L A;  4DR6 O;  4F6R A;  1COW G;  5FPO A;  4CH4 A;  3A2F A;  2HP8 A;  3K9S A;  4FU0 A;  1DK1 A;  1FAF A;  3OGC C;  3PW0 A;  4RUE A;  3DTG A;  1Y1V G;  1GYF A;  1QQC A;  4X88 A;  1KKD A;  4XDK A;  4JI1 H;  2UU9 H;  5LMN O;  3KHH A;  1AB3 A;  3I56 V;  5EWE A;  2F43 G;  5KA6 A;  5KG1 A;  2NN4 A;  5GON A;  1NH2 D;  3F7Y C;  2F95 B;  4YY3 H;  4J80 A;  2XGQ A;  4JV5 H;  5L3D A;  5BR8 H;  1XNR B;  3EVK A;  3S3X A;  3R9R A;  2QM7 A;  2AGO A;  5LOV F;  2PBZ A;  1ZUQ A;  2CAZ C;  2EIL B;  1SRY A;  5JQG F;  5KFK A;  1EZJ A;  2B1G A;  2HVJ C;  3RGX A;  1VP7 A;  1EBO A;  4JI7 B;  2NU7 B;  3A0B Z;  3TQT A;  3CCE V;  5KFD A;  2V4R A;  4FFB B;  2O57 A;  2E5L B;  4LF4 O;  3KHR A;  3HKB A;  4LR3 A;  1KC8 W;  4J7K A;  5J2T B;  4EYH B;  4ECV A;  2QTS A;  1MOF A;  2AXT Z;  3T1H B;  5EC1 C;  4GKJ B;  4PEL A;  3ZHT A;  3LUL A;  1ROP A;  3LP8 A;  4ZOL F;  2COJ A;  4TQD A;  4IRC A;  2JJ1 G;  1KKC A;  1ZTE A;  1YSC A;  2RN9 A;  5JH7 B;  4LF8 H;  5K2M A;  1YF2 A;  4FGR A;  3KG2 A;  1RM1 B;  1IDS A;  4LF9 B;  3TY9 A;  1NQT A;  1ZWI C;  4PHZ A;  4RCN A;  2VR1 A;  4JI8 O;  3KZI Z;  3JAL B;  4JI0 H;  1EZV H;  1J95 A;  4EB6 B;  3H1L H;  3BEH A;  2RJZ A;  1M4U A;  4O4L A;  3N42 B;  3ZHS A;  2HKO A;  2Q0A A;  3RR5 A;  3B8N A;  5B1B C;  1SS3 A;  3T9E A;  2EJ7 A;  4X8A A;  4DR3 O;  3KXY T;  1JX9 A;  3RB6 A;  3WWI A;  3CHX A;  3GV8 B;  5JCO A;  4B3S B;  3NR7 A;  3H3V H;  3JD1 A;  2JA7 G;  2Y69 C;  3CCL V;  2FLP A;  1S3J A;  3ABL B;  2P7T C;  2QR4 A;  4ED2 A;  2CW7 A;  2LW1 A;  2DQ3 A;  4ECW A;  1OZ0 A;  4JTD B;  4K0K B;  4QWB A;  1XNR O;  4BIU A;  3JAS B;  4ECR A;  4DV7 O;  2RMK B;  1JX4 A;  3OGI B;  1T3N A;  2E76 B;  1QVF U;  3HOY G;  1PPJ H;  3Q1K A;  3T5K A;  2ZE8 A;  5CA0 A;  5CBG A;  4JI7 O;  2R7K A;  3TGU H;  2YZL A;  2LP7 A;  4NLG A;  1SA0 B;  2C2A A;  3CX5 F;  4WFE A;  2R8K A;  2E5L O;  2IH3 C;  1OCR B;  5I5S A;  1ZAU A;  3UO2 A;  1S10 A;  3FX7 A;  1E4F T;  5F2V O;  4DRX B;  3CC2 V;  1AIL A;  1QLN A;  3SJA C;  1GKF A;  1WNS A;  4A3G G;  5C8Y A;  4KHP B;  4NYE A;  3MR2 A;  3ETE A;  2YDE A;  4TV8 B;  4A3L G;  4I9W A;  3JZI A;  2PN1 A;  1IX9 A;  4F4Z A;  2JS3 A;  4ED1 A;  2YL2 A;  4DUZ B;  4GZR B;  3E89 A;  1GN4 A;  3U0Z A;  4JYC A;  1WRV A;  3WG7 C;  3ZHR A;  3ZHV A;  4CKE A;  4U7C A;  3T4Z A;  1P49 A;  4A3I G;  4W4L A;  2JA5 G;  5KT4 A;  4CH5 A;  2ABJ A;  3L74 H;  1Q82 W;  4O7Z A;  3AG4 C;  3AW8 A;  3QWU A;  5KHJ A;  5DIS C;  3OTF A;  5J2T F;  3OR7 C;  2XIG A;  3ML0 A;  3H1H H;  4MVS A;  5LP6 C;  5LP6 A;  4B3S O;  2QB5 A;  3BAC A;  2R6F A;  2ZE7 A;  3D3Q A;  1BQZ A;  3PJS K;  3BHP A;  2IA6 A;  4ED0 A;  3L9D A;  2PZS A;  3GB7 C;  2CZG A;  4LFA O;  5CAE B;  1H2M A;  5K1P A;  2YI8 A;  4MV8 A;  2P06 A;  2Q7D A;  5JH7 F;  1R3K C;  2A0L A;  5KX5 B;  3PFF A;  2W9A A;  2NU9 B;  4FMT A;  3HOZ G;  1XDN A;  3A8T A;  5LBQ A;  3CME V;  1FS0 G;  4PBC A;  1AR1 B;  4MW8 A;  2DWE C;  4FBU A;  4NYK A;  1OCZ B;  1J5E B;  4UVA A;  3DTF A;  3GIQ A;  3OTO H;  1NS1 A;  4L8J A;  4P30 A;  3CCS V;  2GQR A;  4O2A B;  4B3M B;  4FLT A;  1Z5V A;  2FE3 A;  1FXV A;  1CP9 A;  5B1A B;  1SZX A;  4BXX G;  4RAI A;  4UB8 Z;  3MAQ A;  2Y4R A;  4O7Y A;  1AN7 A;  2YU9 A;  3SPG A;  2GTA A;  3HO8 A;  2FB9 A;  2V58 A;  4APM A;  4DR6 H;  2QGN A;  1BT8 A;  1BHB A;  3MR6 A;  5LXT A;  5KFV A;  2CTW A;  4UCS A;  2YW2 A;  1V55 C;  1HNX H;  2IBK A;  4FLX A;  1Q86 