4CHIA

(r)-selective amine transaminase from aspergillus fumigatus at 1.27 a resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
320
Chain Sequence
b'ASMDKVFSGYYARQKLLERSDNPFSKGIAYVEGKLVLPSDARIPLLDEGFMHSDLTYDVISVWDGRFFRLDDHLQRILESCDKMRLKFPLALSSVKNILAEMVAKSGIRDAFVEVIVTRGLTGVRGSKPEDLYNNNIYLLVLPYIWVMAPENQLHGGEAIITRTVRRTPPGAFDPTIKNLQWGDLTKGLFEAMDRGATYPFLTDGDTNLTEGSGFNIVLVKNGIIYTPDRGVLRGITRKSVIDVARANSIDIRLEVVPVEQAYHSDEIFMCTTAGGIMPITLLDGQPVNDGQVGPITKKIWDGYWEMHYNPAYSFPVDYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
publication title Crystallographic Characterization of the (R)-Selective Amine Transaminase from Aspergillus Fumigatus.
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Transferase
total genus 106
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.6.1.-:
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 4chiA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 4chiA01
5I5TA 2EJ3A 4CHIA 2DAAA 5CM0A 4DAAA 1DAAA 3CSWA 5I5VA 1A3GA 3DAAA 2ZGIA 5K3WA 1G2WA 2COIA 3LULA 5BWVA 5HNEA 5I60A 1I1MA 4DQNA 1EKFA 5BWUA 3WWHA 4CE5A 3U0GA 3QQMA 5BWXA 5E25A 2HHFA 5BWRA 2HDKA 5I5WA 1EKPA 4K6NA 4PBCA 3CEBA 3UYYA 4CMDA 4WHXA 2COGA 5BWTA 2DABA 1IYEA 1KT8A 1I2KA 3SNOA 1I1KA 3WWJA 3UZBA 3UZOA 2EJ2A 4JXUA 2EJ0A 4UUGA 1KTAA 1I2LA 3DTFA 3JZ6A 2HG8A 5CE8A 1ET0A 3LQSA 4TVIA 3HT5A 1WRVA 2COJA 4TM5A 3WWIA 4CMFA 1I1LA 5FR9A 5I5YA 2A1HA 1A0GA 2HGXA 5DAAA 1EKVA 2Y4RA 5I5XA 5I5UA 3DTGA 1IYDA 2HGWA 5I5SA 2EIYA 5BWWA 2ABJA 2HHFB 4M0JA 5CR5A
chains in the Genus database with same CATH superfamily
4WBNF 2R7NA 2EJ3A 1CQJB 1JDBB 3KALA 4DAAA 4FGRA 5I5VA 3E5NA 1DV1A 4HQ6A 3T9AA 5CB4F 2R85A 3TIIA 3WO0A 4C5CA 3TEKA 4IWXA 4O4HF 1PK8A 1ULZA 1VBHA 3LULA 2GQSA 1XK5A 2YYAA 1VBGA 5BWUA 4FU0A 3W1GA 3U0GA 3T9FA 1C30A 5BWXA 5E25A 3K5HA 2YL2A 4HNUA 1EZ1A 3VPCA 2W71A 2CNUA 1VKZA 2I80A 2FP4B 1AUXA 4HNVA 2QK4A 3HB9A 4E6NA 5CA1F 1GGOA 