4CHIA

(r)-selective amine transaminase from aspergillus fumigatus at 1.27 a resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
320
Chain Sequence
ASMDKVFSGYYARQKLLERSDNPFSKGIAYVEGKLVLPSDARIPLLDEGFMHSDLTYDVISVWDGRFFRLDDHLQRILESCDKMRLKFPLALSSVKNILAEMVAKSGIRDAFVEVIVTRGLTGVRGSKPEDLYNNNIYLLVLPYIWVMAPENQLHGGEAIITRTVRRTPPGAFDPTIKNLQWGDLTKGLFEAMDRGATYPFLTDGDTNLTEGSGFNIVLVKNGIIYTPDRGVLRGITRKSVIDVARANSIDIRLEVVPVEQAYHSDEIFMCTTAGGIMPITLLDGQPVNDGQVGPITKKIWDGYWEMHYNPAYSFPVDYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Characterization of the (R)-Selective Amine Transaminase from Aspergillus Fumigatus.
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Transferase
molecule keywords BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
total genus 106
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.6.1.-:
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 4chiA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 4chiA01
5BWWA 5HNEA 2COGA 5BWUA 2ZGIA 5I5SA 1A0GA 2EIYA 1IYEA 5CM0A 4JXUA 3WWJA 2ABJA 5DAAA 1I2KA 1EKFA 3SNOA 3HT5A 5BWVA 2Y4RA 5I60A 2DABA 5I5UA 5K3WA 5I5VA 1I1KA 4WHXA 1I1LA 5CR5A 1I1MA 1DAAA 2HDKA 2DAAA 5I5WA 3LULA 2EJ2A 2HG8A 3CEBA 3LQSA 5I5XA 5BWXA 1G2WA 3U0GA 4DAAA 3UZBA 1ET0A 3WWIA 5FR9A 4TM5A 5I5YA 2HHFB 3DTGA 1KTAA 3CSWA 3DAAA 4K6NA 4TVIA 3JZ6A 3QQMA 5I5TA 3WWHA 2EJ3A 5BWRA 4CMFA 4CHIA 2HGXA 1EKVA 5E25A 4UUGA 3UZOA 2HHFA 2COJA 2A1HA 1I2LA 4CMDA 1KT8A 3UYYA 4M0JA 2COIA 1A3GA 2EJ0A 5CE8A 1EKPA 4CE5A 1WRVA 4DQNA 2HGWA 3DTFA 4PBCA 5BWTA 1IYDA
chains in the Genus database with same CATH superfamily
4ME6A 1A9XA 5BWUA 3NBYB 4FGRA 1KC7A 2R84A 1CKNA 2IP4A 2R7MA 3U9TA 2ABJA 1OBGA 3U54A 5KX5F 3R5XA 3VA7A 3K3PA 3N8DA 4LH7A 4C5CA 3MWEA 4CC6A 1OBDA 5K3WA 3I12A 4I4TF 3VOTA 1EUDB 5CR5A 1I1MA 3RUPA 2W6OA 4DIMA 1C30A 1XK5A 2X0SA 4UCSA 2J9GA 2HVSA 4ZI7F 4Y8VB 4O84A 4MV7A 2QB5A 3TINA 4XYMB 1AUXA 3HO8A 