W;  3LSS A;  1Q6I A;  1FJG B;  3K3V A;  1S0O A;  3H20 A;  2IW5 A;  2R7N A;  4FVM A;  2XCL A;  2GV9 A;  2Y0P A;  3CS5 A;  5LMN H;  1S5J A;  3J80 W;  5E25 A;  3L75 H;  3OM3 B;  2UXC B;  5DG7 A;  2HVQ A;  4EGQ A;  5DAA A;  4NXM H;  1TWF A;  3ABU A;  4A5U B;  1IXM A;  2R8I A;  4J9Q A;  1MSW D;  4B3R B;  5LYJ B;  1AVM A;  4FLV A;  1V54 B;  1AI4 A;  3BG5 A;  1AI7 A;  4TV8 F;  2EIN C;  3U55 A;  3BQ2 A;  2BTQ A;  2GTS A;  4WFF A;  4JYB A;  5JVD B;  4A3C G;  1M0T A;  3MWM A;  4PZ7 A;  4ZHQ B;  3PW4 A;  1E1Q G;  1NBM G;  2M7W A;  1OBD A;  5H5N A;  4O4J A;  4PZ6 A;  3G4S V;  4RUF A;  2ITC C;  1M56 B;  3RV4 A;  4LF4 H;  2ZD9 A;  3KCX A;  2YC0 A;  1T36 A;  3SPC A;  5A2Q N;  4FE2 A;  3N2K A;  4O3S A;  1YDX A;  2IH1 C;  1J5E O;  4YB8 B;  2PMZ A;  4EG0 A;  2AGP A;  4FFP A;  2P5O A;  2B9Z A;  1JOY A;  2C35 B;  1N56 A;  2X7R B;  4UVB A;  3HKC B;  1IZ3 A;  5KFA A;  4YQW A;  3HBL A;  3HKE B;  5ITZ A;  4LNU A;  5L1J A;  3FB7 C;  4Q45 A;  4RB2 C;  3BCC H;  1FFX A;  1Z5W A;  3Q4H B;  1CKN B;  4I50 F;  3R65 A;  2F93 B;  1SC5 B;  1RJR A;  1LUV A;  3J81 N;  3K5M A;  2HGX A;  4YIO A;  3LUT B;  4DR3 H;  5JVL A;  4GCZ A;  2ZM6 H;  3H1I H;  4ZI7 B;  4ZQI A;  1UNN C;  3VQV A;  4Q4D A;  1L2Z A;  4ECY A;  2WTF A;  3IAY A;  3G80 A;  2UXC O;  2WB1 A;  1N36 H;  1TAE A;  4A2B A;  5KMG A;  3LNM B;  4J9P A;  1IBL H;  3RF2 A;  4O2A F;  4JI1 B;  3ORQ A;  2UU9 B;  4D7S A;  4DV7 H;  4QJF A;  4EFB A;  2LJ2 A;  3UQ8 A;  5IYC O;  4X62 B;  1E4E A;  3THO A;  2HGS A;  2DPJ A;  3ETG A;  5KFG A;  5C4X G;  4JV5 B;  5B3S C;  2WLL B;  4JI7 H;  1AJP A;  1IYD A;  2W6M A;  5BR8 B;  3FKI G;  4QIW A;  1WP7 A;  1XOU A;  3LSU A;  4J7Z A;  1O9G A;  2PUS A;  3FB8 C;  1KUT A;  1R9T A;  4DUY B;  2CQY A;  2E5L H;  4PDB A;  2XT9 A;  2GUZ A;  4H37 A;  1KP3 A;  2FKX A;  3H1K H;  5IT9 N;  1K5S A;  1X59 A;  1B6R A;  3N43 B;  3HR0 A;  3UKM A;  3AG2 C;  3BRC A;  4DV0 H;  3V6K A;  4AI8 A;  4PDR A;  4YJ2 A;  1M6V A;  4U3J B;  1B3Q A;  1P4R A;  3JAW B;  2CGN A;  2AQ4 A;  1JXL A;  3GTJ A;  1US6 A;  1NZ6 A;  2YEV B;  4HQ6 A;  4ED8 A;  5LYJ F;  4HR7 A;  3OW2 U;  5C3E G;  3RN4 A;  1SYX B;  3BQ0 A;  3AG1 B;  5JUM A;  2EIM B;  2QM8 A;  3OE7 G;  5KFQ A;  3GTL A;  5BY1 A;  1DTO A;  4JAA A;  5KFY A;  2VPS A;  3WWJ A;  1KJJ A;  1BGW A;  5KFX A;  3UZO A;  5KFW A;  1C3O A;  2JGU A;  2W9B B;  1O75 A;  3T2M A;  4AYB A;  4B3S H;  1F23 A;  1ZL8 B;  5L3B A;  4B3T B;  1KMI Z;  2RQ6 A;  2K1E A;  4JI0 B;  5CA3 A;  1SZT A;  2PMZ E;  1Q81 W;  1D2D A;  4LFA H;  3TEK A;  3GIM A;  1YHQ V;  5B5E Z;  3RFR A;  1K5Q A;  3D3I A;  4CKC A;  4RUC A;  1TA8 A;  2QA4 V;  4FFR A;  4FBT A;  1BGY H;  4ABM A;  4I55 B;  4X62 O;  3UT5 B;  2YIC A;  3TXQ A;  4RAY A;  1F4M A;  4FIP C;  3K3W A;  3RVZ A;  5BR8 O;  1PX2 A;  2HG8 A;  2JRI A;  1K34 A;  3LQS A;  1IOV A;  3N2G A;  1SFO A;  4DUY O;  4PA7 A;  4YJ3 A;  4ZI7 F;  5FPR A;  1GLV A;  3BQ1 A;  4GX1 A;  5CM0 A;  1D5N A;  1PD3 A;  3NGD A;  2WB1 E;  4WBN F;  3EPI A;  4R8U A;  2Q6A A;  2BTO A;  1PL4 A;  3U10 A;  5LA6 A;  2BCC H;  2EIK B;  4G2K A;  4DV6 O;  1CXZ B;  1VKZ A;  3HKD A;  1TUE B;  5T14 A;  2V4D A;  3HB9 A;  4WFH A;  4PI2 A;  3PW5 A;  3RAX A;  4HNV A;  3JAT B;  5LHI A;  1VQP V;  2PYL A;  4I0X A;  1ZLZ A;  4MV3 A;  1K33 A;  5BPH A;  2Q7G A;  3SDL A;  2RDJ A;  4MTF A;  2XUM A;  3R5F A;  3U0G A;  1YCI A;  3CMA V;  4B3T O;  1IUR A;  3M9N B;  3EYY A;  