2COGA 1JLLB 1KJIA 2Q7DA 2YW2A 2DABA 4NZMA 4IZOA 3NC0B 2DZDA 1JDEA 1OBDA 5EZYF 1KUTA 2OWOA 4C5AA 1KJQA 3NUAA 4O84A 1XDNA 4CC6A 2CNVA 5HV6A 2NUAB 2C00A 1KTAA 1I2LA 4ZOLF 3ETJA 1UC9A 2HG8A 5CE8A 4FFLA 3R9RA 2HGSA 4O82A 1E4EA 5D8DA 4O7RA 3Q2OA 2YRWA 1WRVA 4TM5A 3WWIA 4ZI7F 1Z2PX 1I1LA 4HR7A 2FPGB 3T7AA 2YZNA 1P8LA 5DAAA 4UCSA 5JVDF 1EKVA 2IP4A 4PZ8A 3K5IA 1IYDA 2HIVA 2DIKA 5BWWA 2FPPB 2HVQA 4NZNA 1BNCA 3TIGA 1EUCB 4YB8B 3T9DA 4M0JA 1GSAA 2R86A 3JZIA 4XZ3B 3U9TA 3HO8A 1M0WA 3BACA 3QWUA 1M0TA 2W6QA 3JRXA 5LA6F 1DAAA 3KREA 2VPQA 4UCTA 1B6RA 5K3WA 2R87A 4YAKB 4ZQIA 1G2WA 5FPRA 1FVIA 5BWVA 4EEQA 5HNEA 5I60A 5CAEB 1I1MA 3RUPA 1GSOA 5D1PA 3U54A 5BMVF 2QB5A 1TAEA 4CE5A 3QQMA 4QSHA 2DWCA 1OBGA 2CZGA 4DIMA 5BWRA 2ZDGA 2HDKA 3VPBA 1WR2A 4MV8A 2CFMA 4O4LF 5DMXA 5KS8A 3T9EA 1P16A 2NU8B 4O2BF 3VNNA 1CKOA 1I2KA 3JSNA 4MA0A 2FPIB 3WO1A 3T9CA 2EJ2A 2Z04A 3U9SA 4MV9A 4TV8F 2P0AA 2EJ0A 4UUGA 1A0IA 1ZAUA 4O7SA 4MV7A 2W6OA 3T54A 3TY9A 4O4JF 5DISC 4O7VA 4I50F 5C1OA 4FFOA 2X5RA 5FPOA 2R7LA 4TUYF 4M9UA 5FNVF 3NBZB 1CQIB 2PBZA 5D1OA 2W70A 5JVLA 1A48A 5I5YA 2V5AA 3R5FA 2Q2TA 2HGXA 4CKBA 4IHJF 3HBLA 3DF7A 3TW6A 3DTGA 1CKNA 3W5OA 4ZHQF 5I5SA 4CKCA 2ZDHA 2X0SA 4ME6A 5HBRB 1M6VA 2ABJA 1I7NA 1IOVA 4RCNA 2XCLA 2R82A 4MV6A 2NU6B 5CR5A 5I5TA 2W6MA 5J2UF 4EFEA 2DAAA 3MWDA 4O2AF 1TA8A 4O86A 2WYOA 3TQTA 3PN1A 3WNZA 1A3GA 3DAAA 4XX0B 2GPWA 5D1OB 3QFFA 3I12A 3GJXB 1X9NA 4FFMA 5DGHA 2YS7A 2I8CA 4DQNA 2W6ZA 3ETHA 2R7MA 3WWHA 4FFPA 4EQ5A 4MV1A 3BA9A 4O7YA 5JQWA 1EHIA 1GSHA 1EUDB 1CKMA 4DRFA 2HHFA 5I5WA 4E4TA 2YS6A 4DLKA 3SGIA 2NU7B 1E4EB 4PBCA 5LYJF 3CEBA 5H80A 3K3PA 3T99A 4CMDA 2I87A 1CS0A 3JZFA 2DLNA 4IIJF 4YJ2F 4MV4A 3TW7A 2VR1A 1IYEA 4O4IF 1I1KA 3WWJA 3UZBA 5LXTF 3UZOA 5KX5F 4RZQA 5JH7F 3VMMA 4C5BA 4PZ6A 4JXUA 1W93A 2J9GA 3PFFA 1KJ8A 3DTFA 1C3OA 2R84A 3R5HA 1KJJA 3V4SA 5LOVF 4FFRA 1CE8A 4LH7A 3LQSA 3L2PA 2CNQA 5BPHA 1W96A 3N8DA 1KC7A 4CMFA 3S24A 