4C5BA 2EJ2A 2W71A 5I5XA 1B6SA 3U0GA 3NUAA 4O81A 2YYAA 2HGSA 3UZBA 4E6NA 5BPHA 5FR9A 3QFFA 5IYZF 5I5YA 4CKCA 4HNUA 3PN1A 4UCUA 1GSHA 2YWVA 1Z2PX 3JZIA 2XCLA 4O86A 3DAAA 2I80A 4K6NA 2NU7B 2ZDQA 3K5HA 2R82A 4FFOA 2R85A 1CKOA 1CS0A 4O7VA 4YBZB 3HB9A 3VNNA 1JDBB 4O82A 3TQTA 1C3OA 2GPWA 3HBLA 2HGXA 2V59A 5CAEB 3NBZB 1E4EB 4O7TA 2YS6A 2YZMA 3T9BA 2W6ZA 1EUCB 3MJFA 3VPCA 3G8DA 4Q4CA 3U9SA 3GB8B 1JLLB 1ZAUA 2R86A 1BNCA 3GDEA 2EJ0A 3NC0B 5CE8A 4UCTA 4O7ZA 5BYBA 5I47A 4IWYA 4RCNA 4M9UA 3DTFA 4PBCA 5BWTA 1B6RA 1Z2NX 3RR5A 4XX0B 2YRWA 1DGSA 3RV4A 5BWWA 2COGA 3Q1KA 4YJ3F 5KS8A 1EYZA 5JVLA 4MA0A 3RV3A 1GLVA 2QK4A 2CNVA 4E4TA 2W70A 1WR2A 3TY9A 1VBHA 5DAAA 4O7SA 5LP6F 1TAEA 3QWUA 1V9PA 4IIJF 3HT5A 3OUUA 1SCUB 3KREA 3WO0A 4O4LF 4MV9A 2WYOA 1AUVA 2FPGB 1M0TA 3JSNA 3V4SA 5FPRA 3T9CA 4WHXA 2DZDA 3KYHC 3TY5A 3SE7A 4FFMA 2I8CA 4EQ5A 4HR7A 2YZGA 2CZGA 3GLKA 4IHJF 1EHIA 2VUGA 2W6QA 3RTXA 3S24A 2FPPB 1IOWA 2VR1A 3T99A 1Z2OX 3LULA 4FFPA 2HG8A 3CEBA 2VQDA 2CNUA 5JQWA 2Z04A 1T36A 4HNTA 4TV8F 3BA9A 4IWXA 2QF7A 2HJWA 4PZ7A 3CSWA 1E4EA 3MWDA 2NU9B 4GLXA 2C00A 4TVIA 2HIVA 3QQMA 4EGJA 2Q2TA 5LXTF 5I5TA 2HVRA 1VKZA 5DGIA 2YRXA 3TY8A 3K5IA 1JDEA 3KAJA 4I50F 4NZNA 5BPFA 5DGHA 4UUGA 3UZOA 3BAAA 5EZYF 2YW2A 2COJA 4NZMA 1UC8A 3ORQA 2A1HA 4O7RA 4I55F 1KT8A 1A48A 3TW6A 1KJJA 3LWBA 4O7LA 1KBLA 1TA8A 2YL2A 1ULZA 4CE5A 1W93A 2PBZA 5C8YF 2X5RA 2HGWA 1KJQA 2ZDHA 4NYEA 1B04A 2CFMA 4RZQA 1S68A 2W6NA 4O2AF 5HNEA 2ZGIA 2EIYA 1IYEA 5CM0A 3KALA 3T9AA 2Q2UA 4HQ6A 4JXUA 2GPSA 4PZ6A 4C5AA 2V58A 2OWOA 3T9FA 4CC5A 4EFBA 3JZFA 1EKFA 3VMMA 2W6PA 2DLNA 5BWVA 3ETHA 1UC9A 4O7YA 4Q4DA 2VPQA 3N6RA 5I5UA 2HVQA 5I5VA 3VPBA 4MV4A 2NUAB 1M0WA 1DAAA 2DIKA 3T54A 5H80A 5D8DA 1GGOA 5CB4F 2R7NA 1CQIB 3BA8A 2YS7A 4PZ8A 1CE8A 3TIGA 4FFNA 1VBGA 5DMXA 2R87A 5C1OA 5JH7F 5JQGF 2P0AA 5BWXA 1G2WA 1KJ9A 3WWIA 3T7AA 2HIXA 2V5AA 3JRWA 5CA1F 5DISC 5GONF 3DTGA 3LP8A 3UQ8A 4DRFA 5FNVF 3T9EA 4ZHQF 