1RJP A;  5IY5 C;  4PJ0 Z;  3KTM A;  1RPR A;  1TGO A;  5L3G A;  2Q9L A;  1BL8 A;  5KFP A;  1WB7 A;  4JV2 A;  1Y74 A;  5CN0 A;  1EYZ A;  2OCC B;  3X2Q B;  5EYP B;  1DAA A;  3NBY B;  4HNU A;  2V9W A;  5LGN A;  2QEX V;  2XHB A;  1CKM A;  2VOB A;  1XMO B;  4IIJ B;  2X5R A;  2JGD A;  4JUZ A;  4X89 A;  4XYM B;  3ZS8 C;  5CA1 A;  2UXD H;  5D1O A;  2JJ2 G;  3APQ A;  3ZRS A;  3RUP A;  3ZRW A;  4TV9 F;  1Y76 A;  1J5E H;  1GMG A;  1A9X A;  1RPO A;  1TVK A;  4X1K A;  3RYI B;  2HJW A;  2DE0 X;  4J9Z B;  1KJQ A;  2A7W A;  4AYB E;  3KHL A;  2HHF A;  1NKD A;  5CE8 A;  5B1O A;  2IJI A;  2P90 A;  1H38 A;  1EHI A;  5I5X A;  2E2I A;  1I94 H;  4J41 A;  3OTO B;  3V4S A;  3IC9 A;  3OUS A;  4AQY B;  1K92 A;  2FPP B;  5FR9 A;  5H9C A;  1H2L A;  4O86 A;  2ZDI C;  3FDS A;  3WNZ A;  2ZNJ A;  5KG3 A;  4ETS A;  5KT5 A;  3HB3 B;  2DQ0 A;  1ULZ A;  2DWC A;  4X64 O;  2R85 A;  4I55 F;  4UCU A;  1M57 B;  5JQG A;  5KG4 A;  3FB6 C;  5L3C A;  3VMM A;  5IJ9 A;  3TY5 A;  3OEH G;  1ET0 A;  1R1B A;  1TUB A;  1FD9 A;  3QO5 A;  1WPB A;  4X20 B;  3RB4 A;  1CPY A;  1HNX B;  4HZ3 A;  3JD2 A;  2AGA A;  4MTE A;  2I8C A;  2UXC H;  2KQX A;  3G67 A;  2P4V A;  4LWS A;  1ZQ7 A;  5KG0 A;  4YP3 A;  5LMN B;  4RO2 A;  4WF9 V;  1L0N H;  3MDS A;  4P9O A;  1GAX A;  2JEJ A;  1A3G A;  3AG7 A;  4ZOL A;  1GO3 E;  1YVW A;  4GX2 A;  5BWU A;  4JYA B;  1VQN V;  3H4B A;  2M05 A;  4NXM B;  4I7Z B;  4FZ0 A;  1RP3 B;  1XMO O;  4ED3 A;  1QHT A;  2A79 B;  2RDI A;  2IJH A;  2JEG A;  5JJJ B;  5CB4 A;  4RWU A;  4DR5 B;  4WFG A;  1UC8 A;  2FKL A;  1OCO B;  1JJO A;  3JYC A;  1H2S B;  4LF4 B;  1I6U A;  5C1P A;  4N23 A;  4CS2 A;  1S5L Z;  3ASN B;  4F4L A;  1NVP D;  2X0S A;  3G6X A;  1BMF G;  1M93 A;  4BY1 G;  4UXN A;  4O3O A;  5KFF A;  1OCC C;  2BSK B;  4K35 A;  3OTO O;  4ECS A;  3DAA A;  4AQY O;  4GLX A;  3APO A;  3E22 B;  3IC7 A;  2WLN A;  2Z5U A;  1JVM A;  2EX3 A;  2ZR2 A;  1KQS U;  3K3P A;  4MA5 A;  1S5H C;  5KT2 A;  3GV5 B;  2RNB A;  1KD1 W;  4IIJ F;  3RT3 C;  1M7J A;  3LSQ A;  1S77 D;  4GKK O;  5B1N A;  1VQ5 V;  1K4C C;  3QQM A;  3HPL C;  2YZN A;  4MV9 A;  2XAG A;  3CRR A;  1VQ8 V;  2HJF C;  2YS8 A;  4BIZ A;  2ATK C;  4C5B A;  3GTK A;  3KRE A;  1HNX O;  2VUM A;  3JAM N;  3I55 V;  3DF7 A;  1VF5 B;  2QJ1 A;  1OV9 A;  5IYZ B;  4DR3 B;  2KKW A;  2ZM6 B;  2FK2 A;  3HT5 A;  1H8H G;  2JIZ G;  1VQM V;  1I1L A;  4QWD A;  3E8G A;  5A2Q W;  2XCA A;  2W70 A;  4X62 H;  1YZB A;  4QWE A;  2ASJ A;  1N36 B;  2IU3 A;  2KG7 A;  4JYA O;  1VBG A;  4ECX A;  1IBL B;  4NXM O;  3TW6 A;  3KCY A;  1NH2 B;  1VS0 A;  3RYH A;  1N33 B;  2NU6 B;  4O3Q A;  4DV7 B;  1JCH A;  3CQZ A;  2EIL C;  3AG3 B;  4FFK A;  4NVP A;  4DUY H;  1L8D A;  4DR5 O;  3D36 C;  4H13 B;  2JEI A;  1CQJ B;  1SKV A;  1VMG A;  5FNV B;  4K8X A;  1I2K A;  3RV3 A;  4FFM A;  2BOC C;  3E8H A;  2GBO A;  3CPW U;  4NXN B;  3Q8P B;  1AJQ A;  4DW1 A;  4FFB A;  3GWO A;  3J81 W;  1RFY A;  1DGS A;  4PA6 A;  2Z3Y A;  5J2T A;  4EQ5 A;  2JS5 A;  4DV6 H;  3E86 A;  3E8B A;  3CXH F;  5LMU O;  2Z04 A;  2Q5Z A;  2E75 B;  2YUA A;  2ZXW B;  1BE3 H;  2OTL V;  1AUX A;  4YHH O;  4FJC C;  4QGP A;  5FD5 A;  2HIX A;  4JAS A;  3OD4 A;  1E79 G;  1KEE A;  5JH7 A;  2QK4 A;  4DL4 A;  1XUQ A;  2BQU A;  2J6T A;  3HKB B;  2FK1 A;  1G6U A;  4QPJ A;  3TXS A;  4EYI B;  4B3T H;  4MTX A;  5IYD O;  1I50 A;  4DL6 A;  3GIP A;  4R8C A;  1P7B A;  3OEE G;  3RYC A;  4L87 