4UCUA 5FR9A 5IYZF 3RFCA 1A0GA 4UFZA 1UC8A 4UCRA 2YZMA 5I5XA 5I5UA 2GLTA 3NBYB 4HN2A 4EG0A 2HGWA 3T9BA 1JKJB 2EIYA 4O81A 3GDEA 5C8YF 5BYBA 4MAMA 2FB9A 3BABA 4UCOA 4EFBA 1GLVA 2PN1A 4EGQA 4UCVA 2XD4A 4XYLB 2HJWA 1BXRA 4FE2A 2YWVA 3LP8A 4XYMB 4YJ3F 4CHIA 5CM0A 1B04A 4O83A 3RR5A 3CSWA 2VQDA 5JQGF 1S68A 2NU9B 5BPFA 2W6NA 2ZGIA 1T36A 2Z02A 4NYEA 5KKNB 2GQRA 3V4ZA 1I7LA 3RTXA 3SE7A 2COIA 4O7NA 2ZDQA 3BAAA 5BYAA 1A9XA 2HVRA 2V59A 2R7KA 2HIXA 4MA5A 1SCUB 1EKFA 3N6RA 4HNTA 4YAJB 3TY5A 1B6SA 3TY8A 3ORRA 5K2MA 3UFXB 3KAJA 4TV9F 4I4TF 2QF7A 4PZ7A 1DIKA 3BG5A 4NZOA 2V58A 3LWBA 3R5XA 3VOTA 4Q4DA 5J2TF 3KYHC 4O7WA 1EKPA 4K6NA 1PX2A 4EGJA 2YZGA 3UYYA 5I47A 4WHXA 3MJFA 5BWTA 5DGIA 1V9PA 3Q1KA 1EYZA 4O7TA 2ODTX 3G8CA 3TINA 5LP6F 2YRXA 5C1PA 1AUVA 1CKNB 1KT8A 5CA0F 3SNOA 4LH6A 3AX6A 4Q4CA 4FFNA 1DV2A 4Y8VB 3KAKA 4MV3A 2OLSA 1Z2NX 4YBZB 3GB8B 3JRWA 4O7LA 3RV4A 3JZ6A 1Z2OX 3BA8A 3VPDA 3MWEA 3JSLA 1ET0A 4IWYA 1KEEA 4GLXA 3ORQA 3U55A 4TVIA 2HVSA 3R23A 3VA7A 3HT5A 4I55F 5GONF 4L1KA 2VUGA 2W6PA 2COJA 4CC5A 1KBLA 3RV3A 2Q2UA 2A1HA 1KJ9A 2YZLA 4CKEA 2PVPA 2Y4RA 1IOWA 3GLKA 1VS0A 3GIDA 3OUZA 2GPSA 4O7ZA 3G8DA 3W1BA 1DGSA 3UQ8A 2SCUB 2HHFB 3AW8A 4GLWA 3OUUA
chains in the Genus database with same CATH topology
5I5TA 2EJ3A 3BACA 4CHIA 2DAAA 5CM0A 4DAAA 1DAAA 3CSWA 5I5VA 3T9AA 1A3GA 3DAAA 2ZGIA 5K3WA 3TEKA 1G2WA 4IWXA 2COIA 5BYAA 3LULA 5BWVA 5DGHA 5HNEA 5I60A 1I1MA 4DQNA 2QB5A 1EKFA 5BWUA 3WWHA 4CE5A 3U0GA 3QQMA 5K2MA 3T9FA 5BWXA 5E25A 4NZOA 2HHFA 5BWRA 4Q4DA 2HDKA 5I5WA 1EKPA 4K6NA 3SGIA 4PBCA 3CEBA 3T99A 3UYYA 4CMDA 5I47A 4WHXA 2COGA 5KS8A 5BWTA 5DGIA 3T9EA 2Q7DA 2ODTX 2DABA 4NZMA 3TW7A 1IYEA 1KT8A 1I2KA 3SNOA 1I1KA 3WWJA 3UZBA 3T9CA 4Q4CA 3UZOA 2EJ2A 4JXUA 2EJ0A 4UUGA 3PFFA 1ZAUA 1KTAA 1I2LA 3DTFA 3T54A 3JZ6A 1UC9A 2HG8A 5CE8A 3VPDA 1ET0A 4IWYA 3LQSA 4TVIA 2X5RA 3HT5A 1WRVA 2COJA 4TM5A 3WWIA 4CMFA 1I1LA 5FR9A 5I5YA 3T7AA 2A1HA 1A0GA 