3W5OA 3WWHA 2ZDGA 5BWRA 5FPOA 4O4IF 5JVDF 4O7WA 5E25A 4ZQIA 2HHFA 3BACA 1GSAA 5BMVF 4CMDA 4HNVA 3U55A 2NU8B 3BG5A 3R23A 4XYLB 3R9RA 1CKNB 3PFFA 1EKPA 1P16A 4NZOA 4WBNF 1WRVA 4DQNA 1EZ1A 3ORRA 3JSLA 4YB8B 4EGQA 1IYDA 1KJIA 4UCVA 2NU6B 4UCOA 5I5SA 1PX2A 3TEKA 1DV1A 4O4HF 1A0GA 4O83A 4GLWA 3T9DA 4MV8A 3WWJA 1I2KA 4YJ2F 3W1BA 3RFCA 1BXRA 3AX6A 2ODTX 3E5NA 4UCRA 3SNOA 4UFZA 2SCUB 3R5HA 3R5FA 5HBRB 2Y4RA 5I60A 2YZNA 2Q7DA 2DABA 5C1PA 4FU0A 4EFEA 4CKEA 1I1KA 1I1LA 1P8LA 4O7NA 1VS0A 4O2BF 5LA6F 2FB9A 2HDKA 1CKMA 2PVPA 5LYJF 2FP4B 3Q2OA 5D1OB 1KEEA 4FFRA 2YZLA 2DAAA 4FE2A 2W6MA 2GLTA 3AW8A 4YAJB 3BABA 4LH6A 3WO1A 2FPIB 4MV3A 5I5WA 1XDNA 3LQSA 1I7NA 1DV2A 3KAKA 5CA0F 5KKNB 3OUZA 2PN1A 2I87A 4DAAA 3ETJA 1W96A 1I7LA 3GJXB 1A0IA 1ET0A 5J2TF 1PK8A 4TM5A 5LOVF 1FVIA 2DWCA 4DLKA 2HHFB 1JKJB 2CNQA 3VPDA 1KTAA 4HN2A 4YAKB 1CQJB 3G8CA 5BYAA 5D1OA 1GSOA 3JZ6A 3SGIA 4FFLA 4EG0A 1KUTA 2GQSA 5J2UF 1M6VA 2EJ3A 3TW7A 1DIKA 4TV9F 3L2PA 4TUYF 5HV6A 4L1KA 5K2MA 4CMFA 4CHIA 4EEQA 4O4JF 2OLSA 4MA5A 1EKVA 2R7KA 3UFXB 3W1GA 2XD4A 4QSHA 4MV1A 5D1PA 1X9NA 4XZ3B 1I2LA 2GQRA 3V4ZA 3DF7A 3UYYA 4M0JA 4IZOA 4ZOLF 2COIA 1A3GA 1IOVA 3JRXA 4CKBA 3TIIA 3WNZA 3GIDA 4MV6A 4MAMA 2Z02A 1KJ8A 2R7LA
chains in the Genus database with same CATH topology
5BWWA 5HNEA 2COGA 5BWUA 2ZGIA 5I5SA 3TEKA 5KS8A 1A0GA 2EIYA 1IYEA 5CM0A 4GLWA 3T9DA 3T9AA 4JXUA 3WWJA 2ABJA 3T9FA 5DAAA 1I2KA 1EKFA 2ODTX 3SNOA 3HT5A 5BWVA 1UC9A 2Y4RA 5I60A 4Q4DA 2Q7DA 2DABA 5I5UA 5K3WA 5I5VA 4CKEA 1I1KA 3T9CA 4WHXA 1I1LA 5CR5A 1I1MA 1DAAA 3T54A 2HDKA 2QB5A 2DAAA 3T99A 5I5WA 3LULA 2EJ2A 2HG8A 3CEBA 3LQSA 5I5XA 5BWXA 1G2WA 3U0GA 4DAAA 3UZBA 1ET0A 3WWIA 5FR9A 4IWXA 3T7AA 4TM5A 5I5YA 4CKCA 2HHFB 3DTGA 3VPDA 1KTAA 3CSWA 4HN2A 3DAAA 5BYAA 4K6NA 4TVIA 3JZ6A 3SGIA 3T9EA 3QQMA 5I5TA 5DGIA 3WWHA 2EJ3A 3TW7A 5BWRA 5K2MA 4CMFA 4CHIA 2HGXA 1EKVA 4NZNA 5E25A 5DGHA 3T9BA 4UUGA 3UZOA 2HHFA 3BACA 2COJA 4NZMA 