A;  3Q8Q B;  2ADQ B;  3OT7 A;  4XDJ A;  2PYJ A;  4NZN A;  2ZM6 O;  2OWO A;  2ATL A;  3EPG A;  3H01 A;  4Q4C A;  1EN5 A;  1I5X A;  3JAR B;  5IT9 W;  4FM0 A;  3V4Z A;  1N4C A;  4M7E A;  2YCH A;  3ABL C;  4BAY A;  4LFA B;  3ABK C;  1N36 O;  4I7H A;  2RDC A;  1JLL B;  1QBZ A;  1IBL O;  2YRW A;  3I12 A;  2XOK G;  1N33 O;  2DWD C;  4O4L B;  1URF A;  2IJJ A;  3JRW A;  3K0G A;  5H6R A;  3SPJ A;  4KL1 A;  4QNH B;  2EJ0 A;  2Z02 A;  3N40 P;  4CMD A;  3V6H A;  2DAA A;  3U9S A;  4MV7 A;  2CTP A;  3VA7 A;  4LF5 O;  4E4E A;  4TQF A;  2R9R B;  4DV3 O;  2YXY A;  4NXN O;  2B63 G;  1KEC A;  1PV0 A;  4TUY A;  4I4T A;  4G3I A;  1AI6 A;  3DXR A;  2X0L A;  4DRF A;  3EHB B;  4UFZ A;  5KS8 A;  5L1K A;  2IJK A;  3L71 H;  2P22 C;  3HKZ A;  4DR7 O;  5BWT A;  4X64 H;  2YI9 A;  3ZMZ A;  1RYS A;  4TV8 A;  1SEI A;  1WJZ A;  1FPO A;  1YJW V;  4O7N A;  4Z1V A;  5DMX A;  3H0G G;  5HBR B;  5KKN B;  5KFH A;  5CA0 B;  2V4Q A;  1Y1W A;  5BWR A;  2NVY A;  3SGI A;  4AIL C;  2VRZ A;  2AZ0 A;  4YR3 A;  3TCU A;  1ZX3 A;  1UC9 A;  4OGQ B;  2WLJ A;  4QWA A;  1GN3 A;  5FNV F;  5E1A C;  4J9M A;  4IRK A;  3RGZ A;  2DPI A;  3TK1 A;  5C8Y B;  4NR1 A;  4ME6 A;  4O7S A;  4RZR A;  1DIK A;  2EJ3 A;  1I1K A;  3H40 A;  1AI5 A;  1XMO H;  5EK0 A;  1NI8 A;  2GPS A;  4ECU A;  1GSH A;  3WG7 B;  2YZG A;  1IBM O;  1AR4 A;  2CKZ B;  3N44 B;  4E6N A;  5KFJ A;  4YXW G;  3T9D A;  2ALZ A;  4I50 A;  2WE6 A;  3QG5 A;  4B7E A;  2N74 A;  4X9Q A;  1A0I A;  3LNN A;  1QVG U;  2UXD B;  4DAA A;  3RBE A;  4A3M G;  5D5P A;  3WFV A;  3N8D A;  1MZB A;  5HFL A;  4X1Y A;  1GM8 A;  1VBH A;  2X6A A;  4O83 A;  3CJH A;  2E3C A;  2N04 A;  3B09 A;  4A3D G;  4ED7 A;  4UB6 Z;  4AQY H;  2SCU B;  5DG9 A;  2GLT A;  1KB9 F;  3ABM B;  1CEZ A;  4DR4 H;  3AX6 A;  3L4J A;  4RAZ A;  2ILM A;  2UUA O;  4G28 B;  1LUW A;  4GKK H;  5B1A C;  1I94 B;  1XHX A;  2YIA A;  3SI8 A;  3QF7 A;  2Y0I A;  1THZ A;  3RBD A;  5HNE A;  3BAA A;  5FLX N;  4X65 O;  3P30 A;  4GLW A;  5D1P A;  2HGW A;  1R3J C;  1FFT B;  2R93 A;  1Q8I A;  4O4L F;  3B77 A;  3MD0 A;  3UFX B;  3GDE A;  4IAJ A;  3T1Y O;  2F66 C;  4QPK A;  4QE9 A;  2HG5 C;  4NZM A;  4RQF A;  2NU8 B;  3CP1 A;  1B06 A;  3OAA G;  4RB0 A;  4A3B G;  1JA8 A;  1VAR A;  4P9P A;  1ZSP A;  2CE4 A;  3E2E A;  4JYA H;  1OHH G;  4FLU A;  4XDL A;  1F7Y A;  3HKZ E;  2H3O A;  4MVQ A;  2QWN B;  2YZM A;  3STZ C;  5DLG A;  5L1L A;  1V54 C;  4J9N A;  2JA8 G;  1V55 B;  4XX0 B;  4EKW A;  5BYB A;  4EGJ A;  4X1I A;  1K73 W;  1K1S A;  3CSW A;  3RB3 A;  3JAK B;  1PL0 A;  4MA0 A;  4FM2 A;  4R7R A;  2CH7 B;  4DR5 H;  1N0N A;  5KT7 A;  1X4T A;  4RQE A;  2Q67 A;  3N6R A;  2VUG A;  2QKC A;  3ABT A;  5C5J A;  2UXD O;  1U97 A;  3U9T A;  3L4K A;  4BIO A;  2VQF O;  1EN4 A;  4GX5 A;  1W93 A;  1GSO A;  2WA4 A;  2WDT A;  4DL7 A;  1HW7 A;  1YEW A;  5CBF A;  2FL4 A;  1PM9 A;  2YRX A;  5LMU H;  3SYO A;  3KYH C;  5C8Y F;  3GTG A;  3VBB A;  2XTA A;  4BBS G;  1V4Y A;  2BTQ B;  1N8R W;  1LR1 A;  4LFB O;  4YHH H;  3EXA A;  5EZY A;  2E74 B;  2QKA A;  2X6C A;  2QF7 A;  3GVM A;  1SQG A;  1SQP H;  4FK5 C;  2W0F C;  3ETD A;  3W7T A;  3PVX A;  3HKC A;  4JF3 A;  4MAM A;  3F7V C;  4C5A A;  4O4J B;  1ARO P;  4DV0 O;  1Y1V A;  5JJN B;  1RSO A;  1I94 O;  1B6S A;  1NJI W;  1YI2 V;  2R9I A;  5I5T A;  1GN2 A;  2OT5 A;  3GWK C;  3N2K B;  4JI2 B;  3OUU A;  3L72 H;  1IBK O;  5KX5 F;  4O4H B;  1WA8 A;  3O65 A;  