2HGXA 4CKBA 4CKEA 5DAAA 1UC8A 1EKVA 2Y4RA 5I5XA 5I5UA 3DTGA 4HN2A 1IYDA 2HGWA 5I5SA 3T9BA 4CKCA 2EIYA 5BWWA 5BYBA 4NZNA 2ABJA 2HHFB 3T9DA 4M0JA 4GLWA 4RCNA 5CR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I5T A;  2EJ3 A;  4CHI A;  2DAA A;  5CM0 A;  4DAA A;  1DAA A;  3CSW A;  5I5V A;  1A3G A;  3DAA A;  2ZGI A;  5K3W A;  1G2W A;  2COI A;  3LUL A;  5BWV A;  5HNE A;  5I60 A;  1I1M A;  4DQN A;  1EKF A;  5BWU A;  3WWH A;  4CE5 A;  3U0G A;  3QQM A;  5BWX A;  5E25 A;  2HHF A;  5BWR A;  2HDK A;  5I5W A;  1EKP A;  4K6N A;  4PBC A;  3CEB A;  3UYY A;  4CMD A;  4WHX A;  2COG A;  5BWT A;  2DAB A;  1IYE A;  1KT8 A;  1I2K A;  3SNO A;  1I1K A;  3WWJ A;  3UZB A;  3UZO A;  2EJ2 A;  4JXU A;  2EJ0 A;  4UUG A;  1KTA A;  1I2L A;  3DTF A;  3JZ6 A;  2HG8 A;  5CE8 A;  1ET0 A;  3LQS A;  4TVI A;  3HT5 A;  1WRV A;  2COJ A;  4TM5 A;  3WWI A;  4CMF A;  1I1L A;  5FR9 A;  5I5Y A;  2A1H A;  1A0G A;  2HGX A;  5DAA A;  1EKV A;  2Y4R A;  5I5X A;  5I5U A;  3DTG A;  1IYD A;  2HGW A;  5I5S A;  2EIY A;  5BWW A;  2ABJ A;  2HHF B;  4M0J A;  5CR5 A; 
#chains in the Genus database with same CATH topology
 4WBN F;  2R7N A;  2EJ3 A;  1CQJ B;  1JDB B;  3KAL A;  4DAA A;  4FGR A;  5I5V A;  3E5N A;  1DV1 A;  4HQ6 A;  3T9A A;  5CB4 F;  2R85 A;  3TII A;  3WO0 A;  4C5C A;  3TEK A;  4IWX A;  4O4H F;  1PK8 A;  1ULZ A;  1VBH A;  3LUL A;  2GQS A;  1XK5 A;  2YYA A;  1VBG A;  5BWU A;  4FU0 A;  3W1G A;  3U0G A;  3T9F A;  1C30 A;  5BWX A;  5E25 A;  3K5H A;  2YL2 A;  4HNU A;  1EZ1 A;  3VPC A;  2W71 A;  2CNU A;  1VKZ A;  2I80 A;  2FP4 B;  1AUX A;  4HNV A;  2QK4 A;  3HB9 A;  4E6N A;  5CA1 F;  1GGO A;  2COG A;  1JLL B;  1KJI A;  2Q7D A;  2YW2 A;  2DAB A;  4NZM A;  4IZO A;  3NC0 B;  2DZD A;  1JDE A;  1OBD A;  5EZY F;  1KUT A;  2OWO A;  4C5A A;  1KJQ A;  3NUA A;  4O84 A;  1XDN A;  4CC6 A;  2CNV A;  5HV6 A;  2NUA B;  2C00 A;  1KTA A;  1I2L A;  4ZOL F;  3ETJ A;  1UC9 