1UC8A 2A1HA 4Q4CA 1I2LA 1ZAUA 4CMDA 1KT8A 3UYYA 4M0JA 2COIA 1A3GA 2EJ0A 5CE8A 4CKBA 3PFFA 1EKPA 4CE5A 4NZOA 5BYBA 5I47A 1WRVA 4DQNA 4IWYA 2X5RA 2HGWA 4RCNA 3DTFA 4PBCA 5BWTA 1IYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BWW A;  5HNE A;  2COG A;  5BWU A;  2ZGI A;  5I5S A;  1A0G A;  2EIY A;  1IYE A;  5CM0 A;  4JXU A;  3WWJ A;  2ABJ A;  5DAA A;  1I2K A;  1EKF A;  3SNO A;  3HT5 A;  5BWV A;  2Y4R A;  5I60 A;  2DAB A;  5I5U A;  5K3W A;  5I5V A;  1I1K A;  4WHX A;  1I1L A;  5CR5 A;  1I1M A;  1DAA A;  2HDK A;  2DAA A;  5I5W A;  3LUL A;  2EJ2 A;  2HG8 A;  3CEB A;  3LQS A;  5I5X A;  5BWX A;  1G2W A;  3U0G A;  4DAA A;  3UZB A;  1ET0 A;  3WWI A;  5FR9 A;  4TM5 A;  5I5Y A;  2HHF B;  3DTG A;  1KTA A;  3CSW A;  3DAA A;  4K6N A;  4TVI A;  3JZ6 A;  3QQM A;  5I5T A;  3WWH A;  2EJ3 A;  5BWR A;  4CMF A;  4CHI A;  2HGX A;  1EKV A;  5E25 A;  4UUG A;  3UZO A;  2HHF A;  2COJ A;  2A1H A;  1I2L A;  4CMD A;  1KT8 A;  3UYY A;  4M0J A;  2COI A;  1A3G A;  2EJ0 A;  5CE8 A;  1EKP A;  4CE5 A;  1WRV A;  4DQN A;  2HGW A;  3DTF A;  4PBC A;  5BWT A;  1IYD A; 
#chains in the Genus database with same CATH topology
 4ME6 A;  1A9X A;  5BWU A;  3NBY B;  4FGR A;  1KC7 A;  2R84 A;  1CKN A;  2IP4 A;  2R7M A;  3U9T A;  2ABJ A;  1OBG A;  3U54 A;  5KX5 F;  3R5X A;  3VA7 A;  3K3P A;  3N8D A;  4LH7 A;  4C5C A;  3MWE A;  4CC6 A;  1OBD A;  5K3W A;  3I12 A;  4I4T F;  3VOT A;  1EUD B;  5CR5 A;  1I1M A;  3RUP A;  2W6O A;  4DIM A;  1C30 A;  1XK5 A;  2X0S A;  4UCS A;  2J9G A;  2HVS A;  4ZI7 F;  4Y8V B;  4O84 A;  4MV7 A;  2QB5 A;  3TIN A;  4XYM B;  1AUX A;  3HO8 A;  4C5B A;  2EJ2 A;  2W71 A;  5I5X A;  1B6S A;  3U0G A;  3NUA A;  4O81 A;  2YYA A;  2HGS A;  3UZB A;  4E6N A;  5BPH A;  5FR9 A;  3QFF A;  5IYZ F;  5I5Y A;  4CKC A;  4HNU A;  3PN1 A;  4UCU A;  1GSH A;  2YWV A;  1Z2P X;  3JZI A;  2XCL A;  4O86 A;  3DAA A;  2I80 A;  4K6N A;  2NU7 B;  2ZDQ A;  3K5H A;  