2UVV A;  5L3E A;  1VQ4 V;  4Q6G A;  4ZI7 A;  1W0K G;  3W7U A;  3M7M X;  1I1M A;  3T99 A;  4A3K G;  2PF4 E;  5ITZ B;  4LNU B;  4UUG A;  2DYS C;  2HFE C;  2XC9 A;  3PW2 A;  5IJ0 A;  4WBN A;  4J10 A;  5LL6 Y;  1FFX B;  1SQF A;  3PO3 G;  4O84 A;  1N33 H;  4UUJ C;  3LDC A;  1NTM H;  2CK3 G;  3OFN G;  5IYD G;  2PGG A;  1M5I A;  2A1H A;  3ZMS A;  2V59 A;  4LF5 H;  2W57 A;  5KFS A;  3PZP A;  2WLL A;  3CCV V;  1W96 A;  4DV3 H;  1F4N A;  2WAM A;  4NXN H;  4CC6 A;  4CS3 A;  2ODT X;  1GM9 A;  1SQB H;  4FLY A;  3LDE A;  2EIJ B;  1WN7 A;  4UV9 A;  2CNQ A;  3SPI A;  2COI A;  2Q7E A;  1AR5 A;  2JK5 C;  2N05 A;  5KMG B;  1S9F A;  1RK6 A;  1M1K W;  4TVI A;  2LFS A;  3SYP A;  1AP6 A;  3P3N A;  5BWW A;  4DR7 H;  4DQN A;  2R8J A;  2PI4 A;  4HBN A;  1Y14 B;  3ZRX A;  1E4E B;  1Q7Y W;  2ZDG A;  2WLI A;  2OTJ V;  3JAW A;  2VUM G;  2Q69 A;  4MTG A;  1XNQ H;  5B3S B;  3JAM W;  3ZMT A;  4DV6 B;  1JFF A;  4LSX A;  4I5S A;  2K9P A;  4CMF A;  2UXX A;  3ZX6 A;  2UXB B;  1DV2 A;  4TSF G;  3TIG A;  2B1I A;  2EIM C;  2KB1 A;  5IYB G;  2OLS A;  5JVD F;  3SE7 A;  2JA7 A;  4HNA A;  2ASD A;  1W59 A;  3AG2 B;  1K97 A;  3L70 H;  4JI2 O;  2ZKO A;  4JTC B;  4OPA A;  4TV9 A;  4CBC A;  4ZHQ F;  3GTO A;  2IBZ H;  1WLE A;  2COG A;  2WYO A;  3UZB A;  2AHZ A;  3IJ4 A;  2HDK A;  3VPB A;  4O4I B;  3SYQ A;  2W9B A;  4J9R A;  2YS6 A;  4F4W A;  1Z2P X;  2OH2 A;  3ZN0 A;  2VS0 A;  2R70 A;  2R8G A;  2RF4 A;  3VQX A;  5J2U B;  4PA3 A;  4O3R A;  5B66 Z;  2BE3 A;  1ZHS A;  2W7O A;  1IXB A;  1P84 F;  5KHH A;  1IBM H;  5BXZ A;  1JKJ B;  4O82 A;  5EIB C;  1B6Q A;  4MV1 A;  1KYO F;  2ZIN A;  4A3J G;  3ZMV A;  1QLE B;  4DR1 O;  3UCS C;  5IDJ A;  4EBE A;  1WR2 A;  2KSD A;  4JV0 A;  1Y67 A;  4JTA B;  3UT5 A;  1DF4 A;  3M9M B;  5KFM A;  3RYF A;  2W6I G;  3ZED A;  4JXU A;  3P32 A;  4DXW A;  4O4H F;  2MCT A;  5EWF A;  3IGA C;  1I3Q A;  3OUF A;  5J9P C;  2GPW A;  4IWY A;  3T5J A;  3ZIA G;  4RNO A;  2ZJT A;  1T5E A;  1ZHQ A;  3WB2 A;  4MVU A;  3U54 A;  2OYQ A;  4J7J A;  4KUM A;  3RVY A;  2R7Z A;  1H8E G;  2AU0 A;  2UUA H;  3KKY A;  3AK2 A;  2VA2 A;  1CS0 A;  5HV6 A;  2QTO A;  4X65 H;  1Z2N X;  4IR9 A;  3JZF A;  1EKP A;  2EIK C;  4IT5 A;  5BMV A;  3B2E E;  2V5A A;  3PO2 G;  2HVK C;  3W7S A;  1SES A;  2UXB O;  1VF7 A;  4L1K A;  4X64 B;  3N2G B;  5KG2 A;  1KTA A;  2W71 A;  3VPC A;  3T1Y H;  3T9A A;  1JMK C;  5IP9 G;  1S0N A;  5BPF A;  3FD9 A;  4GX0 A;  1HR0 O;  4BR6 A;  1BJT A;  4QIW E;  1YTF B;  4O7T A;  1CE8 A;  2GSM B;  1NT2 B;  4U3F H;  4R8U B;  3FFQ A;  4CZZ A;  3M4I A;  3BA8 A;  4YIP A;  5LA6 B;  3K5H A;  2BQ3 A;  4XYL B;  4J9Y B;  4W4K A;  2YXL A;  3HKD B;  2HR3 A;  3K08 A;  5EBL C;  3TJT A;  4J9K A;  3J7A U;  2OCC C;  3X2Q C;  2YS7 A;  2F23 A;  4OXS A;  1S68 A;  3FYI B;  1SET A;  4LFC H;  4DO2 A;  3K9A A;  2CNV A;  4QWC A;  4A3F G;  2XCP A;  2L6L A;  2ZQM A;  4FFO A;  1KC7 A;  5DN6 G;  5EBM C;  1AUV A;  2LO1 A;  2W9C A;  3VQW A;  2VQF H;  2WPD G;  2WAQ A;  1KT8 A;  4IHJ A;  3CYO A;  3G71 V;  1P8L A;  1N0J A;  5KFL A;  5IY5 B;  4YBZ B;  1Y1W G;  1EUC B;  2EIY A;  4LFB H;  1Y74 B;  5BWX A;  3S24 A;  3HOX G;  4O4I F;  2MK3 A;  1MZF A;  3K03 A;  4O3N A;  3LDD A;  2DYR B;  4CS4 A;  4DK0 A;  2CNU A;  4NKG B;  4UVC A;  2YIB A;  3K06 A;  2XAF A;  5IWA B;  1R6K A;  2JGD B;  5J2U F;  1A32 A;  5LL6 b;  2R87 A;  4TQS A;  5CA1 B;  3KAL A;  4MVR A;  3JZ6 A;  5D1O