A;  2HG8 A;  5CE8 A;  4FFL A;  3R9R A;  2HGS A;  4O82 A;  1E4E A;  5D8D A;  4O7R A;  3Q2O A;  2YRW A;  1WRV A;  4TM5 A;  3WWI A;  4ZI7 F;  1Z2P X;  1I1L A;  4HR7 A;  2FPG B;  3T7A A;  2YZN A;  1P8L A;  5DAA A;  4UCS A;  5JVD F;  1EKV A;  2IP4 A;  4PZ8 A;  3K5I A;  1IYD A;  2HIV A;  2DIK A;  5BWW A;  2FPP B;  2HVQ A;  4NZN A;  1BNC A;  3TIG A;  1EUC B;  4YB8 B;  3T9D A;  4M0J A;  1GSA A;  2R86 A;  3JZI A;  4XZ3 B;  3U9T A;  3HO8 A;  1M0W A;  3BAC A;  3QWU A;  1M0T A;  2W6Q A;  3JRX A;  5LA6 F;  1DAA A;  3KRE A;  2VPQ A;  4UCT A;  1B6R A;  5K3W A;  2R87 A;  4YAK B;  4ZQI A;  1G2W A;  5FPR A;  1FVI A;  5BWV A;  4EEQ A;  5HNE A;  5I60 A;  5CAE B;  1I1M A;  3RUP A;  1GSO A;  5D1P A;  3U54 A;  5BMV F;  2QB5 A;  1TAE A;  4CE5 A;  3QQM A;  4QSH A;  2DWC A;  1OBG A;  2CZG A;  4DIM A;  5BWR A;  2ZDG A;  2HDK A;  3VPB A;  1WR2 A;  4MV8 A;  2CFM A;  4O4L F;  5DMX A;  5KS8 A;  3T9E A;  1P16 A;  2NU8 B;  4O2B F;  3VNN A;  1CKO A;  1I2K A;  3JSN A;  4MA0 A;  2FPI B;  3WO1 A;  3T9C A;  2EJ2 A;  2Z04 A;  3U9S A;  4MV9 A;  4TV8 F;  2P0A A;  2EJ0 A;  4UUG A;  1A0I A;  1ZAU A;  4O7S A;  4MV7 A;  2W6O A;  3T54 A;  3TY9 A;  4O4J F;  5DIS C;  4O7V A;  4I50 F;  5C1O A;  4FFO A;  2X5R A;  5FPO A;  2R7L A;  4TUY F;  4M9U A;  5FNV F;  3NBZ B;  1CQI B;  2PBZ A;  5D1O A;  2W70 A;  5JVL A;  1A48 A;  5I5Y A;  2V5A A;  3R5F A;  2Q2T A;  2HGX A;  4CKB A;  4IHJ F;  3HBL A;  3DF7 A;  3TW6 A;  3DTG A;  1CKN A;  3W5O A;  4ZHQ F;  5I5S A;  4CKC A;  2ZDH A;  2X0S A;  4ME6 A;  5HBR B;  1M6V A;  2ABJ A;  1I7N A;  1IOV A;  4RCN A;  2XCL A;  2R82 A;  4MV6 A;  2NU6 B;  5CR5 A;  5I5T A;  2W6M A;  5J2U F;  4EFE A;  2DAA A;  3MWD A;  4O2A F;  1TA8 A;  4O86 A;  2WYO A;  3TQT A;  3PN1 A;  3WNZ A;  1A3G A;  3DAA A;  4XX0 B;  2GPW A;  5D1O B;  3QFF A;  3I12 A;  3GJX B;  1X9N A;  4FFM A;  5DGH A;  2YS7 A;  2I8C A;  4DQN A;  2W6Z A;  3ETH A;  2R7M A;  3WWH