2R82 A;  4FFO A;  2R85 A;  1CKO A;  1CS0 A;  4O7V A;  4YBZ B;  3HB9 A;  3VNN A;  1JDB B;  4O82 A;  3TQT A;  1C3O A;  2GPW A;  3HBL A;  2HGX A;  2V59 A;  5CAE B;  3NBZ B;  1E4E B;  4O7T A;  2YS6 A;  2YZM A;  3T9B A;  2W6Z A;  1EUC B;  3MJF A;  3VPC A;  3G8D A;  4Q4C A;  3U9S A;  3GB8 B;  1JLL B;  1ZAU A;  2R86 A;  1BNC A;  3GDE A;  2EJ0 A;  3NC0 B;  5CE8 A;  4UCT A;  4O7Z A;  5BYB A;  5I47 A;  4IWY A;  4RCN A;  4M9U A;  3DTF A;  4PBC A;  5BWT A;  1B6R A;  1Z2N X;  3RR5 A;  4XX0 B;  2YRW A;  1DGS A;  3RV4 A;  5BWW A;  2COG A;  3Q1K A;  4YJ3 F;  5KS8 A;  1EYZ A;  5JVL A;  4MA0 A;  3RV3 A;  1GLV A;  2QK4 A;  2CNV A;  4E4T A;  2W70 A;  1WR2 A;  3TY9 A;  1VBH A;  5DAA A;  4O7S A;  5LP6 F;  1TAE A;  3QWU A;  1V9P A;  4IIJ F;  3HT5 A;  3OUU A;  1SCU B;  3KRE A;  3WO0 A;  4O4L F;  4MV9 A;  2WYO A;  1AUV A;  2FPG B;  1M0T A;  3JSN A;  3V4S A;  5FPR A;  3T9C A;  4WHX A;  2DZD A;  3KYH C;  3TY5 A;  3SE7 A;  4FFM A;  2I8C A;  4EQ5 A;  4HR7 A;  2YZG A;  2CZG A;  3GLK A;  4IHJ F;  1EHI A;  2VUG A;  2W6Q A;  3RTX A;  3S24 A;  2FPP B;  1IOW A;  2VR1 A;  3T99 A;  1Z2O X;  3LUL A;  4FFP A;  2HG8 A;  3CEB A;  2VQD A;  2CNU A;  5JQW A;  2Z04 A;  1T36 A;  4HNT A;  4TV8 F;  3BA9 A;  4IWX A;  2QF7 A;  2HJW A;  4PZ7 A;  3CSW A;  1E4E A;  3MWD A;  2NU9 B;  4GLX A;  2C00 A;  4TVI A;  2HIV A;  3QQM A;  4EGJ A;  2Q2T A;  5LXT F;  5I5T A;  2HVR A;  1VKZ A;  5DGI A;  2YRX A;  3TY8 A;  3K5I A;  1JDE A;  3KAJ A;  4I50 F;  4NZN A;  5BPF A;  5DGH A;  4UUG A;  3UZO A;  3BAA A;  5EZY F;  2YW2 A;  2COJ A;  4NZM A;  1UC8 A;  3ORQ A;  2A1H A;  4O7R A;  4I55 F;  1KT8 A;  1A48 A;  3TW6 A;  1KJJ A;  3LWB A;  4O7L A;  1KBL A;  1TA8 A;  2YL2 A;  1ULZ A;  4CE5 A;  1W93 A;  2PBZ A;  5C8Y F;  2X5R A;  2HGW A;  1KJQ A;  2ZDH A;  4NYE A;  1B04 A;  2CFM A;  4RZQ A;  1S68 A;  2W6N A;  4O2A F;  5HNE A;  2ZGI A;  2EIY A;  1IYE A;  5CM0 A;  3KAL A;  3T9A A;  2Q2U