B;  2HVS A;  2FML A;  3K57 A;  4IL6 Z;  2UUB O;  4H0L B;  2JEU A;  4HAM A;  2WA3 A;  3K04 A;  2W6Q A;  2ZDI A;  4DR4 B;  1Y76 B;  1GRJ A;  2DZD A;  1YJ9 V;  5EDW A;  1IBK H;  4MVM A;  3ASO C;  1TVK B;  3F5T A;  5LOV A;  4GKK B;  1YIJ V;  2NVX A;  2YIB D;  1M57 C;  5GW7 A;  4CC5 A;  4FM1 A;  1MMM A;  2HHF B;  2QE7 G;  4O7W A;  1Y66 A;  4WFA V;  1QCE A;  2ADP A;  2VWK A;  5IP7 G;  3ZHU A;  2QWR B;  3DC6 A;  3F5W C;  3Q2O A;  1H2K A;  5EOY A;  4Q0Y A;  3CRA A;  3OHB A;  5DM6 V;  2ZR3 A;  3OMI B;  1B04 A;  3FAV A;  4P2Z A;  4XBF A;  3ETQ A;  3IG0 A;  4D6T H;  3MHH C;  3CEB A;  5IJ9 B;  5FL7 G;  3KAK A;  1TUB B;  1Z2O X;  3ICX A;  2EBO A;  2Q8V A;  4F6E A;  1JDB B;  1WAZ A;  4CKB A;  3CC4 V;  4LWS B;  3AYH B;  1Q3E A;  3U11 A;  4DL5 A;  2IMW P;  1KP2 A;  1OCO C;  2DAB A;  5KAF Z;  4HNT A;  2CUG A;  4EFE A;  3SNO A;  4CH3 A;  3CCM V;  5FLX W;  4IYI A;  1I7F A;  4BY7 G;  3H4D A;  3VNN A;  4IR1 A;  1E4G T;  1GO3 F;  3FYE B;  4ICG A;  5LA6 F;  2AGQ A;  2FPI B;  4F50 A;  3ASN C;  5LGU A;  5KFO A;  3CRM A;  3EFF K;  5LMU B;  1EKV A;  5IWA O;  3I4M G;  4I9Q A;  5CB4 B;  2BSK A;  1IVS A;  5DLF A;  1PK8 A;  1NVP B;  4YHH B;  4DW0 A;  4DV2 O;  3B8M A;  4JI2 H;  3CWB H;  4DR4 O;  4C7U A;  4HYO A;  4OX9 O;  4ASU G;  3BVO A;  2XAJ A;  5FD6 A;  1EN6 A;  3AEI A;  2WAQ E;  1K83 A;  2AHY A;  5BYA A;  2QSA A;  1VQ9 V;  1XHZ A;  3T9F A;  4LF7 H;  1E1R G;  3M99 B;  1FXK B;  3W7X A;  2IP4 A;  3HOV G;  5I5U A;  1PNM A;  3BPZ A;  1K4D C;  1SQX H;  1XEQ A;  1K9M W;  2QWO B;  5IE9 A;  5DGH A;  2FLL A;  3E35 A;  2VQE H;  2GQS A;  4NZO A;  2P0A A;  4DR1 H;  1I0H A;  2ODM A;  4O2B B;  2HVR A;  5CA1 F;  4JAV A;  4Q8E A;  1P7G A;  1NTK H;  5KA5 A;  1HNZ H;  1I08 A;  1CQI B;  2HIV A;  3GTM A;  1JIH A;  4E4T A;  3G8D A;  4F6R B;  2JA6 A;  1JJ2 U;  1A0G A;  3FB5 C;  3OR6 C;  3OHA A;  3CVZ A;  3AG3 C;  5F9L A;  1G8M A;  5KG7 A;  1L0L H;  2VWJ A;  3D36 A;  5I60 A;  4LF5 B;  5FNV A;  2J6U A;  3SYC A;  3BY6 A;  1MSD A;  4DV3 B;  1FYJ A;  4NB5 A;  4WHX A;  2R84 A;  2AZ2 A;  5GON B;  3ZHQ A;  1WPX A;  5H2F Z;  5TIS Z;  1I7N A;  1B33 N;  4N21 A;  3H1J H;  1Y4M A;  1IYE A;  2KG7 B;  3C3T A;  2HLD G;  1K8A W;  5L3F A;  4DR2 O;  3HXL A;  3RYH B;  2UXB H;  3JCU Z;  4DR7 B;  3G6Y A;  4PDM A;  2ZXW C;  5F9N A;  5I47 A;  4PV1 B;  1R6T A;  1XNQ B;  3I5D A;  1NU1 H;  3OSN A;  4WCE V;  1HR0 H;  2XAS A;  2OCH A;  4QSH A;  2FPG B;  5I5W A;  4WD3 A;  2R72 A;  3T5L A;  1HNW H;  1EM1 A;  1RM1 C;  1XMQ O;  4DV5 B;  2R92 A;  4FS1 A;  3TET A;  4JGS A;  1DV1 A;  2CTR A;  1FKA O;  2WWW A;  3JAL A;  1R73 A;  4EB6 A;  1P16 A;  2BR0 A;  2C00 A;  5CMU A;  4JI4 B;  3PR4 A;  4JPR A;  1V51 A;  1GN6 A;  2F4V H;  2NLJ C;  2PY5 A;  3R5H A;  3C3S A;  2IU0 A;  3CD6 V;  1VF6 C;  2RCV A;  1VF6 A;  3JAR A;  1M90 W;  3QNE A;  4FPP A;  5CB4 F;  5DG8 A;  4U7N A;  2Y4U A;  2FLN A;  1KBH A;  4FLZ A;  1IBM B;  3V6J A;  3ORR A;  3JD4 A;  1WCM A;  5LGT A;  1OJH A;  2HHH B;  1N32 B;  3JCZ A;  1N48 A;  3JAS A;  1S03 G;  3RYC B;  5HFM A;  4NTY A;  4O3P A;  5B1B B;  2QKS A;  5JCO C;  2LFR A;  2HEP A; 
#chains in the Genus database with same CATH homology