A;  4FFP A;  4EQ5 A;  4MV1 A;  3BA9 A;  4O7Y A;  5JQW A;  1EHI A;  1GSH A;  1EUD B;  1CKM A;  4DRF A;  2HHF A;  5I5W A;  4E4T A;  2YS6 A;  4DLK A;  3SGI A;  2NU7 B;  1E4E B;  4PBC A;  5LYJ F;  3CEB A;  5H80 A;  3K3P A;  3T99 A;  4CMD A;  2I87 A;  1CS0 A;  3JZF A;  2DLN A;  4IIJ F;  4YJ2 F;  4MV4 A;  3TW7 A;  2VR1 A;  1IYE A;  4O4I F;  1I1K A;  3WWJ A;  3UZB A;  5LXT F;  3UZO A;  5KX5 F;  4RZQ A;  5JH7 F;  3VMM A;  4C5B A;  4PZ6 A;  4JXU A;  1W93 A;  2J9G A;  3PFF A;  1KJ8 A;  3DTF A;  1C3O A;  2R84 A;  3R5H A;  1KJJ A;  3V4S A;  5LOV F;  4FFR A;  1CE8 A;  4LH7 A;  3LQS A;  3L2P A;  2CNQ A;  5BPH A;  1W96 A;  3N8D A;  1KC7 A;  4CMF A;  3S24 A;  4UCU A;  5FR9 A;  5IYZ F;  3RFC A;  1A0G A;  4UFZ A;  1UC8 A;  4UCR A;  2YZM A;  5I5X A;  5I5U A;  2GLT A;  3NBY B;  4HN2 A;  4EG0 A;  2HGW A;  3T9B A;  1JKJ B;  2EIY A;  4O81 A;  3GDE A;  5C8Y F;  5BYB A;  4MAM A;  2FB9 A;  3BAB A;  4UCO A;  4EFB A;  1GLV A;  2PN1 A;  4EGQ A;  4UCV A;  2XD4 A;  4XYL B;  2HJW A;  1BXR A;  4FE2 A;  2YWV A;  3LP8 A;  4XYM B;  4YJ3 F;  4CHI A;  5CM0 A;  1B04 A;  4O83 A;  3RR5 A;  3CSW A;  2VQD A;  5JQG F;  1S68 A;  2NU9 B;  5BPF A;  2W6N A;  2ZGI A;  1T36 A;  2Z02 A;  4NYE A;  5KKN B;  2GQR A;  3V4Z A;  1I7L A;  3RTX A;  3SE7 A;  2COI A;  4O7N A;  2ZDQ A;  3BAA A;  5BYA A;  1A9X A;  2HVR A;  2V59 A;  2R7K A;  2HIX A;  4MA5 A;  1SCU B;  1EKF A;  3N6R A;  4HNT A;  4YAJ B;  3TY5 A;  1B6S A;  3TY8 A;  3ORR A;  5K2M A;  3UFX B;  3KAJ A;  4TV9 F;  4I4T F;  2QF7 A;  4PZ7 A;  1DIK A;  3BG5 A;  4NZO A;  2V58 A;  3LWB A;  3R5X A;  3VOT A;  4Q4D A;  5J2T F;  3KYH C;  4O7W A;  1EKP A;  4K6N A;  1PX2 A;  4EGJ A;  2YZG A;  3UYY A;  5I47 A;  4WHX A;  3MJF A;  5BWT A;  5DGI A;  1V9P A;  3Q1K A;  1EYZ A;  4O7T A;  2ODT X;  3G8C A;  3TIN A;  5LP6 F;  2YRX A;  5C1P A;  1AUV A;  1CKN B;  1KT8 A;  5CA0 F;  3SNO A;  4LH6 A;  3AX6 A;  4Q4C A;  4FFN A;  1DV2 