A;  4HQ6 A;  4JXU A;  2GPS A;  4PZ6 A;  4C5A A;  2V58 A;  2OWO A;  3T9F A;  4CC5 A;  4EFB A;  3JZF A;  1EKF A;  3VMM A;  2W6P A;  2DLN A;  5BWV A;  3ETH A;  1UC9 A;  4O7Y A;  4Q4D A;  2VPQ A;  3N6R A;  5I5U A;  2HVQ A;  5I5V A;  3VPB A;  4MV4 A;  2NUA B;  1M0W A;  1DAA A;  2DIK A;  3T54 A;  5H80 A;  5D8D A;  1GGO A;  5CB4 F;  2R7N A;  1CQI B;  3BA8 A;  2YS7 A;  4PZ8 A;  1CE8 A;  3TIG A;  4FFN A;  1VBG A;  5DMX A;  2R87 A;  5C1O A;  5JH7 F;  5JQG F;  2P0A A;  5BWX A;  1G2W A;  1KJ9 A;  3WWI A;  3T7A A;  2HIX A;  2V5A A;  3JRW A;  5CA1 F;  5DIS C;  5GON F;  3DTG A;  3LP8 A;  3UQ8 A;  4DRF A;  5FNV F;  3T9E A;  4ZHQ F;  3W5O A;  3WWH A;  2ZDG A;  5BWR A;  5FPO A;  4O4I F;  5JVD F;  4O7W A;  5E25 A;  4ZQI A;  2HHF A;  3BAC A;  1GSA A;  5BMV F;  4CMD A;  4HNV A;  3U55 A;  2NU8 B;  3BG5 A;  3R23 A;  4XYL B;  3R9R A;  1CKN B;  3PFF A;  1EKP A;  1P16 A;  4NZO A;  4WBN F;  1WRV A;  4DQN A;  1EZ1 A;  3ORR A;  3JSL A;  4YB8 B;  4EGQ A;  1IYD A;  1KJI A;  4UCV A;  2NU6 B;  4UCO A;  5I5S A;  1PX2 A;  3TEK A;  1DV1 A;  4O4H F;  1A0G A;  4O83 A;  4GLW A;  3T9D A;  4MV8 A;  3WWJ A;  1I2K A;  4YJ2 F;  3W1B A;  3RFC A;  1BXR A;  3AX6 A;  2ODT X;  3E5N A;  4UCR A;  3SNO A;  4UFZ A;  2SCU B;  3R5H A;  3R5F A;  5HBR B;  2Y4R A;  5I60 A;  2YZN A;  2Q7D A;  2DAB A;  5C1P A;  4FU0 A;  4EFE A;  4CKE A;  1I1K A;  1I1L A;  1P8L A;  4O7N A;  1VS0 A;  4O2B F;  5LA6 F;  2FB9 A;  2HDK A;  1CKM A;  2PVP A;  5LYJ F;  2FP4 B;  3Q2O A;  5D1O B;  1KEE A;  4FFR A;  2YZL A;  2DAA A;  4FE2 A;  2W6M A;  2GLT A;  3AW8 A;  4YAJ B;  3BAB A;  4LH6 A;  3WO1 A;  2FPI B;  4MV3 A;  5I5W A;  1XDN A;  3LQS A;  1I7N A;  1DV2 A;  3KAK A;  5CA0 F;  5KKN B;  3OUZ A;  2PN1 A;  2I87 A;  4DAA A;  3ETJ A;  1W96 A;  1I7L A;  3GJX B;  1A0I A;  1ET0 A;  5J2T F;  1PK8 A;  4TM5 A;  5LOV F;  1FVI A;  2DWC A;  4DLK A;  2HHF B;  1JKJ B;  2CNQ A;  3VPD A;  1KTA A;  4HN2 A;  