 3UT5 B;  3N6X A;  3L2P A;  4DR2 B;  1SA0 A;  3L4K A;  4RAY A;  2UUB H;  3K5N A;  2WDT A;  1HW7 A;  1YEW A;  5LMU H;  3KYH C;  3N2G A;  4DRX A;  4K8Z A;  4DV4 B;  3E22 A;  2BTQ B;  2UUA B;  4YJ3 A;  4YHH H;  3BAB A;  3BA9 A;  5EZY A;  5FPR A;  1SQG A;  1XI1 A;  3K5L A;  3HKC A;  3GJX B;  5D5Q A;  4X65 B;  4O4J B;  1XMQ B;  3K5O A;  5JJN B;  1RSO A;  4TUY B;  4I4T B;  2BTO A;  3U10 A;  5LA6 A;  4FLW A;  3F8N A;  3N2K B;  4J0M A;  4JI2 B;  3T1Y B;  1FVI A;  3HKD A;  4UCT A;  5IYZ A;  4O4H B;  2V4D A;  4JI5 H;  4PI2 A;  3W1B A;  3JAT B;  4O2B A;  4Q6G A;  2PYL A;  4ZI7 A;  4LH7 A;  3M7M X;  2Q7G A;  4LMY A;  4JI8 B;  5ITZ B;  4LNU B;  4F6R A;  4X66 B;  5FPO A;  4CH4 A;  3A2F A;  5IJ0 A;  4WBN A;  1SQF A;  1FFX B;  3EYY A;  2F1M A;  2R9A A;  3J7A K;  1TGO A;  1GYF A;  4LFC B;  1N33 H;  1QQC A;  4JI1 H;  2UU9 H;  5EYP B;  3NBY B;  2PGG A;  1M5I A;  5KX5 A;  2XHB A;  1CKM A;  4LF5 H;  2VOB A;  2W57 A;  1XMO B;  4IIJ B;  5GON A;  2KSW A;  2VQF B;  4DV3 H;  2F95 B;  4YY3 H;  4NXN H;  2UXD H;  3ZS8 C;  4BW9 A;  4CC6 A;  4CS3 A;  5CA1 A;  5LP6 B;  4FLY A;  4JV5 H;  5IWA H;  5D1O A;  4DK1 A;  5BR8 H;  1XNR B;  1WN7 A;  2Q7E A;  5KMG B;  4LFB B;  1J5E H;  2CAZ C;  4RB1 A;  4DV2 H;  4DR7 H;  4X1K A;  1TVK A;  3RYI B;  1XQ8 A;  4PI0 A;  4I50 B;  4HBN A;  2QM4 A;  4O2A A;  3RGX A;  4OX9 H;  4DV0 B;  4JI7 B;  3JAW A;  3CB2 A;  1XNQ H;  3JAM W;  4MTD A;  4X1Y B;  4DV6 B;  1JFF A;  4FFB B;  4JI6 B;  4LSX A;  2E5L B;  1I94 H;  3OTO B;  3HKB A;  4LR3 A;  2UXB B;  4AQY B;  5J2T B;  1IBK B;  4PZ8 A;  3RIZ A;  3T1H B;  2ZNJ A;  4ETS A;  4GKJ B;  4HNA A;  4TV9 A;  4UCU A;  4B08 A;  4TQD A;  5JQG A;  2WYO A;  3TY8 A;  3RWR D;  4GYC B;  5JH7 B;  4DV1 B;  4O4I B;  4LF8 H;  5IJ9 A;  3TY5 A;  3GB8 B;  1TUB A;  1Z2P X;  1WPB A;  4X20 B;  4LF9 B;  3TY9 A;  2R70 A;  1HNX B;  4PHZ A;  3VQX A;  5J2U B;  4MTE A;  2UXC H;  5LXT B;  3JAL B;  5LYJ A;  1ZHS A;  4JI0 H;  5KHH A;  1N34 B;  4EB6 B;  1IBM H;  2RJZ A;  3JAK A;  5EIB C;  1M4U A;  4O4L A;  5LMN B;  3N42 B;  3RR5 A;  2Q0A A;  2ZIN A;  5JVD A;  4RZQ A;  3KAJ A;  3KXY T;  3NBZ B;  4ZHQ A;  3CHX A;  2CFM A;  4ZOL A;  5JCO A;  4JI3 B;  4B3S B;  4LF6 B;  4JYA B;  3WB1 A;  3UT5 A;  4NXM B;  1Q5O A;  1QHT A;  3RYF A;  5KHG A;  3ZED A;  2CW7 A;  2MCT A;  5JJJ B;  5CB4 A;  4DR2 H;  4DR5 B;  4K0K B;  2UUC B;  2ZJT A;  1T5E A;  1ZHQ A;  4X1I B;  3WB2 A;  3JAS B;  3WB0 A;  2OYQ A;  1JJO A;  3VQY A;  2UUA H;  3QTC A;  1H2S B;  4LF4 B;  1I6U A;  3HKE A;  5CA0 A;  4CS2 A;  2RGV A;  3W1G A;  4X65 H;  1Z2N X;  1XMQ H;  1SA0 B;  3C0F B;  1M93 A;  5BMV A;  3B2E E;  1FKA H;  1CKN A;  1VF7 A;  1ZAU A;  4X64 B;  3W5O A;  1E4F T;  3N2G B;  4DRX B;  4GLX A;  4O4H A;  3E22 B;  2CW8 A;  3SJC C;  3SJA C;  2EX3 A;  3T1Y H;  1WNS A;  1WH2 A;  5C8Y A;  1JMK C;  5EZY B;  4KHP B;  4TV8 B;  1BJT A;  4LF7 B;  1NT2 B;  4MV9 A;  3FFQ A;  4DUZ B;  3M4I A;  4CH6 A;  3BA8 A;  5LA6 B;  3U0Z A;  4JI8 H;  3K59 A;  2YXL A;  3DF7 A;  4JI5 B;  3HKD B;  2QJ1 A;  2VQE B;  1P49 A;  5IYZ B;  4DR1 B;  4DR3 B;  2KKW A;  1D5A A;  2ZM6 B;  4CH5 A;  1S68 A;  4LFC H;  5A2Q W;  1HNZ B;  4X62 H;  3QWU A;  5KHJ A;  5DIS C;  3OTF A;  2XIG A;  5LP6 C;  1N36 B;  5LP6 A;  1IBL B;  3VQW A;  2VQF H;  3BHP A;  5K1X A;  5IJ0 B;  4IHJ A;  4WBN B;  2PZS A;  3RYH A;  1VS0 A;  1N33 B;  4RB3 C;  4DV7 B;  1P8L A;  4BWA A;  1XNR H;  4NVP A;  4DUY H;  5K1P A;  1L8D A;  2Q2T A;  2YI8 A;  4LFB H;  3S24 A;  1SKV A;  5FNV B;  4U3J A;  4K8X A;  1Q43 A;  5KX5 B;  4YY3 B;  4NXN B;  4CS4 A;  1XDN A;  4DK0 A;  2YIB A;  5IWA B;  4DV0 H;  2ZNI A;  5LL6 b;  4FFB A;  