A;  4Y8V B;  3KAK A;  4MV3 A;  2OLS A;  1Z2N X;  4YBZ B;  3GB8 B;  3JRW A;  4O7L A;  3RV4 A;  3JZ6 A;  1Z2O X;  3BA8 A;  3VPD A;  3MWE A;  3JSL A;  1ET0 A;  4IWY A;  1KEE A;  4GLX A;  3ORQ A;  3U55 A;  4TVI A;  2HVS A;  3R23 A;  3VA7 A;  3HT5 A;  4I55 F;  5GON F;  4L1K A;  2VUG A;  2W6P A;  2COJ A;  4CC5 A;  1KBL A;  3RV3 A;  2Q2U A;  2A1H A;  1KJ9 A;  2YZL A;  4CKE A;  2PVP A;  2Y4R A;  1IOW A;  3GLK A;  1VS0 A;  3GID A;  3OUZ A;  2GPS A;  4O7Z A;  3G8D A;  3W1B A;  1DGS A;  3UQ8 A;  2SCU B;  2HHF B;  3AW8 A;  4GLW A;  3OUU A; 
#chains in the Genus database with same CATH homology
 5I5T A;  2EJ3 A;  3BAC A;  4CHI A;  2DAA A;  5CM0 A;  4DAA A;  1DAA A;  3CSW A;  5I5V A;  3T9A A;  1A3G A;  3DAA A;  2ZGI A;  5K3W A;  3TEK A;  1G2W A;  4IWX A;  2COI A;  5BYA A;  3LUL A;  5BWV A;  5DGH A;  5HNE A;  5I60 A;  1I1M A;  4DQN A;  2QB5 A;  1EKF A;  5BWU A;  3WWH A;  4CE5 A;  3U0G A;  3QQM A;  5K2M A;  3T9F A;  5BWX A;  5E25 A;  4NZO A;  2HHF A;  5BWR A;  4Q4D A;  2HDK A;  5I5W A;  1EKP A;  4K6N A;  3SGI A;  4PBC A;  3CEB A;  3T99 A;  3UYY A;  4CMD A;  5I47 A;  4WHX A;  2COG A;  5KS8 A;  5BWT A;  5DGI A;  3T9E A;  2Q7D A;  2ODT X;  2DAB A;  4NZM A;  3TW7 A;  1IYE A;  1KT8 A;  1I2K A;  3SNO A;  1I1K A;  3WWJ A;  3UZB A;  3T9C A;  4Q4C A;  3UZO A;  2EJ2 A;  4JXU A;  2EJ0 A;  4UUG A;  3PFF A;  1ZAU A;  1KTA A;  1I2L A;  3DTF A;  3T54 A;  3JZ6 A;  1UC9 A;  2HG8 A;  5CE8 A;  3VPD A;  1ET0 A;  4IWY A;  3LQS A;  4TVI A;  2X5R A;  3HT5 A;  1WRV A;  2COJ A;  4TM5 A;  3WWI A;  4CMF A;  1I1L A;  5FR9 A;  5I5Y A;  3T7A A;  2A1H A;  1A0G A;  2HGX A;  4CKB A;  4CKE A;  5DAA A;  1UC8 A;  1EKV A;  2Y4R A;  5I5X A;  5I5U A;  3DTG A;  4HN2 A;  1IYD A;  2HGW A;  5I5S A;  3T9B A;  4CKC A;  2EIY A;  5BWW A;  5BYB A;  4NZN A;  2ABJ A;  2HHF B;  3T9D A;  4M0J A;  4GLW A;  4RCN A;  5CR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...