4YAK B;  1CQJ B;  3G8C A;  5BYA A;  5D1O A;  1GSO A;  3JZ6 A;  3SGI A;  4FFL A;  4EG0 A;  1KUT A;  2GQS A;  5J2U F;  1M6V A;  2EJ3 A;  3TW7 A;  1DIK A;  4TV9 F;  3L2P A;  4TUY F;  5HV6 A;  4L1K A;  5K2M A;  4CMF A;  4CHI A;  4EEQ A;  4O4J F;  2OLS A;  4MA5 A;  1EKV A;  2R7K A;  3UFX B;  3W1G A;  2XD4 A;  4QSH A;  4MV1 A;  5D1P A;  1X9N A;  4XZ3 B;  1I2L A;  2GQR A;  3V4Z A;  3DF7 A;  3UYY A;  4M0J A;  4IZO A;  4ZOL F;  2COI A;  1A3G A;  1IOV A;  3JRX A;  4CKB A;  3TII A;  3WNZ A;  3GID A;  4MV6 A;  4MAM A;  2Z02 A;  1KJ8 A;  2R7L A; 
#chains in the Genus database with same CATH homology
 5BWW A;  5HNE A;  2COG A;  5BWU A;  2ZGI A;  5I5S A;  3TEK A;  5KS8 A;  1A0G A;  2EIY A;  1IYE A;  5CM0 A;  4GLW A;  3T9D A;  3T9A A;  4JXU A;  3WWJ A;  2ABJ A;  3T9F A;  5DAA A;  1I2K A;  1EKF A;  2ODT X;  3SNO A;  3HT5 A;  5BWV A;  1UC9 A;  2Y4R A;  5I60 A;  4Q4D A;  2Q7D A;  2DAB A;  5I5U A;  5K3W A;  5I5V A;  4CKE A;  1I1K A;  3T9C A;  4WHX A;  1I1L A;  5CR5 A;  1I1M A;  1DAA A;  3T54 A;  2HDK A;  2QB5 A;  2DAA A;  3T99 A;  5I5W A;  3LUL A;  2EJ2 A;  2HG8 A;  3CEB A;  3LQS A;  5I5X A;  5BWX A;  1G2W A;  3U0G A;  4DAA A;  3UZB A;  1ET0 A;  3WWI A;  5FR9 A;  4IWX A;  3T7A A;  4TM5 A;  5I5Y A;  4CKC A;  2HHF B;  3DTG A;  3VPD A;  1KTA A;  3CSW A;  4HN2 A;  3DAA A;  5BYA A;  4K6N A;  4TVI A;  3JZ6 A;  3SGI A;  3T9E A;  3QQM A;  5I5T A;  5DGI A;  3WWH A;  2EJ3 A;  3TW7 A;  5BWR A;  5K2M A;  4CMF A;  4CHI A;  2HGX A;  1EKV A;  4NZN A;  5E25 A;  5DGH A;  3T9B A;  4UUG A;  3UZO A;  2HHF A;  3BAC A;  2COJ A;  4NZM A;  1UC8 A;  2A1H A;  4Q4C A;  1I2L A;  1ZAU A;  4CMD A;  1KT8 A;  3UYY A;  4M0J A;  2COI A;  1A3G A;  2EJ0 A;  5CE8 A;  4CKB A;  3PFF A;  1EKP A;  4CE5 A;  4NZO A;  5BYB A;  5I47 A;  1WRV A;  4DQN A;  4IWY A;  2X5R A;  2HGW A;  4RCN A;  3DTF A;  4PBC A;  5BWT A;  1IYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...