5CA1 B;  3KAL A;  3J81 W;  3JSL A;  5D1O B;  2HVS A;  1DGS A;  3SJB C;  3K57 A;  4UCV A;  5J2T A;  1J5E B;  2JS5 A;  4EQ5 A;  4DV6 H;  3OTO H;  4A2A A;  4DV5 H;  4L8J A;  4DR4 B;  1IBK H;  1HR0 B;  3T1H H;  1TVK B;  5LOV A;  4GKK B;  4GKJ H;  4O2A B;  2YIB D;  4YJ2 B;  2HIX A;  5FD5 A;  4JI4 H;  4CC5 A;  4FM1 A;  4B3M B;  4FLT A;  1Z5V A;  4LH6 A;  1HNW B;  2FE3 A;  4BWS C;  5JH7 A;  2ZCE A;  4O4I A;  3MAQ A;  1AN7 A;  3JSN A;  3PN1 A;  1JFF B;  2RGR A;  4APM A;  3HKB B;  4DR6 H;  2VWK A;  1G6U A;  5JJE B;  5J2U A;  5LXT A;  4B3T H;  5EOY A;  4LF9 H;  4Q0Y A;  4UCS A;  1HNX H;  3NC0 B;  2F4V B;  4FLX A;  4HNA B;  1FJG B;  3K3V A;  3K58 A;  3RYC A;  1B04 A;  3H20 A;  4TV9 B;  4FVM A;  5KHK A;  3ETQ A;  2GV9 A;  2HHH H;  4LF8 B;  1N32 H;  5KHI A;  5LMN H;  3IG0 A;  2PYJ A;  1S5J A;  3RTX A;  3J80 W;  2OWO A;  4I55 A;  5IJ9 B;  3JAR B;  5IT9 W;  4FM0 A;  3KAK A;  1TUB B;  2UXC B;  2ZIO A;  4M7E A;  1Z2O X;  2HVQ A;  2YCH A;  3ICX A;  4LFA B;  4NXM H;  2ZIM A;  1M0W A;  5EIB D;  4I7H A;  4B3R B;  5LYJ B;  4FLV A;  1Q3E A;  3U11 A;  2BTQ A;  4O4L B;  4K0K H;  4TOI A;  5JVD B;  4KL1 A;  4EFE A;  4CH3 A;  5FLX W;  1M0T A;  3N40 P;  4DV4 H;  1I7F A;  3MWM A;  4PZ7 A;  3FMA A;  4ZHQ B;  3VNN A;  4MV7 A;  1O9H A;  2IM9 A;  1E4G T;  4O4J A;  4TQF A;  4PZ6 A;  2UUB B;  4LF4 H;  4TUY A;  4I4T A;  5LMU B;  3RYF B;  3LML A;  4I9Q A;  5CB4 B;  4ZIB A;  3N2K A;  4DRF A;  4UFZ A;  4YHH B;  2P22 C;  4JI2 H;  4YJ3 B;  4X64 H;  2P5O A;  2YI9 A;  4TV8 A;  1SEI A;  3JAT A;  3HKC B;  4AHC A;  4KHP H;  1XK5 A;  5FD6 A;  3HKE B;  5CA0 B;  3SGI A;  4AIL C;  4UCO A;  4LNU A;  5ITZ A;  1XHZ A;  3RGB A;  3RJ0 A;  4LF7 H;  4RB2 C;  5BMV B;  3N41 B;  4DUZ H;  1FFX A;  1Z5W A;  1CKN B;  4X66 H;  2F93 B;  3BPZ A;  1X9N A;  3RGZ A;  5C8Y B;  3K5M A;  2VQE H;  5EYP A;  4DR1 H;  4DR3 H;  4O2B B;  2HVR A;  2ZM6 H;  4ZI7 B;  4IIJ A;  3VQV A;  1L2Z A;  1HNZ H;  2HIV A;  1XMO H;  3IAY A;  4F6R B;  1N36 H;  1TAE A;  4A2B A;  5KMG A;  3SR2 C;  1IBL H;  3CVZ A;  3RF2 A;  4JI1 B;  1V9P A;  2UU9 B;  4LSA A;  3N44 B;  2VWJ A;  4E6N A;  4D7S A;  4DV7 H;  3RYI A;  4EFB A;  4I50 A;  2WE6 A;  3QG5 A;  3UQ8 A;  5FNV A;  4X62 B;  4LF5 B;  3THO A;  4DV3 B;  1A0I A;  2HGS A;  3LNN A;  2UXD B;  5D5P A;  4JV5 B;  5GON B;  1MZB A;  4JI7 H;  4X1Y A;  5BR8 B;  2O03 A;  2E3C A;  1O9G A;  2PUS A;  2JVD A;  3HXL A;  4IHJ B;  4JI6 H;  3RYH B;  4DUY B;  4DV2 B;  2E5L H;  4PDB A;  3DSQ A;  2UXB H;  4DR7 B;  4AQY H;  3N43 B;  4OX9 B;  3BRC A;  4EEQ A;  4X1K B;  4DR4 H;  4YJ2 A;  3L4J A;  1XNQ B;  4U3J B;  4RAZ A;  1HR0 H;  4GKK H;  3JAW B;  2Q2U A;  1I94 B;  1XHX A;  2YIA A;  4B3M H;  3QF7 A;  2R72 A;  1HNW H;  3BAA A;  4X20 A;  4DV1 H;  5D1P A;  4DV5 B;  2Q7H A;  1SYX B;  1Q8I A;  3JAL A;  4EB6 A;  1P16 A;  3GDE A;  4JI4 B;  4IAJ A;  2VPS A;  2F66 C;  5LOV B;  1BGW A;  4FM9 A;  1N34 H;  2F4V H;  1FJG H;  5JQG B;  2PY5 A;  2JGU A;  4RB0 A;  4DR6 B;  3JAR A;  1O75 A;  4JI3 H;  4B3S H;  4B3T B;  4LF6 H;  1KMI Z;  2RQ6 A;  4JYA H;  4FLU A;  4JI0 B;  4FLZ A;  3CSX A;  4D7T A;  1IBM B;  4UCR A;  4LFA H;  4X1I A;  2HHH B;  1N32 B;  1S03 G;  3JAS A;  1CKO A;  3JAK B;  3RFR A;  4R7R A;  3RYC B;  4FM2 A;  4DR5 H;  4B3R H;  2UUC H;  1TA8 A;  2PTM A;  1X4T A;  5JCO C;  2HEP A;  1KU9 A;  4ZOL B;  4I55 B;  2VUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...